data_2M0P
# 
_entry.id   2M0P 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2M0P         
RCSB  RCSB103061   
BMRB  18816        
WWPDB D_1000103061 
# 
loop_
_pdbx_database_related.content_type 
_pdbx_database_related.db_id 
_pdbx_database_related.db_name 
_pdbx_database_related.details 
unspecified 2i1p  PDB  'Solution structure of the twelfth cysteine-rich ligand-binding repeat in rat megalin' 
unspecified 2FYJ  PDB  'NMR Solution structure of calcium-loaded LRP double module'                           
unspecified 18816 BMRB .                                                                                      
# 
_pdbx_database_status.deposit_site                    BMRB 
_pdbx_database_status.entry_id                        2M0P 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2012-11-01 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  REL 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Dagil, R.'     1 
'Kragelund, B.' 2 
# 
_citation.id                        primary 
_citation.title                     
;Gentamicin binds to the megalin receptor as a competitive inhibitor using the common ligand binding motif of complement type repeats: insight from the nmr structure of the 10th complement type repeat domain alone and in complex with gentamicin.
;
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            288 
_citation.page_first                4424 
_citation.page_last                 4435 
_citation.year                      2013 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   23275343 
_citation.pdbx_database_id_DOI      10.1074/jbc.M112.434159 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Dagil, R.'       1 
primary 
;O'Shea, C.
;
2 
primary 'Nykjar, A.'      3 
primary 'Bonvin, A.M.'    4 
primary 'Kragelund, B.B.' 5 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Low-density lipoprotein receptor-related protein 2' 5874.158 1 ? ? ? ? 
2 non-polymer syn 'CALCIUM ION'                                        40.078   1 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'LRP-2, Glycoprotein 330, gp330, Megalin' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       THAPASCLDTQYTCDNHQCISKNWVCDTDNDCGDGSDEKNCNSTETHHHHHH 
_entity_poly.pdbx_seq_one_letter_code_can   THAPASCLDTQYTCDNHQCISKNWVCDTDNDCGDGSDEKNCNSTETHHHHHH 
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  THR n 
1 2  HIS n 
1 3  ALA n 
1 4  PRO n 
1 5  ALA n 
1 6  SER n 
1 7  CYS n 
1 8  LEU n 
1 9  ASP n 
1 10 THR n 
1 11 GLN n 
1 12 TYR n 
1 13 THR n 
1 14 CYS n 
1 15 ASP n 
1 16 ASN n 
1 17 HIS n 
1 18 GLN n 
1 19 CYS n 
1 20 ILE n 
1 21 SER n 
1 22 LYS n 
1 23 ASN n 
1 24 TRP n 
1 25 VAL n 
1 26 CYS n 
1 27 ASP n 
1 28 THR n 
1 29 ASP n 
1 30 ASN n 
1 31 ASP n 
1 32 CYS n 
1 33 GLY n 
1 34 ASP n 
1 35 GLY n 
1 36 SER n 
1 37 ASP n 
1 38 GLU n 
1 39 LYS n 
1 40 ASN n 
1 41 CYS n 
1 42 ASN n 
1 43 SER n 
1 44 THR n 
1 45 GLU n 
1 46 THR n 
1 47 HIS n 
1 48 HIS n 
1 49 HIS n 
1 50 HIS n 
1 51 HIS n 
1 52 HIS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 LRP2 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Komagataella pastoris' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     4922 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pPICaC 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    LRP2_HUMAN 
_struct_ref.pdbx_db_accession          P98164 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   THAPASCLDTQYTCDNHQCISKNWVCDTDNDCGDGSDEKNCNSTET 
_struct_ref.pdbx_align_begin           1103 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2M0P 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 46 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P98164 
_struct_ref_seq.db_align_beg                  1103 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  1148 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1103 
_struct_ref_seq.pdbx_auth_seq_align_end       1148 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2M0P HIS A 47 ? UNP P98164 ? ? 'EXPRESSION TAG' 1149 1 
1 2M0P HIS A 48 ? UNP P98164 ? ? 'EXPRESSION TAG' 1150 2 
1 2M0P HIS A 49 ? UNP P98164 ? ? 'EXPRESSION TAG' 1151 3 
1 2M0P HIS A 50 ? UNP P98164 ? ? 'EXPRESSION TAG' 1152 4 
1 2M0P HIS A 51 ? UNP P98164 ? ? 'EXPRESSION TAG' 1153 5 
1 2M0P HIS A 52 ? UNP P98164 ? ? 'EXPRESSION TAG' 1154 6 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CA  non-polymer         . 'CALCIUM ION'   ? 'Ca 2'           40.078  
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.type 
1 1  1 '2D 1H-15N HSQC'            
1 2  1 '2D 1H-13C HSQC'            
1 3  1 '2D 1H-1H TOCSY aromatic'   
1 4  1 '3D HNCO'                   
1 5  1 '3D HNCA'                   
1 6  1 '3D HNCACB'                 
1 7  1 '3D C(CO)NH'                
1 8  1 '3D CBCA(CO)NH'             
1 9  2 '3D HCCH-TOCSY'             
1 10 1 '3D HN(CO)CA'               
1 11 2 '3D 1H-13C NOESY aliphatic' 
1 12 2 '2D 1H-13C NOESY aromatic'  
1 13 1 '3D H(CCO)NH'               
1 14 1 '3D 1H-15N NOESY'           
1 15 1 '3D 1H-15N TOCSY'           
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      0.2 
_pdbx_nmr_exptl_sample_conditions.pH                  6.5 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature         298 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
loop_
_pdbx_nmr_sample_details.contents 
_pdbx_nmr_sample_details.solution_id 
_pdbx_nmr_sample_details.solvent_system 
;0.6 mM [U-100% 13C; U-100% 15N] CR10, 100 mM sodium chloride, 50 mM calcium chloride, 50 mM TRIS, 0.1 mM DSS, 0.1 % sodium azide, 90% H2O/10% D2O
;
1 '90% H2O/10% D2O' 
;0.6 mM [U-100% 13C; U-100% 15N] CR10, 50 mM calcium chloride, 100 mM sodium chloride, 50 mM TRIS, 0.1 mM DSS, 0.1 % sodium azide, 100% D2O
;
2 '100% D2O'        
# 
loop_
_pdbx_nmr_spectrometer.field_strength 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.type 
750 Varian INOVA  1 'Varian INOVA'  
800 Varian INOVA  2 'Varian INOVA'  
800 Bruker Avance 3 'Bruker Avance' 
# 
_pdbx_nmr_refine.entry_id           2M0P 
_pdbx_nmr_refine.method             'simulated annealing' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy' 
_pdbx_nmr_ensemble.conformers_calculated_total_number            200 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.entry_id                                      2M0P 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.entry_id             2M0P 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.authors 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.ordinal 
CCPN                                                'chemical shift assignment' Analysis 2.2 1 
CCPN                                                'peak picking'              Analysis 2.2 2 
;Linge, O'Donoghue and Nilges
;
'structure solution'        ARIA     ?   3 
;Linge, O'Donoghue and Nilges
;
refinement                  ARIA     ?   4 
'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing                  NMRDraw  ?   5 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.entry_id                   2M0P 
_exptl.method                     'SOLUTION NMR' 
_exptl.method_details             ? 
# 
_struct.entry_id                  2M0P 
_struct.title                     'Solution structure of the tenth complement type repeat of human megalin' 
_struct.pdbx_descriptor           'Low-density lipoprotein receptor-related protein 2' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2M0P 
_struct_keywords.pdbx_keywords   'LIPID BINDING PROTEIN' 
_struct_keywords.text            'Complement type repeat, receptor, megalin, ldl receptor family, lrp2, LIPID BINDING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
_struct_conf.conf_type_id            HELX_P 
_struct_conf.id                      HELX_P1 
_struct_conf.pdbx_PDB_helix_id       1 
_struct_conf.beg_label_comp_id       GLY 
_struct_conf.beg_label_asym_id       A 
_struct_conf.beg_label_seq_id        35 
_struct_conf.pdbx_beg_PDB_ins_code   ? 
_struct_conf.end_label_comp_id       ASN 
_struct_conf.end_label_asym_id       A 
_struct_conf.end_label_seq_id        40 
_struct_conf.pdbx_end_PDB_ins_code   ? 
_struct_conf.beg_auth_comp_id        GLY 
_struct_conf.beg_auth_asym_id        A 
_struct_conf.beg_auth_seq_id         1137 
_struct_conf.end_auth_comp_id        ASN 
_struct_conf.end_auth_asym_id        A 
_struct_conf.end_auth_seq_id         1142 
_struct_conf.pdbx_PDB_helix_class    1 
_struct_conf.details                 ? 
_struct_conf.pdbx_PDB_helix_length   6 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 7  SG  ? ? ? 1_555 A CYS 19 SG ? ? A CYS 1109 A CYS 1121 1_555 ? ? ? ? ? ? ? 2.029 ? 
disulf2 disulf ? ? A CYS 14 SG  ? ? ? 1_555 A CYS 32 SG ? ? A CYS 1116 A CYS 1134 1_555 ? ? ? ? ? ? ? 2.024 ? 
disulf3 disulf ? ? A CYS 26 SG  ? ? ? 1_555 A CYS 41 SG ? ? A CYS 1128 A CYS 1143 1_555 ? ? ? ? ? ? ? 2.029 ? 
metalc1 metalc ? ? A ASP 37 OD2 ? ? ? 1_555 B CA  .  CA ? ? A ASP 1139 A CA  1201 1_555 ? ? ? ? ? ? ? 2.170 ? 
metalc2 metalc ? ? A ASP 27 OD1 ? ? ? 1_555 B CA  .  CA ? ? A ASP 1129 A CA  1201 1_555 ? ? ? ? ? ? ? 2.188 ? 
metalc3 metalc ? ? A ASP 31 OD2 ? ? ? 1_555 B CA  .  CA ? ? A ASP 1133 A CA  1201 1_555 ? ? ? ? ? ? ? 2.219 ? 
metalc4 metalc ? ? A GLU 38 OE2 ? ? ? 1_555 B CA  .  CA ? ? A GLU 1140 A CA  1201 1_555 ? ? ? ? ? ? ? 2.249 ? 
metalc5 metalc ? ? A ASP 29 O   ? ? ? 1_555 B CA  .  CA ? ? A ASP 1131 A CA  1201 1_555 ? ? ? ? ? ? ? 2.253 ? 
metalc6 metalc ? ? A TRP 24 O   ? ? ? 1_555 B CA  .  CA ? ? A TRP 1126 A CA  1201 1_555 ? ? ? ? ? ? ? 2.283 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
metalc ? ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   2 
_struct_sheet.details          ? 
# 
_struct_sheet_order.sheet_id     A 
_struct_sheet_order.range_id_1   1 
_struct_sheet_order.range_id_2   2 
_struct_sheet_order.offset       ? 
_struct_sheet_order.sense        anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLN A 11 ? THR A 13 ? GLN A 1113 THR A 1115 
A 2 CYS A 19 ? SER A 21 ? CYS A 1121 SER A 1123 
# 
_pdbx_struct_sheet_hbond.sheet_id                A 
_pdbx_struct_sheet_hbond.range_id_1              1 
_pdbx_struct_sheet_hbond.range_id_2              2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id   N 
_pdbx_struct_sheet_hbond.range_1_label_comp_id   TYR 
_pdbx_struct_sheet_hbond.range_1_label_asym_id   A 
_pdbx_struct_sheet_hbond.range_1_label_seq_id    12 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id    N 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id    TYR 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id    A 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id     1114 
_pdbx_struct_sheet_hbond.range_2_label_atom_id   O 
_pdbx_struct_sheet_hbond.range_2_label_comp_id   ILE 
_pdbx_struct_sheet_hbond.range_2_label_asym_id   A 
_pdbx_struct_sheet_hbond.range_2_label_seq_id    20 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id    O 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id    ILE 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id    A 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id     1122 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    6 
_struct_site.details              'BINDING SITE FOR RESIDUE CA A 1201' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 6 TRP A 24 ? TRP A 1126 . ? 1_555 ? 
2 AC1 6 ASP A 27 ? ASP A 1129 . ? 1_555 ? 
3 AC1 6 ASP A 29 ? ASP A 1131 . ? 1_555 ? 
4 AC1 6 ASP A 31 ? ASP A 1133 . ? 1_555 ? 
5 AC1 6 ASP A 37 ? ASP A 1139 . ? 1_555 ? 
6 AC1 6 GLU A 38 ? GLU A 1140 . ? 1_555 ? 
# 
_atom_sites.entry_id                    2M0P 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
H  
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N    . THR A 1 1  ? 17.817  19.148  5.824   1.00 12.23 ? 1103 THR A N    1  
ATOM   2     C  CA   . THR A 1 1  ? 18.226  17.738  5.994   1.00 11.73 ? 1103 THR A CA   1  
ATOM   3     C  C    . THR A 1 1  ? 17.008  16.819  5.947   1.00 10.83 ? 1103 THR A C    1  
ATOM   4     O  O    . THR A 1 1  ? 16.324  16.624  6.953   1.00 10.67 ? 1103 THR A O    1  
ATOM   5     C  CB   . THR A 1 1  ? 18.965  17.538  7.334   1.00 11.83 ? 1103 THR A CB   1  
ATOM   6     O  OG1  . THR A 1 1  ? 20.021  18.499  7.459   1.00 12.26 ? 1103 THR A OG1  1  
ATOM   7     C  CG2  . THR A 1 1  ? 19.546  16.136  7.436   1.00 12.04 ? 1103 THR A CG2  1  
ATOM   8     H  H1   . THR A 1 1  ? 17.329  19.271  4.916   1.00 12.23 ? 1103 THR A H1   1  
ATOM   9     H  H2   . THR A 1 1  ? 18.650  19.768  5.844   1.00 12.55 ? 1103 THR A H2   1  
ATOM   10    H  H3   . THR A 1 1  ? 17.173  19.427  6.589   1.00 12.44 ? 1103 THR A H3   1  
ATOM   11    H  HA   . THR A 1 1  ? 18.898  17.477  5.189   1.00 12.16 ? 1103 THR A HA   1  
ATOM   12    H  HB   . THR A 1 1  ? 18.261  17.681  8.141   1.00 11.67 ? 1103 THR A HB   1  
ATOM   13    H  HG1  . THR A 1 1  ? 20.215  18.640  8.395   1.00 12.30 ? 1103 THR A HG1  1  
ATOM   14    H  HG21 . THR A 1 1  ? 20.045  16.022  8.386   1.00 12.31 ? 1103 THR A HG21 1  
ATOM   15    H  HG22 . THR A 1 1  ? 20.255  15.981  6.637   1.00 12.05 ? 1103 THR A HG22 1  
ATOM   16    H  HG23 . THR A 1 1  ? 18.750  15.410  7.358   1.00 12.10 ? 1103 THR A HG23 1  
ATOM   17    N  N    . HIS A 1 2  ? 16.737  16.267  4.773   1.00 10.41 ? 1104 HIS A N    1  
ATOM   18    C  CA   . HIS A 1 2  ? 15.604  15.368  4.595   1.00 9.72  ? 1104 HIS A CA   1  
ATOM   19    C  C    . HIS A 1 2  ? 15.995  13.947  4.960   1.00 8.65  ? 1104 HIS A C    1  
ATOM   20    O  O    . HIS A 1 2  ? 17.141  13.540  4.761   1.00 8.32  ? 1104 HIS A O    1  
ATOM   21    C  CB   . HIS A 1 2  ? 15.098  15.411  3.152   1.00 10.05 ? 1104 HIS A CB   1  
ATOM   22    C  CG   . HIS A 1 2  ? 14.451  16.708  2.777   1.00 10.43 ? 1104 HIS A CG   1  
ATOM   23    N  ND1  . HIS A 1 2  ? 15.087  17.687  2.044   1.00 10.71 ? 1104 HIS A ND1  1  
ATOM   24    C  CD2  . HIS A 1 2  ? 13.210  17.180  3.030   1.00 10.84 ? 1104 HIS A CD2  1  
ATOM   25    C  CE1  . HIS A 1 2  ? 14.265  18.703  1.865   1.00 11.25 ? 1104 HIS A CE1  1  
ATOM   26    N  NE2  . HIS A 1 2  ? 13.119  18.420  2.453   1.00 11.34 ? 1104 HIS A NE2  1  
ATOM   27    H  H    . HIS A 1 2  ? 17.318  16.461  4.005   1.00 10.71 ? 1104 HIS A H    1  
ATOM   28    H  HA   . HIS A 1 2  ? 14.815  15.694  5.255   1.00 9.96  ? 1104 HIS A HA   1  
ATOM   29    H  HB2  . HIS A 1 2  ? 15.929  15.251  2.482   1.00 10.50 ? 1104 HIS A HB2  1  
ATOM   30    H  HB3  . HIS A 1 2  ? 14.373  14.624  3.010   1.00 9.81  ? 1104 HIS A HB3  1  
ATOM   31    H  HD1  . HIS A 1 2  ? 16.012  17.644  1.712   1.00 10.68 ? 1104 HIS A HD1  1  
ATOM   32    H  HD2  . HIS A 1 2  ? 12.432  16.672  3.582   1.00 10.94 ? 1104 HIS A HD2  1  
ATOM   33    H  HE1  . HIS A 1 2  ? 14.492  19.610  1.326   1.00 11.71 ? 1104 HIS A HE1  1  
ATOM   34    H  HE2  . HIS A 1 2  ? 12.300  18.958  2.384   1.00 11.83 ? 1104 HIS A HE2  1  
ATOM   35    N  N    . ALA A 1 3  ? 15.051  13.198  5.502   1.00 8.30  ? 1105 ALA A N    1  
ATOM   36    C  CA   . ALA A 1 3  ? 15.300  11.817  5.867   1.00 7.41  ? 1105 ALA A CA   1  
ATOM   37    C  C    . ALA A 1 3  ? 14.857  10.888  4.747   1.00 6.47  ? 1105 ALA A C    1  
ATOM   38    O  O    . ALA A 1 3  ? 13.684  10.870  4.371   1.00 6.54  ? 1105 ALA A O    1  
ATOM   39    C  CB   . ALA A 1 3  ? 14.589  11.465  7.162   1.00 7.70  ? 1105 ALA A CB   1  
ATOM   40    H  H    . ALA A 1 3  ? 14.157  13.579  5.648   1.00 8.79  ? 1105 ALA A H    1  
ATOM   41    H  HA   . ALA A 1 3  ? 16.363  11.700  6.022   1.00 7.45  ? 1105 ALA A HA   1  
ATOM   42    H  HB1  . ALA A 1 3  ? 14.860  10.463  7.458   1.00 7.93  ? 1105 ALA A HB1  1  
ATOM   43    H  HB2  . ALA A 1 3  ? 13.521  11.520  7.012   1.00 7.73  ? 1105 ALA A HB2  1  
ATOM   44    H  HB3  . ALA A 1 3  ? 14.882  12.161  7.934   1.00 7.95  ? 1105 ALA A HB3  1  
ATOM   45    N  N    . PRO A 1 4  ? 15.793  10.109  4.198   1.00 5.80  ? 1106 PRO A N    1  
ATOM   46    C  CA   . PRO A 1 4  ? 15.505  9.190   3.100   1.00 4.97  ? 1106 PRO A CA   1  
ATOM   47    C  C    . PRO A 1 4  ? 14.695  7.988   3.570   1.00 4.25  ? 1106 PRO A C    1  
ATOM   48    O  O    . PRO A 1 4  ? 15.100  7.271   4.488   1.00 4.22  ? 1106 PRO A O    1  
ATOM   49    C  CB   . PRO A 1 4  ? 16.893  8.759   2.619   1.00 4.84  ? 1106 PRO A CB   1  
ATOM   50    C  CG   . PRO A 1 4  ? 17.786  8.932   3.801   1.00 5.55  ? 1106 PRO A CG   1  
ATOM   51    C  CD   . PRO A 1 4  ? 17.206  10.057  4.617   1.00 6.09  ? 1106 PRO A CD   1  
ATOM   52    H  HA   . PRO A 1 4  ? 14.979  9.685   2.298   1.00 5.32  ? 1106 PRO A HA   1  
ATOM   53    H  HB2  . PRO A 1 4  ? 16.859  7.729   2.298   1.00 4.32  ? 1106 PRO A HB2  1  
ATOM   54    H  HB3  . PRO A 1 4  ? 17.201  9.387   1.797   1.00 5.12  ? 1106 PRO A HB3  1  
ATOM   55    H  HG2  . PRO A 1 4  ? 17.807  8.022   4.381   1.00 5.52  ? 1106 PRO A HG2  1  
ATOM   56    H  HG3  . PRO A 1 4  ? 18.783  9.187   3.471   1.00 6.00  ? 1106 PRO A HG3  1  
ATOM   57    H  HD2  . PRO A 1 4  ? 17.284  9.834   5.670   1.00 6.19  ? 1106 PRO A HD2  1  
ATOM   58    H  HD3  . PRO A 1 4  ? 17.707  10.987  4.393   1.00 6.80  ? 1106 PRO A HD3  1  
ATOM   59    N  N    . ALA A 1 5  ? 13.548  7.776   2.949   1.00 4.09  ? 1107 ALA A N    1  
ATOM   60    C  CA   . ALA A 1 5  ? 12.671  6.680   3.326   1.00 3.77  ? 1107 ALA A CA   1  
ATOM   61    C  C    . ALA A 1 5  ? 13.182  5.364   2.757   1.00 2.63  ? 1107 ALA A C    1  
ATOM   62    O  O    . ALA A 1 5  ? 14.075  5.354   1.907   1.00 2.62  ? 1107 ALA A O    1  
ATOM   63    C  CB   . ALA A 1 5  ? 11.251  6.950   2.853   1.00 4.73  ? 1107 ALA A CB   1  
ATOM   64    H  H    . ALA A 1 5  ? 13.289  8.366   2.207   1.00 4.51  ? 1107 ALA A H    1  
ATOM   65    H  HA   . ALA A 1 5  ? 12.661  6.616   4.405   1.00 4.04  ? 1107 ALA A HA   1  
ATOM   66    H  HB1  . ALA A 1 5  ? 10.911  7.893   3.256   1.00 5.01  ? 1107 ALA A HB1  1  
ATOM   67    H  HB2  . ALA A 1 5  ? 10.602  6.159   3.195   1.00 4.95  ? 1107 ALA A HB2  1  
ATOM   68    H  HB3  . ALA A 1 5  ? 11.233  6.991   1.776   1.00 5.29  ? 1107 ALA A HB3  1  
ATOM   69    N  N    . SER A 1 6  ? 12.623  4.262   3.228   1.00 2.16  ? 1108 SER A N    1  
ATOM   70    C  CA   . SER A 1 6  ? 13.006  2.947   2.744   1.00 1.43  ? 1108 SER A CA   1  
ATOM   71    C  C    . SER A 1 6  ? 12.605  2.773   1.279   1.00 1.29  ? 1108 SER A C    1  
ATOM   72    O  O    . SER A 1 6  ? 11.707  3.465   0.789   1.00 1.97  ? 1108 SER A O    1  
ATOM   73    C  CB   . SER A 1 6  ? 12.367  1.873   3.624   1.00 2.09  ? 1108 SER A CB   1  
ATOM   74    O  OG   . SER A 1 6  ? 11.013  2.187   3.905   1.00 2.97  ? 1108 SER A OG   1  
ATOM   75    H  H    . SER A 1 6  ? 11.926  4.332   3.916   1.00 2.71  ? 1108 SER A H    1  
ATOM   76    H  HA   . SER A 1 6  ? 14.079  2.867   2.821   1.00 1.32  ? 1108 SER A HA   1  
ATOM   77    H  HB2  . SER A 1 6  ? 12.407  0.925   3.114   1.00 2.36  ? 1108 SER A HB2  1  
ATOM   78    H  HB3  . SER A 1 6  ? 12.909  1.806   4.556   1.00 2.13  ? 1108 SER A HB3  1  
ATOM   79    H  HG   . SER A 1 6  ? 10.477  2.018   3.111   1.00 3.32  ? 1108 SER A HG   1  
ATOM   80    N  N    . CYS A 1 7  ? 13.278  1.854   0.587   1.00 0.72  ? 1109 CYS A N    1  
ATOM   81    C  CA   . CYS A 1 7  ? 13.070  1.641   -0.844  1.00 0.49  ? 1109 CYS A CA   1  
ATOM   82    C  C    . CYS A 1 7  ? 13.419  2.898   -1.647  1.00 0.46  ? 1109 CYS A C    1  
ATOM   83    O  O    . CYS A 1 7  ? 14.117  3.790   -1.154  1.00 0.62  ? 1109 CYS A O    1  
ATOM   84    C  CB   . CYS A 1 7  ? 11.628  1.203   -1.108  1.00 0.33  ? 1109 CYS A CB   1  
ATOM   85    S  SG   . CYS A 1 7  ? 11.170  -0.373  -0.309  1.00 0.47  ? 1109 CYS A SG   1  
ATOM   86    H  H    . CYS A 1 7  ? 13.921  1.290   1.055   1.00 0.94  ? 1109 CYS A H    1  
ATOM   87    H  HA   . CYS A 1 7  ? 13.731  0.848   -1.160  1.00 0.60  ? 1109 CYS A HA   1  
ATOM   88    H  HB2  . CYS A 1 7  ? 10.963  1.962   -0.733  1.00 0.41  ? 1109 CYS A HB2  1  
ATOM   89    H  HB3  . CYS A 1 7  ? 11.479  1.090   -2.172  1.00 0.29  ? 1109 CYS A HB3  1  
ATOM   90    N  N    . LEU A 1 8  ? 12.968  2.943   -2.890  1.00 0.34  ? 1110 LEU A N    1  
ATOM   91    C  CA   . LEU A 1 8  ? 13.220  4.077   -3.773  1.00 0.32  ? 1110 LEU A CA   1  
ATOM   92    C  C    . LEU A 1 8  ? 12.381  5.283   -3.354  1.00 0.29  ? 1110 LEU A C    1  
ATOM   93    O  O    . LEU A 1 8  ? 11.464  5.149   -2.543  1.00 0.30  ? 1110 LEU A O    1  
ATOM   94    C  CB   . LEU A 1 8  ? 12.856  3.676   -5.198  1.00 0.28  ? 1110 LEU A CB   1  
ATOM   95    C  CG   . LEU A 1 8  ? 13.638  4.345   -6.322  1.00 0.38  ? 1110 LEU A CG   1  
ATOM   96    C  CD1  . LEU A 1 8  ? 15.113  3.989   -6.236  1.00 0.52  ? 1110 LEU A CD1  1  
ATOM   97    C  CD2  . LEU A 1 8  ? 13.062  3.924   -7.665  1.00 0.39  ? 1110 LEU A CD2  1  
ATOM   98    H  H    . LEU A 1 8  ? 12.456  2.182   -3.236  1.00 0.34  ? 1110 LEU A H    1  
ATOM   99    H  HA   . LEU A 1 8  ? 14.266  4.327   -3.723  1.00 0.40  ? 1110 LEU A HA   1  
ATOM   100   H  HB2  . LEU A 1 8  ? 12.982  2.608   -5.285  1.00 0.32  ? 1110 LEU A HB2  1  
ATOM   101   H  HB3  . LEU A 1 8  ? 11.808  3.899   -5.347  1.00 0.22  ? 1110 LEU A HB3  1  
ATOM   102   H  HG   . LEU A 1 8  ? 13.543  5.416   -6.236  1.00 0.41  ? 1110 LEU A HG   1  
ATOM   103   H  HD11 . LEU A 1 8  ? 15.642  4.447   -7.059  1.00 1.05  ? 1110 LEU A HD11 1  
ATOM   104   H  HD12 . LEU A 1 8  ? 15.229  2.916   -6.288  1.00 1.29  ? 1110 LEU A HD12 1  
ATOM   105   H  HD13 . LEU A 1 8  ? 15.518  4.349   -5.303  1.00 1.07  ? 1110 LEU A HD13 1  
ATOM   106   H  HD21 . LEU A 1 8  ? 13.131  2.850   -7.765  1.00 1.11  ? 1110 LEU A HD21 1  
ATOM   107   H  HD22 . LEU A 1 8  ? 13.615  4.399   -8.459  1.00 1.05  ? 1110 LEU A HD22 1  
ATOM   108   H  HD23 . LEU A 1 8  ? 12.023  4.221   -7.718  1.00 0.97  ? 1110 LEU A HD23 1  
ATOM   109   N  N    . ASP A 1 9  ? 12.682  6.449   -3.913  1.00 0.35  ? 1111 ASP A N    1  
ATOM   110   C  CA   . ASP A 1 9  ? 11.872  7.639   -3.662  1.00 0.38  ? 1111 ASP A CA   1  
ATOM   111   C  C    . ASP A 1 9  ? 10.472  7.444   -4.228  1.00 0.32  ? 1111 ASP A C    1  
ATOM   112   O  O    . ASP A 1 9  ? 9.471   7.792   -3.600  1.00 0.42  ? 1111 ASP A O    1  
ATOM   113   C  CB   . ASP A 1 9  ? 12.514  8.881   -4.289  1.00 0.51  ? 1111 ASP A CB   1  
ATOM   114   C  CG   . ASP A 1 9  ? 11.683  10.133  -4.073  1.00 1.37  ? 1111 ASP A CG   1  
ATOM   115   O  OD1  . ASP A 1 9  ? 11.861  10.803  -3.028  1.00 1.53  ? 1111 ASP A OD1  1  
ATOM   116   O  OD2  . ASP A 1 9  ? 10.848  10.459  -4.943  1.00 2.32  ? 1111 ASP A OD2  1  
ATOM   117   H  H    . ASP A 1 9  ? 13.467  6.514   -4.503  1.00 0.40  ? 1111 ASP A H    1  
ATOM   118   H  HA   . ASP A 1 9  ? 11.804  7.776   -2.592  1.00 0.44  ? 1111 ASP A HA   1  
ATOM   119   H  HB2  . ASP A 1 9  ? 13.487  9.036   -3.849  1.00 0.94  ? 1111 ASP A HB2  1  
ATOM   120   H  HB3  . ASP A 1 9  ? 12.626  8.723   -5.351  1.00 1.01  ? 1111 ASP A HB3  1  
ATOM   121   N  N    . THR A 1 10 ? 10.413  6.864   -5.416  1.00 0.28  ? 1112 THR A N    1  
ATOM   122   C  CA   . THR A 1 10 ? 9.151   6.610   -6.087  1.00 0.31  ? 1112 THR A CA   1  
ATOM   123   C  C    . THR A 1 10 ? 8.589   5.239   -5.725  1.00 0.24  ? 1112 THR A C    1  
ATOM   124   O  O    . THR A 1 10 ? 7.520   4.848   -6.198  1.00 0.30  ? 1112 THR A O    1  
ATOM   125   C  CB   . THR A 1 10 ? 9.321   6.711   -7.612  1.00 0.42  ? 1112 THR A CB   1  
ATOM   126   O  OG1  . THR A 1 10 ? 10.541  6.066   -8.007  1.00 0.45  ? 1112 THR A OG1  1  
ATOM   127   C  CG2  . THR A 1 10 ? 9.340   8.161   -8.060  1.00 0.52  ? 1112 THR A CG2  1  
ATOM   128   H  H    . THR A 1 10 ? 11.247  6.607   -5.863  1.00 0.31  ? 1112 THR A H    1  
ATOM   129   H  HA   . THR A 1 10 ? 8.451   7.371   -5.776  1.00 0.36  ? 1112 THR A HA   1  
ATOM   130   H  HB   . THR A 1 10 ? 8.487   6.213   -8.086  1.00 0.48  ? 1112 THR A HB   1  
ATOM   131   H  HG1  . THR A 1 10 ? 10.350  5.432   -8.711  1.00 0.95  ? 1112 THR A HG1  1  
ATOM   132   H  HG21 . THR A 1 10 ? 10.157  8.676   -7.575  1.00 1.19  ? 1112 THR A HG21 1  
ATOM   133   H  HG22 . THR A 1 10 ? 8.407   8.632   -7.790  1.00 1.09  ? 1112 THR A HG22 1  
ATOM   134   H  HG23 . THR A 1 10 ? 9.471   8.204   -9.130  1.00 1.17  ? 1112 THR A HG23 1  
ATOM   135   N  N    . GLN A 1 11 ? 9.308   4.505   -4.886  1.00 0.18  ? 1113 GLN A N    1  
ATOM   136   C  CA   . GLN A 1 11 ? 8.850   3.203   -4.455  1.00 0.17  ? 1113 GLN A CA   1  
ATOM   137   C  C    . GLN A 1 11 ? 8.169   3.267   -3.109  1.00 0.17  ? 1113 GLN A C    1  
ATOM   138   O  O    . GLN A 1 11 ? 8.449   4.133   -2.284  1.00 0.23  ? 1113 GLN A O    1  
ATOM   139   C  CB   . GLN A 1 11 ? 10.000  2.211   -4.391  1.00 0.17  ? 1113 GLN A CB   1  
ATOM   140   C  CG   . GLN A 1 11 ? 10.400  1.673   -5.748  1.00 0.23  ? 1113 GLN A CG   1  
ATOM   141   C  CD   . GLN A 1 11 ? 11.440  0.578   -5.655  1.00 0.35  ? 1113 GLN A CD   1  
ATOM   142   O  OE1  . GLN A 1 11 ? 12.254  0.553   -4.728  1.00 1.02  ? 1113 GLN A OE1  1  
ATOM   143   N  NE2  . GLN A 1 11 ? 11.429  -0.330  -6.616  1.00 0.67  ? 1113 GLN A NE2  1  
ATOM   144   H  H    . GLN A 1 11 ? 10.160  4.848   -4.549  1.00 0.20  ? 1113 GLN A H    1  
ATOM   145   H  HA   . GLN A 1 11 ? 8.135   2.853   -5.183  1.00 0.22  ? 1113 GLN A HA   1  
ATOM   146   H  HB2  . GLN A 1 11 ? 10.858  2.699   -3.949  1.00 0.16  ? 1113 GLN A HB2  1  
ATOM   147   H  HB3  . GLN A 1 11 ? 9.712   1.383   -3.767  1.00 0.20  ? 1113 GLN A HB3  1  
ATOM   148   H  HG2  . GLN A 1 11 ? 9.522   1.283   -6.228  1.00 0.31  ? 1113 GLN A HG2  1  
ATOM   149   H  HG3  . GLN A 1 11 ? 10.799  2.482   -6.340  1.00 0.22  ? 1113 GLN A HG3  1  
ATOM   150   H  HE21 . GLN A 1 11 ? 10.756  -0.246  -7.325  1.00 1.21  ? 1113 GLN A HE21 1  
ATOM   151   H  HE22 . GLN A 1 11 ? 12.098  -1.047  -6.585  1.00 0.65  ? 1113 GLN A HE22 1  
ATOM   152   N  N    . TYR A 1 12 ? 7.277   2.326   -2.908  1.00 0.15  ? 1114 TYR A N    1  
ATOM   153   C  CA   . TYR A 1 12 ? 6.562   2.180   -1.659  1.00 0.16  ? 1114 TYR A CA   1  
ATOM   154   C  C    . TYR A 1 12 ? 7.162   1.028   -0.883  1.00 0.15  ? 1114 TYR A C    1  
ATOM   155   O  O    . TYR A 1 12 ? 7.655   0.064   -1.471  1.00 0.15  ? 1114 TYR A O    1  
ATOM   156   C  CB   . TYR A 1 12 ? 5.085   1.911   -1.933  1.00 0.18  ? 1114 TYR A CB   1  
ATOM   157   C  CG   . TYR A 1 12 ? 4.229   1.703   -0.702  1.00 0.22  ? 1114 TYR A CG   1  
ATOM   158   C  CD1  . TYR A 1 12 ? 3.937   2.753   0.161   1.00 0.33  ? 1114 TYR A CD1  1  
ATOM   159   C  CD2  . TYR A 1 12 ? 3.698   0.451   -0.416  1.00 0.21  ? 1114 TYR A CD2  1  
ATOM   160   C  CE1  . TYR A 1 12 ? 3.140   2.558   1.274   1.00 0.39  ? 1114 TYR A CE1  1  
ATOM   161   C  CE2  . TYR A 1 12 ? 2.904   0.249   0.695   1.00 0.26  ? 1114 TYR A CE2  1  
ATOM   162   C  CZ   . TYR A 1 12 ? 2.629   1.303   1.537   1.00 0.34  ? 1114 TYR A CZ   1  
ATOM   163   O  OH   . TYR A 1 12 ? 1.828   1.107   2.639   1.00 0.41  ? 1114 TYR A OH   1  
ATOM   164   H  H    . TYR A 1 12 ? 7.107   1.680   -3.635  1.00 0.16  ? 1114 TYR A H    1  
ATOM   165   H  HA   . TYR A 1 12 ? 6.667   3.093   -1.093  1.00 0.18  ? 1114 TYR A HA   1  
ATOM   166   H  HB2  . TYR A 1 12 ? 4.669   2.735   -2.489  1.00 0.23  ? 1114 TYR A HB2  1  
ATOM   167   H  HB3  . TYR A 1 12 ? 5.016   1.017   -2.525  1.00 0.18  ? 1114 TYR A HB3  1  
ATOM   168   H  HD1  . TYR A 1 12 ? 4.342   3.732   -0.048  1.00 0.40  ? 1114 TYR A HD1  1  
ATOM   169   H  HD2  . TYR A 1 12 ? 3.916   -0.375  -1.076  1.00 0.23  ? 1114 TYR A HD2  1  
ATOM   170   H  HE1  . TYR A 1 12 ? 2.924   3.384   1.933   1.00 0.50  ? 1114 TYR A HE1  1  
ATOM   171   H  HE2  . TYR A 1 12 ? 2.504   -0.733  0.901   1.00 0.29  ? 1114 TYR A HE2  1  
ATOM   172   H  HH   . TYR A 1 12 ? 1.974   0.217   2.988   1.00 0.89  ? 1114 TYR A HH   1  
ATOM   173   N  N    . THR A 1 13 ? 7.120   1.131   0.423   1.00 0.18  ? 1115 THR A N    1  
ATOM   174   C  CA   . THR A 1 13 ? 7.656   0.095   1.277   1.00 0.20  ? 1115 THR A CA   1  
ATOM   175   C  C    . THR A 1 13 ? 6.516   -0.672  1.924   1.00 0.23  ? 1115 THR A C    1  
ATOM   176   O  O    . THR A 1 13 ? 5.872   -0.187  2.855   1.00 0.31  ? 1115 THR A O    1  
ATOM   177   C  CB   . THR A 1 13 ? 8.575   0.668   2.367   1.00 0.26  ? 1115 THR A CB   1  
ATOM   178   O  OG1  . THR A 1 13 ? 9.434   1.667   1.802   1.00 0.30  ? 1115 THR A OG1  1  
ATOM   179   C  CG2  . THR A 1 13 ? 9.421   -0.436  2.985   1.00 0.27  ? 1115 THR A CG2  1  
ATOM   180   H  H    . THR A 1 13 ? 6.685   1.912   0.823   1.00 0.22  ? 1115 THR A H    1  
ATOM   181   H  HA   . THR A 1 13 ? 8.232   -0.582  0.661   1.00 0.19  ? 1115 THR A HA   1  
ATOM   182   H  HB   . THR A 1 13 ? 7.965   1.114   3.139   1.00 0.31  ? 1115 THR A HB   1  
ATOM   183   H  HG1  . THR A 1 13 ? 8.930   2.202   1.177   1.00 0.82  ? 1115 THR A HG1  1  
ATOM   184   H  HG21 . THR A 1 13 ? 8.777   -1.208  3.378   1.00 1.01  ? 1115 THR A HG21 1  
ATOM   185   H  HG22 . THR A 1 13 ? 10.020  -0.026  3.785   1.00 1.02  ? 1115 THR A HG22 1  
ATOM   186   H  HG23 . THR A 1 13 ? 10.070  -0.857  2.230   1.00 1.10  ? 1115 THR A HG23 1  
ATOM   187   N  N    . CYS A 1 14 ? 6.256   -1.856  1.402   1.00 0.26  ? 1116 CYS A N    1  
ATOM   188   C  CA   . CYS A 1 14 ? 5.169   -2.687  1.890   1.00 0.34  ? 1116 CYS A CA   1  
ATOM   189   C  C    . CYS A 1 14 ? 5.428   -3.145  3.320   1.00 0.40  ? 1116 CYS A C    1  
ATOM   190   O  O    . CYS A 1 14 ? 6.534   -2.980  3.842   1.00 0.37  ? 1116 CYS A O    1  
ATOM   191   C  CB   . CYS A 1 14 ? 5.007   -3.900  0.982   1.00 0.45  ? 1116 CYS A CB   1  
ATOM   192   S  SG   . CYS A 1 14 ? 4.906   -3.490  -0.786  1.00 0.65  ? 1116 CYS A SG   1  
ATOM   193   H  H    . CYS A 1 14 ? 6.809   -2.180  0.654   1.00 0.28  ? 1116 CYS A H    1  
ATOM   194   H  HA   . CYS A 1 14 ? 4.262   -2.103  1.864   1.00 0.38  ? 1116 CYS A HA   1  
ATOM   195   H  HB2  . CYS A 1 14 ? 5.850   -4.560  1.119   1.00 0.50  ? 1116 CYS A HB2  1  
ATOM   196   H  HB3  . CYS A 1 14 ? 4.101   -4.422  1.252   1.00 0.54  ? 1116 CYS A HB3  1  
ATOM   197   N  N    . ASP A 1 15 ? 4.422   -3.735  3.949   1.00 0.56  ? 1117 ASP A N    1  
ATOM   198   C  CA   . ASP A 1 15 ? 4.580   -4.254  5.304   1.00 0.69  ? 1117 ASP A CA   1  
ATOM   199   C  C    . ASP A 1 15 ? 5.578   -5.407  5.299   1.00 0.65  ? 1117 ASP A C    1  
ATOM   200   O  O    . ASP A 1 15 ? 6.320   -5.616  6.260   1.00 0.71  ? 1117 ASP A O    1  
ATOM   201   C  CB   . ASP A 1 15 ? 3.233   -4.719  5.859   1.00 0.93  ? 1117 ASP A CB   1  
ATOM   202   C  CG   . ASP A 1 15 ? 3.328   -5.193  7.293   1.00 1.83  ? 1117 ASP A CG   1  
ATOM   203   O  OD1  . ASP A 1 15 ? 3.372   -4.342  8.202   1.00 2.62  ? 1117 ASP A OD1  1  
ATOM   204   O  OD2  . ASP A 1 15 ? 3.347   -6.419  7.521   1.00 2.09  ? 1117 ASP A OD2  1  
ATOM   205   H  H    . ASP A 1 15 ? 3.555   -3.829  3.494   1.00 0.63  ? 1117 ASP A H    1  
ATOM   206   H  HA   . ASP A 1 15 ? 4.966   -3.459  5.925   1.00 0.70  ? 1117 ASP A HA   1  
ATOM   207   H  HB2  . ASP A 1 15 ? 2.531   -3.901  5.816   1.00 1.35  ? 1117 ASP A HB2  1  
ATOM   208   H  HB3  . ASP A 1 15 ? 2.865   -5.535  5.253   1.00 0.70  ? 1117 ASP A HB3  1  
ATOM   209   N  N    . ASN A 1 16 ? 5.612   -6.123  4.180   1.00 0.69  ? 1118 ASN A N    1  
ATOM   210   C  CA   . ASN A 1 16 ? 6.549   -7.227  3.983   1.00 0.75  ? 1118 ASN A CA   1  
ATOM   211   C  C    . ASN A 1 16 ? 7.925   -6.695  3.560   1.00 0.59  ? 1118 ASN A C    1  
ATOM   212   O  O    . ASN A 1 16 ? 8.815   -7.455  3.189   1.00 0.65  ? 1118 ASN A O    1  
ATOM   213   C  CB   . ASN A 1 16 ? 5.986   -8.192  2.937   1.00 0.98  ? 1118 ASN A CB   1  
ATOM   214   C  CG   . ASN A 1 16 ? 6.735   -9.513  2.861   1.00 1.77  ? 1118 ASN A CG   1  
ATOM   215   O  OD1  . ASN A 1 16 ? 7.641   -9.686  2.043   1.00 2.75  ? 1118 ASN A OD1  1  
ATOM   216   N  ND2  . ASN A 1 16 ? 6.360   -10.455 3.710   1.00 2.02  ? 1118 ASN A ND2  1  
ATOM   217   H  H    . ASN A 1 16 ? 4.973   -5.913  3.466   1.00 0.75  ? 1118 ASN A H    1  
ATOM   218   H  HA   . ASN A 1 16 ? 6.649   -7.747  4.915   1.00 0.85  ? 1118 ASN A HA   1  
ATOM   219   H  HB2  . ASN A 1 16 ? 4.955   -8.402  3.172   1.00 1.24  ? 1118 ASN A HB2  1  
ATOM   220   H  HB3  . ASN A 1 16 ? 6.039   -7.717  1.976   1.00 1.41  ? 1118 ASN A HB3  1  
ATOM   221   H  HD21 . ASN A 1 16 ? 5.627   -10.254 4.334   1.00 1.91  ? 1118 ASN A HD21 1  
ATOM   222   H  HD22 . ASN A 1 16 ? 6.834   -11.312 3.691   1.00 2.74  ? 1118 ASN A HD22 1  
ATOM   223   N  N    . HIS A 1 17 ? 8.081   -5.369  3.627   1.00 0.46  ? 1119 HIS A N    1  
ATOM   224   C  CA   . HIS A 1 17 ? 9.338   -4.686  3.288   1.00 0.41  ? 1119 HIS A CA   1  
ATOM   225   C  C    . HIS A 1 17 ? 9.643   -4.774  1.798   1.00 0.44  ? 1119 HIS A C    1  
ATOM   226   O  O    . HIS A 1 17 ? 10.784  -4.588  1.374   1.00 0.79  ? 1119 HIS A O    1  
ATOM   227   C  CB   . HIS A 1 17 ? 10.515  -5.238  4.102   1.00 0.51  ? 1119 HIS A CB   1  
ATOM   228   C  CG   . HIS A 1 17 ? 10.399  -4.984  5.572   1.00 0.63  ? 1119 HIS A CG   1  
ATOM   229   N  ND1  . HIS A 1 17 ? 10.147  -5.978  6.492   1.00 0.94  ? 1119 HIS A ND1  1  
ATOM   230   C  CD2  . HIS A 1 17 ? 10.499  -3.836  6.280   1.00 0.78  ? 1119 HIS A CD2  1  
ATOM   231   C  CE1  . HIS A 1 17 ? 10.094  -5.451  7.700   1.00 1.05  ? 1119 HIS A CE1  1  
ATOM   232   N  NE2  . HIS A 1 17 ? 10.305  -4.155  7.599   1.00 0.93  ? 1119 HIS A NE2  1  
ATOM   233   H  H    . HIS A 1 17 ? 7.321   -4.824  3.925   1.00 0.47  ? 1119 HIS A H    1  
ATOM   234   H  HA   . HIS A 1 17 ? 9.209   -3.644  3.541   1.00 0.38  ? 1119 HIS A HA   1  
ATOM   235   H  HB2  . HIS A 1 17 ? 10.576  -6.306  3.954   1.00 0.60  ? 1119 HIS A HB2  1  
ATOM   236   H  HB3  . HIS A 1 17 ? 11.430  -4.778  3.756   1.00 0.55  ? 1119 HIS A HB3  1  
ATOM   237   H  HD1  . HIS A 1 17 ? 10.033  -6.935  6.291   1.00 1.18  ? 1119 HIS A HD1  1  
ATOM   238   H  HD2  . HIS A 1 17 ? 10.696  -2.852  5.881   1.00 1.00  ? 1119 HIS A HD2  1  
ATOM   239   H  HE1  . HIS A 1 17 ? 9.910   -5.992  8.615   1.00 1.35  ? 1119 HIS A HE1  1  
ATOM   240   H  HE2  . HIS A 1 17 ? 10.429  -3.543  8.357   1.00 1.09  ? 1119 HIS A HE2  1  
ATOM   241   N  N    . GLN A 1 18 ? 8.617   -5.045  1.007   1.00 0.40  ? 1120 GLN A N    1  
ATOM   242   C  CA   . GLN A 1 18 ? 8.762   -5.109  -0.437  1.00 0.38  ? 1120 GLN A CA   1  
ATOM   243   C  C    . GLN A 1 18 ? 8.792   -3.701  -1.025  1.00 0.29  ? 1120 GLN A C    1  
ATOM   244   O  O    . GLN A 1 18 ? 8.136   -2.794  -0.507  1.00 0.39  ? 1120 GLN A O    1  
ATOM   245   C  CB   . GLN A 1 18 ? 7.613   -5.919  -1.047  1.00 0.49  ? 1120 GLN A CB   1  
ATOM   246   C  CG   . GLN A 1 18 ? 7.724   -6.102  -2.553  1.00 0.50  ? 1120 GLN A CG   1  
ATOM   247   C  CD   . GLN A 1 18 ? 9.026   -6.765  -2.958  1.00 1.05  ? 1120 GLN A CD   1  
ATOM   248   O  OE1  . GLN A 1 18 ? 10.020  -6.092  -3.232  1.00 1.91  ? 1120 GLN A OE1  1  
ATOM   249   N  NE2  . GLN A 1 18 ? 9.029   -8.085  -2.994  1.00 1.51  ? 1120 GLN A NE2  1  
ATOM   250   H  H    . GLN A 1 18 ? 7.740   -5.207  1.405   1.00 0.63  ? 1120 GLN A H    1  
ATOM   251   H  HA   . GLN A 1 18 ? 9.698   -5.602  -0.657  1.00 0.42  ? 1120 GLN A HA   1  
ATOM   252   H  HB2  . GLN A 1 18 ? 7.594   -6.896  -0.588  1.00 0.62  ? 1120 GLN A HB2  1  
ATOM   253   H  HB3  . GLN A 1 18 ? 6.681   -5.414  -0.836  1.00 0.52  ? 1120 GLN A HB3  1  
ATOM   254   H  HG2  . GLN A 1 18 ? 6.903   -6.717  -2.891  1.00 0.87  ? 1120 GLN A HG2  1  
ATOM   255   H  HG3  . GLN A 1 18 ? 7.667   -5.134  -3.026  1.00 0.86  ? 1120 GLN A HG3  1  
ATOM   256   H  HE21 . GLN A 1 18 ? 8.199   -8.557  -2.758  1.00 1.83  ? 1120 GLN A HE21 1  
ATOM   257   H  HE22 . GLN A 1 18 ? 9.859   -8.540  -3.247  1.00 1.99  ? 1120 GLN A HE22 1  
ATOM   258   N  N    . CYS A 1 19 ? 9.556   -3.525  -2.091  1.00 0.21  ? 1121 CYS A N    1  
ATOM   259   C  CA   . CYS A 1 19 ? 9.675   -2.232  -2.745  1.00 0.21  ? 1121 CYS A CA   1  
ATOM   260   C  C    . CYS A 1 19 ? 8.944   -2.240  -4.082  1.00 0.20  ? 1121 CYS A C    1  
ATOM   261   O  O    . CYS A 1 19 ? 9.457   -2.748  -5.082  1.00 0.34  ? 1121 CYS A O    1  
ATOM   262   C  CB   . CYS A 1 19 ? 11.150  -1.879  -2.953  1.00 0.34  ? 1121 CYS A CB   1  
ATOM   263   S  SG   . CYS A 1 19 ? 12.122  -1.785  -1.413  1.00 0.42  ? 1121 CYS A SG   1  
ATOM   264   H  H    . CYS A 1 19 ? 10.050  -4.293  -2.458  1.00 0.29  ? 1121 CYS A H    1  
ATOM   265   H  HA   . CYS A 1 19 ? 9.223   -1.491  -2.102  1.00 0.24  ? 1121 CYS A HA   1  
ATOM   266   H  HB2  . CYS A 1 19 ? 11.605  -2.628  -3.583  1.00 0.39  ? 1121 CYS A HB2  1  
ATOM   267   H  HB3  . CYS A 1 19 ? 11.216  -0.917  -3.442  1.00 0.41  ? 1121 CYS A HB3  1  
ATOM   268   N  N    . ILE A 1 20 ? 7.740   -1.689  -4.095  1.00 0.15  ? 1122 ILE A N    1  
ATOM   269   C  CA   . ILE A 1 20 ? 6.948   -1.610  -5.314  1.00 0.14  ? 1122 ILE A CA   1  
ATOM   270   C  C    . ILE A 1 20 ? 6.787   -0.162  -5.745  1.00 0.14  ? 1122 ILE A C    1  
ATOM   271   O  O    . ILE A 1 20 ? 7.208   0.746   -5.039  1.00 0.18  ? 1122 ILE A O    1  
ATOM   272   C  CB   . ILE A 1 20 ? 5.550   -2.225  -5.134  1.00 0.14  ? 1122 ILE A CB   1  
ATOM   273   C  CG1  . ILE A 1 20 ? 4.756   -1.442  -4.091  1.00 0.13  ? 1122 ILE A CG1  1  
ATOM   274   C  CG2  . ILE A 1 20 ? 5.659   -3.692  -4.741  1.00 0.19  ? 1122 ILE A CG2  1  
ATOM   275   C  CD1  . ILE A 1 20 ? 3.302   -1.841  -4.025  1.00 0.17  ? 1122 ILE A CD1  1  
ATOM   276   H  H    . ILE A 1 20 ? 7.376   -1.317  -3.261  1.00 0.22  ? 1122 ILE A H    1  
ATOM   277   H  HA   . ILE A 1 20 ? 7.463   -2.153  -6.088  1.00 0.17  ? 1122 ILE A HA   1  
ATOM   278   H  HB   . ILE A 1 20 ? 5.037   -2.170  -6.081  1.00 0.16  ? 1122 ILE A HB   1  
ATOM   279   H  HG12 . ILE A 1 20 ? 5.191   -1.607  -3.116  1.00 0.15  ? 1122 ILE A HG12 1  
ATOM   280   H  HG13 . ILE A 1 20 ? 4.803   -0.389  -4.328  1.00 0.14  ? 1122 ILE A HG13 1  
ATOM   281   H  HG21 . ILE A 1 20 ? 6.180   -4.236  -5.514  1.00 0.98  ? 1122 ILE A HG21 1  
ATOM   282   H  HG22 . ILE A 1 20 ? 4.669   -4.103  -4.616  1.00 1.05  ? 1122 ILE A HG22 1  
ATOM   283   H  HG23 . ILE A 1 20 ? 6.203   -3.774  -3.812  1.00 0.97  ? 1122 ILE A HG23 1  
ATOM   284   H  HD11 . ILE A 1 20 ? 2.845   -1.687  -4.990  1.00 1.07  ? 1122 ILE A HD11 1  
ATOM   285   H  HD12 . ILE A 1 20 ? 2.797   -1.238  -3.285  1.00 0.99  ? 1122 ILE A HD12 1  
ATOM   286   H  HD13 . ILE A 1 20 ? 3.228   -2.883  -3.754  1.00 1.03  ? 1122 ILE A HD13 1  
ATOM   287   N  N    . SER A 1 21 ? 6.182   0.057   -6.898  1.00 0.16  ? 1123 SER A N    1  
ATOM   288   C  CA   . SER A 1 21 ? 5.877   1.405   -7.347  1.00 0.17  ? 1123 SER A CA   1  
ATOM   289   C  C    . SER A 1 21 ? 4.748   1.997   -6.517  1.00 0.15  ? 1123 SER A C    1  
ATOM   290   O  O    . SER A 1 21 ? 3.788   1.306   -6.168  1.00 0.17  ? 1123 SER A O    1  
ATOM   291   C  CB   . SER A 1 21 ? 5.473   1.400   -8.822  1.00 0.24  ? 1123 SER A CB   1  
ATOM   292   O  OG   . SER A 1 21 ? 4.959   2.666   -9.211  1.00 0.33  ? 1123 SER A OG   1  
ATOM   293   H  H    . SER A 1 21 ? 5.938   -0.705  -7.464  1.00 0.20  ? 1123 SER A H    1  
ATOM   294   H  HA   . SER A 1 21 ? 6.765   2.009   -7.223  1.00 0.19  ? 1123 SER A HA   1  
ATOM   295   H  HB2  . SER A 1 21 ? 6.335   1.171   -9.429  1.00 0.27  ? 1123 SER A HB2  1  
ATOM   296   H  HB3  . SER A 1 21 ? 4.712   0.650   -8.982  1.00 0.24  ? 1123 SER A HB3  1  
ATOM   297   H  HG   . SER A 1 21 ? 4.141   2.540   -9.705  1.00 0.63  ? 1123 SER A HG   1  
ATOM   298   N  N    . LYS A 1 22 ? 4.858   3.286   -6.215  1.00 0.17  ? 1124 LYS A N    1  
ATOM   299   C  CA   . LYS A 1 22 ? 3.810   3.993   -5.492  1.00 0.19  ? 1124 LYS A CA   1  
ATOM   300   C  C    . LYS A 1 22 ? 2.549   4.116   -6.342  1.00 0.22  ? 1124 LYS A C    1  
ATOM   301   O  O    . LYS A 1 22 ? 1.481   4.445   -5.831  1.00 0.25  ? 1124 LYS A O    1  
ATOM   302   C  CB   . LYS A 1 22 ? 4.287   5.380   -5.058  1.00 0.23  ? 1124 LYS A CB   1  
ATOM   303   C  CG   . LYS A 1 22 ? 5.279   5.348   -3.910  1.00 0.25  ? 1124 LYS A CG   1  
ATOM   304   C  CD   . LYS A 1 22 ? 5.763   6.742   -3.549  1.00 0.25  ? 1124 LYS A CD   1  
ATOM   305   C  CE   . LYS A 1 22 ? 6.672   6.708   -2.332  1.00 0.30  ? 1124 LYS A CE   1  
ATOM   306   N  NZ   . LYS A 1 22 ? 7.239   8.047   -2.022  1.00 1.24  ? 1124 LYS A NZ   1  
ATOM   307   H  H    . LYS A 1 22 ? 5.671   3.774   -6.480  1.00 0.20  ? 1124 LYS A H    1  
ATOM   308   H  HA   . LYS A 1 22 ? 3.575   3.415   -4.611  1.00 0.19  ? 1124 LYS A HA   1  
ATOM   309   H  HB2  . LYS A 1 22 ? 4.758   5.867   -5.899  1.00 0.30  ? 1124 LYS A HB2  1  
ATOM   310   H  HB3  . LYS A 1 22 ? 3.431   5.961   -4.749  1.00 0.30  ? 1124 LYS A HB3  1  
ATOM   311   H  HG2  . LYS A 1 22 ? 4.802   4.910   -3.045  1.00 0.37  ? 1124 LYS A HG2  1  
ATOM   312   H  HG3  . LYS A 1 22 ? 6.129   4.745   -4.198  1.00 0.37  ? 1124 LYS A HG3  1  
ATOM   313   H  HD2  . LYS A 1 22 ? 6.310   7.153   -4.384  1.00 0.32  ? 1124 LYS A HD2  1  
ATOM   314   H  HD3  . LYS A 1 22 ? 4.908   7.365   -3.331  1.00 0.33  ? 1124 LYS A HD3  1  
ATOM   315   H  HE2  . LYS A 1 22 ? 6.102   6.363   -1.483  1.00 0.93  ? 1124 LYS A HE2  1  
ATOM   316   H  HE3  . LYS A 1 22 ? 7.482   6.020   -2.523  1.00 0.95  ? 1124 LYS A HE3  1  
ATOM   317   H  HZ1  . LYS A 1 22 ? 6.478   8.753   -1.964  1.00 1.76  ? 1124 LYS A HZ1  1  
ATOM   318   H  HZ2  . LYS A 1 22 ? 7.911   8.333   -2.765  1.00 1.77  ? 1124 LYS A HZ2  1  
ATOM   319   H  HZ3  . LYS A 1 22 ? 7.740   8.019   -1.113  1.00 1.88  ? 1124 LYS A HZ3  1  
ATOM   320   N  N    . ASN A 1 23 ? 2.672   3.844   -7.639  1.00 0.24  ? 1125 ASN A N    1  
ATOM   321   C  CA   . ASN A 1 23 ? 1.519   3.891   -8.535  1.00 0.28  ? 1125 ASN A CA   1  
ATOM   322   C  C    . ASN A 1 23 ? 0.734   2.586   -8.469  1.00 0.26  ? 1125 ASN A C    1  
ATOM   323   O  O    . ASN A 1 23 ? -0.366  2.483   -9.004  1.00 0.32  ? 1125 ASN A O    1  
ATOM   324   C  CB   . ASN A 1 23 ? 1.956   4.161   -9.976  1.00 0.36  ? 1125 ASN A CB   1  
ATOM   325   C  CG   . ASN A 1 23 ? 2.617   5.516   -10.143 1.00 1.03  ? 1125 ASN A CG   1  
ATOM   326   O  OD1  . ASN A 1 23 ? 3.831   5.649   -9.983  1.00 1.75  ? 1125 ASN A OD1  1  
ATOM   327   N  ND2  . ASN A 1 23 ? 1.828   6.528   -10.468 1.00 1.69  ? 1125 ASN A ND2  1  
ATOM   328   H  H    . ASN A 1 23 ? 3.556   3.614   -7.999  1.00 0.25  ? 1125 ASN A H    1  
ATOM   329   H  HA   . ASN A 1 23 ? 0.878   4.696   -8.206  1.00 0.31  ? 1125 ASN A HA   1  
ATOM   330   H  HB2  . ASN A 1 23 ? 2.659   3.401   -10.279 1.00 0.82  ? 1125 ASN A HB2  1  
ATOM   331   H  HB3  . ASN A 1 23 ? 1.091   4.121   -10.622 1.00 0.82  ? 1125 ASN A HB3  1  
ATOM   332   H  HD21 . ASN A 1 23 ? 0.869   6.353   -10.582 1.00 1.99  ? 1125 ASN A HD21 1  
ATOM   333   H  HD22 . ASN A 1 23 ? 2.237   7.413   -10.586 1.00 2.22  ? 1125 ASN A HD22 1  
ATOM   334   N  N    . TRP A 1 24 ? 1.310   1.590   -7.808  1.00 0.22  ? 1126 TRP A N    1  
ATOM   335   C  CA   . TRP A 1 24 ? 0.663   0.292   -7.669  1.00 0.22  ? 1126 TRP A CA   1  
ATOM   336   C  C    . TRP A 1 24 ? -0.125  0.227   -6.370  1.00 0.20  ? 1126 TRP A C    1  
ATOM   337   O  O    . TRP A 1 24 ? -0.937  -0.670  -6.166  1.00 0.26  ? 1126 TRP A O    1  
ATOM   338   C  CB   . TRP A 1 24 ? 1.699   -0.833  -7.677  1.00 0.25  ? 1126 TRP A CB   1  
ATOM   339   C  CG   . TRP A 1 24 ? 2.490   -0.955  -8.947  1.00 0.31  ? 1126 TRP A CG   1  
ATOM   340   C  CD1  . TRP A 1 24 ? 2.310   -0.259  -10.110 1.00 0.37  ? 1126 TRP A CD1  1  
ATOM   341   C  CD2  . TRP A 1 24 ? 3.590   -1.842  -9.178  1.00 0.38  ? 1126 TRP A CD2  1  
ATOM   342   N  NE1  . TRP A 1 24 ? 3.243   -0.651  -11.039 1.00 0.45  ? 1126 TRP A NE1  1  
ATOM   343   C  CE2  . TRP A 1 24 ? 4.036   -1.623  -10.492 1.00 0.45  ? 1126 TRP A CE2  1  
ATOM   344   C  CE3  . TRP A 1 24 ? 4.243   -2.796  -8.397  1.00 0.44  ? 1126 TRP A CE3  1  
ATOM   345   C  CZ2  . TRP A 1 24 ? 5.105   -2.326  -11.043 1.00 0.54  ? 1126 TRP A CZ2  1  
ATOM   346   C  CZ3  . TRP A 1 24 ? 5.302   -3.494  -8.942  1.00 0.55  ? 1126 TRP A CZ3  1  
ATOM   347   C  CH2  . TRP A 1 24 ? 5.725   -3.255  -10.254 1.00 0.58  ? 1126 TRP A CH2  1  
ATOM   348   H  H    . TRP A 1 24 ? 2.191   1.731   -7.398  1.00 0.23  ? 1126 TRP A H    1  
ATOM   349   H  HA   . TRP A 1 24 ? -0.016  0.160   -8.501  1.00 0.25  ? 1126 TRP A HA   1  
ATOM   350   H  HB2  . TRP A 1 24 ? 2.399   -0.666  -6.873  1.00 0.27  ? 1126 TRP A HB2  1  
ATOM   351   H  HB3  . TRP A 1 24 ? 1.192   -1.771  -7.510  1.00 0.28  ? 1126 TRP A HB3  1  
ATOM   352   H  HD1  . TRP A 1 24 ? 1.549   0.492   -10.258 1.00 0.40  ? 1126 TRP A HD1  1  
ATOM   353   H  HE1  . TRP A 1 24 ? 3.325   -0.294  -11.952 1.00 0.53  ? 1126 TRP A HE1  1  
ATOM   354   H  HE3  . TRP A 1 24 ? 3.928   -2.997  -7.384  1.00 0.45  ? 1126 TRP A HE3  1  
ATOM   355   H  HZ2  . TRP A 1 24 ? 5.445   -2.153  -12.054 1.00 0.61  ? 1126 TRP A HZ2  1  
ATOM   356   H  HZ3  . TRP A 1 24 ? 5.817   -4.237  -8.351  1.00 0.62  ? 1126 TRP A HZ3  1  
ATOM   357   H  HH2  . TRP A 1 24 ? 6.557   -3.824  -10.640 1.00 0.67  ? 1126 TRP A HH2  1  
ATOM   358   N  N    . VAL A 1 25 ? 0.135   1.173   -5.489  1.00 0.19  ? 1127 VAL A N    1  
ATOM   359   C  CA   . VAL A 1 25 ? -0.508  1.211   -4.181  1.00 0.18  ? 1127 VAL A CA   1  
ATOM   360   C  C    . VAL A 1 25 ? -2.004  1.462   -4.314  1.00 0.19  ? 1127 VAL A C    1  
ATOM   361   O  O    . VAL A 1 25 ? -2.425  2.488   -4.854  1.00 0.23  ? 1127 VAL A O    1  
ATOM   362   C  CB   . VAL A 1 25 ? 0.125   2.302   -3.288  1.00 0.21  ? 1127 VAL A CB   1  
ATOM   363   C  CG1  . VAL A 1 25 ? -0.548  2.359   -1.925  1.00 0.24  ? 1127 VAL A CG1  1  
ATOM   364   C  CG2  . VAL A 1 25 ? 1.617   2.061   -3.137  1.00 0.24  ? 1127 VAL A CG2  1  
ATOM   365   H  H    . VAL A 1 25 ? 0.774   1.874   -5.724  1.00 0.21  ? 1127 VAL A H    1  
ATOM   366   H  HA   . VAL A 1 25 ? -0.358  0.249   -3.708  1.00 0.19  ? 1127 VAL A HA   1  
ATOM   367   H  HB   . VAL A 1 25 ? -0.014  3.258   -3.773  1.00 0.23  ? 1127 VAL A HB   1  
ATOM   368   H  HG11 . VAL A 1 25 ? -1.595  2.591   -2.050  1.00 1.01  ? 1127 VAL A HG11 1  
ATOM   369   H  HG12 . VAL A 1 25 ? -0.078  3.123   -1.324  1.00 1.02  ? 1127 VAL A HG12 1  
ATOM   370   H  HG13 . VAL A 1 25 ? -0.448  1.403   -1.434  1.00 1.00  ? 1127 VAL A HG13 1  
ATOM   371   H  HG21 . VAL A 1 25 ? 2.053   2.856   -2.551  1.00 1.05  ? 1127 VAL A HG21 1  
ATOM   372   H  HG22 . VAL A 1 25 ? 2.079   2.039   -4.113  1.00 1.06  ? 1127 VAL A HG22 1  
ATOM   373   H  HG23 . VAL A 1 25 ? 1.781   1.116   -2.641  1.00 1.01  ? 1127 VAL A HG23 1  
ATOM   374   N  N    . CYS A 1 26 ? -2.793  0.503   -3.835  1.00 0.19  ? 1128 CYS A N    1  
ATOM   375   C  CA   . CYS A 1 26 ? -4.252  0.602   -3.859  1.00 0.26  ? 1128 CYS A CA   1  
ATOM   376   C  C    . CYS A 1 26 ? -4.761  0.684   -5.297  1.00 0.27  ? 1128 CYS A C    1  
ATOM   377   O  O    . CYS A 1 26 ? -5.528  1.578   -5.661  1.00 0.37  ? 1128 CYS A O    1  
ATOM   378   C  CB   . CYS A 1 26 ? -4.724  1.810   -3.041  1.00 0.32  ? 1128 CYS A CB   1  
ATOM   379   S  SG   . CYS A 1 26 ? -6.536  1.937   -2.855  1.00 0.58  ? 1128 CYS A SG   1  
ATOM   380   H  H    . CYS A 1 26 ? -2.378  -0.302  -3.451  1.00 0.19  ? 1128 CYS A H    1  
ATOM   381   H  HA   . CYS A 1 26 ? -4.645  -0.298  -3.409  1.00 0.28  ? 1128 CYS A HA   1  
ATOM   382   H  HB2  . CYS A 1 26 ? -4.297  1.751   -2.053  1.00 0.36  ? 1128 CYS A HB2  1  
ATOM   383   H  HB3  . CYS A 1 26 ? -4.378  2.713   -3.519  1.00 0.36  ? 1128 CYS A HB3  1  
ATOM   384   N  N    . ASP A 1 27 ? -4.319  -0.255  -6.115  1.00 0.25  ? 1129 ASP A N    1  
ATOM   385   C  CA   . ASP A 1 27 ? -4.755  -0.325  -7.505  1.00 0.30  ? 1129 ASP A CA   1  
ATOM   386   C  C    . ASP A 1 27 ? -5.633  -1.559  -7.708  1.00 0.37  ? 1129 ASP A C    1  
ATOM   387   O  O    . ASP A 1 27 ? -5.730  -2.097  -8.809  1.00 0.41  ? 1129 ASP A O    1  
ATOM   388   C  CB   . ASP A 1 27 ? -3.546  -0.349  -8.454  1.00 0.31  ? 1129 ASP A CB   1  
ATOM   389   C  CG   . ASP A 1 27 ? -2.886  -1.709  -8.551  1.00 0.35  ? 1129 ASP A CG   1  
ATOM   390   O  OD1  . ASP A 1 27 ? -2.661  -2.348  -7.505  1.00 0.31  ? 1129 ASP A OD1  1  
ATOM   391   O  OD2  . ASP A 1 27 ? -2.575  -2.138  -9.678  1.00 0.46  ? 1129 ASP A OD2  1  
ATOM   392   H  H    . ASP A 1 27 ? -3.679  -0.922  -5.773  1.00 0.24  ? 1129 ASP A H    1  
ATOM   393   H  HA   . ASP A 1 27 ? -5.345  0.556   -7.710  1.00 0.33  ? 1129 ASP A HA   1  
ATOM   394   H  HB2  . ASP A 1 27 ? -3.865  -0.058  -9.442  1.00 0.36  ? 1129 ASP A HB2  1  
ATOM   395   H  HB3  . ASP A 1 27 ? -2.812  0.359   -8.099  1.00 0.29  ? 1129 ASP A HB3  1  
ATOM   396   N  N    . THR A 1 28 ? -6.255  -1.989  -6.608  1.00 0.45  ? 1130 THR A N    1  
ATOM   397   C  CA   . THR A 1 28 ? -7.172  -3.139  -6.561  1.00 0.56  ? 1130 THR A CA   1  
ATOM   398   C  C    . THR A 1 28 ? -6.494  -4.446  -6.975  1.00 0.61  ? 1130 THR A C    1  
ATOM   399   O  O    . THR A 1 28 ? -7.153  -5.386  -7.421  1.00 0.73  ? 1130 THR A O    1  
ATOM   400   C  CB   . THR A 1 28 ? -8.473  -2.923  -7.380  1.00 0.59  ? 1130 THR A CB   1  
ATOM   401   O  OG1  . THR A 1 28 ? -8.199  -2.739  -8.774  1.00 0.56  ? 1130 THR A OG1  1  
ATOM   402   C  CG2  . THR A 1 28 ? -9.246  -1.723  -6.855  1.00 0.65  ? 1130 THR A CG2  1  
ATOM   403   H  H    . THR A 1 28 ? -6.079  -1.513  -5.769  1.00 0.46  ? 1130 THR A H    1  
ATOM   404   H  HA   . THR A 1 28 ? -7.467  -3.248  -5.525  1.00 0.64  ? 1130 THR A HA   1  
ATOM   405   H  HB   . THR A 1 28 ? -9.092  -3.800  -7.265  1.00 0.67  ? 1130 THR A HB   1  
ATOM   406   H  HG1  . THR A 1 28 ? -7.245  -2.721  -8.914  1.00 0.53  ? 1130 THR A HG1  1  
ATOM   407   H  HG21 . THR A 1 28 ? -10.144 -1.591  -7.438  1.00 1.34  ? 1130 THR A HG21 1  
ATOM   408   H  HG22 . THR A 1 28 ? -8.633  -0.836  -6.930  1.00 1.09  ? 1130 THR A HG22 1  
ATOM   409   H  HG23 . THR A 1 28 ? -9.511  -1.891  -5.821  1.00 1.21  ? 1130 THR A HG23 1  
ATOM   410   N  N    . ASP A 1 29 ? -5.178  -4.497  -6.822  1.00 0.59  ? 1131 ASP A N    1  
ATOM   411   C  CA   . ASP A 1 29 ? -4.419  -5.720  -7.042  1.00 0.69  ? 1131 ASP A CA   1  
ATOM   412   C  C    . ASP A 1 29 ? -3.223  -5.759  -6.103  1.00 0.67  ? 1131 ASP A C    1  
ATOM   413   O  O    . ASP A 1 29 ? -2.375  -4.874  -6.146  1.00 0.53  ? 1131 ASP A O    1  
ATOM   414   C  CB   . ASP A 1 29 ? -3.942  -5.797  -8.490  1.00 0.75  ? 1131 ASP A CB   1  
ATOM   415   C  CG   . ASP A 1 29 ? -3.400  -7.168  -8.851  1.00 0.92  ? 1131 ASP A CG   1  
ATOM   416   O  OD1  . ASP A 1 29 ? -4.193  -8.130  -8.880  1.00 1.21  ? 1131 ASP A OD1  1  
ATOM   417   O  OD2  . ASP A 1 29 ? -2.185  -7.290  -9.123  1.00 0.92  ? 1131 ASP A OD2  1  
ATOM   418   H  H    . ASP A 1 29 ? -4.697  -3.683  -6.575  1.00 0.55  ? 1131 ASP A H    1  
ATOM   419   H  HA   . ASP A 1 29 ? -5.064  -6.561  -6.833  1.00 0.81  ? 1131 ASP A HA   1  
ATOM   420   H  HB2  . ASP A 1 29 ? -4.768  -5.567  -9.141  1.00 0.81  ? 1131 ASP A HB2  1  
ATOM   421   H  HB3  . ASP A 1 29 ? -3.159  -5.068  -8.642  1.00 0.68  ? 1131 ASP A HB3  1  
ATOM   422   N  N    . ASN A 1 30 ? -3.161  -6.761  -5.241  1.00 0.94  ? 1132 ASN A N    1  
ATOM   423   C  CA   . ASN A 1 30 ? -2.072  -6.856  -4.269  1.00 1.00  ? 1132 ASN A CA   1  
ATOM   424   C  C    . ASN A 1 30 ? -0.730  -7.067  -4.967  1.00 0.91  ? 1132 ASN A C    1  
ATOM   425   O  O    . ASN A 1 30 ? -0.538  -8.040  -5.693  1.00 1.06  ? 1132 ASN A O    1  
ATOM   426   C  CB   . ASN A 1 30 ? -2.327  -7.977  -3.248  1.00 1.29  ? 1132 ASN A CB   1  
ATOM   427   C  CG   . ASN A 1 30 ? -2.485  -9.356  -3.870  1.00 1.72  ? 1132 ASN A CG   1  
ATOM   428   O  OD1  . ASN A 1 30 ? -3.005  -9.506  -4.976  1.00 2.58  ? 1132 ASN A OD1  1  
ATOM   429   N  ND2  . ASN A 1 30 ? -2.039  -10.378 -3.157  1.00 2.07  ? 1132 ASN A ND2  1  
ATOM   430   H  H    . ASN A 1 30 ? -3.852  -7.459  -5.262  1.00 1.15  ? 1132 ASN A H    1  
ATOM   431   H  HA   . ASN A 1 30 ? -2.032  -5.914  -3.742  1.00 0.97  ? 1132 ASN A HA   1  
ATOM   432   H  HB2  . ASN A 1 30 ? -1.497  -8.017  -2.558  1.00 1.52  ? 1132 ASN A HB2  1  
ATOM   433   H  HB3  . ASN A 1 30 ? -3.228  -7.750  -2.697  1.00 1.97  ? 1132 ASN A HB3  1  
ATOM   434   H  HD21 . ASN A 1 30 ? -1.638  -10.195 -2.279  1.00 2.11  ? 1132 ASN A HD21 1  
ATOM   435   H  HD22 . ASN A 1 30 ? -2.122  -11.278 -3.538  1.00 2.73  ? 1132 ASN A HD22 1  
ATOM   436   N  N    . ASP A 1 31 ? 0.198   -6.142  -4.747  1.00 0.86  ? 1133 ASP A N    1  
ATOM   437   C  CA   . ASP A 1 31 ? 1.514   -6.221  -5.379  1.00 0.77  ? 1133 ASP A CA   1  
ATOM   438   C  C    . ASP A 1 31 ? 2.546   -6.727  -4.394  1.00 0.78  ? 1133 ASP A C    1  
ATOM   439   O  O    . ASP A 1 31 ? 3.514   -7.382  -4.769  1.00 1.28  ? 1133 ASP A O    1  
ATOM   440   C  CB   . ASP A 1 31 ? 1.956   -4.864  -5.921  1.00 0.67  ? 1133 ASP A CB   1  
ATOM   441   C  CG   . ASP A 1 31 ? 1.189   -4.445  -7.152  1.00 0.58  ? 1133 ASP A CG   1  
ATOM   442   O  OD1  . ASP A 1 31 ? 1.566   -4.864  -8.269  1.00 1.09  ? 1133 ASP A OD1  1  
ATOM   443   O  OD2  . ASP A 1 31 ? 0.199   -3.695  -7.011  1.00 1.00  ? 1133 ASP A OD2  1  
ATOM   444   H  H    . ASP A 1 31 ? -0.001  -5.393  -4.136  1.00 1.05  ? 1133 ASP A H    1  
ATOM   445   H  HA   . ASP A 1 31 ? 1.446   -6.917  -6.197  1.00 0.87  ? 1133 ASP A HA   1  
ATOM   446   H  HB2  . ASP A 1 31 ? 1.804   -4.119  -5.159  1.00 1.04  ? 1133 ASP A HB2  1  
ATOM   447   H  HB3  . ASP A 1 31 ? 3.006   -4.907  -6.170  1.00 1.05  ? 1133 ASP A HB3  1  
ATOM   448   N  N    . CYS A 1 32 ? 2.325   -6.429  -3.127  1.00 0.76  ? 1134 CYS A N    1  
ATOM   449   C  CA   . CYS A 1 32 ? 3.251   -6.829  -2.078  1.00 0.78  ? 1134 CYS A CA   1  
ATOM   450   C  C    . CYS A 1 32 ? 3.014   -8.277  -1.661  1.00 0.85  ? 1134 CYS A C    1  
ATOM   451   O  O    . CYS A 1 32 ? 3.692   -8.795  -0.774  1.00 1.57  ? 1134 CYS A O    1  
ATOM   452   C  CB   . CYS A 1 32 ? 3.080   -5.909  -0.876  1.00 0.82  ? 1134 CYS A CB   1  
ATOM   453   S  SG   . CYS A 1 32 ? 3.062   -4.141  -1.308  1.00 1.16  ? 1134 CYS A SG   1  
ATOM   454   H  H    . CYS A 1 32 ? 1.529   -5.905  -2.888  1.00 1.11  ? 1134 CYS A H    1  
ATOM   455   H  HA   . CYS A 1 32 ? 4.255   -6.730  -2.461  1.00 0.88  ? 1134 CYS A HA   1  
ATOM   456   H  HB2  . CYS A 1 32 ? 2.147   -6.138  -0.384  1.00 1.25  ? 1134 CYS A HB2  1  
ATOM   457   H  HB3  . CYS A 1 32 ? 3.895   -6.073  -0.187  1.00 1.22  ? 1134 CYS A HB3  1  
ATOM   458   N  N    . GLY A 1 33 ? 2.051   -8.927  -2.304  1.00 1.17  ? 1135 GLY A N    1  
ATOM   459   C  CA   . GLY A 1 33 ? 1.694   -10.285 -1.938  1.00 1.22  ? 1135 GLY A CA   1  
ATOM   460   C  C    . GLY A 1 33 ? 0.747   -10.315 -0.757  1.00 1.18  ? 1135 GLY A C    1  
ATOM   461   O  O    . GLY A 1 33 ? -0.369  -10.827 -0.853  1.00 1.68  ? 1135 GLY A O    1  
ATOM   462   H  H    . GLY A 1 33 ? 1.586   -8.485  -3.043  1.00 1.82  ? 1135 GLY A H    1  
ATOM   463   H  HA2  . GLY A 1 33 ? 1.219   -10.764 -2.783  1.00 1.26  ? 1135 GLY A HA2  1  
ATOM   464   H  HA3  . GLY A 1 33 ? 2.591   -10.828 -1.683  1.00 1.39  ? 1135 GLY A HA3  1  
ATOM   465   N  N    . ASP A 1 34 ? 1.188   -9.733  0.352   1.00 1.02  ? 1136 ASP A N    1  
ATOM   466   C  CA   . ASP A 1 34 ? 0.375   -9.643  1.558   1.00 1.11  ? 1136 ASP A CA   1  
ATOM   467   C  C    . ASP A 1 34 ? -0.725  -8.603  1.372   1.00 0.93  ? 1136 ASP A C    1  
ATOM   468   O  O    . ASP A 1 34 ? -1.698  -8.560  2.122   1.00 1.35  ? 1136 ASP A O    1  
ATOM   469   C  CB   . ASP A 1 34 ? 1.245   -9.287  2.773   1.00 1.44  ? 1136 ASP A CB   1  
ATOM   470   C  CG   . ASP A 1 34 ? 1.724   -7.842  2.778   1.00 2.10  ? 1136 ASP A CG   1  
ATOM   471   O  OD1  . ASP A 1 34 ? 1.983   -7.278  1.692   1.00 2.85  ? 1136 ASP A OD1  1  
ATOM   472   O  OD2  . ASP A 1 34 ? 1.838   -7.258  3.876   1.00 2.47  ? 1136 ASP A OD2  1  
ATOM   473   H  H    . ASP A 1 34 ? 2.096   -9.357  0.361   1.00 1.22  ? 1136 ASP A H    1  
ATOM   474   H  HA   . ASP A 1 34 ? -0.081  -10.607 1.722   1.00 1.27  ? 1136 ASP A HA   1  
ATOM   475   H  HB2  . ASP A 1 34 ? 0.674   -9.453  3.673   1.00 1.68  ? 1136 ASP A HB2  1  
ATOM   476   H  HB3  . ASP A 1 34 ? 2.112   -9.931  2.782   1.00 1.84  ? 1136 ASP A HB3  1  
ATOM   477   N  N    . GLY A 1 35 ? -0.551  -7.764  0.358   1.00 0.62  ? 1137 GLY A N    1  
ATOM   478   C  CA   . GLY A 1 35 ? -1.559  -6.783  0.017   1.00 0.49  ? 1137 GLY A CA   1  
ATOM   479   C  C    . GLY A 1 35 ? -1.494  -5.559  0.898   1.00 0.36  ? 1137 GLY A C    1  
ATOM   480   O  O    . GLY A 1 35 ? -2.479  -4.838  1.040   1.00 0.36  ? 1137 GLY A O    1  
ATOM   481   H  H    . GLY A 1 35 ? 0.282   -7.807  -0.154  1.00 0.82  ? 1137 GLY A H    1  
ATOM   482   H  HA2  . GLY A 1 35 ? -1.417  -6.482  -1.010  1.00 0.51  ? 1137 GLY A HA2  1  
ATOM   483   H  HA3  . GLY A 1 35 ? -2.533  -7.236  0.119   1.00 0.72  ? 1137 GLY A HA3  1  
ATOM   484   N  N    . SER A 1 36 ? -0.332  -5.313  1.486   1.00 0.32  ? 1138 SER A N    1  
ATOM   485   C  CA   . SER A 1 36 ? -0.159  -4.170  2.366   1.00 0.28  ? 1138 SER A CA   1  
ATOM   486   C  C    . SER A 1 36 ? -0.277  -2.854  1.600   1.00 0.25  ? 1138 SER A C    1  
ATOM   487   O  O    . SER A 1 36 ? -0.655  -1.829  2.166   1.00 0.40  ? 1138 SER A O    1  
ATOM   488   C  CB   . SER A 1 36 ? 1.177   -4.261  3.097   1.00 0.33  ? 1138 SER A CB   1  
ATOM   489   O  OG   . SER A 1 36 ? 2.218   -4.676  2.227   1.00 0.44  ? 1138 SER A OG   1  
ATOM   490   H  H    . SER A 1 36 ? 0.425   -5.919  1.332   1.00 0.37  ? 1138 SER A H    1  
ATOM   491   H  HA   . SER A 1 36 ? -0.953  -4.208  3.096   1.00 0.33  ? 1138 SER A HA   1  
ATOM   492   H  HB2  . SER A 1 36 ? 1.427   -3.293  3.502   1.00 0.40  ? 1138 SER A HB2  1  
ATOM   493   H  HB3  . SER A 1 36 ? 1.094   -4.976  3.902   1.00 0.39  ? 1138 SER A HB3  1  
ATOM   494   H  HG   . SER A 1 36 ? 2.190   -5.647  2.133   1.00 1.17  ? 1138 SER A HG   1  
ATOM   495   N  N    . ASP A 1 37 ? 0.021   -2.892  0.307   1.00 0.18  ? 1139 ASP A N    1  
ATOM   496   C  CA   . ASP A 1 37 ? -0.122  -1.715  -0.541  1.00 0.18  ? 1139 ASP A CA   1  
ATOM   497   C  C    . ASP A 1 37 ? -1.596  -1.425  -0.793  1.00 0.20  ? 1139 ASP A C    1  
ATOM   498   O  O    . ASP A 1 37 ? -1.977  -0.304  -1.115  1.00 0.29  ? 1139 ASP A O    1  
ATOM   499   C  CB   . ASP A 1 37 ? 0.608   -1.907  -1.873  1.00 0.19  ? 1139 ASP A CB   1  
ATOM   500   C  CG   . ASP A 1 37 ? -0.056  -2.925  -2.781  1.00 0.26  ? 1139 ASP A CG   1  
ATOM   501   O  OD1  . ASP A 1 37 ? 0.077   -4.149  -2.539  1.00 0.33  ? 1139 ASP A OD1  1  
ATOM   502   O  OD2  . ASP A 1 37 ? -0.709  -2.505  -3.753  1.00 0.32  ? 1139 ASP A OD2  1  
ATOM   503   H  H    . ASP A 1 37 ? 0.350   -3.729  -0.086  1.00 0.26  ? 1139 ASP A H    1  
ATOM   504   H  HA   . ASP A 1 37 ? 0.312   -0.876  -0.018  1.00 0.20  ? 1139 ASP A HA   1  
ATOM   505   H  HB2  . ASP A 1 37 ? 0.639   -0.962  -2.393  1.00 0.22  ? 1139 ASP A HB2  1  
ATOM   506   H  HB3  . ASP A 1 37 ? 1.618   -2.231  -1.678  1.00 0.19  ? 1139 ASP A HB3  1  
ATOM   507   N  N    . GLU A 1 38 ? -2.425  -2.445  -0.641  1.00 0.22  ? 1140 GLU A N    1  
ATOM   508   C  CA   . GLU A 1 38 ? -3.857  -2.287  -0.812  1.00 0.27  ? 1140 GLU A CA   1  
ATOM   509   C  C    . GLU A 1 38 ? -4.520  -1.964  0.526   1.00 0.31  ? 1140 GLU A C    1  
ATOM   510   O  O    . GLU A 1 38 ? -5.532  -1.265  0.570   1.00 0.44  ? 1140 GLU A O    1  
ATOM   511   C  CB   . GLU A 1 38 ? -4.466  -3.560  -1.407  1.00 0.29  ? 1140 GLU A CB   1  
ATOM   512   C  CG   . GLU A 1 38 ? -3.930  -3.924  -2.787  1.00 0.29  ? 1140 GLU A CG   1  
ATOM   513   C  CD   . GLU A 1 38 ? -4.249  -2.884  -3.847  1.00 0.28  ? 1140 GLU A CD   1  
ATOM   514   O  OE1  . GLU A 1 38 ? -5.415  -2.445  -3.928  1.00 0.38  ? 1140 GLU A OE1  1  
ATOM   515   O  OE2  . GLU A 1 38 ? -3.335  -2.507  -4.613  1.00 0.28  ? 1140 GLU A OE2  1  
ATOM   516   H  H    . GLU A 1 38 ? -2.062  -3.325  -0.408  1.00 0.24  ? 1140 GLU A H    1  
ATOM   517   H  HA   . GLU A 1 38 ? -4.023  -1.463  -1.493  1.00 0.30  ? 1140 GLU A HA   1  
ATOM   518   H  HB2  . GLU A 1 38 ? -4.264  -4.385  -0.739  1.00 0.32  ? 1140 GLU A HB2  1  
ATOM   519   H  HB3  . GLU A 1 38 ? -5.535  -3.427  -1.484  1.00 0.33  ? 1140 GLU A HB3  1  
ATOM   520   H  HG2  . GLU A 1 38 ? -2.857  -4.028  -2.725  1.00 0.29  ? 1140 GLU A HG2  1  
ATOM   521   H  HG3  . GLU A 1 38 ? -4.363  -4.867  -3.088  1.00 0.33  ? 1140 GLU A HG3  1  
ATOM   522   N  N    . LYS A 1 39 ? -3.941  -2.469  1.618   1.00 0.30  ? 1141 LYS A N    1  
ATOM   523   C  CA   . LYS A 1 39 ? -4.504  -2.258  2.951   1.00 0.37  ? 1141 LYS A CA   1  
ATOM   524   C  C    . LYS A 1 39 ? -4.314  -0.810  3.389   1.00 0.49  ? 1141 LYS A C    1  
ATOM   525   O  O    . LYS A 1 39 ? -5.120  -0.265  4.141   1.00 0.57  ? 1141 LYS A O    1  
ATOM   526   C  CB   . LYS A 1 39 ? -3.869  -3.210  3.980   1.00 0.47  ? 1141 LYS A CB   1  
ATOM   527   C  CG   . LYS A 1 39 ? -2.537  -2.730  4.541   1.00 0.57  ? 1141 LYS A CG   1  
ATOM   528   C  CD   . LYS A 1 39 ? -1.930  -3.736  5.501   1.00 0.76  ? 1141 LYS A CD   1  
ATOM   529   C  CE   . LYS A 1 39 ? -0.647  -3.205  6.117   1.00 0.91  ? 1141 LYS A CE   1  
ATOM   530   N  NZ   . LYS A 1 39 ? -0.892  -2.050  7.022   1.00 1.55  ? 1141 LYS A NZ   1  
ATOM   531   H  H    . LYS A 1 39 ? -3.125  -3.006  1.520   1.00 0.32  ? 1141 LYS A H    1  
ATOM   532   H  HA   . LYS A 1 39 ? -5.562  -2.464  2.894   1.00 0.39  ? 1141 LYS A HA   1  
ATOM   533   H  HB2  . LYS A 1 39 ? -4.552  -3.333  4.805   1.00 0.56  ? 1141 LYS A HB2  1  
ATOM   534   H  HB3  . LYS A 1 39 ? -3.710  -4.170  3.511   1.00 0.47  ? 1141 LYS A HB3  1  
ATOM   535   H  HG2  . LYS A 1 39 ? -1.848  -2.569  3.726   1.00 0.50  ? 1141 LYS A HG2  1  
ATOM   536   H  HG3  . LYS A 1 39 ? -2.695  -1.800  5.066   1.00 0.65  ? 1141 LYS A HG3  1  
ATOM   537   H  HD2  . LYS A 1 39 ? -2.639  -3.941  6.290   1.00 0.88  ? 1141 LYS A HD2  1  
ATOM   538   H  HD3  . LYS A 1 39 ? -1.710  -4.647  4.964   1.00 0.73  ? 1141 LYS A HD3  1  
ATOM   539   H  HE2  . LYS A 1 39 ? -0.180  -3.995  6.677   1.00 1.15  ? 1141 LYS A HE2  1  
ATOM   540   H  HE3  . LYS A 1 39 ? 0.012   -2.893  5.322   1.00 1.18  ? 1141 LYS A HE3  1  
ATOM   541   H  HZ1  . LYS A 1 39 ? 0.015   -1.648  7.337   1.00 2.08  ? 1141 LYS A HZ1  1  
ATOM   542   H  HZ2  . LYS A 1 39 ? -1.425  -2.356  7.859   1.00 1.99  ? 1141 LYS A HZ2  1  
ATOM   543   H  HZ3  . LYS A 1 39 ? -1.434  -1.310  6.531   1.00 1.97  ? 1141 LYS A HZ3  1  
ATOM   544   N  N    . ASN A 1 40 ? -3.244  -0.192  2.911   1.00 0.60  ? 1142 ASN A N    1  
ATOM   545   C  CA   . ASN A 1 40 ? -2.968  1.201   3.217   1.00 0.81  ? 1142 ASN A CA   1  
ATOM   546   C  C    . ASN A 1 40 ? -3.653  2.091   2.189   1.00 0.91  ? 1142 ASN A C    1  
ATOM   547   O  O    . ASN A 1 40 ? -3.019  2.623   1.277   1.00 1.44  ? 1142 ASN A O    1  
ATOM   548   C  CB   . ASN A 1 40 ? -1.458  1.457   3.238   1.00 1.07  ? 1142 ASN A CB   1  
ATOM   549   C  CG   . ASN A 1 40 ? -1.109  2.905   3.530   1.00 1.37  ? 1142 ASN A CG   1  
ATOM   550   O  OD1  . ASN A 1 40 ? -1.841  3.611   4.225   1.00 2.05  ? 1142 ASN A OD1  1  
ATOM   551   N  ND2  . ASN A 1 40 ? 0.019   3.350   3.006   1.00 1.92  ? 1142 ASN A ND2  1  
ATOM   552   H  H    . ASN A 1 40 ? -2.626  -0.686  2.332   1.00 0.58  ? 1142 ASN A H    1  
ATOM   553   H  HA   . ASN A 1 40 ? -3.378  1.415   4.193   1.00 0.86  ? 1142 ASN A HA   1  
ATOM   554   H  HB2  . ASN A 1 40 ? -1.008  0.839   4.000   1.00 1.54  ? 1142 ASN A HB2  1  
ATOM   555   H  HB3  . ASN A 1 40 ? -1.043  1.194   2.276   1.00 1.56  ? 1142 ASN A HB3  1  
ATOM   556   H  HD21 . ASN A 1 40 ? 0.558   2.727   2.470   1.00 2.20  ? 1142 ASN A HD21 1  
ATOM   557   H  HD22 . ASN A 1 40 ? 0.271   4.282   3.169   1.00 2.44  ? 1142 ASN A HD22 1  
ATOM   558   N  N    . CYS A 1 41 ? -4.959  2.228   2.339   1.00 0.76  ? 1143 CYS A N    1  
ATOM   559   C  CA   . CYS A 1 41 ? -5.772  2.985   1.411   1.00 0.99  ? 1143 CYS A CA   1  
ATOM   560   C  C    . CYS A 1 41 ? -7.167  3.162   1.995   1.00 1.29  ? 1143 CYS A C    1  
ATOM   561   O  O    . CYS A 1 41 ? -7.653  2.297   2.723   1.00 1.67  ? 1143 CYS A O    1  
ATOM   562   C  CB   . CYS A 1 41 ? -5.836  2.257   0.068   1.00 0.93  ? 1143 CYS A CB   1  
ATOM   563   S  SG   . CYS A 1 41 ? -6.773  3.127   -1.229  1.00 1.10  ? 1143 CYS A SG   1  
ATOM   564   H  H    . CYS A 1 41 ? -5.395  1.804   3.107   1.00 0.89  ? 1143 CYS A H    1  
ATOM   565   H  HA   . CYS A 1 41 ? -5.318  3.955   1.275   1.00 1.23  ? 1143 CYS A HA   1  
ATOM   566   H  HB2  . CYS A 1 41 ? -4.830  2.117   -0.296  1.00 0.98  ? 1143 CYS A HB2  1  
ATOM   567   H  HB3  . CYS A 1 41 ? -6.294  1.290   0.213   1.00 1.29  ? 1143 CYS A HB3  1  
ATOM   568   N  N    . ASN A 1 42 ? -7.799  4.284   1.700   1.00 1.87  ? 1144 ASN A N    1  
ATOM   569   C  CA   . ASN A 1 42 ? -9.122  4.571   2.239   1.00 2.36  ? 1144 ASN A CA   1  
ATOM   570   C  C    . ASN A 1 42 ? -10.168 4.685   1.129   1.00 3.05  ? 1144 ASN A C    1  
ATOM   571   O  O    . ASN A 1 42 ? -10.467 5.772   0.632   1.00 3.73  ? 1144 ASN A O    1  
ATOM   572   C  CB   . ASN A 1 42 ? -9.100  5.846   3.103   1.00 3.11  ? 1144 ASN A CB   1  
ATOM   573   C  CG   . ASN A 1 42 ? -8.626  7.088   2.360   1.00 3.87  ? 1144 ASN A CG   1  
ATOM   574   O  OD1  . ASN A 1 42 ? -7.777  7.019   1.470   1.00 4.27  ? 1144 ASN A OD1  1  
ATOM   575   N  ND2  . ASN A 1 42 ? -9.179  8.234   2.720   1.00 4.59  ? 1144 ASN A ND2  1  
ATOM   576   H  H    . ASN A 1 42 ? -7.369  4.936   1.111   1.00 2.27  ? 1144 ASN A H    1  
ATOM   577   H  HA   . ASN A 1 42 ? -9.395  3.738   2.871   1.00 2.42  ? 1144 ASN A HA   1  
ATOM   578   H  HB2  . ASN A 1 42 ? -10.095 6.034   3.470   1.00 3.41  ? 1144 ASN A HB2  1  
ATOM   579   H  HB3  . ASN A 1 42 ? -8.442  5.684   3.944   1.00 3.38  ? 1144 ASN A HB3  1  
ATOM   580   H  HD21 . ASN A 1 42 ? -9.853  8.220   3.434   1.00 4.61  ? 1144 ASN A HD21 1  
ATOM   581   H  HD22 . ASN A 1 42 ? -8.894  9.051   2.259   1.00 5.30  ? 1144 ASN A HD22 1  
ATOM   582   N  N    . SER A 1 43 ? -10.718 3.549   0.735   1.00 3.53  ? 1145 SER A N    1  
ATOM   583   C  CA   . SER A 1 43 ? -11.791 3.514   -0.246  1.00 4.69  ? 1145 SER A CA   1  
ATOM   584   C  C    . SER A 1 43 ? -12.692 2.310   -0.001  1.00 5.23  ? 1145 SER A C    1  
ATOM   585   O  O    . SER A 1 43 ? -12.237 1.273   0.479   1.00 5.32  ? 1145 SER A O    1  
ATOM   586   C  CB   . SER A 1 43 ? -11.217 3.488   -1.667  1.00 5.40  ? 1145 SER A CB   1  
ATOM   587   O  OG   . SER A 1 43 ? -10.055 2.677   -1.740  1.00 5.26  ? 1145 SER A OG   1  
ATOM   588   H  H    . SER A 1 43 ? -10.392 2.703   1.112   1.00 3.45  ? 1145 SER A H    1  
ATOM   589   H  HA   . SER A 1 43 ? -12.376 4.412   -0.122  1.00 5.07  ? 1145 SER A HA   1  
ATOM   590   H  HB2  . SER A 1 43 ? -11.959 3.092   -2.344  1.00 6.23  ? 1145 SER A HB2  1  
ATOM   591   H  HB3  . SER A 1 43 ? -10.960 4.492   -1.966  1.00 5.56  ? 1145 SER A HB3  1  
ATOM   592   H  HG   . SER A 1 43 ? -10.316 1.739   -1.762  1.00 5.21  ? 1145 SER A HG   1  
ATOM   593   N  N    . THR A 1 44 ? -13.974 2.461   -0.302  1.00 5.97  ? 1146 THR A N    1  
ATOM   594   C  CA   . THR A 1 44 ? -14.940 1.395   -0.091  1.00 6.81  ? 1146 THR A CA   1  
ATOM   595   C  C    . THR A 1 44 ? -15.087 0.521   -1.337  1.00 7.34  ? 1146 THR A C    1  
ATOM   596   O  O    . THR A 1 44 ? -16.199 0.185   -1.747  1.00 8.15  ? 1146 THR A O    1  
ATOM   597   C  CB   . THR A 1 44 ? -16.312 1.971   0.312   1.00 7.69  ? 1146 THR A CB   1  
ATOM   598   O  OG1  . THR A 1 44 ? -16.683 3.030   -0.581  1.00 7.92  ? 1146 THR A OG1  1  
ATOM   599   C  CG2  . THR A 1 44 ? -16.277 2.493   1.741   1.00 7.74  ? 1146 THR A CG2  1  
ATOM   600   H  H    . THR A 1 44 ? -14.281 3.312   -0.687  1.00 6.16  ? 1146 THR A H    1  
ATOM   601   H  HA   . THR A 1 44 ? -14.583 0.783   0.722   1.00 6.75  ? 1146 THR A HA   1  
ATOM   602   H  HB   . THR A 1 44 ? -17.049 1.183   0.250   1.00 8.40  ? 1146 THR A HB   1  
ATOM   603   H  HG1  . THR A 1 44 ? -17.195 2.666   -1.316  1.00 8.03  ? 1146 THR A HG1  1  
ATOM   604   H  HG21 . THR A 1 44 ? -15.530 3.268   1.824   1.00 7.71  ? 1146 THR A HG21 1  
ATOM   605   H  HG22 . THR A 1 44 ? -16.032 1.683   2.412   1.00 7.80  ? 1146 THR A HG22 1  
ATOM   606   H  HG23 . THR A 1 44 ? -17.245 2.895   2.000   1.00 8.03  ? 1146 THR A HG23 1  
ATOM   607   N  N    . GLU A 1 45 ? -13.960 0.144   -1.933  1.00 7.13  ? 1147 GLU A N    1  
ATOM   608   C  CA   . GLU A 1 45 ? -13.972 -0.660  -3.150  1.00 7.94  ? 1147 GLU A CA   1  
ATOM   609   C  C    . GLU A 1 45 ? -14.292 -2.116  -2.829  1.00 8.95  ? 1147 GLU A C    1  
ATOM   610   O  O    . GLU A 1 45 ? -14.601 -2.910  -3.717  1.00 9.87  ? 1147 GLU A O    1  
ATOM   611   C  CB   . GLU A 1 45 ? -12.627 -0.568  -3.887  1.00 7.79  ? 1147 GLU A CB   1  
ATOM   612   C  CG   . GLU A 1 45 ? -11.495 -1.370  -3.249  1.00 7.90  ? 1147 GLU A CG   1  
ATOM   613   C  CD   . GLU A 1 45 ? -11.174 -0.935  -1.833  1.00 8.00  ? 1147 GLU A CD   1  
ATOM   614   O  OE1  . GLU A 1 45 ? -10.578 0.141   -1.662  1.00 8.08  ? 1147 GLU A OE1  1  
ATOM   615   O  OE2  . GLU A 1 45 ? -11.523 -1.670  -0.883  1.00 8.23  ? 1147 GLU A OE2  1  
ATOM   616   H  H    . GLU A 1 45 ? -13.098 0.409   -1.540  1.00 6.60  ? 1147 GLU A H    1  
ATOM   617   H  HA   . GLU A 1 45 ? -14.749 -0.271  -3.792  1.00 8.20  ? 1147 GLU A HA   1  
ATOM   618   H  HB2  . GLU A 1 45 ? -12.761 -0.927  -4.896  1.00 8.33  ? 1147 GLU A HB2  1  
ATOM   619   H  HB3  . GLU A 1 45 ? -12.324 0.468   -3.925  1.00 7.37  ? 1147 GLU A HB3  1  
ATOM   620   H  HG2  . GLU A 1 45 ? -11.780 -2.411  -3.229  1.00 7.80  ? 1147 GLU A HG2  1  
ATOM   621   H  HG3  . GLU A 1 45 ? -10.607 -1.254  -3.854  1.00 8.35  ? 1147 GLU A HG3  1  
ATOM   622   N  N    . THR A 1 46 ? -14.211 -2.437  -1.541  1.00 8.94  ? 1148 THR A N    1  
ATOM   623   C  CA   . THR A 1 46 ? -14.446 -3.781  -1.040  1.00 10.03 ? 1148 THR A CA   1  
ATOM   624   C  C    . THR A 1 46 ? -13.337 -4.735  -1.500  1.00 10.71 ? 1148 THR A C    1  
ATOM   625   O  O    . THR A 1 46 ? -13.571 -5.661  -2.277  1.00 11.12 ? 1148 THR A O    1  
ATOM   626   C  CB   . THR A 1 46 ? -15.835 -4.304  -1.469  1.00 10.21 ? 1148 THR A CB   1  
ATOM   627   O  OG1  . THR A 1 46 ? -16.820 -3.280  -1.253  1.00 9.58  ? 1148 THR A OG1  1  
ATOM   628   C  CG2  . THR A 1 46 ? -16.224 -5.545  -0.677  1.00 11.01 ? 1148 THR A CG2  1  
ATOM   629   H  H    . THR A 1 46 ? -13.979 -1.735  -0.900  1.00 8.30  ? 1148 THR A H    1  
ATOM   630   H  HA   . THR A 1 46 ? -14.427 -3.731  0.040   1.00 10.45 ? 1148 THR A HA   1  
ATOM   631   H  HB   . THR A 1 46 ? -15.803 -4.554  -2.520  1.00 10.48 ? 1148 THR A HB   1  
ATOM   632   H  HG1  . THR A 1 46 ? -16.705 -2.585  -1.915  1.00 9.43  ? 1148 THR A HG1  1  
ATOM   633   H  HG21 . THR A 1 46 ? -16.238 -5.311  0.375   1.00 11.19 ? 1148 THR A HG21 1  
ATOM   634   H  HG22 . THR A 1 46 ? -15.507 -6.330  -0.862  1.00 11.07 ? 1148 THR A HG22 1  
ATOM   635   H  HG23 . THR A 1 46 ? -17.205 -5.875  -0.986  1.00 11.53 ? 1148 THR A HG23 1  
HETATM 636   CA CA   . CA  B 2 .  ? -1.437  -2.861  -5.766  1.00 0.28  ? 1201 CA  A CA   1  
ATOM   637   N  N    . THR A 1 1  ? 10.846  12.970  12.676  1.00 12.23 ? 1103 THR A N    2  
ATOM   638   C  CA   . THR A 1 1  ? 12.099  13.483  12.088  1.00 11.73 ? 1103 THR A CA   2  
ATOM   639   C  C    . THR A 1 1  ? 12.862  12.366  11.393  1.00 10.83 ? 1103 THR A C    2  
ATOM   640   O  O    . THR A 1 1  ? 12.952  11.251  11.916  1.00 10.67 ? 1103 THR A O    2  
ATOM   641   C  CB   . THR A 1 1  ? 12.995  14.120  13.166  1.00 11.83 ? 1103 THR A CB   2  
ATOM   642   O  OG1  . THR A 1 1  ? 13.098  13.246  14.299  1.00 12.26 ? 1103 THR A OG1  2  
ATOM   643   C  CG2  . THR A 1 1  ? 12.441  15.466  13.600  1.00 12.04 ? 1103 THR A CG2  2  
ATOM   644   H  H1   . THR A 1 1  ? 10.248  12.556  11.934  1.00 12.23 ? 1103 THR A H1   2  
ATOM   645   H  H2   . THR A 1 1  ? 10.323  13.741  13.137  1.00 12.55 ? 1103 THR A H2   2  
ATOM   646   H  H3   . THR A 1 1  ? 11.059  12.241  13.382  1.00 12.44 ? 1103 THR A H3   2  
ATOM   647   H  HA   . THR A 1 1  ? 11.849  14.241  11.361  1.00 12.16 ? 1103 THR A HA   2  
ATOM   648   H  HB   . THR A 1 1  ? 13.981  14.272  12.748  1.00 11.67 ? 1103 THR A HB   2  
ATOM   649   H  HG1  . THR A 1 1  ? 13.806  13.560  14.882  1.00 12.30 ? 1103 THR A HG1  2  
ATOM   650   H  HG21 . THR A 1 1  ? 11.428  15.343  13.950  1.00 12.31 ? 1103 THR A HG21 2  
ATOM   651   H  HG22 . THR A 1 1  ? 12.451  16.147  12.762  1.00 12.05 ? 1103 THR A HG22 2  
ATOM   652   H  HG23 . THR A 1 1  ? 13.051  15.866  14.396  1.00 12.10 ? 1103 THR A HG23 2  
ATOM   653   N  N    . HIS A 1 2  ? 13.396  12.673  10.211  1.00 10.41 ? 1104 HIS A N    2  
ATOM   654   C  CA   . HIS A 1 2  ? 14.169  11.718  9.418   1.00 9.72  ? 1104 HIS A CA   2  
ATOM   655   C  C    . HIS A 1 2  ? 13.295  10.547  8.977   1.00 8.65  ? 1104 HIS A C    2  
ATOM   656   O  O    . HIS A 1 2  ? 13.363  9.457   9.546   1.00 8.32  ? 1104 HIS A O    2  
ATOM   657   C  CB   . HIS A 1 2  ? 15.387  11.209  10.201  1.00 10.05 ? 1104 HIS A CB   2  
ATOM   658   C  CG   . HIS A 1 2  ? 16.344  10.406  9.372   1.00 10.43 ? 1104 HIS A CG   2  
ATOM   659   N  ND1  . HIS A 1 2  ? 16.382  9.027   9.380   1.00 10.71 ? 1104 HIS A ND1  2  
ATOM   660   C  CD2  . HIS A 1 2  ? 17.305  10.799  8.503   1.00 10.84 ? 1104 HIS A CD2  2  
ATOM   661   C  CE1  . HIS A 1 2  ? 17.323  8.611   8.557   1.00 11.25 ? 1104 HIS A CE1  2  
ATOM   662   N  NE2  . HIS A 1 2  ? 17.898  9.665   8.012   1.00 11.34 ? 1104 HIS A NE2  2  
ATOM   663   H  H    . HIS A 1 2  ? 13.255  13.577  9.850   1.00 10.71 ? 1104 HIS A H    2  
ATOM   664   H  HA   . HIS A 1 2  ? 14.516  12.235  8.536   1.00 9.96  ? 1104 HIS A HA   2  
ATOM   665   H  HB2  . HIS A 1 2  ? 15.924  12.052  10.607  1.00 10.50 ? 1104 HIS A HB2  2  
ATOM   666   H  HB3  . HIS A 1 2  ? 15.046  10.584  11.014  1.00 9.81  ? 1104 HIS A HB3  2  
ATOM   667   H  HD1  . HIS A 1 2  ? 15.800  8.436   9.911   1.00 10.68 ? 1104 HIS A HD1  2  
ATOM   668   H  HD2  . HIS A 1 2  ? 17.557  11.819  8.246   1.00 10.94 ? 1104 HIS A HD2  2  
ATOM   669   H  HE1  . HIS A 1 2  ? 17.580  7.580   8.361   1.00 11.71 ? 1104 HIS A HE1  2  
ATOM   670   H  HE2  . HIS A 1 2  ? 18.716  9.642   7.470   1.00 11.83 ? 1104 HIS A HE2  2  
ATOM   671   N  N    . ALA A 1 3  ? 12.467  10.789  7.972   1.00 8.30  ? 1105 ALA A N    2  
ATOM   672   C  CA   . ALA A 1 3  ? 11.636  9.744   7.396   1.00 7.41  ? 1105 ALA A CA   2  
ATOM   673   C  C    . ALA A 1 3  ? 12.512  8.679   6.748   1.00 6.47  ? 1105 ALA A C    2  
ATOM   674   O  O    . ALA A 1 3  ? 13.456  9.005   6.023   1.00 6.54  ? 1105 ALA A O    2  
ATOM   675   C  CB   . ALA A 1 3  ? 10.675  10.336  6.376   1.00 7.70  ? 1105 ALA A CB   2  
ATOM   676   H  H    . ALA A 1 3  ? 12.412  11.697  7.607   1.00 8.79  ? 1105 ALA A H    2  
ATOM   677   H  HA   . ALA A 1 3  ? 11.058  9.298   8.191   1.00 7.45  ? 1105 ALA A HA   2  
ATOM   678   H  HB1  . ALA A 1 3  ? 10.051  9.553   5.972   1.00 7.93  ? 1105 ALA A HB1  2  
ATOM   679   H  HB2  . ALA A 1 3  ? 11.236  10.799  5.578   1.00 7.73  ? 1105 ALA A HB2  2  
ATOM   680   H  HB3  . ALA A 1 3  ? 10.053  11.078  6.855   1.00 7.95  ? 1105 ALA A HB3  2  
ATOM   681   N  N    . PRO A 1 4  ? 12.232  7.396   7.015   1.00 5.80  ? 1106 PRO A N    2  
ATOM   682   C  CA   . PRO A 1 4  ? 13.012  6.288   6.462   1.00 4.97  ? 1106 PRO A CA   2  
ATOM   683   C  C    . PRO A 1 4  ? 12.957  6.253   4.939   1.00 4.25  ? 1106 PRO A C    2  
ATOM   684   O  O    . PRO A 1 4  ? 11.884  6.123   4.343   1.00 4.22  ? 1106 PRO A O    2  
ATOM   685   C  CB   . PRO A 1 4  ? 12.351  5.037   7.039   1.00 4.84  ? 1106 PRO A CB   2  
ATOM   686   C  CG   . PRO A 1 4  ? 11.533  5.509   8.192   1.00 5.55  ? 1106 PRO A CG   2  
ATOM   687   C  CD   . PRO A 1 4  ? 11.135  6.920   7.874   1.00 6.09  ? 1106 PRO A CD   2  
ATOM   688   H  HA   . PRO A 1 4  ? 14.042  6.335   6.782   1.00 5.32  ? 1106 PRO A HA   2  
ATOM   689   H  HB2  . PRO A 1 4  ? 11.736  4.581   6.279   1.00 4.32  ? 1106 PRO A HB2  2  
ATOM   690   H  HB3  . PRO A 1 4  ? 13.112  4.341   7.354   1.00 5.12  ? 1106 PRO A HB3  2  
ATOM   691   H  HG2  . PRO A 1 4  ? 10.657  4.888   8.299   1.00 5.52  ? 1106 PRO A HG2  2  
ATOM   692   H  HG3  . PRO A 1 4  ? 12.124  5.482   9.095   1.00 6.00  ? 1106 PRO A HG3  2  
ATOM   693   H  HD2  . PRO A 1 4  ? 10.195  6.936   7.343   1.00 6.19  ? 1106 PRO A HD2  2  
ATOM   694   H  HD3  . PRO A 1 4  ? 11.071  7.504   8.779   1.00 6.80  ? 1106 PRO A HD3  2  
ATOM   695   N  N    . ALA A 1 5  ? 14.120  6.353   4.322   1.00 4.09  ? 1107 ALA A N    2  
ATOM   696   C  CA   . ALA A 1 5  ? 14.225  6.379   2.873   1.00 3.77  ? 1107 ALA A CA   2  
ATOM   697   C  C    . ALA A 1 5  ? 14.362  4.965   2.325   1.00 2.63  ? 1107 ALA A C    2  
ATOM   698   O  O    . ALA A 1 5  ? 15.300  4.655   1.588   1.00 2.62  ? 1107 ALA A O    2  
ATOM   699   C  CB   . ALA A 1 5  ? 15.409  7.232   2.447   1.00 4.73  ? 1107 ALA A CB   2  
ATOM   700   H  H    . ALA A 1 5  ? 14.939  6.394   4.861   1.00 4.51  ? 1107 ALA A H    2  
ATOM   701   H  HA   . ALA A 1 5  ? 13.324  6.824   2.478   1.00 4.04  ? 1107 ALA A HA   2  
ATOM   702   H  HB1  . ALA A 1 5  ? 15.467  7.255   1.370   1.00 5.01  ? 1107 ALA A HB1  2  
ATOM   703   H  HB2  . ALA A 1 5  ? 16.319  6.811   2.849   1.00 4.95  ? 1107 ALA A HB2  2  
ATOM   704   H  HB3  . ALA A 1 5  ? 15.280  8.235   2.823   1.00 5.29  ? 1107 ALA A HB3  2  
ATOM   705   N  N    . SER A 1 6  ? 13.428  4.110   2.702   1.00 2.16  ? 1108 SER A N    2  
ATOM   706   C  CA   . SER A 1 6  ? 13.435  2.731   2.257   1.00 1.43  ? 1108 SER A CA   2  
ATOM   707   C  C    . SER A 1 6  ? 12.891  2.622   0.838   1.00 1.29  ? 1108 SER A C    2  
ATOM   708   O  O    . SER A 1 6  ? 12.017  3.398   0.440   1.00 1.97  ? 1108 SER A O    2  
ATOM   709   C  CB   . SER A 1 6  ? 12.624  1.871   3.223   1.00 2.09  ? 1108 SER A CB   2  
ATOM   710   O  OG   . SER A 1 6  ? 11.422  2.525   3.605   1.00 2.97  ? 1108 SER A OG   2  
ATOM   711   H  H    . SER A 1 6  ? 12.706  4.417   3.292   1.00 2.71  ? 1108 SER A H    2  
ATOM   712   H  HA   . SER A 1 6  ? 14.456  2.389   2.261   1.00 1.32  ? 1108 SER A HA   2  
ATOM   713   H  HB2  . SER A 1 6  ? 12.376  0.936   2.745   1.00 2.36  ? 1108 SER A HB2  2  
ATOM   714   H  HB3  . SER A 1 6  ? 13.211  1.677   4.108   1.00 2.13  ? 1108 SER A HB3  2  
ATOM   715   H  HG   . SER A 1 6  ? 10.762  2.421   2.900   1.00 3.32  ? 1108 SER A HG   2  
ATOM   716   N  N    . CYS A 1 7  ? 13.417  1.661   0.084   1.00 0.72  ? 1109 CYS A N    2  
ATOM   717   C  CA   . CYS A 1 7  ? 13.057  1.485   -1.316  1.00 0.49  ? 1109 CYS A CA   2  
ATOM   718   C  C    . CYS A 1 7  ? 13.405  2.732   -2.132  1.00 0.46  ? 1109 CYS A C    2  
ATOM   719   O  O    . CYS A 1 7  ? 14.125  3.619   -1.660  1.00 0.62  ? 1109 CYS A O    2  
ATOM   720   C  CB   . CYS A 1 7  ? 11.569  1.157   -1.436  1.00 0.33  ? 1109 CYS A CB   2  
ATOM   721   S  SG   . CYS A 1 7  ? 11.057  -0.322  -0.500  1.00 0.47  ? 1109 CYS A SG   2  
ATOM   722   H  H    . CYS A 1 7  ? 14.052  1.042   0.486   1.00 0.94  ? 1109 CYS A H    2  
ATOM   723   H  HA   . CYS A 1 7  ? 13.627  0.655   -1.702  1.00 0.60  ? 1109 CYS A HA   2  
ATOM   724   H  HB2  . CYS A 1 7  ? 11.003  1.992   -1.058  1.00 0.41  ? 1109 CYS A HB2  2  
ATOM   725   H  HB3  . CYS A 1 7  ? 11.322  0.996   -2.473  1.00 0.29  ? 1109 CYS A HB3  2  
ATOM   726   N  N    . LEU A 1 8  ? 12.915  2.786   -3.359  1.00 0.34  ? 1110 LEU A N    2  
ATOM   727   C  CA   . LEU A 1 8  ? 13.158  3.921   -4.238  1.00 0.32  ? 1110 LEU A CA   2  
ATOM   728   C  C    . LEU A 1 8  ? 12.412  5.154   -3.742  1.00 0.29  ? 1110 LEU A C    2  
ATOM   729   O  O    . LEU A 1 8  ? 11.501  5.037   -2.918  1.00 0.30  ? 1110 LEU A O    2  
ATOM   730   C  CB   . LEU A 1 8  ? 12.681  3.573   -5.643  1.00 0.28  ? 1110 LEU A CB   2  
ATOM   731   C  CG   . LEU A 1 8  ? 13.475  4.165   -6.802  1.00 0.38  ? 1110 LEU A CG   2  
ATOM   732   C  CD1  . LEU A 1 8  ? 14.908  3.657   -6.782  1.00 0.52  ? 1110 LEU A CD1  2  
ATOM   733   C  CD2  . LEU A 1 8  ? 12.798  3.816   -8.120  1.00 0.39  ? 1110 LEU A CD2  2  
ATOM   734   H  H    . LEU A 1 8  ? 12.386  2.032   -3.695  1.00 0.34  ? 1110 LEU A H    2  
ATOM   735   H  HA   . LEU A 1 8  ? 14.217  4.122   -4.256  1.00 0.40  ? 1110 LEU A HA   2  
ATOM   736   H  HB2  . LEU A 1 8  ? 12.686  2.501   -5.739  1.00 0.32  ? 1110 LEU A HB2  2  
ATOM   737   H  HB3  . LEU A 1 8  ? 11.657  3.910   -5.737  1.00 0.22  ? 1110 LEU A HB3  2  
ATOM   738   H  HG   . LEU A 1 8  ? 13.499  5.239   -6.707  1.00 0.41  ? 1110 LEU A HG   2  
ATOM   739   H  HD11 . LEU A 1 8  ? 14.908  2.577   -6.816  1.00 1.05  ? 1110 LEU A HD11 2  
ATOM   740   H  HD12 . LEU A 1 8  ? 15.397  3.988   -5.877  1.00 1.29  ? 1110 LEU A HD12 2  
ATOM   741   H  HD13 . LEU A 1 8  ? 15.439  4.043   -7.638  1.00 1.07  ? 1110 LEU A HD13 2  
ATOM   742   H  HD21 . LEU A 1 8  ? 12.761  2.741   -8.231  1.00 1.11  ? 1110 LEU A HD21 2  
ATOM   743   H  HD22 . LEU A 1 8  ? 13.357  4.245   -8.937  1.00 1.05  ? 1110 LEU A HD22 2  
ATOM   744   H  HD23 . LEU A 1 8  ? 11.792  4.211   -8.122  1.00 0.97  ? 1110 LEU A HD23 2  
ATOM   745   N  N    . ASP A 1 9  ? 12.782  6.325   -4.240  1.00 0.35  ? 1111 ASP A N    2  
ATOM   746   C  CA   . ASP A 1 9  ? 12.079  7.555   -3.886  1.00 0.38  ? 1111 ASP A CA   2  
ATOM   747   C  C    . ASP A 1 9  ? 10.621  7.479   -4.326  1.00 0.32  ? 1111 ASP A C    2  
ATOM   748   O  O    . ASP A 1 9  ? 9.714   7.868   -3.588  1.00 0.42  ? 1111 ASP A O    2  
ATOM   749   C  CB   . ASP A 1 9  ? 12.761  8.768   -4.523  1.00 0.51  ? 1111 ASP A CB   2  
ATOM   750   C  CG   . ASP A 1 9  ? 11.949  10.043  -4.385  1.00 1.37  ? 1111 ASP A CG   2  
ATOM   751   O  OD1  . ASP A 1 9  ? 11.839  10.563  -3.252  1.00 1.53  ? 1111 ASP A OD1  2  
ATOM   752   O  OD2  . ASP A 1 9  ? 11.415  10.530  -5.406  1.00 2.32  ? 1111 ASP A OD2  2  
ATOM   753   H  H    . ASP A 1 9  ? 13.547  6.370   -4.855  1.00 0.40  ? 1111 ASP A H    2  
ATOM   754   H  HA   . ASP A 1 9  ? 12.113  7.657   -2.812  1.00 0.44  ? 1111 ASP A HA   2  
ATOM   755   H  HB2  . ASP A 1 9  ? 13.718  8.922   -4.050  1.00 0.94  ? 1111 ASP A HB2  2  
ATOM   756   H  HB3  . ASP A 1 9  ? 12.914  8.573   -5.574  1.00 1.01  ? 1111 ASP A HB3  2  
ATOM   757   N  N    . THR A 1 10 ? 10.399  6.953   -5.522  1.00 0.28  ? 1112 THR A N    2  
ATOM   758   C  CA   . THR A 1 10 ? 9.053   6.805   -6.048  1.00 0.31  ? 1112 THR A CA   2  
ATOM   759   C  C    . THR A 1 10 ? 8.489   5.411   -5.770  1.00 0.24  ? 1112 THR A C    2  
ATOM   760   O  O    . THR A 1 10 ? 7.428   5.048   -6.284  1.00 0.30  ? 1112 THR A O    2  
ATOM   761   C  CB   . THR A 1 10 ? 9.016   7.080   -7.562  1.00 0.42  ? 1112 THR A CB   2  
ATOM   762   O  OG1  . THR A 1 10 ? 10.047  6.332   -8.220  1.00 0.45  ? 1112 THR A OG1  2  
ATOM   763   C  CG2  . THR A 1 10 ? 9.191   8.564   -7.848  1.00 0.52  ? 1112 THR A CG2  2  
ATOM   764   H  H    . THR A 1 10 ? 11.162  6.668   -6.072  1.00 0.31  ? 1112 THR A H    2  
ATOM   765   H  HA   . THR A 1 10 ? 8.427   7.536   -5.559  1.00 0.36  ? 1112 THR A HA   2  
ATOM   766   H  HB   . THR A 1 10 ? 8.055   6.766   -7.945  1.00 0.48  ? 1112 THR A HB   2  
ATOM   767   H  HG1  . THR A 1 10 ? 10.798  6.912   -8.405  1.00 0.95  ? 1112 THR A HG1  2  
ATOM   768   H  HG21 . THR A 1 10 ? 9.155   8.733   -8.914  1.00 1.19  ? 1112 THR A HG21 2  
ATOM   769   H  HG22 . THR A 1 10 ? 10.146  8.893   -7.464  1.00 1.09  ? 1112 THR A HG22 2  
ATOM   770   H  HG23 . THR A 1 10 ? 8.400   9.120   -7.368  1.00 1.17  ? 1112 THR A HG23 2  
ATOM   771   N  N    . GLN A 1 11 ? 9.199   4.619   -4.973  1.00 0.18  ? 1113 GLN A N    2  
ATOM   772   C  CA   . GLN A 1 11 ? 8.700   3.314   -4.580  1.00 0.17  ? 1113 GLN A CA   2  
ATOM   773   C  C    . GLN A 1 11 ? 8.120   3.334   -3.179  1.00 0.17  ? 1113 GLN A C    2  
ATOM   774   O  O    . GLN A 1 11 ? 8.470   4.175   -2.349  1.00 0.23  ? 1113 GLN A O    2  
ATOM   775   C  CB   . GLN A 1 11 ? 9.794   2.260   -4.652  1.00 0.17  ? 1113 GLN A CB   2  
ATOM   776   C  CG   . GLN A 1 11 ? 10.059  1.761   -6.058  1.00 0.23  ? 1113 GLN A CG   2  
ATOM   777   C  CD   . GLN A 1 11 ? 10.969  0.550   -6.078  1.00 0.35  ? 1113 GLN A CD   2  
ATOM   778   O  OE1  . GLN A 1 11 ? 11.806  0.375   -5.193  1.00 1.02  ? 1113 GLN A OE1  2  
ATOM   779   N  NE2  . GLN A 1 11 ? 10.814  -0.287  -7.088  1.00 0.67  ? 1113 GLN A NE2  2  
ATOM   780   H  H    . GLN A 1 11 ? 10.076  4.912   -4.647  1.00 0.20  ? 1113 GLN A H    2  
ATOM   781   H  HA   . GLN A 1 11 ? 7.916   3.045   -5.270  1.00 0.22  ? 1113 GLN A HA   2  
ATOM   782   H  HB2  . GLN A 1 11 ? 10.711  2.681   -4.264  1.00 0.16  ? 1113 GLN A HB2  2  
ATOM   783   H  HB3  . GLN A 1 11 ? 9.509   1.421   -4.042  1.00 0.20  ? 1113 GLN A HB3  2  
ATOM   784   H  HG2  . GLN A 1 11 ? 9.119   1.498   -6.507  1.00 0.31  ? 1113 GLN A HG2  2  
ATOM   785   H  HG3  . GLN A 1 11 ? 10.521  2.551   -6.629  1.00 0.22  ? 1113 GLN A HG3  2  
ATOM   786   H  HE21 . GLN A 1 11 ? 10.129  -0.085  -7.760  1.00 1.21  ? 1113 GLN A HE21 2  
ATOM   787   H  HE22 . GLN A 1 11 ? 11.394  -1.077  -7.128  1.00 0.65  ? 1113 GLN A HE22 2  
ATOM   788   N  N    . TYR A 1 12 ? 7.236   2.390   -2.935  1.00 0.15  ? 1114 TYR A N    2  
ATOM   789   C  CA   . TYR A 1 12 ? 6.597   2.237   -1.644  1.00 0.16  ? 1114 TYR A CA   2  
ATOM   790   C  C    . TYR A 1 12 ? 7.258   1.108   -0.879  1.00 0.15  ? 1114 TYR A C    2  
ATOM   791   O  O    . TYR A 1 12 ? 7.749   0.146   -1.472  1.00 0.15  ? 1114 TYR A O    2  
ATOM   792   C  CB   . TYR A 1 12 ? 5.108   1.935   -1.821  1.00 0.18  ? 1114 TYR A CB   2  
ATOM   793   C  CG   . TYR A 1 12 ? 4.338   1.760   -0.525  1.00 0.22  ? 1114 TYR A CG   2  
ATOM   794   C  CD1  . TYR A 1 12 ? 4.116   2.831   0.328   1.00 0.33  ? 1114 TYR A CD1  2  
ATOM   795   C  CD2  . TYR A 1 12 ? 3.827   0.515   -0.163  1.00 0.21  ? 1114 TYR A CD2  2  
ATOM   796   C  CE1  . TYR A 1 12 ? 3.410   2.672   1.506   1.00 0.39  ? 1114 TYR A CE1  2  
ATOM   797   C  CE2  . TYR A 1 12 ? 3.119   0.348   1.014   1.00 0.26  ? 1114 TYR A CE2  2  
ATOM   798   C  CZ   . TYR A 1 12 ? 2.915   1.430   1.843   1.00 0.34  ? 1114 TYR A CZ   2  
ATOM   799   O  OH   . TYR A 1 12 ? 2.211   1.270   3.017   1.00 0.41  ? 1114 TYR A OH   2  
ATOM   800   H  H    . TYR A 1 12 ? 7.018   1.751   -3.656  1.00 0.16  ? 1114 TYR A H    2  
ATOM   801   H  HA   . TYR A 1 12 ? 6.714   3.158   -1.096  1.00 0.18  ? 1114 TYR A HA   2  
ATOM   802   H  HB2  . TYR A 1 12 ? 4.647   2.737   -2.375  1.00 0.23  ? 1114 TYR A HB2  2  
ATOM   803   H  HB3  . TYR A 1 12 ? 5.016   1.021   -2.377  1.00 0.18  ? 1114 TYR A HB3  2  
ATOM   804   H  HD1  . TYR A 1 12 ? 4.506   3.803   0.063   1.00 0.40  ? 1114 TYR A HD1  2  
ATOM   805   H  HD2  . TYR A 1 12 ? 3.991   -0.328  -0.817  1.00 0.23  ? 1114 TYR A HD2  2  
ATOM   806   H  HE1  . TYR A 1 12 ? 3.247   3.518   2.157   1.00 0.50  ? 1114 TYR A HE1  2  
ATOM   807   H  HE2  . TYR A 1 12 ? 2.731   -0.627  1.279   1.00 0.29  ? 1114 TYR A HE2  2  
ATOM   808   H  HH   . TYR A 1 12 ? 1.579   1.993   3.108   1.00 0.89  ? 1114 TYR A HH   2  
ATOM   809   N  N    . THR A 1 13 ? 7.265   1.236   0.427   1.00 0.18  ? 1115 THR A N    2  
ATOM   810   C  CA   . THR A 1 13 ? 7.809   0.213   1.293   1.00 0.20  ? 1115 THR A CA   2  
ATOM   811   C  C    . THR A 1 13 ? 6.673   -0.492  2.023   1.00 0.23  ? 1115 THR A C    2  
ATOM   812   O  O    . THR A 1 13 ? 6.077   0.066   2.949   1.00 0.31  ? 1115 THR A O    2  
ATOM   813   C  CB   . THR A 1 13 ? 8.787   0.816   2.318   1.00 0.26  ? 1115 THR A CB   2  
ATOM   814   O  OG1  . THR A 1 13 ? 9.646   1.760   1.666   1.00 0.30  ? 1115 THR A OG1  2  
ATOM   815   C  CG2  . THR A 1 13 ? 9.633   -0.271  2.965   1.00 0.27  ? 1115 THR A CG2  2  
ATOM   816   H  H    . THR A 1 13 ? 6.873   2.041   0.821   1.00 0.22  ? 1115 THR A H    2  
ATOM   817   H  HA   . THR A 1 13 ? 8.341   -0.503  0.684   1.00 0.19  ? 1115 THR A HA   2  
ATOM   818   H  HB   . THR A 1 13 ? 8.221   1.321   3.085   1.00 0.31  ? 1115 THR A HB   2  
ATOM   819   H  HG1  . THR A 1 13 ? 9.547   1.673   0.712   1.00 0.82  ? 1115 THR A HG1  2  
ATOM   820   H  HG21 . THR A 1 13 ? 10.237  -0.752  2.209   1.00 1.01  ? 1115 THR A HG21 2  
ATOM   821   H  HG22 . THR A 1 13 ? 8.989   -1.001  3.430   1.00 1.02  ? 1115 THR A HG22 2  
ATOM   822   H  HG23 . THR A 1 13 ? 10.275  0.172   3.711   1.00 1.10  ? 1115 THR A HG23 2  
ATOM   823   N  N    . CYS A 1 14 ? 6.350   -1.697  1.574   1.00 0.26  ? 1116 CYS A N    2  
ATOM   824   C  CA   . CYS A 1 14 ? 5.269   -2.475  2.168   1.00 0.34  ? 1116 CYS A CA   2  
ATOM   825   C  C    . CYS A 1 14 ? 5.560   -2.855  3.614   1.00 0.40  ? 1116 CYS A C    2  
ATOM   826   O  O    . CYS A 1 14 ? 6.683   -2.685  4.097   1.00 0.37  ? 1116 CYS A O    2  
ATOM   827   C  CB   . CYS A 1 14 ? 5.022   -3.743  1.359   1.00 0.45  ? 1116 CYS A CB   2  
ATOM   828   S  SG   . CYS A 1 14 ? 4.073   -3.490  -0.170  1.00 0.65  ? 1116 CYS A SG   2  
ATOM   829   H  H    . CYS A 1 14 ? 6.845   -2.072  0.809   1.00 0.28  ? 1116 CYS A H    2  
ATOM   830   H  HA   . CYS A 1 14 ? 4.378   -1.869  2.144   1.00 0.38  ? 1116 CYS A HA   2  
ATOM   831   H  HB2  . CYS A 1 14 ? 5.973   -4.174  1.084   1.00 0.50  ? 1116 CYS A HB2  2  
ATOM   832   H  HB3  . CYS A 1 14 ? 4.476   -4.448  1.970   1.00 0.54  ? 1116 CYS A HB3  2  
ATOM   833   N  N    . ASP A 1 15 ? 4.551   -3.383  4.294   1.00 0.56  ? 1117 ASP A N    2  
ATOM   834   C  CA   . ASP A 1 15 ? 4.709   -3.851  5.666   1.00 0.69  ? 1117 ASP A CA   2  
ATOM   835   C  C    . ASP A 1 15 ? 5.800   -4.912  5.732   1.00 0.65  ? 1117 ASP A C    2  
ATOM   836   O  O    . ASP A 1 15 ? 6.679   -4.870  6.591   1.00 0.71  ? 1117 ASP A O    2  
ATOM   837   C  CB   . ASP A 1 15 ? 3.384   -4.412  6.188   1.00 0.93  ? 1117 ASP A CB   2  
ATOM   838   C  CG   . ASP A 1 15 ? 3.476   -4.902  7.619   1.00 1.83  ? 1117 ASP A CG   2  
ATOM   839   O  OD1  . ASP A 1 15 ? 3.472   -4.061  8.538   1.00 2.62  ? 1117 ASP A OD1  2  
ATOM   840   O  OD2  . ASP A 1 15 ? 3.568   -6.132  7.830   1.00 2.09  ? 1117 ASP A OD2  2  
ATOM   841   H  H    . ASP A 1 15 ? 3.669   -3.453  3.865   1.00 0.63  ? 1117 ASP A H    2  
ATOM   842   H  HA   . ASP A 1 15 ? 5.003   -3.009  6.275   1.00 0.70  ? 1117 ASP A HA   2  
ATOM   843   H  HB2  . ASP A 1 15 ? 2.631   -3.639  6.143   1.00 1.35  ? 1117 ASP A HB2  2  
ATOM   844   H  HB3  . ASP A 1 15 ? 3.081   -5.240  5.562   1.00 0.70  ? 1117 ASP A HB3  2  
ATOM   845   N  N    . ASN A 1 16 ? 5.766   -5.834  4.776   1.00 0.69  ? 1118 ASN A N    2  
ATOM   846   C  CA   . ASN A 1 16 ? 6.774   -6.888  4.678   1.00 0.75  ? 1118 ASN A CA   2  
ATOM   847   C  C    . ASN A 1 16 ? 8.015   -6.377  3.927   1.00 0.59  ? 1118 ASN A C    2  
ATOM   848   O  O    . ASN A 1 16 ? 8.825   -7.151  3.418   1.00 0.65  ? 1118 ASN A O    2  
ATOM   849   C  CB   . ASN A 1 16 ? 6.171   -8.114  3.990   1.00 0.98  ? 1118 ASN A CB   2  
ATOM   850   C  CG   . ASN A 1 16 ? 7.088   -9.324  3.985   1.00 1.77  ? 1118 ASN A CG   2  
ATOM   851   O  OD1  . ASN A 1 16 ? 7.974   -9.460  4.833   1.00 2.75  ? 1118 ASN A OD1  2  
ATOM   852   N  ND2  . ASN A 1 16 ? 6.859   -10.226 3.045   1.00 2.02  ? 1118 ASN A ND2  2  
ATOM   853   H  H    . ASN A 1 16 ? 5.036   -5.815  4.126   1.00 0.75  ? 1118 ASN A H    2  
ATOM   854   H  HA   . ASN A 1 16 ? 7.064   -7.160  5.675   1.00 0.85  ? 1118 ASN A HA   2  
ATOM   855   H  HB2  . ASN A 1 16 ? 5.256   -8.387  4.495   1.00 1.24  ? 1118 ASN A HB2  2  
ATOM   856   H  HB3  . ASN A 1 16 ? 5.947   -7.855  2.974   1.00 1.41  ? 1118 ASN A HB3  2  
ATOM   857   H  HD21 . ASN A 1 16 ? 6.112   -10.063 2.415   1.00 1.91  ? 1118 ASN A HD21 2  
ATOM   858   H  HD22 . ASN A 1 16 ? 7.431   -11.018 3.009   1.00 2.74  ? 1118 ASN A HD22 2  
ATOM   859   N  N    . HIS A 1 17 ? 8.142   -5.051  3.865   1.00 0.46  ? 1119 HIS A N    2  
ATOM   860   C  CA   . HIS A 1 17 ? 9.310   -4.380  3.286   1.00 0.41  ? 1119 HIS A CA   2  
ATOM   861   C  C    . HIS A 1 17 ? 9.487   -4.687  1.801   1.00 0.44  ? 1119 HIS A C    2  
ATOM   862   O  O    . HIS A 1 17 ? 10.590  -4.588  1.266   1.00 0.79  ? 1119 HIS A O    2  
ATOM   863   C  CB   . HIS A 1 17 ? 10.584  -4.739  4.058   1.00 0.51  ? 1119 HIS A CB   2  
ATOM   864   C  CG   . HIS A 1 17 ? 10.619  -4.182  5.446   1.00 0.63  ? 1119 HIS A CG   2  
ATOM   865   N  ND1  . HIS A 1 17 ? 10.454  -4.955  6.574   1.00 0.94  ? 1119 HIS A ND1  2  
ATOM   866   C  CD2  . HIS A 1 17 ? 10.804  -2.915  5.886   1.00 0.78  ? 1119 HIS A CD2  2  
ATOM   867   C  CE1  . HIS A 1 17 ? 10.534  -4.190  7.645   1.00 1.05  ? 1119 HIS A CE1  2  
ATOM   868   N  NE2  . HIS A 1 17 ? 10.747  -2.949  7.256   1.00 0.93  ? 1119 HIS A NE2  2  
ATOM   869   H  H    . HIS A 1 17 ? 7.419   -4.496  4.230   1.00 0.47  ? 1119 HIS A H    2  
ATOM   870   H  HA   . HIS A 1 17 ? 9.145   -3.317  3.388   1.00 0.38  ? 1119 HIS A HA   2  
ATOM   871   H  HB2  . HIS A 1 17 ? 10.660  -5.813  4.130   1.00 0.60  ? 1119 HIS A HB2  2  
ATOM   872   H  HB3  . HIS A 1 17 ? 11.441  -4.358  3.523   1.00 0.55  ? 1119 HIS A HB3  2  
ATOM   873   H  HD1  . HIS A 1 17 ? 10.300  -5.924  6.588   1.00 1.18  ? 1119 HIS A HD1  2  
ATOM   874   H  HD2  . HIS A 1 17 ? 10.962  -2.040  5.273   1.00 1.00  ? 1119 HIS A HD2  2  
ATOM   875   H  HE1  . HIS A 1 17 ? 10.445  -4.524  8.668   1.00 1.35  ? 1119 HIS A HE1  2  
ATOM   876   H  HE2  . HIS A 1 17 ? 10.964  -2.197  7.854   1.00 1.09  ? 1119 HIS A HE2  2  
ATOM   877   N  N    . GLN A 1 18 ? 8.397   -5.051  1.144   1.00 0.40  ? 1120 GLN A N    2  
ATOM   878   C  CA   . GLN A 1 18 ? 8.410   -5.265  -0.295  1.00 0.38  ? 1120 GLN A CA   2  
ATOM   879   C  C    . GLN A 1 18 ? 8.354   -3.923  -1.015  1.00 0.29  ? 1120 GLN A C    2  
ATOM   880   O  O    . GLN A 1 18 ? 7.440   -3.127  -0.789  1.00 0.39  ? 1120 GLN A O    2  
ATOM   881   C  CB   . GLN A 1 18 ? 7.223   -6.147  -0.707  1.00 0.49  ? 1120 GLN A CB   2  
ATOM   882   C  CG   . GLN A 1 18 ? 7.114   -6.410  -2.204  1.00 0.50  ? 1120 GLN A CG   2  
ATOM   883   C  CD   . GLN A 1 18 ? 8.333   -7.107  -2.779  1.00 1.05  ? 1120 GLN A CD   2  
ATOM   884   O  OE1  . GLN A 1 18 ? 8.430   -8.332  -2.754  1.00 1.91  ? 1120 GLN A OE1  2  
ATOM   885   N  NE2  . GLN A 1 18 ? 9.251   -6.336  -3.343  1.00 1.51  ? 1120 GLN A NE2  2  
ATOM   886   H  H    . GLN A 1 18 ? 7.567   -5.186  1.638   1.00 0.63  ? 1120 GLN A H    2  
ATOM   887   H  HA   . GLN A 1 18 ? 9.332   -5.765  -0.553  1.00 0.42  ? 1120 GLN A HA   2  
ATOM   888   H  HB2  . GLN A 1 18 ? 7.312   -7.098  -0.205  1.00 0.62  ? 1120 GLN A HB2  2  
ATOM   889   H  HB3  . GLN A 1 18 ? 6.310   -5.668  -0.382  1.00 0.52  ? 1120 GLN A HB3  2  
ATOM   890   H  HG2  . GLN A 1 18 ? 6.250   -7.031  -2.383  1.00 0.87  ? 1120 GLN A HG2  2  
ATOM   891   H  HG3  . GLN A 1 18 ? 6.985   -5.466  -2.713  1.00 0.86  ? 1120 GLN A HG3  2  
ATOM   892   H  HE21 . GLN A 1 18 ? 9.095   -5.367  -3.363  1.00 1.83  ? 1120 GLN A HE21 2  
ATOM   893   H  HE22 . GLN A 1 18 ? 10.050  -6.764  -3.717  1.00 1.99  ? 1120 GLN A HE22 2  
ATOM   894   N  N    . CYS A 1 19 ? 9.349   -3.663  -1.845  1.00 0.21  ? 1121 CYS A N    2  
ATOM   895   C  CA   . CYS A 1 19 ? 9.395   -2.431  -2.617  1.00 0.21  ? 1121 CYS A CA   2  
ATOM   896   C  C    . CYS A 1 19 ? 8.574   -2.563  -3.893  1.00 0.20  ? 1121 CYS A C    2  
ATOM   897   O  O    . CYS A 1 19 ? 8.787   -3.480  -4.687  1.00 0.34  ? 1121 CYS A O    2  
ATOM   898   C  CB   . CYS A 1 19 ? 10.842  -2.076  -2.962  1.00 0.34  ? 1121 CYS A CB   2  
ATOM   899   S  SG   . CYS A 1 19 ? 11.917  -1.859  -1.507  1.00 0.42  ? 1121 CYS A SG   2  
ATOM   900   H  H    . CYS A 1 19 ? 10.083  -4.309  -1.931  1.00 0.29  ? 1121 CYS A H    2  
ATOM   901   H  HA   . CYS A 1 19 ? 8.975   -1.644  -2.011  1.00 0.24  ? 1121 CYS A HA   2  
ATOM   902   H  HB2  . CYS A 1 19 ? 11.264  -2.863  -3.568  1.00 0.39  ? 1121 CYS A HB2  2  
ATOM   903   H  HB3  . CYS A 1 19 ? 10.854  -1.152  -3.523  1.00 0.41  ? 1121 CYS A HB3  2  
ATOM   904   N  N    . ILE A 1 20 ? 7.616   -1.663  -4.061  1.00 0.15  ? 1122 ILE A N    2  
ATOM   905   C  CA   . ILE A 1 20 ? 6.808   -1.595  -5.274  1.00 0.14  ? 1122 ILE A CA   2  
ATOM   906   C  C    . ILE A 1 20 ? 6.671   -0.146  -5.710  1.00 0.14  ? 1122 ILE A C    2  
ATOM   907   O  O    . ILE A 1 20 ? 7.108   0.750   -5.001  1.00 0.18  ? 1122 ILE A O    2  
ATOM   908   C  CB   . ILE A 1 20 ? 5.394   -2.179  -5.077  1.00 0.14  ? 1122 ILE A CB   2  
ATOM   909   C  CG1  . ILE A 1 20 ? 4.643   -1.407  -3.992  1.00 0.13  ? 1122 ILE A CG1  2  
ATOM   910   C  CG2  . ILE A 1 20 ? 5.463   -3.660  -4.731  1.00 0.19  ? 1122 ILE A CG2  2  
ATOM   911   C  CD1  . ILE A 1 20 ? 3.204   -1.833  -3.842  1.00 0.17  ? 1122 ILE A CD1  2  
ATOM   912   H  H    . ILE A 1 20 ? 7.447   -1.013  -3.344  1.00 0.22  ? 1122 ILE A H    2  
ATOM   913   H  HA   . ILE A 1 20 ? 7.308   -2.155  -6.049  1.00 0.17  ? 1122 ILE A HA   2  
ATOM   914   H  HB   . ILE A 1 20 ? 4.859   -2.081  -6.009  1.00 0.16  ? 1122 ILE A HB   2  
ATOM   915   H  HG12 . ILE A 1 20 ? 5.134   -1.562  -3.046  1.00 0.15  ? 1122 ILE A HG12 2  
ATOM   916   H  HG13 . ILE A 1 20 ? 4.656   -0.354  -4.233  1.00 0.14  ? 1122 ILE A HG13 2  
ATOM   917   H  HG21 . ILE A 1 20 ? 5.920   -4.198  -5.545  1.00 0.98  ? 1122 ILE A HG21 2  
ATOM   918   H  HG22 . ILE A 1 20 ? 4.466   -4.037  -4.563  1.00 1.05  ? 1122 ILE A HG22 2  
ATOM   919   H  HG23 . ILE A 1 20 ? 6.053   -3.792  -3.836  1.00 0.97  ? 1122 ILE A HG23 2  
ATOM   920   H  HD11 . ILE A 1 20 ? 3.165   -2.893  -3.644  1.00 1.07  ? 1122 ILE A HD11 2  
ATOM   921   H  HD12 . ILE A 1 20 ? 2.670   -1.619  -4.758  1.00 0.99  ? 1122 ILE A HD12 2  
ATOM   922   H  HD13 . ILE A 1 20 ? 2.748   -1.294  -3.022  1.00 1.03  ? 1122 ILE A HD13 2  
ATOM   923   N  N    . SER A 1 21 ? 6.071   0.087   -6.859  1.00 0.16  ? 1123 SER A N    2  
ATOM   924   C  CA   . SER A 1 21 ? 5.809   1.447   -7.307  1.00 0.17  ? 1123 SER A CA   2  
ATOM   925   C  C    . SER A 1 21 ? 4.724   2.081   -6.444  1.00 0.15  ? 1123 SER A C    2  
ATOM   926   O  O    . SER A 1 21 ? 3.736   1.431   -6.105  1.00 0.17  ? 1123 SER A O    2  
ATOM   927   C  CB   . SER A 1 21 ? 5.369   1.440   -8.774  1.00 0.24  ? 1123 SER A CB   2  
ATOM   928   O  OG   . SER A 1 21 ? 4.933   2.723   -9.191  1.00 0.33  ? 1123 SER A OG   2  
ATOM   929   H  H    . SER A 1 21 ? 5.796   -0.667  -7.420  1.00 0.20  ? 1123 SER A H    2  
ATOM   930   H  HA   . SER A 1 21 ? 6.721   2.015   -7.208  1.00 0.19  ? 1123 SER A HA   2  
ATOM   931   H  HB2  . SER A 1 21 ? 6.199   1.138   -9.394  1.00 0.27  ? 1123 SER A HB2  2  
ATOM   932   H  HB3  . SER A 1 21 ? 4.556   0.739   -8.898  1.00 0.24  ? 1123 SER A HB3  2  
ATOM   933   H  HG   . SER A 1 21 ? 4.024   2.663   -9.507  1.00 0.63  ? 1123 SER A HG   2  
ATOM   934   N  N    . LYS A 1 22 ? 4.908   3.354   -6.086  1.00 0.17  ? 1124 LYS A N    2  
ATOM   935   C  CA   . LYS A 1 22 ? 3.890   4.091   -5.341  1.00 0.19  ? 1124 LYS A CA   2  
ATOM   936   C  C    . LYS A 1 22 ? 2.622   4.230   -6.173  1.00 0.22  ? 1124 LYS A C    2  
ATOM   937   O  O    . LYS A 1 22 ? 1.529   4.410   -5.639  1.00 0.25  ? 1124 LYS A O    2  
ATOM   938   C  CB   . LYS A 1 22 ? 4.391   5.480   -4.934  1.00 0.23  ? 1124 LYS A CB   2  
ATOM   939   C  CG   . LYS A 1 22 ? 5.416   5.471   -3.813  1.00 0.25  ? 1124 LYS A CG   2  
ATOM   940   C  CD   . LYS A 1 22 ? 5.834   6.886   -3.445  1.00 0.25  ? 1124 LYS A CD   2  
ATOM   941   C  CE   . LYS A 1 22 ? 6.867   6.910   -2.329  1.00 0.30  ? 1124 LYS A CE   2  
ATOM   942   N  NZ   . LYS A 1 22 ? 6.331   6.374   -1.051  1.00 1.24  ? 1124 LYS A NZ   2  
ATOM   943   H  H    . LYS A 1 22 ? 5.749   3.806   -6.329  1.00 0.20  ? 1124 LYS A H    2  
ATOM   944   H  HA   . LYS A 1 22 ? 3.659   3.526   -4.449  1.00 0.19  ? 1124 LYS A HA   2  
ATOM   945   H  HB2  . LYS A 1 22 ? 4.840   5.951   -5.796  1.00 0.30  ? 1124 LYS A HB2  2  
ATOM   946   H  HB3  . LYS A 1 22 ? 3.547   6.073   -4.615  1.00 0.30  ? 1124 LYS A HB3  2  
ATOM   947   H  HG2  . LYS A 1 22 ? 4.985   4.994   -2.945  1.00 0.37  ? 1124 LYS A HG2  2  
ATOM   948   H  HG3  . LYS A 1 22 ? 6.287   4.919   -4.136  1.00 0.37  ? 1124 LYS A HG3  2  
ATOM   949   H  HD2  . LYS A 1 22 ? 6.255   7.363   -4.317  1.00 0.32  ? 1124 LYS A HD2  2  
ATOM   950   H  HD3  . LYS A 1 22 ? 4.960   7.434   -3.123  1.00 0.33  ? 1124 LYS A HD3  2  
ATOM   951   H  HE2  . LYS A 1 22 ? 7.714   6.311   -2.630  1.00 0.93  ? 1124 LYS A HE2  2  
ATOM   952   H  HE3  . LYS A 1 22 ? 7.188   7.929   -2.176  1.00 0.95  ? 1124 LYS A HE3  2  
ATOM   953   H  HZ1  . LYS A 1 22 ? 7.041   6.471   -0.297  1.00 1.76  ? 1124 LYS A HZ1  2  
ATOM   954   H  HZ2  . LYS A 1 22 ? 6.090   5.370   -1.153  1.00 1.77  ? 1124 LYS A HZ2  2  
ATOM   955   H  HZ3  . LYS A 1 22 ? 5.475   6.895   -0.774  1.00 1.88  ? 1124 LYS A HZ3  2  
ATOM   956   N  N    . ASN A 1 23 ? 2.778   4.132   -7.488  1.00 0.24  ? 1125 ASN A N    2  
ATOM   957   C  CA   . ASN A 1 23 ? 1.647   4.222   -8.405  1.00 0.28  ? 1125 ASN A CA   2  
ATOM   958   C  C    . ASN A 1 23 ? 0.889   2.900   -8.433  1.00 0.26  ? 1125 ASN A C    2  
ATOM   959   O  O    . ASN A 1 23 ? -0.192  2.800   -9.008  1.00 0.32  ? 1125 ASN A O    2  
ATOM   960   C  CB   . ASN A 1 23 ? 2.120   4.587   -9.819  1.00 0.36  ? 1125 ASN A CB   2  
ATOM   961   C  CG   . ASN A 1 23 ? 2.834   5.927   -9.885  1.00 1.03  ? 1125 ASN A CG   2  
ATOM   962   O  OD1  . ASN A 1 23 ? 3.480   6.354   -8.927  1.00 1.75  ? 1125 ASN A OD1  2  
ATOM   963   N  ND2  . ASN A 1 23 ? 2.724   6.599   -11.016 1.00 1.69  ? 1125 ASN A ND2  2  
ATOM   964   H  H    . ASN A 1 23 ? 3.681   4.011   -7.851  1.00 0.25  ? 1125 ASN A H    2  
ATOM   965   H  HA   . ASN A 1 23 ? 0.987   4.995   -8.041  1.00 0.31  ? 1125 ASN A HA   2  
ATOM   966   H  HB2  . ASN A 1 23 ? 2.799   3.827   -10.172 1.00 0.82  ? 1125 ASN A HB2  2  
ATOM   967   H  HB3  . ASN A 1 23 ? 1.263   4.627   -10.476 1.00 0.82  ? 1125 ASN A HB3  2  
ATOM   968   H  HD21 . ASN A 1 23 ? 2.195   6.203   -11.742 1.00 1.99  ? 1125 ASN A HD21 2  
ATOM   969   H  HD22 . ASN A 1 23 ? 3.182   7.464   -11.088 1.00 2.22  ? 1125 ASN A HD22 2  
ATOM   970   N  N    . TRP A 1 24 ? 1.467   1.889   -7.796  1.00 0.22  ? 1126 TRP A N    2  
ATOM   971   C  CA   . TRP A 1 24 ? 0.855   0.571   -7.727  1.00 0.22  ? 1126 TRP A CA   2  
ATOM   972   C  C    . TRP A 1 24 ? 0.145   0.376   -6.399  1.00 0.20  ? 1126 TRP A C    2  
ATOM   973   O  O    . TRP A 1 24 ? -0.466  -0.656  -6.155  1.00 0.26  ? 1126 TRP A O    2  
ATOM   974   C  CB   . TRP A 1 24 ? 1.908   -0.523  -7.897  1.00 0.25  ? 1126 TRP A CB   2  
ATOM   975   C  CG   . TRP A 1 24 ? 2.439   -0.654  -9.292  1.00 0.31  ? 1126 TRP A CG   2  
ATOM   976   C  CD1  . TRP A 1 24 ? 1.962   -0.044  -10.416 1.00 0.37  ? 1126 TRP A CD1  2  
ATOM   977   C  CD2  . TRP A 1 24 ? 3.544   -1.463  -9.712  1.00 0.38  ? 1126 TRP A CD2  2  
ATOM   978   N  NE1  . TRP A 1 24 ? 2.710   -0.414  -11.505 1.00 0.45  ? 1126 TRP A NE1  2  
ATOM   979   C  CE2  . TRP A 1 24 ? 3.686   -1.286  -11.100 1.00 0.45  ? 1126 TRP A CE2  2  
ATOM   980   C  CE3  . TRP A 1 24 ? 4.432   -2.315  -9.048  1.00 0.44  ? 1126 TRP A CE3  2  
ATOM   981   C  CZ2  . TRP A 1 24 ? 4.677   -1.931  -11.836 1.00 0.54  ? 1126 TRP A CZ2  2  
ATOM   982   C  CZ3  . TRP A 1 24 ? 5.415   -2.956  -9.779  1.00 0.55  ? 1126 TRP A CZ3  2  
ATOM   983   C  CH2  . TRP A 1 24 ? 5.530   -2.760  -11.162 1.00 0.58  ? 1126 TRP A CH2  2  
ATOM   984   H  H    . TRP A 1 24 ? 2.328   2.036   -7.348  1.00 0.23  ? 1126 TRP A H    2  
ATOM   985   H  HA   . TRP A 1 24 ? 0.134   0.493   -8.526  1.00 0.25  ? 1126 TRP A HA   2  
ATOM   986   H  HB2  . TRP A 1 24 ? 2.743   -0.311  -7.245  1.00 0.27  ? 1126 TRP A HB2  2  
ATOM   987   H  HB3  . TRP A 1 24 ? 1.473   -1.467  -7.612  1.00 0.28  ? 1126 TRP A HB3  2  
ATOM   988   H  HD1  . TRP A 1 24 ? 1.123   0.634   -10.431 1.00 0.40  ? 1126 TRP A HD1  2  
ATOM   989   H  HE1  . TRP A 1 24 ? 2.566   -0.105  -12.425 1.00 0.53  ? 1126 TRP A HE1  2  
ATOM   990   H  HE3  . TRP A 1 24 ? 4.358   -2.479  -7.983  1.00 0.45  ? 1126 TRP A HE3  2  
ATOM   991   H  HZ2  . TRP A 1 24 ? 4.778   -1.790  -12.902 1.00 0.61  ? 1126 TRP A HZ2  2  
ATOM   992   H  HZ3  . TRP A 1 24 ? 6.108   -3.619  -9.283  1.00 0.62  ? 1126 TRP A HZ3  2  
ATOM   993   H  HH2  . TRP A 1 24 ? 6.312   -3.281  -11.693 1.00 0.67  ? 1126 TRP A HH2  2  
ATOM   994   N  N    . VAL A 1 25 ? 0.241   1.366   -5.535  1.00 0.19  ? 1127 VAL A N    2  
ATOM   995   C  CA   . VAL A 1 25 ? -0.389  1.292   -4.224  1.00 0.18  ? 1127 VAL A CA   2  
ATOM   996   C  C    . VAL A 1 25 ? -1.900  1.445   -4.337  1.00 0.19  ? 1127 VAL A C    2  
ATOM   997   O  O    . VAL A 1 25 ? -2.395  2.428   -4.897  1.00 0.23  ? 1127 VAL A O    2  
ATOM   998   C  CB   . VAL A 1 25 ? 0.177   2.360   -3.263  1.00 0.21  ? 1127 VAL A CB   2  
ATOM   999   C  CG1  . VAL A 1 25 ? -0.526  2.315   -1.913  1.00 0.24  ? 1127 VAL A CG1  2  
ATOM   1000  C  CG2  . VAL A 1 25 ? 1.674   2.169   -3.087  1.00 0.24  ? 1127 VAL A CG2  2  
ATOM   1001  H  H    . VAL A 1 25 ? 0.748   2.163   -5.781  1.00 0.21  ? 1127 VAL A H    2  
ATOM   1002  H  HA   . VAL A 1 25 ? -0.175  0.316   -3.811  1.00 0.19  ? 1127 VAL A HA   2  
ATOM   1003  H  HB   . VAL A 1 25 ? 0.010   3.334   -3.699  1.00 0.23  ? 1127 VAL A HB   2  
ATOM   1004  H  HG11 . VAL A 1 25 ? -1.580  2.508   -2.049  1.00 1.01  ? 1127 VAL A HG11 2  
ATOM   1005  H  HG12 . VAL A 1 25 ? -0.104  3.065   -1.261  1.00 1.02  ? 1127 VAL A HG12 2  
ATOM   1006  H  HG13 . VAL A 1 25 ? -0.394  1.338   -1.473  1.00 1.00  ? 1127 VAL A HG13 2  
ATOM   1007  H  HG21 . VAL A 1 25 ? 2.064   2.948   -2.448  1.00 1.05  ? 1127 VAL A HG21 2  
ATOM   1008  H  HG22 . VAL A 1 25 ? 2.158   2.217   -4.050  1.00 1.06  ? 1127 VAL A HG22 2  
ATOM   1009  H  HG23 . VAL A 1 25 ? 1.863   1.205   -2.637  1.00 1.01  ? 1127 VAL A HG23 2  
ATOM   1010  N  N    . CYS A 1 26 ? -2.616  0.449   -3.824  1.00 0.19  ? 1128 CYS A N    2  
ATOM   1011  C  CA   . CYS A 1 26 ? -4.075  0.456   -3.803  1.00 0.26  ? 1128 CYS A CA   2  
ATOM   1012  C  C    . CYS A 1 26 ? -4.627  0.473   -5.226  1.00 0.27  ? 1128 CYS A C    2  
ATOM   1013  O  O    . CYS A 1 26 ? -5.491  1.286   -5.568  1.00 0.37  ? 1128 CYS A O    2  
ATOM   1014  C  CB   . CYS A 1 26 ? -4.596  1.656   -3.019  1.00 0.32  ? 1128 CYS A CB   2  
ATOM   1015  S  SG   . CYS A 1 26 ? -6.283  1.446   -2.361  1.00 0.58  ? 1128 CYS A SG   2  
ATOM   1016  H  H    . CYS A 1 26 ? -2.140  -0.329  -3.452  1.00 0.19  ? 1128 CYS A H    2  
ATOM   1017  H  HA   . CYS A 1 26 ? -4.404  -0.444  -3.311  1.00 0.28  ? 1128 CYS A HA   2  
ATOM   1018  H  HB2  . CYS A 1 26 ? -3.939  1.841   -2.185  1.00 0.36  ? 1128 CYS A HB2  2  
ATOM   1019  H  HB3  . CYS A 1 26 ? -4.600  2.517   -3.662  1.00 0.36  ? 1128 CYS A HB3  2  
ATOM   1020  N  N    . ASP A 1 27 ? -4.115  -0.424  -6.054  1.00 0.25  ? 1129 ASP A N    2  
ATOM   1021  C  CA   . ASP A 1 27 ? -4.493  -0.478  -7.462  1.00 0.30  ? 1129 ASP A CA   2  
ATOM   1022  C  C    . ASP A 1 27 ? -5.171  -1.807  -7.785  1.00 0.37  ? 1129 ASP A C    2  
ATOM   1023  O  O    . ASP A 1 27 ? -5.289  -2.185  -8.951  1.00 0.41  ? 1129 ASP A O    2  
ATOM   1024  C  CB   . ASP A 1 27 ? -3.257  -0.291  -8.348  1.00 0.31  ? 1129 ASP A CB   2  
ATOM   1025  C  CG   . ASP A 1 27 ? -2.411  -1.547  -8.460  1.00 0.35  ? 1129 ASP A CG   2  
ATOM   1026  O  OD1  . ASP A 1 27 ? -2.209  -2.238  -7.433  1.00 0.31  ? 1129 ASP A OD1  2  
ATOM   1027  O  OD2  . ASP A 1 27 ? -1.939  -1.843  -9.577  1.00 0.46  ? 1129 ASP A OD2  2  
ATOM   1028  H  H    . ASP A 1 27 ? -3.464  -1.081  -5.705  1.00 0.24  ? 1129 ASP A H    2  
ATOM   1029  H  HA   . ASP A 1 27 ? -5.188  0.325   -7.651  1.00 0.33  ? 1129 ASP A HA   2  
ATOM   1030  H  HB2  . ASP A 1 27 ? -3.575  -0.008  -9.339  1.00 0.36  ? 1129 ASP A HB2  2  
ATOM   1031  H  HB3  . ASP A 1 27 ? -2.644  0.497   -7.934  1.00 0.29  ? 1129 ASP A HB3  2  
ATOM   1032  N  N    . THR A 1 28 ? -5.598  -2.496  -6.729  1.00 0.45  ? 1130 THR A N    2  
ATOM   1033  C  CA   . THR A 1 28 ? -6.275  -3.797  -6.805  1.00 0.56  ? 1130 THR A CA   2  
ATOM   1034  C  C    . THR A 1 28 ? -5.397  -4.869  -7.461  1.00 0.61  ? 1130 THR A C    2  
ATOM   1035  O  O    . THR A 1 28 ? -5.898  -5.804  -8.089  1.00 0.73  ? 1130 THR A O    2  
ATOM   1036  C  CB   . THR A 1 28 ? -7.667  -3.730  -7.496  1.00 0.59  ? 1130 THR A CB   2  
ATOM   1037  O  OG1  . THR A 1 28 ? -7.563  -3.373  -8.880  1.00 0.56  ? 1130 THR A OG1  2  
ATOM   1038  C  CG2  . THR A 1 28 ? -8.564  -2.728  -6.786  1.00 0.65  ? 1130 THR A CG2  2  
ATOM   1039  H  H    . THR A 1 28 ? -5.436  -2.117  -5.834  1.00 0.46  ? 1130 THR A H    2  
ATOM   1040  H  HA   . THR A 1 28 ? -6.446  -4.107  -5.782  1.00 0.64  ? 1130 THR A HA   2  
ATOM   1041  H  HB   . THR A 1 28 ? -8.129  -4.704  -7.425  1.00 0.67  ? 1130 THR A HB   2  
ATOM   1042  H  HG1  . THR A 1 28 ? -6.777  -2.834  -9.014  1.00 0.53  ? 1130 THR A HG1  2  
ATOM   1043  H  HG21 . THR A 1 28 ? -8.675  -3.016  -5.751  1.00 1.34  ? 1130 THR A HG21 2  
ATOM   1044  H  HG22 . THR A 1 28 ? -9.533  -2.710  -7.262  1.00 1.09  ? 1130 THR A HG22 2  
ATOM   1045  H  HG23 . THR A 1 28 ? -8.118  -1.745  -6.839  1.00 1.21  ? 1130 THR A HG23 2  
ATOM   1046  N  N    . ASP A 1 29 ? -4.085  -4.725  -7.313  1.00 0.59  ? 1131 ASP A N    2  
ATOM   1047  C  CA   . ASP A 1 29 ? -3.147  -5.761  -7.729  1.00 0.69  ? 1131 ASP A CA   2  
ATOM   1048  C  C    . ASP A 1 29 ? -2.166  -6.053  -6.601  1.00 0.67  ? 1131 ASP A C    2  
ATOM   1049  O  O    . ASP A 1 29 ? -1.683  -5.129  -5.936  1.00 0.53  ? 1131 ASP A O    2  
ATOM   1050  C  CB   . ASP A 1 29 ? -2.380  -5.337  -8.981  1.00 0.75  ? 1131 ASP A CB   2  
ATOM   1051  C  CG   . ASP A 1 29 ? -1.480  -6.443  -9.513  1.00 0.92  ? 1131 ASP A CG   2  
ATOM   1052  O  OD1  . ASP A 1 29 ? -0.324  -6.552  -9.051  1.00 0.92  ? 1131 ASP A OD1  2  
ATOM   1053  O  OD2  . ASP A 1 29 ? -1.920  -7.209  -10.396 1.00 1.21  ? 1131 ASP A OD2  2  
ATOM   1054  H  H    . ASP A 1 29 ? -3.735  -3.894  -6.928  1.00 0.55  ? 1131 ASP A H    2  
ATOM   1055  H  HA   . ASP A 1 29 ? -3.711  -6.656  -7.945  1.00 0.81  ? 1131 ASP A HA   2  
ATOM   1056  H  HB2  . ASP A 1 29 ? -3.085  -5.067  -9.750  1.00 0.81  ? 1131 ASP A HB2  2  
ATOM   1057  H  HB3  . ASP A 1 29 ? -1.765  -4.480  -8.746  1.00 0.68  ? 1131 ASP A HB3  2  
ATOM   1058  N  N    . ASN A 1 30 ? -1.872  -7.328  -6.388  1.00 0.94  ? 1132 ASN A N    2  
ATOM   1059  C  CA   . ASN A 1 30 ? -0.975  -7.738  -5.312  1.00 1.00  ? 1132 ASN A CA   2  
ATOM   1060  C  C    . ASN A 1 30 ? 0.492   -7.663  -5.724  1.00 0.91  ? 1132 ASN A C    2  
ATOM   1061  O  O    . ASN A 1 30 ? 1.253   -8.608  -5.522  1.00 1.06  ? 1132 ASN A O    2  
ATOM   1062  C  CB   . ASN A 1 30 ? -1.310  -9.148  -4.818  1.00 1.29  ? 1132 ASN A CB   2  
ATOM   1063  C  CG   . ASN A 1 30 ? -2.427  -9.150  -3.791  1.00 1.72  ? 1132 ASN A CG   2  
ATOM   1064  O  OD1  . ASN A 1 30 ? -2.181  -9.019  -2.592  1.00 2.58  ? 1132 ASN A OD1  2  
ATOM   1065  N  ND2  . ASN A 1 30 ? -3.658  -9.304  -4.248  1.00 2.07  ? 1132 ASN A ND2  2  
ATOM   1066  H  H    . ASN A 1 30 ? -2.274  -8.014  -6.966  1.00 1.15  ? 1132 ASN A H    2  
ATOM   1067  H  HA   . ASN A 1 30 ? -1.127  -7.049  -4.493  1.00 0.97  ? 1132 ASN A HA   2  
ATOM   1068  H  HB2  . ASN A 1 30 ? -1.616  -9.753  -5.658  1.00 1.52  ? 1132 ASN A HB2  2  
ATOM   1069  H  HB3  . ASN A 1 30 ? -0.430  -9.583  -4.367  1.00 1.97  ? 1132 ASN A HB3  2  
ATOM   1070  H  HD21 . ASN A 1 30 ? -3.785  -9.410  -5.216  1.00 2.11  ? 1132 ASN A HD21 2  
ATOM   1071  H  HD22 . ASN A 1 30 ? -4.396  -9.301  -3.603  1.00 2.73  ? 1132 ASN A HD22 2  
ATOM   1072  N  N    . ASP A 1 31 ? 0.875   -6.534  -6.307  1.00 0.86  ? 1133 ASP A N    2  
ATOM   1073  C  CA   . ASP A 1 31 ? 2.282   -6.205  -6.550  1.00 0.77  ? 1133 ASP A CA   2  
ATOM   1074  C  C    . ASP A 1 31 ? 3.084   -6.362  -5.270  1.00 0.78  ? 1133 ASP A C    2  
ATOM   1075  O  O    . ASP A 1 31 ? 4.187   -6.908  -5.267  1.00 1.28  ? 1133 ASP A O    2  
ATOM   1076  C  CB   . ASP A 1 31 ? 2.410   -4.759  -7.039  1.00 0.67  ? 1133 ASP A CB   2  
ATOM   1077  C  CG   . ASP A 1 31 ? 1.288   -3.886  -6.529  1.00 0.58  ? 1133 ASP A CG   2  
ATOM   1078  O  OD1  . ASP A 1 31 ? 1.148   -3.726  -5.306  1.00 1.00  ? 1133 ASP A OD1  2  
ATOM   1079  O  OD2  . ASP A 1 31 ? 0.502   -3.377  -7.340  1.00 1.09  ? 1133 ASP A OD2  2  
ATOM   1080  H  H    . ASP A 1 31 ? 0.185   -5.898  -6.596  1.00 1.05  ? 1133 ASP A H    2  
ATOM   1081  H  HA   . ASP A 1 31 ? 2.667   -6.877  -7.301  1.00 0.87  ? 1133 ASP A HA   2  
ATOM   1082  H  HB2  . ASP A 1 31 ? 3.346   -4.343  -6.680  1.00 1.04  ? 1133 ASP A HB2  2  
ATOM   1083  H  HB3  . ASP A 1 31 ? 2.399   -4.741  -8.118  1.00 1.05  ? 1133 ASP A HB3  2  
ATOM   1084  N  N    . CYS A 1 32 ? 2.502   -5.875  -4.189  1.00 0.76  ? 1134 CYS A N    2  
ATOM   1085  C  CA   . CYS A 1 32 ? 3.100   -5.941  -2.867  1.00 0.78  ? 1134 CYS A CA   2  
ATOM   1086  C  C    . CYS A 1 32 ? 3.250   -7.385  -2.379  1.00 0.85  ? 1134 CYS A C    2  
ATOM   1087  O  O    . CYS A 1 32 ? 3.972   -7.651  -1.418  1.00 1.57  ? 1134 CYS A O    2  
ATOM   1088  C  CB   . CYS A 1 32 ? 2.228   -5.141  -1.902  1.00 0.82  ? 1134 CYS A CB   2  
ATOM   1089  S  SG   . CYS A 1 32 ? 2.830   -5.090  -0.191  1.00 1.16  ? 1134 CYS A SG   2  
ATOM   1090  H  H    . CYS A 1 32 ? 1.636   -5.418  -4.291  1.00 1.11  ? 1134 CYS A H    2  
ATOM   1091  H  HA   . CYS A 1 32 ? 4.077   -5.486  -2.918  1.00 0.88  ? 1134 CYS A HA   2  
ATOM   1092  H  HB2  . CYS A 1 32 ? 2.164   -4.122  -2.252  1.00 1.25  ? 1134 CYS A HB2  2  
ATOM   1093  H  HB3  . CYS A 1 32 ? 1.237   -5.570  -1.888  1.00 1.22  ? 1134 CYS A HB3  2  
ATOM   1094  N  N    . GLY A 1 33 ? 2.566   -8.315  -3.040  1.00 1.17  ? 1135 GLY A N    2  
ATOM   1095  C  CA   . GLY A 1 33 ? 2.624   -9.709  -2.641  1.00 1.22  ? 1135 GLY A CA   2  
ATOM   1096  C  C    . GLY A 1 33 ? 1.750   -9.993  -1.437  1.00 1.18  ? 1135 GLY A C    2  
ATOM   1097  O  O    . GLY A 1 33 ? 0.765   -10.726 -1.530  1.00 1.68  ? 1135 GLY A O    2  
ATOM   1098  H  H    . GLY A 1 33 ? 2.028   -8.055  -3.817  1.00 1.82  ? 1135 GLY A H    2  
ATOM   1099  H  HA2  . GLY A 1 33 ? 2.294   -10.323 -3.466  1.00 1.26  ? 1135 GLY A HA2  2  
ATOM   1100  H  HA3  . GLY A 1 33 ? 3.644   -9.963  -2.400  1.00 1.39  ? 1135 GLY A HA3  2  
ATOM   1101  N  N    . ASP A 1 34 ? 2.110   -9.401  -0.305  1.00 1.02  ? 1136 ASP A N    2  
ATOM   1102  C  CA   . ASP A 1 34 ? 1.333   -9.535  0.921   1.00 1.11  ? 1136 ASP A CA   2  
ATOM   1103  C  C    . ASP A 1 34 ? 0.105   -8.637  0.865   1.00 0.93  ? 1136 ASP A C    2  
ATOM   1104  O  O    . ASP A 1 34 ? -0.835  -8.788  1.645   1.00 1.35  ? 1136 ASP A O    2  
ATOM   1105  C  CB   . ASP A 1 34 ? 2.184   -9.191  2.141   1.00 1.44  ? 1136 ASP A CB   2  
ATOM   1106  C  CG   . ASP A 1 34 ? 3.362   -10.129 2.313   1.00 2.10  ? 1136 ASP A CG   2  
ATOM   1107  O  OD1  . ASP A 1 34 ? 4.440   -9.848  1.747   1.00 2.85  ? 1136 ASP A OD1  2  
ATOM   1108  O  OD2  . ASP A 1 34 ? 3.215   -11.151 3.016   1.00 2.47  ? 1136 ASP A OD2  2  
ATOM   1109  H  H    . ASP A 1 34 ? 2.934   -8.862  -0.294  1.00 1.22  ? 1136 ASP A H    2  
ATOM   1110  H  HA   . ASP A 1 34 ? 1.012   -10.557 0.998   1.00 1.27  ? 1136 ASP A HA   2  
ATOM   1111  H  HB2  . ASP A 1 34 ? 2.560   -8.192  2.028   1.00 1.68  ? 1136 ASP A HB2  2  
ATOM   1112  H  HB3  . ASP A 1 34 ? 1.570   -9.244  3.029   1.00 1.84  ? 1136 ASP A HB3  2  
ATOM   1113  N  N    . GLY A 1 35 ? 0.137   -7.690  -0.064  1.00 0.62  ? 1137 GLY A N    2  
ATOM   1114  C  CA   . GLY A 1 35 ? -1.012  -6.844  -0.320  1.00 0.49  ? 1137 GLY A CA   2  
ATOM   1115  C  C    . GLY A 1 35 ? -1.214  -5.765  0.723   1.00 0.36  ? 1137 GLY A C    2  
ATOM   1116  O  O    . GLY A 1 35 ? -2.338  -5.309  0.934   1.00 0.36  ? 1137 GLY A O    2  
ATOM   1117  H  H    . GLY A 1 35 ? 0.952   -7.573  -0.590  1.00 0.82  ? 1137 GLY A H    2  
ATOM   1118  H  HA2  . GLY A 1 35 ? -0.888  -6.374  -1.283  1.00 0.51  ? 1137 GLY A HA2  2  
ATOM   1119  H  HA3  . GLY A 1 35 ? -1.896  -7.466  -0.351  1.00 0.72  ? 1137 GLY A HA3  2  
ATOM   1120  N  N    . SER A 1 36 ? -0.135  -5.336  1.372   1.00 0.32  ? 1138 SER A N    2  
ATOM   1121  C  CA   . SER A 1 36 ? -0.246  -4.293  2.382   1.00 0.28  ? 1138 SER A CA   2  
ATOM   1122  C  C    . SER A 1 36 ? -0.461  -2.928  1.733   1.00 0.25  ? 1138 SER A C    2  
ATOM   1123  O  O    . SER A 1 36 ? -0.957  -1.998  2.370   1.00 0.40  ? 1138 SER A O    2  
ATOM   1124  C  CB   . SER A 1 36 ? 0.987   -4.278  3.295   1.00 0.33  ? 1138 SER A CB   2  
ATOM   1125  O  OG   . SER A 1 36 ? 2.192   -4.163  2.559   1.00 0.44  ? 1138 SER A OG   2  
ATOM   1126  H  H    . SER A 1 36 ? 0.740   -5.730  1.175   1.00 0.37  ? 1138 SER A H    2  
ATOM   1127  H  HA   . SER A 1 36 ? -1.114  -4.522  2.981   1.00 0.33  ? 1138 SER A HA   2  
ATOM   1128  H  HB2  . SER A 1 36 ? 0.914   -3.442  3.971   1.00 0.40  ? 1138 SER A HB2  2  
ATOM   1129  H  HB3  . SER A 1 36 ? 1.017   -5.193  3.864   1.00 0.39  ? 1138 SER A HB3  2  
ATOM   1130  H  HG   . SER A 1 36 ? 2.010   -3.753  1.705   1.00 1.17  ? 1138 SER A HG   2  
ATOM   1131  N  N    . ASP A 1 37 ? -0.114  -2.818  0.455   1.00 0.18  ? 1139 ASP A N    2  
ATOM   1132  C  CA   . ASP A 1 37 ? -0.324  -1.579  -0.288  1.00 0.18  ? 1139 ASP A CA   2  
ATOM   1133  C  C    . ASP A 1 37 ? -1.812  -1.395  -0.562  1.00 0.20  ? 1139 ASP A C    2  
ATOM   1134  O  O    . ASP A 1 37 ? -2.310  -0.275  -0.669  1.00 0.29  ? 1139 ASP A O    2  
ATOM   1135  C  CB   . ASP A 1 37 ? 0.447   -1.599  -1.610  1.00 0.19  ? 1139 ASP A CB   2  
ATOM   1136  C  CG   . ASP A 1 37 ? -0.250  -2.415  -2.681  1.00 0.26  ? 1139 ASP A CG   2  
ATOM   1137  O  OD1  . ASP A 1 37 ? -0.298  -3.655  -2.556  1.00 0.33  ? 1139 ASP A OD1  2  
ATOM   1138  O  OD2  . ASP A 1 37 ? -0.766  -1.816  -3.645  1.00 0.32  ? 1139 ASP A OD2  2  
ATOM   1139  H  H    . ASP A 1 37 ? 0.284   -3.588  -0.004  1.00 0.26  ? 1139 ASP A H    2  
ATOM   1140  H  HA   . ASP A 1 37 ? 0.032   -0.758  0.316   1.00 0.20  ? 1139 ASP A HA   2  
ATOM   1141  H  HB2  . ASP A 1 37 ? 0.557   -0.589  -1.970  1.00 0.22  ? 1139 ASP A HB2  2  
ATOM   1142  H  HB3  . ASP A 1 37 ? 1.426   -2.023  -1.440  1.00 0.19  ? 1139 ASP A HB3  2  
ATOM   1143  N  N    . GLU A 1 38 ? -2.515  -2.515  -0.659  1.00 0.22  ? 1140 GLU A N    2  
ATOM   1144  C  CA   . GLU A 1 38 ? -3.944  -2.515  -0.921  1.00 0.27  ? 1140 GLU A CA   2  
ATOM   1145  C  C    . GLU A 1 38 ? -4.728  -2.386  0.379   1.00 0.31  ? 1140 GLU A C    2  
ATOM   1146  O  O    . GLU A 1 38 ? -5.912  -2.054  0.364   1.00 0.44  ? 1140 GLU A O    2  
ATOM   1147  C  CB   . GLU A 1 38 ? -4.350  -3.813  -1.622  1.00 0.29  ? 1140 GLU A CB   2  
ATOM   1148  C  CG   . GLU A 1 38 ? -3.635  -4.068  -2.939  1.00 0.29  ? 1140 GLU A CG   2  
ATOM   1149  C  CD   . GLU A 1 38 ? -3.965  -3.041  -3.998  1.00 0.28  ? 1140 GLU A CD   2  
ATOM   1150  O  OE1  . GLU A 1 38 ? -5.101  -2.530  -4.006  1.00 0.38  ? 1140 GLU A OE1  2  
ATOM   1151  O  OE2  . GLU A 1 38 ? -3.088  -2.737  -4.831  1.00 0.28  ? 1140 GLU A OE2  2  
ATOM   1152  H  H    . GLU A 1 38 ? -2.052  -3.374  -0.564  1.00 0.24  ? 1140 GLU A H    2  
ATOM   1153  H  HA   . GLU A 1 38 ? -4.171  -1.673  -1.564  1.00 0.30  ? 1140 GLU A HA   2  
ATOM   1154  H  HB2  . GLU A 1 38 ? -4.141  -4.642  -0.962  1.00 0.32  ? 1140 GLU A HB2  2  
ATOM   1155  H  HB3  . GLU A 1 38 ? -5.411  -3.782  -1.817  1.00 0.33  ? 1140 GLU A HB3  2  
ATOM   1156  H  HG2  . GLU A 1 38 ? -2.570  -4.046  -2.762  1.00 0.29  ? 1140 GLU A HG2  2  
ATOM   1157  H  HG3  . GLU A 1 38 ? -3.917  -5.045  -3.304  1.00 0.33  ? 1140 GLU A HG3  2  
ATOM   1158  N  N    . LYS A 1 39 ? -4.067  -2.663  1.501   1.00 0.30  ? 1141 LYS A N    2  
ATOM   1159  C  CA   . LYS A 1 39 ? -4.737  -2.656  2.796   1.00 0.37  ? 1141 LYS A CA   2  
ATOM   1160  C  C    . LYS A 1 39 ? -4.592  -1.299  3.473   1.00 0.49  ? 1141 LYS A C    2  
ATOM   1161  O  O    . LYS A 1 39 ? -5.460  -0.874  4.235   1.00 0.57  ? 1141 LYS A O    2  
ATOM   1162  C  CB   . LYS A 1 39 ? -4.183  -3.769  3.704   1.00 0.47  ? 1141 LYS A CB   2  
ATOM   1163  C  CG   . LYS A 1 39 ? -2.936  -3.393  4.498   1.00 0.57  ? 1141 LYS A CG   2  
ATOM   1164  C  CD   . LYS A 1 39 ? -2.452  -4.554  5.347   1.00 0.76  ? 1141 LYS A CD   2  
ATOM   1165  C  CE   . LYS A 1 39 ? -1.241  -4.176  6.183   1.00 0.91  ? 1141 LYS A CE   2  
ATOM   1166  N  NZ   . LYS A 1 39 ? -1.540  -3.094  7.158   1.00 1.55  ? 1141 LYS A NZ   2  
ATOM   1167  H  H    . LYS A 1 39 ? -3.115  -2.879  1.452   1.00 0.32  ? 1141 LYS A H    2  
ATOM   1168  H  HA   . LYS A 1 39 ? -5.786  -2.842  2.619   1.00 0.39  ? 1141 LYS A HA   2  
ATOM   1169  H  HB2  . LYS A 1 39 ? -4.948  -4.053  4.403   1.00 0.56  ? 1141 LYS A HB2  2  
ATOM   1170  H  HB3  . LYS A 1 39 ? -3.942  -4.623  3.089   1.00 0.47  ? 1141 LYS A HB3  2  
ATOM   1171  H  HG2  . LYS A 1 39 ? -2.152  -3.110  3.816   1.00 0.50  ? 1141 LYS A HG2  2  
ATOM   1172  H  HG3  . LYS A 1 39 ? -3.170  -2.561  5.146   1.00 0.65  ? 1141 LYS A HG3  2  
ATOM   1173  H  HD2  . LYS A 1 39 ? -3.249  -4.864  6.005   1.00 0.88  ? 1141 LYS A HD2  2  
ATOM   1174  H  HD3  . LYS A 1 39 ? -2.182  -5.371  4.694   1.00 0.73  ? 1141 LYS A HD3  2  
ATOM   1175  H  HE2  . LYS A 1 39 ? -0.911  -5.047  6.718   1.00 1.15  ? 1141 LYS A HE2  2  
ATOM   1176  H  HE3  . LYS A 1 39 ? -0.456  -3.844  5.522   1.00 1.18  ? 1141 LYS A HE3  2  
ATOM   1177  H  HZ1  . LYS A 1 39 ? -2.353  -3.363  7.760   1.00 2.08  ? 1141 LYS A HZ1  2  
ATOM   1178  H  HZ2  . LYS A 1 39 ? -1.772  -2.213  6.659   1.00 1.99  ? 1141 LYS A HZ2  2  
ATOM   1179  H  HZ3  . LYS A 1 39 ? -0.716  -2.924  7.767   1.00 1.97  ? 1141 LYS A HZ3  2  
ATOM   1180  N  N    . ASN A 1 40 ? -3.489  -0.625  3.192   1.00 0.60  ? 1142 ASN A N    2  
ATOM   1181  C  CA   . ASN A 1 40 ? -3.214  0.668   3.798   1.00 0.81  ? 1142 ASN A CA   2  
ATOM   1182  C  C    . ASN A 1 40 ? -3.222  1.757   2.734   1.00 0.91  ? 1142 ASN A C    2  
ATOM   1183  O  O    . ASN A 1 40 ? -2.171  2.247   2.317   1.00 1.44  ? 1142 ASN A O    2  
ATOM   1184  C  CB   . ASN A 1 40 ? -1.865  0.641   4.524   1.00 1.07  ? 1142 ASN A CB   2  
ATOM   1185  C  CG   . ASN A 1 40 ? -1.636  1.871   5.386   1.00 1.37  ? 1142 ASN A CG   2  
ATOM   1186  O  OD1  . ASN A 1 40 ? -1.972  1.886   6.571   1.00 2.05  ? 1142 ASN A OD1  2  
ATOM   1187  N  ND2  . ASN A 1 40 ? -1.072  2.914   4.798   1.00 1.92  ? 1142 ASN A ND2  2  
ATOM   1188  H  H    . ASN A 1 40 ? -2.842  -1.007  2.561   1.00 0.58  ? 1142 ASN A H    2  
ATOM   1189  H  HA   . ASN A 1 40 ? -3.996  0.873   4.513   1.00 0.86  ? 1142 ASN A HA   2  
ATOM   1190  H  HB2  . ASN A 1 40 ? -1.825  -0.231  5.161   1.00 1.54  ? 1142 ASN A HB2  2  
ATOM   1191  H  HB3  . ASN A 1 40 ? -1.072  0.583   3.793   1.00 1.56  ? 1142 ASN A HB3  2  
ATOM   1192  H  HD21 . ASN A 1 40 ? -0.841  2.839   3.847   1.00 2.20  ? 1142 ASN A HD21 2  
ATOM   1193  H  HD22 . ASN A 1 40 ? -0.910  3.718   5.334   1.00 2.44  ? 1142 ASN A HD22 2  
ATOM   1194  N  N    . CYS A 1 41 ? -4.410  2.105   2.275   1.00 0.76  ? 1143 CYS A N    2  
ATOM   1195  C  CA   . CYS A 1 41 ? -4.568  3.148   1.290   1.00 0.99  ? 1143 CYS A CA   2  
ATOM   1196  C  C    . CYS A 1 41 ? -5.818  3.980   1.590   1.00 1.29  ? 1143 CYS A C    2  
ATOM   1197  O  O    . CYS A 1 41 ? -5.725  5.175   1.884   1.00 1.67  ? 1143 CYS A O    2  
ATOM   1198  C  CB   . CYS A 1 41 ? -4.617  2.512   -0.100  1.00 0.93  ? 1143 CYS A CB   2  
ATOM   1199  S  SG   . CYS A 1 41 ? -5.966  1.314   -0.363  1.00 1.10  ? 1143 CYS A SG   2  
ATOM   1200  H  H    . CYS A 1 41 ? -5.202  1.637   2.593   1.00 0.89  ? 1143 CYS A H    2  
ATOM   1201  H  HA   . CYS A 1 41 ? -3.703  3.792   1.350   1.00 1.23  ? 1143 CYS A HA   2  
ATOM   1202  H  HB2  . CYS A 1 41 ? -4.719  3.278   -0.841  1.00 0.98  ? 1143 CYS A HB2  2  
ATOM   1203  H  HB3  . CYS A 1 41 ? -3.687  1.987   -0.260  1.00 1.29  ? 1143 CYS A HB3  2  
ATOM   1204  N  N    . ASN A 1 42 ? -6.979  3.342   1.522   1.00 1.87  ? 1144 ASN A N    2  
ATOM   1205  C  CA   . ASN A 1 42 ? -8.241  3.961   1.929   1.00 2.36  ? 1144 ASN A CA   2  
ATOM   1206  C  C    . ASN A 1 42 ? -9.248  2.871   2.268   1.00 3.05  ? 1144 ASN A C    2  
ATOM   1207  O  O    . ASN A 1 42 ? -10.451 3.113   2.376   1.00 3.73  ? 1144 ASN A O    2  
ATOM   1208  C  CB   . ASN A 1 42 ? -8.798  4.875   0.824   1.00 3.11  ? 1144 ASN A CB   2  
ATOM   1209  C  CG   . ASN A 1 42 ? -9.294  4.121   -0.401  1.00 3.87  ? 1144 ASN A CG   2  
ATOM   1210  O  OD1  . ASN A 1 42 ? -8.796  3.047   -0.739  1.00 4.27  ? 1144 ASN A OD1  2  
ATOM   1211  N  ND2  . ASN A 1 42 ? -10.278 4.687   -1.081  1.00 4.59  ? 1144 ASN A ND2  2  
ATOM   1212  H  H    . ASN A 1 42 ? -6.996  2.428   1.165   1.00 2.27  ? 1144 ASN A H    2  
ATOM   1213  H  HA   . ASN A 1 42 ? -8.050  4.549   2.814   1.00 2.42  ? 1144 ASN A HA   2  
ATOM   1214  H  HB2  . ASN A 1 42 ? -9.623  5.444   1.223   1.00 3.41  ? 1144 ASN A HB2  2  
ATOM   1215  H  HB3  . ASN A 1 42 ? -8.020  5.556   0.511   1.00 3.38  ? 1144 ASN A HB3  2  
ATOM   1216  H  HD21 . ASN A 1 42 ? -10.627 5.548   -0.761  1.00 4.61  ? 1144 ASN A HD21 2  
ATOM   1217  H  HD22 . ASN A 1 42 ? -10.621 4.226   -1.875  1.00 5.30  ? 1144 ASN A HD22 2  
ATOM   1218  N  N    . SER A 1 43 ? -8.730  1.671   2.456   1.00 3.53  ? 1145 SER A N    2  
ATOM   1219  C  CA   . SER A 1 43 ? -9.544  0.489   2.659   1.00 4.69  ? 1145 SER A CA   2  
ATOM   1220  C  C    . SER A 1 43 ? -9.515  0.044   4.118   1.00 5.23  ? 1145 SER A C    2  
ATOM   1221  O  O    . SER A 1 43 ? -8.560  0.329   4.846   1.00 5.32  ? 1145 SER A O    2  
ATOM   1222  C  CB   . SER A 1 43 ? -9.008  -0.621  1.761   1.00 5.40  ? 1145 SER A CB   2  
ATOM   1223  O  OG   . SER A 1 43 ? -7.593  -0.672  1.841   1.00 5.26  ? 1145 SER A OG   2  
ATOM   1224  H  H    . SER A 1 43 ? -7.757  1.571   2.468   1.00 3.45  ? 1145 SER A H    2  
ATOM   1225  H  HA   . SER A 1 43 ? -10.558 0.721   2.375   1.00 5.07  ? 1145 SER A HA   2  
ATOM   1226  H  HB2  . SER A 1 43 ? -9.413  -1.570  2.078   1.00 6.23  ? 1145 SER A HB2  2  
ATOM   1227  H  HB3  . SER A 1 43 ? -9.294  -0.427  0.737   1.00 5.56  ? 1145 SER A HB3  2  
ATOM   1228  H  HG   . SER A 1 43 ? -7.247  -1.249  1.145   1.00 5.21  ? 1145 SER A HG   2  
ATOM   1229  N  N    . THR A 1 44 ? -10.563 -0.643  4.542   1.00 5.97  ? 1146 THR A N    2  
ATOM   1230  C  CA   . THR A 1 44 ? -10.617 -1.213  5.877   1.00 6.81  ? 1146 THR A CA   2  
ATOM   1231  C  C    . THR A 1 44 ? -9.949  -2.578  5.896   1.00 7.34  ? 1146 THR A C    2  
ATOM   1232  O  O    . THR A 1 44 ? -10.577 -3.596  5.607   1.00 8.15  ? 1146 THR A O    2  
ATOM   1233  C  CB   . THR A 1 44 ? -12.073 -1.332  6.364   1.00 7.69  ? 1146 THR A CB   2  
ATOM   1234  O  OG1  . THR A 1 44 ? -12.952 -1.474  5.237   1.00 7.92  ? 1146 THR A OG1  2  
ATOM   1235  C  CG2  . THR A 1 44 ? -12.473 -0.114  7.182   1.00 7.74  ? 1146 THR A CG2  2  
ATOM   1236  H  H    . THR A 1 44 ? -11.326 -0.778  3.937   1.00 6.16  ? 1146 THR A H    2  
ATOM   1237  H  HA   . THR A 1 44 ? -10.084 -0.559  6.551   1.00 6.75  ? 1146 THR A HA   2  
ATOM   1238  H  HB   . THR A 1 44 ? -12.157 -2.210  6.988   1.00 8.40  ? 1146 THR A HB   2  
ATOM   1239  H  HG1  . THR A 1 44 ? -13.270 -0.603  4.967   1.00 8.03  ? 1146 THR A HG1  2  
ATOM   1240  H  HG21 . THR A 1 44 ? -13.502 -0.210  7.494   1.00 7.71  ? 1146 THR A HG21 2  
ATOM   1241  H  HG22 . THR A 1 44 ? -12.360 0.776   6.582   1.00 7.80  ? 1146 THR A HG22 2  
ATOM   1242  H  HG23 . THR A 1 44 ? -11.839 -0.042  8.053   1.00 8.03  ? 1146 THR A HG23 2  
ATOM   1243  N  N    . GLU A 1 45 ? -8.662  -2.587  6.214   1.00 7.13  ? 1147 GLU A N    2  
ATOM   1244  C  CA   . GLU A 1 45 ? -7.898  -3.823  6.264   1.00 7.94  ? 1147 GLU A CA   2  
ATOM   1245  C  C    . GLU A 1 45 ? -8.397  -4.707  7.400   1.00 8.95  ? 1147 GLU A C    2  
ATOM   1246  O  O    . GLU A 1 45 ? -8.464  -5.928  7.252   1.00 9.87  ? 1147 GLU A O    2  
ATOM   1247  C  CB   . GLU A 1 45 ? -6.403  -3.528  6.435   1.00 7.79  ? 1147 GLU A CB   2  
ATOM   1248  C  CG   . GLU A 1 45 ? -6.050  -2.805  7.725   1.00 7.90  ? 1147 GLU A CG   2  
ATOM   1249  C  CD   . GLU A 1 45 ? -4.557  -2.641  7.905   1.00 8.00  ? 1147 GLU A CD   2  
ATOM   1250  O  OE1  . GLU A 1 45 ? -3.897  -3.595  8.366   1.00 8.23  ? 1147 GLU A OE1  2  
ATOM   1251  O  OE2  . GLU A 1 45 ? -4.035  -1.549  7.599   1.00 8.08  ? 1147 GLU A OE2  2  
ATOM   1252  H  H    . GLU A 1 45 ? -8.213  -1.737  6.420   1.00 6.60  ? 1147 GLU A H    2  
ATOM   1253  H  HA   . GLU A 1 45 ? -8.049  -4.342  5.329   1.00 8.20  ? 1147 GLU A HA   2  
ATOM   1254  H  HB2  . GLU A 1 45 ? -5.861  -4.461  6.413   1.00 8.33  ? 1147 GLU A HB2  2  
ATOM   1255  H  HB3  . GLU A 1 45 ? -6.076  -2.916  5.606   1.00 7.37  ? 1147 GLU A HB3  2  
ATOM   1256  H  HG2  . GLU A 1 45 ? -6.506  -1.827  7.713   1.00 7.80  ? 1147 GLU A HG2  2  
ATOM   1257  H  HG3  . GLU A 1 45 ? -6.439  -3.372  8.558   1.00 8.35  ? 1147 GLU A HG3  2  
ATOM   1258  N  N    . THR A 1 46 ? -8.776  -4.072  8.510   1.00 8.94  ? 1148 THR A N    2  
ATOM   1259  C  CA   . THR A 1 46 ? -9.246  -4.775  9.703   1.00 10.03 ? 1148 THR A CA   2  
ATOM   1260  C  C    . THR A 1 46 ? -8.170  -5.696  10.288  1.00 10.71 ? 1148 THR A C    2  
ATOM   1261  O  O    . THR A 1 46 ? -7.742  -6.661  9.652   1.00 11.12 ? 1148 THR A O    2  
ATOM   1262  C  CB   . THR A 1 46 ? -10.515 -5.597  9.396   1.00 10.21 ? 1148 THR A CB   2  
ATOM   1263  O  OG1  . THR A 1 46 ? -11.519 -4.745  8.827   1.00 9.58  ? 1148 THR A OG1  2  
ATOM   1264  C  CG2  . THR A 1 46 ? -11.063 -6.256  10.654  1.00 11.01 ? 1148 THR A CG2  2  
ATOM   1265  H  H    . THR A 1 46 ? -8.754  -3.088  8.518   1.00 8.30  ? 1148 THR A H    2  
ATOM   1266  H  HA   . THR A 1 46 ? -9.501  -4.031  10.443  1.00 10.45 ? 1148 THR A HA   2  
ATOM   1267  H  HB   . THR A 1 46 ? -10.262 -6.368  8.683   1.00 10.48 ? 1148 THR A HB   2  
ATOM   1268  H  HG1  . THR A 1 46 ? -11.579 -3.933  9.344   1.00 9.43  ? 1148 THR A HG1  2  
ATOM   1269  H  HG21 . THR A 1 46 ? -11.328 -5.495  11.372  1.00 11.19 ? 1148 THR A HG21 2  
ATOM   1270  H  HG22 . THR A 1 46 ? -10.309 -6.903  11.078  1.00 11.07 ? 1148 THR A HG22 2  
ATOM   1271  H  HG23 . THR A 1 46 ? -11.937 -6.838  10.405  1.00 11.53 ? 1148 THR A HG23 2  
HETATM 1272  CA CA   . CA  B 2 .  ? -0.994  -2.830  -5.622  1.00 0.28  ? 1201 CA  A CA   2  
ATOM   1273  N  N    . THR A 1 1  ? 21.745  -10.026 7.966   1.00 12.23 ? 1103 THR A N    3  
ATOM   1274  C  CA   . THR A 1 1  ? 21.718  -9.277  6.695   1.00 11.73 ? 1103 THR A CA   3  
ATOM   1275  C  C    . THR A 1 1  ? 22.067  -7.810  6.931   1.00 10.83 ? 1103 THR A C    3  
ATOM   1276  O  O    . THR A 1 1  ? 21.323  -7.082  7.586   1.00 10.67 ? 1103 THR A O    3  
ATOM   1277  C  CB   . THR A 1 1  ? 20.333  -9.380  6.025   1.00 11.83 ? 1103 THR A CB   3  
ATOM   1278  O  OG1  . THR A 1 1  ? 19.950  -10.758 5.896   1.00 12.26 ? 1103 THR A OG1  3  
ATOM   1279  C  CG2  . THR A 1 1  ? 20.344  -8.728  4.650   1.00 12.04 ? 1103 THR A CG2  3  
ATOM   1280  H  H1   . THR A 1 1  ? 22.690  -9.965  8.397   1.00 12.23 ? 1103 THR A H1   3  
ATOM   1281  H  H2   . THR A 1 1  ? 21.518  -11.025 7.796   1.00 12.55 ? 1103 THR A H2   3  
ATOM   1282  H  H3   . THR A 1 1  ? 21.050  -9.632  8.628   1.00 12.44 ? 1103 THR A H3   3  
ATOM   1283  H  HA   . THR A 1 1  ? 22.453  -9.708  6.032   1.00 12.16 ? 1103 THR A HA   3  
ATOM   1284  H  HB   . THR A 1 1  ? 19.611  -8.869  6.644   1.00 11.67 ? 1103 THR A HB   3  
ATOM   1285  H  HG1  . THR A 1 1  ? 19.331  -10.847 5.157   1.00 12.30 ? 1103 THR A HG1  3  
ATOM   1286  H  HG21 . THR A 1 1  ? 20.643  -7.695  4.743   1.00 12.31 ? 1103 THR A HG21 3  
ATOM   1287  H  HG22 . THR A 1 1  ? 19.356  -8.779  4.219   1.00 12.05 ? 1103 THR A HG22 3  
ATOM   1288  H  HG23 . THR A 1 1  ? 21.042  -9.249  4.010   1.00 12.10 ? 1103 THR A HG23 3  
ATOM   1289  N  N    . HIS A 1 2  ? 23.213  -7.387  6.405   1.00 10.41 ? 1104 HIS A N    3  
ATOM   1290  C  CA   . HIS A 1 2  ? 23.661  -6.005  6.551   1.00 9.72  ? 1104 HIS A CA   3  
ATOM   1291  C  C    . HIS A 1 2  ? 23.031  -5.114  5.491   1.00 8.65  ? 1104 HIS A C    3  
ATOM   1292  O  O    . HIS A 1 2  ? 23.063  -3.888  5.601   1.00 8.32  ? 1104 HIS A O    3  
ATOM   1293  C  CB   . HIS A 1 2  ? 25.188  -5.916  6.469   1.00 10.05 ? 1104 HIS A CB   3  
ATOM   1294  C  CG   . HIS A 1 2  ? 25.887  -6.368  7.712   1.00 10.43 ? 1104 HIS A CG   3  
ATOM   1295  N  ND1  . HIS A 1 2  ? 26.479  -7.605  7.841   1.00 10.71 ? 1104 HIS A ND1  3  
ATOM   1296  C  CD2  . HIS A 1 2  ? 26.097  -5.730  8.888   1.00 10.84 ? 1104 HIS A CD2  3  
ATOM   1297  C  CE1  . HIS A 1 2  ? 27.021  -7.708  9.040   1.00 11.25 ? 1104 HIS A CE1  3  
ATOM   1298  N  NE2  . HIS A 1 2  ? 26.803  -6.585  9.692   1.00 11.34 ? 1104 HIS A NE2  3  
ATOM   1299  H  H    . HIS A 1 2  ? 23.774  -8.023  5.908   1.00 10.71 ? 1104 HIS A H    3  
ATOM   1300  H  HA   . HIS A 1 2  ? 23.345  -5.660  7.524   1.00 9.96  ? 1104 HIS A HA   3  
ATOM   1301  H  HB2  . HIS A 1 2  ? 25.533  -6.534  5.653   1.00 10.50 ? 1104 HIS A HB2  3  
ATOM   1302  H  HB3  . HIS A 1 2  ? 25.470  -4.891  6.280   1.00 9.81  ? 1104 HIS A HB3  3  
ATOM   1303  H  HD1  . HIS A 1 2  ? 26.497  -8.310  7.154   1.00 10.68 ? 1104 HIS A HD1  3  
ATOM   1304  H  HD2  . HIS A 1 2  ? 25.767  -4.733  9.145   1.00 10.94 ? 1104 HIS A HD2  3  
ATOM   1305  H  HE1  . HIS A 1 2  ? 27.553  -8.565  9.420   1.00 11.71 ? 1104 HIS A HE1  3  
ATOM   1306  H  HE2  . HIS A 1 2  ? 27.026  -6.424  10.637  1.00 11.83 ? 1104 HIS A HE2  3  
ATOM   1307  N  N    . ALA A 1 3  ? 22.471  -5.731  4.463   1.00 8.30  ? 1105 ALA A N    3  
ATOM   1308  C  CA   . ALA A 1 3  ? 21.795  -4.987  3.412   1.00 7.41  ? 1105 ALA A CA   3  
ATOM   1309  C  C    . ALA A 1 3  ? 20.381  -4.615  3.851   1.00 6.47  ? 1105 ALA A C    3  
ATOM   1310  O  O    . ALA A 1 3  ? 19.568  -5.491  4.144   1.00 6.54  ? 1105 ALA A O    3  
ATOM   1311  C  CB   . ALA A 1 3  ? 21.756  -5.800  2.126   1.00 7.70  ? 1105 ALA A CB   3  
ATOM   1312  H  H    . ALA A 1 3  ? 22.510  -6.708  4.410   1.00 8.79  ? 1105 ALA A H    3  
ATOM   1313  H  HA   . ALA A 1 3  ? 22.357  -4.084  3.227   1.00 7.45  ? 1105 ALA A HA   3  
ATOM   1314  H  HB1  . ALA A 1 3  ? 22.764  -6.058  1.833   1.00 7.93  ? 1105 ALA A HB1  3  
ATOM   1315  H  HB2  . ALA A 1 3  ? 21.293  -5.214  1.346   1.00 7.73  ? 1105 ALA A HB2  3  
ATOM   1316  H  HB3  . ALA A 1 3  ? 21.186  -6.702  2.287   1.00 7.95  ? 1105 ALA A HB3  3  
ATOM   1317  N  N    . PRO A 1 4  ? 20.076  -3.313  3.911   1.00 5.80  ? 1106 PRO A N    3  
ATOM   1318  C  CA   . PRO A 1 4  ? 18.762  -2.833  4.329   1.00 4.97  ? 1106 PRO A CA   3  
ATOM   1319  C  C    . PRO A 1 4  ? 17.746  -2.885  3.193   1.00 4.25  ? 1106 PRO A C    3  
ATOM   1320  O  O    . PRO A 1 4  ? 18.099  -2.712  2.023   1.00 4.22  ? 1106 PRO A O    3  
ATOM   1321  C  CB   . PRO A 1 4  ? 19.040  -1.390  4.739   1.00 4.84  ? 1106 PRO A CB   3  
ATOM   1322  C  CG   . PRO A 1 4  ? 20.175  -0.962  3.869   1.00 5.55  ? 1106 PRO A CG   3  
ATOM   1323  C  CD   . PRO A 1 4  ? 20.986  -2.203  3.576   1.00 6.09  ? 1106 PRO A CD   3  
ATOM   1324  H  HA   . PRO A 1 4  ? 18.385  -3.389  5.175   1.00 5.32  ? 1106 PRO A HA   3  
ATOM   1325  H  HB2  . PRO A 1 4  ? 18.159  -0.788  4.569   1.00 4.32  ? 1106 PRO A HB2  3  
ATOM   1326  H  HB3  . PRO A 1 4  ? 19.311  -1.355  5.784   1.00 5.12  ? 1106 PRO A HB3  3  
ATOM   1327  H  HG2  . PRO A 1 4  ? 19.793  -0.540  2.950   1.00 5.52  ? 1106 PRO A HG2  3  
ATOM   1328  H  HG3  . PRO A 1 4  ? 20.781  -0.234  4.389   1.00 6.00  ? 1106 PRO A HG3  3  
ATOM   1329  H  HD2  . PRO A 1 4  ? 21.261  -2.235  2.532   1.00 6.19  ? 1106 PRO A HD2  3  
ATOM   1330  H  HD3  . PRO A 1 4  ? 21.869  -2.229  4.197   1.00 6.80  ? 1106 PRO A HD3  3  
ATOM   1331  N  N    . ALA A 1 5  ? 16.489  -3.124  3.531   1.00 4.09  ? 1107 ALA A N    3  
ATOM   1332  C  CA   . ALA A 1 5  ? 15.435  -3.200  2.531   1.00 3.77  ? 1107 ALA A CA   3  
ATOM   1333  C  C    . ALA A 1 5  ? 14.829  -1.824  2.274   1.00 2.63  ? 1107 ALA A C    3  
ATOM   1334  O  O    . ALA A 1 5  ? 13.634  -1.607  2.482   1.00 2.62  ? 1107 ALA A O    3  
ATOM   1335  C  CB   . ALA A 1 5  ? 14.362  -4.190  2.966   1.00 4.73  ? 1107 ALA A CB   3  
ATOM   1336  H  H    . ALA A 1 5  ? 16.262  -3.251  4.476   1.00 4.51  ? 1107 ALA A H    3  
ATOM   1337  H  HA   . ALA A 1 5  ? 15.876  -3.565  1.614   1.00 4.04  ? 1107 ALA A HA   3  
ATOM   1338  H  HB1  . ALA A 1 5  ? 13.616  -4.277  2.190   1.00 5.01  ? 1107 ALA A HB1  3  
ATOM   1339  H  HB2  . ALA A 1 5  ? 13.895  -3.839  3.874   1.00 4.95  ? 1107 ALA A HB2  3  
ATOM   1340  H  HB3  . ALA A 1 5  ? 14.812  -5.155  3.142   1.00 5.29  ? 1107 ALA A HB3  3  
ATOM   1341  N  N    . SER A 1 6  ? 15.664  -0.889  1.842   1.00 2.16  ? 1108 SER A N    3  
ATOM   1342  C  CA   . SER A 1 6  ? 15.207  0.451   1.515   1.00 1.43  ? 1108 SER A CA   3  
ATOM   1343  C  C    . SER A 1 6  ? 14.757  0.513   0.059   1.00 1.29  ? 1108 SER A C    3  
ATOM   1344  O  O    . SER A 1 6  ? 15.377  -0.092  -0.820  1.00 1.97  ? 1108 SER A O    3  
ATOM   1345  C  CB   . SER A 1 6  ? 16.322  1.461   1.786   1.00 2.09  ? 1108 SER A CB   3  
ATOM   1346  O  OG   . SER A 1 6  ? 17.568  1.005   1.279   1.00 2.97  ? 1108 SER A OG   3  
ATOM   1347  H  H    . SER A 1 6  ? 16.613  -1.109  1.733   1.00 2.71  ? 1108 SER A H    3  
ATOM   1348  H  HA   . SER A 1 6  ? 14.365  0.679   2.150   1.00 1.32  ? 1108 SER A HA   3  
ATOM   1349  H  HB2  . SER A 1 6  ? 16.076  2.399   1.312   1.00 2.36  ? 1108 SER A HB2  3  
ATOM   1350  H  HB3  . SER A 1 6  ? 16.415  1.611   2.851   1.00 2.13  ? 1108 SER A HB3  3  
ATOM   1351  H  HG   . SER A 1 6  ? 18.248  1.113   1.959   1.00 3.32  ? 1108 SER A HG   3  
ATOM   1352  N  N    . CYS A 1 7  ? 13.677  1.233   -0.193  1.00 0.72  ? 1109 CYS A N    3  
ATOM   1353  C  CA   . CYS A 1 7  ? 13.096  1.282   -1.524  1.00 0.49  ? 1109 CYS A CA   3  
ATOM   1354  C  C    . CYS A 1 7  ? 13.451  2.580   -2.237  1.00 0.46  ? 1109 CYS A C    3  
ATOM   1355  O  O    . CYS A 1 7  ? 14.111  3.455   -1.675  1.00 0.62  ? 1109 CYS A O    3  
ATOM   1356  C  CB   . CYS A 1 7  ? 11.576  1.130   -1.443  1.00 0.33  ? 1109 CYS A CB   3  
ATOM   1357  S  SG   . CYS A 1 7  ? 11.035  -0.337  -0.505  1.00 0.47  ? 1109 CYS A SG   3  
ATOM   1358  H  H    . CYS A 1 7  ? 13.260  1.747   0.532   1.00 0.94  ? 1109 CYS A H    3  
ATOM   1359  H  HA   . CYS A 1 7  ? 13.499  0.456   -2.089  1.00 0.60  ? 1109 CYS A HA   3  
ATOM   1360  H  HB2  . CYS A 1 7  ? 11.156  2.001   -0.966  1.00 0.41  ? 1109 CYS A HB2  3  
ATOM   1361  H  HB3  . CYS A 1 7  ? 11.178  1.046   -2.443  1.00 0.29  ? 1109 CYS A HB3  3  
ATOM   1362  N  N    . LEU A 1 8  ? 13.015  2.684   -3.483  1.00 0.34  ? 1110 LEU A N    3  
ATOM   1363  C  CA   . LEU A 1 8  ? 13.224  3.875   -4.292  1.00 0.32  ? 1110 LEU A CA   3  
ATOM   1364  C  C    . LEU A 1 8  ? 12.432  5.049   -3.722  1.00 0.29  ? 1110 LEU A C    3  
ATOM   1365  O  O    . LEU A 1 8  ? 11.542  4.851   -2.893  1.00 0.30  ? 1110 LEU A O    3  
ATOM   1366  C  CB   . LEU A 1 8  ? 12.753  3.590   -5.716  1.00 0.28  ? 1110 LEU A CB   3  
ATOM   1367  C  CG   . LEU A 1 8  ? 13.588  4.168   -6.850  1.00 0.38  ? 1110 LEU A CG   3  
ATOM   1368  C  CD1  . LEU A 1 8  ? 14.985  3.563   -6.857  1.00 0.52  ? 1110 LEU A CD1  3  
ATOM   1369  C  CD2  . LEU A 1 8  ? 12.884  3.914   -8.172  1.00 0.39  ? 1110 LEU A CD2  3  
ATOM   1370  H  H    . LEU A 1 8  ? 12.539  1.923   -3.881  1.00 0.34  ? 1110 LEU A H    3  
ATOM   1371  H  HA   . LEU A 1 8  ? 14.275  4.112   -4.297  1.00 0.40  ? 1110 LEU A HA   3  
ATOM   1372  H  HB2  . LEU A 1 8  ? 12.712  2.520   -5.843  1.00 0.32  ? 1110 LEU A HB2  3  
ATOM   1373  H  HB3  . LEU A 1 8  ? 11.746  3.973   -5.815  1.00 0.22  ? 1110 LEU A HB3  3  
ATOM   1374  H  HG   . LEU A 1 8  ? 13.683  5.232   -6.717  1.00 0.41  ? 1110 LEU A HG   3  
ATOM   1375  H  HD11 . LEU A 1 8  ? 15.557  3.987   -7.668  1.00 1.05  ? 1110 LEU A HD11 3  
ATOM   1376  H  HD12 . LEU A 1 8  ? 14.913  2.494   -6.988  1.00 1.29  ? 1110 LEU A HD12 3  
ATOM   1377  H  HD13 . LEU A 1 8  ? 15.475  3.778   -5.919  1.00 1.07  ? 1110 LEU A HD13 3  
ATOM   1378  H  HD21 . LEU A 1 8  ? 12.674  2.858   -8.270  1.00 1.11  ? 1110 LEU A HD21 3  
ATOM   1379  H  HD22 . LEU A 1 8  ? 13.517  4.233   -8.986  1.00 1.05  ? 1110 LEU A HD22 3  
ATOM   1380  H  HD23 . LEU A 1 8  ? 11.956  4.466   -8.197  1.00 0.97  ? 1110 LEU A HD23 3  
ATOM   1381  N  N    . ASP A 1 9  ? 12.733  6.256   -4.171  1.00 0.35  ? 1111 ASP A N    3  
ATOM   1382  C  CA   . ASP A 1 9  ? 11.992  7.435   -3.731  1.00 0.38  ? 1111 ASP A CA   3  
ATOM   1383  C  C    . ASP A 1 9  ? 10.554  7.374   -4.237  1.00 0.32  ? 1111 ASP A C    3  
ATOM   1384  O  O    . ASP A 1 9  ? 9.615   7.751   -3.532  1.00 0.42  ? 1111 ASP A O    3  
ATOM   1385  C  CB   . ASP A 1 9  ? 12.679  8.713   -4.219  1.00 0.51  ? 1111 ASP A CB   3  
ATOM   1386  C  CG   . ASP A 1 9  ? 11.937  9.973   -3.816  1.00 1.37  ? 1111 ASP A CG   3  
ATOM   1387  O  OD1  . ASP A 1 9  ? 11.696  10.169  -2.608  1.00 1.53  ? 1111 ASP A OD1  3  
ATOM   1388  O  OD2  . ASP A 1 9  ? 11.624  10.791  -4.706  1.00 2.32  ? 1111 ASP A OD2  3  
ATOM   1389  H  H    . ASP A 1 9  ? 13.471  6.363   -4.812  1.00 0.40  ? 1111 ASP A H    3  
ATOM   1390  H  HA   . ASP A 1 9  ? 11.980  7.432   -2.652  1.00 0.44  ? 1111 ASP A HA   3  
ATOM   1391  H  HB2  . ASP A 1 9  ? 13.674  8.758   -3.803  1.00 0.94  ? 1111 ASP A HB2  3  
ATOM   1392  H  HB3  . ASP A 1 9  ? 12.747  8.686   -5.296  1.00 1.01  ? 1111 ASP A HB3  3  
ATOM   1393  N  N    . THR A 1 10 ? 10.383  6.874   -5.455  1.00 0.28  ? 1112 THR A N    3  
ATOM   1394  C  CA   . THR A 1 10 ? 9.058   6.707   -6.032  1.00 0.31  ? 1112 THR A CA   3  
ATOM   1395  C  C    . THR A 1 10 ? 8.496   5.318   -5.736  1.00 0.24  ? 1112 THR A C    3  
ATOM   1396  O  O    . THR A 1 10 ? 7.411   4.964   -6.201  1.00 0.30  ? 1112 THR A O    3  
ATOM   1397  C  CB   . THR A 1 10 ? 9.075   6.941   -7.555  1.00 0.42  ? 1112 THR A CB   3  
ATOM   1398  O  OG1  . THR A 1 10 ? 10.102  6.145   -8.165  1.00 0.45  ? 1112 THR A OG1  3  
ATOM   1399  C  CG2  . THR A 1 10 ? 9.307   8.410   -7.875  1.00 0.52  ? 1112 THR A CG2  3  
ATOM   1400  H  H    . THR A 1 10 ? 11.171  6.625   -5.986  1.00 0.31  ? 1112 THR A H    3  
ATOM   1401  H  HA   . THR A 1 10 ? 8.409   7.444   -5.585  1.00 0.36  ? 1112 THR A HA   3  
ATOM   1402  H  HB   . THR A 1 10 ? 8.117   6.649   -7.960  1.00 0.48  ? 1112 THR A HB   3  
ATOM   1403  H  HG1  . THR A 1 10 ? 10.929  6.644   -8.178  1.00 0.95  ? 1112 THR A HG1  3  
ATOM   1404  H  HG21 . THR A 1 10 ? 10.261  8.720   -7.474  1.00 1.19  ? 1112 THR A HG21 3  
ATOM   1405  H  HG22 . THR A 1 10 ? 8.521   9.003   -7.431  1.00 1.09  ? 1112 THR A HG22 3  
ATOM   1406  H  HG23 . THR A 1 10 ? 9.303   8.550   -8.945  1.00 1.17  ? 1112 THR A HG23 3  
ATOM   1407  N  N    . GLN A 1 11 ? 9.233   4.530   -4.963  1.00 0.18  ? 1113 GLN A N    3  
ATOM   1408  C  CA   . GLN A 1 11 ? 8.764   3.217   -4.574  1.00 0.17  ? 1113 GLN A CA   3  
ATOM   1409  C  C    . GLN A 1 11 ? 8.157   3.224   -3.186  1.00 0.17  ? 1113 GLN A C    3  
ATOM   1410  O  O    . GLN A 1 11 ? 8.512   4.031   -2.329  1.00 0.23  ? 1113 GLN A O    3  
ATOM   1411  C  CB   . GLN A 1 11 ? 9.882   2.188   -4.634  1.00 0.17  ? 1113 GLN A CB   3  
ATOM   1412  C  CG   . GLN A 1 11 ? 10.191  1.728   -6.043  1.00 0.23  ? 1113 GLN A CG   3  
ATOM   1413  C  CD   . GLN A 1 11 ? 11.136  0.544   -6.076  1.00 0.35  ? 1113 GLN A CD   3  
ATOM   1414  O  OE1  . GLN A 1 11 ? 11.967  0.372   -5.182  1.00 1.02  ? 1113 GLN A OE1  3  
ATOM   1415  N  NE2  . GLN A 1 11 ? 11.023  -0.273  -7.107  1.00 0.67  ? 1113 GLN A NE2  3  
ATOM   1416  H  H    . GLN A 1 11 ? 10.109  4.834   -4.648  1.00 0.20  ? 1113 GLN A H    3  
ATOM   1417  H  HA   . GLN A 1 11 ? 7.997   2.929   -5.276  1.00 0.22  ? 1113 GLN A HA   3  
ATOM   1418  H  HB2  . GLN A 1 11 ? 10.778  2.619   -4.208  1.00 0.16  ? 1113 GLN A HB2  3  
ATOM   1419  H  HB3  . GLN A 1 11 ? 9.595   1.331   -4.051  1.00 0.20  ? 1113 GLN A HB3  3  
ATOM   1420  H  HG2  . GLN A 1 11 ? 9.269   1.453   -6.521  1.00 0.31  ? 1113 GLN A HG2  3  
ATOM   1421  H  HG3  . GLN A 1 11 ? 10.642  2.545   -6.585  1.00 0.22  ? 1113 GLN A HG3  3  
ATOM   1422  H  HE21 . GLN A 1 11 ? 10.343  -0.072  -7.786  1.00 1.21  ? 1113 GLN A HE21 3  
ATOM   1423  H  HE22 . GLN A 1 11 ? 11.631  -1.044  -7.160  1.00 0.65  ? 1113 GLN A HE22 3  
ATOM   1424  N  N    . TYR A 1 12 ? 7.243   2.299   -2.990  1.00 0.15  ? 1114 TYR A N    3  
ATOM   1425  C  CA   . TYR A 1 12 ? 6.536   2.145   -1.734  1.00 0.16  ? 1114 TYR A CA   3  
ATOM   1426  C  C    . TYR A 1 12 ? 7.143   0.985   -0.965  1.00 0.15  ? 1114 TYR A C    3  
ATOM   1427  O  O    . TYR A 1 12 ? 7.640   0.030   -1.566  1.00 0.15  ? 1114 TYR A O    3  
ATOM   1428  C  CB   . TYR A 1 12 ? 5.056   1.877   -2.008  1.00 0.18  ? 1114 TYR A CB   3  
ATOM   1429  C  CG   . TYR A 1 12 ? 4.173   1.806   -0.781  1.00 0.22  ? 1114 TYR A CG   3  
ATOM   1430  C  CD1  . TYR A 1 12 ? 3.812   2.961   -0.098  1.00 0.33  ? 1114 TYR A CD1  3  
ATOM   1431  C  CD2  . TYR A 1 12 ? 3.719   0.587   -0.293  1.00 0.21  ? 1114 TYR A CD2  3  
ATOM   1432  C  CE1  . TYR A 1 12 ? 3.024   2.905   1.034   1.00 0.39  ? 1114 TYR A CE1  3  
ATOM   1433  C  CE2  . TYR A 1 12 ? 2.926   0.523   0.838   1.00 0.26  ? 1114 TYR A CE2  3  
ATOM   1434  C  CZ   . TYR A 1 12 ? 2.518   1.666   1.451   1.00 0.34  ? 1114 TYR A CZ   3  
ATOM   1435  O  OH   . TYR A 1 12 ? 1.799   1.619   2.630   1.00 0.41  ? 1114 TYR A OH   3  
ATOM   1436  H  H    . TYR A 1 12 ? 7.051   1.670   -3.725  1.00 0.16  ? 1114 TYR A H    3  
ATOM   1437  H  HA   . TYR A 1 12 ? 6.643   3.054   -1.162  1.00 0.18  ? 1114 TYR A HA   3  
ATOM   1438  H  HB2  . TYR A 1 12 ? 4.669   2.657   -2.645  1.00 0.23  ? 1114 TYR A HB2  3  
ATOM   1439  H  HB3  . TYR A 1 12 ? 4.975   0.933   -2.519  1.00 0.18  ? 1114 TYR A HB3  3  
ATOM   1440  H  HD1  . TYR A 1 12 ? 4.159   3.917   -0.465  1.00 0.40  ? 1114 TYR A HD1  3  
ATOM   1441  H  HD2  . TYR A 1 12 ? 3.988   -0.321  -0.813  1.00 0.23  ? 1114 TYR A HD2  3  
ATOM   1442  H  HE1  . TYR A 1 12 ? 2.758   3.815   1.550   1.00 0.50  ? 1114 TYR A HE1  3  
ATOM   1443  H  HE2  . TYR A 1 12 ? 2.580   -0.433  1.201   1.00 0.29  ? 1114 TYR A HE2  3  
ATOM   1444  H  HH   . TYR A 1 12 ? 2.120   0.908   3.202   1.00 0.89  ? 1114 TYR A HH   3  
ATOM   1445  N  N    . THR A 1 13 ? 7.099   1.068   0.346   1.00 0.18  ? 1115 THR A N    3  
ATOM   1446  C  CA   . THR A 1 13 ? 7.667   0.037   1.191   1.00 0.20  ? 1115 THR A CA   3  
ATOM   1447  C  C    . THR A 1 13 ? 6.564   -0.695  1.939   1.00 0.23  ? 1115 THR A C    3  
ATOM   1448  O  O    . THR A 1 13 ? 5.979   -0.162  2.886   1.00 0.31  ? 1115 THR A O    3  
ATOM   1449  C  CB   . THR A 1 13 ? 8.671   0.627   2.201   1.00 0.26  ? 1115 THR A CB   3  
ATOM   1450  O  OG1  . THR A 1 13 ? 9.604   1.473   1.515   1.00 0.30  ? 1115 THR A OG1  3  
ATOM   1451  C  CG2  . THR A 1 13 ? 9.431   -0.481  2.922   1.00 0.27  ? 1115 THR A CG2  3  
ATOM   1452  H  H    . THR A 1 13 ? 6.655   1.836   0.757   1.00 0.22  ? 1115 THR A H    3  
ATOM   1453  H  HA   . THR A 1 13 ? 8.189   -0.666  0.558   1.00 0.19  ? 1115 THR A HA   3  
ATOM   1454  H  HB   . THR A 1 13 ? 8.131   1.211   2.932   1.00 0.31  ? 1115 THR A HB   3  
ATOM   1455  H  HG1  . THR A 1 13 ? 10.081  0.950   0.860   1.00 0.82  ? 1115 THR A HG1  3  
ATOM   1456  H  HG21 . THR A 1 13 ? 10.100  -0.045  3.649   1.00 1.01  ? 1115 THR A HG21 3  
ATOM   1457  H  HG22 . THR A 1 13 ? 10.004  -1.051  2.204   1.00 1.02  ? 1115 THR A HG22 3  
ATOM   1458  H  HG23 . THR A 1 13 ? 8.731   -1.135  3.422   1.00 1.10  ? 1115 THR A HG23 3  
ATOM   1459  N  N    . CYS A 1 14 ? 6.267   -1.906  1.491   1.00 0.26  ? 1116 CYS A N    3  
ATOM   1460  C  CA   . CYS A 1 14 ? 5.253   -2.734  2.126   1.00 0.34  ? 1116 CYS A CA   3  
ATOM   1461  C  C    . CYS A 1 14 ? 5.618   -3.035  3.573   1.00 0.40  ? 1116 CYS A C    3  
ATOM   1462  O  O    . CYS A 1 14 ? 6.781   -2.892  3.965   1.00 0.37  ? 1116 CYS A O    3  
ATOM   1463  C  CB   . CYS A 1 14 ? 5.071   -4.044  1.355   1.00 0.45  ? 1116 CYS A CB   3  
ATOM   1464  S  SG   . CYS A 1 14 ? 4.402   -3.840  -0.323  1.00 0.65  ? 1116 CYS A SG   3  
ATOM   1465  H  H    . CYS A 1 14 ? 6.743   -2.250  0.699   1.00 0.28  ? 1116 CYS A H    3  
ATOM   1466  H  HA   . CYS A 1 14 ? 4.323   -2.187  2.109   1.00 0.38  ? 1116 CYS A HA   3  
ATOM   1467  H  HB2  . CYS A 1 14 ? 6.030   -4.538  1.263   1.00 0.50  ? 1116 CYS A HB2  3  
ATOM   1468  H  HB3  . CYS A 1 14 ? 4.395   -4.682  1.904   1.00 0.54  ? 1116 CYS A HB3  3  
ATOM   1469  N  N    . ASP A 1 15 ? 4.637   -3.443  4.362   1.00 0.56  ? 1117 ASP A N    3  
ATOM   1470  C  CA   . ASP A 1 15 ? 4.864   -3.765  5.766   1.00 0.69  ? 1117 ASP A CA   3  
ATOM   1471  C  C    . ASP A 1 15 ? 5.961   -4.821  5.909   1.00 0.65  ? 1117 ASP A C    3  
ATOM   1472  O  O    . ASP A 1 15 ? 6.904   -4.648  6.684   1.00 0.71  ? 1117 ASP A O    3  
ATOM   1473  C  CB   . ASP A 1 15 ? 3.565   -4.244  6.422   1.00 0.93  ? 1117 ASP A CB   3  
ATOM   1474  C  CG   . ASP A 1 15 ? 3.768   -4.681  7.857   1.00 1.83  ? 1117 ASP A CG   3  
ATOM   1475  O  OD1  . ASP A 1 15 ? 3.880   -3.806  8.741   1.00 2.62  ? 1117 ASP A OD1  3  
ATOM   1476  O  OD2  . ASP A 1 15 ? 3.804   -5.902  8.110   1.00 2.09  ? 1117 ASP A OD2  3  
ATOM   1477  H  H    . ASP A 1 15 ? 3.730   -3.531  3.991   1.00 0.63  ? 1117 ASP A H    3  
ATOM   1478  H  HA   . ASP A 1 15 ? 5.192   -2.862  6.258   1.00 0.70  ? 1117 ASP A HA   3  
ATOM   1479  H  HB2  . ASP A 1 15 ? 2.848   -3.437  6.412   1.00 1.35  ? 1117 ASP A HB2  3  
ATOM   1480  H  HB3  . ASP A 1 15 ? 3.172   -5.077  5.860   1.00 0.70  ? 1117 ASP A HB3  3  
ATOM   1481  N  N    . ASN A 1 16 ? 5.862   -5.891  5.124   1.00 0.69  ? 1118 ASN A N    3  
ATOM   1482  C  CA   . ASN A 1 16 ? 6.880   -6.949  5.132   1.00 0.75  ? 1118 ASN A CA   3  
ATOM   1483  C  C    . ASN A 1 16 ? 8.118   -6.559  4.320   1.00 0.59  ? 1118 ASN A C    3  
ATOM   1484  O  O    . ASN A 1 16 ? 8.836   -7.423  3.821   1.00 0.65  ? 1118 ASN A O    3  
ATOM   1485  C  CB   . ASN A 1 16 ? 6.313   -8.269  4.594   1.00 0.98  ? 1118 ASN A CB   3  
ATOM   1486  C  CG   . ASN A 1 16 ? 5.824   -9.195  5.693   1.00 1.77  ? 1118 ASN A CG   3  
ATOM   1487  O  OD1  . ASN A 1 16 ? 6.597   -9.973  6.251   1.00 2.75  ? 1118 ASN A OD1  3  
ATOM   1488  N  ND2  . ASN A 1 16 ? 4.535   -9.149  5.987   1.00 2.02  ? 1118 ASN A ND2  3  
ATOM   1489  H  H    . ASN A 1 16 ? 5.078   -5.978  4.533   1.00 0.75  ? 1118 ASN A H    3  
ATOM   1490  H  HA   . ASN A 1 16 ? 7.182   -7.099  6.158   1.00 0.85  ? 1118 ASN A HA   3  
ATOM   1491  H  HB2  . ASN A 1 16 ? 5.485   -8.053  3.939   1.00 1.24  ? 1118 ASN A HB2  3  
ATOM   1492  H  HB3  . ASN A 1 16 ? 7.083   -8.780  4.036   1.00 1.41  ? 1118 ASN A HB3  3  
ATOM   1493  H  HD21 . ASN A 1 16 ? 3.960   -8.526  5.479   1.00 1.91  ? 1118 ASN A HD21 3  
ATOM   1494  H  HD22 . ASN A 1 16 ? 4.199   -9.736  6.696   1.00 2.74  ? 1118 ASN A HD22 3  
ATOM   1495  N  N    . HIS A 1 17 ? 8.350   -5.251  4.194   1.00 0.46  ? 1119 HIS A N    3  
ATOM   1496  C  CA   . HIS A 1 17 ? 9.518   -4.711  3.494   1.00 0.41  ? 1119 HIS A CA   3  
ATOM   1497  C  C    . HIS A 1 17 ? 9.588   -5.166  2.041   1.00 0.44  ? 1119 HIS A C    3  
ATOM   1498  O  O    . HIS A 1 17 ? 10.523  -5.856  1.640   1.00 0.79  ? 1119 HIS A O    3  
ATOM   1499  C  CB   . HIS A 1 17 ? 10.818  -5.078  4.217   1.00 0.51  ? 1119 HIS A CB   3  
ATOM   1500  C  CG   . HIS A 1 17 ? 11.064  -4.277  5.457   1.00 0.63  ? 1119 HIS A CG   3  
ATOM   1501  N  ND1  . HIS A 1 17 ? 11.091  -4.824  6.718   1.00 0.94  ? 1119 HIS A ND1  3  
ATOM   1502  C  CD2  . HIS A 1 17 ? 11.315  -2.957  5.617   1.00 0.78  ? 1119 HIS A CD2  3  
ATOM   1503  C  CE1  . HIS A 1 17 ? 11.344  -3.876  7.600   1.00 1.05  ? 1119 HIS A CE1  3  
ATOM   1504  N  NE2  . HIS A 1 17 ? 11.486  -2.733  6.959   1.00 0.93  ? 1119 HIS A NE2  3  
ATOM   1505  H  H    . HIS A 1 17 ? 7.709   -4.622  4.591   1.00 0.47  ? 1119 HIS A H    3  
ATOM   1506  H  HA   . HIS A 1 17 ? 9.421   -3.633  3.501   1.00 0.38  ? 1119 HIS A HA   3  
ATOM   1507  H  HB2  . HIS A 1 17 ? 10.780  -6.120  4.499   1.00 0.60  ? 1119 HIS A HB2  3  
ATOM   1508  H  HB3  . HIS A 1 17 ? 11.651  -4.922  3.547   1.00 0.55  ? 1119 HIS A HB3  3  
ATOM   1509  H  HD1  . HIS A 1 17 ? 10.957  -5.774  6.937   1.00 1.18  ? 1119 HIS A HD1  3  
ATOM   1510  H  HD2  . HIS A 1 17 ? 11.369  -2.216  4.832   1.00 1.00  ? 1119 HIS A HD2  3  
ATOM   1511  H  HE1  . HIS A 1 17 ? 11.422  -4.013  8.669   1.00 1.35  ? 1119 HIS A HE1  3  
ATOM   1512  H  HE2  . HIS A 1 17 ? 11.513  -1.847  7.387   1.00 1.09  ? 1119 HIS A HE2  3  
ATOM   1513  N  N    . GLN A 1 18 ? 8.601   -4.768  1.255   1.00 0.40  ? 1120 GLN A N    3  
ATOM   1514  C  CA   . GLN A 1 18 ? 8.623   -5.030  -0.175  1.00 0.38  ? 1120 GLN A CA   3  
ATOM   1515  C  C    . GLN A 1 18 ? 8.591   -3.709  -0.927  1.00 0.29  ? 1120 GLN A C    3  
ATOM   1516  O  O    . GLN A 1 18 ? 7.883   -2.787  -0.525  1.00 0.39  ? 1120 GLN A O    3  
ATOM   1517  C  CB   . GLN A 1 18 ? 7.441   -5.900  -0.605  1.00 0.49  ? 1120 GLN A CB   3  
ATOM   1518  C  CG   . GLN A 1 18 ? 7.587   -6.424  -2.023  1.00 0.50  ? 1120 GLN A CG   3  
ATOM   1519  C  CD   . GLN A 1 18 ? 6.378   -7.192  -2.516  1.00 1.05  ? 1120 GLN A CD   3  
ATOM   1520  O  OE1  . GLN A 1 18 ? 5.645   -7.800  -1.737  1.00 1.91  ? 1120 GLN A OE1  3  
ATOM   1521  N  NE2  . GLN A 1 18 ? 6.170   -7.177  -3.826  1.00 1.51  ? 1120 GLN A NE2  3  
ATOM   1522  H  H    . GLN A 1 18 ? 7.850   -4.278  1.641   1.00 0.63  ? 1120 GLN A H    3  
ATOM   1523  H  HA   . GLN A 1 18 ? 9.545   -5.543  -0.407  1.00 0.42  ? 1120 GLN A HA   3  
ATOM   1524  H  HB2  . GLN A 1 18 ? 7.360   -6.742  0.067   1.00 0.62  ? 1120 GLN A HB2  3  
ATOM   1525  H  HB3  . GLN A 1 18 ? 6.534   -5.315  -0.551  1.00 0.52  ? 1120 GLN A HB3  3  
ATOM   1526  H  HG2  . GLN A 1 18 ? 7.751   -5.587  -2.684  1.00 0.87  ? 1120 GLN A HG2  3  
ATOM   1527  H  HG3  . GLN A 1 18 ? 8.444   -7.075  -2.054  1.00 0.86  ? 1120 GLN A HG3  3  
ATOM   1528  H  HE21 . GLN A 1 18 ? 6.803   -6.677  -4.388  1.00 1.83  ? 1120 GLN A HE21 3  
ATOM   1529  H  HE22 . GLN A 1 18 ? 5.401   -7.668  -4.184  1.00 1.99  ? 1120 GLN A HE22 3  
ATOM   1530  N  N    . CYS A 1 19 ? 9.353   -3.617  -2.002  1.00 0.21  ? 1121 CYS A N    3  
ATOM   1531  C  CA   . CYS A 1 19 ? 9.452   -2.379  -2.754  1.00 0.21  ? 1121 CYS A CA   3  
ATOM   1532  C  C    . CYS A 1 19 ? 8.695   -2.468  -4.071  1.00 0.20  ? 1121 CYS A C    3  
ATOM   1533  O  O    . CYS A 1 19 ? 9.078   -3.209  -4.978  1.00 0.34  ? 1121 CYS A O    3  
ATOM   1534  C  CB   . CYS A 1 19 ? 10.920  -2.040  -3.011  1.00 0.34  ? 1121 CYS A CB   3  
ATOM   1535  S  SG   . CYS A 1 19 ? 11.910  -1.880  -1.490  1.00 0.42  ? 1121 CYS A SG   3  
ATOM   1536  H  H    . CYS A 1 19 ? 9.860   -4.402  -2.304  1.00 0.29  ? 1121 CYS A H    3  
ATOM   1537  H  HA   . CYS A 1 19 ? 9.014   -1.595  -2.156  1.00 0.24  ? 1121 CYS A HA   3  
ATOM   1538  H  HB2  . CYS A 1 19 ? 11.364  -2.817  -3.614  1.00 0.39  ? 1121 CYS A HB2  3  
ATOM   1539  H  HB3  . CYS A 1 19 ? 10.979  -1.100  -3.542  1.00 0.41  ? 1121 CYS A HB3  3  
ATOM   1540  N  N    . ILE A 1 20 ? 7.606   -1.720  -4.157  1.00 0.15  ? 1122 ILE A N    3  
ATOM   1541  C  CA   . ILE A 1 20 ? 6.826   -1.614  -5.383  1.00 0.14  ? 1122 ILE A CA   3  
ATOM   1542  C  C    . ILE A 1 20 ? 6.718   -0.152  -5.783  1.00 0.14  ? 1122 ILE A C    3  
ATOM   1543  O  O    . ILE A 1 20 ? 7.242   0.707   -5.093  1.00 0.18  ? 1122 ILE A O    3  
ATOM   1544  C  CB   . ILE A 1 20 ? 5.405   -2.188  -5.216  1.00 0.14  ? 1122 ILE A CB   3  
ATOM   1545  C  CG1  . ILE A 1 20 ? 4.654   -1.428  -4.125  1.00 0.13  ? 1122 ILE A CG1  3  
ATOM   1546  C  CG2  . ILE A 1 20 ? 5.466   -3.675  -4.894  1.00 0.19  ? 1122 ILE A CG2  3  
ATOM   1547  C  CD1  . ILE A 1 20 ? 3.200   -1.816  -4.018  1.00 0.17  ? 1122 ILE A CD1  3  
ATOM   1548  H  H    . ILE A 1 20 ? 7.321   -1.209  -3.367  1.00 0.22  ? 1122 ILE A H    3  
ATOM   1549  H  HA   . ILE A 1 20 ? 7.332   -2.163  -6.161  1.00 0.17  ? 1122 ILE A HA   3  
ATOM   1550  H  HB   . ILE A 1 20 ? 4.882   -2.070  -6.152  1.00 0.16  ? 1122 ILE A HB   3  
ATOM   1551  H  HG12 . ILE A 1 20 ? 5.121   -1.620  -3.172  1.00 0.15  ? 1122 ILE A HG12 3  
ATOM   1552  H  HG13 . ILE A 1 20 ? 4.700   -0.369  -4.338  1.00 0.14  ? 1122 ILE A HG13 3  
ATOM   1553  H  HG21 . ILE A 1 20 ? 4.464   -4.057  -4.764  1.00 0.98  ? 1122 ILE A HG21 3  
ATOM   1554  H  HG22 . ILE A 1 20 ? 6.028   -3.824  -3.985  1.00 1.05  ? 1122 ILE A HG22 3  
ATOM   1555  H  HG23 . ILE A 1 20 ? 5.948   -4.199  -5.705  1.00 0.97  ? 1122 ILE A HG23 3  
ATOM   1556  H  HD11 . ILE A 1 20 ? 2.766   -1.352  -3.144  1.00 1.07  ? 1122 ILE A HD11 3  
ATOM   1557  H  HD12 . ILE A 1 20 ? 3.122   -2.889  -3.938  1.00 0.99  ? 1122 ILE A HD12 3  
ATOM   1558  H  HD13 . ILE A 1 20 ? 2.677   -1.484  -4.901  1.00 1.03  ? 1122 ILE A HD13 3  
ATOM   1559  N  N    . SER A 1 21 ? 6.050   0.139   -6.882  1.00 0.16  ? 1123 SER A N    3  
ATOM   1560  C  CA   . SER A 1 21 ? 5.819   1.524   -7.267  1.00 0.17  ? 1123 SER A CA   3  
ATOM   1561  C  C    . SER A 1 21 ? 4.737   2.139   -6.382  1.00 0.15  ? 1123 SER A C    3  
ATOM   1562  O  O    . SER A 1 21 ? 3.769   1.472   -6.017  1.00 0.17  ? 1123 SER A O    3  
ATOM   1563  C  CB   . SER A 1 21 ? 5.404   1.606   -8.738  1.00 0.24  ? 1123 SER A CB   3  
ATOM   1564  O  OG   . SER A 1 21 ? 4.981   2.916   -9.083  1.00 0.33  ? 1123 SER A OG   3  
ATOM   1565  H  H    . SER A 1 21 ? 5.705   -0.584  -7.446  1.00 0.20  ? 1123 SER A H    3  
ATOM   1566  H  HA   . SER A 1 21 ? 6.741   2.069   -7.127  1.00 0.19  ? 1123 SER A HA   3  
ATOM   1567  H  HB2  . SER A 1 21 ? 6.243   1.337   -9.362  1.00 0.27  ? 1123 SER A HB2  3  
ATOM   1568  H  HB3  . SER A 1 21 ? 4.588   0.919   -8.918  1.00 0.24  ? 1123 SER A HB3  3  
ATOM   1569  H  HG   . SER A 1 21 ? 4.068   2.888   -9.391  1.00 0.63  ? 1123 SER A HG   3  
ATOM   1570  N  N    . LYS A 1 22 ? 4.907   3.413   -6.040  1.00 0.17  ? 1124 LYS A N    3  
ATOM   1571  C  CA   . LYS A 1 22 ? 3.924   4.127   -5.229  1.00 0.19  ? 1124 LYS A CA   3  
ATOM   1572  C  C    . LYS A 1 22 ? 2.615   4.305   -5.985  1.00 0.22  ? 1124 LYS A C    3  
ATOM   1573  O  O    . LYS A 1 22 ? 1.570   4.563   -5.388  1.00 0.25  ? 1124 LYS A O    3  
ATOM   1574  C  CB   . LYS A 1 22 ? 4.468   5.488   -4.788  1.00 0.23  ? 1124 LYS A CB   3  
ATOM   1575  C  CG   . LYS A 1 22 ? 5.468   5.403   -3.647  1.00 0.25  ? 1124 LYS A CG   3  
ATOM   1576  C  CD   . LYS A 1 22 ? 6.016   6.772   -3.278  1.00 0.25  ? 1124 LYS A CD   3  
ATOM   1577  C  CE   . LYS A 1 22 ? 6.890   6.702   -2.037  1.00 0.30  ? 1124 LYS A CE   3  
ATOM   1578  N  NZ   . LYS A 1 22 ? 7.422   8.034   -1.651  1.00 1.24  ? 1124 LYS A NZ   3  
ATOM   1579  H  H    . LYS A 1 22 ? 5.718   3.887   -6.337  1.00 0.20  ? 1124 LYS A H    3  
ATOM   1580  H  HA   . LYS A 1 22 ? 3.733   3.530   -4.349  1.00 0.19  ? 1124 LYS A HA   3  
ATOM   1581  H  HB2  . LYS A 1 22 ? 4.954   5.958   -5.630  1.00 0.30  ? 1124 LYS A HB2  3  
ATOM   1582  H  HB3  . LYS A 1 22 ? 3.642   6.106   -4.469  1.00 0.30  ? 1124 LYS A HB3  3  
ATOM   1583  H  HG2  . LYS A 1 22 ? 4.979   4.980   -2.782  1.00 0.37  ? 1124 LYS A HG2  3  
ATOM   1584  H  HG3  . LYS A 1 22 ? 6.288   4.767   -3.947  1.00 0.37  ? 1124 LYS A HG3  3  
ATOM   1585  H  HD2  . LYS A 1 22 ? 6.605   7.148   -4.101  1.00 0.32  ? 1124 LYS A HD2  3  
ATOM   1586  H  HD3  . LYS A 1 22 ? 5.190   7.440   -3.090  1.00 0.33  ? 1124 LYS A HD3  3  
ATOM   1587  H  HE2  . LYS A 1 22 ? 6.303   6.310   -1.220  1.00 0.93  ? 1124 LYS A HE2  3  
ATOM   1588  H  HE3  . LYS A 1 22 ? 7.717   6.037   -2.235  1.00 0.95  ? 1124 LYS A HE3  3  
ATOM   1589  H  HZ1  . LYS A 1 22 ? 6.655   8.736   -1.627  1.00 1.76  ? 1124 LYS A HZ1  3  
ATOM   1590  H  HZ2  . LYS A 1 22 ? 8.143   8.347   -2.333  1.00 1.77  ? 1124 LYS A HZ2  3  
ATOM   1591  H  HZ3  . LYS A 1 22 ? 7.858   7.983   -0.706  1.00 1.88  ? 1124 LYS A HZ3  3  
ATOM   1592  N  N    . ASN A 1 23 ? 2.673   4.160   -7.304  1.00 0.24  ? 1125 ASN A N    3  
ATOM   1593  C  CA   . ASN A 1 23 ? 1.468   4.224   -8.123  1.00 0.28  ? 1125 ASN A CA   3  
ATOM   1594  C  C    . ASN A 1 23 ? 0.707   2.902   -8.042  1.00 0.26  ? 1125 ASN A C    3  
ATOM   1595  O  O    . ASN A 1 23 ? -0.463  2.814   -8.410  1.00 0.32  ? 1125 ASN A O    3  
ATOM   1596  C  CB   . ASN A 1 23 ? 1.828   4.528   -9.578  1.00 0.36  ? 1125 ASN A CB   3  
ATOM   1597  C  CG   . ASN A 1 23 ? 0.609   4.816   -10.438 1.00 1.03  ? 1125 ASN A CG   3  
ATOM   1598  O  OD1  . ASN A 1 23 ? -0.388  5.361   -9.961  1.00 1.75  ? 1125 ASN A OD1  3  
ATOM   1599  N  ND2  . ASN A 1 23 ? 0.679   4.451   -11.706 1.00 1.69  ? 1125 ASN A ND2  3  
ATOM   1600  H  H    . ASN A 1 23 ? 3.543   4.024   -7.734  1.00 0.25  ? 1125 ASN A H    3  
ATOM   1601  H  HA   . ASN A 1 23 ? 0.842   5.016   -7.738  1.00 0.31  ? 1125 ASN A HA   3  
ATOM   1602  H  HB2  . ASN A 1 23 ? 2.477   5.388   -9.608  1.00 0.82  ? 1125 ASN A HB2  3  
ATOM   1603  H  HB3  . ASN A 1 23 ? 2.348   3.678   -9.996  1.00 0.82  ? 1125 ASN A HB3  3  
ATOM   1604  H  HD21 . ASN A 1 23 ? 1.503   4.019   -12.022 1.00 1.99  ? 1125 ASN A HD21 3  
ATOM   1605  H  HD22 . ASN A 1 23 ? -0.096  4.620   -12.281 1.00 2.22  ? 1125 ASN A HD22 3  
ATOM   1606  N  N    . TRP A 1 24 ? 1.374   1.879   -7.532  1.00 0.22  ? 1126 TRP A N    3  
ATOM   1607  C  CA   . TRP A 1 24 ? 0.802   0.540   -7.484  1.00 0.22  ? 1126 TRP A CA   3  
ATOM   1608  C  C    . TRP A 1 24 ? 0.039   0.317   -6.188  1.00 0.20  ? 1126 TRP A C    3  
ATOM   1609  O  O    . TRP A 1 24 ? -0.563  -0.734  -5.978  1.00 0.26  ? 1126 TRP A O    3  
ATOM   1610  C  CB   . TRP A 1 24 ? 1.898   -0.513  -7.633  1.00 0.25  ? 1126 TRP A CB   3  
ATOM   1611  C  CG   . TRP A 1 24 ? 2.555   -0.516  -8.984  1.00 0.31  ? 1126 TRP A CG   3  
ATOM   1612  C  CD1  . TRP A 1 24 ? 2.310   0.340   -10.022 1.00 0.37  ? 1126 TRP A CD1  3  
ATOM   1613  C  CD2  . TRP A 1 24 ? 3.565   -1.421  -9.445  1.00 0.38  ? 1126 TRP A CD2  3  
ATOM   1614  N  NE1  . TRP A 1 24 ? 3.103   0.021   -11.095 1.00 0.45  ? 1126 TRP A NE1  3  
ATOM   1615  C  CE2  . TRP A 1 24 ? 3.884   -1.055  -10.766 1.00 0.45  ? 1126 TRP A CE2  3  
ATOM   1616  C  CE3  . TRP A 1 24 ? 4.234   -2.502  -8.867  1.00 0.44  ? 1126 TRP A CE3  3  
ATOM   1617  C  CZ2  . TRP A 1 24 ? 4.839   -1.738  -11.517 1.00 0.54  ? 1126 TRP A CZ2  3  
ATOM   1618  C  CZ3  . TRP A 1 24 ? 5.180   -3.177  -9.612  1.00 0.55  ? 1126 TRP A CZ3  3  
ATOM   1619  C  CH2  . TRP A 1 24 ? 5.477   -2.792  -10.925 1.00 0.58  ? 1126 TRP A CH2  3  
ATOM   1620  H  H    . TRP A 1 24 ? 2.273   2.027   -7.163  1.00 0.23  ? 1126 TRP A H    3  
ATOM   1621  H  HA   . TRP A 1 24 ? 0.114   0.447   -8.311  1.00 0.25  ? 1126 TRP A HA   3  
ATOM   1622  H  HB2  . TRP A 1 24 ? 2.663   -0.340  -6.890  1.00 0.27  ? 1126 TRP A HB2  3  
ATOM   1623  H  HB3  . TRP A 1 24 ? 1.464   -1.484  -7.469  1.00 0.28  ? 1126 TRP A HB3  3  
ATOM   1624  H  HD1  . TRP A 1 24 ? 1.593   1.147   -9.988  1.00 0.40  ? 1126 TRP A HD1  3  
ATOM   1625  H  HE1  . TRP A 1 24 ? 3.110   0.489   -11.958 1.00 0.53  ? 1126 TRP A HE1  3  
ATOM   1626  H  HE3  . TRP A 1 24 ? 4.020   -2.815  -7.857  1.00 0.45  ? 1126 TRP A HE3  3  
ATOM   1627  H  HZ2  . TRP A 1 24 ? 5.078   -1.454  -12.529 1.00 0.61  ? 1126 TRP A HZ2  3  
ATOM   1628  H  HZ3  . TRP A 1 24 ? 5.705   -4.016  -9.180  1.00 0.62  ? 1126 TRP A HZ3  3  
ATOM   1629  H  HH2  . TRP A 1 24 ? 6.224   -3.349  -11.471 1.00 0.67  ? 1126 TRP A HH2  3  
ATOM   1630  N  N    . VAL A 1 25 ? 0.077   1.309   -5.322  1.00 0.19  ? 1127 VAL A N    3  
ATOM   1631  C  CA   . VAL A 1 25 ? -0.638  1.256   -4.054  1.00 0.18  ? 1127 VAL A CA   3  
ATOM   1632  C  C    . VAL A 1 25 ? -2.143  1.384   -4.276  1.00 0.19  ? 1127 VAL A C    3  
ATOM   1633  O  O    . VAL A 1 25 ? -2.611  2.381   -4.829  1.00 0.23  ? 1127 VAL A O    3  
ATOM   1634  C  CB   . VAL A 1 25 ? -0.156  2.376   -3.105  1.00 0.21  ? 1127 VAL A CB   3  
ATOM   1635  C  CG1  . VAL A 1 25 ? -0.894  2.332   -1.775  1.00 0.24  ? 1127 VAL A CG1  3  
ATOM   1636  C  CG2  . VAL A 1 25 ? 1.343   2.277   -2.886  1.00 0.24  ? 1127 VAL A CG2  3  
ATOM   1637  H  H    . VAL A 1 25 ? 0.605   2.100   -5.539  1.00 0.21  ? 1127 VAL A H    3  
ATOM   1638  H  HA   . VAL A 1 25 ? -0.433  0.301   -3.594  1.00 0.19  ? 1127 VAL A HA   3  
ATOM   1639  H  HB   . VAL A 1 25 ? -0.366  3.327   -3.573  1.00 0.23  ? 1127 VAL A HB   3  
ATOM   1640  H  HG11 . VAL A 1 25 ? -1.954  2.450   -1.946  1.00 1.01  ? 1127 VAL A HG11 3  
ATOM   1641  H  HG12 . VAL A 1 25 ? -0.541  3.132   -1.141  1.00 1.02  ? 1127 VAL A HG12 3  
ATOM   1642  H  HG13 . VAL A 1 25 ? -0.711  1.383   -1.293  1.00 1.00  ? 1127 VAL A HG13 3  
ATOM   1643  H  HG21 . VAL A 1 25 ? 1.665   3.071   -2.228  1.00 1.05  ? 1127 VAL A HG21 3  
ATOM   1644  H  HG22 . VAL A 1 25 ? 1.852   2.367   -3.835  1.00 1.06  ? 1127 VAL A HG22 3  
ATOM   1645  H  HG23 . VAL A 1 25 ? 1.581   1.322   -2.440  1.00 1.01  ? 1127 VAL A HG23 3  
ATOM   1646  N  N    . CYS A 1 26 ? -2.885  0.361   -3.850  1.00 0.19  ? 1128 CYS A N    3  
ATOM   1647  C  CA   . CYS A 1 26 ? -4.339  0.328   -4.000  1.00 0.26  ? 1128 CYS A CA   3  
ATOM   1648  C  C    . CYS A 1 26 ? -4.718  0.408   -5.478  1.00 0.27  ? 1128 CYS A C    3  
ATOM   1649  O  O    . CYS A 1 26 ? -5.543  1.224   -5.887  1.00 0.37  ? 1128 CYS A O    3  
ATOM   1650  C  CB   . CYS A 1 26 ? -4.998  1.469   -3.209  1.00 0.32  ? 1128 CYS A CB   3  
ATOM   1651  S  SG   . CYS A 1 26 ? -6.827  1.446   -3.230  1.00 0.58  ? 1128 CYS A SG   3  
ATOM   1652  H  H    . CYS A 1 26 ? -2.436  -0.400  -3.422  1.00 0.19  ? 1128 CYS A H    3  
ATOM   1653  H  HA   . CYS A 1 26 ? -4.687  -0.616  -3.608  1.00 0.28  ? 1128 CYS A HA   3  
ATOM   1654  H  HB2  . CYS A 1 26 ? -4.682  1.411   -2.179  1.00 0.36  ? 1128 CYS A HB2  3  
ATOM   1655  H  HB3  . CYS A 1 26 ? -4.677  2.413   -3.622  1.00 0.36  ? 1128 CYS A HB3  3  
ATOM   1656  N  N    . ASP A 1 27 ? -4.099  -0.442  -6.279  1.00 0.25  ? 1129 ASP A N    3  
ATOM   1657  C  CA   . ASP A 1 27 ? -4.353  -0.451  -7.714  1.00 0.30  ? 1129 ASP A CA   3  
ATOM   1658  C  C    . ASP A 1 27 ? -5.032  -1.752  -8.126  1.00 0.37  ? 1129 ASP A C    3  
ATOM   1659  O  O    . ASP A 1 27 ? -5.127  -2.063  -9.310  1.00 0.41  ? 1129 ASP A O    3  
ATOM   1660  C  CB   . ASP A 1 27 ? -3.046  -0.273  -8.490  1.00 0.31  ? 1129 ASP A CB   3  
ATOM   1661  C  CG   . ASP A 1 27 ? -2.260  -1.561  -8.622  1.00 0.35  ? 1129 ASP A CG   3  
ATOM   1662  O  OD1  . ASP A 1 27 ? -2.124  -2.297  -7.617  1.00 0.31  ? 1129 ASP A OD1  3  
ATOM   1663  O  OD2  . ASP A 1 27 ? -1.772  -1.839  -9.736  1.00 0.46  ? 1129 ASP A OD2  3  
ATOM   1664  H  H    . ASP A 1 27 ? -3.453  -1.081  -5.897  1.00 0.24  ? 1129 ASP A H    3  
ATOM   1665  H  HA   . ASP A 1 27 ? -5.013  0.374   -7.939  1.00 0.33  ? 1129 ASP A HA   3  
ATOM   1666  H  HB2  . ASP A 1 27 ? -3.273  0.090   -9.481  1.00 0.36  ? 1129 ASP A HB2  3  
ATOM   1667  H  HB3  . ASP A 1 27 ? -2.430  0.453   -7.978  1.00 0.29  ? 1129 ASP A HB3  3  
ATOM   1668  N  N    . THR A 1 28 ? -5.477  -2.506  -7.122  1.00 0.45  ? 1130 THR A N    3  
ATOM   1669  C  CA   . THR A 1 28 ? -6.173  -3.787  -7.302  1.00 0.56  ? 1130 THR A CA   3  
ATOM   1670  C  C    . THR A 1 28 ? -5.311  -4.815  -8.038  1.00 0.61  ? 1130 THR A C    3  
ATOM   1671  O  O    . THR A 1 28 ? -5.826  -5.765  -8.632  1.00 0.73  ? 1130 THR A O    3  
ATOM   1672  C  CB   . THR A 1 28 ? -7.551  -3.642  -8.006  1.00 0.59  ? 1130 THR A CB   3  
ATOM   1673  O  OG1  . THR A 1 28 ? -7.419  -3.102  -9.329  1.00 0.56  ? 1130 THR A OG1  3  
ATOM   1674  C  CG2  . THR A 1 28 ? -8.479  -2.755  -7.189  1.00 0.65  ? 1130 THR A CG2  3  
ATOM   1675  H  H    . THR A 1 28 ? -5.323  -2.193  -6.203  1.00 0.46  ? 1130 THR A H    3  
ATOM   1676  H  HA   . THR A 1 28 ? -6.360  -4.175  -6.311  1.00 0.64  ? 1130 THR A HA   3  
ATOM   1677  H  HB   . THR A 1 28 ? -7.999  -4.621  -8.076  1.00 0.67  ? 1130 THR A HB   3  
ATOM   1678  H  HG1  . THR A 1 28 ? -6.480  -3.092  -9.580  1.00 0.53  ? 1130 THR A HG1  3  
ATOM   1679  H  HG21 . THR A 1 28 ? -9.430  -2.667  -7.694  1.00 1.34  ? 1130 THR A HG21 3  
ATOM   1680  H  HG22 . THR A 1 28 ? -8.038  -1.776  -7.080  1.00 1.09  ? 1130 THR A HG22 3  
ATOM   1681  H  HG23 . THR A 1 28 ? -8.630  -3.192  -6.214  1.00 1.21  ? 1130 THR A HG23 3  
ATOM   1682  N  N    . ASP A 1 29 ? -3.999  -4.634  -7.983  1.00 0.59  ? 1131 ASP A N    3  
ATOM   1683  C  CA   . ASP A 1 29 ? -3.074  -5.593  -8.566  1.00 0.69  ? 1131 ASP A CA   3  
ATOM   1684  C  C    . ASP A 1 29 ? -2.136  -6.130  -7.498  1.00 0.67  ? 1131 ASP A C    3  
ATOM   1685  O  O    . ASP A 1 29 ? -1.682  -5.378  -6.617  1.00 0.53  ? 1131 ASP A O    3  
ATOM   1686  C  CB   . ASP A 1 29 ? -2.265  -4.963  -9.700  1.00 0.75  ? 1131 ASP A CB   3  
ATOM   1687  C  CG   . ASP A 1 29 ? -1.379  -5.973  -10.402 1.00 0.92  ? 1131 ASP A CG   3  
ATOM   1688  O  OD1  . ASP A 1 29 ? -0.242  -6.200  -9.944  1.00 0.92  ? 1131 ASP A OD1  3  
ATOM   1689  O  OD2  . ASP A 1 29 ? -1.824  -6.556  -11.414 1.00 1.21  ? 1131 ASP A OD2  3  
ATOM   1690  H  H    . ASP A 1 29 ? -3.642  -3.831  -7.542  1.00 0.55  ? 1131 ASP A H    3  
ATOM   1691  H  HA   . ASP A 1 29 ? -3.656  -6.412  -8.962  1.00 0.81  ? 1131 ASP A HA   3  
ATOM   1692  H  HB2  . ASP A 1 29 ? -2.942  -4.539  -10.425 1.00 0.81  ? 1131 ASP A HB2  3  
ATOM   1693  H  HB3  . ASP A 1 29 ? -1.639  -4.182  -9.296  1.00 0.68  ? 1131 ASP A HB3  3  
ATOM   1694  N  N    . ASN A 1 30 ? -1.846  -7.426  -7.580  1.00 0.94  ? 1132 ASN A N    3  
ATOM   1695  C  CA   . ASN A 1 30 ? -1.009  -8.096  -6.593  1.00 1.00  ? 1132 ASN A CA   3  
ATOM   1696  C  C    . ASN A 1 30 ? 0.469   -7.895  -6.909  1.00 0.91  ? 1132 ASN A C    3  
ATOM   1697  O  O    . ASN A 1 30 ? 1.196   -8.840  -7.224  1.00 1.06  ? 1132 ASN A O    3  
ATOM   1698  C  CB   . ASN A 1 30 ? -1.335  -9.591  -6.533  1.00 1.29  ? 1132 ASN A CB   3  
ATOM   1699  C  CG   . ASN A 1 30 ? -0.720  -10.268 -5.322  1.00 1.72  ? 1132 ASN A CG   3  
ATOM   1700  O  OD1  . ASN A 1 30 ? 0.410   -10.756 -5.367  1.00 2.58  ? 1132 ASN A OD1  3  
ATOM   1701  N  ND2  . ASN A 1 30 ? -1.462  -10.308 -4.229  1.00 2.07  ? 1132 ASN A ND2  3  
ATOM   1702  H  H    . ASN A 1 30 ? -2.201  -7.944  -8.330  1.00 1.15  ? 1132 ASN A H    3  
ATOM   1703  H  HA   . ASN A 1 30 ? -1.220  -7.653  -5.631  1.00 0.97  ? 1132 ASN A HA   3  
ATOM   1704  H  HB2  . ASN A 1 30 ? -2.406  -9.721  -6.489  1.00 1.52  ? 1132 ASN A HB2  3  
ATOM   1705  H  HB3  . ASN A 1 30 ? -0.954  -10.071 -7.423  1.00 1.97  ? 1132 ASN A HB3  3  
ATOM   1706  H  HD21 . ASN A 1 30 ? -2.359  -9.906  -4.261  1.00 2.11  ? 1132 ASN A HD21 3  
ATOM   1707  H  HD22 . ASN A 1 30 ? -1.087  -10.734 -3.428  1.00 2.73  ? 1132 ASN A HD22 3  
ATOM   1708  N  N    . ASP A 1 31 ? 0.889   -6.648  -6.876  1.00 0.86  ? 1133 ASP A N    3  
ATOM   1709  C  CA   . ASP A 1 31 ? 2.297   -6.302  -6.955  1.00 0.77  ? 1133 ASP A CA   3  
ATOM   1710  C  C    . ASP A 1 31 ? 2.977   -6.703  -5.659  1.00 0.78  ? 1133 ASP A C    3  
ATOM   1711  O  O    . ASP A 1 31 ? 3.904   -7.516  -5.649  1.00 1.28  ? 1133 ASP A O    3  
ATOM   1712  C  CB   . ASP A 1 31 ? 2.462   -4.796  -7.200  1.00 0.67  ? 1133 ASP A CB   3  
ATOM   1713  C  CG   . ASP A 1 31 ? 1.304   -3.996  -6.649  1.00 0.58  ? 1133 ASP A CG   3  
ATOM   1714  O  OD1  . ASP A 1 31 ? 1.072   -4.030  -5.433  1.00 1.00  ? 1133 ASP A OD1  3  
ATOM   1715  O  OD2  . ASP A 1 31 ? 0.641   -3.276  -7.414  1.00 1.09  ? 1133 ASP A OD2  3  
ATOM   1716  H  H    . ASP A 1 31 ? 0.225   -5.929  -6.796  1.00 1.05  ? 1133 ASP A H    3  
ATOM   1717  H  HA   . ASP A 1 31 ? 2.738   -6.851  -7.774  1.00 0.87  ? 1133 ASP A HA   3  
ATOM   1718  H  HB2  . ASP A 1 31 ? 3.366   -4.451  -6.719  1.00 1.04  ? 1133 ASP A HB2  3  
ATOM   1719  H  HB3  . ASP A 1 31 ? 2.530   -4.615  -8.262  1.00 1.05  ? 1133 ASP A HB3  3  
ATOM   1720  N  N    . CYS A 1 32 ? 2.484   -6.147  -4.570  1.00 0.76  ? 1134 CYS A N    3  
ATOM   1721  C  CA   . CYS A 1 32 ? 2.974   -6.473  -3.248  1.00 0.78  ? 1134 CYS A CA   3  
ATOM   1722  C  C    . CYS A 1 32 ? 2.348   -7.776  -2.760  1.00 0.85  ? 1134 CYS A C    3  
ATOM   1723  O  O    . CYS A 1 32 ? 1.125   -7.889  -2.651  1.00 1.57  ? 1134 CYS A O    3  
ATOM   1724  C  CB   . CYS A 1 32 ? 2.649   -5.332  -2.284  1.00 0.82  ? 1134 CYS A CB   3  
ATOM   1725  S  SG   . CYS A 1 32 ? 3.328   -5.539  -0.609  1.00 1.16  ? 1134 CYS A SG   3  
ATOM   1726  H  H    . CYS A 1 32 ? 1.765   -5.476  -4.659  1.00 1.11  ? 1134 CYS A H    3  
ATOM   1727  H  HA   . CYS A 1 32 ? 4.045   -6.595  -3.307  1.00 0.88  ? 1134 CYS A HA   3  
ATOM   1728  H  HB2  . CYS A 1 32 ? 3.045   -4.412  -2.684  1.00 1.25  ? 1134 CYS A HB2  3  
ATOM   1729  H  HB3  . CYS A 1 32 ? 1.575   -5.244  -2.195  1.00 1.22  ? 1134 CYS A HB3  3  
ATOM   1730  N  N    . GLY A 1 33 ? 3.192   -8.760  -2.477  1.00 1.17  ? 1135 GLY A N    3  
ATOM   1731  C  CA   . GLY A 1 33 ? 2.714   -10.035 -1.982  1.00 1.22  ? 1135 GLY A CA   3  
ATOM   1732  C  C    . GLY A 1 33 ? 2.286   -9.939  -0.535  1.00 1.18  ? 1135 GLY A C    3  
ATOM   1733  O  O    . GLY A 1 33 ? 1.511   -10.759 -0.044  1.00 1.68  ? 1135 GLY A O    3  
ATOM   1734  H  H    . GLY A 1 33 ? 4.157   -8.612  -2.591  1.00 1.82  ? 1135 GLY A H    3  
ATOM   1735  H  HA2  . GLY A 1 33 ? 1.872   -10.352 -2.581  1.00 1.26  ? 1135 GLY A HA2  3  
ATOM   1736  H  HA3  . GLY A 1 33 ? 3.505   -10.765 -2.067  1.00 1.39  ? 1135 GLY A HA3  3  
ATOM   1737  N  N    . ASP A 1 34 ? 2.801   -8.924  0.142   1.00 1.02  ? 1136 ASP A N    3  
ATOM   1738  C  CA   . ASP A 1 34 ? 2.417   -8.638  1.516   1.00 1.11  ? 1136 ASP A CA   3  
ATOM   1739  C  C    . ASP A 1 34 ? 1.030   -7.997  1.549   1.00 0.93  ? 1136 ASP A C    3  
ATOM   1740  O  O    . ASP A 1 34 ? 0.298   -8.107  2.532   1.00 1.35  ? 1136 ASP A O    3  
ATOM   1741  C  CB   . ASP A 1 34 ? 3.465   -7.729  2.157   1.00 1.44  ? 1136 ASP A CB   3  
ATOM   1742  C  CG   . ASP A 1 34 ? 3.096   -7.250  3.546   1.00 2.10  ? 1136 ASP A CG   3  
ATOM   1743  O  OD1  . ASP A 1 34 ? 2.648   -8.084  4.352   1.00 2.47  ? 1136 ASP A OD1  3  
ATOM   1744  O  OD2  . ASP A 1 34 ? 3.231   -6.044  3.833   1.00 2.85  ? 1136 ASP A OD2  3  
ATOM   1745  H  H    . ASP A 1 34 ? 3.467   -8.352  -0.296  1.00 1.22  ? 1136 ASP A H    3  
ATOM   1746  H  HA   . ASP A 1 34 ? 2.385   -9.569  2.054   1.00 1.27  ? 1136 ASP A HA   3  
ATOM   1747  H  HB2  . ASP A 1 34 ? 4.398   -8.266  2.224   1.00 1.68  ? 1136 ASP A HB2  3  
ATOM   1748  H  HB3  . ASP A 1 34 ? 3.603   -6.866  1.526   1.00 1.84  ? 1136 ASP A HB3  3  
ATOM   1749  N  N    . GLY A 1 35 ? 0.683   -7.329  0.452   1.00 0.62  ? 1137 GLY A N    3  
ATOM   1750  C  CA   . GLY A 1 35 ? -0.662  -6.807  0.272   1.00 0.49  ? 1137 GLY A CA   3  
ATOM   1751  C  C    . GLY A 1 35 ? -0.965  -5.601  1.134   1.00 0.36  ? 1137 GLY A C    3  
ATOM   1752  O  O    . GLY A 1 35 ? -2.127  -5.208  1.271   1.00 0.36  ? 1137 GLY A O    3  
ATOM   1753  H  H    . GLY A 1 35 ? 1.349   -7.193  -0.251  1.00 0.82  ? 1137 GLY A H    3  
ATOM   1754  H  HA2  . GLY A 1 35 ? -0.786  -6.528  -0.763  1.00 0.51  ? 1137 GLY A HA2  3  
ATOM   1755  H  HA3  . GLY A 1 35 ? -1.372  -7.587  0.506   1.00 0.72  ? 1137 GLY A HA3  3  
ATOM   1756  N  N    . SER A 1 36 ? 0.064   -4.999  1.706   1.00 0.32  ? 1138 SER A N    3  
ATOM   1757  C  CA   . SER A 1 36 ? -0.131  -3.849  2.570   1.00 0.28  ? 1138 SER A CA   3  
ATOM   1758  C  C    . SER A 1 36 ? -0.344  -2.581  1.752   1.00 0.25  ? 1138 SER A C    3  
ATOM   1759  O  O    . SER A 1 36 ? -0.824  -1.574  2.271   1.00 0.40  ? 1138 SER A O    3  
ATOM   1760  C  CB   . SER A 1 36 ? 1.051   -3.699  3.525   1.00 0.33  ? 1138 SER A CB   3  
ATOM   1761  O  OG   . SER A 1 36 ? 2.276   -3.902  2.850   1.00 0.44  ? 1138 SER A OG   3  
ATOM   1762  H  H    . SER A 1 36 ? 0.972   -5.332  1.545   1.00 0.37  ? 1138 SER A H    3  
ATOM   1763  H  HA   . SER A 1 36 ? -1.024  -4.033  3.148   1.00 0.33  ? 1138 SER A HA   3  
ATOM   1764  H  HB2  . SER A 1 36 ? 1.046   -2.708  3.950   1.00 0.40  ? 1138 SER A HB2  3  
ATOM   1765  H  HB3  . SER A 1 36 ? 0.967   -4.429  4.317   1.00 0.39  ? 1138 SER A HB3  3  
ATOM   1766  H  HG   . SER A 1 36 ? 2.655   -4.755  3.133   1.00 1.17  ? 1138 SER A HG   3  
ATOM   1767  N  N    . ASP A 1 37 ? -0.014  -2.645  0.469   1.00 0.18  ? 1139 ASP A N    3  
ATOM   1768  C  CA   . ASP A 1 37 ? -0.243  -1.525  -0.433  1.00 0.18  ? 1139 ASP A CA   3  
ATOM   1769  C  C    . ASP A 1 37 ? -1.731  -1.411  -0.739  1.00 0.20  ? 1139 ASP A C    3  
ATOM   1770  O  O    . ASP A 1 37 ? -2.273  -0.316  -0.875  1.00 0.29  ? 1139 ASP A O    3  
ATOM   1771  C  CB   . ASP A 1 37 ? 0.537   -1.711  -1.735  1.00 0.19  ? 1139 ASP A CB   3  
ATOM   1772  C  CG   . ASP A 1 37 ? -0.097  -2.741  -2.650  1.00 0.26  ? 1139 ASP A CG   3  
ATOM   1773  O  OD1  . ASP A 1 37 ? -0.132  -3.933  -2.277  1.00 0.33  ? 1139 ASP A OD1  3  
ATOM   1774  O  OD2  . ASP A 1 37 ? -0.590  -2.355  -3.730  1.00 0.32  ? 1139 ASP A OD2  3  
ATOM   1775  H  H    . ASP A 1 37 ? 0.392   -3.466  0.118   1.00 0.26  ? 1139 ASP A H    3  
ATOM   1776  H  HA   . ASP A 1 37 ? 0.087   -0.622  0.057   1.00 0.20  ? 1139 ASP A HA   3  
ATOM   1777  H  HB2  . ASP A 1 37 ? 0.581   -0.770  -2.259  1.00 0.22  ? 1139 ASP A HB2  3  
ATOM   1778  H  HB3  . ASP A 1 37 ? 1.540   -2.035  -1.502  1.00 0.19  ? 1139 ASP A HB3  3  
ATOM   1779  N  N    . GLU A 1 38 ? -2.391  -2.557  -0.829  1.00 0.22  ? 1140 GLU A N    3  
ATOM   1780  C  CA   . GLU A 1 38 ? -3.813  -2.596  -1.116  1.00 0.27  ? 1140 GLU A CA   3  
ATOM   1781  C  C    . GLU A 1 38 ? -4.610  -2.302  0.149   1.00 0.31  ? 1140 GLU A C    3  
ATOM   1782  O  O    . GLU A 1 38 ? -5.703  -1.740  0.089   1.00 0.44  ? 1140 GLU A O    3  
ATOM   1783  C  CB   . GLU A 1 38 ? -4.206  -3.962  -1.686  1.00 0.29  ? 1140 GLU A CB   3  
ATOM   1784  C  CG   . GLU A 1 38 ? -3.570  -4.284  -3.034  1.00 0.29  ? 1140 GLU A CG   3  
ATOM   1785  C  CD   . GLU A 1 38 ? -3.975  -3.316  -4.133  1.00 0.28  ? 1140 GLU A CD   3  
ATOM   1786  O  OE1  . GLU A 1 38 ? -5.172  -2.976  -4.226  1.00 0.38  ? 1140 GLU A OE1  3  
ATOM   1787  O  OE2  . GLU A 1 38 ? -3.095  -2.897  -4.919  1.00 0.28  ? 1140 GLU A OE2  3  
ATOM   1788  H  H    . GLU A 1 38 ? -1.901  -3.400  -0.710  1.00 0.24  ? 1140 GLU A H    3  
ATOM   1789  H  HA   . GLU A 1 38 ? -4.025  -1.831  -1.848  1.00 0.30  ? 1140 GLU A HA   3  
ATOM   1790  H  HB2  . GLU A 1 38 ? -3.911  -4.728  -0.986  1.00 0.32  ? 1140 GLU A HB2  3  
ATOM   1791  H  HB3  . GLU A 1 38 ? -5.279  -3.994  -1.803  1.00 0.33  ? 1140 GLU A HB3  3  
ATOM   1792  H  HG2  . GLU A 1 38 ? -2.497  -4.249  -2.928  1.00 0.29  ? 1140 GLU A HG2  3  
ATOM   1793  H  HG3  . GLU A 1 38 ? -3.869  -5.280  -3.327  1.00 0.33  ? 1140 GLU A HG3  3  
ATOM   1794  N  N    . LYS A 1 39 ? -4.050  -2.673  1.298   1.00 0.30  ? 1141 LYS A N    3  
ATOM   1795  C  CA   . LYS A 1 39 ? -4.715  -2.434  2.573   1.00 0.37  ? 1141 LYS A CA   3  
ATOM   1796  C  C    . LYS A 1 39 ? -4.595  -0.963  2.959   1.00 0.49  ? 1141 LYS A C    3  
ATOM   1797  O  O    . LYS A 1 39 ? -5.470  -0.408  3.626   1.00 0.57  ? 1141 LYS A O    3  
ATOM   1798  C  CB   . LYS A 1 39 ? -4.128  -3.326  3.678   1.00 0.47  ? 1141 LYS A CB   3  
ATOM   1799  C  CG   . LYS A 1 39 ? -2.937  -2.723  4.410   1.00 0.57  ? 1141 LYS A CG   3  
ATOM   1800  C  CD   . LYS A 1 39 ? -2.404  -3.660  5.476   1.00 0.76  ? 1141 LYS A CD   3  
ATOM   1801  C  CE   . LYS A 1 39 ? -1.316  -2.999  6.301   1.00 0.91  ? 1141 LYS A CE   3  
ATOM   1802  N  NZ   . LYS A 1 39 ? -1.833  -1.851  7.092   1.00 1.55  ? 1141 LYS A NZ   3  
ATOM   1803  H  H    . LYS A 1 39 ? -3.179  -3.122  1.285   1.00 0.32  ? 1141 LYS A H    3  
ATOM   1804  H  HA   . LYS A 1 39 ? -5.760  -2.674  2.446   1.00 0.39  ? 1141 LYS A HA   3  
ATOM   1805  H  HB2  . LYS A 1 39 ? -4.897  -3.525  4.402   1.00 0.56  ? 1141 LYS A HB2  3  
ATOM   1806  H  HB3  . LYS A 1 39 ? -3.815  -4.260  3.236   1.00 0.47  ? 1141 LYS A HB3  3  
ATOM   1807  H  HG2  . LYS A 1 39 ? -2.150  -2.521  3.701   1.00 0.50  ? 1141 LYS A HG2  3  
ATOM   1808  H  HG3  . LYS A 1 39 ? -3.245  -1.800  4.877   1.00 0.65  ? 1141 LYS A HG3  3  
ATOM   1809  H  HD2  . LYS A 1 39 ? -3.214  -3.945  6.129   1.00 0.88  ? 1141 LYS A HD2  3  
ATOM   1810  H  HD3  . LYS A 1 39 ? -1.997  -4.538  4.998   1.00 0.73  ? 1141 LYS A HD3  3  
ATOM   1811  H  HE2  . LYS A 1 39 ? -0.903  -3.730  6.974   1.00 1.15  ? 1141 LYS A HE2  3  
ATOM   1812  H  HE3  . LYS A 1 39 ? -0.541  -2.647  5.635   1.00 1.18  ? 1141 LYS A HE3  3  
ATOM   1813  H  HZ1  . LYS A 1 39 ? -2.223  -1.125  6.459   1.00 2.08  ? 1141 LYS A HZ1  3  
ATOM   1814  H  HZ2  . LYS A 1 39 ? -1.068  -1.428  7.653   1.00 1.99  ? 1141 LYS A HZ2  3  
ATOM   1815  H  HZ3  . LYS A 1 39 ? -2.582  -2.171  7.737   1.00 1.97  ? 1141 LYS A HZ3  3  
ATOM   1816  N  N    . ASN A 1 40 ? -3.512  -0.333  2.514   1.00 0.60  ? 1142 ASN A N    3  
ATOM   1817  C  CA   . ASN A 1 40 ? -3.270  1.083   2.779   1.00 0.81  ? 1142 ASN A CA   3  
ATOM   1818  C  C    . ASN A 1 40 ? -4.113  1.940   1.838   1.00 0.91  ? 1142 ASN A C    3  
ATOM   1819  O  O    . ASN A 1 40 ? -3.603  2.774   1.091   1.00 1.44  ? 1142 ASN A O    3  
ATOM   1820  C  CB   . ASN A 1 40 ? -1.777  1.404   2.618   1.00 1.07  ? 1142 ASN A CB   3  
ATOM   1821  C  CG   . ASN A 1 40 ? -1.414  2.828   3.015   1.00 1.37  ? 1142 ASN A CG   3  
ATOM   1822  O  OD1  . ASN A 1 40 ? -0.501  3.428   2.443   1.00 2.05  ? 1142 ASN A OD1  3  
ATOM   1823  N  ND2  . ASN A 1 40 ? -2.107  3.374   4.003   1.00 1.92  ? 1142 ASN A ND2  3  
ATOM   1824  H  H    . ASN A 1 40 ? -2.852  -0.838  1.994   1.00 0.58  ? 1142 ASN A H    3  
ATOM   1825  H  HA   . ASN A 1 40 ? -3.569  1.285   3.797   1.00 0.86  ? 1142 ASN A HA   3  
ATOM   1826  H  HB2  . ASN A 1 40 ? -1.203  0.727   3.234   1.00 1.54  ? 1142 ASN A HB2  3  
ATOM   1827  H  HB3  . ASN A 1 40 ? -1.499  1.260   1.584   1.00 1.56  ? 1142 ASN A HB3  3  
ATOM   1828  H  HD21 . ASN A 1 40 ? -2.810  2.842   4.432   1.00 2.20  ? 1142 ASN A HD21 3  
ATOM   1829  H  HD22 . ASN A 1 40 ? -1.896  4.297   4.263   1.00 2.44  ? 1142 ASN A HD22 3  
ATOM   1830  N  N    . CYS A 1 41 ? -5.412  1.704   1.865   1.00 0.76  ? 1143 CYS A N    3  
ATOM   1831  C  CA   . CYS A 1 41 ? -6.341  2.433   1.022   1.00 0.99  ? 1143 CYS A CA   3  
ATOM   1832  C  C    . CYS A 1 41 ? -7.614  2.737   1.804   1.00 1.29  ? 1143 CYS A C    3  
ATOM   1833  O  O    . CYS A 1 41 ? -8.612  3.199   1.250   1.00 1.67  ? 1143 CYS A O    3  
ATOM   1834  C  CB   . CYS A 1 41 ? -6.659  1.601   -0.219  1.00 0.93  ? 1143 CYS A CB   3  
ATOM   1835  S  SG   . CYS A 1 41 ? -7.360  2.543   -1.608  1.00 1.10  ? 1143 CYS A SG   3  
ATOM   1836  H  H    . CYS A 1 41 ? -5.754  1.001   2.460   1.00 0.89  ? 1143 CYS A H    3  
ATOM   1837  H  HA   . CYS A 1 41 ? -5.875  3.360   0.724   1.00 1.23  ? 1143 CYS A HA   3  
ATOM   1838  H  HB2  . CYS A 1 41 ? -5.753  1.131   -0.567  1.00 0.98  ? 1143 CYS A HB2  3  
ATOM   1839  H  HB3  . CYS A 1 41 ? -7.372  0.834   0.049   1.00 1.29  ? 1143 CYS A HB3  3  
ATOM   1840  N  N    . ASN A 1 42 ? -7.559  2.488   3.106   1.00 1.87  ? 1144 ASN A N    3  
ATOM   1841  C  CA   . ASN A 1 42 ? -8.699  2.701   3.987   1.00 2.36  ? 1144 ASN A CA   3  
ATOM   1842  C  C    . ASN A 1 42 ? -8.643  4.102   4.582   1.00 3.05  ? 1144 ASN A C    3  
ATOM   1843  O  O    . ASN A 1 42 ? -9.451  4.461   5.439   1.00 3.73  ? 1144 ASN A O    3  
ATOM   1844  C  CB   . ASN A 1 42 ? -8.720  1.650   5.107   1.00 3.11  ? 1144 ASN A CB   3  
ATOM   1845  C  CG   . ASN A 1 42 ? -7.485  1.706   5.994   1.00 3.87  ? 1144 ASN A CG   3  
ATOM   1846  O  OD1  . ASN A 1 42 ? -6.397  2.074   5.548   1.00 4.27  ? 1144 ASN A OD1  3  
ATOM   1847  N  ND2  . ASN A 1 42 ? -7.641  1.328   7.250   1.00 4.59  ? 1144 ASN A ND2  3  
ATOM   1848  H  H    . ASN A 1 42 ? -6.719  2.166   3.495   1.00 2.27  ? 1144 ASN A H    3  
ATOM   1849  H  HA   . ASN A 1 42 ? -9.599  2.608   3.396   1.00 2.42  ? 1144 ASN A HA   3  
ATOM   1850  H  HB2  . ASN A 1 42 ? -9.589  1.812   5.727   1.00 3.41  ? 1144 ASN A HB2  3  
ATOM   1851  H  HB3  . ASN A 1 42 ? -8.777  0.666   4.665   1.00 3.38  ? 1144 ASN A HB3  3  
ATOM   1852  H  HD21 . ASN A 1 42 ? -8.530  1.033   7.541   1.00 4.61  ? 1144 ASN A HD21 3  
ATOM   1853  H  HD22 . ASN A 1 42 ? -6.860  1.366   7.845   1.00 5.30  ? 1144 ASN A HD22 3  
ATOM   1854  N  N    . SER A 1 43 ? -7.680  4.882   4.117   1.00 3.53  ? 1145 SER A N    3  
ATOM   1855  C  CA   . SER A 1 43 ? -7.511  6.248   4.568   1.00 4.69  ? 1145 SER A CA   3  
ATOM   1856  C  C    . SER A 1 43 ? -8.546  7.158   3.916   1.00 5.23  ? 1145 SER A C    3  
ATOM   1857  O  O    . SER A 1 43 ? -8.999  6.901   2.794   1.00 5.32  ? 1145 SER A O    3  
ATOM   1858  C  CB   . SER A 1 43 ? -6.092  6.717   4.243   1.00 5.40  ? 1145 SER A CB   3  
ATOM   1859  O  OG   . SER A 1 43 ? -5.726  6.331   2.928   1.00 5.26  ? 1145 SER A OG   3  
ATOM   1860  H  H    . SER A 1 43 ? -7.066  4.530   3.440   1.00 3.45  ? 1145 SER A H    3  
ATOM   1861  H  HA   . SER A 1 43 ? -7.652  6.265   5.636   1.00 5.07  ? 1145 SER A HA   3  
ATOM   1862  H  HB2  . SER A 1 43 ? -6.044  7.793   4.316   1.00 6.23  ? 1145 SER A HB2  3  
ATOM   1863  H  HB3  . SER A 1 43 ? -5.397  6.277   4.943   1.00 5.56  ? 1145 SER A HB3  3  
ATOM   1864  H  HG   . SER A 1 43 ? -4.897  6.761   2.686   1.00 5.21  ? 1145 SER A HG   3  
ATOM   1865  N  N    . THR A 1 44 ? -8.918  8.219   4.613   1.00 5.97  ? 1146 THR A N    3  
ATOM   1866  C  CA   . THR A 1 44 ? -9.938  9.131   4.126   1.00 6.81  ? 1146 THR A CA   3  
ATOM   1867  C  C    . THR A 1 44 ? -9.339  10.241  3.264   1.00 7.34  ? 1146 THR A C    3  
ATOM   1868  O  O    . THR A 1 44 ? -9.811  11.379  3.274   1.00 8.15  ? 1146 THR A O    3  
ATOM   1869  C  CB   . THR A 1 44 ? -10.732 9.745   5.295   1.00 7.69  ? 1146 THR A CB   3  
ATOM   1870  O  OG1  . THR A 1 44 ? -9.827  10.225  6.298   1.00 7.92  ? 1146 THR A OG1  3  
ATOM   1871  C  CG2  . THR A 1 44 ? -11.677 8.719   5.903   1.00 7.74  ? 1146 THR A CG2  3  
ATOM   1872  H  H    . THR A 1 44 ? -8.499  8.395   5.484   1.00 6.16  ? 1146 THR A H    3  
ATOM   1873  H  HA   . THR A 1 44 ? -10.623 8.559   3.521   1.00 6.75  ? 1146 THR A HA   3  
ATOM   1874  H  HB   . THR A 1 44 ? -11.316 10.573  4.920   1.00 8.40  ? 1146 THR A HB   3  
ATOM   1875  H  HG1  . THR A 1 44 ? -10.029 9.800   7.141   1.00 8.03  ? 1146 THR A HG1  3  
ATOM   1876  H  HG21 . THR A 1 44 ? -11.109 7.870   6.257   1.00 7.71  ? 1146 THR A HG21 3  
ATOM   1877  H  HG22 . THR A 1 44 ? -12.384 8.391   5.155   1.00 7.80  ? 1146 THR A HG22 3  
ATOM   1878  H  HG23 . THR A 1 44 ? -12.209 9.164   6.729   1.00 8.03  ? 1146 THR A HG23 3  
ATOM   1879  N  N    . GLU A 1 45 ? -8.294  9.900   2.516   1.00 7.13  ? 1147 GLU A N    3  
ATOM   1880  C  CA   . GLU A 1 45 ? -7.677  10.826  1.586   1.00 7.94  ? 1147 GLU A CA   3  
ATOM   1881  C  C    . GLU A 1 45 ? -8.412  10.798  0.247   1.00 8.95  ? 1147 GLU A C    3  
ATOM   1882  O  O    . GLU A 1 45 ? -8.007  11.468  -0.703  1.00 9.87  ? 1147 GLU A O    3  
ATOM   1883  C  CB   . GLU A 1 45 ? -6.207  10.468  1.386   1.00 7.79  ? 1147 GLU A CB   3  
ATOM   1884  C  CG   . GLU A 1 45 ? -5.335  11.685  1.157   1.00 7.90  ? 1147 GLU A CG   3  
ATOM   1885  C  CD   . GLU A 1 45 ? -3.889  11.336  0.874   1.00 8.00  ? 1147 GLU A CD   3  
ATOM   1886  O  OE1  . GLU A 1 45 ? -3.111  11.170  1.837   1.00 8.23  ? 1147 GLU A OE1  3  
ATOM   1887  O  OE2  . GLU A 1 45 ? -3.521  11.225  -0.313  1.00 8.08  ? 1147 GLU A OE2  3  
ATOM   1888  H  H    . GLU A 1 45 ? -7.915  9.005   2.607   1.00 6.60  ? 1147 GLU A H    3  
ATOM   1889  H  HA   . GLU A 1 45 ? -7.748  11.818  2.005   1.00 8.20  ? 1147 GLU A HA   3  
ATOM   1890  H  HB2  . GLU A 1 45 ? -5.849  9.950   2.263   1.00 8.33  ? 1147 GLU A HB2  3  
ATOM   1891  H  HB3  . GLU A 1 45 ? -6.116  9.819   0.529   1.00 7.37  ? 1147 GLU A HB3  3  
ATOM   1892  H  HG2  . GLU A 1 45 ? -5.727  12.242  0.319   1.00 7.80  ? 1147 GLU A HG2  3  
ATOM   1893  H  HG3  . GLU A 1 45 ? -5.379  12.291  2.045   1.00 8.35  ? 1147 GLU A HG3  3  
ATOM   1894  N  N    . THR A 1 46 ? -9.471  9.992   0.184   1.00 8.94  ? 1148 THR A N    3  
ATOM   1895  C  CA   . THR A 1 46 ? -10.297 9.855   -1.013  1.00 10.03 ? 1148 THR A CA   3  
ATOM   1896  C  C    . THR A 1 46 ? -10.648 11.224  -1.599  1.00 10.71 ? 1148 THR A C    3  
ATOM   1897  O  O    . THR A 1 46 ? -11.450 11.964  -1.020  1.00 11.12 ? 1148 THR A O    3  
ATOM   1898  C  CB   . THR A 1 46 ? -11.594 9.100   -0.676  1.00 10.21 ? 1148 THR A CB   3  
ATOM   1899  O  OG1  . THR A 1 46 ? -11.295 7.993   0.184   1.00 9.58  ? 1148 THR A OG1  3  
ATOM   1900  C  CG2  . THR A 1 46 ? -12.275 8.590   -1.935  1.00 11.01 ? 1148 THR A CG2  3  
ATOM   1901  H  H    . THR A 1 46 ? -9.707  9.465   0.975   1.00 8.30  ? 1148 THR A H    3  
ATOM   1902  H  HA   . THR A 1 46 ? -9.745  9.283   -1.744  1.00 10.45 ? 1148 THR A HA   3  
ATOM   1903  H  HB   . THR A 1 46 ? -12.268 9.775   -0.165  1.00 10.48 ? 1148 THR A HB   3  
ATOM   1904  H  HG1  . THR A 1 46 ? -10.925 7.269   -0.340  1.00 9.43  ? 1148 THR A HG1  3  
ATOM   1905  H  HG21 . THR A 1 46 ? -11.621 7.897   -2.441  1.00 11.19 ? 1148 THR A HG21 3  
ATOM   1906  H  HG22 . THR A 1 46 ? -12.493 9.423   -2.587  1.00 11.07 ? 1148 THR A HG22 3  
ATOM   1907  H  HG23 . THR A 1 46 ? -13.195 8.090   -1.669  1.00 11.53 ? 1148 THR A HG23 3  
HETATM 1908  CA CA   . CA  B 2 .  ? -1.033  -3.027  -5.795  1.00 0.28  ? 1201 CA  A CA   3  
ATOM   1909  N  N    . THR A 1 1  ? 24.518  2.552   12.365  1.00 12.23 ? 1103 THR A N    4  
ATOM   1910  C  CA   . THR A 1 1  ? 23.276  3.338   12.256  1.00 11.73 ? 1103 THR A CA   4  
ATOM   1911  C  C    . THR A 1 1  ? 22.210  2.526   11.532  1.00 10.83 ? 1103 THR A C    4  
ATOM   1912  O  O    . THR A 1 1  ? 22.297  2.311   10.322  1.00 10.67 ? 1103 THR A O    4  
ATOM   1913  C  CB   . THR A 1 1  ? 23.524  4.653   11.492  1.00 11.83 ? 1103 THR A CB   4  
ATOM   1914  O  OG1  . THR A 1 1  ? 24.723  5.283   11.972  1.00 12.26 ? 1103 THR A OG1  4  
ATOM   1915  C  CG2  . THR A 1 1  ? 22.347  5.607   11.657  1.00 12.04 ? 1103 THR A CG2  4  
ATOM   1916  H  H1   . THR A 1 1  ? 24.343  1.684   12.911  1.00 12.23 ? 1103 THR A H1   4  
ATOM   1917  H  H2   . THR A 1 1  ? 25.253  3.109   12.842  1.00 12.55 ? 1103 THR A H2   4  
ATOM   1918  H  H3   . THR A 1 1  ? 24.854  2.289   11.418  1.00 12.44 ? 1103 THR A H3   4  
ATOM   1919  H  HA   . THR A 1 1  ? 22.927  3.576   13.251  1.00 12.16 ? 1103 THR A HA   4  
ATOM   1920  H  HB   . THR A 1 1  ? 23.641  4.427   10.443  1.00 11.67 ? 1103 THR A HB   4  
ATOM   1921  H  HG1  . THR A 1 1  ? 24.640  5.460   12.921  1.00 12.30 ? 1103 THR A HG1  4  
ATOM   1922  H  HG21 . THR A 1 1  ? 22.203  5.822   12.705  1.00 12.31 ? 1103 THR A HG21 4  
ATOM   1923  H  HG22 . THR A 1 1  ? 21.455  5.149   11.257  1.00 12.05 ? 1103 THR A HG22 4  
ATOM   1924  H  HG23 . THR A 1 1  ? 22.550  6.525   11.127  1.00 12.10 ? 1103 THR A HG23 4  
ATOM   1925  N  N    . HIS A 1 2  ? 21.213  2.062   12.275  1.00 10.41 ? 1104 HIS A N    4  
ATOM   1926  C  CA   . HIS A 1 2  ? 20.171  1.222   11.705  1.00 9.72  ? 1104 HIS A CA   4  
ATOM   1927  C  C    . HIS A 1 2  ? 19.223  2.040   10.846  1.00 8.65  ? 1104 HIS A C    4  
ATOM   1928  O  O    . HIS A 1 2  ? 18.293  2.669   11.348  1.00 8.32  ? 1104 HIS A O    4  
ATOM   1929  C  CB   . HIS A 1 2  ? 19.392  0.491   12.800  1.00 10.05 ? 1104 HIS A CB   4  
ATOM   1930  C  CG   . HIS A 1 2  ? 20.179  -0.596  13.464  1.00 10.43 ? 1104 HIS A CG   4  
ATOM   1931  N  ND1  . HIS A 1 2  ? 20.157  -0.824  14.822  1.00 10.71 ? 1104 HIS A ND1  4  
ATOM   1932  C  CD2  . HIS A 1 2  ? 21.006  -1.532  12.942  1.00 10.84 ? 1104 HIS A CD2  4  
ATOM   1933  C  CE1  . HIS A 1 2  ? 20.938  -1.850  15.105  1.00 11.25 ? 1104 HIS A CE1  4  
ATOM   1934  N  NE2  . HIS A 1 2  ? 21.462  -2.297  13.983  1.00 11.34 ? 1104 HIS A NE2  4  
ATOM   1935  H  H    . HIS A 1 2  ? 21.174  2.299   13.227  1.00 10.71 ? 1104 HIS A H    4  
ATOM   1936  H  HA   . HIS A 1 2  ? 20.653  0.488   11.077  1.00 9.96  ? 1104 HIS A HA   4  
ATOM   1937  H  HB2  . HIS A 1 2  ? 19.100  1.200   13.559  1.00 10.50 ? 1104 HIS A HB2  4  
ATOM   1938  H  HB3  . HIS A 1 2  ? 18.507  0.048   12.368  1.00 9.81  ? 1104 HIS A HB3  4  
ATOM   1939  H  HD1  . HIS A 1 2  ? 19.645  -0.309  15.485  1.00 10.68 ? 1104 HIS A HD1  4  
ATOM   1940  H  HD2  . HIS A 1 2  ? 21.260  -1.652  11.898  1.00 10.94 ? 1104 HIS A HD2  4  
ATOM   1941  H  HE1  . HIS A 1 2  ? 21.117  -2.254  16.089  1.00 11.71 ? 1104 HIS A HE1  4  
ATOM   1942  H  HE2  . HIS A 1 2  ? 22.174  -2.974  13.921  1.00 11.83 ? 1104 HIS A HE2  4  
ATOM   1943  N  N    . ALA A 1 3  ? 19.482  2.036   9.552   1.00 8.30  ? 1105 ALA A N    4  
ATOM   1944  C  CA   . ALA A 1 3  ? 18.642  2.729   8.597   1.00 7.41  ? 1105 ALA A CA   4  
ATOM   1945  C  C    . ALA A 1 3  ? 17.489  1.827   8.179   1.00 6.47  ? 1105 ALA A C    4  
ATOM   1946  O  O    . ALA A 1 3  ? 17.710  0.680   7.783   1.00 6.54  ? 1105 ALA A O    4  
ATOM   1947  C  CB   . ALA A 1 3  ? 19.462  3.148   7.386   1.00 7.70  ? 1105 ALA A CB   4  
ATOM   1948  H  H    . ALA A 1 3  ? 20.263  1.537   9.225   1.00 8.79  ? 1105 ALA A H    4  
ATOM   1949  H  HA   . ALA A 1 3  ? 18.250  3.617   9.071   1.00 7.45  ? 1105 ALA A HA   4  
ATOM   1950  H  HB1  . ALA A 1 3  ? 18.833  3.689   6.695   1.00 7.93  ? 1105 ALA A HB1  4  
ATOM   1951  H  HB2  . ALA A 1 3  ? 19.859  2.269   6.901   1.00 7.73  ? 1105 ALA A HB2  4  
ATOM   1952  H  HB3  . ALA A 1 3  ? 20.276  3.782   7.704   1.00 7.95  ? 1105 ALA A HB3  4  
ATOM   1953  N  N    . PRO A 1 4  ? 16.247  2.329   8.289   1.00 5.80  ? 1106 PRO A N    4  
ATOM   1954  C  CA   . PRO A 1 4  ? 15.044  1.573   7.922   1.00 4.97  ? 1106 PRO A CA   4  
ATOM   1955  C  C    . PRO A 1 4  ? 15.130  0.991   6.517   1.00 4.25  ? 1106 PRO A C    4  
ATOM   1956  O  O    . PRO A 1 4  ? 15.743  1.582   5.624   1.00 4.22  ? 1106 PRO A O    4  
ATOM   1957  C  CB   . PRO A 1 4  ? 13.932  2.622   7.989   1.00 4.84  ? 1106 PRO A CB   4  
ATOM   1958  C  CG   . PRO A 1 4  ? 14.424  3.633   8.962   1.00 5.55  ? 1106 PRO A CG   4  
ATOM   1959  C  CD   . PRO A 1 4  ? 15.917  3.674   8.797   1.00 6.09  ? 1106 PRO A CD   4  
ATOM   1960  H  HA   . PRO A 1 4  ? 14.841  0.783   8.627   1.00 5.32  ? 1106 PRO A HA   4  
ATOM   1961  H  HB2  . PRO A 1 4  ? 13.783  3.056   7.011   1.00 4.32  ? 1106 PRO A HB2  4  
ATOM   1962  H  HB3  . PRO A 1 4  ? 13.017  2.161   8.327   1.00 5.12  ? 1106 PRO A HB3  4  
ATOM   1963  H  HG2  . PRO A 1 4  ? 13.995  4.599   8.738   1.00 5.52  ? 1106 PRO A HG2  4  
ATOM   1964  H  HG3  . PRO A 1 4  ? 14.165  3.331   9.966   1.00 6.00  ? 1106 PRO A HG3  4  
ATOM   1965  H  HD2  . PRO A 1 4  ? 16.196  4.433   8.084   1.00 6.19  ? 1106 PRO A HD2  4  
ATOM   1966  H  HD3  . PRO A 1 4  ? 16.396  3.853   9.748   1.00 6.80  ? 1106 PRO A HD3  4  
ATOM   1967  N  N    . ALA A 1 5  ? 14.511  -0.165  6.323   1.00 4.09  ? 1107 ALA A N    4  
ATOM   1968  C  CA   . ALA A 1 5  ? 14.520  -0.840  5.033   1.00 3.77  ? 1107 ALA A CA   4  
ATOM   1969  C  C    . ALA A 1 5  ? 13.538  -0.180  4.069   1.00 2.63  ? 1107 ALA A C    4  
ATOM   1970  O  O    . ALA A 1 5  ? 12.625  -0.822  3.552   1.00 2.62  ? 1107 ALA A O    4  
ATOM   1971  C  CB   . ALA A 1 5  ? 14.192  -2.315  5.209   1.00 4.73  ? 1107 ALA A CB   4  
ATOM   1972  H  H    . ALA A 1 5  ? 14.030  -0.576  7.071   1.00 4.51  ? 1107 ALA A H    4  
ATOM   1973  H  HA   . ALA A 1 5  ? 15.516  -0.762  4.624   1.00 4.04  ? 1107 ALA A HA   4  
ATOM   1974  H  HB1  . ALA A 1 5  ? 14.900  -2.761  5.891   1.00 5.01  ? 1107 ALA A HB1  4  
ATOM   1975  H  HB2  . ALA A 1 5  ? 14.251  -2.813  4.253   1.00 4.95  ? 1107 ALA A HB2  4  
ATOM   1976  H  HB3  . ALA A 1 5  ? 13.194  -2.418  5.608   1.00 5.29  ? 1107 ALA A HB3  4  
ATOM   1977  N  N    . SER A 1 6  ? 13.741  1.108   3.841   1.00 2.16  ? 1108 SER A N    4  
ATOM   1978  C  CA   . SER A 1 6  ? 12.905  1.881   2.950   1.00 1.43  ? 1108 SER A CA   4  
ATOM   1979  C  C    . SER A 1 6  ? 13.256  1.587   1.496   1.00 1.29  ? 1108 SER A C    4  
ATOM   1980  O  O    . SER A 1 6  ? 14.332  1.058   1.194   1.00 1.97  ? 1108 SER A O    4  
ATOM   1981  C  CB   . SER A 1 6  ? 13.078  3.369   3.256   1.00 2.09  ? 1108 SER A CB   4  
ATOM   1982  O  OG   . SER A 1 6  ? 14.452  3.709   3.356   1.00 2.97  ? 1108 SER A OG   4  
ATOM   1983  H  H    . SER A 1 6  ? 14.491  1.558   4.291   1.00 2.71  ? 1108 SER A H    4  
ATOM   1984  H  HA   . SER A 1 6  ? 11.877  1.601   3.125   1.00 1.32  ? 1108 SER A HA   4  
ATOM   1985  H  HB2  . SER A 1 6  ? 12.632  3.953   2.463   1.00 2.36  ? 1108 SER A HB2  4  
ATOM   1986  H  HB3  . SER A 1 6  ? 12.594  3.602   4.192   1.00 2.13  ? 1108 SER A HB3  4  
ATOM   1987  H  HG   . SER A 1 6  ? 14.533  4.629   3.631   1.00 3.32  ? 1108 SER A HG   4  
ATOM   1988  N  N    . CYS A 1 7  ? 12.336  1.905   0.607   1.00 0.72  ? 1109 CYS A N    4  
ATOM   1989  C  CA   . CYS A 1 7  ? 12.535  1.690   -0.814  1.00 0.49  ? 1109 CYS A CA   4  
ATOM   1990  C  C    . CYS A 1 7  ? 12.792  3.009   -1.529  1.00 0.46  ? 1109 CYS A C    4  
ATOM   1991  O  O    . CYS A 1 7  ? 12.983  4.044   -0.882  1.00 0.62  ? 1109 CYS A O    4  
ATOM   1992  C  CB   . CYS A 1 7  ? 11.318  0.979   -1.399  1.00 0.33  ? 1109 CYS A CB   4  
ATOM   1993  S  SG   . CYS A 1 7  ? 10.980  -0.635  -0.623  1.00 0.47  ? 1109 CYS A SG   4  
ATOM   1994  H  H    . CYS A 1 7  ? 11.488  2.287   0.917   1.00 0.94  ? 1109 CYS A H    4  
ATOM   1995  H  HA   . CYS A 1 7  ? 13.399  1.060   -0.943  1.00 0.60  ? 1109 CYS A HA   4  
ATOM   1996  H  HB2  . CYS A 1 7  ? 10.444  1.600   -1.265  1.00 0.41  ? 1109 CYS A HB2  4  
ATOM   1997  H  HB3  . CYS A 1 7  ? 11.478  0.811   -2.455  1.00 0.29  ? 1109 CYS A HB3  4  
ATOM   1998  N  N    . LEU A 1 8  ? 12.808  2.956   -2.854  1.00 0.34  ? 1110 LEU A N    4  
ATOM   1999  C  CA   . LEU A 1 8  ? 13.074  4.116   -3.704  1.00 0.32  ? 1110 LEU A CA   4  
ATOM   2000  C  C    . LEU A 1 8  ? 12.179  5.303   -3.347  1.00 0.29  ? 1110 LEU A C    4  
ATOM   2001  O  O    . LEU A 1 8  ? 11.127  5.134   -2.727  1.00 0.30  ? 1110 LEU A O    4  
ATOM   2002  C  CB   . LEU A 1 8  ? 12.813  3.716   -5.151  1.00 0.28  ? 1110 LEU A CB   4  
ATOM   2003  C  CG   . LEU A 1 8  ? 13.683  4.374   -6.217  1.00 0.38  ? 1110 LEU A CG   4  
ATOM   2004  C  CD1  . LEU A 1 8  ? 15.148  4.005   -6.028  1.00 0.52  ? 1110 LEU A CD1  4  
ATOM   2005  C  CD2  . LEU A 1 8  ? 13.198  3.951   -7.594  1.00 0.39  ? 1110 LEU A CD2  4  
ATOM   2006  H  H    . LEU A 1 8  ? 12.643  2.091   -3.289  1.00 0.34  ? 1110 LEU A H    4  
ATOM   2007  H  HA   . LEU A 1 8  ? 14.109  4.394   -3.591  1.00 0.40  ? 1110 LEU A HA   4  
ATOM   2008  H  HB2  . LEU A 1 8  ? 12.929  2.646   -5.226  1.00 0.32  ? 1110 LEU A HB2  4  
ATOM   2009  H  HB3  . LEU A 1 8  ? 11.782  3.952   -5.375  1.00 0.22  ? 1110 LEU A HB3  4  
ATOM   2010  H  HG   . LEU A 1 8  ? 13.592  5.447   -6.141  1.00 0.41  ? 1110 LEU A HG   4  
ATOM   2011  H  HD11 . LEU A 1 8  ? 15.257  2.932   -6.068  1.00 1.05  ? 1110 LEU A HD11 4  
ATOM   2012  H  HD12 . LEU A 1 8  ? 15.490  4.367   -5.071  1.00 1.29  ? 1110 LEU A HD12 4  
ATOM   2013  H  HD13 . LEU A 1 8  ? 15.735  4.455   -6.813  1.00 1.07  ? 1110 LEU A HD13 4  
ATOM   2014  H  HD21 . LEU A 1 8  ? 13.263  2.876   -7.682  1.00 1.11  ? 1110 LEU A HD21 4  
ATOM   2015  H  HD22 . LEU A 1 8  ? 13.811  4.414   -8.352  1.00 1.05  ? 1110 LEU A HD22 4  
ATOM   2016  H  HD23 . LEU A 1 8  ? 12.169  4.258   -7.723  1.00 0.97  ? 1110 LEU A HD23 4  
ATOM   2017  N  N    . ASP A 1 9  ? 12.586  6.496   -3.760  1.00 0.35  ? 1111 ASP A N    4  
ATOM   2018  C  CA   . ASP A 1 9  ? 11.781  7.697   -3.551  1.00 0.38  ? 1111 ASP A CA   4  
ATOM   2019  C  C    . ASP A 1 9  ? 10.424  7.559   -4.239  1.00 0.32  ? 1111 ASP A C    4  
ATOM   2020  O  O    . ASP A 1 9  ? 9.397   7.986   -3.713  1.00 0.42  ? 1111 ASP A O    4  
ATOM   2021  C  CB   . ASP A 1 9  ? 12.517  8.928   -4.083  1.00 0.51  ? 1111 ASP A CB   4  
ATOM   2022  C  CG   . ASP A 1 9  ? 11.697  10.200  -3.978  1.00 1.37  ? 1111 ASP A CG   4  
ATOM   2023  O  OD1  . ASP A 1 9  ? 11.598  10.762  -2.866  1.00 1.53  ? 1111 ASP A OD1  4  
ATOM   2024  O  OD2  . ASP A 1 9  ? 11.126  10.633  -5.002  1.00 2.32  ? 1111 ASP A OD2  4  
ATOM   2025  H  H    . ASP A 1 9  ? 13.457  6.576   -4.212  1.00 0.40  ? 1111 ASP A H    4  
ATOM   2026  H  HA   . ASP A 1 9  ? 11.622  7.813   -2.488  1.00 0.44  ? 1111 ASP A HA   4  
ATOM   2027  H  HB2  . ASP A 1 9  ? 13.427  9.065   -3.518  1.00 0.94  ? 1111 ASP A HB2  4  
ATOM   2028  H  HB3  . ASP A 1 9  ? 12.768  8.767   -5.122  1.00 1.01  ? 1111 ASP A HB3  4  
ATOM   2029  N  N    . THR A 1 10 ? 10.428  6.939   -5.409  1.00 0.28  ? 1112 THR A N    4  
ATOM   2030  C  CA   . THR A 1 10 ? 9.202   6.711   -6.158  1.00 0.31  ? 1112 THR A CA   4  
ATOM   2031  C  C    . THR A 1 10 ? 8.597   5.344   -5.836  1.00 0.24  ? 1112 THR A C    4  
ATOM   2032  O  O    . THR A 1 10 ? 7.544   4.977   -6.363  1.00 0.30  ? 1112 THR A O    4  
ATOM   2033  C  CB   . THR A 1 10 ? 9.462   6.820   -7.670  1.00 0.42  ? 1112 THR A CB   4  
ATOM   2034  O  OG1  . THR A 1 10 ? 10.664  6.113   -8.009  1.00 0.45  ? 1112 THR A OG1  4  
ATOM   2035  C  CG2  . THR A 1 10 ? 9.586   8.275   -8.092  1.00 0.52  ? 1112 THR A CG2  4  
ATOM   2036  H  H    . THR A 1 10 ? 11.279  6.634   -5.788  1.00 0.31  ? 1112 THR A H    4  
ATOM   2037  H  HA   . THR A 1 10 ? 8.496   7.480   -5.880  1.00 0.36  ? 1112 THR A HA   4  
ATOM   2038  H  HB   . THR A 1 10 ? 8.629   6.377   -8.198  1.00 0.48  ? 1112 THR A HB   4  
ATOM   2039  H  HG1  . THR A 1 10 ? 10.446  5.364   -8.575  1.00 0.95  ? 1112 THR A HG1  4  
ATOM   2040  H  HG21 . THR A 1 10 ? 10.380  8.745   -7.531  1.00 1.19  ? 1112 THR A HG21 4  
ATOM   2041  H  HG22 . THR A 1 10 ? 8.656   8.787   -7.896  1.00 1.09  ? 1112 THR A HG22 4  
ATOM   2042  H  HG23 . THR A 1 10 ? 9.811   8.327   -9.147  1.00 1.17  ? 1112 THR A HG23 4  
ATOM   2043  N  N    . GLN A 1 11 ? 9.264   4.591   -4.969  1.00 0.18  ? 1113 GLN A N    4  
ATOM   2044  C  CA   . GLN A 1 11 ? 8.777   3.285   -4.573  1.00 0.17  ? 1113 GLN A CA   4  
ATOM   2045  C  C    . GLN A 1 11 ? 8.080   3.324   -3.227  1.00 0.17  ? 1113 GLN A C    4  
ATOM   2046  O  O    . GLN A 1 11 ? 8.284   4.232   -2.419  1.00 0.23  ? 1113 GLN A O    4  
ATOM   2047  C  CB   . GLN A 1 11 ? 9.919   2.279   -4.510  1.00 0.17  ? 1113 GLN A CB   4  
ATOM   2048  C  CG   . GLN A 1 11 ? 10.344  1.760   -5.866  1.00 0.23  ? 1113 GLN A CG   4  
ATOM   2049  C  CD   . GLN A 1 11 ? 11.340  0.626   -5.764  1.00 0.35  ? 1113 GLN A CD   4  
ATOM   2050  O  OE1  . GLN A 1 11 ? 12.131  0.561   -4.821  1.00 1.02  ? 1113 GLN A OE1  4  
ATOM   2051  N  NE2  . GLN A 1 11 ? 11.306  -0.281  -6.723  1.00 0.67  ? 1113 GLN A NE2  4  
ATOM   2052  H  H    . GLN A 1 11 ? 10.103  4.922   -4.585  1.00 0.20  ? 1113 GLN A H    4  
ATOM   2053  H  HA   . GLN A 1 11 ? 8.071   2.958   -5.319  1.00 0.22  ? 1113 GLN A HA   4  
ATOM   2054  H  HB2  . GLN A 1 11 ? 10.772  2.751   -4.046  1.00 0.16  ? 1113 GLN A HB2  4  
ATOM   2055  H  HB3  . GLN A 1 11 ? 9.612   1.442   -3.905  1.00 0.20  ? 1113 GLN A HB3  4  
ATOM   2056  H  HG2  . GLN A 1 11 ? 9.474   1.413   -6.385  1.00 0.31  ? 1113 GLN A HG2  4  
ATOM   2057  H  HG3  . GLN A 1 11 ? 10.795  2.567   -6.423  1.00 0.22  ? 1113 GLN A HG3  4  
ATOM   2058  H  HE21 . GLN A 1 11 ? 10.641  -0.175  -7.437  1.00 1.21  ? 1113 GLN A HE21 4  
ATOM   2059  H  HE22 . GLN A 1 11 ? 11.948  -1.019  -6.687  1.00 0.65  ? 1113 GLN A HE22 4  
ATOM   2060  N  N    . TYR A 1 12 ? 7.262   2.317   -3.005  1.00 0.15  ? 1114 TYR A N    4  
ATOM   2061  C  CA   . TYR A 1 12 ? 6.578   2.137   -1.740  1.00 0.16  ? 1114 TYR A CA   4  
ATOM   2062  C  C    . TYR A 1 12 ? 7.228   0.997   -0.987  1.00 0.15  ? 1114 TYR A C    4  
ATOM   2063  O  O    . TYR A 1 12 ? 7.717   0.042   -1.590  1.00 0.15  ? 1114 TYR A O    4  
ATOM   2064  C  CB   . TYR A 1 12 ? 5.098   1.822   -1.960  1.00 0.18  ? 1114 TYR A CB   4  
ATOM   2065  C  CG   . TYR A 1 12 ? 4.296   1.593   -0.691  1.00 0.22  ? 1114 TYR A CG   4  
ATOM   2066  C  CD1  . TYR A 1 12 ? 4.026   2.635   0.189   1.00 0.33  ? 1114 TYR A CD1  4  
ATOM   2067  C  CD2  . TYR A 1 12 ? 3.793   0.330   -0.382  1.00 0.21  ? 1114 TYR A CD2  4  
ATOM   2068  C  CE1  . TYR A 1 12 ? 3.284   2.426   1.338   1.00 0.39  ? 1114 TYR A CE1  4  
ATOM   2069  C  CE2  . TYR A 1 12 ? 3.050   0.113   0.767   1.00 0.26  ? 1114 TYR A CE2  4  
ATOM   2070  C  CZ   . TYR A 1 12 ? 2.799   1.166   1.621   1.00 0.34  ? 1114 TYR A CZ   4  
ATOM   2071  O  OH   . TYR A 1 12 ? 2.058   0.960   2.766   1.00 0.41  ? 1114 TYR A OH   4  
ATOM   2072  H  H    . TYR A 1 12 ? 7.131   1.651   -3.723  1.00 0.16  ? 1114 TYR A H    4  
ATOM   2073  H  HA   . TYR A 1 12 ? 6.675   3.047   -1.167  1.00 0.18  ? 1114 TYR A HA   4  
ATOM   2074  H  HB2  . TYR A 1 12 ? 4.638   2.634   -2.501  1.00 0.23  ? 1114 TYR A HB2  4  
ATOM   2075  H  HB3  . TYR A 1 12 ? 5.033   0.926   -2.546  1.00 0.18  ? 1114 TYR A HB3  4  
ATOM   2076  H  HD1  . TYR A 1 12 ? 4.407   3.622   -0.032  1.00 0.40  ? 1114 TYR A HD1  4  
ATOM   2077  H  HD2  . TYR A 1 12 ? 3.994   -0.492  -1.055  1.00 0.23  ? 1114 TYR A HD2  4  
ATOM   2078  H  HE1  . TYR A 1 12 ? 3.087   3.249   2.006   1.00 0.50  ? 1114 TYR A HE1  4  
ATOM   2079  H  HE2  . TYR A 1 12 ? 2.668   -0.878  0.991   1.00 0.29  ? 1114 TYR A HE2  4  
ATOM   2080  H  HH   . TYR A 1 12 ? 1.377   1.642   2.827   1.00 0.89  ? 1114 TYR A HH   4  
ATOM   2081  N  N    . THR A 1 13 ? 7.225   1.106   0.317   1.00 0.18  ? 1115 THR A N    4  
ATOM   2082  C  CA   . THR A 1 13 ? 7.755   0.068   1.168   1.00 0.20  ? 1115 THR A CA   4  
ATOM   2083  C  C    . THR A 1 13 ? 6.600   -0.671  1.817   1.00 0.23  ? 1115 THR A C    4  
ATOM   2084  O  O    . THR A 1 13 ? 6.027   -0.204  2.802   1.00 0.31  ? 1115 THR A O    4  
ATOM   2085  C  CB   . THR A 1 13 ? 8.677   0.643   2.254   1.00 0.26  ? 1115 THR A CB   4  
ATOM   2086  O  OG1  . THR A 1 13 ? 9.548   1.626   1.671   1.00 0.30  ? 1115 THR A OG1  4  
ATOM   2087  C  CG2  . THR A 1 13 ? 9.506   -0.460  2.896   1.00 0.27  ? 1115 THR A CG2  4  
ATOM   2088  H  H    . THR A 1 13 ? 6.823   1.900   0.722   1.00 0.22  ? 1115 THR A H    4  
ATOM   2089  H  HA   . THR A 1 13 ? 8.323   -0.620  0.555   1.00 0.19  ? 1115 THR A HA   4  
ATOM   2090  H  HB   . THR A 1 13 ? 8.069   1.111   3.014   1.00 0.31  ? 1115 THR A HB   4  
ATOM   2091  H  HG1  . THR A 1 13 ? 9.048   2.144   1.028   1.00 0.82  ? 1115 THR A HG1  4  
ATOM   2092  H  HG21 . THR A 1 13 ? 10.081  -0.050  3.712   1.00 1.01  ? 1115 THR A HG21 4  
ATOM   2093  H  HG22 . THR A 1 13 ? 10.174  -0.879  2.161   1.00 1.02  ? 1115 THR A HG22 4  
ATOM   2094  H  HG23 . THR A 1 13 ? 8.852   -1.237  3.269   1.00 1.10  ? 1115 THR A HG23 4  
ATOM   2095  N  N    . CYS A 1 14 ? 6.242   -1.804  1.238   1.00 0.26  ? 1116 CYS A N    4  
ATOM   2096  C  CA   . CYS A 1 14 ? 5.110   -2.582  1.710   1.00 0.34  ? 1116 CYS A CA   4  
ATOM   2097  C  C    . CYS A 1 14 ? 5.306   -3.008  3.158   1.00 0.40  ? 1116 CYS A C    4  
ATOM   2098  O  O    . CYS A 1 14 ? 6.429   -3.006  3.670   1.00 0.37  ? 1116 CYS A O    4  
ATOM   2099  C  CB   . CYS A 1 14 ? 4.920   -3.817  0.833   1.00 0.45  ? 1116 CYS A CB   4  
ATOM   2100  S  SG   . CYS A 1 14 ? 4.888   -3.462  -0.952  1.00 0.65  ? 1116 CYS A SG   4  
ATOM   2101  H  H    . CYS A 1 14 ? 6.752   -2.124  0.457   1.00 0.28  ? 1116 CYS A H    4  
ATOM   2102  H  HA   . CYS A 1 14 ? 4.228   -1.964  1.643   1.00 0.38  ? 1116 CYS A HA   4  
ATOM   2103  H  HB2  . CYS A 1 14 ? 5.730   -4.506  1.015   1.00 0.50  ? 1116 CYS A HB2  4  
ATOM   2104  H  HB3  . CYS A 1 14 ? 3.986   -4.292  1.092   1.00 0.54  ? 1116 CYS A HB3  4  
ATOM   2105  N  N    . ASP A 1 15 ? 4.216   -3.385  3.809   1.00 0.56  ? 1117 ASP A N    4  
ATOM   2106  C  CA   . ASP A 1 15 ? 4.259   -3.854  5.191   1.00 0.69  ? 1117 ASP A CA   4  
ATOM   2107  C  C    . ASP A 1 15 ? 5.201   -5.048  5.325   1.00 0.65  ? 1117 ASP A C    4  
ATOM   2108  O  O    . ASP A 1 15 ? 5.821   -5.260  6.364   1.00 0.71  ? 1117 ASP A O    4  
ATOM   2109  C  CB   . ASP A 1 15 ? 2.846   -4.232  5.642   1.00 0.93  ? 1117 ASP A CB   4  
ATOM   2110  C  CG   . ASP A 1 15 ? 2.789   -4.797  7.043   1.00 1.83  ? 1117 ASP A CG   4  
ATOM   2111  O  OD1  . ASP A 1 15 ? 3.350   -4.167  7.966   1.00 2.62  ? 1117 ASP A OD1  4  
ATOM   2112  O  OD2  . ASP A 1 15 ? 2.155   -5.857  7.230   1.00 2.09  ? 1117 ASP A OD2  4  
ATOM   2113  H  H    . ASP A 1 15 ? 3.349   -3.344  3.348   1.00 0.63  ? 1117 ASP A H    4  
ATOM   2114  H  HA   . ASP A 1 15 ? 4.624   -3.046  5.809   1.00 0.70  ? 1117 ASP A HA   4  
ATOM   2115  H  HB2  . ASP A 1 15 ? 2.222   -3.353  5.609   1.00 1.35  ? 1117 ASP A HB2  4  
ATOM   2116  H  HB3  . ASP A 1 15 ? 2.450   -4.970  4.961   1.00 0.70  ? 1117 ASP A HB3  4  
ATOM   2117  N  N    . ASN A 1 16 ? 5.337   -5.791  4.236   1.00 0.69  ? 1118 ASN A N    4  
ATOM   2118  C  CA   . ASN A 1 16 ? 6.181   -6.981  4.204   1.00 0.75  ? 1118 ASN A CA   4  
ATOM   2119  C  C    . ASN A 1 16 ? 7.611   -6.628  3.789   1.00 0.59  ? 1118 ASN A C    4  
ATOM   2120  O  O    . ASN A 1 16 ? 8.377   -7.499  3.377   1.00 0.65  ? 1118 ASN A O    4  
ATOM   2121  C  CB   . ASN A 1 16 ? 5.601   -8.000  3.218   1.00 0.98  ? 1118 ASN A CB   4  
ATOM   2122  C  CG   . ASN A 1 16 ? 4.107   -8.141  3.338   1.00 1.77  ? 1118 ASN A CG   4  
ATOM   2123  O  OD1  . ASN A 1 16 ? 3.350   -7.390  2.714   1.00 2.75  ? 1118 ASN A OD1  4  
ATOM   2124  N  ND2  . ASN A 1 16 ? 3.670   -9.103  4.117   1.00 2.02  ? 1118 ASN A ND2  4  
ATOM   2125  H  H    . ASN A 1 16 ? 4.843   -5.540  3.430   1.00 0.75  ? 1118 ASN A H    4  
ATOM   2126  H  HA   . ASN A 1 16 ? 6.195   -7.411  5.193   1.00 0.85  ? 1118 ASN A HA   4  
ATOM   2127  H  HB2  . ASN A 1 16 ? 5.816   -7.691  2.217   1.00 1.24  ? 1118 ASN A HB2  4  
ATOM   2128  H  HB3  . ASN A 1 16 ? 6.051   -8.965  3.400   1.00 1.41  ? 1118 ASN A HB3  4  
ATOM   2129  H  HD21 . ASN A 1 16 ? 4.328   -9.672  4.574   1.00 1.91  ? 1118 ASN A HD21 4  
ATOM   2130  H  HD22 . ASN A 1 16 ? 2.712   -9.211  4.204   1.00 2.74  ? 1118 ASN A HD22 4  
ATOM   2131  N  N    . HIS A 1 17 ? 7.954   -5.342  3.897   1.00 0.46  ? 1119 HIS A N    4  
ATOM   2132  C  CA   . HIS A 1 17 ? 9.262   -4.827  3.468   1.00 0.41  ? 1119 HIS A CA   4  
ATOM   2133  C  C    . HIS A 1 17 ? 9.521   -5.163  2.001   1.00 0.44  ? 1119 HIS A C    4  
ATOM   2134  O  O    . HIS A 1 17 ? 10.558  -5.722  1.649   1.00 0.79  ? 1119 HIS A O    4  
ATOM   2135  C  CB   . HIS A 1 17 ? 10.401  -5.376  4.342   1.00 0.51  ? 1119 HIS A CB   4  
ATOM   2136  C  CG   . HIS A 1 17 ? 10.445  -4.808  5.728   1.00 0.63  ? 1119 HIS A CG   4  
ATOM   2137  N  ND1  . HIS A 1 17 ? 10.302  -5.578  6.862   1.00 0.94  ? 1119 HIS A ND1  4  
ATOM   2138  C  CD2  . HIS A 1 17 ? 10.647  -3.541  6.162   1.00 0.78  ? 1119 HIS A CD2  4  
ATOM   2139  C  CE1  . HIS A 1 17 ? 10.412  -4.812  7.931   1.00 1.05  ? 1119 HIS A CE1  4  
ATOM   2140  N  NE2  . HIS A 1 17 ? 10.622  -3.572  7.534   1.00 0.93  ? 1119 HIS A NE2  4  
ATOM   2141  H  H    . HIS A 1 17 ? 7.305   -4.712  4.280   1.00 0.47  ? 1119 HIS A H    4  
ATOM   2142  H  HA   . HIS A 1 17 ? 9.237   -3.748  3.569   1.00 0.38  ? 1119 HIS A HA   4  
ATOM   2143  H  HB2  . HIS A 1 17 ? 10.289  -6.447  4.430   1.00 0.60  ? 1119 HIS A HB2  4  
ATOM   2144  H  HB3  . HIS A 1 17 ? 11.345  -5.159  3.862   1.00 0.55  ? 1119 HIS A HB3  4  
ATOM   2145  H  HD1  . HIS A 1 17 ? 10.151  -6.551  6.881   1.00 1.18  ? 1119 HIS A HD1  4  
ATOM   2146  H  HD2  . HIS A 1 17 ? 10.797  -2.668  5.543   1.00 1.00  ? 1119 HIS A HD2  4  
ATOM   2147  H  HE1  . HIS A 1 17 ? 10.345  -5.144  8.956   1.00 1.35  ? 1119 HIS A HE1  4  
ATOM   2148  H  HE2  . HIS A 1 17 ? 10.847  -2.820  8.129   1.00 1.09  ? 1119 HIS A HE2  4  
ATOM   2149  N  N    . GLN A 1 18 ? 8.563   -4.827  1.151   1.00 0.40  ? 1120 GLN A N    4  
ATOM   2150  C  CA   . GLN A 1 18 ? 8.678   -5.087  -0.278  1.00 0.38  ? 1120 GLN A CA   4  
ATOM   2151  C  C    . GLN A 1 18 ? 8.685   -3.769  -1.036  1.00 0.29  ? 1120 GLN A C    4  
ATOM   2152  O  O    . GLN A 1 18 ? 8.002   -2.824  -0.644  1.00 0.39  ? 1120 GLN A O    4  
ATOM   2153  C  CB   . GLN A 1 18 ? 7.519   -5.975  -0.749  1.00 0.49  ? 1120 GLN A CB   4  
ATOM   2154  C  CG   . GLN A 1 18 ? 7.600   -6.380  -2.213  1.00 0.50  ? 1120 GLN A CG   4  
ATOM   2155  C  CD   . GLN A 1 18 ? 8.865   -7.150  -2.540  1.00 1.05  ? 1120 GLN A CD   4  
ATOM   2156  O  OE1  . GLN A 1 18 ? 9.423   -7.844  -1.690  1.00 1.91  ? 1120 GLN A OE1  4  
ATOM   2157  N  NE2  . GLN A 1 18 ? 9.325   -7.036  -3.776  1.00 1.51  ? 1120 GLN A NE2  4  
ATOM   2158  H  H    . GLN A 1 18 ? 7.763   -4.379  1.488   1.00 0.63  ? 1120 GLN A H    4  
ATOM   2159  H  HA   . GLN A 1 18 ? 9.613   -5.599  -0.451  1.00 0.42  ? 1120 GLN A HA   4  
ATOM   2160  H  HB2  . GLN A 1 18 ? 7.507   -6.875  -0.152  1.00 0.62  ? 1120 GLN A HB2  4  
ATOM   2161  H  HB3  . GLN A 1 18 ? 6.592   -5.443  -0.597  1.00 0.52  ? 1120 GLN A HB3  4  
ATOM   2162  H  HG2  . GLN A 1 18 ? 6.749   -7.001  -2.450  1.00 0.87  ? 1120 GLN A HG2  4  
ATOM   2163  H  HG3  . GLN A 1 18 ? 7.573   -5.488  -2.821  1.00 0.86  ? 1120 GLN A HG3  4  
ATOM   2164  H  HE21 . GLN A 1 18 ? 8.829   -6.467  -4.405  1.00 1.83  ? 1120 GLN A HE21 4  
ATOM   2165  H  HE22 . GLN A 1 18 ? 10.136  -7.530  -4.015  1.00 1.99  ? 1120 GLN A HE22 4  
ATOM   2166  N  N    . CYS A 1 19 ? 9.467   -3.699  -2.102  1.00 0.21  ? 1121 CYS A N    4  
ATOM   2167  C  CA   . CYS A 1 19 ? 9.588   -2.474  -2.875  1.00 0.21  ? 1121 CYS A CA   4  
ATOM   2168  C  C    . CYS A 1 19 ? 8.766   -2.538  -4.154  1.00 0.20  ? 1121 CYS A C    4  
ATOM   2169  O  O    . CYS A 1 19 ? 9.103   -3.268  -5.089  1.00 0.34  ? 1121 CYS A O    4  
ATOM   2170  C  CB   . CYS A 1 19 ? 11.057  -2.204  -3.200  1.00 0.34  ? 1121 CYS A CB   4  
ATOM   2171  S  SG   . CYS A 1 19 ? 12.084  -1.932  -1.722  1.00 0.42  ? 1121 CYS A SG   4  
ATOM   2172  H  H    . CYS A 1 19 ? 9.983   -4.490  -2.376  1.00 0.29  ? 1121 CYS A H    4  
ATOM   2173  H  HA   . CYS A 1 19 ? 9.215   -1.665  -2.266  1.00 0.24  ? 1121 CYS A HA   4  
ATOM   2174  H  HB2  . CYS A 1 19 ? 11.463  -3.049  -3.736  1.00 0.39  ? 1121 CYS A HB2  4  
ATOM   2175  H  HB3  . CYS A 1 19 ? 11.126  -1.322  -3.820  1.00 0.41  ? 1121 CYS A HB3  4  
ATOM   2176  N  N    . ILE A 1 20 ? 7.679   -1.780  -4.177  1.00 0.15  ? 1122 ILE A N    4  
ATOM   2177  C  CA   . ILE A 1 20 ? 6.840   -1.663  -5.360  1.00 0.14  ? 1122 ILE A CA   4  
ATOM   2178  C  C    . ILE A 1 20 ? 6.771   -0.210  -5.799  1.00 0.14  ? 1122 ILE A C    4  
ATOM   2179  O  O    . ILE A 1 20 ? 7.293   0.667   -5.119  1.00 0.18  ? 1122 ILE A O    4  
ATOM   2180  C  CB   . ILE A 1 20 ? 5.403   -2.160  -5.105  1.00 0.14  ? 1122 ILE A CB   4  
ATOM   2181  C  CG1  . ILE A 1 20 ? 4.727   -1.312  -4.026  1.00 0.13  ? 1122 ILE A CG1  4  
ATOM   2182  C  CG2  . ILE A 1 20 ? 5.410   -3.632  -4.712  1.00 0.19  ? 1122 ILE A CG2  4  
ATOM   2183  C  CD1  . ILE A 1 20 ? 3.233   -1.527  -3.940  1.00 0.17  ? 1122 ILE A CD1  4  
ATOM   2184  H  H    . ILE A 1 20 ? 7.435   -1.276  -3.371  1.00 0.22  ? 1122 ILE A H    4  
ATOM   2185  H  HA   . ILE A 1 20 ? 7.274   -2.256  -6.149  1.00 0.17  ? 1122 ILE A HA   4  
ATOM   2186  H  HB   . ILE A 1 20 ? 4.848   -2.063  -6.024  1.00 0.16  ? 1122 ILE A HB   4  
ATOM   2187  H  HG12 . ILE A 1 20 ? 5.153   -1.558  -3.065  1.00 0.15  ? 1122 ILE A HG12 4  
ATOM   2188  H  HG13 . ILE A 1 20 ? 4.901   -0.268  -4.237  1.00 0.14  ? 1122 ILE A HG13 4  
ATOM   2189  H  HG21 . ILE A 1 20 ? 5.841   -4.217  -5.510  1.00 0.98  ? 1122 ILE A HG21 4  
ATOM   2190  H  HG22 . ILE A 1 20 ? 4.397   -3.960  -4.530  1.00 1.05  ? 1122 ILE A HG22 4  
ATOM   2191  H  HG23 . ILE A 1 20 ? 5.995   -3.759  -3.814  1.00 0.97  ? 1122 ILE A HG23 4  
ATOM   2192  H  HD11 . ILE A 1 20 ? 2.762   -1.131  -4.826  1.00 1.07  ? 1122 ILE A HD11 4  
ATOM   2193  H  HD12 . ILE A 1 20 ? 2.841   -1.023  -3.064  1.00 0.99  ? 1122 ILE A HD12 4  
ATOM   2194  H  HD13 . ILE A 1 20 ? 3.028   -2.585  -3.869  1.00 1.03  ? 1122 ILE A HD13 4  
ATOM   2195  N  N    . SER A 1 21 ? 6.129   0.048   -6.923  1.00 0.16  ? 1123 SER A N    4  
ATOM   2196  C  CA   . SER A 1 21 ? 5.901   1.415   -7.366  1.00 0.17  ? 1123 SER A CA   4  
ATOM   2197  C  C    . SER A 1 21 ? 4.773   2.037   -6.555  1.00 0.15  ? 1123 SER A C    4  
ATOM   2198  O  O    . SER A 1 21 ? 3.814   1.358   -6.188  1.00 0.17  ? 1123 SER A O    4  
ATOM   2199  C  CB   . SER A 1 21 ? 5.549   1.443   -8.857  1.00 0.24  ? 1123 SER A CB   4  
ATOM   2200  O  OG   . SER A 1 21 ? 5.138   2.740   -9.263  1.00 0.33  ? 1123 SER A OG   4  
ATOM   2201  H  H    . SER A 1 21 ? 5.794   -0.694  -7.465  1.00 0.20  ? 1123 SER A H    4  
ATOM   2202  H  HA   . SER A 1 21 ? 6.808   1.979   -7.202  1.00 0.19  ? 1123 SER A HA   4  
ATOM   2203  H  HB2  . SER A 1 21 ? 6.414   1.155   -9.434  1.00 0.27  ? 1123 SER A HB2  4  
ATOM   2204  H  HB3  . SER A 1 21 ? 4.743   0.747   -9.045  1.00 0.24  ? 1123 SER A HB3  4  
ATOM   2205  H  HG   . SER A 1 21 ? 4.270   2.687   -9.682  1.00 0.63  ? 1123 SER A HG   4  
ATOM   2206  N  N    . LYS A 1 22 ? 4.888   3.331   -6.275  1.00 0.17  ? 1124 LYS A N    4  
ATOM   2207  C  CA   . LYS A 1 22 ? 3.844   4.048   -5.558  1.00 0.19  ? 1124 LYS A CA   4  
ATOM   2208  C  C    . LYS A 1 22 ? 2.563   4.107   -6.383  1.00 0.22  ? 1124 LYS A C    4  
ATOM   2209  O  O    . LYS A 1 22 ? 1.475   4.286   -5.838  1.00 0.25  ? 1124 LYS A O    4  
ATOM   2210  C  CB   . LYS A 1 22 ? 4.304   5.459   -5.188  1.00 0.23  ? 1124 LYS A CB   4  
ATOM   2211  C  CG   . LYS A 1 22 ? 5.257   5.491   -4.004  1.00 0.25  ? 1124 LYS A CG   4  
ATOM   2212  C  CD   . LYS A 1 22 ? 5.693   6.909   -3.671  1.00 0.25  ? 1124 LYS A CD   4  
ATOM   2213  C  CE   . LYS A 1 22 ? 6.581   6.940   -2.438  1.00 0.30  ? 1124 LYS A CE   4  
ATOM   2214  N  NZ   . LYS A 1 22 ? 7.124   8.298   -2.174  1.00 1.24  ? 1124 LYS A NZ   4  
ATOM   2215  H  H    . LYS A 1 22 ? 5.698   3.813   -6.557  1.00 0.20  ? 1124 LYS A H    4  
ATOM   2216  H  HA   . LYS A 1 22 ? 3.642   3.501   -4.650  1.00 0.19  ? 1124 LYS A HA   4  
ATOM   2217  H  HB2  . LYS A 1 22 ? 4.806   5.895   -6.039  1.00 0.30  ? 1124 LYS A HB2  4  
ATOM   2218  H  HB3  . LYS A 1 22 ? 3.439   6.056   -4.944  1.00 0.30  ? 1124 LYS A HB3  4  
ATOM   2219  H  HG2  . LYS A 1 22 ? 4.760   5.068   -3.143  1.00 0.37  ? 1124 LYS A HG2  4  
ATOM   2220  H  HG3  . LYS A 1 22 ? 6.130   4.901   -4.242  1.00 0.37  ? 1124 LYS A HG3  4  
ATOM   2221  H  HD2  . LYS A 1 22 ? 6.242   7.311   -4.508  1.00 0.32  ? 1124 LYS A HD2  4  
ATOM   2222  H  HD3  . LYS A 1 22 ? 4.815   7.512   -3.489  1.00 0.33  ? 1124 LYS A HD3  4  
ATOM   2223  H  HE2  . LYS A 1 22 ? 5.999   6.625   -1.584  1.00 0.93  ? 1124 LYS A HE2  4  
ATOM   2224  H  HE3  . LYS A 1 22 ? 7.401   6.255   -2.586  1.00 0.95  ? 1124 LYS A HE3  4  
ATOM   2225  H  HZ1  . LYS A 1 22 ? 6.351   8.981   -2.056  1.00 1.76  ? 1124 LYS A HZ1  4  
ATOM   2226  H  HZ2  . LYS A 1 22 ? 7.725   8.604   -2.967  1.00 1.77  ? 1124 LYS A HZ2  4  
ATOM   2227  H  HZ3  . LYS A 1 22 ? 7.700   8.290   -1.307  1.00 1.88  ? 1124 LYS A HZ3  4  
ATOM   2228  N  N    . ASN A 1 23 ? 2.694   3.930   -7.695  1.00 0.24  ? 1125 ASN A N    4  
ATOM   2229  C  CA   . ASN A 1 23 ? 1.529   3.901   -8.575  1.00 0.28  ? 1125 ASN A CA   4  
ATOM   2230  C  C    . ASN A 1 23 ? 0.831   2.549   -8.492  1.00 0.26  ? 1125 ASN A C    4  
ATOM   2231  O  O    . ASN A 1 23 ? -0.278  2.376   -8.995  1.00 0.32  ? 1125 ASN A O    4  
ATOM   2232  C  CB   . ASN A 1 23 ? 1.928   4.196   -10.021 1.00 0.36  ? 1125 ASN A CB   4  
ATOM   2233  C  CG   . ASN A 1 23 ? 2.481   5.596   -10.197 1.00 1.03  ? 1125 ASN A CG   4  
ATOM   2234  O  OD1  . ASN A 1 23 ? 3.682   5.820   -10.058 1.00 1.75  ? 1125 ASN A OD1  4  
ATOM   2235  N  ND2  . ASN A 1 23 ? 1.614   6.549   -10.506 1.00 1.69  ? 1125 ASN A ND2  4  
ATOM   2236  H  H    . ASN A 1 23 ? 3.592   3.826   -8.077  1.00 0.25  ? 1125 ASN A H    4  
ATOM   2237  H  HA   . ASN A 1 23 ? 0.845   4.665   -8.237  1.00 0.31  ? 1125 ASN A HA   4  
ATOM   2238  H  HB2  . ASN A 1 23 ? 2.685   3.491   -10.329 1.00 0.82  ? 1125 ASN A HB2  4  
ATOM   2239  H  HB3  . ASN A 1 23 ? 1.062   4.089   -10.656 1.00 0.82  ? 1125 ASN A HB3  4  
ATOM   2240  H  HD21 . ASN A 1 23 ? 0.667   6.301   -10.603 1.00 1.99  ? 1125 ASN A HD21 4  
ATOM   2241  H  HD22 . ASN A 1 23 ? 1.952   7.462   -10.631 1.00 2.22  ? 1125 ASN A HD22 4  
ATOM   2242  N  N    . TRP A 1 24 ? 1.492   1.590   -7.852  1.00 0.22  ? 1126 TRP A N    4  
ATOM   2243  C  CA   . TRP A 1 24 ? 0.929   0.260   -7.669  1.00 0.22  ? 1126 TRP A CA   4  
ATOM   2244  C  C    . TRP A 1 24 ? 0.169   0.191   -6.355  1.00 0.20  ? 1126 TRP A C    4  
ATOM   2245  O  O    . TRP A 1 24 ? -0.563  -0.756  -6.102  1.00 0.26  ? 1126 TRP A O    4  
ATOM   2246  C  CB   . TRP A 1 24 ? 2.027   -0.808  -7.661  1.00 0.25  ? 1126 TRP A CB   4  
ATOM   2247  C  CG   . TRP A 1 24 ? 2.771   -0.955  -8.955  1.00 0.31  ? 1126 TRP A CG   4  
ATOM   2248  C  CD1  . TRP A 1 24 ? 2.583   -0.244  -10.106 1.00 0.37  ? 1126 TRP A CD1  4  
ATOM   2249  C  CD2  . TRP A 1 24 ? 3.827   -1.885  -9.226  1.00 0.38  ? 1126 TRP A CD2  4  
ATOM   2250  N  NE1  . TRP A 1 24 ? 3.466   -0.667  -11.068 1.00 0.45  ? 1126 TRP A NE1  4  
ATOM   2251  C  CE2  . TRP A 1 24 ? 4.238   -1.675  -10.554 1.00 0.45  ? 1126 TRP A CE2  4  
ATOM   2252  C  CE3  . TRP A 1 24 ? 4.465   -2.872  -8.472  1.00 0.44  ? 1126 TRP A CE3  4  
ATOM   2253  C  CZ2  . TRP A 1 24 ? 5.261   -2.415  -11.142 1.00 0.54  ? 1126 TRP A CZ2  4  
ATOM   2254  C  CZ3  . TRP A 1 24 ? 5.479   -3.606  -9.056  1.00 0.55  ? 1126 TRP A CZ3  4  
ATOM   2255  C  CH2  . TRP A 1 24 ? 5.870   -3.374  -10.380 1.00 0.58  ? 1126 TRP A CH2  4  
ATOM   2256  H  H    . TRP A 1 24 ? 2.380   1.786   -7.482  1.00 0.23  ? 1126 TRP A H    4  
ATOM   2257  H  HA   . TRP A 1 24 ? 0.248   0.065   -8.484  1.00 0.25  ? 1126 TRP A HA   4  
ATOM   2258  H  HB2  . TRP A 1 24 ? 2.748   -0.564  -6.896  1.00 0.27  ? 1126 TRP A HB2  4  
ATOM   2259  H  HB3  . TRP A 1 24 ? 1.578   -1.760  -7.425  1.00 0.28  ? 1126 TRP A HB3  4  
ATOM   2260  H  HD1  . TRP A 1 24 ? 1.850   0.539   -10.223 1.00 0.40  ? 1126 TRP A HD1  4  
ATOM   2261  H  HE1  . TRP A 1 24 ? 3.531   -0.305  -11.980 1.00 0.53  ? 1126 TRP A HE1  4  
ATOM   2262  H  HE3  . TRP A 1 24 ? 4.176   -3.068  -7.452  1.00 0.45  ? 1126 TRP A HE3  4  
ATOM   2263  H  HZ2  . TRP A 1 24 ? 5.575   -2.248  -12.161 1.00 0.61  ? 1126 TRP A HZ2  4  
ATOM   2264  H  HZ3  . TRP A 1 24 ? 5.984   -4.373  -8.488  1.00 0.62  ? 1126 TRP A HZ3  4  
ATOM   2265  H  HH2  . TRP A 1 24 ? 6.667   -3.972  -10.796 1.00 0.67  ? 1126 TRP A HH2  4  
ATOM   2266  N  N    . VAL A 1 25 ? 0.358   1.192   -5.520  1.00 0.19  ? 1127 VAL A N    4  
ATOM   2267  C  CA   . VAL A 1 25 ? -0.266  1.215   -4.206  1.00 0.18  ? 1127 VAL A CA   4  
ATOM   2268  C  C    . VAL A 1 25 ? -1.763  1.450   -4.313  1.00 0.19  ? 1127 VAL A C    4  
ATOM   2269  O  O    . VAL A 1 25 ? -2.202  2.448   -4.890  1.00 0.23  ? 1127 VAL A O    4  
ATOM   2270  C  CB   . VAL A 1 25 ? 0.359   2.301   -3.307  1.00 0.21  ? 1127 VAL A CB   4  
ATOM   2271  C  CG1  . VAL A 1 25 ? -0.291  2.316   -1.932  1.00 0.24  ? 1127 VAL A CG1  4  
ATOM   2272  C  CG2  . VAL A 1 25 ? 1.857   2.088   -3.186  1.00 0.24  ? 1127 VAL A CG2  4  
ATOM   2273  H  H    . VAL A 1 25 ? 0.931   1.936   -5.791  1.00 0.21  ? 1127 VAL A H    4  
ATOM   2274  H  HA   . VAL A 1 25 ? -0.101  0.252   -3.746  1.00 0.19  ? 1127 VAL A HA   4  
ATOM   2275  H  HB   . VAL A 1 25 ? 0.192   3.261   -3.771  1.00 0.23  ? 1127 VAL A HB   4  
ATOM   2276  H  HG11 . VAL A 1 25 ? -0.151  1.358   -1.455  1.00 1.01  ? 1127 VAL A HG11 4  
ATOM   2277  H  HG12 . VAL A 1 25 ? -1.347  2.515   -2.036  1.00 1.02  ? 1127 VAL A HG12 4  
ATOM   2278  H  HG13 . VAL A 1 25 ? 0.163   3.088   -1.329  1.00 1.00  ? 1127 VAL A HG13 4  
ATOM   2279  H  HG21 . VAL A 1 25 ? 2.289   2.895   -2.612  1.00 1.05  ? 1127 VAL A HG21 4  
ATOM   2280  H  HG22 . VAL A 1 25 ? 2.298   2.068   -4.171  1.00 1.06  ? 1127 VAL A HG22 4  
ATOM   2281  H  HG23 . VAL A 1 25 ? 2.048   1.150   -2.688  1.00 1.01  ? 1127 VAL A HG23 4  
ATOM   2282  N  N    . CYS A 1 26 ? -2.534  0.511   -3.770  1.00 0.19  ? 1128 CYS A N    4  
ATOM   2283  C  CA   . CYS A 1 26 ? -3.985  0.627   -3.723  1.00 0.26  ? 1128 CYS A CA   4  
ATOM   2284  C  C    . CYS A 1 26 ? -4.556  0.632   -5.140  1.00 0.27  ? 1128 CYS A C    4  
ATOM   2285  O  O    . CYS A 1 26 ? -5.364  1.487   -5.508  1.00 0.37  ? 1128 CYS A O    4  
ATOM   2286  C  CB   . CYS A 1 26 ? -4.380  1.895   -2.953  1.00 0.32  ? 1128 CYS A CB   4  
ATOM   2287  S  SG   . CYS A 1 26 ? -6.158  2.058   -2.589  1.00 0.58  ? 1128 CYS A SG   4  
ATOM   2288  H  H    . CYS A 1 26 ? -2.106  -0.296  -3.398  1.00 0.19  ? 1128 CYS A H    4  
ATOM   2289  H  HA   . CYS A 1 26 ? -4.369  -0.236  -3.199  1.00 0.28  ? 1128 CYS A HA   4  
ATOM   2290  H  HB2  . CYS A 1 26 ? -3.854  1.908   -2.011  1.00 0.36  ? 1128 CYS A HB2  4  
ATOM   2291  H  HB3  . CYS A 1 26 ? -4.083  2.757   -3.530  1.00 0.36  ? 1128 CYS A HB3  4  
ATOM   2292  N  N    . ASP A 1 27 ? -4.120  -0.338  -5.930  1.00 0.25  ? 1129 ASP A N    4  
ATOM   2293  C  CA   . ASP A 1 27 ? -4.534  -0.448  -7.326  1.00 0.30  ? 1129 ASP A CA   4  
ATOM   2294  C  C    . ASP A 1 27 ? -5.307  -1.745  -7.549  1.00 0.37  ? 1129 ASP A C    4  
ATOM   2295  O  O    . ASP A 1 27 ? -5.475  -2.190  -8.684  1.00 0.41  ? 1129 ASP A O    4  
ATOM   2296  C  CB   . ASP A 1 27 ? -3.307  -0.418  -8.241  1.00 0.31  ? 1129 ASP A CB   4  
ATOM   2297  C  CG   . ASP A 1 27 ? -2.610  -1.764  -8.330  1.00 0.35  ? 1129 ASP A CG   4  
ATOM   2298  O  OD1  . ASP A 1 27 ? -2.314  -2.364  -7.272  1.00 0.31  ? 1129 ASP A OD1  4  
ATOM   2299  O  OD2  . ASP A 1 27 ? -2.354  -2.225  -9.463  1.00 0.46  ? 1129 ASP A OD2  4  
ATOM   2300  H  H    . ASP A 1 27 ? -3.501  -1.011  -5.560  1.00 0.24  ? 1129 ASP A H    4  
ATOM   2301  H  HA   . ASP A 1 27 ? -5.173  0.390   -7.556  1.00 0.33  ? 1129 ASP A HA   4  
ATOM   2302  H  HB2  . ASP A 1 27 ? -3.613  -0.128  -9.235  1.00 0.36  ? 1129 ASP A HB2  4  
ATOM   2303  H  HB3  . ASP A 1 27 ? -2.602  0.308   -7.862  1.00 0.29  ? 1129 ASP A HB3  4  
ATOM   2304  N  N    . THR A 1 28 ? -5.757  -2.335  -6.443  1.00 0.45  ? 1130 THR A N    4  
ATOM   2305  C  CA   . THR A 1 28 ? -6.479  -3.614  -6.414  1.00 0.56  ? 1130 THR A CA   4  
ATOM   2306  C  C    . THR A 1 28 ? -5.653  -4.764  -6.996  1.00 0.61  ? 1130 THR A C    4  
ATOM   2307  O  O    . THR A 1 28 ? -6.199  -5.735  -7.521  1.00 0.73  ? 1130 THR A O    4  
ATOM   2308  C  CB   . THR A 1 28 ? -7.883  -3.554  -7.083  1.00 0.59  ? 1130 THR A CB   4  
ATOM   2309  O  OG1  . THR A 1 28 ? -7.804  -3.188  -8.468  1.00 0.56  ? 1130 THR A OG1  4  
ATOM   2310  C  CG2  . THR A 1 28 ? -8.775  -2.569  -6.350  1.00 0.65  ? 1130 THR A CG2  4  
ATOM   2311  H  H    . THR A 1 28 ? -5.580  -1.892  -5.582  1.00 0.46  ? 1130 THR A H    4  
ATOM   2312  H  HA   . THR A 1 28 ? -6.640  -3.840  -5.369  1.00 0.64  ? 1130 THR A HA   4  
ATOM   2313  H  HB   . THR A 1 28 ? -8.332  -4.534  -7.010  1.00 0.67  ? 1130 THR A HB   4  
ATOM   2314  H  HG1  . THR A 1 28 ? -6.902  -2.911  -8.674  1.00 0.53  ? 1130 THR A HG1  4  
ATOM   2315  H  HG21 . THR A 1 28 ? -9.746  -2.540  -6.824  1.00 1.34  ? 1130 THR A HG21 4  
ATOM   2316  H  HG22 . THR A 1 28 ? -8.331  -1.585  -6.384  1.00 1.09  ? 1130 THR A HG22 4  
ATOM   2317  H  HG23 . THR A 1 28 ? -8.885  -2.878  -5.321  1.00 1.21  ? 1130 THR A HG23 4  
ATOM   2318  N  N    . ASP A 1 29 ? -4.333  -4.650  -6.889  1.00 0.59  ? 1131 ASP A N    4  
ATOM   2319  C  CA   . ASP A 1 29 ? -3.432  -5.735  -7.266  1.00 0.69  ? 1131 ASP A CA   4  
ATOM   2320  C  C    . ASP A 1 29 ? -2.463  -6.024  -6.126  1.00 0.67  ? 1131 ASP A C    4  
ATOM   2321  O  O    . ASP A 1 29 ? -1.923  -5.098  -5.513  1.00 0.53  ? 1131 ASP A O    4  
ATOM   2322  C  CB   . ASP A 1 29 ? -2.653  -5.377  -8.533  1.00 0.75  ? 1131 ASP A CB   4  
ATOM   2323  C  CG   . ASP A 1 29 ? -1.759  -6.511  -9.007  1.00 0.92  ? 1131 ASP A CG   4  
ATOM   2324  O  OD1  . ASP A 1 29 ? -2.239  -7.376  -9.772  1.00 1.21  ? 1131 ASP A OD1  4  
ATOM   2325  O  OD2  . ASP A 1 29 ? -0.574  -6.545  -8.622  1.00 0.92  ? 1131 ASP A OD2  4  
ATOM   2326  H  H    . ASP A 1 29 ? -3.953  -3.809  -6.558  1.00 0.55  ? 1131 ASP A H    4  
ATOM   2327  H  HA   . ASP A 1 29 ? -4.028  -6.615  -7.452  1.00 0.81  ? 1131 ASP A HA   4  
ATOM   2328  H  HB2  . ASP A 1 29 ? -3.351  -5.137  -9.317  1.00 0.81  ? 1131 ASP A HB2  4  
ATOM   2329  H  HB3  . ASP A 1 29 ? -2.032  -4.515  -8.334  1.00 0.68  ? 1131 ASP A HB3  4  
ATOM   2330  N  N    . ASN A 1 30 ? -2.240  -7.299  -5.846  1.00 0.94  ? 1132 ASN A N    4  
ATOM   2331  C  CA   . ASN A 1 30 ? -1.391  -7.704  -4.727  1.00 1.00  ? 1132 ASN A CA   4  
ATOM   2332  C  C    . ASN A 1 30 ? 0.083   -7.718  -5.118  1.00 0.91  ? 1132 ASN A C    4  
ATOM   2333  O  O    . ASN A 1 30 ? 0.766   -8.739  -5.008  1.00 1.06  ? 1132 ASN A O    4  
ATOM   2334  C  CB   . ASN A 1 30 ? -1.812  -9.078  -4.196  1.00 1.29  ? 1132 ASN A CB   4  
ATOM   2335  C  CG   . ASN A 1 30 ? -3.098  -9.029  -3.393  1.00 1.72  ? 1132 ASN A CG   4  
ATOM   2336  O  OD1  . ASN A 1 30 ? -3.956  -8.175  -3.614  1.00 2.58  ? 1132 ASN A OD1  4  
ATOM   2337  N  ND2  . ASN A 1 30 ? -3.239  -9.950  -2.452  1.00 2.07  ? 1132 ASN A ND2  4  
ATOM   2338  H  H    . ASN A 1 30 ? -2.652  -7.991  -6.407  1.00 1.15  ? 1132 ASN A H    4  
ATOM   2339  H  HA   . ASN A 1 30 ? -1.527  -6.975  -3.941  1.00 0.97  ? 1132 ASN A HA   4  
ATOM   2340  H  HB2  . ASN A 1 30 ? -1.957  -9.748  -5.028  1.00 1.52  ? 1132 ASN A HB2  4  
ATOM   2341  H  HB3  . ASN A 1 30 ? -1.027  -9.465  -3.561  1.00 1.97  ? 1132 ASN A HB3  4  
ATOM   2342  H  HD21 . ASN A 1 30 ? -2.518  -10.601 -2.330  1.00 2.11  ? 1132 ASN A HD21 4  
ATOM   2343  H  HD22 . ASN A 1 30 ? -4.063  -9.947  -1.920  1.00 2.73  ? 1132 ASN A HD22 4  
ATOM   2344  N  N    . ASP A 1 31 ? 0.567   -6.573  -5.569  1.00 0.86  ? 1133 ASP A N    4  
ATOM   2345  C  CA   . ASP A 1 31 ? 1.978   -6.391  -5.902  1.00 0.77  ? 1133 ASP A CA   4  
ATOM   2346  C  C    . ASP A 1 31 ? 2.854   -6.567  -4.668  1.00 0.78  ? 1133 ASP A C    4  
ATOM   2347  O  O    . ASP A 1 31 ? 3.950   -7.115  -4.753  1.00 1.28  ? 1133 ASP A O    4  
ATOM   2348  C  CB   . ASP A 1 31 ? 2.209   -5.011  -6.529  1.00 0.67  ? 1133 ASP A CB   4  
ATOM   2349  C  CG   . ASP A 1 31 ? 1.153   -4.013  -6.121  1.00 0.58  ? 1133 ASP A CG   4  
ATOM   2350  O  OD1  . ASP A 1 31 ? 1.025   -3.724  -4.920  1.00 1.00  ? 1133 ASP A OD1  4  
ATOM   2351  O  OD2  . ASP A 1 31 ? 0.472   -3.460  -6.994  1.00 1.09  ? 1133 ASP A OD2  4  
ATOM   2352  H  H    . ASP A 1 31 ? -0.047  -5.818  -5.687  1.00 1.05  ? 1133 ASP A H    4  
ATOM   2353  H  HA   . ASP A 1 31 ? 2.243   -7.151  -6.622  1.00 0.87  ? 1133 ASP A HA   4  
ATOM   2354  H  HB2  . ASP A 1 31 ? 3.171   -4.631  -6.215  1.00 1.04  ? 1133 ASP A HB2  4  
ATOM   2355  H  HB3  . ASP A 1 31 ? 2.197   -5.103  -7.606  1.00 1.05  ? 1133 ASP A HB3  4  
ATOM   2356  N  N    . CYS A 1 32 ? 2.365   -6.119  -3.516  1.00 0.76  ? 1134 CYS A N    4  
ATOM   2357  C  CA   . CYS A 1 32 ? 3.077   -6.320  -2.254  1.00 0.78  ? 1134 CYS A CA   4  
ATOM   2358  C  C    . CYS A 1 32 ? 2.955   -7.760  -1.760  1.00 0.85  ? 1134 CYS A C    4  
ATOM   2359  O  O    . CYS A 1 32 ? 3.410   -8.088  -0.661  1.00 1.57  ? 1134 CYS A O    4  
ATOM   2360  C  CB   . CYS A 1 32 ? 2.545   -5.378  -1.173  1.00 0.82  ? 1134 CYS A CB   4  
ATOM   2361  S  SG   . CYS A 1 32 ? 2.929   -3.623  -1.447  1.00 1.16  ? 1134 CYS A SG   4  
ATOM   2362  H  H    . CYS A 1 32 ? 1.522   -5.611  -3.518  1.00 1.11  ? 1134 CYS A H    4  
ATOM   2363  H  HA   . CYS A 1 32 ? 4.119   -6.100  -2.425  1.00 0.88  ? 1134 CYS A HA   4  
ATOM   2364  H  HB2  . CYS A 1 32 ? 1.471   -5.472  -1.123  1.00 1.25  ? 1134 CYS A HB2  4  
ATOM   2365  H  HB3  . CYS A 1 32 ? 2.967   -5.662  -0.220  1.00 1.22  ? 1134 CYS A HB3  4  
ATOM   2366  N  N    . GLY A 1 33 ? 2.334   -8.617  -2.561  1.00 1.17  ? 1135 GLY A N    4  
ATOM   2367  C  CA   . GLY A 1 33 ? 2.120   -9.991  -2.156  1.00 1.22  ? 1135 GLY A CA   4  
ATOM   2368  C  C    . GLY A 1 33 ? 0.954   -10.119 -1.202  1.00 1.18  ? 1135 GLY A C    4  
ATOM   2369  O  O    . GLY A 1 33 ? -0.090  -10.661 -1.553  1.00 1.68  ? 1135 GLY A O    4  
ATOM   2370  H  H    . GLY A 1 33 ? 2.026   -8.315  -3.443  1.00 1.82  ? 1135 GLY A H    4  
ATOM   2371  H  HA2  . GLY A 1 33 ? 1.923   -10.589 -3.035  1.00 1.26  ? 1135 GLY A HA2  4  
ATOM   2372  H  HA3  . GLY A 1 33 ? 3.011   -10.358 -1.673  1.00 1.39  ? 1135 GLY A HA3  4  
ATOM   2373  N  N    . ASP A 1 34 ? 1.132   -9.604  0.007   1.00 1.02  ? 1136 ASP A N    4  
ATOM   2374  C  CA   . ASP A 1 34 ? 0.059   -9.554  0.994   1.00 1.11  ? 1136 ASP A CA   4  
ATOM   2375  C  C    . ASP A 1 34 ? -1.018  -8.573  0.557   1.00 0.93  ? 1136 ASP A C    4  
ATOM   2376  O  O    . ASP A 1 34 ? -2.188  -8.699  0.916   1.00 1.35  ? 1136 ASP A O    4  
ATOM   2377  C  CB   . ASP A 1 34 ? 0.619   -9.146  2.361   1.00 1.44  ? 1136 ASP A CB   4  
ATOM   2378  C  CG   . ASP A 1 34 ? -0.451  -8.699  3.346   1.00 2.10  ? 1136 ASP A CG   4  
ATOM   2379  O  OD1  . ASP A 1 34 ? -1.331  -9.516  3.689   1.00 2.47  ? 1136 ASP A OD1  4  
ATOM   2380  O  OD2  . ASP A 1 34 ? -0.417  -7.530  3.779   1.00 2.85  ? 1136 ASP A OD2  4  
ATOM   2381  H  H    . ASP A 1 34 ? 2.016   -9.248  0.245   1.00 1.22  ? 1136 ASP A H    4  
ATOM   2382  H  HA   . ASP A 1 34 ? -0.371  -10.536 1.069   1.00 1.27  ? 1136 ASP A HA   4  
ATOM   2383  H  HB2  . ASP A 1 34 ? 1.141   -9.987  2.792   1.00 1.68  ? 1136 ASP A HB2  4  
ATOM   2384  H  HB3  . ASP A 1 34 ? 1.313   -8.335  2.222   1.00 1.84  ? 1136 ASP A HB3  4  
ATOM   2385  N  N    . GLY A 1 35 ? -0.610  -7.619  -0.264  1.00 0.62  ? 1137 GLY A N    4  
ATOM   2386  C  CA   . GLY A 1 35 ? -1.497  -6.548  -0.648  1.00 0.49  ? 1137 GLY A CA   4  
ATOM   2387  C  C    . GLY A 1 35 ? -1.560  -5.498  0.433   1.00 0.36  ? 1137 GLY A C    4  
ATOM   2388  O  O    . GLY A 1 35 ? -2.588  -4.868  0.645   1.00 0.36  ? 1137 GLY A O    4  
ATOM   2389  H  H    . GLY A 1 35 ? 0.300   -7.650  -0.616  1.00 0.82  ? 1137 GLY A H    4  
ATOM   2390  H  HA2  . GLY A 1 35 ? -1.137  -6.098  -1.563  1.00 0.51  ? 1137 GLY A HA2  4  
ATOM   2391  H  HA3  . GLY A 1 35 ? -2.487  -6.945  -0.813  1.00 0.72  ? 1137 GLY A HA3  4  
ATOM   2392  N  N    . SER A 1 36 ? -0.446  -5.321  1.129   1.00 0.32  ? 1138 SER A N    4  
ATOM   2393  C  CA   . SER A 1 36 ? -0.371  -4.365  2.217   1.00 0.28  ? 1138 SER A CA   4  
ATOM   2394  C  C    . SER A 1 36 ? -0.471  -2.936  1.704   1.00 0.25  ? 1138 SER A C    4  
ATOM   2395  O  O    . SER A 1 36 ? -0.890  -2.034  2.427   1.00 0.40  ? 1138 SER A O    4  
ATOM   2396  C  CB   . SER A 1 36 ? 0.915   -4.576  3.009   1.00 0.33  ? 1138 SER A CB   4  
ATOM   2397  O  OG   . SER A 1 36 ? 2.018   -4.846  2.158   1.00 0.44  ? 1138 SER A OG   4  
ATOM   2398  H  H    . SER A 1 36 ? 0.343   -5.853  0.910   1.00 0.37  ? 1138 SER A H    4  
ATOM   2399  H  HA   . SER A 1 36 ? -1.213  -4.551  2.869   1.00 0.33  ? 1138 SER A HA   4  
ATOM   2400  H  HB2  . SER A 1 36 ? 1.123   -3.689  3.582   1.00 0.40  ? 1138 SER A HB2  4  
ATOM   2401  H  HB3  . SER A 1 36 ? 0.786   -5.406  3.678   1.00 0.39  ? 1138 SER A HB3  4  
ATOM   2402  H  HG   . SER A 1 36 ? 2.332   -5.747  2.324   1.00 1.17  ? 1138 SER A HG   4  
ATOM   2403  N  N    . ASP A 1 37 ? -0.105  -2.744  0.448   1.00 0.18  ? 1139 ASP A N    4  
ATOM   2404  C  CA   . ASP A 1 37 ? -0.275  -1.461  -0.214  1.00 0.18  ? 1139 ASP A CA   4  
ATOM   2405  C  C    . ASP A 1 37 ? -1.764  -1.175  -0.385  1.00 0.20  ? 1139 ASP A C    4  
ATOM   2406  O  O    . ASP A 1 37 ? -2.199  -0.025  -0.418  1.00 0.29  ? 1139 ASP A O    4  
ATOM   2407  C  CB   . ASP A 1 37 ? 0.403   -1.485  -1.579  1.00 0.19  ? 1139 ASP A CB   4  
ATOM   2408  C  CG   . ASP A 1 37 ? -0.353  -2.335  -2.572  1.00 0.26  ? 1139 ASP A CG   4  
ATOM   2409  O  OD1  . ASP A 1 37 ? -0.384  -3.575  -2.411  1.00 0.33  ? 1139 ASP A OD1  4  
ATOM   2410  O  OD2  . ASP A 1 37 ? -0.946  -1.763  -3.508  1.00 0.32  ? 1139 ASP A OD2  4  
ATOM   2411  H  H    . ASP A 1 37 ? 0.285   -3.489  -0.057  1.00 0.26  ? 1139 ASP A H    4  
ATOM   2412  H  HA   . ASP A 1 37 ? 0.177   -0.695  0.396   1.00 0.20  ? 1139 ASP A HA   4  
ATOM   2413  H  HB2  . ASP A 1 37 ? 0.463   -0.479  -1.964  1.00 0.22  ? 1139 ASP A HB2  4  
ATOM   2414  H  HB3  . ASP A 1 37 ? 1.399   -1.886  -1.474  1.00 0.19  ? 1139 ASP A HB3  4  
ATOM   2415  N  N    . GLU A 1 38 ? -2.535  -2.250  -0.485  1.00 0.22  ? 1140 GLU A N    4  
ATOM   2416  C  CA   . GLU A 1 38 ? -3.976  -2.168  -0.642  1.00 0.27  ? 1140 GLU A CA   4  
ATOM   2417  C  C    . GLU A 1 38 ? -4.645  -1.976  0.714   1.00 0.31  ? 1140 GLU A C    4  
ATOM   2418  O  O    . GLU A 1 38 ? -5.619  -1.233  0.841   1.00 0.44  ? 1140 GLU A O    4  
ATOM   2419  C  CB   . GLU A 1 38 ? -4.505  -3.454  -1.284  1.00 0.29  ? 1140 GLU A CB   4  
ATOM   2420  C  CG   . GLU A 1 38 ? -3.825  -3.827  -2.593  1.00 0.29  ? 1140 GLU A CG   4  
ATOM   2421  C  CD   . GLU A 1 38 ? -4.149  -2.873  -3.719  1.00 0.28  ? 1140 GLU A CD   4  
ATOM   2422  O  OE1  . GLU A 1 38 ? -5.278  -2.341  -3.741  1.00 0.38  ? 1140 GLU A OE1  4  
ATOM   2423  O  OE2  . GLU A 1 38 ? -3.280  -2.655  -4.594  1.00 0.28  ? 1140 GLU A OE2  4  
ATOM   2424  H  H    . GLU A 1 38 ? -2.114  -3.135  -0.459  1.00 0.24  ? 1140 GLU A H    4  
ATOM   2425  H  HA   . GLU A 1 38 ? -4.203  -1.326  -1.280  1.00 0.30  ? 1140 GLU A HA   4  
ATOM   2426  H  HB2  . GLU A 1 38 ? -4.369  -4.267  -0.589  1.00 0.32  ? 1140 GLU A HB2  4  
ATOM   2427  H  HB3  . GLU A 1 38 ? -5.560  -3.332  -1.474  1.00 0.33  ? 1140 GLU A HB3  4  
ATOM   2428  H  HG2  . GLU A 1 38 ? -2.756  -3.822  -2.438  1.00 0.29  ? 1140 GLU A HG2  4  
ATOM   2429  H  HG3  . GLU A 1 38 ? -4.141  -4.821  -2.878  1.00 0.33  ? 1140 GLU A HG3  4  
ATOM   2430  N  N    . LYS A 1 39 ? -4.113  -2.657  1.729   1.00 0.30  ? 1141 LYS A N    4  
ATOM   2431  C  CA   . LYS A 1 39 ? -4.692  -2.612  3.067   1.00 0.37  ? 1141 LYS A CA   4  
ATOM   2432  C  C    . LYS A 1 39 ? -4.366  -1.286  3.747   1.00 0.49  ? 1141 LYS A C    4  
ATOM   2433  O  O    . LYS A 1 39 ? -5.120  -0.805  4.591   1.00 0.57  ? 1141 LYS A O    4  
ATOM   2434  C  CB   . LYS A 1 39 ? -4.205  -3.805  3.909   1.00 0.47  ? 1141 LYS A CB   4  
ATOM   2435  C  CG   . LYS A 1 39 ? -2.835  -3.639  4.556   1.00 0.57  ? 1141 LYS A CG   4  
ATOM   2436  C  CD   . LYS A 1 39 ? -2.305  -4.981  5.051   1.00 0.76  ? 1141 LYS A CD   4  
ATOM   2437  C  CE   . LYS A 1 39 ? -1.041  -4.843  5.885   1.00 0.91  ? 1141 LYS A CE   4  
ATOM   2438  N  NZ   . LYS A 1 39 ? -0.488  -6.174  6.265   1.00 1.55  ? 1141 LYS A NZ   4  
ATOM   2439  H  H    . LYS A 1 39 ? -3.321  -3.215  1.567   1.00 0.32  ? 1141 LYS A H    4  
ATOM   2440  H  HA   . LYS A 1 39 ? -5.763  -2.682  2.957   1.00 0.39  ? 1141 LYS A HA   4  
ATOM   2441  H  HB2  . LYS A 1 39 ? -4.917  -3.980  4.693   1.00 0.56  ? 1141 LYS A HB2  4  
ATOM   2442  H  HB3  . LYS A 1 39 ? -4.170  -4.677  3.274   1.00 0.47  ? 1141 LYS A HB3  4  
ATOM   2443  H  HG2  . LYS A 1 39 ? -2.150  -3.232  3.829   1.00 0.50  ? 1141 LYS A HG2  4  
ATOM   2444  H  HG3  . LYS A 1 39 ? -2.920  -2.962  5.393   1.00 0.65  ? 1141 LYS A HG3  4  
ATOM   2445  H  HD2  . LYS A 1 39 ? -3.064  -5.459  5.650   1.00 0.88  ? 1141 LYS A HD2  4  
ATOM   2446  H  HD3  . LYS A 1 39 ? -2.084  -5.599  4.194   1.00 0.73  ? 1141 LYS A HD3  4  
ATOM   2447  H  HE2  . LYS A 1 39 ? -0.301  -4.307  5.310   1.00 1.15  ? 1141 LYS A HE2  4  
ATOM   2448  H  HE3  . LYS A 1 39 ? -1.272  -4.287  6.781   1.00 1.18  ? 1141 LYS A HE3  4  
ATOM   2449  H  HZ1  . LYS A 1 39 ? -1.149  -6.671  6.898   1.00 2.08  ? 1141 LYS A HZ1  4  
ATOM   2450  H  HZ2  . LYS A 1 39 ? 0.429   -6.061  6.755   1.00 1.99  ? 1141 LYS A HZ2  4  
ATOM   2451  H  HZ3  . LYS A 1 39 ? -0.342  -6.758  5.411   1.00 1.97  ? 1141 LYS A HZ3  4  
ATOM   2452  N  N    . ASN A 1 40 ? -3.251  -0.688  3.351   1.00 0.60  ? 1142 ASN A N    4  
ATOM   2453  C  CA   . ASN A 1 40 ? -2.856  0.619   3.860   1.00 0.81  ? 1142 ASN A CA   4  
ATOM   2454  C  C    . ASN A 1 40 ? -3.369  1.708   2.918   1.00 0.91  ? 1142 ASN A C    4  
ATOM   2455  O  O    . ASN A 1 40 ? -2.612  2.542   2.423   1.00 1.44  ? 1142 ASN A O    4  
ATOM   2456  C  CB   . ASN A 1 40 ? -1.328  0.690   4.006   1.00 1.07  ? 1142 ASN A CB   4  
ATOM   2457  C  CG   . ASN A 1 40 ? -0.854  1.887   4.815   1.00 1.37  ? 1142 ASN A CG   4  
ATOM   2458  O  OD1  . ASN A 1 40 ? -0.551  2.949   4.275   1.00 2.05  ? 1142 ASN A OD1  4  
ATOM   2459  N  ND2  . ASN A 1 40 ? -0.776  1.718   6.123   1.00 1.92  ? 1142 ASN A ND2  4  
ATOM   2460  H  H    . ASN A 1 40 ? -2.673  -1.143  2.698   1.00 0.58  ? 1142 ASN A H    4  
ATOM   2461  H  HA   . ASN A 1 40 ? -3.314  0.750   4.830   1.00 0.86  ? 1142 ASN A HA   4  
ATOM   2462  H  HB2  . ASN A 1 40 ? -0.983  -0.205  4.497   1.00 1.54  ? 1142 ASN A HB2  4  
ATOM   2463  H  HB3  . ASN A 1 40 ? -0.885  0.748   3.024   1.00 1.56  ? 1142 ASN A HB3  4  
ATOM   2464  H  HD21 . ASN A 1 40 ? -1.028  0.846   6.493   1.00 2.20  ? 1142 ASN A HD21 4  
ATOM   2465  H  HD22 . ASN A 1 40 ? -0.468  2.472   6.671   1.00 2.44  ? 1142 ASN A HD22 4  
ATOM   2466  N  N    . CYS A 1 41 ? -4.667  1.670   2.658   1.00 0.76  ? 1143 CYS A N    4  
ATOM   2467  C  CA   . CYS A 1 41 ? -5.301  2.626   1.764   1.00 0.99  ? 1143 CYS A CA   4  
ATOM   2468  C  C    . CYS A 1 41 ? -6.639  3.077   2.338   1.00 1.29  ? 1143 CYS A C    4  
ATOM   2469  O  O    . CYS A 1 41 ? -7.699  2.673   1.855   1.00 1.67  ? 1143 CYS A O    4  
ATOM   2470  C  CB   . CYS A 1 41 ? -5.491  2.005   0.374   1.00 0.93  ? 1143 CYS A CB   4  
ATOM   2471  S  SG   . CYS A 1 41 ? -6.198  3.139   -0.871  1.00 1.10  ? 1143 CYS A SG   4  
ATOM   2472  H  H    . CYS A 1 41 ? -5.217  0.979   3.082   1.00 0.89  ? 1143 CYS A H    4  
ATOM   2473  H  HA   . CYS A 1 41 ? -4.650  3.483   1.682   1.00 1.23  ? 1143 CYS A HA   4  
ATOM   2474  H  HB2  . CYS A 1 41 ? -4.534  1.671   0.004   1.00 0.98  ? 1143 CYS A HB2  4  
ATOM   2475  H  HB3  . CYS A 1 41 ? -6.153  1.154   0.459   1.00 1.29  ? 1143 CYS A HB3  4  
ATOM   2476  N  N    . ASN A 1 42 ? -6.560  3.893   3.394   1.00 1.87  ? 1144 ASN A N    4  
ATOM   2477  C  CA   . ASN A 1 42 ? -7.722  4.490   4.079   1.00 2.36  ? 1144 ASN A CA   4  
ATOM   2478  C  C    . ASN A 1 42 ? -8.799  3.463   4.453   1.00 3.05  ? 1144 ASN A C    4  
ATOM   2479  O  O    . ASN A 1 42 ? -8.614  2.250   4.295   1.00 3.73  ? 1144 ASN A O    4  
ATOM   2480  C  CB   . ASN A 1 42 ? -8.336  5.649   3.262   1.00 3.11  ? 1144 ASN A CB   4  
ATOM   2481  C  CG   . ASN A 1 42 ? -9.150  5.214   2.052   1.00 3.87  ? 1144 ASN A CG   4  
ATOM   2482  O  OD1  . ASN A 1 42 ? -10.326 4.879   2.170   1.00 4.27  ? 1144 ASN A OD1  4  
ATOM   2483  N  ND2  . ASN A 1 42 ? -8.547  5.261   0.875   1.00 4.59  ? 1144 ASN A ND2  4  
ATOM   2484  H  H    . ASN A 1 42 ? -5.667  4.108   3.739   1.00 2.27  ? 1144 ASN A H    4  
ATOM   2485  H  HA   . ASN A 1 42 ? -7.345  4.905   5.001   1.00 2.42  ? 1144 ASN A HA   4  
ATOM   2486  H  HB2  . ASN A 1 42 ? -8.984  6.222   3.906   1.00 3.41  ? 1144 ASN A HB2  4  
ATOM   2487  H  HB3  . ASN A 1 42 ? -7.538  6.290   2.917   1.00 3.38  ? 1144 ASN A HB3  4  
ATOM   2488  H  HD21 . ASN A 1 42 ? -7.616  5.572   0.840   1.00 4.61  ? 1144 ASN A HD21 4  
ATOM   2489  H  HD22 . ASN A 1 42 ? -9.055  4.983   0.082   1.00 5.30  ? 1144 ASN A HD22 4  
ATOM   2490  N  N    . SER A 1 43 ? -9.907  3.974   4.998   1.00 3.53  ? 1145 SER A N    4  
ATOM   2491  C  CA   . SER A 1 43 ? -11.076 3.175   5.383   1.00 4.69  ? 1145 SER A CA   4  
ATOM   2492  C  C    . SER A 1 43 ? -10.705 2.010   6.309   1.00 5.23  ? 1145 SER A C    4  
ATOM   2493  O  O    . SER A 1 43 ? -9.602  1.955   6.861   1.00 5.32  ? 1145 SER A O    4  
ATOM   2494  C  CB   . SER A 1 43 ? -11.828 2.672   4.138   1.00 5.40  ? 1145 SER A CB   4  
ATOM   2495  O  OG   . SER A 1 43 ? -11.023 1.827   3.334   1.00 5.26  ? 1145 SER A OG   4  
ATOM   2496  H  H    . SER A 1 43 ? -9.941  4.941   5.154   1.00 3.45  ? 1145 SER A H    4  
ATOM   2497  H  HA   . SER A 1 43 ? -11.736 3.832   5.931   1.00 5.07  ? 1145 SER A HA   4  
ATOM   2498  H  HB2  . SER A 1 43 ? -12.701 2.118   4.450   1.00 6.23  ? 1145 SER A HB2  4  
ATOM   2499  H  HB3  . SER A 1 43 ? -12.136 3.520   3.546   1.00 5.56  ? 1145 SER A HB3  4  
ATOM   2500  H  HG   . SER A 1 43 ? -10.090 2.041   3.478   1.00 5.21  ? 1145 SER A HG   4  
ATOM   2501  N  N    . THR A 1 44 ? -11.633 1.081   6.487   1.00 5.97  ? 1146 THR A N    4  
ATOM   2502  C  CA   . THR A 1 44 ? -11.409 -0.055  7.361   1.00 6.81  ? 1146 THR A CA   4  
ATOM   2503  C  C    . THR A 1 44 ? -10.793 -1.226  6.600   1.00 7.34  ? 1146 THR A C    4  
ATOM   2504  O  O    . THR A 1 44 ? -11.193 -2.374  6.779   1.00 8.15  ? 1146 THR A O    4  
ATOM   2505  C  CB   . THR A 1 44 ? -12.719 -0.501  8.045   1.00 7.69  ? 1146 THR A CB   4  
ATOM   2506  O  OG1  . THR A 1 44 ? -13.789 -0.534  7.089   1.00 7.92  ? 1146 THR A OG1  4  
ATOM   2507  C  CG2  . THR A 1 44 ? -13.081 0.436   9.187   1.00 7.74  ? 1146 THR A CG2  4  
ATOM   2508  H  H    . THR A 1 44 ? -12.487 1.157   6.013   1.00 6.16  ? 1146 THR A H    4  
ATOM   2509  H  HA   . THR A 1 44 ? -10.718 0.255   8.132   1.00 6.75  ? 1146 THR A HA   4  
ATOM   2510  H  HB   . THR A 1 44 ? -12.578 -1.494  8.446   1.00 8.40  ? 1146 THR A HB   4  
ATOM   2511  H  HG1  . THR A 1 44 ? -13.520 -1.063  6.323   1.00 8.03  ? 1146 THR A HG1  4  
ATOM   2512  H  HG21 . THR A 1 44 ? -14.004 0.109   9.643   1.00 7.71  ? 1146 THR A HG21 4  
ATOM   2513  H  HG22 . THR A 1 44 ? -13.203 1.439   8.805   1.00 7.80  ? 1146 THR A HG22 4  
ATOM   2514  H  HG23 . THR A 1 44 ? -12.292 0.425   9.925   1.00 8.03  ? 1146 THR A HG23 4  
ATOM   2515  N  N    . GLU A 1 45 ? -9.821  -0.926  5.741   1.00 7.13  ? 1147 GLU A N    4  
ATOM   2516  C  CA   . GLU A 1 45 ? -9.086  -1.951  5.039   1.00 7.94  ? 1147 GLU A CA   4  
ATOM   2517  C  C    . GLU A 1 45 ? -8.152  -2.670  6.004   1.00 8.95  ? 1147 GLU A C    4  
ATOM   2518  O  O    . GLU A 1 45 ? -7.702  -3.788  5.748   1.00 9.87  ? 1147 GLU A O    4  
ATOM   2519  C  CB   . GLU A 1 45 ? -8.304  -1.329  3.892   1.00 7.79  ? 1147 GLU A CB   4  
ATOM   2520  C  CG   . GLU A 1 45 ? -9.178  -0.816  2.758   1.00 7.90  ? 1147 GLU A CG   4  
ATOM   2521  C  CD   . GLU A 1 45 ? -10.065 -1.893  2.166   1.00 8.00  ? 1147 GLU A CD   4  
ATOM   2522  O  OE1  . GLU A 1 45 ? -9.565  -2.700  1.353   1.00 8.08  ? 1147 GLU A OE1  4  
ATOM   2523  O  OE2  . GLU A 1 45 ? -11.269 -1.941  2.511   1.00 8.23  ? 1147 GLU A OE2  4  
ATOM   2524  H  H    . GLU A 1 45 ? -9.600  0.008   5.567   1.00 6.60  ? 1147 GLU A H    4  
ATOM   2525  H  HA   . GLU A 1 45 ? -9.794  -2.660  4.642   1.00 8.20  ? 1147 GLU A HA   4  
ATOM   2526  H  HB2  . GLU A 1 45 ? -7.729  -0.501  4.275   1.00 8.33  ? 1147 GLU A HB2  4  
ATOM   2527  H  HB3  . GLU A 1 45 ? -7.636  -2.061  3.499   1.00 7.37  ? 1147 GLU A HB3  4  
ATOM   2528  H  HG2  . GLU A 1 45 ? -9.807  -0.024  3.138   1.00 7.80  ? 1147 GLU A HG2  4  
ATOM   2529  H  HG3  . GLU A 1 45 ? -8.540  -0.426  1.980   1.00 8.35  ? 1147 GLU A HG3  4  
ATOM   2530  N  N    . THR A 1 46 ? -7.857  -2.004  7.112   1.00 8.94  ? 1148 THR A N    4  
ATOM   2531  C  CA   . THR A 1 46 ? -7.145  -2.623  8.208   1.00 10.03 ? 1148 THR A CA   4  
ATOM   2532  C  C    . THR A 1 46 ? -8.061  -3.630  8.896   1.00 10.71 ? 1148 THR A C    4  
ATOM   2533  O  O    . THR A 1 46 ? -8.969  -3.255  9.640   1.00 11.12 ? 1148 THR A O    4  
ATOM   2534  C  CB   . THR A 1 46 ? -6.661  -1.563  9.216   1.00 10.21 ? 1148 THR A CB   4  
ATOM   2535  O  OG1  . THR A 1 46 ? -7.713  -0.620  9.473   1.00 9.58  ? 1148 THR A OG1  4  
ATOM   2536  C  CG2  . THR A 1 46 ? -5.435  -0.830  8.689   1.00 11.01 ? 1148 THR A CG2  4  
ATOM   2537  H  H    . THR A 1 46 ? -8.136  -1.070  7.196   1.00 8.30  ? 1148 THR A H    4  
ATOM   2538  H  HA   . THR A 1 46 ? -6.285  -3.140  7.806   1.00 10.45 ? 1148 THR A HA   4  
ATOM   2539  H  HB   . THR A 1 46 ? -6.398  -2.058  10.140  1.00 10.48 ? 1148 THR A HB   4  
ATOM   2540  H  HG1  . THR A 1 46 ? -8.321  -0.996  10.123  1.00 9.43  ? 1148 THR A HG1  4  
ATOM   2541  H  HG21 . THR A 1 46 ? -5.115  -0.097  9.413   1.00 11.19 ? 1148 THR A HG21 4  
ATOM   2542  H  HG22 . THR A 1 46 ? -5.682  -0.337  7.762   1.00 11.07 ? 1148 THR A HG22 4  
ATOM   2543  H  HG23 . THR A 1 46 ? -4.638  -1.539  8.517   1.00 11.53 ? 1148 THR A HG23 4  
HETATM 2544  CA CA   . CA  B 2 .  ? -1.156  -2.865  -5.397  1.00 0.28  ? 1201 CA  A CA   4  
ATOM   2545  N  N    . THR A 1 1  ? 28.299  -4.485  4.032   1.00 12.23 ? 1103 THR A N    5  
ATOM   2546  C  CA   . THR A 1 1  ? 27.785  -3.104  3.924   1.00 11.73 ? 1103 THR A CA   5  
ATOM   2547  C  C    . THR A 1 1  ? 26.633  -2.892  4.903   1.00 10.83 ? 1103 THR A C    5  
ATOM   2548  O  O    . THR A 1 1  ? 26.065  -3.857  5.420   1.00 10.67 ? 1103 THR A O    5  
ATOM   2549  C  CB   . THR A 1 1  ? 27.317  -2.790  2.481   1.00 11.83 ? 1103 THR A CB   5  
ATOM   2550  O  OG1  . THR A 1 1  ? 26.976  -1.402  2.356   1.00 12.26 ? 1103 THR A OG1  5  
ATOM   2551  C  CG2  . THR A 1 1  ? 26.118  -3.643  2.091   1.00 12.04 ? 1103 THR A CG2  5  
ATOM   2552  H  H1   . THR A 1 1  ? 28.666  -4.654  4.990   1.00 12.23 ? 1103 THR A H1   5  
ATOM   2553  H  H2   . THR A 1 1  ? 29.066  -4.638  3.346   1.00 12.55 ? 1103 THR A H2   5  
ATOM   2554  H  H3   . THR A 1 1  ? 27.538  -5.165  3.843   1.00 12.44 ? 1103 THR A H3   5  
ATOM   2555  H  HA   . THR A 1 1  ? 28.585  -2.425  4.178   1.00 12.16 ? 1103 THR A HA   5  
ATOM   2556  H  HB   . THR A 1 1  ? 28.129  -3.012  1.803   1.00 11.67 ? 1103 THR A HB   5  
ATOM   2557  H  HG1  . THR A 1 1  ? 26.800  -1.197  1.429   1.00 12.30 ? 1103 THR A HG1  5  
ATOM   2558  H  HG21 . THR A 1 1  ? 26.400  -4.685  2.101   1.00 12.31 ? 1103 THR A HG21 5  
ATOM   2559  H  HG22 . THR A 1 1  ? 25.790  -3.369  1.099   1.00 12.05 ? 1103 THR A HG22 5  
ATOM   2560  H  HG23 . THR A 1 1  ? 25.315  -3.479  2.794   1.00 12.10 ? 1103 THR A HG23 5  
ATOM   2561  N  N    . HIS A 1 2  ? 26.302  -1.634  5.165   1.00 10.41 ? 1104 HIS A N    5  
ATOM   2562  C  CA   . HIS A 1 2  ? 25.209  -1.299  6.064   1.00 9.72  ? 1104 HIS A CA   5  
ATOM   2563  C  C    . HIS A 1 2  ? 24.201  -0.409  5.344   1.00 8.65  ? 1104 HIS A C    5  
ATOM   2564  O  O    . HIS A 1 2  ? 24.151  0.804   5.558   1.00 8.32  ? 1104 HIS A O    5  
ATOM   2565  C  CB   . HIS A 1 2  ? 25.744  -0.600  7.322   1.00 10.05 ? 1104 HIS A CB   5  
ATOM   2566  C  CG   . HIS A 1 2  ? 24.698  -0.335  8.366   1.00 10.43 ? 1104 HIS A CG   5  
ATOM   2567  N  ND1  . HIS A 1 2  ? 24.136  0.907   8.571   1.00 10.71 ? 1104 HIS A ND1  5  
ATOM   2568  C  CD2  . HIS A 1 2  ? 24.120  -1.158  9.271   1.00 10.84 ? 1104 HIS A CD2  5  
ATOM   2569  C  CE1  . HIS A 1 2  ? 23.259  0.834   9.552   1.00 11.25 ? 1104 HIS A CE1  5  
ATOM   2570  N  NE2  . HIS A 1 2  ? 23.228  -0.407  9.995   1.00 11.34 ? 1104 HIS A NE2  5  
ATOM   2571  H  H    . HIS A 1 2  ? 26.804  -0.906  4.729   1.00 10.71 ? 1104 HIS A H    5  
ATOM   2572  H  HA   . HIS A 1 2  ? 24.721  -2.220  6.350   1.00 9.96  ? 1104 HIS A HA   5  
ATOM   2573  H  HB2  . HIS A 1 2  ? 26.507  -1.219  7.769   1.00 10.50 ? 1104 HIS A HB2  5  
ATOM   2574  H  HB3  . HIS A 1 2  ? 26.178  0.346   7.038   1.00 9.81  ? 1104 HIS A HB3  5  
ATOM   2575  H  HD1  . HIS A 1 2  ? 24.356  1.728   8.075   1.00 10.68 ? 1104 HIS A HD1  5  
ATOM   2576  H  HD2  . HIS A 1 2  ? 24.321  -2.211  9.400   1.00 10.94 ? 1104 HIS A HD2  5  
ATOM   2577  H  HE1  . HIS A 1 2  ? 22.665  1.654   9.930   1.00 11.71 ? 1104 HIS A HE1  5  
ATOM   2578  H  HE2  . HIS A 1 2  ? 22.546  -0.769  10.602  1.00 11.83 ? 1104 HIS A HE2  5  
ATOM   2579  N  N    . ALA A 1 3  ? 23.418  -1.019  4.471   1.00 8.30  ? 1105 ALA A N    5  
ATOM   2580  C  CA   . ALA A 1 3  ? 22.407  -0.299  3.718   1.00 7.41  ? 1105 ALA A CA   5  
ATOM   2581  C  C    . ALA A 1 3  ? 21.035  -0.513  4.343   1.00 6.47  ? 1105 ALA A C    5  
ATOM   2582  O  O    . ALA A 1 3  ? 20.649  -1.649  4.630   1.00 6.54  ? 1105 ALA A O    5  
ATOM   2583  C  CB   . ALA A 1 3  ? 22.409  -0.750  2.264   1.00 7.70  ? 1105 ALA A CB   5  
ATOM   2584  H  H    . ALA A 1 3  ? 23.511  -1.989  4.342   1.00 8.79  ? 1105 ALA A H    5  
ATOM   2585  H  HA   . ALA A 1 3  ? 22.649  0.752   3.749   1.00 7.45  ? 1105 ALA A HA   5  
ATOM   2586  H  HB1  . ALA A 1 3  ? 22.157  -1.798  2.211   1.00 7.93  ? 1105 ALA A HB1  5  
ATOM   2587  H  HB2  . ALA A 1 3  ? 23.391  -0.595  1.842   1.00 7.73  ? 1105 ALA A HB2  5  
ATOM   2588  H  HB3  . ALA A 1 3  ? 21.683  -0.175  1.708   1.00 7.95  ? 1105 ALA A HB3  5  
ATOM   2589  N  N    . PRO A 1 4  ? 20.291  0.572   4.589   1.00 5.80  ? 1106 PRO A N    5  
ATOM   2590  C  CA   . PRO A 1 4  ? 18.942  0.486   5.142   1.00 4.97  ? 1106 PRO A CA   5  
ATOM   2591  C  C    . PRO A 1 4  ? 17.939  -0.016  4.109   1.00 4.25  ? 1106 PRO A C    5  
ATOM   2592  O  O    . PRO A 1 4  ? 18.129  0.170   2.902   1.00 4.22  ? 1106 PRO A O    5  
ATOM   2593  C  CB   . PRO A 1 4  ? 18.629  1.927   5.543   1.00 4.84  ? 1106 PRO A CB   5  
ATOM   2594  C  CG   . PRO A 1 4  ? 19.466  2.766   4.641   1.00 5.55  ? 1106 PRO A CG   5  
ATOM   2595  C  CD   . PRO A 1 4  ? 20.708  1.965   4.353   1.00 6.09  ? 1106 PRO A CD   5  
ATOM   2596  H  HA   . PRO A 1 4  ? 18.910  -0.151  6.014   1.00 5.32  ? 1106 PRO A HA   5  
ATOM   2597  H  HB2  . PRO A 1 4  ? 17.576  2.121   5.399   1.00 4.32  ? 1106 PRO A HB2  5  
ATOM   2598  H  HB3  . PRO A 1 4  ? 18.891  2.080   6.578   1.00 5.12  ? 1106 PRO A HB3  5  
ATOM   2599  H  HG2  . PRO A 1 4  ? 18.930  2.966   3.725   1.00 5.52  ? 1106 PRO A HG2  5  
ATOM   2600  H  HG3  . PRO A 1 4  ? 19.723  3.691   5.134   1.00 6.00  ? 1106 PRO A HG3  5  
ATOM   2601  H  HD2  . PRO A 1 4  ? 21.017  2.106   3.329   1.00 6.19  ? 1106 PRO A HD2  5  
ATOM   2602  H  HD3  . PRO A 1 4  ? 21.502  2.246   5.028   1.00 6.80  ? 1106 PRO A HD3  5  
ATOM   2603  N  N    . ALA A 1 5  ? 16.867  -0.633  4.587   1.00 4.09  ? 1107 ALA A N    5  
ATOM   2604  C  CA   . ALA A 1 5  ? 15.861  -1.225  3.713   1.00 3.77  ? 1107 ALA A CA   5  
ATOM   2605  C  C    . ALA A 1 5  ? 14.897  -0.171  3.174   1.00 2.63  ? 1107 ALA A C    5  
ATOM   2606  O  O    . ALA A 1 5  ? 13.692  -0.405  3.063   1.00 2.62  ? 1107 ALA A O    5  
ATOM   2607  C  CB   . ALA A 1 5  ? 15.099  -2.316  4.452   1.00 4.73  ? 1107 ALA A CB   5  
ATOM   2608  H  H    . ALA A 1 5  ? 16.746  -0.689  5.559   1.00 4.51  ? 1107 ALA A H    5  
ATOM   2609  H  HA   . ALA A 1 5  ? 16.377  -1.683  2.880   1.00 4.04  ? 1107 ALA A HA   5  
ATOM   2610  H  HB1  . ALA A 1 5  ? 14.414  -2.800  3.771   1.00 5.01  ? 1107 ALA A HB1  5  
ATOM   2611  H  HB2  . ALA A 1 5  ? 14.547  -1.877  5.269   1.00 4.95  ? 1107 ALA A HB2  5  
ATOM   2612  H  HB3  . ALA A 1 5  ? 15.797  -3.043  4.837   1.00 5.29  ? 1107 ALA A HB3  5  
ATOM   2613  N  N    . SER A 1 6  ? 15.436  0.984   2.836   1.00 2.16  ? 1108 SER A N    5  
ATOM   2614  C  CA   . SER A 1 6  ? 14.651  2.061   2.277   1.00 1.43  ? 1108 SER A CA   5  
ATOM   2615  C  C    . SER A 1 6  ? 14.537  1.897   0.765   1.00 1.29  ? 1108 SER A C    5  
ATOM   2616  O  O    . SER A 1 6  ? 15.546  1.788   0.063   1.00 1.97  ? 1108 SER A O    5  
ATOM   2617  C  CB   . SER A 1 6  ? 15.296  3.400   2.636   1.00 2.09  ? 1108 SER A CB   5  
ATOM   2618  O  OG   . SER A 1 6  ? 16.688  3.382   2.362   1.00 2.97  ? 1108 SER A OG   5  
ATOM   2619  H  H    . SER A 1 6  ? 16.401  1.114   2.958   1.00 2.71  ? 1108 SER A H    5  
ATOM   2620  H  HA   . SER A 1 6  ? 13.665  2.015   2.710   1.00 1.32  ? 1108 SER A HA   5  
ATOM   2621  H  HB2  . SER A 1 6  ? 14.837  4.185   2.056   1.00 2.36  ? 1108 SER A HB2  5  
ATOM   2622  H  HB3  . SER A 1 6  ? 15.151  3.597   3.688   1.00 2.13  ? 1108 SER A HB3  5  
ATOM   2623  H  HG   . SER A 1 6  ? 16.828  3.571   1.427   1.00 3.32  ? 1108 SER A HG   5  
ATOM   2624  N  N    . CYS A 1 7  ? 13.309  1.855   0.273   1.00 0.72  ? 1109 CYS A N    5  
ATOM   2625  C  CA   . CYS A 1 7  ? 13.059  1.675   -1.150  1.00 0.49  ? 1109 CYS A CA   5  
ATOM   2626  C  C    . CYS A 1 7  ? 13.271  2.981   -1.907  1.00 0.46  ? 1109 CYS A C    5  
ATOM   2627  O  O    . CYS A 1 7  ? 13.663  3.992   -1.321  1.00 0.62  ? 1109 CYS A O    5  
ATOM   2628  C  CB   . CYS A 1 7  ? 11.636  1.159   -1.379  1.00 0.33  ? 1109 CYS A CB   5  
ATOM   2629  S  SG   . CYS A 1 7  ? 11.283  -0.438  -0.573  1.00 0.47  ? 1109 CYS A SG   5  
ATOM   2630  H  H    . CYS A 1 7  ? 12.547  1.948   0.883   1.00 0.94  ? 1109 CYS A H    5  
ATOM   2631  H  HA   . CYS A 1 7  ? 13.760  0.944   -1.521  1.00 0.60  ? 1109 CYS A HA   5  
ATOM   2632  H  HB2  . CYS A 1 7  ? 10.931  1.882   -0.993  1.00 0.41  ? 1109 CYS A HB2  5  
ATOM   2633  H  HB3  . CYS A 1 7  ? 11.472  1.036   -2.440  1.00 0.29  ? 1109 CYS A HB3  5  
ATOM   2634  N  N    . LEU A 1 8  ? 13.015  2.951   -3.208  1.00 0.34  ? 1110 LEU A N    5  
ATOM   2635  C  CA   . LEU A 1 8  ? 13.130  4.134   -4.055  1.00 0.32  ? 1110 LEU A CA   5  
ATOM   2636  C  C    . LEU A 1 8  ? 12.210  5.242   -3.550  1.00 0.29  ? 1110 LEU A C    5  
ATOM   2637  O  O    . LEU A 1 8  ? 11.283  4.974   -2.783  1.00 0.30  ? 1110 LEU A O    5  
ATOM   2638  C  CB   . LEU A 1 8  ? 12.728  3.763   -5.479  1.00 0.28  ? 1110 LEU A CB   5  
ATOM   2639  C  CG   . LEU A 1 8  ? 13.416  4.516   -6.614  1.00 0.38  ? 1110 LEU A CG   5  
ATOM   2640  C  CD1  . LEU A 1 8  ? 14.915  4.254   -6.607  1.00 0.52  ? 1110 LEU A CD1  5  
ATOM   2641  C  CD2  . LEU A 1 8  ? 12.800  4.100   -7.940  1.00 0.39  ? 1110 LEU A CD2  5  
ATOM   2642  H  H    . LEU A 1 8  ? 12.742  2.102   -3.618  1.00 0.34  ? 1110 LEU A H    5  
ATOM   2643  H  HA   . LEU A 1 8  ? 14.153  4.474   -4.042  1.00 0.40  ? 1110 LEU A HA   5  
ATOM   2644  H  HB2  . LEU A 1 8  ? 12.906  2.710   -5.612  1.00 0.32  ? 1110 LEU A HB2  5  
ATOM   2645  H  HB3  . LEU A 1 8  ? 11.665  3.933   -5.571  1.00 0.22  ? 1110 LEU A HB3  5  
ATOM   2646  H  HG   . LEU A 1 8  ? 13.257  5.576   -6.487  1.00 0.41  ? 1110 LEU A HG   5  
ATOM   2647  H  HD11 . LEU A 1 8  ? 15.345  4.638   -5.694  1.00 1.05  ? 1110 LEU A HD11 5  
ATOM   2648  H  HD12 . LEU A 1 8  ? 15.370  4.748   -7.453  1.00 1.29  ? 1110 LEU A HD12 5  
ATOM   2649  H  HD13 . LEU A 1 8  ? 15.095  3.192   -6.671  1.00 1.07  ? 1110 LEU A HD13 5  
ATOM   2650  H  HD21 . LEU A 1 8  ? 11.751  4.357   -7.945  1.00 1.11  ? 1110 LEU A HD21 5  
ATOM   2651  H  HD22 . LEU A 1 8  ? 12.907  3.031   -8.065  1.00 1.05  ? 1110 LEU A HD22 5  
ATOM   2652  H  HD23 . LEU A 1 8  ? 13.303  4.611   -8.747  1.00 0.97  ? 1110 LEU A HD23 5  
ATOM   2653  N  N    . ASP A 1 9  ? 12.441  6.471   -3.980  1.00 0.35  ? 1111 ASP A N    5  
ATOM   2654  C  CA   . ASP A 1 9  ? 11.555  7.565   -3.606  1.00 0.38  ? 1111 ASP A CA   5  
ATOM   2655  C  C    . ASP A 1 9  ? 10.146  7.288   -4.107  1.00 0.32  ? 1111 ASP A C    5  
ATOM   2656  O  O    . ASP A 1 9  ? 9.178   7.377   -3.355  1.00 0.42  ? 1111 ASP A O    5  
ATOM   2657  C  CB   . ASP A 1 9  ? 12.050  8.894   -4.170  1.00 0.51  ? 1111 ASP A CB   5  
ATOM   2658  C  CG   . ASP A 1 9  ? 11.151  10.049  -3.777  1.00 1.37  ? 1111 ASP A CG   5  
ATOM   2659  O  OD1  . ASP A 1 9  ? 11.208  10.479  -2.605  1.00 1.53  ? 1111 ASP A OD1  5  
ATOM   2660  O  OD2  . ASP A 1 9  ? 10.384  10.532  -4.638  1.00 2.32  ? 1111 ASP A OD2  5  
ATOM   2661  H  H    . ASP A 1 9  ? 13.223  6.650   -4.548  1.00 0.40  ? 1111 ASP A H    5  
ATOM   2662  H  HA   . ASP A 1 9  ? 11.538  7.623   -2.529  1.00 0.44  ? 1111 ASP A HA   5  
ATOM   2663  H  HB2  . ASP A 1 9  ? 13.043  9.090   -3.796  1.00 0.94  ? 1111 ASP A HB2  5  
ATOM   2664  H  HB3  . ASP A 1 9  ? 12.079  8.833   -5.247  1.00 1.01  ? 1111 ASP A HB3  5  
ATOM   2665  N  N    . THR A 1 10 ? 10.048  6.905   -5.372  1.00 0.28  ? 1112 THR A N    5  
ATOM   2666  C  CA   . THR A 1 10 ? 8.763   6.618   -5.989  1.00 0.31  ? 1112 THR A CA   5  
ATOM   2667  C  C    . THR A 1 10 ? 8.288   5.207   -5.666  1.00 0.24  ? 1112 THR A C    5  
ATOM   2668  O  O    . THR A 1 10 ? 7.192   4.805   -6.063  1.00 0.30  ? 1112 THR A O    5  
ATOM   2669  C  CB   . THR A 1 10 ? 8.836   6.787   -7.513  1.00 0.42  ? 1112 THR A CB   5  
ATOM   2670  O  OG1  . THR A 1 10 ? 9.976   6.081   -8.025  1.00 0.45  ? 1112 THR A OG1  5  
ATOM   2671  C  CG2  . THR A 1 10 ? 8.927   8.255   -7.887  1.00 0.52  ? 1112 THR A CG2  5  
ATOM   2672  H  H    . THR A 1 10 ? 10.863  6.815   -5.909  1.00 0.31  ? 1112 THR A H    5  
ATOM   2673  H  HA   . THR A 1 10 ? 8.043   7.325   -5.605  1.00 0.36  ? 1112 THR A HA   5  
ATOM   2674  H  HB   . THR A 1 10 ? 7.939   6.373   -7.950  1.00 0.48  ? 1112 THR A HB   5  
ATOM   2675  H  HG1  . THR A 1 10 ? 10.657  6.714   -8.280  1.00 0.95  ? 1112 THR A HG1  5  
ATOM   2676  H  HG21 . THR A 1 10 ? 8.063   8.778   -7.504  1.00 1.19  ? 1112 THR A HG21 5  
ATOM   2677  H  HG22 . THR A 1 10 ? 8.959   8.351   -8.961  1.00 1.09  ? 1112 THR A HG22 5  
ATOM   2678  H  HG23 . THR A 1 10 ? 9.823   8.681   -7.460  1.00 1.17  ? 1112 THR A HG23 5  
ATOM   2679  N  N    . GLN A 1 11 ? 9.111   4.448   -4.954  1.00 0.18  ? 1113 GLN A N    5  
ATOM   2680  C  CA   . GLN A 1 11 ? 8.728   3.115   -4.552  1.00 0.17  ? 1113 GLN A CA   5  
ATOM   2681  C  C    . GLN A 1 11 ? 8.059   3.113   -3.193  1.00 0.17  ? 1113 GLN A C    5  
ATOM   2682  O  O    . GLN A 1 11 ? 8.306   3.978   -2.352  1.00 0.23  ? 1113 GLN A O    5  
ATOM   2683  C  CB   . GLN A 1 11 ? 9.927   2.177   -4.531  1.00 0.17  ? 1113 GLN A CB   5  
ATOM   2684  C  CG   . GLN A 1 11 ? 10.324  1.685   -5.907  1.00 0.23  ? 1113 GLN A CG   5  
ATOM   2685  C  CD   . GLN A 1 11 ? 11.399  0.619   -5.860  1.00 0.35  ? 1113 GLN A CD   5  
ATOM   2686  O  OE1  . GLN A 1 11 ? 12.218  0.583   -4.937  1.00 1.02  ? 1113 GLN A OE1  5  
ATOM   2687  N  NE2  . GLN A 1 11 ? 11.415  -0.246  -6.858  1.00 0.67  ? 1113 GLN A NE2  5  
ATOM   2688  H  H    . GLN A 1 11 ? 9.991   4.792   -4.695  1.00 0.20  ? 1113 GLN A H    5  
ATOM   2689  H  HA   . GLN A 1 11 ? 8.020   2.748   -5.280  1.00 0.22  ? 1113 GLN A HA   5  
ATOM   2690  H  HB2  . GLN A 1 11 ? 10.770  2.697   -4.099  1.00 0.16  ? 1113 GLN A HB2  5  
ATOM   2691  H  HB3  . GLN A 1 11 ? 9.691   1.323   -3.919  1.00 0.20  ? 1113 GLN A HB3  5  
ATOM   2692  H  HG2  . GLN A 1 11 ? 9.451   1.277   -6.382  1.00 0.31  ? 1113 GLN A HG2  5  
ATOM   2693  H  HG3  . GLN A 1 11 ? 10.689  2.520   -6.486  1.00 0.22  ? 1113 GLN A HG3  5  
ATOM   2694  H  HE21 . GLN A 1 11 ? 10.737  -0.153  -7.563  1.00 1.21  ? 1113 GLN A HE21 5  
ATOM   2695  H  HE22 . GLN A 1 11 ? 12.111  -0.937  -6.863  1.00 0.65  ? 1113 GLN A HE22 5  
ATOM   2696  N  N    . TYR A 1 12 ? 7.212   2.126   -3.002  1.00 0.15  ? 1114 TYR A N    5  
ATOM   2697  C  CA   . TYR A 1 12 ? 6.514   1.931   -1.749  1.00 0.16  ? 1114 TYR A CA   5  
ATOM   2698  C  C    . TYR A 1 12 ? 7.190   0.815   -0.977  1.00 0.15  ? 1114 TYR A C    5  
ATOM   2699  O  O    . TYR A 1 12 ? 7.721   -0.124  -1.571  1.00 0.15  ? 1114 TYR A O    5  
ATOM   2700  C  CB   . TYR A 1 12 ? 5.052   1.571   -2.009  1.00 0.18  ? 1114 TYR A CB   5  
ATOM   2701  C  CG   . TYR A 1 12 ? 4.212   1.393   -0.761  1.00 0.22  ? 1114 TYR A CG   5  
ATOM   2702  C  CD1  . TYR A 1 12 ? 3.729   2.488   -0.056  1.00 0.33  ? 1114 TYR A CD1  5  
ATOM   2703  C  CD2  . TYR A 1 12 ? 3.892   0.122   -0.298  1.00 0.21  ? 1114 TYR A CD2  5  
ATOM   2704  C  CE1  . TYR A 1 12 ? 2.954   2.320   1.077   1.00 0.39  ? 1114 TYR A CE1  5  
ATOM   2705  C  CE2  . TYR A 1 12 ? 3.119   -0.053  0.832   1.00 0.26  ? 1114 TYR A CE2  5  
ATOM   2706  C  CZ   . TYR A 1 12 ? 2.653   1.048   1.516   1.00 0.34  ? 1114 TYR A CZ   5  
ATOM   2707  O  OH   . TYR A 1 12 ? 1.884   0.876   2.646   1.00 0.41  ? 1114 TYR A OH   5  
ATOM   2708  H  H    . TYR A 1 12 ? 7.069   1.482   -3.737  1.00 0.16  ? 1114 TYR A H    5  
ATOM   2709  H  HA   . TYR A 1 12 ? 6.568   2.846   -1.181  1.00 0.18  ? 1114 TYR A HA   5  
ATOM   2710  H  HB2  . TYR A 1 12 ? 4.595   2.345   -2.607  1.00 0.23  ? 1114 TYR A HB2  5  
ATOM   2711  H  HB3  . TYR A 1 12 ? 5.027   0.644   -2.550  1.00 0.18  ? 1114 TYR A HB3  5  
ATOM   2712  H  HD1  . TYR A 1 12 ? 3.968   3.482   -0.402  1.00 0.40  ? 1114 TYR A HD1  5  
ATOM   2713  H  HD2  . TYR A 1 12 ? 4.259   -0.740  -0.835  1.00 0.23  ? 1114 TYR A HD2  5  
ATOM   2714  H  HE1  . TYR A 1 12 ? 2.588   3.184   1.612   1.00 0.50  ? 1114 TYR A HE1  5  
ATOM   2715  H  HE2  . TYR A 1 12 ? 2.883   -1.050  1.176   1.00 0.29  ? 1114 TYR A HE2  5  
ATOM   2716  H  HH   . TYR A 1 12 ? 1.131   1.473   2.613   1.00 0.89  ? 1114 TYR A HH   5  
ATOM   2717  N  N    . THR A 1 13 ? 7.159   0.919   0.332   1.00 0.18  ? 1115 THR A N    5  
ATOM   2718  C  CA   . THR A 1 13 ? 7.763   -0.082  1.188   1.00 0.20  ? 1115 THR A CA   5  
ATOM   2719  C  C    . THR A 1 13 ? 6.678   -0.839  1.937   1.00 0.23  ? 1115 THR A C    5  
ATOM   2720  O  O    . THR A 1 13 ? 6.064   -0.307  2.864   1.00 0.31  ? 1115 THR A O    5  
ATOM   2721  C  CB   . THR A 1 13 ? 8.738   0.553   2.199   1.00 0.26  ? 1115 THR A CB   5  
ATOM   2722  O  OG1  . THR A 1 13 ? 9.571   1.510   1.530   1.00 0.30  ? 1115 THR A OG1  5  
ATOM   2723  C  CG2  . THR A 1 13 ? 9.609   -0.513  2.854   1.00 0.27  ? 1115 THR A CG2  5  
ATOM   2724  H  H    . THR A 1 13 ? 6.694   1.681   0.734   1.00 0.22  ? 1115 THR A H    5  
ATOM   2725  H  HA   . THR A 1 13 ? 8.313   -0.773  0.564   1.00 0.19  ? 1115 THR A HA   5  
ATOM   2726  H  HB   . THR A 1 13 ? 8.167   1.054   2.966   1.00 0.31  ? 1115 THR A HB   5  
ATOM   2727  H  HG1  . THR A 1 13 ? 9.014   2.111   1.015   1.00 0.82  ? 1115 THR A HG1  5  
ATOM   2728  H  HG21 . THR A 1 13 ? 8.981   -1.246  3.339   1.00 1.01  ? 1115 THR A HG21 5  
ATOM   2729  H  HG22 . THR A 1 13 ? 10.253  -0.051  3.587   1.00 1.02  ? 1115 THR A HG22 5  
ATOM   2730  H  HG23 . THR A 1 13 ? 10.211  -0.999  2.100   1.00 1.10  ? 1115 THR A HG23 5  
ATOM   2731  N  N    . CYS A 1 14 ? 6.419   -2.067  1.507   1.00 0.26  ? 1116 CYS A N    5  
ATOM   2732  C  CA   . CYS A 1 14 ? 5.414   -2.906  2.144   1.00 0.34  ? 1116 CYS A CA   5  
ATOM   2733  C  C    . CYS A 1 14 ? 5.742   -3.150  3.611   1.00 0.40  ? 1116 CYS A C    5  
ATOM   2734  O  O    . CYS A 1 14 ? 6.894   -2.993  4.022   1.00 0.37  ? 1116 CYS A O    5  
ATOM   2735  C  CB   . CYS A 1 14 ? 5.303   -4.242  1.420   1.00 0.45  ? 1116 CYS A CB   5  
ATOM   2736  S  SG   . CYS A 1 14 ? 4.753   -4.104  -0.307  1.00 0.65  ? 1116 CYS A SG   5  
ATOM   2737  H  H    . CYS A 1 14 ? 6.909   -2.412  0.724   1.00 0.28  ? 1116 CYS A H    5  
ATOM   2738  H  HA   . CYS A 1 14 ? 4.465   -2.394  2.081   1.00 0.38  ? 1116 CYS A HA   5  
ATOM   2739  H  HB2  . CYS A 1 14 ? 6.270   -4.722  1.420   1.00 0.50  ? 1116 CYS A HB2  5  
ATOM   2740  H  HB3  . CYS A 1 14 ? 4.598   -4.868  1.943   1.00 0.54  ? 1116 CYS A HB3  5  
ATOM   2741  N  N    . ASP A 1 15 ? 4.744   -3.540  4.391   1.00 0.56  ? 1117 ASP A N    5  
ATOM   2742  C  CA   . ASP A 1 15 ? 4.942   -3.786  5.818   1.00 0.69  ? 1117 ASP A CA   5  
ATOM   2743  C  C    . ASP A 1 15 ? 6.042   -4.823  6.035   1.00 0.65  ? 1117 ASP A C    5  
ATOM   2744  O  O    . ASP A 1 15 ? 6.937   -4.631  6.857   1.00 0.71  ? 1117 ASP A O    5  
ATOM   2745  C  CB   . ASP A 1 15 ? 3.635   -4.247  6.465   1.00 0.93  ? 1117 ASP A CB   5  
ATOM   2746  C  CG   . ASP A 1 15 ? 3.769   -4.454  7.963   1.00 1.83  ? 1117 ASP A CG   5  
ATOM   2747  O  OD1  . ASP A 1 15 ? 4.123   -5.576  8.381   1.00 2.09  ? 1117 ASP A OD1  5  
ATOM   2748  O  OD2  . ASP A 1 15 ? 3.532   -3.500  8.731   1.00 2.62  ? 1117 ASP A OD2  5  
ATOM   2749  H  H    . ASP A 1 15 ? 3.849   -3.664  4.003   1.00 0.63  ? 1117 ASP A H    5  
ATOM   2750  H  HA   . ASP A 1 15 ? 5.249   -2.855  6.272   1.00 0.70  ? 1117 ASP A HA   5  
ATOM   2751  H  HB2  . ASP A 1 15 ? 2.876   -3.499  6.293   1.00 1.35  ? 1117 ASP A HB2  5  
ATOM   2752  H  HB3  . ASP A 1 15 ? 3.324   -5.177  6.015   1.00 0.70  ? 1117 ASP A HB3  5  
ATOM   2753  N  N    . ASN A 1 16 ? 6.001   -5.895  5.248   1.00 0.69  ? 1118 ASN A N    5  
ATOM   2754  C  CA   . ASN A 1 16 ? 7.000   -6.958  5.345   1.00 0.75  ? 1118 ASN A CA   5  
ATOM   2755  C  C    . ASN A 1 16 ? 8.262   -6.614  4.557   1.00 0.59  ? 1118 ASN A C    5  
ATOM   2756  O  O    . ASN A 1 16 ? 9.087   -7.485  4.277   1.00 0.65  ? 1118 ASN A O    5  
ATOM   2757  C  CB   . ASN A 1 16 ? 6.436   -8.292  4.842   1.00 0.98  ? 1118 ASN A CB   5  
ATOM   2758  C  CG   . ASN A 1 16 ? 5.278   -8.803  5.675   1.00 1.77  ? 1118 ASN A CG   5  
ATOM   2759  O  OD1  . ASN A 1 16 ? 5.175   -8.515  6.865   1.00 2.75  ? 1118 ASN A OD1  5  
ATOM   2760  N  ND2  . ASN A 1 16 ? 4.407   -9.582  5.055   1.00 2.02  ? 1118 ASN A ND2  5  
ATOM   2761  H  H    . ASN A 1 16 ? 5.274   -5.979  4.598   1.00 0.75  ? 1118 ASN A H    5  
ATOM   2762  H  HA   . ASN A 1 16 ? 7.263   -7.065  6.386   1.00 0.85  ? 1118 ASN A HA   5  
ATOM   2763  H  HB2  . ASN A 1 16 ? 6.091   -8.166  3.829   1.00 1.24  ? 1118 ASN A HB2  5  
ATOM   2764  H  HB3  . ASN A 1 16 ? 7.221   -9.034  4.858   1.00 1.41  ? 1118 ASN A HB3  5  
ATOM   2765  H  HD21 . ASN A 1 16 ? 4.560   -9.786  4.108   1.00 1.91  ? 1118 ASN A HD21 5  
ATOM   2766  H  HD22 . ASN A 1 16 ? 3.642   -9.920  5.567   1.00 2.74  ? 1118 ASN A HD22 5  
ATOM   2767  N  N    . HIS A 1 17 ? 8.401   -5.333  4.212   1.00 0.46  ? 1119 HIS A N    5  
ATOM   2768  C  CA   . HIS A 1 17 ? 9.558   -4.820  3.474   1.00 0.41  ? 1119 HIS A CA   5  
ATOM   2769  C  C    . HIS A 1 17 ? 9.619   -5.369  2.052   1.00 0.44  ? 1119 HIS A C    5  
ATOM   2770  O  O    . HIS A 1 17 ? 10.309  -6.349  1.773   1.00 0.79  ? 1119 HIS A O    5  
ATOM   2771  C  CB   . HIS A 1 17 ? 10.866  -5.108  4.222   1.00 0.51  ? 1119 HIS A CB   5  
ATOM   2772  C  CG   . HIS A 1 17 ? 11.043  -4.268  5.449   1.00 0.63  ? 1119 HIS A CG   5  
ATOM   2773  N  ND1  . HIS A 1 17 ? 10.783  -4.723  6.723   1.00 0.94  ? 1119 HIS A ND1  5  
ATOM   2774  C  CD2  . HIS A 1 17 ? 11.451  -2.985  5.587   1.00 0.78  ? 1119 HIS A CD2  5  
ATOM   2775  C  CE1  . HIS A 1 17 ? 11.022  -3.756  7.588   1.00 1.05  ? 1119 HIS A CE1  5  
ATOM   2776  N  NE2  . HIS A 1 17 ? 11.429  -2.690  6.925   1.00 0.93  ? 1119 HIS A NE2  5  
ATOM   2777  H  H    . HIS A 1 17 ? 7.693   -4.703  4.468   1.00 0.47  ? 1119 HIS A H    5  
ATOM   2778  H  HA   . HIS A 1 17 ? 9.437   -3.745  3.410   1.00 0.38  ? 1119 HIS A HA   5  
ATOM   2779  H  HB2  . HIS A 1 17 ? 10.881  -6.145  4.522   1.00 0.60  ? 1119 HIS A HB2  5  
ATOM   2780  H  HB3  . HIS A 1 17 ? 11.700  -4.915  3.561   1.00 0.55  ? 1119 HIS A HB3  5  
ATOM   2781  H  HD1  . HIS A 1 17 ? 10.469  -5.625  6.962   1.00 1.18  ? 1119 HIS A HD1  5  
ATOM   2782  H  HD2  . HIS A 1 17 ? 11.738  -2.315  4.789   1.00 1.00  ? 1119 HIS A HD2  5  
ATOM   2783  H  HE1  . HIS A 1 17 ? 10.908  -3.827  8.660   1.00 1.35  ? 1119 HIS A HE1  5  
ATOM   2784  H  HE2  . HIS A 1 17 ? 11.869  -1.911  7.335   1.00 1.09  ? 1119 HIS A HE2  5  
ATOM   2785  N  N    . GLN A 1 18 ? 8.883   -4.724  1.160   1.00 0.40  ? 1120 GLN A N    5  
ATOM   2786  C  CA   . GLN A 1 18 ? 8.905   -5.050  -0.259  1.00 0.38  ? 1120 GLN A CA   5  
ATOM   2787  C  C    . GLN A 1 18 ? 8.796   -3.763  -1.063  1.00 0.29  ? 1120 GLN A C    5  
ATOM   2788  O  O    . GLN A 1 18 ? 7.939   -2.928  -0.776  1.00 0.39  ? 1120 GLN A O    5  
ATOM   2789  C  CB   . GLN A 1 18 ? 7.753   -5.996  -0.617  1.00 0.49  ? 1120 GLN A CB   5  
ATOM   2790  C  CG   . GLN A 1 18 ? 7.705   -6.388  -2.087  1.00 0.50  ? 1120 GLN A CG   5  
ATOM   2791  C  CD   . GLN A 1 18 ? 8.917   -7.186  -2.528  1.00 1.05  ? 1120 GLN A CD   5  
ATOM   2792  O  OE1  . GLN A 1 18 ? 9.510   -7.926  -1.741  1.00 1.91  ? 1120 GLN A OE1  5  
ATOM   2793  N  NE2  . GLN A 1 18 ? 9.289   -7.045  -3.791  1.00 1.51  ? 1120 GLN A NE2  5  
ATOM   2794  H  H    . GLN A 1 18 ? 8.305   -3.994  1.465   1.00 0.63  ? 1120 GLN A H    5  
ATOM   2795  H  HA   . GLN A 1 18 ? 9.846   -5.529  -0.482  1.00 0.42  ? 1120 GLN A HA   5  
ATOM   2796  H  HB2  . GLN A 1 18 ? 7.852   -6.898  -0.032  1.00 0.62  ? 1120 GLN A HB2  5  
ATOM   2797  H  HB3  . GLN A 1 18 ? 6.819   -5.516  -0.365  1.00 0.52  ? 1120 GLN A HB3  5  
ATOM   2798  H  HG2  . GLN A 1 18 ? 6.821   -6.982  -2.258  1.00 0.87  ? 1120 GLN A HG2  5  
ATOM   2799  H  HG3  . GLN A 1 18 ? 7.650   -5.486  -2.683  1.00 0.86  ? 1120 GLN A HG3  5  
ATOM   2800  H  HE21 . GLN A 1 18 ? 8.770   -6.442  -4.365  1.00 1.83  ? 1120 GLN A HE21 5  
ATOM   2801  H  HE22 . GLN A 1 18 ? 10.072  -7.549  -4.105  1.00 1.99  ? 1120 GLN A HE22 5  
ATOM   2802  N  N    . CYS A 1 19 ? 9.669   -3.595  -2.043  1.00 0.21  ? 1121 CYS A N    5  
ATOM   2803  C  CA   . CYS A 1 19 ? 9.697   -2.372  -2.833  1.00 0.21  ? 1121 CYS A CA   5  
ATOM   2804  C  C    . CYS A 1 19 ? 8.880   -2.521  -4.112  1.00 0.20  ? 1121 CYS A C    5  
ATOM   2805  O  O    . CYS A 1 19 ? 9.241   -3.283  -5.008  1.00 0.34  ? 1121 CYS A O    5  
ATOM   2806  C  CB   . CYS A 1 19 ? 11.138  -1.998  -3.184  1.00 0.34  ? 1121 CYS A CB   5  
ATOM   2807  S  SG   . CYS A 1 19 ? 12.236  -1.795  -1.742  1.00 0.42  ? 1121 CYS A SG   5  
ATOM   2808  H  H    . CYS A 1 19 ? 10.315  -4.309  -2.242  1.00 0.29  ? 1121 CYS A H    5  
ATOM   2809  H  HA   . CYS A 1 19 ? 9.267   -1.583  -2.235  1.00 0.24  ? 1121 CYS A HA   5  
ATOM   2810  H  HB2  . CYS A 1 19 ? 11.561  -2.771  -3.808  1.00 0.39  ? 1121 CYS A HB2  5  
ATOM   2811  H  HB3  . CYS A 1 19 ? 11.137  -1.065  -3.730  1.00 0.41  ? 1121 CYS A HB3  5  
ATOM   2812  N  N    . ILE A 1 20 ? 7.769   -1.804  -4.178  1.00 0.15  ? 1122 ILE A N    5  
ATOM   2813  C  CA   . ILE A 1 20 ? 6.963   -1.733  -5.392  1.00 0.14  ? 1122 ILE A CA   5  
ATOM   2814  C  C    . ILE A 1 20 ? 6.795   -0.277  -5.794  1.00 0.14  ? 1122 ILE A C    5  
ATOM   2815  O  O    . ILE A 1 20 ? 7.348   0.599   -5.151  1.00 0.18  ? 1122 ILE A O    5  
ATOM   2816  C  CB   . ILE A 1 20 ? 5.570   -2.366  -5.209  1.00 0.14  ? 1122 ILE A CB   5  
ATOM   2817  C  CG1  . ILE A 1 20 ? 4.806   -1.651  -4.095  1.00 0.13  ? 1122 ILE A CG1  5  
ATOM   2818  C  CG2  . ILE A 1 20 ? 5.695   -3.852  -4.910  1.00 0.19  ? 1122 ILE A CG2  5  
ATOM   2819  C  CD1  . ILE A 1 20 ? 3.352   -2.040  -4.013  1.00 0.17  ? 1122 ILE A CD1  5  
ATOM   2820  H  H    . ILE A 1 20 ? 7.482   -1.295  -3.388  1.00 0.22  ? 1122 ILE A H    5  
ATOM   2821  H  HA   . ILE A 1 20 ? 7.482   -2.261  -6.177  1.00 0.17  ? 1122 ILE A HA   5  
ATOM   2822  H  HB   . ILE A 1 20 ? 5.026   -2.255  -6.134  1.00 0.16  ? 1122 ILE A HB   5  
ATOM   2823  H  HG12 . ILE A 1 20 ? 5.262   -1.889  -3.150  1.00 0.15  ? 1122 ILE A HG12 5  
ATOM   2824  H  HG13 . ILE A 1 20 ? 4.858   -0.585  -4.258  1.00 0.14  ? 1122 ILE A HG13 5  
ATOM   2825  H  HG21 . ILE A 1 20 ? 6.197   -4.344  -5.731  1.00 0.98  ? 1122 ILE A HG21 5  
ATOM   2826  H  HG22 . ILE A 1 20 ? 4.710   -4.278  -4.783  1.00 1.05  ? 1122 ILE A HG22 5  
ATOM   2827  H  HG23 . ILE A 1 20 ? 6.266   -3.990  -4.004  1.00 0.97  ? 1122 ILE A HG23 5  
ATOM   2828  H  HD11 . ILE A 1 20 ? 3.274   -3.107  -3.878  1.00 1.07  ? 1122 ILE A HD11 5  
ATOM   2829  H  HD12 . ILE A 1 20 ? 2.853   -1.755  -4.926  1.00 0.99  ? 1122 ILE A HD12 5  
ATOM   2830  H  HD13 . ILE A 1 20 ? 2.891   -1.536  -3.177  1.00 1.03  ? 1122 ILE A HD13 5  
ATOM   2831  N  N    . SER A 1 21 ? 6.039   -0.012  -6.841  1.00 0.16  ? 1123 SER A N    5  
ATOM   2832  C  CA   . SER A 1 21 ? 5.756   1.361   -7.230  1.00 0.17  ? 1123 SER A CA   5  
ATOM   2833  C  C    . SER A 1 21 ? 4.669   1.952   -6.337  1.00 0.15  ? 1123 SER A C    5  
ATOM   2834  O  O    . SER A 1 21 ? 3.733   1.258   -5.940  1.00 0.17  ? 1123 SER A O    5  
ATOM   2835  C  CB   . SER A 1 21 ? 5.314   1.418   -8.694  1.00 0.24  ? 1123 SER A CB   5  
ATOM   2836  O  OG   . SER A 1 21 ? 4.873   2.721   -9.045  1.00 0.33  ? 1123 SER A OG   5  
ATOM   2837  H  H    . SER A 1 21 ? 5.668   -0.749  -7.366  1.00 0.20  ? 1123 SER A H    5  
ATOM   2838  H  HA   . SER A 1 21 ? 6.661   1.937   -7.111  1.00 0.19  ? 1123 SER A HA   5  
ATOM   2839  H  HB2  . SER A 1 21 ? 6.145   1.150   -9.330  1.00 0.27  ? 1123 SER A HB2  5  
ATOM   2840  H  HB3  . SER A 1 21 ? 4.502   0.723   -8.852  1.00 0.24  ? 1123 SER A HB3  5  
ATOM   2841  H  HG   . SER A 1 21 ? 4.056   2.660   -9.550  1.00 0.63  ? 1123 SER A HG   5  
ATOM   2842  N  N    . LYS A 1 22 ? 4.798   3.240   -6.019  1.00 0.17  ? 1124 LYS A N    5  
ATOM   2843  C  CA   . LYS A 1 22 ? 3.763   3.945   -5.273  1.00 0.19  ? 1124 LYS A CA   5  
ATOM   2844  C  C    . LYS A 1 22 ? 2.502   4.081   -6.115  1.00 0.22  ? 1124 LYS A C    5  
ATOM   2845  O  O    . LYS A 1 22 ? 1.424   4.366   -5.596  1.00 0.25  ? 1124 LYS A O    5  
ATOM   2846  C  CB   . LYS A 1 22 ? 4.242   5.329   -4.830  1.00 0.23  ? 1124 LYS A CB   5  
ATOM   2847  C  CG   . LYS A 1 22 ? 5.200   5.298   -3.652  1.00 0.25  ? 1124 LYS A CG   5  
ATOM   2848  C  CD   . LYS A 1 22 ? 5.635   6.698   -3.255  1.00 0.25  ? 1124 LYS A CD   5  
ATOM   2849  C  CE   . LYS A 1 22 ? 6.511   6.676   -2.016  1.00 0.30  ? 1124 LYS A CE   5  
ATOM   2850  N  NZ   . LYS A 1 22 ? 6.980   8.035   -1.642  1.00 1.24  ? 1124 LYS A NZ   5  
ATOM   2851  H  H    . LYS A 1 22 ? 5.614   3.724   -6.289  1.00 0.20  ? 1124 LYS A H    5  
ATOM   2852  H  HA   . LYS A 1 22 ? 3.535   3.356   -4.398  1.00 0.19  ? 1124 LYS A HA   5  
ATOM   2853  H  HB2  . LYS A 1 22 ? 4.743   5.806   -5.659  1.00 0.30  ? 1124 LYS A HB2  5  
ATOM   2854  H  HB3  . LYS A 1 22 ? 3.383   5.921   -4.551  1.00 0.30  ? 1124 LYS A HB3  5  
ATOM   2855  H  HG2  . LYS A 1 22 ? 4.707   4.832   -2.811  1.00 0.37  ? 1124 LYS A HG2  5  
ATOM   2856  H  HG3  . LYS A 1 22 ? 6.072   4.722   -3.923  1.00 0.37  ? 1124 LYS A HG3  5  
ATOM   2857  H  HD2  . LYS A 1 22 ? 6.191   7.138   -4.070  1.00 0.32  ? 1124 LYS A HD2  5  
ATOM   2858  H  HD3  . LYS A 1 22 ? 4.757   7.294   -3.053  1.00 0.33  ? 1124 LYS A HD3  5  
ATOM   2859  H  HE2  . LYS A 1 22 ? 5.945   6.263   -1.197  1.00 0.93  ? 1124 LYS A HE2  5  
ATOM   2860  H  HE3  . LYS A 1 22 ? 7.370   6.049   -2.211  1.00 0.95  ? 1124 LYS A HE3  5  
ATOM   2861  H  HZ1  . LYS A 1 22 ? 7.497   8.000   -0.741  1.00 1.76  ? 1124 LYS A HZ1  5  
ATOM   2862  H  HZ2  . LYS A 1 22 ? 6.172   8.678   -1.540  1.00 1.77  ? 1124 LYS A HZ2  5  
ATOM   2863  H  HZ3  . LYS A 1 22 ? 7.616   8.408   -2.379  1.00 1.88  ? 1124 LYS A HZ3  5  
ATOM   2864  N  N    . ASN A 1 23 ? 2.642   3.867   -7.420  1.00 0.24  ? 1125 ASN A N    5  
ATOM   2865  C  CA   . ASN A 1 23 ? 1.497   3.895   -8.320  1.00 0.28  ? 1125 ASN A CA   5  
ATOM   2866  C  C    . ASN A 1 23 ? 0.704   2.601   -8.177  1.00 0.26  ? 1125 ASN A C    5  
ATOM   2867  O  O    . ASN A 1 23 ? -0.462  2.518   -8.560  1.00 0.32  ? 1125 ASN A O    5  
ATOM   2868  C  CB   . ASN A 1 23 ? 1.961   4.069   -9.769  1.00 0.36  ? 1125 ASN A CB   5  
ATOM   2869  C  CG   . ASN A 1 23 ? 0.820   4.367   -10.724 1.00 1.03  ? 1125 ASN A CG   5  
ATOM   2870  O  OD1  . ASN A 1 23 ? -0.186  4.963   -10.345 1.00 1.75  ? 1125 ASN A OD1  5  
ATOM   2871  N  ND2  . ASN A 1 23 ? 0.977   3.962   -11.973 1.00 1.69  ? 1125 ASN A ND2  5  
ATOM   2872  H  H    . ASN A 1 23 ? 3.539   3.692   -7.784  1.00 0.25  ? 1125 ASN A H    5  
ATOM   2873  H  HA   . ASN A 1 23 ? 0.868   4.727   -8.042  1.00 0.31  ? 1125 ASN A HA   5  
ATOM   2874  H  HB2  . ASN A 1 23 ? 2.666   4.882   -9.818  1.00 0.82  ? 1125 ASN A HB2  5  
ATOM   2875  H  HB3  . ASN A 1 23 ? 2.446   3.161   -10.094 1.00 0.82  ? 1125 ASN A HB3  5  
ATOM   2876  H  HD21 . ASN A 1 23 ? 1.810   3.498   -12.209 1.00 1.99  ? 1125 ASN A HD21 5  
ATOM   2877  H  HD22 . ASN A 1 23 ? 0.257   4.146   -12.616 1.00 2.22  ? 1125 ASN A HD22 5  
ATOM   2878  N  N    . TRP A 1 24 ? 1.348   1.596   -7.595  1.00 0.22  ? 1126 TRP A N    5  
ATOM   2879  C  CA   . TRP A 1 24 ? 0.740   0.285   -7.424  1.00 0.22  ? 1126 TRP A CA   5  
ATOM   2880  C  C    . TRP A 1 24 ? -0.014  0.211   -6.104  1.00 0.20  ? 1126 TRP A C    5  
ATOM   2881  O  O    . TRP A 1 24 ? -0.712  -0.759  -5.825  1.00 0.26  ? 1126 TRP A O    5  
ATOM   2882  C  CB   . TRP A 1 24 ? 1.807   -0.811  -7.473  1.00 0.25  ? 1126 TRP A CB   5  
ATOM   2883  C  CG   . TRP A 1 24 ? 2.480   -0.952  -8.806  1.00 0.31  ? 1126 TRP A CG   5  
ATOM   2884  C  CD1  . TRP A 1 24 ? 2.286   -0.181  -9.917  1.00 0.37  ? 1126 TRP A CD1  5  
ATOM   2885  C  CD2  . TRP A 1 24 ? 3.459   -1.934  -9.168  1.00 0.38  ? 1126 TRP A CD2  5  
ATOM   2886  N  NE1  . TRP A 1 24 ? 3.081   -0.626  -10.945 1.00 0.45  ? 1126 TRP A NE1  5  
ATOM   2887  C  CE2  . TRP A 1 24 ? 3.808   -1.701  -10.511 1.00 0.45  ? 1126 TRP A CE2  5  
ATOM   2888  C  CE3  . TRP A 1 24 ? 4.071   -2.989  -8.489  1.00 0.44  ? 1126 TRP A CE3  5  
ATOM   2889  C  CZ2  . TRP A 1 24 ? 4.743   -2.483  -11.183 1.00 0.54  ? 1126 TRP A CZ2  5  
ATOM   2890  C  CZ3  . TRP A 1 24 ? 4.999   -3.765  -9.155  1.00 0.55  ? 1126 TRP A CZ3  5  
ATOM   2891  C  CH2  . TRP A 1 24 ? 5.327   -3.509  -10.492 1.00 0.58  ? 1126 TRP A CH2  5  
ATOM   2892  H  H    . TRP A 1 24 ? 2.260   1.742   -7.262  1.00 0.23  ? 1126 TRP A H    5  
ATOM   2893  H  HA   . TRP A 1 24 ? 0.043   0.133   -8.234  1.00 0.25  ? 1126 TRP A HA   5  
ATOM   2894  H  HB2  . TRP A 1 24 ? 2.569   -0.598  -6.738  1.00 0.27  ? 1126 TRP A HB2  5  
ATOM   2895  H  HB3  . TRP A 1 24 ? 1.342   -1.750  -7.231  1.00 0.28  ? 1126 TRP A HB3  5  
ATOM   2896  H  HD1  . TRP A 1 24 ? 1.604   0.656   -9.966  1.00 0.40  ? 1126 TRP A HD1  5  
ATOM   2897  H  HE1  . TRP A 1 24 ? 3.118   -0.238  -11.844 1.00 0.53  ? 1126 TRP A HE1  5  
ATOM   2898  H  HE3  . TRP A 1 24 ? 3.831   -3.202  -7.458  1.00 0.45  ? 1126 TRP A HE3  5  
ATOM   2899  H  HZ2  . TRP A 1 24 ? 5.006   -2.298  -12.214 1.00 0.61  ? 1126 TRP A HZ2  5  
ATOM   2900  H  HZ3  . TRP A 1 24 ? 5.481   -4.584  -8.645  1.00 0.62  ? 1126 TRP A HZ3  5  
ATOM   2901  H  HH2  . TRP A 1 24 ? 6.056   -4.140  -10.974 1.00 0.67  ? 1126 TRP A HH2  5  
ATOM   2902  N  N    . VAL A 1 25 ? 0.137   1.237   -5.294  1.00 0.19  ? 1127 VAL A N    5  
ATOM   2903  C  CA   . VAL A 1 25 ? -0.546  1.305   -4.011  1.00 0.18  ? 1127 VAL A CA   5  
ATOM   2904  C  C    . VAL A 1 25 ? -2.039  1.528   -4.208  1.00 0.19  ? 1127 VAL A C    5  
ATOM   2905  O  O    . VAL A 1 25 ? -2.461  2.591   -4.672  1.00 0.23  ? 1127 VAL A O    5  
ATOM   2906  C  CB   . VAL A 1 25 ? 0.042   2.428   -3.128  1.00 0.21  ? 1127 VAL A CB   5  
ATOM   2907  C  CG1  . VAL A 1 25 ? -0.686  2.525   -1.796  1.00 0.24  ? 1127 VAL A CG1  5  
ATOM   2908  C  CG2  . VAL A 1 25 ? 1.527   2.200   -2.909  1.00 0.24  ? 1127 VAL A CG2  5  
ATOM   2909  H  H    . VAL A 1 25 ? 0.727   1.967   -5.562  1.00 0.21  ? 1127 VAL A H    5  
ATOM   2910  H  HA   . VAL A 1 25 ? -0.402  0.362   -3.508  1.00 0.19  ? 1127 VAL A HA   5  
ATOM   2911  H  HB   . VAL A 1 25 ? -0.081  3.368   -3.648  1.00 0.23  ? 1127 VAL A HB   5  
ATOM   2912  H  HG11 . VAL A 1 25 ? -1.730  2.733   -1.970  1.00 1.01  ? 1127 VAL A HG11 5  
ATOM   2913  H  HG12 . VAL A 1 25 ? -0.253  3.321   -1.206  1.00 1.02  ? 1127 VAL A HG12 5  
ATOM   2914  H  HG13 . VAL A 1 25 ? -0.589  1.590   -1.263  1.00 1.00  ? 1127 VAL A HG13 5  
ATOM   2915  H  HG21 . VAL A 1 25 ? 2.026   2.138   -3.864  1.00 1.05  ? 1127 VAL A HG21 5  
ATOM   2916  H  HG22 . VAL A 1 25 ? 1.673   1.276   -2.367  1.00 1.06  ? 1127 VAL A HG22 5  
ATOM   2917  H  HG23 . VAL A 1 25 ? 1.937   3.020   -2.340  1.00 1.01  ? 1127 VAL A HG23 5  
ATOM   2918  N  N    . CYS A 1 26 ? -2.824  0.505   -3.876  1.00 0.19  ? 1128 CYS A N    5  
ATOM   2919  C  CA   . CYS A 1 26 ? -4.278  0.563   -4.000  1.00 0.26  ? 1128 CYS A CA   5  
ATOM   2920  C  C    . CYS A 1 26 ? -4.670  0.695   -5.468  1.00 0.27  ? 1128 CYS A C    5  
ATOM   2921  O  O    . CYS A 1 26 ? -5.497  1.527   -5.845  1.00 0.37  ? 1128 CYS A O    5  
ATOM   2922  C  CB   . CYS A 1 26 ? -4.840  1.730   -3.181  1.00 0.32  ? 1128 CYS A CB   5  
ATOM   2923  S  SG   . CYS A 1 26 ? -6.659  1.817   -3.123  1.00 0.58  ? 1128 CYS A SG   5  
ATOM   2924  H  H    . CYS A 1 26 ? -2.409  -0.324  -3.547  1.00 0.19  ? 1128 CYS A H    5  
ATOM   2925  H  HA   . CYS A 1 26 ? -4.678  -0.362  -3.615  1.00 0.28  ? 1128 CYS A HA   5  
ATOM   2926  H  HB2  . CYS A 1 26 ? -4.487  1.643   -2.165  1.00 0.36  ? 1128 CYS A HB2  5  
ATOM   2927  H  HB3  . CYS A 1 26 ? -4.480  2.658   -3.601  1.00 0.36  ? 1128 CYS A HB3  5  
ATOM   2928  N  N    . ASP A 1 27 ? -4.061  -0.134  -6.298  1.00 0.25  ? 1129 ASP A N    5  
ATOM   2929  C  CA   . ASP A 1 27 ? -4.306  -0.093  -7.734  1.00 0.30  ? 1129 ASP A CA   5  
ATOM   2930  C  C    . ASP A 1 27 ? -5.095  -1.321  -8.176  1.00 0.37  ? 1129 ASP A C    5  
ATOM   2931  O  O    . ASP A 1 27 ? -5.120  -1.661  -9.359  1.00 0.41  ? 1129 ASP A O    5  
ATOM   2932  C  CB   . ASP A 1 27 ? -2.982  -0.013  -8.501  1.00 0.31  ? 1129 ASP A CB   5  
ATOM   2933  C  CG   . ASP A 1 27 ? -2.259  -1.345  -8.584  1.00 0.35  ? 1129 ASP A CG   5  
ATOM   2934  O  OD1  . ASP A 1 27 ? -2.210  -2.076  -7.564  1.00 0.31  ? 1129 ASP A OD1  5  
ATOM   2935  O  OD2  . ASP A 1 27 ? -1.730  -1.661  -9.671  1.00 0.46  ? 1129 ASP A OD2  5  
ATOM   2936  H  H    . ASP A 1 27 ? -3.425  -0.796  -5.934  1.00 0.24  ? 1129 ASP A H    5  
ATOM   2937  H  HA   . ASP A 1 27 ? -4.889  0.791   -7.945  1.00 0.33  ? 1129 ASP A HA   5  
ATOM   2938  H  HB2  . ASP A 1 27 ? -3.177  0.328   -9.507  1.00 0.36  ? 1129 ASP A HB2  5  
ATOM   2939  H  HB3  . ASP A 1 27 ? -2.333  0.697   -8.009  1.00 0.29  ? 1129 ASP A HB3  5  
ATOM   2940  N  N    . THR A 1 28 ? -5.736  -1.970  -7.206  1.00 0.45  ? 1130 THR A N    5  
ATOM   2941  C  CA   . THR A 1 28 ? -6.505  -3.196  -7.421  1.00 0.56  ? 1130 THR A CA   5  
ATOM   2942  C  C    . THR A 1 28 ? -5.673  -4.255  -8.136  1.00 0.61  ? 1130 THR A C    5  
ATOM   2943  O  O    . THR A 1 28 ? -6.146  -4.926  -9.053  1.00 0.73  ? 1130 THR A O    5  
ATOM   2944  C  CB   . THR A 1 28 ? -7.844  -2.958  -8.177  1.00 0.59  ? 1130 THR A CB   5  
ATOM   2945  O  OG1  . THR A 1 28 ? -7.632  -2.333  -9.451  1.00 0.56  ? 1130 THR A OG1  5  
ATOM   2946  C  CG2  . THR A 1 28 ? -8.782  -2.099  -7.349  1.00 0.65  ? 1130 THR A CG2  5  
ATOM   2947  H  H    . THR A 1 28 ? -5.675  -1.617  -6.293  1.00 0.46  ? 1130 THR A H    5  
ATOM   2948  H  HA   . THR A 1 28 ? -6.752  -3.581  -6.440  1.00 0.64  ? 1130 THR A HA   5  
ATOM   2949  H  HB   . THR A 1 28 ? -8.318  -3.917  -8.337  1.00 0.67  ? 1130 THR A HB   5  
ATOM   2950  H  HG1  . THR A 1 28 ? -6.726  -2.001  -9.496  1.00 0.53  ? 1130 THR A HG1  5  
ATOM   2951  H  HG21 . THR A 1 28 ? -8.330  -1.133  -7.181  1.00 1.34  ? 1130 THR A HG21 5  
ATOM   2952  H  HG22 . THR A 1 28 ? -8.969  -2.580  -6.400  1.00 1.09  ? 1130 THR A HG22 5  
ATOM   2953  H  HG23 . THR A 1 28 ? -9.715  -1.973  -7.877  1.00 1.21  ? 1130 THR A HG23 5  
ATOM   2954  N  N    . ASP A 1 29 ? -4.419  -4.385  -7.726  1.00 0.59  ? 1131 ASP A N    5  
ATOM   2955  C  CA   . ASP A 1 29 ? -3.543  -5.417  -8.257  1.00 0.69  ? 1131 ASP A CA   5  
ATOM   2956  C  C    . ASP A 1 29 ? -2.711  -6.015  -7.132  1.00 0.67  ? 1131 ASP A C    5  
ATOM   2957  O  O    . ASP A 1 29 ? -2.338  -5.309  -6.182  1.00 0.53  ? 1131 ASP A O    5  
ATOM   2958  C  CB   . ASP A 1 29 ? -2.637  -4.844  -9.343  1.00 0.75  ? 1131 ASP A CB   5  
ATOM   2959  C  CG   . ASP A 1 29 ? -1.940  -5.923  -10.150 1.00 0.92  ? 1131 ASP A CG   5  
ATOM   2960  O  OD1  . ASP A 1 29 ? -0.904  -6.446  -9.694  1.00 0.92  ? 1131 ASP A OD1  5  
ATOM   2961  O  OD2  . ASP A 1 29 ? -2.427  -6.257  -11.251 1.00 1.21  ? 1131 ASP A OD2  5  
ATOM   2962  H  H    . ASP A 1 29 ? -4.069  -3.762  -7.056  1.00 0.55  ? 1131 ASP A H    5  
ATOM   2963  H  HA   . ASP A 1 29 ? -4.163  -6.192  -8.683  1.00 0.81  ? 1131 ASP A HA   5  
ATOM   2964  H  HB2  . ASP A 1 29 ? -3.229  -4.241  -10.012 1.00 0.81  ? 1131 ASP A HB2  5  
ATOM   2965  H  HB3  . ASP A 1 29 ? -1.884  -4.224  -8.880  1.00 0.68  ? 1131 ASP A HB3  5  
ATOM   2966  N  N    . ASN A 1 30 ? -2.406  -7.302  -7.259  1.00 0.94  ? 1132 ASN A N    5  
ATOM   2967  C  CA   . ASN A 1 30 ? -1.774  -8.074  -6.191  1.00 1.00  ? 1132 ASN A CA   5  
ATOM   2968  C  C    . ASN A 1 30 ? -0.249  -7.962  -6.205  1.00 0.91  ? 1132 ASN A C    5  
ATOM   2969  O  O    . ASN A 1 30 ? 0.454   -8.931  -5.910  1.00 1.06  ? 1132 ASN A O    5  
ATOM   2970  C  CB   . ASN A 1 30 ? -2.180  -9.554  -6.277  1.00 1.29  ? 1132 ASN A CB   5  
ATOM   2971  C  CG   . ASN A 1 30 ? -1.754  -10.221 -7.577  1.00 1.72  ? 1132 ASN A CG   5  
ATOM   2972  O  OD1  . ASN A 1 30 ? -1.738  -9.598  -8.640  1.00 2.58  ? 1132 ASN A OD1  5  
ATOM   2973  N  ND2  . ASN A 1 30 ? -1.394  -11.493 -7.499  1.00 2.07  ? 1132 ASN A ND2  5  
ATOM   2974  H  H    . ASN A 1 30 ? -2.604  -7.750  -8.109  1.00 1.15  ? 1132 ASN A H    5  
ATOM   2975  H  HA   . ASN A 1 30 ? -2.133  -7.677  -5.253  1.00 0.97  ? 1132 ASN A HA   5  
ATOM   2976  H  HB2  . ASN A 1 30 ? -1.726  -10.090 -5.459  1.00 1.52  ? 1132 ASN A HB2  5  
ATOM   2977  H  HB3  . ASN A 1 30 ? -3.254  -9.627  -6.194  1.00 1.97  ? 1132 ASN A HB3  5  
ATOM   2978  H  HD21 . ASN A 1 30 ? -1.420  -11.928 -6.620  1.00 2.11  ? 1132 ASN A HD21 5  
ATOM   2979  H  HD22 . ASN A 1 30 ? -1.123  -11.949 -8.324  1.00 2.73  ? 1132 ASN A HD22 5  
ATOM   2980  N  N    . ASP A 1 31 ? 0.259   -6.788  -6.547  1.00 0.86  ? 1133 ASP A N    5  
ATOM   2981  C  CA   . ASP A 1 31 ? 1.679   -6.488  -6.373  1.00 0.77  ? 1133 ASP A CA   5  
ATOM   2982  C  C    . ASP A 1 31 ? 2.034   -6.541  -4.896  1.00 0.78  ? 1133 ASP A C    5  
ATOM   2983  O  O    . ASP A 1 31 ? 1.141   -6.618  -4.049  1.00 1.28  ? 1133 ASP A O    5  
ATOM   2984  C  CB   . ASP A 1 31 ? 2.019   -5.107  -6.933  1.00 0.67  ? 1133 ASP A CB   5  
ATOM   2985  C  CG   . ASP A 1 31 ? 0.939   -4.106  -6.629  1.00 0.58  ? 1133 ASP A CG   5  
ATOM   2986  O  OD1  . ASP A 1 31 ? -0.050  -4.030  -7.366  1.00 1.09  ? 1133 ASP A OD1  5  
ATOM   2987  O  OD2  . ASP A 1 31 ? 1.082   -3.347  -5.656  1.00 1.00  ? 1133 ASP A OD2  5  
ATOM   2988  H  H    . ASP A 1 31 ? -0.334  -6.102  -6.926  1.00 1.05  ? 1133 ASP A H    5  
ATOM   2989  H  HA   . ASP A 1 31 ? 2.250   -7.239  -6.899  1.00 0.87  ? 1133 ASP A HA   5  
ATOM   2990  H  HB2  . ASP A 1 31 ? 2.944   -4.753  -6.485  1.00 1.04  ? 1133 ASP A HB2  5  
ATOM   2991  H  HB3  . ASP A 1 31 ? 2.139   -5.174  -8.004  1.00 1.05  ? 1133 ASP A HB3  5  
ATOM   2992  N  N    . CYS A 1 32 ? 3.330   -6.502  -4.600  1.00 0.76  ? 1134 CYS A N    5  
ATOM   2993  C  CA   . CYS A 1 32 ? 3.820   -6.613  -3.228  1.00 0.78  ? 1134 CYS A CA   5  
ATOM   2994  C  C    . CYS A 1 32 ? 3.680   -8.054  -2.733  1.00 0.85  ? 1134 CYS A C    5  
ATOM   2995  O  O    . CYS A 1 32 ? 2.843   -8.816  -3.220  1.00 1.57  ? 1134 CYS A O    5  
ATOM   2996  C  CB   . CYS A 1 32 ? 3.074   -5.639  -2.300  1.00 0.82  ? 1134 CYS A CB   5  
ATOM   2997  S  SG   . CYS A 1 32 ? 3.566   -5.729  -0.549  1.00 1.16  ? 1134 CYS A SG   5  
ATOM   2998  H  H    . CYS A 1 32 ? 3.979   -6.401  -5.328  1.00 1.11  ? 1134 CYS A H    5  
ATOM   2999  H  HA   . CYS A 1 32 ? 4.869   -6.354  -3.236  1.00 0.88  ? 1134 CYS A HA   5  
ATOM   3000  H  HB2  . CYS A 1 32 ? 3.254   -4.629  -2.635  1.00 1.25  ? 1134 CYS A HB2  5  
ATOM   3001  H  HB3  . CYS A 1 32 ? 2.015   -5.844  -2.356  1.00 1.22  ? 1134 CYS A HB3  5  
ATOM   3002  N  N    . GLY A 1 33 ? 4.515   -8.435  -1.779  1.00 1.17  ? 1135 GLY A N    5  
ATOM   3003  C  CA   . GLY A 1 33 ? 4.483   -9.791  -1.271  1.00 1.22  ? 1135 GLY A CA   5  
ATOM   3004  C  C    . GLY A 1 33 ? 3.642   -9.912  -0.021  1.00 1.18  ? 1135 GLY A C    5  
ATOM   3005  O  O    . GLY A 1 33 ? 3.913   -10.749 0.838   1.00 1.68  ? 1135 GLY A O    5  
ATOM   3006  H  H    . GLY A 1 33 ? 5.152   -7.790  -1.407  1.00 1.82  ? 1135 GLY A H    5  
ATOM   3007  H  HA2  . GLY A 1 33 ? 4.074   -10.441 -2.031  1.00 1.26  ? 1135 GLY A HA2  5  
ATOM   3008  H  HA3  . GLY A 1 33 ? 5.491   -10.106 -1.045  1.00 1.39  ? 1135 GLY A HA3  5  
ATOM   3009  N  N    . ASP A 1 34 ? 2.623   -9.070  0.083   1.00 1.02  ? 1136 ASP A N    5  
ATOM   3010  C  CA   . ASP A 1 34 ? 1.759   -9.061  1.256   1.00 1.11  ? 1136 ASP A CA   5  
ATOM   3011  C  C    . ASP A 1 34 ? 0.408   -8.434  0.942   1.00 0.93  ? 1136 ASP A C    5  
ATOM   3012  O  O    . ASP A 1 34 ? -0.638  -8.985  1.286   1.00 1.35  ? 1136 ASP A O    5  
ATOM   3013  C  CB   . ASP A 1 34 ? 2.421   -8.313  2.411   1.00 1.44  ? 1136 ASP A CB   5  
ATOM   3014  C  CG   . ASP A 1 34 ? 1.487   -8.123  3.589   1.00 2.10  ? 1136 ASP A CG   5  
ATOM   3015  O  OD1  . ASP A 1 34 ? 1.257   -9.102  4.327   1.00 2.47  ? 1136 ASP A OD1  5  
ATOM   3016  O  OD2  . ASP A 1 34 ? 0.988   -6.996  3.788   1.00 2.85  ? 1136 ASP A OD2  5  
ATOM   3017  H  H    . ASP A 1 34 ? 2.440   -8.450  -0.652  1.00 1.22  ? 1136 ASP A H    5  
ATOM   3018  H  HA   . ASP A 1 34 ? 1.602   -10.082 1.554   1.00 1.27  ? 1136 ASP A HA   5  
ATOM   3019  H  HB2  . ASP A 1 34 ? 3.284   -8.869  2.746   1.00 1.68  ? 1136 ASP A HB2  5  
ATOM   3020  H  HB3  . ASP A 1 34 ? 2.736   -7.343  2.065   1.00 1.84  ? 1136 ASP A HB3  5  
ATOM   3021  N  N    . GLY A 1 35 ? 0.441   -7.284  0.280   1.00 0.62  ? 1137 GLY A N    5  
ATOM   3022  C  CA   . GLY A 1 35 ? -0.785  -6.593  -0.065  1.00 0.49  ? 1137 GLY A CA   5  
ATOM   3023  C  C    . GLY A 1 35 ? -1.024  -5.387  0.818   1.00 0.36  ? 1137 GLY A C    5  
ATOM   3024  O  O    . GLY A 1 35 ? -2.104  -4.796  0.800   1.00 0.36  ? 1137 GLY A O    5  
ATOM   3025  H  H    . GLY A 1 35 ? 1.303   -6.903  0.020   1.00 0.82  ? 1137 GLY A H    5  
ATOM   3026  H  HA2  . GLY A 1 35 ? -0.727  -6.269  -1.094  1.00 0.51  ? 1137 GLY A HA2  5  
ATOM   3027  H  HA3  . GLY A 1 35 ? -1.615  -7.274  0.043   1.00 0.72  ? 1137 GLY A HA3  5  
ATOM   3028  N  N    . SER A 1 36 ? -0.005  -5.013  1.589   1.00 0.32  ? 1138 SER A N    5  
ATOM   3029  C  CA   . SER A 1 36 ? -0.095  -3.872  2.491   1.00 0.28  ? 1138 SER A CA   5  
ATOM   3030  C  C    . SER A 1 36 ? -0.271  -2.571  1.711   1.00 0.25  ? 1138 SER A C    5  
ATOM   3031  O  O    . SER A 1 36 ? -0.672  -1.548  2.264   1.00 0.40  ? 1138 SER A O    5  
ATOM   3032  C  CB   . SER A 1 36 ? 1.158   -3.810  3.375   1.00 0.33  ? 1138 SER A CB   5  
ATOM   3033  O  OG   . SER A 1 36 ? 2.341   -3.748  2.590   1.00 0.44  ? 1138 SER A OG   5  
ATOM   3034  H  H    . SER A 1 36 ? 0.828   -5.528  1.559   1.00 0.37  ? 1138 SER A H    5  
ATOM   3035  H  HA   . SER A 1 36 ? -0.962  -4.018  3.118   1.00 0.33  ? 1138 SER A HA   5  
ATOM   3036  H  HB2  . SER A 1 36 ? 1.115   -2.936  4.007   1.00 0.40  ? 1138 SER A HB2  5  
ATOM   3037  H  HB3  . SER A 1 36 ? 1.201   -4.695  3.992   1.00 0.39  ? 1138 SER A HB3  5  
ATOM   3038  H  HG   . SER A 1 36 ? 2.158   -3.268  1.774   1.00 1.17  ? 1138 SER A HG   5  
ATOM   3039  N  N    . ASP A 1 37 ? 0.015   -2.631  0.420   1.00 0.18  ? 1139 ASP A N    5  
ATOM   3040  C  CA   . ASP A 1 37 ? -0.151  -1.487  -0.462  1.00 0.18  ? 1139 ASP A CA   5  
ATOM   3041  C  C    . ASP A 1 37 ? -1.634  -1.249  -0.734  1.00 0.20  ? 1139 ASP A C    5  
ATOM   3042  O  O    . ASP A 1 37 ? -2.084  -0.111  -0.854  1.00 0.29  ? 1139 ASP A O    5  
ATOM   3043  C  CB   . ASP A 1 37 ? 0.579   -1.738  -1.779  1.00 0.19  ? 1139 ASP A CB   5  
ATOM   3044  C  CG   . ASP A 1 37 ? -0.073  -2.842  -2.585  1.00 0.26  ? 1139 ASP A CG   5  
ATOM   3045  O  OD1  . ASP A 1 37 ? 0.059   -4.020  -2.194  1.00 0.33  ? 1139 ASP A OD1  5  
ATOM   3046  O  OD2  . ASP A 1 37 ? -0.754  -2.528  -3.586  1.00 0.32  ? 1139 ASP A OD2  5  
ATOM   3047  H  H    . ASP A 1 37 ? 0.333   -3.479  0.039   1.00 0.26  ? 1139 ASP A H    5  
ATOM   3048  H  HA   . ASP A 1 37 ? 0.270   -0.619  0.021   1.00 0.20  ? 1139 ASP A HA   5  
ATOM   3049  H  HB2  . ASP A 1 37 ? 0.577   -0.834  -2.367  1.00 0.22  ? 1139 ASP A HB2  5  
ATOM   3050  H  HB3  . ASP A 1 37 ? 1.598   -2.025  -1.569  1.00 0.19  ? 1139 ASP A HB3  5  
ATOM   3051  N  N    . GLU A 1 38 ? -2.391  -2.336  -0.810  1.00 0.22  ? 1140 GLU A N    5  
ATOM   3052  C  CA   . GLU A 1 38 ? -3.816  -2.257  -1.082  1.00 0.27  ? 1140 GLU A CA   5  
ATOM   3053  C  C    . GLU A 1 38 ? -4.575  -1.928  0.196   1.00 0.31  ? 1140 GLU A C    5  
ATOM   3054  O  O    . GLU A 1 38 ? -5.633  -1.298  0.158   1.00 0.44  ? 1140 GLU A O    5  
ATOM   3055  C  CB   . GLU A 1 38 ? -4.326  -3.582  -1.664  1.00 0.29  ? 1140 GLU A CB   5  
ATOM   3056  C  CG   . GLU A 1 38 ? -3.700  -3.966  -3.000  1.00 0.29  ? 1140 GLU A CG   5  
ATOM   3057  C  CD   . GLU A 1 38 ? -4.132  -3.066  -4.145  1.00 0.28  ? 1140 GLU A CD   5  
ATOM   3058  O  OE1  . GLU A 1 38 ? -5.349  -2.952  -4.389  1.00 0.38  ? 1140 GLU A OE1  5  
ATOM   3059  O  OE2  . GLU A 1 38 ? -3.259  -2.476  -4.815  1.00 0.28  ? 1140 GLU A OE2  5  
ATOM   3060  H  H    . GLU A 1 38 ? -1.976  -3.217  -0.678  1.00 0.24  ? 1140 GLU A H    5  
ATOM   3061  H  HA   . GLU A 1 38 ? -3.977  -1.469  -1.801  1.00 0.30  ? 1140 GLU A HA   5  
ATOM   3062  H  HB2  . GLU A 1 38 ? -4.118  -4.371  -0.958  1.00 0.32  ? 1140 GLU A HB2  5  
ATOM   3063  H  HB3  . GLU A 1 38 ? -5.394  -3.510  -1.801  1.00 0.33  ? 1140 GLU A HB3  5  
ATOM   3064  H  HG2  . GLU A 1 38 ? -2.626  -3.909  -2.908  1.00 0.29  ? 1140 GLU A HG2  5  
ATOM   3065  H  HG3  . GLU A 1 38 ? -3.985  -4.982  -3.234  1.00 0.33  ? 1140 GLU A HG3  5  
ATOM   3066  N  N    . LYS A 1 39 ? -4.022  -2.352  1.331   1.00 0.30  ? 1141 LYS A N    5  
ATOM   3067  C  CA   . LYS A 1 39 ? -4.676  -2.155  2.621   1.00 0.37  ? 1141 LYS A CA   5  
ATOM   3068  C  C    . LYS A 1 39 ? -4.575  -0.696  3.066   1.00 0.49  ? 1141 LYS A C    5  
ATOM   3069  O  O    . LYS A 1 39 ? -5.471  -0.178  3.733   1.00 0.57  ? 1141 LYS A O    5  
ATOM   3070  C  CB   . LYS A 1 39 ? -4.067  -3.080  3.685   1.00 0.47  ? 1141 LYS A CB   5  
ATOM   3071  C  CG   . LYS A 1 39 ? -2.846  -2.509  4.391   1.00 0.57  ? 1141 LYS A CG   5  
ATOM   3072  C  CD   . LYS A 1 39 ? -2.317  -3.454  5.450   1.00 0.76  ? 1141 LYS A CD   5  
ATOM   3073  C  CE   . LYS A 1 39 ? -1.231  -2.789  6.278   1.00 0.91  ? 1141 LYS A CE   5  
ATOM   3074  N  NZ   . LYS A 1 39 ? -1.774  -1.704  7.138   1.00 1.55  ? 1141 LYS A NZ   5  
ATOM   3075  H  H    . LYS A 1 39 ? -3.161  -2.818  1.296   1.00 0.32  ? 1141 LYS A H    5  
ATOM   3076  H  HA   . LYS A 1 39 ? -5.720  -2.405  2.499   1.00 0.39  ? 1141 LYS A HA   5  
ATOM   3077  H  HB2  . LYS A 1 39 ? -4.814  -3.288  4.431   1.00 0.56  ? 1141 LYS A HB2  5  
ATOM   3078  H  HB3  . LYS A 1 39 ? -3.780  -4.008  3.213   1.00 0.47  ? 1141 LYS A HB3  5  
ATOM   3079  H  HG2  . LYS A 1 39 ? -2.070  -2.333  3.664   1.00 0.50  ? 1141 LYS A HG2  5  
ATOM   3080  H  HG3  . LYS A 1 39 ? -3.120  -1.576  4.859   1.00 0.65  ? 1141 LYS A HG3  5  
ATOM   3081  H  HD2  . LYS A 1 39 ? -3.127  -3.744  6.100   1.00 0.88  ? 1141 LYS A HD2  5  
ATOM   3082  H  HD3  . LYS A 1 39 ? -1.905  -4.330  4.968   1.00 0.73  ? 1141 LYS A HD3  5  
ATOM   3083  H  HE2  . LYS A 1 39 ? -0.766  -3.534  6.901   1.00 1.15  ? 1141 LYS A HE2  5  
ATOM   3084  H  HE3  . LYS A 1 39 ? -0.495  -2.370  5.609   1.00 1.18  ? 1141 LYS A HE3  5  
ATOM   3085  H  HZ1  . LYS A 1 39 ? -1.007  -1.265  7.686   1.00 2.08  ? 1141 LYS A HZ1  5  
ATOM   3086  H  HZ2  . LYS A 1 39 ? -2.477  -2.090  7.801   1.00 1.99  ? 1141 LYS A HZ2  5  
ATOM   3087  H  HZ3  . LYS A 1 39 ? -2.232  -0.973  6.555   1.00 1.97  ? 1141 LYS A HZ3  5  
ATOM   3088  N  N    . ASN A 1 40 ? -3.485  -0.035  2.684   1.00 0.60  ? 1142 ASN A N    5  
ATOM   3089  C  CA   . ASN A 1 40 ? -3.274  1.366   3.042   1.00 0.81  ? 1142 ASN A CA   5  
ATOM   3090  C  C    . ASN A 1 40 ? -4.036  2.260   2.071   1.00 0.91  ? 1142 ASN A C    5  
ATOM   3091  O  O    . ASN A 1 40 ? -3.447  3.029   1.305   1.00 1.44  ? 1142 ASN A O    5  
ATOM   3092  C  CB   . ASN A 1 40 ? -1.778  1.706   3.029   1.00 1.07  ? 1142 ASN A CB   5  
ATOM   3093  C  CG   . ASN A 1 40 ? -1.462  3.002   3.757   1.00 1.37  ? 1142 ASN A CG   5  
ATOM   3094  O  OD1  . ASN A 1 40 ? -1.218  3.000   4.965   1.00 2.05  ? 1142 ASN A OD1  5  
ATOM   3095  N  ND2  . ASN A 1 40 ? -1.450  4.111   3.035   1.00 1.92  ? 1142 ASN A ND2  5  
ATOM   3096  H  H    . ASN A 1 40 ? -2.807  -0.500  2.151   1.00 0.58  ? 1142 ASN A H    5  
ATOM   3097  H  HA   . ASN A 1 40 ? -3.665  1.519   4.037   1.00 0.86  ? 1142 ASN A HA   5  
ATOM   3098  H  HB2  . ASN A 1 40 ? -1.231  0.907   3.506   1.00 1.54  ? 1142 ASN A HB2  5  
ATOM   3099  H  HB3  . ASN A 1 40 ? -1.448  1.800   2.005   1.00 1.56  ? 1142 ASN A HB3  5  
ATOM   3100  H  HD21 . ASN A 1 40 ? -1.644  4.042   2.076   1.00 2.20  ? 1142 ASN A HD21 5  
ATOM   3101  H  HD22 . ASN A 1 40 ? -1.248  4.959   3.490   1.00 2.44  ? 1142 ASN A HD22 5  
ATOM   3102  N  N    . CYS A 1 41 ? -5.355  2.134   2.108   1.00 0.76  ? 1143 CYS A N    5  
ATOM   3103  C  CA   . CYS A 1 41 ? -6.235  2.802   1.171   1.00 0.99  ? 1143 CYS A CA   5  
ATOM   3104  C  C    . CYS A 1 41 ? -7.677  2.454   1.503   1.00 1.29  ? 1143 CYS A C    5  
ATOM   3105  O  O    . CYS A 1 41 ? -7.955  1.397   2.074   1.00 1.67  ? 1143 CYS A O    5  
ATOM   3106  C  CB   . CYS A 1 41 ? -5.907  2.353   -0.257  1.00 0.93  ? 1143 CYS A CB   5  
ATOM   3107  S  SG   . CYS A 1 41 ? -7.001  3.037   -1.544  1.00 1.10  ? 1143 CYS A SG   5  
ATOM   3108  H  H    . CYS A 1 41 ? -5.756  1.563   2.800   1.00 0.89  ? 1143 CYS A H    5  
ATOM   3109  H  HA   . CYS A 1 41 ? -6.090  3.868   1.260   1.00 1.23  ? 1143 CYS A HA   5  
ATOM   3110  H  HB2  . CYS A 1 41 ? -4.898  2.654   -0.494  1.00 0.98  ? 1143 CYS A HB2  5  
ATOM   3111  H  HB3  . CYS A 1 41 ? -5.974  1.276   -0.308  1.00 1.29  ? 1143 CYS A HB3  5  
ATOM   3112  N  N    . ASN A 1 42 ? -8.587  3.350   1.150   1.00 1.87  ? 1144 ASN A N    5  
ATOM   3113  C  CA   . ASN A 1 42 ? -10.010 3.126   1.364   1.00 2.36  ? 1144 ASN A CA   5  
ATOM   3114  C  C    . ASN A 1 42 ? -10.535 2.036   0.436   1.00 3.05  ? 1144 ASN A C    5  
ATOM   3115  O  O    . ASN A 1 42 ? -11.574 1.434   0.706   1.00 3.73  ? 1144 ASN A O    5  
ATOM   3116  C  CB   . ASN A 1 42 ? -10.811 4.425   1.180   1.00 3.11  ? 1144 ASN A CB   5  
ATOM   3117  C  CG   . ASN A 1 42 ? -10.532 5.146   -0.134  1.00 3.87  ? 1144 ASN A CG   5  
ATOM   3118  O  OD1  . ASN A 1 42 ? -10.228 4.533   -1.159  1.00 4.27  ? 1144 ASN A OD1  5  
ATOM   3119  N  ND2  . ASN A 1 42 ? -10.630 6.465   -0.109  1.00 4.59  ? 1144 ASN A ND2  5  
ATOM   3120  H  H    . ASN A 1 42 ? -8.290  4.187   0.733   1.00 2.27  ? 1144 ASN A H    5  
ATOM   3121  H  HA   . ASN A 1 42 ? -10.132 2.788   2.383   1.00 2.42  ? 1144 ASN A HA   5  
ATOM   3122  H  HB2  . ASN A 1 42 ? -11.865 4.195   1.217   1.00 3.41  ? 1144 ASN A HB2  5  
ATOM   3123  H  HB3  . ASN A 1 42 ? -10.572 5.098   1.990   1.00 3.38  ? 1144 ASN A HB3  5  
ATOM   3124  H  HD21 . ASN A 1 42 ? -10.873 6.898   0.738   1.00 4.61  ? 1144 ASN A HD21 5  
ATOM   3125  H  HD22 . ASN A 1 42 ? -10.458 6.959   -0.937  1.00 5.30  ? 1144 ASN A HD22 5  
ATOM   3126  N  N    . SER A 1 43 ? -9.786  1.800   -0.649  1.00 3.53  ? 1145 SER A N    5  
ATOM   3127  C  CA   . SER A 1 43 ? -10.071 0.761   -1.647  1.00 4.69  ? 1145 SER A CA   5  
ATOM   3128  C  C    . SER A 1 43 ? -11.444 0.942   -2.297  1.00 5.23  ? 1145 SER A C    5  
ATOM   3129  O  O    . SER A 1 43 ? -12.263 1.754   -1.865  1.00 5.32  ? 1145 SER A O    5  
ATOM   3130  C  CB   . SER A 1 43 ? -9.939  -0.648  -1.039  1.00 5.40  ? 1145 SER A CB   5  
ATOM   3131  O  OG   . SER A 1 43 ? -10.948 -0.915  -0.078  1.00 5.26  ? 1145 SER A OG   5  
ATOM   3132  H  H    . SER A 1 43 ? -8.998  2.366   -0.791  1.00 3.45  ? 1145 SER A H    5  
ATOM   3133  H  HA   . SER A 1 43 ? -9.325  0.864   -2.421  1.00 5.07  ? 1145 SER A HA   5  
ATOM   3134  H  HB2  . SER A 1 43 ? -10.013 -1.381  -1.828  1.00 6.23  ? 1145 SER A HB2  5  
ATOM   3135  H  HB3  . SER A 1 43 ? -8.975  -0.737  -0.561  1.00 5.56  ? 1145 SER A HB3  5  
ATOM   3136  H  HG   . SER A 1 43 ? -11.348 -0.077  0.201   1.00 5.21  ? 1145 SER A HG   5  
ATOM   3137  N  N    . THR A 1 44 ? -11.678 0.199   -3.361  1.00 5.97  ? 1146 THR A N    5  
ATOM   3138  C  CA   . THR A 1 44 ? -12.955 0.220   -4.039  1.00 6.81  ? 1146 THR A CA   5  
ATOM   3139  C  C    . THR A 1 44 ? -13.874 -0.837  -3.446  1.00 7.34  ? 1146 THR A C    5  
ATOM   3140  O  O    . THR A 1 44 ? -14.258 -1.794  -4.112  1.00 8.15  ? 1146 THR A O    5  
ATOM   3141  C  CB   . THR A 1 44 ? -12.784 -0.004  -5.554  1.00 7.69  ? 1146 THR A CB   5  
ATOM   3142  O  OG1  . THR A 1 44 ? -11.940 -1.138  -5.802  1.00 7.92  ? 1146 THR A OG1  5  
ATOM   3143  C  CG2  . THR A 1 44 ? -12.190 1.230   -6.216  1.00 7.74  ? 1146 THR A CG2  5  
ATOM   3144  H  H    . THR A 1 44 ? -10.966 -0.383  -3.704  1.00 6.16  ? 1146 THR A H    5  
ATOM   3145  H  HA   . THR A 1 44 ? -13.400 1.193   -3.885  1.00 6.75  ? 1146 THR A HA   5  
ATOM   3146  H  HB   . THR A 1 44 ? -13.757 -0.190  -5.986  1.00 8.40  ? 1146 THR A HB   5  
ATOM   3147  H  HG1  . THR A 1 44 ? -11.020 -0.894  -5.642  1.00 8.03  ? 1146 THR A HG1  5  
ATOM   3148  H  HG21 . THR A 1 44 ? -11.240 1.462   -5.757  1.00 7.71  ? 1146 THR A HG21 5  
ATOM   3149  H  HG22 . THR A 1 44 ? -12.864 2.065   -6.091  1.00 7.80  ? 1146 THR A HG22 5  
ATOM   3150  H  HG23 . THR A 1 44 ? -12.044 1.039   -7.267  1.00 8.03  ? 1146 THR A HG23 5  
ATOM   3151  N  N    . GLU A 1 45 ? -14.224 -0.639  -2.181  1.00 7.13  ? 1147 GLU A N    5  
ATOM   3152  C  CA   . GLU A 1 45 ? -15.012 -1.609  -1.427  1.00 7.94  ? 1147 GLU A CA   5  
ATOM   3153  C  C    . GLU A 1 45 ? -16.391 -1.843  -2.045  1.00 8.95  ? 1147 GLU A C    5  
ATOM   3154  O  O    . GLU A 1 45 ? -16.983 -2.907  -1.867  1.00 9.87  ? 1147 GLU A O    5  
ATOM   3155  C  CB   . GLU A 1 45 ? -15.123 -1.190  0.053   1.00 7.79  ? 1147 GLU A CB   5  
ATOM   3156  C  CG   . GLU A 1 45 ? -15.280 0.310   0.300   1.00 7.90  ? 1147 GLU A CG   5  
ATOM   3157  C  CD   . GLU A 1 45 ? -16.561 0.881   -0.266  1.00 8.00  ? 1147 GLU A CD   5  
ATOM   3158  O  OE1  . GLU A 1 45 ? -17.618 0.724   0.377   1.00 8.23  ? 1147 GLU A OE1  5  
ATOM   3159  O  OE2  . GLU A 1 45 ? -16.518 1.492   -1.355  1.00 8.08  ? 1147 GLU A OE2  5  
ATOM   3160  H  H    . GLU A 1 45 ? -13.938 0.187   -1.740  1.00 6.60  ? 1147 GLU A H    5  
ATOM   3161  H  HA   . GLU A 1 45 ? -14.474 -2.545  -1.468  1.00 8.20  ? 1147 GLU A HA   5  
ATOM   3162  H  HB2  . GLU A 1 45 ? -15.979 -1.686  0.484   1.00 8.33  ? 1147 GLU A HB2  5  
ATOM   3163  H  HB3  . GLU A 1 45 ? -14.234 -1.524  0.571   1.00 7.37  ? 1147 GLU A HB3  5  
ATOM   3164  H  HG2  . GLU A 1 45 ? -15.275 0.482   1.365   1.00 7.80  ? 1147 GLU A HG2  5  
ATOM   3165  H  HG3  . GLU A 1 45 ? -14.443 0.827   -0.144  1.00 8.35  ? 1147 GLU A HG3  5  
ATOM   3166  N  N    . THR A 1 46 ? -16.891 -0.864  -2.784  1.00 8.94  ? 1148 THR A N    5  
ATOM   3167  C  CA   . THR A 1 46 ? -18.169 -1.011  -3.460  1.00 10.03 ? 1148 THR A CA   5  
ATOM   3168  C  C    . THR A 1 46 ? -18.009 -1.909  -4.684  1.00 10.71 ? 1148 THR A C    5  
ATOM   3169  O  O    . THR A 1 46 ? -18.852 -2.769  -4.956  1.00 11.12 ? 1148 THR A O    5  
ATOM   3170  C  CB   . THR A 1 46 ? -18.743 0.358   -3.884  1.00 10.21 ? 1148 THR A CB   5  
ATOM   3171  O  OG1  . THR A 1 46 ? -18.776 1.246   -2.757  1.00 9.58  ? 1148 THR A OG1  5  
ATOM   3172  C  CG2  . THR A 1 46 ? -20.146 0.209   -4.450  1.00 11.01 ? 1148 THR A CG2  5  
ATOM   3173  H  H    . THR A 1 46 ? -16.387 -0.024  -2.876  1.00 8.30  ? 1148 THR A H    5  
ATOM   3174  H  HA   . THR A 1 46 ? -18.860 -1.474  -2.771  1.00 10.45 ? 1148 THR A HA   5  
ATOM   3175  H  HB   . THR A 1 46 ? -18.106 0.778   -4.647  1.00 10.48 ? 1148 THR A HB   5  
ATOM   3176  H  HG1  . THR A 1 46 ? -17.966 1.133   -2.228  1.00 9.43  ? 1148 THR A HG1  5  
ATOM   3177  H  HG21 . THR A 1 46 ? -20.122 -0.447  -5.308  1.00 11.19 ? 1148 THR A HG21 5  
ATOM   3178  H  HG22 . THR A 1 46 ? -20.518 1.178   -4.748  1.00 11.07 ? 1148 THR A HG22 5  
ATOM   3179  H  HG23 . THR A 1 46 ? -20.795 -0.209  -3.696  1.00 11.53 ? 1148 THR A HG23 5  
HETATM 3180  CA CA   . CA  B 2 .  ? -1.263  -3.019  -5.690  1.00 0.28  ? 1201 CA  A CA   5  
ATOM   3181  N  N    . THR A 1 1  ? 3.438   12.946  9.237   1.00 12.23 ? 1103 THR A N    6  
ATOM   3182  C  CA   . THR A 1 1  ? 4.166   14.035  8.554   1.00 11.73 ? 1103 THR A CA   6  
ATOM   3183  C  C    . THR A 1 1  ? 4.608   13.601  7.159   1.00 10.83 ? 1103 THR A C    6  
ATOM   3184  O  O    . THR A 1 1  ? 4.259   14.234  6.162   1.00 10.67 ? 1103 THR A O    6  
ATOM   3185  C  CB   . THR A 1 1  ? 5.393   14.477  9.374   1.00 11.83 ? 1103 THR A CB   6  
ATOM   3186  O  OG1  . THR A 1 1  ? 4.979   14.892  10.683  1.00 12.26 ? 1103 THR A OG1  6  
ATOM   3187  C  CG2  . THR A 1 1  ? 6.129   15.619  8.689   1.00 12.04 ? 1103 THR A CG2  6  
ATOM   3188  H  H1   . THR A 1 1  ? 4.040   12.102  9.313   1.00 12.23 ? 1103 THR A H1   6  
ATOM   3189  H  H2   . THR A 1 1  ? 2.581   12.698  8.703   1.00 12.55 ? 1103 THR A H2   6  
ATOM   3190  H  H3   . THR A 1 1  ? 3.162   13.246  10.192  1.00 12.44 ? 1103 THR A H3   6  
ATOM   3191  H  HA   . THR A 1 1  ? 3.498   14.879  8.458   1.00 12.16 ? 1103 THR A HA   6  
ATOM   3192  H  HB   . THR A 1 1  ? 6.067   13.638  9.468   1.00 11.67 ? 1103 THR A HB   6  
ATOM   3193  H  HG1  . THR A 1 1  ? 4.689   15.814  10.648  1.00 12.30 ? 1103 THR A HG1  6  
ATOM   3194  H  HG21 . THR A 1 1  ? 5.459   16.458  8.568   1.00 12.31 ? 1103 THR A HG21 6  
ATOM   3195  H  HG22 . THR A 1 1  ? 6.475   15.293  7.718   1.00 12.05 ? 1103 THR A HG22 6  
ATOM   3196  H  HG23 . THR A 1 1  ? 6.975   15.918  9.291   1.00 12.10 ? 1103 THR A HG23 6  
ATOM   3197  N  N    . HIS A 1 2  ? 5.375   12.520  7.091   1.00 10.41 ? 1104 HIS A N    6  
ATOM   3198  C  CA   . HIS A 1 2  ? 5.865   12.006  5.821   1.00 9.72  ? 1104 HIS A CA   6  
ATOM   3199  C  C    . HIS A 1 2  ? 6.253   10.544  5.977   1.00 8.65  ? 1104 HIS A C    6  
ATOM   3200  O  O    . HIS A 1 2  ? 7.119   10.213  6.785   1.00 8.32  ? 1104 HIS A O    6  
ATOM   3201  C  CB   . HIS A 1 2  ? 7.069   12.824  5.335   1.00 10.05 ? 1104 HIS A CB   6  
ATOM   3202  C  CG   . HIS A 1 2  ? 7.503   12.494  3.938   1.00 10.43 ? 1104 HIS A CG   6  
ATOM   3203  N  ND1  . HIS A 1 2  ? 8.628   11.753  3.651   1.00 10.71 ? 1104 HIS A ND1  6  
ATOM   3204  C  CD2  . HIS A 1 2  ? 6.953   12.816  2.743   1.00 10.84 ? 1104 HIS A CD2  6  
ATOM   3205  C  CE1  . HIS A 1 2  ? 8.750   11.632  2.342   1.00 11.25 ? 1104 HIS A CE1  6  
ATOM   3206  N  NE2  . HIS A 1 2  ? 7.746   12.267  1.768   1.00 11.34 ? 1104 HIS A NE2  6  
ATOM   3207  H  H    . HIS A 1 2  ? 5.613   12.044  7.917   1.00 10.71 ? 1104 HIS A H    6  
ATOM   3208  H  HA   . HIS A 1 2  ? 5.067   12.082  5.099   1.00 9.96  ? 1104 HIS A HA   6  
ATOM   3209  H  HB2  . HIS A 1 2  ? 6.816   13.874  5.363   1.00 10.50 ? 1104 HIS A HB2  6  
ATOM   3210  H  HB3  . HIS A 1 2  ? 7.905   12.646  5.995   1.00 9.81  ? 1104 HIS A HB3  6  
ATOM   3211  H  HD1  . HIS A 1 2  ? 9.253   11.374  4.309   1.00 10.68 ? 1104 HIS A HD1  6  
ATOM   3212  H  HD2  . HIS A 1 2  ? 6.058   13.400  2.587   1.00 10.94 ? 1104 HIS A HD2  6  
ATOM   3213  H  HE1  . HIS A 1 2  ? 9.535   11.100  1.828   1.00 11.71 ? 1104 HIS A HE1  6  
ATOM   3214  H  HE2  . HIS A 1 2  ? 7.501   12.187  0.820   1.00 11.83 ? 1104 HIS A HE2  6  
ATOM   3215  N  N    . ALA A 1 3  ? 5.609   9.677   5.211   1.00 8.30  ? 1105 ALA A N    6  
ATOM   3216  C  CA   . ALA A 1 3  ? 5.857   8.245   5.302   1.00 7.41  ? 1105 ALA A CA   6  
ATOM   3217  C  C    . ALA A 1 3  ? 7.242   7.891   4.769   1.00 6.47  ? 1105 ALA A C    6  
ATOM   3218  O  O    . ALA A 1 3  ? 7.557   8.157   3.606   1.00 6.54  ? 1105 ALA A O    6  
ATOM   3219  C  CB   . ALA A 1 3  ? 4.786   7.472   4.547   1.00 7.70  ? 1105 ALA A CB   6  
ATOM   3220  H  H    . ALA A 1 3  ? 4.953   10.007  4.561   1.00 8.79  ? 1105 ALA A H    6  
ATOM   3221  H  HA   . ALA A 1 3  ? 5.801   7.965   6.343   1.00 7.45  ? 1105 ALA A HA   6  
ATOM   3222  H  HB1  . ALA A 1 3  ? 3.814   7.723   4.946   1.00 7.93  ? 1105 ALA A HB1  6  
ATOM   3223  H  HB2  . ALA A 1 3  ? 4.960   6.413   4.662   1.00 7.73  ? 1105 ALA A HB2  6  
ATOM   3224  H  HB3  . ALA A 1 3  ? 4.824   7.732   3.500   1.00 7.95  ? 1105 ALA A HB3  6  
ATOM   3225  N  N    . PRO A 1 4  ? 8.092   7.307   5.624   1.00 5.80  ? 1106 PRO A N    6  
ATOM   3226  C  CA   . PRO A 1 4  ? 9.424   6.862   5.234   1.00 4.97  ? 1106 PRO A CA   6  
ATOM   3227  C  C    . PRO A 1 4  ? 9.396   5.486   4.578   1.00 4.25  ? 1106 PRO A C    6  
ATOM   3228  O  O    . PRO A 1 4  ? 8.729   4.565   5.058   1.00 4.22  ? 1106 PRO A O    6  
ATOM   3229  C  CB   . PRO A 1 4  ? 10.173  6.818   6.564   1.00 4.84  ? 1106 PRO A CB   6  
ATOM   3230  C  CG   . PRO A 1 4  ? 9.129   6.515   7.586   1.00 5.55  ? 1106 PRO A CG   6  
ATOM   3231  C  CD   . PRO A 1 4  ? 7.821   7.047   7.049   1.00 6.09  ? 1106 PRO A CD   6  
ATOM   3232  H  HA   . PRO A 1 4  ? 9.899   7.569   4.570   1.00 5.32  ? 1106 PRO A HA   6  
ATOM   3233  H  HB2  . PRO A 1 4  ? 10.928  6.044   6.528   1.00 4.32  ? 1106 PRO A HB2  6  
ATOM   3234  H  HB3  . PRO A 1 4  ? 10.640  7.773   6.749   1.00 5.12  ? 1106 PRO A HB3  6  
ATOM   3235  H  HG2  . PRO A 1 4  ? 9.063   5.447   7.733   1.00 5.52  ? 1106 PRO A HG2  6  
ATOM   3236  H  HG3  . PRO A 1 4  ? 9.376   7.004   8.516   1.00 6.00  ? 1106 PRO A HG3  6  
ATOM   3237  H  HD2  . PRO A 1 4  ? 7.042   6.308   7.161   1.00 6.19  ? 1106 PRO A HD2  6  
ATOM   3238  H  HD3  . PRO A 1 4  ? 7.549   7.959   7.559   1.00 6.80  ? 1106 PRO A HD3  6  
ATOM   3239  N  N    . ALA A 1 5  ? 10.115  5.348   3.480   1.00 4.09  ? 1107 ALA A N    6  
ATOM   3240  C  CA   . ALA A 1 5  ? 10.160  4.095   2.752   1.00 3.77  ? 1107 ALA A CA   6  
ATOM   3241  C  C    . ALA A 1 5  ? 11.603  3.669   2.521   1.00 2.63  ? 1107 ALA A C    6  
ATOM   3242  O  O    . ALA A 1 5  ? 12.421  4.461   2.050   1.00 2.62  ? 1107 ALA A O    6  
ATOM   3243  C  CB   . ALA A 1 5  ? 9.422   4.235   1.429   1.00 4.73  ? 1107 ALA A CB   6  
ATOM   3244  H  H    . ALA A 1 5  ? 10.636  6.110   3.148   1.00 4.51  ? 1107 ALA A H    6  
ATOM   3245  H  HA   . ALA A 1 5  ? 9.659   3.344   3.344   1.00 4.04  ? 1107 ALA A HA   6  
ATOM   3246  H  HB1  . ALA A 1 5  ? 9.441   3.292   0.904   1.00 5.01  ? 1107 ALA A HB1  6  
ATOM   3247  H  HB2  . ALA A 1 5  ? 9.902   4.992   0.826   1.00 4.95  ? 1107 ALA A HB2  6  
ATOM   3248  H  HB3  . ALA A 1 5  ? 8.397   4.522   1.616   1.00 5.29  ? 1107 ALA A HB3  6  
ATOM   3249  N  N    . SER A 1 6  ? 11.919  2.419   2.843   1.00 2.16  ? 1108 SER A N    6  
ATOM   3250  C  CA   . SER A 1 6  ? 13.269  1.902   2.656   1.00 1.43  ? 1108 SER A CA   6  
ATOM   3251  C  C    . SER A 1 6  ? 13.453  1.394   1.233   1.00 1.29  ? 1108 SER A C    6  
ATOM   3252  O  O    . SER A 1 6  ? 14.129  0.396   0.975   1.00 1.97  ? 1108 SER A O    6  
ATOM   3253  C  CB   . SER A 1 6  ? 13.567  0.807   3.683   1.00 2.09  ? 1108 SER A CB   6  
ATOM   3254  O  OG   . SER A 1 6  ? 12.512  -0.140  3.747   1.00 2.97  ? 1108 SER A OG   6  
ATOM   3255  H  H    . SER A 1 6  ? 11.225  1.825   3.204   1.00 2.71  ? 1108 SER A H    6  
ATOM   3256  H  HA   . SER A 1 6  ? 13.948  2.722   2.806   1.00 1.32  ? 1108 SER A HA   6  
ATOM   3257  H  HB2  . SER A 1 6  ? 14.476  0.295   3.403   1.00 2.36  ? 1108 SER A HB2  6  
ATOM   3258  H  HB3  . SER A 1 6  ? 13.692  1.256   4.658   1.00 2.13  ? 1108 SER A HB3  6  
ATOM   3259  H  HG   . SER A 1 6  ? 12.752  -0.921  3.227   1.00 3.32  ? 1108 SER A HG   6  
ATOM   3260  N  N    . CYS A 1 7  ? 12.843  2.116   0.321   1.00 0.72  ? 1109 CYS A N    6  
ATOM   3261  C  CA   . CYS A 1 7  ? 12.919  1.833   -1.101  1.00 0.49  ? 1109 CYS A CA   6  
ATOM   3262  C  C    . CYS A 1 7  ? 13.182  3.121   -1.867  1.00 0.46  ? 1109 CYS A C    6  
ATOM   3263  O  O    . CYS A 1 7  ? 13.562  4.138   -1.276  1.00 0.62  ? 1109 CYS A O    6  
ATOM   3264  C  CB   . CYS A 1 7  ? 11.614  1.189   -1.582  1.00 0.33  ? 1109 CYS A CB   6  
ATOM   3265  S  SG   . CYS A 1 7  ? 11.168  -0.346  -0.705  1.00 0.47  ? 1109 CYS A SG   6  
ATOM   3266  H  H    . CYS A 1 7  ? 12.320  2.884   0.623   1.00 0.94  ? 1109 CYS A H    6  
ATOM   3267  H  HA   . CYS A 1 7  ? 13.736  1.152   -1.280  1.00 0.60  ? 1109 CYS A HA   6  
ATOM   3268  H  HB2  . CYS A 1 7  ? 10.805  1.890   -1.445  1.00 0.41  ? 1109 CYS A HB2  6  
ATOM   3269  H  HB3  . CYS A 1 7  ? 11.703  0.954   -2.632  1.00 0.29  ? 1109 CYS A HB3  6  
ATOM   3270  N  N    . LEU A 1 8  ? 12.991  3.062   -3.175  1.00 0.34  ? 1110 LEU A N    6  
ATOM   3271  C  CA   . LEU A 1 8  ? 13.120  4.221   -4.047  1.00 0.32  ? 1110 LEU A CA   6  
ATOM   3272  C  C    . LEU A 1 8  ? 12.233  5.366   -3.563  1.00 0.29  ? 1110 LEU A C    6  
ATOM   3273  O  O    . LEU A 1 8  ? 11.249  5.146   -2.855  1.00 0.30  ? 1110 LEU A O    6  
ATOM   3274  C  CB   . LEU A 1 8  ? 12.685  3.811   -5.446  1.00 0.28  ? 1110 LEU A CB   6  
ATOM   3275  C  CG   . LEU A 1 8  ? 13.390  4.496   -6.611  1.00 0.38  ? 1110 LEU A CG   6  
ATOM   3276  C  CD1  . LEU A 1 8  ? 14.863  4.121   -6.642  1.00 0.52  ? 1110 LEU A CD1  6  
ATOM   3277  C  CD2  . LEU A 1 8  ? 12.712  4.113   -7.916  1.00 0.39  ? 1110 LEU A CD2  6  
ATOM   3278  H  H    . LEU A 1 8  ? 12.759  2.196   -3.579  1.00 0.34  ? 1110 LEU A H    6  
ATOM   3279  H  HA   . LEU A 1 8  ? 14.150  4.535   -4.063  1.00 0.40  ? 1110 LEU A HA   6  
ATOM   3280  H  HB2  . LEU A 1 8  ? 12.829  2.745   -5.533  1.00 0.32  ? 1110 LEU A HB2  6  
ATOM   3281  H  HB3  . LEU A 1 8  ? 11.625  4.009   -5.534  1.00 0.22  ? 1110 LEU A HB3  6  
ATOM   3282  H  HG   . LEU A 1 8  ? 13.316  5.567   -6.494  1.00 0.41  ? 1110 LEU A HG   6  
ATOM   3283  H  HD11 . LEU A 1 8  ? 15.336  4.593   -7.489  1.00 1.05  ? 1110 LEU A HD11 6  
ATOM   3284  H  HD12 . LEU A 1 8  ? 14.960  3.051   -6.727  1.00 1.29  ? 1110 LEU A HD12 6  
ATOM   3285  H  HD13 . LEU A 1 8  ? 15.340  4.453   -5.732  1.00 1.07  ? 1110 LEU A HD13 6  
ATOM   3286  H  HD21 . LEU A 1 8  ? 11.684  4.447   -7.900  1.00 1.11  ? 1110 LEU A HD21 6  
ATOM   3287  H  HD22 . LEU A 1 8  ? 12.737  3.038   -8.032  1.00 1.05  ? 1110 LEU A HD22 6  
ATOM   3288  H  HD23 . LEU A 1 8  ? 13.229  4.578   -8.742  1.00 0.97  ? 1110 LEU A HD23 6  
ATOM   3289  N  N    . ASP A 1 9  ? 12.573  6.583   -3.966  1.00 0.35  ? 1111 ASP A N    6  
ATOM   3290  C  CA   . ASP A 1 9  ? 11.778  7.757   -3.620  1.00 0.38  ? 1111 ASP A CA   6  
ATOM   3291  C  C    . ASP A 1 9  ? 10.388  7.672   -4.234  1.00 0.32  ? 1111 ASP A C    6  
ATOM   3292  O  O    . ASP A 1 9  ? 9.435   8.259   -3.725  1.00 0.42  ? 1111 ASP A O    6  
ATOM   3293  C  CB   . ASP A 1 9  ? 12.472  9.039   -4.082  1.00 0.51  ? 1111 ASP A CB   6  
ATOM   3294  C  CG   . ASP A 1 9  ? 13.612  9.441   -3.172  1.00 1.37  ? 1111 ASP A CG   6  
ATOM   3295  O  OD1  . ASP A 1 9  ? 14.729  8.907   -3.333  1.00 2.32  ? 1111 ASP A OD1  6  
ATOM   3296  O  OD2  . ASP A 1 9  ? 13.395  10.289  -2.284  1.00 1.53  ? 1111 ASP A OD2  6  
ATOM   3297  H  H    . ASP A 1 9  ? 13.391  6.697   -4.500  1.00 0.40  ? 1111 ASP A H    6  
ATOM   3298  H  HA   . ASP A 1 9  ? 11.679  7.782   -2.545  1.00 0.44  ? 1111 ASP A HA   6  
ATOM   3299  H  HB2  . ASP A 1 9  ? 12.867  8.888   -5.076  1.00 0.94  ? 1111 ASP A HB2  6  
ATOM   3300  H  HB3  . ASP A 1 9  ? 11.752  9.843   -4.103  1.00 1.01  ? 1111 ASP A HB3  6  
ATOM   3301  N  N    . THR A 1 10 ? 10.277  6.938   -5.332  1.00 0.28  ? 1112 THR A N    6  
ATOM   3302  C  CA   . THR A 1 10 ? 8.994   6.729   -5.978  1.00 0.31  ? 1112 THR A CA   6  
ATOM   3303  C  C    . THR A 1 10 ? 8.464   5.322   -5.703  1.00 0.24  ? 1112 THR A C    6  
ATOM   3304  O  O    . THR A 1 10 ? 7.424   4.922   -6.229  1.00 0.30  ? 1112 THR A O    6  
ATOM   3305  C  CB   . THR A 1 10 ? 9.097   6.962   -7.495  1.00 0.42  ? 1112 THR A CB   6  
ATOM   3306  O  OG1  . THR A 1 10 ? 10.232  6.260   -8.019  1.00 0.45  ? 1112 THR A OG1  6  
ATOM   3307  C  CG2  . THR A 1 10 ? 9.221   8.446   -7.802  1.00 0.52  ? 1112 THR A CG2  6  
ATOM   3308  H  H    . THR A 1 10 ? 11.079  6.538   -5.724  1.00 0.31  ? 1112 THR A H    6  
ATOM   3309  H  HA   . THR A 1 10 ? 8.297   7.449   -5.572  1.00 0.36  ? 1112 THR A HA   6  
ATOM   3310  H  HB   . THR A 1 10 ? 8.201   6.585   -7.964  1.00 0.48  ? 1112 THR A HB   6  
ATOM   3311  H  HG1  . THR A 1 10 ? 10.648  6.795   -8.709  1.00 0.95  ? 1112 THR A HG1  6  
ATOM   3312  H  HG21 . THR A 1 10 ? 8.359   8.967   -7.413  1.00 1.19  ? 1112 THR A HG21 6  
ATOM   3313  H  HG22 . THR A 1 10 ? 9.276   8.589   -8.871  1.00 1.09  ? 1112 THR A HG22 6  
ATOM   3314  H  HG23 . THR A 1 10 ? 10.115  8.835   -7.339  1.00 1.17  ? 1112 THR A HG23 6  
ATOM   3315  N  N    . GLN A 1 11 ? 9.186   4.571   -4.878  1.00 0.18  ? 1113 GLN A N    6  
ATOM   3316  C  CA   . GLN A 1 11 ? 8.755   3.240   -4.497  1.00 0.17  ? 1113 GLN A CA   6  
ATOM   3317  C  C    . GLN A 1 11 ? 8.123   3.236   -3.118  1.00 0.17  ? 1113 GLN A C    6  
ATOM   3318  O  O    . GLN A 1 11 ? 8.401   4.098   -2.282  1.00 0.23  ? 1113 GLN A O    6  
ATOM   3319  C  CB   . GLN A 1 11 ? 9.922   2.261   -4.519  1.00 0.17  ? 1113 GLN A CB   6  
ATOM   3320  C  CG   . GLN A 1 11 ? 10.258  1.752   -5.906  1.00 0.23  ? 1113 GLN A CG   6  
ATOM   3321  C  CD   . GLN A 1 11 ? 11.327  0.677   -5.890  1.00 0.35  ? 1113 GLN A CD   6  
ATOM   3322  O  OE1  . GLN A 1 11 ? 12.194  0.658   -5.013  1.00 1.02  ? 1113 GLN A OE1  6  
ATOM   3323  N  NE2  . GLN A 1 11 ? 11.276  -0.224  -6.856  1.00 0.67  ? 1113 GLN A NE2  6  
ATOM   3324  H  H    . GLN A 1 11 ? 10.027  4.919   -4.513  1.00 0.20  ? 1113 GLN A H    6  
ATOM   3325  H  HA   . GLN A 1 11 ? 8.018   2.916   -5.215  1.00 0.22  ? 1113 GLN A HA   6  
ATOM   3326  H  HB2  . GLN A 1 11 ? 10.796  2.755   -4.119  1.00 0.16  ? 1113 GLN A HB2  6  
ATOM   3327  H  HB3  . GLN A 1 11 ? 9.683   1.418   -3.894  1.00 0.20  ? 1113 GLN A HB3  6  
ATOM   3328  H  HG2  . GLN A 1 11 ? 9.365   1.348   -6.343  1.00 0.31  ? 1113 GLN A HG2  6  
ATOM   3329  H  HG3  . GLN A 1 11 ? 10.607  2.577   -6.507  1.00 0.22  ? 1113 GLN A HG3  6  
ATOM   3330  H  HE21 . GLN A 1 11 ? 10.556  -0.151  -7.520  1.00 1.21  ? 1113 GLN A HE21 6  
ATOM   3331  H  HE22 . GLN A 1 11 ? 11.962  -0.928  -6.875  1.00 0.65  ? 1113 GLN A HE22 6  
ATOM   3332  N  N    . TYR A 1 12 ? 7.278   2.253   -2.900  1.00 0.15  ? 1114 TYR A N    6  
ATOM   3333  C  CA   . TYR A 1 12 ? 6.626   2.055   -1.622  1.00 0.16  ? 1114 TYR A CA   6  
ATOM   3334  C  C    . TYR A 1 12 ? 7.242   0.854   -0.930  1.00 0.15  ? 1114 TYR A C    6  
ATOM   3335  O  O    . TYR A 1 12 ? 7.749   -0.056  -1.586  1.00 0.15  ? 1114 TYR A O    6  
ATOM   3336  C  CB   . TYR A 1 12 ? 5.124   1.838   -1.817  1.00 0.18  ? 1114 TYR A CB   6  
ATOM   3337  C  CG   . TYR A 1 12 ? 4.336   1.686   -0.531  1.00 0.22  ? 1114 TYR A CG   6  
ATOM   3338  C  CD1  . TYR A 1 12 ? 4.145   2.768   0.321   1.00 0.33  ? 1114 TYR A CD1  6  
ATOM   3339  C  CD2  . TYR A 1 12 ? 3.791   0.462   -0.167  1.00 0.21  ? 1114 TYR A CD2  6  
ATOM   3340  C  CE1  . TYR A 1 12 ? 3.433   2.636   1.498   1.00 0.39  ? 1114 TYR A CE1  6  
ATOM   3341  C  CE2  . TYR A 1 12 ? 3.076   0.322   1.007   1.00 0.26  ? 1114 TYR A CE2  6  
ATOM   3342  C  CZ   . TYR A 1 12 ? 2.881   1.404   1.823   1.00 0.34  ? 1114 TYR A CZ   6  
ATOM   3343  O  OH   . TYR A 1 12 ? 2.193   1.273   3.007   1.00 0.41  ? 1114 TYR A OH   6  
ATOM   3344  H  H    . TYR A 1 12 ? 7.100   1.615   -3.631  1.00 0.16  ? 1114 TYR A H    6  
ATOM   3345  H  HA   . TYR A 1 12 ? 6.787   2.935   -1.017  1.00 0.18  ? 1114 TYR A HA   6  
ATOM   3346  H  HB2  . TYR A 1 12 ? 4.712   2.675   -2.359  1.00 0.23  ? 1114 TYR A HB2  6  
ATOM   3347  H  HB3  . TYR A 1 12 ? 4.980   0.939   -2.393  1.00 0.18  ? 1114 TYR A HB3  6  
ATOM   3348  H  HD1  . TYR A 1 12 ? 4.564   3.726   0.051   1.00 0.40  ? 1114 TYR A HD1  6  
ATOM   3349  H  HD2  . TYR A 1 12 ? 3.931   -0.389  -0.817  1.00 0.23  ? 1114 TYR A HD2  6  
ATOM   3350  H  HE1  . TYR A 1 12 ? 3.295   3.491   2.146   1.00 0.50  ? 1114 TYR A HE1  6  
ATOM   3351  H  HE2  . TYR A 1 12 ? 2.660   -0.638  1.272   1.00 0.29  ? 1114 TYR A HE2  6  
ATOM   3352  H  HH   . TYR A 1 12 ? 1.582   2.009   3.101   1.00 0.89  ? 1114 TYR A HH   6  
ATOM   3353  N  N    . THR A 1 13 ? 7.197   0.857   0.382   1.00 0.18  ? 1115 THR A N    6  
ATOM   3354  C  CA   . THR A 1 13 ? 7.764   -0.216  1.168   1.00 0.20  ? 1115 THR A CA   6  
ATOM   3355  C  C    . THR A 1 13 ? 6.661   -0.941  1.927   1.00 0.23  ? 1115 THR A C    6  
ATOM   3356  O  O    . THR A 1 13 ? 6.189   -0.470  2.961   1.00 0.31  ? 1115 THR A O    6  
ATOM   3357  C  CB   . THR A 1 13 ? 8.818   0.332   2.146   1.00 0.26  ? 1115 THR A CB   6  
ATOM   3358  O  OG1  . THR A 1 13 ? 9.731   1.173   1.437   1.00 0.30  ? 1115 THR A OG1  6  
ATOM   3359  C  CG2  . THR A 1 13 ? 9.593   -0.791  2.807   1.00 0.27  ? 1115 THR A CG2  6  
ATOM   3360  H  H    . THR A 1 13 ? 6.755   1.600   0.837   1.00 0.22  ? 1115 THR A H    6  
ATOM   3361  H  HA   . THR A 1 13 ? 8.246   -0.908  0.494   1.00 0.19  ? 1115 THR A HA   6  
ATOM   3362  H  HB   . THR A 1 13 ? 8.319   0.911   2.911   1.00 0.31  ? 1115 THR A HB   6  
ATOM   3363  H  HG1  . THR A 1 13 ? 10.037  0.712   0.646   1.00 0.82  ? 1115 THR A HG1  6  
ATOM   3364  H  HG21 . THR A 1 13 ? 8.928   -1.374  3.427   1.00 1.01  ? 1115 THR A HG21 6  
ATOM   3365  H  HG22 . THR A 1 13 ? 10.381  -0.369  3.416   1.00 1.02  ? 1115 THR A HG22 6  
ATOM   3366  H  HG23 . THR A 1 13 ? 10.028  -1.422  2.047   1.00 1.10  ? 1115 THR A HG23 6  
ATOM   3367  N  N    . CYS A 1 14 ? 6.233   -2.068  1.382   1.00 0.26  ? 1116 CYS A N    6  
ATOM   3368  C  CA   . CYS A 1 14 ? 5.141   -2.840  1.961   1.00 0.34  ? 1116 CYS A CA   6  
ATOM   3369  C  C    . CYS A 1 14 ? 5.561   -3.589  3.221   1.00 0.40  ? 1116 CYS A C    6  
ATOM   3370  O  O    . CYS A 1 14 ? 6.691   -3.454  3.693   1.00 0.37  ? 1116 CYS A O    6  
ATOM   3371  C  CB   . CYS A 1 14 ? 4.612   -3.831  0.930   1.00 0.45  ? 1116 CYS A CB   6  
ATOM   3372  S  SG   . CYS A 1 14 ? 3.765   -3.055  -0.476  1.00 0.65  ? 1116 CYS A SG   6  
ATOM   3373  H  H    . CYS A 1 14 ? 6.653   -2.387  0.553   1.00 0.28  ? 1116 CYS A H    6  
ATOM   3374  H  HA   . CYS A 1 14 ? 4.350   -2.151  2.215   1.00 0.38  ? 1116 CYS A HA   6  
ATOM   3375  H  HB2  . CYS A 1 14 ? 5.440   -4.402  0.539   1.00 0.50  ? 1116 CYS A HB2  6  
ATOM   3376  H  HB3  . CYS A 1 14 ? 3.918   -4.501  1.409   1.00 0.54  ? 1116 CYS A HB3  6  
ATOM   3377  N  N    . ASP A 1 15 ? 4.642   -4.389  3.748   1.00 0.56  ? 1117 ASP A N    6  
ATOM   3378  C  CA   . ASP A 1 15 ? 4.868   -5.168  4.964   1.00 0.69  ? 1117 ASP A CA   6  
ATOM   3379  C  C    . ASP A 1 15 ? 6.130   -6.031  4.857   1.00 0.65  ? 1117 ASP A C    6  
ATOM   3380  O  O    . ASP A 1 15 ? 6.930   -6.091  5.789   1.00 0.71  ? 1117 ASP A O    6  
ATOM   3381  C  CB   . ASP A 1 15 ? 3.641   -6.044  5.248   1.00 0.93  ? 1117 ASP A CB   6  
ATOM   3382  C  CG   . ASP A 1 15 ? 3.425   -7.119  4.198   1.00 1.83  ? 1117 ASP A CG   6  
ATOM   3383  O  OD1  . ASP A 1 15 ? 3.132   -6.767  3.037   1.00 2.62  ? 1117 ASP A OD1  6  
ATOM   3384  O  OD2  . ASP A 1 15 ? 3.540   -8.322  4.539   1.00 2.09  ? 1117 ASP A OD2  6  
ATOM   3385  H  H    . ASP A 1 15 ? 3.766   -4.455  3.306   1.00 0.63  ? 1117 ASP A H    6  
ATOM   3386  H  HA   . ASP A 1 15 ? 4.993   -4.473  5.780   1.00 0.70  ? 1117 ASP A HA   6  
ATOM   3387  H  HB2  . ASP A 1 15 ? 3.759   -6.523  6.206   1.00 1.35  ? 1117 ASP A HB2  6  
ATOM   3388  H  HB3  . ASP A 1 15 ? 2.763   -5.415  5.274   1.00 0.70  ? 1117 ASP A HB3  6  
ATOM   3389  N  N    . ASN A 1 16 ? 6.320   -6.668  3.710   1.00 0.69  ? 1118 ASN A N    6  
ATOM   3390  C  CA   . ASN A 1 16 ? 7.492   -7.517  3.487   1.00 0.75  ? 1118 ASN A CA   6  
ATOM   3391  C  C    . ASN A 1 16 ? 8.679   -6.698  2.999   1.00 0.59  ? 1118 ASN A C    6  
ATOM   3392  O  O    . ASN A 1 16 ? 9.626   -7.247  2.440   1.00 0.65  ? 1118 ASN A O    6  
ATOM   3393  C  CB   . ASN A 1 16 ? 7.180   -8.610  2.459   1.00 0.98  ? 1118 ASN A CB   6  
ATOM   3394  C  CG   . ASN A 1 16 ? 6.180   -9.632  2.960   1.00 1.77  ? 1118 ASN A CG   6  
ATOM   3395  O  OD1  . ASN A 1 16 ? 6.118   -9.926  4.153   1.00 2.75  ? 1118 ASN A OD1  6  
ATOM   3396  N  ND2  . ASN A 1 16 ? 5.397   -10.189 2.049   1.00 2.02  ? 1118 ASN A ND2  6  
ATOM   3397  H  H    . ASN A 1 16 ? 5.648   -6.583  3.001   1.00 0.75  ? 1118 ASN A H    6  
ATOM   3398  H  HA   . ASN A 1 16 ? 7.750   -7.980  4.426   1.00 0.85  ? 1118 ASN A HA   6  
ATOM   3399  H  HB2  . ASN A 1 16 ? 6.777   -8.151  1.568   1.00 1.24  ? 1118 ASN A HB2  6  
ATOM   3400  H  HB3  . ASN A 1 16 ? 8.095   -9.125  2.206   1.00 1.41  ? 1118 ASN A HB3  6  
ATOM   3401  H  HD21 . ASN A 1 16 ? 5.508   -9.916  1.113   1.00 1.91  ? 1118 ASN A HD21 6  
ATOM   3402  H  HD22 . ASN A 1 16 ? 4.731   -10.845 2.349   1.00 2.74  ? 1118 ASN A HD22 6  
ATOM   3403  N  N    . HIS A 1 17 ? 8.620   -5.382  3.211   1.00 0.46  ? 1119 HIS A N    6  
ATOM   3404  C  CA   . HIS A 1 17 ? 9.619   -4.454  2.676   1.00 0.41  ? 1119 HIS A CA   6  
ATOM   3405  C  C    . HIS A 1 17 ? 9.669   -4.568  1.161   1.00 0.44  ? 1119 HIS A C    6  
ATOM   3406  O  O    . HIS A 1 17 ? 10.698  -4.311  0.536   1.00 0.79  ? 1119 HIS A O    6  
ATOM   3407  C  CB   . HIS A 1 17 ? 11.012  -4.706  3.266   1.00 0.51  ? 1119 HIS A CB   6  
ATOM   3408  C  CG   . HIS A 1 17 ? 11.118  -4.399  4.726   1.00 0.63  ? 1119 HIS A CG   6  
ATOM   3409  N  ND1  . HIS A 1 17 ? 11.766  -5.218  5.620   1.00 0.94  ? 1119 HIS A ND1  6  
ATOM   3410  C  CD2  . HIS A 1 17 ? 10.655  -3.351  5.446   1.00 0.78  ? 1119 HIS A CD2  6  
ATOM   3411  C  CE1  . HIS A 1 17 ? 11.697  -4.689  6.827   1.00 1.05  ? 1119 HIS A CE1  6  
ATOM   3412  N  NE2  . HIS A 1 17 ? 11.027  -3.555  6.750   1.00 0.93  ? 1119 HIS A NE2  6  
ATOM   3413  H  H    . HIS A 1 17 ? 7.876   -5.021  3.744   1.00 0.47  ? 1119 HIS A H    6  
ATOM   3414  H  HA   . HIS A 1 17 ? 9.305   -3.453  2.934   1.00 0.38  ? 1119 HIS A HA   6  
ATOM   3415  H  HB2  . HIS A 1 17 ? 11.269  -5.743  3.129   1.00 0.60  ? 1119 HIS A HB2  6  
ATOM   3416  H  HB3  . HIS A 1 17 ? 11.731  -4.092  2.744   1.00 0.55  ? 1119 HIS A HB3  6  
ATOM   3417  H  HD1  . HIS A 1 17 ? 12.223  -6.062  5.401   1.00 1.18  ? 1119 HIS A HD1  6  
ATOM   3418  H  HD2  . HIS A 1 17 ? 10.096  -2.510  5.064   1.00 1.00  ? 1119 HIS A HD2  6  
ATOM   3419  H  HE1  . HIS A 1 17 ? 12.119  -5.111  7.725   1.00 1.35  ? 1119 HIS A HE1  6  
ATOM   3420  H  HE2  . HIS A 1 17 ? 10.645  -3.081  7.522   1.00 1.09  ? 1119 HIS A HE2  6  
ATOM   3421  N  N    . GLN A 1 18 ? 8.539   -4.954  0.583   1.00 0.40  ? 1120 GLN A N    6  
ATOM   3422  C  CA   . GLN A 1 18 ? 8.443   -5.157  -0.847  1.00 0.38  ? 1120 GLN A CA   6  
ATOM   3423  C  C    . GLN A 1 18 ? 8.457   -3.810  -1.547  1.00 0.29  ? 1120 GLN A C    6  
ATOM   3424  O  O    . GLN A 1 18 ? 7.532   -3.014  -1.388  1.00 0.39  ? 1120 GLN A O    6  
ATOM   3425  C  CB   . GLN A 1 18 ? 7.158   -5.917  -1.184  1.00 0.49  ? 1120 GLN A CB   6  
ATOM   3426  C  CG   . GLN A 1 18 ? 7.119   -6.475  -2.598  1.00 0.50  ? 1120 GLN A CG   6  
ATOM   3427  C  CD   . GLN A 1 18 ? 8.166   -7.545  -2.829  1.00 1.05  ? 1120 GLN A CD   6  
ATOM   3428  O  OE1  . GLN A 1 18 ? 7.935   -8.724  -2.556  1.00 1.91  ? 1120 GLN A OE1  6  
ATOM   3429  N  NE2  . GLN A 1 18 ? 9.317   -7.149  -3.349  1.00 1.51  ? 1120 GLN A NE2  6  
ATOM   3430  H  H    . GLN A 1 18 ? 7.745   -5.095  1.138   1.00 0.63  ? 1120 GLN A H    6  
ATOM   3431  H  HA   . GLN A 1 18 ? 9.296   -5.734  -1.167  1.00 0.42  ? 1120 GLN A HA   6  
ATOM   3432  H  HB2  . GLN A 1 18 ? 7.052   -6.741  -0.493  1.00 0.62  ? 1120 GLN A HB2  6  
ATOM   3433  H  HB3  . GLN A 1 18 ? 6.319   -5.250  -1.062  1.00 0.52  ? 1120 GLN A HB3  6  
ATOM   3434  H  HG2  . GLN A 1 18 ? 6.143   -6.903  -2.778  1.00 0.87  ? 1120 GLN A HG2  6  
ATOM   3435  H  HG3  . GLN A 1 18 ? 7.290   -5.667  -3.294  1.00 0.86  ? 1120 GLN A HG3  6  
ATOM   3436  H  HE21 . GLN A 1 18 ? 9.430   -6.199  -3.556  1.00 1.83  ? 1120 GLN A HE21 6  
ATOM   3437  H  HE22 . GLN A 1 18 ? 10.010  -7.825  -3.509  1.00 1.99  ? 1120 GLN A HE22 6  
ATOM   3438  N  N    . CYS A 1 19 ? 9.524   -3.545  -2.281  1.00 0.21  ? 1121 CYS A N    6  
ATOM   3439  C  CA   . CYS A 1 19 ? 9.660   -2.285  -2.983  1.00 0.21  ? 1121 CYS A CA   6  
ATOM   3440  C  C    . CYS A 1 19 ? 8.875   -2.312  -4.282  1.00 0.20  ? 1121 CYS A C    6  
ATOM   3441  O  O    . CYS A 1 19 ? 9.332   -2.843  -5.297  1.00 0.34  ? 1121 CYS A O    6  
ATOM   3442  C  CB   . CYS A 1 19 ? 11.133  -1.988  -3.254  1.00 0.34  ? 1121 CYS A CB   6  
ATOM   3443  S  SG   . CYS A 1 19 ? 12.133  -1.797  -1.742  1.00 0.42  ? 1121 CYS A SG   6  
ATOM   3444  H  H    . CYS A 1 19 ? 10.243  -4.211  -2.346  1.00 0.29  ? 1121 CYS A H    6  
ATOM   3445  H  HA   . CYS A 1 19 ? 9.257   -1.510  -2.351  1.00 0.24  ? 1121 CYS A HA   6  
ATOM   3446  H  HB2  . CYS A 1 19 ? 11.558  -2.797  -3.830  1.00 0.39  ? 1121 CYS A HB2  6  
ATOM   3447  H  HB3  . CYS A 1 19 ? 11.212  -1.070  -3.819  1.00 0.41  ? 1121 CYS A HB3  6  
ATOM   3448  N  N    . ILE A 1 20 ? 7.685   -1.748  -4.233  1.00 0.15  ? 1122 ILE A N    6  
ATOM   3449  C  CA   . ILE A 1 20 ? 6.843   -1.622  -5.407  1.00 0.14  ? 1122 ILE A CA   6  
ATOM   3450  C  C    . ILE A 1 20 ? 6.714   -0.159  -5.772  1.00 0.14  ? 1122 ILE A C    6  
ATOM   3451  O  O    . ILE A 1 20 ? 7.219   0.700   -5.060  1.00 0.18  ? 1122 ILE A O    6  
ATOM   3452  C  CB   . ILE A 1 20 ? 5.439   -2.209  -5.172  1.00 0.14  ? 1122 ILE A CB   6  
ATOM   3453  C  CG1  . ILE A 1 20 ? 4.732   -1.465  -4.036  1.00 0.13  ? 1122 ILE A CG1  6  
ATOM   3454  C  CG2  . ILE A 1 20 ? 5.532   -3.698  -4.868  1.00 0.19  ? 1122 ILE A CG2  6  
ATOM   3455  C  CD1  . ILE A 1 20 ? 3.277   -1.843  -3.887  1.00 0.17  ? 1122 ILE A CD1  6  
ATOM   3456  H  H    . ILE A 1 20 ? 7.362   -1.397  -3.375  1.00 0.22  ? 1122 ILE A H    6  
ATOM   3457  H  HA   . ILE A 1 20 ? 7.307   -2.154  -6.220  1.00 0.17  ? 1122 ILE A HA   6  
ATOM   3458  H  HB   . ILE A 1 20 ? 4.868   -2.088  -6.080  1.00 0.16  ? 1122 ILE A HB   6  
ATOM   3459  H  HG12 . ILE A 1 20 ? 5.229   -1.687  -3.105  1.00 0.15  ? 1122 ILE A HG12 6  
ATOM   3460  H  HG13 . ILE A 1 20 ? 4.782   -0.402  -4.224  1.00 0.14  ? 1122 ILE A HG13 6  
ATOM   3461  H  HG21 . ILE A 1 20 ? 5.925   -4.218  -5.729  1.00 0.98  ? 1122 ILE A HG21 6  
ATOM   3462  H  HG22 . ILE A 1 20 ? 4.549   -4.082  -4.631  1.00 1.05  ? 1122 ILE A HG22 6  
ATOM   3463  H  HG23 . ILE A 1 20 ? 6.188   -3.851  -4.025  1.00 0.97  ? 1122 ILE A HG23 6  
ATOM   3464  H  HD11 . ILE A 1 20 ? 2.855   -1.332  -3.032  1.00 1.07  ? 1122 ILE A HD11 6  
ATOM   3465  H  HD12 . ILE A 1 20 ? 3.198   -2.913  -3.744  1.00 0.99  ? 1122 ILE A HD12 6  
ATOM   3466  H  HD13 . ILE A 1 20 ? 2.740   -1.560  -4.779  1.00 1.03  ? 1122 ILE A HD13 6  
ATOM   3467  N  N    . SER A 1 21 ? 6.050   0.135   -6.867  1.00 0.16  ? 1123 SER A N    6  
ATOM   3468  C  CA   . SER A 1 21 ? 5.801   1.515   -7.227  1.00 0.17  ? 1123 SER A CA   6  
ATOM   3469  C  C    . SER A 1 21 ? 4.716   2.095   -6.334  1.00 0.15  ? 1123 SER A C    6  
ATOM   3470  O  O    . SER A 1 21 ? 3.786   1.393   -5.934  1.00 0.17  ? 1123 SER A O    6  
ATOM   3471  C  CB   . SER A 1 21 ? 5.372   1.619   -8.688  1.00 0.24  ? 1123 SER A CB   6  
ATOM   3472  O  OG   . SER A 1 21 ? 4.883   2.918   -8.978  1.00 0.33  ? 1123 SER A OG   6  
ATOM   3473  H  H    . SER A 1 21 ? 5.719   -0.584  -7.442  1.00 0.20  ? 1123 SER A H    6  
ATOM   3474  H  HA   . SER A 1 21 ? 6.714   2.071   -7.082  1.00 0.19  ? 1123 SER A HA   6  
ATOM   3475  H  HB2  . SER A 1 21 ? 6.220   1.419   -9.325  1.00 0.27  ? 1123 SER A HB2  6  
ATOM   3476  H  HB3  . SER A 1 21 ? 4.592   0.901   -8.887  1.00 0.24  ? 1123 SER A HB3  6  
ATOM   3477  H  HG   . SER A 1 21 ? 4.173   2.853   -9.628  1.00 0.63  ? 1123 SER A HG   6  
ATOM   3478  N  N    . LYS A 1 22 ? 4.833   3.383   -6.028  1.00 0.17  ? 1124 LYS A N    6  
ATOM   3479  C  CA   . LYS A 1 22 ? 3.794   4.086   -5.289  1.00 0.19  ? 1124 LYS A CA   6  
ATOM   3480  C  C    . LYS A 1 22 ? 2.517   4.164   -6.118  1.00 0.22  ? 1124 LYS A C    6  
ATOM   3481  O  O    . LYS A 1 22 ? 1.447   4.485   -5.600  1.00 0.25  ? 1124 LYS A O    6  
ATOM   3482  C  CB   . LYS A 1 22 ? 4.256   5.491   -4.901  1.00 0.23  ? 1124 LYS A CB   6  
ATOM   3483  C  CG   . LYS A 1 22 ? 5.279   5.509   -3.779  1.00 0.25  ? 1124 LYS A CG   6  
ATOM   3484  C  CD   . LYS A 1 22 ? 5.728   6.924   -3.459  1.00 0.25  ? 1124 LYS A CD   6  
ATOM   3485  C  CE   . LYS A 1 22 ? 6.693   6.952   -2.284  1.00 0.30  ? 1124 LYS A CE   6  
ATOM   3486  N  NZ   . LYS A 1 22 ? 7.214   8.319   -2.033  1.00 1.24  ? 1124 LYS A NZ   6  
ATOM   3487  H  H    . LYS A 1 22 ? 5.642   3.873   -6.306  1.00 0.20  ? 1124 LYS A H    6  
ATOM   3488  H  HA   . LYS A 1 22 ? 3.593   3.522   -4.390  1.00 0.19  ? 1124 LYS A HA   6  
ATOM   3489  H  HB2  . LYS A 1 22 ? 4.696   5.964   -5.767  1.00 0.30  ? 1124 LYS A HB2  6  
ATOM   3490  H  HB3  . LYS A 1 22 ? 3.397   6.066   -4.586  1.00 0.30  ? 1124 LYS A HB3  6  
ATOM   3491  H  HG2  . LYS A 1 22 ? 4.837   5.073   -2.894  1.00 0.37  ? 1124 LYS A HG2  6  
ATOM   3492  H  HG3  . LYS A 1 22 ? 6.138   4.925   -4.078  1.00 0.37  ? 1124 LYS A HG3  6  
ATOM   3493  H  HD2  . LYS A 1 22 ? 6.221   7.337   -4.325  1.00 0.32  ? 1124 LYS A HD2  6  
ATOM   3494  H  HD3  . LYS A 1 22 ? 4.860   7.520   -3.216  1.00 0.33  ? 1124 LYS A HD3  6  
ATOM   3495  H  HE2  . LYS A 1 22 ? 6.176   6.605   -1.402  1.00 0.93  ? 1124 LYS A HE2  6  
ATOM   3496  H  HE3  . LYS A 1 22 ? 7.521   6.293   -2.499  1.00 0.95  ? 1124 LYS A HE3  6  
ATOM   3497  H  HZ1  . LYS A 1 22 ? 6.428   8.984   -1.887  1.00 1.76  ? 1124 LYS A HZ1  6  
ATOM   3498  H  HZ2  . LYS A 1 22 ? 7.781   8.641   -2.845  1.00 1.77  ? 1124 LYS A HZ2  6  
ATOM   3499  H  HZ3  . LYS A 1 22 ? 7.816   8.322   -1.185  1.00 1.88  ? 1124 LYS A HZ3  6  
ATOM   3500  N  N    . ASN A 1 23 ? 2.639   3.863   -7.409  1.00 0.24  ? 1125 ASN A N    6  
ATOM   3501  C  CA   . ASN A 1 23 ? 1.484   3.832   -8.299  1.00 0.28  ? 1125 ASN A CA   6  
ATOM   3502  C  C    . ASN A 1 23 ? 0.795   2.474   -8.227  1.00 0.26  ? 1125 ASN A C    6  
ATOM   3503  O  O    . ASN A 1 23 ? -0.349  2.326   -8.653  1.00 0.32  ? 1125 ASN A O    6  
ATOM   3504  C  CB   . ASN A 1 23 ? 1.900   4.128   -9.744  1.00 0.36  ? 1125 ASN A CB   6  
ATOM   3505  C  CG   . ASN A 1 23 ? 2.408   5.546   -9.943  1.00 1.03  ? 1125 ASN A CG   6  
ATOM   3506  O  OD1  . ASN A 1 23 ? 2.961   6.166   -9.030  1.00 1.75  ? 1125 ASN A OD1  6  
ATOM   3507  N  ND2  . ASN A 1 23 ? 2.228   6.071   -11.143 1.00 1.69  ? 1125 ASN A ND2  6  
ATOM   3508  H  H    . ASN A 1 23 ? 3.530   3.668   -7.772  1.00 0.25  ? 1125 ASN A H    6  
ATOM   3509  H  HA   . ASN A 1 23 ? 0.791   4.592   -7.968  1.00 0.31  ? 1125 ASN A HA   6  
ATOM   3510  H  HB2  . ASN A 1 23 ? 2.682   3.446   -10.031 1.00 0.82  ? 1125 ASN A HB2  6  
ATOM   3511  H  HB3  . ASN A 1 23 ? 1.048   3.978   -10.389 1.00 0.82  ? 1125 ASN A HB3  6  
ATOM   3512  H  HD21 . ASN A 1 23 ? 1.783   5.526   -11.829 1.00 1.99  ? 1125 ASN A HD21 6  
ATOM   3513  H  HD22 . ASN A 1 23 ? 2.547   6.986   -11.301 1.00 2.22  ? 1125 ASN A HD22 6  
ATOM   3514  N  N    . TRP A 1 24 ? 1.496   1.483   -7.678  1.00 0.22  ? 1126 TRP A N    6  
ATOM   3515  C  CA   . TRP A 1 24 ? 0.941   0.139   -7.530  1.00 0.22  ? 1126 TRP A CA   6  
ATOM   3516  C  C    . TRP A 1 24 ? 0.223   0.018   -6.195  1.00 0.20  ? 1126 TRP A C    6  
ATOM   3517  O  O    . TRP A 1 24 ? -0.462  -0.969  -5.922  1.00 0.26  ? 1126 TRP A O    6  
ATOM   3518  C  CB   . TRP A 1 24 ? 2.032   -0.931  -7.627  1.00 0.25  ? 1126 TRP A CB   6  
ATOM   3519  C  CG   . TRP A 1 24 ? 2.724   -0.982  -8.958  1.00 0.31  ? 1126 TRP A CG   6  
ATOM   3520  C  CD1  . TRP A 1 24 ? 2.460   -0.216  -10.059 1.00 0.37  ? 1126 TRP A CD1  6  
ATOM   3521  C  CD2  . TRP A 1 24 ? 3.794   -1.858  -9.329  1.00 0.38  ? 1126 TRP A CD2  6  
ATOM   3522  N  NE1  . TRP A 1 24 ? 3.307   -0.553  -11.084 1.00 0.45  ? 1126 TRP A NE1  6  
ATOM   3523  C  CE2  . TRP A 1 24 ? 4.133   -1.562  -10.662 1.00 0.45  ? 1126 TRP A CE2  6  
ATOM   3524  C  CE3  . TRP A 1 24 ? 4.500   -2.862  -8.662  1.00 0.44  ? 1126 TRP A CE3  6  
ATOM   3525  C  CZ2  . TRP A 1 24 ? 5.149   -2.234  -11.339 1.00 0.54  ? 1126 TRP A CZ2  6  
ATOM   3526  C  CZ3  . TRP A 1 24 ? 5.507   -3.528  -9.333  1.00 0.55  ? 1126 TRP A CZ3  6  
ATOM   3527  C  CH2  . TRP A 1 24 ? 5.823   -3.212  -10.659 1.00 0.58  ? 1126 TRP A CH2  6  
ATOM   3528  H  H    . TRP A 1 24 ? 2.407   1.662   -7.354  1.00 0.23  ? 1126 TRP A H    6  
ATOM   3529  H  HA   . TRP A 1 24 ? 0.224   -0.012  -8.325  1.00 0.25  ? 1126 TRP A HA   6  
ATOM   3530  H  HB2  . TRP A 1 24 ? 2.781   -0.753  -6.870  1.00 0.27  ? 1126 TRP A HB2  6  
ATOM   3531  H  HB3  . TRP A 1 24 ? 1.582   -1.895  -7.451  1.00 0.28  ? 1126 TRP A HB3  6  
ATOM   3532  H  HD1  . TRP A 1 24 ? 1.696   0.548   -10.099 1.00 0.40  ? 1126 TRP A HD1  6  
ATOM   3533  H  HE1  . TRP A 1 24 ? 3.316   -0.140  -11.976 1.00 0.53  ? 1126 TRP A HE1  6  
ATOM   3534  H  HE3  . TRP A 1 24 ? 4.269   -3.121  -7.640  1.00 0.45  ? 1126 TRP A HE3  6  
ATOM   3535  H  HZ2  . TRP A 1 24 ? 5.406   -2.002  -12.362 1.00 0.61  ? 1126 TRP A HZ2  6  
ATOM   3536  H  HZ3  . TRP A 1 24 ? 6.064   -4.307  -8.833  1.00 0.62  ? 1126 TRP A HZ3  6  
ATOM   3537  H  HH2  . TRP A 1 24 ? 6.618   -3.759  -11.145 1.00 0.67  ? 1126 TRP A HH2  6  
ATOM   3538  N  N    . VAL A 1 25 ? 0.406   1.027   -5.365  1.00 0.19  ? 1127 VAL A N    6  
ATOM   3539  C  CA   . VAL A 1 25 ? -0.283  1.112   -4.091  1.00 0.18  ? 1127 VAL A CA   6  
ATOM   3540  C  C    . VAL A 1 25 ? -1.763  1.369   -4.318  1.00 0.19  ? 1127 VAL A C    6  
ATOM   3541  O  O    . VAL A 1 25 ? -2.139  2.387   -4.909  1.00 0.23  ? 1127 VAL A O    6  
ATOM   3542  C  CB   . VAL A 1 25 ? 0.307   2.234   -3.210  1.00 0.21  ? 1127 VAL A CB   6  
ATOM   3543  C  CG1  . VAL A 1 25 ? -0.437  2.345   -1.887  1.00 0.24  ? 1127 VAL A CG1  6  
ATOM   3544  C  CG2  . VAL A 1 25 ? 1.787   1.995   -2.971  1.00 0.24  ? 1127 VAL A CG2  6  
ATOM   3545  H  H    . VAL A 1 25 ? 1.029   1.734   -5.617  1.00 0.21  ? 1127 VAL A H    6  
ATOM   3546  H  HA   . VAL A 1 25 ? -0.164  0.170   -3.579  1.00 0.19  ? 1127 VAL A HA   6  
ATOM   3547  H  HB   . VAL A 1 25 ? 0.198   3.170   -3.737  1.00 0.23  ? 1127 VAL A HB   6  
ATOM   3548  H  HG11 . VAL A 1 25 ? -1.479  2.560   -2.077  1.00 1.01  ? 1127 VAL A HG11 6  
ATOM   3549  H  HG12 . VAL A 1 25 ? -0.008  3.142   -1.297  1.00 1.02  ? 1127 VAL A HG12 6  
ATOM   3550  H  HG13 . VAL A 1 25 ? -0.354  1.413   -1.347  1.00 1.00  ? 1127 VAL A HG13 6  
ATOM   3551  H  HG21 . VAL A 1 25 ? 2.300   1.942   -3.918  1.00 1.05  ? 1127 VAL A HG21 6  
ATOM   3552  H  HG22 . VAL A 1 25 ? 1.920   1.066   -2.436  1.00 1.06  ? 1127 VAL A HG22 6  
ATOM   3553  H  HG23 . VAL A 1 25 ? 2.193   2.806   -2.386  1.00 1.01  ? 1127 VAL A HG23 6  
ATOM   3554  N  N    . CYS A 1 26 ? -2.589  0.429   -3.868  1.00 0.19  ? 1128 CYS A N    6  
ATOM   3555  C  CA   . CYS A 1 26 ? -4.035  0.530   -4.012  1.00 0.26  ? 1128 CYS A CA   6  
ATOM   3556  C  C    . CYS A 1 26 ? -4.416  0.478   -5.490  1.00 0.27  ? 1128 CYS A C    6  
ATOM   3557  O  O    . CYS A 1 26 ? -5.185  1.305   -5.984  1.00 0.37  ? 1128 CYS A O    6  
ATOM   3558  C  CB   . CYS A 1 26 ? -4.551  1.819   -3.357  1.00 0.32  ? 1128 CYS A CB   6  
ATOM   3559  S  SG   . CYS A 1 26 ? -6.369  1.963   -3.285  1.00 0.58  ? 1128 CYS A SG   6  
ATOM   3560  H  H    . CYS A 1 26 ? -2.209  -0.366  -3.433  1.00 0.19  ? 1128 CYS A H    6  
ATOM   3561  H  HA   . CYS A 1 26 ? -4.477  -0.320  -3.511  1.00 0.28  ? 1128 CYS A HA   6  
ATOM   3562  H  HB2  . CYS A 1 26 ? -4.181  1.871   -2.345  1.00 0.36  ? 1128 CYS A HB2  6  
ATOM   3563  H  HB3  . CYS A 1 26 ? -4.175  2.666   -3.912  1.00 0.36  ? 1128 CYS A HB3  6  
ATOM   3564  N  N    . ASP A 1 27 ? -3.859  -0.496  -6.196  1.00 0.25  ? 1129 ASP A N    6  
ATOM   3565  C  CA   . ASP A 1 27 ? -4.115  -0.648  -7.625  1.00 0.30  ? 1129 ASP A CA   6  
ATOM   3566  C  C    . ASP A 1 27 ? -4.911  -1.921  -7.882  1.00 0.37  ? 1129 ASP A C    6  
ATOM   3567  O  O    . ASP A 1 27 ? -5.088  -2.338  -9.030  1.00 0.41  ? 1129 ASP A O    6  
ATOM   3568  C  CB   . ASP A 1 27 ? -2.799  -0.679  -8.410  1.00 0.31  ? 1129 ASP A CB   6  
ATOM   3569  C  CG   . ASP A 1 27 ? -2.119  -2.038  -8.399  1.00 0.35  ? 1129 ASP A CG   6  
ATOM   3570  O  OD1  . ASP A 1 27 ? -2.073  -2.690  -7.330  1.00 0.31  ? 1129 ASP A OD1  6  
ATOM   3571  O  OD2  . ASP A 1 27 ? -1.617  -2.452  -9.465  1.00 0.46  ? 1129 ASP A OD2  6  
ATOM   3572  H  H    . ASP A 1 27 ? -3.263  -1.138  -5.743  1.00 0.24  ? 1129 ASP A H    6  
ATOM   3573  H  HA   . ASP A 1 27 ? -4.700  0.199   -7.948  1.00 0.33  ? 1129 ASP A HA   6  
ATOM   3574  H  HB2  . ASP A 1 27 ? -2.998  -0.410  -9.437  1.00 0.36  ? 1129 ASP A HB2  6  
ATOM   3575  H  HB3  . ASP A 1 27 ? -2.120  0.044   -7.983  1.00 0.29  ? 1129 ASP A HB3  6  
ATOM   3576  N  N    . THR A 1 28 ? -5.375  -2.527  -6.790  1.00 0.45  ? 1130 THR A N    6  
ATOM   3577  C  CA   . THR A 1 28 ? -6.182  -3.749  -6.807  1.00 0.56  ? 1130 THR A CA   6  
ATOM   3578  C  C    . THR A 1 28 ? -5.499  -4.894  -7.560  1.00 0.61  ? 1130 THR A C    6  
ATOM   3579  O  O    . THR A 1 28 ? -6.160  -5.802  -8.064  1.00 0.73  ? 1130 THR A O    6  
ATOM   3580  C  CB   . THR A 1 28 ? -7.613  -3.512  -7.360  1.00 0.59  ? 1130 THR A CB   6  
ATOM   3581  O  OG1  . THR A 1 28 ? -7.576  -2.937  -8.672  1.00 0.56  ? 1130 THR A OG1  6  
ATOM   3582  C  CG2  . THR A 1 28 ? -8.401  -2.599  -6.432  1.00 0.65  ? 1130 THR A CG2  6  
ATOM   3583  H  H    . THR A 1 28 ? -5.151  -2.136  -5.912  1.00 0.46  ? 1130 THR A H    6  
ATOM   3584  H  HA   . THR A 1 28 ? -6.288  -4.059  -5.775  1.00 0.64  ? 1130 THR A HA   6  
ATOM   3585  H  HB   . THR A 1 28 ? -8.120  -4.464  -7.410  1.00 0.67  ? 1130 THR A HB   6  
ATOM   3586  H  HG1  . THR A 1 28 ? -6.660  -2.908  -8.980  1.00 0.53  ? 1130 THR A HG1  6  
ATOM   3587  H  HG21 . THR A 1 28 ? -8.496  -3.065  -5.464  1.00 1.34  ? 1130 THR A HG21 6  
ATOM   3588  H  HG22 . THR A 1 28 ? -9.383  -2.425  -6.847  1.00 1.09  ? 1130 THR A HG22 6  
ATOM   3589  H  HG23 . THR A 1 28 ? -7.882  -1.657  -6.328  1.00 1.21  ? 1130 THR A HG23 6  
ATOM   3590  N  N    . ASP A 1 29 ? -4.174  -4.849  -7.627  1.00 0.59  ? 1131 ASP A N    6  
ATOM   3591  C  CA   . ASP A 1 29 ? -3.398  -5.944  -8.194  1.00 0.69  ? 1131 ASP A CA   6  
ATOM   3592  C  C    . ASP A 1 29 ? -2.302  -6.340  -7.219  1.00 0.67  ? 1131 ASP A C    6  
ATOM   3593  O  O    . ASP A 1 29 ? -1.698  -5.476  -6.577  1.00 0.53  ? 1131 ASP A O    6  
ATOM   3594  C  CB   . ASP A 1 29 ? -2.798  -5.555  -9.543  1.00 0.75  ? 1131 ASP A CB   6  
ATOM   3595  C  CG   . ASP A 1 29 ? -2.193  -6.745  -10.260 1.00 0.92  ? 1131 ASP A CG   6  
ATOM   3596  O  OD1  . ASP A 1 29 ? -2.950  -7.577  -10.798 1.00 1.21  ? 1131 ASP A OD1  6  
ATOM   3597  O  OD2  . ASP A 1 29 ? -0.951  -6.855  -10.295 1.00 0.92  ? 1131 ASP A OD2  6  
ATOM   3598  H  H    . ASP A 1 29 ? -3.700  -4.055  -7.290  1.00 0.55  ? 1131 ASP A H    6  
ATOM   3599  H  HA   . ASP A 1 29 ? -4.062  -6.784  -8.331  1.00 0.81  ? 1131 ASP A HA   6  
ATOM   3600  H  HB2  . ASP A 1 29 ? -3.572  -5.133  -10.166 1.00 0.81  ? 1131 ASP A HB2  6  
ATOM   3601  H  HB3  . ASP A 1 29 ? -2.023  -4.818  -9.387  1.00 0.68  ? 1131 ASP A HB3  6  
ATOM   3602  N  N    . ASN A 1 30 ? -2.063  -7.639  -7.092  1.00 0.94  ? 1132 ASN A N    6  
ATOM   3603  C  CA   . ASN A 1 30 ? -1.165  -8.151  -6.066  1.00 1.00  ? 1132 ASN A CA   6  
ATOM   3604  C  C    . ASN A 1 30 ? 0.295   -7.948  -6.443  1.00 0.91  ? 1132 ASN A C    6  
ATOM   3605  O  O    . ASN A 1 30 ? 0.852   -8.672  -7.269  1.00 1.06  ? 1132 ASN A O    6  
ATOM   3606  C  CB   . ASN A 1 30 ? -1.435  -9.632  -5.788  1.00 1.29  ? 1132 ASN A CB   6  
ATOM   3607  C  CG   . ASN A 1 30 ? -0.576  -10.164 -4.652  1.00 1.72  ? 1132 ASN A CG   6  
ATOM   3608  O  OD1  . ASN A 1 30 ? 0.515   -10.691 -4.874  1.00 2.58  ? 1132 ASN A OD1  6  
ATOM   3609  N  ND2  . ASN A 1 30 ? -1.056  -10.014 -3.426  1.00 2.07  ? 1132 ASN A ND2  6  
ATOM   3610  H  H    . ASN A 1 30 ? -2.495  -8.269  -7.708  1.00 1.15  ? 1132 ASN A H    6  
ATOM   3611  H  HA   . ASN A 1 30 ? -1.360  -7.595  -5.163  1.00 0.97  ? 1132 ASN A HA   6  
ATOM   3612  H  HB2  . ASN A 1 30 ? -2.473  -9.760  -5.523  1.00 1.52  ? 1132 ASN A HB2  6  
ATOM   3613  H  HB3  . ASN A 1 30 ? -1.219  -10.205 -6.678  1.00 1.97  ? 1132 ASN A HB3  6  
ATOM   3614  H  HD21 . ASN A 1 30 ? -1.926  -9.572  -3.320  1.00 2.11  ? 1132 ASN A HD21 6  
ATOM   3615  H  HD22 . ASN A 1 30 ? -0.520  -10.344 -2.674  1.00 2.73  ? 1132 ASN A HD22 6  
ATOM   3616  N  N    . ASP A 1 31 ? 0.897   -6.941  -5.838  1.00 0.86  ? 1133 ASP A N    6  
ATOM   3617  C  CA   . ASP A 1 31 ? 2.319   -6.667  -5.998  1.00 0.77  ? 1133 ASP A CA   6  
ATOM   3618  C  C    . ASP A 1 31 ? 3.033   -6.851  -4.664  1.00 0.78  ? 1133 ASP A C    6  
ATOM   3619  O  O    . ASP A 1 31 ? 4.241   -7.080  -4.618  1.00 1.28  ? 1133 ASP A O    6  
ATOM   3620  C  CB   . ASP A 1 31 ? 2.540   -5.250  -6.552  1.00 0.67  ? 1133 ASP A CB   6  
ATOM   3621  C  CG   . ASP A 1 31 ? 1.446   -4.299  -6.136  1.00 0.58  ? 1133 ASP A CG   6  
ATOM   3622  O  OD1  . ASP A 1 31 ? 1.234   -4.113  -4.925  1.00 1.00  ? 1133 ASP A OD1  6  
ATOM   3623  O  OD2  . ASP A 1 31 ? 0.819   -3.681  -7.006  1.00 1.09  ? 1133 ASP A OD2  6  
ATOM   3624  H  H    . ASP A 1 31 ? 0.363   -6.347  -5.262  1.00 1.05  ? 1133 ASP A H    6  
ATOM   3625  H  HA   . ASP A 1 31 ? 2.713   -7.386  -6.702  1.00 0.87  ? 1133 ASP A HA   6  
ATOM   3626  H  HB2  . ASP A 1 31 ? 3.478   -4.859  -6.187  1.00 1.04  ? 1133 ASP A HB2  6  
ATOM   3627  H  HB3  . ASP A 1 31 ? 2.565   -5.291  -7.631  1.00 1.05  ? 1133 ASP A HB3  6  
ATOM   3628  N  N    . CYS A 1 32 ? 2.273   -6.768  -3.579  1.00 0.76  ? 1134 CYS A N    6  
ATOM   3629  C  CA   . CYS A 1 32 ? 2.807   -7.026  -2.251  1.00 0.78  ? 1134 CYS A CA   6  
ATOM   3630  C  C    . CYS A 1 32 ? 2.058   -8.175  -1.580  1.00 0.85  ? 1134 CYS A C    6  
ATOM   3631  O  O    . CYS A 1 32 ? 0.842   -8.291  -1.727  1.00 1.57  ? 1134 CYS A O    6  
ATOM   3632  C  CB   . CYS A 1 32 ? 2.738   -5.766  -1.391  1.00 0.82  ? 1134 CYS A CB   6  
ATOM   3633  S  SG   . CYS A 1 32 ? 3.883   -4.459  -1.933  1.00 1.16  ? 1134 CYS A SG   6  
ATOM   3634  H  H    . CYS A 1 32 ? 1.332   -6.515  -3.673  1.00 1.11  ? 1134 CYS A H    6  
ATOM   3635  H  HA   . CYS A 1 32 ? 3.843   -7.308  -2.369  1.00 0.88  ? 1134 CYS A HA   6  
ATOM   3636  H  HB2  . CYS A 1 32 ? 1.736   -5.365  -1.429  1.00 1.25  ? 1134 CYS A HB2  6  
ATOM   3637  H  HB3  . CYS A 1 32 ? 2.984   -6.019  -0.369  1.00 1.22  ? 1134 CYS A HB3  6  
ATOM   3638  N  N    . GLY A 1 33 ? 2.793   -9.020  -0.853  1.00 1.17  ? 1135 GLY A N    6  
ATOM   3639  C  CA   . GLY A 1 33 ? 2.231   -10.244 -0.288  1.00 1.22  ? 1135 GLY A CA   6  
ATOM   3640  C  C    . GLY A 1 33 ? 0.958   -10.034 0.514   1.00 1.18  ? 1135 GLY A C    6  
ATOM   3641  O  O    . GLY A 1 33 ? -0.112  -10.517 0.129   1.00 1.68  ? 1135 GLY A O    6  
ATOM   3642  H  H    . GLY A 1 33 ? 3.740   -8.815  -0.705  1.00 1.82  ? 1135 GLY A H    6  
ATOM   3643  H  HA2  . GLY A 1 33 ? 2.015   -10.927 -1.095  1.00 1.26  ? 1135 GLY A HA2  6  
ATOM   3644  H  HA3  . GLY A 1 33 ? 2.972   -10.697 0.354   1.00 1.39  ? 1135 GLY A HA3  6  
ATOM   3645  N  N    . ASP A 1 34 ? 1.071   -9.312  1.624   1.00 1.02  ? 1136 ASP A N    6  
ATOM   3646  C  CA   . ASP A 1 34 ? -0.066  -9.071  2.516   1.00 1.11  ? 1136 ASP A CA   6  
ATOM   3647  C  C    . ASP A 1 34 ? -1.133  -8.214  1.846   1.00 0.93  ? 1136 ASP A C    6  
ATOM   3648  O  O    . ASP A 1 34 ? -2.285  -8.171  2.283   1.00 1.35  ? 1136 ASP A O    6  
ATOM   3649  C  CB   . ASP A 1 34 ? 0.421   -8.396  3.805   1.00 1.44  ? 1136 ASP A CB   6  
ATOM   3650  C  CG   . ASP A 1 34 ? -0.695  -7.860  4.686   1.00 2.10  ? 1136 ASP A CG   6  
ATOM   3651  O  OD1  . ASP A 1 34 ? -1.368  -8.666  5.365   1.00 2.47  ? 1136 ASP A OD1  6  
ATOM   3652  O  OD2  . ASP A 1 34 ? -0.922  -6.633  4.693   1.00 2.85  ? 1136 ASP A OD2  6  
ATOM   3653  H  H    . ASP A 1 34 ? 1.946   -8.939  1.861   1.00 1.22  ? 1136 ASP A H    6  
ATOM   3654  H  HA   . ASP A 1 34 ? -0.495  -10.024 2.768   1.00 1.27  ? 1136 ASP A HA   6  
ATOM   3655  H  HB2  . ASP A 1 34 ? 0.987   -9.111  4.381   1.00 1.68  ? 1136 ASP A HB2  6  
ATOM   3656  H  HB3  . ASP A 1 34 ? 1.067   -7.575  3.540   1.00 1.84  ? 1136 ASP A HB3  6  
ATOM   3657  N  N    . GLY A 1 35 ? -0.758  -7.573  0.750   1.00 0.62  ? 1137 GLY A N    6  
ATOM   3658  C  CA   . GLY A 1 35 ? -1.619  -6.582  0.149   1.00 0.49  ? 1137 GLY A CA   6  
ATOM   3659  C  C    . GLY A 1 35 ? -1.666  -5.350  1.014   1.00 0.36  ? 1137 GLY A C    6  
ATOM   3660  O  O    . GLY A 1 35 ? -2.681  -4.661  1.093   1.00 0.36  ? 1137 GLY A O    6  
ATOM   3661  H  H    . GLY A 1 35 ? 0.102   -7.793  0.333   1.00 0.82  ? 1137 GLY A H    6  
ATOM   3662  H  HA2  . GLY A 1 35 ? -1.238  -6.322  -0.828  1.00 0.51  ? 1137 GLY A HA2  6  
ATOM   3663  H  HA3  . GLY A 1 35 ? -2.615  -6.985  0.051   1.00 0.72  ? 1137 GLY A HA3  6  
ATOM   3664  N  N    . SER A 1 36 ? -0.549  -5.090  1.682   1.00 0.32  ? 1138 SER A N    6  
ATOM   3665  C  CA   . SER A 1 36 ? -0.446  -3.989  2.616   1.00 0.28  ? 1138 SER A CA   6  
ATOM   3666  C  C    . SER A 1 36 ? -0.502  -2.650  1.892   1.00 0.25  ? 1138 SER A C    6  
ATOM   3667  O  O    . SER A 1 36 ? -0.923  -1.640  2.458   1.00 0.40  ? 1138 SER A O    6  
ATOM   3668  C  CB   . SER A 1 36 ? 0.841   -4.127  3.434   1.00 0.33  ? 1138 SER A CB   6  
ATOM   3669  O  OG   . SER A 1 36 ? 1.946   -4.446  2.601   1.00 0.44  ? 1138 SER A OG   6  
ATOM   3670  H  H    . SER A 1 36 ? 0.233   -5.660  1.539   1.00 0.37  ? 1138 SER A H    6  
ATOM   3671  H  HA   . SER A 1 36 ? -1.291  -4.051  3.283   1.00 0.33  ? 1138 SER A HA   6  
ATOM   3672  H  HB2  . SER A 1 36 ? 1.040   -3.198  3.943   1.00 0.40  ? 1138 SER A HB2  6  
ATOM   3673  H  HB3  . SER A 1 36 ? 0.723   -4.914  4.165   1.00 0.39  ? 1138 SER A HB3  6  
ATOM   3674  H  HG   . SER A 1 36 ? 2.200   -5.376  2.743   1.00 1.17  ? 1138 SER A HG   6  
ATOM   3675  N  N    . ASP A 1 37 ? -0.099  -2.659  0.632   1.00 0.18  ? 1139 ASP A N    6  
ATOM   3676  C  CA   . ASP A 1 37 ? -0.197  -1.484  -0.215  1.00 0.18  ? 1139 ASP A CA   6  
ATOM   3677  C  C    . ASP A 1 37 ? -1.666  -1.185  -0.508  1.00 0.20  ? 1139 ASP A C    6  
ATOM   3678  O  O    . ASP A 1 37 ? -2.073  -0.032  -0.615  1.00 0.29  ? 1139 ASP A O    6  
ATOM   3679  C  CB   . ASP A 1 37 ? 0.561   -1.718  -1.521  1.00 0.19  ? 1139 ASP A CB   6  
ATOM   3680  C  CG   . ASP A 1 37 ? -0.098  -2.770  -2.384  1.00 0.26  ? 1139 ASP A CG   6  
ATOM   3681  O  OD1  . ASP A 1 37 ? -0.128  -3.954  -1.974  1.00 0.33  ? 1139 ASP A OD1  6  
ATOM   3682  O  OD2  . ASP A 1 37 ? -0.621  -2.415  -3.459  1.00 0.32  ? 1139 ASP A OD2  6  
ATOM   3683  H  H    . ASP A 1 37 ? 0.278   -3.484  0.256   1.00 0.26  ? 1139 ASP A H    6  
ATOM   3684  H  HA   . ASP A 1 37 ? 0.241   -0.649  0.308   1.00 0.20  ? 1139 ASP A HA   6  
ATOM   3685  H  HB2  . ASP A 1 37 ? 0.603   -0.795  -2.077  1.00 0.22  ? 1139 ASP A HB2  6  
ATOM   3686  H  HB3  . ASP A 1 37 ? 1.566   -2.042  -1.293  1.00 0.19  ? 1139 ASP A HB3  6  
ATOM   3687  N  N    . GLU A 1 38 ? -2.461  -2.243  -0.612  1.00 0.22  ? 1140 GLU A N    6  
ATOM   3688  C  CA   . GLU A 1 38 ? -3.887  -2.112  -0.871  1.00 0.27  ? 1140 GLU A CA   6  
ATOM   3689  C  C    . GLU A 1 38 ? -4.621  -1.732  0.409   1.00 0.31  ? 1140 GLU A C    6  
ATOM   3690  O  O    . GLU A 1 38 ? -5.533  -0.905  0.395   1.00 0.44  ? 1140 GLU A O    6  
ATOM   3691  C  CB   . GLU A 1 38 ? -4.458  -3.425  -1.416  1.00 0.29  ? 1140 GLU A CB   6  
ATOM   3692  C  CG   . GLU A 1 38 ? -3.781  -3.926  -2.683  1.00 0.29  ? 1140 GLU A CG   6  
ATOM   3693  C  CD   . GLU A 1 38 ? -3.982  -3.010  -3.874  1.00 0.28  ? 1140 GLU A CD   6  
ATOM   3694  O  OE1  . GLU A 1 38 ? -5.069  -2.413  -4.001  1.00 0.38  ? 1140 GLU A OE1  6  
ATOM   3695  O  OE2  . GLU A 1 38 ? -3.049  -2.888  -4.700  1.00 0.28  ? 1140 GLU A OE2  6  
ATOM   3696  H  H    . GLU A 1 38 ? -2.074  -3.139  -0.516  1.00 0.24  ? 1140 GLU A H    6  
ATOM   3697  H  HA   . GLU A 1 38 ? -4.025  -1.333  -1.605  1.00 0.30  ? 1140 GLU A HA   6  
ATOM   3698  H  HB2  . GLU A 1 38 ? -4.357  -4.186  -0.658  1.00 0.32  ? 1140 GLU A HB2  6  
ATOM   3699  H  HB3  . GLU A 1 38 ? -5.507  -3.283  -1.629  1.00 0.33  ? 1140 GLU A HB3  6  
ATOM   3700  H  HG2  . GLU A 1 38 ? -2.722  -4.010  -2.494  1.00 0.29  ? 1140 GLU A HG2  6  
ATOM   3701  H  HG3  . GLU A 1 38 ? -4.180  -4.900  -2.925  1.00 0.33  ? 1140 GLU A HG3  6  
ATOM   3702  N  N    . LYS A 1 39 ? -4.205  -2.332  1.521   1.00 0.30  ? 1141 LYS A N    6  
ATOM   3703  C  CA   . LYS A 1 39 ? -4.871  -2.117  2.800   1.00 0.37  ? 1141 LYS A CA   6  
ATOM   3704  C  C    . LYS A 1 39 ? -4.645  -0.696  3.294   1.00 0.49  ? 1141 LYS A C    6  
ATOM   3705  O  O    . LYS A 1 39 ? -5.462  -0.153  4.034   1.00 0.57  ? 1141 LYS A O    6  
ATOM   3706  C  CB   . LYS A 1 39 ? -4.392  -3.133  3.842   1.00 0.47  ? 1141 LYS A CB   6  
ATOM   3707  C  CG   . LYS A 1 39 ? -3.088  -2.778  4.535   1.00 0.57  ? 1141 LYS A CG   6  
ATOM   3708  C  CD   . LYS A 1 39 ? -2.576  -3.958  5.345   1.00 0.76  ? 1141 LYS A CD   6  
ATOM   3709  C  CE   . LYS A 1 39 ? -1.340  -3.612  6.148   1.00 0.91  ? 1141 LYS A CE   6  
ATOM   3710  N  NZ   . LYS A 1 39 ? -0.787  -4.813  6.829   1.00 1.55  ? 1141 LYS A NZ   6  
ATOM   3711  H  H    . LYS A 1 39 ? -3.437  -2.944  1.475   1.00 0.32  ? 1141 LYS A H    6  
ATOM   3712  H  HA   . LYS A 1 39 ? -5.929  -2.257  2.641   1.00 0.39  ? 1141 LYS A HA   6  
ATOM   3713  H  HB2  . LYS A 1 39 ? -5.149  -3.229  4.596   1.00 0.56  ? 1141 LYS A HB2  6  
ATOM   3714  H  HB3  . LYS A 1 39 ? -4.264  -4.088  3.355   1.00 0.47  ? 1141 LYS A HB3  6  
ATOM   3715  H  HG2  . LYS A 1 39 ? -2.352  -2.505  3.792   1.00 0.50  ? 1141 LYS A HG2  6  
ATOM   3716  H  HG3  . LYS A 1 39 ? -3.259  -1.943  5.200   1.00 0.65  ? 1141 LYS A HG3  6  
ATOM   3717  H  HD2  . LYS A 1 39 ? -3.350  -4.281  6.021   1.00 0.88  ? 1141 LYS A HD2  6  
ATOM   3718  H  HD3  . LYS A 1 39 ? -2.331  -4.762  4.666   1.00 0.73  ? 1141 LYS A HD3  6  
ATOM   3719  H  HE2  . LYS A 1 39 ? -0.592  -3.207  5.482   1.00 1.15  ? 1141 LYS A HE2  6  
ATOM   3720  H  HE3  . LYS A 1 39 ? -1.600  -2.873  6.890   1.00 1.18  ? 1141 LYS A HE3  6  
ATOM   3721  H  HZ1  . LYS A 1 39 ? 0.093   -4.572  7.324   1.00 2.08  ? 1141 LYS A HZ1  6  
ATOM   3722  H  HZ2  . LYS A 1 39 ? -0.590  -5.562  6.129   1.00 1.99  ? 1141 LYS A HZ2  6  
ATOM   3723  H  HZ3  . LYS A 1 39 ? -1.473  -5.180  7.521   1.00 1.97  ? 1141 LYS A HZ3  6  
ATOM   3724  N  N    . ASN A 1 40 ? -3.547  -0.090  2.865   1.00 0.60  ? 1142 ASN A N    6  
ATOM   3725  C  CA   . ASN A 1 40 ? -3.262  1.305   3.187   1.00 0.81  ? 1142 ASN A CA   6  
ATOM   3726  C  C    . ASN A 1 40 ? -4.035  2.208   2.221   1.00 0.91  ? 1142 ASN A C    6  
ATOM   3727  O  O    . ASN A 1 40 ? -3.519  3.193   1.694   1.00 1.44  ? 1142 ASN A O    6  
ATOM   3728  C  CB   . ASN A 1 40 ? -1.749  1.565   3.105   1.00 1.07  ? 1142 ASN A CB   6  
ATOM   3729  C  CG   . ASN A 1 40 ? -1.326  2.879   3.749   1.00 1.37  ? 1142 ASN A CG   6  
ATOM   3730  O  OD1  . ASN A 1 40 ? -1.058  2.937   4.951   1.00 2.05  ? 1142 ASN A OD1  6  
ATOM   3731  N  ND2  . ASN A 1 40 ? -1.248  3.938   2.958   1.00 1.92  ? 1142 ASN A ND2  6  
ATOM   3732  H  H    . ASN A 1 40 ? -2.906  -0.597  2.320   1.00 0.58  ? 1142 ASN A H    6  
ATOM   3733  H  HA   . ASN A 1 40 ? -3.604  1.493   4.194   1.00 0.86  ? 1142 ASN A HA   6  
ATOM   3734  H  HB2  . ASN A 1 40 ? -1.229  0.763   3.607   1.00 1.54  ? 1142 ASN A HB2  6  
ATOM   3735  H  HB3  . ASN A 1 40 ? -1.452  1.581   2.068   1.00 1.56  ? 1142 ASN A HB3  6  
ATOM   3736  H  HD21 . ASN A 1 40 ? -1.468  3.821   2.008   1.00 2.20  ? 1142 ASN A HD21 6  
ATOM   3737  H  HD22 . ASN A 1 40 ? -0.981  4.794   3.352   1.00 2.44  ? 1142 ASN A HD22 6  
ATOM   3738  N  N    . CYS A 1 41 ? -5.289  1.843   1.994   1.00 0.76  ? 1143 CYS A N    6  
ATOM   3739  C  CA   . CYS A 1 41 ? -6.152  2.534   1.052   1.00 0.99  ? 1143 CYS A CA   6  
ATOM   3740  C  C    . CYS A 1 41 ? -7.576  2.003   1.173   1.00 1.29  ? 1143 CYS A C    6  
ATOM   3741  O  O    . CYS A 1 41 ? -8.522  2.763   1.385   1.00 1.67  ? 1143 CYS A O    6  
ATOM   3742  C  CB   . CYS A 1 41 ? -5.642  2.345   -0.377  1.00 0.93  ? 1143 CYS A CB   6  
ATOM   3743  S  SG   . CYS A 1 41 ? -6.682  3.126   -1.653  1.00 1.10  ? 1143 CYS A SG   6  
ATOM   3744  H  H    . CYS A 1 41 ? -5.653  1.079   2.491   1.00 0.89  ? 1143 CYS A H    6  
ATOM   3745  H  HA   . CYS A 1 41 ? -6.146  3.585   1.298   1.00 1.23  ? 1143 CYS A HA   6  
ATOM   3746  H  HB2  . CYS A 1 41 ? -4.653  2.769   -0.458  1.00 0.98  ? 1143 CYS A HB2  6  
ATOM   3747  H  HB3  . CYS A 1 41 ? -5.593  1.289   -0.595  1.00 1.29  ? 1143 CYS A HB3  6  
ATOM   3748  N  N    . ASN A 1 42 ? -7.723  0.689   1.049   1.00 1.87  ? 1144 ASN A N    6  
ATOM   3749  C  CA   . ASN A 1 42 ? -9.027  0.055   1.184   1.00 2.36  ? 1144 ASN A CA   6  
ATOM   3750  C  C    . ASN A 1 42 ? -9.065  -0.846  2.411   1.00 3.05  ? 1144 ASN A C    6  
ATOM   3751  O  O    . ASN A 1 42 ? -8.612  -1.991  2.372   1.00 3.73  ? 1144 ASN A O    6  
ATOM   3752  C  CB   . ASN A 1 42 ? -9.366  -0.749  -0.057  1.00 3.11  ? 1144 ASN A CB   6  
ATOM   3753  C  CG   . ASN A 1 42 ? -10.806 -1.234  -0.060  1.00 3.87  ? 1144 ASN A CG   6  
ATOM   3754  O  OD1  . ASN A 1 42 ? -11.116 -2.318  0.439   1.00 4.27  ? 1144 ASN A OD1  6  
ATOM   3755  N  ND2  . ASN A 1 42 ? -11.699 -0.433  -0.622  1.00 4.59  ? 1144 ASN A ND2  6  
ATOM   3756  H  H    . ASN A 1 42 ? -6.935  0.129   0.852   1.00 2.27  ? 1144 ASN A H    6  
ATOM   3757  H  HA   . ASN A 1 42 ? -9.755  0.821   1.296   1.00 2.42  ? 1144 ASN A HA   6  
ATOM   3758  H  HB2  . ASN A 1 42 ? -9.204  -0.142  -0.934  1.00 3.41  ? 1144 ASN A HB2  6  
ATOM   3759  H  HB3  . ASN A 1 42 ? -8.725  -1.594  -0.088  1.00 3.38  ? 1144 ASN A HB3  6  
ATOM   3760  H  HD21 . ASN A 1 42 ? -11.388 0.418   -1.001  1.00 4.61  ? 1144 ASN A HD21 6  
ATOM   3761  H  HD22 . ASN A 1 42 ? -12.636 -0.723  -0.640  1.00 5.30  ? 1144 ASN A HD22 6  
ATOM   3762  N  N    . SER A 1 43 ? -9.588  -0.313  3.506   1.00 3.53  ? 1145 SER A N    6  
ATOM   3763  C  CA   . SER A 1 43 ? -9.735  -1.067  4.741   1.00 4.69  ? 1145 SER A CA   6  
ATOM   3764  C  C    . SER A 1 43 ? -10.639 -0.320  5.708   1.00 5.23  ? 1145 SER A C    6  
ATOM   3765  O  O    . SER A 1 43 ? -10.526 0.898   5.864   1.00 5.32  ? 1145 SER A O    6  
ATOM   3766  C  CB   . SER A 1 43 ? -8.370  -1.327  5.387   1.00 5.40  ? 1145 SER A CB   6  
ATOM   3767  O  OG   . SER A 1 43 ? -7.634  -0.123  5.538   1.00 5.26  ? 1145 SER A OG   6  
ATOM   3768  H  H    . SER A 1 43 ? -9.896  0.619   3.482   1.00 3.45  ? 1145 SER A H    6  
ATOM   3769  H  HA   . SER A 1 43 ? -10.193 -2.014  4.498   1.00 5.07  ? 1145 SER A HA   6  
ATOM   3770  H  HB2  . SER A 1 43 ? -8.514  -1.770  6.360   1.00 6.23  ? 1145 SER A HB2  6  
ATOM   3771  H  HB3  . SER A 1 43 ? -7.806  -2.004  4.765   1.00 5.56  ? 1145 SER A HB3  6  
ATOM   3772  H  HG   . SER A 1 43 ? -6.869  -0.137  4.940   1.00 5.21  ? 1145 SER A HG   6  
ATOM   3773  N  N    . THR A 1 44 ? -11.530 -1.044  6.358   1.00 5.97  ? 1146 THR A N    6  
ATOM   3774  C  CA   . THR A 1 44 ? -12.443 -0.450  7.320   1.00 6.81  ? 1146 THR A CA   6  
ATOM   3775  C  C    . THR A 1 44 ? -11.828 -0.439  8.716   1.00 7.34  ? 1146 THR A C    6  
ATOM   3776  O  O    . THR A 1 44 ? -12.467 -0.817  9.700   1.00 8.15  ? 1146 THR A O    6  
ATOM   3777  C  CB   . THR A 1 44 ? -13.790 -1.200  7.344   1.00 7.69  ? 1146 THR A CB   6  
ATOM   3778  O  OG1  . THR A 1 44 ? -13.573 -2.616  7.465   1.00 7.92  ? 1146 THR A OG1  6  
ATOM   3779  C  CG2  . THR A 1 44 ? -14.587 -0.908  6.084   1.00 7.74  ? 1146 THR A CG2  6  
ATOM   3780  H  H    . THR A 1 44 ? -11.573 -2.010  6.190   1.00 6.16  ? 1146 THR A H    6  
ATOM   3781  H  HA   . THR A 1 44 ? -12.629 0.569   7.013   1.00 6.75  ? 1146 THR A HA   6  
ATOM   3782  H  HB   . THR A 1 44 ? -14.358 -0.857  8.197   1.00 8.40  ? 1146 THR A HB   6  
ATOM   3783  H  HG1  . THR A 1 44 ? -12.627 -2.794  7.556   1.00 8.03  ? 1146 THR A HG1  6  
ATOM   3784  H  HG21 . THR A 1 44 ? -15.515 -1.457  6.110   1.00 7.71  ? 1146 THR A HG21 6  
ATOM   3785  H  HG22 . THR A 1 44 ? -14.014 -1.209  5.219   1.00 7.80  ? 1146 THR A HG22 6  
ATOM   3786  H  HG23 . THR A 1 44 ? -14.795 0.150   6.026   1.00 8.03  ? 1146 THR A HG23 6  
ATOM   3787  N  N    . GLU A 1 45 ? -10.582 0.016   8.794   1.00 7.13  ? 1147 GLU A N    6  
ATOM   3788  C  CA   . GLU A 1 45 ? -9.838  0.037   10.050  1.00 7.94  ? 1147 GLU A CA   6  
ATOM   3789  C  C    . GLU A 1 45 ? -10.417 1.054   11.031  1.00 8.95  ? 1147 GLU A C    6  
ATOM   3790  O  O    . GLU A 1 45 ? -10.100 1.034   12.222  1.00 9.87  ? 1147 GLU A O    6  
ATOM   3791  C  CB   . GLU A 1 45 ? -8.343  0.295   9.790   1.00 7.79  ? 1147 GLU A CB   6  
ATOM   3792  C  CG   . GLU A 1 45 ? -8.032  1.464   8.855   1.00 7.90  ? 1147 GLU A CG   6  
ATOM   3793  C  CD   . GLU A 1 45 ? -8.223  2.822   9.495   1.00 8.00  ? 1147 GLU A CD   6  
ATOM   3794  O  OE1  . GLU A 1 45 ? -7.376  3.219   10.320  1.00 8.23  ? 1147 GLU A OE1  6  
ATOM   3795  O  OE2  . GLU A 1 45 ? -9.224  3.497   9.177   1.00 8.08  ? 1147 GLU A OE2  6  
ATOM   3796  H  H    . GLU A 1 45 ? -10.148 0.345   7.978   1.00 6.60  ? 1147 GLU A H    6  
ATOM   3797  H  HA   . GLU A 1 45 ? -9.941  -0.943  10.491  1.00 8.20  ? 1147 GLU A HA   6  
ATOM   3798  H  HB2  . GLU A 1 45 ? -7.861  0.493   10.735  1.00 8.33  ? 1147 GLU A HB2  6  
ATOM   3799  H  HB3  . GLU A 1 45 ? -7.909  -0.598  9.364   1.00 7.37  ? 1147 GLU A HB3  6  
ATOM   3800  H  HG2  . GLU A 1 45 ? -7.005  1.384   8.535   1.00 7.80  ? 1147 GLU A HG2  6  
ATOM   3801  H  HG3  . GLU A 1 45 ? -8.676  1.397   7.991   1.00 8.35  ? 1147 GLU A HG3  6  
ATOM   3802  N  N    . THR A 1 46 ? -11.278 1.929   10.527  1.00 8.94  ? 1148 THR A N    6  
ATOM   3803  C  CA   . THR A 1 46 ? -11.967 2.898   11.363  1.00 10.03 ? 1148 THR A CA   6  
ATOM   3804  C  C    . THR A 1 46 ? -13.045 2.207   12.204  1.00 10.71 ? 1148 THR A C    6  
ATOM   3805  O  O    . THR A 1 46 ? -13.526 2.751   13.197  1.00 11.12 ? 1148 THR A O    6  
ATOM   3806  C  CB   . THR A 1 46 ? -12.600 4.015   10.503  1.00 10.21 ? 1148 THR A CB   6  
ATOM   3807  O  OG1  . THR A 1 46 ? -13.105 5.073   11.329  1.00 9.58  ? 1148 THR A OG1  6  
ATOM   3808  C  CG2  . THR A 1 46 ? -13.725 3.454   9.661   1.00 11.01 ? 1148 THR A CG2  6  
ATOM   3809  H  H    . THR A 1 46 ? -11.440 1.935   9.561   1.00 8.30  ? 1148 THR A H    6  
ATOM   3810  H  HA   . THR A 1 46 ? -11.249 3.346   12.018  1.00 10.45 ? 1148 THR A HA   6  
ATOM   3811  H  HB   . THR A 1 46 ? -11.842 4.413   9.843   1.00 10.48 ? 1148 THR A HB   6  
ATOM   3812  H  HG1  . THR A 1 46 ? -12.366 5.529   11.753  1.00 9.43  ? 1148 THR A HG1  6  
ATOM   3813  H  HG21 . THR A 1 46 ? -14.147 4.239   9.054   1.00 11.19 ? 1148 THR A HG21 6  
ATOM   3814  H  HG22 . THR A 1 46 ? -14.483 3.049   10.311  1.00 11.07 ? 1148 THR A HG22 6  
ATOM   3815  H  HG23 . THR A 1 46 ? -13.338 2.673   9.028   1.00 11.53 ? 1148 THR A HG23 6  
HETATM 3816  CA CA   . CA  B 2 .  ? -0.946  -3.339  -5.458  1.00 0.28  ? 1201 CA  A CA   6  
ATOM   3817  N  N    . THR A 1 1  ? 25.144  -3.070  11.722  1.00 12.23 ? 1103 THR A N    7  
ATOM   3818  C  CA   . THR A 1 1  ? 25.362  -4.172  10.767  1.00 11.73 ? 1103 THR A CA   7  
ATOM   3819  C  C    . THR A 1 1  ? 24.491  -3.989  9.526   1.00 10.83 ? 1103 THR A C    7  
ATOM   3820  O  O    . THR A 1 1  ? 23.461  -4.648  9.376   1.00 10.67 ? 1103 THR A O    7  
ATOM   3821  C  CB   . THR A 1 1  ? 25.046  -5.528  11.423  1.00 11.83 ? 1103 THR A CB   7  
ATOM   3822  O  OG1  . THR A 1 1  ? 25.578  -5.557  12.755  1.00 12.26 ? 1103 THR A OG1  7  
ATOM   3823  C  CG2  . THR A 1 1  ? 25.640  -6.675  10.617  1.00 12.04 ? 1103 THR A CG2  7  
ATOM   3824  H  H1   . THR A 1 1  ? 25.721  -3.216  12.572  1.00 12.23 ? 1103 THR A H1   7  
ATOM   3825  H  H2   . THR A 1 1  ? 24.145  -3.029  11.997  1.00 12.55 ? 1103 THR A H2   7  
ATOM   3826  H  H3   . THR A 1 1  ? 25.410  -2.164  11.289  1.00 12.44 ? 1103 THR A H3   7  
ATOM   3827  H  HA   . THR A 1 1  ? 26.401  -4.168  10.470  1.00 12.16 ? 1103 THR A HA   7  
ATOM   3828  H  HB   . THR A 1 1  ? 23.974  -5.652  11.465  1.00 11.67 ? 1103 THR A HB   7  
ATOM   3829  H  HG1  . THR A 1 1  ? 24.847  -5.645  13.385  1.00 12.30 ? 1103 THR A HG1  7  
ATOM   3830  H  HG21 . THR A 1 1  ? 26.712  -6.564  10.569  1.00 12.31 ? 1103 THR A HG21 7  
ATOM   3831  H  HG22 . THR A 1 1  ? 25.231  -6.663  9.619   1.00 12.05 ? 1103 THR A HG22 7  
ATOM   3832  H  HG23 . THR A 1 1  ? 25.397  -7.614  11.095  1.00 12.10 ? 1103 THR A HG23 7  
ATOM   3833  N  N    . HIS A 1 2  ? 24.910  -3.075  8.650   1.00 10.41 ? 1104 HIS A N    7  
ATOM   3834  C  CA   . HIS A 1 2  ? 24.200  -2.793  7.404   1.00 9.72  ? 1104 HIS A CA   7  
ATOM   3835  C  C    . HIS A 1 2  ? 22.811  -2.220  7.687   1.00 8.65  ? 1104 HIS A C    7  
ATOM   3836  O  O    . HIS A 1 2  ? 21.817  -2.945  7.715   1.00 8.32  ? 1104 HIS A O    7  
ATOM   3837  C  CB   . HIS A 1 2  ? 24.094  -4.059  6.538   1.00 10.05 ? 1104 HIS A CB   7  
ATOM   3838  C  CG   . HIS A 1 2  ? 23.561  -3.811  5.158   1.00 10.43 ? 1104 HIS A CG   7  
ATOM   3839  N  ND1  . HIS A 1 2  ? 22.260  -4.081  4.788   1.00 10.71 ? 1104 HIS A ND1  7  
ATOM   3840  C  CD2  . HIS A 1 2  ? 24.170  -3.332  4.050   1.00 10.84 ? 1104 HIS A CD2  7  
ATOM   3841  C  CE1  . HIS A 1 2  ? 22.096  -3.781  3.514   1.00 11.25 ? 1104 HIS A CE1  7  
ATOM   3842  N  NE2  . HIS A 1 2  ? 23.240  -3.323  3.041   1.00 11.34 ? 1104 HIS A NE2  7  
ATOM   3843  H  H    . HIS A 1 2  ? 25.725  -2.566  8.853   1.00 10.71 ? 1104 HIS A H    7  
ATOM   3844  H  HA   . HIS A 1 2  ? 24.773  -2.052  6.866   1.00 9.96  ? 1104 HIS A HA   7  
ATOM   3845  H  HB2  . HIS A 1 2  ? 25.073  -4.501  6.438   1.00 10.50 ? 1104 HIS A HB2  7  
ATOM   3846  H  HB3  . HIS A 1 2  ? 23.436  -4.764  7.026   1.00 9.81  ? 1104 HIS A HB3  7  
ATOM   3847  H  HD1  . HIS A 1 2  ? 21.556  -4.435  5.376   1.00 10.68 ? 1104 HIS A HD1  7  
ATOM   3848  H  HD2  . HIS A 1 2  ? 25.200  -3.011  3.973   1.00 10.94 ? 1104 HIS A HD2  7  
ATOM   3849  H  HE1  . HIS A 1 2  ? 21.180  -3.890  2.952   1.00 11.71 ? 1104 HIS A HE1  7  
ATOM   3850  H  HE2  . HIS A 1 2  ? 23.443  -3.203  2.087   1.00 11.83 ? 1104 HIS A HE2  7  
ATOM   3851  N  N    . ALA A 1 3  ? 22.756  -0.913  7.897   1.00 8.30  ? 1105 ALA A N    7  
ATOM   3852  C  CA   . ALA A 1 3  ? 21.495  -0.234  8.164   1.00 7.41  ? 1105 ALA A CA   7  
ATOM   3853  C  C    . ALA A 1 3  ? 20.604  -0.261  6.927   1.00 6.47  ? 1105 ALA A C    7  
ATOM   3854  O  O    . ALA A 1 3  ? 21.055  0.076   5.829   1.00 6.54  ? 1105 ALA A O    7  
ATOM   3855  C  CB   . ALA A 1 3  ? 21.749  1.200   8.601   1.00 7.70  ? 1105 ALA A CB   7  
ATOM   3856  H  H    . ALA A 1 3  ? 23.584  -0.388  7.867   1.00 8.79  ? 1105 ALA A H    7  
ATOM   3857  H  HA   . ALA A 1 3  ? 20.999  -0.751  8.970   1.00 7.45  ? 1105 ALA A HA   7  
ATOM   3858  H  HB1  . ALA A 1 3  ? 22.204  1.748   7.792   1.00 7.93  ? 1105 ALA A HB1  7  
ATOM   3859  H  HB2  . ALA A 1 3  ? 22.412  1.205   9.454   1.00 7.73  ? 1105 ALA A HB2  7  
ATOM   3860  H  HB3  . ALA A 1 3  ? 20.812  1.666   8.871   1.00 7.95  ? 1105 ALA A HB3  7  
ATOM   3861  N  N    . PRO A 1 4  ? 19.334  -0.677  7.082   1.00 5.80  ? 1106 PRO A N    7  
ATOM   3862  C  CA   . PRO A 1 4  ? 18.387  -0.752  5.969   1.00 4.97  ? 1106 PRO A CA   7  
ATOM   3863  C  C    . PRO A 1 4  ? 18.173  0.605   5.311   1.00 4.25  ? 1106 PRO A C    7  
ATOM   3864  O  O    . PRO A 1 4  ? 17.825  1.585   5.975   1.00 4.22  ? 1106 PRO A O    7  
ATOM   3865  C  CB   . PRO A 1 4  ? 17.085  -1.240  6.610   1.00 4.84  ? 1106 PRO A CB   7  
ATOM   3866  C  CG   . PRO A 1 4  ? 17.490  -1.844  7.911   1.00 5.55  ? 1106 PRO A CG   7  
ATOM   3867  C  CD   . PRO A 1 4  ? 18.724  -1.109  8.351   1.00 6.09  ? 1106 PRO A CD   7  
ATOM   3868  H  HA   . PRO A 1 4  ? 18.713  -1.461  5.224   1.00 5.32  ? 1106 PRO A HA   7  
ATOM   3869  H  HB2  . PRO A 1 4  ? 16.420  -0.402  6.754   1.00 4.32  ? 1106 PRO A HB2  7  
ATOM   3870  H  HB3  . PRO A 1 4  ? 16.616  -1.969  5.967   1.00 5.12  ? 1106 PRO A HB3  7  
ATOM   3871  H  HG2  . PRO A 1 4  ? 16.700  -1.717  8.636   1.00 5.52  ? 1106 PRO A HG2  7  
ATOM   3872  H  HG3  . PRO A 1 4  ? 17.708  -2.894  7.775   1.00 6.00  ? 1106 PRO A HG3  7  
ATOM   3873  H  HD2  . PRO A 1 4  ? 18.461  -0.259  8.963   1.00 6.19  ? 1106 PRO A HD2  7  
ATOM   3874  H  HD3  . PRO A 1 4  ? 19.384  -1.774  8.889   1.00 6.80  ? 1106 PRO A HD3  7  
ATOM   3875  N  N    . ALA A 1 5  ? 18.388  0.654   4.011   1.00 4.09  ? 1107 ALA A N    7  
ATOM   3876  C  CA   . ALA A 1 5  ? 18.235  1.883   3.254   1.00 3.77  ? 1107 ALA A CA   7  
ATOM   3877  C  C    . ALA A 1 5  ? 16.789  2.059   2.817   1.00 2.63  ? 1107 ALA A C    7  
ATOM   3878  O  O    . ALA A 1 5  ? 16.048  1.081   2.683   1.00 2.62  ? 1107 ALA A O    7  
ATOM   3879  C  CB   . ALA A 1 5  ? 19.158  1.871   2.046   1.00 4.73  ? 1107 ALA A CB   7  
ATOM   3880  H  H    . ALA A 1 5  ? 18.650  -0.166  3.541   1.00 4.51  ? 1107 ALA A H    7  
ATOM   3881  H  HA   . ALA A 1 5  ? 18.516  2.710   3.890   1.00 4.04  ? 1107 ALA A HA   7  
ATOM   3882  H  HB1  . ALA A 1 5  ? 18.887  1.052   1.395   1.00 5.01  ? 1107 ALA A HB1  7  
ATOM   3883  H  HB2  . ALA A 1 5  ? 20.179  1.748   2.374   1.00 4.95  ? 1107 ALA A HB2  7  
ATOM   3884  H  HB3  . ALA A 1 5  ? 19.061  2.803   1.509   1.00 5.29  ? 1107 ALA A HB3  7  
ATOM   3885  N  N    . SER A 1 6  ? 16.385  3.301   2.616   1.00 2.16  ? 1108 SER A N    7  
ATOM   3886  C  CA   . SER A 1 6  ? 15.044  3.599   2.154   1.00 1.43  ? 1108 SER A CA   7  
ATOM   3887  C  C    . SER A 1 6  ? 14.955  3.377   0.653   1.00 1.29  ? 1108 SER A C    7  
ATOM   3888  O  O    . SER A 1 6  ? 15.854  3.767   -0.099  1.00 1.97  ? 1108 SER A O    7  
ATOM   3889  C  CB   . SER A 1 6  ? 14.661  5.038   2.515   1.00 2.09  ? 1108 SER A CB   7  
ATOM   3890  O  OG   . SER A 1 6  ? 15.657  5.960   2.102   1.00 2.97  ? 1108 SER A OG   7  
ATOM   3891  H  H    . SER A 1 6  ? 17.007  4.041   2.777   1.00 2.71  ? 1108 SER A H    7  
ATOM   3892  H  HA   . SER A 1 6  ? 14.368  2.918   2.648   1.00 1.32  ? 1108 SER A HA   7  
ATOM   3893  H  HB2  . SER A 1 6  ? 13.730  5.292   2.029   1.00 2.36  ? 1108 SER A HB2  7  
ATOM   3894  H  HB3  . SER A 1 6  ? 14.538  5.116   3.586   1.00 2.13  ? 1108 SER A HB3  7  
ATOM   3895  H  HG   . SER A 1 6  ? 15.324  6.859   2.219   1.00 3.32  ? 1108 SER A HG   7  
ATOM   3896  N  N    . CYS A 1 7  ? 13.884  2.726   0.230   1.00 0.72  ? 1109 CYS A N    7  
ATOM   3897  C  CA   . CYS A 1 7  ? 13.662  2.432   -1.176  1.00 0.49  ? 1109 CYS A CA   7  
ATOM   3898  C  C    . CYS A 1 7  ? 13.395  3.703   -1.976  1.00 0.46  ? 1109 CYS A C    7  
ATOM   3899  O  O    . CYS A 1 7  ? 13.371  4.803   -1.417  1.00 0.62  ? 1109 CYS A O    7  
ATOM   3900  C  CB   . CYS A 1 7  ? 12.525  1.417   -1.309  1.00 0.33  ? 1109 CYS A CB   7  
ATOM   3901  S  SG   . CYS A 1 7  ? 12.964  -0.208  -0.608  1.00 0.47  ? 1109 CYS A SG   7  
ATOM   3902  H  H    . CYS A 1 7  ? 13.217  2.426   0.889   1.00 0.94  ? 1109 CYS A H    7  
ATOM   3903  H  HA   . CYS A 1 7  ? 14.559  1.980   -1.561  1.00 0.60  ? 1109 CYS A HA   7  
ATOM   3904  H  HB2  . CYS A 1 7  ? 11.654  1.784   -0.787  1.00 0.41  ? 1109 CYS A HB2  7  
ATOM   3905  H  HB3  . CYS A 1 7  ? 12.280  1.272   -2.347  1.00 0.29  ? 1109 CYS A HB3  7  
ATOM   3906  N  N    . LEU A 1 8  ? 13.217  3.540   -3.282  1.00 0.34  ? 1110 LEU A N    7  
ATOM   3907  C  CA   . LEU A 1 8  ? 13.044  4.655   -4.212  1.00 0.32  ? 1110 LEU A CA   7  
ATOM   3908  C  C    . LEU A 1 8  ? 12.011  5.653   -3.695  1.00 0.29  ? 1110 LEU A C    7  
ATOM   3909  O  O    . LEU A 1 8  ? 11.080  5.283   -2.979  1.00 0.30  ? 1110 LEU A O    7  
ATOM   3910  C  CB   . LEU A 1 8  ? 12.570  4.091   -5.543  1.00 0.28  ? 1110 LEU A CB   7  
ATOM   3911  C  CG   . LEU A 1 8  ? 13.067  4.776   -6.810  1.00 0.38  ? 1110 LEU A CG   7  
ATOM   3912  C  CD1  . LEU A 1 8  ? 14.587  4.754   -6.876  1.00 0.52  ? 1110 LEU A CD1  7  
ATOM   3913  C  CD2  . LEU A 1 8  ? 12.470  4.079   -8.020  1.00 0.39  ? 1110 LEU A CD2  7  
ATOM   3914  H  H    . LEU A 1 8  ? 13.193  2.627   -3.643  1.00 0.34  ? 1110 LEU A H    7  
ATOM   3915  H  HA   . LEU A 1 8  ? 13.992  5.149   -4.344  1.00 0.40  ? 1110 LEU A HA   7  
ATOM   3916  H  HB2  . LEU A 1 8  ? 12.860  3.056   -5.586  1.00 0.32  ? 1110 LEU A HB2  7  
ATOM   3917  H  HB3  . LEU A 1 8  ? 11.491  4.130   -5.548  1.00 0.22  ? 1110 LEU A HB3  7  
ATOM   3918  H  HG   . LEU A 1 8  ? 12.741  5.805   -6.814  1.00 0.41  ? 1110 LEU A HG   7  
ATOM   3919  H  HD11 . LEU A 1 8  ? 14.934  3.734   -6.820  1.00 1.05  ? 1110 LEU A HD11 7  
ATOM   3920  H  HD12 . LEU A 1 8  ? 14.992  5.320   -6.052  1.00 1.29  ? 1110 LEU A HD12 7  
ATOM   3921  H  HD13 . LEU A 1 8  ? 14.911  5.193   -7.808  1.00 1.07  ? 1110 LEU A HD13 7  
ATOM   3922  H  HD21 . LEU A 1 8  ? 11.394  4.166   -7.987  1.00 1.11  ? 1110 LEU A HD21 7  
ATOM   3923  H  HD22 . LEU A 1 8  ? 12.745  3.033   -8.004  1.00 1.05  ? 1110 LEU A HD22 7  
ATOM   3924  H  HD23 . LEU A 1 8  ? 12.842  4.539   -8.922  1.00 0.97  ? 1110 LEU A HD23 7  
ATOM   3925  N  N    . ASP A 1 9  ? 12.170  6.912   -4.076  1.00 0.35  ? 1111 ASP A N    7  
ATOM   3926  C  CA   . ASP A 1 9  ? 11.219  7.951   -3.697  1.00 0.38  ? 1111 ASP A CA   7  
ATOM   3927  C  C    . ASP A 1 9  ? 9.841   7.639   -4.265  1.00 0.32  ? 1111 ASP A C    7  
ATOM   3928  O  O    . ASP A 1 9  ? 8.820   8.047   -3.717  1.00 0.42  ? 1111 ASP A O    7  
ATOM   3929  C  CB   . ASP A 1 9  ? 11.689  9.323   -4.184  1.00 0.51  ? 1111 ASP A CB   7  
ATOM   3930  C  CG   . ASP A 1 9  ? 10.712  10.427  -3.833  1.00 1.37  ? 1111 ASP A CG   7  
ATOM   3931  O  OD1  . ASP A 1 9  ? 10.615  10.784  -2.637  1.00 1.53  ? 1111 ASP A OD1  7  
ATOM   3932  O  OD2  . ASP A 1 9  ? 10.035  10.943  -4.748  1.00 2.32  ? 1111 ASP A OD2  7  
ATOM   3933  H  H    . ASP A 1 9  ? 12.952  7.155   -4.620  1.00 0.40  ? 1111 ASP A H    7  
ATOM   3934  H  HA   . ASP A 1 9  ? 11.155  7.963   -2.620  1.00 0.44  ? 1111 ASP A HA   7  
ATOM   3935  H  HB2  . ASP A 1 9  ? 12.640  9.553   -3.731  1.00 0.94  ? 1111 ASP A HB2  7  
ATOM   3936  H  HB3  . ASP A 1 9  ? 11.802  9.297   -5.259  1.00 1.01  ? 1111 ASP A HB3  7  
ATOM   3937  N  N    . THR A 1 10 ? 9.825   6.911   -5.370  1.00 0.28  ? 1112 THR A N    7  
ATOM   3938  C  CA   . THR A 1 10 ? 8.585   6.470   -5.975  1.00 0.31  ? 1112 THR A CA   7  
ATOM   3939  C  C    . THR A 1 10 ? 8.269   5.026   -5.594  1.00 0.24  ? 1112 THR A C    7  
ATOM   3940  O  O    . THR A 1 10 ? 7.306   4.444   -6.091  1.00 0.30  ? 1112 THR A O    7  
ATOM   3941  C  CB   . THR A 1 10 ? 8.647   6.604   -7.505  1.00 0.42  ? 1112 THR A CB   7  
ATOM   3942  O  OG1  . THR A 1 10 ? 9.923   6.151   -7.979  1.00 0.45  ? 1112 THR A OG1  7  
ATOM   3943  C  CG2  . THR A 1 10 ? 8.420   8.045   -7.928  1.00 0.52  ? 1112 THR A CG2  7  
ATOM   3944  H  H    . THR A 1 10 ? 10.673  6.672   -5.799  1.00 0.31  ? 1112 THR A H    7  
ATOM   3945  H  HA   . THR A 1 10 ? 7.793   7.108   -5.612  1.00 0.36  ? 1112 THR A HA   7  
ATOM   3946  H  HB   . THR A 1 10 ? 7.870   5.989   -7.938  1.00 0.48  ? 1112 THR A HB   7  
ATOM   3947  H  HG1  . THR A 1 10 ? 9.808   5.702   -8.825  1.00 0.95  ? 1112 THR A HG1  7  
ATOM   3948  H  HG21 . THR A 1 10 ? 8.461   8.116   -9.005  1.00 1.19  ? 1112 THR A HG21 7  
ATOM   3949  H  HG22 . THR A 1 10 ? 9.188   8.671   -7.496  1.00 1.09  ? 1112 THR A HG22 7  
ATOM   3950  H  HG23 . THR A 1 10 ? 7.451   8.374   -7.582  1.00 1.17  ? 1112 THR A HG23 7  
ATOM   3951  N  N    . GLN A 1 11 ? 9.084   4.445   -4.717  1.00 0.18  ? 1113 GLN A N    7  
ATOM   3952  C  CA   . GLN A 1 11 ? 8.830   3.105   -4.226  1.00 0.17  ? 1113 GLN A CA   7  
ATOM   3953  C  C    . GLN A 1 11 ? 8.164   3.121   -2.864  1.00 0.17  ? 1113 GLN A C    7  
ATOM   3954  O  O    . GLN A 1 11 ? 8.398   4.004   -2.039  1.00 0.23  ? 1113 GLN A O    7  
ATOM   3955  C  CB   . GLN A 1 11 ? 10.114  2.285   -4.159  1.00 0.17  ? 1113 GLN A CB   7  
ATOM   3956  C  CG   . GLN A 1 11 ? 10.488  1.668   -5.492  1.00 0.23  ? 1113 GLN A CG   7  
ATOM   3957  C  CD   . GLN A 1 11 ? 11.695  0.756   -5.395  1.00 0.35  ? 1113 GLN A CD   7  
ATOM   3958  O  OE1  . GLN A 1 11 ? 12.565  0.947   -4.542  1.00 1.02  ? 1113 GLN A OE1  7  
ATOM   3959  N  NE2  . GLN A 1 11 ? 11.761  -0.230  -6.268  1.00 0.67  ? 1113 GLN A NE2  7  
ATOM   3960  H  H    . GLN A 1 11 ? 9.879   4.925   -4.399  1.00 0.20  ? 1113 GLN A H    7  
ATOM   3961  H  HA   . GLN A 1 11 ? 8.158   2.629   -4.924  1.00 0.22  ? 1113 GLN A HA   7  
ATOM   3962  H  HB2  . GLN A 1 11 ? 10.923  2.928   -3.841  1.00 0.16  ? 1113 GLN A HB2  7  
ATOM   3963  H  HB3  . GLN A 1 11 ? 9.997   1.494   -3.436  1.00 0.20  ? 1113 GLN A HB3  7  
ATOM   3964  H  HG2  . GLN A 1 11 ? 9.646   1.103   -5.855  1.00 0.31  ? 1113 GLN A HG2  7  
ATOM   3965  H  HG3  . GLN A 1 11 ? 10.709  2.461   -6.190  1.00 0.22  ? 1113 GLN A HG3  7  
ATOM   3966  H  HE21 . GLN A 1 11 ? 11.034  -0.321  -6.922  1.00 1.21  ? 1113 GLN A HE21 7  
ATOM   3967  H  HE22 . GLN A 1 11 ? 12.539  -0.824  -6.236  1.00 0.65  ? 1113 GLN A HE22 7  
ATOM   3968  N  N    . TYR A 1 12 ? 7.322   2.135   -2.658  1.00 0.15  ? 1114 TYR A N    7  
ATOM   3969  C  CA   . TYR A 1 12 ? 6.659   1.921   -1.391  1.00 0.16  ? 1114 TYR A CA   7  
ATOM   3970  C  C    . TYR A 1 12 ? 7.276   0.712   -0.715  1.00 0.15  ? 1114 TYR A C    7  
ATOM   3971  O  O    . TYR A 1 12 ? 7.646   -0.253  -1.380  1.00 0.15  ? 1114 TYR A O    7  
ATOM   3972  C  CB   . TYR A 1 12 ? 5.172   1.682   -1.624  1.00 0.18  ? 1114 TYR A CB   7  
ATOM   3973  C  CG   . TYR A 1 12 ? 4.351   1.480   -0.372  1.00 0.22  ? 1114 TYR A CG   7  
ATOM   3974  C  CD1  . TYR A 1 12 ? 4.109   2.528   0.504   1.00 0.33  ? 1114 TYR A CD1  7  
ATOM   3975  C  CD2  . TYR A 1 12 ? 3.805   0.237   -0.078  1.00 0.21  ? 1114 TYR A CD2  7  
ATOM   3976  C  CE1  . TYR A 1 12 ? 3.346   2.343   1.640   1.00 0.39  ? 1114 TYR A CE1  7  
ATOM   3977  C  CE2  . TYR A 1 12 ? 3.042   0.043   1.055   1.00 0.26  ? 1114 TYR A CE2  7  
ATOM   3978  C  CZ   . TYR A 1 12 ? 2.816   1.100   1.912   1.00 0.34  ? 1114 TYR A CZ   7  
ATOM   3979  O  OH   . TYR A 1 12 ? 2.054   0.914   3.044   1.00 0.41  ? 1114 TYR A OH   7  
ATOM   3980  H  H    . TYR A 1 12 ? 7.148   1.507   -3.400  1.00 0.16  ? 1114 TYR A H    7  
ATOM   3981  H  HA   . TYR A 1 12 ? 6.797   2.796   -0.774  1.00 0.18  ? 1114 TYR A HA   7  
ATOM   3982  H  HB2  . TYR A 1 12 ? 4.755   2.518   -2.161  1.00 0.23  ? 1114 TYR A HB2  7  
ATOM   3983  H  HB3  . TYR A 1 12 ? 5.070   0.794   -2.218  1.00 0.18  ? 1114 TYR A HB3  7  
ATOM   3984  H  HD1  . TYR A 1 12 ? 4.528   3.500   0.289   1.00 0.40  ? 1114 TYR A HD1  7  
ATOM   3985  H  HD2  . TYR A 1 12 ? 3.985   -0.586  -0.751  1.00 0.23  ? 1114 TYR A HD2  7  
ATOM   3986  H  HE1  . TYR A 1 12 ? 3.167   3.170   2.309   1.00 0.50  ? 1114 TYR A HE1  7  
ATOM   3987  H  HE2  . TYR A 1 12 ? 2.627   -0.932  1.264   1.00 0.29  ? 1114 TYR A HE2  7  
ATOM   3988  H  HH   . TYR A 1 12 ? 2.286   0.068   3.447   1.00 0.89  ? 1114 TYR A HH   7  
ATOM   3989  N  N    . THR A 1 13 ? 7.376   0.760   0.591   1.00 0.18  ? 1115 THR A N    7  
ATOM   3990  C  CA   . THR A 1 13 ? 7.976   -0.328  1.340   1.00 0.20  ? 1115 THR A CA   7  
ATOM   3991  C  C    . THR A 1 13 ? 6.873   -1.244  1.867   1.00 0.23  ? 1115 THR A C    7  
ATOM   3992  O  O    . THR A 1 13 ? 6.210   -0.926  2.855   1.00 0.31  ? 1115 THR A O    7  
ATOM   3993  C  CB   . THR A 1 13 ? 8.820   0.199   2.515   1.00 0.26  ? 1115 THR A CB   7  
ATOM   3994  O  OG1  . THR A 1 13 ? 9.543   1.365   2.099   1.00 0.30  ? 1115 THR A OG1  7  
ATOM   3995  C  CG2  . THR A 1 13 ? 9.808   -0.858  2.989   1.00 0.27  ? 1115 THR A CG2  7  
ATOM   3996  H  H    . THR A 1 13 ? 7.003   1.528   1.066   1.00 0.22  ? 1115 THR A H    7  
ATOM   3997  H  HA   . THR A 1 13 ? 8.623   -0.881  0.667   1.00 0.19  ? 1115 THR A HA   7  
ATOM   3998  H  HB   . THR A 1 13 ? 8.161   0.456   3.333   1.00 0.31  ? 1115 THR A HB   7  
ATOM   3999  H  HG1  . THR A 1 13 ? 9.489   1.449   1.140   1.00 0.82  ? 1115 THR A HG1  7  
ATOM   4000  H  HG21 . THR A 1 13 ? 10.304  -0.510  3.883   1.00 1.01  ? 1115 THR A HG21 7  
ATOM   4001  H  HG22 . THR A 1 13 ? 10.544  -1.031  2.216   1.00 1.02  ? 1115 THR A HG22 7  
ATOM   4002  H  HG23 . THR A 1 13 ? 9.283   -1.781  3.202   1.00 1.10  ? 1115 THR A HG23 7  
ATOM   4003  N  N    . CYS A 1 14 ? 6.669   -2.364  1.189   1.00 0.26  ? 1116 CYS A N    7  
ATOM   4004  C  CA   . CYS A 1 14 ? 5.549   -3.253  1.476   1.00 0.34  ? 1116 CYS A CA   7  
ATOM   4005  C  C    . CYS A 1 14 ? 5.655   -3.950  2.823   1.00 0.40  ? 1116 CYS A C    7  
ATOM   4006  O  O    . CYS A 1 14 ? 6.682   -3.883  3.504   1.00 0.37  ? 1116 CYS A O    7  
ATOM   4007  C  CB   . CYS A 1 14 ? 5.421   -4.319  0.391   1.00 0.45  ? 1116 CYS A CB   7  
ATOM   4008  S  SG   . CYS A 1 14 ? 4.678   -3.732  -1.157  1.00 0.65  ? 1116 CYS A SG   7  
ATOM   4009  H  H    . CYS A 1 14 ? 7.291   -2.605  0.464   1.00 0.28  ? 1116 CYS A H    7  
ATOM   4010  H  HA   . CYS A 1 14 ? 4.651   -2.655  1.470   1.00 0.38  ? 1116 CYS A HA   7  
ATOM   4011  H  HB2  . CYS A 1 14 ? 6.406   -4.695  0.155   1.00 0.50  ? 1116 CYS A HB2  7  
ATOM   4012  H  HB3  . CYS A 1 14 ? 4.816   -5.130  0.764   1.00 0.54  ? 1116 CYS A HB3  7  
ATOM   4013  N  N    . ASP A 1 15 ? 4.574   -4.626  3.176   1.00 0.56  ? 1117 ASP A N    7  
ATOM   4014  C  CA   . ASP A 1 15 ? 4.511   -5.489  4.345   1.00 0.69  ? 1117 ASP A CA   7  
ATOM   4015  C  C    . ASP A 1 15 ? 5.694   -6.465  4.387   1.00 0.65  ? 1117 ASP A C    7  
ATOM   4016  O  O    . ASP A 1 15 ? 6.400   -6.567  5.392   1.00 0.71  ? 1117 ASP A O    7  
ATOM   4017  C  CB   . ASP A 1 15 ? 3.175   -6.252  4.326   1.00 0.93  ? 1117 ASP A CB   7  
ATOM   4018  C  CG   . ASP A 1 15 ? 2.775   -6.743  2.933   1.00 1.83  ? 1117 ASP A CG   7  
ATOM   4019  O  OD1  . ASP A 1 15 ? 3.643   -7.268  2.207   1.00 2.62  ? 1117 ASP A OD1  7  
ATOM   4020  O  OD2  . ASP A 1 15 ? 1.589   -6.636  2.560   1.00 2.09  ? 1117 ASP A OD2  7  
ATOM   4021  H  H    . ASP A 1 15 ? 3.762   -4.530  2.627   1.00 0.63  ? 1117 ASP A H    7  
ATOM   4022  H  HA   . ASP A 1 15 ? 4.543   -4.863  5.223   1.00 0.70  ? 1117 ASP A HA   7  
ATOM   4023  H  HB2  . ASP A 1 15 ? 3.243   -7.101  4.979   1.00 1.35  ? 1117 ASP A HB2  7  
ATOM   4024  H  HB3  . ASP A 1 15 ? 2.397   -5.597  4.689   1.00 0.70  ? 1117 ASP A HB3  7  
ATOM   4025  N  N    . ASN A 1 16 ? 5.920   -7.146  3.273   1.00 0.69  ? 1118 ASN A N    7  
ATOM   4026  C  CA   . ASN A 1 16 ? 6.997   -8.121  3.136   1.00 0.75  ? 1118 ASN A CA   7  
ATOM   4027  C  C    . ASN A 1 16 ? 8.353   -7.428  2.960   1.00 0.59  ? 1118 ASN A C    7  
ATOM   4028  O  O    . ASN A 1 16 ? 9.359   -8.071  2.674   1.00 0.65  ? 1118 ASN A O    7  
ATOM   4029  C  CB   . ASN A 1 16 ? 6.699   -9.024  1.936   1.00 0.98  ? 1118 ASN A CB   7  
ATOM   4030  C  CG   . ASN A 1 16 ? 7.533   -10.292 1.912   1.00 1.77  ? 1118 ASN A CG   7  
ATOM   4031  O  OD1  . ASN A 1 16 ? 8.620   -10.330 1.335   1.00 2.75  ? 1118 ASN A OD1  7  
ATOM   4032  N  ND2  . ASN A 1 16 ? 7.022   -11.345 2.531   1.00 2.02  ? 1118 ASN A ND2  7  
ATOM   4033  H  H    . ASN A 1 16 ? 5.302   -7.013  2.515   1.00 0.75  ? 1118 ASN A H    7  
ATOM   4034  H  HA   . ASN A 1 16 ? 7.021   -8.722  4.022   1.00 0.85  ? 1118 ASN A HA   7  
ATOM   4035  H  HB2  . ASN A 1 16 ? 5.658   -9.304  1.955   1.00 1.24  ? 1118 ASN A HB2  7  
ATOM   4036  H  HB3  . ASN A 1 16 ? 6.899   -8.471  1.039   1.00 1.41  ? 1118 ASN A HB3  7  
ATOM   4037  H  HD21 . ASN A 1 16 ? 6.146   -11.249 2.966   1.00 1.91  ? 1118 ASN A HD21 7  
ATOM   4038  H  HD22 . ASN A 1 16 ? 7.536   -12.179 2.528   1.00 2.74  ? 1118 ASN A HD22 7  
ATOM   4039  N  N    . HIS A 1 17 ? 8.361   -6.103  3.130   1.00 0.46  ? 1119 HIS A N    7  
ATOM   4040  C  CA   . HIS A 1 17 ? 9.569   -5.276  2.981   1.00 0.41  ? 1119 HIS A CA   7  
ATOM   4041  C  C    . HIS A 1 17 ? 10.005  -5.192  1.522   1.00 0.44  ? 1119 HIS A C    7  
ATOM   4042  O  O    . HIS A 1 17 ? 11.038  -4.603  1.205   1.00 0.79  ? 1119 HIS A O    7  
ATOM   4043  C  CB   . HIS A 1 17 ? 10.721  -5.792  3.855   1.00 0.51  ? 1119 HIS A CB   7  
ATOM   4044  C  CG   . HIS A 1 17 ? 10.428  -5.754  5.323   1.00 0.63  ? 1119 HIS A CG   7  
ATOM   4045  N  ND1  . HIS A 1 17 ? 10.174  -6.884  6.068   1.00 0.94  ? 1119 HIS A ND1  7  
ATOM   4046  C  CD2  . HIS A 1 17 ? 10.349  -4.712  6.183   1.00 0.78  ? 1119 HIS A CD2  7  
ATOM   4047  C  CE1  . HIS A 1 17 ? 9.948   -6.539  7.321   1.00 1.05  ? 1119 HIS A CE1  7  
ATOM   4048  N  NE2  . HIS A 1 17 ? 10.048  -5.227  7.419   1.00 0.93  ? 1119 HIS A NE2  7  
ATOM   4049  H  H    . HIS A 1 17 ? 7.519   -5.657  3.372   1.00 0.47  ? 1119 HIS A H    7  
ATOM   4050  H  HA   . HIS A 1 17 ? 9.313   -4.275  3.309   1.00 0.38  ? 1119 HIS A HA   7  
ATOM   4051  H  HB2  . HIS A 1 17 ? 10.932  -6.816  3.587   1.00 0.60  ? 1119 HIS A HB2  7  
ATOM   4052  H  HB3  . HIS A 1 17 ? 11.599  -5.190  3.674   1.00 0.55  ? 1119 HIS A HB3  7  
ATOM   4053  H  HD1  . HIS A 1 17 ? 10.164  -7.808  5.728   1.00 1.18  ? 1119 HIS A HD1  7  
ATOM   4054  H  HD2  . HIS A 1 17 ? 10.496  -3.669  5.941   1.00 1.00  ? 1119 HIS A HD2  7  
ATOM   4055  H  HE1  . HIS A 1 17 ? 9.720   -7.216  8.131   1.00 1.35  ? 1119 HIS A HE1  7  
ATOM   4056  H  HE2  . HIS A 1 17 ? 9.752   -4.699  8.195   1.00 1.09  ? 1119 HIS A HE2  7  
ATOM   4057  N  N    . GLN A 1 18 ? 9.212   -5.785  0.640   1.00 0.40  ? 1120 GLN A N    7  
ATOM   4058  C  CA   . GLN A 1 18 ? 9.427   -5.656  -0.791  1.00 0.38  ? 1120 GLN A CA   7  
ATOM   4059  C  C    . GLN A 1 18 ? 9.025   -4.253  -1.214  1.00 0.29  ? 1120 GLN A C    7  
ATOM   4060  O  O    . GLN A 1 18 ? 8.017   -3.735  -0.750  1.00 0.39  ? 1120 GLN A O    7  
ATOM   4061  C  CB   . GLN A 1 18 ? 8.601   -6.707  -1.549  1.00 0.49  ? 1120 GLN A CB   7  
ATOM   4062  C  CG   . GLN A 1 18 ? 8.639   -6.558  -3.065  1.00 0.50  ? 1120 GLN A CG   7  
ATOM   4063  C  CD   . GLN A 1 18 ? 10.040  -6.639  -3.636  1.00 1.05  ? 1120 GLN A CD   7  
ATOM   4064  O  OE1  . GLN A 1 18 ? 10.911  -7.320  -3.091  1.00 1.91  ? 1120 GLN A OE1  7  
ATOM   4065  N  NE2  . GLN A 1 18 ? 10.265  -5.949  -4.741  1.00 1.51  ? 1120 GLN A NE2  7  
ATOM   4066  H  H    . GLN A 1 18 ? 8.459   -6.319  0.962   1.00 0.63  ? 1120 GLN A H    7  
ATOM   4067  H  HA   . GLN A 1 18 ? 10.477  -5.803  -0.994  1.00 0.42  ? 1120 GLN A HA   7  
ATOM   4068  H  HB2  . GLN A 1 18 ? 8.977   -7.688  -1.300  1.00 0.62  ? 1120 GLN A HB2  7  
ATOM   4069  H  HB3  . GLN A 1 18 ? 7.572   -6.636  -1.229  1.00 0.52  ? 1120 GLN A HB3  7  
ATOM   4070  H  HG2  . GLN A 1 18 ? 8.042   -7.344  -3.505  1.00 0.87  ? 1120 GLN A HG2  7  
ATOM   4071  H  HG3  . GLN A 1 18 ? 8.216   -5.599  -3.328  1.00 0.86  ? 1120 GLN A HG3  7  
ATOM   4072  H  HE21 . GLN A 1 18 ? 9.521   -5.433  -5.124  1.00 1.83  ? 1120 GLN A HE21 7  
ATOM   4073  H  HE22 . GLN A 1 18 ? 11.163  -5.977  -5.135  1.00 1.99  ? 1120 GLN A HE22 7  
ATOM   4074  N  N    . CYS A 1 19 ? 9.809   -3.622  -2.056  1.00 0.21  ? 1121 CYS A N    7  
ATOM   4075  C  CA   . CYS A 1 19 ? 9.498   -2.267  -2.452  1.00 0.21  ? 1121 CYS A CA   7  
ATOM   4076  C  C    . CYS A 1 19 ? 8.951   -2.216  -3.865  1.00 0.20  ? 1121 CYS A C    7  
ATOM   4077  O  O    . CYS A 1 19 ? 9.606   -2.618  -4.828  1.00 0.34  ? 1121 CYS A O    7  
ATOM   4078  C  CB   . CYS A 1 19 ? 10.714  -1.368  -2.275  1.00 0.34  ? 1121 CYS A CB   7  
ATOM   4079  S  SG   . CYS A 1 19 ? 11.208  -1.206  -0.529  1.00 0.42  ? 1121 CYS A SG   7  
ATOM   4080  H  H    . CYS A 1 19 ? 10.607  -4.066  -2.418  1.00 0.29  ? 1121 CYS A H    7  
ATOM   4081  H  HA   . CYS A 1 19 ? 8.722   -1.917  -1.786  1.00 0.24  ? 1121 CYS A HA   7  
ATOM   4082  H  HB2  . CYS A 1 19 ? 11.548  -1.779  -2.823  1.00 0.39  ? 1121 CYS A HB2  7  
ATOM   4083  H  HB3  . CYS A 1 19 ? 10.487  -0.382  -2.650  1.00 0.41  ? 1121 CYS A HB3  7  
ATOM   4084  N  N    . ILE A 1 20 ? 7.724   -1.731  -3.961  1.00 0.15  ? 1122 ILE A N    7  
ATOM   4085  C  CA   . ILE A 1 20 ? 7.006   -1.647  -5.220  1.00 0.14  ? 1122 ILE A CA   7  
ATOM   4086  C  C    . ILE A 1 20 ? 6.879   -0.192  -5.633  1.00 0.14  ? 1122 ILE A C    7  
ATOM   4087  O  O    . ILE A 1 20 ? 7.241   0.698   -4.875  1.00 0.18  ? 1122 ILE A O    7  
ATOM   4088  C  CB   . ILE A 1 20 ? 5.591   -2.248  -5.097  1.00 0.14  ? 1122 ILE A CB   7  
ATOM   4089  C  CG1  . ILE A 1 20 ? 4.785   -1.483  -4.045  1.00 0.13  ? 1122 ILE A CG1  7  
ATOM   4090  C  CG2  . ILE A 1 20 ? 5.668   -3.729  -4.748  1.00 0.19  ? 1122 ILE A CG2  7  
ATOM   4091  C  CD1  . ILE A 1 20 ? 3.351   -1.941  -3.926  1.00 0.17  ? 1122 ILE A CD1  7  
ATOM   4092  H  H    . ILE A 1 20 ? 7.290   -1.394  -3.148  1.00 0.22  ? 1122 ILE A H    7  
ATOM   4093  H  HA   . ILE A 1 20 ? 7.554   -2.192  -5.971  1.00 0.17  ? 1122 ILE A HA   7  
ATOM   4094  H  HB   . ILE A 1 20 ? 5.098   -2.156  -6.054  1.00 0.16  ? 1122 ILE A HB   7  
ATOM   4095  H  HG12 . ILE A 1 20 ? 5.253   -1.614  -3.081  1.00 0.15  ? 1122 ILE A HG12 7  
ATOM   4096  H  HG13 . ILE A 1 20 ? 4.779   -0.434  -4.299  1.00 0.14  ? 1122 ILE A HG13 7  
ATOM   4097  H  HG21 . ILE A 1 20 ? 6.191   -4.257  -5.530  1.00 0.98  ? 1122 ILE A HG21 7  
ATOM   4098  H  HG22 . ILE A 1 20 ? 4.668   -4.127  -4.648  1.00 1.05  ? 1122 ILE A HG22 7  
ATOM   4099  H  HG23 . ILE A 1 20 ? 6.199   -3.850  -3.815  1.00 0.97  ? 1122 ILE A HG23 7  
ATOM   4100  H  HD11 . ILE A 1 20 ? 2.844   -1.778  -4.865  1.00 1.07  ? 1122 ILE A HD11 7  
ATOM   4101  H  HD12 . ILE A 1 20 ? 2.858   -1.380  -3.145  1.00 0.99  ? 1122 ILE A HD12 7  
ATOM   4102  H  HD13 . ILE A 1 20 ? 3.332   -2.993  -3.684  1.00 1.03  ? 1122 ILE A HD13 7  
ATOM   4103  N  N    . SER A 1 21 ? 6.363   0.054   -6.819  1.00 0.16  ? 1123 SER A N    7  
ATOM   4104  C  CA   . SER A 1 21 ? 6.093   1.412   -7.245  1.00 0.17  ? 1123 SER A CA   7  
ATOM   4105  C  C    . SER A 1 21 ? 4.850   1.925   -6.521  1.00 0.15  ? 1123 SER A C    7  
ATOM   4106  O  O    . SER A 1 21 ? 3.862   1.202   -6.389  1.00 0.17  ? 1123 SER A O    7  
ATOM   4107  C  CB   . SER A 1 21 ? 5.886   1.453   -8.761  1.00 0.24  ? 1123 SER A CB   7  
ATOM   4108  O  OG   . SER A 1 21 ? 5.626   2.771   -9.213  1.00 0.33  ? 1123 SER A OG   7  
ATOM   4109  H  H    . SER A 1 21 ? 6.155   -0.691  -7.417  1.00 0.20  ? 1123 SER A H    7  
ATOM   4110  H  HA   . SER A 1 21 ? 6.943   2.025   -6.978  1.00 0.19  ? 1123 SER A HA   7  
ATOM   4111  H  HB2  . SER A 1 21 ? 6.775   1.088   -9.253  1.00 0.27  ? 1123 SER A HB2  7  
ATOM   4112  H  HB3  . SER A 1 21 ? 5.047   0.824   -9.024  1.00 0.24  ? 1123 SER A HB3  7  
ATOM   4113  H  HG   . SER A 1 21 ? 4.678   2.888   -9.333  1.00 0.63  ? 1123 SER A HG   7  
ATOM   4114  N  N    . LYS A 1 22 ? 4.909   3.170   -6.046  1.00 0.17  ? 1124 LYS A N    7  
ATOM   4115  C  CA   . LYS A 1 22 ? 3.789   3.778   -5.324  1.00 0.19  ? 1124 LYS A CA   7  
ATOM   4116  C  C    . LYS A 1 22 ? 2.553   3.860   -6.214  1.00 0.22  ? 1124 LYS A C    7  
ATOM   4117  O  O    . LYS A 1 22 ? 1.430   3.963   -5.724  1.00 0.25  ? 1124 LYS A O    7  
ATOM   4118  C  CB   . LYS A 1 22 ? 4.158   5.176   -4.815  1.00 0.23  ? 1124 LYS A CB   7  
ATOM   4119  C  CG   . LYS A 1 22 ? 5.186   5.179   -3.692  1.00 0.25  ? 1124 LYS A CG   7  
ATOM   4120  C  CD   . LYS A 1 22 ? 5.524   6.597   -3.255  1.00 0.25  ? 1124 LYS A CD   7  
ATOM   4121  C  CE   . LYS A 1 22 ? 6.600   6.621   -2.179  1.00 0.30  ? 1124 LYS A CE   7  
ATOM   4122  N  NZ   . LYS A 1 22 ? 6.146   6.016   -0.898  1.00 1.24  ? 1124 LYS A NZ   7  
ATOM   4123  H  H    . LYS A 1 22 ? 5.729   3.697   -6.185  1.00 0.20  ? 1124 LYS A H    7  
ATOM   4124  H  HA   . LYS A 1 22 ? 3.567   3.146   -4.478  1.00 0.19  ? 1124 LYS A HA   7  
ATOM   4125  H  HB2  . LYS A 1 22 ? 4.559   5.750   -5.637  1.00 0.30  ? 1124 LYS A HB2  7  
ATOM   4126  H  HB3  . LYS A 1 22 ? 3.263   5.661   -4.454  1.00 0.30  ? 1124 LYS A HB3  7  
ATOM   4127  H  HG2  . LYS A 1 22 ? 4.784   4.639   -2.848  1.00 0.37  ? 1124 LYS A HG2  7  
ATOM   4128  H  HG3  . LYS A 1 22 ? 6.085   4.693   -4.039  1.00 0.37  ? 1124 LYS A HG3  7  
ATOM   4129  H  HD2  . LYS A 1 22 ? 5.877   7.151   -4.113  1.00 0.32  ? 1124 LYS A HD2  7  
ATOM   4130  H  HD3  . LYS A 1 22 ? 4.632   7.065   -2.869  1.00 0.33  ? 1124 LYS A HD3  7  
ATOM   4131  H  HE2  . LYS A 1 22 ? 7.458   6.071   -2.537  1.00 0.93  ? 1124 LYS A HE2  7  
ATOM   4132  H  HE3  . LYS A 1 22 ? 6.885   7.648   -2.001  1.00 0.95  ? 1124 LYS A HE3  7  
ATOM   4133  H  HZ1  . LYS A 1 22 ? 5.390   6.593   -0.475  1.00 1.76  ? 1124 LYS A HZ1  7  
ATOM   4134  H  HZ2  . LYS A 1 22 ? 6.939   5.964   -0.226  1.00 1.77  ? 1124 LYS A HZ2  7  
ATOM   4135  H  HZ3  . LYS A 1 22 ? 5.783   5.059   -1.060  1.00 1.88  ? 1124 LYS A HZ3  7  
ATOM   4136  N  N    . ASN A 1 23 ? 2.777   3.813   -7.524  1.00 0.24  ? 1125 ASN A N    7  
ATOM   4137  C  CA   . ASN A 1 23 ? 1.689   3.791   -8.497  1.00 0.28  ? 1125 ASN A CA   7  
ATOM   4138  C  C    . ASN A 1 23 ? 0.850   2.522   -8.350  1.00 0.26  ? 1125 ASN A C    7  
ATOM   4139  O  O    . ASN A 1 23 ? -0.338  2.506   -8.670  1.00 0.32  ? 1125 ASN A O    7  
ATOM   4140  C  CB   . ASN A 1 23 ? 2.255   3.882   -9.919  1.00 0.36  ? 1125 ASN A CB   7  
ATOM   4141  C  CG   . ASN A 1 23 ? 1.178   3.886   -10.988 1.00 1.03  ? 1125 ASN A CG   7  
ATOM   4142  O  OD1  . ASN A 1 23 ? 0.802   2.837   -11.509 1.00 1.75  ? 1125 ASN A OD1  7  
ATOM   4143  N  ND2  . ASN A 1 23 ? 0.678   5.065   -11.325 1.00 1.69  ? 1125 ASN A ND2  7  
ATOM   4144  H  H    . ASN A 1 23 ? 3.704   3.816   -7.844  1.00 0.25  ? 1125 ASN A H    7  
ATOM   4145  H  HA   . ASN A 1 23 ? 1.061   4.649   -8.314  1.00 0.31  ? 1125 ASN A HA   7  
ATOM   4146  H  HB2  . ASN A 1 23 ? 2.830   4.789   -10.013 1.00 0.82  ? 1125 ASN A HB2  7  
ATOM   4147  H  HB3  . ASN A 1 23 ? 2.903   3.035   -10.092 1.00 0.82  ? 1125 ASN A HB3  7  
ATOM   4148  H  HD21 . ASN A 1 23 ? 1.025   5.865   -10.873 1.00 1.99  ? 1125 ASN A HD21 7  
ATOM   4149  H  HD22 . ASN A 1 23 ? -0.018  5.092   -12.015 1.00 2.22  ? 1125 ASN A HD22 7  
ATOM   4150  N  N    . TRP A 1 24 ? 1.470   1.465   -7.840  1.00 0.22  ? 1126 TRP A N    7  
ATOM   4151  C  CA   . TRP A 1 24 ? 0.800   0.179   -7.683  1.00 0.22  ? 1126 TRP A CA   7  
ATOM   4152  C  C    . TRP A 1 24 ? -0.029  0.166   -6.409  1.00 0.20  ? 1126 TRP A C    7  
ATOM   4153  O  O    . TRP A 1 24 ? -0.915  -0.667  -6.238  1.00 0.26  ? 1126 TRP A O    7  
ATOM   4154  C  CB   . TRP A 1 24 ? 1.819   -0.959  -7.613  1.00 0.25  ? 1126 TRP A CB   7  
ATOM   4155  C  CG   . TRP A 1 24 ? 2.725   -1.070  -8.803  1.00 0.31  ? 1126 TRP A CG   7  
ATOM   4156  C  CD1  . TRP A 1 24 ? 2.723   -0.296  -9.928  1.00 0.37  ? 1126 TRP A CD1  7  
ATOM   4157  C  CD2  . TRP A 1 24 ? 3.775   -2.025  -8.974  1.00 0.38  ? 1126 TRP A CD2  7  
ATOM   4158  N  NE1  . TRP A 1 24 ? 3.710   -0.714  -10.785 1.00 0.45  ? 1126 TRP A NE1  7  
ATOM   4159  C  CE2  . TRP A 1 24 ? 4.369   -1.774  -10.222 1.00 0.45  ? 1126 TRP A CE2  7  
ATOM   4160  C  CE3  . TRP A 1 24 ? 4.270   -3.071  -8.190  1.00 0.44  ? 1126 TRP A CE3  7  
ATOM   4161  C  CZ2  . TRP A 1 24 ? 5.436   -2.528  -10.704 1.00 0.54  ? 1126 TRP A CZ2  7  
ATOM   4162  C  CZ3  . TRP A 1 24 ? 5.328   -3.819  -8.668  1.00 0.55  ? 1126 TRP A CZ3  7  
ATOM   4163  C  CH2  . TRP A 1 24 ? 5.899   -3.545  -9.915  1.00 0.58  ? 1126 TRP A CH2  7  
ATOM   4164  H  H    . TRP A 1 24 ? 2.405   1.553   -7.549  1.00 0.23  ? 1126 TRP A H    7  
ATOM   4165  H  HA   . TRP A 1 24 ? 0.148   0.027   -8.532  1.00 0.25  ? 1126 TRP A HA   7  
ATOM   4166  H  HB2  . TRP A 1 24 ? 2.442   -0.814  -6.744  1.00 0.27  ? 1126 TRP A HB2  7  
ATOM   4167  H  HB3  . TRP A 1 24 ? 1.289   -1.894  -7.510  1.00 0.28  ? 1126 TRP A HB3  7  
ATOM   4168  H  HD1  . TRP A 1 24 ? 2.040   0.522   -10.104 1.00 0.40  ? 1126 TRP A HD1  7  
ATOM   4169  H  HE1  . TRP A 1 24 ? 3.911   -0.314  -11.662 1.00 0.53  ? 1126 TRP A HE1  7  
ATOM   4170  H  HE3  . TRP A 1 24 ? 3.839   -3.298  -7.225  1.00 0.45  ? 1126 TRP A HE3  7  
ATOM   4171  H  HZ2  . TRP A 1 24 ? 5.889   -2.329  -11.663 1.00 0.61  ? 1126 TRP A HZ2  7  
ATOM   4172  H  HZ3  . TRP A 1 24 ? 5.724   -4.631  -8.076  1.00 0.62  ? 1126 TRP A HZ3  7  
ATOM   4173  H  HH2  . TRP A 1 24 ? 6.724   -4.156  -10.250 1.00 0.67  ? 1126 TRP A HH2  7  
ATOM   4174  N  N    . VAL A 1 25 ? 0.281   1.080   -5.511  1.00 0.19  ? 1127 VAL A N    7  
ATOM   4175  C  CA   . VAL A 1 25 ? -0.391  1.153   -4.224  1.00 0.18  ? 1127 VAL A CA   7  
ATOM   4176  C  C    . VAL A 1 25 ? -1.855  1.524   -4.401  1.00 0.19  ? 1127 VAL A C    7  
ATOM   4177  O  O    . VAL A 1 25 ? -2.174  2.588   -4.935  1.00 0.23  ? 1127 VAL A O    7  
ATOM   4178  C  CB   . VAL A 1 25 ? 0.308   2.175   -3.297  1.00 0.21  ? 1127 VAL A CB   7  
ATOM   4179  C  CG1  . VAL A 1 25 ? -0.418  2.309   -1.967  1.00 0.24  ? 1127 VAL A CG1  7  
ATOM   4180  C  CG2  . VAL A 1 25 ? 1.758   1.777   -3.074  1.00 0.24  ? 1127 VAL A CG2  7  
ATOM   4181  H  H    . VAL A 1 25 ? 0.978   1.734   -5.721  1.00 0.21  ? 1127 VAL A H    7  
ATOM   4182  H  HA   . VAL A 1 25 ? -0.339  0.176   -3.765  1.00 0.19  ? 1127 VAL A HA   7  
ATOM   4183  H  HB   . VAL A 1 25 ? 0.296   3.139   -3.785  1.00 0.23  ? 1127 VAL A HB   7  
ATOM   4184  H  HG11 . VAL A 1 25 ? -0.441  1.350   -1.472  1.00 1.01  ? 1127 VAL A HG11 7  
ATOM   4185  H  HG12 . VAL A 1 25 ? -1.427  2.650   -2.142  1.00 1.02  ? 1127 VAL A HG12 7  
ATOM   4186  H  HG13 . VAL A 1 25 ? 0.100   3.023   -1.345  1.00 1.00  ? 1127 VAL A HG13 7  
ATOM   4187  H  HG21 . VAL A 1 25 ? 1.797   0.840   -2.540  1.00 1.05  ? 1127 VAL A HG21 7  
ATOM   4188  H  HG22 . VAL A 1 25 ? 2.256   2.542   -2.497  1.00 1.06  ? 1127 VAL A HG22 7  
ATOM   4189  H  HG23 . VAL A 1 25 ? 2.250   1.668   -4.028  1.00 1.01  ? 1127 VAL A HG23 7  
ATOM   4190  N  N    . CYS A 1 26 ? -2.732  0.619   -3.967  1.00 0.19  ? 1128 CYS A N    7  
ATOM   4191  C  CA   . CYS A 1 26 ? -4.173  0.829   -4.043  1.00 0.26  ? 1128 CYS A CA   7  
ATOM   4192  C  C    . CYS A 1 26 ? -4.630  0.855   -5.502  1.00 0.27  ? 1128 CYS A C    7  
ATOM   4193  O  O    . CYS A 1 26 ? -5.269  1.803   -5.965  1.00 0.37  ? 1128 CYS A O    7  
ATOM   4194  C  CB   . CYS A 1 26 ? -4.550  2.122   -3.312  1.00 0.32  ? 1128 CYS A CB   7  
ATOM   4195  S  SG   . CYS A 1 26 ? -6.335  2.480   -3.226  1.00 0.58  ? 1128 CYS A SG   7  
ATOM   4196  H  H    . CYS A 1 26 ? -2.396  -0.221  -3.581  1.00 0.19  ? 1128 CYS A H    7  
ATOM   4197  H  HA   . CYS A 1 26 ? -4.651  -0.004  -3.549  1.00 0.28  ? 1128 CYS A HA   7  
ATOM   4198  H  HB2  . CYS A 1 26 ? -4.184  2.065   -2.301  1.00 0.36  ? 1128 CYS A HB2  7  
ATOM   4199  H  HB3  . CYS A 1 26 ? -4.074  2.951   -3.807  1.00 0.36  ? 1128 CYS A HB3  7  
ATOM   4200  N  N    . ASP A 1 27 ? -4.277  -0.197  -6.228  1.00 0.25  ? 1129 ASP A N    7  
ATOM   4201  C  CA   . ASP A 1 27 ? -4.668  -0.332  -7.631  1.00 0.30  ? 1129 ASP A CA   7  
ATOM   4202  C  C    . ASP A 1 27 ? -5.556  -1.563  -7.814  1.00 0.37  ? 1129 ASP A C    7  
ATOM   4203  O  O    . ASP A 1 27 ? -5.612  -2.157  -8.894  1.00 0.41  ? 1129 ASP A O    7  
ATOM   4204  C  CB   . ASP A 1 27 ? -3.424  -0.418  -8.532  1.00 0.31  ? 1129 ASP A CB   7  
ATOM   4205  C  CG   . ASP A 1 27 ? -2.788  -1.796  -8.553  1.00 0.35  ? 1129 ASP A CG   7  
ATOM   4206  O  OD1  . ASP A 1 27 ? -2.692  -2.431  -7.481  1.00 0.31  ? 1129 ASP A OD1  7  
ATOM   4207  O  OD2  . ASP A 1 27 ? -2.364  -2.238  -9.642  1.00 0.46  ? 1129 ASP A OD2  7  
ATOM   4208  H  H    . ASP A 1 27 ? -3.731  -0.904  -5.806  1.00 0.24  ? 1129 ASP A H    7  
ATOM   4209  H  HA   . ASP A 1 27 ? -5.236  0.546   -7.898  1.00 0.33  ? 1129 ASP A HA   7  
ATOM   4210  H  HB2  . ASP A 1 27 ? -3.698  -0.159  -9.541  1.00 0.36  ? 1129 ASP A HB2  7  
ATOM   4211  H  HB3  . ASP A 1 27 ? -2.688  0.289   -8.176  1.00 0.29  ? 1129 ASP A HB3  7  
ATOM   4212  N  N    . THR A 1 28 ? -6.252  -1.922  -6.737  1.00 0.45  ? 1130 THR A N    7  
ATOM   4213  C  CA   . THR A 1 28 ? -7.122  -3.102  -6.678  1.00 0.56  ? 1130 THR A CA   7  
ATOM   4214  C  C    . THR A 1 28 ? -6.389  -4.377  -7.100  1.00 0.61  ? 1130 THR A C    7  
ATOM   4215  O  O    . THR A 1 28 ? -6.953  -5.247  -7.766  1.00 0.73  ? 1130 THR A O    7  
ATOM   4216  C  CB   . THR A 1 28 ? -8.433  -2.933  -7.491  1.00 0.59  ? 1130 THR A CB   7  
ATOM   4217  O  OG1  . THR A 1 28 ? -8.172  -2.561  -8.852  1.00 0.56  ? 1130 THR A OG1  7  
ATOM   4218  C  CG2  . THR A 1 28 ? -9.329  -1.887  -6.842  1.00 0.65  ? 1130 THR A CG2  7  
ATOM   4219  H  H    . THR A 1 28 ? -6.174  -1.369  -5.931  1.00 0.46  ? 1130 THR A H    7  
ATOM   4220  H  HA   . THR A 1 28 ? -7.404  -3.222  -5.642  1.00 0.64  ? 1130 THR A HA   7  
ATOM   4221  H  HB   . THR A 1 28 ? -8.958  -3.876  -7.484  1.00 0.67  ? 1130 THR A HB   7  
ATOM   4222  H  HG1  . THR A 1 28 ? -7.219  -2.590  -9.014  1.00 0.53  ? 1130 THR A HG1  7  
ATOM   4223  H  HG21 . THR A 1 28 ? -10.236 -1.785  -7.420  1.00 1.34  ? 1130 THR A HG21 7  
ATOM   4224  H  HG22 . THR A 1 28 ? -8.812  -0.940  -6.809  1.00 1.09  ? 1130 THR A HG22 7  
ATOM   4225  H  HG23 . THR A 1 28 ? -9.576  -2.199  -5.837  1.00 1.21  ? 1130 THR A HG23 7  
ATOM   4226  N  N    . ASP A 1 29 ? -5.126  -4.476  -6.702  1.00 0.59  ? 1131 ASP A N    7  
ATOM   4227  C  CA   . ASP A 1 29 ? -4.328  -5.666  -6.962  1.00 0.69  ? 1131 ASP A CA   7  
ATOM   4228  C  C    . ASP A 1 29 ? -3.256  -5.824  -5.889  1.00 0.67  ? 1131 ASP A C    7  
ATOM   4229  O  O    . ASP A 1 29 ? -2.537  -4.872  -5.576  1.00 0.53  ? 1131 ASP A O    7  
ATOM   4230  C  CB   . ASP A 1 29 ? -3.675  -5.569  -8.336  1.00 0.75  ? 1131 ASP A CB   7  
ATOM   4231  C  CG   . ASP A 1 29 ? -3.223  -6.918  -8.853  1.00 0.92  ? 1131 ASP A CG   7  
ATOM   4232  O  OD1  . ASP A 1 29 ? -2.128  -7.370  -8.476  1.00 0.92  ? 1131 ASP A OD1  7  
ATOM   4233  O  OD2  . ASP A 1 29 ? -3.974  -7.539  -9.637  1.00 1.21  ? 1131 ASP A OD2  7  
ATOM   4234  H  H    . ASP A 1 29 ? -4.713  -3.722  -6.237  1.00 0.55  ? 1131 ASP A H    7  
ATOM   4235  H  HA   . ASP A 1 29 ? -4.985  -6.522  -6.937  1.00 0.81  ? 1131 ASP A HA   7  
ATOM   4236  H  HB2  . ASP A 1 29 ? -4.384  -5.151  -9.031  1.00 0.81  ? 1131 ASP A HB2  7  
ATOM   4237  H  HB3  . ASP A 1 29 ? -2.814  -4.921  -8.273  1.00 0.68  ? 1131 ASP A HB3  7  
ATOM   4238  N  N    . ASN A 1 30 ? -3.152  -7.014  -5.321  1.00 0.94  ? 1132 ASN A N    7  
ATOM   4239  C  CA   . ASN A 1 30 ? -2.192  -7.272  -4.251  1.00 1.00  ? 1132 ASN A CA   7  
ATOM   4240  C  C    . ASN A 1 30 ? -0.770  -7.367  -4.798  1.00 0.91  ? 1132 ASN A C    7  
ATOM   4241  O  O    . ASN A 1 30 ? -0.382  -8.394  -5.355  1.00 1.06  ? 1132 ASN A O    7  
ATOM   4242  C  CB   . ASN A 1 30 ? -2.546  -8.569  -3.514  1.00 1.29  ? 1132 ASN A CB   7  
ATOM   4243  C  CG   . ASN A 1 30 ? -3.851  -8.477  -2.745  1.00 1.72  ? 1132 ASN A CG   7  
ATOM   4244  O  OD1  . ASN A 1 30 ? -4.926  -8.690  -3.300  1.00 2.58  ? 1132 ASN A OD1  7  
ATOM   4245  N  ND2  . ASN A 1 30 ? -3.764  -8.187  -1.454  1.00 2.07  ? 1132 ASN A ND2  7  
ATOM   4246  H  H    . ASN A 1 30 ? -3.731  -7.743  -5.633  1.00 1.15  ? 1132 ASN A H    7  
ATOM   4247  H  HA   . ASN A 1 30 ? -2.243  -6.448  -3.555  1.00 0.97  ? 1132 ASN A HA   7  
ATOM   4248  H  HB2  . ASN A 1 30 ? -2.633  -9.369  -4.232  1.00 1.52  ? 1132 ASN A HB2  7  
ATOM   4249  H  HB3  . ASN A 1 30 ? -1.755  -8.804  -2.817  1.00 1.97  ? 1132 ASN A HB3  7  
ATOM   4250  H  HD21 . ASN A 1 30 ? -2.874  -8.053  -1.069  1.00 2.11  ? 1132 ASN A HD21 7  
ATOM   4251  H  HD22 . ASN A 1 30 ? -4.596  -8.127  -0.932  1.00 2.73  ? 1132 ASN A HD22 7  
ATOM   4252  N  N    . ASP A 1 31 ? 0.009   -6.303  -4.637  1.00 0.86  ? 1133 ASP A N    7  
ATOM   4253  C  CA   . ASP A 1 31 ? 1.392   -6.306  -5.112  1.00 0.77  ? 1133 ASP A CA   7  
ATOM   4254  C  C    . ASP A 1 31 ? 2.329   -6.722  -3.995  1.00 0.78  ? 1133 ASP A C    7  
ATOM   4255  O  O    . ASP A 1 31 ? 3.306   -7.435  -4.223  1.00 1.28  ? 1133 ASP A O    7  
ATOM   4256  C  CB   . ASP A 1 31 ? 1.816   -4.939  -5.653  1.00 0.67  ? 1133 ASP A CB   7  
ATOM   4257  C  CG   . ASP A 1 31 ? 1.092   -4.561  -6.927  1.00 0.58  ? 1133 ASP A CG   7  
ATOM   4258  O  OD1  . ASP A 1 31 ? 1.502   -5.024  -8.013  1.00 1.09  ? 1133 ASP A OD1  7  
ATOM   4259  O  OD2  . ASP A 1 31 ? 0.110   -3.792  -6.847  1.00 1.00  ? 1133 ASP A OD2  7  
ATOM   4260  H  H    . ASP A 1 31 ? -0.345  -5.509  -4.181  1.00 1.05  ? 1133 ASP A H    7  
ATOM   4261  H  HA   . ASP A 1 31 ? 1.462   -7.030  -5.906  1.00 0.87  ? 1133 ASP A HA   7  
ATOM   4262  H  HB2  . ASP A 1 31 ? 1.617   -4.188  -4.911  1.00 1.04  ? 1133 ASP A HB2  7  
ATOM   4263  H  HB3  . ASP A 1 31 ? 2.876   -4.959  -5.860  1.00 1.05  ? 1133 ASP A HB3  7  
ATOM   4264  N  N    . CYS A 1 32 ? 2.026   -6.273  -2.787  1.00 0.76  ? 1134 CYS A N    7  
ATOM   4265  C  CA   . CYS A 1 32 ? 2.815   -6.633  -1.620  1.00 0.78  ? 1134 CYS A CA   7  
ATOM   4266  C  C    . CYS A 1 32 ? 2.574   -8.091  -1.232  1.00 0.85  ? 1134 CYS A C    7  
ATOM   4267  O  O    . CYS A 1 32 ? 1.817   -8.801  -1.902  1.00 1.57  ? 1134 CYS A O    7  
ATOM   4268  C  CB   . CYS A 1 32 ? 2.472   -5.711  -0.452  1.00 0.82  ? 1134 CYS A CB   7  
ATOM   4269  S  SG   . CYS A 1 32 ? 2.690   -3.938  -0.816  1.00 1.16  ? 1134 CYS A SG   7  
ATOM   4270  H  H    . CYS A 1 32 ? 1.256   -5.673  -2.677  1.00 1.11  ? 1134 CYS A H    7  
ATOM   4271  H  HA   . CYS A 1 32 ? 3.857   -6.507  -1.873  1.00 0.88  ? 1134 CYS A HA   7  
ATOM   4272  H  HB2  . CYS A 1 32 ? 1.439   -5.862  -0.176  1.00 1.25  ? 1134 CYS A HB2  7  
ATOM   4273  H  HB3  . CYS A 1 32 ? 3.102   -5.956  0.388   1.00 1.22  ? 1134 CYS A HB3  7  
ATOM   4274  N  N    . GLY A 1 33 ? 3.199   -8.538  -0.153  1.00 1.17  ? 1135 GLY A N    7  
ATOM   4275  C  CA   . GLY A 1 33 ? 3.059   -9.918  0.259   1.00 1.22  ? 1135 GLY A CA   7  
ATOM   4276  C  C    . GLY A 1 33 ? 1.687   -10.200 0.827   1.00 1.18  ? 1135 GLY A C    7  
ATOM   4277  O  O    . GLY A 1 33 ? 1.001   -11.126 0.391   1.00 1.68  ? 1135 GLY A O    7  
ATOM   4278  H  H    . GLY A 1 33 ? 3.738   -7.919  0.388   1.00 1.82  ? 1135 GLY A H    7  
ATOM   4279  H  HA2  . GLY A 1 33 ? 3.226   -10.558 -0.594  1.00 1.26  ? 1135 GLY A HA2  7  
ATOM   4280  H  HA3  . GLY A 1 33 ? 3.801   -10.136 1.013   1.00 1.39  ? 1135 GLY A HA3  7  
ATOM   4281  N  N    . ASP A 1 34 ? 1.280   -9.389  1.789   1.00 1.02  ? 1136 ASP A N    7  
ATOM   4282  C  CA   . ASP A 1 34 ? -0.033  -9.526  2.403   1.00 1.11  ? 1136 ASP A CA   7  
ATOM   4283  C  C    . ASP A 1 34 ? -1.036  -8.633  1.689   1.00 0.93  ? 1136 ASP A C    7  
ATOM   4284  O  O    . ASP A 1 34 ? -2.236  -8.908  1.667   1.00 1.35  ? 1136 ASP A O    7  
ATOM   4285  C  CB   . ASP A 1 34 ? 0.022   -9.163  3.886   1.00 1.44  ? 1136 ASP A CB   7  
ATOM   4286  C  CG   . ASP A 1 34 ? 0.919   -10.083 4.689   1.00 2.10  ? 1136 ASP A CG   7  
ATOM   4287  O  OD1  . ASP A 1 34 ? 0.434   -11.128 5.174   1.00 2.47  ? 1136 ASP A OD1  7  
ATOM   4288  O  OD2  . ASP A 1 34 ? 2.118   -9.771  4.834   1.00 2.85  ? 1136 ASP A OD2  7  
ATOM   4289  H  H    . ASP A 1 34 ? 1.880   -8.670  2.096   1.00 1.22  ? 1136 ASP A H    7  
ATOM   4290  H  HA   . ASP A 1 34 ? -0.341  -10.548 2.305   1.00 1.27  ? 1136 ASP A HA   7  
ATOM   4291  H  HB2  . ASP A 1 34 ? 0.393   -8.161  3.982   1.00 1.68  ? 1136 ASP A HB2  7  
ATOM   4292  H  HB3  . ASP A 1 34 ? -0.976  -9.213  4.299   1.00 1.84  ? 1136 ASP A HB3  7  
ATOM   4293  N  N    . GLY A 1 35 ? -0.529  -7.556  1.110   1.00 0.62  ? 1137 GLY A N    7  
ATOM   4294  C  CA   . GLY A 1 35 ? -1.368  -6.635  0.375   1.00 0.49  ? 1137 GLY A CA   7  
ATOM   4295  C  C    . GLY A 1 35 ? -1.495  -5.309  1.085   1.00 0.36  ? 1137 GLY A C    7  
ATOM   4296  O  O    . GLY A 1 35 ? -2.520  -4.632  0.982   1.00 0.36  ? 1137 GLY A O    7  
ATOM   4297  H  H    . GLY A 1 35 ? 0.432   -7.371  1.208   1.00 0.82  ? 1137 GLY A H    7  
ATOM   4298  H  HA2  . GLY A 1 35 ? -0.940  -6.472  -0.604  1.00 0.51  ? 1137 GLY A HA2  7  
ATOM   4299  H  HA3  . GLY A 1 35 ? -2.351  -7.067  0.264   1.00 0.72  ? 1137 GLY A HA3  7  
ATOM   4300  N  N    . SER A 1 36 ? -0.449  -4.941  1.810   1.00 0.32  ? 1138 SER A N    7  
ATOM   4301  C  CA   . SER A 1 36 ? -0.440  -3.725  2.603   1.00 0.28  ? 1138 SER A CA   7  
ATOM   4302  C  C    . SER A 1 36 ? -0.583  -2.479  1.725   1.00 0.25  ? 1138 SER A C    7  
ATOM   4303  O  O    . SER A 1 36 ? -1.098  -1.455  2.173   1.00 0.40  ? 1138 SER A O    7  
ATOM   4304  C  CB   . SER A 1 36 ? 0.852   -3.666  3.420   1.00 0.33  ? 1138 SER A CB   7  
ATOM   4305  O  OG   . SER A 1 36 ? 1.988   -3.550  2.580   1.00 0.44  ? 1138 SER A OG   7  
ATOM   4306  H  H    . SER A 1 36 ? 0.350   -5.523  1.831   1.00 0.37  ? 1138 SER A H    7  
ATOM   4307  H  HA   . SER A 1 36 ? -1.281  -3.771  3.280   1.00 0.33  ? 1138 SER A HA   7  
ATOM   4308  H  HB2  . SER A 1 36 ? 0.824   -2.823  4.087   1.00 0.40  ? 1138 SER A HB2  7  
ATOM   4309  H  HB3  . SER A 1 36 ? 0.943   -4.573  3.998   1.00 0.39  ? 1138 SER A HB3  7  
ATOM   4310  H  HG   . SER A 1 36 ? 2.445   -2.723  2.778   1.00 1.17  ? 1138 SER A HG   7  
ATOM   4311  N  N    . ASP A 1 37 ? -0.148  -2.576  0.471   1.00 0.18  ? 1139 ASP A N    7  
ATOM   4312  C  CA   . ASP A 1 37 ? -0.254  -1.458  -0.463  1.00 0.18  ? 1139 ASP A CA   7  
ATOM   4313  C  C    . ASP A 1 37 ? -1.715  -1.170  -0.782  1.00 0.20  ? 1139 ASP A C    7  
ATOM   4314  O  O    . ASP A 1 37 ? -2.087  -0.047  -1.106  1.00 0.29  ? 1139 ASP A O    7  
ATOM   4315  C  CB   . ASP A 1 37 ? 0.520   -1.743  -1.759  1.00 0.19  ? 1139 ASP A CB   7  
ATOM   4316  C  CG   . ASP A 1 37 ? -0.159  -2.754  -2.669  1.00 0.26  ? 1139 ASP A CG   7  
ATOM   4317  O  OD1  . ASP A 1 37 ? -0.171  -3.963  -2.343  1.00 0.33  ? 1139 ASP A OD1  7  
ATOM   4318  O  OD2  . ASP A 1 37 ? -0.679  -2.342  -3.726  1.00 0.32  ? 1139 ASP A OD2  7  
ATOM   4319  H  H    . ASP A 1 37 ? 0.261   -3.415  0.170   1.00 0.26  ? 1139 ASP A H    7  
ATOM   4320  H  HA   . ASP A 1 37 ? 0.172   -0.588  0.015   1.00 0.20  ? 1139 ASP A HA   7  
ATOM   4321  H  HB2  . ASP A 1 37 ? 0.631   -0.822  -2.307  1.00 0.22  ? 1139 ASP A HB2  7  
ATOM   4322  H  HB3  . ASP A 1 37 ? 1.500   -2.119  -1.505  1.00 0.19  ? 1139 ASP A HB3  7  
ATOM   4323  N  N    . GLU A 1 38 ? -2.541  -2.191  -0.675  1.00 0.22  ? 1140 GLU A N    7  
ATOM   4324  C  CA   . GLU A 1 38 ? -3.961  -2.046  -0.930  1.00 0.27  ? 1140 GLU A CA   7  
ATOM   4325  C  C    . GLU A 1 38 ? -4.692  -1.619  0.336   1.00 0.31  ? 1140 GLU A C    7  
ATOM   4326  O  O    . GLU A 1 38 ? -5.687  -0.897  0.277   1.00 0.44  ? 1140 GLU A O    7  
ATOM   4327  C  CB   . GLU A 1 38 ? -4.533  -3.363  -1.444  1.00 0.29  ? 1140 GLU A CB   7  
ATOM   4328  C  CG   . GLU A 1 38 ? -3.952  -3.793  -2.780  1.00 0.29  ? 1140 GLU A CG   7  
ATOM   4329  C  CD   . GLU A 1 38 ? -4.292  -2.823  -3.891  1.00 0.28  ? 1140 GLU A CD   7  
ATOM   4330  O  OE1  . GLU A 1 38 ? -5.489  -2.562  -4.101  1.00 0.38  ? 1140 GLU A OE1  7  
ATOM   4331  O  OE2  . GLU A 1 38 ? -3.365  -2.317  -4.561  1.00 0.28  ? 1140 GLU A OE2  7  
ATOM   4332  H  H    . GLU A 1 38 ? -2.186  -3.070  -0.416  1.00 0.24  ? 1140 GLU A H    7  
ATOM   4333  H  HA   . GLU A 1 38 ? -4.089  -1.280  -1.686  1.00 0.30  ? 1140 GLU A HA   7  
ATOM   4334  H  HB2  . GLU A 1 38 ? -4.329  -4.138  -0.720  1.00 0.32  ? 1140 GLU A HB2  7  
ATOM   4335  H  HB3  . GLU A 1 38 ? -5.602  -3.259  -1.556  1.00 0.33  ? 1140 GLU A HB3  7  
ATOM   4336  H  HG2  . GLU A 1 38 ? -2.878  -3.853  -2.692  1.00 0.29  ? 1140 GLU A HG2  7  
ATOM   4337  H  HG3  . GLU A 1 38 ? -4.349  -4.765  -3.036  1.00 0.33  ? 1140 GLU A HG3  7  
ATOM   4338  N  N    . LYS A 1 39 ? -4.186  -2.061  1.483   1.00 0.30  ? 1141 LYS A N    7  
ATOM   4339  C  CA   . LYS A 1 39 ? -4.819  -1.744  2.757   1.00 0.37  ? 1141 LYS A CA   7  
ATOM   4340  C  C    . LYS A 1 39 ? -4.536  -0.296  3.139   1.00 0.49  ? 1141 LYS A C    7  
ATOM   4341  O  O    . LYS A 1 39 ? -5.344  0.359   3.798   1.00 0.57  ? 1141 LYS A O    7  
ATOM   4342  C  CB   . LYS A 1 39 ? -4.338  -2.701  3.860   1.00 0.47  ? 1141 LYS A CB   7  
ATOM   4343  C  CG   . LYS A 1 39 ? -3.036  -2.298  4.534   1.00 0.57  ? 1141 LYS A CG   7  
ATOM   4344  C  CD   . LYS A 1 39 ? -2.634  -3.297  5.600   1.00 0.76  ? 1141 LYS A CD   7  
ATOM   4345  C  CE   . LYS A 1 39 ? -1.401  -2.838  6.352   1.00 0.91  ? 1141 LYS A CE   7  
ATOM   4346  N  NZ   . LYS A 1 39 ? -1.650  -1.600  7.137   1.00 1.55  ? 1141 LYS A NZ   7  
ATOM   4347  H  H    . LYS A 1 39 ? -3.377  -2.613  1.470   1.00 0.32  ? 1141 LYS A H    7  
ATOM   4348  H  HA   . LYS A 1 39 ? -5.884  -1.864  2.630   1.00 0.39  ? 1141 LYS A HA   7  
ATOM   4349  H  HB2  . LYS A 1 39 ? -5.096  -2.759  4.620   1.00 0.56  ? 1141 LYS A HB2  7  
ATOM   4350  H  HB3  . LYS A 1 39 ? -4.203  -3.682  3.429   1.00 0.47  ? 1141 LYS A HB3  7  
ATOM   4351  H  HG2  . LYS A 1 39 ? -2.255  -2.245  3.795   1.00 0.50  ? 1141 LYS A HG2  7  
ATOM   4352  H  HG3  . LYS A 1 39 ? -3.164  -1.329  4.994   1.00 0.65  ? 1141 LYS A HG3  7  
ATOM   4353  H  HD2  . LYS A 1 39 ? -3.449  -3.412  6.299   1.00 0.88  ? 1141 LYS A HD2  7  
ATOM   4354  H  HD3  . LYS A 1 39 ? -2.425  -4.247  5.129   1.00 0.73  ? 1141 LYS A HD3  7  
ATOM   4355  H  HE2  . LYS A 1 39 ? -1.096  -3.622  7.022   1.00 1.15  ? 1141 LYS A HE2  7  
ATOM   4356  H  HE3  . LYS A 1 39 ? -0.613  -2.648  5.639   1.00 1.18  ? 1141 LYS A HE3  7  
ATOM   4357  H  HZ1  . LYS A 1 39 ? -1.941  -0.827  6.509   1.00 2.08  ? 1141 LYS A HZ1  7  
ATOM   4358  H  HZ2  . LYS A 1 39 ? -0.784  -1.313  7.638   1.00 1.99  ? 1141 LYS A HZ2  7  
ATOM   4359  H  HZ3  . LYS A 1 39 ? -2.399  -1.763  7.839   1.00 1.97  ? 1141 LYS A HZ3  7  
ATOM   4360  N  N    . ASN A 1 40 ? -3.386  0.200   2.703   1.00 0.60  ? 1142 ASN A N    7  
ATOM   4361  C  CA   . ASN A 1 40 ? -2.985  1.575   2.964   1.00 0.81  ? 1142 ASN A CA   7  
ATOM   4362  C  C    . ASN A 1 40 ? -3.636  2.503   1.943   1.00 0.91  ? 1142 ASN A C    7  
ATOM   4363  O  O    . ASN A 1 40 ? -2.964  3.063   1.073   1.00 1.44  ? 1142 ASN A O    7  
ATOM   4364  C  CB   . ASN A 1 40 ? -1.458  1.693   2.894   1.00 1.07  ? 1142 ASN A CB   7  
ATOM   4365  C  CG   . ASN A 1 40 ? -0.932  3.001   3.458   1.00 1.37  ? 1142 ASN A CG   7  
ATOM   4366  O  OD1  . ASN A 1 40 ? -0.626  3.095   4.647   1.00 2.05  ? 1142 ASN A OD1  7  
ATOM   4367  N  ND2  . ASN A 1 40 ? -0.816  4.014   2.616   1.00 1.92  ? 1142 ASN A ND2  7  
ATOM   4368  H  H    . ASN A 1 40 ? -2.784  -0.381  2.188   1.00 0.58  ? 1142 ASN A H    7  
ATOM   4369  H  HA   . ASN A 1 40 ? -3.321  1.844   3.953   1.00 0.86  ? 1142 ASN A HA   7  
ATOM   4370  H  HB2  . ASN A 1 40 ? -1.017  0.883   3.455   1.00 1.54  ? 1142 ASN A HB2  7  
ATOM   4371  H  HB3  . ASN A 1 40 ? -1.146  1.618   1.862   1.00 1.56  ? 1142 ASN A HB3  7  
ATOM   4372  H  HD21 . ASN A 1 40 ? -1.075  3.871   1.681   1.00 2.20  ? 1142 ASN A HD21 7  
ATOM   4373  H  HD22 . ASN A 1 40 ? -0.476  4.867   2.961   1.00 2.44  ? 1142 ASN A HD22 7  
ATOM   4374  N  N    . CYS A 1 41 ? -4.952  2.643   2.041   1.00 0.76  ? 1143 CYS A N    7  
ATOM   4375  C  CA   . CYS A 1 41 ? -5.714  3.439   1.089   1.00 0.99  ? 1143 CYS A CA   7  
ATOM   4376  C  C    . CYS A 1 41 ? -7.147  3.620   1.579   1.00 1.29  ? 1143 CYS A C    7  
ATOM   4377  O  O    . CYS A 1 41 ? -7.889  2.644   1.682   1.00 1.67  ? 1143 CYS A O    7  
ATOM   4378  C  CB   . CYS A 1 41 ? -5.711  2.751   -0.277  1.00 0.93  ? 1143 CYS A CB   7  
ATOM   4379  S  SG   . CYS A 1 41 ? -6.488  3.710   -1.618  1.00 1.10  ? 1143 CYS A SG   7  
ATOM   4380  H  H    . CYS A 1 41 ? -5.428  2.188   2.770   1.00 0.89  ? 1143 CYS A H    7  
ATOM   4381  H  HA   . CYS A 1 41 ? -5.244  4.408   1.003   1.00 1.23  ? 1143 CYS A HA   7  
ATOM   4382  H  HB2  . CYS A 1 41 ? -4.690  2.558   -0.563  1.00 0.98  ? 1143 CYS A HB2  7  
ATOM   4383  H  HB3  . CYS A 1 41 ? -6.237  1.812   -0.196  1.00 1.29  ? 1143 CYS A HB3  7  
ATOM   4384  N  N    . ASN A 1 42 ? -7.507  4.872   1.886   1.00 1.87  ? 1144 ASN A N    7  
ATOM   4385  C  CA   . ASN A 1 42 ? -8.841  5.245   2.385   1.00 2.36  ? 1144 ASN A CA   7  
ATOM   4386  C  C    . ASN A 1 42 ? -9.407  4.198   3.348   1.00 3.05  ? 1144 ASN A C    7  
ATOM   4387  O  O    . ASN A 1 42 ? -10.477 3.631   3.129   1.00 3.73  ? 1144 ASN A O    7  
ATOM   4388  C  CB   . ASN A 1 42 ? -9.823  5.546   1.228   1.00 3.11  ? 1144 ASN A CB   7  
ATOM   4389  C  CG   . ASN A 1 42 ? -10.141 4.359   0.327   1.00 3.87  ? 1144 ASN A CG   7  
ATOM   4390  O  OD1  . ASN A 1 42 ? -11.093 3.616   0.569   1.00 4.27  ? 1144 ASN A OD1  7  
ATOM   4391  N  ND2  . ASN A 1 42 ? -9.372  4.193   -0.735  1.00 4.59  ? 1144 ASN A ND2  7  
ATOM   4392  H  H    . ASN A 1 42 ? -6.838  5.583   1.784   1.00 2.27  ? 1144 ASN A H    7  
ATOM   4393  H  HA   . ASN A 1 42 ? -8.707  6.156   2.949   1.00 2.42  ? 1144 ASN A HA   7  
ATOM   4394  H  HB2  . ASN A 1 42 ? -10.753 5.898   1.648   1.00 3.41  ? 1144 ASN A HB2  7  
ATOM   4395  H  HB3  . ASN A 1 42 ? -9.402  6.331   0.615   1.00 3.38  ? 1144 ASN A HB3  7  
ATOM   4396  H  HD21 . ASN A 1 42 ? -8.648  4.835   -0.892  1.00 4.61  ? 1144 ASN A HD21 7  
ATOM   4397  H  HD22 . ASN A 1 42 ? -9.555  3.430   -1.326  1.00 5.30  ? 1144 ASN A HD22 7  
ATOM   4398  N  N    . SER A 1 43 ? -8.676  3.957   4.425   1.00 3.53  ? 1145 SER A N    7  
ATOM   4399  C  CA   . SER A 1 43 ? -9.067  2.956   5.403   1.00 4.69  ? 1145 SER A CA   7  
ATOM   4400  C  C    . SER A 1 43 ? -10.302 3.407   6.179   1.00 5.23  ? 1145 SER A C    7  
ATOM   4401  O  O    . SER A 1 43 ? -11.426 3.011   5.867   1.00 5.32  ? 1145 SER A O    7  
ATOM   4402  C  CB   . SER A 1 43 ? -7.899  2.669   6.352   1.00 5.40  ? 1145 SER A CB   7  
ATOM   4403  O  OG   . SER A 1 43 ? -7.326  3.876   6.835   1.00 5.26  ? 1145 SER A OG   7  
ATOM   4404  H  H    . SER A 1 43 ? -7.858  4.477   4.573   1.00 3.45  ? 1145 SER A H    7  
ATOM   4405  H  HA   . SER A 1 43 ? -9.312  2.051   4.872   1.00 5.07  ? 1145 SER A HA   7  
ATOM   4406  H  HB2  . SER A 1 43 ? -8.255  2.092   7.193   1.00 6.23  ? 1145 SER A HB2  7  
ATOM   4407  H  HB3  . SER A 1 43 ? -7.139  2.110   5.826   1.00 5.56  ? 1145 SER A HB3  7  
ATOM   4408  H  HG   . SER A 1 43 ? -6.542  4.088   6.314   1.00 5.21  ? 1145 SER A HG   7  
ATOM   4409  N  N    . THR A 1 44 ? -10.092 4.234   7.182   1.00 5.97  ? 1146 THR A N    7  
ATOM   4410  C  CA   . THR A 1 44 ? -11.185 4.744   7.979   1.00 6.81  ? 1146 THR A CA   7  
ATOM   4411  C  C    . THR A 1 44 ? -11.695 6.073   7.425   1.00 7.34  ? 1146 THR A C    7  
ATOM   4412  O  O    . THR A 1 44 ? -11.349 7.147   7.925   1.00 8.15  ? 1146 THR A O    7  
ATOM   4413  C  CB   . THR A 1 44 ? -10.756 4.892   9.450   1.00 7.69  ? 1146 THR A CB   7  
ATOM   4414  O  OG1  . THR A 1 44 ? -9.522  5.620   9.535   1.00 7.92  ? 1146 THR A OG1  7  
ATOM   4415  C  CG2  . THR A 1 44 ? -10.580 3.522   10.083  1.00 7.74  ? 1146 THR A CG2  7  
ATOM   4416  H  H    . THR A 1 44 ? -9.174  4.513   7.390   1.00 6.16  ? 1146 THR A H    7  
ATOM   4417  H  HA   . THR A 1 44 ? -11.988 4.022   7.935   1.00 6.75  ? 1146 THR A HA   7  
ATOM   4418  H  HB   . THR A 1 44 ? -11.525 5.427   9.988   1.00 8.40  ? 1146 THR A HB   7  
ATOM   4419  H  HG1  . THR A 1 44 ? -8.849  5.062   9.947   1.00 8.03  ? 1146 THR A HG1  7  
ATOM   4420  H  HG21 . THR A 1 44 ? -9.878  2.945   9.495   1.00 7.71  ? 1146 THR A HG21 7  
ATOM   4421  H  HG22 . THR A 1 44 ? -11.531 3.012   10.108  1.00 7.80  ? 1146 THR A HG22 7  
ATOM   4422  H  HG23 . THR A 1 44 ? -10.202 3.634   11.088  1.00 8.03  ? 1146 THR A HG23 7  
ATOM   4423  N  N    . GLU A 1 45 ? -12.499 6.002   6.372   1.00 7.13  ? 1147 GLU A N    7  
ATOM   4424  C  CA   . GLU A 1 45 ? -13.065 7.206   5.780   1.00 7.94  ? 1147 GLU A CA   7  
ATOM   4425  C  C    . GLU A 1 45 ? -14.438 7.514   6.370   1.00 8.95  ? 1147 GLU A C    7  
ATOM   4426  O  O    . GLU A 1 45 ? -14.931 8.638   6.289   1.00 9.87  ? 1147 GLU A O    7  
ATOM   4427  C  CB   . GLU A 1 45 ? -13.104 7.116   4.241   1.00 7.79  ? 1147 GLU A CB   7  
ATOM   4428  C  CG   . GLU A 1 45 ? -13.537 5.767   3.672   1.00 7.90  ? 1147 GLU A CG   7  
ATOM   4429  C  CD   . GLU A 1 45 ? -15.020 5.497   3.816   1.00 8.00  ? 1147 GLU A CD   7  
ATOM   4430  O  OE1  . GLU A 1 45 ? -15.804 6.016   2.993   1.00 8.08  ? 1147 GLU A OE1  7  
ATOM   4431  O  OE2  . GLU A 1 45 ? -15.412 4.778   4.756   1.00 8.23  ? 1147 GLU A OE2  7  
ATOM   4432  H  H    . GLU A 1 45 ? -12.714 5.125   5.987   1.00 6.60  ? 1147 GLU A H    7  
ATOM   4433  H  HA   . GLU A 1 45 ? -12.407 8.020   6.049   1.00 8.20  ? 1147 GLU A HA   7  
ATOM   4434  H  HB2  . GLU A 1 45 ? -13.790 7.863   3.873   1.00 8.33  ? 1147 GLU A HB2  7  
ATOM   4435  H  HB3  . GLU A 1 45 ? -12.118 7.337   3.860   1.00 7.37  ? 1147 GLU A HB3  7  
ATOM   4436  H  HG2  . GLU A 1 45 ? -13.288 5.740   2.621   1.00 7.80  ? 1147 GLU A HG2  7  
ATOM   4437  H  HG3  . GLU A 1 45 ? -12.994 4.985   4.183   1.00 8.35  ? 1147 GLU A HG3  7  
ATOM   4438  N  N    . THR A 1 46 ? -15.024 6.492   6.992   1.00 8.94  ? 1148 THR A N    7  
ATOM   4439  C  CA   . THR A 1 46 ? -16.283 6.620   7.723   1.00 10.03 ? 1148 THR A CA   7  
ATOM   4440  C  C    . THR A 1 46 ? -17.414 7.096   6.806   1.00 10.71 ? 1148 THR A C    7  
ATOM   4441  O  O    . THR A 1 46 ? -18.281 7.866   7.216   1.00 11.12 ? 1148 THR A O    7  
ATOM   4442  C  CB   . THR A 1 46 ? -16.120 7.584   8.920   1.00 10.21 ? 1148 THR A CB   7  
ATOM   4443  O  OG1  . THR A 1 46 ? -14.851 7.357   9.547   1.00 9.58  ? 1148 THR A OG1  7  
ATOM   4444  C  CG2  . THR A 1 46 ? -17.221 7.379   9.952   1.00 11.01 ? 1148 THR A CG2  7  
ATOM   4445  H  H    . THR A 1 46 ? -14.593 5.615   6.956   1.00 8.30  ? 1148 THR A H    7  
ATOM   4446  H  HA   . THR A 1 46 ? -16.538 5.644   8.110   1.00 10.45 ? 1148 THR A HA   7  
ATOM   4447  H  HB   . THR A 1 46 ? -16.163 8.600   8.559   1.00 10.48 ? 1148 THR A HB   7  
ATOM   4448  H  HG1  . THR A 1 46 ? -14.165 7.827   9.057   1.00 9.43  ? 1148 THR A HG1  7  
ATOM   4449  H  HG21 . THR A 1 46 ? -17.163 6.377   10.346  1.00 11.19 ? 1148 THR A HG21 7  
ATOM   4450  H  HG22 . THR A 1 46 ? -18.183 7.526   9.485   1.00 11.07 ? 1148 THR A HG22 7  
ATOM   4451  H  HG23 . THR A 1 46 ? -17.098 8.090   10.755  1.00 11.53 ? 1148 THR A HG23 7  
HETATM 4452  CA CA   . CA  B 2 .  ? -1.497  -2.820  -5.701  1.00 0.28  ? 1201 CA  A CA   7  
ATOM   4453  N  N    . THR A 1 1  ? 25.302  -0.498  12.915  1.00 12.23 ? 1103 THR A N    8  
ATOM   4454  C  CA   . THR A 1 1  ? 23.990  0.151   12.732  1.00 11.73 ? 1103 THR A CA   8  
ATOM   4455  C  C    . THR A 1 1  ? 23.252  -0.452  11.538  1.00 10.83 ? 1103 THR A C    8  
ATOM   4456  O  O    . THR A 1 1  ? 23.641  -0.244  10.386  1.00 10.67 ? 1103 THR A O    8  
ATOM   4457  C  CB   . THR A 1 1  ? 24.158  1.668   12.516  1.00 11.83 ? 1103 THR A CB   8  
ATOM   4458  O  OG1  . THR A 1 1  ? 24.952  2.224   13.575  1.00 12.26 ? 1103 THR A OG1  8  
ATOM   4459  C  CG2  . THR A 1 1  ? 22.806  2.371   12.467  1.00 12.04 ? 1103 THR A CG2  8  
ATOM   4460  H  H1   . THR A 1 1  ? 25.874  -0.390  12.055  1.00 12.23 ? 1103 THR A H1   8  
ATOM   4461  H  H2   . THR A 1 1  ? 25.177  -1.510  13.109  1.00 12.55 ? 1103 THR A H2   8  
ATOM   4462  H  H3   . THR A 1 1  ? 25.809  -0.063  13.711  1.00 12.44 ? 1103 THR A H3   8  
ATOM   4463  H  HA   . THR A 1 1  ? 23.400  -0.005  13.624  1.00 12.16 ? 1103 THR A HA   8  
ATOM   4464  H  HB   . THR A 1 1  ? 24.665  1.828   11.575  1.00 11.67 ? 1103 THR A HB   8  
ATOM   4465  H  HG1  . THR A 1 1  ? 24.456  2.187   14.404  1.00 12.30 ? 1103 THR A HG1  8  
ATOM   4466  H  HG21 . THR A 1 1  ? 22.219  1.964   11.658  1.00 12.31 ? 1103 THR A HG21 8  
ATOM   4467  H  HG22 . THR A 1 1  ? 22.956  3.429   12.307  1.00 12.05 ? 1103 THR A HG22 8  
ATOM   4468  H  HG23 . THR A 1 1  ? 22.287  2.219   13.402  1.00 12.10 ? 1103 THR A HG23 8  
ATOM   4469  N  N    . HIS A 1 2  ? 22.199  -1.213  11.818  1.00 10.41 ? 1104 HIS A N    8  
ATOM   4470  C  CA   . HIS A 1 2  ? 21.390  -1.812  10.764  1.00 9.72  ? 1104 HIS A CA   8  
ATOM   4471  C  C    . HIS A 1 2  ? 20.503  -0.764  10.112  1.00 8.65  ? 1104 HIS A C    8  
ATOM   4472  O  O    . HIS A 1 2  ? 19.921  0.083   10.789  1.00 8.32  ? 1104 HIS A O    8  
ATOM   4473  C  CB   . HIS A 1 2  ? 20.534  -2.957  11.310  1.00 10.05 ? 1104 HIS A CB   8  
ATOM   4474  C  CG   . HIS A 1 2  ? 21.293  -4.230  11.520  1.00 10.43 ? 1104 HIS A CG   8  
ATOM   4475  N  ND1  . HIS A 1 2  ? 21.876  -4.579  12.718  1.00 10.71 ? 1104 HIS A ND1  8  
ATOM   4476  C  CD2  . HIS A 1 2  ? 21.553  -5.249  10.669  1.00 10.84 ? 1104 HIS A CD2  8  
ATOM   4477  C  CE1  . HIS A 1 2  ? 22.460  -5.755  12.596  1.00 11.25 ? 1104 HIS A CE1  8  
ATOM   4478  N  NE2  . HIS A 1 2  ? 22.279  -6.185  11.361  1.00 11.34 ? 1104 HIS A NE2  8  
ATOM   4479  H  H    . HIS A 1 2  ? 21.956  -1.371  12.758  1.00 10.71 ? 1104 HIS A H    8  
ATOM   4480  H  HA   . HIS A 1 2  ? 22.064  -2.206  10.017  1.00 9.96  ? 1104 HIS A HA   8  
ATOM   4481  H  HB2  . HIS A 1 2  ? 20.115  -2.662  12.260  1.00 10.50 ? 1104 HIS A HB2  8  
ATOM   4482  H  HB3  . HIS A 1 2  ? 19.732  -3.159  10.617  1.00 9.81  ? 1104 HIS A HB3  8  
ATOM   4483  H  HD1  . HIS A 1 2  ? 21.865  -4.039  13.542  1.00 10.68 ? 1104 HIS A HD1  8  
ATOM   4484  H  HD2  . HIS A 1 2  ? 21.249  -5.313  9.634   1.00 10.94 ? 1104 HIS A HD2  8  
ATOM   4485  H  HE1  . HIS A 1 2  ? 22.990  -6.280  13.376  1.00 11.71 ? 1104 HIS A HE1  8  
ATOM   4486  H  HE2  . HIS A 1 2  ? 22.442  -7.105  11.060  1.00 11.83 ? 1104 HIS A HE2  8  
ATOM   4487  N  N    . ALA A 1 3  ? 20.414  -0.825  8.797   1.00 8.30  ? 1105 ALA A N    8  
ATOM   4488  C  CA   . ALA A 1 3  ? 19.653  0.149   8.041   1.00 7.41  ? 1105 ALA A CA   8  
ATOM   4489  C  C    . ALA A 1 3  ? 18.283  -0.402  7.656   1.00 6.47  ? 1105 ALA A C    8  
ATOM   4490  O  O    . ALA A 1 3  ? 18.164  -1.554  7.232   1.00 6.54  ? 1105 ALA A O    8  
ATOM   4491  C  CB   . ALA A 1 3  ? 20.428  0.547   6.799   1.00 7.70  ? 1105 ALA A CB   8  
ATOM   4492  H  H    . ALA A 1 3  ? 20.869  -1.551  8.319   1.00 8.79  ? 1105 ALA A H    8  
ATOM   4493  H  HA   . ALA A 1 3  ? 19.524  1.026   8.656   1.00 7.45  ? 1105 ALA A HA   8  
ATOM   4494  H  HB1  . ALA A 1 3  ? 21.386  0.953   7.087   1.00 7.93  ? 1105 ALA A HB1  8  
ATOM   4495  H  HB2  . ALA A 1 3  ? 19.870  1.292   6.251   1.00 7.73  ? 1105 ALA A HB2  8  
ATOM   4496  H  HB3  . ALA A 1 3  ? 20.577  -0.321  6.177   1.00 7.95  ? 1105 ALA A HB3  8  
ATOM   4497  N  N    . PRO A 1 4  ? 17.228  0.412   7.823   1.00 5.80  ? 1106 PRO A N    8  
ATOM   4498  C  CA   . PRO A 1 4  ? 15.873  0.064   7.376   1.00 4.97  ? 1106 PRO A CA   8  
ATOM   4499  C  C    . PRO A 1 4  ? 15.801  -0.121  5.861   1.00 4.25  ? 1106 PRO A C    8  
ATOM   4500  O  O    . PRO A 1 4  ? 16.732  0.236   5.133   1.00 4.22  ? 1106 PRO A O    8  
ATOM   4501  C  CB   . PRO A 1 4  ? 15.029  1.274   7.800   1.00 4.84  ? 1106 PRO A CB   8  
ATOM   4502  C  CG   . PRO A 1 4  ? 15.832  1.962   8.847   1.00 5.55  ? 1106 PRO A CG   8  
ATOM   4503  C  CD   . PRO A 1 4  ? 17.267  1.726   8.483   1.00 6.09  ? 1106 PRO A CD   8  
ATOM   4504  H  HA   . PRO A 1 4  ? 15.508  -0.825  7.868   1.00 5.32  ? 1106 PRO A HA   8  
ATOM   4505  H  HB2  . PRO A 1 4  ? 14.862  1.915   6.947   1.00 4.32  ? 1106 PRO A HB2  8  
ATOM   4506  H  HB3  . PRO A 1 4  ? 14.082  0.935   8.192   1.00 5.12  ? 1106 PRO A HB3  8  
ATOM   4507  H  HG2  . PRO A 1 4  ? 15.612  3.019   8.845   1.00 5.52  ? 1106 PRO A HG2  8  
ATOM   4508  H  HG3  . PRO A 1 4  ? 15.616  1.534   9.816   1.00 6.00  ? 1106 PRO A HG3  8  
ATOM   4509  H  HD2  . PRO A 1 4  ? 17.617  2.490   7.806   1.00 6.19  ? 1106 PRO A HD2  8  
ATOM   4510  H  HD3  . PRO A 1 4  ? 17.881  1.694   9.371   1.00 6.80  ? 1106 PRO A HD3  8  
ATOM   4511  N  N    . ALA A 1 5  ? 14.696  -0.682  5.390   1.00 4.09  ? 1107 ALA A N    8  
ATOM   4512  C  CA   . ALA A 1 5  ? 14.507  -0.926  3.969   1.00 3.77  ? 1107 ALA A CA   8  
ATOM   4513  C  C    . ALA A 1 5  ? 14.082  0.351   3.256   1.00 2.63  ? 1107 ALA A C    8  
ATOM   4514  O  O    . ALA A 1 5  ? 12.891  0.631   3.114   1.00 2.62  ? 1107 ALA A O    8  
ATOM   4515  C  CB   . ALA A 1 5  ? 13.476  -2.024  3.755   1.00 4.73  ? 1107 ALA A CB   8  
ATOM   4516  H  H    . ALA A 1 5  ? 13.981  -0.926  6.018   1.00 4.51  ? 1107 ALA A H    8  
ATOM   4517  H  HA   . ALA A 1 5  ? 15.448  -1.262  3.559   1.00 4.04  ? 1107 ALA A HA   8  
ATOM   4518  H  HB1  . ALA A 1 5  ? 13.793  -2.919  4.265   1.00 5.01  ? 1107 ALA A HB1  8  
ATOM   4519  H  HB2  . ALA A 1 5  ? 13.380  -2.226  2.697   1.00 4.95  ? 1107 ALA A HB2  8  
ATOM   4520  H  HB3  . ALA A 1 5  ? 12.523  -1.704  4.147   1.00 5.29  ? 1107 ALA A HB3  8  
ATOM   4521  N  N    . SER A 1 6  ? 15.058  1.135   2.832   1.00 2.16  ? 1108 SER A N    8  
ATOM   4522  C  CA   . SER A 1 6  ? 14.788  2.370   2.124   1.00 1.43  ? 1108 SER A CA   8  
ATOM   4523  C  C    . SER A 1 6  ? 14.621  2.112   0.630   1.00 1.29  ? 1108 SER A C    8  
ATOM   4524  O  O    . SER A 1 6  ? 15.601  2.012   -0.110  1.00 1.97  ? 1108 SER A O    8  
ATOM   4525  C  CB   . SER A 1 6  ? 15.913  3.375   2.384   1.00 2.09  ? 1108 SER A CB   8  
ATOM   4526  O  OG   . SER A 1 6  ? 17.192  2.780   2.204   1.00 2.97  ? 1108 SER A OG   8  
ATOM   4527  H  H    . SER A 1 6  ? 15.988  0.877   3.005   1.00 2.71  ? 1108 SER A H    8  
ATOM   4528  H  HA   . SER A 1 6  ? 13.863  2.774   2.510   1.00 1.32  ? 1108 SER A HA   8  
ATOM   4529  H  HB2  . SER A 1 6  ? 15.818  4.203   1.699   1.00 2.36  ? 1108 SER A HB2  8  
ATOM   4530  H  HB3  . SER A 1 6  ? 15.838  3.739   3.397   1.00 2.13  ? 1108 SER A HB3  8  
ATOM   4531  H  HG   . SER A 1 6  ? 17.760  3.392   1.717   1.00 3.32  ? 1108 SER A HG   8  
ATOM   4532  N  N    . CYS A 1 7  ? 13.375  1.984   0.194   1.00 0.72  ? 1109 CYS A N    8  
ATOM   4533  C  CA   . CYS A 1 7  ? 13.076  1.776   -1.215  1.00 0.49  ? 1109 CYS A CA   8  
ATOM   4534  C  C    . CYS A 1 7  ? 13.230  3.081   -1.994  1.00 0.46  ? 1109 CYS A C    8  
ATOM   4535  O  O    . CYS A 1 7  ? 13.696  4.086   -1.450  1.00 0.62  ? 1109 CYS A O    8  
ATOM   4536  C  CB   . CYS A 1 7  ? 11.660  1.216   -1.377  1.00 0.33  ? 1109 CYS A CB   8  
ATOM   4537  S  SG   . CYS A 1 7  ? 11.322  -0.264  -0.361  1.00 0.47  ? 1109 CYS A SG   8  
ATOM   4538  H  H    . CYS A 1 7  ? 12.638  2.022   0.838   1.00 0.94  ? 1109 CYS A H    8  
ATOM   4539  H  HA   . CYS A 1 7  ? 13.780  1.059   -1.607  1.00 0.60  ? 1109 CYS A HA   8  
ATOM   4540  H  HB2  . CYS A 1 7  ? 10.946  1.974   -1.097  1.00 0.41  ? 1109 CYS A HB2  8  
ATOM   4541  H  HB3  . CYS A 1 7  ? 11.505  0.946   -2.410  1.00 0.29  ? 1109 CYS A HB3  8  
ATOM   4542  N  N    . LEU A 1 8  ? 12.851  3.059   -3.262  1.00 0.34  ? 1110 LEU A N    8  
ATOM   4543  C  CA   . LEU A 1 8  ? 12.966  4.229   -4.127  1.00 0.32  ? 1110 LEU A CA   8  
ATOM   4544  C  C    . LEU A 1 8  ? 12.133  5.386   -3.587  1.00 0.29  ? 1110 LEU A C    8  
ATOM   4545  O  O    . LEU A 1 8  ? 11.232  5.180   -2.771  1.00 0.30  ? 1110 LEU A O    8  
ATOM   4546  C  CB   . LEU A 1 8  ? 12.479  3.873   -5.526  1.00 0.28  ? 1110 LEU A CB   8  
ATOM   4547  C  CG   . LEU A 1 8  ? 13.074  4.670   -6.683  1.00 0.38  ? 1110 LEU A CG   8  
ATOM   4548  C  CD1  . LEU A 1 8  ? 14.575  4.438   -6.789  1.00 0.52  ? 1110 LEU A CD1  8  
ATOM   4549  C  CD2  . LEU A 1 8  ? 12.376  4.285   -7.979  1.00 0.39  ? 1110 LEU A CD2  8  
ATOM   4550  H  H    . LEU A 1 8  ? 12.486  2.228   -3.634  1.00 0.34  ? 1110 LEU A H    8  
ATOM   4551  H  HA   . LEU A 1 8  ? 14.002  4.520   -4.171  1.00 0.40  ? 1110 LEU A HA   8  
ATOM   4552  H  HB2  . LEU A 1 8  ? 12.671  2.827   -5.689  1.00 0.32  ? 1110 LEU A HB2  8  
ATOM   4553  H  HB3  . LEU A 1 8  ? 11.408  4.018   -5.546  1.00 0.22  ? 1110 LEU A HB3  8  
ATOM   4554  H  HG   . LEU A 1 8  ? 12.908  5.723   -6.512  1.00 0.41  ? 1110 LEU A HG   8  
ATOM   4555  H  HD11 . LEU A 1 8  ? 15.056  4.774   -5.883  1.00 1.05  ? 1110 LEU A HD11 8  
ATOM   4556  H  HD12 . LEU A 1 8  ? 14.966  4.991   -7.630  1.00 1.29  ? 1110 LEU A HD12 8  
ATOM   4557  H  HD13 . LEU A 1 8  ? 14.768  3.385   -6.930  1.00 1.07  ? 1110 LEU A HD13 8  
ATOM   4558  H  HD21 . LEU A 1 8  ? 12.536  3.234   -8.176  1.00 1.11  ? 1110 LEU A HD21 8  
ATOM   4559  H  HD22 . LEU A 1 8  ? 12.776  4.870   -8.793  1.00 1.05  ? 1110 LEU A HD22 8  
ATOM   4560  H  HD23 . LEU A 1 8  ? 11.315  4.473   -7.885  1.00 0.97  ? 1110 LEU A HD23 8  
ATOM   4561  N  N    . ASP A 1 9  ? 12.422  6.593   -4.046  1.00 0.35  ? 1111 ASP A N    8  
ATOM   4562  C  CA   . ASP A 1 9  ? 11.647  7.765   -3.650  1.00 0.38  ? 1111 ASP A CA   8  
ATOM   4563  C  C    . ASP A 1 9  ? 10.205  7.605   -4.108  1.00 0.32  ? 1111 ASP A C    8  
ATOM   4564  O  O    . ASP A 1 9  ? 9.262   7.945   -3.391  1.00 0.42  ? 1111 ASP A O    8  
ATOM   4565  C  CB   . ASP A 1 9  ? 12.240  9.037   -4.258  1.00 0.51  ? 1111 ASP A CB   8  
ATOM   4566  C  CG   . ASP A 1 9  ? 13.724  9.166   -3.999  1.00 1.37  ? 1111 ASP A CG   8  
ATOM   4567  O  OD1  . ASP A 1 9  ? 14.109  9.721   -2.948  1.00 1.53  ? 1111 ASP A OD1  8  
ATOM   4568  O  OD2  . ASP A 1 9  ? 14.517  8.699   -4.845  1.00 2.32  ? 1111 ASP A OD2  8  
ATOM   4569  H  H    . ASP A 1 9  ? 13.185  6.705   -4.657  1.00 0.40  ? 1111 ASP A H    8  
ATOM   4570  H  HA   . ASP A 1 9  ? 11.670  7.837   -2.573  1.00 0.44  ? 1111 ASP A HA   8  
ATOM   4571  H  HB2  . ASP A 1 9  ? 12.079  9.026   -5.326  1.00 0.94  ? 1111 ASP A HB2  8  
ATOM   4572  H  HB3  . ASP A 1 9  ? 11.742  9.896   -3.833  1.00 1.01  ? 1111 ASP A HB3  8  
ATOM   4573  N  N    . THR A 1 10 ? 10.047  7.059   -5.305  1.00 0.28  ? 1112 THR A N    8  
ATOM   4574  C  CA   . THR A 1 10 ? 8.737   6.838   -5.886  1.00 0.31  ? 1112 THR A CA   8  
ATOM   4575  C  C    . THR A 1 10 ? 8.257   5.403   -5.660  1.00 0.24  ? 1112 THR A C    8  
ATOM   4576  O  O    . THR A 1 10 ? 7.227   4.989   -6.193  1.00 0.30  ? 1112 THR A O    8  
ATOM   4577  C  CB   . THR A 1 10 ? 8.767   7.143   -7.390  1.00 0.42  ? 1112 THR A CB   8  
ATOM   4578  O  OG1  . THR A 1 10 ? 9.924   6.538   -7.979  1.00 0.45  ? 1112 THR A OG1  8  
ATOM   4579  C  CG2  . THR A 1 10 ? 8.790   8.643   -7.643  1.00 0.52  ? 1112 THR A CG2  8  
ATOM   4580  H  H    . THR A 1 10 ? 10.840  6.809   -5.824  1.00 0.31  ? 1112 THR A H    8  
ATOM   4581  H  HA   . THR A 1 10 ? 8.044   7.518   -5.417  1.00 0.36  ? 1112 THR A HA   8  
ATOM   4582  H  HB   . THR A 1 10 ? 7.881   6.728   -7.846  1.00 0.48  ? 1112 THR A HB   8  
ATOM   4583  H  HG1  . THR A 1 10 ? 9.685   6.163   -8.837  1.00 0.95  ? 1112 THR A HG1  8  
ATOM   4584  H  HG21 . THR A 1 10 ? 8.810   8.828   -8.706  1.00 1.19  ? 1112 THR A HG21 8  
ATOM   4585  H  HG22 . THR A 1 10 ? 9.671   9.073   -7.186  1.00 1.09  ? 1112 THR A HG22 8  
ATOM   4586  H  HG23 . THR A 1 10 ? 7.907   9.093   -7.215  1.00 1.17  ? 1112 THR A HG23 8  
ATOM   4587  N  N    . GLN A 1 11 ? 9.009   4.640   -4.875  1.00 0.18  ? 1113 GLN A N    8  
ATOM   4588  C  CA   . GLN A 1 11 ? 8.598   3.297   -4.502  1.00 0.17  ? 1113 GLN A CA   8  
ATOM   4589  C  C    . GLN A 1 11 ? 7.994   3.271   -3.104  1.00 0.17  ? 1113 GLN A C    8  
ATOM   4590  O  O    . GLN A 1 11 ? 8.210   4.179   -2.300  1.00 0.23  ? 1113 GLN A O    8  
ATOM   4591  C  CB   . GLN A 1 11 ? 9.780   2.338   -4.556  1.00 0.17  ? 1113 GLN A CB   8  
ATOM   4592  C  CG   . GLN A 1 11 ? 10.079  1.798   -5.942  1.00 0.23  ? 1113 GLN A CG   8  
ATOM   4593  C  CD   . GLN A 1 11 ? 11.208  0.788   -5.917  1.00 0.35  ? 1113 GLN A CD   8  
ATOM   4594  O  OE1  . GLN A 1 11 ? 11.462  0.170   -4.896  1.00 1.02  ? 1113 GLN A OE1  8  
ATOM   4595  N  NE2  . GLN A 1 11 ? 11.879  0.596   -7.036  1.00 0.67  ? 1113 GLN A NE2  8  
ATOM   4596  H  H    . GLN A 1 11 ? 9.867   4.984   -4.545  1.00 0.20  ? 1113 GLN A H    8  
ATOM   4597  H  HA   . GLN A 1 11 ? 7.851   2.973   -5.210  1.00 0.22  ? 1113 GLN A HA   8  
ATOM   4598  H  HB2  . GLN A 1 11 ? 10.657  2.851   -4.197  1.00 0.16  ? 1113 GLN A HB2  8  
ATOM   4599  H  HB3  . GLN A 1 11 ? 9.576   1.504   -3.903  1.00 0.20  ? 1113 GLN A HB3  8  
ATOM   4600  H  HG2  . GLN A 1 11 ? 9.195   1.329   -6.330  1.00 0.31  ? 1113 GLN A HG2  8  
ATOM   4601  H  HG3  . GLN A 1 11 ? 10.362  2.617   -6.584  1.00 0.22  ? 1113 GLN A HG3  8  
ATOM   4602  H  HE21 . GLN A 1 11 ? 11.622  1.111   -7.830  1.00 1.21  ? 1113 GLN A HE21 8  
ATOM   4603  H  HE22 . GLN A 1 11 ? 12.603  -0.072  -7.029  1.00 0.65  ? 1113 GLN A HE22 8  
ATOM   4604  N  N    . TYR A 1 12 ? 7.245   2.219   -2.830  1.00 0.15  ? 1114 TYR A N    8  
ATOM   4605  C  CA   . TYR A 1 12 ? 6.620   2.018   -1.535  1.00 0.16  ? 1114 TYR A CA   8  
ATOM   4606  C  C    . TYR A 1 12 ? 7.226   0.802   -0.846  1.00 0.15  ? 1114 TYR A C    8  
ATOM   4607  O  O    . TYR A 1 12 ? 7.735   -0.104  -1.506  1.00 0.15  ? 1114 TYR A O    8  
ATOM   4608  C  CB   . TYR A 1 12 ? 5.112   1.820   -1.704  1.00 0.18  ? 1114 TYR A CB   8  
ATOM   4609  C  CG   . TYR A 1 12 ? 4.359   1.637   -0.400  1.00 0.22  ? 1114 TYR A CG   8  
ATOM   4610  C  CD1  . TYR A 1 12 ? 4.266   2.667   0.526   1.00 0.33  ? 1114 TYR A CD1  8  
ATOM   4611  C  CD2  . TYR A 1 12 ? 3.751   0.423   -0.097  1.00 0.21  ? 1114 TYR A CD2  8  
ATOM   4612  C  CE1  . TYR A 1 12 ? 3.588   2.494   1.717   1.00 0.39  ? 1114 TYR A CE1  8  
ATOM   4613  C  CE2  . TYR A 1 12 ? 3.069   0.244   1.091   1.00 0.26  ? 1114 TYR A CE2  8  
ATOM   4614  C  CZ   . TYR A 1 12 ? 2.993   1.281   1.995   1.00 0.34  ? 1114 TYR A CZ   8  
ATOM   4615  O  OH   . TYR A 1 12 ? 2.325   1.107   3.187   1.00 0.41  ? 1114 TYR A OH   8  
ATOM   4616  H  H    . TYR A 1 12 ? 7.110   1.539   -3.532  1.00 0.16  ? 1114 TYR A H    8  
ATOM   4617  H  HA   . TYR A 1 12 ? 6.801   2.895   -0.932  1.00 0.18  ? 1114 TYR A HA   8  
ATOM   4618  H  HB2  . TYR A 1 12 ? 4.694   2.673   -2.214  1.00 0.23  ? 1114 TYR A HB2  8  
ATOM   4619  H  HB3  . TYR A 1 12 ? 4.949   0.938   -2.299  1.00 0.18  ? 1114 TYR A HB3  8  
ATOM   4620  H  HD1  . TYR A 1 12 ? 4.732   3.616   0.306   1.00 0.40  ? 1114 TYR A HD1  8  
ATOM   4621  H  HD2  . TYR A 1 12 ? 3.815   -0.388  -0.808  1.00 0.23  ? 1114 TYR A HD2  8  
ATOM   4622  H  HE1  . TYR A 1 12 ? 3.525   3.307   2.424   1.00 0.50  ? 1114 TYR A HE1  8  
ATOM   4623  H  HE2  . TYR A 1 12 ? 2.602   -0.708  1.307   1.00 0.29  ? 1114 TYR A HE2  8  
ATOM   4624  H  HH   . TYR A 1 12 ? 1.806   1.898   3.381   1.00 0.89  ? 1114 TYR A HH   8  
ATOM   4625  N  N    . THR A 1 13 ? 7.165   0.794   0.471   1.00 0.18  ? 1115 THR A N    8  
ATOM   4626  C  CA   . THR A 1 13 ? 7.657   -0.320  1.261   1.00 0.20  ? 1115 THR A CA   8  
ATOM   4627  C  C    . THR A 1 13 ? 6.486   -1.066  1.895   1.00 0.23  ? 1115 THR A C    8  
ATOM   4628  O  O    . THR A 1 13 ? 5.845   -0.561  2.818   1.00 0.31  ? 1115 THR A O    8  
ATOM   4629  C  CB   . THR A 1 13 ? 8.604   0.164   2.372   1.00 0.26  ? 1115 THR A CB   8  
ATOM   4630  O  OG1  . THR A 1 13 ? 9.534   1.118   1.840   1.00 0.30  ? 1115 THR A OG1  8  
ATOM   4631  C  CG2  . THR A 1 13 ? 9.366   -1.004  2.986   1.00 0.27  ? 1115 THR A CG2  8  
ATOM   4632  H  H    . THR A 1 13 ? 6.765   1.561   0.929   1.00 0.22  ? 1115 THR A H    8  
ATOM   4633  H  HA   . THR A 1 13 ? 8.197   -0.991  0.609   1.00 0.19  ? 1115 THR A HA   8  
ATOM   4634  H  HB   . THR A 1 13 ? 8.016   0.637   3.144   1.00 0.31  ? 1115 THR A HB   8  
ATOM   4635  H  HG1  . THR A 1 13 ? 9.523   1.068   0.877   1.00 0.82  ? 1115 THR A HG1  8  
ATOM   4636  H  HG21 . THR A 1 13 ? 10.013  -0.640  3.770   1.00 1.01  ? 1115 THR A HG21 8  
ATOM   4637  H  HG22 . THR A 1 13 ? 9.960   -1.487  2.224   1.00 1.02  ? 1115 THR A HG22 8  
ATOM   4638  H  HG23 . THR A 1 13 ? 8.664   -1.713  3.399   1.00 1.10  ? 1115 THR A HG23 8  
ATOM   4639  N  N    . CYS A 1 14 ? 6.194   -2.253  1.383   1.00 0.26  ? 1116 CYS A N    8  
ATOM   4640  C  CA   . CYS A 1 14 ? 5.092   -3.057  1.900   1.00 0.34  ? 1116 CYS A CA   8  
ATOM   4641  C  C    . CYS A 1 14 ? 5.455   -3.717  3.231   1.00 0.40  ? 1116 CYS A C    8  
ATOM   4642  O  O    . CYS A 1 14 ? 6.594   -3.609  3.690   1.00 0.37  ? 1116 CYS A O    8  
ATOM   4643  C  CB   . CYS A 1 14 ? 4.689   -4.115  0.872   1.00 0.45  ? 1116 CYS A CB   8  
ATOM   4644  S  SG   . CYS A 1 14 ? 3.912   -3.426  -0.623  1.00 0.65  ? 1116 CYS A SG   8  
ATOM   4645  H  H    . CYS A 1 14 ? 6.726   -2.593  0.629   1.00 0.28  ? 1116 CYS A H    8  
ATOM   4646  H  HA   . CYS A 1 14 ? 4.254   -2.396  2.063   1.00 0.38  ? 1116 CYS A HA   8  
ATOM   4647  H  HB2  . CYS A 1 14 ? 5.570   -4.658  0.563   1.00 0.50  ? 1116 CYS A HB2  8  
ATOM   4648  H  HB3  . CYS A 1 14 ? 3.993   -4.802  1.324   1.00 0.54  ? 1116 CYS A HB3  8  
ATOM   4649  N  N    . ASP A 1 15 ? 4.500   -4.409  3.845   1.00 0.56  ? 1117 ASP A N    8  
ATOM   4650  C  CA   . ASP A 1 15 ? 4.731   -5.062  5.137   1.00 0.69  ? 1117 ASP A CA   8  
ATOM   4651  C  C    . ASP A 1 15 ? 5.807   -6.138  5.012   1.00 0.65  ? 1117 ASP A C    8  
ATOM   4652  O  O    . ASP A 1 15 ? 6.538   -6.421  5.961   1.00 0.71  ? 1117 ASP A O    8  
ATOM   4653  C  CB   . ASP A 1 15 ? 3.434   -5.680  5.681   1.00 0.93  ? 1117 ASP A CB   8  
ATOM   4654  C  CG   . ASP A 1 15 ? 3.060   -6.987  5.003   1.00 1.83  ? 1117 ASP A CG   8  
ATOM   4655  O  OD1  . ASP A 1 15 ? 2.804   -6.975  3.782   1.00 2.09  ? 1117 ASP A OD1  8  
ATOM   4656  O  OD2  . ASP A 1 15 ? 3.034   -8.031  5.687   1.00 2.62  ? 1117 ASP A OD2  8  
ATOM   4657  H  H    . ASP A 1 15 ? 3.612   -4.477  3.426   1.00 0.63  ? 1117 ASP A H    8  
ATOM   4658  H  HA   . ASP A 1 15 ? 5.077   -4.309  5.829   1.00 0.70  ? 1117 ASP A HA   8  
ATOM   4659  H  HB2  . ASP A 1 15 ? 3.551   -5.868  6.737   1.00 1.35  ? 1117 ASP A HB2  8  
ATOM   4660  H  HB3  . ASP A 1 15 ? 2.626   -4.978  5.536   1.00 0.70  ? 1117 ASP A HB3  8  
ATOM   4661  N  N    . ASN A 1 16 ? 5.917   -6.710  3.822   1.00 0.69  ? 1118 ASN A N    8  
ATOM   4662  C  CA   . ASN A 1 16 ? 6.913   -7.736  3.544   1.00 0.75  ? 1118 ASN A CA   8  
ATOM   4663  C  C    . ASN A 1 16 ? 8.263   -7.094  3.218   1.00 0.59  ? 1118 ASN A C    8  
ATOM   4664  O  O    . ASN A 1 16 ? 9.201   -7.768  2.797   1.00 0.65  ? 1118 ASN A O    8  
ATOM   4665  C  CB   . ASN A 1 16 ? 6.440   -8.602  2.380   1.00 0.98  ? 1118 ASN A CB   8  
ATOM   4666  C  CG   . ASN A 1 16 ? 7.191   -9.918  2.263   1.00 1.77  ? 1118 ASN A CG   8  
ATOM   4667  O  OD1  . ASN A 1 16 ? 8.208   -10.010 1.578   1.00 2.75  ? 1118 ASN A OD1  8  
ATOM   4668  N  ND2  . ASN A 1 16 ? 6.683   -10.950 2.919   1.00 2.02  ? 1118 ASN A ND2  8  
ATOM   4669  H  H    . ASN A 1 16 ? 5.294   -6.448  3.112   1.00 0.75  ? 1118 ASN A H    8  
ATOM   4670  H  HA   . ASN A 1 16 ? 7.016   -8.349  4.417   1.00 0.85  ? 1118 ASN A HA   8  
ATOM   4671  H  HB2  . ASN A 1 16 ? 5.391   -8.821  2.507   1.00 1.24  ? 1118 ASN A HB2  8  
ATOM   4672  H  HB3  . ASN A 1 16 ? 6.578   -8.052  1.470   1.00 1.41  ? 1118 ASN A HB3  8  
ATOM   4673  H  HD21 . ASN A 1 16 ? 5.859   -10.812 3.437   1.00 1.91  ? 1118 ASN A HD21 8  
ATOM   4674  H  HD22 . ASN A 1 16 ? 7.146   -11.810 2.860   1.00 2.74  ? 1118 ASN A HD22 8  
ATOM   4675  N  N    . HIS A 1 17 ? 8.350   -5.779  3.432   1.00 0.46  ? 1119 HIS A N    8  
ATOM   4676  C  CA   . HIS A 1 17 ? 9.542   -5.000  3.092   1.00 0.41  ? 1119 HIS A CA   8  
ATOM   4677  C  C    . HIS A 1 17 ? 9.786   -5.035  1.590   1.00 0.44  ? 1119 HIS A C    8  
ATOM   4678  O  O    . HIS A 1 17 ? 10.914  -4.883  1.122   1.00 0.79  ? 1119 HIS A O    8  
ATOM   4679  C  CB   . HIS A 1 17 ? 10.778  -5.503  3.850   1.00 0.51  ? 1119 HIS A CB   8  
ATOM   4680  C  CG   . HIS A 1 17 ? 10.762  -5.180  5.312   1.00 0.63  ? 1119 HIS A CG   8  
ATOM   4681  N  ND1  . HIS A 1 17 ? 10.320  -6.058  6.278   1.00 0.94  ? 1119 HIS A ND1  8  
ATOM   4682  C  CD2  . HIS A 1 17 ? 11.143  -4.062  5.971   1.00 0.78  ? 1119 HIS A CD2  8  
ATOM   4683  C  CE1  . HIS A 1 17 ? 10.429  -5.493  7.465   1.00 1.05  ? 1119 HIS A CE1  8  
ATOM   4684  N  NE2  . HIS A 1 17 ? 10.928  -4.281  7.308   1.00 0.93  ? 1119 HIS A NE2  8  
ATOM   4685  H  H    . HIS A 1 17 ? 7.584   -5.317  3.835   1.00 0.47  ? 1119 HIS A H    8  
ATOM   4686  H  HA   . HIS A 1 17 ? 9.351   -3.977  3.382   1.00 0.38  ? 1119 HIS A HA   8  
ATOM   4687  H  HB2  . HIS A 1 17 ? 10.840  -6.577  3.749   1.00 0.60  ? 1119 HIS A HB2  8  
ATOM   4688  H  HB3  . HIS A 1 17 ? 11.661  -5.056  3.419   1.00 0.55  ? 1119 HIS A HB3  8  
ATOM   4689  H  HD1  . HIS A 1 17 ? 9.977   -6.965  6.118   1.00 1.18  ? 1119 HIS A HD1  8  
ATOM   4690  H  HD2  . HIS A 1 17 ? 11.543  -3.161  5.526   1.00 1.00  ? 1119 HIS A HD2  8  
ATOM   4691  H  HE1  . HIS A 1 17 ? 10.156  -5.944  8.406   1.00 1.35  ? 1119 HIS A HE1  8  
ATOM   4692  H  HE2  . HIS A 1 17 ? 11.317  -3.740  8.032   1.00 1.09  ? 1119 HIS A HE2  8  
ATOM   4693  N  N    . GLN A 1 18 ? 8.706   -5.227  0.844   1.00 0.40  ? 1120 GLN A N    8  
ATOM   4694  C  CA   . GLN A 1 18 ? 8.776   -5.301  -0.605  1.00 0.38  ? 1120 GLN A CA   8  
ATOM   4695  C  C    . GLN A 1 18 ? 8.706   -3.902  -1.201  1.00 0.29  ? 1120 GLN A C    8  
ATOM   4696  O  O    . GLN A 1 18 ? 7.837   -3.111  -0.831  1.00 0.39  ? 1120 GLN A O    8  
ATOM   4697  C  CB   . GLN A 1 18 ? 7.629   -6.166  -1.138  1.00 0.49  ? 1120 GLN A CB   8  
ATOM   4698  C  CG   . GLN A 1 18 ? 7.647   -6.372  -2.646  1.00 0.50  ? 1120 GLN A CG   8  
ATOM   4699  C  CD   . GLN A 1 18 ? 8.809   -7.227  -3.121  1.00 1.05  ? 1120 GLN A CD   8  
ATOM   4700  O  OE1  . GLN A 1 18 ? 9.895   -7.217  -2.537  1.00 1.91  ? 1120 GLN A OE1  8  
ATOM   4701  N  NE2  . GLN A 1 18 ? 8.586   -7.977  -4.185  1.00 1.51  ? 1120 GLN A NE2  8  
ATOM   4702  H  H    . GLN A 1 18 ? 7.834   -5.315  1.281   1.00 0.63  ? 1120 GLN A H    8  
ATOM   4703  H  HA   . GLN A 1 18 ? 9.720   -5.754  -0.874  1.00 0.42  ? 1120 GLN A HA   8  
ATOM   4704  H  HB2  . GLN A 1 18 ? 7.678   -7.136  -0.666  1.00 0.62  ? 1120 GLN A HB2  8  
ATOM   4705  H  HB3  . GLN A 1 18 ? 6.692   -5.699  -0.873  1.00 0.52  ? 1120 GLN A HB3  8  
ATOM   4706  H  HG2  . GLN A 1 18 ? 6.726   -6.853  -2.939  1.00 0.87  ? 1120 GLN A HG2  8  
ATOM   4707  H  HG3  . GLN A 1 18 ? 7.713   -5.405  -3.125  1.00 0.86  ? 1120 GLN A HG3  8  
ATOM   4708  H  HE21 . GLN A 1 18 ? 7.695   -7.938  -4.601  1.00 1.83  ? 1120 GLN A HE21 8  
ATOM   4709  H  HE22 . GLN A 1 18 ? 9.312   -8.545  -4.513  1.00 1.99  ? 1120 GLN A HE22 8  
ATOM   4710  N  N    . CYS A 1 19 ? 9.628   -3.598  -2.101  1.00 0.21  ? 1121 CYS A N    8  
ATOM   4711  C  CA   . CYS A 1 19 ? 9.667   -2.294  -2.739  1.00 0.21  ? 1121 CYS A CA   8  
ATOM   4712  C  C    . CYS A 1 19 ? 8.927   -2.316  -4.074  1.00 0.20  ? 1121 CYS A C    8  
ATOM   4713  O  O    . CYS A 1 19 ? 9.441   -2.818  -5.077  1.00 0.34  ? 1121 CYS A O    8  
ATOM   4714  C  CB   . CYS A 1 19 ? 11.115  -1.847  -2.949  1.00 0.34  ? 1121 CYS A CB   8  
ATOM   4715  S  SG   . CYS A 1 19 ? 12.119  -1.799  -1.426  1.00 0.42  ? 1121 CYS A SG   8  
ATOM   4716  H  H    . CYS A 1 19 ? 10.307  -4.265  -2.337  1.00 0.29  ? 1121 CYS A H    8  
ATOM   4717  H  HA   . CYS A 1 19 ? 9.176   -1.590  -2.082  1.00 0.24  ? 1121 CYS A HA   8  
ATOM   4718  H  HB2  . CYS A 1 19 ? 11.600  -2.518  -3.646  1.00 0.39  ? 1121 CYS A HB2  8  
ATOM   4719  H  HB3  . CYS A 1 19 ? 11.113  -0.852  -3.368  1.00 0.41  ? 1121 CYS A HB3  8  
ATOM   4720  N  N    . ILE A 1 20 ? 7.712   -1.787  -4.076  1.00 0.15  ? 1122 ILE A N    8  
ATOM   4721  C  CA   . ILE A 1 20 ? 6.920   -1.672  -5.296  1.00 0.14  ? 1122 ILE A CA   8  
ATOM   4722  C  C    . ILE A 1 20 ? 6.785   -0.214  -5.699  1.00 0.14  ? 1122 ILE A C    8  
ATOM   4723  O  O    . ILE A 1 20 ? 7.203   0.670   -4.968  1.00 0.18  ? 1122 ILE A O    8  
ATOM   4724  C  CB   . ILE A 1 20 ? 5.508   -2.255  -5.129  1.00 0.14  ? 1122 ILE A CB   8  
ATOM   4725  C  CG1  . ILE A 1 20 ? 4.785   -1.557  -3.976  1.00 0.13  ? 1122 ILE A CG1  8  
ATOM   4726  C  CG2  . ILE A 1 20 ? 5.582   -3.758  -4.909  1.00 0.19  ? 1122 ILE A CG2  8  
ATOM   4727  C  CD1  . ILE A 1 20 ? 3.331   -1.945  -3.852  1.00 0.17  ? 1122 ILE A CD1  8  
ATOM   4728  H  H    . ILE A 1 20 ? 7.338   -1.454  -3.230  1.00 0.22  ? 1122 ILE A H    8  
ATOM   4729  H  HA   . ILE A 1 20 ? 7.422   -2.215  -6.079  1.00 0.17  ? 1122 ILE A HA   8  
ATOM   4730  H  HB   . ILE A 1 20 ? 4.963   -2.079  -6.043  1.00 0.16  ? 1122 ILE A HB   8  
ATOM   4731  H  HG12 . ILE A 1 20 ? 5.275   -1.810  -3.051  1.00 0.15  ? 1122 ILE A HG12 8  
ATOM   4732  H  HG13 . ILE A 1 20 ? 4.833   -0.487  -4.122  1.00 0.14  ? 1122 ILE A HG13 8  
ATOM   4733  H  HG21 . ILE A 1 20 ? 6.181   -3.964  -4.033  1.00 0.98  ? 1122 ILE A HG21 8  
ATOM   4734  H  HG22 . ILE A 1 20 ? 6.032   -4.226  -5.771  1.00 1.05  ? 1122 ILE A HG22 8  
ATOM   4735  H  HG23 . ILE A 1 20 ? 4.586   -4.150  -4.764  1.00 0.97  ? 1122 ILE A HG23 8  
ATOM   4736  H  HD11 . ILE A 1 20 ? 2.814   -1.685  -4.763  1.00 1.07  ? 1122 ILE A HD11 8  
ATOM   4737  H  HD12 . ILE A 1 20 ? 2.888   -1.417  -3.019  1.00 0.99  ? 1122 ILE A HD12 8  
ATOM   4738  H  HD13 . ILE A 1 20 ? 3.257   -3.009  -3.685  1.00 1.03  ? 1122 ILE A HD13 8  
ATOM   4739  N  N    . SER A 1 21 ? 6.197   0.032   -6.854  1.00 0.16  ? 1123 SER A N    8  
ATOM   4740  C  CA   . SER A 1 21 ? 5.924   1.393   -7.287  1.00 0.17  ? 1123 SER A CA   8  
ATOM   4741  C  C    . SER A 1 21 ? 4.788   1.986   -6.462  1.00 0.15  ? 1123 SER A C    8  
ATOM   4742  O  O    . SER A 1 21 ? 3.817   1.297   -6.145  1.00 0.17  ? 1123 SER A O    8  
ATOM   4743  C  CB   . SER A 1 21 ? 5.548   1.406   -8.772  1.00 0.24  ? 1123 SER A CB   8  
ATOM   4744  O  OG   . SER A 1 21 ? 4.938   2.633   -9.143  1.00 0.33  ? 1123 SER A OG   8  
ATOM   4745  H  H    . SER A 1 21 ? 5.933   -0.717  -7.424  1.00 0.20  ? 1123 SER A H    8  
ATOM   4746  H  HA   . SER A 1 21 ? 6.816   1.981   -7.138  1.00 0.19  ? 1123 SER A HA   8  
ATOM   4747  H  HB2  . SER A 1 21 ? 6.438   1.270   -9.367  1.00 0.27  ? 1123 SER A HB2  8  
ATOM   4748  H  HB3  . SER A 1 21 ? 4.857   0.599   -8.972  1.00 0.24  ? 1123 SER A HB3  8  
ATOM   4749  H  HG   . SER A 1 21 ? 4.128   2.449   -9.633  1.00 0.63  ? 1123 SER A HG   8  
ATOM   4750  N  N    . LYS A 1 22 ? 4.905   3.269   -6.123  1.00 0.17  ? 1124 LYS A N    8  
ATOM   4751  C  CA   . LYS A 1 22 ? 3.845   3.967   -5.405  1.00 0.19  ? 1124 LYS A CA   8  
ATOM   4752  C  C    . LYS A 1 22 ? 2.594   4.078   -6.270  1.00 0.22  ? 1124 LYS A C    8  
ATOM   4753  O  O    . LYS A 1 22 ? 1.504   4.348   -5.768  1.00 0.25  ? 1124 LYS A O    8  
ATOM   4754  C  CB   . LYS A 1 22 ? 4.295   5.361   -4.961  1.00 0.23  ? 1124 LYS A CB   8  
ATOM   4755  C  CG   . LYS A 1 22 ? 5.170   5.358   -3.717  1.00 0.25  ? 1124 LYS A CG   8  
ATOM   4756  C  CD   . LYS A 1 22 ? 5.651   6.759   -3.367  1.00 0.25  ? 1124 LYS A CD   8  
ATOM   4757  C  CE   . LYS A 1 22 ? 6.455   6.769   -2.076  1.00 0.30  ? 1124 LYS A CE   8  
ATOM   4758  N  NZ   . LYS A 1 22 ? 7.048   8.105   -1.797  1.00 1.24  ? 1124 LYS A NZ   8  
ATOM   4759  H  H    . LYS A 1 22 ? 5.728   3.758   -6.358  1.00 0.20  ? 1124 LYS A H    8  
ATOM   4760  H  HA   . LYS A 1 22 ? 3.608   3.383   -4.528  1.00 0.19  ? 1124 LYS A HA   8  
ATOM   4761  H  HB2  . LYS A 1 22 ? 4.854   5.817   -5.765  1.00 0.30  ? 1124 LYS A HB2  8  
ATOM   4762  H  HB3  . LYS A 1 22 ? 3.420   5.961   -4.759  1.00 0.30  ? 1124 LYS A HB3  8  
ATOM   4763  H  HG2  . LYS A 1 22 ? 4.599   4.967   -2.888  1.00 0.37  ? 1124 LYS A HG2  8  
ATOM   4764  H  HG3  . LYS A 1 22 ? 6.028   4.727   -3.894  1.00 0.37  ? 1124 LYS A HG3  8  
ATOM   4765  H  HD2  . LYS A 1 22 ? 6.274   7.124   -4.170  1.00 0.32  ? 1124 LYS A HD2  8  
ATOM   4766  H  HD3  . LYS A 1 22 ? 4.793   7.405   -3.253  1.00 0.33  ? 1124 LYS A HD3  8  
ATOM   4767  H  HE2  . LYS A 1 22 ? 5.804   6.497   -1.260  1.00 0.93  ? 1124 LYS A HE2  8  
ATOM   4768  H  HE3  . LYS A 1 22 ? 7.250   6.041   -2.158  1.00 0.95  ? 1124 LYS A HE3  8  
ATOM   4769  H  HZ1  . LYS A 1 22 ? 7.548   8.093   -0.887  1.00 1.76  ? 1124 LYS A HZ1  8  
ATOM   4770  H  HZ2  . LYS A 1 22 ? 6.306   8.830   -1.764  1.00 1.77  ? 1124 LYS A HZ2  8  
ATOM   4771  H  HZ3  . LYS A 1 22 ? 7.728   8.358   -2.547  1.00 1.88  ? 1124 LYS A HZ3  8  
ATOM   4772  N  N    . ASN A 1 23 ? 2.756   3.859   -7.574  1.00 0.24  ? 1125 ASN A N    8  
ATOM   4773  C  CA   . ASN A 1 23 ? 1.623   3.872   -8.491  1.00 0.28  ? 1125 ASN A CA   8  
ATOM   4774  C  C    . ASN A 1 23 ? 0.842   2.571   -8.365  1.00 0.26  ? 1125 ASN A C    8  
ATOM   4775  O  O    . ASN A 1 23 ? -0.344  2.506   -8.687  1.00 0.32  ? 1125 ASN A O    8  
ATOM   4776  C  CB   . ASN A 1 23 ? 2.089   4.059   -9.941  1.00 0.36  ? 1125 ASN A CB   8  
ATOM   4777  C  CG   . ASN A 1 23 ? 2.896   5.327   -10.147 1.00 1.03  ? 1125 ASN A CG   8  
ATOM   4778  O  OD1  . ASN A 1 23 ? 2.343   6.395   -10.402 1.00 1.75  ? 1125 ASN A OD1  8  
ATOM   4779  N  ND2  . ASN A 1 23 ? 4.214   5.217   -10.063 1.00 1.69  ? 1125 ASN A ND2  8  
ATOM   4780  H  H    . ASN A 1 23 ? 3.660   3.691   -7.922  1.00 0.25  ? 1125 ASN A H    8  
ATOM   4781  H  HA   . ASN A 1 23 ? 0.981   4.695   -8.217  1.00 0.31  ? 1125 ASN A HA   8  
ATOM   4782  H  HB2  . ASN A 1 23 ? 2.702   3.219   -10.224 1.00 0.82  ? 1125 ASN A HB2  8  
ATOM   4783  H  HB3  . ASN A 1 23 ? 1.223   4.097   -10.586 1.00 0.82  ? 1125 ASN A HB3  8  
ATOM   4784  H  HD21 . ASN A 1 23 ? 4.599   4.330   -9.877  1.00 1.99  ? 1125 ASN A HD21 8  
ATOM   4785  H  HD22 . ASN A 1 23 ? 4.759   6.026   -10.188 1.00 2.22  ? 1125 ASN A HD22 8  
ATOM   4786  N  N    . TRP A 1 24 ? 1.513   1.538   -7.865  1.00 0.22  ? 1126 TRP A N    8  
ATOM   4787  C  CA   . TRP A 1 24 ? 0.902   0.222   -7.723  1.00 0.22  ? 1126 TRP A CA   8  
ATOM   4788  C  C    . TRP A 1 24 ? 0.163   0.119   -6.398  1.00 0.20  ? 1126 TRP A C    8  
ATOM   4789  O  O    . TRP A 1 24 ? -0.568  -0.836  -6.151  1.00 0.26  ? 1126 TRP A O    8  
ATOM   4790  C  CB   . TRP A 1 24 ? 1.962   -0.880  -7.810  1.00 0.25  ? 1126 TRP A CB   8  
ATOM   4791  C  CG   . TRP A 1 24 ? 2.654   -0.963  -9.139  1.00 0.31  ? 1126 TRP A CG   8  
ATOM   4792  C  CD1  . TRP A 1 24 ? 2.346   -0.270  -10.276 1.00 0.37  ? 1126 TRP A CD1  8  
ATOM   4793  C  CD2  . TRP A 1 24 ? 3.771   -1.797  -9.470  1.00 0.38  ? 1126 TRP A CD2  8  
ATOM   4794  N  NE1  . TRP A 1 24 ? 3.207   -0.617  -11.287 1.00 0.45  ? 1126 TRP A NE1  8  
ATOM   4795  C  CE2  . TRP A 1 24 ? 4.090   -1.554  -10.819 1.00 0.45  ? 1126 TRP A CE2  8  
ATOM   4796  C  CE3  . TRP A 1 24 ? 4.533   -2.726  -8.756  1.00 0.44  ? 1126 TRP A CE3  8  
ATOM   4797  C  CZ2  . TRP A 1 24 ? 5.140   -2.204  -11.465 1.00 0.54  ? 1126 TRP A CZ2  8  
ATOM   4798  C  CZ3  . TRP A 1 24 ? 5.573   -3.370  -9.397  1.00 0.55  ? 1126 TRP A CZ3  8  
ATOM   4799  C  CH2  . TRP A 1 24 ? 5.868   -3.105  -10.741 1.00 0.58  ? 1126 TRP A CH2  8  
ATOM   4800  H  H    . TRP A 1 24 ? 2.440   1.667   -7.569  1.00 0.23  ? 1126 TRP A H    8  
ATOM   4801  H  HA   . TRP A 1 24 ? 0.194   0.094   -8.529  1.00 0.25  ? 1126 TRP A HA   8  
ATOM   4802  H  HB2  . TRP A 1 24 ? 2.714   -0.708  -7.054  1.00 0.27  ? 1126 TRP A HB2  8  
ATOM   4803  H  HB3  . TRP A 1 24 ? 1.488   -1.828  -7.619  1.00 0.28  ? 1126 TRP A HB3  8  
ATOM   4804  H  HD1  . TRP A 1 24 ? 1.543   0.447   -10.351 1.00 0.40  ? 1126 TRP A HD1  8  
ATOM   4805  H  HE1  . TRP A 1 24 ? 3.193   -0.254  -12.198 1.00 0.53  ? 1126 TRP A HE1  8  
ATOM   4806  H  HE3  . TRP A 1 24 ? 4.320   -2.943  -7.719  1.00 0.45  ? 1126 TRP A HE3  8  
ATOM   4807  H  HZ2  . TRP A 1 24 ? 5.379   -2.011  -12.500 1.00 0.61  ? 1126 TRP A HZ2  8  
ATOM   4808  H  HZ3  . TRP A 1 24 ? 6.173   -4.089  -8.860  1.00 0.62  ? 1126 TRP A HZ3  8  
ATOM   4809  H  HH2  . TRP A 1 24 ? 6.690   -3.633  -11.202 1.00 0.67  ? 1126 TRP A HH2  8  
ATOM   4810  N  N    . VAL A 1 25 ? 0.371   1.104   -5.545  1.00 0.19  ? 1127 VAL A N    8  
ATOM   4811  C  CA   . VAL A 1 25 ? -0.293  1.151   -4.252  1.00 0.18  ? 1127 VAL A CA   8  
ATOM   4812  C  C    . VAL A 1 25 ? -1.781  1.432   -4.421  1.00 0.19  ? 1127 VAL A C    8  
ATOM   4813  O  O    . VAL A 1 25 ? -2.164  2.443   -5.016  1.00 0.23  ? 1127 VAL A O    8  
ATOM   4814  C  CB   . VAL A 1 25 ? 0.338   2.229   -3.342  1.00 0.21  ? 1127 VAL A CB   8  
ATOM   4815  C  CG1  . VAL A 1 25 ? -0.383  2.314   -2.004  1.00 0.24  ? 1127 VAL A CG1  8  
ATOM   4816  C  CG2  . VAL A 1 25 ? 1.816   1.947   -3.134  1.00 0.24  ? 1127 VAL A CG2  8  
ATOM   4817  H  H    . VAL A 1 25 ? 0.992   1.816   -5.791  1.00 0.21  ? 1127 VAL A H    8  
ATOM   4818  H  HA   . VAL A 1 25 ? -0.173  0.187   -3.778  1.00 0.19  ? 1127 VAL A HA   8  
ATOM   4819  H  HB   . VAL A 1 25 ? 0.244   3.185   -3.836  1.00 0.23  ? 1127 VAL A HB   8  
ATOM   4820  H  HG11 . VAL A 1 25 ? -1.421  2.561   -2.169  1.00 1.01  ? 1127 VAL A HG11 8  
ATOM   4821  H  HG12 . VAL A 1 25 ? 0.076   3.077   -1.394  1.00 1.02  ? 1127 VAL A HG12 8  
ATOM   4822  H  HG13 . VAL A 1 25 ? -0.317  1.362   -1.499  1.00 1.00  ? 1127 VAL A HG13 8  
ATOM   4823  H  HG21 . VAL A 1 25 ? 2.261   2.753   -2.569  1.00 1.05  ? 1127 VAL A HG21 8  
ATOM   4824  H  HG22 . VAL A 1 25 ? 2.306   1.864   -4.092  1.00 1.06  ? 1127 VAL A HG22 8  
ATOM   4825  H  HG23 . VAL A 1 25 ? 1.933   1.021   -2.589  1.00 1.01  ? 1127 VAL A HG23 8  
ATOM   4826  N  N    . CYS A 1 26 ? -2.605  0.515   -3.918  1.00 0.19  ? 1128 CYS A N    8  
ATOM   4827  C  CA   . CYS A 1 26 ? -4.058  0.654   -3.972  1.00 0.26  ? 1128 CYS A CA   8  
ATOM   4828  C  C    . CYS A 1 26 ? -4.536  0.636   -5.422  1.00 0.27  ? 1128 CYS A C    8  
ATOM   4829  O  O    . CYS A 1 26 ? -5.300  1.500   -5.862  1.00 0.37  ? 1128 CYS A O    8  
ATOM   4830  C  CB   . CYS A 1 26 ? -4.499  1.944   -3.269  1.00 0.32  ? 1128 CYS A CB   8  
ATOM   4831  S  SG   . CYS A 1 26 ? -6.299  2.094   -3.010  1.00 0.58  ? 1128 CYS A SG   8  
ATOM   4832  H  H    . CYS A 1 26 ? -2.219  -0.290  -3.505  1.00 0.19  ? 1128 CYS A H    8  
ATOM   4833  H  HA   . CYS A 1 26 ? -4.488  -0.193  -3.457  1.00 0.28  ? 1128 CYS A HA   8  
ATOM   4834  H  HB2  . CYS A 1 26 ? -4.026  1.993   -2.301  1.00 0.36  ? 1128 CYS A HB2  8  
ATOM   4835  H  HB3  . CYS A 1 26 ? -4.182  2.790   -3.858  1.00 0.36  ? 1128 CYS A HB3  8  
ATOM   4836  N  N    . ASP A 1 27 ? -4.072  -0.356  -6.164  1.00 0.25  ? 1129 ASP A N    8  
ATOM   4837  C  CA   . ASP A 1 27 ? -4.418  -0.481  -7.573  1.00 0.30  ? 1129 ASP A CA   8  
ATOM   4838  C  C    . ASP A 1 27 ? -5.251  -1.736  -7.804  1.00 0.37  ? 1129 ASP A C    8  
ATOM   4839  O  O    . ASP A 1 27 ? -5.421  -2.178  -8.937  1.00 0.41  ? 1129 ASP A O    8  
ATOM   4840  C  CB   . ASP A 1 27 ? -3.151  -0.530  -8.432  1.00 0.31  ? 1129 ASP A CB   8  
ATOM   4841  C  CG   . ASP A 1 27 ? -2.492  -1.897  -8.429  1.00 0.35  ? 1129 ASP A CG   8  
ATOM   4842  O  OD1  . ASP A 1 27 ? -2.339  -2.496  -7.337  1.00 0.31  ? 1129 ASP A OD1  8  
ATOM   4843  O  OD2  . ASP A 1 27 ? -2.122  -2.374  -9.523  1.00 0.46  ? 1129 ASP A OD2  8  
ATOM   4844  H  H    . ASP A 1 27 ? -3.480  -1.028  -5.749  1.00 0.24  ? 1129 ASP A H    8  
ATOM   4845  H  HA   . ASP A 1 27 ? -5.002  0.383   -7.852  1.00 0.33  ? 1129 ASP A HA   8  
ATOM   4846  H  HB2  . ASP A 1 27 ? -3.405  -0.279  -9.450  1.00 0.36  ? 1129 ASP A HB2  8  
ATOM   4847  H  HB3  . ASP A 1 27 ? -2.441  0.192   -8.055  1.00 0.29  ? 1129 ASP A HB3  8  
ATOM   4848  N  N    . THR A 1 28 ? -5.759  -2.296  -6.709  1.00 0.45  ? 1130 THR A N    8  
ATOM   4849  C  CA   . THR A 1 28 ? -6.558  -3.526  -6.713  1.00 0.56  ? 1130 THR A CA   8  
ATOM   4850  C  C    . THR A 1 28 ? -5.805  -4.701  -7.343  1.00 0.61  ? 1130 THR A C    8  
ATOM   4851  O  O    . THR A 1 28 ? -6.409  -5.604  -7.924  1.00 0.73  ? 1130 THR A O    8  
ATOM   4852  C  CB   . THR A 1 28 ? -7.951  -3.356  -7.384  1.00 0.59  ? 1130 THR A CB   8  
ATOM   4853  O  OG1  . THR A 1 28 ? -7.837  -3.031  -8.777  1.00 0.56  ? 1130 THR A OG1  8  
ATOM   4854  C  CG2  . THR A 1 28 ? -8.754  -2.275  -6.680  1.00 0.65  ? 1130 THR A CG2  8  
ATOM   4855  H  H    . THR A 1 28 ? -5.578  -1.866  -5.842  1.00 0.46  ? 1130 THR A H    8  
ATOM   4856  H  HA   . THR A 1 28 ? -6.734  -3.776  -5.676  1.00 0.64  ? 1130 THR A HA   8  
ATOM   4857  H  HB   . THR A 1 28 ? -8.487  -4.288  -7.291  1.00 0.67  ? 1130 THR A HB   8  
ATOM   4858  H  HG1  . THR A 1 28 ? -7.055  -2.480  -8.914  1.00 0.53  ? 1130 THR A HG1  8  
ATOM   4859  H  HG21 . THR A 1 28 ? -8.865  -2.533  -5.637  1.00 1.34  ? 1130 THR A HG21 8  
ATOM   4860  H  HG22 . THR A 1 28 ? -9.731  -2.196  -7.135  1.00 1.09  ? 1130 THR A HG22 8  
ATOM   4861  H  HG23 . THR A 1 28 ? -8.240  -1.330  -6.766  1.00 1.21  ? 1130 THR A HG23 8  
ATOM   4862  N  N    . ASP A 1 29 ? -4.481  -4.683  -7.223  1.00 0.59  ? 1131 ASP A N    8  
ATOM   4863  C  CA   . ASP A 1 29 ? -3.655  -5.794  -7.676  1.00 0.69  ? 1131 ASP A CA   8  
ATOM   4864  C  C    . ASP A 1 29 ? -2.632  -6.151  -6.607  1.00 0.67  ? 1131 ASP A C    8  
ATOM   4865  O  O    . ASP A 1 29 ? -2.068  -5.264  -5.949  1.00 0.53  ? 1131 ASP A O    8  
ATOM   4866  C  CB   . ASP A 1 29 ? -2.940  -5.446  -8.982  1.00 0.75  ? 1131 ASP A CB   8  
ATOM   4867  C  CG   . ASP A 1 29 ? -2.238  -6.642  -9.597  1.00 0.92  ? 1131 ASP A CG   8  
ATOM   4868  O  OD1  . ASP A 1 29 ? -1.105  -6.956  -9.175  1.00 0.92  ? 1131 ASP A OD1  8  
ATOM   4869  O  OD2  . ASP A 1 29 ? -2.807  -7.277  -10.506 1.00 1.21  ? 1131 ASP A OD2  8  
ATOM   4870  H  H    . ASP A 1 29 ? -4.046  -3.899  -6.827  1.00 0.55  ? 1131 ASP A H    8  
ATOM   4871  H  HA   . ASP A 1 29 ? -4.301  -6.644  -7.841  1.00 0.81  ? 1131 ASP A HA   8  
ATOM   4872  H  HB2  . ASP A 1 29 ? -3.662  -5.070  -9.686  1.00 0.81  ? 1131 ASP A HB2  8  
ATOM   4873  H  HB3  . ASP A 1 29 ? -2.203  -4.680  -8.786  1.00 0.68  ? 1131 ASP A HB3  8  
ATOM   4874  N  N    . ASN A 1 30 ? -2.398  -7.444  -6.436  1.00 0.94  ? 1132 ASN A N    8  
ATOM   4875  C  CA   . ASN A 1 30 ? -1.463  -7.933  -5.431  1.00 1.00  ? 1132 ASN A CA   8  
ATOM   4876  C  C    . ASN A 1 30 ? -0.032  -7.926  -5.949  1.00 0.91  ? 1132 ASN A C    8  
ATOM   4877  O  O    . ASN A 1 30 ? 0.571   -8.976  -6.181  1.00 1.06  ? 1132 ASN A O    8  
ATOM   4878  C  CB   . ASN A 1 30 ? -1.856  -9.337  -4.963  1.00 1.29  ? 1132 ASN A CB   8  
ATOM   4879  C  CG   . ASN A 1 30 ? -2.998  -9.315  -3.965  1.00 1.72  ? 1132 ASN A CG   8  
ATOM   4880  O  OD1  . ASN A 1 30 ? -4.171  -9.326  -4.342  1.00 2.58  ? 1132 ASN A OD1  8  
ATOM   4881  N  ND2  . ASN A 1 30 ? -2.663  -9.296  -2.683  1.00 2.07  ? 1132 ASN A ND2  8  
ATOM   4882  H  H    . ASN A 1 30 ? -2.862  -8.091  -7.009  1.00 1.15  ? 1132 ASN A H    8  
ATOM   4883  H  HA   . ASN A 1 30 ? -1.520  -7.262  -4.587  1.00 0.97  ? 1132 ASN A HA   8  
ATOM   4884  H  HB2  . ASN A 1 30 ? -2.160  -9.923  -5.817  1.00 1.52  ? 1132 ASN A HB2  8  
ATOM   4885  H  HB3  . ASN A 1 30 ? -1.002  -9.806  -4.496  1.00 1.97  ? 1132 ASN A HB3  8  
ATOM   4886  H  HD21 . ASN A 1 30 ? -1.708  -9.299  -2.453  1.00 2.11  ? 1132 ASN A HD21 8  
ATOM   4887  H  HD22 . ASN A 1 30 ? -3.382  -9.281  -2.015  1.00 2.73  ? 1132 ASN A HD22 8  
ATOM   4888  N  N    . ASP A 1 31 ? 0.489   -6.728  -6.157  1.00 0.86  ? 1133 ASP A N    8  
ATOM   4889  C  CA   . ASP A 1 31 ? 1.906   -6.532  -6.444  1.00 0.77  ? 1133 ASP A CA   8  
ATOM   4890  C  C    . ASP A 1 31 ? 2.719   -6.997  -5.248  1.00 0.78  ? 1133 ASP A C    8  
ATOM   4891  O  O    . ASP A 1 31 ? 3.716   -7.704  -5.397  1.00 1.28  ? 1133 ASP A O    8  
ATOM   4892  C  CB   . ASP A 1 31 ? 2.198   -5.058  -6.752  1.00 0.67  ? 1133 ASP A CB   8  
ATOM   4893  C  CG   . ASP A 1 31 ? 1.105   -4.146  -6.246  1.00 0.58  ? 1133 ASP A CG   8  
ATOM   4894  O  OD1  . ASP A 1 31 ? 0.876   -4.089  -5.030  1.00 1.00  ? 1133 ASP A OD1  8  
ATOM   4895  O  OD2  . ASP A 1 31 ? 0.428   -3.504  -7.064  1.00 1.09  ? 1133 ASP A OD2  8  
ATOM   4896  H  H    . ASP A 1 31 ? -0.099  -5.945  -6.109  1.00 1.05  ? 1133 ASP A H    8  
ATOM   4897  H  HA   . ASP A 1 31 ? 2.162   -7.137  -7.301  1.00 0.87  ? 1133 ASP A HA   8  
ATOM   4898  H  HB2  . ASP A 1 31 ? 3.126   -4.768  -6.279  1.00 1.04  ? 1133 ASP A HB2  8  
ATOM   4899  H  HB3  . ASP A 1 31 ? 2.285   -4.927  -7.819  1.00 1.05  ? 1133 ASP A HB3  8  
ATOM   4900  N  N    . CYS A 1 32 ? 2.280   -6.594  -4.065  1.00 0.76  ? 1134 CYS A N    8  
ATOM   4901  C  CA   . CYS A 1 32 ? 2.808   -7.140  -2.826  1.00 0.78  ? 1134 CYS A CA   8  
ATOM   4902  C  C    . CYS A 1 32 ? 1.918   -8.282  -2.348  1.00 0.85  ? 1134 CYS A C    8  
ATOM   4903  O  O    . CYS A 1 32 ? 0.689   -8.170  -2.396  1.00 1.57  ? 1134 CYS A O    8  
ATOM   4904  C  CB   . CYS A 1 32 ? 2.911   -6.062  -1.747  1.00 0.82  ? 1134 CYS A CB   8  
ATOM   4905  S  SG   . CYS A 1 32 ? 4.233   -4.845  -2.036  1.00 1.16  ? 1134 CYS A SG   8  
ATOM   4906  H  H    . CYS A 1 32 ? 1.585   -5.898  -4.024  1.00 1.11  ? 1134 CYS A H    8  
ATOM   4907  H  HA   . CYS A 1 32 ? 3.794   -7.530  -3.031  1.00 0.88  ? 1134 CYS A HA   8  
ATOM   4908  H  HB2  . CYS A 1 32 ? 1.976   -5.525  -1.696  1.00 1.25  ? 1134 CYS A HB2  8  
ATOM   4909  H  HB3  . CYS A 1 32 ? 3.101   -6.533  -0.796  1.00 1.22  ? 1134 CYS A HB3  8  
ATOM   4910  N  N    . GLY A 1 33 ? 2.534   -9.371  -1.904  1.00 1.17  ? 1135 GLY A N    8  
ATOM   4911  C  CA   . GLY A 1 33 ? 1.798   -10.593 -1.607  1.00 1.22  ? 1135 GLY A CA   8  
ATOM   4912  C  C    . GLY A 1 33 ? 0.618   -10.388 -0.675  1.00 1.18  ? 1135 GLY A C    8  
ATOM   4913  O  O    . GLY A 1 33 ? -0.519  -10.737 -1.011  1.00 1.68  ? 1135 GLY A O    8  
ATOM   4914  H  H    . GLY A 1 33 ? 3.507   -9.348  -1.770  1.00 1.82  ? 1135 GLY A H    8  
ATOM   4915  H  HA2  . GLY A 1 33 ? 1.434   -11.010 -2.534  1.00 1.26  ? 1135 GLY A HA2  8  
ATOM   4916  H  HA3  . GLY A 1 33 ? 2.478   -11.301 -1.154  1.00 1.39  ? 1135 GLY A HA3  8  
ATOM   4917  N  N    . ASP A 1 34 ? 0.879   -9.798  0.485   1.00 1.02  ? 1136 ASP A N    8  
ATOM   4918  C  CA   . ASP A 1 34 ? -0.147  -9.636  1.508   1.00 1.11  ? 1136 ASP A CA   8  
ATOM   4919  C  C    . ASP A 1 34 ? -0.999  -8.399  1.264   1.00 0.93  ? 1136 ASP A C    8  
ATOM   4920  O  O    . ASP A 1 34 ? -1.905  -8.091  2.041   1.00 1.35  ? 1136 ASP A O    8  
ATOM   4921  C  CB   . ASP A 1 34 ? 0.481   -9.572  2.898   1.00 1.44  ? 1136 ASP A CB   8  
ATOM   4922  C  CG   . ASP A 1 34 ? 1.155   -10.872 3.286   1.00 2.10  ? 1136 ASP A CG   8  
ATOM   4923  O  OD1  . ASP A 1 34 ? 0.446   -11.821 3.673   1.00 2.47  ? 1136 ASP A OD1  8  
ATOM   4924  O  OD2  . ASP A 1 34 ? 2.396   -10.957 3.195   1.00 2.85  ? 1136 ASP A OD2  8  
ATOM   4925  H  H    . ASP A 1 34 ? 1.787   -9.464  0.656   1.00 1.22  ? 1136 ASP A H    8  
ATOM   4926  H  HA   . ASP A 1 34 ? -0.784  -10.500 1.466   1.00 1.27  ? 1136 ASP A HA   8  
ATOM   4927  H  HB2  . ASP A 1 34 ? 1.217   -8.790  2.909   1.00 1.68  ? 1136 ASP A HB2  8  
ATOM   4928  H  HB3  . ASP A 1 34 ? -0.286  -9.353  3.625   1.00 1.84  ? 1136 ASP A HB3  8  
ATOM   4929  N  N    . GLY A 1 35 ? -0.694  -7.695  0.178   1.00 0.62  ? 1137 GLY A N    8  
ATOM   4930  C  CA   . GLY A 1 35 ? -1.479  -6.543  -0.230  1.00 0.49  ? 1137 GLY A CA   8  
ATOM   4931  C  C    . GLY A 1 35 ? -1.513  -5.448  0.815   1.00 0.36  ? 1137 GLY A C    8  
ATOM   4932  O  O    . GLY A 1 35 ? -2.557  -4.837  1.046   1.00 0.36  ? 1137 GLY A O    8  
ATOM   4933  H  H    . GLY A 1 35 ? 0.078   -7.969  -0.363  1.00 0.82  ? 1137 GLY A H    8  
ATOM   4934  H  HA2  . GLY A 1 35 ? -1.057  -6.141  -1.139  1.00 0.51  ? 1137 GLY A HA2  8  
ATOM   4935  H  HA3  . GLY A 1 35 ? -2.489  -6.864  -0.429  1.00 0.72  ? 1137 GLY A HA3  8  
ATOM   4936  N  N    . SER A 1 36 ? -0.379  -5.195  1.450   1.00 0.32  ? 1138 SER A N    8  
ATOM   4937  C  CA   . SER A 1 36 ? -0.294  -4.148  2.456   1.00 0.28  ? 1138 SER A CA   8  
ATOM   4938  C  C    . SER A 1 36 ? -0.291  -2.770  1.805   1.00 0.25  ? 1138 SER A C    8  
ATOM   4939  O  O    . SER A 1 36 ? -0.530  -1.759  2.462   1.00 0.40  ? 1138 SER A O    8  
ATOM   4940  C  CB   . SER A 1 36 ? 0.953   -4.345  3.314   1.00 0.33  ? 1138 SER A CB   8  
ATOM   4941  O  OG   . SER A 1 36 ? 2.031   -4.840  2.538   1.00 0.44  ? 1138 SER A OG   8  
ATOM   4942  H  H    . SER A 1 36 ? 0.420   -5.722  1.240   1.00 0.37  ? 1138 SER A H    8  
ATOM   4943  H  HA   . SER A 1 36 ? -1.171  -4.227  3.086   1.00 0.33  ? 1138 SER A HA   8  
ATOM   4944  H  HB2  . SER A 1 36 ? 1.240   -3.401  3.748   1.00 0.40  ? 1138 SER A HB2  8  
ATOM   4945  H  HB3  . SER A 1 36 ? 0.739   -5.051  4.100   1.00 0.39  ? 1138 SER A HB3  8  
ATOM   4946  H  HG   . SER A 1 36 ? 2.247   -5.744  2.834   1.00 1.17  ? 1138 SER A HG   8  
ATOM   4947  N  N    . ASP A 1 37 ? -0.033  -2.738  0.509   1.00 0.18  ? 1139 ASP A N    8  
ATOM   4948  C  CA   . ASP A 1 37 ? -0.117  -1.504  -0.251  1.00 0.18  ? 1139 ASP A CA   8  
ATOM   4949  C  C    . ASP A 1 37 ? -1.583  -1.138  -0.449  1.00 0.20  ? 1139 ASP A C    8  
ATOM   4950  O  O    . ASP A 1 37 ? -1.956  0.033   -0.436  1.00 0.29  ? 1139 ASP A O    8  
ATOM   4951  C  CB   . ASP A 1 37 ? 0.571   -1.659  -1.607  1.00 0.19  ? 1139 ASP A CB   8  
ATOM   4952  C  CG   . ASP A 1 37 ? -0.254  -2.467  -2.586  1.00 0.26  ? 1139 ASP A CG   8  
ATOM   4953  O  OD1  . ASP A 1 37 ? -0.425  -3.684  -2.374  1.00 0.33  ? 1139 ASP A OD1  8  
ATOM   4954  O  OD2  . ASP A 1 37 ? -0.761  -1.877  -3.562  1.00 0.32  ? 1139 ASP A OD2  8  
ATOM   4955  H  H    . ASP A 1 37 ? 0.226   -3.565  0.049   1.00 0.26  ? 1139 ASP A H    8  
ATOM   4956  H  HA   . ASP A 1 37 ? 0.371   -0.723  0.312   1.00 0.20  ? 1139 ASP A HA   8  
ATOM   4957  H  HB2  . ASP A 1 37 ? 0.742   -0.681  -2.032  1.00 0.22  ? 1139 ASP A HB2  8  
ATOM   4958  H  HB3  . ASP A 1 37 ? 1.519   -2.156  -1.467  1.00 0.19  ? 1139 ASP A HB3  8  
ATOM   4959  N  N    . GLU A 1 38 ? -2.411  -2.165  -0.610  1.00 0.22  ? 1140 GLU A N    8  
ATOM   4960  C  CA   . GLU A 1 38 ? -3.842  -1.983  -0.788  1.00 0.27  ? 1140 GLU A CA   8  
ATOM   4961  C  C    . GLU A 1 38 ? -4.478  -1.556  0.530   1.00 0.31  ? 1140 GLU A C    8  
ATOM   4962  O  O    . GLU A 1 38 ? -5.356  -0.694  0.558   1.00 0.44  ? 1140 GLU A O    8  
ATOM   4963  C  CB   . GLU A 1 38 ? -4.486  -3.281  -1.286  1.00 0.29  ? 1140 GLU A CB   8  
ATOM   4964  C  CG   . GLU A 1 38 ? -3.899  -3.811  -2.592  1.00 0.29  ? 1140 GLU A CG   8  
ATOM   4965  C  CD   . GLU A 1 38 ? -4.176  -2.908  -3.781  1.00 0.28  ? 1140 GLU A CD   8  
ATOM   4966  O  OE1  . GLU A 1 38 ? -5.330  -2.460  -3.937  1.00 0.38  ? 1140 GLU A OE1  8  
ATOM   4967  O  OE2  . GLU A 1 38 ? -3.242  -2.650  -4.574  1.00 0.28  ? 1140 GLU A OE2  8  
ATOM   4968  H  H    . GLU A 1 38 ? -2.041  -3.073  -0.618  1.00 0.24  ? 1140 GLU A H    8  
ATOM   4969  H  HA   . GLU A 1 38 ? -3.993  -1.206  -1.522  1.00 0.30  ? 1140 GLU A HA   8  
ATOM   4970  H  HB2  . GLU A 1 38 ? -4.362  -4.042  -0.530  1.00 0.32  ? 1140 GLU A HB2  8  
ATOM   4971  H  HB3  . GLU A 1 38 ? -5.541  -3.108  -1.437  1.00 0.33  ? 1140 GLU A HB3  8  
ATOM   4972  H  HG2  . GLU A 1 38 ? -2.830  -3.904  -2.477  1.00 0.29  ? 1140 GLU A HG2  8  
ATOM   4973  H  HG3  . GLU A 1 38 ? -4.322  -4.785  -2.791  1.00 0.33  ? 1140 GLU A HG3  8  
ATOM   4974  N  N    . LYS A 1 39 ? -4.010  -2.154  1.628   1.00 0.30  ? 1141 LYS A N    8  
ATOM   4975  C  CA   . LYS A 1 39 ? -4.513  -1.813  2.955   1.00 0.37  ? 1141 LYS A CA   8  
ATOM   4976  C  C    . LYS A 1 39 ? -4.123  -0.380  3.305   1.00 0.49  ? 1141 LYS A C    8  
ATOM   4977  O  O    . LYS A 1 39 ? -4.819  0.307   4.053   1.00 0.57  ? 1141 LYS A O    8  
ATOM   4978  C  CB   . LYS A 1 39 ? -3.974  -2.786  4.017   1.00 0.47  ? 1141 LYS A CB   8  
ATOM   4979  C  CG   . LYS A 1 39 ? -2.617  -2.402  4.589   1.00 0.57  ? 1141 LYS A CG   8  
ATOM   4980  C  CD   . LYS A 1 39 ? -2.158  -3.375  5.656   1.00 0.76  ? 1141 LYS A CD   8  
ATOM   4981  C  CE   . LYS A 1 39 ? -0.841  -2.934  6.270   1.00 0.91  ? 1141 LYS A CE   8  
ATOM   4982  N  NZ   . LYS A 1 39 ? -0.941  -1.599  6.920   1.00 1.55  ? 1141 LYS A NZ   8  
ATOM   4983  H  H    . LYS A 1 39 ? -3.320  -2.845  1.538   1.00 0.32  ? 1141 LYS A H    8  
ATOM   4984  H  HA   . LYS A 1 39 ? -5.592  -1.884  2.927   1.00 0.39  ? 1141 LYS A HA   8  
ATOM   4985  H  HB2  . LYS A 1 39 ? -4.675  -2.835  4.830   1.00 0.56  ? 1141 LYS A HB2  8  
ATOM   4986  H  HB3  . LYS A 1 39 ? -3.886  -3.767  3.574   1.00 0.47  ? 1141 LYS A HB3  8  
ATOM   4987  H  HG2  . LYS A 1 39 ? -1.888  -2.392  3.794   1.00 0.50  ? 1141 LYS A HG2  8  
ATOM   4988  H  HG3  . LYS A 1 39 ? -2.689  -1.416  5.023   1.00 0.65  ? 1141 LYS A HG3  8  
ATOM   4989  H  HD2  . LYS A 1 39 ? -2.908  -3.428  6.432   1.00 0.88  ? 1141 LYS A HD2  8  
ATOM   4990  H  HD3  . LYS A 1 39 ? -2.026  -4.349  5.209   1.00 0.73  ? 1141 LYS A HD3  8  
ATOM   4991  H  HE2  . LYS A 1 39 ? -0.543  -3.659  7.006   1.00 1.15  ? 1141 LYS A HE2  8  
ATOM   4992  H  HE3  . LYS A 1 39 ? -0.095  -2.889  5.491   1.00 1.18  ? 1141 LYS A HE3  8  
ATOM   4993  H  HZ1  . LYS A 1 39 ? -0.028  -1.338  7.340   1.00 2.08  ? 1141 LYS A HZ1  8  
ATOM   4994  H  HZ2  . LYS A 1 39 ? -1.660  -1.616  7.669   1.00 1.99  ? 1141 LYS A HZ2  8  
ATOM   4995  H  HZ3  . LYS A 1 39 ? -1.206  -0.875  6.222   1.00 1.97  ? 1141 LYS A HZ3  8  
ATOM   4996  N  N    . ASN A 1 40 ? -3.006  0.062   2.742   1.00 0.60  ? 1142 ASN A N    8  
ATOM   4997  C  CA   . ASN A 1 40 ? -2.527  1.424   2.928   1.00 0.81  ? 1142 ASN A CA   8  
ATOM   4998  C  C    . ASN A 1 40 ? -3.262  2.349   1.966   1.00 0.91  ? 1142 ASN A C    8  
ATOM   4999  O  O    . ASN A 1 40 ? -2.656  2.991   1.104   1.00 1.44  ? 1142 ASN A O    8  
ATOM   5000  C  CB   . ASN A 1 40 ? -1.014  1.483   2.681   1.00 1.07  ? 1142 ASN A CB   8  
ATOM   5001  C  CG   . ASN A 1 40 ? -0.374  2.765   3.187   1.00 1.37  ? 1142 ASN A CG   8  
ATOM   5002  O  OD1  . ASN A 1 40 ? 0.064   2.837   4.335   1.00 2.05  ? 1142 ASN A OD1  8  
ATOM   5003  N  ND2  . ASN A 1 40 ? -0.296  3.773   2.333   1.00 1.92  ? 1142 ASN A ND2  8  
ATOM   5004  H  H    . ASN A 1 40 ? -2.485  -0.552  2.182   1.00 0.58  ? 1142 ASN A H    8  
ATOM   5005  H  HA   . ASN A 1 40 ? -2.740  1.724   3.942   1.00 0.86  ? 1142 ASN A HA   8  
ATOM   5006  H  HB2  . ASN A 1 40 ? -0.544  0.651   3.181   1.00 1.54  ? 1142 ASN A HB2  8  
ATOM   5007  H  HB3  . ASN A 1 40 ? -0.830  1.406   1.620   1.00 1.56  ? 1142 ASN A HB3  8  
ATOM   5008  H  HD21 . ASN A 1 40 ? -0.656  3.643   1.428   1.00 2.20  ? 1142 ASN A HD21 8  
ATOM   5009  H  HD22 . ASN A 1 40 ? 0.116   4.610   2.639   1.00 2.44  ? 1142 ASN A HD22 8  
ATOM   5010  N  N    . CYS A 1 41 ? -4.578  2.398   2.118   1.00 0.76  ? 1143 CYS A N    8  
ATOM   5011  C  CA   . CYS A 1 41 ? -5.438  3.142   1.213   1.00 0.99  ? 1143 CYS A CA   8  
ATOM   5012  C  C    . CYS A 1 41 ? -6.890  3.016   1.643   1.00 1.29  ? 1143 CYS A C    8  
ATOM   5013  O  O    . CYS A 1 41 ? -7.639  3.992   1.638   1.00 1.67  ? 1143 CYS A O    8  
ATOM   5014  C  CB   . CYS A 1 41 ? -5.278  2.621   -0.216  1.00 0.93  ? 1143 CYS A CB   8  
ATOM   5015  S  SG   . CYS A 1 41 ? -6.450  3.333   -1.412  1.00 1.10  ? 1143 CYS A SG   8  
ATOM   5016  H  H    . CYS A 1 41 ? -4.984  1.919   2.874   1.00 0.89  ? 1143 CYS A H    8  
ATOM   5017  H  HA   . CYS A 1 41 ? -5.146  4.180   1.248   1.00 1.23  ? 1143 CYS A HA   8  
ATOM   5018  H  HB2  . CYS A 1 41 ? -4.282  2.850   -0.561  1.00 0.98  ? 1143 CYS A HB2  8  
ATOM   5019  H  HB3  . CYS A 1 41 ? -5.417  1.549   -0.218  1.00 1.29  ? 1143 CYS A HB3  8  
ATOM   5020  N  N    . ASN A 1 42 ? -7.283  1.807   2.019   1.00 1.87  ? 1144 ASN A N    8  
ATOM   5021  C  CA   . ASN A 1 42 ? -8.655  1.543   2.424   1.00 2.36  ? 1144 ASN A CA   8  
ATOM   5022  C  C    . ASN A 1 42 ? -8.701  0.412   3.438   1.00 3.05  ? 1144 ASN A C    8  
ATOM   5023  O  O    . ASN A 1 42 ? -7.831  -0.459  3.456   1.00 3.73  ? 1144 ASN A O    8  
ATOM   5024  C  CB   . ASN A 1 42 ? -9.517  1.179   1.207   1.00 3.11  ? 1144 ASN A CB   8  
ATOM   5025  C  CG   . ASN A 1 42 ? -9.076  -0.109  0.530   1.00 3.87  ? 1144 ASN A CG   8  
ATOM   5026  O  OD1  . ASN A 1 42 ? -9.505  -1.201  0.904   1.00 4.27  ? 1144 ASN A OD1  8  
ATOM   5027  N  ND2  . ASN A 1 42 ? -8.233  0.010   -0.485  1.00 4.59  ? 1144 ASN A ND2  8  
ATOM   5028  H  H    . ASN A 1 42 ? -6.635  1.068   2.023   1.00 2.27  ? 1144 ASN A H    8  
ATOM   5029  H  HA   . ASN A 1 42 ? -9.046  2.438   2.880   1.00 2.42  ? 1144 ASN A HA   8  
ATOM   5030  H  HB2  . ASN A 1 42 ? -10.542 1.059   1.526   1.00 3.41  ? 1144 ASN A HB2  8  
ATOM   5031  H  HB3  . ASN A 1 42 ? -9.463  1.980   0.485   1.00 3.38  ? 1144 ASN A HB3  8  
ATOM   5032  H  HD21 . ASN A 1 42 ? -7.944  0.909   -0.746  1.00 4.61  ? 1144 ASN A HD21 8  
ATOM   5033  H  HD22 . ASN A 1 42 ? -7.931  -0.808  -0.936  1.00 5.30  ? 1144 ASN A HD22 8  
ATOM   5034  N  N    . SER A 1 43 ? -9.707  0.453   4.296   1.00 3.53  ? 1145 SER A N    8  
ATOM   5035  C  CA   . SER A 1 43 ? -9.945  -0.610  5.254   1.00 4.69  ? 1145 SER A CA   8  
ATOM   5036  C  C    . SER A 1 43 ? -10.993 -1.571  4.716   1.00 5.23  ? 1145 SER A C    8  
ATOM   5037  O  O    . SER A 1 43 ? -10.814 -2.787  4.741   1.00 5.32  ? 1145 SER A O    8  
ATOM   5038  C  CB   . SER A 1 43 ? -10.403 -0.028  6.578   1.00 5.40  ? 1145 SER A CB   8  
ATOM   5039  O  OG   . SER A 1 43 ? -9.516  0.982   7.029   1.00 5.26  ? 1145 SER A OG   8  
ATOM   5040  H  H    . SER A 1 43 ? -10.308 1.227   4.289   1.00 3.45  ? 1145 SER A H    8  
ATOM   5041  H  HA   . SER A 1 43 ? -9.040  -1.137  5.409   1.00 5.07  ? 1145 SER A HA   8  
ATOM   5042  H  HB2  . SER A 1 43 ? -11.371 0.396   6.445   1.00 6.23  ? 1145 SER A HB2  8  
ATOM   5043  H  HB3  . SER A 1 43 ? -10.449 -0.811  7.320   1.00 5.56  ? 1145 SER A HB3  8  
ATOM   5044  H  HG   . SER A 1 43 ? -8.648  0.849   6.625   1.00 5.21  ? 1145 SER A HG   8  
ATOM   5045  N  N    . THR A 1 44 ? -12.080 -1.009  4.220   1.00 5.97  ? 1146 THR A N    8  
ATOM   5046  C  CA   . THR A 1 44 ? -13.189 -1.797  3.727   1.00 6.81  ? 1146 THR A CA   8  
ATOM   5047  C  C    . THR A 1 44 ? -13.051 -2.086  2.233   1.00 7.34  ? 1146 THR A C    8  
ATOM   5048  O  O    . THR A 1 44 ? -13.759 -1.510  1.404   1.00 8.15  ? 1146 THR A O    8  
ATOM   5049  C  CB   . THR A 1 44 ? -14.511 -1.071  4.028   1.00 7.69  ? 1146 THR A CB   8  
ATOM   5050  O  OG1  . THR A 1 44 ? -14.502 0.243   3.450   1.00 7.92  ? 1146 THR A OG1  8  
ATOM   5051  C  CG2  . THR A 1 44 ? -14.706 -0.961  5.531   1.00 7.74  ? 1146 THR A CG2  8  
ATOM   5052  H  H    . THR A 1 44 ? -12.139 -0.029  4.182   1.00 6.16  ? 1146 THR A H    8  
ATOM   5053  H  HA   . THR A 1 44 ? -13.192 -2.736  4.262   1.00 6.75  ? 1146 THR A HA   8  
ATOM   5054  H  HB   . THR A 1 44 ? -15.327 -1.640  3.611   1.00 8.40  ? 1146 THR A HB   8  
ATOM   5055  H  HG1  . THR A 1 44 ? -14.011 0.222   2.614   1.00 8.03  ? 1146 THR A HG1  8  
ATOM   5056  H  HG21 . THR A 1 44 ? -13.811 -0.540  5.975   1.00 7.71  ? 1146 THR A HG21 8  
ATOM   5057  H  HG22 . THR A 1 44 ? -14.885 -1.941  5.944   1.00 7.80  ? 1146 THR A HG22 8  
ATOM   5058  H  HG23 . THR A 1 44 ? -15.549 -0.319  5.740   1.00 8.03  ? 1146 THR A HG23 8  
ATOM   5059  N  N    . GLU A 1 45 ? -12.133 -2.984  1.895   1.00 7.13  ? 1147 GLU A N    8  
ATOM   5060  C  CA   . GLU A 1 45 ? -11.889 -3.348  0.503   1.00 7.94  ? 1147 GLU A CA   8  
ATOM   5061  C  C    . GLU A 1 45 ? -13.119 -4.022  -0.097  1.00 8.95  ? 1147 GLU A C    8  
ATOM   5062  O  O    . GLU A 1 45 ? -13.399 -3.879  -1.283  1.00 9.87  ? 1147 GLU A O    8  
ATOM   5063  C  CB   . GLU A 1 45 ? -10.659 -4.265  0.376   1.00 7.79  ? 1147 GLU A CB   8  
ATOM   5064  C  CG   . GLU A 1 45 ? -10.849 -5.679  0.923   1.00 7.90  ? 1147 GLU A CG   8  
ATOM   5065  C  CD   . GLU A 1 45 ? -11.128 -5.718  2.411   1.00 8.00  ? 1147 GLU A CD   8  
ATOM   5066  O  OE1  . GLU A 1 45 ? -10.168 -5.649  3.201   1.00 8.08  ? 1147 GLU A OE1  8  
ATOM   5067  O  OE2  . GLU A 1 45 ? -12.315 -5.814  2.796   1.00 8.23  ? 1147 GLU A OE2  8  
ATOM   5068  H  H    . GLU A 1 45 ? -11.603 -3.414  2.603   1.00 6.60  ? 1147 GLU A H    8  
ATOM   5069  H  HA   . GLU A 1 45 ? -11.698 -2.434  -0.042  1.00 8.20  ? 1147 GLU A HA   8  
ATOM   5070  H  HB2  . GLU A 1 45 ? -10.397 -4.344  -0.668  1.00 8.33  ? 1147 GLU A HB2  8  
ATOM   5071  H  HB3  . GLU A 1 45 ? -9.837  -3.809  0.905   1.00 7.37  ? 1147 GLU A HB3  8  
ATOM   5072  H  HG2  . GLU A 1 45 ? -11.682 -6.138  0.409   1.00 7.80  ? 1147 GLU A HG2  8  
ATOM   5073  H  HG3  . GLU A 1 45 ? -9.952  -6.248  0.725   1.00 8.35  ? 1147 GLU A HG3  8  
ATOM   5074  N  N    . THR A 1 46 ? -13.849 -4.750  0.734   1.00 8.94  ? 1148 THR A N    8  
ATOM   5075  C  CA   . THR A 1 46 ? -15.066 -5.417  0.305   1.00 10.03 ? 1148 THR A CA   8  
ATOM   5076  C  C    . THR A 1 46 ? -16.246 -4.447  0.292   1.00 10.71 ? 1148 THR A C    8  
ATOM   5077  O  O    . THR A 1 46 ? -17.115 -4.484  1.162   1.00 11.12 ? 1148 THR A O    8  
ATOM   5078  C  CB   . THR A 1 46 ? -15.374 -6.620  1.218   1.00 10.21 ? 1148 THR A CB   8  
ATOM   5079  O  OG1  . THR A 1 46 ? -15.001 -6.314  2.573   1.00 9.58  ? 1148 THR A OG1  8  
ATOM   5080  C  CG2  . THR A 1 46 ? -14.627 -7.858  0.748   1.00 11.01 ? 1148 THR A CG2  8  
ATOM   5081  H  H    . THR A 1 46 ? -13.552 -4.849  1.667   1.00 8.30  ? 1148 THR A H    8  
ATOM   5082  H  HA   . THR A 1 46 ? -14.907 -5.786  -0.697  1.00 10.45 ? 1148 THR A HA   8  
ATOM   5083  H  HB   . THR A 1 46 ? -16.435 -6.819  1.180   1.00 10.48 ? 1148 THR A HB   8  
ATOM   5084  H  HG1  . THR A 1 46 ? -14.030 -6.310  2.646   1.00 9.43  ? 1148 THR A HG1  8  
ATOM   5085  H  HG21 . THR A 1 46 ? -14.844 -8.683  1.411   1.00 11.19 ? 1148 THR A HG21 8  
ATOM   5086  H  HG22 . THR A 1 46 ? -13.565 -7.661  0.756   1.00 11.07 ? 1148 THR A HG22 8  
ATOM   5087  H  HG23 . THR A 1 46 ? -14.940 -8.111  -0.253  1.00 11.53 ? 1148 THR A HG23 8  
HETATM 5088  CA CA   . CA  B 2 .  ? -1.171  -2.989  -5.424  1.00 0.28  ? 1201 CA  A CA   8  
ATOM   5089  N  N    . THR A 1 1  ? 24.206  -1.952  12.356  1.00 12.23 ? 1103 THR A N    9  
ATOM   5090  C  CA   . THR A 1 1  ? 24.506  -3.166  11.570  1.00 11.73 ? 1103 THR A CA   9  
ATOM   5091  C  C    . THR A 1 1  ? 23.360  -3.490  10.611  1.00 10.83 ? 1103 THR A C    9  
ATOM   5092  O  O    . THR A 1 1  ? 22.188  -3.409  10.986  1.00 10.67 ? 1103 THR A O    9  
ATOM   5093  C  CB   . THR A 1 1  ? 24.784  -4.383  12.488  1.00 11.83 ? 1103 THR A CB   9  
ATOM   5094  O  OG1  . THR A 1 1  ? 25.032  -5.554  11.697  1.00 12.26 ? 1103 THR A OG1  9  
ATOM   5095  C  CG2  . THR A 1 1  ? 23.620  -4.646  13.435  1.00 12.04 ? 1103 THR A CG2  9  
ATOM   5096  H  H1   . THR A 1 1  ? 23.318  -2.074  12.879  1.00 12.23 ? 1103 THR A H1   9  
ATOM   5097  H  H2   . THR A 1 1  ? 24.109  -1.133  11.722  1.00 12.55 ? 1103 THR A H2   9  
ATOM   5098  H  H3   . THR A 1 1  ? 24.972  -1.761  13.032  1.00 12.44 ? 1103 THR A H3   9  
ATOM   5099  H  HA   . THR A 1 1  ? 25.396  -2.975  10.988  1.00 12.16 ? 1103 THR A HA   9  
ATOM   5100  H  HB   . THR A 1 1  ? 25.665  -4.170  13.079  1.00 11.67 ? 1103 THR A HB   9  
ATOM   5101  H  HG1  . THR A 1 1  ? 25.987  -5.672  11.592  1.00 12.30 ? 1103 THR A HG1  9  
ATOM   5102  H  HG21 . THR A 1 1  ? 23.847  -5.503  14.053  1.00 12.31 ? 1103 THR A HG21 9  
ATOM   5103  H  HG22 . THR A 1 1  ? 22.726  -4.841  12.861  1.00 12.05 ? 1103 THR A HG22 9  
ATOM   5104  H  HG23 . THR A 1 1  ? 23.464  -3.782  14.063  1.00 12.10 ? 1103 THR A HG23 9  
ATOM   5105  N  N    . HIS A 1 2  ? 23.715  -3.837  9.373   1.00 10.41 ? 1104 HIS A N    9  
ATOM   5106  C  CA   . HIS A 1 2  ? 22.748  -4.254  8.355   1.00 9.72  ? 1104 HIS A CA   9  
ATOM   5107  C  C    . HIS A 1 2  ? 21.790  -3.126  7.991   1.00 8.65  ? 1104 HIS A C    9  
ATOM   5108  O  O    . HIS A 1 2  ? 20.755  -2.930  8.635   1.00 8.32  ? 1104 HIS A O    9  
ATOM   5109  C  CB   . HIS A 1 2  ? 21.977  -5.494  8.813   1.00 10.05 ? 1104 HIS A CB   9  
ATOM   5110  C  CG   . HIS A 1 2  ? 22.794  -6.747  8.767   1.00 10.43 ? 1104 HIS A CG   9  
ATOM   5111  N  ND1  . HIS A 1 2  ? 23.678  -7.119  9.760   1.00 10.71 ? 1104 HIS A ND1  9  
ATOM   5112  C  CD2  . HIS A 1 2  ? 22.864  -7.713  7.825   1.00 10.84 ? 1104 HIS A CD2  9  
ATOM   5113  C  CE1  . HIS A 1 2  ? 24.253  -8.260  9.426   1.00 11.25 ? 1104 HIS A CE1  9  
ATOM   5114  N  NE2  . HIS A 1 2  ? 23.775  -8.640  8.259   1.00 11.34 ? 1104 HIS A NE2  9  
ATOM   5115  H  H    . HIS A 1 2  ? 24.666  -3.804  9.131   1.00 10.71 ? 1104 HIS A H    9  
ATOM   5116  H  HA   . HIS A 1 2  ? 23.311  -4.514  7.470   1.00 9.96  ? 1104 HIS A HA   9  
ATOM   5117  H  HB2  . HIS A 1 2  ? 21.646  -5.348  9.830   1.00 10.50 ? 1104 HIS A HB2  9  
ATOM   5118  H  HB3  . HIS A 1 2  ? 21.116  -5.632  8.175   1.00 9.81  ? 1104 HIS A HB3  9  
ATOM   5119  H  HD1  . HIS A 1 2  ? 23.866  -6.615  10.587  1.00 10.68 ? 1104 HIS A HD1  9  
ATOM   5120  H  HD2  . HIS A 1 2  ? 22.305  -7.746  6.902   1.00 10.94 ? 1104 HIS A HD2  9  
ATOM   5121  H  HE1  . HIS A 1 2  ? 24.992  -8.790  10.009  1.00 11.71 ? 1104 HIS A HE1  9  
ATOM   5122  H  HE2  . HIS A 1 2  ? 23.974  -9.494  7.817   1.00 11.83 ? 1104 HIS A HE2  9  
ATOM   5123  N  N    . ALA A 1 3  ? 22.148  -2.393  6.945   1.00 8.30  ? 1105 ALA A N    9  
ATOM   5124  C  CA   . ALA A 1 3  ? 21.339  -1.289  6.455   1.00 7.41  ? 1105 ALA A CA   9  
ATOM   5125  C  C    . ALA A 1 3  ? 19.974  -1.782  5.987   1.00 6.47  ? 1105 ALA A C    9  
ATOM   5126  O  O    . ALA A 1 3  ? 19.888  -2.682  5.150   1.00 6.54  ? 1105 ALA A O    9  
ATOM   5127  C  CB   . ALA A 1 3  ? 22.062  -0.586  5.317   1.00 7.70  ? 1105 ALA A CB   9  
ATOM   5128  H  H    . ALA A 1 3  ? 22.981  -2.611  6.476   1.00 8.79  ? 1105 ALA A H    9  
ATOM   5129  H  HA   . ALA A 1 3  ? 21.208  -0.581  7.261   1.00 7.45  ? 1105 ALA A HA   9  
ATOM   5130  H  HB1  . ALA A 1 3  ? 23.027  -0.248  5.660   1.00 7.93  ? 1105 ALA A HB1  9  
ATOM   5131  H  HB2  . ALA A 1 3  ? 21.479  0.261   4.989   1.00 7.73  ? 1105 ALA A HB2  9  
ATOM   5132  H  HB3  . ALA A 1 3  ? 22.192  -1.273  4.495   1.00 7.95  ? 1105 ALA A HB3  9  
ATOM   5133  N  N    . PRO A 1 4  ? 18.889  -1.214  6.541   1.00 5.80  ? 1106 PRO A N    9  
ATOM   5134  C  CA   . PRO A 1 4  ? 17.517  -1.587  6.176   1.00 4.97  ? 1106 PRO A CA   9  
ATOM   5135  C  C    . PRO A 1 4  ? 17.261  -1.454  4.681   1.00 4.25  ? 1106 PRO A C    9  
ATOM   5136  O  O    . PRO A 1 4  ? 17.804  -0.560  4.026   1.00 4.22  ? 1106 PRO A O    9  
ATOM   5137  C  CB   . PRO A 1 4  ? 16.653  -0.585  6.947   1.00 4.84  ? 1106 PRO A CB   9  
ATOM   5138  C  CG   . PRO A 1 4  ? 17.504  -0.156  8.090   1.00 5.55  ? 1106 PRO A CG   9  
ATOM   5139  C  CD   . PRO A 1 4  ? 18.915  -0.167  7.578   1.00 6.09  ? 1106 PRO A CD   9  
ATOM   5140  H  HA   . PRO A 1 4  ? 17.281  -2.591  6.494   1.00 5.32  ? 1106 PRO A HA   9  
ATOM   5141  H  HB2  . PRO A 1 4  ? 16.403  0.247   6.305   1.00 4.32  ? 1106 PRO A HB2  9  
ATOM   5142  H  HB3  . PRO A 1 4  ? 15.751  -1.068  7.287   1.00 5.12  ? 1106 PRO A HB3  9  
ATOM   5143  H  HG2  . PRO A 1 4  ? 17.226  0.838   8.403   1.00 5.52  ? 1106 PRO A HG2  9  
ATOM   5144  H  HG3  . PRO A 1 4  ? 17.399  -0.853  8.909   1.00 6.00  ? 1106 PRO A HG3  9  
ATOM   5145  H  HD2  . PRO A 1 4  ? 19.170  0.793   7.153   1.00 6.19  ? 1106 PRO A HD2  9  
ATOM   5146  H  HD3  . PRO A 1 4  ? 19.602  -0.426  8.370   1.00 6.80  ? 1106 PRO A HD3  9  
ATOM   5147  N  N    . ALA A 1 5  ? 16.436  -2.339  4.147   1.00 4.09  ? 1107 ALA A N    9  
ATOM   5148  C  CA   . ALA A 1 5  ? 16.104  -2.320  2.730   1.00 3.77  ? 1107 ALA A CA   9  
ATOM   5149  C  C    . ALA A 1 5  ? 15.078  -1.232  2.430   1.00 2.63  ? 1107 ALA A C    9  
ATOM   5150  O  O    . ALA A 1 5  ? 13.897  -1.510  2.226   1.00 2.62  ? 1107 ALA A O    9  
ATOM   5151  C  CB   . ALA A 1 5  ? 15.586  -3.681  2.292   1.00 4.73  ? 1107 ALA A CB   9  
ATOM   5152  H  H    . ALA A 1 5  ? 16.037  -3.028  4.720   1.00 4.51  ? 1107 ALA A H    9  
ATOM   5153  H  HA   . ALA A 1 5  ? 17.009  -2.108  2.179   1.00 4.04  ? 1107 ALA A HA   9  
ATOM   5154  H  HB1  . ALA A 1 5  ? 15.370  -3.660  1.233   1.00 5.01  ? 1107 ALA A HB1  9  
ATOM   5155  H  HB2  . ALA A 1 5  ? 14.686  -3.916  2.838   1.00 4.95  ? 1107 ALA A HB2  9  
ATOM   5156  H  HB3  . ALA A 1 5  ? 16.336  -4.431  2.491   1.00 5.29  ? 1107 ALA A HB3  9  
ATOM   5157  N  N    . SER A 1 6  ? 15.536  0.007   2.426   1.00 2.16  ? 1108 SER A N    9  
ATOM   5158  C  CA   . SER A 1 6  ? 14.686  1.139   2.112   1.00 1.43  ? 1108 SER A CA   9  
ATOM   5159  C  C    . SER A 1 6  ? 14.475  1.235   0.607   1.00 1.29  ? 1108 SER A C    9  
ATOM   5160  O  O    . SER A 1 6  ? 15.433  1.181   -0.167  1.00 1.97  ? 1108 SER A O    9  
ATOM   5161  C  CB   . SER A 1 6  ? 15.317  2.418   2.656   1.00 2.09  ? 1108 SER A CB   9  
ATOM   5162  O  OG   . SER A 1 6  ? 16.689  2.497   2.299   1.00 2.97  ? 1108 SER A OG   9  
ATOM   5163  H  H    . SER A 1 6  ? 16.480  0.167   2.645   1.00 2.71  ? 1108 SER A H    9  
ATOM   5164  H  HA   . SER A 1 6  ? 13.732  0.982   2.592   1.00 1.32  ? 1108 SER A HA   9  
ATOM   5165  H  HB2  . SER A 1 6  ? 14.802  3.274   2.248   1.00 2.36  ? 1108 SER A HB2  9  
ATOM   5166  H  HB3  . SER A 1 6  ? 15.236  2.429   3.733   1.00 2.13  ? 1108 SER A HB3  9  
ATOM   5167  H  HG   . SER A 1 6  ? 16.790  2.268   1.365   1.00 3.32  ? 1108 SER A HG   9  
ATOM   5168  N  N    . CYS A 1 7  ? 13.225  1.370   0.194   1.00 0.72  ? 1109 CYS A N    9  
ATOM   5169  C  CA   . CYS A 1 7  ? 12.896  1.391   -1.222  1.00 0.49  ? 1109 CYS A CA   9  
ATOM   5170  C  C    . CYS A 1 7  ? 13.155  2.759   -1.840  1.00 0.46  ? 1109 CYS A C    9  
ATOM   5171  O  O    . CYS A 1 7  ? 13.574  3.697   -1.153  1.00 0.62  ? 1109 CYS A O    9  
ATOM   5172  C  CB   . CYS A 1 7  ? 11.439  0.980   -1.432  1.00 0.33  ? 1109 CYS A CB   9  
ATOM   5173  S  SG   . CYS A 1 7  ? 11.053  -0.680  -0.791  1.00 0.47  ? 1109 CYS A SG   9  
ATOM   5174  H  H    . CYS A 1 7  ? 12.507  1.458   0.857   1.00 0.94  ? 1109 CYS A H    9  
ATOM   5175  H  HA   . CYS A 1 7  ? 13.530  0.669   -1.713  1.00 0.60  ? 1109 CYS A HA   9  
ATOM   5176  H  HB2  . CYS A 1 7  ? 10.795  1.687   -0.934  1.00 0.41  ? 1109 CYS A HB2  9  
ATOM   5177  H  HB3  . CYS A 1 7  ? 11.221  0.984   -2.490  1.00 0.29  ? 1109 CYS A HB3  9  
ATOM   5178  N  N    . LEU A 1 8  ? 12.913  2.857   -3.141  1.00 0.34  ? 1110 LEU A N    9  
ATOM   5179  C  CA   . LEU A 1 8  ? 13.095  4.096   -3.888  1.00 0.32  ? 1110 LEU A CA   9  
ATOM   5180  C  C    . LEU A 1 8  ? 12.250  5.214   -3.285  1.00 0.29  ? 1110 LEU A C    9  
ATOM   5181  O  O    . LEU A 1 8  ? 11.252  4.954   -2.609  1.00 0.30  ? 1110 LEU A O    9  
ATOM   5182  C  CB   . LEU A 1 8  ? 12.663  3.863   -5.334  1.00 0.28  ? 1110 LEU A CB   9  
ATOM   5183  C  CG   . LEU A 1 8  ? 13.403  4.649   -6.412  1.00 0.38  ? 1110 LEU A CG   9  
ATOM   5184  C  CD1  . LEU A 1 8  ? 14.896  4.372   -6.354  1.00 0.52  ? 1110 LEU A CD1  9  
ATOM   5185  C  CD2  . LEU A 1 8  ? 12.846  4.278   -7.778  1.00 0.39  ? 1110 LEU A CD2  9  
ATOM   5186  H  H    . LEU A 1 8  ? 12.600  2.059   -3.623  1.00 0.34  ? 1110 LEU A H    9  
ATOM   5187  H  HA   . LEU A 1 8  ? 14.136  4.370   -3.859  1.00 0.40  ? 1110 LEU A HA   9  
ATOM   5188  H  HB2  . LEU A 1 8  ? 12.764  2.813   -5.550  1.00 0.32  ? 1110 LEU A HB2  9  
ATOM   5189  H  HB3  . LEU A 1 8  ? 11.614  4.115   -5.406  1.00 0.22  ? 1110 LEU A HB3  9  
ATOM   5190  H  HG   . LEU A 1 8  ? 13.246  5.705   -6.259  1.00 0.41  ? 1110 LEU A HG   9  
ATOM   5191  H  HD11 . LEU A 1 8  ? 15.069  3.309   -6.427  1.00 1.05  ? 1110 LEU A HD11 9  
ATOM   5192  H  HD12 . LEU A 1 8  ? 15.296  4.740   -5.422  1.00 1.29  ? 1110 LEU A HD12 9  
ATOM   5193  H  HD13 . LEU A 1 8  ? 15.385  4.873   -7.176  1.00 1.07  ? 1110 LEU A HD13 9  
ATOM   5194  H  HD21 . LEU A 1 8  ? 13.374  4.825   -8.544  1.00 1.11  ? 1110 LEU A HD21 9  
ATOM   5195  H  HD22 . LEU A 1 8  ? 11.794  4.524   -7.816  1.00 1.05  ? 1110 LEU A HD22 9  
ATOM   5196  H  HD23 . LEU A 1 8  ? 12.971  3.216   -7.941  1.00 0.97  ? 1110 LEU A HD23 9  
ATOM   5197  N  N    . ASP A 1 9  ? 12.639  6.455   -3.548  1.00 0.35  ? 1111 ASP A N    9  
ATOM   5198  C  CA   . ASP A 1 9  ? 11.889  7.610   -3.064  1.00 0.38  ? 1111 ASP A CA   9  
ATOM   5199  C  C    . ASP A 1 9  ? 10.531  7.668   -3.751  1.00 0.32  ? 1111 ASP A C    9  
ATOM   5200  O  O    . ASP A 1 9  ? 9.566   8.204   -3.206  1.00 0.42  ? 1111 ASP A O    9  
ATOM   5201  C  CB   . ASP A 1 9  ? 12.657  8.912   -3.317  1.00 0.51  ? 1111 ASP A CB   9  
ATOM   5202  C  CG   . ASP A 1 9  ? 14.008  8.946   -2.628  1.00 1.37  ? 1111 ASP A CG   9  
ATOM   5203  O  OD1  . ASP A 1 9  ? 15.002  8.484   -3.226  1.00 2.32  ? 1111 ASP A OD1  9  
ATOM   5204  O  OD2  . ASP A 1 9  ? 14.079  9.430   -1.476  1.00 1.53  ? 1111 ASP A OD2  9  
ATOM   5205  H  H    . ASP A 1 9  ? 13.454  6.600   -4.078  1.00 0.40  ? 1111 ASP A H    9  
ATOM   5206  H  HA   . ASP A 1 9  ? 11.739  7.488   -2.001  1.00 0.44  ? 1111 ASP A HA   9  
ATOM   5207  H  HB2  . ASP A 1 9  ? 12.815  9.030   -4.379  1.00 0.94  ? 1111 ASP A HB2  9  
ATOM   5208  H  HB3  . ASP A 1 9  ? 12.068  9.743   -2.954  1.00 1.01  ? 1111 ASP A HB3  9  
ATOM   5209  N  N    . THR A 1 10 ? 10.468  7.105   -4.952  1.00 0.28  ? 1112 THR A N    9  
ATOM   5210  C  CA   . THR A 1 10 ? 9.227   7.030   -5.706  1.00 0.31  ? 1112 THR A CA   9  
ATOM   5211  C  C    . THR A 1 10 ? 8.580   5.652   -5.569  1.00 0.24  ? 1112 THR A C    9  
ATOM   5212  O  O    . THR A 1 10 ? 7.541   5.379   -6.169  1.00 0.30  ? 1112 THR A O    9  
ATOM   5213  C  CB   . THR A 1 10 ? 9.470   7.347   -7.192  1.00 0.42  ? 1112 THR A CB   9  
ATOM   5214  O  OG1  . THR A 1 10 ? 10.668  6.696   -7.638  1.00 0.45  ? 1112 THR A OG1  9  
ATOM   5215  C  CG2  . THR A 1 10 ? 9.590   8.848   -7.416  1.00 0.52  ? 1112 THR A CG2  9  
ATOM   5216  H  H    . THR A 1 10 ? 11.284  6.738   -5.349  1.00 0.31  ? 1112 THR A H    9  
ATOM   5217  H  HA   . THR A 1 10 ? 8.550   7.773   -5.307  1.00 0.36  ? 1112 THR A HA   9  
ATOM   5218  H  HB   . THR A 1 10 ? 8.632   6.977   -7.767  1.00 0.48  ? 1112 THR A HB   9  
ATOM   5219  H  HG1  . THR A 1 10 ? 10.458  6.120   -8.387  1.00 0.95  ? 1112 THR A HG1  9  
ATOM   5220  H  HG21 . THR A 1 10 ? 10.427  9.230   -6.852  1.00 1.19  ? 1112 THR A HG21 9  
ATOM   5221  H  HG22 . THR A 1 10 ? 8.685   9.334   -7.087  1.00 1.09  ? 1112 THR A HG22 9  
ATOM   5222  H  HG23 . THR A 1 10 ? 9.744   9.045   -8.466  1.00 1.17  ? 1112 THR A HG23 9  
ATOM   5223  N  N    . GLN A 1 11 ? 9.204   4.782   -4.784  1.00 0.18  ? 1113 GLN A N    9  
ATOM   5224  C  CA   . GLN A 1 11 ? 8.649   3.467   -4.521  1.00 0.17  ? 1113 GLN A CA   9  
ATOM   5225  C  C    . GLN A 1 11 ? 7.961   3.425   -3.173  1.00 0.17  ? 1113 GLN A C    9  
ATOM   5226  O  O    . GLN A 1 11 ? 8.145   4.307   -2.334  1.00 0.23  ? 1113 GLN A O    9  
ATOM   5227  C  CB   . GLN A 1 11 ? 9.736   2.401   -4.547  1.00 0.17  ? 1113 GLN A CB   9  
ATOM   5228  C  CG   . GLN A 1 11 ? 10.133  1.971   -5.942  1.00 0.23  ? 1113 GLN A CG   9  
ATOM   5229  C  CD   . GLN A 1 11 ? 11.122  0.824   -5.931  1.00 0.35  ? 1113 GLN A CD   9  
ATOM   5230  O  OE1  . GLN A 1 11 ? 11.913  0.680   -4.996  1.00 1.02  ? 1113 GLN A OE1  9  
ATOM   5231  N  NE2  . GLN A 1 11 ? 11.086  0.004   -6.965  1.00 0.67  ? 1113 GLN A NE2  9  
ATOM   5232  H  H    . GLN A 1 11 ? 10.058  5.027   -4.369  1.00 0.20  ? 1113 GLN A H    9  
ATOM   5233  H  HA   . GLN A 1 11 ? 7.925   3.249   -5.291  1.00 0.22  ? 1113 GLN A HA   9  
ATOM   5234  H  HB2  . GLN A 1 11 ? 10.613  2.786   -4.048  1.00 0.16  ? 1113 GLN A HB2  9  
ATOM   5235  H  HB3  . GLN A 1 11 ? 9.385   1.535   -4.011  1.00 0.20  ? 1113 GLN A HB3  9  
ATOM   5236  H  HG2  . GLN A 1 11 ? 9.250   1.663   -6.467  1.00 0.31  ? 1113 GLN A HG2  9  
ATOM   5237  H  HG3  . GLN A 1 11 ? 10.581  2.809   -6.454  1.00 0.22  ? 1113 GLN A HG3  9  
ATOM   5238  H  HE21 . GLN A 1 11 ? 10.428  0.181   -7.675  1.00 1.21  ? 1113 GLN A HE21 9  
ATOM   5239  H  HE22 . GLN A 1 11 ? 11.724  -0.740  -6.990  1.00 0.65  ? 1113 GLN A HE22 9  
ATOM   5240  N  N    . TYR A 1 12 ? 7.171   2.390   -2.983  1.00 0.15  ? 1114 TYR A N    9  
ATOM   5241  C  CA   . TYR A 1 12 ? 6.544   2.130   -1.706  1.00 0.16  ? 1114 TYR A CA   9  
ATOM   5242  C  C    . TYR A 1 12 ? 7.182   0.912   -1.063  1.00 0.15  ? 1114 TYR A C    9  
ATOM   5243  O  O    . TYR A 1 12 ? 7.660   0.010   -1.755  1.00 0.15  ? 1114 TYR A O    9  
ATOM   5244  C  CB   . TYR A 1 12 ? 5.043   1.895   -1.870  1.00 0.18  ? 1114 TYR A CB   9  
ATOM   5245  C  CG   . TYR A 1 12 ? 4.319   1.694   -0.557  1.00 0.22  ? 1114 TYR A CG   9  
ATOM   5246  C  CD1  . TYR A 1 12 ? 4.180   2.739   0.345   1.00 0.33  ? 1114 TYR A CD1  9  
ATOM   5247  C  CD2  . TYR A 1 12 ? 3.787   0.455   -0.214  1.00 0.21  ? 1114 TYR A CD2  9  
ATOM   5248  C  CE1  . TYR A 1 12 ? 3.535   2.558   1.553   1.00 0.39  ? 1114 TYR A CE1  9  
ATOM   5249  C  CE2  . TYR A 1 12 ? 3.137   0.267   0.991   1.00 0.26  ? 1114 TYR A CE2  9  
ATOM   5250  C  CZ   . TYR A 1 12 ? 3.016   1.321   1.871   1.00 0.34  ? 1114 TYR A CZ   9  
ATOM   5251  O  OH   . TYR A 1 12 ? 2.375   1.138   3.075   1.00 0.41  ? 1114 TYR A OH   9  
ATOM   5252  H  H    . TYR A 1 12 ? 7.013   1.769   -3.733  1.00 0.16  ? 1114 TYR A H    9  
ATOM   5253  H  HA   . TYR A 1 12 ? 6.703   2.989   -1.072  1.00 0.18  ? 1114 TYR A HA   9  
ATOM   5254  H  HB2  . TYR A 1 12 ? 4.600   2.738   -2.374  1.00 0.23  ? 1114 TYR A HB2  9  
ATOM   5255  H  HB3  . TYR A 1 12 ? 4.898   1.008   -2.462  1.00 0.18  ? 1114 TYR A HB3  9  
ATOM   5256  H  HD1  . TYR A 1 12 ? 4.587   3.706   0.092   1.00 0.40  ? 1114 TYR A HD1  9  
ATOM   5257  H  HD2  . TYR A 1 12 ? 3.885   -0.368  -0.907  1.00 0.23  ? 1114 TYR A HD2  9  
ATOM   5258  H  HE1  . TYR A 1 12 ? 3.437   3.384   2.242   1.00 0.50  ? 1114 TYR A HE1  9  
ATOM   5259  H  HE2  . TYR A 1 12 ? 2.730   -0.703  1.240   1.00 0.29  ? 1114 TYR A HE2  9  
ATOM   5260  H  HH   . TYR A 1 12 ? 1.813   1.896   3.258   1.00 0.89  ? 1114 TYR A HH   9  
ATOM   5261  N  N    . THR A 1 13 ? 7.187   0.898   0.253   1.00 0.18  ? 1115 THR A N    9  
ATOM   5262  C  CA   . THR A 1 13 ? 7.728   -0.209  1.012   1.00 0.20  ? 1115 THR A CA   9  
ATOM   5263  C  C    . THR A 1 13 ? 6.606   -0.910  1.763   1.00 0.23  ? 1115 THR A C    9  
ATOM   5264  O  O    . THR A 1 13 ? 6.114   -0.400  2.773   1.00 0.31  ? 1115 THR A O    9  
ATOM   5265  C  CB   . THR A 1 13 ? 8.790   0.272   2.017   1.00 0.26  ? 1115 THR A CB   9  
ATOM   5266  O  OG1  . THR A 1 13 ? 9.699   1.174   1.371   1.00 0.30  ? 1115 THR A OG1  9  
ATOM   5267  C  CG2  . THR A 1 13 ? 9.563   -0.905  2.593   1.00 0.27  ? 1115 THR A CG2  9  
ATOM   5268  H  H    . THR A 1 13 ? 6.794   1.657   0.731   1.00 0.22  ? 1115 THR A H    9  
ATOM   5269  H  HA   . THR A 1 13 ? 8.188   -0.903  0.324   1.00 0.19  ? 1115 THR A HA   9  
ATOM   5270  H  HB   . THR A 1 13 ? 8.291   0.790   2.825   1.00 0.31  ? 1115 THR A HB   9  
ATOM   5271  H  HG1  . THR A 1 13 ? 9.199   1.777   0.807   1.00 0.82  ? 1115 THR A HG1  9  
ATOM   5272  H  HG21 . THR A 1 13 ? 10.057  -1.436  1.794   1.00 1.01  ? 1115 THR A HG21 9  
ATOM   5273  H  HG22 . THR A 1 13 ? 8.881   -1.570  3.101   1.00 1.02  ? 1115 THR A HG22 9  
ATOM   5274  H  HG23 . THR A 1 13 ? 10.301  -0.543  3.293   1.00 1.10  ? 1115 THR A HG23 9  
ATOM   5275  N  N    . CYS A 1 14 ? 6.184   -2.058  1.255   1.00 0.26  ? 1116 CYS A N    9  
ATOM   5276  C  CA   . CYS A 1 14 ? 5.117   -2.825  1.886   1.00 0.34  ? 1116 CYS A CA   9  
ATOM   5277  C  C    . CYS A 1 14 ? 5.550   -3.362  3.251   1.00 0.40  ? 1116 CYS A C    9  
ATOM   5278  O  O    . CYS A 1 14 ? 6.732   -3.293  3.601   1.00 0.37  ? 1116 CYS A O    9  
ATOM   5279  C  CB   . CYS A 1 14 ? 4.670   -3.960  0.966   1.00 0.45  ? 1116 CYS A CB   9  
ATOM   5280  S  SG   . CYS A 1 14 ? 3.747   -3.387  -0.495  1.00 0.65  ? 1116 CYS A SG   9  
ATOM   5281  H  H    . CYS A 1 14 ? 6.593   -2.394  0.426   1.00 0.28  ? 1116 CYS A H    9  
ATOM   5282  H  HA   . CYS A 1 14 ? 4.283   -2.154  2.035   1.00 0.38  ? 1116 CYS A HA   9  
ATOM   5283  H  HB2  . CYS A 1 14 ? 5.541   -4.495  0.619   1.00 0.50  ? 1116 CYS A HB2  9  
ATOM   5284  H  HB3  . CYS A 1 14 ? 4.036   -4.636  1.519   1.00 0.54  ? 1116 CYS A HB3  9  
ATOM   5285  N  N    . ASP A 1 15 ? 4.595   -3.887  4.014   1.00 0.56  ? 1117 ASP A N    9  
ATOM   5286  C  CA   . ASP A 1 15 ? 4.842   -4.291  5.401   1.00 0.69  ? 1117 ASP A CA   9  
ATOM   5287  C  C    . ASP A 1 15 ? 6.012   -5.268  5.507   1.00 0.65  ? 1117 ASP A C    9  
ATOM   5288  O  O    . ASP A 1 15 ? 6.911   -5.082  6.330   1.00 0.71  ? 1117 ASP A O    9  
ATOM   5289  C  CB   . ASP A 1 15 ? 3.579   -4.910  6.009   1.00 0.93  ? 1117 ASP A CB   9  
ATOM   5290  C  CG   . ASP A 1 15 ? 3.745   -5.255  7.480   1.00 1.83  ? 1117 ASP A CG   9  
ATOM   5291  O  OD1  . ASP A 1 15 ? 4.254   -6.356  7.784   1.00 2.09  ? 1117 ASP A OD1  9  
ATOM   5292  O  OD2  . ASP A 1 15 ? 3.384   -4.425  8.342   1.00 2.62  ? 1117 ASP A OD2  9  
ATOM   5293  H  H    . ASP A 1 15 ? 3.693   -4.008  3.635   1.00 0.63  ? 1117 ASP A H    9  
ATOM   5294  H  HA   . ASP A 1 15 ? 5.091   -3.400  5.957   1.00 0.70  ? 1117 ASP A HA   9  
ATOM   5295  H  HB2  . ASP A 1 15 ? 2.764   -4.208  5.917   1.00 1.35  ? 1117 ASP A HB2  9  
ATOM   5296  H  HB3  . ASP A 1 15 ? 3.330   -5.812  5.471   1.00 0.70  ? 1117 ASP A HB3  9  
ATOM   5297  N  N    . ASN A 1 16 ? 6.025   -6.283  4.652   1.00 0.69  ? 1118 ASN A N    9  
ATOM   5298  C  CA   . ASN A 1 16 ? 7.091   -7.285  4.683   1.00 0.75  ? 1118 ASN A CA   9  
ATOM   5299  C  C    . ASN A 1 16 ? 8.274   -6.872  3.812   1.00 0.59  ? 1118 ASN A C    9  
ATOM   5300  O  O    . ASN A 1 16 ? 8.982   -7.720  3.266   1.00 0.65  ? 1118 ASN A O    9  
ATOM   5301  C  CB   . ASN A 1 16 ? 6.574   -8.658  4.249   1.00 0.98  ? 1118 ASN A CB   9  
ATOM   5302  C  CG   . ASN A 1 16 ? 5.647   -9.279  5.273   1.00 1.77  ? 1118 ASN A CG   9  
ATOM   5303  O  OD1  . ASN A 1 16 ? 6.094   -9.961  6.198   1.00 2.75  ? 1118 ASN A OD1  9  
ATOM   5304  N  ND2  . ASN A 1 16 ? 4.351   -9.058  5.113   1.00 2.02  ? 1118 ASN A ND2  9  
ATOM   5305  H  H    . ASN A 1 16 ? 5.304   -6.365  3.987   1.00 0.75  ? 1118 ASN A H    9  
ATOM   5306  H  HA   . ASN A 1 16 ? 7.433   -7.355  5.705   1.00 0.85  ? 1118 ASN A HA   9  
ATOM   5307  H  HB2  . ASN A 1 16 ? 6.037   -8.558  3.319   1.00 1.24  ? 1118 ASN A HB2  9  
ATOM   5308  H  HB3  . ASN A 1 16 ? 7.414   -9.320  4.104   1.00 1.41  ? 1118 ASN A HB3  9  
ATOM   5309  H  HD21 . ASN A 1 16 ? 4.064   -8.507  4.342   1.00 1.91  ? 1118 ASN A HD21 9  
ATOM   5310  H  HD22 . ASN A 1 16 ? 3.730   -9.447  5.762   1.00 2.74  ? 1118 ASN A HD22 9  
ATOM   5311  N  N    . HIS A 1 17 ? 8.476   -5.561  3.696   1.00 0.46  ? 1119 HIS A N    9  
ATOM   5312  C  CA   . HIS A 1 17 ? 9.613   -4.989  2.971   1.00 0.41  ? 1119 HIS A CA   9  
ATOM   5313  C  C    . HIS A 1 17 ? 9.629   -5.408  1.509   1.00 0.44  ? 1119 HIS A C    9  
ATOM   5314  O  O    . HIS A 1 17 ? 10.542  -6.102  1.057   1.00 0.79  ? 1119 HIS A O    9  
ATOM   5315  C  CB   . HIS A 1 17 ? 10.943  -5.367  3.632   1.00 0.51  ? 1119 HIS A CB   9  
ATOM   5316  C  CG   . HIS A 1 17 ? 11.183  -4.691  4.945   1.00 0.63  ? 1119 HIS A CG   9  
ATOM   5317  N  ND1  . HIS A 1 17 ? 12.136  -5.118  5.842   1.00 0.94  ? 1119 HIS A ND1  9  
ATOM   5318  C  CD2  . HIS A 1 17 ? 10.598  -3.607  5.507   1.00 0.78  ? 1119 HIS A CD2  9  
ATOM   5319  C  CE1  . HIS A 1 17 ? 12.125  -4.329  6.899   1.00 1.05  ? 1119 HIS A CE1  9  
ATOM   5320  N  NE2  . HIS A 1 17 ? 11.202  -3.403  6.720   1.00 0.93  ? 1119 HIS A NE2  9  
ATOM   5321  H  H    . HIS A 1 17 ? 7.828   -4.949  4.110   1.00 0.47  ? 1119 HIS A H    9  
ATOM   5322  H  HA   . HIS A 1 17 ? 9.507   -3.916  3.010   1.00 0.38  ? 1119 HIS A HA   9  
ATOM   5323  H  HB2  . HIS A 1 17 ? 10.960  -6.433  3.801   1.00 0.60  ? 1119 HIS A HB2  9  
ATOM   5324  H  HB3  . HIS A 1 17 ? 11.752  -5.101  2.967   1.00 0.55  ? 1119 HIS A HB3  9  
ATOM   5325  H  HD1  . HIS A 1 17 ? 12.744  -5.880  5.713   1.00 1.18  ? 1119 HIS A HD1  9  
ATOM   5326  H  HD2  . HIS A 1 17 ? 9.805   -3.012  5.078   1.00 1.00  ? 1119 HIS A HD2  9  
ATOM   5327  H  HE1  . HIS A 1 17 ? 12.765  -4.424  7.763   1.00 1.35  ? 1119 HIS A HE1  9  
ATOM   5328  H  HE2  . HIS A 1 17 ? 10.899  -2.768  7.405   1.00 1.09  ? 1119 HIS A HE2  9  
ATOM   5329  N  N    . GLN A 1 18 ? 8.620   -4.991  0.767   1.00 0.40  ? 1120 GLN A N    9  
ATOM   5330  C  CA   . GLN A 1 18 ? 8.608   -5.206  -0.665  1.00 0.38  ? 1120 GLN A CA   9  
ATOM   5331  C  C    . GLN A 1 18 ? 8.580   -3.867  -1.381  1.00 0.29  ? 1120 GLN A C    9  
ATOM   5332  O  O    . GLN A 1 18 ? 7.757   -3.005  -1.068  1.00 0.39  ? 1120 GLN A O    9  
ATOM   5333  C  CB   . GLN A 1 18 ? 7.419   -6.072  -1.082  1.00 0.49  ? 1120 GLN A CB   9  
ATOM   5334  C  CG   . GLN A 1 18 ? 7.386   -6.410  -2.568  1.00 0.50  ? 1120 GLN A CG   9  
ATOM   5335  C  CD   . GLN A 1 18 ? 8.588   -7.215  -3.034  1.00 1.05  ? 1120 GLN A CD   9  
ATOM   5336  O  OE1  . GLN A 1 18 ? 9.698   -7.079  -2.514  1.00 1.91  ? 1120 GLN A OE1  9  
ATOM   5337  N  NE2  . GLN A 1 18 ? 8.373   -8.069  -4.017  1.00 1.51  ? 1120 GLN A NE2  9  
ATOM   5338  H  H    . GLN A 1 18 ? 7.867   -4.528  1.191   1.00 0.63  ? 1120 GLN A H    9  
ATOM   5339  H  HA   . GLN A 1 18 ? 9.524   -5.718  -0.928  1.00 0.42  ? 1120 GLN A HA   9  
ATOM   5340  H  HB2  . GLN A 1 18 ? 7.453   -6.998  -0.529  1.00 0.62  ? 1120 GLN A HB2  9  
ATOM   5341  H  HB3  . GLN A 1 18 ? 6.506   -5.551  -0.836  1.00 0.52  ? 1120 GLN A HB3  9  
ATOM   5342  H  HG2  . GLN A 1 18 ? 6.494   -6.981  -2.772  1.00 0.87  ? 1120 GLN A HG2  9  
ATOM   5343  H  HG3  . GLN A 1 18 ? 7.353   -5.487  -3.130  1.00 0.86  ? 1120 GLN A HG3  9  
ATOM   5344  H  HE21 . GLN A 1 18 ? 7.466   -8.136  -4.385  1.00 1.83  ? 1120 GLN A HE21 9  
ATOM   5345  H  HE22 . GLN A 1 18 ? 9.131   -8.603  -4.340  1.00 1.99  ? 1120 GLN A HE22 9  
ATOM   5346  N  N    . CYS A 1 19 ? 9.500   -3.691  -2.315  1.00 0.21  ? 1121 CYS A N    9  
ATOM   5347  C  CA   . CYS A 1 19 ? 9.609   -2.447  -3.055  1.00 0.21  ? 1121 CYS A CA   9  
ATOM   5348  C  C    . CYS A 1 19 ? 8.761   -2.487  -4.315  1.00 0.20  ? 1121 CYS A C    9  
ATOM   5349  O  O    . CYS A 1 19 ? 9.032   -3.257  -5.239  1.00 0.34  ? 1121 CYS A O    9  
ATOM   5350  C  CB   . CYS A 1 19 ? 11.067  -2.168  -3.416  1.00 0.34  ? 1121 CYS A CB   9  
ATOM   5351  S  SG   . CYS A 1 19 ? 12.143  -1.918  -1.970  1.00 0.42  ? 1121 CYS A SG   9  
ATOM   5352  H  H    . CYS A 1 19 ? 10.124  -4.419  -2.514  1.00 0.29  ? 1121 CYS A H    9  
ATOM   5353  H  HA   . CYS A 1 19 ? 9.248   -1.651  -2.420  1.00 0.24  ? 1121 CYS A HA   9  
ATOM   5354  H  HB2  . CYS A 1 19 ? 11.459  -3.001  -3.977  1.00 0.39  ? 1121 CYS A HB2  9  
ATOM   5355  H  HB3  . CYS A 1 19 ? 11.117  -1.275  -4.022  1.00 0.41  ? 1121 CYS A HB3  9  
ATOM   5356  N  N    . ILE A 1 20 ? 7.725   -1.670  -4.334  1.00 0.15  ? 1122 ILE A N    9  
ATOM   5357  C  CA   . ILE A 1 20 ? 6.860   -1.553  -5.495  1.00 0.14  ? 1122 ILE A CA   9  
ATOM   5358  C  C    . ILE A 1 20 ? 6.680   -0.093  -5.865  1.00 0.14  ? 1122 ILE A C    9  
ATOM   5359  O  O    . ILE A 1 20 ? 7.078   0.794   -5.119  1.00 0.18  ? 1122 ILE A O    9  
ATOM   5360  C  CB   . ILE A 1 20 ? 5.474   -2.172  -5.248  1.00 0.14  ? 1122 ILE A CB   9  
ATOM   5361  C  CG1  . ILE A 1 20 ? 4.777   -1.474  -4.080  1.00 0.13  ? 1122 ILE A CG1  9  
ATOM   5362  C  CG2  . ILE A 1 20 ? 5.597   -3.668  -4.994  1.00 0.19  ? 1122 ILE A CG2  9  
ATOM   5363  C  CD1  . ILE A 1 20 ? 3.374   -1.974  -3.835  1.00 0.17  ? 1122 ILE A CD1  9  
ATOM   5364  H  H    . ILE A 1 20 ? 7.534   -1.123  -3.539  1.00 0.22  ? 1122 ILE A H    9  
ATOM   5365  H  HA   . ILE A 1 20 ? 7.324   -2.073  -6.317  1.00 0.17  ? 1122 ILE A HA   9  
ATOM   5366  H  HB   . ILE A 1 20 ? 4.883   -2.033  -6.140  1.00 0.16  ? 1122 ILE A HB   9  
ATOM   5367  H  HG12 . ILE A 1 20 ? 5.350   -1.635  -3.182  1.00 0.15  ? 1122 ILE A HG12 9  
ATOM   5368  H  HG13 . ILE A 1 20 ? 4.723   -0.412  -4.282  1.00 0.14  ? 1122 ILE A HG13 9  
ATOM   5369  H  HG21 . ILE A 1 20 ? 6.282   -3.840  -4.178  1.00 0.98  ? 1122 ILE A HG21 9  
ATOM   5370  H  HG22 . ILE A 1 20 ? 5.965   -4.156  -5.884  1.00 1.05  ? 1122 ILE A HG22 9  
ATOM   5371  H  HG23 . ILE A 1 20 ? 4.627   -4.070  -4.738  1.00 0.97  ? 1122 ILE A HG23 9  
ATOM   5372  H  HD11 . ILE A 1 20 ? 3.405   -3.030  -3.604  1.00 1.07  ? 1122 ILE A HD11 9  
ATOM   5373  H  HD12 . ILE A 1 20 ? 2.777   -1.815  -4.721  1.00 0.99  ? 1122 ILE A HD12 9  
ATOM   5374  H  HD13 . ILE A 1 20 ? 2.939   -1.436  -3.005  1.00 1.03  ? 1122 ILE A HD13 9  
ATOM   5375  N  N    . SER A 1 21 ? 6.090   0.150   -7.014  1.00 0.16  ? 1123 SER A N    9  
ATOM   5376  C  CA   . SER A 1 21 ? 5.772   1.502   -7.434  1.00 0.17  ? 1123 SER A CA   9  
ATOM   5377  C  C    . SER A 1 21 ? 4.636   2.053   -6.586  1.00 0.15  ? 1123 SER A C    9  
ATOM   5378  O  O    . SER A 1 21 ? 3.726   1.319   -6.201  1.00 0.17  ? 1123 SER A O    9  
ATOM   5379  C  CB   . SER A 1 21 ? 5.377   1.501   -8.913  1.00 0.24  ? 1123 SER A CB   9  
ATOM   5380  O  OG   . SER A 1 21 ? 4.773   2.727   -9.299  1.00 0.33  ? 1123 SER A OG   9  
ATOM   5381  H  H    . SER A 1 21 ? 5.854   -0.601  -7.598  1.00 0.20  ? 1123 SER A H    9  
ATOM   5382  H  HA   . SER A 1 21 ? 6.650   2.114   -7.296  1.00 0.19  ? 1123 SER A HA   9  
ATOM   5383  H  HB2  . SER A 1 21 ? 6.258   1.350   -9.515  1.00 0.27  ? 1123 SER A HB2  9  
ATOM   5384  H  HB3  . SER A 1 21 ? 4.677   0.699   -9.093  1.00 0.24  ? 1123 SER A HB3  9  
ATOM   5385  H  HG   . SER A 1 21 ? 5.157   3.454   -8.795  1.00 0.63  ? 1123 SER A HG   9  
ATOM   5386  N  N    . LYS A 1 22 ? 4.684   3.349   -6.298  1.00 0.17  ? 1124 LYS A N    9  
ATOM   5387  C  CA   . LYS A 1 22 ? 3.598   4.003   -5.582  1.00 0.19  ? 1124 LYS A CA   9  
ATOM   5388  C  C    . LYS A 1 22 ? 2.352   4.066   -6.461  1.00 0.22  ? 1124 LYS A C    9  
ATOM   5389  O  O    . LYS A 1 22 ? 1.263   4.399   -5.991  1.00 0.25  ? 1124 LYS A O    9  
ATOM   5390  C  CB   . LYS A 1 22 ? 3.997   5.409   -5.129  1.00 0.23  ? 1124 LYS A CB   9  
ATOM   5391  C  CG   . LYS A 1 22 ? 4.999   5.425   -3.986  1.00 0.25  ? 1124 LYS A CG   9  
ATOM   5392  C  CD   . LYS A 1 22 ? 5.301   6.844   -3.536  1.00 0.25  ? 1124 LYS A CD   9  
ATOM   5393  C  CE   . LYS A 1 22 ? 6.295   6.868   -2.387  1.00 0.30  ? 1124 LYS A CE   9  
ATOM   5394  N  NZ   . LYS A 1 22 ? 6.534   8.249   -1.890  1.00 1.24  ? 1124 LYS A NZ   9  
ATOM   5395  H  H    . LYS A 1 22 ? 5.466   3.878   -6.575  1.00 0.20  ? 1124 LYS A H    9  
ATOM   5396  H  HA   . LYS A 1 22 ? 3.380   3.403   -4.711  1.00 0.19  ? 1124 LYS A HA   9  
ATOM   5397  H  HB2  . LYS A 1 22 ? 4.430   5.936   -5.966  1.00 0.30  ? 1124 LYS A HB2  9  
ATOM   5398  H  HB3  . LYS A 1 22 ? 3.109   5.935   -4.806  1.00 0.30  ? 1124 LYS A HB3  9  
ATOM   5399  H  HG2  . LYS A 1 22 ? 4.589   4.872   -3.154  1.00 0.37  ? 1124 LYS A HG2  9  
ATOM   5400  H  HG3  . LYS A 1 22 ? 5.915   4.956   -4.315  1.00 0.37  ? 1124 LYS A HG3  9  
ATOM   5401  H  HD2  . LYS A 1 22 ? 5.717   7.393   -4.367  1.00 0.32  ? 1124 LYS A HD2  9  
ATOM   5402  H  HD3  . LYS A 1 22 ? 4.383   7.313   -3.216  1.00 0.33  ? 1124 LYS A HD3  9  
ATOM   5403  H  HE2  . LYS A 1 22 ? 5.907   6.268   -1.578  1.00 0.93  ? 1124 LYS A HE2  9  
ATOM   5404  H  HE3  . LYS A 1 22 ? 7.230   6.451   -2.728  1.00 0.95  ? 1124 LYS A HE3  9  
ATOM   5405  H  HZ1  . LYS A 1 22 ? 6.854   8.861   -2.667  1.00 1.76  ? 1124 LYS A HZ1  9  
ATOM   5406  H  HZ2  . LYS A 1 22 ? 7.264   8.242   -1.149  1.00 1.77  ? 1124 LYS A HZ2  9  
ATOM   5407  H  HZ3  . LYS A 1 22 ? 5.658   8.644   -1.491  1.00 1.88  ? 1124 LYS A HZ3  9  
ATOM   5408  N  N    . ASN A 1 23 ? 2.524   3.749   -7.743  1.00 0.24  ? 1125 ASN A N    9  
ATOM   5409  C  CA   . ASN A 1 23 ? 1.398   3.643   -8.663  1.00 0.28  ? 1125 ASN A CA   9  
ATOM   5410  C  C    . ASN A 1 23 ? 0.704   2.303   -8.477  1.00 0.26  ? 1125 ASN A C    9  
ATOM   5411  O  O    . ASN A 1 23 ? -0.456  2.131   -8.842  1.00 0.32  ? 1125 ASN A O    9  
ATOM   5412  C  CB   . ASN A 1 23 ? 1.851   3.783   -10.123 1.00 0.36  ? 1125 ASN A CB   9  
ATOM   5413  C  CG   . ASN A 1 23 ? 2.382   5.166   -10.461 1.00 1.03  ? 1125 ASN A CG   9  
ATOM   5414  O  OD1  . ASN A 1 23 ? 2.960   5.855   -9.619  1.00 1.75  ? 1125 ASN A OD1  9  
ATOM   5415  N  ND2  . ASN A 1 23 ? 2.192   5.580   -11.702 1.00 1.69  ? 1125 ASN A ND2  9  
ATOM   5416  H  H    . ASN A 1 23 ? 3.429   3.585   -8.077  1.00 0.25  ? 1125 ASN A H    9  
ATOM   5417  H  HA   . ASN A 1 23 ? 0.700   4.433   -8.430  1.00 0.31  ? 1125 ASN A HA   9  
ATOM   5418  H  HB2  . ASN A 1 23 ? 2.634   3.065   -10.318 1.00 0.82  ? 1125 ASN A HB2  9  
ATOM   5419  H  HB3  . ASN A 1 23 ? 1.012   3.574   -10.770 1.00 0.82  ? 1125 ASN A HB3  9  
ATOM   5420  H  HD21 . ASN A 1 23 ? 1.724   4.981   -12.326 1.00 1.99  ? 1125 ASN A HD21 9  
ATOM   5421  H  HD22 . ASN A 1 23 ? 2.527   6.465   -11.954 1.00 2.22  ? 1125 ASN A HD22 9  
ATOM   5422  N  N    . TRP A 1 24 ? 1.426   1.356   -7.894  1.00 0.22  ? 1126 TRP A N    9  
ATOM   5423  C  CA   . TRP A 1 24 ? 0.897   0.021   -7.658  1.00 0.22  ? 1126 TRP A CA   9  
ATOM   5424  C  C    . TRP A 1 24 ? 0.168   -0.031  -6.321  1.00 0.20  ? 1126 TRP A C    9  
ATOM   5425  O  O    . TRP A 1 24 ? -0.559  -0.977  -6.035  1.00 0.26  ? 1126 TRP A O    9  
ATOM   5426  C  CB   . TRP A 1 24 ? 2.024   -1.017  -7.674  1.00 0.25  ? 1126 TRP A CB   9  
ATOM   5427  C  CG   . TRP A 1 24 ? 2.675   -1.193  -9.017  1.00 0.31  ? 1126 TRP A CG   9  
ATOM   5428  C  CD1  . TRP A 1 24 ? 2.380   -0.525  -10.171 1.00 0.37  ? 1126 TRP A CD1  9  
ATOM   5429  C  CD2  . TRP A 1 24 ? 3.731   -2.105  -9.342  1.00 0.38  ? 1126 TRP A CD2  9  
ATOM   5430  N  NE1  . TRP A 1 24 ? 3.191   -0.962  -11.189 1.00 0.45  ? 1126 TRP A NE1  9  
ATOM   5431  C  CE2  . TRP A 1 24 ? 4.026   -1.932  -10.706 1.00 0.45  ? 1126 TRP A CE2  9  
ATOM   5432  C  CE3  . TRP A 1 24 ? 4.457   -3.050  -8.611  1.00 0.44  ? 1126 TRP A CE3  9  
ATOM   5433  C  CZ2  . TRP A 1 24 ? 5.014   -2.667  -11.352 1.00 0.54  ? 1126 TRP A CZ2  9  
ATOM   5434  C  CZ3  . TRP A 1 24 ? 5.437   -3.781  -9.255  1.00 0.55  ? 1126 TRP A CZ3  9  
ATOM   5435  C  CH2  . TRP A 1 24 ? 5.709   -3.584  -10.614 1.00 0.58  ? 1126 TRP A CH2  9  
ATOM   5436  H  H    . TRP A 1 24 ? 2.341   1.561   -7.608  1.00 0.23  ? 1126 TRP A H    9  
ATOM   5437  H  HA   . TRP A 1 24 ? 0.197   -0.205  -8.449  1.00 0.25  ? 1126 TRP A HA   9  
ATOM   5438  H  HB2  . TRP A 1 24 ? 2.789   -0.718  -6.973  1.00 0.27  ? 1126 TRP A HB2  9  
ATOM   5439  H  HB3  . TRP A 1 24 ? 1.623   -1.971  -7.369  1.00 0.28  ? 1126 TRP A HB3  9  
ATOM   5440  H  HD1  . TRP A 1 24 ? 1.621   0.237   -10.254 1.00 0.40  ? 1126 TRP A HD1  9  
ATOM   5441  H  HE1  . TRP A 1 24 ? 3.172   -0.637  -12.114 1.00 0.53  ? 1126 TRP A HE1  9  
ATOM   5442  H  HE3  . TRP A 1 24 ? 4.261   -3.218  -7.564  1.00 0.45  ? 1126 TRP A HE3  9  
ATOM   5443  H  HZ2  . TRP A 1 24 ? 5.238   -2.528  -12.400 1.00 0.61  ? 1126 TRP A HZ2  9  
ATOM   5444  H  HZ3  . TRP A 1 24 ? 6.008   -4.515  -8.707  1.00 0.62  ? 1126 TRP A HZ3  9  
ATOM   5445  H  HH2  . TRP A 1 24 ? 6.484   -4.176  -11.077 1.00 0.67  ? 1126 TRP A HH2  9  
ATOM   5446  N  N    . VAL A 1 25 ? 0.372   0.990   -5.507  1.00 0.19  ? 1127 VAL A N    9  
ATOM   5447  C  CA   . VAL A 1 25 ? -0.288  1.084   -4.213  1.00 0.18  ? 1127 VAL A CA   9  
ATOM   5448  C  C    . VAL A 1 25 ? -1.777  1.351   -4.394  1.00 0.19  ? 1127 VAL A C    9  
ATOM   5449  O  O    . VAL A 1 25 ? -2.163  2.351   -5.003  1.00 0.23  ? 1127 VAL A O    9  
ATOM   5450  C  CB   . VAL A 1 25 ? 0.332   2.204   -3.351  1.00 0.21  ? 1127 VAL A CB   9  
ATOM   5451  C  CG1  . VAL A 1 25 ? -0.390  2.340   -2.018  1.00 0.24  ? 1127 VAL A CG1  9  
ATOM   5452  C  CG2  . VAL A 1 25 ? 1.810   1.939   -3.134  1.00 0.24  ? 1127 VAL A CG2  9  
ATOM   5453  H  H    . VAL A 1 25 ? 0.983   1.700   -5.784  1.00 0.21  ? 1127 VAL A H    9  
ATOM   5454  H  HA   . VAL A 1 25 ? -0.158  0.141   -3.699  1.00 0.19  ? 1127 VAL A HA   9  
ATOM   5455  H  HB   . VAL A 1 25 ? 0.232   3.137   -3.886  1.00 0.23  ? 1127 VAL A HB   9  
ATOM   5456  H  HG11 . VAL A 1 25 ? -1.426  2.589   -2.194  1.00 1.01  ? 1127 VAL A HG11 9  
ATOM   5457  H  HG12 . VAL A 1 25 ? 0.074   3.120   -1.435  1.00 1.02  ? 1127 VAL A HG12 9  
ATOM   5458  H  HG13 . VAL A 1 25 ? -0.331  1.405   -1.480  1.00 1.00  ? 1127 VAL A HG13 9  
ATOM   5459  H  HG21 . VAL A 1 25 ? 2.301   1.834   -4.089  1.00 1.05  ? 1127 VAL A HG21 9  
ATOM   5460  H  HG22 . VAL A 1 25 ? 1.933   1.030   -2.564  1.00 1.06  ? 1127 VAL A HG22 9  
ATOM   5461  H  HG23 . VAL A 1 25 ? 2.248   2.765   -2.593  1.00 1.01  ? 1127 VAL A HG23 9  
ATOM   5462  N  N    . CYS A 1 26 ? -2.601  0.441   -3.879  1.00 0.19  ? 1128 CYS A N    9  
ATOM   5463  C  CA   . CYS A 1 26 ? -4.054  0.560   -3.968  1.00 0.26  ? 1128 CYS A CA   9  
ATOM   5464  C  C    . CYS A 1 26 ? -4.504  0.510   -5.430  1.00 0.27  ? 1128 CYS A C    9  
ATOM   5465  O  O    . CYS A 1 26 ? -5.275  1.350   -5.898  1.00 0.37  ? 1128 CYS A O    9  
ATOM   5466  C  CB   . CYS A 1 26 ? -4.537  1.851   -3.289  1.00 0.32  ? 1128 CYS A CB   9  
ATOM   5467  S  SG   . CYS A 1 26 ? -6.351  2.002   -3.157  1.00 0.58  ? 1128 CYS A SG   9  
ATOM   5468  H  H    . CYS A 1 26 ? -2.216  -0.345  -3.431  1.00 0.19  ? 1128 CYS A H    9  
ATOM   5469  H  HA   . CYS A 1 26 ? -4.484  -0.285  -3.450  1.00 0.28  ? 1128 CYS A HA   9  
ATOM   5470  H  HB2  . CYS A 1 26 ? -4.132  1.894   -2.290  1.00 0.36  ? 1128 CYS A HB2  9  
ATOM   5471  H  HB3  . CYS A 1 26 ? -4.178  2.700   -3.853  1.00 0.36  ? 1128 CYS A HB3  9  
ATOM   5472  N  N    . ASP A 1 27 ? -4.002  -0.481  -6.151  1.00 0.25  ? 1129 ASP A N    9  
ATOM   5473  C  CA   . ASP A 1 27 ? -4.343  -0.657  -7.559  1.00 0.30  ? 1129 ASP A CA   9  
ATOM   5474  C  C    . ASP A 1 27 ? -5.123  -1.953  -7.741  1.00 0.37  ? 1129 ASP A C    9  
ATOM   5475  O  O    . ASP A 1 27 ? -5.312  -2.434  -8.860  1.00 0.41  ? 1129 ASP A O    9  
ATOM   5476  C  CB   . ASP A 1 27 ? -3.076  -0.677  -8.421  1.00 0.31  ? 1129 ASP A CB   9  
ATOM   5477  C  CG   . ASP A 1 27 ? -2.368  -2.020  -8.407  1.00 0.35  ? 1129 ASP A CG   9  
ATOM   5478  O  OD1  . ASP A 1 27 ? -2.259  -2.640  -7.323  1.00 0.31  ? 1129 ASP A OD1  9  
ATOM   5479  O  OD2  . ASP A 1 27 ? -1.912  -2.456  -9.485  1.00 0.46  ? 1129 ASP A OD2  9  
ATOM   5480  H  H    . ASP A 1 27 ? -3.389  -1.121  -5.722  1.00 0.24  ? 1129 ASP A H    9  
ATOM   5481  H  HA   . ASP A 1 27 ? -4.965  0.173   -7.858  1.00 0.33  ? 1129 ASP A HA   9  
ATOM   5482  H  HB2  . ASP A 1 27 ? -3.341  -0.445  -9.442  1.00 0.36  ? 1129 ASP A HB2  9  
ATOM   5483  H  HB3  . ASP A 1 27 ? -2.391  0.073   -8.054  1.00 0.29  ? 1129 ASP A HB3  9  
ATOM   5484  N  N    . THR A 1 28 ? -5.554  -2.509  -6.611  1.00 0.45  ? 1130 THR A N    9  
ATOM   5485  C  CA   . THR A 1 28 ? -6.316  -3.756  -6.549  1.00 0.56  ? 1130 THR A CA   9  
ATOM   5486  C  C    . THR A 1 28 ? -5.586  -4.917  -7.226  1.00 0.61  ? 1130 THR A C    9  
ATOM   5487  O  O    . THR A 1 28 ? -6.212  -5.822  -7.779  1.00 0.73  ? 1130 THR A O    9  
ATOM   5488  C  CB   . THR A 1 28 ? -7.753  -3.614  -7.115  1.00 0.59  ? 1130 THR A CB   9  
ATOM   5489  O  OG1  . THR A 1 28 ? -7.739  -3.266  -8.508  1.00 0.56  ? 1130 THR A OG1  9  
ATOM   5490  C  CG2  . THR A 1 28 ? -8.531  -2.562  -6.339  1.00 0.65  ? 1130 THR A CG2  9  
ATOM   5491  H  H    . THR A 1 28 ? -5.337  -2.059  -5.762  1.00 0.46  ? 1130 THR A H    9  
ATOM   5492  H  HA   . THR A 1 28 ? -6.409  -4.002  -5.502  1.00 0.64  ? 1130 THR A HA   9  
ATOM   5493  H  HB   . THR A 1 28 ? -8.259  -4.560  -7.001  1.00 0.67  ? 1130 THR A HB   9  
ATOM   5494  H  HG1  . THR A 1 28 ? -6.834  -3.057  -8.775  1.00 0.53  ? 1130 THR A HG1  9  
ATOM   5495  H  HG21 . THR A 1 28 ? -9.516  -2.456  -6.768  1.00 1.34  ? 1130 THR A HG21 9  
ATOM   5496  H  HG22 . THR A 1 28 ? -8.010  -1.619  -6.394  1.00 1.09  ? 1130 THR A HG22 9  
ATOM   5497  H  HG23 . THR A 1 28 ? -8.618  -2.868  -5.308  1.00 1.21  ? 1130 THR A HG23 9  
ATOM   5498  N  N    . ASP A 1 29 ? -4.260  -4.886  -7.180  1.00 0.59  ? 1131 ASP A N    9  
ATOM   5499  C  CA   . ASP A 1 29 ? -3.460  -5.996  -7.676  1.00 0.69  ? 1131 ASP A CA   9  
ATOM   5500  C  C    . ASP A 1 29 ? -2.411  -6.389  -6.646  1.00 0.67  ? 1131 ASP A C    9  
ATOM   5501  O  O    . ASP A 1 29 ? -1.899  -5.535  -5.905  1.00 0.53  ? 1131 ASP A O    9  
ATOM   5502  C  CB   . ASP A 1 29 ? -2.788  -5.644  -9.000  1.00 0.75  ? 1131 ASP A CB   9  
ATOM   5503  C  CG   . ASP A 1 29 ? -2.179  -6.861  -9.670  1.00 0.92  ? 1131 ASP A CG   9  
ATOM   5504  O  OD1  . ASP A 1 29 ? -2.929  -7.700  -10.208 1.00 1.21  ? 1131 ASP A OD1  9  
ATOM   5505  O  OD2  . ASP A 1 29 ? -0.939  -6.982  -9.671  1.00 0.92  ? 1131 ASP A OD2  9  
ATOM   5506  H  H    . ASP A 1 29 ? -3.807  -4.094  -6.817  1.00 0.55  ? 1131 ASP A H    9  
ATOM   5507  H  HA   . ASP A 1 29 ? -4.123  -6.834  -7.831  1.00 0.81  ? 1131 ASP A HA   9  
ATOM   5508  H  HB2  . ASP A 1 29 ? -3.521  -5.216  -9.667  1.00 0.81  ? 1131 ASP A HB2  9  
ATOM   5509  H  HB3  . ASP A 1 29 ? -2.004  -4.923  -8.820  1.00 0.68  ? 1131 ASP A HB3  9  
ATOM   5510  N  N    . ASN A 1 30 ? -2.105  -7.683  -6.599  1.00 0.94  ? 1132 ASN A N    9  
ATOM   5511  C  CA   . ASN A 1 30 ? -1.167  -8.222  -5.622  1.00 1.00  ? 1132 ASN A CA   9  
ATOM   5512  C  C    . ASN A 1 30 ? 0.273   -8.042  -6.083  1.00 0.91  ? 1132 ASN A C    9  
ATOM   5513  O  O    . ASN A 1 30 ? 0.852   -8.918  -6.729  1.00 1.06  ? 1132 ASN A O    9  
ATOM   5514  C  CB   . ASN A 1 30 ? -1.441  -9.707  -5.357  1.00 1.29  ? 1132 ASN A CB   9  
ATOM   5515  C  CG   . ASN A 1 30 ? -2.789  -9.952  -4.712  1.00 1.72  ? 1132 ASN A CG   9  
ATOM   5516  O  OD1  . ASN A 1 30 ? -2.931  -9.886  -3.490  1.00 2.58  ? 1132 ASN A OD1  9  
ATOM   5517  N  ND2  . ASN A 1 30 ? -3.788  -10.258 -5.523  1.00 2.07  ? 1132 ASN A ND2  9  
ATOM   5518  H  H    . ASN A 1 30 ? -2.521  -8.292  -7.245  1.00 1.15  ? 1132 ASN A H    9  
ATOM   5519  H  HA   . ASN A 1 30 ? -1.304  -7.676  -4.703  1.00 0.97  ? 1132 ASN A HA   9  
ATOM   5520  H  HB2  . ASN A 1 30 ? -1.412  -10.243 -6.293  1.00 1.52  ? 1132 ASN A HB2  9  
ATOM   5521  H  HB3  . ASN A 1 30 ? -0.674  -10.095 -4.701  1.00 1.97  ? 1132 ASN A HB3  9  
ATOM   5522  H  HD21 . ASN A 1 30 ? -3.605  -10.312 -6.487  1.00 2.11  ? 1132 ASN A HD21 9  
ATOM   5523  H  HD22 . ASN A 1 30 ? -4.678  -10.410 -5.130  1.00 2.73  ? 1132 ASN A HD22 9  
ATOM   5524  N  N    . ASP A 1 31 ? 0.842   -6.902  -5.743  1.00 0.86  ? 1133 ASP A N    9  
ATOM   5525  C  CA   . ASP A 1 31 ? 2.223   -6.596  -6.081  1.00 0.77  ? 1133 ASP A CA   9  
ATOM   5526  C  C    . ASP A 1 31 ? 3.130   -6.883  -4.894  1.00 0.78  ? 1133 ASP A C    9  
ATOM   5527  O  O    . ASP A 1 31 ? 4.343   -7.039  -5.048  1.00 1.28  ? 1133 ASP A O    9  
ATOM   5528  C  CB   . ASP A 1 31 ? 2.365   -5.134  -6.520  1.00 0.67  ? 1133 ASP A CB   9  
ATOM   5529  C  CG   . ASP A 1 31 ? 1.185   -4.283  -6.103  1.00 0.58  ? 1133 ASP A CG   9  
ATOM   5530  O  OD1  . ASP A 1 31 ? 0.935   -4.148  -4.893  1.00 1.00  ? 1133 ASP A OD1  9  
ATOM   5531  O  OD2  . ASP A 1 31 ? 0.514   -3.701  -6.969  1.00 1.09  ? 1133 ASP A OD2  9  
ATOM   5532  H  H    . ASP A 1 31 ? 0.319   -6.240  -5.236  1.00 1.05  ? 1133 ASP A H    9  
ATOM   5533  H  HA   . ASP A 1 31 ? 2.512   -7.237  -6.901  1.00 0.87  ? 1133 ASP A HA   9  
ATOM   5534  H  HB2  . ASP A 1 31 ? 3.256   -4.716  -6.078  1.00 1.04  ? 1133 ASP A HB2  9  
ATOM   5535  H  HB3  . ASP A 1 31 ? 2.452   -5.094  -7.595  1.00 1.05  ? 1133 ASP A HB3  9  
ATOM   5536  N  N    . CYS A 1 32 ? 2.533   -6.963  -3.715  1.00 0.76  ? 1134 CYS A N    9  
ATOM   5537  C  CA   . CYS A 1 32 ? 3.253   -7.334  -2.508  1.00 0.78  ? 1134 CYS A CA   9  
ATOM   5538  C  C    . CYS A 1 32 ? 2.666   -8.611  -1.920  1.00 0.85  ? 1134 CYS A C    9  
ATOM   5539  O  O    . CYS A 1 32 ? 1.459   -8.846  -2.008  1.00 1.57  ? 1134 CYS A O    9  
ATOM   5540  C  CB   . CYS A 1 32 ? 3.201   -6.207  -1.476  1.00 0.82  ? 1134 CYS A CB   9  
ATOM   5541  S  SG   . CYS A 1 32 ? 4.190   -4.749  -1.931  1.00 1.16  ? 1134 CYS A SG   9  
ATOM   5542  H  H    . CYS A 1 32 ? 1.573   -6.761  -3.654  1.00 1.11  ? 1134 CYS A H    9  
ATOM   5543  H  HA   . CYS A 1 32 ? 4.281   -7.514  -2.781  1.00 0.88  ? 1134 CYS A HA   9  
ATOM   5544  H  HB2  . CYS A 1 32 ? 2.177   -5.886  -1.355  1.00 1.25  ? 1134 CYS A HB2  9  
ATOM   5545  H  HB3  . CYS A 1 32 ? 3.571   -6.576  -0.531  1.00 1.22  ? 1134 CYS A HB3  9  
ATOM   5546  N  N    . GLY A 1 33 ? 3.519   -9.430  -1.316  1.00 1.17  ? 1135 GLY A N    9  
ATOM   5547  C  CA   . GLY A 1 33 ? 3.082   -10.707 -0.777  1.00 1.22  ? 1135 GLY A CA   9  
ATOM   5548  C  C    . GLY A 1 33 ? 2.401   -10.578 0.571   1.00 1.18  ? 1135 GLY A C    9  
ATOM   5549  O  O    . GLY A 1 33 ? 2.706   -11.328 1.503   1.00 1.68  ? 1135 GLY A O    9  
ATOM   5550  H  H    . GLY A 1 33 ? 4.461   -9.166  -1.232  1.00 1.82  ? 1135 GLY A H    9  
ATOM   5551  H  HA2  . GLY A 1 33 ? 2.391   -11.158 -1.473  1.00 1.26  ? 1135 GLY A HA2  9  
ATOM   5552  H  HA3  . GLY A 1 33 ? 3.941   -11.353 -0.672  1.00 1.39  ? 1135 GLY A HA3  9  
ATOM   5553  N  N    . ASP A 1 34 ? 1.476   -9.634  0.666   1.00 1.02  ? 1136 ASP A N    9  
ATOM   5554  C  CA   . ASP A 1 34 ? 0.709   -9.404  1.887   1.00 1.11  ? 1136 ASP A CA   9  
ATOM   5555  C  C    . ASP A 1 34 ? -0.510  -8.534  1.601   1.00 0.93  ? 1136 ASP A C    9  
ATOM   5556  O  O    . ASP A 1 34 ? -1.580  -8.737  2.178   1.00 1.35  ? 1136 ASP A O    9  
ATOM   5557  C  CB   . ASP A 1 34 ? 1.569   -8.778  3.003   1.00 1.44  ? 1136 ASP A CB   9  
ATOM   5558  C  CG   . ASP A 1 34 ? 2.414   -7.594  2.556   1.00 2.10  ? 1136 ASP A CG   9  
ATOM   5559  O  OD1  . ASP A 1 34 ? 1.875   -6.715  1.848   1.00 2.85  ? 1136 ASP A OD1  9  
ATOM   5560  O  OD2  . ASP A 1 34 ? 3.618   -7.542  2.885   1.00 2.47  ? 1136 ASP A OD2  9  
ATOM   5561  H  H    . ASP A 1 34 ? 1.286   -9.081  -0.123  1.00 1.22  ? 1136 ASP A H    9  
ATOM   5562  H  HA   . ASP A 1 34 ? 0.358   -10.368 2.225   1.00 1.27  ? 1136 ASP A HA   9  
ATOM   5563  H  HB2  . ASP A 1 34 ? 0.918   -8.443  3.795   1.00 1.68  ? 1136 ASP A HB2  9  
ATOM   5564  H  HB3  . ASP A 1 34 ? 2.232   -9.538  3.395   1.00 1.84  ? 1136 ASP A HB3  9  
ATOM   5565  N  N    . GLY A 1 35 ? -0.352  -7.586  0.686   1.00 0.62  ? 1137 GLY A N    9  
ATOM   5566  C  CA   . GLY A 1 35 ? -1.451  -6.723  0.306   1.00 0.49  ? 1137 GLY A CA   9  
ATOM   5567  C  C    . GLY A 1 35 ? -1.503  -5.470  1.152   1.00 0.36  ? 1137 GLY A C    9  
ATOM   5568  O  O    . GLY A 1 35 ? -2.527  -4.783  1.202   1.00 0.36  ? 1137 GLY A O    9  
ATOM   5569  H  H    . GLY A 1 35 ? 0.530   -7.458  0.281   1.00 0.82  ? 1137 GLY A H    9  
ATOM   5570  H  HA2  . GLY A 1 35 ? -1.335  -6.443  -0.729  1.00 0.51  ? 1137 GLY A HA2  9  
ATOM   5571  H  HA3  . GLY A 1 35 ? -2.378  -7.264  0.422   1.00 0.72  ? 1137 GLY A HA3  9  
ATOM   5572  N  N    . SER A 1 36 ? -0.391  -5.164  1.806   1.00 0.32  ? 1138 SER A N    9  
ATOM   5573  C  CA   . SER A 1 36 ? -0.314  -4.013  2.693   1.00 0.28  ? 1138 SER A CA   9  
ATOM   5574  C  C    . SER A 1 36 ? -0.380  -2.699  1.910   1.00 0.25  ? 1138 SER A C    9  
ATOM   5575  O  O    . SER A 1 36 ? -0.766  -1.662  2.456   1.00 0.40  ? 1138 SER A O    9  
ATOM   5576  C  CB   . SER A 1 36 ? 0.965   -4.088  3.534   1.00 0.33  ? 1138 SER A CB   9  
ATOM   5577  O  OG   . SER A 1 36 ? 2.113   -4.247  2.719   1.00 0.44  ? 1138 SER A OG   9  
ATOM   5578  H  H    . SER A 1 36 ? 0.404   -5.739  1.698   1.00 0.37  ? 1138 SER A H    9  
ATOM   5579  H  HA   . SER A 1 36 ? -1.167  -4.058  3.357   1.00 0.33  ? 1138 SER A HA   9  
ATOM   5580  H  HB2  . SER A 1 36 ? 1.071   -3.182  4.111   1.00 0.40  ? 1138 SER A HB2  9  
ATOM   5581  H  HB3  . SER A 1 36 ? 0.900   -4.930  4.205   1.00 0.39  ? 1138 SER A HB3  9  
ATOM   5582  H  HG   . SER A 1 36 ? 2.103   -5.139  2.321   1.00 1.17  ? 1138 SER A HG   9  
ATOM   5583  N  N    . ASP A 1 37 ? -0.029  -2.745  0.628   1.00 0.18  ? 1139 ASP A N    9  
ATOM   5584  C  CA   . ASP A 1 37 ? -0.119  -1.567  -0.229  1.00 0.18  ? 1139 ASP A CA   9  
ATOM   5585  C  C    . ASP A 1 37 ? -1.584  -1.214  -0.471  1.00 0.20  ? 1139 ASP A C    9  
ATOM   5586  O  O    . ASP A 1 37 ? -1.947  -0.049  -0.600  1.00 0.29  ? 1139 ASP A O    9  
ATOM   5587  C  CB   . ASP A 1 37 ? 0.572   -1.801  -1.575  1.00 0.19  ? 1139 ASP A CB   9  
ATOM   5588  C  CG   . ASP A 1 37 ? -0.270  -2.636  -2.515  1.00 0.26  ? 1139 ASP A CG   9  
ATOM   5589  O  OD1  . ASP A 1 37 ? -0.448  -3.842  -2.251  1.00 0.33  ? 1139 ASP A OD1  9  
ATOM   5590  O  OD2  . ASP A 1 37 ? -0.788  -2.080  -3.506  1.00 0.32  ? 1139 ASP A OD2  9  
ATOM   5591  H  H    . ASP A 1 37 ? 0.303   -3.588  0.250   1.00 0.26  ? 1139 ASP A H    9  
ATOM   5592  H  HA   . ASP A 1 37 ? 0.362   -0.745  0.279   1.00 0.20  ? 1139 ASP A HA   9  
ATOM   5593  H  HB2  . ASP A 1 37 ? 0.762   -0.848  -2.044  1.00 0.22  ? 1139 ASP A HB2  9  
ATOM   5594  H  HB3  . ASP A 1 37 ? 1.508   -2.309  -1.410  1.00 0.19  ? 1139 ASP A HB3  9  
ATOM   5595  N  N    . GLU A 1 38 ? -2.421  -2.237  -0.515  1.00 0.22  ? 1140 GLU A N    9  
ATOM   5596  C  CA   . GLU A 1 38 ? -3.840  -2.051  -0.748  1.00 0.27  ? 1140 GLU A CA   9  
ATOM   5597  C  C    . GLU A 1 38 ? -4.536  -1.615  0.536   1.00 0.31  ? 1140 GLU A C    9  
ATOM   5598  O  O    . GLU A 1 38 ? -5.562  -0.939  0.502   1.00 0.44  ? 1140 GLU A O    9  
ATOM   5599  C  CB   . GLU A 1 38 ? -4.464  -3.352  -1.260  1.00 0.29  ? 1140 GLU A CB   9  
ATOM   5600  C  CG   . GLU A 1 38 ? -3.861  -3.865  -2.564  1.00 0.29  ? 1140 GLU A CG   9  
ATOM   5601  C  CD   . GLU A 1 38 ? -4.115  -2.942  -3.739  1.00 0.28  ? 1140 GLU A CD   9  
ATOM   5602  O  OE1  . GLU A 1 38 ? -5.214  -2.351  -3.809  1.00 0.38  ? 1140 GLU A OE1  9  
ATOM   5603  O  OE2  . GLU A 1 38 ? -3.220  -2.805  -4.603  1.00 0.28  ? 1140 GLU A OE2  9  
ATOM   5604  H  H    . GLU A 1 38 ? -2.070  -3.147  -0.399  1.00 0.24  ? 1140 GLU A H    9  
ATOM   5605  H  HA   . GLU A 1 38 ? -3.961  -1.281  -1.495  1.00 0.30  ? 1140 GLU A HA   9  
ATOM   5606  H  HB2  . GLU A 1 38 ? -4.335  -4.117  -0.508  1.00 0.32  ? 1140 GLU A HB2  9  
ATOM   5607  H  HB3  . GLU A 1 38 ? -5.520  -3.191  -1.417  1.00 0.33  ? 1140 GLU A HB3  9  
ATOM   5608  H  HG2  . GLU A 1 38 ? -2.794  -3.970  -2.435  1.00 0.29  ? 1140 GLU A HG2  9  
ATOM   5609  H  HG3  . GLU A 1 38 ? -4.291  -4.831  -2.786  1.00 0.33  ? 1140 GLU A HG3  9  
ATOM   5610  N  N    . LYS A 1 39 ? -3.961  -1.989  1.674   1.00 0.30  ? 1141 LYS A N    9  
ATOM   5611  C  CA   . LYS A 1 39 ? -4.601  -1.743  2.959   1.00 0.37  ? 1141 LYS A CA   9  
ATOM   5612  C  C    . LYS A 1 39 ? -4.342  -0.324  3.455   1.00 0.49  ? 1141 LYS A C    9  
ATOM   5613  O  O    . LYS A 1 39 ? -5.148  0.235   4.195   1.00 0.57  ? 1141 LYS A O    9  
ATOM   5614  C  CB   . LYS A 1 39 ? -4.139  -2.765  4.004   1.00 0.47  ? 1141 LYS A CB   9  
ATOM   5615  C  CG   . LYS A 1 39 ? -2.793  -2.474  4.643   1.00 0.57  ? 1141 LYS A CG   9  
ATOM   5616  C  CD   . LYS A 1 39 ? -2.416  -3.570  5.625   1.00 0.76  ? 1141 LYS A CD   9  
ATOM   5617  C  CE   . LYS A 1 39 ? -1.136  -3.253  6.377   1.00 0.91  ? 1141 LYS A CE   9  
ATOM   5618  N  NZ   . LYS A 1 39 ? -0.817  -4.302  7.383   1.00 1.55  ? 1141 LYS A NZ   9  
ATOM   5619  H  H    . LYS A 1 39 ? -3.095  -2.448  1.646   1.00 0.32  ? 1141 LYS A H    9  
ATOM   5620  H  HA   . LYS A 1 39 ? -5.664  -1.860  2.814   1.00 0.39  ? 1141 LYS A HA   9  
ATOM   5621  H  HB2  . LYS A 1 39 ? -4.870  -2.805  4.788   1.00 0.56  ? 1141 LYS A HB2  9  
ATOM   5622  H  HB3  . LYS A 1 39 ? -4.082  -3.736  3.534   1.00 0.47  ? 1141 LYS A HB3  9  
ATOM   5623  H  HG2  . LYS A 1 39 ? -2.041  -2.412  3.872   1.00 0.50  ? 1141 LYS A HG2  9  
ATOM   5624  H  HG3  . LYS A 1 39 ? -2.850  -1.533  5.170   1.00 0.65  ? 1141 LYS A HG3  9  
ATOM   5625  H  HD2  . LYS A 1 39 ? -3.218  -3.689  6.338   1.00 0.88  ? 1141 LYS A HD2  9  
ATOM   5626  H  HD3  . LYS A 1 39 ? -2.281  -4.490  5.078   1.00 0.73  ? 1141 LYS A HD3  9  
ATOM   5627  H  HE2  . LYS A 1 39 ? -0.325  -3.186  5.669   1.00 1.15  ? 1141 LYS A HE2  9  
ATOM   5628  H  HE3  . LYS A 1 39 ? -1.253  -2.305  6.880   1.00 1.18  ? 1141 LYS A HE3  9  
ATOM   5629  H  HZ1  . LYS A 1 39 ? 0.040   -4.045  7.912   1.00 2.08  ? 1141 LYS A HZ1  9  
ATOM   5630  H  HZ2  . LYS A 1 39 ? -0.659  -5.217  6.912   1.00 1.99  ? 1141 LYS A HZ2  9  
ATOM   5631  H  HZ3  . LYS A 1 39 ? -1.604  -4.409  8.054   1.00 1.97  ? 1141 LYS A HZ3  9  
ATOM   5632  N  N    . ASN A 1 40 ? -3.226  0.265   3.037   1.00 0.60  ? 1142 ASN A N    9  
ATOM   5633  C  CA   . ASN A 1 40 ? -2.875  1.616   3.478   1.00 0.81  ? 1142 ASN A CA   9  
ATOM   5634  C  C    . ASN A 1 40 ? -3.509  2.661   2.566   1.00 0.91  ? 1142 ASN A C    9  
ATOM   5635  O  O    . ASN A 1 40 ? -3.117  3.829   2.569   1.00 1.44  ? 1142 ASN A O    9  
ATOM   5636  C  CB   . ASN A 1 40 ? -1.349  1.814   3.534   1.00 1.07  ? 1142 ASN A CB   9  
ATOM   5637  C  CG   . ASN A 1 40 ? -0.704  2.005   2.171   1.00 1.37  ? 1142 ASN A CG   9  
ATOM   5638  O  OD1  . ASN A 1 40 ? -0.587  3.125   1.672   1.00 2.05  ? 1142 ASN A OD1  9  
ATOM   5639  N  ND2  . ASN A 1 40 ? -0.249  0.924   1.572   1.00 1.92  ? 1142 ASN A ND2  9  
ATOM   5640  H  H    . ASN A 1 40 ? -2.631  -0.217  2.427   1.00 0.58  ? 1142 ASN A H    9  
ATOM   5641  H  HA   . ASN A 1 40 ? -3.277  1.746   4.471   1.00 0.86  ? 1142 ASN A HA   9  
ATOM   5642  H  HB2  . ASN A 1 40 ? -1.132  2.684   4.133   1.00 1.54  ? 1142 ASN A HB2  9  
ATOM   5643  H  HB3  . ASN A 1 40 ? -0.902  0.948   4.002   1.00 1.56  ? 1142 ASN A HB3  9  
ATOM   5644  H  HD21 . ASN A 1 40 ? -0.346  0.058   2.033   1.00 2.20  ? 1142 ASN A HD21 9  
ATOM   5645  H  HD22 . ASN A 1 40 ? 0.168   1.024   0.691   1.00 2.44  ? 1142 ASN A HD22 9  
ATOM   5646  N  N    . CYS A 1 41 ? -4.514  2.241   1.805   1.00 0.76  ? 1143 CYS A N    9  
ATOM   5647  C  CA   . CYS A 1 41 ? -5.188  3.118   0.856   1.00 0.99  ? 1143 CYS A CA   9  
ATOM   5648  C  C    . CYS A 1 41 ? -6.130  4.086   1.579   1.00 1.29  ? 1143 CYS A C    9  
ATOM   5649  O  O    . CYS A 1 41 ? -7.348  4.051   1.401   1.00 1.67  ? 1143 CYS A O    9  
ATOM   5650  C  CB   . CYS A 1 41 ? -5.957  2.283   -0.170  1.00 0.93  ? 1143 CYS A CB   9  
ATOM   5651  S  SG   . CYS A 1 41 ? -6.626  3.236   -1.570  1.00 1.10  ? 1143 CYS A SG   9  
ATOM   5652  H  H    . CYS A 1 41 ? -4.811  1.310   1.885   1.00 0.89  ? 1143 CYS A H    9  
ATOM   5653  H  HA   . CYS A 1 41 ? -4.430  3.691   0.342   1.00 1.23  ? 1143 CYS A HA   9  
ATOM   5654  H  HB2  . CYS A 1 41 ? -5.299  1.530   -0.574  1.00 0.98  ? 1143 CYS A HB2  9  
ATOM   5655  H  HB3  . CYS A 1 41 ? -6.786  1.798   0.323   1.00 1.29  ? 1143 CYS A HB3  9  
ATOM   5656  N  N    . ASN A 1 42 ? -5.546  4.934   2.410   1.00 1.87  ? 1144 ASN A N    9  
ATOM   5657  C  CA   . ASN A 1 42 ? -6.276  5.974   3.124   1.00 2.36  ? 1144 ASN A CA   9  
ATOM   5658  C  C    . ASN A 1 42 ? -5.342  7.151   3.377   1.00 3.05  ? 1144 ASN A C    9  
ATOM   5659  O  O    . ASN A 1 42 ? -5.400  7.808   4.415   1.00 3.73  ? 1144 ASN A O    9  
ATOM   5660  C  CB   . ASN A 1 42 ? -6.852  5.441   4.449   1.00 3.11  ? 1144 ASN A CB   9  
ATOM   5661  C  CG   . ASN A 1 42 ? -5.798  4.856   5.378   1.00 3.87  ? 1144 ASN A CG   9  
ATOM   5662  O  OD1  . ASN A 1 42 ? -5.199  5.564   6.187   1.00 4.27  ? 1144 ASN A OD1  9  
ATOM   5663  N  ND2  . ASN A 1 42 ? -5.584  3.553   5.287   1.00 4.59  ? 1144 ASN A ND2  9  
ATOM   5664  H  H    . ASN A 1 42 ? -4.576  4.856   2.556   1.00 2.27  ? 1144 ASN A H    9  
ATOM   5665  H  HA   . ASN A 1 42 ? -7.087  6.304   2.491   1.00 2.42  ? 1144 ASN A HA   9  
ATOM   5666  H  HB2  . ASN A 1 42 ? -7.345  6.249   4.967   1.00 3.41  ? 1144 ASN A HB2  9  
ATOM   5667  H  HB3  . ASN A 1 42 ? -7.576  4.670   4.230   1.00 3.38  ? 1144 ASN A HB3  9  
ATOM   5668  H  HD21 . ASN A 1 42 ? -6.110  3.041   4.633   1.00 4.61  ? 1144 ASN A HD21 9  
ATOM   5669  H  HD22 . ASN A 1 42 ? -4.918  3.148   5.883   1.00 5.30  ? 1144 ASN A HD22 9  
ATOM   5670  N  N    . SER A 1 43 ? -4.480  7.403   2.402   1.00 3.53  ? 1145 SER A N    9  
ATOM   5671  C  CA   . SER A 1 43 ? -3.460  8.436   2.510   1.00 4.69  ? 1145 SER A CA   9  
ATOM   5672  C  C    . SER A 1 43 ? -4.085  9.825   2.592   1.00 5.23  ? 1145 SER A C    9  
ATOM   5673  O  O    . SER A 1 43 ? -5.181  10.059  2.068   1.00 5.32  ? 1145 SER A O    9  
ATOM   5674  C  CB   . SER A 1 43 ? -2.528  8.354   1.302   1.00 5.40  ? 1145 SER A CB   9  
ATOM   5675  O  OG   . SER A 1 43 ? -3.259  8.424   0.088   1.00 5.26  ? 1145 SER A OG   9  
ATOM   5676  H  H    . SER A 1 43 ? -4.544  6.886   1.570   1.00 3.45  ? 1145 SER A H    9  
ATOM   5677  H  HA   . SER A 1 43 ? -2.891  8.253   3.408   1.00 5.07  ? 1145 SER A HA   9  
ATOM   5678  H  HB2  . SER A 1 43 ? -1.826  9.175   1.334   1.00 6.23  ? 1145 SER A HB2  9  
ATOM   5679  H  HB3  . SER A 1 43 ? -1.989  7.417   1.329   1.00 5.56  ? 1145 SER A HB3  9  
ATOM   5680  H  HG   . SER A 1 43 ? -4.202  8.319   0.273   1.00 5.21  ? 1145 SER A HG   9  
ATOM   5681  N  N    . THR A 1 44 ? -3.386  10.740  3.255   1.00 5.97  ? 1146 THR A N    9  
ATOM   5682  C  CA   . THR A 1 44 ? -3.844  12.112  3.373   1.00 6.81  ? 1146 THR A CA   9  
ATOM   5683  C  C    . THR A 1 44 ? -3.747  12.829  2.030   1.00 7.34  ? 1146 THR A C    9  
ATOM   5684  O  O    . THR A 1 44 ? -2.683  13.315  1.641   1.00 8.15  ? 1146 THR A O    9  
ATOM   5685  C  CB   . THR A 1 44 ? -3.039  12.883  4.440   1.00 7.69  ? 1146 THR A CB   9  
ATOM   5686  O  OG1  . THR A 1 44 ? -1.635  12.629  4.280   1.00 7.92  ? 1146 THR A OG1  9  
ATOM   5687  C  CG2  . THR A 1 44 ? -3.473  12.483  5.842   1.00 7.74  ? 1146 THR A CG2  9  
ATOM   5688  H  H    . THR A 1 44 ? -2.537  10.485  3.675   1.00 6.16  ? 1146 THR A H    9  
ATOM   5689  H  HA   . THR A 1 44 ? -4.879  12.090  3.680   1.00 6.75  ? 1146 THR A HA   9  
ATOM   5690  H  HB   . THR A 1 44 ? -3.222  13.941  4.312   1.00 8.40  ? 1146 THR A HB   9  
ATOM   5691  H  HG1  . THR A 1 44 ? -1.159  13.472  4.250   1.00 8.03  ? 1146 THR A HG1  9  
ATOM   5692  H  HG21 . THR A 1 44 ? -3.289  11.430  5.987   1.00 7.71  ? 1146 THR A HG21 9  
ATOM   5693  H  HG22 . THR A 1 44 ? -4.526  12.686  5.966   1.00 7.80  ? 1146 THR A HG22 9  
ATOM   5694  H  HG23 . THR A 1 44 ? -2.909  13.050  6.567   1.00 8.03  ? 1146 THR A HG23 9  
ATOM   5695  N  N    . GLU A 1 45 ? -4.862  12.858  1.312   1.00 7.13  ? 1147 GLU A N    9  
ATOM   5696  C  CA   . GLU A 1 45 ? -4.933  13.509  0.012   1.00 7.94  ? 1147 GLU A CA   9  
ATOM   5697  C  C    . GLU A 1 45 ? -4.791  15.020  0.164   1.00 8.95  ? 1147 GLU A C    9  
ATOM   5698  O  O    . GLU A 1 45 ? -4.360  15.716  -0.754  1.00 9.87  ? 1147 GLU A O    9  
ATOM   5699  C  CB   . GLU A 1 45 ? -6.255  13.160  -0.672  1.00 7.79  ? 1147 GLU A CB   9  
ATOM   5700  C  CG   . GLU A 1 45 ? -7.474  13.448  0.188   1.00 7.90  ? 1147 GLU A CG   9  
ATOM   5701  C  CD   . GLU A 1 45 ? -8.747  12.915  -0.418  1.00 8.00  ? 1147 GLU A CD   9  
ATOM   5702  O  OE1  . GLU A 1 45 ? -9.073  11.735  -0.177  1.00 8.23  ? 1147 GLU A OE1  9  
ATOM   5703  O  OE2  . GLU A 1 45 ? -9.430  13.673  -1.141  1.00 8.08  ? 1147 GLU A OE2  9  
ATOM   5704  H  H    . GLU A 1 45 ? -5.665  12.428  1.674   1.00 6.60  ? 1147 GLU A H    9  
ATOM   5705  H  HA   . GLU A 1 45 ? -4.117  13.141  -0.590  1.00 8.20  ? 1147 GLU A HA   9  
ATOM   5706  H  HB2  . GLU A 1 45 ? -6.338  13.733  -1.583  1.00 8.33  ? 1147 GLU A HB2  9  
ATOM   5707  H  HB3  . GLU A 1 45 ? -6.254  12.108  -0.917  1.00 7.37  ? 1147 GLU A HB3  9  
ATOM   5708  H  HG2  . GLU A 1 45 ? -7.335  12.987  1.155   1.00 7.80  ? 1147 GLU A HG2  9  
ATOM   5709  H  HG3  . GLU A 1 45 ? -7.569  14.517  0.311   1.00 8.35  ? 1147 GLU A HG3  9  
ATOM   5710  N  N    . THR A 1 46 ? -5.155  15.512  1.335   1.00 8.94  ? 1148 THR A N    9  
ATOM   5711  C  CA   . THR A 1 46 ? -4.991  16.909  1.666   1.00 10.03 ? 1148 THR A CA   9  
ATOM   5712  C  C    . THR A 1 46 ? -3.714  17.085  2.486   1.00 10.71 ? 1148 THR A C    9  
ATOM   5713  O  O    . THR A 1 46 ? -3.348  16.202  3.264   1.00 11.12 ? 1148 THR A O    9  
ATOM   5714  C  CB   . THR A 1 46 ? -6.213  17.416  2.457   1.00 10.21 ? 1148 THR A CB   9  
ATOM   5715  O  OG1  . THR A 1 46 ? -7.415  17.055  1.763   1.00 9.58  ? 1148 THR A OG1  9  
ATOM   5716  C  CG2  . THR A 1 46 ? -6.168  18.925  2.634   1.00 11.01 ? 1148 THR A CG2  9  
ATOM   5717  H  H    . THR A 1 46 ? -5.543  14.908  2.005   1.00 8.30  ? 1148 THR A H    9  
ATOM   5718  H  HA   . THR A 1 46 ? -4.909  17.473  0.748   1.00 10.45 ? 1148 THR A HA   9  
ATOM   5719  H  HB   . THR A 1 46 ? -6.211  16.950  3.431   1.00 10.48 ? 1148 THR A HB   9  
ATOM   5720  H  HG1  . THR A 1 46 ? -7.200  16.846  0.845   1.00 9.43  ? 1148 THR A HG1  9  
ATOM   5721  H  HG21 . THR A 1 46 ? -5.271  19.198  3.171   1.00 11.19 ? 1148 THR A HG21 9  
ATOM   5722  H  HG22 . THR A 1 46 ? -7.034  19.247  3.193   1.00 11.07 ? 1148 THR A HG22 9  
ATOM   5723  H  HG23 . THR A 1 46 ? -6.168  19.401  1.664   1.00 11.53 ? 1148 THR A HG23 9  
HETATM 5724  CA CA   . CA  B 2 .  ? -1.137  -3.158  -5.432  1.00 0.28  ? 1201 CA  A CA   9  
ATOM   5725  N  N    . THR A 1 1  ? 21.400  -13.860 4.249   1.00 12.23 ? 1103 THR A N    10 
ATOM   5726  C  CA   . THR A 1 1  ? 20.169  -13.171 3.824   1.00 11.73 ? 1103 THR A CA   10 
ATOM   5727  C  C    . THR A 1 1  ? 20.465  -11.715 3.485   1.00 10.83 ? 1103 THR A C    10 
ATOM   5728  O  O    . THR A 1 1  ? 20.980  -10.971 4.320   1.00 10.67 ? 1103 THR A O    10 
ATOM   5729  C  CB   . THR A 1 1  ? 19.103  -13.228 4.934   1.00 11.83 ? 1103 THR A CB   10 
ATOM   5730  O  OG1  . THR A 1 1  ? 18.945  -14.580 5.384   1.00 12.26 ? 1103 THR A OG1  10 
ATOM   5731  C  CG2  . THR A 1 1  ? 17.765  -12.698 4.437   1.00 12.04 ? 1103 THR A CG2  10 
ATOM   5732  H  H1   . THR A 1 1  ? 21.183  -14.838 4.523   1.00 12.23 ? 1103 THR A H1   10 
ATOM   5733  H  H2   . THR A 1 1  ? 21.820  -13.371 5.062   1.00 12.55 ? 1103 THR A H2   10 
ATOM   5734  H  H3   . THR A 1 1  ? 22.089  -13.874 3.473   1.00 12.44 ? 1103 THR A H3   10 
ATOM   5735  H  HA   . THR A 1 1  ? 19.781  -13.665 2.946   1.00 12.16 ? 1103 THR A HA   10 
ATOM   5736  H  HB   . THR A 1 1  ? 19.433  -12.616 5.760   1.00 11.67 ? 1103 THR A HB   10 
ATOM   5737  H  HG1  . THR A 1 1  ? 18.073  -14.680 5.787   1.00 12.30 ? 1103 THR A HG1  10 
ATOM   5738  H  HG21 . THR A 1 1  ? 17.044  -12.734 5.240   1.00 12.31 ? 1103 THR A HG21 10 
ATOM   5739  H  HG22 . THR A 1 1  ? 17.418  -13.307 3.615   1.00 12.05 ? 1103 THR A HG22 10 
ATOM   5740  H  HG23 . THR A 1 1  ? 17.883  -11.678 4.105   1.00 12.10 ? 1103 THR A HG23 10 
ATOM   5741  N  N    . HIS A 1 2  ? 20.158  -11.318 2.255   1.00 10.41 ? 1104 HIS A N    10 
ATOM   5742  C  CA   . HIS A 1 2  ? 20.319  -9.931  1.842   1.00 9.72  ? 1104 HIS A CA   10 
ATOM   5743  C  C    . HIS A 1 2  ? 19.402  -9.034  2.665   1.00 8.65  ? 1104 HIS A C    10 
ATOM   5744  O  O    . HIS A 1 2  ? 18.178  -9.171  2.616   1.00 8.32  ? 1104 HIS A O    10 
ATOM   5745  C  CB   . HIS A 1 2  ? 20.018  -9.778  0.345   1.00 10.05 ? 1104 HIS A CB   10 
ATOM   5746  C  CG   . HIS A 1 2  ? 20.090  -8.365  -0.158  1.00 10.43 ? 1104 HIS A CG   10 
ATOM   5747  N  ND1  . HIS A 1 2  ? 19.037  -7.738  -0.787  1.00 10.71 ? 1104 HIS A ND1  10 
ATOM   5748  C  CD2  . HIS A 1 2  ? 21.099  -7.462  -0.134  1.00 10.84 ? 1104 HIS A CD2  10 
ATOM   5749  C  CE1  . HIS A 1 2  ? 19.394  -6.515  -1.128  1.00 11.25 ? 1104 HIS A CE1  10 
ATOM   5750  N  NE2  . HIS A 1 2  ? 20.641  -6.321  -0.743  1.00 11.34 ? 1104 HIS A NE2  10 
ATOM   5751  H  H    . HIS A 1 2  ? 19.821  -11.975 1.608   1.00 10.71 ? 1104 HIS A H    10 
ATOM   5752  H  HA   . HIS A 1 2  ? 21.344  -9.647  2.028   1.00 9.96  ? 1104 HIS A HA   10 
ATOM   5753  H  HB2  . HIS A 1 2  ? 20.729  -10.364 -0.216  1.00 10.50 ? 1104 HIS A HB2  10 
ATOM   5754  H  HB3  . HIS A 1 2  ? 19.023  -10.152 0.150   1.00 9.81  ? 1104 HIS A HB3  10 
ATOM   5755  H  HD1  . HIS A 1 2  ? 18.155  -8.135  -0.968  1.00 10.68 ? 1104 HIS A HD1  10 
ATOM   5756  H  HD2  . HIS A 1 2  ? 22.082  -7.612  0.287   1.00 10.94 ? 1104 HIS A HD2  10 
ATOM   5757  H  HE1  . HIS A 1 2  ? 18.771  -5.794  -1.634  1.00 11.71 ? 1104 HIS A HE1  10 
ATOM   5758  H  HE2  . HIS A 1 2  ? 21.205  -5.572  -1.037  1.00 11.83 ? 1104 HIS A HE2  10 
ATOM   5759  N  N    . ALA A 1 3  ? 20.006  -8.139  3.433   1.00 8.30  ? 1105 ALA A N    10 
ATOM   5760  C  CA   . ALA A 1 3  ? 19.258  -7.211  4.263   1.00 7.41  ? 1105 ALA A CA   10 
ATOM   5761  C  C    . ALA A 1 3  ? 18.406  -6.294  3.399   1.00 6.47  ? 1105 ALA A C    10 
ATOM   5762  O  O    . ALA A 1 3  ? 18.910  -5.688  2.451   1.00 6.54  ? 1105 ALA A O    10 
ATOM   5763  C  CB   . ALA A 1 3  ? 20.203  -6.393  5.128   1.00 7.70  ? 1105 ALA A CB   10 
ATOM   5764  H  H    . ALA A 1 3  ? 20.987  -8.099  3.436   1.00 8.79  ? 1105 ALA A H    10 
ATOM   5765  H  HA   . ALA A 1 3  ? 18.613  -7.785  4.912   1.00 7.45  ? 1105 ALA A HA   10 
ATOM   5766  H  HB1  . ALA A 1 3  ? 19.631  -5.722  5.751   1.00 7.93  ? 1105 ALA A HB1  10 
ATOM   5767  H  HB2  . ALA A 1 3  ? 20.864  -5.820  4.495   1.00 7.73  ? 1105 ALA A HB2  10 
ATOM   5768  H  HB3  . ALA A 1 3  ? 20.785  -7.055  5.751   1.00 7.95  ? 1105 ALA A HB3  10 
ATOM   5769  N  N    . PRO A 1 4  ? 17.106  -6.189  3.707   1.00 5.80  ? 1106 PRO A N    10 
ATOM   5770  C  CA   . PRO A 1 4  ? 16.189  -5.347  2.943   1.00 4.97  ? 1106 PRO A CA   10 
ATOM   5771  C  C    . PRO A 1 4  ? 16.508  -3.871  3.130   1.00 4.25  ? 1106 PRO A C    10 
ATOM   5772  O  O    . PRO A 1 4  ? 16.445  -3.343  4.244   1.00 4.22  ? 1106 PRO A O    10 
ATOM   5773  C  CB   . PRO A 1 4  ? 14.814  -5.681  3.522   1.00 4.84  ? 1106 PRO A CB   10 
ATOM   5774  C  CG   . PRO A 1 4  ? 15.087  -6.202  4.891   1.00 5.55  ? 1106 PRO A CG   10 
ATOM   5775  C  CD   . PRO A 1 4  ? 16.436  -6.866  4.831   1.00 6.09  ? 1106 PRO A CD   10 
ATOM   5776  H  HA   . PRO A 1 4  ? 16.214  -5.590  1.891   1.00 5.32  ? 1106 PRO A HA   10 
ATOM   5777  H  HB2  . PRO A 1 4  ? 14.211  -4.787  3.555   1.00 4.32  ? 1106 PRO A HB2  10 
ATOM   5778  H  HB3  . PRO A 1 4  ? 14.332  -6.426  2.907   1.00 5.12  ? 1106 PRO A HB3  10 
ATOM   5779  H  HG2  . PRO A 1 4  ? 15.107  -5.383  5.596   1.00 5.52  ? 1106 PRO A HG2  10 
ATOM   5780  H  HG3  . PRO A 1 4  ? 14.328  -6.918  5.169   1.00 6.00  ? 1106 PRO A HG3  10 
ATOM   5781  H  HD2  . PRO A 1 4  ? 16.975  -6.705  5.753   1.00 6.19  ? 1106 PRO A HD2  10 
ATOM   5782  H  HD3  . PRO A 1 4  ? 16.330  -7.922  4.635   1.00 6.80  ? 1106 PRO A HD3  10 
ATOM   5783  N  N    . ALA A 1 5  ? 16.852  -3.213  2.039   1.00 4.09  ? 1107 ALA A N    10 
ATOM   5784  C  CA   . ALA A 1 5  ? 17.245  -1.818  2.081   1.00 3.77  ? 1107 ALA A CA   10 
ATOM   5785  C  C    . ALA A 1 5  ? 16.039  -0.910  1.911   1.00 2.63  ? 1107 ALA A C    10 
ATOM   5786  O  O    . ALA A 1 5  ? 14.915  -1.384  1.710   1.00 2.62  ? 1107 ALA A O    10 
ATOM   5787  C  CB   . ALA A 1 5  ? 18.280  -1.531  1.003   1.00 4.73  ? 1107 ALA A CB   10 
ATOM   5788  H  H    . ALA A 1 5  ? 16.835  -3.681  1.175   1.00 4.51  ? 1107 ALA A H    10 
ATOM   5789  H  HA   . ALA A 1 5  ? 17.698  -1.626  3.043   1.00 4.04  ? 1107 ALA A HA   10 
ATOM   5790  H  HB1  . ALA A 1 5  ? 17.844  -1.706  0.031   1.00 5.01  ? 1107 ALA A HB1  10 
ATOM   5791  H  HB2  . ALA A 1 5  ? 19.131  -2.181  1.137   1.00 4.95  ? 1107 ALA A HB2  10 
ATOM   5792  H  HB3  . ALA A 1 5  ? 18.599  -0.503  1.074   1.00 5.29  ? 1107 ALA A HB3  10 
ATOM   5793  N  N    . SER A 1 6  ? 16.272  0.389   2.002   1.00 2.16  ? 1108 SER A N    10 
ATOM   5794  C  CA   . SER A 1 6  ? 15.228  1.367   1.776   1.00 1.43  ? 1108 SER A CA   10 
ATOM   5795  C  C    . SER A 1 6  ? 14.853  1.391   0.300   1.00 1.29  ? 1108 SER A C    10 
ATOM   5796  O  O    . SER A 1 6  ? 15.719  1.301   -0.576  1.00 1.97  ? 1108 SER A O    10 
ATOM   5797  C  CB   . SER A 1 6  ? 15.704  2.744   2.239   1.00 2.09  ? 1108 SER A CB   10 
ATOM   5798  O  OG   . SER A 1 6  ? 17.018  3.011   1.778   1.00 2.97  ? 1108 SER A OG   10 
ATOM   5799  H  H    . SER A 1 6  ? 17.175  0.701   2.214   1.00 2.71  ? 1108 SER A H    10 
ATOM   5800  H  HA   . SER A 1 6  ? 14.365  1.077   2.354   1.00 1.32  ? 1108 SER A HA   10 
ATOM   5801  H  HB2  . SER A 1 6  ? 15.038  3.501   1.853   1.00 2.36  ? 1108 SER A HB2  10 
ATOM   5802  H  HB3  . SER A 1 6  ? 15.700  2.780   3.318   1.00 2.13  ? 1108 SER A HB3  10 
ATOM   5803  H  HG   . SER A 1 6  ? 17.145  3.968   1.712   1.00 3.32  ? 1108 SER A HG   10 
ATOM   5804  N  N    . CYS A 1 7  ? 13.565  1.485   0.029   1.00 0.72  ? 1109 CYS A N    10 
ATOM   5805  C  CA   . CYS A 1 7  ? 13.080  1.494   -1.336  1.00 0.49  ? 1109 CYS A CA   10 
ATOM   5806  C  C    . CYS A 1 7  ? 13.285  2.863   -1.965  1.00 0.46  ? 1109 CYS A C    10 
ATOM   5807  O  O    . CYS A 1 7  ? 13.680  3.814   -1.284  1.00 0.62  ? 1109 CYS A O    10 
ATOM   5808  C  CB   . CYS A 1 7  ? 11.604  1.103   -1.374  1.00 0.33  ? 1109 CYS A CB   10 
ATOM   5809  S  SG   . CYS A 1 7  ? 11.249  -0.455  -0.500  1.00 0.47  ? 1109 CYS A SG   10 
ATOM   5810  H  H    . CYS A 1 7  ? 12.922  1.550   0.766   1.00 0.94  ? 1109 CYS A H    10 
ATOM   5811  H  HA   . CYS A 1 7  ? 13.646  0.767   -1.895  1.00 0.60  ? 1109 CYS A HA   10 
ATOM   5812  H  HB2  . CYS A 1 7  ? 11.015  1.886   -0.922  1.00 0.41  ? 1109 CYS A HB2  10 
ATOM   5813  H  HB3  . CYS A 1 7  ? 11.298  0.981   -2.403  1.00 0.29  ? 1109 CYS A HB3  10 
ATOM   5814  N  N    . LEU A 1 8  ? 13.028  2.950   -3.261  1.00 0.34  ? 1110 LEU A N    10 
ATOM   5815  C  CA   . LEU A 1 8  ? 13.133  4.205   -3.990  1.00 0.32  ? 1110 LEU A CA   10 
ATOM   5816  C  C    . LEU A 1 8  ? 12.235  5.255   -3.349  1.00 0.29  ? 1110 LEU A C    10 
ATOM   5817  O  O    . LEU A 1 8  ? 11.204  4.922   -2.763  1.00 0.30  ? 1110 LEU A O    10 
ATOM   5818  C  CB   . LEU A 1 8  ? 12.691  3.983   -5.434  1.00 0.28  ? 1110 LEU A CB   10 
ATOM   5819  C  CG   . LEU A 1 8  ? 13.408  4.804   -6.504  1.00 0.38  ? 1110 LEU A CG   10 
ATOM   5820  C  CD1  . LEU A 1 8  ? 14.901  4.517   -6.498  1.00 0.52  ? 1110 LEU A CD1  10 
ATOM   5821  C  CD2  . LEU A 1 8  ? 12.815  4.490   -7.867  1.00 0.39  ? 1110 LEU A CD2  10 
ATOM   5822  H  H    . LEU A 1 8  ? 12.760  2.145   -3.745  1.00 0.34  ? 1110 LEU A H    10 
ATOM   5823  H  HA   . LEU A 1 8  ? 14.158  4.537   -3.967  1.00 0.40  ? 1110 LEU A HA   10 
ATOM   5824  H  HB2  . LEU A 1 8  ? 12.812  2.939   -5.667  1.00 0.32  ? 1110 LEU A HB2  10 
ATOM   5825  H  HB3  . LEU A 1 8  ? 11.637  4.213   -5.492  1.00 0.22  ? 1110 LEU A HB3  10 
ATOM   5826  H  HG   . LEU A 1 8  ? 13.263  5.855   -6.307  1.00 0.41  ? 1110 LEU A HG   10 
ATOM   5827  H  HD11 . LEU A 1 8  ? 15.321  4.807   -5.548  1.00 1.05  ? 1110 LEU A HD11 10 
ATOM   5828  H  HD12 . LEU A 1 8  ? 15.379  5.076   -7.289  1.00 1.29  ? 1110 LEU A HD12 10 
ATOM   5829  H  HD13 . LEU A 1 8  ? 15.064  3.460   -6.654  1.00 1.07  ? 1110 LEU A HD13 10 
ATOM   5830  H  HD21 . LEU A 1 8  ? 13.265  5.127   -8.613  1.00 1.11  ? 1110 LEU A HD21 10 
ATOM   5831  H  HD22 . LEU A 1 8  ? 11.747  4.658   -7.842  1.00 1.05  ? 1110 LEU A HD22 10 
ATOM   5832  H  HD23 . LEU A 1 8  ? 13.008  3.455   -8.111  1.00 0.97  ? 1110 LEU A HD23 10 
ATOM   5833  N  N    . ASP A 1 9  ? 12.618  6.516   -3.472  1.00 0.35  ? 1111 ASP A N    10 
ATOM   5834  C  CA   . ASP A 1 9  ? 11.805  7.614   -2.960  1.00 0.38  ? 1111 ASP A CA   10 
ATOM   5835  C  C    . ASP A 1 9  ? 10.485  7.694   -3.718  1.00 0.32  ? 1111 ASP A C    10 
ATOM   5836  O  O    . ASP A 1 9  ? 9.498   8.226   -3.215  1.00 0.42  ? 1111 ASP A O    10 
ATOM   5837  C  CB   . ASP A 1 9  ? 12.551  8.947   -3.060  1.00 0.51  ? 1111 ASP A CB   10 
ATOM   5838  C  CG   . ASP A 1 9  ? 13.663  9.078   -2.038  1.00 1.37  ? 1111 ASP A CG   10 
ATOM   5839  O  OD1  . ASP A 1 9  ? 13.395  9.546   -0.909  1.00 2.32  ? 1111 ASP A OD1  10 
ATOM   5840  O  OD2  . ASP A 1 9  ? 14.814  8.711   -2.351  1.00 1.53  ? 1111 ASP A OD2  10 
ATOM   5841  H  H    . ASP A 1 9  ? 13.476  6.716   -3.908  1.00 0.40  ? 1111 ASP A H    10 
ATOM   5842  H  HA   . ASP A 1 9  ? 11.593  7.408   -1.922  1.00 0.44  ? 1111 ASP A HA   10 
ATOM   5843  H  HB2  . ASP A 1 9  ? 12.986  9.035   -4.044  1.00 0.94  ? 1111 ASP A HB2  10 
ATOM   5844  H  HB3  . ASP A 1 9  ? 11.851  9.756   -2.908  1.00 1.01  ? 1111 ASP A HB3  10 
ATOM   5845  N  N    . THR A 1 10 ? 10.478  7.164   -4.934  1.00 0.28  ? 1112 THR A N    10 
ATOM   5846  C  CA   . THR A 1 10 ? 9.264   7.080   -5.726  1.00 0.31  ? 1112 THR A CA   10 
ATOM   5847  C  C    . THR A 1 10 ? 8.670   5.670   -5.676  1.00 0.24  ? 1112 THR A C    10 
ATOM   5848  O  O    . THR A 1 10 ? 7.723   5.351   -6.397  1.00 0.30  ? 1112 THR A O    10 
ATOM   5849  C  CB   . THR A 1 10 ? 9.529   7.490   -7.184  1.00 0.42  ? 1112 THR A CB   10 
ATOM   5850  O  OG1  . THR A 1 10 ? 10.774  6.933   -7.626  1.00 0.45  ? 1112 THR A OG1  10 
ATOM   5851  C  CG2  . THR A 1 10 ? 9.560   9.005   -7.323  1.00 0.52  ? 1112 THR A CG2  10 
ATOM   5852  H  H    . THR A 1 10 ? 11.317  6.831   -5.315  1.00 0.31  ? 1112 THR A H    10 
ATOM   5853  H  HA   . THR A 1 10 ? 8.548   7.772   -5.307  1.00 0.36  ? 1112 THR A HA   10 
ATOM   5854  H  HB   . THR A 1 10 ? 8.731   7.103   -7.802  1.00 0.48  ? 1112 THR A HB   10 
ATOM   5855  H  HG1  . THR A 1 10 ? 11.465  7.606   -7.564  1.00 0.95  ? 1112 THR A HG1  10 
ATOM   5856  H  HG21 . THR A 1 10 ? 8.606   9.414   -7.023  1.00 1.19  ? 1112 THR A HG21 10 
ATOM   5857  H  HG22 . THR A 1 10 ? 9.758   9.268   -8.352  1.00 1.09  ? 1112 THR A HG22 10 
ATOM   5858  H  HG23 . THR A 1 10 ? 10.339  9.407   -6.692  1.00 1.17  ? 1112 THR A HG23 10 
ATOM   5859  N  N    . GLN A 1 11 ? 9.241   4.821   -4.826  1.00 0.18  ? 1113 GLN A N    10 
ATOM   5860  C  CA   . GLN A 1 11 ? 8.694   3.501   -4.583  1.00 0.17  ? 1113 GLN A CA   10 
ATOM   5861  C  C    . GLN A 1 11 ? 8.016   3.438   -3.231  1.00 0.17  ? 1113 GLN A C    10 
ATOM   5862  O  O    . GLN A 1 11 ? 8.163   4.333   -2.401  1.00 0.23  ? 1113 GLN A O    10 
ATOM   5863  C  CB   . GLN A 1 11 ? 9.790   2.443   -4.630  1.00 0.17  ? 1113 GLN A CB   10 
ATOM   5864  C  CG   . GLN A 1 11 ? 10.186  2.023   -6.032  1.00 0.23  ? 1113 GLN A CG   10 
ATOM   5865  C  CD   . GLN A 1 11 ? 11.192  0.892   -6.015  1.00 0.35  ? 1113 GLN A CD   10 
ATOM   5866  O  OE1  . GLN A 1 11 ? 11.254  0.126   -5.065  1.00 1.02  ? 1113 GLN A OE1  10 
ATOM   5867  N  NE2  . GLN A 1 11 ? 11.977  0.764   -7.065  1.00 0.67  ? 1113 GLN A NE2  10 
ATOM   5868  H  H    . GLN A 1 11 ? 10.058  5.087   -4.353  1.00 0.20  ? 1113 GLN A H    10 
ATOM   5869  H  HA   . GLN A 1 11 ? 7.962   3.292   -5.349  1.00 0.22  ? 1113 GLN A HA   10 
ATOM   5870  H  HB2  . GLN A 1 11 ? 10.667  2.829   -4.127  1.00 0.16  ? 1113 GLN A HB2  10 
ATOM   5871  H  HB3  . GLN A 1 11 ? 9.447   1.571   -4.100  1.00 0.20  ? 1113 GLN A HB3  10 
ATOM   5872  H  HG2  . GLN A 1 11 ? 9.308   1.707   -6.557  1.00 0.31  ? 1113 GLN A HG2  10 
ATOM   5873  H  HG3  . GLN A 1 11 ? 10.624  2.869   -6.540  1.00 0.22  ? 1113 GLN A HG3  10 
ATOM   5874  H  HE21 . GLN A 1 11 ? 11.880  1.403   -7.803  1.00 1.21  ? 1113 GLN A HE21 10 
ATOM   5875  H  HE22 . GLN A 1 11 ? 12.623  0.022   -7.066  1.00 0.65  ? 1113 GLN A HE22 10 
ATOM   5876  N  N    . TYR A 1 12 ? 7.274   2.372   -3.022  1.00 0.15  ? 1114 TYR A N    10 
ATOM   5877  C  CA   . TYR A 1 12 ? 6.610   2.130   -1.757  1.00 0.16  ? 1114 TYR A CA   10 
ATOM   5878  C  C    . TYR A 1 12 ? 7.302   0.996   -1.014  1.00 0.15  ? 1114 TYR A C    10 
ATOM   5879  O  O    . TYR A 1 12 ? 7.881   0.100   -1.628  1.00 0.15  ? 1114 TYR A O    10 
ATOM   5880  C  CB   . TYR A 1 12 ? 5.141   1.781   -1.990  1.00 0.18  ? 1114 TYR A CB   10 
ATOM   5881  C  CG   . TYR A 1 12 ? 4.367   1.494   -0.726  1.00 0.22  ? 1114 TYR A CG   10 
ATOM   5882  C  CD1  . TYR A 1 12 ? 4.167   2.481   0.229   1.00 0.33  ? 1114 TYR A CD1  10 
ATOM   5883  C  CD2  . TYR A 1 12 ? 3.836   0.232   -0.489  1.00 0.21  ? 1114 TYR A CD2  10 
ATOM   5884  C  CE1  . TYR A 1 12 ? 3.461   2.219   1.386   1.00 0.39  ? 1114 TYR A CE1  10 
ATOM   5885  C  CE2  . TYR A 1 12 ? 3.127   -0.037  0.665   1.00 0.26  ? 1114 TYR A CE2  10 
ATOM   5886  C  CZ   . TYR A 1 12 ? 2.943   0.959   1.598   1.00 0.34  ? 1114 TYR A CZ   10 
ATOM   5887  O  OH   . TYR A 1 12 ? 2.239   0.696   2.747   1.00 0.41  ? 1114 TYR A OH   10 
ATOM   5888  H  H    . TYR A 1 12 ? 7.171   1.715   -3.752  1.00 0.16  ? 1114 TYR A H    10 
ATOM   5889  H  HA   . TYR A 1 12 ? 6.673   3.030   -1.165  1.00 0.18  ? 1114 TYR A HA   10 
ATOM   5890  H  HB2  . TYR A 1 12 ? 4.657   2.600   -2.499  1.00 0.23  ? 1114 TYR A HB2  10 
ATOM   5891  H  HB3  . TYR A 1 12 ? 5.095   0.902   -2.607  1.00 0.18  ? 1114 TYR A HB3  10 
ATOM   5892  H  HD1  . TYR A 1 12 ? 4.575   3.466   0.058   1.00 0.40  ? 1114 TYR A HD1  10 
ATOM   5893  H  HD2  . TYR A 1 12 ? 3.982   -0.547  -1.223  1.00 0.23  ? 1114 TYR A HD2  10 
ATOM   5894  H  HE1  . TYR A 1 12 ? 3.314   2.999   2.117   1.00 0.50  ? 1114 TYR A HE1  10 
ATOM   5895  H  HE2  . TYR A 1 12 ? 2.722   -1.024  0.831   1.00 0.29  ? 1114 TYR A HE2  10 
ATOM   5896  H  HH   . TYR A 1 12 ? 1.660   1.440   2.939   1.00 0.89  ? 1114 TYR A HH   10 
ATOM   5897  N  N    . THR A 1 13 ? 7.228   1.049   0.302   1.00 0.18  ? 1115 THR A N    10 
ATOM   5898  C  CA   . THR A 1 13 ? 7.817   0.028   1.151   1.00 0.20  ? 1115 THR A CA   10 
ATOM   5899  C  C    . THR A 1 13 ? 6.716   -0.819  1.777   1.00 0.23  ? 1115 THR A C    10 
ATOM   5900  O  O    . THR A 1 13 ? 5.913   -0.318  2.567   1.00 0.31  ? 1115 THR A O    10 
ATOM   5901  C  CB   . THR A 1 13 ? 8.670   0.652   2.272   1.00 0.26  ? 1115 THR A CB   10 
ATOM   5902  O  OG1  . THR A 1 13 ? 9.532   1.661   1.728   1.00 0.30  ? 1115 THR A OG1  10 
ATOM   5903  C  CG2  . THR A 1 13 ? 9.510   -0.410  2.973   1.00 0.27  ? 1115 THR A CG2  10 
ATOM   5904  H  H    . THR A 1 13 ? 6.737   1.786   0.713   1.00 0.22  ? 1115 THR A H    10 
ATOM   5905  H  HA   . THR A 1 13 ? 8.449   -0.601  0.541   1.00 0.19  ? 1115 THR A HA   10 
ATOM   5906  H  HB   . THR A 1 13 ? 8.012   1.105   2.998   1.00 0.31  ? 1115 THR A HB   10 
ATOM   5907  H  HG1  . THR A 1 13 ? 9.246   1.874   0.830   1.00 0.82  ? 1115 THR A HG1  10 
ATOM   5908  H  HG21 . THR A 1 13 ? 10.176  -0.871  2.258   1.00 1.01  ? 1115 THR A HG21 10 
ATOM   5909  H  HG22 . THR A 1 13 ? 8.860   -1.162  3.396   1.00 1.02  ? 1115 THR A HG22 10 
ATOM   5910  H  HG23 . THR A 1 13 ? 10.090  0.050   3.760   1.00 1.10  ? 1115 THR A HG23 10 
ATOM   5911  N  N    . CYS A 1 14 ? 6.663   -2.086  1.408   1.00 0.26  ? 1116 CYS A N    10 
ATOM   5912  C  CA   . CYS A 1 14 ? 5.643   -2.986  1.926   1.00 0.34  ? 1116 CYS A CA   10 
ATOM   5913  C  C    . CYS A 1 14 ? 5.966   -3.407  3.355   1.00 0.40  ? 1116 CYS A C    10 
ATOM   5914  O  O    . CYS A 1 14 ? 7.082   -3.188  3.828   1.00 0.37  ? 1116 CYS A O    10 
ATOM   5915  C  CB   . CYS A 1 14 ? 5.534   -4.226  1.041   1.00 0.45  ? 1116 CYS A CB   10 
ATOM   5916  S  SG   . CYS A 1 14 ? 5.410   -3.865  -0.739  1.00 0.65  ? 1116 CYS A SG   10 
ATOM   5917  H  H    . CYS A 1 14 ? 7.325   -2.426  0.762   1.00 0.28  ? 1116 CYS A H    10 
ATOM   5918  H  HA   . CYS A 1 14 ? 4.698   -2.463  1.918   1.00 0.38  ? 1116 CYS A HA   10 
ATOM   5919  H  HB2  . CYS A 1 14 ? 6.407   -4.843  1.189   1.00 0.50  ? 1116 CYS A HB2  10 
ATOM   5920  H  HB3  . CYS A 1 14 ? 4.654   -4.783  1.326   1.00 0.54  ? 1116 CYS A HB3  10 
ATOM   5921  N  N    . ASP A 1 15 ? 5.001   -4.017  4.035   1.00 0.56  ? 1117 ASP A N    10 
ATOM   5922  C  CA   . ASP A 1 15 ? 5.221   -4.521  5.391   1.00 0.69  ? 1117 ASP A CA   10 
ATOM   5923  C  C    . ASP A 1 15 ? 6.389   -5.504  5.418   1.00 0.65  ? 1117 ASP A C    10 
ATOM   5924  O  O    . ASP A 1 15 ? 7.195   -5.512  6.348   1.00 0.71  ? 1117 ASP A O    10 
ATOM   5925  C  CB   . ASP A 1 15 ? 3.951   -5.195  5.920   1.00 0.93  ? 1117 ASP A CB   10 
ATOM   5926  C  CG   . ASP A 1 15 ? 4.151   -5.819  7.287   1.00 1.83  ? 1117 ASP A CG   10 
ATOM   5927  O  OD1  . ASP A 1 15 ? 4.142   -5.079  8.289   1.00 2.62  ? 1117 ASP A OD1  10 
ATOM   5928  O  OD2  . ASP A 1 15 ? 4.318   -7.053  7.370   1.00 2.09  ? 1117 ASP A OD2  10 
ATOM   5929  H  H    . ASP A 1 15 ? 4.114   -4.113  3.625   1.00 0.63  ? 1117 ASP A H    10 
ATOM   5930  H  HA   . ASP A 1 15 ? 5.462   -3.679  6.022   1.00 0.70  ? 1117 ASP A HA   10 
ATOM   5931  H  HB2  . ASP A 1 15 ? 3.164   -4.459  5.993   1.00 1.35  ? 1117 ASP A HB2  10 
ATOM   5932  H  HB3  . ASP A 1 15 ? 3.649   -5.970  5.230   1.00 0.70  ? 1117 ASP A HB3  10 
ATOM   5933  N  N    . ASN A 1 16 ? 6.501   -6.298  4.359   1.00 0.69  ? 1118 ASN A N    10 
ATOM   5934  C  CA   . ASN A 1 16 ? 7.566   -7.296  4.241   1.00 0.75  ? 1118 ASN A CA   10 
ATOM   5935  C  C    . ASN A 1 16 ? 8.878   -6.655  3.796   1.00 0.59  ? 1118 ASN A C    10 
ATOM   5936  O  O    . ASN A 1 16 ? 9.813   -7.353  3.403   1.00 0.65  ? 1118 ASN A O    10 
ATOM   5937  C  CB   . ASN A 1 16 ? 7.173   -8.376  3.231   1.00 0.98  ? 1118 ASN A CB   10 
ATOM   5938  C  CG   . ASN A 1 16 ? 5.869   -9.071  3.572   1.00 1.77  ? 1118 ASN A CG   10 
ATOM   5939  O  OD1  . ASN A 1 16 ? 5.508   -9.214  4.740   1.00 2.75  ? 1118 ASN A OD1  10 
ATOM   5940  N  ND2  . ASN A 1 16 ? 5.149   -9.495  2.548   1.00 2.02  ? 1118 ASN A ND2  10 
ATOM   5941  H  H    . ASN A 1 16 ? 5.843   -6.220  3.640   1.00 0.75  ? 1118 ASN A H    10 
ATOM   5942  H  HA   . ASN A 1 16 ? 7.707   -7.752  5.209   1.00 0.85  ? 1118 ASN A HA   10 
ATOM   5943  H  HB2  . ASN A 1 16 ? 7.071   -7.924  2.257   1.00 1.24  ? 1118 ASN A HB2  10 
ATOM   5944  H  HB3  . ASN A 1 16 ? 7.955   -9.120  3.194   1.00 1.41  ? 1118 ASN A HB3  10 
ATOM   5945  H  HD21 . ASN A 1 16 ? 5.492   -9.340  1.640   1.00 1.91  ? 1118 ASN A HD21 10 
ATOM   5946  H  HD22 . ASN A 1 16 ? 4.294   -9.956  2.738   1.00 2.74  ? 1118 ASN A HD22 10 
ATOM   5947  N  N    . HIS A 1 17 ? 8.933   -5.323  3.844   1.00 0.46  ? 1119 HIS A N    10 
ATOM   5948  C  CA   . HIS A 1 17 ? 10.105  -4.561  3.403   1.00 0.41  ? 1119 HIS A CA   10 
ATOM   5949  C  C    . HIS A 1 17 ? 10.345  -4.749  1.907   1.00 0.44  ? 1119 HIS A C    10 
ATOM   5950  O  O    . HIS A 1 17 ? 11.472  -4.637  1.428   1.00 0.79  ? 1119 HIS A O    10 
ATOM   5951  C  CB   . HIS A 1 17 ? 11.362  -4.957  4.187   1.00 0.51  ? 1119 HIS A CB   10 
ATOM   5952  C  CG   . HIS A 1 17 ? 11.309  -4.611  5.640   1.00 0.63  ? 1119 HIS A CG   10 
ATOM   5953  N  ND1  . HIS A 1 17 ? 11.427  -5.549  6.640   1.00 0.94  ? 1119 HIS A ND1  10 
ATOM   5954  C  CD2  . HIS A 1 17 ? 11.163  -3.417  6.262   1.00 0.78  ? 1119 HIS A CD2  10 
ATOM   5955  C  CE1  . HIS A 1 17 ? 11.354  -4.951  7.814   1.00 1.05  ? 1119 HIS A CE1  10 
ATOM   5956  N  NE2  . HIS A 1 17 ? 11.193  -3.655  7.614   1.00 0.93  ? 1119 HIS A NE2  10 
ATOM   5957  H  H    . HIS A 1 17 ? 8.156   -4.832  4.193   1.00 0.47  ? 1119 HIS A H    10 
ATOM   5958  H  HA   . HIS A 1 17 ? 9.898   -3.515  3.584   1.00 0.38  ? 1119 HIS A HA   10 
ATOM   5959  H  HB2  . HIS A 1 17 ? 11.502  -6.024  4.108   1.00 0.60  ? 1119 HIS A HB2  10 
ATOM   5960  H  HB3  . HIS A 1 17 ? 12.216  -4.457  3.755   1.00 0.55  ? 1119 HIS A HB3  10 
ATOM   5961  H  HD1  . HIS A 1 17 ? 11.546  -6.518  6.509   1.00 1.18  ? 1119 HIS A HD1  10 
ATOM   5962  H  HD2  . HIS A 1 17 ? 11.044  -2.456  5.783   1.00 1.00  ? 1119 HIS A HD2  10 
ATOM   5963  H  HE1  . HIS A 1 17 ? 11.419  -5.437  8.776   1.00 1.35  ? 1119 HIS A HE1  10 
ATOM   5964  H  HE2  . HIS A 1 17 ? 10.916  -3.013  8.304   1.00 1.09  ? 1119 HIS A HE2  10 
ATOM   5965  N  N    . GLN A 1 18 ? 9.277   -5.046  1.182   1.00 0.40  ? 1120 GLN A N    10 
ATOM   5966  C  CA   . GLN A 1 18 ? 9.355   -5.216  -0.261  1.00 0.38  ? 1120 GLN A CA   10 
ATOM   5967  C  C    . GLN A 1 18 ? 9.168   -3.865  -0.940  1.00 0.29  ? 1120 GLN A C    10 
ATOM   5968  O  O    . GLN A 1 18 ? 8.514   -2.978  -0.393  1.00 0.39  ? 1120 GLN A O    10 
ATOM   5969  C  CB   . GLN A 1 18 ? 8.291   -6.214  -0.733  1.00 0.49  ? 1120 GLN A CB   10 
ATOM   5970  C  CG   . GLN A 1 18 ? 8.365   -6.550  -2.215  1.00 0.50  ? 1120 GLN A CG   10 
ATOM   5971  C  CD   . GLN A 1 18 ? 9.724   -7.085  -2.623  1.00 1.05  ? 1120 GLN A CD   10 
ATOM   5972  O  OE1  . GLN A 1 18 ? 10.614  -6.323  -3.004  1.00 1.91  ? 1120 GLN A OE1  10 
ATOM   5973  N  NE2  . GLN A 1 18 ? 9.894   -8.395  -2.545  1.00 1.51  ? 1120 GLN A NE2  10 
ATOM   5974  H  H    . GLN A 1 18 ? 8.416   -5.149  1.627   1.00 0.63  ? 1120 GLN A H    10 
ATOM   5975  H  HA   . GLN A 1 18 ? 10.335  -5.598  -0.501  1.00 0.42  ? 1120 GLN A HA   10 
ATOM   5976  H  HB2  . GLN A 1 18 ? 8.406   -7.130  -0.174  1.00 0.62  ? 1120 GLN A HB2  10 
ATOM   5977  H  HB3  . GLN A 1 18 ? 7.314   -5.800  -0.529  1.00 0.52  ? 1120 GLN A HB3  10 
ATOM   5978  H  HG2  . GLN A 1 18 ? 7.619   -7.296  -2.440  1.00 0.87  ? 1120 GLN A HG2  10 
ATOM   5979  H  HG3  . GLN A 1 18 ? 8.162   -5.654  -2.783  1.00 0.86  ? 1120 GLN A HG3  10 
ATOM   5980  H  HE21 . GLN A 1 18 ? 9.141   -8.944  -2.233  1.00 1.83  ? 1120 GLN A HE21 10 
ATOM   5981  H  HE22 . GLN A 1 18 ? 10.766  -8.764  -2.803  1.00 1.99  ? 1120 GLN A HE22 10 
ATOM   5982  N  N    . CYS A 1 19 ? 9.748   -3.706  -2.117  1.00 0.21  ? 1121 CYS A N    10 
ATOM   5983  C  CA   . CYS A 1 19 ? 9.701   -2.432  -2.809  1.00 0.21  ? 1121 CYS A CA   10 
ATOM   5984  C  C    . CYS A 1 19 ? 8.878   -2.519  -4.087  1.00 0.20  ? 1121 CYS A C    10 
ATOM   5985  O  O    . CYS A 1 19 ? 9.250   -3.211  -5.039  1.00 0.34  ? 1121 CYS A O    10 
ATOM   5986  C  CB   . CYS A 1 19 ? 11.118  -1.957  -3.116  1.00 0.34  ? 1121 CYS A CB   10 
ATOM   5987  S  SG   . CYS A 1 19 ? 12.183  -1.850  -1.642  1.00 0.42  ? 1121 CYS A SG   10 
ATOM   5988  H  H    . CYS A 1 19 ? 10.218  -4.463  -2.530  1.00 0.29  ? 1121 CYS A H    10 
ATOM   5989  H  HA   . CYS A 1 19 ? 9.233   -1.719  -2.147  1.00 0.24  ? 1121 CYS A HA   10 
ATOM   5990  H  HB2  . CYS A 1 19 ? 11.585  -2.629  -3.821  1.00 0.39  ? 1121 CYS A HB2  10 
ATOM   5991  H  HB3  . CYS A 1 19 ? 11.068  -0.970  -3.551  1.00 0.41  ? 1121 CYS A HB3  10 
ATOM   5992  N  N    . ILE A 1 20 ? 7.754   -1.820  -4.098  1.00 0.15  ? 1122 ILE A N    10 
ATOM   5993  C  CA   . ILE A 1 20 ? 6.888   -1.763  -5.266  1.00 0.14  ? 1122 ILE A CA   10 
ATOM   5994  C  C    . ILE A 1 20 ? 6.736   -0.317  -5.724  1.00 0.14  ? 1122 ILE A C    10 
ATOM   5995  O  O    . ILE A 1 20 ? 7.146   0.603   -5.023  1.00 0.18  ? 1122 ILE A O    10 
ATOM   5996  C  CB   . ILE A 1 20 ? 5.488   -2.349  -4.976  1.00 0.14  ? 1122 ILE A CB   10 
ATOM   5997  C  CG1  . ILE A 1 20 ? 4.755   -1.490  -3.947  1.00 0.13  ? 1122 ILE A CG1  10 
ATOM   5998  C  CG2  . ILE A 1 20 ? 5.598   -3.790  -4.494  1.00 0.19  ? 1122 ILE A CG2  10 
ATOM   5999  C  CD1  . ILE A 1 20 ? 3.330   -1.926  -3.711  1.00 0.17  ? 1122 ILE A CD1  10 
ATOM   6000  H  H    . ILE A 1 20 ? 7.502   -1.314  -3.293  1.00 0.22  ? 1122 ILE A H    10 
ATOM   6001  H  HA   . ILE A 1 20 ? 7.343   -2.340  -6.055  1.00 0.17  ? 1122 ILE A HA   10 
ATOM   6002  H  HB   . ILE A 1 20 ? 4.923   -2.351  -5.896  1.00 0.16  ? 1122 ILE A HB   10 
ATOM   6003  H  HG12 . ILE A 1 20 ? 5.280   -1.541  -3.006  1.00 0.15  ? 1122 ILE A HG12 10 
ATOM   6004  H  HG13 . ILE A 1 20 ? 4.738   -0.466  -4.290  1.00 0.14  ? 1122 ILE A HG13 10 
ATOM   6005  H  HG21 . ILE A 1 20 ? 4.609   -4.176  -4.286  1.00 0.98  ? 1122 ILE A HG21 10 
ATOM   6006  H  HG22 . ILE A 1 20 ? 6.193   -3.825  -3.593  1.00 1.05  ? 1122 ILE A HG22 10 
ATOM   6007  H  HG23 . ILE A 1 20 ? 6.065   -4.391  -5.259  1.00 0.97  ? 1122 ILE A HG23 10 
ATOM   6008  H  HD11 . ILE A 1 20 ? 3.325   -2.926  -3.302  1.00 1.07  ? 1122 ILE A HD11 10 
ATOM   6009  H  HD12 . ILE A 1 20 ? 2.795   -1.917  -4.649  1.00 0.99  ? 1122 ILE A HD12 10 
ATOM   6010  H  HD13 . ILE A 1 20 ? 2.855   -1.249  -3.017  1.00 1.03  ? 1122 ILE A HD13 10 
ATOM   6011  N  N    . SER A 1 21 ? 6.162   -0.121  -6.897  1.00 0.16  ? 1123 SER A N    10 
ATOM   6012  C  CA   . SER A 1 21 ? 5.883   1.218   -7.393  1.00 0.17  ? 1123 SER A CA   10 
ATOM   6013  C  C    . SER A 1 21 ? 4.725   1.830   -6.623  1.00 0.15  ? 1123 SER A C    10 
ATOM   6014  O  O    . SER A 1 21 ? 3.789   1.131   -6.226  1.00 0.17  ? 1123 SER A O    10 
ATOM   6015  C  CB   . SER A 1 21 ? 5.545   1.171   -8.886  1.00 0.24  ? 1123 SER A CB   10 
ATOM   6016  O  OG   . SER A 1 21 ? 5.002   2.407   -9.326  1.00 0.33  ? 1123 SER A OG   10 
ATOM   6017  H  H    . SER A 1 21 ? 5.919   -0.895  -7.447  1.00 0.20  ? 1123 SER A H    10 
ATOM   6018  H  HA   . SER A 1 21 ? 6.761   1.828   -7.240  1.00 0.19  ? 1123 SER A HA   10 
ATOM   6019  H  HB2  . SER A 1 21 ? 6.443   0.966   -9.451  1.00 0.27  ? 1123 SER A HB2  10 
ATOM   6020  H  HB3  . SER A 1 21 ? 4.820   0.389   -9.065  1.00 0.24  ? 1123 SER A HB3  10 
ATOM   6021  H  HG   . SER A 1 21 ? 4.197   2.246   -9.830  1.00 0.63  ? 1123 SER A HG   10 
ATOM   6022  N  N    . LYS A 1 22 ? 4.784   3.144   -6.424  1.00 0.17  ? 1124 LYS A N    10 
ATOM   6023  C  CA   . LYS A 1 22 ? 3.722   3.847   -5.727  1.00 0.19  ? 1124 LYS A CA   10 
ATOM   6024  C  C    . LYS A 1 22 ? 2.441   3.843   -6.558  1.00 0.22  ? 1124 LYS A C    10 
ATOM   6025  O  O    . LYS A 1 22 ? 1.359   4.122   -6.043  1.00 0.25  ? 1124 LYS A O    10 
ATOM   6026  C  CB   . LYS A 1 22 ? 4.124   5.288   -5.408  1.00 0.23  ? 1124 LYS A CB   10 
ATOM   6027  C  CG   . LYS A 1 22 ? 5.338   5.413   -4.501  1.00 0.25  ? 1124 LYS A CG   10 
ATOM   6028  C  CD   . LYS A 1 22 ? 5.404   6.803   -3.873  1.00 0.25  ? 1124 LYS A CD   10 
ATOM   6029  C  CE   . LYS A 1 22 ? 6.491   6.912   -2.813  1.00 0.30  ? 1124 LYS A CE   10 
ATOM   6030  N  NZ   . LYS A 1 22 ? 6.158   6.148   -1.580  1.00 1.24  ? 1124 LYS A NZ   10 
ATOM   6031  H  H    . LYS A 1 22 ? 5.562   3.652   -6.757  1.00 0.20  ? 1124 LYS A H    10 
ATOM   6032  H  HA   . LYS A 1 22 ? 3.539   3.321   -4.800  1.00 0.19  ? 1124 LYS A HA   10 
ATOM   6033  H  HB2  . LYS A 1 22 ? 4.340   5.799   -6.334  1.00 0.30  ? 1124 LYS A HB2  10 
ATOM   6034  H  HB3  . LYS A 1 22 ? 3.291   5.779   -4.927  1.00 0.30  ? 1124 LYS A HB3  10 
ATOM   6035  H  HG2  . LYS A 1 22 ? 5.289   4.662   -3.729  1.00 0.37  ? 1124 LYS A HG2  10 
ATOM   6036  H  HG3  . LYS A 1 22 ? 6.228   5.258   -5.094  1.00 0.37  ? 1124 LYS A HG3  10 
ATOM   6037  H  HD2  . LYS A 1 22 ? 5.606   7.524   -4.649  1.00 0.32  ? 1124 LYS A HD2  10 
ATOM   6038  H  HD3  . LYS A 1 22 ? 4.449   7.024   -3.419  1.00 0.33  ? 1124 LYS A HD3  10 
ATOM   6039  H  HE2  . LYS A 1 22 ? 7.411   6.523   -3.219  1.00 0.93  ? 1124 LYS A HE2  10 
ATOM   6040  H  HE3  . LYS A 1 22 ? 6.623   7.953   -2.556  1.00 0.95  ? 1124 LYS A HE3  10 
ATOM   6041  H  HZ1  . LYS A 1 22 ? 5.247   6.466   -1.195  1.00 1.76  ? 1124 LYS A HZ1  10 
ATOM   6042  H  HZ2  . LYS A 1 22 ? 6.896   6.293   -0.860  1.00 1.77  ? 1124 LYS A HZ2  10 
ATOM   6043  H  HZ3  . LYS A 1 22 ? 6.097   5.134   -1.793  1.00 1.88  ? 1124 LYS A HZ3  10 
ATOM   6044  N  N    . ASN A 1 23 ? 2.571   3.524   -7.847  1.00 0.24  ? 1125 ASN A N    10 
ATOM   6045  C  CA   . ASN A 1 23 ? 1.412   3.446   -8.734  1.00 0.28  ? 1125 ASN A CA   10 
ATOM   6046  C  C    . ASN A 1 23 ? 0.603   2.191   -8.452  1.00 0.26  ? 1125 ASN A C    10 
ATOM   6047  O  O    . ASN A 1 23 ? -0.584  2.121   -8.761  1.00 0.32  ? 1125 ASN A O    10 
ATOM   6048  C  CB   . ASN A 1 23 ? 1.843   3.455   -10.201 1.00 0.36  ? 1125 ASN A CB   10 
ATOM   6049  C  CG   . ASN A 1 23 ? 2.420   4.786   -10.632 1.00 1.03  ? 1125 ASN A CG   10 
ATOM   6050  O  OD1  . ASN A 1 23 ? 3.617   5.032   -10.485 1.00 1.75  ? 1125 ASN A OD1  10 
ATOM   6051  N  ND2  . ASN A 1 23 ? 1.577   5.649   -11.172 1.00 1.69  ? 1125 ASN A ND2  10 
ATOM   6052  H  H    . ASN A 1 23 ? 3.467   3.346   -8.207  1.00 0.25  ? 1125 ASN A H    10 
ATOM   6053  H  HA   . ASN A 1 23 ? 0.792   4.309   -8.544  1.00 0.31  ? 1125 ASN A HA   10 
ATOM   6054  H  HB2  . ASN A 1 23 ? 2.592   2.695   -10.352 1.00 0.82  ? 1125 ASN A HB2  10 
ATOM   6055  H  HB3  . ASN A 1 23 ? 0.986   3.238   -10.822 1.00 0.82  ? 1125 ASN A HB3  10 
ATOM   6056  H  HD21 . ASN A 1 23 ? 0.635   5.383   -11.263 1.00 1.99  ? 1125 ASN A HD21 10 
ATOM   6057  H  HD22 . ASN A 1 23 ? 1.925   6.520   -11.459 1.00 2.22  ? 1125 ASN A HD22 10 
ATOM   6058  N  N    . TRP A 1 24 ? 1.251   1.201   -7.853  1.00 0.22  ? 1126 TRP A N    10 
ATOM   6059  C  CA   . TRP A 1 24 ? 0.594   -0.063  -7.561  1.00 0.22  ? 1126 TRP A CA   10 
ATOM   6060  C  C    . TRP A 1 24 ? -0.253  0.064   -6.307  1.00 0.20  ? 1126 TRP A C    10 
ATOM   6061  O  O    . TRP A 1 24 ? -1.203  -0.684  -6.115  1.00 0.26  ? 1126 TRP A O    10 
ATOM   6062  C  CB   . TRP A 1 24 ? 1.618   -1.189  -7.375  1.00 0.25  ? 1126 TRP A CB   10 
ATOM   6063  C  CG   . TRP A 1 24 ? 2.463   -1.466  -8.585  1.00 0.31  ? 1126 TRP A CG   10 
ATOM   6064  C  CD1  . TRP A 1 24 ? 2.458   -0.795  -9.775  1.00 0.37  ? 1126 TRP A CD1  10 
ATOM   6065  C  CD2  . TRP A 1 24 ? 3.437   -2.505  -8.717  1.00 0.38  ? 1126 TRP A CD2  10 
ATOM   6066  N  NE1  . TRP A 1 24 ? 3.372   -1.353  -10.635 1.00 0.45  ? 1126 TRP A NE1  10 
ATOM   6067  C  CE2  . TRP A 1 24 ? 3.984   -2.406  -10.009 1.00 0.45  ? 1126 TRP A CE2  10 
ATOM   6068  C  CE3  . TRP A 1 24 ? 3.901   -3.512  -7.867  1.00 0.44  ? 1126 TRP A CE3  10 
ATOM   6069  C  CZ2  . TRP A 1 24 ? 4.970   -3.272  -10.469 1.00 0.54  ? 1126 TRP A CZ2  10 
ATOM   6070  C  CZ3  . TRP A 1 24 ? 4.878   -4.372  -8.324  1.00 0.55  ? 1126 TRP A CZ3  10 
ATOM   6071  C  CH2  . TRP A 1 24 ? 5.405   -4.247  -9.615  1.00 0.58  ? 1126 TRP A CH2  10 
ATOM   6072  H  H    . TRP A 1 24 ? 2.188   1.326   -7.592  1.00 0.23  ? 1126 TRP A H    10 
ATOM   6073  H  HA   . TRP A 1 24 ? -0.052  -0.304  -8.394  1.00 0.25  ? 1126 TRP A HA   10 
ATOM   6074  H  HB2  . TRP A 1 24 ? 2.278   -0.936  -6.560  1.00 0.27  ? 1126 TRP A HB2  10 
ATOM   6075  H  HB3  . TRP A 1 24 ? 1.091   -2.099  -7.126  1.00 0.28  ? 1126 TRP A HB3  10 
ATOM   6076  H  HD1  . TRP A 1 24 ? 1.824   0.051   -9.994  1.00 0.40  ? 1126 TRP A HD1  10 
ATOM   6077  H  HE1  . TRP A 1 24 ? 3.555   -1.048  -11.552 1.00 0.53  ? 1126 TRP A HE1  10 
ATOM   6078  H  HE3  . TRP A 1 24 ? 3.506   -3.624  -6.868  1.00 0.45  ? 1126 TRP A HE3  10 
ATOM   6079  H  HZ2  . TRP A 1 24 ? 5.387   -3.189  -11.460 1.00 0.61  ? 1126 TRP A HZ2  10 
ATOM   6080  H  HZ3  . TRP A 1 24 ? 5.249   -5.157  -7.680  1.00 0.62  ? 1126 TRP A HZ3  10 
ATOM   6081  H  HH2  . TRP A 1 24 ? 6.168   -4.942  -9.929  1.00 0.67  ? 1126 TRP A HH2  10 
ATOM   6082  N  N    . VAL A 1 25 ? 0.093   1.024   -5.466  1.00 0.19  ? 1127 VAL A N    10 
ATOM   6083  C  CA   . VAL A 1 25 ? -0.591  1.213   -4.196  1.00 0.18  ? 1127 VAL A CA   10 
ATOM   6084  C  C    . VAL A 1 25 ? -2.047  1.598   -4.412  1.00 0.19  ? 1127 VAL A C    10 
ATOM   6085  O  O    . VAL A 1 25 ? -2.343  2.645   -4.991  1.00 0.23  ? 1127 VAL A O    10 
ATOM   6086  C  CB   . VAL A 1 25 ? 0.107   2.297   -3.348  1.00 0.21  ? 1127 VAL A CB   10 
ATOM   6087  C  CG1  . VAL A 1 25 ? -0.611  2.505   -2.023  1.00 0.24  ? 1127 VAL A CG1  10 
ATOM   6088  C  CG2  . VAL A 1 25 ? 1.565   1.936   -3.117  1.00 0.24  ? 1127 VAL A CG2  10 
ATOM   6089  H  H    . VAL A 1 25 ? 0.820   1.632   -5.710  1.00 0.21  ? 1127 VAL A H    10 
ATOM   6090  H  HA   . VAL A 1 25 ? -0.557  0.279   -3.658  1.00 0.19  ? 1127 VAL A HA   10 
ATOM   6091  H  HB   . VAL A 1 25 ? 0.074   3.227   -3.898  1.00 0.23  ? 1127 VAL A HB   10 
ATOM   6092  H  HG11 . VAL A 1 25 ? -1.628  2.815   -2.207  1.00 1.01  ? 1127 VAL A HG11 10 
ATOM   6093  H  HG12 . VAL A 1 25 ? -0.099  3.267   -1.453  1.00 1.02  ? 1127 VAL A HG12 10 
ATOM   6094  H  HG13 . VAL A 1 25 ? -0.613  1.580   -1.465  1.00 1.00  ? 1127 VAL A HG13 10 
ATOM   6095  H  HG21 . VAL A 1 25 ? 2.062   1.817   -4.068  1.00 1.05  ? 1127 VAL A HG21 10 
ATOM   6096  H  HG22 . VAL A 1 25 ? 1.624   1.012   -2.563  1.00 1.06  ? 1127 VAL A HG22 10 
ATOM   6097  H  HG23 . VAL A 1 25 ? 2.046   2.724   -2.556  1.00 1.01  ? 1127 VAL A HG23 10 
ATOM   6098  N  N    . CYS A 1 26 ? -2.945  0.728   -3.955  1.00 0.19  ? 1128 CYS A N    10 
ATOM   6099  C  CA   . CYS A 1 26 ? -4.380  0.966   -4.054  1.00 0.26  ? 1128 CYS A CA   10 
ATOM   6100  C  C    . CYS A 1 26 ? -4.808  1.009   -5.523  1.00 0.27  ? 1128 CYS A C    10 
ATOM   6101  O  O    . CYS A 1 26 ? -5.445  1.955   -5.993  1.00 0.37  ? 1128 CYS A O    10 
ATOM   6102  C  CB   . CYS A 1 26 ? -4.749  2.256   -3.307  1.00 0.32  ? 1128 CYS A CB   10 
ATOM   6103  S  SG   . CYS A 1 26 ? -6.501  2.767   -3.433  1.00 0.58  ? 1128 CYS A SG   10 
ATOM   6104  H  H    . CYS A 1 26 ? -2.629  -0.108  -3.549  1.00 0.19  ? 1128 CYS A H    10 
ATOM   6105  H  HA   . CYS A 1 26 ? -4.880  0.134   -3.580  1.00 0.28  ? 1128 CYS A HA   10 
ATOM   6106  H  HB2  . CYS A 1 26 ? -4.525  2.126   -2.260  1.00 0.36  ? 1128 CYS A HB2  10 
ATOM   6107  H  HB3  . CYS A 1 26 ? -4.144  3.054   -3.689  1.00 0.36  ? 1128 CYS A HB3  10 
ATOM   6108  N  N    . ASP A 1 27 ? -4.425  -0.027  -6.251  1.00 0.25  ? 1129 ASP A N    10 
ATOM   6109  C  CA   . ASP A 1 27 ? -4.823  -0.180  -7.648  1.00 0.30  ? 1129 ASP A CA   10 
ATOM   6110  C  C    . ASP A 1 27 ? -5.808  -1.338  -7.774  1.00 0.37  ? 1129 ASP A C    10 
ATOM   6111  O  O    . ASP A 1 27 ? -6.069  -1.830  -8.870  1.00 0.41  ? 1129 ASP A O    10 
ATOM   6112  C  CB   . ASP A 1 27 ? -3.596  -0.422  -8.540  1.00 0.31  ? 1129 ASP A CB   10 
ATOM   6113  C  CG   . ASP A 1 27 ? -3.133  -1.866  -8.537  1.00 0.35  ? 1129 ASP A CG   10 
ATOM   6114  O  OD1  . ASP A 1 27 ? -2.926  -2.427  -7.443  1.00 0.31  ? 1129 ASP A OD1  10 
ATOM   6115  O  OD2  . ASP A 1 27 ? -2.963  -2.440  -9.633  1.00 0.46  ? 1129 ASP A OD2  10 
ATOM   6116  H  H    . ASP A 1 27 ? -3.850  -0.714  -5.833  1.00 0.24  ? 1129 ASP A H    10 
ATOM   6117  H  HA   . ASP A 1 27 ? -5.313  0.732   -7.955  1.00 0.33  ? 1129 ASP A HA   10 
ATOM   6118  H  HB2  . ASP A 1 27 ? -3.836  -0.148  -9.554  1.00 0.36  ? 1129 ASP A HB2  10 
ATOM   6119  H  HB3  . ASP A 1 27 ? -2.782  0.197   -8.191  1.00 0.29  ? 1129 ASP A HB3  10 
ATOM   6120  N  N    . THR A 1 28 ? -6.324  -1.762  -6.615  1.00 0.45  ? 1130 THR A N    10 
ATOM   6121  C  CA   . THR A 1 28 ? -7.287  -2.865  -6.471  1.00 0.56  ? 1130 THR A CA   10 
ATOM   6122  C  C    . THR A 1 28 ? -6.679  -4.218  -6.852  1.00 0.61  ? 1130 THR A C    10 
ATOM   6123  O  O    . THR A 1 28 ? -7.377  -5.233  -6.920  1.00 0.73  ? 1130 THR A O    10 
ATOM   6124  C  CB   . THR A 1 28 ? -8.630  -2.635  -7.220  1.00 0.59  ? 1130 THR A CB   10 
ATOM   6125  O  OG1  . THR A 1 28 ? -8.460  -2.648  -8.643  1.00 0.56  ? 1130 THR A OG1  10 
ATOM   6126  C  CG2  . THR A 1 28 ? -9.253  -1.314  -6.797  1.00 0.65  ? 1130 THR A CG2  10 
ATOM   6127  H  H    . THR A 1 28 ? -6.026  -1.311  -5.793  1.00 0.46  ? 1130 THR A H    10 
ATOM   6128  H  HA   . THR A 1 28 ? -7.523  -2.913  -5.417  1.00 0.64  ? 1130 THR A HA   10 
ATOM   6129  H  HB   . THR A 1 28 ? -9.308  -3.429  -6.948  1.00 0.67  ? 1130 THR A HB   10 
ATOM   6130  H  HG1  . THR A 1 28 ? -7.685  -2.124  -8.877  1.00 0.53  ? 1130 THR A HG1  10 
ATOM   6131  H  HG21 . THR A 1 28 ? -8.593  -0.502  -7.061  1.00 1.34  ? 1130 THR A HG21 10 
ATOM   6132  H  HG22 . THR A 1 28 ? -9.408  -1.318  -5.728  1.00 1.09  ? 1130 THR A HG22 10 
ATOM   6133  H  HG23 . THR A 1 28 ? -10.202 -1.186  -7.297  1.00 1.21  ? 1130 THR A HG23 10 
ATOM   6134  N  N    . ASP A 1 29 ? -5.374  -4.229  -7.079  1.00 0.59  ? 1131 ASP A N    10 
ATOM   6135  C  CA   . ASP A 1 29 ? -4.635  -5.464  -7.292  1.00 0.69  ? 1131 ASP A CA   10 
ATOM   6136  C  C    . ASP A 1 29 ? -3.553  -5.585  -6.231  1.00 0.67  ? 1131 ASP A C    10 
ATOM   6137  O  O    . ASP A 1 29 ? -2.542  -4.893  -6.286  1.00 0.53  ? 1131 ASP A O    10 
ATOM   6138  C  CB   . ASP A 1 29 ? -4.018  -5.485  -8.690  1.00 0.75  ? 1131 ASP A CB   10 
ATOM   6139  C  CG   . ASP A 1 29 ? -3.179  -6.722  -8.939  1.00 0.92  ? 1131 ASP A CG   10 
ATOM   6140  O  OD1  . ASP A 1 29 ? -3.750  -7.830  -9.008  1.00 1.21  ? 1131 ASP A OD1  10 
ATOM   6141  O  OD2  . ASP A 1 29 ? -1.941  -6.596  -9.071  1.00 0.92  ? 1131 ASP A OD2  10 
ATOM   6142  H  H    . ASP A 1 29 ? -4.889  -3.377  -7.115  1.00 0.55  ? 1131 ASP A H    10 
ATOM   6143  H  HA   . ASP A 1 29 ? -5.324  -6.288  -7.191  1.00 0.81  ? 1131 ASP A HA   10 
ATOM   6144  H  HB2  . ASP A 1 29 ? -4.807  -5.453  -9.422  1.00 0.81  ? 1131 ASP A HB2  10 
ATOM   6145  H  HB3  . ASP A 1 29 ? -3.387  -4.616  -8.810  1.00 0.68  ? 1131 ASP A HB3  10 
ATOM   6146  N  N    . ASN A 1 30 ? -3.784  -6.440  -5.246  1.00 0.94  ? 1132 ASN A N    10 
ATOM   6147  C  CA   . ASN A 1 30 ? -2.890  -6.537  -4.093  1.00 1.00  ? 1132 ASN A CA   10 
ATOM   6148  C  C    . ASN A 1 30 ? -1.467  -6.908  -4.503  1.00 0.91  ? 1132 ASN A C    10 
ATOM   6149  O  O    . ASN A 1 30 ? -1.247  -7.867  -5.248  1.00 1.06  ? 1132 ASN A O    10 
ATOM   6150  C  CB   . ASN A 1 30 ? -3.433  -7.537  -3.059  1.00 1.29  ? 1132 ASN A CB   10 
ATOM   6151  C  CG   . ASN A 1 30 ? -3.513  -8.965  -3.574  1.00 1.72  ? 1132 ASN A CG   10 
ATOM   6152  O  OD1  . ASN A 1 30 ? -2.563  -9.741  -3.447  1.00 2.58  ? 1132 ASN A OD1  10 
ATOM   6153  N  ND2  . ASN A 1 30 ? -4.656  -9.331  -4.134  1.00 2.07  ? 1132 ASN A ND2  10 
ATOM   6154  H  H    . ASN A 1 30 ? -4.573  -7.021  -5.293  1.00 1.15  ? 1132 ASN A H    10 
ATOM   6155  H  HA   . ASN A 1 30 ? -2.859  -5.560  -3.633  1.00 0.97  ? 1132 ASN A HA   10 
ATOM   6156  H  HB2  . ASN A 1 30 ? -2.788  -7.530  -2.194  1.00 1.52  ? 1132 ASN A HB2  10 
ATOM   6157  H  HB3  . ASN A 1 30 ? -4.425  -7.229  -2.761  1.00 1.97  ? 1132 ASN A HB3  10 
ATOM   6158  H  HD21 . ASN A 1 30 ? -5.381  -8.670  -4.186  1.00 2.11  ? 1132 ASN A HD21 10 
ATOM   6159  H  HD22 . ASN A 1 30 ? -4.734  -10.248 -4.474  1.00 2.73  ? 1132 ASN A HD22 10 
ATOM   6160  N  N    . ASP A 1 31 ? -0.504  -6.123  -4.030  1.00 0.86  ? 1133 ASP A N    10 
ATOM   6161  C  CA   . ASP A 1 31 ? 0.905   -6.402  -4.275  1.00 0.77  ? 1133 ASP A CA   10 
ATOM   6162  C  C    . ASP A 1 31 ? 1.574   -6.748  -2.960  1.00 0.78  ? 1133 ASP A C    10 
ATOM   6163  O  O    . ASP A 1 31 ? 0.893   -6.924  -1.950  1.00 1.28  ? 1133 ASP A O    10 
ATOM   6164  C  CB   . ASP A 1 31 ? 1.618   -5.211  -4.935  1.00 0.67  ? 1133 ASP A CB   10 
ATOM   6165  C  CG   . ASP A 1 31 ? 1.023   -4.843  -6.274  1.00 0.58  ? 1133 ASP A CG   10 
ATOM   6166  O  OD1  . ASP A 1 31 ? 1.367   -5.492  -7.283  1.00 1.09  ? 1133 ASP A OD1  10 
ATOM   6167  O  OD2  . ASP A 1 31 ? 0.201   -3.904  -6.325  1.00 1.00  ? 1133 ASP A OD2  10 
ATOM   6168  H  H    . ASP A 1 31 ? -0.746  -5.339  -3.481  1.00 1.05  ? 1133 ASP A H    10 
ATOM   6169  H  HA   . ASP A 1 31 ? 0.964   -7.253  -4.931  1.00 0.87  ? 1133 ASP A HA   10 
ATOM   6170  H  HB2  . ASP A 1 31 ? 1.558   -4.353  -4.289  1.00 1.04  ? 1133 ASP A HB2  10 
ATOM   6171  H  HB3  . ASP A 1 31 ? 2.657   -5.467  -5.085  1.00 1.05  ? 1133 ASP A HB3  10 
ATOM   6172  N  N    . CYS A 1 32 ? 2.896   -6.876  -2.975  1.00 0.76  ? 1134 CYS A N    10 
ATOM   6173  C  CA   . CYS A 1 32 ? 3.664   -7.156  -1.761  1.00 0.78  ? 1134 CYS A CA   10 
ATOM   6174  C  C    . CYS A 1 32 ? 3.357   -8.551  -1.217  1.00 0.85  ? 1134 CYS A C    10 
ATOM   6175  O  O    . CYS A 1 32 ? 3.756   -8.889  -0.102  1.00 1.57  ? 1134 CYS A O    10 
ATOM   6176  C  CB   . CYS A 1 32 ? 3.352   -6.116  -0.677  1.00 0.82  ? 1134 CYS A CB   10 
ATOM   6177  S  SG   . CYS A 1 32 ? 3.506   -4.380  -1.214  1.00 1.16  ? 1134 CYS A SG   10 
ATOM   6178  H  H    . CYS A 1 32 ? 3.374   -6.781  -3.827  1.00 1.11  ? 1134 CYS A H    10 
ATOM   6179  H  HA   . CYS A 1 32 ? 4.713   -7.099  -2.011  1.00 0.88  ? 1134 CYS A HA   10 
ATOM   6180  H  HB2  . CYS A 1 32 ? 2.336   -6.260  -0.340  1.00 1.25  ? 1134 CYS A HB2  10 
ATOM   6181  H  HB3  . CYS A 1 32 ? 4.020   -6.268  0.156   1.00 1.22  ? 1134 CYS A HB3  10 
ATOM   6182  N  N    . GLY A 1 33 ? 2.627   -9.349  -1.991  1.00 1.17  ? 1135 GLY A N    10 
ATOM   6183  C  CA   . GLY A 1 33 ? 2.220   -10.670 -1.543  1.00 1.22  ? 1135 GLY A CA   10 
ATOM   6184  C  C    . GLY A 1 33 ? 1.099   -10.627 -0.514  1.00 1.18  ? 1135 GLY A C    10 
ATOM   6185  O  O    . GLY A 1 33 ? 0.117   -11.358 -0.621  1.00 1.68  ? 1135 GLY A O    10 
ATOM   6186  H  H    . GLY A 1 33 ? 2.369   -9.039  -2.886  1.00 1.82  ? 1135 GLY A H    10 
ATOM   6187  H  HA2  . GLY A 1 33 ? 1.884   -11.239 -2.397  1.00 1.26  ? 1135 GLY A HA2  10 
ATOM   6188  H  HA3  . GLY A 1 33 ? 3.072   -11.168 -1.107  1.00 1.39  ? 1135 GLY A HA3  10 
ATOM   6189  N  N    . ASP A 1 34 ? 1.252   -9.764  0.482   1.00 1.02  ? 1136 ASP A N    10 
ATOM   6190  C  CA   . ASP A 1 34 ? 0.289   -9.661  1.572   1.00 1.11  ? 1136 ASP A CA   10 
ATOM   6191  C  C    . ASP A 1 34 ? -0.730  -8.553  1.334   1.00 0.93  ? 1136 ASP A C    10 
ATOM   6192  O  O    . ASP A 1 34 ? -1.693  -8.417  2.085   1.00 1.35  ? 1136 ASP A O    10 
ATOM   6193  C  CB   . ASP A 1 34 ? 1.006   -9.420  2.896   1.00 1.44  ? 1136 ASP A CB   10 
ATOM   6194  C  CG   . ASP A 1 34 ? 1.713   -10.656 3.407   1.00 2.10  ? 1136 ASP A CG   10 
ATOM   6195  O  OD1  . ASP A 1 34 ? 1.066   -11.471 4.097   1.00 2.47  ? 1136 ASP A OD1  10 
ATOM   6196  O  OD2  . ASP A 1 34 ? 2.919   -10.818 3.130   1.00 2.85  ? 1136 ASP A OD2  10 
ATOM   6197  H  H    . ASP A 1 34 ? 2.051   -9.194  0.494   1.00 1.22  ? 1136 ASP A H    10 
ATOM   6198  H  HA   . ASP A 1 34 ? -0.232  -10.598 1.635   1.00 1.27  ? 1136 ASP A HA   10 
ATOM   6199  H  HB2  . ASP A 1 34 ? 1.738   -8.645  2.757   1.00 1.68  ? 1136 ASP A HB2  10 
ATOM   6200  H  HB3  . ASP A 1 34 ? 0.289   -9.104  3.637   1.00 1.84  ? 1136 ASP A HB3  10 
ATOM   6201  N  N    . GLY A 1 35 ? -0.511  -7.755  0.299   1.00 0.62  ? 1137 GLY A N    10 
ATOM   6202  C  CA   . GLY A 1 35 ? -1.463  -6.714  -0.045  1.00 0.49  ? 1137 GLY A CA   10 
ATOM   6203  C  C    . GLY A 1 35 ? -1.384  -5.524  0.886   1.00 0.36  ? 1137 GLY A C    10 
ATOM   6204  O  O    . GLY A 1 35 ? -2.377  -4.835  1.112   1.00 0.36  ? 1137 GLY A O    10 
ATOM   6205  H  H    . GLY A 1 35 ? 0.304   -7.870  -0.240  1.00 0.82  ? 1137 GLY A H    10 
ATOM   6206  H  HA2  . GLY A 1 35 ? -1.265  -6.380  -1.053  1.00 0.51  ? 1137 GLY A HA2  10 
ATOM   6207  H  HA3  . GLY A 1 35 ? -2.460  -7.126  -0.003  1.00 0.72  ? 1137 GLY A HA3  10 
ATOM   6208  N  N    . SER A 1 36 ? -0.192  -5.262  1.402   1.00 0.32  ? 1138 SER A N    10 
ATOM   6209  C  CA   . SER A 1 36 ? 0.013   -4.177  2.352   1.00 0.28  ? 1138 SER A CA   10 
ATOM   6210  C  C    . SER A 1 36 ? -0.039  -2.814  1.662   1.00 0.25  ? 1138 SER A C    10 
ATOM   6211  O  O    . SER A 1 36 ? 0.090   -1.774  2.303   1.00 0.40  ? 1138 SER A O    10 
ATOM   6212  C  CB   . SER A 1 36 ? 1.354   -4.367  3.067   1.00 0.33  ? 1138 SER A CB   10 
ATOM   6213  O  OG   . SER A 1 36 ? 2.410   -4.557  2.135   1.00 0.44  ? 1138 SER A OG   10 
ATOM   6214  H  H    . SER A 1 36 ? 0.572   -5.813  1.139   1.00 0.37  ? 1138 SER A H    10 
ATOM   6215  H  HA   . SER A 1 36 ? -0.784  -4.222  3.081   1.00 0.33  ? 1138 SER A HA   10 
ATOM   6216  H  HB2  . SER A 1 36 ? 1.569   -3.492  3.661   1.00 0.40  ? 1138 SER A HB2  10 
ATOM   6217  H  HB3  . SER A 1 36 ? 1.298   -5.232  3.710   1.00 0.39  ? 1138 SER A HB3  10 
ATOM   6218  H  HG   . SER A 1 36 ? 2.434   -3.807  1.527   1.00 1.17  ? 1138 SER A HG   10 
ATOM   6219  N  N    . ASP A 1 37 ? -0.233  -2.826  0.354   1.00 0.18  ? 1139 ASP A N    10 
ATOM   6220  C  CA   . ASP A 1 37 ? -0.354  -1.600  -0.411  1.00 0.18  ? 1139 ASP A CA   10 
ATOM   6221  C  C    . ASP A 1 37 ? -1.825  -1.248  -0.605  1.00 0.20  ? 1139 ASP A C    10 
ATOM   6222  O  O    . ASP A 1 37 ? -2.186  -0.081  -0.746  1.00 0.29  ? 1139 ASP A O    10 
ATOM   6223  C  CB   . ASP A 1 37 ? 0.335   -1.754  -1.767  1.00 0.19  ? 1139 ASP A CB   10 
ATOM   6224  C  CG   . ASP A 1 37 ? -0.426  -2.666  -2.708  1.00 0.26  ? 1139 ASP A CG   10 
ATOM   6225  O  OD1  . ASP A 1 37 ? -0.609  -3.860  -2.384  1.00 0.33  ? 1139 ASP A OD1  10 
ATOM   6226  O  OD2  . ASP A 1 37 ? -0.861  -2.188  -3.772  1.00 0.32  ? 1139 ASP A OD2  10 
ATOM   6227  H  H    . ASP A 1 37 ? -0.298  -3.687  -0.114  1.00 0.26  ? 1139 ASP A H    10 
ATOM   6228  H  HA   . ASP A 1 37 ? 0.128   -0.808  0.145   1.00 0.20  ? 1139 ASP A HA   10 
ATOM   6229  H  HB2  . ASP A 1 37 ? 0.424   -0.784  -2.231  1.00 0.22  ? 1139 ASP A HB2  10 
ATOM   6230  H  HB3  . ASP A 1 37 ? 1.322   -2.167  -1.617  1.00 0.19  ? 1139 ASP A HB3  10 
ATOM   6231  N  N    . GLU A 1 38 ? -2.674  -2.266  -0.584  1.00 0.22  ? 1140 GLU A N    10 
ATOM   6232  C  CA   . GLU A 1 38 ? -4.106  -2.071  -0.769  1.00 0.27  ? 1140 GLU A CA   10 
ATOM   6233  C  C    . GLU A 1 38 ? -4.795  -1.895  0.580   1.00 0.31  ? 1140 GLU A C    10 
ATOM   6234  O  O    . GLU A 1 38 ? -5.975  -1.558  0.642   1.00 0.44  ? 1140 GLU A O    10 
ATOM   6235  C  CB   . GLU A 1 38 ? -4.723  -3.272  -1.488  1.00 0.29  ? 1140 GLU A CB   10 
ATOM   6236  C  CG   . GLU A 1 38 ? -4.136  -3.558  -2.858  1.00 0.29  ? 1140 GLU A CG   10 
ATOM   6237  C  CD   . GLU A 1 38 ? -4.413  -2.465  -3.866  1.00 0.28  ? 1140 GLU A CD   10 
ATOM   6238  O  OE1  . GLU A 1 38 ? -5.526  -1.904  -3.857  1.00 0.38  ? 1140 GLU A OE1  10 
ATOM   6239  O  OE2  . GLU A 1 38 ? -3.513  -2.166  -4.680  1.00 0.28  ? 1140 GLU A OE2  10 
ATOM   6240  H  H    . GLU A 1 38 ? -2.330  -3.175  -0.442  1.00 0.24  ? 1140 GLU A H    10 
ATOM   6241  H  HA   . GLU A 1 38 ? -4.253  -1.174  -1.369  1.00 0.30  ? 1140 GLU A HA   10 
ATOM   6242  H  HB2  . GLU A 1 38 ? -4.583  -4.150  -0.875  1.00 0.32  ? 1140 GLU A HB2  10 
ATOM   6243  H  HB3  . GLU A 1 38 ? -5.783  -3.097  -1.605  1.00 0.33  ? 1140 GLU A HB3  10 
ATOM   6244  H  HG2  . GLU A 1 38 ? -3.067  -3.665  -2.758  1.00 0.29  ? 1140 GLU A HG2  10 
ATOM   6245  H  HG3  . GLU A 1 38 ? -4.556  -4.482  -3.227  1.00 0.33  ? 1140 GLU A HG3  10 
ATOM   6246  N  N    . LYS A 1 39 ? -4.057  -2.128  1.660   1.00 0.30  ? 1141 LYS A N    10 
ATOM   6247  C  CA   . LYS A 1 39 ? -4.623  -2.033  3.002   1.00 0.37  ? 1141 LYS A CA   10 
ATOM   6248  C  C    . LYS A 1 39 ? -5.015  -0.590  3.321   1.00 0.49  ? 1141 LYS A C    10 
ATOM   6249  O  O    . LYS A 1 39 ? -5.950  -0.339  4.077   1.00 0.57  ? 1141 LYS A O    10 
ATOM   6250  C  CB   . LYS A 1 39 ? -3.635  -2.571  4.044   1.00 0.47  ? 1141 LYS A CB   10 
ATOM   6251  C  CG   . LYS A 1 39 ? -2.422  -1.685  4.277   1.00 0.57  ? 1141 LYS A CG   10 
ATOM   6252  C  CD   . LYS A 1 39 ? -1.474  -2.301  5.287   1.00 0.76  ? 1141 LYS A CD   10 
ATOM   6253  C  CE   . LYS A 1 39 ? -0.274  -1.408  5.542   1.00 0.91  ? 1141 LYS A CE   10 
ATOM   6254  N  NZ   . LYS A 1 39 ? -0.647  -0.159  6.256   1.00 1.55  ? 1141 LYS A NZ   10 
ATOM   6255  H  H    . LYS A 1 39 ? -3.119  -2.385  1.552   1.00 0.32  ? 1141 LYS A H    10 
ATOM   6256  H  HA   . LYS A 1 39 ? -5.515  -2.642  3.022   1.00 0.39  ? 1141 LYS A HA   10 
ATOM   6257  H  HB2  . LYS A 1 39 ? -4.147  -2.691  4.984   1.00 0.56  ? 1141 LYS A HB2  10 
ATOM   6258  H  HB3  . LYS A 1 39 ? -3.284  -3.538  3.716   1.00 0.47  ? 1141 LYS A HB3  10 
ATOM   6259  H  HG2  . LYS A 1 39 ? -1.900  -1.549  3.342   1.00 0.50  ? 1141 LYS A HG2  10 
ATOM   6260  H  HG3  . LYS A 1 39 ? -2.752  -0.727  4.647   1.00 0.65  ? 1141 LYS A HG3  10 
ATOM   6261  H  HD2  . LYS A 1 39 ? -2.002  -2.451  6.216   1.00 0.88  ? 1141 LYS A HD2  10 
ATOM   6262  H  HD3  . LYS A 1 39 ? -1.132  -3.252  4.909   1.00 0.73  ? 1141 LYS A HD3  10 
ATOM   6263  H  HE2  . LYS A 1 39 ? 0.436   -1.953  6.140   1.00 1.15  ? 1141 LYS A HE2  10 
ATOM   6264  H  HE3  . LYS A 1 39 ? 0.177   -1.153  4.595   1.00 1.18  ? 1141 LYS A HE3  10 
ATOM   6265  H  HZ1  . LYS A 1 39 ? -1.398  0.343   5.738   1.00 2.08  ? 1141 LYS A HZ1  10 
ATOM   6266  H  HZ2  . LYS A 1 39 ? 0.179   0.467   6.335   1.00 1.99  ? 1141 LYS A HZ2  10 
ATOM   6267  H  HZ3  . LYS A 1 39 ? -0.989  -0.383  7.212   1.00 1.97  ? 1141 LYS A HZ3  10 
ATOM   6268  N  N    . ASN A 1 40 ? -4.307  0.355   2.716   1.00 0.60  ? 1142 ASN A N    10 
ATOM   6269  C  CA   . ASN A 1 40 ? -4.628  1.772   2.867   1.00 0.81  ? 1142 ASN A CA   10 
ATOM   6270  C  C    . ASN A 1 40 ? -5.743  2.144   1.893   1.00 0.91  ? 1142 ASN A C    10 
ATOM   6271  O  O    . ASN A 1 40 ? -6.301  3.238   1.939   1.00 1.44  ? 1142 ASN A O    10 
ATOM   6272  C  CB   . ASN A 1 40 ? -3.373  2.620   2.619   1.00 1.07  ? 1142 ASN A CB   10 
ATOM   6273  C  CG   . ASN A 1 40 ? -3.599  4.107   2.836   1.00 1.37  ? 1142 ASN A CG   10 
ATOM   6274  O  OD1  . ASN A 1 40 ? -3.506  4.599   3.960   1.00 2.05  ? 1142 ASN A OD1  10 
ATOM   6275  N  ND2  . ASN A 1 40 ? -3.864  4.839   1.766   1.00 1.92  ? 1142 ASN A ND2  10 
ATOM   6276  H  H    . ASN A 1 40 ? -3.547  0.096   2.154   1.00 0.58  ? 1142 ASN A H    10 
ATOM   6277  H  HA   . ASN A 1 40 ? -4.975  1.930   3.878   1.00 0.86  ? 1142 ASN A HA   10 
ATOM   6278  H  HB2  . ASN A 1 40 ? -2.596  2.298   3.295   1.00 1.54  ? 1142 ASN A HB2  10 
ATOM   6279  H  HB3  . ASN A 1 40 ? -3.040  2.468   1.603   1.00 1.56  ? 1142 ASN A HB3  10 
ATOM   6280  H  HD21 . ASN A 1 40 ? -3.902  4.392   0.891   1.00 2.20  ? 1142 ASN A HD21 10 
ATOM   6281  H  HD22 . ASN A 1 40 ? -4.011  5.801   1.889   1.00 2.44  ? 1142 ASN A HD22 10 
ATOM   6282  N  N    . CYS A 1 41 ? -6.083  1.193   1.036   1.00 0.76  ? 1143 CYS A N    10 
ATOM   6283  C  CA   . CYS A 1 41 ? -7.098  1.384   0.014   1.00 0.99  ? 1143 CYS A CA   10 
ATOM   6284  C  C    . CYS A 1 41 ? -8.437  0.832   0.496   1.00 1.29  ? 1143 CYS A C    10 
ATOM   6285  O  O    . CYS A 1 41 ? -9.361  0.620   -0.294  1.00 1.67  ? 1143 CYS A O    10 
ATOM   6286  C  CB   . CYS A 1 41 ? -6.662  0.664   -1.267  1.00 0.93  ? 1143 CYS A CB   10 
ATOM   6287  S  SG   . CYS A 1 41 ? -7.551  1.161   -2.775  1.00 1.10  ? 1143 CYS A SG   10 
ATOM   6288  H  H    . CYS A 1 41 ? -5.637  0.320   1.097   1.00 0.89  ? 1143 CYS A H    10 
ATOM   6289  H  HA   . CYS A 1 41 ? -7.194  2.441   -0.181  1.00 1.23  ? 1143 CYS A HA   10 
ATOM   6290  H  HB2  . CYS A 1 41 ? -5.615  0.849   -1.430  1.00 0.98  ? 1143 CYS A HB2  10 
ATOM   6291  H  HB3  . CYS A 1 41 ? -6.813  -0.399  -1.135  1.00 1.29  ? 1143 CYS A HB3  10 
ATOM   6292  N  N    . ASN A 1 42 ? -8.508  0.604   1.816   1.00 1.87  ? 1144 ASN A N    10 
ATOM   6293  C  CA   . ASN A 1 42 ? -9.672  0.014   2.490   1.00 2.36  ? 1144 ASN A CA   10 
ATOM   6294  C  C    . ASN A 1 42 ? -10.245 -1.167  1.711   1.00 3.05  ? 1144 ASN A C    10 
ATOM   6295  O  O    . ASN A 1 42 ? -11.439 -1.223  1.418   1.00 3.73  ? 1144 ASN A O    10 
ATOM   6296  C  CB   . ASN A 1 42 ? -10.758 1.068   2.809   1.00 3.11  ? 1144 ASN A CB   10 
ATOM   6297  C  CG   . ASN A 1 42 ? -11.295 1.818   1.599   1.00 3.87  ? 1144 ASN A CG   10 
ATOM   6298  O  OD1  . ASN A 1 42 ? -10.744 2.847   1.199   1.00 4.27  ? 1144 ASN A OD1  10 
ATOM   6299  N  ND2  . ASN A 1 42 ? -12.389 1.333   1.030   1.00 4.59  ? 1144 ASN A ND2  10 
ATOM   6300  H  H    . ASN A 1 42 ? -7.734  0.848   2.364   1.00 2.27  ? 1144 ASN A H    10 
ATOM   6301  H  HA   . ASN A 1 42 ? -9.308  -0.375  3.431   1.00 2.42  ? 1144 ASN A HA   10 
ATOM   6302  H  HB2  . ASN A 1 42 ? -11.589 0.573   3.285   1.00 3.41  ? 1144 ASN A HB2  10 
ATOM   6303  H  HB3  . ASN A 1 42 ? -10.346 1.791   3.499   1.00 3.38  ? 1144 ASN A HB3  10 
ATOM   6304  H  HD21 . ASN A 1 42 ? -12.790 0.522   1.418   1.00 4.61  ? 1144 ASN A HD21 10 
ATOM   6305  H  HD22 . ASN A 1 42 ? -12.753 1.799   0.248   1.00 5.30  ? 1144 ASN A HD22 10 
ATOM   6306  N  N    . SER A 1 43 ? -9.378  -2.120  1.389   1.00 3.53  ? 1145 SER A N    10 
ATOM   6307  C  CA   . SER A 1 43 ? -9.784  -3.312  0.669   1.00 4.69  ? 1145 SER A CA   10 
ATOM   6308  C  C    . SER A 1 43 ? -10.757 -4.136  1.505   1.00 5.23  ? 1145 SER A C    10 
ATOM   6309  O  O    . SER A 1 43 ? -10.501 -4.418  2.678   1.00 5.32  ? 1145 SER A O    10 
ATOM   6310  C  CB   . SER A 1 43 ? -8.553  -4.141  0.299   1.00 5.40  ? 1145 SER A CB   10 
ATOM   6311  O  OG   . SER A 1 43 ? -7.655  -4.241  1.394   1.00 5.26  ? 1145 SER A OG   10 
ATOM   6312  H  H    . SER A 1 43 ? -8.439  -2.024  1.658   1.00 3.45  ? 1145 SER A H    10 
ATOM   6313  H  HA   . SER A 1 43 ? -10.282 -2.999  -0.236  1.00 5.07  ? 1145 SER A HA   10 
ATOM   6314  H  HB2  . SER A 1 43 ? -8.863  -5.134  0.013   1.00 6.23  ? 1145 SER A HB2  10 
ATOM   6315  H  HB3  . SER A 1 43 ? -8.044  -3.671  -0.528  1.00 5.56  ? 1145 SER A HB3  10 
ATOM   6316  H  HG   . SER A 1 43 ? -7.175  -5.087  1.342   1.00 5.21  ? 1145 SER A HG   10 
ATOM   6317  N  N    . THR A 1 44 ? -11.871 -4.517  0.898   1.00 5.97  ? 1146 THR A N    10 
ATOM   6318  C  CA   . THR A 1 44 ? -12.910 -5.269  1.591   1.00 6.81  ? 1146 THR A CA   10 
ATOM   6319  C  C    . THR A 1 44 ? -12.547 -6.751  1.694   1.00 7.34  ? 1146 THR A C    10 
ATOM   6320  O  O    . THR A 1 44 ? -13.371 -7.635  1.447   1.00 8.15  ? 1146 THR A O    10 
ATOM   6321  C  CB   . THR A 1 44 ? -14.263 -5.114  0.874   1.00 7.69  ? 1146 THR A CB   10 
ATOM   6322  O  OG1  . THR A 1 44 ? -14.108 -5.386  -0.527  1.00 7.92  ? 1146 THR A OG1  10 
ATOM   6323  C  CG2  . THR A 1 44 ? -14.819 -3.713  1.063   1.00 7.74  ? 1146 THR A CG2  10 
ATOM   6324  H  H    . THR A 1 44 ? -12.002 -4.284  -0.046  1.00 6.16  ? 1146 THR A H    10 
ATOM   6325  H  HA   . THR A 1 44 ? -13.006 -4.862  2.587   1.00 6.75  ? 1146 THR A HA   10 
ATOM   6326  H  HB   . THR A 1 44 ? -14.960 -5.823  1.296   1.00 8.40  ? 1146 THR A HB   10 
ATOM   6327  H  HG1  . THR A 1 44 ? -14.819 -5.970  -0.817  1.00 8.03  ? 1146 THR A HG1  10 
ATOM   6328  H  HG21 . THR A 1 44 ? -14.962 -3.522  2.117   1.00 7.71  ? 1146 THR A HG21 10 
ATOM   6329  H  HG22 . THR A 1 44 ? -15.765 -3.629  0.550   1.00 7.80  ? 1146 THR A HG22 10 
ATOM   6330  H  HG23 . THR A 1 44 ? -14.123 -2.992  0.659   1.00 8.03  ? 1146 THR A HG23 10 
ATOM   6331  N  N    . GLU A 1 45 ? -11.307 -7.012  2.079   1.00 7.13  ? 1147 GLU A N    10 
ATOM   6332  C  CA   . GLU A 1 45 ? -10.794 -8.367  2.143   1.00 7.94  ? 1147 GLU A CA   10 
ATOM   6333  C  C    . GLU A 1 45 ? -11.069 -9.002  3.502   1.00 8.95  ? 1147 GLU A C    10 
ATOM   6334  O  O    . GLU A 1 45 ? -10.881 -10.202 3.685   1.00 9.87  ? 1147 GLU A O    10 
ATOM   6335  C  CB   . GLU A 1 45 ? -9.295  -8.382  1.828   1.00 7.79  ? 1147 GLU A CB   10 
ATOM   6336  C  CG   . GLU A 1 45 ? -8.483  -7.358  2.605   1.00 7.90  ? 1147 GLU A CG   10 
ATOM   6337  C  CD   . GLU A 1 45 ? -7.004  -7.432  2.284   1.00 8.00  ? 1147 GLU A CD   10 
ATOM   6338  O  OE1  . GLU A 1 45 ? -6.293  -8.226  2.934   1.00 8.23  ? 1147 GLU A OE1  10 
ATOM   6339  O  OE2  . GLU A 1 45 ? -6.546  -6.689  1.388   1.00 8.08  ? 1147 GLU A OE2  10 
ATOM   6340  H  H    . GLU A 1 45 ? -10.721 -6.265  2.331   1.00 6.60  ? 1147 GLU A H    10 
ATOM   6341  H  HA   . GLU A 1 45 ? -11.307 -8.943  1.389   1.00 8.20  ? 1147 GLU A HA   10 
ATOM   6342  H  HB2  . GLU A 1 45 ? -8.904  -9.362  2.055   1.00 8.33  ? 1147 GLU A HB2  10 
ATOM   6343  H  HB3  . GLU A 1 45 ? -9.162  -8.189  0.774   1.00 7.37  ? 1147 GLU A HB3  10 
ATOM   6344  H  HG2  . GLU A 1 45 ? -8.841  -6.371  2.356   1.00 7.80  ? 1147 GLU A HG2  10 
ATOM   6345  H  HG3  . GLU A 1 45 ? -8.618  -7.533  3.662   1.00 8.35  ? 1147 GLU A HG3  10 
ATOM   6346  N  N    . THR A 1 46 ? -11.554 -8.208  4.445   1.00 8.94  ? 1148 THR A N    10 
ATOM   6347  C  CA   . THR A 1 46 ? -11.853 -8.714  5.776   1.00 10.03 ? 1148 THR A CA   10 
ATOM   6348  C  C    . THR A 1 46 ? -13.245 -9.355  5.798   1.00 10.71 ? 1148 THR A C    10 
ATOM   6349  O  O    . THR A 1 46 ? -14.111 -9.004  6.606   1.00 11.12 ? 1148 THR A O    10 
ATOM   6350  C  CB   . THR A 1 46 ? -11.762 -7.591  6.826   1.00 10.21 ? 1148 THR A CB   10 
ATOM   6351  O  OG1  . THR A 1 46 ? -10.584 -6.810  6.586   1.00 9.58  ? 1148 THR A OG1  10 
ATOM   6352  C  CG2  . THR A 1 46 ? -11.703 -8.166  8.235   1.00 11.01 ? 1148 THR A CG2  10 
ATOM   6353  H  H    . THR A 1 46 ? -11.724 -7.264  4.242   1.00 8.30  ? 1148 THR A H    10 
ATOM   6354  H  HA   . THR A 1 46 ? -11.119 -9.469  6.017   1.00 10.45 ? 1148 THR A HA   10 
ATOM   6355  H  HB   . THR A 1 46 ? -12.634 -6.961  6.742   1.00 10.48 ? 1148 THR A HB   10 
ATOM   6356  H  HG1  . THR A 1 46 ? -10.843 -5.932  6.278   1.00 9.43  ? 1148 THR A HG1  10 
ATOM   6357  H  HG21 . THR A 1 46 ? -12.584 -8.764  8.417   1.00 11.19 ? 1148 THR A HG21 10 
ATOM   6358  H  HG22 . THR A 1 46 ? -11.664 -7.359  8.950   1.00 11.07 ? 1148 THR A HG22 10 
ATOM   6359  H  HG23 . THR A 1 46 ? -10.822 -8.782  8.336   1.00 11.53 ? 1148 THR A HG23 10 
HETATM 6360  CA CA   . CA  B 2 .  ? -1.637  -2.876  -5.701  1.00 0.28  ? 1201 CA  A CA   10 
ATOM   6361  N  N    . THR A 1 1  ? 25.504  0.601   13.471  1.00 12.23 ? 1103 THR A N    11 
ATOM   6362  C  CA   . THR A 1 1  ? 25.647  -0.699  12.791  1.00 11.73 ? 1103 THR A CA   11 
ATOM   6363  C  C    . THR A 1 1  ? 24.458  -0.956  11.875  1.00 10.83 ? 1103 THR A C    11 
ATOM   6364  O  O    . THR A 1 1  ? 23.335  -0.553  12.186  1.00 10.67 ? 1103 THR A O    11 
ATOM   6365  C  CB   . THR A 1 1  ? 25.772  -1.843  13.816  1.00 11.83 ? 1103 THR A CB   11 
ATOM   6366  O  OG1  . THR A 1 1  ? 24.769  -1.706  14.832  1.00 12.26 ? 1103 THR A OG1  11 
ATOM   6367  C  CG2  . THR A 1 1  ? 27.151  -1.851  14.457  1.00 12.04 ? 1103 THR A CG2  11 
ATOM   6368  H  H1   . THR A 1 1  ? 25.428  1.364   12.771  1.00 12.23 ? 1103 THR A H1   11 
ATOM   6369  H  H2   . THR A 1 1  ? 26.327  0.782   14.077  1.00 12.55 ? 1103 THR A H2   11 
ATOM   6370  H  H3   . THR A 1 1  ? 24.649  0.599   14.060  1.00 12.44 ? 1103 THR A H3   11 
ATOM   6371  H  HA   . THR A 1 1  ? 26.547  -0.674  12.197  1.00 12.16 ? 1103 THR A HA   11 
ATOM   6372  H  HB   . THR A 1 1  ? 25.625  -2.782  13.302  1.00 11.67 ? 1103 THR A HB   11 
ATOM   6373  H  HG1  . THR A 1 1  ? 24.082  -2.374  14.697  1.00 12.30 ? 1103 THR A HG1  11 
ATOM   6374  H  HG21 . THR A 1 1  ? 27.903  -1.969  13.692  1.00 12.31 ? 1103 THR A HG21 11 
ATOM   6375  H  HG22 . THR A 1 1  ? 27.217  -2.672  15.157  1.00 12.05 ? 1103 THR A HG22 11 
ATOM   6376  H  HG23 . THR A 1 1  ? 27.311  -0.919  14.979  1.00 12.10 ? 1103 THR A HG23 11 
ATOM   6377  N  N    . HIS A 1 2  ? 24.716  -1.615  10.745  1.00 10.41 ? 1104 HIS A N    11 
ATOM   6378  C  CA   . HIS A 1 2  ? 23.681  -1.927  9.759   1.00 9.72  ? 1104 HIS A CA   11 
ATOM   6379  C  C    . HIS A 1 2  ? 23.063  -0.647  9.196   1.00 8.65  ? 1104 HIS A C    11 
ATOM   6380  O  O    . HIS A 1 2  ? 22.142  -0.075  9.783   1.00 8.32  ? 1104 HIS A O    11 
ATOM   6381  C  CB   . HIS A 1 2  ? 22.598  -2.832  10.369  1.00 10.05 ? 1104 HIS A CB   11 
ATOM   6382  C  CG   . HIS A 1 2  ? 21.480  -3.171  9.426   1.00 10.43 ? 1104 HIS A CG   11 
ATOM   6383  N  ND1  . HIS A 1 2  ? 20.150  -2.996  9.743   1.00 10.71 ? 1104 HIS A ND1  11 
ATOM   6384  C  CD2  . HIS A 1 2  ? 21.501  -3.679  8.173   1.00 10.84 ? 1104 HIS A CD2  11 
ATOM   6385  C  CE1  . HIS A 1 2  ? 19.403  -3.380  8.726   1.00 11.25 ? 1104 HIS A CE1  11 
ATOM   6386  N  NE2  . HIS A 1 2  ? 20.198  -3.799  7.759   1.00 11.34 ? 1104 HIS A NE2  11 
ATOM   6387  H  H    . HIS A 1 2  ? 25.639  -1.898  10.564  1.00 10.71 ? 1104 HIS A H    11 
ATOM   6388  H  HA   . HIS A 1 2  ? 24.159  -2.457  8.947   1.00 9.96  ? 1104 HIS A HA   11 
ATOM   6389  H  HB2  . HIS A 1 2  ? 23.052  -3.757  10.685  1.00 10.50 ? 1104 HIS A HB2  11 
ATOM   6390  H  HB3  . HIS A 1 2  ? 22.170  -2.337  11.228  1.00 9.81  ? 1104 HIS A HB3  11 
ATOM   6391  H  HD1  . HIS A 1 2  ? 19.802  -2.652  10.599  1.00 10.68 ? 1104 HIS A HD1  11 
ATOM   6392  H  HD2  . HIS A 1 2  ? 22.380  -3.943  7.603   1.00 10.94 ? 1104 HIS A HD2  11 
ATOM   6393  H  HE1  . HIS A 1 2  ? 18.324  -3.354  8.690   1.00 11.71 ? 1104 HIS A HE1  11 
ATOM   6394  H  HE2  . HIS A 1 2  ? 19.912  -3.972  6.834   1.00 11.83 ? 1104 HIS A HE2  11 
ATOM   6395  N  N    . ALA A 1 3  ? 23.583  -0.204  8.063   1.00 8.30  ? 1105 ALA A N    11 
ATOM   6396  C  CA   . ALA A 1 3  ? 23.083  0.992   7.402   1.00 7.41  ? 1105 ALA A CA   11 
ATOM   6397  C  C    . ALA A 1 3  ? 21.669  0.767   6.871   1.00 6.47  ? 1105 ALA A C    11 
ATOM   6398  O  O    . ALA A 1 3  ? 21.439  -0.142  6.072   1.00 6.54  ? 1105 ALA A O    11 
ATOM   6399  C  CB   . ALA A 1 3  ? 24.015  1.391   6.269   1.00 7.70  ? 1105 ALA A CB   11 
ATOM   6400  H  H    . ALA A 1 3  ? 24.328  -0.699  7.654   1.00 8.79  ? 1105 ALA A H    11 
ATOM   6401  H  HA   . ALA A 1 3  ? 23.068  1.792   8.125   1.00 7.45  ? 1105 ALA A HA   11 
ATOM   6402  H  HB1  . ALA A 1 3  ? 24.020  0.617   5.517   1.00 7.93  ? 1105 ALA A HB1  11 
ATOM   6403  H  HB2  . ALA A 1 3  ? 25.015  1.526   6.655   1.00 7.73  ? 1105 ALA A HB2  11 
ATOM   6404  H  HB3  . ALA A 1 3  ? 23.671  2.316   5.830   1.00 7.95  ? 1105 ALA A HB3  11 
ATOM   6405  N  N    . PRO A 1 4  ? 20.698  1.576   7.327   1.00 5.80  ? 1106 PRO A N    11 
ATOM   6406  C  CA   . PRO A 1 4  ? 19.309  1.481   6.867   1.00 4.97  ? 1106 PRO A CA   11 
ATOM   6407  C  C    . PRO A 1 4  ? 19.171  1.855   5.395   1.00 4.25  ? 1106 PRO A C    11 
ATOM   6408  O  O    . PRO A 1 4  ? 19.593  2.936   4.973   1.00 4.22  ? 1106 PRO A O    11 
ATOM   6409  C  CB   . PRO A 1 4  ? 18.554  2.488   7.744   1.00 4.84  ? 1106 PRO A CB   11 
ATOM   6410  C  CG   . PRO A 1 4  ? 19.479  2.811   8.870   1.00 5.55  ? 1106 PRO A CG   11 
ATOM   6411  C  CD   . PRO A 1 4  ? 20.867  2.638   8.330   1.00 6.09  ? 1106 PRO A CD   11 
ATOM   6412  H  HA   . PRO A 1 4  ? 18.910  0.490   7.023   1.00 5.32  ? 1106 PRO A HA   11 
ATOM   6413  H  HB2  . PRO A 1 4  ? 18.321  3.367   7.162   1.00 4.32  ? 1106 PRO A HB2  11 
ATOM   6414  H  HB3  . PRO A 1 4  ? 17.641  2.039   8.103   1.00 5.12  ? 1106 PRO A HB3  11 
ATOM   6415  H  HG2  . PRO A 1 4  ? 19.327  3.831   9.190   1.00 5.52  ? 1106 PRO A HG2  11 
ATOM   6416  H  HG3  . PRO A 1 4  ? 19.309  2.130   9.691   1.00 6.00  ? 1106 PRO A HG3  11 
ATOM   6417  H  HD2  . PRO A 1 4  ? 21.212  3.552   7.871   1.00 6.19  ? 1106 PRO A HD2  11 
ATOM   6418  H  HD3  . PRO A 1 4  ? 21.539  2.326   9.114   1.00 6.80  ? 1106 PRO A HD3  11 
ATOM   6419  N  N    . ALA A 1 5  ? 18.584  0.961   4.617   1.00 4.09  ? 1107 ALA A N    11 
ATOM   6420  C  CA   . ALA A 1 5  ? 18.421  1.184   3.192   1.00 3.77  ? 1107 ALA A CA   11 
ATOM   6421  C  C    . ALA A 1 5  ? 16.984  0.921   2.767   1.00 2.63  ? 1107 ALA A C    11 
ATOM   6422  O  O    . ALA A 1 5  ? 16.581  -0.228  2.586   1.00 2.62  ? 1107 ALA A O    11 
ATOM   6423  C  CB   . ALA A 1 5  ? 19.383  0.301   2.410   1.00 4.73  ? 1107 ALA A CB   11 
ATOM   6424  H  H    . ALA A 1 5  ? 18.240  0.132   5.013   1.00 4.51  ? 1107 ALA A H    11 
ATOM   6425  H  HA   . ALA A 1 5  ? 18.667  2.215   2.986   1.00 4.04  ? 1107 ALA A HA   11 
ATOM   6426  H  HB1  . ALA A 1 5  ? 20.396  0.514   2.715   1.00 5.01  ? 1107 ALA A HB1  11 
ATOM   6427  H  HB2  . ALA A 1 5  ? 19.274  0.499   1.355   1.00 4.95  ? 1107 ALA A HB2  11 
ATOM   6428  H  HB3  . ALA A 1 5  ? 19.158  -0.736  2.607   1.00 5.29  ? 1107 ALA A HB3  11 
ATOM   6429  N  N    . SER A 1 6  ? 16.212  1.986   2.621   1.00 2.16  ? 1108 SER A N    11 
ATOM   6430  C  CA   . SER A 1 6  ? 14.823  1.869   2.213   1.00 1.43  ? 1108 SER A CA   11 
ATOM   6431  C  C    . SER A 1 6  ? 14.704  1.810   0.692   1.00 1.29  ? 1108 SER A C    11 
ATOM   6432  O  O    . SER A 1 6  ? 15.712  1.835   -0.024  1.00 1.97  ? 1108 SER A O    11 
ATOM   6433  C  CB   . SER A 1 6  ? 14.015  3.039   2.776   1.00 2.09  ? 1108 SER A CB   11 
ATOM   6434  O  OG   . SER A 1 6  ? 14.635  4.280   2.479   1.00 2.97  ? 1108 SER A OG   11 
ATOM   6435  H  H    . SER A 1 6  ? 16.583  2.878   2.793   1.00 2.71  ? 1108 SER A H    11 
ATOM   6436  H  HA   . SER A 1 6  ? 14.435  0.951   2.622   1.00 1.32  ? 1108 SER A HA   11 
ATOM   6437  H  HB2  . SER A 1 6  ? 13.026  3.033   2.343   1.00 2.36  ? 1108 SER A HB2  11 
ATOM   6438  H  HB3  . SER A 1 6  ? 13.938  2.937   3.849   1.00 2.13  ? 1108 SER A HB3  11 
ATOM   6439  H  HG   . SER A 1 6  ? 13.963  4.913   2.192   1.00 3.32  ? 1108 SER A HG   11 
ATOM   6440  N  N    . CYS A 1 7  ? 13.475  1.734   0.207   1.00 0.72  ? 1109 CYS A N    11 
ATOM   6441  C  CA   . CYS A 1 7  ? 13.216  1.612   -1.222  1.00 0.49  ? 1109 CYS A CA   11 
ATOM   6442  C  C    . CYS A 1 7  ? 13.516  2.913   -1.967  1.00 0.46  ? 1109 CYS A C    11 
ATOM   6443  O  O    . CYS A 1 7  ? 14.031  3.875   -1.389  1.00 0.62  ? 1109 CYS A O    11 
ATOM   6444  C  CB   . CYS A 1 7  ? 11.761  1.200   -1.453  1.00 0.33  ? 1109 CYS A CB   11 
ATOM   6445  S  SG   . CYS A 1 7  ? 11.276  -0.327  -0.585  1.00 0.47  ? 1109 CYS A SG   11 
ATOM   6446  H  H    . CYS A 1 7  ? 12.719  1.753   0.827   1.00 0.94  ? 1109 CYS A H    11 
ATOM   6447  H  HA   . CYS A 1 7  ? 13.860  0.838   -1.609  1.00 0.60  ? 1109 CYS A HA   11 
ATOM   6448  H  HB2  . CYS A 1 7  ? 11.112  1.992   -1.111  1.00 0.41  ? 1109 CYS A HB2  11 
ATOM   6449  H  HB3  . CYS A 1 7  ? 11.603  1.044   -2.510  1.00 0.29  ? 1109 CYS A HB3  11 
ATOM   6450  N  N    . LEU A 1 8  ? 13.210  2.920   -3.256  1.00 0.34  ? 1110 LEU A N    11 
ATOM   6451  C  CA   . LEU A 1 8  ? 13.382  4.098   -4.097  1.00 0.32  ? 1110 LEU A CA   11 
ATOM   6452  C  C    . LEU A 1 8  ? 12.539  5.256   -3.569  1.00 0.29  ? 1110 LEU A C    11 
ATOM   6453  O  O    . LEU A 1 8  ? 11.587  5.042   -2.819  1.00 0.30  ? 1110 LEU A O    11 
ATOM   6454  C  CB   . LEU A 1 8  ? 12.933  3.755   -5.515  1.00 0.28  ? 1110 LEU A CB   11 
ATOM   6455  C  CG   . LEU A 1 8  ? 13.668  4.441   -6.662  1.00 0.38  ? 1110 LEU A CG   11 
ATOM   6456  C  CD1  . LEU A 1 8  ? 15.146  4.077   -6.655  1.00 0.52  ? 1110 LEU A CD1  11 
ATOM   6457  C  CD2  . LEU A 1 8  ? 13.024  4.041   -7.980  1.00 0.39  ? 1110 LEU A CD2  11 
ATOM   6458  H  H    . LEU A 1 8  ? 12.863  2.096   -3.665  1.00 0.34  ? 1110 LEU A H    11 
ATOM   6459  H  HA   . LEU A 1 8  ? 14.423  4.375   -4.100  1.00 0.40  ? 1110 LEU A HA   11 
ATOM   6460  H  HB2  . LEU A 1 8  ? 13.025  2.690   -5.643  1.00 0.32  ? 1110 LEU A HB2  11 
ATOM   6461  H  HB3  . LEU A 1 8  ? 11.885  4.008   -5.596  1.00 0.22  ? 1110 LEU A HB3  11 
ATOM   6462  H  HG   . LEU A 1 8  ? 13.583  5.512   -6.555  1.00 0.41  ? 1110 LEU A HG   11 
ATOM   6463  H  HD11 . LEU A 1 8  ? 15.643  4.569   -7.478  1.00 1.05  ? 1110 LEU A HD11 11 
ATOM   6464  H  HD12 . LEU A 1 8  ? 15.254  3.007   -6.757  1.00 1.29  ? 1110 LEU A HD12 11 
ATOM   6465  H  HD13 . LEU A 1 8  ? 15.593  4.395   -5.725  1.00 1.07  ? 1110 LEU A HD13 11 
ATOM   6466  H  HD21 . LEU A 1 8  ? 13.086  2.969   -8.100  1.00 1.11  ? 1110 LEU A HD21 11 
ATOM   6467  H  HD22 . LEU A 1 8  ? 13.537  4.526   -8.796  1.00 1.05  ? 1110 LEU A HD22 11 
ATOM   6468  H  HD23 . LEU A 1 8  ? 11.984  4.339   -7.976  1.00 0.97  ? 1110 LEU A HD23 11 
ATOM   6469  N  N    . ASP A 1 9  ? 12.871  6.474   -3.972  1.00 0.35  ? 1111 ASP A N    11 
ATOM   6470  C  CA   . ASP A 1 9  ? 12.079  7.638   -3.584  1.00 0.38  ? 1111 ASP A CA   11 
ATOM   6471  C  C    . ASP A 1 9  ? 10.680  7.544   -4.177  1.00 0.32  ? 1111 ASP A C    11 
ATOM   6472  O  O    . ASP A 1 9  ? 9.700   7.949   -3.554  1.00 0.42  ? 1111 ASP A O    11 
ATOM   6473  C  CB   . ASP A 1 9  ? 12.747  8.943   -4.028  1.00 0.51  ? 1111 ASP A CB   11 
ATOM   6474  C  CG   . ASP A 1 9  ? 13.975  9.279   -3.206  1.00 1.37  ? 1111 ASP A CG   11 
ATOM   6475  O  OD1  . ASP A 1 9  ? 13.825  9.609   -2.011  1.00 1.53  ? 1111 ASP A OD1  11 
ATOM   6476  O  OD2  . ASP A 1 9  ? 15.100  9.231   -3.755  1.00 2.32  ? 1111 ASP A OD2  11 
ATOM   6477  H  H    . ASP A 1 9  ? 13.668  6.596   -4.531  1.00 0.40  ? 1111 ASP A H    11 
ATOM   6478  H  HA   . ASP A 1 9  ? 11.998  7.634   -2.507  1.00 0.44  ? 1111 ASP A HA   11 
ATOM   6479  H  HB2  . ASP A 1 9  ? 13.044  8.854   -5.062  1.00 0.94  ? 1111 ASP A HB2  11 
ATOM   6480  H  HB3  . ASP A 1 9  ? 12.039  9.752   -3.930  1.00 1.01  ? 1111 ASP A HB3  11 
ATOM   6481  N  N    . THR A 1 10 ? 10.593  6.984   -5.375  1.00 0.28  ? 1112 THR A N    11 
ATOM   6482  C  CA   . THR A 1 10 ? 9.315   6.812   -6.042  1.00 0.31  ? 1112 THR A CA   11 
ATOM   6483  C  C    . THR A 1 10 ? 8.680   5.472   -5.682  1.00 0.24  ? 1112 THR A C    11 
ATOM   6484  O  O    . THR A 1 10 ? 7.562   5.175   -6.097  1.00 0.30  ? 1112 THR A O    11 
ATOM   6485  C  CB   . THR A 1 10 ? 9.473   6.906   -7.570  1.00 0.42  ? 1112 THR A CB   11 
ATOM   6486  O  OG1  . THR A 1 10 ? 10.518  6.027   -8.006  1.00 0.45  ? 1112 THR A OG1  11 
ATOM   6487  C  CG2  . THR A 1 10 ? 9.790   8.332   -7.995  1.00 0.52  ? 1112 THR A CG2  11 
ATOM   6488  H  H    . THR A 1 10 ? 11.409  6.687   -5.827  1.00 0.31  ? 1112 THR A H    11 
ATOM   6489  H  HA   . THR A 1 10 ? 8.660   7.608   -5.718  1.00 0.36  ? 1112 THR A HA   11 
ATOM   6490  H  HB   . THR A 1 10 ? 8.543   6.606   -8.033  1.00 0.48  ? 1112 THR A HB   11 
ATOM   6491  H  HG1  . THR A 1 10 ? 10.129  5.200   -8.322  1.00 0.95  ? 1112 THR A HG1  11 
ATOM   6492  H  HG21 . THR A 1 10 ? 9.907   8.371   -9.067  1.00 1.19  ? 1112 THR A HG21 11 
ATOM   6493  H  HG22 . THR A 1 10 ? 10.704  8.655   -7.520  1.00 1.09  ? 1112 THR A HG22 11 
ATOM   6494  H  HG23 . THR A 1 10 ? 8.981   8.983   -7.698  1.00 1.17  ? 1112 THR A HG23 11 
ATOM   6495  N  N    . GLN A 1 11 ? 9.392   4.660   -4.914  1.00 0.18  ? 1113 GLN A N    11 
ATOM   6496  C  CA   . GLN A 1 11 ? 8.882   3.361   -4.524  1.00 0.17  ? 1113 GLN A CA   11 
ATOM   6497  C  C    . GLN A 1 11 ? 8.196   3.399   -3.172  1.00 0.17  ? 1113 GLN A C    11 
ATOM   6498  O  O    . GLN A 1 11 ? 8.450   4.268   -2.338  1.00 0.23  ? 1113 GLN A O    11 
ATOM   6499  C  CB   . GLN A 1 11 ? 9.998   2.330   -4.488  1.00 0.17  ? 1113 GLN A CB   11 
ATOM   6500  C  CG   . GLN A 1 11 ? 10.388  1.814   -5.857  1.00 0.23  ? 1113 GLN A CG   11 
ATOM   6501  C  CD   . GLN A 1 11 ? 11.438  0.726   -5.777  1.00 0.35  ? 1113 GLN A CD   11 
ATOM   6502  O  OE1  . GLN A 1 11 ? 12.251  0.698   -4.848  1.00 1.02  ? 1113 GLN A OE1  11 
ATOM   6503  N  NE2  . GLN A 1 11 ? 11.437  -0.170  -6.746  1.00 0.67  ? 1113 GLN A NE2  11 
ATOM   6504  H  H    . GLN A 1 11 ? 10.278  4.939   -4.602  1.00 0.20  ? 1113 GLN A H    11 
ATOM   6505  H  HA   . GLN A 1 11 ? 8.158   3.059   -5.265  1.00 0.22  ? 1113 GLN A HA   11 
ATOM   6506  H  HB2  . GLN A 1 11 ? 10.871  2.778   -4.036  1.00 0.16  ? 1113 GLN A HB2  11 
ATOM   6507  H  HB3  . GLN A 1 11 ? 9.682   1.495   -3.887  1.00 0.20  ? 1113 GLN A HB3  11 
ATOM   6508  H  HG2  . GLN A 1 11 ? 9.512   1.421   -6.336  1.00 0.31  ? 1113 GLN A HG2  11 
ATOM   6509  H  HG3  . GLN A 1 11 ? 10.776  2.631   -6.442  1.00 0.22  ? 1113 GLN A HG3  11 
ATOM   6510  H  HE21 . GLN A 1 11 ? 10.760  -0.086  -7.456  1.00 1.21  ? 1113 GLN A HE21 11 
ATOM   6511  H  HE22 . GLN A 1 11 ? 12.113  -0.879  -6.723  1.00 0.65  ? 1113 GLN A HE22 11 
ATOM   6512  N  N    . TYR A 1 12 ? 7.330   2.427   -2.980  1.00 0.15  ? 1114 TYR A N    11 
ATOM   6513  C  CA   . TYR A 1 12 ? 6.625   2.232   -1.731  1.00 0.16  ? 1114 TYR A CA   11 
ATOM   6514  C  C    . TYR A 1 12 ? 7.268   1.077   -0.986  1.00 0.15  ? 1114 TYR A C    11 
ATOM   6515  O  O    . TYR A 1 12 ? 7.822   0.164   -1.601  1.00 0.15  ? 1114 TYR A O    11 
ATOM   6516  C  CB   . TYR A 1 12 ? 5.153   1.923   -2.009  1.00 0.18  ? 1114 TYR A CB   11 
ATOM   6517  C  CG   . TYR A 1 12 ? 4.291   1.749   -0.777  1.00 0.22  ? 1114 TYR A CG   11 
ATOM   6518  C  CD1  . TYR A 1 12 ? 3.851   2.854   -0.054  1.00 0.33  ? 1114 TYR A CD1  11 
ATOM   6519  C  CD2  . TYR A 1 12 ? 3.928   0.487   -0.330  1.00 0.21  ? 1114 TYR A CD2  11 
ATOM   6520  C  CE1  . TYR A 1 12 ? 3.071   2.703   1.075   1.00 0.39  ? 1114 TYR A CE1  11 
ATOM   6521  C  CE2  . TYR A 1 12 ? 3.148   0.330   0.799   1.00 0.26  ? 1114 TYR A CE2  11 
ATOM   6522  C  CZ   . TYR A 1 12 ? 2.693   1.417   1.474   1.00 0.34  ? 1114 TYR A CZ   11 
ATOM   6523  O  OH   . TYR A 1 12 ? 1.938   1.284   2.620   1.00 0.41  ? 1114 TYR A OH   11 
ATOM   6524  H  H    . TYR A 1 12 ? 7.168   1.793   -3.717  1.00 0.16  ? 1114 TYR A H    11 
ATOM   6525  H  HA   . TYR A 1 12 ? 6.707   3.134   -1.143  1.00 0.18  ? 1114 TYR A HA   11 
ATOM   6526  H  HB2  . TYR A 1 12 ? 4.729   2.723   -2.596  1.00 0.23  ? 1114 TYR A HB2  11 
ATOM   6527  H  HB3  . TYR A 1 12 ? 5.102   1.009   -2.573  1.00 0.18  ? 1114 TYR A HB3  11 
ATOM   6528  H  HD1  . TYR A 1 12 ? 4.124   3.845   -0.390  1.00 0.40  ? 1114 TYR A HD1  11 
ATOM   6529  H  HD2  . TYR A 1 12 ? 4.261   -0.380  -0.879  1.00 0.23  ? 1114 TYR A HD2  11 
ATOM   6530  H  HE1  . TYR A 1 12 ? 2.740   3.573   1.624   1.00 0.50  ? 1114 TYR A HE1  11 
ATOM   6531  H  HE2  . TYR A 1 12 ? 2.874   -0.658  1.131   1.00 0.29  ? 1114 TYR A HE2  11 
ATOM   6532  H  HH   . TYR A 1 12 ? 2.250   0.521   3.123   1.00 0.89  ? 1114 TYR A HH   11 
ATOM   6533  N  N    . THR A 1 13 ? 7.196   1.120   0.324   1.00 0.18  ? 1115 THR A N    11 
ATOM   6534  C  CA   . THR A 1 13 ? 7.771   0.077   1.147   1.00 0.20  ? 1115 THR A CA   11 
ATOM   6535  C  C    . THR A 1 13 ? 6.671   -0.652  1.904   1.00 0.23  ? 1115 THR A C    11 
ATOM   6536  O  O    . THR A 1 13 ? 6.154   -0.153  2.906   1.00 0.31  ? 1115 THR A O    11 
ATOM   6537  C  CB   . THR A 1 13 ? 8.796   0.648   2.144   1.00 0.26  ? 1115 THR A CB   11 
ATOM   6538  O  OG1  . THR A 1 13 ? 9.693   1.533   1.457   1.00 0.30  ? 1115 THR A OG1  11 
ATOM   6539  C  CG2  . THR A 1 13 ? 9.593   -0.470  2.809   1.00 0.27  ? 1115 THR A CG2  11 
ATOM   6540  H  H    . THR A 1 13 ? 6.720   1.861   0.750   1.00 0.22  ? 1115 THR A H    11 
ATOM   6541  H  HA   . THR A 1 13 ? 8.277   -0.624  0.497   1.00 0.19  ? 1115 THR A HA   11 
ATOM   6542  H  HB   . THR A 1 13 ? 8.268   1.200   2.909   1.00 0.31  ? 1115 THR A HB   11 
ATOM   6543  H  HG1  . THR A 1 13 ? 9.791   1.235   0.546   1.00 0.82  ? 1115 THR A HG1  11 
ATOM   6544  H  HG21 . THR A 1 13 ? 8.919   -1.134  3.330   1.00 1.01  ? 1115 THR A HG21 11 
ATOM   6545  H  HG22 . THR A 1 13 ? 10.294  -0.045  3.511   1.00 1.02  ? 1115 THR A HG22 11 
ATOM   6546  H  HG23 . THR A 1 13 ? 10.132  -1.026  2.054   1.00 1.10  ? 1115 THR A HG23 11 
ATOM   6547  N  N    . CYS A 1 14 ? 6.295   -1.818  1.393   1.00 0.26  ? 1116 CYS A N    11 
ATOM   6548  C  CA   . CYS A 1 14 ? 5.275   -2.645  2.025   1.00 0.34  ? 1116 CYS A CA   11 
ATOM   6549  C  C    . CYS A 1 14 ? 5.705   -3.031  3.434   1.00 0.40  ? 1116 CYS A C    11 
ATOM   6550  O  O    . CYS A 1 14 ? 6.885   -2.958  3.770   1.00 0.37  ? 1116 CYS A O    11 
ATOM   6551  C  CB   . CYS A 1 14 ? 5.053   -3.916  1.206   1.00 0.45  ? 1116 CYS A CB   11 
ATOM   6552  S  SG   . CYS A 1 14 ? 4.754   -3.630  -0.566  1.00 0.65  ? 1116 CYS A SG   11 
ATOM   6553  H  H    . CYS A 1 14 ? 6.716   -2.132  0.560   1.00 0.28  ? 1116 CYS A H    11 
ATOM   6554  H  HA   . CYS A 1 14 ? 4.357   -2.082  2.071   1.00 0.38  ? 1116 CYS A HA   11 
ATOM   6555  H  HB2  . CYS A 1 14 ? 5.925   -4.546  1.292   1.00 0.50  ? 1116 CYS A HB2  11 
ATOM   6556  H  HB3  . CYS A 1 14 ? 4.196   -4.443  1.601   1.00 0.54  ? 1116 CYS A HB3  11 
ATOM   6557  N  N    . ASP A 1 15 ? 4.743   -3.474  4.240   1.00 0.56  ? 1117 ASP A N    11 
ATOM   6558  C  CA   . ASP A 1 15 ? 5.012   -3.913  5.612   1.00 0.69  ? 1117 ASP A CA   11 
ATOM   6559  C  C    . ASP A 1 15 ? 5.842   -5.201  5.608   1.00 0.65  ? 1117 ASP A C    11 
ATOM   6560  O  O    . ASP A 1 15 ? 6.245   -5.712  6.652   1.00 0.71  ? 1117 ASP A O    11 
ATOM   6561  C  CB   . ASP A 1 15 ? 3.686   -4.132  6.348   1.00 0.93  ? 1117 ASP A CB   11 
ATOM   6562  C  CG   . ASP A 1 15 ? 3.846   -4.246  7.852   1.00 1.83  ? 1117 ASP A CG   11 
ATOM   6563  O  OD1  . ASP A 1 15 ? 3.942   -3.195  8.526   1.00 2.62  ? 1117 ASP A OD1  11 
ATOM   6564  O  OD2  . ASP A 1 15 ? 3.839   -5.378  8.376   1.00 2.09  ? 1117 ASP A OD2  11 
ATOM   6565  H  H    . ASP A 1 15 ? 3.819   -3.493  3.910   1.00 0.63  ? 1117 ASP A H    11 
ATOM   6566  H  HA   . ASP A 1 15 ? 5.571   -3.135  6.110   1.00 0.70  ? 1117 ASP A HA   11 
ATOM   6567  H  HB2  . ASP A 1 15 ? 3.028   -3.302  6.141   1.00 1.35  ? 1117 ASP A HB2  11 
ATOM   6568  H  HB3  . ASP A 1 15 ? 3.231   -5.042  5.985   1.00 0.70  ? 1117 ASP A HB3  11 
ATOM   6569  N  N    . ASN A 1 16 ? 6.088   -5.713  4.408   1.00 0.69  ? 1118 ASN A N    11 
ATOM   6570  C  CA   . ASN A 1 16 ? 6.910   -6.902  4.212   1.00 0.75  ? 1118 ASN A CA   11 
ATOM   6571  C  C    . ASN A 1 16 ? 8.286   -6.509  3.680   1.00 0.59  ? 1118 ASN A C    11 
ATOM   6572  O  O    . ASN A 1 16 ? 9.025   -7.351  3.168   1.00 0.65  ? 1118 ASN A O    11 
ATOM   6573  C  CB   . ASN A 1 16 ? 6.237   -7.853  3.216   1.00 0.98  ? 1118 ASN A CB   11 
ATOM   6574  C  CG   . ASN A 1 16 ? 4.887   -8.345  3.667   1.00 1.77  ? 1118 ASN A CG   11 
ATOM   6575  O  OD1  . ASN A 1 16 ? 4.004   -8.601  2.844   1.00 2.75  ? 1118 ASN A OD1  11 
ATOM   6576  N  ND2  . ASN A 1 16 ? 4.705   -8.478  4.960   1.00 2.02  ? 1118 ASN A ND2  11 
ATOM   6577  H  H    . ASN A 1 16 ? 5.703   -5.273  3.627   1.00 0.75  ? 1118 ASN A H    11 
ATOM   6578  H  HA   . ASN A 1 16 ? 7.022   -7.398  5.163   1.00 0.85  ? 1118 ASN A HA   11 
ATOM   6579  H  HB2  . ASN A 1 16 ? 6.091   -7.339  2.290   1.00 1.24  ? 1118 ASN A HB2  11 
ATOM   6580  H  HB3  . ASN A 1 16 ? 6.876   -8.708  3.054   1.00 1.41  ? 1118 ASN A HB3  11 
ATOM   6581  H  HD21 . ASN A 1 16 ? 5.445   -8.254  5.564   1.00 1.91  ? 1118 ASN A HD21 11 
ATOM   6582  H  HD22 . ASN A 1 16 ? 3.842   -8.799  5.263   1.00 2.74  ? 1118 ASN A HD22 11 
ATOM   6583  N  N    . HIS A 1 17 ? 8.615   -5.218  3.794   1.00 0.46  ? 1119 HIS A N    11 
ATOM   6584  C  CA   . HIS A 1 17 ? 9.858   -4.665  3.243   1.00 0.41  ? 1119 HIS A CA   11 
ATOM   6585  C  C    . HIS A 1 17 ? 9.954   -4.913  1.740   1.00 0.44  ? 1119 HIS A C    11 
ATOM   6586  O  O    . HIS A 1 17 ? 11.043  -5.075  1.190   1.00 0.79  ? 1119 HIS A O    11 
ATOM   6587  C  CB   . HIS A 1 17 ? 11.089  -5.236  3.958   1.00 0.51  ? 1119 HIS A CB   11 
ATOM   6588  C  CG   . HIS A 1 17 ? 11.376  -4.587  5.278   1.00 0.63  ? 1119 HIS A CG   11 
ATOM   6589  N  ND1  . HIS A 1 17 ? 11.057  -5.160  6.490   1.00 0.94  ? 1119 HIS A ND1  11 
ATOM   6590  C  CD2  . HIS A 1 17 ? 11.972  -3.407  5.571   1.00 0.78  ? 1119 HIS A CD2  11 
ATOM   6591  C  CE1  . HIS A 1 17 ? 11.444  -4.363  7.468   1.00 1.05  ? 1119 HIS A CE1  11 
ATOM   6592  N  NE2  . HIS A 1 17 ? 12.003  -3.294  6.937   1.00 0.93  ? 1119 HIS A NE2  11 
ATOM   6593  H  H    . HIS A 1 17 ? 8.007   -4.615  4.280   1.00 0.47  ? 1119 HIS A H    11 
ATOM   6594  H  HA   . HIS A 1 17 ? 9.832   -3.595  3.406   1.00 0.38  ? 1119 HIS A HA   11 
ATOM   6595  H  HB2  . HIS A 1 17 ? 10.937  -6.290  4.135   1.00 0.60  ? 1119 HIS A HB2  11 
ATOM   6596  H  HB3  . HIS A 1 17 ? 11.956  -5.105  3.328   1.00 0.55  ? 1119 HIS A HB3  11 
ATOM   6597  H  HD1  . HIS A 1 17 ? 10.594  -6.019  6.615   1.00 1.18  ? 1119 HIS A HD1  11 
ATOM   6598  H  HD2  . HIS A 1 17 ? 12.350  -2.687  4.859   1.00 1.00  ? 1119 HIS A HD2  11 
ATOM   6599  H  HE1  . HIS A 1 17 ? 11.328  -4.557  8.525   1.00 1.35  ? 1119 HIS A HE1  11 
ATOM   6600  H  HE2  . HIS A 1 17 ? 12.313  -2.506  7.435   1.00 1.09  ? 1119 HIS A HE2  11 
ATOM   6601  N  N    . GLN A 1 18 ? 8.804   -4.928  1.083   1.00 0.40  ? 1120 GLN A N    11 
ATOM   6602  C  CA   . GLN A 1 18 ? 8.736   -5.145  -0.353  1.00 0.38  ? 1120 GLN A CA   11 
ATOM   6603  C  C    . GLN A 1 18 ? 8.678   -3.805  -1.073  1.00 0.29  ? 1120 GLN A C    11 
ATOM   6604  O  O    . GLN A 1 18 ? 7.823   -2.971  -0.774  1.00 0.39  ? 1120 GLN A O    11 
ATOM   6605  C  CB   . GLN A 1 18 ? 7.500   -5.987  -0.695  1.00 0.49  ? 1120 GLN A CB   11 
ATOM   6606  C  CG   . GLN A 1 18 ? 7.363   -6.352  -2.167  1.00 0.50  ? 1120 GLN A CG   11 
ATOM   6607  C  CD   . GLN A 1 18 ? 8.496   -7.229  -2.664  1.00 1.05  ? 1120 GLN A CD   11 
ATOM   6608  O  OE1  . GLN A 1 18 ? 8.451   -8.452  -2.532  1.00 1.91  ? 1120 GLN A OE1  11 
ATOM   6609  N  NE2  . GLN A 1 18 ? 9.497   -6.617  -3.272  1.00 1.51  ? 1120 GLN A NE2  11 
ATOM   6610  H  H    . GLN A 1 18 ? 7.977   -4.780  1.580   1.00 0.63  ? 1120 GLN A H    11 
ATOM   6611  H  HA   . GLN A 1 18 ? 9.626   -5.676  -0.659  1.00 0.42  ? 1120 GLN A HA   11 
ATOM   6612  H  HB2  . GLN A 1 18 ? 7.541   -6.904  -0.126  1.00 0.62  ? 1120 GLN A HB2  11 
ATOM   6613  H  HB3  . GLN A 1 18 ? 6.619   -5.437  -0.403  1.00 0.52  ? 1120 GLN A HB3  11 
ATOM   6614  H  HG2  . GLN A 1 18 ? 6.432   -6.881  -2.308  1.00 0.87  ? 1120 GLN A HG2  11 
ATOM   6615  H  HG3  . GLN A 1 18 ? 7.349   -5.442  -2.750  1.00 0.86  ? 1120 GLN A HG3  11 
ATOM   6616  H  HE21 . GLN A 1 18 ? 9.457   -5.644  -3.372  1.00 1.83  ? 1120 GLN A HE21 11 
ATOM   6617  H  HE22 . GLN A 1 18 ? 10.241  -7.166  -3.604  1.00 1.99  ? 1120 GLN A HE22 11 
ATOM   6618  N  N    . CYS A 1 19 ? 9.601   -3.591  -1.995  1.00 0.21  ? 1121 CYS A N    11 
ATOM   6619  C  CA   . CYS A 1 19 ? 9.633   -2.356  -2.759  1.00 0.21  ? 1121 CYS A CA   11 
ATOM   6620  C  C    . CYS A 1 19 ? 8.795   -2.476  -4.024  1.00 0.20  ? 1121 CYS A C    11 
ATOM   6621  O  O    . CYS A 1 19 ? 9.046   -3.335  -4.871  1.00 0.34  ? 1121 CYS A O    11 
ATOM   6622  C  CB   . CYS A 1 19 ? 11.073  -1.990  -3.114  1.00 0.34  ? 1121 CYS A CB   11 
ATOM   6623  S  SG   . CYS A 1 19 ? 12.160  -1.800  -1.665  1.00 0.42  ? 1121 CYS A SG   11 
ATOM   6624  H  H    . CYS A 1 19 ? 10.288  -4.273  -2.158  1.00 0.29  ? 1121 CYS A H    11 
ATOM   6625  H  HA   . CYS A 1 19 ? 9.219   -1.575  -2.140  1.00 0.24  ? 1121 CYS A HA   11 
ATOM   6626  H  HB2  . CYS A 1 19 ? 11.490  -2.766  -3.740  1.00 0.39  ? 1121 CYS A HB2  11 
ATOM   6627  H  HB3  . CYS A 1 19 ? 11.079  -1.056  -3.656  1.00 0.41  ? 1121 CYS A HB3  11 
ATOM   6628  N  N    . ILE A 1 20 ? 7.785   -1.627  -4.129  1.00 0.15  ? 1122 ILE A N    11 
ATOM   6629  C  CA   . ILE A 1 20 ? 6.941   -1.566  -5.317  1.00 0.14  ? 1122 ILE A CA   11 
ATOM   6630  C  C    . ILE A 1 20 ? 6.765   -0.117  -5.745  1.00 0.14  ? 1122 ILE A C    11 
ATOM   6631  O  O    . ILE A 1 20 ? 7.209   0.790   -5.053  1.00 0.18  ? 1122 ILE A O    11 
ATOM   6632  C  CB   . ILE A 1 20 ? 5.546   -2.184  -5.077  1.00 0.14  ? 1122 ILE A CB   11 
ATOM   6633  C  CG1  . ILE A 1 20 ? 4.800   -1.407  -3.990  1.00 0.13  ? 1122 ILE A CG1  11 
ATOM   6634  C  CG2  . ILE A 1 20 ? 5.661   -3.657  -4.705  1.00 0.19  ? 1122 ILE A CG2  11 
ATOM   6635  C  CD1  . ILE A 1 20 ? 3.379   -1.872  -3.789  1.00 0.17  ? 1122 ILE A CD1  11 
ATOM   6636  H  H    . ILE A 1 20 ? 7.601   -1.010  -3.385  1.00 0.22  ? 1122 ILE A H    11 
ATOM   6637  H  HA   . ILE A 1 20 ? 7.428   -2.115  -6.106  1.00 0.17  ? 1122 ILE A HA   11 
ATOM   6638  H  HB   . ILE A 1 20 ? 4.988   -2.117  -6.000  1.00 0.16  ? 1122 ILE A HB   11 
ATOM   6639  H  HG12 . ILE A 1 20 ? 5.323   -1.517  -3.053  1.00 0.15  ? 1122 ILE A HG12 11 
ATOM   6640  H  HG13 . ILE A 1 20 ? 4.772   -0.361  -4.260  1.00 0.14  ? 1122 ILE A HG13 11 
ATOM   6641  H  HG21 . ILE A 1 20 ? 6.279   -3.759  -3.824  1.00 0.98  ? 1122 ILE A HG21 11 
ATOM   6642  H  HG22 . ILE A 1 20 ? 6.107   -4.203  -5.523  1.00 1.05  ? 1122 ILE A HG22 11 
ATOM   6643  H  HG23 . ILE A 1 20 ? 4.677   -4.055  -4.501  1.00 0.97  ? 1122 ILE A HG23 11 
ATOM   6644  H  HD11 . ILE A 1 20 ? 3.379   -2.911  -3.494  1.00 1.07  ? 1122 ILE A HD11 11 
ATOM   6645  H  HD12 . ILE A 1 20 ? 2.832   -1.762  -4.716  1.00 0.99  ? 1122 ILE A HD12 11 
ATOM   6646  H  HD13 . ILE A 1 20 ? 2.909   -1.280  -3.020  1.00 1.03  ? 1122 ILE A HD13 11 
ATOM   6647  N  N    . SER A 1 21 ? 6.134   0.101   -6.881  1.00 0.16  ? 1123 SER A N    11 
ATOM   6648  C  CA   . SER A 1 21 ? 5.805   1.448   -7.315  1.00 0.17  ? 1123 SER A CA   11 
ATOM   6649  C  C    . SER A 1 21 ? 4.684   2.018   -6.452  1.00 0.15  ? 1123 SER A C    11 
ATOM   6650  O  O    . SER A 1 21 ? 3.745   1.311   -6.083  1.00 0.17  ? 1123 SER A O    11 
ATOM   6651  C  CB   . SER A 1 21 ? 5.374   1.437   -8.785  1.00 0.24  ? 1123 SER A CB   11 
ATOM   6652  O  OG   . SER A 1 21 ? 4.769   2.669   -9.158  1.00 0.33  ? 1123 SER A OG   11 
ATOM   6653  H  H    . SER A 1 21 ? 5.891   -0.661  -7.449  1.00 0.20  ? 1123 SER A H    11 
ATOM   6654  H  HA   . SER A 1 21 ? 6.689   2.062   -7.205  1.00 0.19  ? 1123 SER A HA   11 
ATOM   6655  H  HB2  . SER A 1 21 ? 6.241   1.275   -9.410  1.00 0.27  ? 1123 SER A HB2  11 
ATOM   6656  H  HB3  . SER A 1 21 ? 4.664   0.639   -8.944  1.00 0.24  ? 1123 SER A HB3  11 
ATOM   6657  H  HG   . SER A 1 21 ? 5.176   3.388   -8.665  1.00 0.63  ? 1123 SER A HG   11 
ATOM   6658  N  N    . LYS A 1 22 ? 4.785   3.308   -6.135  1.00 0.17  ? 1124 LYS A N    11 
ATOM   6659  C  CA   . LYS A 1 22 ? 3.737   3.998   -5.397  1.00 0.19  ? 1124 LYS A CA   11 
ATOM   6660  C  C    . LYS A 1 22 ? 2.457   4.052   -6.220  1.00 0.22  ? 1124 LYS A C    11 
ATOM   6661  O  O    . LYS A 1 22 ? 1.369   4.216   -5.676  1.00 0.25  ? 1124 LYS A O    11 
ATOM   6662  C  CB   . LYS A 1 22 ? 4.172   5.417   -5.024  1.00 0.23  ? 1124 LYS A CB   11 
ATOM   6663  C  CG   . LYS A 1 22 ? 5.257   5.468   -3.964  1.00 0.25  ? 1124 LYS A CG   11 
ATOM   6664  C  CD   . LYS A 1 22 ? 5.686   6.898   -3.678  1.00 0.25  ? 1124 LYS A CD   11 
ATOM   6665  C  CE   . LYS A 1 22 ? 6.729   6.955   -2.574  1.00 0.30  ? 1124 LYS A CE   11 
ATOM   6666  N  NZ   . LYS A 1 22 ? 7.189   8.344   -2.307  1.00 1.24  ? 1124 LYS A NZ   11 
ATOM   6667  H  H    . LYS A 1 22 ? 5.589   3.806   -6.402  1.00 0.20  ? 1124 LYS A H    11 
ATOM   6668  H  HA   . LYS A 1 22 ? 3.546   3.440   -4.493  1.00 0.19  ? 1124 LYS A HA   11 
ATOM   6669  H  HB2  . LYS A 1 22 ? 4.540   5.911   -5.909  1.00 0.30  ? 1124 LYS A HB2  11 
ATOM   6670  H  HB3  . LYS A 1 22 ? 3.312   5.958   -4.654  1.00 0.30  ? 1124 LYS A HB3  11 
ATOM   6671  H  HG2  . LYS A 1 22 ? 4.881   5.025   -3.054  1.00 0.37  ? 1124 LYS A HG2  11 
ATOM   6672  H  HG3  . LYS A 1 22 ? 6.112   4.906   -4.313  1.00 0.37  ? 1124 LYS A HG3  11 
ATOM   6673  H  HD2  . LYS A 1 22 ? 6.105   7.326   -4.577  1.00 0.32  ? 1124 LYS A HD2  11 
ATOM   6674  H  HD3  . LYS A 1 22 ? 4.820   7.468   -3.375  1.00 0.33  ? 1124 LYS A HD3  11 
ATOM   6675  H  HE2  . LYS A 1 22 ? 6.299   6.551   -1.669  1.00 0.93  ? 1124 LYS A HE2  11 
ATOM   6676  H  HE3  . LYS A 1 22 ? 7.577   6.353   -2.866  1.00 0.95  ? 1124 LYS A HE3  11 
ATOM   6677  H  HZ1  . LYS A 1 22 ? 7.799   8.360   -1.467  1.00 1.76  ? 1124 LYS A HZ1  11 
ATOM   6678  H  HZ2  . LYS A 1 22 ? 6.375   8.968   -2.143  1.00 1.77  ? 1124 LYS A HZ2  11 
ATOM   6679  H  HZ3  . LYS A 1 22 ? 7.731   8.706   -3.120  1.00 1.88  ? 1124 LYS A HZ3  11 
ATOM   6680  N  N    . ASN A 1 23 ? 2.592   3.895   -7.533  1.00 0.24  ? 1125 ASN A N    11 
ATOM   6681  C  CA   . ASN A 1 23 ? 1.435   3.914   -8.424  1.00 0.28  ? 1125 ASN A CA   11 
ATOM   6682  C  C    . ASN A 1 23 ? 0.700   2.581   -8.378  1.00 0.26  ? 1125 ASN A C    11 
ATOM   6683  O  O    . ASN A 1 23 ? -0.430  2.465   -8.846  1.00 0.32  ? 1125 ASN A O    11 
ATOM   6684  C  CB   . ASN A 1 23 ? 1.852   4.236   -9.862  1.00 0.36  ? 1125 ASN A CB   11 
ATOM   6685  C  CG   . ASN A 1 23 ? 2.377   5.650   -10.015 1.00 1.03  ? 1125 ASN A CG   11 
ATOM   6686  O  OD1  . ASN A 1 23 ? 1.615   6.589   -10.244 1.00 1.75  ? 1125 ASN A OD1  11 
ATOM   6687  N  ND2  . ASN A 1 23 ? 3.684   5.813   -9.907  1.00 1.69  ? 1125 ASN A ND2  11 
ATOM   6688  H  H    . ASN A 1 23 ? 3.486   3.756   -7.911  1.00 0.25  ? 1125 ASN A H    11 
ATOM   6689  H  HA   . ASN A 1 23 ? 0.767   4.688   -8.073  1.00 0.31  ? 1125 ASN A HA   11 
ATOM   6690  H  HB2  . ASN A 1 23 ? 2.628   3.551   -10.167 1.00 0.82  ? 1125 ASN A HB2  11 
ATOM   6691  H  HB3  . ASN A 1 23 ? 0.998   4.117   -10.512 1.00 0.82  ? 1125 ASN A HB3  11 
ATOM   6692  H  HD21 . ASN A 1 23 ? 4.240   5.022   -9.742  1.00 1.99  ? 1125 ASN A HD21 11 
ATOM   6693  H  HD22 . ASN A 1 23 ? 4.047   6.720   -9.993  1.00 2.22  ? 1125 ASN A HD22 11 
ATOM   6694  N  N    . TRP A 1 24 ? 1.352   1.577   -7.804  1.00 0.22  ? 1126 TRP A N    11 
ATOM   6695  C  CA   . TRP A 1 24 ? 0.750   0.260   -7.650  1.00 0.22  ? 1126 TRP A CA   11 
ATOM   6696  C  C    . TRP A 1 24 ? -0.067  0.200   -6.368  1.00 0.20  ? 1126 TRP A C    11 
ATOM   6697  O  O    . TRP A 1 24 ? -0.901  -0.676  -6.194  1.00 0.26  ? 1126 TRP A O    11 
ATOM   6698  C  CB   . TRP A 1 24 ? 1.824   -0.832  -7.606  1.00 0.25  ? 1126 TRP A CB   11 
ATOM   6699  C  CG   . TRP A 1 24 ? 2.584   -1.019  -8.887  1.00 0.31  ? 1126 TRP A CG   11 
ATOM   6700  C  CD1  . TRP A 1 24 ? 2.548   -0.227  -9.999  1.00 0.37  ? 1126 TRP A CD1  11 
ATOM   6701  C  CD2  . TRP A 1 24 ? 3.497   -2.083  -9.181  1.00 0.38  ? 1126 TRP A CD2  11 
ATOM   6702  N  NE1  . TRP A 1 24 ? 3.385   -0.733  -10.964 1.00 0.45  ? 1126 TRP A NE1  11 
ATOM   6703  C  CE2  . TRP A 1 24 ? 3.977   -1.873  -10.486 1.00 0.45  ? 1126 TRP A CE2  11 
ATOM   6704  C  CE3  . TRP A 1 24 ? 3.956   -3.192  -8.464  1.00 0.44  ? 1126 TRP A CE3  11 
ATOM   6705  C  CZ2  . TRP A 1 24 ? 4.890   -2.733  -11.090 1.00 0.54  ? 1126 TRP A CZ2  11 
ATOM   6706  C  CZ3  . TRP A 1 24 ? 4.862   -4.044  -9.066  1.00 0.55  ? 1126 TRP A CZ3  11 
ATOM   6707  C  CH2  . TRP A 1 24 ? 5.321   -3.811  -10.365 1.00 0.58  ? 1126 TRP A CH2  11 
ATOM   6708  H  H    . TRP A 1 24 ? 2.264   1.726   -7.473  1.00 0.23  ? 1126 TRP A H    11 
ATOM   6709  H  HA   . TRP A 1 24 ? 0.096   0.085   -8.493  1.00 0.25  ? 1126 TRP A HA   11 
ATOM   6710  H  HB2  . TRP A 1 24 ? 2.537   -0.592  -6.834  1.00 0.27  ? 1126 TRP A HB2  11 
ATOM   6711  H  HB3  . TRP A 1 24 ? 1.350   -1.774  -7.362  1.00 0.28  ? 1126 TRP A HB3  11 
ATOM   6712  H  HD1  . TRP A 1 24 ? 1.947   0.664   -10.092 1.00 0.40  ? 1126 TRP A HD1  11 
ATOM   6713  H  HE1  . TRP A 1 24 ? 3.533   -0.345  -11.852 1.00 0.53  ? 1126 TRP A HE1  11 
ATOM   6714  H  HE3  . TRP A 1 24 ? 3.611   -3.389  -7.459  1.00 0.45  ? 1126 TRP A HE3  11 
ATOM   6715  H  HZ2  . TRP A 1 24 ? 5.255   -2.567  -12.092 1.00 0.61  ? 1126 TRP A HZ2  11 
ATOM   6716  H  HZ3  . TRP A 1 24 ? 5.225   -4.907  -8.527  1.00 0.62  ? 1126 TRP A HZ3  11 
ATOM   6717  H  HH2  . TRP A 1 24 ? 6.029   -4.503  -10.796 1.00 0.67  ? 1126 TRP A HH2  11 
ATOM   6718  N  N    . VAL A 1 25 ? 0.180   1.133   -5.470  1.00 0.19  ? 1127 VAL A N    11 
ATOM   6719  C  CA   . VAL A 1 25 ? -0.480  1.134   -4.172  1.00 0.18  ? 1127 VAL A CA   11 
ATOM   6720  C  C    . VAL A 1 25 ? -1.968  1.420   -4.314  1.00 0.19  ? 1127 VAL A C    11 
ATOM   6721  O  O    . VAL A 1 25 ? -2.362  2.464   -4.840  1.00 0.23  ? 1127 VAL A O    11 
ATOM   6722  C  CB   . VAL A 1 25 ? 0.164   2.171   -3.227  1.00 0.21  ? 1127 VAL A CB   11 
ATOM   6723  C  CG1  . VAL A 1 25 ? -0.515  2.175   -1.867  1.00 0.24  ? 1127 VAL A CG1  11 
ATOM   6724  C  CG2  . VAL A 1 25 ? 1.650   1.900   -3.080  1.00 0.24  ? 1127 VAL A CG2  11 
ATOM   6725  H  H    . VAL A 1 25 ? 0.817   1.846   -5.684  1.00 0.21  ? 1127 VAL A H    11 
ATOM   6726  H  HA   . VAL A 1 25 ? -0.361  0.151   -3.737  1.00 0.19  ? 1127 VAL A HA   11 
ATOM   6727  H  HB   . VAL A 1 25 ? 0.043   3.148   -3.668  1.00 0.23  ? 1127 VAL A HB   11 
ATOM   6728  H  HG11 . VAL A 1 25 ? -0.043  2.911   -1.232  1.00 1.01  ? 1127 VAL A HG11 11 
ATOM   6729  H  HG12 . VAL A 1 25 ? -0.424  1.199   -1.415  1.00 1.02  ? 1127 VAL A HG12 11 
ATOM   6730  H  HG13 . VAL A 1 25 ? -1.560  2.421   -1.987  1.00 1.00  ? 1127 VAL A HG13 11 
ATOM   6731  H  HG21 . VAL A 1 25 ? 1.797   0.925   -2.639  1.00 1.05  ? 1127 VAL A HG21 11 
ATOM   6732  H  HG22 . VAL A 1 25 ? 2.093   2.652   -2.442  1.00 1.06  ? 1127 VAL A HG22 11 
ATOM   6733  H  HG23 . VAL A 1 25 ? 2.120   1.930   -4.051  1.00 1.01  ? 1127 VAL A HG23 11 
ATOM   6734  N  N    . CYS A 1 26 ? -2.782  0.471   -3.855  1.00 0.19  ? 1128 CYS A N    11 
ATOM   6735  C  CA   . CYS A 1 26 ? -4.235  0.592   -3.896  1.00 0.26  ? 1128 CYS A CA   11 
ATOM   6736  C  C    . CYS A 1 26 ? -4.721  0.687   -5.342  1.00 0.27  ? 1128 CYS A C    11 
ATOM   6737  O  O    . CYS A 1 26 ? -5.424  1.622   -5.728  1.00 0.37  ? 1128 CYS A O    11 
ATOM   6738  C  CB   . CYS A 1 26 ? -4.689  1.805   -3.074  1.00 0.32  ? 1128 CYS A CB   11 
ATOM   6739  S  SG   . CYS A 1 26 ? -6.497  1.998   -2.926  1.00 0.58  ? 1128 CYS A SG   11 
ATOM   6740  H  H    . CYS A 1 26 ? -2.387  -0.344  -3.473  1.00 0.19  ? 1128 CYS A H    11 
ATOM   6741  H  HA   . CYS A 1 26 ? -4.649  -0.303  -3.454  1.00 0.28  ? 1128 CYS A HA   11 
ATOM   6742  H  HB2  . CYS A 1 26 ? -4.290  1.717   -2.075  1.00 0.36  ? 1128 CYS A HB2  11 
ATOM   6743  H  HB3  . CYS A 1 26 ? -4.298  2.699   -3.528  1.00 0.36  ? 1128 CYS A HB3  11 
ATOM   6744  N  N    . ASP A 1 27 ? -4.326  -0.291  -6.141  1.00 0.25  ? 1129 ASP A N    11 
ATOM   6745  C  CA   . ASP A 1 27 ? -4.717  -0.347  -7.551  1.00 0.30  ? 1129 ASP A CA   11 
ATOM   6746  C  C    . ASP A 1 27 ? -5.560  -1.596  -7.818  1.00 0.37  ? 1129 ASP A C    11 
ATOM   6747  O  O    . ASP A 1 27 ? -5.566  -2.134  -8.921  1.00 0.41  ? 1129 ASP A O    11 
ATOM   6748  C  CB   . ASP A 1 27 ? -3.471  -0.342  -8.450  1.00 0.31  ? 1129 ASP A CB   11 
ATOM   6749  C  CG   . ASP A 1 27 ? -2.755  -1.678  -8.470  1.00 0.35  ? 1129 ASP A CG   11 
ATOM   6750  O  OD1  . ASP A 1 27 ? -2.722  -2.354  -7.424  1.00 0.31  ? 1129 ASP A OD1  11 
ATOM   6751  O  OD2  . ASP A 1 27 ? -2.216  -2.053  -9.529  1.00 0.46  ? 1129 ASP A OD2  11 
ATOM   6752  H  H    . ASP A 1 27 ? -3.747  -1.001  -5.772  1.00 0.24  ? 1129 ASP A H    11 
ATOM   6753  H  HA   . ASP A 1 27 ? -5.312  0.527   -7.766  1.00 0.33  ? 1129 ASP A HA   11 
ATOM   6754  H  HB2  . ASP A 1 27 ? -3.760  -0.098  -9.460  1.00 0.36  ? 1129 ASP A HB2  11 
ATOM   6755  H  HB3  . ASP A 1 27 ? -2.781  0.407   -8.090  1.00 0.29  ? 1129 ASP A HB3  11 
ATOM   6756  N  N    . THR A 1 28 ? -6.249  -2.049  -6.772  1.00 0.45  ? 1130 THR A N    11 
ATOM   6757  C  CA   . THR A 1 28 ? -7.109  -3.245  -6.795  1.00 0.56  ? 1130 THR A CA   11 
ATOM   6758  C  C    . THR A 1 28 ? -6.329  -4.517  -7.150  1.00 0.61  ? 1130 THR A C    11 
ATOM   6759  O  O    . THR A 1 28 ? -6.917  -5.545  -7.492  1.00 0.73  ? 1130 THR A O    11 
ATOM   6760  C  CB   . THR A 1 28 ? -8.348  -3.103  -7.725  1.00 0.59  ? 1130 THR A CB   11 
ATOM   6761  O  OG1  . THR A 1 28 ? -7.977  -3.042  -9.108  1.00 0.56  ? 1130 THR A OG1  11 
ATOM   6762  C  CG2  . THR A 1 28 ? -9.150  -1.864  -7.359  1.00 0.65  ? 1130 THR A CG2  11 
ATOM   6763  H  H    . THR A 1 28 ? -6.171  -1.559  -5.925  1.00 0.46  ? 1130 THR A H    11 
ATOM   6764  H  HA   . THR A 1 28 ? -7.482  -3.366  -5.789  1.00 0.64  ? 1130 THR A HA   11 
ATOM   6765  H  HB   . THR A 1 28 ? -8.980  -3.965  -7.576  1.00 0.67  ? 1130 THR A HB   11 
ATOM   6766  H  HG1  . THR A 1 28 ? -7.120  -2.603  -9.192  1.00 0.53  ? 1130 THR A HG1  11 
ATOM   6767  H  HG21 . THR A 1 28 ? -10.022 -1.797  -7.992  1.00 1.34  ? 1130 THR A HG21 11 
ATOM   6768  H  HG22 . THR A 1 28 ? -8.536  -0.986  -7.498  1.00 1.09  ? 1130 THR A HG22 11 
ATOM   6769  H  HG23 . THR A 1 28 ? -9.457  -1.927  -6.325  1.00 1.21  ? 1130 THR A HG23 11 
ATOM   6770  N  N    . ASP A 1 29 ? -5.008  -4.450  -7.049  1.00 0.59  ? 1131 ASP A N    11 
ATOM   6771  C  CA   . ASP A 1 29 ? -4.161  -5.607  -7.302  1.00 0.69  ? 1131 ASP A CA   11 
ATOM   6772  C  C    . ASP A 1 29 ? -3.127  -5.739  -6.192  1.00 0.67  ? 1131 ASP A C    11 
ATOM   6773  O  O    . ASP A 1 29 ? -2.340  -4.829  -5.962  1.00 0.53  ? 1131 ASP A O    11 
ATOM   6774  C  CB   . ASP A 1 29 ? -3.466  -5.475  -8.659  1.00 0.75  ? 1131 ASP A CB   11 
ATOM   6775  C  CG   . ASP A 1 29 ? -2.800  -6.763  -9.102  1.00 0.92  ? 1131 ASP A CG   11 
ATOM   6776  O  OD1  . ASP A 1 29 ? -1.619  -6.981  -8.766  1.00 0.92  ? 1131 ASP A OD1  11 
ATOM   6777  O  OD2  . ASP A 1 29 ? -3.457  -7.568  -9.795  1.00 1.21  ? 1131 ASP A OD2  11 
ATOM   6778  H  H    . ASP A 1 29 ? -4.589  -3.597  -6.806  1.00 0.55  ? 1131 ASP A H    11 
ATOM   6779  H  HA   . ASP A 1 29 ? -4.786  -6.486  -7.308  1.00 0.81  ? 1131 ASP A HA   11 
ATOM   6780  H  HB2  . ASP A 1 29 ? -4.197  -5.196  -9.401  1.00 0.81  ? 1131 ASP A HB2  11 
ATOM   6781  H  HB3  . ASP A 1 29 ? -2.712  -4.704  -8.596  1.00 0.68  ? 1131 ASP A HB3  11 
ATOM   6782  N  N    . ASN A 1 30 ? -3.145  -6.855  -5.488  1.00 0.94  ? 1132 ASN A N    11 
ATOM   6783  C  CA   . ASN A 1 30 ? -2.238  -7.060  -4.361  1.00 1.00  ? 1132 ASN A CA   11 
ATOM   6784  C  C    . ASN A 1 30 ? -0.796  -7.231  -4.841  1.00 0.91  ? 1132 ASN A C    11 
ATOM   6785  O  O    . ASN A 1 30 ? -0.424  -8.269  -5.392  1.00 1.06  ? 1132 ASN A O    11 
ATOM   6786  C  CB   . ASN A 1 30 ? -2.683  -8.265  -3.514  1.00 1.29  ? 1132 ASN A CB   11 
ATOM   6787  C  CG   . ASN A 1 30 ? -2.798  -9.561  -4.307  1.00 1.72  ? 1132 ASN A CG   11 
ATOM   6788  O  OD1  . ASN A 1 30 ? -3.076  -9.556  -5.506  1.00 2.58  ? 1132 ASN A OD1  11 
ATOM   6789  N  ND2  . ASN A 1 30 ? -2.598  -10.682 -3.637  1.00 2.07  ? 1132 ASN A ND2  11 
ATOM   6790  H  H    . ASN A 1 30 ? -3.772  -7.570  -5.734  1.00 1.15  ? 1132 ASN A H    11 
ATOM   6791  H  HA   . ASN A 1 30 ? -2.285  -6.172  -3.747  1.00 0.97  ? 1132 ASN A HA   11 
ATOM   6792  H  HB2  . ASN A 1 30 ? -1.964  -8.420  -2.724  1.00 1.52  ? 1132 ASN A HB2  11 
ATOM   6793  H  HB3  . ASN A 1 30 ? -3.646  -8.048  -3.077  1.00 1.97  ? 1132 ASN A HB3  11 
ATOM   6794  H  HD21 . ASN A 1 30 ? -2.389  -10.621 -2.678  1.00 2.11  ? 1132 ASN A HD21 11 
ATOM   6795  H  HD22 . ASN A 1 30 ? -2.669  -11.530 -4.122  1.00 2.73  ? 1132 ASN A HD22 11 
ATOM   6796  N  N    . ASP A 1 31 ? 0.020   -6.201  -4.630  1.00 0.86  ? 1133 ASP A N    11 
ATOM   6797  C  CA   . ASP A 1 31 ? 1.401   -6.224  -5.101  1.00 0.77  ? 1133 ASP A CA   11 
ATOM   6798  C  C    . ASP A 1 31 ? 2.333   -6.693  -4.004  1.00 0.78  ? 1133 ASP A C    11 
ATOM   6799  O  O    . ASP A 1 31 ? 3.273   -7.444  -4.257  1.00 1.28  ? 1133 ASP A O    11 
ATOM   6800  C  CB   . ASP A 1 31 ? 1.847   -4.853  -5.611  1.00 0.67  ? 1133 ASP A CB   11 
ATOM   6801  C  CG   . ASP A 1 31 ? 1.128   -4.442  -6.874  1.00 0.58  ? 1133 ASP A CG   11 
ATOM   6802  O  OD1  . ASP A 1 31 ? 1.454   -4.974  -7.953  1.00 1.09  ? 1133 ASP A OD1  11 
ATOM   6803  O  OD2  . ASP A 1 31 ? 0.226   -3.586  -6.789  1.00 1.00  ? 1133 ASP A OD2  11 
ATOM   6804  H  H    . ASP A 1 31 ? -0.308  -5.421  -4.132  1.00 1.05  ? 1133 ASP A H    11 
ATOM   6805  H  HA   . ASP A 1 31 ? 1.453   -6.925  -5.915  1.00 0.87  ? 1133 ASP A HA   11 
ATOM   6806  H  HB2  . ASP A 1 31 ? 1.652   -4.114  -4.854  1.00 1.04  ? 1133 ASP A HB2  11 
ATOM   6807  H  HB3  . ASP A 1 31 ? 2.907   -4.881  -5.816  1.00 1.05  ? 1133 ASP A HB3  11 
ATOM   6808  N  N    . CYS A 1 32 ? 2.076   -6.251  -2.785  1.00 0.76  ? 1134 CYS A N    11 
ATOM   6809  C  CA   . CYS A 1 32 ? 2.847   -6.718  -1.648  1.00 0.78  ? 1134 CYS A CA   11 
ATOM   6810  C  C    . CYS A 1 32 ? 2.433   -8.145  -1.312  1.00 0.85  ? 1134 CYS A C    11 
ATOM   6811  O  O    . CYS A 1 32 ? 1.304   -8.539  -1.612  1.00 1.57  ? 1134 CYS A O    11 
ATOM   6812  C  CB   . CYS A 1 32 ? 2.626   -5.810  -0.437  1.00 0.82  ? 1134 CYS A CB   11 
ATOM   6813  S  SG   . CYS A 1 32 ? 2.782   -4.032  -0.795  1.00 1.16  ? 1134 CYS A SG   11 
ATOM   6814  H  H    . CYS A 1 32 ? 1.357   -5.591  -2.648  1.00 1.11  ? 1134 CYS A H    11 
ATOM   6815  H  HA   . CYS A 1 32 ? 3.892   -6.708  -1.921  1.00 0.88  ? 1134 CYS A HA   11 
ATOM   6816  H  HB2  . CYS A 1 32 ? 1.634   -5.979  -0.048  1.00 1.25  ? 1134 CYS A HB2  11 
ATOM   6817  H  HB3  . CYS A 1 32 ? 3.352   -6.057  0.325   1.00 1.22  ? 1134 CYS A HB3  11 
ATOM   6818  N  N    . GLY A 1 33 ? 3.337   -8.918  -0.718  1.00 1.17  ? 1135 GLY A N    11 
ATOM   6819  C  CA   . GLY A 1 33 ? 3.029   -10.297 -0.367  1.00 1.22  ? 1135 GLY A CA   11 
ATOM   6820  C  C    . GLY A 1 33 ? 1.723   -10.427 0.393   1.00 1.18  ? 1135 GLY A C    11 
ATOM   6821  O  O    . GLY A 1 33 ? 0.801   -11.116 -0.055  1.00 1.68  ? 1135 GLY A O    11 
ATOM   6822  H  H    . GLY A 1 33 ? 4.231   -8.560  -0.534  1.00 1.82  ? 1135 GLY A H    11 
ATOM   6823  H  HA2  . GLY A 1 33 ? 2.965   -10.881 -1.272  1.00 1.26  ? 1135 GLY A HA2  11 
ATOM   6824  H  HA3  . GLY A 1 33 ? 3.829   -10.687 0.244   1.00 1.39  ? 1135 GLY A HA3  11 
ATOM   6825  N  N    . ASP A 1 34 ? 1.637   -9.751  1.532   1.00 1.02  ? 1136 ASP A N    11 
ATOM   6826  C  CA   . ASP A 1 34 ? 0.425   -9.771  2.345   1.00 1.11  ? 1136 ASP A CA   11 
ATOM   6827  C  C    . ASP A 1 34 ? -0.660  -8.892  1.728   1.00 0.93  ? 1136 ASP A C    11 
ATOM   6828  O  O    . ASP A 1 34 ? -1.850  -9.090  1.974   1.00 1.35  ? 1136 ASP A O    11 
ATOM   6829  C  CB   . ASP A 1 34 ? 0.734   -9.313  3.767   1.00 1.44  ? 1136 ASP A CB   11 
ATOM   6830  C  CG   . ASP A 1 34 ? -0.473  -9.380  4.684   1.00 2.10  ? 1136 ASP A CG   11 
ATOM   6831  O  OD1  . ASP A 1 34 ? -0.832  -10.493 5.119   1.00 2.47  ? 1136 ASP A OD1  11 
ATOM   6832  O  OD2  . ASP A 1 34 ? -1.056  -8.320  4.983   1.00 2.85  ? 1136 ASP A OD2  11 
ATOM   6833  H  H    . ASP A 1 34 ? 2.417   -9.245  1.848   1.00 1.22  ? 1136 ASP A H    11 
ATOM   6834  H  HA   . ASP A 1 34 ? 0.068   -10.785 2.378   1.00 1.27  ? 1136 ASP A HA   11 
ATOM   6835  H  HB2  . ASP A 1 34 ? 1.508   -9.941  4.179   1.00 1.68  ? 1136 ASP A HB2  11 
ATOM   6836  H  HB3  . ASP A 1 34 ? 1.083   -8.295  3.736   1.00 1.84  ? 1136 ASP A HB3  11 
ATOM   6837  N  N    . GLY A 1 35 ? -0.242  -7.945  0.896   1.00 0.62  ? 1137 GLY A N    11 
ATOM   6838  C  CA   . GLY A 1 35 ? -1.183  -7.049  0.242   1.00 0.49  ? 1137 GLY A CA   11 
ATOM   6839  C  C    . GLY A 1 35 ? -1.353  -5.737  0.986   1.00 0.36  ? 1137 GLY A C    11 
ATOM   6840  O  O    . GLY A 1 35 ? -2.395  -5.091  0.892   1.00 0.36  ? 1137 GLY A O    11 
ATOM   6841  H  H    . GLY A 1 35 ? 0.712   -7.869  0.706   1.00 0.82  ? 1137 GLY A H    11 
ATOM   6842  H  HA2  . GLY A 1 35 ? -0.828  -6.839  -0.756  1.00 0.51  ? 1137 GLY A HA2  11 
ATOM   6843  H  HA3  . GLY A 1 35 ? -2.142  -7.539  0.176   1.00 0.72  ? 1137 GLY A HA3  11 
ATOM   6844  N  N    . SER A 1 36 ? -0.313  -5.331  1.704   1.00 0.32  ? 1138 SER A N    11 
ATOM   6845  C  CA   . SER A 1 36 ? -0.376  -4.146  2.548   1.00 0.28  ? 1138 SER A CA   11 
ATOM   6846  C  C    . SER A 1 36 ? -0.575  -2.865  1.731   1.00 0.25  ? 1138 SER A C    11 
ATOM   6847  O  O    . SER A 1 36 ? -1.076  -1.868  2.249   1.00 0.40  ? 1138 SER A O    11 
ATOM   6848  C  CB   . SER A 1 36 ? 0.895   -4.045  3.393   1.00 0.33  ? 1138 SER A CB   11 
ATOM   6849  O  OG   . SER A 1 36 ? 2.052   -3.951  2.578   1.00 0.44  ? 1138 SER A OG   11 
ATOM   6850  H  H    . SER A 1 36 ? 0.517   -5.846  1.674   1.00 0.37  ? 1138 SER A H    11 
ATOM   6851  H  HA   . SER A 1 36 ? -1.221  -4.265  3.212   1.00 0.33  ? 1138 SER A HA   11 
ATOM   6852  H  HB2  . SER A 1 36 ? 0.837   -3.170  4.020   1.00 0.40  ? 1138 SER A HB2  11 
ATOM   6853  H  HB3  . SER A 1 36 ? 0.980   -4.923  4.012   1.00 0.39  ? 1138 SER A HB3  11 
ATOM   6854  H  HG   . SER A 1 36 ? 2.154   -3.037  2.279   1.00 1.17  ? 1138 SER A HG   11 
ATOM   6855  N  N    . ASP A 1 37 ? -0.196  -2.897  0.456   1.00 0.18  ? 1139 ASP A N    11 
ATOM   6856  C  CA   . ASP A 1 37 ? -0.336  -1.728  -0.409  1.00 0.18  ? 1139 ASP A CA   11 
ATOM   6857  C  C    . ASP A 1 37 ? -1.805  -1.464  -0.719  1.00 0.20  ? 1139 ASP A C    11 
ATOM   6858  O  O    . ASP A 1 37 ? -2.201  -0.337  -1.003  1.00 0.29  ? 1139 ASP A O    11 
ATOM   6859  C  CB   . ASP A 1 37 ? 0.446   -1.911  -1.714  1.00 0.19  ? 1139 ASP A CB   11 
ATOM   6860  C  CG   . ASP A 1 37 ? -0.153  -2.960  -2.632  1.00 0.26  ? 1139 ASP A CG   11 
ATOM   6861  O  OD1  . ASP A 1 37 ? -0.008  -4.172  -2.352  1.00 0.33  ? 1139 ASP A OD1  11 
ATOM   6862  O  OD2  . ASP A 1 37 ? -0.773  -2.575  -3.643  1.00 0.32  ? 1139 ASP A OD2  11 
ATOM   6863  H  H    . ASP A 1 37 ? 0.186   -3.722  0.088   1.00 0.26  ? 1139 ASP A H    11 
ATOM   6864  H  HA   . ASP A 1 37 ? 0.063   -0.876  0.121   1.00 0.20  ? 1139 ASP A HA   11 
ATOM   6865  H  HB2  . ASP A 1 37 ? 0.465   -0.971  -2.245  1.00 0.22  ? 1139 ASP A HB2  11 
ATOM   6866  H  HB3  . ASP A 1 37 ? 1.459   -2.200  -1.480  1.00 0.19  ? 1139 ASP A HB3  11 
ATOM   6867  N  N    . GLU A 1 38 ? -2.607  -2.513  -0.655  1.00 0.22  ? 1140 GLU A N    11 
ATOM   6868  C  CA   . GLU A 1 38 ? -4.033  -2.394  -0.894  1.00 0.27  ? 1140 GLU A CA   11 
ATOM   6869  C  C    . GLU A 1 38 ? -4.769  -2.111  0.411   1.00 0.31  ? 1140 GLU A C    11 
ATOM   6870  O  O    . GLU A 1 38 ? -5.814  -1.461  0.420   1.00 0.44  ? 1140 GLU A O    11 
ATOM   6871  C  CB   . GLU A 1 38 ? -4.573  -3.674  -1.527  1.00 0.29  ? 1140 GLU A CB   11 
ATOM   6872  C  CG   . GLU A 1 38 ? -3.982  -3.979  -2.894  1.00 0.29  ? 1140 GLU A CG   11 
ATOM   6873  C  CD   . GLU A 1 38 ? -4.319  -2.921  -3.922  1.00 0.28  ? 1140 GLU A CD   11 
ATOM   6874  O  OE1  . GLU A 1 38 ? -5.508  -2.574  -4.052  1.00 0.38  ? 1140 GLU A OE1  11 
ATOM   6875  O  OE2  . GLU A 1 38 ? -3.394  -2.427  -4.605  1.00 0.28  ? 1140 GLU A OE2  11 
ATOM   6876  H  H    . GLU A 1 38 ? -2.228  -3.393  -0.441  1.00 0.24  ? 1140 GLU A H    11 
ATOM   6877  H  HA   . GLU A 1 38 ? -4.191  -1.565  -1.574  1.00 0.30  ? 1140 GLU A HA   11 
ATOM   6878  H  HB2  . GLU A 1 38 ? -4.355  -4.505  -0.871  1.00 0.32  ? 1140 GLU A HB2  11 
ATOM   6879  H  HB3  . GLU A 1 38 ? -5.643  -3.585  -1.634  1.00 0.33  ? 1140 GLU A HB3  11 
ATOM   6880  H  HG2  . GLU A 1 38 ? -2.907  -4.040  -2.803  1.00 0.29  ? 1140 GLU A HG2  11 
ATOM   6881  H  HG3  . GLU A 1 38 ? -4.366  -4.929  -3.237  1.00 0.33  ? 1140 GLU A HG3  11 
ATOM   6882  N  N    . LYS A 1 39 ? -4.220  -2.605  1.517   1.00 0.30  ? 1141 LYS A N    11 
ATOM   6883  C  CA   . LYS A 1 39 ? -4.842  -2.405  2.818   1.00 0.37  ? 1141 LYS A CA   11 
ATOM   6884  C  C    . LYS A 1 39 ? -4.608  -0.976  3.297   1.00 0.49  ? 1141 LYS A C    11 
ATOM   6885  O  O    . LYS A 1 39 ? -5.447  -0.391  3.982   1.00 0.57  ? 1141 LYS A O    11 
ATOM   6886  C  CB   . LYS A 1 39 ? -4.317  -3.422  3.845   1.00 0.47  ? 1141 LYS A CB   11 
ATOM   6887  C  CG   . LYS A 1 39 ? -3.033  -3.019  4.553   1.00 0.57  ? 1141 LYS A CG   11 
ATOM   6888  C  CD   . LYS A 1 39 ? -2.554  -4.120  5.487   1.00 0.76  ? 1141 LYS A CD   11 
ATOM   6889  C  CE   . LYS A 1 39 ? -1.353  -3.683  6.303   1.00 0.91  ? 1141 LYS A CE   11 
ATOM   6890  N  NZ   . LYS A 1 39 ? -0.936  -4.722  7.279   1.00 1.55  ? 1141 LYS A NZ   11 
ATOM   6891  H  H    . LYS A 1 39 ? -3.392  -3.125  1.452   1.00 0.32  ? 1141 LYS A H    11 
ATOM   6892  H  HA   . LYS A 1 39 ? -5.906  -2.553  2.695   1.00 0.39  ? 1141 LYS A HA   11 
ATOM   6893  H  HB2  . LYS A 1 39 ? -5.072  -3.576  4.595   1.00 0.56  ? 1141 LYS A HB2  11 
ATOM   6894  H  HB3  . LYS A 1 39 ? -4.139  -4.360  3.339   1.00 0.47  ? 1141 LYS A HB3  11 
ATOM   6895  H  HG2  . LYS A 1 39 ? -2.270  -2.822  3.817   1.00 0.50  ? 1141 LYS A HG2  11 
ATOM   6896  H  HG3  . LYS A 1 39 ? -3.217  -2.126  5.131   1.00 0.65  ? 1141 LYS A HG3  11 
ATOM   6897  H  HD2  . LYS A 1 39 ? -3.355  -4.384  6.158   1.00 0.88  ? 1141 LYS A HD2  11 
ATOM   6898  H  HD3  . LYS A 1 39 ? -2.280  -4.981  4.896   1.00 0.73  ? 1141 LYS A HD3  11 
ATOM   6899  H  HE2  . LYS A 1 39 ? -0.531  -3.485  5.631   1.00 1.15  ? 1141 LYS A HE2  11 
ATOM   6900  H  HE3  . LYS A 1 39 ? -1.606  -2.781  6.836   1.00 1.18  ? 1141 LYS A HE3  11 
ATOM   6901  H  HZ1  . LYS A 1 39 ? -0.720  -5.610  6.787   1.00 2.08  ? 1141 LYS A HZ1  11 
ATOM   6902  H  HZ2  . LYS A 1 39 ? -1.697  -4.897  7.965   1.00 1.99  ? 1141 LYS A HZ2  11 
ATOM   6903  H  HZ3  . LYS A 1 39 ? -0.087  -4.411  7.795   1.00 1.97  ? 1141 LYS A HZ3  11 
ATOM   6904  N  N    . ASN A 1 40 ? -3.470  -0.410  2.915   1.00 0.60  ? 1142 ASN A N    11 
ATOM   6905  C  CA   . ASN A 1 40 ? -3.152  0.971   3.249   1.00 0.81  ? 1142 ASN A CA   11 
ATOM   6906  C  C    . ASN A 1 40 ? -3.826  1.902   2.249   1.00 0.91  ? 1142 ASN A C    11 
ATOM   6907  O  O    . ASN A 1 40 ? -3.174  2.507   1.397   1.00 1.44  ? 1142 ASN A O    11 
ATOM   6908  C  CB   . ASN A 1 40 ? -1.635  1.191   3.253   1.00 1.07  ? 1142 ASN A CB   11 
ATOM   6909  C  CG   . ASN A 1 40 ? -1.230  2.520   3.871   1.00 1.37  ? 1142 ASN A CG   11 
ATOM   6910  O  OD1  . ASN A 1 40 ? -1.011  2.611   5.078   1.00 2.05  ? 1142 ASN A OD1  11 
ATOM   6911  N  ND2  . ASN A 1 40 ? -1.115  3.553   3.052   1.00 1.92  ? 1142 ASN A ND2  11 
ATOM   6912  H  H    . ASN A 1 40 ? -2.822  -0.938  2.397   1.00 0.58  ? 1142 ASN A H    11 
ATOM   6913  H  HA   . ASN A 1 40 ? -3.544  1.174   4.235   1.00 0.86  ? 1142 ASN A HA   11 
ATOM   6914  H  HB2  . ASN A 1 40 ? -1.165  0.399   3.815   1.00 1.54  ? 1142 ASN A HB2  11 
ATOM   6915  H  HB3  . ASN A 1 40 ? -1.273  1.165   2.234   1.00 1.56  ? 1142 ASN A HB3  11 
ATOM   6916  H  HD21 . ASN A 1 40 ? -1.298  3.414   2.096   1.00 2.20  ? 1142 ASN A HD21 11 
ATOM   6917  H  HD22 . ASN A 1 40 ? -0.861  4.420   3.433   1.00 2.44  ? 1142 ASN A HD22 11 
ATOM   6918  N  N    . CYS A 1 41 ? -5.143  1.983   2.339   1.00 0.76  ? 1143 CYS A N    11 
ATOM   6919  C  CA   . CYS A 1 41 ? -5.925  2.797   1.426   1.00 0.99  ? 1143 CYS A CA   11 
ATOM   6920  C  C    . CYS A 1 41 ? -7.311  3.034   2.010   1.00 1.29  ? 1143 CYS A C    11 
ATOM   6921  O  O    . CYS A 1 41 ? -8.328  2.891   1.335   1.00 1.67  ? 1143 CYS A O    11 
ATOM   6922  C  CB   . CYS A 1 41 ? -6.024  2.103   0.063   1.00 0.93  ? 1143 CYS A CB   11 
ATOM   6923  S  SG   . CYS A 1 41 ? -6.728  3.137   -1.264  1.00 1.10  ? 1143 CYS A SG   11 
ATOM   6924  H  H    . CYS A 1 41 ? -5.605  1.471   3.039   1.00 0.89  ? 1143 CYS A H    11 
ATOM   6925  H  HA   . CYS A 1 41 ? -5.424  3.746   1.308   1.00 1.23  ? 1143 CYS A HA   11 
ATOM   6926  H  HB2  . CYS A 1 41 ? -5.035  1.802   -0.247  1.00 0.98  ? 1143 CYS A HB2  11 
ATOM   6927  H  HB3  . CYS A 1 41 ? -6.645  1.226   0.160   1.00 1.29  ? 1143 CYS A HB3  11 
ATOM   6928  N  N    . ASN A 1 42 ? -7.343  3.387   3.283   1.00 1.87  ? 1144 ASN A N    11 
ATOM   6929  C  CA   . ASN A 1 42 ? -8.597  3.644   3.971   1.00 2.36  ? 1144 ASN A CA   11 
ATOM   6930  C  C    . ASN A 1 42 ? -8.689  5.108   4.366   1.00 3.05  ? 1144 ASN A C    11 
ATOM   6931  O  O    . ASN A 1 42 ? -7.687  5.828   4.332   1.00 3.73  ? 1144 ASN A O    11 
ATOM   6932  C  CB   . ASN A 1 42 ? -8.733  2.750   5.211   1.00 3.11  ? 1144 ASN A CB   11 
ATOM   6933  C  CG   . ASN A 1 42 ? -7.625  2.976   6.223   1.00 3.87  ? 1144 ASN A CG   11 
ATOM   6934  O  OD1  . ASN A 1 42 ? -6.568  2.351   6.149   1.00 4.27  ? 1144 ASN A OD1  11 
ATOM   6935  N  ND2  . ASN A 1 42 ? -7.857  3.866   7.177   1.00 4.59  ? 1144 ASN A ND2  11 
ATOM   6936  H  H    . ASN A 1 42 ? -6.498  3.497   3.771   1.00 2.27  ? 1144 ASN A H    11 
ATOM   6937  H  HA   . ASN A 1 42 ? -9.401  3.419   3.285   1.00 2.42  ? 1144 ASN A HA   11 
ATOM   6938  H  HB2  . ASN A 1 42 ? -9.678  2.956   5.690   1.00 3.41  ? 1144 ASN A HB2  11 
ATOM   6939  H  HB3  . ASN A 1 42 ? -8.710  1.715   4.904   1.00 3.38  ? 1144 ASN A HB3  11 
ATOM   6940  H  HD21 . ASN A 1 42 ? -8.723  4.331   7.183   1.00 4.61  ? 1144 ASN A HD21 11 
ATOM   6941  H  HD22 . ASN A 1 42 ? -7.155  4.022   7.845   1.00 5.30  ? 1144 ASN A HD22 11 
ATOM   6942  N  N    . SER A 1 43 ? -9.888  5.532   4.739   1.00 3.53  ? 1145 SER A N    11 
ATOM   6943  C  CA   . SER A 1 43 ? -10.151 6.911   5.122   1.00 4.69  ? 1145 SER A CA   11 
ATOM   6944  C  C    . SER A 1 43 ? -9.757  7.878   4.016   1.00 5.23  ? 1145 SER A C    11 
ATOM   6945  O  O    . SER A 1 43 ? -8.803  8.650   4.139   1.00 5.32  ? 1145 SER A O    11 
ATOM   6946  C  CB   . SER A 1 43 ? -9.437  7.262   6.403   1.00 5.40  ? 1145 SER A CB   11 
ATOM   6947  O  OG   . SER A 1 43 ? -9.765  6.355   7.446   1.00 5.26  ? 1145 SER A OG   11 
ATOM   6948  H  H    . SER A 1 43 ? -10.629 4.891   4.759   1.00 3.45  ? 1145 SER A H    11 
ATOM   6949  H  HA   . SER A 1 43 ? -11.198 7.002   5.288   1.00 5.07  ? 1145 SER A HA   11 
ATOM   6950  H  HB2  . SER A 1 43 ? -8.386  7.230   6.229   1.00 6.23  ? 1145 SER A HB2  11 
ATOM   6951  H  HB3  . SER A 1 43 ? -9.728  8.256   6.695   1.00 5.56  ? 1145 SER A HB3  11 
ATOM   6952  H  HG   . SER A 1 43 ? -10.687 6.084   7.352   1.00 5.21  ? 1145 SER A HG   11 
ATOM   6953  N  N    . THR A 1 44 ? -10.504 7.823   2.941   1.00 5.97  ? 1146 THR A N    11 
ATOM   6954  C  CA   . THR A 1 44 ? -10.250 8.653   1.783   1.00 6.81  ? 1146 THR A CA   11 
ATOM   6955  C  C    . THR A 1 44 ? -11.019 9.965   1.875   1.00 7.34  ? 1146 THR A C    11 
ATOM   6956  O  O    . THR A 1 44 ? -12.139 10.082  1.381   1.00 8.15  ? 1146 THR A O    11 
ATOM   6957  C  CB   . THR A 1 44 ? -10.621 7.902   0.492   1.00 7.69  ? 1146 THR A CB   11 
ATOM   6958  O  OG1  . THR A 1 44 ? -11.900 7.270   0.643   1.00 7.92  ? 1146 THR A OG1  11 
ATOM   6959  C  CG2  . THR A 1 44 ? -9.569  6.855   0.163   1.00 7.74  ? 1146 THR A CG2  11 
ATOM   6960  H  H    . THR A 1 44 ? -11.265 7.211   2.933   1.00 6.16  ? 1146 THR A H    11 
ATOM   6961  H  HA   . THR A 1 44 ? -9.193  8.873   1.755   1.00 6.75  ? 1146 THR A HA   11 
ATOM   6962  H  HB   . THR A 1 44 ? -10.671 8.612   -0.320  1.00 8.40  ? 1146 THR A HB   11 
ATOM   6963  H  HG1  . THR A 1 44 ? -11.773 6.325   0.796   1.00 8.03  ? 1146 THR A HG1  11 
ATOM   6964  H  HG21 . THR A 1 44 ? -9.484  6.162   0.989   1.00 7.71  ? 1146 THR A HG21 11 
ATOM   6965  H  HG22 . THR A 1 44 ? -8.616  7.338   -0.001  1.00 7.80  ? 1146 THR A HG22 11 
ATOM   6966  H  HG23 . THR A 1 44 ? -9.859  6.318   -0.728  1.00 8.03  ? 1146 THR A HG23 11 
ATOM   6967  N  N    . GLU A 1 45 ? -10.401 10.954  2.507   1.00 7.13  ? 1147 GLU A N    11 
ATOM   6968  C  CA   . GLU A 1 45 ? -11.033 12.251  2.721   1.00 7.94  ? 1147 GLU A CA   11 
ATOM   6969  C  C    . GLU A 1 45 ? -11.308 12.953  1.395   1.00 8.95  ? 1147 GLU A C    11 
ATOM   6970  O  O    . GLU A 1 45 ? -12.232 13.758  1.293   1.00 9.87  ? 1147 GLU A O    11 
ATOM   6971  C  CB   . GLU A 1 45 ? -10.173 13.149  3.628   1.00 7.79  ? 1147 GLU A CB   11 
ATOM   6972  C  CG   . GLU A 1 45 ? -8.762  13.416  3.114   1.00 7.90  ? 1147 GLU A CG   11 
ATOM   6973  C  CD   . GLU A 1 45 ? -7.874  12.190  3.166   1.00 8.00  ? 1147 GLU A CD   11 
ATOM   6974  O  OE1  . GLU A 1 45 ? -7.402  11.838  4.264   1.00 8.23  ? 1147 GLU A OE1  11 
ATOM   6975  O  OE2  . GLU A 1 45 ? -7.654  11.568  2.107   1.00 8.08  ? 1147 GLU A OE2  11 
ATOM   6976  H  H    . GLU A 1 45 ? -9.484  10.811  2.833   1.00 6.60  ? 1147 GLU A H    11 
ATOM   6977  H  HA   . GLU A 1 45 ? -11.978 12.072  3.212   1.00 8.20  ? 1147 GLU A HA   11 
ATOM   6978  H  HB2  . GLU A 1 45 ? -10.671 14.100  3.740   1.00 8.33  ? 1147 GLU A HB2  11 
ATOM   6979  H  HB3  . GLU A 1 45 ? -10.095 12.683  4.599   1.00 7.37  ? 1147 GLU A HB3  11 
ATOM   6980  H  HG2  . GLU A 1 45 ? -8.825  13.753  2.091   1.00 7.80  ? 1147 GLU A HG2  11 
ATOM   6981  H  HG3  . GLU A 1 45 ? -8.316  14.193  3.719   1.00 8.35  ? 1147 GLU A HG3  11 
ATOM   6982  N  N    . THR A 1 46 ? -10.516 12.632  0.383   1.00 8.94  ? 1148 THR A N    11 
ATOM   6983  C  CA   . THR A 1 46 ? -10.698 13.213  -0.938  1.00 10.03 ? 1148 THR A CA   11 
ATOM   6984  C  C    . THR A 1 46 ? -11.949 12.661  -1.616  1.00 10.71 ? 1148 THR A C    11 
ATOM   6985  O  O    . THR A 1 46 ? -12.723 13.409  -2.216  1.00 11.12 ? 1148 THR A O    11 
ATOM   6986  C  CB   . THR A 1 46 ? -9.464  12.967  -1.821  1.00 10.21 ? 1148 THR A CB   11 
ATOM   6987  O  OG1  . THR A 1 46 ? -8.888  11.693  -1.500  1.00 9.58  ? 1148 THR A OG1  11 
ATOM   6988  C  CG2  . THR A 1 46 ? -8.428  14.064  -1.625  1.00 11.01 ? 1148 THR A CG2  11 
ATOM   6989  H  H    . THR A 1 46 ? -9.787  11.987  0.527   1.00 8.30  ? 1148 THR A H    11 
ATOM   6990  H  HA   . THR A 1 46 ? -10.815 14.280  -0.815  1.00 10.45 ? 1148 THR A HA   11 
ATOM   6991  H  HB   . THR A 1 46 ? -9.773  12.963  -2.856  1.00 10.48 ? 1148 THR A HB   11 
ATOM   6992  H  HG1  . THR A 1 46 ? -7.960  11.684  -1.772  1.00 9.43  ? 1148 THR A HG1  11 
ATOM   6993  H  HG21 . THR A 1 46 ? -7.577  13.875  -2.261  1.00 11.19 ? 1148 THR A HG21 11 
ATOM   6994  H  HG22 . THR A 1 46 ? -8.110  14.077  -0.593  1.00 11.07 ? 1148 THR A HG22 11 
ATOM   6995  H  HG23 . THR A 1 46 ? -8.862  15.020  -1.879  1.00 11.53 ? 1148 THR A HG23 11 
HETATM 6996  CA CA   . CA  B 2 .  ? -1.473  -2.783  -5.690  1.00 0.28  ? 1201 CA  A CA   11 
ATOM   6997  N  N    . THR A 1 1  ? 4.269   4.579   6.746   1.00 12.23 ? 1103 THR A N    12 
ATOM   6998  C  CA   . THR A 1 1  ? 3.850   3.268   7.288   1.00 11.73 ? 1103 THR A CA   12 
ATOM   6999  C  C    . THR A 1 1  ? 4.519   2.964   8.631   1.00 10.83 ? 1103 THR A C    12 
ATOM   7000  O  O    . THR A 1 1  ? 4.493   1.819   9.088   1.00 10.67 ? 1103 THR A O    12 
ATOM   7001  C  CB   . THR A 1 1  ? 4.170   2.132   6.294   1.00 11.83 ? 1103 THR A CB   12 
ATOM   7002  O  OG1  . THR A 1 1  ? 5.516   2.257   5.811   1.00 12.26 ? 1103 THR A OG1  12 
ATOM   7003  C  CG2  . THR A 1 1  ? 3.202   2.146   5.121   1.00 12.04 ? 1103 THR A CG2  12 
ATOM   7004  H  H1   . THR A 1 1  ? 5.299   4.598   6.615   1.00 12.23 ? 1103 THR A H1   12 
ATOM   7005  H  H2   . THR A 1 1  ? 3.995   5.342   7.393   1.00 12.55 ? 1103 THR A H2   12 
ATOM   7006  H  H3   . THR A 1 1  ? 3.814   4.745   5.827   1.00 12.44 ? 1103 THR A H3   12 
ATOM   7007  H  HA   . THR A 1 1  ? 2.779   3.291   7.434   1.00 12.16 ? 1103 THR A HA   12 
ATOM   7008  H  HB   . THR A 1 1  ? 4.072   1.188   6.808   1.00 11.67 ? 1103 THR A HB   12 
ATOM   7009  H  HG1  . THR A 1 1  ? 6.085   1.635   6.279   1.00 12.30 ? 1103 THR A HG1  12 
ATOM   7010  H  HG21 . THR A 1 1  ? 2.194   2.009   5.484   1.00 12.31 ? 1103 THR A HG21 12 
ATOM   7011  H  HG22 . THR A 1 1  ? 3.451   1.346   4.438   1.00 12.05 ? 1103 THR A HG22 12 
ATOM   7012  H  HG23 . THR A 1 1  ? 3.274   3.092   4.607   1.00 12.10 ? 1103 THR A HG23 12 
ATOM   7013  N  N    . HIS A 1 2  ? 5.107   3.993   9.262   1.00 10.41 ? 1104 HIS A N    12 
ATOM   7014  C  CA   . HIS A 1 2  ? 5.819   3.852   10.545  1.00 9.72  ? 1104 HIS A CA   12 
ATOM   7015  C  C    . HIS A 1 2  ? 7.137   3.104   10.362  1.00 8.65  ? 1104 HIS A C    12 
ATOM   7016  O  O    . HIS A 1 2  ? 8.205   3.624   10.693  1.00 8.32  ? 1104 HIS A O    12 
ATOM   7017  C  CB   . HIS A 1 2  ? 4.959   3.151   11.610  1.00 10.05 ? 1104 HIS A CB   12 
ATOM   7018  C  CG   . HIS A 1 2  ? 3.791   3.958   12.085  1.00 10.43 ? 1104 HIS A CG   12 
ATOM   7019  N  ND1  . HIS A 1 2  ? 2.483   3.564   11.913  1.00 10.71 ? 1104 HIS A ND1  12 
ATOM   7020  C  CD2  . HIS A 1 2  ? 3.741   5.132   12.756  1.00 10.84 ? 1104 HIS A CD2  12 
ATOM   7021  C  CE1  . HIS A 1 2  ? 1.681   4.460   12.454  1.00 11.25 ? 1104 HIS A CE1  12 
ATOM   7022  N  NE2  . HIS A 1 2  ? 2.418   5.422   12.975  1.00 11.34 ? 1104 HIS A NE2  12 
ATOM   7023  H  H    . HIS A 1 2  ? 5.069   4.883   8.849   1.00 10.71 ? 1104 HIS A H    12 
ATOM   7024  H  HA   . HIS A 1 2  ? 6.046   4.849   10.894  1.00 9.96  ? 1104 HIS A HA   12 
ATOM   7025  H  HB2  . HIS A 1 2  ? 4.575   2.229   11.198  1.00 10.50 ? 1104 HIS A HB2  12 
ATOM   7026  H  HB3  . HIS A 1 2  ? 5.577   2.923   12.466  1.00 9.81  ? 1104 HIS A HB3  12 
ATOM   7027  H  HD1  . HIS A 1 2  ? 2.185   2.741   11.466  1.00 10.68 ? 1104 HIS A HD1  12 
ATOM   7028  H  HD2  . HIS A 1 2  ? 4.587   5.734   13.056  1.00 10.94 ? 1104 HIS A HD2  12 
ATOM   7029  H  HE1  . HIS A 1 2  ? 0.604   4.414   12.468  1.00 11.71 ? 1104 HIS A HE1  12 
ATOM   7030  H  HE2  . HIS A 1 2  ? 2.088   6.090   13.616  1.00 11.83 ? 1104 HIS A HE2  12 
ATOM   7031  N  N    . ALA A 1 3  ? 7.053   1.885   9.846   1.00 8.30  ? 1105 ALA A N    12 
ATOM   7032  C  CA   . ALA A 1 3  ? 8.231   1.092   9.530   1.00 7.41  ? 1105 ALA A CA   12 
ATOM   7033  C  C    . ALA A 1 3  ? 9.078   1.813   8.486   1.00 6.47  ? 1105 ALA A C    12 
ATOM   7034  O  O    . ALA A 1 3  ? 8.543   2.315   7.495   1.00 6.54  ? 1105 ALA A O    12 
ATOM   7035  C  CB   . ALA A 1 3  ? 7.816   -0.282  9.024   1.00 7.70  ? 1105 ALA A CB   12 
ATOM   7036  H  H    . ALA A 1 3  ? 6.163   1.507   9.666   1.00 8.79  ? 1105 ALA A H    12 
ATOM   7037  H  HA   . ALA A 1 3  ? 8.807   0.966   10.434  1.00 7.45  ? 1105 ALA A HA   12 
ATOM   7038  H  HB1  . ALA A 1 3  ? 7.220   -0.778  9.777   1.00 7.93  ? 1105 ALA A HB1  12 
ATOM   7039  H  HB2  . ALA A 1 3  ? 8.698   -0.872  8.818   1.00 7.73  ? 1105 ALA A HB2  12 
ATOM   7040  H  HB3  . ALA A 1 3  ? 7.236   -0.173  8.120   1.00 7.95  ? 1105 ALA A HB3  12 
ATOM   7041  N  N    . PRO A 1 4  ? 10.404  1.888   8.707   1.00 5.80  ? 1106 PRO A N    12 
ATOM   7042  C  CA   . PRO A 1 4  ? 11.325  2.609   7.819   1.00 4.97  ? 1106 PRO A CA   12 
ATOM   7043  C  C    . PRO A 1 4  ? 11.142  2.242   6.352   1.00 4.25  ? 1106 PRO A C    12 
ATOM   7044  O  O    . PRO A 1 4  ? 11.293  1.079   5.964   1.00 4.22  ? 1106 PRO A O    12 
ATOM   7045  C  CB   . PRO A 1 4  ? 12.701  2.179   8.310   1.00 4.84  ? 1106 PRO A CB   12 
ATOM   7046  C  CG   . PRO A 1 4  ? 12.499  1.844   9.744   1.00 5.55  ? 1106 PRO A CG   12 
ATOM   7047  C  CD   . PRO A 1 4  ? 11.113  1.267   9.841   1.00 6.09  ? 1106 PRO A CD   12 
ATOM   7048  H  HA   . PRO A 1 4  ? 11.224  3.673   7.932   1.00 5.32  ? 1106 PRO A HA   12 
ATOM   7049  H  HB2  . PRO A 1 4  ? 13.030  1.326   7.744   1.00 4.32  ? 1106 PRO A HB2  12 
ATOM   7050  H  HB3  . PRO A 1 4  ? 13.402  2.991   8.189   1.00 5.12  ? 1106 PRO A HB3  12 
ATOM   7051  H  HG2  . PRO A 1 4  ? 13.231  1.115   10.058  1.00 5.52  ? 1106 PRO A HG2  12 
ATOM   7052  H  HG3  . PRO A 1 4  ? 12.577  2.738   10.345  1.00 6.00  ? 1106 PRO A HG3  12 
ATOM   7053  H  HD2  . PRO A 1 4  ? 11.144  0.193   9.736   1.00 6.19  ? 1106 PRO A HD2  12 
ATOM   7054  H  HD3  . PRO A 1 4  ? 10.656  1.544   10.779  1.00 6.80  ? 1106 PRO A HD3  12 
ATOM   7055  N  N    . ALA A 1 5  ? 10.812  3.242   5.548   1.00 4.09  ? 1107 ALA A N    12 
ATOM   7056  C  CA   . ALA A 1 5  ? 10.574  3.050   4.128   1.00 3.77  ? 1107 ALA A CA   12 
ATOM   7057  C  C    . ALA A 1 5  ? 11.893  2.954   3.371   1.00 2.63  ? 1107 ALA A C    12 
ATOM   7058  O  O    . ALA A 1 5  ? 12.294  3.885   2.672   1.00 2.62  ? 1107 ALA A O    12 
ATOM   7059  C  CB   . ALA A 1 5  ? 9.718   4.187   3.583   1.00 4.73  ? 1107 ALA A CB   12 
ATOM   7060  H  H    . ALA A 1 5  ? 10.732  4.145   5.922   1.00 4.51  ? 1107 ALA A H    12 
ATOM   7061  H  HA   . ALA A 1 5  ? 10.028  2.126   4.002   1.00 4.04  ? 1107 ALA A HA   12 
ATOM   7062  H  HB1  . ALA A 1 5  ? 9.494   4.003   2.544   1.00 5.01  ? 1107 ALA A HB1  12 
ATOM   7063  H  HB2  . ALA A 1 5  ? 10.256  5.119   3.676   1.00 4.95  ? 1107 ALA A HB2  12 
ATOM   7064  H  HB3  . ALA A 1 5  ? 8.797   4.245   4.145   1.00 5.29  ? 1107 ALA A HB3  12 
ATOM   7065  N  N    . SER A 1 6  ? 12.568  1.825   3.523   1.00 2.16  ? 1108 SER A N    12 
ATOM   7066  C  CA   . SER A 1 6  ? 13.862  1.603   2.895   1.00 1.43  ? 1108 SER A CA   12 
ATOM   7067  C  C    . SER A 1 6  ? 13.710  1.196   1.429   1.00 1.29  ? 1108 SER A C    12 
ATOM   7068  O  O    . SER A 1 6  ? 14.154  0.125   1.015   1.00 1.97  ? 1108 SER A O    12 
ATOM   7069  C  CB   . SER A 1 6  ? 14.631  0.539   3.676   1.00 2.09  ? 1108 SER A CB   12 
ATOM   7070  O  OG   . SER A 1 6  ? 13.794  -0.566  3.987   1.00 2.97  ? 1108 SER A OG   12 
ATOM   7071  H  H    . SER A 1 6  ? 12.189  1.116   4.090   1.00 2.71  ? 1108 SER A H    12 
ATOM   7072  H  HA   . SER A 1 6  ? 14.411  2.531   2.938   1.00 1.32  ? 1108 SER A HA   12 
ATOM   7073  H  HB2  . SER A 1 6  ? 15.460  0.190   3.081   1.00 2.36  ? 1108 SER A HB2  12 
ATOM   7074  H  HB3  . SER A 1 6  ? 15.001  0.965   4.596   1.00 2.13  ? 1108 SER A HB3  12 
ATOM   7075  H  HG   . SER A 1 6  ? 13.587  -1.050  3.175   1.00 3.32  ? 1108 SER A HG   12 
ATOM   7076  N  N    . CYS A 1 7  ? 13.063  2.053   0.657   1.00 0.72  ? 1109 CYS A N    12 
ATOM   7077  C  CA   . CYS A 1 7  ? 12.902  1.832   -0.771  1.00 0.49  ? 1109 CYS A CA   12 
ATOM   7078  C  C    . CYS A 1 7  ? 13.129  3.130   -1.536  1.00 0.46  ? 1109 CYS A C    12 
ATOM   7079  O  O    . CYS A 1 7  ? 13.478  4.153   -0.943  1.00 0.62  ? 1109 CYS A O    12 
ATOM   7080  C  CB   . CYS A 1 7  ? 11.508  1.280   -1.080  1.00 0.33  ? 1109 CYS A CB   12 
ATOM   7081  S  SG   . CYS A 1 7  ? 11.128  -0.303  -0.256  1.00 0.47  ? 1109 CYS A SG   12 
ATOM   7082  H  H    . CYS A 1 7  ? 12.686  2.865   1.060   1.00 0.94  ? 1109 CYS A H    12 
ATOM   7083  H  HA   . CYS A 1 7  ? 13.642  1.112   -1.085  1.00 0.60  ? 1109 CYS A HA   12 
ATOM   7084  H  HB2  . CYS A 1 7  ? 10.766  1.999   -0.765  1.00 0.41  ? 1109 CYS A HB2  12 
ATOM   7085  H  HB3  . CYS A 1 7  ? 11.420  1.126   -2.145  1.00 0.29  ? 1109 CYS A HB3  12 
ATOM   7086  N  N    . LEU A 1 8  ? 12.940  3.073   -2.847  1.00 0.34  ? 1110 LEU A N    12 
ATOM   7087  C  CA   . LEU A 1 8  ? 13.048  4.244   -3.711  1.00 0.32  ? 1110 LEU A CA   12 
ATOM   7088  C  C    . LEU A 1 8  ? 12.043  5.311   -3.286  1.00 0.29  ? 1110 LEU A C    12 
ATOM   7089  O  O    . LEU A 1 8  ? 11.027  5.002   -2.662  1.00 0.30  ? 1110 LEU A O    12 
ATOM   7090  C  CB   . LEU A 1 8  ? 12.753  3.817   -5.147  1.00 0.28  ? 1110 LEU A CB   12 
ATOM   7091  C  CG   . LEU A 1 8  ? 13.505  4.548   -6.257  1.00 0.38  ? 1110 LEU A CG   12 
ATOM   7092  C  CD1  . LEU A 1 8  ? 15.009  4.405   -6.083  1.00 0.52  ? 1110 LEU A CD1  12 
ATOM   7093  C  CD2  . LEU A 1 8  ? 13.072  3.992   -7.603  1.00 0.39  ? 1110 LEU A CD2  12 
ATOM   7094  H  H    . LEU A 1 8  ? 12.729  2.205   -3.257  1.00 0.34  ? 1110 LEU A H    12 
ATOM   7095  H  HA   . LEU A 1 8  ? 14.049  4.637   -3.643  1.00 0.40  ? 1110 LEU A HA   12 
ATOM   7096  H  HB2  . LEU A 1 8  ? 12.961  2.764   -5.232  1.00 0.32  ? 1110 LEU A HB2  12 
ATOM   7097  H  HB3  . LEU A 1 8  ? 11.695  3.958   -5.319  1.00 0.22  ? 1110 LEU A HB3  12 
ATOM   7098  H  HG   . LEU A 1 8  ? 13.258  5.598   -6.230  1.00 0.41  ? 1110 LEU A HG   12 
ATOM   7099  H  HD11 . LEU A 1 8  ? 15.276  3.360   -6.104  1.00 1.05  ? 1110 LEU A HD11 12 
ATOM   7100  H  HD12 . LEU A 1 8  ? 15.308  4.831   -5.139  1.00 1.29  ? 1110 LEU A HD12 12 
ATOM   7101  H  HD13 . LEU A 1 8  ? 15.515  4.920   -6.885  1.00 1.07  ? 1110 LEU A HD13 12 
ATOM   7102  H  HD21 . LEU A 1 8  ? 13.288  2.933   -7.640  1.00 1.11  ? 1110 LEU A HD21 12 
ATOM   7103  H  HD22 . LEU A 1 8  ? 13.606  4.497   -8.392  1.00 1.05  ? 1110 LEU A HD22 12 
ATOM   7104  H  HD23 . LEU A 1 8  ? 12.009  4.143   -7.729  1.00 0.97  ? 1110 LEU A HD23 12 
ATOM   7105  N  N    . ASP A 1 9  ? 12.318  6.559   -3.642  1.00 0.35  ? 1111 ASP A N    12 
ATOM   7106  C  CA   . ASP A 1 9  ? 11.408  7.660   -3.335  1.00 0.38  ? 1111 ASP A CA   12 
ATOM   7107  C  C    . ASP A 1 9  ? 10.129  7.545   -4.157  1.00 0.32  ? 1111 ASP A C    12 
ATOM   7108  O  O    . ASP A 1 9  ? 9.082   8.056   -3.773  1.00 0.42  ? 1111 ASP A O    12 
ATOM   7109  C  CB   . ASP A 1 9  ? 12.087  9.009   -3.593  1.00 0.51  ? 1111 ASP A CB   12 
ATOM   7110  C  CG   . ASP A 1 9  ? 11.213  10.189  -3.204  1.00 1.37  ? 1111 ASP A CG   12 
ATOM   7111  O  OD1  . ASP A 1 9  ? 10.899  10.331  -2.006  1.00 1.53  ? 1111 ASP A OD1  12 
ATOM   7112  O  OD2  . ASP A 1 9  ? 10.828  10.973  -4.097  1.00 2.32  ? 1111 ASP A OD2  12 
ATOM   7113  H  H    . ASP A 1 9  ? 13.161  6.751   -4.112  1.00 0.40  ? 1111 ASP A H    12 
ATOM   7114  H  HA   . ASP A 1 9  ? 11.153  7.591   -2.288  1.00 0.44  ? 1111 ASP A HA   12 
ATOM   7115  H  HB2  . ASP A 1 9  ? 13.000  9.060   -3.021  1.00 0.94  ? 1111 ASP A HB2  12 
ATOM   7116  H  HB3  . ASP A 1 9  ? 12.321  9.091   -4.643  1.00 1.01  ? 1111 ASP A HB3  12 
ATOM   7117  N  N    . THR A 1 10 ? 10.222  6.865   -5.293  1.00 0.28  ? 1112 THR A N    12 
ATOM   7118  C  CA   . THR A 1 10 ? 9.056   6.581   -6.115  1.00 0.31  ? 1112 THR A CA   12 
ATOM   7119  C  C    . THR A 1 10 ? 8.516   5.182   -5.830  1.00 0.24  ? 1112 THR A C    12 
ATOM   7120  O  O    . THR A 1 10 ? 7.519   4.751   -6.418  1.00 0.30  ? 1112 THR A O    12 
ATOM   7121  C  CB   . THR A 1 10 ? 9.391   6.702   -7.609  1.00 0.42  ? 1112 THR A CB   12 
ATOM   7122  O  OG1  . THR A 1 10 ? 10.636  6.048   -7.876  1.00 0.45  ? 1112 THR A OG1  12 
ATOM   7123  C  CG2  . THR A 1 10 ? 9.475   8.158   -8.038  1.00 0.52  ? 1112 THR A CG2  12 
ATOM   7124  H  H    . THR A 1 10 ? 11.103  6.555   -5.594  1.00 0.31  ? 1112 THR A H    12 
ATOM   7125  H  HA   . THR A 1 10 ? 8.292   7.307   -5.875  1.00 0.36  ? 1112 THR A HA   12 
ATOM   7126  H  HB   . THR A 1 10 ? 8.611   6.219   -8.179  1.00 0.48  ? 1112 THR A HB   12 
ATOM   7127  H  HG1  . THR A 1 10 ? 11.165  6.595   -8.467  1.00 0.95  ? 1112 THR A HG1  12 
ATOM   7128  H  HG21 . THR A 1 10 ? 8.518   8.633   -7.886  1.00 1.19  ? 1112 THR A HG21 12 
ATOM   7129  H  HG22 . THR A 1 10 ? 9.742   8.212   -9.083  1.00 1.09  ? 1112 THR A HG22 12 
ATOM   7130  H  HG23 . THR A 1 10 ? 10.225  8.663   -7.448  1.00 1.17  ? 1112 THR A HG23 12 
ATOM   7131  N  N    . GLN A 1 11 ? 9.187   4.469   -4.934  1.00 0.18  ? 1113 GLN A N    12 
ATOM   7132  C  CA   . GLN A 1 11 ? 8.756   3.143   -4.541  1.00 0.17  ? 1113 GLN A CA   12 
ATOM   7133  C  C    . GLN A 1 11 ? 8.003   3.170   -3.226  1.00 0.17  ? 1113 GLN A C    12 
ATOM   7134  O  O    . GLN A 1 11 ? 8.167   4.074   -2.409  1.00 0.23  ? 1113 GLN A O    12 
ATOM   7135  C  CB   . GLN A 1 11 ? 9.944   2.203   -4.411  1.00 0.17  ? 1113 GLN A CB   12 
ATOM   7136  C  CG   . GLN A 1 11 ? 10.435  1.654   -5.734  1.00 0.23  ? 1113 GLN A CG   12 
ATOM   7137  C  CD   . GLN A 1 11 ? 11.542  0.638   -5.550  1.00 0.35  ? 1113 GLN A CD   12 
ATOM   7138  O  OE1  . GLN A 1 11 ? 12.321  0.722   -4.600  1.00 1.02  ? 1113 GLN A OE1  12 
ATOM   7139  N  NE2  . GLN A 1 11 ? 11.613  -0.332  -6.443  1.00 0.67  ? 1113 GLN A NE2  12 
ATOM   7140  H  H    . GLN A 1 11 ? 9.996   4.844   -4.526  1.00 0.20  ? 1113 GLN A H    12 
ATOM   7141  H  HA   . GLN A 1 11 ? 8.098   2.769   -5.309  1.00 0.22  ? 1113 GLN A HA   12 
ATOM   7142  H  HB2  . GLN A 1 11 ? 10.758  2.737   -3.943  1.00 0.16  ? 1113 GLN A HB2  12 
ATOM   7143  H  HB3  . GLN A 1 11 ? 9.663   1.375   -3.781  1.00 0.20  ? 1113 GLN A HB3  12 
ATOM   7144  H  HG2  . GLN A 1 11 ? 9.612   1.188   -6.238  1.00 0.31  ? 1113 GLN A HG2  12 
ATOM   7145  H  HG3  . GLN A 1 11 ? 10.808  2.470   -6.334  1.00 0.22  ? 1113 GLN A HG3  12 
ATOM   7146  H  HE21 . GLN A 1 11 ? 10.951  -0.347  -7.166  1.00 1.21  ? 1113 GLN A HE21 12 
ATOM   7147  H  HE22 . GLN A 1 11 ? 12.330  -0.996  -6.347  1.00 0.65  ? 1113 GLN A HE22 12 
ATOM   7148  N  N    . TYR A 1 12 ? 7.191   2.155   -3.037  1.00 0.15  ? 1114 TYR A N    12 
ATOM   7149  C  CA   . TYR A 1 12 ? 6.438   1.983   -1.812  1.00 0.16  ? 1114 TYR A CA   12 
ATOM   7150  C  C    . TYR A 1 12 ? 7.060   0.859   -1.006  1.00 0.15  ? 1114 TYR A C    12 
ATOM   7151  O  O    . TYR A 1 12 ? 7.651   -0.063  -1.571  1.00 0.15  ? 1114 TYR A O    12 
ATOM   7152  C  CB   . TYR A 1 12 ? 4.980   1.662   -2.135  1.00 0.18  ? 1114 TYR A CB   12 
ATOM   7153  C  CG   . TYR A 1 12 ? 4.065   1.581   -0.931  1.00 0.22  ? 1114 TYR A CG   12 
ATOM   7154  C  CD1  . TYR A 1 12 ? 3.652   2.735   -0.276  1.00 0.33  ? 1114 TYR A CD1  12 
ATOM   7155  C  CD2  . TYR A 1 12 ? 3.630   0.356   -0.441  1.00 0.21  ? 1114 TYR A CD2  12 
ATOM   7156  C  CE1  . TYR A 1 12 ? 2.834   2.670   0.833   1.00 0.39  ? 1114 TYR A CE1  12 
ATOM   7157  C  CE2  . TYR A 1 12 ? 2.806   0.284   0.668   1.00 0.26  ? 1114 TYR A CE2  12 
ATOM   7158  C  CZ   . TYR A 1 12 ? 2.359   1.421   1.258   1.00 0.34  ? 1114 TYR A CZ   12 
ATOM   7159  O  OH   . TYR A 1 12 ? 1.602   1.380   2.410   1.00 0.41  ? 1114 TYR A OH   12 
ATOM   7160  H  H    . TYR A 1 12 ? 7.110   1.477   -3.750  1.00 0.16  ? 1114 TYR A H    12 
ATOM   7161  H  HA   . TYR A 1 12 ? 6.490   2.902   -1.247  1.00 0.18  ? 1114 TYR A HA   12 
ATOM   7162  H  HB2  . TYR A 1 12 ? 4.589   2.421   -2.794  1.00 0.23  ? 1114 TYR A HB2  12 
ATOM   7163  H  HB3  . TYR A 1 12 ? 4.945   0.709   -2.635  1.00 0.18  ? 1114 TYR A HB3  12 
ATOM   7164  H  HD1  . TYR A 1 12 ? 3.982   3.695   -0.644  1.00 0.40  ? 1114 TYR A HD1  12 
ATOM   7165  H  HD2  . TYR A 1 12 ? 3.940   -0.551  -0.939  1.00 0.23  ? 1114 TYR A HD2  12 
ATOM   7166  H  HE1  . TYR A 1 12 ? 2.524   3.578   1.328   1.00 0.50  ? 1114 TYR A HE1  12 
ATOM   7167  H  HE2  . TYR A 1 12 ? 2.478   -0.677  1.035   1.00 0.29  ? 1114 TYR A HE2  12 
ATOM   7168  H  HH   . TYR A 1 12 ? 0.959   2.099   2.373   1.00 0.89  ? 1114 TYR A HH   12 
ATOM   7169  N  N    . THR A 1 13 ? 6.927   0.936   0.299   1.00 0.18  ? 1115 THR A N    12 
ATOM   7170  C  CA   . THR A 1 13 ? 7.529   -0.043  1.178   1.00 0.20  ? 1115 THR A CA   12 
ATOM   7171  C  C    . THR A 1 13 ? 6.451   -0.844  1.901   1.00 0.23  ? 1115 THR A C    12 
ATOM   7172  O  O    . THR A 1 13 ? 5.757   -0.328  2.781   1.00 0.31  ? 1115 THR A O    12 
ATOM   7173  C  CB   . THR A 1 13 ? 8.468   0.639   2.190   1.00 0.26  ? 1115 THR A CB   12 
ATOM   7174  O  OG1  . THR A 1 13 ? 9.366   1.515   1.489   1.00 0.30  ? 1115 THR A OG1  12 
ATOM   7175  C  CG2  . THR A 1 13 ? 9.279   -0.390  2.967   1.00 0.27  ? 1115 THR A CG2  12 
ATOM   7176  H  H    . THR A 1 13 ? 6.393   1.661   0.683   1.00 0.22  ? 1115 THR A H    12 
ATOM   7177  H  HA   . THR A 1 13 ? 8.116   -0.718  0.570   1.00 0.19  ? 1115 THR A HA   12 
ATOM   7178  H  HB   . THR A 1 13 ? 7.876   1.216   2.885   1.00 0.31  ? 1115 THR A HB   12 
ATOM   7179  H  HG1  . THR A 1 13 ? 9.990   0.985   0.981   1.00 0.82  ? 1115 THR A HG1  12 
ATOM   7180  H  HG21 . THR A 1 13 ? 9.852   -0.991  2.278   1.00 1.01  ? 1115 THR A HG21 12 
ATOM   7181  H  HG22 . THR A 1 13 ? 8.612   -1.023  3.532   1.00 1.02  ? 1115 THR A HG22 12 
ATOM   7182  H  HG23 . THR A 1 13 ? 9.951   0.120   3.644   1.00 1.10  ? 1115 THR A HG23 12 
ATOM   7183  N  N    . CYS A 1 14 ? 6.298   -2.096  1.496   1.00 0.26  ? 1116 CYS A N    12 
ATOM   7184  C  CA   . CYS A 1 14 ? 5.295   -2.980  2.075   1.00 0.34  ? 1116 CYS A CA   12 
ATOM   7185  C  C    . CYS A 1 14 ? 5.607   -3.317  3.526   1.00 0.40  ? 1116 CYS A C    12 
ATOM   7186  O  O    . CYS A 1 14 ? 6.702   -3.039  4.020   1.00 0.37  ? 1116 CYS A O    12 
ATOM   7187  C  CB   . CYS A 1 14 ? 5.217   -4.290  1.296   1.00 0.45  ? 1116 CYS A CB   12 
ATOM   7188  S  SG   . CYS A 1 14 ? 4.775   -4.128  -0.459  1.00 0.65  ? 1116 CYS A SG   12 
ATOM   7189  H  H    . CYS A 1 14 ? 6.877   -2.437  0.774   1.00 0.28  ? 1116 CYS A H    12 
ATOM   7190  H  HA   . CYS A 1 14 ? 4.340   -2.482  2.024   1.00 0.38  ? 1116 CYS A HA   12 
ATOM   7191  H  HB2  . CYS A 1 14 ? 6.176   -4.781  1.342   1.00 0.50  ? 1116 CYS A HB2  12 
ATOM   7192  H  HB3  . CYS A 1 14 ? 4.477   -4.926  1.762   1.00 0.54  ? 1116 CYS A HB3  12 
ATOM   7193  N  N    . ASP A 1 15 ? 4.649   -3.954  4.191   1.00 0.56  ? 1117 ASP A N    12 
ATOM   7194  C  CA   . ASP A 1 15 ? 4.869   -4.505  5.524   1.00 0.69  ? 1117 ASP A CA   12 
ATOM   7195  C  C    . ASP A 1 15 ? 6.022   -5.507  5.483   1.00 0.65  ? 1117 ASP A C    12 
ATOM   7196  O  O    . ASP A 1 15 ? 6.799   -5.626  6.428   1.00 0.71  ? 1117 ASP A O    12 
ATOM   7197  C  CB   . ASP A 1 15 ? 3.588   -5.188  6.023   1.00 0.93  ? 1117 ASP A CB   12 
ATOM   7198  C  CG   . ASP A 1 15 ? 3.771   -5.912  7.345   1.00 1.83  ? 1117 ASP A CG   12 
ATOM   7199  O  OD1  . ASP A 1 15 ? 4.231   -7.072  7.340   1.00 2.09  ? 1117 ASP A OD1  12 
ATOM   7200  O  OD2  . ASP A 1 15 ? 3.438   -5.328  8.399   1.00 2.62  ? 1117 ASP A OD2  12 
ATOM   7201  H  H    . ASP A 1 15 ? 3.763   -4.049  3.775   1.00 0.63  ? 1117 ASP A H    12 
ATOM   7202  H  HA   . ASP A 1 15 ? 5.127   -3.695  6.189   1.00 0.70  ? 1117 ASP A HA   12 
ATOM   7203  H  HB2  . ASP A 1 15 ? 2.822   -4.438  6.154   1.00 1.35  ? 1117 ASP A HB2  12 
ATOM   7204  H  HB3  . ASP A 1 15 ? 3.258   -5.902  5.283   1.00 0.70  ? 1117 ASP A HB3  12 
ATOM   7205  N  N    . ASN A 1 16 ? 6.141   -6.192  4.351   1.00 0.69  ? 1118 ASN A N    12 
ATOM   7206  C  CA   . ASN A 1 16 ? 7.184   -7.196  4.147   1.00 0.75  ? 1118 ASN A CA   12 
ATOM   7207  C  C    . ASN A 1 16 ? 8.525   -6.545  3.815   1.00 0.59  ? 1118 ASN A C    12 
ATOM   7208  O  O    . ASN A 1 16 ? 9.504   -7.242  3.551   1.00 0.65  ? 1118 ASN A O    12 
ATOM   7209  C  CB   . ASN A 1 16 ? 6.802   -8.134  2.998   1.00 0.98  ? 1118 ASN A CB   12 
ATOM   7210  C  CG   . ASN A 1 16 ? 5.376   -8.601  3.055   1.00 1.77  ? 1118 ASN A CG   12 
ATOM   7211  O  OD1  . ASN A 1 16 ? 4.476   -7.946  2.526   1.00 2.75  ? 1118 ASN A OD1  12 
ATOM   7212  N  ND2  . ASN A 1 16 ? 5.154   -9.731  3.676   1.00 2.02  ? 1118 ASN A ND2  12 
ATOM   7213  H  H    . ASN A 1 16 ? 5.492   -6.033  3.635   1.00 0.75  ? 1118 ASN A H    12 
ATOM   7214  H  HA   . ASN A 1 16 ? 7.283   -7.769  5.055   1.00 0.85  ? 1118 ASN A HA   12 
ATOM   7215  H  HB2  . ASN A 1 16 ? 6.936   -7.626  2.065   1.00 1.24  ? 1118 ASN A HB2  12 
ATOM   7216  H  HB3  . ASN A 1 16 ? 7.445   -9.002  3.023   1.00 1.41  ? 1118 ASN A HB3  12 
ATOM   7217  H  HD21 . ASN A 1 16 ? 5.918   -10.206 4.068   1.00 1.91  ? 1118 ASN A HD21 12 
ATOM   7218  H  HD22 . ASN A 1 16 ? 4.243   -10.060 3.706   1.00 2.74  ? 1118 ASN A HD22 12 
ATOM   7219  N  N    . HIS A 1 17 ? 8.556   -5.209  3.821   1.00 0.46  ? 1119 HIS A N    12 
ATOM   7220  C  CA   . HIS A 1 17 ? 9.738   -4.443  3.408   1.00 0.41  ? 1119 HIS A CA   12 
ATOM   7221  C  C    . HIS A 1 17 ? 10.043  -4.670  1.929   1.00 0.44  ? 1119 HIS A C    12 
ATOM   7222  O  O    . HIS A 1 17 ? 11.187  -4.559  1.490   1.00 0.79  ? 1119 HIS A O    12 
ATOM   7223  C  CB   . HIS A 1 17 ? 10.967  -4.777  4.268   1.00 0.51  ? 1119 HIS A CB   12 
ATOM   7224  C  CG   . HIS A 1 17 ? 10.930  -4.170  5.638   1.00 0.63  ? 1119 HIS A CG   12 
ATOM   7225  N  ND1  . HIS A 1 17 ? 10.568  -4.871  6.766   1.00 0.94  ? 1119 HIS A ND1  12 
ATOM   7226  C  CD2  . HIS A 1 17 ? 11.220  -2.914  6.057   1.00 0.78  ? 1119 HIS A CD2  12 
ATOM   7227  C  CE1  . HIS A 1 17 ? 10.636  -4.076  7.816   1.00 1.05  ? 1119 HIS A CE1  12 
ATOM   7228  N  NE2  . HIS A 1 17 ? 11.030  -2.883  7.416   1.00 0.93  ? 1119 HIS A NE2  12 
ATOM   7229  H  H    . HIS A 1 17 ? 7.757   -4.719  4.120   1.00 0.47  ? 1119 HIS A H    12 
ATOM   7230  H  HA   . HIS A 1 17 ? 9.500   -3.398  3.544   1.00 0.38  ? 1119 HIS A HA   12 
ATOM   7231  H  HB2  . HIS A 1 17 ? 11.036  -5.849  4.383   1.00 0.60  ? 1119 HIS A HB2  12 
ATOM   7232  H  HB3  . HIS A 1 17 ? 11.855  -4.418  3.768   1.00 0.55  ? 1119 HIS A HB3  12 
ATOM   7233  H  HD1  . HIS A 1 17 ? 10.309  -5.820  6.796   1.00 1.18  ? 1119 HIS A HD1  12 
ATOM   7234  H  HD2  . HIS A 1 17 ? 11.542  -2.090  5.436   1.00 1.00  ? 1119 HIS A HD2  12 
ATOM   7235  H  HE1  . HIS A 1 17 ? 10.409  -4.355  8.834   1.00 1.35  ? 1119 HIS A HE1  12 
ATOM   7236  H  HE2  . HIS A 1 17 ? 11.358  -2.174  8.015   1.00 1.09  ? 1119 HIS A HE2  12 
ATOM   7237  N  N    . GLN A 1 18 ? 9.004   -4.986  1.169   1.00 0.40  ? 1120 GLN A N    12 
ATOM   7238  C  CA   . GLN A 1 18 ? 9.125   -5.157  -0.271  1.00 0.38  ? 1120 GLN A CA   12 
ATOM   7239  C  C    . GLN A 1 18 ? 8.927   -3.813  -0.960  1.00 0.29  ? 1120 GLN A C    12 
ATOM   7240  O  O    . GLN A 1 18 ? 8.081   -3.018  -0.545  1.00 0.39  ? 1120 GLN A O    12 
ATOM   7241  C  CB   . GLN A 1 18 ? 8.096   -6.177  -0.768  1.00 0.49  ? 1120 GLN A CB   12 
ATOM   7242  C  CG   . GLN A 1 18 ? 8.175   -6.466  -2.260  1.00 0.50  ? 1120 GLN A CG   12 
ATOM   7243  C  CD   . GLN A 1 18 ? 9.509   -7.054  -2.675  1.00 1.05  ? 1120 GLN A CD   12 
ATOM   7244  O  OE1  . GLN A 1 18 ? 10.172  -7.740  -1.895  1.00 1.91  ? 1120 GLN A OE1  12 
ATOM   7245  N  NE2  . GLN A 1 18 ? 9.917   -6.788  -3.903  1.00 1.51  ? 1120 GLN A NE2  12 
ATOM   7246  H  H    . GLN A 1 18 ? 8.130   -5.103  1.588   1.00 0.63  ? 1120 GLN A H    12 
ATOM   7247  H  HA   . GLN A 1 18 ? 10.120  -5.519  -0.483  1.00 0.42  ? 1120 GLN A HA   12 
ATOM   7248  H  HB2  . GLN A 1 18 ? 8.246   -7.105  -0.237  1.00 0.62  ? 1120 GLN A HB2  12 
ATOM   7249  H  HB3  . GLN A 1 18 ? 7.107   -5.805  -0.547  1.00 0.52  ? 1120 GLN A HB3  12 
ATOM   7250  H  HG2  . GLN A 1 18 ? 7.395   -7.166  -2.521  1.00 0.87  ? 1120 GLN A HG2  12 
ATOM   7251  H  HG3  . GLN A 1 18 ? 8.023   -5.542  -2.800  1.00 0.86  ? 1120 GLN A HG3  12 
ATOM   7252  H  HE21 . GLN A 1 18 ? 9.342   -6.231  -4.473  1.00 1.83  ? 1120 GLN A HE21 12 
ATOM   7253  H  HE22 . GLN A 1 18 ? 10.775  -7.162  -4.199  1.00 1.99  ? 1120 GLN A HE22 12 
ATOM   7254  N  N    . CYS A 1 19 ? 9.715   -3.560  -1.992  1.00 0.21  ? 1121 CYS A N    12 
ATOM   7255  C  CA   . CYS A 1 19 ? 9.686   -2.277  -2.675  1.00 0.21  ? 1121 CYS A CA   12 
ATOM   7256  C  C    . CYS A 1 19 ? 8.947   -2.370  -4.009  1.00 0.20  ? 1121 CYS A C    12 
ATOM   7257  O  O    . CYS A 1 19 ? 9.483   -2.886  -4.990  1.00 0.34  ? 1121 CYS A O    12 
ATOM   7258  C  CB   . CYS A 1 19 ? 11.116  -1.784  -2.902  1.00 0.34  ? 1121 CYS A CB   12 
ATOM   7259  S  SG   . CYS A 1 19 ? 12.110  -1.679  -1.377  1.00 0.42  ? 1121 CYS A SG   12 
ATOM   7260  H  H    . CYS A 1 19 ? 10.340  -4.251  -2.300  1.00 0.29  ? 1121 CYS A H    12 
ATOM   7261  H  HA   . CYS A 1 19 ? 9.170   -1.574  -2.039  1.00 0.24  ? 1121 CYS A HA   12 
ATOM   7262  H  HB2  . CYS A 1 19 ? 11.620  -2.460  -3.576  1.00 0.39  ? 1121 CYS A HB2  12 
ATOM   7263  H  HB3  . CYS A 1 19 ? 11.085  -0.799  -3.342  1.00 0.41  ? 1121 CYS A HB3  12 
ATOM   7264  N  N    . ILE A 1 20 ? 7.713   -1.880  -4.034  1.00 0.15  ? 1122 ILE A N    12 
ATOM   7265  C  CA   . ILE A 1 20 ? 6.937   -1.819  -5.270  1.00 0.14  ? 1122 ILE A CA   12 
ATOM   7266  C  C    . ILE A 1 20 ? 6.836   -0.377  -5.750  1.00 0.14  ? 1122 ILE A C    12 
ATOM   7267  O  O    . ILE A 1 20 ? 7.389   0.520   -5.129  1.00 0.18  ? 1122 ILE A O    12 
ATOM   7268  C  CB   . ILE A 1 20 ? 5.511   -2.384  -5.102  1.00 0.14  ? 1122 ILE A CB   12 
ATOM   7269  C  CG1  . ILE A 1 20 ? 4.711   -1.548  -4.102  1.00 0.13  ? 1122 ILE A CG1  12 
ATOM   7270  C  CG2  . ILE A 1 20 ? 5.558   -3.842  -4.669  1.00 0.19  ? 1122 ILE A CG2  12 
ATOM   7271  C  CD1  . ILE A 1 20 ? 3.238   -1.882  -4.089  1.00 0.17  ? 1122 ILE A CD1  12 
ATOM   7272  H  H    . ILE A 1 20 ? 7.317   -1.538  -3.203  1.00 0.22  ? 1122 ILE A H    12 
ATOM   7273  H  HA   . ILE A 1 20 ? 7.448   -2.404  -6.017  1.00 0.17  ? 1122 ILE A HA   12 
ATOM   7274  H  HB   . ILE A 1 20 ? 5.021   -2.341  -6.061  1.00 0.16  ? 1122 ILE A HB   12 
ATOM   7275  H  HG12 . ILE A 1 20 ? 5.099   -1.716  -3.109  1.00 0.15  ? 1122 ILE A HG12 12 
ATOM   7276  H  HG13 . ILE A 1 20 ? 4.813   -0.503  -4.353  1.00 0.14  ? 1122 ILE A HG13 12 
ATOM   7277  H  HG21 . ILE A 1 20 ? 4.550   -4.210  -4.541  1.00 0.98  ? 1122 ILE A HG21 12 
ATOM   7278  H  HG22 . ILE A 1 20 ? 6.093   -3.923  -3.734  1.00 1.05  ? 1122 ILE A HG22 12 
ATOM   7279  H  HG23 . ILE A 1 20 ? 6.061   -4.425  -5.424  1.00 0.97  ? 1122 ILE A HG23 12 
ATOM   7280  H  HD11 . ILE A 1 20 ? 2.733   -1.260  -3.365  1.00 1.07  ? 1122 ILE A HD11 12 
ATOM   7281  H  HD12 . ILE A 1 20 ? 3.110   -2.920  -3.825  1.00 0.99  ? 1122 ILE A HD12 12 
ATOM   7282  H  HD13 . ILE A 1 20 ? 2.823   -1.706  -5.070  1.00 1.03  ? 1122 ILE A HD13 12 
ATOM   7283  N  N    . SER A 1 21 ? 6.129   -0.153  -6.845  1.00 0.16  ? 1123 SER A N    12 
ATOM   7284  C  CA   . SER A 1 21 ? 5.896   1.199   -7.332  1.00 0.17  ? 1123 SER A CA   12 
ATOM   7285  C  C    . SER A 1 21 ? 4.781   1.864   -6.535  1.00 0.15  ? 1123 SER A C    12 
ATOM   7286  O  O    . SER A 1 21 ? 3.785   1.225   -6.194  1.00 0.17  ? 1123 SER A O    12 
ATOM   7287  C  CB   . SER A 1 21 ? 5.513   1.172   -8.814  1.00 0.24  ? 1123 SER A CB   12 
ATOM   7288  O  OG   . SER A 1 21 ? 4.974   2.423   -9.225  1.00 0.33  ? 1123 SER A OG   12 
ATOM   7289  H  H    . SER A 1 21 ? 5.752   -0.911  -7.335  1.00 0.20  ? 1123 SER A H    12 
ATOM   7290  H  HA   . SER A 1 21 ? 6.807   1.765   -7.209  1.00 0.19  ? 1123 SER A HA   12 
ATOM   7291  H  HB2  . SER A 1 21 ? 6.389   0.961   -9.407  1.00 0.27  ? 1123 SER A HB2  12 
ATOM   7292  H  HB3  . SER A 1 21 ? 4.772   0.403   -8.978  1.00 0.24  ? 1123 SER A HB3  12 
ATOM   7293  H  HG   . SER A 1 21 ? 4.162   2.270   -9.725  1.00 0.63  ? 1123 SER A HG   12 
ATOM   7294  N  N    . LYS A 1 22 ? 4.948   3.155   -6.254  1.00 0.17  ? 1124 LYS A N    12 
ATOM   7295  C  CA   . LYS A 1 22 ? 3.916   3.928   -5.574  1.00 0.19  ? 1124 LYS A CA   12 
ATOM   7296  C  C    . LYS A 1 22 ? 2.673   4.067   -6.444  1.00 0.22  ? 1124 LYS A C    12 
ATOM   7297  O  O    . LYS A 1 22 ? 1.596   4.386   -5.946  1.00 0.25  ? 1124 LYS A O    12 
ATOM   7298  C  CB   . LYS A 1 22 ? 4.425   5.319   -5.195  1.00 0.23  ? 1124 LYS A CB   12 
ATOM   7299  C  CG   . LYS A 1 22 ? 5.321   5.334   -3.971  1.00 0.25  ? 1124 LYS A CG   12 
ATOM   7300  C  CD   . LYS A 1 22 ? 5.747   6.748   -3.623  1.00 0.25  ? 1124 LYS A CD   12 
ATOM   7301  C  CE   . LYS A 1 22 ? 6.562   6.783   -2.343  1.00 0.30  ? 1124 LYS A CE   12 
ATOM   7302  N  NZ   . LYS A 1 22 ? 6.999   8.161   -2.007  1.00 1.24  ? 1124 LYS A NZ   12 
ATOM   7303  H  H    . LYS A 1 22 ? 5.792   3.597   -6.506  1.00 0.20  ? 1124 LYS A H    12 
ATOM   7304  H  HA   . LYS A 1 22 ? 3.652   3.396   -4.672  1.00 0.19  ? 1124 LYS A HA   12 
ATOM   7305  H  HB2  . LYS A 1 22 ? 4.982   5.723   -6.026  1.00 0.30  ? 1124 LYS A HB2  12 
ATOM   7306  H  HB3  . LYS A 1 22 ? 3.576   5.957   -5.000  1.00 0.30  ? 1124 LYS A HB3  12 
ATOM   7307  H  HG2  . LYS A 1 22 ? 4.781   4.914   -3.135  1.00 0.37  ? 1124 LYS A HG2  12 
ATOM   7308  H  HG3  . LYS A 1 22 ? 6.200   4.739   -4.171  1.00 0.37  ? 1124 LYS A HG3  12 
ATOM   7309  H  HD2  . LYS A 1 22 ? 6.348   7.141   -4.430  1.00 0.32  ? 1124 LYS A HD2  12 
ATOM   7310  H  HD3  . LYS A 1 22 ? 4.867   7.359   -3.495  1.00 0.33  ? 1124 LYS A HD3  12 
ATOM   7311  H  HE2  . LYS A 1 22 ? 5.960   6.397   -1.536  1.00 0.93  ? 1124 LYS A HE2  12 
ATOM   7312  H  HE3  . LYS A 1 22 ? 7.435   6.160   -2.471  1.00 0.95  ? 1124 LYS A HE3  12 
ATOM   7313  H  HZ1  . LYS A 1 22 ? 7.530   8.163   -1.113  1.00 1.76  ? 1124 LYS A HZ1  12 
ATOM   7314  H  HZ2  . LYS A 1 22 ? 6.176   8.787   -1.908  1.00 1.77  ? 1124 LYS A HZ2  12 
ATOM   7315  H  HZ3  . LYS A 1 22 ? 7.614   8.536   -2.762  1.00 1.88  ? 1124 LYS A HZ3  12 
ATOM   7316  N  N    . ASN A 1 23 ? 2.822   3.819   -7.743  1.00 0.24  ? 1125 ASN A N    12 
ATOM   7317  C  CA   . ASN A 1 23 ? 1.697   3.931   -8.664  1.00 0.28  ? 1125 ASN A CA   12 
ATOM   7318  C  C    . ASN A 1 23 ? 0.818   2.690   -8.591  1.00 0.26  ? 1125 ASN A C    12 
ATOM   7319  O  O    . ASN A 1 23 ? -0.340  2.708   -9.003  1.00 0.32  ? 1125 ASN A O    12 
ATOM   7320  C  CB   . ASN A 1 23 ? 2.182   4.151   -10.100 1.00 0.36  ? 1125 ASN A CB   12 
ATOM   7321  C  CG   . ASN A 1 23 ? 2.880   5.487   -10.283 1.00 1.03  ? 1125 ASN A CG   12 
ATOM   7322  O  OD1  . ASN A 1 23 ? 2.237   6.503   -10.544 1.00 1.75  ? 1125 ASN A OD1  12 
ATOM   7323  N  ND2  . ASN A 1 23 ? 4.201   5.493   -10.166 1.00 1.69  ? 1125 ASN A ND2  12 
ATOM   7324  H  H    . ASN A 1 23 ? 3.705   3.558   -8.084  1.00 0.25  ? 1125 ASN A H    12 
ATOM   7325  H  HA   . ASN A 1 23 ? 1.110   4.786   -8.359  1.00 0.31  ? 1125 ASN A HA   12 
ATOM   7326  H  HB2  . ASN A 1 23 ? 2.875   3.368   -10.361 1.00 0.82  ? 1125 ASN A HB2  12 
ATOM   7327  H  HB3  . ASN A 1 23 ? 1.335   4.115   -10.768 1.00 0.82  ? 1125 ASN A HB3  12 
ATOM   7328  H  HD21 . ASN A 1 23 ? 4.656   4.647   -9.972  1.00 1.99  ? 1125 ASN A HD21 12 
ATOM   7329  H  HD22 . ASN A 1 23 ? 4.672   6.348   -10.282 1.00 2.22  ? 1125 ASN A HD22 12 
ATOM   7330  N  N    . TRP A 1 24 ? 1.369   1.617   -8.036  1.00 0.22  ? 1126 TRP A N    12 
ATOM   7331  C  CA   . TRP A 1 24 ? 0.644   0.358   -7.912  1.00 0.22  ? 1126 TRP A CA   12 
ATOM   7332  C  C    . TRP A 1 24 ? -0.098  0.291   -6.586  1.00 0.20  ? 1126 TRP A C    12 
ATOM   7333  O  O    . TRP A 1 24 ? -0.894  -0.611  -6.350  1.00 0.26  ? 1126 TRP A O    12 
ATOM   7334  C  CB   . TRP A 1 24 ? 1.602   -0.827  -8.019  1.00 0.25  ? 1126 TRP A CB   12 
ATOM   7335  C  CG   . TRP A 1 24 ? 2.259   -0.961  -9.361  1.00 0.31  ? 1126 TRP A CG   12 
ATOM   7336  C  CD1  . TRP A 1 24 ? 1.819   -0.452  -10.550 1.00 0.37  ? 1126 TRP A CD1  12 
ATOM   7337  C  CD2  . TRP A 1 24 ? 3.468   -1.669  -9.652  1.00 0.38  ? 1126 TRP A CD2  12 
ATOM   7338  N  NE1  . TRP A 1 24 ? 2.690   -0.789  -11.557 1.00 0.45  ? 1126 TRP A NE1  12 
ATOM   7339  C  CE2  . TRP A 1 24 ? 3.710   -1.538  -11.033 1.00 0.45  ? 1126 TRP A CE2  12 
ATOM   7340  C  CE3  . TRP A 1 24 ? 4.375   -2.397  -8.878  1.00 0.44  ? 1126 TRP A CE3  12 
ATOM   7341  C  CZ2  . TRP A 1 24 ? 4.819   -2.109  -11.653 1.00 0.54  ? 1126 TRP A CZ2  12 
ATOM   7342  C  CZ3  . TRP A 1 24 ? 5.473   -2.963  -9.493  1.00 0.55  ? 1126 TRP A CZ3  12 
ATOM   7343  C  CH2  . TRP A 1 24 ? 5.689   -2.815  -10.870 1.00 0.58  ? 1126 TRP A CH2  12 
ATOM   7344  H  H    . TRP A 1 24 ? 2.284   1.674   -7.688  1.00 0.23  ? 1126 TRP A H    12 
ATOM   7345  H  HA   . TRP A 1 24 ? -0.076  0.303   -8.717  1.00 0.25  ? 1126 TRP A HA   12 
ATOM   7346  H  HB2  . TRP A 1 24 ? 2.384   -0.718  -7.278  1.00 0.27  ? 1126 TRP A HB2  12 
ATOM   7347  H  HB3  . TRP A 1 24 ? 1.055   -1.732  -7.821  1.00 0.28  ? 1126 TRP A HB3  12 
ATOM   7348  H  HD1  . TRP A 1 24 ? 0.921   0.135   -10.665 1.00 0.40  ? 1126 TRP A HD1  12 
ATOM   7349  H  HE1  . TRP A 1 24 ? 2.597   -0.535  -12.503 1.00 0.53  ? 1126 TRP A HE1  12 
ATOM   7350  H  HE3  . TRP A 1 24 ? 4.225   -2.520  -7.817  1.00 0.45  ? 1126 TRP A HE3  12 
ATOM   7351  H  HZ2  . TRP A 1 24 ? 4.998   -2.006  -12.713 1.00 0.61  ? 1126 TRP A HZ2  12 
ATOM   7352  H  HZ3  . TRP A 1 24 ? 6.184   -3.529  -8.908  1.00 0.62  ? 1126 TRP A HZ3  12 
ATOM   7353  H  HH2  . TRP A 1 24 ? 6.560   -3.276  -11.308 1.00 0.67  ? 1126 TRP A HH2  12 
ATOM   7354  N  N    . VAL A 1 25 ? 0.177   1.248   -5.723  1.00 0.19  ? 1127 VAL A N    12 
ATOM   7355  C  CA   . VAL A 1 25 ? -0.440  1.294   -4.404  1.00 0.18  ? 1127 VAL A CA   12 
ATOM   7356  C  C    . VAL A 1 25 ? -1.932  1.577   -4.505  1.00 0.19  ? 1127 VAL A C    12 
ATOM   7357  O  O    . VAL A 1 25 ? -2.344  2.555   -5.134  1.00 0.23  ? 1127 VAL A O    12 
ATOM   7358  C  CB   . VAL A 1 25 ? 0.228   2.366   -3.519  1.00 0.21  ? 1127 VAL A CB   12 
ATOM   7359  C  CG1  . VAL A 1 25 ? -0.418  2.434   -2.142  1.00 0.24  ? 1127 VAL A CG1  12 
ATOM   7360  C  CG2  . VAL A 1 25 ? 1.716   2.093   -3.400  1.00 0.24  ? 1127 VAL A CG2  12 
ATOM   7361  H  H    . VAL A 1 25 ? 0.815   1.943   -5.978  1.00 0.21  ? 1127 VAL A H    12 
ATOM   7362  H  HA   . VAL A 1 25 ? -0.302  0.329   -3.938  1.00 0.19  ? 1127 VAL A HA   12 
ATOM   7363  H  HB   . VAL A 1 25 ? 0.102   3.326   -3.997  1.00 0.23  ? 1127 VAL A HB   12 
ATOM   7364  H  HG11 . VAL A 1 25 ? 0.081   3.183   -1.545  1.00 1.01  ? 1127 VAL A HG11 12 
ATOM   7365  H  HG12 . VAL A 1 25 ? -0.332  1.472   -1.656  1.00 1.02  ? 1127 VAL A HG12 12 
ATOM   7366  H  HG13 . VAL A 1 25 ? -1.462  2.692   -2.245  1.00 1.00  ? 1127 VAL A HG13 12 
ATOM   7367  H  HG21 . VAL A 1 25 ? 2.184   2.881   -2.830  1.00 1.05  ? 1127 VAL A HG21 12 
ATOM   7368  H  HG22 . VAL A 1 25 ? 2.154   2.051   -4.387  1.00 1.06  ? 1127 VAL A HG22 12 
ATOM   7369  H  HG23 . VAL A 1 25 ? 1.869   1.148   -2.899  1.00 1.01  ? 1127 VAL A HG23 12 
ATOM   7370  N  N    . CYS A 1 26 ? -2.726  0.694   -3.902  1.00 0.19  ? 1128 CYS A N    12 
ATOM   7371  C  CA   . CYS A 1 26 ? -4.177  0.846   -3.852  1.00 0.26  ? 1128 CYS A CA   12 
ATOM   7372  C  C    . CYS A 1 26 ? -4.758  0.904   -5.262  1.00 0.27  ? 1128 CYS A C    12 
ATOM   7373  O  O    . CYS A 1 26 ? -5.517  1.807   -5.611  1.00 0.37  ? 1128 CYS A O    12 
ATOM   7374  C  CB   . CYS A 1 26 ? -4.547  2.095   -3.047  1.00 0.32  ? 1128 CYS A CB   12 
ATOM   7375  S  SG   . CYS A 1 26 ? -6.332  2.311   -2.737  1.00 0.58  ? 1128 CYS A SG   12 
ATOM   7376  H  H    . CYS A 1 26 ? -2.321  -0.091  -3.477  1.00 0.19  ? 1128 CYS A H    12 
ATOM   7377  H  HA   . CYS A 1 26 ? -4.577  -0.023  -3.351  1.00 0.28  ? 1128 CYS A HA   12 
ATOM   7378  H  HB2  . CYS A 1 26 ? -4.055  2.048   -2.088  1.00 0.36  ? 1128 CYS A HB2  12 
ATOM   7379  H  HB3  . CYS A 1 26 ? -4.196  2.962   -3.573  1.00 0.36  ? 1128 CYS A HB3  12 
ATOM   7380  N  N    . ASP A 1 27 ? -4.387  -0.075  -6.071  1.00 0.25  ? 1129 ASP A N    12 
ATOM   7381  C  CA   . ASP A 1 27 ? -4.852  -0.149  -7.453  1.00 0.30  ? 1129 ASP A CA   12 
ATOM   7382  C  C    . ASP A 1 27 ? -5.767  -1.360  -7.630  1.00 0.37  ? 1129 ASP A C    12 
ATOM   7383  O  O    . ASP A 1 27 ? -5.991  -1.826  -8.747  1.00 0.41  ? 1129 ASP A O    12 
ATOM   7384  C  CB   . ASP A 1 27 ? -3.660  -0.241  -8.413  1.00 0.31  ? 1129 ASP A CB   12 
ATOM   7385  C  CG   . ASP A 1 27 ? -3.093  -1.643  -8.508  1.00 0.35  ? 1129 ASP A CG   12 
ATOM   7386  O  OD1  . ASP A 1 27 ? -2.827  -2.255  -7.451  1.00 0.31  ? 1129 ASP A OD1  12 
ATOM   7387  O  OD2  . ASP A 1 27 ? -2.908  -2.132  -9.639  1.00 0.46  ? 1129 ASP A OD2  12 
ATOM   7388  H  H    . ASP A 1 27 ? -3.782  -0.774  -5.726  1.00 0.24  ? 1129 ASP A H    12 
ATOM   7389  H  HA   . ASP A 1 27 ? -5.413  0.749   -7.665  1.00 0.33  ? 1129 ASP A HA   12 
ATOM   7390  H  HB2  . ASP A 1 27 ? -3.973  0.067   -9.398  1.00 0.36  ? 1129 ASP A HB2  12 
ATOM   7391  H  HB3  . ASP A 1 27 ? -2.879  0.420   -8.067  1.00 0.29  ? 1129 ASP A HB3  12 
ATOM   7392  N  N    . THR A 1 28 ? -6.271  -1.854  -6.500  1.00 0.45  ? 1130 THR A N    12 
ATOM   7393  C  CA   . THR A 1 28 ? -7.155  -3.024  -6.426  1.00 0.56  ? 1130 THR A CA   12 
ATOM   7394  C  C    . THR A 1 28 ? -6.515  -4.284  -7.015  1.00 0.61  ? 1130 THR A C    12 
ATOM   7395  O  O    . THR A 1 28 ? -7.204  -5.179  -7.505  1.00 0.73  ? 1130 THR A O    12 
ATOM   7396  C  CB   . THR A 1 28 ? -8.561  -2.782  -7.043  1.00 0.59  ? 1130 THR A CB   12 
ATOM   7397  O  OG1  . THR A 1 28 ? -8.487  -2.358  -8.411  1.00 0.56  ? 1130 THR A OG1  12 
ATOM   7398  C  CG2  . THR A 1 28 ? -9.320  -1.745  -6.231  1.00 0.65  ? 1130 THR A CG2  12 
ATOM   7399  H  H    . THR A 1 28 ? -6.025  -1.414  -5.656  1.00 0.46  ? 1130 THR A H    12 
ATOM   7400  H  HA   . THR A 1 28 ? -7.307  -3.214  -5.373  1.00 0.64  ? 1130 THR A HA   12 
ATOM   7401  H  HB   . THR A 1 28 ? -9.112  -3.710  -6.999  1.00 0.67  ? 1130 THR A HB   12 
ATOM   7402  H  HG1  . THR A 1 28 ? -7.564  -2.217  -8.654  1.00 0.53  ? 1130 THR A HG1  12 
ATOM   7403  H  HG21 . THR A 1 28 ? -8.775  -0.813  -6.235  1.00 1.34  ? 1130 THR A HG21 12 
ATOM   7404  H  HG22 . THR A 1 28 ? -9.427  -2.094  -5.213  1.00 1.09  ? 1130 THR A HG22 12 
ATOM   7405  H  HG23 . THR A 1 28 ? -10.297 -1.593  -6.662  1.00 1.21  ? 1130 THR A HG23 12 
ATOM   7406  N  N    . ASP A 1 29 ? -5.190  -4.342  -6.955  1.00 0.59  ? 1131 ASP A N    12 
ATOM   7407  C  CA   . ASP A 1 29 ? -4.451  -5.542  -7.314  1.00 0.69  ? 1131 ASP A CA   12 
ATOM   7408  C  C    . ASP A 1 29 ? -3.258  -5.700  -6.384  1.00 0.67  ? 1131 ASP A C    12 
ATOM   7409  O  O    . ASP A 1 29 ? -2.674  -4.708  -5.945  1.00 0.53  ? 1131 ASP A O    12 
ATOM   7410  C  CB   . ASP A 1 29 ? -3.977  -5.461  -8.761  1.00 0.75  ? 1131 ASP A CB   12 
ATOM   7411  C  CG   . ASP A 1 29 ? -3.394  -6.771  -9.256  1.00 0.92  ? 1131 ASP A CG   12 
ATOM   7412  O  OD1  . ASP A 1 29 ? -4.073  -7.812  -9.131  1.00 1.21  ? 1131 ASP A OD1  12 
ATOM   7413  O  OD2  . ASP A 1 29 ? -2.267  -6.766  -9.793  1.00 0.92  ? 1131 ASP A OD2  12 
ATOM   7414  H  H    . ASP A 1 29 ? -4.692  -3.546  -6.685  1.00 0.55  ? 1131 ASP A H    12 
ATOM   7415  H  HA   . ASP A 1 29 ? -5.108  -6.392  -7.198  1.00 0.81  ? 1131 ASP A HA   12 
ATOM   7416  H  HB2  . ASP A 1 29 ? -4.813  -5.194  -9.387  1.00 0.81  ? 1131 ASP A HB2  12 
ATOM   7417  H  HB3  . ASP A 1 29 ? -3.216  -4.697  -8.840  1.00 0.68  ? 1131 ASP A HB3  12 
ATOM   7418  N  N    . ASN A 1 30 ? -2.901  -6.931  -6.062  1.00 0.94  ? 1132 ASN A N    12 
ATOM   7419  C  CA   . ASN A 1 30 ? -1.787  -7.163  -5.157  1.00 1.00  ? 1132 ASN A CA   12 
ATOM   7420  C  C    . ASN A 1 30 ? -0.482  -7.302  -5.929  1.00 0.91  ? 1132 ASN A C    12 
ATOM   7421  O  O    . ASN A 1 30 ? -0.278  -8.265  -6.669  1.00 1.06  ? 1132 ASN A O    12 
ATOM   7422  C  CB   . ASN A 1 30 ? -2.028  -8.396  -4.284  1.00 1.29  ? 1132 ASN A CB   12 
ATOM   7423  C  CG   . ASN A 1 30 ? -0.886  -8.631  -3.315  1.00 1.72  ? 1132 ASN A CG   12 
ATOM   7424  O  OD1  . ASN A 1 30 ? -0.161  -7.702  -2.960  1.00 2.58  ? 1132 ASN A OD1  12 
ATOM   7425  N  ND2  . ASN A 1 30 ? -0.723  -9.863  -2.866  1.00 2.07  ? 1132 ASN A ND2  12 
ATOM   7426  H  H    . ASN A 1 30 ? -3.385  -7.695  -6.443  1.00 1.15  ? 1132 ASN A H    12 
ATOM   7427  H  HA   . ASN A 1 30 ? -1.709  -6.297  -4.515  1.00 0.97  ? 1132 ASN A HA   12 
ATOM   7428  H  HB2  . ASN A 1 30 ? -2.936  -8.260  -3.717  1.00 1.52  ? 1132 ASN A HB2  12 
ATOM   7429  H  HB3  . ASN A 1 30 ? -2.125  -9.265  -4.916  1.00 1.97  ? 1132 ASN A HB3  12 
ATOM   7430  H  HD21 . ASN A 1 30 ? -1.342  -10.560 -3.179  1.00 2.11  ? 1132 ASN A HD21 12 
ATOM   7431  H  HD22 . ASN A 1 30 ? 0.009   -10.033 -2.233  1.00 2.73  ? 1132 ASN A HD22 12 
ATOM   7432  N  N    . ASP A 1 31 ? 0.399   -6.329  -5.742  1.00 0.86  ? 1133 ASP A N    12 
ATOM   7433  C  CA   . ASP A 1 31 ? 1.682   -6.299  -6.435  1.00 0.77  ? 1133 ASP A CA   12 
ATOM   7434  C  C    . ASP A 1 31 ? 2.786   -6.740  -5.499  1.00 0.78  ? 1133 ASP A C    12 
ATOM   7435  O  O    . ASP A 1 31 ? 3.953   -6.817  -5.883  1.00 1.28  ? 1133 ASP A O    12 
ATOM   7436  C  CB   . ASP A 1 31 ? 1.999   -4.887  -6.926  1.00 0.67  ? 1133 ASP A CB   12 
ATOM   7437  C  CG   . ASP A 1 31 ? 0.850   -4.249  -7.664  1.00 0.58  ? 1133 ASP A CG   12 
ATOM   7438  O  OD1  . ASP A 1 31 ? 0.010   -3.599  -7.004  1.00 1.00  ? 1133 ASP A OD1  12 
ATOM   7439  O  OD2  . ASP A 1 31 ? 0.779   -4.389  -8.902  1.00 1.09  ? 1133 ASP A OD2  12 
ATOM   7440  H  H    . ASP A 1 31 ? 0.183   -5.607  -5.114  1.00 1.05  ? 1133 ASP A H    12 
ATOM   7441  H  HA   . ASP A 1 31 ? 1.634   -6.968  -7.276  1.00 0.87  ? 1133 ASP A HA   12 
ATOM   7442  H  HB2  . ASP A 1 31 ? 2.242   -4.272  -6.078  1.00 1.04  ? 1133 ASP A HB2  12 
ATOM   7443  H  HB3  . ASP A 1 31 ? 2.851   -4.929  -7.590  1.00 1.05  ? 1133 ASP A HB3  12 
ATOM   7444  N  N    . CYS A 1 32 ? 2.409   -7.026  -4.267  1.00 0.76  ? 1134 CYS A N    12 
ATOM   7445  C  CA   . CYS A 1 32 ? 3.373   -7.286  -3.218  1.00 0.78  ? 1134 CYS A CA   12 
ATOM   7446  C  C    . CYS A 1 32 ? 3.068   -8.620  -2.539  1.00 0.85  ? 1134 CYS A C    12 
ATOM   7447  O  O    . CYS A 1 32 ? 2.179   -9.352  -2.981  1.00 1.57  ? 1134 CYS A O    12 
ATOM   7448  C  CB   . CYS A 1 32 ? 3.330   -6.131  -2.212  1.00 0.82  ? 1134 CYS A CB   12 
ATOM   7449  S  SG   . CYS A 1 32 ? 4.747   -6.061  -1.077  1.00 1.16  ? 1134 CYS A SG   12 
ATOM   7450  H  H    . CYS A 1 32 ? 1.452   -7.077  -4.057  1.00 1.11  ? 1134 CYS A H    12 
ATOM   7451  H  HA   . CYS A 1 32 ? 4.354   -7.331  -3.665  1.00 0.88  ? 1134 CYS A HA   12 
ATOM   7452  H  HB2  . CYS A 1 32 ? 3.299   -5.197  -2.752  1.00 1.25  ? 1134 CYS A HB2  12 
ATOM   7453  H  HB3  . CYS A 1 32 ? 2.433   -6.222  -1.614  1.00 1.22  ? 1134 CYS A HB3  12 
ATOM   7454  N  N    . GLY A 1 33 ? 3.807   -8.948  -1.489  1.00 1.17  ? 1135 GLY A N    12 
ATOM   7455  C  CA   . GLY A 1 33 ? 3.562   -10.184 -0.772  1.00 1.22  ? 1135 GLY A CA   12 
ATOM   7456  C  C    . GLY A 1 33 ? 2.269   -10.149 0.015   1.00 1.18  ? 1135 GLY A C    12 
ATOM   7457  O  O    . GLY A 1 33 ? 1.299   -10.825 -0.335  1.00 1.68  ? 1135 GLY A O    12 
ATOM   7458  H  H    . GLY A 1 33 ? 4.536   -8.353  -1.202  1.00 1.82  ? 1135 GLY A H    12 
ATOM   7459  H  HA2  . GLY A 1 33 ? 3.517   -10.996 -1.480  1.00 1.26  ? 1135 GLY A HA2  12 
ATOM   7460  H  HA3  . GLY A 1 33 ? 4.380   -10.361 -0.089  1.00 1.39  ? 1135 GLY A HA3  12 
ATOM   7461  N  N    . ASP A 1 34 ? 2.249   -9.344  1.070   1.00 1.02  ? 1136 ASP A N    12 
ATOM   7462  C  CA   . ASP A 1 34 ? 1.081   -9.244  1.942   1.00 1.11  ? 1136 ASP A CA   12 
ATOM   7463  C  C    . ASP A 1 34 ? -0.073  -8.524  1.256   1.00 0.93  ? 1136 ASP A C    12 
ATOM   7464  O  O    . ASP A 1 34 ? -1.242  -8.824  1.499   1.00 1.35  ? 1136 ASP A O    12 
ATOM   7465  C  CB   . ASP A 1 34 ? 1.446   -8.514  3.234   1.00 1.44  ? 1136 ASP A CB   12 
ATOM   7466  C  CG   . ASP A 1 34 ? 0.248   -8.272  4.131   1.00 2.10  ? 1136 ASP A CG   12 
ATOM   7467  O  OD1  . ASP A 1 34 ? -0.116  -9.180  4.906   1.00 2.47  ? 1136 ASP A OD1  12 
ATOM   7468  O  OD2  . ASP A 1 34 ? -0.338  -7.170  4.060   1.00 2.85  ? 1136 ASP A OD2  12 
ATOM   7469  H  H    . ASP A 1 34 ? 3.047   -8.810  1.279   1.00 1.22  ? 1136 ASP A H    12 
ATOM   7470  H  HA   . ASP A 1 34 ? 0.768   -10.243 2.188   1.00 1.27  ? 1136 ASP A HA   12 
ATOM   7471  H  HB2  . ASP A 1 34 ? 2.166   -9.103  3.782   1.00 1.68  ? 1136 ASP A HB2  12 
ATOM   7472  H  HB3  . ASP A 1 34 ? 1.883   -7.562  2.985   1.00 1.84  ? 1136 ASP A HB3  12 
ATOM   7473  N  N    . GLY A 1 35 ? 0.266   -7.594  0.377   1.00 0.62  ? 1137 GLY A N    12 
ATOM   7474  C  CA   . GLY A 1 35 ? -0.740  -6.747  -0.227  1.00 0.49  ? 1137 GLY A CA   12 
ATOM   7475  C  C    . GLY A 1 35 ? -0.995  -5.527  0.620   1.00 0.36  ? 1137 GLY A C    12 
ATOM   7476  O  O    . GLY A 1 35 ? -2.078  -4.938  0.586   1.00 0.36  ? 1137 GLY A O    12 
ATOM   7477  H  H    . GLY A 1 35 ? 1.207   -7.488  0.129   1.00 0.82  ? 1137 GLY A H    12 
ATOM   7478  H  HA2  . GLY A 1 35 ? -0.403  -6.436  -1.206  1.00 0.51  ? 1137 GLY A HA2  12 
ATOM   7479  H  HA3  . GLY A 1 35 ? -1.660  -7.303  -0.328  1.00 0.72  ? 1137 GLY A HA3  12 
ATOM   7480  N  N    . SER A 1 36 ? 0.024   -5.141  1.377   1.00 0.32  ? 1138 SER A N    12 
ATOM   7481  C  CA   . SER A 1 36 ? -0.091  -4.062  2.336   1.00 0.28  ? 1138 SER A CA   12 
ATOM   7482  C  C    . SER A 1 36 ? -0.265  -2.711  1.641   1.00 0.25  ? 1138 SER A C    12 
ATOM   7483  O  O    . SER A 1 36 ? -0.709  -1.741  2.258   1.00 0.40  ? 1138 SER A O    12 
ATOM   7484  C  CB   . SER A 1 36 ? 1.138   -4.055  3.246   1.00 0.33  ? 1138 SER A CB   12 
ATOM   7485  O  OG   . SER A 1 36 ? 2.332   -3.942  2.491   1.00 0.44  ? 1138 SER A OG   12 
ATOM   7486  H  H    . SER A 1 36 ? 0.881   -5.605  1.291   1.00 0.37  ? 1138 SER A H    12 
ATOM   7487  H  HA   . SER A 1 36 ? -0.964  -4.255  2.936   1.00 0.33  ? 1138 SER A HA   12 
ATOM   7488  H  HB2  . SER A 1 36 ? 1.077   -3.222  3.928   1.00 0.40  ? 1138 SER A HB2  12 
ATOM   7489  H  HB3  . SER A 1 36 ? 1.169   -4.976  3.808   1.00 0.39  ? 1138 SER A HB3  12 
ATOM   7490  H  HG   . SER A 1 36 ? 2.414   -3.035  2.167   1.00 1.17  ? 1138 SER A HG   12 
ATOM   7491  N  N    . ASP A 1 37 ? 0.057   -2.666  0.350   1.00 0.18  ? 1139 ASP A N    12 
ATOM   7492  C  CA   . ASP A 1 37 ? -0.108  -1.452  -0.444  1.00 0.18  ? 1139 ASP A CA   12 
ATOM   7493  C  C    . ASP A 1 37 ? -1.588  -1.154  -0.635  1.00 0.20  ? 1139 ASP A C    12 
ATOM   7494  O  O    . ASP A 1 37 ? -1.987  -0.018  -0.885  1.00 0.29  ? 1139 ASP A O    12 
ATOM   7495  C  CB   . ASP A 1 37 ? 0.583   -1.592  -1.807  1.00 0.19  ? 1139 ASP A CB   12 
ATOM   7496  C  CG   . ASP A 1 37 ? -0.081  -2.613  -2.716  1.00 0.26  ? 1139 ASP A CG   12 
ATOM   7497  O  OD1  . ASP A 1 37 ? -0.035  -3.820  -2.401  1.00 0.33  ? 1139 ASP A OD1  12 
ATOM   7498  O  OD2  . ASP A 1 37 ? -0.646  -2.210  -3.757  1.00 0.32  ? 1139 ASP A OD2  12 
ATOM   7499  H  H    . ASP A 1 37 ? 0.407   -3.474  -0.084  1.00 0.26  ? 1139 ASP A H    12 
ATOM   7500  H  HA   . ASP A 1 37 ? 0.345   -0.636  0.099   1.00 0.20  ? 1139 ASP A HA   12 
ATOM   7501  H  HB2  . ASP A 1 37 ? 0.569   -0.636  -2.307  1.00 0.22  ? 1139 ASP A HB2  12 
ATOM   7502  H  HB3  . ASP A 1 37 ? 1.607   -1.892  -1.652  1.00 0.19  ? 1139 ASP A HB3  12 
ATOM   7503  N  N    . GLU A 1 38 ? -2.399  -2.188  -0.508  1.00 0.22  ? 1140 GLU A N    12 
ATOM   7504  C  CA   . GLU A 1 38 ? -3.837  -2.049  -0.619  1.00 0.27  ? 1140 GLU A CA   12 
ATOM   7505  C  C    . GLU A 1 38 ? -4.459  -1.884  0.768   1.00 0.31  ? 1140 GLU A C    12 
ATOM   7506  O  O    . GLU A 1 38 ? -5.378  -1.090  0.951   1.00 0.44  ? 1140 GLU A O    12 
ATOM   7507  C  CB   . GLU A 1 38 ? -4.428  -3.281  -1.305  1.00 0.29  ? 1140 GLU A CB   12 
ATOM   7508  C  CG   . GLU A 1 38 ? -3.837  -3.577  -2.677  1.00 0.29  ? 1140 GLU A CG   12 
ATOM   7509  C  CD   . GLU A 1 38 ? -4.242  -2.569  -3.736  1.00 0.28  ? 1140 GLU A CD   12 
ATOM   7510  O  OE1  . GLU A 1 38 ? -5.434  -2.198  -3.786  1.00 0.38  ? 1140 GLU A OE1  12 
ATOM   7511  O  OE2  . GLU A 1 38 ? -3.373  -2.152  -4.532  1.00 0.28  ? 1140 GLU A OE2  12 
ATOM   7512  H  H    . GLU A 1 38 ? -2.016  -3.077  -0.341  1.00 0.24  ? 1140 GLU A H    12 
ATOM   7513  H  HA   . GLU A 1 38 ? -4.048  -1.166  -1.216  1.00 0.30  ? 1140 GLU A HA   12 
ATOM   7514  H  HB2  . GLU A 1 38 ? -4.259  -4.141  -0.675  1.00 0.32  ? 1140 GLU A HB2  12 
ATOM   7515  H  HB3  . GLU A 1 38 ? -5.491  -3.136  -1.419  1.00 0.33  ? 1140 GLU A HB3  12 
ATOM   7516  H  HG2  . GLU A 1 38 ? -2.760  -3.570  -2.597  1.00 0.29  ? 1140 GLU A HG2  12 
ATOM   7517  H  HG3  . GLU A 1 38 ? -4.163  -4.557  -2.991  1.00 0.33  ? 1140 GLU A HG3  12 
ATOM   7518  N  N    . LYS A 1 39 ? -3.939  -2.626  1.749   1.00 0.30  ? 1141 LYS A N    12 
ATOM   7519  C  CA   . LYS A 1 39 ? -4.518  -2.638  3.096   1.00 0.37  ? 1141 LYS A CA   12 
ATOM   7520  C  C    . LYS A 1 39 ? -4.318  -1.298  3.798   1.00 0.49  ? 1141 LYS A C    12 
ATOM   7521  O  O    . LYS A 1 39 ? -5.132  -0.894  4.631   1.00 0.57  ? 1141 LYS A O    12 
ATOM   7522  C  CB   . LYS A 1 39 ? -3.925  -3.775  3.944   1.00 0.47  ? 1141 LYS A CB   12 
ATOM   7523  C  CG   . LYS A 1 39 ? -2.646  -3.418  4.695   1.00 0.57  ? 1141 LYS A CG   12 
ATOM   7524  C  CD   . LYS A 1 39 ? -2.062  -4.629  5.403   1.00 0.76  ? 1141 LYS A CD   12 
ATOM   7525  C  CE   . LYS A 1 39 ? -0.812  -4.276  6.192   1.00 0.91  ? 1141 LYS A CE   12 
ATOM   7526  N  NZ   . LYS A 1 39 ? -1.105  -3.409  7.362   1.00 1.55  ? 1141 LYS A NZ   12 
ATOM   7527  H  H    . LYS A 1 39 ? -3.156  -3.188  1.560   1.00 0.32  ? 1141 LYS A H    12 
ATOM   7528  H  HA   . LYS A 1 39 ? -5.580  -2.808  2.987   1.00 0.39  ? 1141 LYS A HA   12 
ATOM   7529  H  HB2  . LYS A 1 39 ? -4.660  -4.078  4.670   1.00 0.56  ? 1141 LYS A HB2  12 
ATOM   7530  H  HB3  . LYS A 1 39 ? -3.711  -4.612  3.295   1.00 0.47  ? 1141 LYS A HB3  12 
ATOM   7531  H  HG2  . LYS A 1 39 ? -1.919  -3.035  3.998   1.00 0.50  ? 1141 LYS A HG2  12 
ATOM   7532  H  HG3  . LYS A 1 39 ? -2.871  -2.662  5.432   1.00 0.65  ? 1141 LYS A HG3  12 
ATOM   7533  H  HD2  . LYS A 1 39 ? -2.800  -5.029  6.082   1.00 0.88  ? 1141 LYS A HD2  12 
ATOM   7534  H  HD3  . LYS A 1 39 ? -1.809  -5.378  4.666   1.00 0.73  ? 1141 LYS A HD3  12 
ATOM   7535  H  HE2  . LYS A 1 39 ? -0.358  -5.187  6.538   1.00 1.15  ? 1141 LYS A HE2  12 
ATOM   7536  H  HE3  . LYS A 1 39 ? -0.126  -3.761  5.537   1.00 1.18  ? 1141 LYS A HE3  12 
ATOM   7537  H  HZ1  . LYS A 1 39 ? -0.226  -3.192  7.874   1.00 2.08  ? 1141 LYS A HZ1  12 
ATOM   7538  H  HZ2  . LYS A 1 39 ? -1.758  -3.891  8.011   1.00 1.99  ? 1141 LYS A HZ2  12 
ATOM   7539  H  HZ3  . LYS A 1 39 ? -1.540  -2.517  7.053   1.00 1.97  ? 1141 LYS A HZ3  12 
ATOM   7540  N  N    . ASN A 1 40 ? -3.232  -0.612  3.463   1.00 0.60  ? 1142 ASN A N    12 
ATOM   7541  C  CA   . ASN A 1 40 ? -2.959  0.702   4.033   1.00 0.81  ? 1142 ASN A CA   12 
ATOM   7542  C  C    . ASN A 1 40 ? -3.875  1.739   3.391   1.00 0.91  ? 1142 ASN A C    12 
ATOM   7543  O  O    . ASN A 1 40 ? -4.083  2.828   3.922   1.00 1.44  ? 1142 ASN A O    12 
ATOM   7544  C  CB   . ASN A 1 40 ? -1.489  1.080   3.842   1.00 1.07  ? 1142 ASN A CB   12 
ATOM   7545  C  CG   . ASN A 1 40 ? -1.101  2.336   4.601   1.00 1.37  ? 1142 ASN A CG   12 
ATOM   7546  O  OD1  . ASN A 1 40 ? -1.696  2.667   5.632   1.00 2.05  ? 1142 ASN A OD1  12 
ATOM   7547  N  ND2  . ASN A 1 40 ? -0.089  3.031   4.110   1.00 1.92  ? 1142 ASN A ND2  12 
ATOM   7548  H  H    . ASN A 1 40 ? -2.596  -1.002  2.825   1.00 0.58  ? 1142 ASN A H    12 
ATOM   7549  H  HA   . ASN A 1 40 ? -3.177  0.654   5.091   1.00 0.86  ? 1142 ASN A HA   12 
ATOM   7550  H  HB2  . ASN A 1 40 ? -0.866  0.267   4.187   1.00 1.54  ? 1142 ASN A HB2  12 
ATOM   7551  H  HB3  . ASN A 1 40 ? -1.302  1.246   2.791   1.00 1.56  ? 1142 ASN A HB3  12 
ATOM   7552  H  HD21 . ASN A 1 40 ? 0.351   2.697   3.293   1.00 2.20  ? 1142 ASN A HD21 12 
ATOM   7553  H  HD22 . ASN A 1 40 ? 0.188   3.847   4.580   1.00 2.44  ? 1142 ASN A HD22 12 
ATOM   7554  N  N    . CYS A 1 41 ? -4.436  1.375   2.250   1.00 0.76  ? 1143 CYS A N    12 
ATOM   7555  C  CA   . CYS A 1 41 ? -5.435  2.192   1.584   1.00 0.99  ? 1143 CYS A CA   12 
ATOM   7556  C  C    . CYS A 1 41 ? -6.822  1.685   1.966   1.00 1.29  ? 1143 CYS A C    12 
ATOM   7557  O  O    . CYS A 1 41 ? -7.616  1.272   1.119   1.00 1.67  ? 1143 CYS A O    12 
ATOM   7558  C  CB   . CYS A 1 41 ? -5.230  2.137   0.069   1.00 0.93  ? 1143 CYS A CB   12 
ATOM   7559  S  SG   . CYS A 1 41 ? -6.382  3.170   -0.900  1.00 1.10  ? 1143 CYS A SG   12 
ATOM   7560  H  H    . CYS A 1 41 ? -4.182  0.519   1.846   1.00 0.89  ? 1143 CYS A H    12 
ATOM   7561  H  HA   . CYS A 1 41 ? -5.322  3.210   1.927   1.00 1.23  ? 1143 CYS A HA   12 
ATOM   7562  H  HB2  . CYS A 1 41 ? -4.229  2.470   -0.159  1.00 0.98  ? 1143 CYS A HB2  12 
ATOM   7563  H  HB3  . CYS A 1 41 ? -5.347  1.115   -0.264  1.00 1.29  ? 1143 CYS A HB3  12 
ATOM   7564  N  N    . ASN A 1 42 ? -7.094  1.703   3.262   1.00 1.87  ? 1144 ASN A N    12 
ATOM   7565  C  CA   . ASN A 1 42 ? -8.340  1.174   3.801   1.00 2.36  ? 1144 ASN A CA   12 
ATOM   7566  C  C    . ASN A 1 42 ? -9.469  2.190   3.679   1.00 3.05  ? 1144 ASN A C    12 
ATOM   7567  O  O    . ASN A 1 42 ? -10.023 2.652   4.673   1.00 3.73  ? 1144 ASN A O    12 
ATOM   7568  C  CB   . ASN A 1 42 ? -8.156  0.743   5.263   1.00 3.11  ? 1144 ASN A CB   12 
ATOM   7569  C  CG   . ASN A 1 42 ? -7.397  1.766   6.091   1.00 3.87  ? 1144 ASN A CG   12 
ATOM   7570  O  OD1  . ASN A 1 42 ? -7.975  2.706   6.632   1.00 4.27  ? 1144 ASN A OD1  12 
ATOM   7571  N  ND2  . ASN A 1 42 ? -6.089  1.579   6.211   1.00 4.59  ? 1144 ASN A ND2  12 
ATOM   7572  H  H    . ASN A 1 42 ? -6.439  2.095   3.879   1.00 2.27  ? 1144 ASN A H    12 
ATOM   7573  H  HA   . ASN A 1 42 ? -8.600  0.305   3.215   1.00 2.42  ? 1144 ASN A HA   12 
ATOM   7574  H  HB2  . ASN A 1 42 ? -9.127  0.599   5.712   1.00 3.41  ? 1144 ASN A HB2  12 
ATOM   7575  H  HB3  . ASN A 1 42 ? -7.611  -0.189  5.290   1.00 3.38  ? 1144 ASN A HB3  12 
ATOM   7576  H  HD21 . ASN A 1 42 ? -5.689  0.797   5.767   1.00 4.61  ? 1144 ASN A HD21 12 
ATOM   7577  H  HD22 . ASN A 1 42 ? -5.573  2.230   6.735   1.00 5.30  ? 1144 ASN A HD22 12 
ATOM   7578  N  N    . SER A 1 43 ? -9.805  2.533   2.451   1.00 3.53  ? 1145 SER A N    12 
ATOM   7579  C  CA   . SER A 1 43 ? -10.893 3.454   2.189   1.00 4.69  ? 1145 SER A CA   12 
ATOM   7580  C  C    . SER A 1 43 ? -11.962 2.781   1.341   1.00 5.23  ? 1145 SER A C    12 
ATOM   7581  O  O    . SER A 1 43 ? -11.650 2.123   0.348   1.00 5.32  ? 1145 SER A O    12 
ATOM   7582  C  CB   . SER A 1 43 ? -10.365 4.708   1.496   1.00 5.40  ? 1145 SER A CB   12 
ATOM   7583  O  OG   . SER A 1 43 ? -9.508  4.371   0.413   1.00 5.26  ? 1145 SER A OG   12 
ATOM   7584  H  H    . SER A 1 43 ? -9.307  2.153   1.694   1.00 3.45  ? 1145 SER A H    12 
ATOM   7585  H  HA   . SER A 1 43 ? -11.326 3.731   3.138   1.00 5.07  ? 1145 SER A HA   12 
ATOM   7586  H  HB2  . SER A 1 43 ? -11.195 5.282   1.114   1.00 6.23  ? 1145 SER A HB2  12 
ATOM   7587  H  HB3  . SER A 1 43 ? -9.812  5.303   2.207   1.00 5.56  ? 1145 SER A HB3  12 
ATOM   7588  H  HG   . SER A 1 43 ? -9.887  3.629   -0.076  1.00 5.21  ? 1145 SER A HG   12 
ATOM   7589  N  N    . THR A 1 44 ? -13.214 2.944   1.742   1.00 5.97  ? 1146 THR A N    12 
ATOM   7590  C  CA   . THR A 1 44 ? -14.328 2.313   1.053   1.00 6.81  ? 1146 THR A CA   12 
ATOM   7591  C  C    . THR A 1 44 ? -14.560 2.939   -0.319  1.00 7.34  ? 1146 THR A C    12 
ATOM   7592  O  O    . THR A 1 44 ? -15.184 3.999   -0.433  1.00 8.15  ? 1146 THR A O    12 
ATOM   7593  C  CB   . THR A 1 44 ? -15.620 2.410   1.887   1.00 7.69  ? 1146 THR A CB   12 
ATOM   7594  O  OG1  . THR A 1 44 ? -15.829 3.763   2.310   1.00 7.92  ? 1146 THR A OG1  12 
ATOM   7595  C  CG2  . THR A 1 44 ? -15.553 1.496   3.101   1.00 7.74  ? 1146 THR A CG2  12 
ATOM   7596  H  H    . THR A 1 44 ? -13.396 3.508   2.526   1.00 6.16  ? 1146 THR A H    12 
ATOM   7597  H  HA   . THR A 1 44 ? -14.086 1.269   0.923   1.00 6.75  ? 1146 THR A HA   12 
ATOM   7598  H  HB   . THR A 1 44 ? -16.452 2.101   1.270   1.00 8.40  ? 1146 THR A HB   12 
ATOM   7599  H  HG1  . THR A 1 44 ? -15.787 4.346   1.541   1.00 8.03  ? 1146 THR A HG1  12 
ATOM   7600  H  HG21 . THR A 1 44 ? -14.716 1.782   3.723   1.00 7.71  ? 1146 THR A HG21 12 
ATOM   7601  H  HG22 . THR A 1 44 ? -15.426 0.474   2.775   1.00 7.80  ? 1146 THR A HG22 12 
ATOM   7602  H  HG23 . THR A 1 44 ? -16.469 1.582   3.668   1.00 8.03  ? 1146 THR A HG23 12 
ATOM   7603  N  N    . GLU A 1 45 ? -14.053 2.286   -1.360  1.00 7.13  ? 1147 GLU A N    12 
ATOM   7604  C  CA   . GLU A 1 45 ? -14.233 2.767   -2.725  1.00 7.94  ? 1147 GLU A CA   12 
ATOM   7605  C  C    . GLU A 1 45 ? -15.677 2.549   -3.165  1.00 8.95  ? 1147 GLU A C    12 
ATOM   7606  O  O    . GLU A 1 45 ? -16.171 3.226   -4.068  1.00 9.87  ? 1147 GLU A O    12 
ATOM   7607  C  CB   . GLU A 1 45 ? -13.273 2.050   -3.684  1.00 7.79  ? 1147 GLU A CB   12 
ATOM   7608  C  CG   . GLU A 1 45 ? -13.578 0.571   -3.871  1.00 7.90  ? 1147 GLU A CG   12 
ATOM   7609  C  CD   . GLU A 1 45 ? -12.584 -0.128  -4.774  1.00 8.00  ? 1147 GLU A CD   12 
ATOM   7610  O  OE1  . GLU A 1 45 ? -12.493 0.238   -5.962  1.00 8.08  ? 1147 GLU A OE1  12 
ATOM   7611  O  OE2  . GLU A 1 45 ? -11.885 -1.050  -4.297  1.00 8.23  ? 1147 GLU A OE2  12 
ATOM   7612  H  H    . GLU A 1 45 ? -13.537 1.464   -1.203  1.00 6.60  ? 1147 GLU A H    12 
ATOM   7613  H  HA   . GLU A 1 45 ? -14.020 3.826   -2.736  1.00 8.20  ? 1147 GLU A HA   12 
ATOM   7614  H  HB2  . GLU A 1 45 ? -13.326 2.529   -4.650  1.00 8.33  ? 1147 GLU A HB2  12 
ATOM   7615  H  HB3  . GLU A 1 45 ? -12.267 2.142   -3.303  1.00 7.37  ? 1147 GLU A HB3  12 
ATOM   7616  H  HG2  . GLU A 1 45 ? -13.562 0.091   -2.906  1.00 7.80  ? 1147 GLU A HG2  12 
ATOM   7617  H  HG3  . GLU A 1 45 ? -14.563 0.474   -4.303  1.00 8.35  ? 1147 GLU A HG3  12 
ATOM   7618  N  N    . THR A 1 46 ? -16.341 1.609   -2.490  1.00 8.94  ? 1148 THR A N    12 
ATOM   7619  C  CA   . THR A 1 46 ? -17.710 1.220   -2.802  1.00 10.03 ? 1148 THR A CA   12 
ATOM   7620  C  C    . THR A 1 46 ? -17.767 0.518   -4.158  1.00 10.71 ? 1148 THR A C    12 
ATOM   7621  O  O    . THR A 1 46 ? -17.820 -0.708  -4.228  1.00 11.12 ? 1148 THR A O    12 
ATOM   7622  C  CB   . THR A 1 46 ? -18.670 2.429   -2.779  1.00 10.21 ? 1148 THR A CB   12 
ATOM   7623  O  OG1  . THR A 1 46 ? -18.462 3.182   -1.577  1.00 9.58  ? 1148 THR A OG1  12 
ATOM   7624  C  CG2  . THR A 1 46 ? -20.120 1.976   -2.847  1.00 11.01 ? 1148 THR A CG2  12 
ATOM   7625  H  H    . THR A 1 46 ? -15.884 1.153   -1.753  1.00 8.30  ? 1148 THR A H    12 
ATOM   7626  H  HA   . THR A 1 46 ? -18.031 0.521   -2.042  1.00 10.45 ? 1148 THR A HA   12 
ATOM   7627  H  HB   . THR A 1 46 ? -18.460 3.057   -3.633  1.00 10.48 ? 1148 THR A HB   12 
ATOM   7628  H  HG1  . THR A 1 46 ? -17.585 3.583   -1.601  1.00 9.43  ? 1148 THR A HG1  12 
ATOM   7629  H  HG21 . THR A 1 46 ? -20.767 2.840   -2.869  1.00 11.19 ? 1148 THR A HG21 12 
ATOM   7630  H  HG22 . THR A 1 46 ? -20.351 1.375   -1.980  1.00 11.07 ? 1148 THR A HG22 12 
ATOM   7631  H  HG23 . THR A 1 46 ? -20.272 1.390   -3.741  1.00 11.53 ? 1148 THR A HG23 12 
HETATM 7632  CA CA   . CA  B 2 .  ? -1.540  -2.711  -5.713  1.00 0.28  ? 1201 CA  A CA   12 
ATOM   7633  N  N    . THR A 1 1  ? 18.803  0.283   14.881  1.00 12.23 ? 1103 THR A N    13 
ATOM   7634  C  CA   . THR A 1 1  ? 19.526  0.890   13.748  1.00 11.73 ? 1103 THR A CA   13 
ATOM   7635  C  C    . THR A 1 1  ? 19.015  2.305   13.483  1.00 10.83 ? 1103 THR A C    13 
ATOM   7636  O  O    . THR A 1 1  ? 17.892  2.650   13.852  1.00 10.67 ? 1103 THR A O    13 
ATOM   7637  C  CB   . THR A 1 1  ? 19.375  0.034   12.465  1.00 11.83 ? 1103 THR A CB   13 
ATOM   7638  O  OG1  . THR A 1 1  ? 20.137  0.601   11.392  1.00 12.26 ? 1103 THR A OG1  13 
ATOM   7639  C  CG2  . THR A 1 1  ? 17.917  -0.079  12.044  1.00 12.04 ? 1103 THR A CG2  13 
ATOM   7640  H  H1   . THR A 1 1  ? 17.792  0.216   14.662  1.00 12.23 ? 1103 THR A H1   13 
ATOM   7641  H  H2   . THR A 1 1  ? 18.920  0.865   15.733  1.00 12.55 ? 1103 THR A H2   13 
ATOM   7642  H  H3   . THR A 1 1  ? 19.172  -0.671  15.073  1.00 12.44 ? 1103 THR A H3   13 
ATOM   7643  H  HA   . THR A 1 1  ? 20.574  0.939   14.002  1.00 12.16 ? 1103 THR A HA   13 
ATOM   7644  H  HB   . THR A 1 1  ? 19.749  -0.958  12.671  1.00 11.67 ? 1103 THR A HB   13 
ATOM   7645  H  HG1  . THR A 1 1  ? 20.425  -0.104  10.796  1.00 12.30 ? 1103 THR A HG1  13 
ATOM   7646  H  HG21 . THR A 1 1  ? 17.525  0.906   11.835  1.00 12.31 ? 1103 THR A HG21 13 
ATOM   7647  H  HG22 . THR A 1 1  ? 17.344  -0.532  12.839  1.00 12.05 ? 1103 THR A HG22 13 
ATOM   7648  H  HG23 . THR A 1 1  ? 17.845  -0.690  11.156  1.00 12.10 ? 1103 THR A HG23 13 
ATOM   7649  N  N    . HIS A 1 2  ? 19.859  3.127   12.871  1.00 10.41 ? 1104 HIS A N    13 
ATOM   7650  C  CA   . HIS A 1 2  ? 19.474  4.479   12.484  1.00 9.72  ? 1104 HIS A CA   13 
ATOM   7651  C  C    . HIS A 1 2  ? 19.185  4.536   10.989  1.00 8.65  ? 1104 HIS A C    13 
ATOM   7652  O  O    . HIS A 1 2  ? 18.826  5.583   10.451  1.00 8.32  ? 1104 HIS A O    13 
ATOM   7653  C  CB   . HIS A 1 2  ? 20.573  5.485   12.831  1.00 10.05 ? 1104 HIS A CB   13 
ATOM   7654  C  CG   . HIS A 1 2  ? 20.589  5.897   14.269  1.00 10.43 ? 1104 HIS A CG   13 
ATOM   7655  N  ND1  . HIS A 1 2  ? 20.382  7.194   14.682  1.00 10.71 ? 1104 HIS A ND1  13 
ATOM   7656  C  CD2  . HIS A 1 2  ? 20.813  5.180   15.391  1.00 10.84 ? 1104 HIS A CD2  13 
ATOM   7657  C  CE1  . HIS A 1 2  ? 20.480  7.257   15.995  1.00 11.25 ? 1104 HIS A CE1  13 
ATOM   7658  N  NE2  . HIS A 1 2  ? 20.742  6.048   16.455  1.00 11.34 ? 1104 HIS A NE2  13 
ATOM   7659  H  H    . HIS A 1 2  ? 20.768  2.814   12.668  1.00 10.71 ? 1104 HIS A H    13 
ATOM   7660  H  HA   . HIS A 1 2  ? 18.578  4.735   13.027  1.00 9.96  ? 1104 HIS A HA   13 
ATOM   7661  H  HB2  . HIS A 1 2  ? 21.532  5.050   12.603  1.00 10.50 ? 1104 HIS A HB2  13 
ATOM   7662  H  HB3  . HIS A 1 2  ? 20.436  6.373   12.232  1.00 9.81  ? 1104 HIS A HB3  13 
ATOM   7663  H  HD1  . HIS A 1 2  ? 20.190  7.960   14.093  1.00 10.68 ? 1104 HIS A HD1  13 
ATOM   7664  H  HD2  . HIS A 1 2  ? 20.993  4.117   15.442  1.00 10.94 ? 1104 HIS A HD2  13 
ATOM   7665  H  HE1  . HIS A 1 2  ? 20.364  8.148   16.593  1.00 11.71 ? 1104 HIS A HE1  13 
ATOM   7666  H  HE2  . HIS A 1 2  ? 21.104  5.864   17.350  1.00 11.83 ? 1104 HIS A HE2  13 
ATOM   7667  N  N    . ALA A 1 3  ? 19.364  3.405   10.323  1.00 8.30  ? 1105 ALA A N    13 
ATOM   7668  C  CA   . ALA A 1 3  ? 19.144  3.316   8.890   1.00 7.41  ? 1105 ALA A CA   13 
ATOM   7669  C  C    . ALA A 1 3  ? 17.785  2.692   8.590   1.00 6.47  ? 1105 ALA A C    13 
ATOM   7670  O  O    . ALA A 1 3  ? 17.516  1.561   8.999   1.00 6.54  ? 1105 ALA A O    13 
ATOM   7671  C  CB   . ALA A 1 3  ? 20.254  2.504   8.244   1.00 7.70  ? 1105 ALA A CB   13 
ATOM   7672  H  H    . ALA A 1 3  ? 19.648  2.601   10.813  1.00 8.79  ? 1105 ALA A H    13 
ATOM   7673  H  HA   . ALA A 1 3  ? 19.176  4.314   8.483   1.00 7.45  ? 1105 ALA A HA   13 
ATOM   7674  H  HB1  . ALA A 1 3  ? 20.103  2.472   7.176   1.00 7.93  ? 1105 ALA A HB1  13 
ATOM   7675  H  HB2  . ALA A 1 3  ? 20.242  1.498   8.639   1.00 7.73  ? 1105 ALA A HB2  13 
ATOM   7676  H  HB3  . ALA A 1 3  ? 21.208  2.962   8.459   1.00 7.95  ? 1105 ALA A HB3  13 
ATOM   7677  N  N    . PRO A 1 4  ? 16.901  3.422   7.896   1.00 5.80  ? 1106 PRO A N    13 
ATOM   7678  C  CA   . PRO A 1 4  ? 15.593  2.906   7.505   1.00 4.97  ? 1106 PRO A CA   13 
ATOM   7679  C  C    . PRO A 1 4  ? 15.691  1.926   6.339   1.00 4.25  ? 1106 PRO A C    13 
ATOM   7680  O  O    . PRO A 1 4  ? 16.570  2.047   5.484   1.00 4.22  ? 1106 PRO A O    13 
ATOM   7681  C  CB   . PRO A 1 4  ? 14.807  4.156   7.075   1.00 4.84  ? 1106 PRO A CB   13 
ATOM   7682  C  CG   . PRO A 1 4  ? 15.682  5.326   7.387   1.00 5.55  ? 1106 PRO A CG   13 
ATOM   7683  C  CD   . PRO A 1 4  ? 17.089  4.805   7.451   1.00 6.09  ? 1106 PRO A CD   13 
ATOM   7684  H  HA   . PRO A 1 4  ? 15.092  2.428   8.335   1.00 5.32  ? 1106 PRO A HA   13 
ATOM   7685  H  HB2  . PRO A 1 4  ? 14.592  4.098   6.019   1.00 4.32  ? 1106 PRO A HB2  13 
ATOM   7686  H  HB3  . PRO A 1 4  ? 13.879  4.202   7.628   1.00 5.12  ? 1106 PRO A HB3  13 
ATOM   7687  H  HG2  . PRO A 1 4  ? 15.596  6.066   6.604   1.00 5.52  ? 1106 PRO A HG2  13 
ATOM   7688  H  HG3  . PRO A 1 4  ? 15.397  5.753   8.337   1.00 6.00  ? 1106 PRO A HG3  13 
ATOM   7689  H  HD2  . PRO A 1 4  ? 17.553  4.840   6.476   1.00 6.19  ? 1106 PRO A HD2  13 
ATOM   7690  H  HD3  . PRO A 1 4  ? 17.665  5.370   8.169   1.00 6.80  ? 1106 PRO A HD3  13 
ATOM   7691  N  N    . ALA A 1 5  ? 14.784  0.964   6.306   1.00 4.09  ? 1107 ALA A N    13 
ATOM   7692  C  CA   . ALA A 1 5  ? 14.727  -0.003  5.217   1.00 3.77  ? 1107 ALA A CA   13 
ATOM   7693  C  C    . ALA A 1 5  ? 13.744  0.463   4.152   1.00 2.63  ? 1107 ALA A C    13 
ATOM   7694  O  O    . ALA A 1 5  ? 13.027  -0.337  3.550   1.00 2.62  ? 1107 ALA A O    13 
ATOM   7695  C  CB   . ALA A 1 5  ? 14.333  -1.373  5.747   1.00 4.73  ? 1107 ALA A CB   13 
ATOM   7696  H  H    . ALA A 1 5  ? 14.128  0.902   7.032   1.00 4.51  ? 1107 ALA A H    13 
ATOM   7697  H  HA   . ALA A 1 5  ? 15.713  -0.077  4.781   1.00 4.04  ? 1107 ALA A HA   13 
ATOM   7698  H  HB1  . ALA A 1 5  ? 14.346  -2.089  4.939   1.00 5.01  ? 1107 ALA A HB1  13 
ATOM   7699  H  HB2  . ALA A 1 5  ? 13.340  -1.323  6.168   1.00 4.95  ? 1107 ALA A HB2  13 
ATOM   7700  H  HB3  . ALA A 1 5  ? 15.032  -1.678  6.510   1.00 5.29  ? 1107 ALA A HB3  13 
ATOM   7701  N  N    . SER A 1 6  ? 13.728  1.766   3.928   1.00 2.16  ? 1108 SER A N    13 
ATOM   7702  C  CA   . SER A 1 6  ? 12.807  2.383   2.993   1.00 1.43  ? 1108 SER A CA   13 
ATOM   7703  C  C    . SER A 1 6  ? 13.224  2.122   1.549   1.00 1.29  ? 1108 SER A C    13 
ATOM   7704  O  O    . SER A 1 6  ? 14.412  1.970   1.243   1.00 1.97  ? 1108 SER A O    13 
ATOM   7705  C  CB   . SER A 1 6  ? 12.743  3.880   3.275   1.00 2.09  ? 1108 SER A CB   13 
ATOM   7706  O  OG   . SER A 1 6  ? 14.039  4.410   3.502   1.00 2.97  ? 1108 SER A OG   13 
ATOM   7707  H  H    . SER A 1 6  ? 14.368  2.337   4.402   1.00 2.71  ? 1108 SER A H    13 
ATOM   7708  H  HA   . SER A 1 6  ? 11.831  1.955   3.158   1.00 1.32  ? 1108 SER A HA   13 
ATOM   7709  H  HB2  . SER A 1 6  ? 12.302  4.383   2.429   1.00 2.36  ? 1108 SER A HB2  13 
ATOM   7710  H  HB3  . SER A 1 6  ? 12.138  4.054   4.153   1.00 2.13  ? 1108 SER A HB3  13 
ATOM   7711  H  HG   . SER A 1 6  ? 13.984  5.370   3.550   1.00 3.32  ? 1108 SER A HG   13 
ATOM   7712  N  N    . CYS A 1 7  ? 12.234  2.059   0.676   1.00 0.72  ? 1109 CYS A N    13 
ATOM   7713  C  CA   . CYS A 1 7  ? 12.454  1.805   -0.738  1.00 0.49  ? 1109 CYS A CA   13 
ATOM   7714  C  C    . CYS A 1 7  ? 12.735  3.100   -1.497  1.00 0.46  ? 1109 CYS A C    13 
ATOM   7715  O  O    . CYS A 1 7  ? 12.964  4.150   -0.890  1.00 0.62  ? 1109 CYS A O    13 
ATOM   7716  C  CB   . CYS A 1 7  ? 11.236  1.088   -1.319  1.00 0.33  ? 1109 CYS A CB   13 
ATOM   7717  S  SG   . CYS A 1 7  ? 10.880  -0.512  -0.519  1.00 0.47  ? 1109 CYS A SG   13 
ATOM   7718  H  H    . CYS A 1 7  ? 11.310  2.179   0.997   1.00 0.94  ? 1109 CYS A H    13 
ATOM   7719  H  HA   . CYS A 1 7  ? 13.310  1.161   -0.838  1.00 0.60  ? 1109 CYS A HA   13 
ATOM   7720  H  HB2  . CYS A 1 7  ? 10.365  1.717   -1.201  1.00 0.41  ? 1109 CYS A HB2  13 
ATOM   7721  H  HB3  . CYS A 1 7  ? 11.401  0.901   -2.370  1.00 0.29  ? 1109 CYS A HB3  13 
ATOM   7722  N  N    . LEU A 1 8  ? 12.730  2.999   -2.821  1.00 0.34  ? 1110 LEU A N    13 
ATOM   7723  C  CA   . LEU A 1 8  ? 13.010  4.113   -3.717  1.00 0.32  ? 1110 LEU A CA   13 
ATOM   7724  C  C    . LEU A 1 8  ? 12.153  5.333   -3.393  1.00 0.29  ? 1110 LEU A C    13 
ATOM   7725  O  O    . LEU A 1 8  ? 11.132  5.218   -2.717  1.00 0.30  ? 1110 LEU A O    13 
ATOM   7726  C  CB   . LEU A 1 8  ? 12.717  3.666   -5.145  1.00 0.28  ? 1110 LEU A CB   13 
ATOM   7727  C  CG   . LEU A 1 8  ? 13.694  4.136   -6.220  1.00 0.38  ? 1110 LEU A CG   13 
ATOM   7728  C  CD1  . LEU A 1 8  ? 15.079  3.549   -5.988  1.00 0.52  ? 1110 LEU A CD1  13 
ATOM   7729  C  CD2  . LEU A 1 8  ? 13.170  3.756   -7.596  1.00 0.39  ? 1110 LEU A CD2  13 
ATOM   7730  H  H    . LEU A 1 8  ? 12.542  2.127   -3.218  1.00 0.34  ? 1110 LEU A H    13 
ATOM   7731  H  HA   . LEU A 1 8  ? 14.053  4.371   -3.631  1.00 0.40  ? 1110 LEU A HA   13 
ATOM   7732  H  HB2  . LEU A 1 8  ? 12.682  2.587   -5.155  1.00 0.32  ? 1110 LEU A HB2  13 
ATOM   7733  H  HB3  . LEU A 1 8  ? 11.733  4.026   -5.407  1.00 0.22  ? 1110 LEU A HB3  13 
ATOM   7734  H  HG   . LEU A 1 8  ? 13.775  5.211   -6.176  1.00 0.41  ? 1110 LEU A HG   13 
ATOM   7735  H  HD11 . LEU A 1 8  ? 15.746  3.885   -6.770  1.00 1.05  ? 1110 LEU A HD11 13 
ATOM   7736  H  HD12 . LEU A 1 8  ? 15.020  2.471   -6.003  1.00 1.29  ? 1110 LEU A HD12 13 
ATOM   7737  H  HD13 . LEU A 1 8  ? 15.454  3.877   -5.031  1.00 1.07  ? 1110 LEU A HD13 13 
ATOM   7738  H  HD21 . LEU A 1 8  ? 13.071  2.682   -7.659  1.00 1.11  ? 1110 LEU A HD21 13 
ATOM   7739  H  HD22 . LEU A 1 8  ? 13.859  4.101   -8.351  1.00 1.05  ? 1110 LEU A HD22 13 
ATOM   7740  H  HD23 . LEU A 1 8  ? 12.204  4.214   -7.753  1.00 0.97  ? 1110 LEU A HD23 13 
ATOM   7741  N  N    . ASP A 1 9  ? 12.546  6.491   -3.896  1.00 0.35  ? 1111 ASP A N    13 
ATOM   7742  C  CA   . ASP A 1 9  ? 11.782  7.712   -3.665  1.00 0.38  ? 1111 ASP A CA   13 
ATOM   7743  C  C    . ASP A 1 9  ? 10.381  7.576   -4.250  1.00 0.32  ? 1111 ASP A C    13 
ATOM   7744  O  O    . ASP A 1 9  ? 9.397   7.997   -3.642  1.00 0.42  ? 1111 ASP A O    13 
ATOM   7745  C  CB   . ASP A 1 9  ? 12.496  8.924   -4.265  1.00 0.51  ? 1111 ASP A CB   13 
ATOM   7746  C  CG   . ASP A 1 9  ? 13.839  9.180   -3.616  1.00 1.37  ? 1111 ASP A CG   13 
ATOM   7747  O  OD1  . ASP A 1 9  ? 13.873  9.805   -2.535  1.00 1.53  ? 1111 ASP A OD1  13 
ATOM   7748  O  OD2  . ASP A 1 9  ? 14.869  8.769   -4.187  1.00 2.32  ? 1111 ASP A OD2  13 
ATOM   7749  H  H    . ASP A 1 9  ? 13.368  6.532   -4.432  1.00 0.40  ? 1111 ASP A H    13 
ATOM   7750  H  HA   . ASP A 1 9  ? 11.698  7.848   -2.597  1.00 0.44  ? 1111 ASP A HA   13 
ATOM   7751  H  HB2  . ASP A 1 9  ? 12.653  8.759   -5.319  1.00 0.94  ? 1111 ASP A HB2  13 
ATOM   7752  H  HB3  . ASP A 1 9  ? 11.878  9.800   -4.131  1.00 1.01  ? 1111 ASP A HB3  13 
ATOM   7753  N  N    . THR A 1 10 ? 10.293  6.963   -5.422  1.00 0.28  ? 1112 THR A N    13 
ATOM   7754  C  CA   . THR A 1 10 ? 9.010   6.714   -6.057  1.00 0.31  ? 1112 THR A CA   13 
ATOM   7755  C  C    . THR A 1 10 ? 8.496   5.311   -5.742  1.00 0.24  ? 1112 THR A C    13 
ATOM   7756  O  O    . THR A 1 10 ? 7.508   4.857   -6.325  1.00 0.30  ? 1112 THR A O    13 
ATOM   7757  C  CB   . THR A 1 10 ? 9.105   6.880   -7.582  1.00 0.42  ? 1112 THR A CB   13 
ATOM   7758  O  OG1  . THR A 1 10 ? 10.210  6.119   -8.083  1.00 0.45  ? 1112 THR A OG1  13 
ATOM   7759  C  CG2  . THR A 1 10 ? 9.271   8.343   -7.961  1.00 0.52  ? 1112 THR A CG2  13 
ATOM   7760  H  H    . THR A 1 10 ? 11.115  6.685   -5.883  1.00 0.31  ? 1112 THR A H    13 
ATOM   7761  H  HA   . THR A 1 10 ? 8.304   7.439   -5.680  1.00 0.36  ? 1112 THR A HA   13 
ATOM   7762  H  HB   . THR A 1 10 ? 8.190   6.510   -8.023  1.00 0.48  ? 1112 THR A HB   13 
ATOM   7763  H  HG1  . THR A 1 10 ? 10.174  6.099   -9.048  1.00 0.95  ? 1112 THR A HG1  13 
ATOM   7764  H  HG21 . THR A 1 10 ? 9.351   8.430   -9.033  1.00 1.19  ? 1112 THR A HG21 13 
ATOM   7765  H  HG22 . THR A 1 10 ? 10.166  8.735   -7.500  1.00 1.09  ? 1112 THR A HG22 13 
ATOM   7766  H  HG23 . THR A 1 10 ? 8.415   8.903   -7.617  1.00 1.17  ? 1112 THR A HG23 13 
ATOM   7767  N  N    . GLN A 1 11 ? 9.162   4.615   -4.828  1.00 0.18  ? 1113 GLN A N    13 
ATOM   7768  C  CA   . GLN A 1 11 ? 8.727   3.292   -4.446  1.00 0.17  ? 1113 GLN A CA   13 
ATOM   7769  C  C    . GLN A 1 11 ? 8.184   3.258   -3.037  1.00 0.17  ? 1113 GLN A C    13 
ATOM   7770  O  O    . GLN A 1 11 ? 8.584   4.032   -2.168  1.00 0.23  ? 1113 GLN A O    13 
ATOM   7771  C  CB   . GLN A 1 11 ? 9.854   2.279   -4.605  1.00 0.17  ? 1113 GLN A CB   13 
ATOM   7772  C  CG   . GLN A 1 11 ? 10.075  1.891   -6.053  1.00 0.23  ? 1113 GLN A CG   13 
ATOM   7773  C  CD   . GLN A 1 11 ? 10.809  0.577   -6.239  1.00 0.35  ? 1113 GLN A CD   13 
ATOM   7774  O  OE1  . GLN A 1 11 ? 10.572  -0.140  -7.208  1.00 1.02  ? 1113 GLN A OE1  13 
ATOM   7775  N  NE2  . GLN A 1 11 ? 11.719  0.257   -5.336  1.00 0.67  ? 1113 GLN A NE2  13 
ATOM   7776  H  H    . GLN A 1 11 ? 9.965   4.992   -4.409  1.00 0.20  ? 1113 GLN A H    13 
ATOM   7777  H  HA   . GLN A 1 11 ? 7.923   3.018   -5.113  1.00 0.22  ? 1113 GLN A HA   13 
ATOM   7778  H  HB2  . GLN A 1 11 ? 10.767  2.712   -4.222  1.00 0.16  ? 1113 GLN A HB2  13 
ATOM   7779  H  HB3  . GLN A 1 11 ? 9.622   1.395   -4.038  1.00 0.20  ? 1113 GLN A HB3  13 
ATOM   7780  H  HG2  . GLN A 1 11 ? 9.117   1.816   -6.520  1.00 0.31  ? 1113 GLN A HG2  13 
ATOM   7781  H  HG3  . GLN A 1 11 ? 10.643  2.673   -6.536  1.00 0.22  ? 1113 GLN A HG3  13 
ATOM   7782  H  HE21 . GLN A 1 11 ? 11.878  0.874   -4.597  1.00 1.21  ? 1113 GLN A HE21 13 
ATOM   7783  H  HE22 . GLN A 1 11 ? 12.201  -0.590  -5.445  1.00 0.65  ? 1113 GLN A HE22 13 
ATOM   7784  N  N    . TYR A 1 12 ? 7.263   2.347   -2.841  1.00 0.15  ? 1114 TYR A N    13 
ATOM   7785  C  CA   . TYR A 1 12 ? 6.607   2.167   -1.565  1.00 0.16  ? 1114 TYR A CA   13 
ATOM   7786  C  C    . TYR A 1 12 ? 7.255   1.018   -0.821  1.00 0.15  ? 1114 TYR A C    13 
ATOM   7787  O  O    . TYR A 1 12 ? 7.731   0.060   -1.433  1.00 0.15  ? 1114 TYR A O    13 
ATOM   7788  C  CB   . TYR A 1 12 ? 5.119   1.883   -1.770  1.00 0.18  ? 1114 TYR A CB   13 
ATOM   7789  C  CG   . TYR A 1 12 ? 4.326   1.714   -0.492  1.00 0.22  ? 1114 TYR A CG   13 
ATOM   7790  C  CD1  . TYR A 1 12 ? 4.075   2.803   0.334   1.00 0.33  ? 1114 TYR A CD1  13 
ATOM   7791  C  CD2  . TYR A 1 12 ? 3.828   0.474   -0.112  1.00 0.21  ? 1114 TYR A CD2  13 
ATOM   7792  C  CE1  . TYR A 1 12 ? 3.354   2.663   1.502   1.00 0.39  ? 1114 TYR A CE1  13 
ATOM   7793  C  CE2  . TYR A 1 12 ? 3.105   0.325   1.056   1.00 0.26  ? 1114 TYR A CE2  13 
ATOM   7794  C  CZ   . TYR A 1 12 ? 2.869   1.384   1.853   1.00 0.34  ? 1114 TYR A CZ   13 
ATOM   7795  O  OH   . TYR A 1 12 ? 2.146   1.275   3.020   1.00 0.41  ? 1114 TYR A OH   13 
ATOM   7796  H  H    . TYR A 1 12 ? 7.030   1.748   -3.589  1.00 0.16  ? 1114 TYR A H    13 
ATOM   7797  H  HA   . TYR A 1 12 ? 6.724   3.074   -0.991  1.00 0.18  ? 1114 TYR A HA   13 
ATOM   7798  H  HB2  . TYR A 1 12 ? 4.675   2.690   -2.331  1.00 0.23  ? 1114 TYR A HB2  13 
ATOM   7799  H  HB3  . TYR A 1 12 ? 5.026   0.971   -2.330  1.00 0.18  ? 1114 TYR A HB3  13 
ATOM   7800  H  HD1  . TYR A 1 12 ? 4.455   3.773   0.052   1.00 0.40  ? 1114 TYR A HD1  13 
ATOM   7801  H  HD2  . TYR A 1 12 ? 4.016   -0.382  -0.742  1.00 0.23  ? 1114 TYR A HD2  13 
ATOM   7802  H  HE1  . TYR A 1 12 ? 3.173   3.525   2.131   1.00 0.50  ? 1114 TYR A HE1  13 
ATOM   7803  H  HE2  . TYR A 1 12 ? 2.724   -0.647  1.335   1.00 0.29  ? 1114 TYR A HE2  13 
ATOM   7804  H  HH   . TYR A 1 12 ? 2.458   0.492   3.492   1.00 0.89  ? 1114 TYR A HH   13 
ATOM   7805  N  N    . THR A 1 13 ? 7.265   1.124   0.485   1.00 0.18  ? 1115 THR A N    13 
ATOM   7806  C  CA   . THR A 1 13 ? 7.840   0.102   1.331   1.00 0.20  ? 1115 THR A CA   13 
ATOM   7807  C  C    . THR A 1 13 ? 6.731   -0.628  2.068   1.00 0.23  ? 1115 THR A C    13 
ATOM   7808  O  O    . THR A 1 13 ? 6.189   -0.124  3.055   1.00 0.31  ? 1115 THR A O    13 
ATOM   7809  C  CB   . THR A 1 13 ? 8.823   0.705   2.347   1.00 0.26  ? 1115 THR A CB   13 
ATOM   7810  O  OG1  . THR A 1 13 ? 9.644   1.693   1.704   1.00 0.30  ? 1115 THR A OG1  13 
ATOM   7811  C  CG2  . THR A 1 13 ? 9.705   -0.381  2.943   1.00 0.27  ? 1115 THR A CG2  13 
ATOM   7812  H  H    . THR A 1 13 ? 6.849   1.909   0.895   1.00 0.22  ? 1115 THR A H    13 
ATOM   7813  H  HA   . THR A 1 13 ? 8.374   -0.597  0.703   1.00 0.19  ? 1115 THR A HA   13 
ATOM   7814  H  HB   . THR A 1 13 ? 8.260   1.172   3.142   1.00 0.31  ? 1115 THR A HB   13 
ATOM   7815  H  HG1  . THR A 1 13 ? 9.079   2.319   1.233   1.00 0.82  ? 1115 THR A HG1  13 
ATOM   7816  H  HG21 . THR A 1 13 ? 10.261  -0.866  2.153   1.00 1.01  ? 1115 THR A HG21 13 
ATOM   7817  H  HG22 . THR A 1 13 ? 9.088   -1.110  3.447   1.00 1.02  ? 1115 THR A HG22 13 
ATOM   7818  H  HG23 . THR A 1 13 ? 10.393  0.059   3.648   1.00 1.10  ? 1115 THR A HG23 13 
ATOM   7819  N  N    . CYS A 1 14 ? 6.371   -1.798  1.571   1.00 0.26  ? 1116 CYS A N    13 
ATOM   7820  C  CA   . CYS A 1 14 ? 5.290   -2.569  2.157   1.00 0.34  ? 1116 CYS A CA   13 
ATOM   7821  C  C    . CYS A 1 14 ? 5.693   -3.184  3.491   1.00 0.40  ? 1116 CYS A C    13 
ATOM   7822  O  O    . CYS A 1 14 ? 6.857   -3.108  3.890   1.00 0.37  ? 1116 CYS A O    13 
ATOM   7823  C  CB   . CYS A 1 14 ? 4.833   -3.655  1.188   1.00 0.45  ? 1116 CYS A CB   13 
ATOM   7824  S  SG   . CYS A 1 14 ? 3.973   -3.015  -0.281  1.00 0.65  ? 1116 CYS A SG   13 
ATOM   7825  H  H    . CYS A 1 14 ? 6.842   -2.149  0.782   1.00 0.28  ? 1116 CYS A H    13 
ATOM   7826  H  HA   . CYS A 1 14 ? 4.465   -1.893  2.328   1.00 0.38  ? 1116 CYS A HA   13 
ATOM   7827  H  HB2  . CYS A 1 14 ? 5.694   -4.211  0.849   1.00 0.50  ? 1116 CYS A HB2  13 
ATOM   7828  H  HB3  . CYS A 1 14 ? 4.157   -4.325  1.701   1.00 0.54  ? 1116 CYS A HB3  13 
ATOM   7829  N  N    . ASP A 1 15 ? 4.735   -3.794  4.175   1.00 0.56  ? 1117 ASP A N    13 
ATOM   7830  C  CA   . ASP A 1 15 ? 4.981   -4.393  5.483   1.00 0.69  ? 1117 ASP A CA   13 
ATOM   7831  C  C    . ASP A 1 15 ? 6.076   -5.453  5.399   1.00 0.65  ? 1117 ASP A C    13 
ATOM   7832  O  O    . ASP A 1 15 ? 6.963   -5.518  6.250   1.00 0.71  ? 1117 ASP A O    13 
ATOM   7833  C  CB   . ASP A 1 15 ? 3.687   -5.001  6.023   1.00 0.93  ? 1117 ASP A CB   13 
ATOM   7834  C  CG   . ASP A 1 15 ? 3.873   -5.714  7.345   1.00 1.83  ? 1117 ASP A CG   13 
ATOM   7835  O  OD1  . ASP A 1 15 ? 4.510   -5.144  8.254   1.00 2.62  ? 1117 ASP A OD1  13 
ATOM   7836  O  OD2  . ASP A 1 15 ? 3.355   -6.841  7.489   1.00 2.09  ? 1117 ASP A OD2  13 
ATOM   7837  H  H    . ASP A 1 15 ? 3.831   -3.838  3.794   1.00 0.63  ? 1117 ASP A H    13 
ATOM   7838  H  HA   . ASP A 1 15 ? 5.306   -3.609  6.150   1.00 0.70  ? 1117 ASP A HA   13 
ATOM   7839  H  HB2  . ASP A 1 15 ? 2.960   -4.215  6.163   1.00 1.35  ? 1117 ASP A HB2  13 
ATOM   7840  H  HB3  . ASP A 1 15 ? 3.307   -5.709  5.303   1.00 0.70  ? 1117 ASP A HB3  13 
ATOM   7841  N  N    . ASN A 1 16 ? 6.041   -6.243  4.336   1.00 0.69  ? 1118 ASN A N    13 
ATOM   7842  C  CA   . ASN A 1 16 ? 7.032   -7.293  4.123   1.00 0.75  ? 1118 ASN A CA   13 
ATOM   7843  C  C    . ASN A 1 16 ? 8.295   -6.724  3.476   1.00 0.59  ? 1118 ASN A C    13 
ATOM   7844  O  O    . ASN A 1 16 ? 9.136   -7.467  2.963   1.00 0.65  ? 1118 ASN A O    13 
ATOM   7845  C  CB   . ASN A 1 16 ? 6.450   -8.415  3.254   1.00 0.98  ? 1118 ASN A CB   13 
ATOM   7846  C  CG   . ASN A 1 16 ? 6.140   -7.972  1.834   1.00 1.77  ? 1118 ASN A CG   13 
ATOM   7847  O  OD1  . ASN A 1 16 ? 5.837   -6.803  1.579   1.00 2.75  ? 1118 ASN A OD1  13 
ATOM   7848  N  ND2  . ASN A 1 16 ? 6.201   -8.909  0.903   1.00 2.02  ? 1118 ASN A ND2  13 
ATOM   7849  H  H    . ASN A 1 16 ? 5.329   -6.120  3.673   1.00 0.75  ? 1118 ASN A H    13 
ATOM   7850  H  HA   . ASN A 1 16 ? 7.292   -7.699  5.089   1.00 0.85  ? 1118 ASN A HA   13 
ATOM   7851  H  HB2  . ASN A 1 16 ? 7.158   -9.227  3.207   1.00 1.24  ? 1118 ASN A HB2  13 
ATOM   7852  H  HB3  . ASN A 1 16 ? 5.536   -8.769  3.705   1.00 1.41  ? 1118 ASN A HB3  13 
ATOM   7853  H  HD21 . ASN A 1 16 ? 6.435   -9.824  1.180   1.00 1.91  ? 1118 ASN A HD21 13 
ATOM   7854  H  HD22 . ASN A 1 16 ? 6.013   -8.656  -0.028  1.00 2.74  ? 1118 ASN A HD22 13 
ATOM   7855  N  N    . HIS A 1 17 ? 8.407   -5.395  3.504   1.00 0.46  ? 1119 HIS A N    13 
ATOM   7856  C  CA   . HIS A 1 17 ? 9.566   -4.676  2.972   1.00 0.41  ? 1119 HIS A CA   13 
ATOM   7857  C  C    . HIS A 1 17 ? 9.712   -4.872  1.469   1.00 0.44  ? 1119 HIS A C    13 
ATOM   7858  O  O    . HIS A 1 17 ? 10.804  -4.722  0.921   1.00 0.79  ? 1119 HIS A O    13 
ATOM   7859  C  CB   . HIS A 1 17 ? 10.856  -5.090  3.688   1.00 0.51  ? 1119 HIS A CB   13 
ATOM   7860  C  CG   . HIS A 1 17 ? 10.913  -4.645  5.115   1.00 0.63  ? 1119 HIS A CG   13 
ATOM   7861  N  ND1  . HIS A 1 17 ? 10.924  -5.518  6.180   1.00 0.94  ? 1119 HIS A ND1  13 
ATOM   7862  C  CD2  . HIS A 1 17 ? 10.968  -3.405  5.651   1.00 0.78  ? 1119 HIS A CD2  13 
ATOM   7863  C  CE1  . HIS A 1 17 ? 10.981  -4.837  7.305   1.00 1.05  ? 1119 HIS A CE1  13 
ATOM   7864  N  NE2  . HIS A 1 17 ? 11.010  -3.552  7.013   1.00 0.93  ? 1119 HIS A NE2  13 
ATOM   7865  H  H    . HIS A 1 17 ? 7.676   -4.872  3.902   1.00 0.47  ? 1119 HIS A H    13 
ATOM   7866  H  HA   . HIS A 1 17 ? 9.397   -3.623  3.157   1.00 0.38  ? 1119 HIS A HA   13 
ATOM   7867  H  HB2  . HIS A 1 17 ? 10.940  -6.166  3.670   1.00 0.60  ? 1119 HIS A HB2  13 
ATOM   7868  H  HB3  . HIS A 1 17 ? 11.700  -4.660  3.170   1.00 0.55  ? 1119 HIS A HB3  13 
ATOM   7869  H  HD1  . HIS A 1 17 ? 10.889  -6.503  6.120   1.00 1.18  ? 1119 HIS A HD1  13 
ATOM   7870  H  HD2  . HIS A 1 17 ? 10.978  -2.470  5.107   1.00 1.00  ? 1119 HIS A HD2  13 
ATOM   7871  H  HE1  . HIS A 1 17 ? 11.005  -5.257  8.299   1.00 1.35  ? 1119 HIS A HE1  13 
ATOM   7872  H  HE2  . HIS A 1 17 ? 10.881  -2.828  7.663   1.00 1.09  ? 1119 HIS A HE2  13 
ATOM   7873  N  N    . GLN A 1 18 ? 8.617   -5.209  0.804   1.00 0.40  ? 1120 GLN A N    13 
ATOM   7874  C  CA   . GLN A 1 18 ? 8.628   -5.318  -0.644  1.00 0.38  ? 1120 GLN A CA   13 
ATOM   7875  C  C    . GLN A 1 18 ? 8.607   -3.927  -1.257  1.00 0.29  ? 1120 GLN A C    13 
ATOM   7876  O  O    . GLN A 1 18 ? 7.847   -3.060  -0.819  1.00 0.39  ? 1120 GLN A O    13 
ATOM   7877  C  CB   . GLN A 1 18 ? 7.438   -6.142  -1.141  1.00 0.49  ? 1120 GLN A CB   13 
ATOM   7878  C  CG   . GLN A 1 18 ? 7.436   -6.363  -2.647  1.00 0.50  ? 1120 GLN A CG   13 
ATOM   7879  C  CD   . GLN A 1 18 ? 8.703   -7.039  -3.135  1.00 1.05  ? 1120 GLN A CD   13 
ATOM   7880  O  OE1  . GLN A 1 18 ? 9.680   -6.377  -3.487  1.00 1.91  ? 1120 GLN A OE1  13 
ATOM   7881  N  NE2  . GLN A 1 18 ? 8.694   -8.360  -3.157  1.00 1.51  ? 1120 GLN A NE2  13 
ATOM   7882  H  H    . GLN A 1 18 ? 7.790   -5.389  1.295   1.00 0.63  ? 1120 GLN A H    13 
ATOM   7883  H  HA   . GLN A 1 18 ? 9.545   -5.811  -0.931  1.00 0.42  ? 1120 GLN A HA   13 
ATOM   7884  H  HB2  . GLN A 1 18 ? 7.457   -7.108  -0.659  1.00 0.62  ? 1120 GLN A HB2  13 
ATOM   7885  H  HB3  . GLN A 1 18 ? 6.524   -5.633  -0.872  1.00 0.52  ? 1120 GLN A HB3  13 
ATOM   7886  H  HG2  . GLN A 1 18 ? 6.591   -6.983  -2.908  1.00 0.87  ? 1120 GLN A HG2  13 
ATOM   7887  H  HG3  . GLN A 1 18 ? 7.343   -5.405  -3.139  1.00 0.86  ? 1120 GLN A HG3  13 
ATOM   7888  H  HE21 . GLN A 1 18 ? 7.881   -8.823  -2.864  1.00 1.83  ? 1120 GLN A HE21 13 
ATOM   7889  H  HE22 . GLN A 1 18 ? 9.505   -8.824  -3.455  1.00 1.99  ? 1120 GLN A HE22 13 
ATOM   7890  N  N    . CYS A 1 19 ? 9.453   -3.716  -2.249  1.00 0.21  ? 1121 CYS A N    13 
ATOM   7891  C  CA   . CYS A 1 19 ? 9.569   -2.419  -2.885  1.00 0.21  ? 1121 CYS A CA   13 
ATOM   7892  C  C    . CYS A 1 19 ? 8.816   -2.396  -4.206  1.00 0.20  ? 1121 CYS A C    13 
ATOM   7893  O  O    . CYS A 1 19 ? 9.269   -2.959  -5.204  1.00 0.34  ? 1121 CYS A O    13 
ATOM   7894  C  CB   . CYS A 1 19 ? 11.039  -2.069  -3.110  1.00 0.34  ? 1121 CYS A CB   13 
ATOM   7895  S  SG   . CYS A 1 19 ? 11.988  -1.845  -1.572  1.00 0.42  ? 1121 CYS A SG   13 
ATOM   7896  H  H    . CYS A 1 19 ? 10.009  -4.457  -2.569  1.00 0.29  ? 1121 CYS A H    13 
ATOM   7897  H  HA   . CYS A 1 19 ? 9.132   -1.685  -2.221  1.00 0.24  ? 1121 CYS A HA   13 
ATOM   7898  H  HB2  . CYS A 1 19 ? 11.506  -2.864  -3.671  1.00 0.39  ? 1121 CYS A HB2  13 
ATOM   7899  H  HB3  . CYS A 1 19 ? 11.101  -1.150  -3.674  1.00 0.41  ? 1121 CYS A HB3  13 
ATOM   7900  N  N    . ILE A 1 20 ? 7.656   -1.761  -4.196  1.00 0.15  ? 1122 ILE A N    13 
ATOM   7901  C  CA   . ILE A 1 20 ? 6.855   -1.603  -5.398  1.00 0.14  ? 1122 ILE A CA   13 
ATOM   7902  C  C    . ILE A 1 20 ? 6.737   -0.131  -5.751  1.00 0.14  ? 1122 ILE A C    13 
ATOM   7903  O  O    . ILE A 1 20 ? 7.057   0.731   -4.940  1.00 0.18  ? 1122 ILE A O    13 
ATOM   7904  C  CB   . ILE A 1 20 ? 5.436   -2.176  -5.222  1.00 0.14  ? 1122 ILE A CB   13 
ATOM   7905  C  CG1  . ILE A 1 20 ? 4.705   -1.430  -4.107  1.00 0.13  ? 1122 ILE A CG1  13 
ATOM   7906  C  CG2  . ILE A 1 20 ? 5.494   -3.669  -4.928  1.00 0.19  ? 1122 ILE A CG2  13 
ATOM   7907  C  CD1  . ILE A 1 20 ? 3.285   -1.892  -3.899  1.00 0.17  ? 1122 ILE A CD1  13 
ATOM   7908  H  H    . ILE A 1 20 ? 7.332   -1.379  -3.352  1.00 0.22  ? 1122 ILE A H    13 
ATOM   7909  H  HA   . ILE A 1 20 ? 7.338   -2.129  -6.205  1.00 0.17  ? 1122 ILE A HA   13 
ATOM   7910  H  HB   . ILE A 1 20 ? 4.900   -2.038  -6.148  1.00 0.16  ? 1122 ILE A HB   13 
ATOM   7911  H  HG12 . ILE A 1 20 ? 5.240   -1.571  -3.185  1.00 0.15  ? 1122 ILE A HG12 13 
ATOM   7912  H  HG13 . ILE A 1 20 ? 4.680   -0.375  -4.345  1.00 0.14  ? 1122 ILE A HG13 13 
ATOM   7913  H  HG21 . ILE A 1 20 ? 6.086   -3.838  -4.041  1.00 0.98  ? 1122 ILE A HG21 13 
ATOM   7914  H  HG22 . ILE A 1 20 ? 5.943   -4.183  -5.764  1.00 1.05  ? 1122 ILE A HG22 13 
ATOM   7915  H  HG23 . ILE A 1 20 ? 4.494   -4.044  -4.770  1.00 0.97  ? 1122 ILE A HG23 13 
ATOM   7916  H  HD11 . ILE A 1 20 ? 2.845   -1.347  -3.078  1.00 1.07  ? 1122 ILE A HD11 13 
ATOM   7917  H  HD12 . ILE A 1 20 ? 3.283   -2.949  -3.674  1.00 0.99  ? 1122 ILE A HD12 13 
ATOM   7918  H  HD13 . ILE A 1 20 ? 2.715   -1.715  -4.798  1.00 1.03  ? 1122 ILE A HD13 13 
ATOM   7919  N  N    . SER A 1 21 ? 6.286   0.153   -6.954  1.00 0.16  ? 1123 SER A N    13 
ATOM   7920  C  CA   . SER A 1 21 ? 6.018   1.520   -7.361  1.00 0.17  ? 1123 SER A CA   13 
ATOM   7921  C  C    . SER A 1 21 ? 4.800   2.030   -6.608  1.00 0.15  ? 1123 SER A C    13 
ATOM   7922  O  O    . SER A 1 21 ? 3.828   1.297   -6.416  1.00 0.17  ? 1123 SER A O    13 
ATOM   7923  C  CB   . SER A 1 21 ? 5.774   1.584   -8.874  1.00 0.24  ? 1123 SER A CB   13 
ATOM   7924  O  OG   . SER A 1 21 ? 5.435   2.899   -9.296  1.00 0.33  ? 1123 SER A OG   13 
ATOM   7925  H  H    . SER A 1 21 ? 6.127   -0.578  -7.587  1.00 0.20  ? 1123 SER A H    13 
ATOM   7926  H  HA   . SER A 1 21 ? 6.873   2.128   -7.105  1.00 0.19  ? 1123 SER A HA   13 
ATOM   7927  H  HB2  . SER A 1 21 ? 6.671   1.278   -9.392  1.00 0.27  ? 1123 SER A HB2  13 
ATOM   7928  H  HB3  . SER A 1 21 ? 4.966   0.917   -9.134  1.00 0.24  ? 1123 SER A HB3  13 
ATOM   7929  H  HG   . SER A 1 21 ? 5.317   3.471   -8.525  1.00 0.63  ? 1123 SER A HG   13 
ATOM   7930  N  N    . LYS A 1 22 ? 4.852   3.288   -6.180  1.00 0.17  ? 1124 LYS A N    13 
ATOM   7931  C  CA   . LYS A 1 22 ? 3.751   3.884   -5.432  1.00 0.19  ? 1124 LYS A CA   13 
ATOM   7932  C  C    . LYS A 1 22 ? 2.493   3.955   -6.293  1.00 0.22  ? 1124 LYS A C    13 
ATOM   7933  O  O    . LYS A 1 22 ? 1.391   4.159   -5.786  1.00 0.25  ? 1124 LYS A O    13 
ATOM   7934  C  CB   . LYS A 1 22 ? 4.119   5.284   -4.939  1.00 0.23  ? 1124 LYS A CB   13 
ATOM   7935  C  CG   . LYS A 1 22 ? 5.399   5.336   -4.122  1.00 0.25  ? 1124 LYS A CG   13 
ATOM   7936  C  CD   . LYS A 1 22 ? 5.543   6.678   -3.426  1.00 0.25  ? 1124 LYS A CD   13 
ATOM   7937  C  CE   . LYS A 1 22 ? 6.715   6.690   -2.460  1.00 0.30  ? 1124 LYS A CE   13 
ATOM   7938  N  NZ   . LYS A 1 22 ? 6.832   7.988   -1.745  1.00 1.24  ? 1124 LYS A NZ   13 
ATOM   7939  H  H    . LYS A 1 22 ? 5.655   3.828   -6.368  1.00 0.20  ? 1124 LYS A H    13 
ATOM   7940  H  HA   . LYS A 1 22 ? 3.553   3.254   -4.579  1.00 0.19  ? 1124 LYS A HA   13 
ATOM   7941  H  HB2  . LYS A 1 22 ? 4.241   5.932   -5.793  1.00 0.30  ? 1124 LYS A HB2  13 
ATOM   7942  H  HB3  . LYS A 1 22 ? 3.313   5.659   -4.327  1.00 0.30  ? 1124 LYS A HB3  13 
ATOM   7943  H  HG2  . LYS A 1 22 ? 5.388   4.546   -3.387  1.00 0.37  ? 1124 LYS A HG2  13 
ATOM   7944  H  HG3  . LYS A 1 22 ? 6.240   5.196   -4.786  1.00 0.37  ? 1124 LYS A HG3  13 
ATOM   7945  H  HD2  . LYS A 1 22 ? 5.701   7.442   -4.173  1.00 0.32  ? 1124 LYS A HD2  13 
ATOM   7946  H  HD3  . LYS A 1 22 ? 4.636   6.889   -2.879  1.00 0.33  ? 1124 LYS A HD3  13 
ATOM   7947  H  HE2  . LYS A 1 22 ? 6.575   5.901   -1.736  1.00 0.93  ? 1124 LYS A HE2  13 
ATOM   7948  H  HE3  . LYS A 1 22 ? 7.624   6.510   -3.016  1.00 0.95  ? 1124 LYS A HE3  13 
ATOM   7949  H  HZ1  . LYS A 1 22 ? 7.677   7.987   -1.140  1.00 1.76  ? 1124 LYS A HZ1  13 
ATOM   7950  H  HZ2  . LYS A 1 22 ? 5.995   8.148   -1.149  1.00 1.77  ? 1124 LYS A HZ2  13 
ATOM   7951  H  HZ3  . LYS A 1 22 ? 6.910   8.771   -2.428  1.00 1.88  ? 1124 LYS A HZ3  13 
ATOM   7952  N  N    . ASN A 1 23 ? 2.674   3.783   -7.597  1.00 0.24  ? 1125 ASN A N    13 
ATOM   7953  C  CA   . ASN A 1 23 ? 1.564   3.763   -8.540  1.00 0.28  ? 1125 ASN A CA   13 
ATOM   7954  C  C    . ASN A 1 23 ? 0.772   2.462   -8.412  1.00 0.26  ? 1125 ASN A C    13 
ATOM   7955  O  O    . ASN A 1 23 ? -0.392  2.390   -8.800  1.00 0.32  ? 1125 ASN A O    13 
ATOM   7956  C  CB   . ASN A 1 23 ? 2.095   3.922   -9.968  1.00 0.36  ? 1125 ASN A CB   13 
ATOM   7957  C  CG   . ASN A 1 23 ? 1.012   4.282   -10.966 1.00 1.03  ? 1125 ASN A CG   13 
ATOM   7958  O  OD1  . ASN A 1 23 ? 0.697   5.460   -11.152 1.00 1.75  ? 1125 ASN A OD1  13 
ATOM   7959  N  ND2  . ASN A 1 23 ? 0.452   3.285   -11.632 1.00 1.69  ? 1125 ASN A ND2  13 
ATOM   7960  H  H    . ASN A 1 23 ? 3.587   3.685   -7.938  1.00 0.25  ? 1125 ASN A H    13 
ATOM   7961  H  HA   . ASN A 1 23 ? 0.915   4.594   -8.309  1.00 0.31  ? 1125 ASN A HA   13 
ATOM   7962  H  HB2  . ASN A 1 23 ? 2.840   4.702   -9.981  1.00 0.82  ? 1125 ASN A HB2  13 
ATOM   7963  H  HB3  . ASN A 1 23 ? 2.551   2.993   -10.279 1.00 0.82  ? 1125 ASN A HB3  13 
ATOM   7964  H  HD21 . ASN A 1 23 ? 0.760   2.369   -11.451 1.00 1.99  ? 1125 ASN A HD21 13 
ATOM   7965  H  HD22 . ASN A 1 23 ? -0.248  3.498   -12.286 1.00 2.22  ? 1125 ASN A HD22 13 
ATOM   7966  N  N    . TRP A 1 24 ? 1.410   1.436   -7.851  1.00 0.22  ? 1126 TRP A N    13 
ATOM   7967  C  CA   . TRP A 1 24 ? 0.767   0.137   -7.665  1.00 0.22  ? 1126 TRP A CA   13 
ATOM   7968  C  C    . TRP A 1 24 ? -0.011  0.115   -6.359  1.00 0.20  ? 1126 TRP A C    13 
ATOM   7969  O  O    . TRP A 1 24 ? -0.856  -0.747  -6.141  1.00 0.26  ? 1126 TRP A O    13 
ATOM   7970  C  CB   . TRP A 1 24 ? 1.802   -0.993  -7.644  1.00 0.25  ? 1126 TRP A CB   13 
ATOM   7971  C  CG   . TRP A 1 24 ? 2.629   -1.108  -8.890  1.00 0.31  ? 1126 TRP A CG   13 
ATOM   7972  C  CD1  . TRP A 1 24 ? 2.548   -0.334  -10.012 1.00 0.37  ? 1126 TRP A CD1  13 
ATOM   7973  C  CD2  . TRP A 1 24 ? 3.667   -2.063  -9.137  1.00 0.38  ? 1126 TRP A CD2  13 
ATOM   7974  N  NE1  . TRP A 1 24 ? 3.472   -0.748  -10.937 1.00 0.45  ? 1126 TRP A NE1  13 
ATOM   7975  C  CE2  . TRP A 1 24 ? 4.171   -1.807  -10.425 1.00 0.45  ? 1126 TRP A CE2  13 
ATOM   7976  C  CE3  . TRP A 1 24 ? 4.218   -3.109  -8.393  1.00 0.44  ? 1126 TRP A CE3  13 
ATOM   7977  C  CZ2  . TRP A 1 24 ? 5.202   -2.557  -10.985 1.00 0.54  ? 1126 TRP A CZ2  13 
ATOM   7978  C  CZ3  . TRP A 1 24 ? 5.241   -3.854  -8.950  1.00 0.55  ? 1126 TRP A CZ3  13 
ATOM   7979  C  CH2  . TRP A 1 24 ? 5.724   -3.575  -10.235 1.00 0.58  ? 1126 TRP A CH2  13 
ATOM   7980  H  H    . TRP A 1 24 ? 2.338   1.555   -7.553  1.00 0.23  ? 1126 TRP A H    13 
ATOM   7981  H  HA   . TRP A 1 24 ? 0.085   -0.020  -8.487  1.00 0.25  ? 1126 TRP A HA   13 
ATOM   7982  H  HB2  . TRP A 1 24 ? 2.476   -0.839  -6.814  1.00 0.27  ? 1126 TRP A HB2  13 
ATOM   7983  H  HB3  . TRP A 1 24 ? 1.286   -1.930  -7.501  1.00 0.28  ? 1126 TRP A HB3  13 
ATOM   7984  H  HD1  . TRP A 1 24 ? 1.853   0.484   -10.138 1.00 0.40  ? 1126 TRP A HD1  13 
ATOM   7985  H  HE1  . TRP A 1 24 ? 3.609   -0.347  -11.823 1.00 0.53  ? 1126 TRP A HE1  13 
ATOM   7986  H  HE3  . TRP A 1 24 ? 3.858   -3.343  -7.399  1.00 0.45  ? 1126 TRP A HE3  13 
ATOM   7987  H  HZ2  . TRP A 1 24 ? 5.585   -2.354  -11.973 1.00 0.61  ? 1126 TRP A HZ2  13 
ATOM   7988  H  HZ3  . TRP A 1 24 ? 5.681   -4.667  -8.390  1.00 0.62  ? 1126 TRP A HZ3  13 
ATOM   7989  H  HH2  . TRP A 1 24 ? 6.523   -4.183  -10.630 1.00 0.67  ? 1126 TRP A HH2  13 
ATOM   7990  N  N    . VAL A 1 25 ? 0.296   1.057   -5.488  1.00 0.19  ? 1127 VAL A N    13 
ATOM   7991  C  CA   . VAL A 1 25 ? -0.358  1.146   -4.192  1.00 0.18  ? 1127 VAL A CA   13 
ATOM   7992  C  C    . VAL A 1 25 ? -1.828  1.494   -4.357  1.00 0.19  ? 1127 VAL A C    13 
ATOM   7993  O  O    . VAL A 1 25 ? -2.169  2.554   -4.885  1.00 0.23  ? 1127 VAL A O    13 
ATOM   7994  C  CB   . VAL A 1 25 ? 0.331   2.195   -3.295  1.00 0.21  ? 1127 VAL A CB   13 
ATOM   7995  C  CG1  . VAL A 1 25 ? -0.378  2.328   -1.954  1.00 0.24  ? 1127 VAL A CG1  13 
ATOM   7996  C  CG2  . VAL A 1 25 ? 1.793   1.837   -3.092  1.00 0.24  ? 1127 VAL A CG2  13 
ATOM   7997  H  H    . VAL A 1 25 ? 0.979   1.715   -5.725  1.00 0.21  ? 1127 VAL A H    13 
ATOM   7998  H  HA   . VAL A 1 25 ? -0.285  0.179   -3.714  1.00 0.19  ? 1127 VAL A HA   13 
ATOM   7999  H  HB   . VAL A 1 25 ? 0.286   3.151   -3.796  1.00 0.23  ? 1127 VAL A HB   13 
ATOM   8000  H  HG11 . VAL A 1 25 ? 0.131   3.065   -1.349  1.00 1.01  ? 1127 VAL A HG11 13 
ATOM   8001  H  HG12 . VAL A 1 25 ? -0.367  1.375   -1.447  1.00 1.02  ? 1127 VAL A HG12 13 
ATOM   8002  H  HG13 . VAL A 1 25 ? -1.399  2.638   -2.116  1.00 1.00  ? 1127 VAL A HG13 13 
ATOM   8003  H  HG21 . VAL A 1 25 ? 2.275   1.735   -4.054  1.00 1.05  ? 1127 VAL A HG21 13 
ATOM   8004  H  HG22 . VAL A 1 25 ? 1.865   0.902   -2.555  1.00 1.06  ? 1127 VAL A HG22 13 
ATOM   8005  H  HG23 . VAL A 1 25 ? 2.281   2.616   -2.527  1.00 1.01  ? 1127 VAL A HG23 13 
ATOM   8006  N  N    . CYS A 1 26 ? -2.684  0.578   -3.919  1.00 0.19  ? 1128 CYS A N    13 
ATOM   8007  C  CA   . CYS A 1 26 ? -4.129  0.733   -4.039  1.00 0.26  ? 1128 CYS A CA   13 
ATOM   8008  C  C    . CYS A 1 26 ? -4.534  0.773   -5.510  1.00 0.27  ? 1128 CYS A C    13 
ATOM   8009  O  O    . CYS A 1 26 ? -5.126  1.740   -5.996  1.00 0.37  ? 1128 CYS A O    13 
ATOM   8010  C  CB   . CYS A 1 26 ? -4.616  1.982   -3.300  1.00 0.32  ? 1128 CYS A CB   13 
ATOM   8011  S  SG   . CYS A 1 26 ? -6.427  2.197   -3.315  1.00 0.58  ? 1128 CYS A SG   13 
ATOM   8012  H  H    . CYS A 1 26 ? -2.330  -0.241  -3.505  1.00 0.19  ? 1128 CYS A H    13 
ATOM   8013  H  HA   . CYS A 1 26 ? -4.583  -0.137  -3.587  1.00 0.28  ? 1128 CYS A HA   13 
ATOM   8014  H  HB2  . CYS A 1 26 ? -4.301  1.928   -2.270  1.00 0.36  ? 1128 CYS A HB2  13 
ATOM   8015  H  HB3  . CYS A 1 26 ? -4.177  2.854   -3.756  1.00 0.36  ? 1128 CYS A HB3  13 
ATOM   8016  N  N    . ASP A 1 27 ? -4.174  -0.279  -6.223  1.00 0.25  ? 1129 ASP A N    13 
ATOM   8017  C  CA   . ASP A 1 27 ? -4.569  -0.435  -7.619  1.00 0.30  ? 1129 ASP A CA   13 
ATOM   8018  C  C    . ASP A 1 27 ? -5.473  -1.656  -7.761  1.00 0.37  ? 1129 ASP A C    13 
ATOM   8019  O  O    . ASP A 1 27 ? -5.562  -2.263  -8.826  1.00 0.41  ? 1129 ASP A O    13 
ATOM   8020  C  CB   . ASP A 1 27 ? -3.341  -0.560  -8.532  1.00 0.31  ? 1129 ASP A CB   13 
ATOM   8021  C  CG   . ASP A 1 27 ? -2.695  -1.930  -8.482  1.00 0.35  ? 1129 ASP A CG   13 
ATOM   8022  O  OD1  . ASP A 1 27 ? -2.595  -2.511  -7.381  1.00 0.31  ? 1129 ASP A OD1  13 
ATOM   8023  O  OD2  . ASP A 1 27 ? -2.275  -2.428  -9.544  1.00 0.46  ? 1129 ASP A OD2  13 
ATOM   8024  H  H    . ASP A 1 27 ? -3.623  -0.976  -5.795  1.00 0.24  ? 1129 ASP A H    13 
ATOM   8025  H  HA   . ASP A 1 27 ? -5.131  0.445   -7.901  1.00 0.33  ? 1129 ASP A HA   13 
ATOM   8026  H  HB2  . ASP A 1 27 ? -3.641  -0.365  -9.551  1.00 0.36  ? 1129 ASP A HB2  13 
ATOM   8027  H  HB3  . ASP A 1 27 ? -2.606  0.174   -8.235  1.00 0.29  ? 1129 ASP A HB3  13 
ATOM   8028  N  N    . THR A 1 28 ? -6.113  -2.009  -6.645  1.00 0.45  ? 1130 THR A N    13 
ATOM   8029  C  CA   . THR A 1 28 ? -7.087  -3.103  -6.553  1.00 0.56  ? 1130 THR A CA   13 
ATOM   8030  C  C    . THR A 1 28 ? -6.450  -4.474  -6.794  1.00 0.61  ? 1130 THR A C    13 
ATOM   8031  O  O    . THR A 1 28 ? -7.150  -5.466  -7.013  1.00 0.73  ? 1130 THR A O    13 
ATOM   8032  C  CB   . THR A 1 28 ? -8.321  -2.904  -7.478  1.00 0.59  ? 1130 THR A CB   13 
ATOM   8033  O  OG1  . THR A 1 28 ? -7.978  -3.012  -8.867  1.00 0.56  ? 1130 THR A OG1  13 
ATOM   8034  C  CG2  . THR A 1 28 ? -8.954  -1.548  -7.224  1.00 0.65  ? 1130 THR A CG2  13 
ATOM   8035  H  H    . THR A 1 28 ? -5.908  -1.511  -5.823  1.00 0.46  ? 1130 THR A H    13 
ATOM   8036  H  HA   . THR A 1 28 ? -7.454  -3.094  -5.536  1.00 0.64  ? 1130 THR A HA   13 
ATOM   8037  H  HB   . THR A 1 28 ? -9.049  -3.666  -7.239  1.00 0.67  ? 1130 THR A HB   13 
ATOM   8038  H  HG1  . THR A 1 28 ? -7.016  -3.048  -8.958  1.00 0.53  ? 1130 THR A HG1  13 
ATOM   8039  H  HG21 . THR A 1 28 ? -8.247  -0.769  -7.467  1.00 1.34  ? 1130 THR A HG21 13 
ATOM   8040  H  HG22 . THR A 1 28 ? -9.230  -1.471  -6.183  1.00 1.09  ? 1130 THR A HG22 13 
ATOM   8041  H  HG23 . THR A 1 28 ? -9.835  -1.440  -7.840  1.00 1.21  ? 1130 THR A HG23 13 
ATOM   8042  N  N    . ASP A 1 29 ? -5.123  -4.526  -6.743  1.00 0.59  ? 1131 ASP A N    13 
ATOM   8043  C  CA   . ASP A 1 29 ? -4.402  -5.786  -6.848  1.00 0.69  ? 1131 ASP A CA   13 
ATOM   8044  C  C    . ASP A 1 29 ? -3.306  -5.861  -5.794  1.00 0.67  ? 1131 ASP A C    13 
ATOM   8045  O  O    . ASP A 1 29 ? -2.562  -4.901  -5.588  1.00 0.53  ? 1131 ASP A O    13 
ATOM   8046  C  CB   . ASP A 1 29 ? -3.794  -5.942  -8.241  1.00 0.75  ? 1131 ASP A CB   13 
ATOM   8047  C  CG   . ASP A 1 29 ? -3.164  -7.309  -8.446  1.00 0.92  ? 1131 ASP A CG   13 
ATOM   8048  O  OD1  . ASP A 1 29 ? -3.841  -8.329  -8.208  1.00 1.21  ? 1131 ASP A OD1  13 
ATOM   8049  O  OD2  . ASP A 1 29 ? -1.986  -7.370  -8.856  1.00 0.92  ? 1131 ASP A OD2  13 
ATOM   8050  H  H    . ASP A 1 29 ? -4.616  -3.695  -6.648  1.00 0.55  ? 1131 ASP A H    13 
ATOM   8051  H  HA   . ASP A 1 29 ? -5.106  -6.587  -6.678  1.00 0.81  ? 1131 ASP A HA   13 
ATOM   8052  H  HB2  . ASP A 1 29 ? -4.567  -5.804  -8.977  1.00 0.81  ? 1131 ASP A HB2  13 
ATOM   8053  H  HB3  . ASP A 1 29 ? -3.031  -5.191  -8.380  1.00 0.68  ? 1131 ASP A HB3  13 
ATOM   8054  N  N    . ASN A 1 30 ? -3.224  -6.993  -5.117  1.00 0.94  ? 1132 ASN A N    13 
ATOM   8055  C  CA   . ASN A 1 30 ? -2.217  -7.201  -4.086  1.00 1.00  ? 1132 ASN A CA   13 
ATOM   8056  C  C    . ASN A 1 30 ? -0.854  -7.450  -4.719  1.00 0.91  ? 1132 ASN A C    13 
ATOM   8057  O  O    . ASN A 1 30 ? -0.622  -8.503  -5.310  1.00 1.06  ? 1132 ASN A O    13 
ATOM   8058  C  CB   . ASN A 1 30 ? -2.607  -8.385  -3.197  1.00 1.29  ? 1132 ASN A CB   13 
ATOM   8059  C  CG   . ASN A 1 30 ? -3.887  -8.138  -2.422  1.00 1.72  ? 1132 ASN A CG   13 
ATOM   8060  O  OD1  . ASN A 1 30 ? -4.195  -7.006  -2.052  1.00 2.58  ? 1132 ASN A OD1  13 
ATOM   8061  N  ND2  . ASN A 1 30 ? -4.645  -9.194  -2.175  1.00 2.07  ? 1132 ASN A ND2  13 
ATOM   8062  H  H    . ASN A 1 30 ? -3.855  -7.716  -5.318  1.00 1.15  ? 1132 ASN A H    13 
ATOM   8063  H  HA   . ASN A 1 30 ? -2.166  -6.307  -3.482  1.00 0.97  ? 1132 ASN A HA   13 
ATOM   8064  H  HB2  . ASN A 1 30 ? -2.749  -9.259  -3.815  1.00 1.52  ? 1132 ASN A HB2  13 
ATOM   8065  H  HB3  . ASN A 1 30 ? -1.812  -8.577  -2.491  1.00 1.97  ? 1132 ASN A HB3  13 
ATOM   8066  H  HD21 . ASN A 1 30 ? -4.341  -10.068 -2.502  1.00 2.11  ? 1132 ASN A HD21 13 
ATOM   8067  H  HD22 . ASN A 1 30 ? -5.478  -9.060  -1.679  1.00 2.73  ? 1132 ASN A HD22 13 
ATOM   8068  N  N    . ASP A 1 31 ? 0.044   -6.479  -4.605  1.00 0.86  ? 1133 ASP A N    13 
ATOM   8069  C  CA   . ASP A 1 31 ? 1.362   -6.601  -5.219  1.00 0.77  ? 1133 ASP A CA   13 
ATOM   8070  C  C    . ASP A 1 31 ? 2.368   -7.145  -4.225  1.00 0.78  ? 1133 ASP A C    13 
ATOM   8071  O  O    . ASP A 1 31 ? 3.154   -8.036  -4.544  1.00 1.28  ? 1133 ASP A O    13 
ATOM   8072  C  CB   . ASP A 1 31 ? 1.849   -5.260  -5.775  1.00 0.67  ? 1133 ASP A CB   13 
ATOM   8073  C  CG   . ASP A 1 31 ? 0.994   -4.771  -6.920  1.00 0.58  ? 1133 ASP A CG   13 
ATOM   8074  O  OD1  . ASP A 1 31 ? 1.171   -5.268  -8.051  1.00 1.09  ? 1133 ASP A OD1  13 
ATOM   8075  O  OD2  . ASP A 1 31 ? 0.136   -3.892  -6.690  1.00 1.00  ? 1133 ASP A OD2  13 
ATOM   8076  H  H    . ASP A 1 31 ? -0.180  -5.672  -4.094  1.00 1.05  ? 1133 ASP A H    13 
ATOM   8077  H  HA   . ASP A 1 31 ? 1.276   -7.298  -6.033  1.00 0.87  ? 1133 ASP A HA   13 
ATOM   8078  H  HB2  . ASP A 1 31 ? 1.827   -4.519  -4.994  1.00 1.04  ? 1133 ASP A HB2  13 
ATOM   8079  H  HB3  . ASP A 1 31 ? 2.863   -5.372  -6.130  1.00 1.05  ? 1133 ASP A HB3  13 
ATOM   8080  N  N    . CYS A 1 32 ? 2.331   -6.617  -3.016  1.00 0.76  ? 1134 CYS A N    13 
ATOM   8081  C  CA   . CYS A 1 32 ? 3.245   -7.046  -1.971  1.00 0.78  ? 1134 CYS A CA   13 
ATOM   8082  C  C    . CYS A 1 32 ? 2.727   -8.290  -1.265  1.00 0.85  ? 1134 CYS A C    13 
ATOM   8083  O  O    . CYS A 1 32 ? 2.439   -8.257  -0.066  1.00 1.57  ? 1134 CYS A O    13 
ATOM   8084  C  CB   . CYS A 1 32 ? 3.453   -5.920  -0.966  1.00 0.82  ? 1134 CYS A CB   13 
ATOM   8085  S  SG   . CYS A 1 32 ? 4.272   -4.456  -1.672  1.00 1.16  ? 1134 CYS A SG   13 
ATOM   8086  H  H    . CYS A 1 32 ? 1.676   -5.912  -2.820  1.00 1.11  ? 1134 CYS A H    13 
ATOM   8087  H  HA   . CYS A 1 32 ? 4.191   -7.278  -2.434  1.00 0.88  ? 1134 CYS A HA   13 
ATOM   8088  H  HB2  . CYS A 1 32 ? 2.492   -5.606  -0.585  1.00 1.25  ? 1134 CYS A HB2  13 
ATOM   8089  H  HB3  . CYS A 1 32 ? 4.058   -6.280  -0.149  1.00 1.22  ? 1134 CYS A HB3  13 
ATOM   8090  N  N    . GLY A 1 33 ? 2.598   -9.376  -2.021  1.00 1.17  ? 1135 GLY A N    13 
ATOM   8091  C  CA   . GLY A 1 33 ? 2.153   -10.637 -1.463  1.00 1.22  ? 1135 GLY A CA   13 
ATOM   8092  C  C    . GLY A 1 33 ? 0.743   -10.564 -0.924  1.00 1.18  ? 1135 GLY A C    13 
ATOM   8093  O  O    . GLY A 1 33 ? -0.223  -10.761 -1.659  1.00 1.68  ? 1135 GLY A O    13 
ATOM   8094  H  H    . GLY A 1 33 ? 2.803   -9.314  -2.980  1.00 1.82  ? 1135 GLY A H    13 
ATOM   8095  H  HA2  . GLY A 1 33 ? 2.193   -11.393 -2.232  1.00 1.26  ? 1135 GLY A HA2  13 
ATOM   8096  H  HA3  . GLY A 1 33 ? 2.819   -10.919 -0.662  1.00 1.39  ? 1135 GLY A HA3  13 
ATOM   8097  N  N    . ASP A 1 34 ? 0.629   -10.269 0.363   1.00 1.02  ? 1136 ASP A N    13 
ATOM   8098  C  CA   . ASP A 1 34 ? -0.665  -10.131 1.010   1.00 1.11  ? 1136 ASP A CA   13 
ATOM   8099  C  C    . ASP A 1 34 ? -1.367  -8.868  0.537   1.00 0.93  ? 1136 ASP A C    13 
ATOM   8100  O  O    . ASP A 1 34 ? -2.592  -8.770  0.577   1.00 1.35  ? 1136 ASP A O    13 
ATOM   8101  C  CB   . ASP A 1 34 ? -0.511  -10.108 2.527   1.00 1.44  ? 1136 ASP A CB   13 
ATOM   8102  C  CG   . ASP A 1 34 ? -0.003  -11.424 3.079   1.00 2.10  ? 1136 ASP A CG   13 
ATOM   8103  O  OD1  . ASP A 1 34 ? 1.227   -11.657 3.042   1.00 2.85  ? 1136 ASP A OD1  13 
ATOM   8104  O  OD2  . ASP A 1 34 ? -0.826  -12.236 3.543   1.00 2.47  ? 1136 ASP A OD2  13 
ATOM   8105  H  H    . ASP A 1 34 ? 1.444   -10.138 0.894   1.00 1.22  ? 1136 ASP A H    13 
ATOM   8106  H  HA   . ASP A 1 34 ? -1.261  -10.983 0.737   1.00 1.27  ? 1136 ASP A HA   13 
ATOM   8107  H  HB2  . ASP A 1 34 ? 0.186   -9.336  2.791   1.00 1.68  ? 1136 ASP A HB2  13 
ATOM   8108  H  HB3  . ASP A 1 34 ? -1.469  -9.895  2.978   1.00 1.84  ? 1136 ASP A HB3  13 
ATOM   8109  N  N    . GLY A 1 35 ? -0.576  -7.902  0.081   1.00 0.62  ? 1137 GLY A N    13 
ATOM   8110  C  CA   . GLY A 1 35 ? -1.138  -6.688  -0.471  1.00 0.49  ? 1137 GLY A CA   13 
ATOM   8111  C  C    . GLY A 1 35 ? -1.286  -5.593  0.559   1.00 0.36  ? 1137 GLY A C    13 
ATOM   8112  O  O    . GLY A 1 35 ? -2.324  -4.941  0.636   1.00 0.36  ? 1137 GLY A O    13 
ATOM   8113  H  H    . GLY A 1 35 ? 0.400   -8.021  0.120   1.00 0.82  ? 1137 GLY A H    13 
ATOM   8114  H  HA2  . GLY A 1 35 ? -0.495  -6.335  -1.263  1.00 0.51  ? 1137 GLY A HA2  13 
ATOM   8115  H  HA3  . GLY A 1 35 ? -2.110  -6.910  -0.884  1.00 0.72  ? 1137 GLY A HA3  13 
ATOM   8116  N  N    . SER A 1 36 ? -0.239  -5.379  1.345   1.00 0.32  ? 1138 SER A N    13 
ATOM   8117  C  CA   . SER A 1 36 ? -0.245  -4.326  2.350   1.00 0.28  ? 1138 SER A CA   13 
ATOM   8118  C  C    . SER A 1 36 ? -0.390  -2.954  1.698   1.00 0.25  ? 1138 SER A C    13 
ATOM   8119  O  O    . SER A 1 36 ? -0.810  -1.996  2.334   1.00 0.40  ? 1138 SER A O    13 
ATOM   8120  C  CB   . SER A 1 36 ? 1.041   -4.388  3.177   1.00 0.33  ? 1138 SER A CB   13 
ATOM   8121  O  OG   . SER A 1 36 ? 2.179   -4.473  2.339   1.00 0.44  ? 1138 SER A OG   13 
ATOM   8122  H  H    . SER A 1 36 ? 0.554   -5.946  1.252   1.00 0.37  ? 1138 SER A H    13 
ATOM   8123  H  HA   . SER A 1 36 ? -1.093  -4.491  3.004   1.00 0.33  ? 1138 SER A HA   13 
ATOM   8124  H  HB2  . SER A 1 36 ? 1.121   -3.498  3.781   1.00 0.40  ? 1138 SER A HB2  13 
ATOM   8125  H  HB3  . SER A 1 36 ? 1.014   -5.256  3.817   1.00 0.39  ? 1138 SER A HB3  13 
ATOM   8126  H  HG   . SER A 1 36 ? 2.101   -3.828  1.628   1.00 1.17  ? 1138 SER A HG   13 
ATOM   8127  N  N    . ASP A 1 37 ? -0.065  -2.881  0.415   1.00 0.18  ? 1139 ASP A N    13 
ATOM   8128  C  CA   . ASP A 1 37 ? -0.153  -1.636  -0.335  1.00 0.18  ? 1139 ASP A CA   13 
ATOM   8129  C  C    . ASP A 1 37 ? -1.609  -1.269  -0.607  1.00 0.20  ? 1139 ASP A C    13 
ATOM   8130  O  O    . ASP A 1 37 ? -1.928  -0.131  -0.940  1.00 0.29  ? 1139 ASP A O    13 
ATOM   8131  C  CB   . ASP A 1 37 ? 0.609   -1.768  -1.654  1.00 0.19  ? 1139 ASP A CB   13 
ATOM   8132  C  CG   . ASP A 1 37 ? 0.009   -2.806  -2.584  1.00 0.26  ? 1139 ASP A CG   13 
ATOM   8133  O  OD1  . ASP A 1 37 ? 0.154   -4.023  -2.316  1.00 0.33  ? 1139 ASP A OD1  13 
ATOM   8134  O  OD2  . ASP A 1 37 ? -0.610  -2.409  -3.591  1.00 0.32  ? 1139 ASP A OD2  13 
ATOM   8135  H  H    . ASP A 1 37 ? 0.233   -3.692  -0.050  1.00 0.26  ? 1139 ASP A H    13 
ATOM   8136  H  HA   . ASP A 1 37 ? 0.299   -0.856  0.258   1.00 0.20  ? 1139 ASP A HA   13 
ATOM   8137  H  HB2  . ASP A 1 37 ? 0.602   -0.815  -2.159  1.00 0.22  ? 1139 ASP A HB2  13 
ATOM   8138  H  HB3  . ASP A 1 37 ? 1.630   -2.049  -1.443  1.00 0.19  ? 1139 ASP A HB3  13 
ATOM   8139  N  N    . GLU A 1 38 ? -2.493  -2.243  -0.463  1.00 0.22  ? 1140 GLU A N    13 
ATOM   8140  C  CA   . GLU A 1 38 ? -3.915  -2.014  -0.656  1.00 0.27  ? 1140 GLU A CA   13 
ATOM   8141  C  C    . GLU A 1 38 ? -4.597  -1.724  0.681   1.00 0.31  ? 1140 GLU A C    13 
ATOM   8142  O  O    . GLU A 1 38 ? -5.620  -1.040  0.736   1.00 0.44  ? 1140 GLU A O    13 
ATOM   8143  C  CB   . GLU A 1 38 ? -4.562  -3.243  -1.299  1.00 0.29  ? 1140 GLU A CB   13 
ATOM   8144  C  CG   . GLU A 1 38 ? -3.972  -3.633  -2.647  1.00 0.29  ? 1140 GLU A CG   13 
ATOM   8145  C  CD   . GLU A 1 38 ? -4.243  -2.611  -3.731  1.00 0.28  ? 1140 GLU A CD   13 
ATOM   8146  O  OE1  . GLU A 1 38 ? -5.400  -2.169  -3.863  1.00 0.38  ? 1140 GLU A OE1  13 
ATOM   8147  O  OE2  . GLU A 1 38 ? -3.295  -2.248  -4.464  1.00 0.28  ? 1140 GLU A OE2  13 
ATOM   8148  H  H    . GLU A 1 38 ? -2.179  -3.143  -0.228  1.00 0.24  ? 1140 GLU A H    13 
ATOM   8149  H  HA   . GLU A 1 38 ? -4.037  -1.160  -1.312  1.00 0.30  ? 1140 GLU A HA   13 
ATOM   8150  H  HB2  . GLU A 1 38 ? -4.450  -4.083  -0.629  1.00 0.32  ? 1140 GLU A HB2  13 
ATOM   8151  H  HB3  . GLU A 1 38 ? -5.614  -3.046  -1.437  1.00 0.33  ? 1140 GLU A HB3  13 
ATOM   8152  H  HG2  . GLU A 1 38 ? -2.903  -3.743  -2.539  1.00 0.29  ? 1140 GLU A HG2  13 
ATOM   8153  H  HG3  . GLU A 1 38 ? -4.398  -4.579  -2.950  1.00 0.33  ? 1140 GLU A HG3  13 
ATOM   8154  N  N    . LYS A 1 39 ? -4.009  -2.232  1.763   1.00 0.30  ? 1141 LYS A N    13 
ATOM   8155  C  CA   . LYS A 1 39 ? -4.636  -2.164  3.083   1.00 0.37  ? 1141 LYS A CA   13 
ATOM   8156  C  C    . LYS A 1 39 ? -4.621  -0.743  3.641   1.00 0.49  ? 1141 LYS A C    13 
ATOM   8157  O  O    . LYS A 1 39 ? -5.434  -0.393  4.495   1.00 0.57  ? 1141 LYS A O    13 
ATOM   8158  C  CB   . LYS A 1 39 ? -3.933  -3.106  4.068   1.00 0.47  ? 1141 LYS A CB   13 
ATOM   8159  C  CG   . LYS A 1 39 ? -2.622  -2.568  4.626   1.00 0.57  ? 1141 LYS A CG   13 
ATOM   8160  C  CD   . LYS A 1 39 ? -2.050  -3.483  5.693   1.00 0.76  ? 1141 LYS A CD   13 
ATOM   8161  C  CE   . LYS A 1 39 ? -0.708  -2.978  6.197   1.00 0.91  ? 1141 LYS A CE   13 
ATOM   8162  N  NZ   . LYS A 1 39 ? -0.798  -1.614  6.787   1.00 1.55  ? 1141 LYS A NZ   13 
ATOM   8163  H  H    . LYS A 1 39 ? -3.137  -2.667  1.670   1.00 0.32  ? 1141 LYS A H    13 
ATOM   8164  H  HA   . LYS A 1 39 ? -5.663  -2.478  2.974   1.00 0.39  ? 1141 LYS A HA   13 
ATOM   8165  H  HB2  . LYS A 1 39 ? -4.593  -3.293  4.895   1.00 0.56  ? 1141 LYS A HB2  13 
ATOM   8166  H  HB3  . LYS A 1 39 ? -3.728  -4.040  3.568   1.00 0.47  ? 1141 LYS A HB3  13 
ATOM   8167  H  HG2  . LYS A 1 39 ? -1.907  -2.478  3.824   1.00 0.50  ? 1141 LYS A HG2  13 
ATOM   8168  H  HG3  . LYS A 1 39 ? -2.800  -1.596  5.059   1.00 0.65  ? 1141 LYS A HG3  13 
ATOM   8169  H  HD2  . LYS A 1 39 ? -2.740  -3.528  6.522   1.00 0.88  ? 1141 LYS A HD2  13 
ATOM   8170  H  HD3  . LYS A 1 39 ? -1.920  -4.470  5.276   1.00 0.73  ? 1141 LYS A HD3  13 
ATOM   8171  H  HE2  . LYS A 1 39 ? -0.350  -3.657  6.949   1.00 1.15  ? 1141 LYS A HE2  13 
ATOM   8172  H  HE3  . LYS A 1 39 ? -0.013  -2.958  5.372   1.00 1.18  ? 1141 LYS A HE3  13 
ATOM   8173  H  HZ1  . LYS A 1 39 ? -1.507  -1.597  7.545   1.00 2.08  ? 1141 LYS A HZ1  13 
ATOM   8174  H  HZ2  . LYS A 1 39 ? -1.068  -0.921  6.062   1.00 1.99  ? 1141 LYS A HZ2  13 
ATOM   8175  H  HZ3  . LYS A 1 39 ? 0.122   -1.335  7.186   1.00 1.97  ? 1141 LYS A HZ3  13 
ATOM   8176  N  N    . ASN A 1 40 ? -3.693  0.067   3.161   1.00 0.60  ? 1142 ASN A N    13 
ATOM   8177  C  CA   . ASN A 1 40 ? -3.540  1.426   3.667   1.00 0.81  ? 1142 ASN A CA   13 
ATOM   8178  C  C    . ASN A 1 40 ? -4.242  2.436   2.766   1.00 0.91  ? 1142 ASN A C    13 
ATOM   8179  O  O    . ASN A 1 40 ? -3.995  3.640   2.853   1.00 1.44  ? 1142 ASN A O    13 
ATOM   8180  C  CB   . ASN A 1 40 ? -2.055  1.782   3.811   1.00 1.07  ? 1142 ASN A CB   13 
ATOM   8181  C  CG   . ASN A 1 40 ? -1.309  1.778   2.490   1.00 1.37  ? 1142 ASN A CG   13 
ATOM   8182  O  OD1  . ASN A 1 40 ? -0.785  0.752   2.067   1.00 2.05  ? 1142 ASN A OD1  13 
ATOM   8183  N  ND2  . ASN A 1 40 ? -1.243  2.925   1.836   1.00 1.92  ? 1142 ASN A ND2  13 
ATOM   8184  H  H    . ASN A 1 40 ? -3.092  -0.259  2.459   1.00 0.58  ? 1142 ASN A H    13 
ATOM   8185  H  HA   . ASN A 1 40 ? -4.000  1.462   4.643   1.00 0.86  ? 1142 ASN A HA   13 
ATOM   8186  H  HB2  . ASN A 1 40 ? -1.970  2.764   4.244   1.00 1.54  ? 1142 ASN A HB2  13 
ATOM   8187  H  HB3  . ASN A 1 40 ? -1.586  1.064   4.468   1.00 1.56  ? 1142 ASN A HB3  13 
ATOM   8188  H  HD21 . ASN A 1 40 ? -1.675  3.713   2.235   1.00 2.20  ? 1142 ASN A HD21 13 
ATOM   8189  H  HD22 . ASN A 1 40 ? -0.769  2.944   0.978   1.00 2.44  ? 1142 ASN A HD22 13 
ATOM   8190  N  N    . CYS A 1 41 ? -5.127  1.949   1.912   1.00 0.76  ? 1143 CYS A N    13 
ATOM   8191  C  CA   . CYS A 1 41 ? -5.859  2.822   1.011   1.00 0.99  ? 1143 CYS A CA   13 
ATOM   8192  C  C    . CYS A 1 41 ? -7.139  3.311   1.677   1.00 1.29  ? 1143 CYS A C    13 
ATOM   8193  O  O    . CYS A 1 41 ? -8.192  2.678   1.574   1.00 1.67  ? 1143 CYS A O    13 
ATOM   8194  C  CB   . CYS A 1 41 ? -6.186  2.101   -0.294  1.00 0.93  ? 1143 CYS A CB   13 
ATOM   8195  S  SG   . CYS A 1 41 ? -6.822  3.204   -1.598  1.00 1.10  ? 1143 CYS A SG   13 
ATOM   8196  H  H    . CYS A 1 41 ? -5.297  0.984   1.890   1.00 0.89  ? 1143 CYS A H    13 
ATOM   8197  H  HA   . CYS A 1 41 ? -5.232  3.674   0.795   1.00 1.23  ? 1143 CYS A HA   13 
ATOM   8198  H  HB2  . CYS A 1 41 ? -5.293  1.623   -0.667  1.00 0.98  ? 1143 CYS A HB2  13 
ATOM   8199  H  HB3  . CYS A 1 41 ? -6.937  1.348   -0.102  1.00 1.29  ? 1143 CYS A HB3  13 
ATOM   8200  N  N    . ASN A 1 42 ? -7.038  4.434   2.373   1.00 1.87  ? 1144 ASN A N    13 
ATOM   8201  C  CA   . ASN A 1 42 ? -8.179  5.010   3.075   1.00 2.36  ? 1144 ASN A CA   13 
ATOM   8202  C  C    . ASN A 1 42 ? -9.015  5.870   2.136   1.00 3.05  ? 1144 ASN A C    13 
ATOM   8203  O  O    . ASN A 1 42 ? -10.172 6.186   2.425   1.00 3.73  ? 1144 ASN A O    13 
ATOM   8204  C  CB   . ASN A 1 42 ? -7.711  5.850   4.272   1.00 3.11  ? 1144 ASN A CB   13 
ATOM   8205  C  CG   . ASN A 1 42 ? -6.888  7.065   3.866   1.00 3.87  ? 1144 ASN A CG   13 
ATOM   8206  O  OD1  . ASN A 1 42 ? -6.152  7.040   2.877   1.00 4.27  ? 1144 ASN A OD1  13 
ATOM   8207  N  ND2  . ASN A 1 42 ? -7.012  8.139   4.628   1.00 4.59  ? 1144 ASN A ND2  13 
ATOM   8208  H  H    . ASN A 1 42 ? -6.171  4.892   2.419   1.00 2.27  ? 1144 ASN A H    13 
ATOM   8209  H  HA   . ASN A 1 42 ? -8.789  4.196   3.437   1.00 2.42  ? 1144 ASN A HA   13 
ATOM   8210  H  HB2  . ASN A 1 42 ? -8.576  6.195   4.818   1.00 3.41  ? 1144 ASN A HB2  13 
ATOM   8211  H  HB3  . ASN A 1 42 ? -7.107  5.231   4.919   1.00 3.38  ? 1144 ASN A HB3  13 
ATOM   8212  H  HD21 . ASN A 1 42 ? -7.619  8.093   5.399   1.00 4.61  ? 1144 ASN A HD21 13 
ATOM   8213  H  HD22 . ASN A 1 42 ? -6.499  8.941   4.389   1.00 5.30  ? 1144 ASN A HD22 13 
ATOM   8214  N  N    . SER A 1 43 ? -8.419  6.251   1.016   1.00 3.53  ? 1145 SER A N    13 
ATOM   8215  C  CA   . SER A 1 43 ? -9.095  7.065   0.024   1.00 4.69  ? 1145 SER A CA   13 
ATOM   8216  C  C    . SER A 1 43 ? -10.055 6.221   -0.803  1.00 5.23  ? 1145 SER A C    13 
ATOM   8217  O  O    . SER A 1 43 ? -11.255 6.167   -0.525  1.00 5.32  ? 1145 SER A O    13 
ATOM   8218  C  CB   . SER A 1 43 ? -8.055  7.743   -0.872  1.00 5.40  ? 1145 SER A CB   13 
ATOM   8219  O  OG   . SER A 1 43 ? -7.039  6.825   -1.251  1.00 5.26  ? 1145 SER A OG   13 
ATOM   8220  H  H    . SER A 1 43 ? -7.495  5.975   0.849   1.00 3.45  ? 1145 SER A H    13 
ATOM   8221  H  HA   . SER A 1 43 ? -9.659  7.824   0.541   1.00 5.07  ? 1145 SER A HA   13 
ATOM   8222  H  HB2  . SER A 1 43 ? -8.538  8.113   -1.764  1.00 6.23  ? 1145 SER A HB2  13 
ATOM   8223  H  HB3  . SER A 1 43 ? -7.602  8.564   -0.339  1.00 5.56  ? 1145 SER A HB3  13 
ATOM   8224  H  HG   . SER A 1 43 ? -6.401  7.270   -1.824  1.00 5.21  ? 1145 SER A HG   13 
ATOM   8225  N  N    . THR A 1 44 ? -9.517  5.547   -1.801  1.00 5.97  ? 1146 THR A N    13 
ATOM   8226  C  CA   . THR A 1 44 ? -10.316 4.733   -2.692  1.00 6.81  ? 1146 THR A CA   13 
ATOM   8227  C  C    . THR A 1 44 ? -10.406 3.293   -2.195  1.00 7.34  ? 1146 THR A C    13 
ATOM   8228  O  O    . THR A 1 44 ? -9.790  2.390   -2.761  1.00 8.15  ? 1146 THR A O    13 
ATOM   8229  C  CB   . THR A 1 44 ? -9.737  4.772   -4.116  1.00 7.69  ? 1146 THR A CB   13 
ATOM   8230  O  OG1  . THR A 1 44 ? -8.332  4.481   -4.081  1.00 7.92  ? 1146 THR A OG1  13 
ATOM   8231  C  CG2  . THR A 1 44 ? -9.961  6.142   -4.739  1.00 7.74  ? 1146 THR A CG2  13 
ATOM   8232  H  H    . THR A 1 44 ? -8.546  5.597   -1.941  1.00 6.16  ? 1146 THR A H    13 
ATOM   8233  H  HA   . THR A 1 44 ? -11.310 5.153   -2.721  1.00 6.75  ? 1146 THR A HA   13 
ATOM   8234  H  HB   . THR A 1 44 ? -10.241 4.030   -4.719  1.00 8.40  ? 1146 THR A HB   13 
ATOM   8235  H  HG1  . THR A 1 44 ? -8.179  3.719   -3.499  1.00 8.03  ? 1146 THR A HG1  13 
ATOM   8236  H  HG21 . THR A 1 44 ? -11.021 6.323   -4.840  1.00 7.71  ? 1146 THR A HG21 13 
ATOM   8237  H  HG22 . THR A 1 44 ? -9.494  6.178   -5.711  1.00 7.80  ? 1146 THR A HG22 13 
ATOM   8238  H  HG23 . THR A 1 44 ? -9.527  6.900   -4.100  1.00 8.03  ? 1146 THR A HG23 13 
ATOM   8239  N  N    . GLU A 1 45 ? -11.173 3.089   -1.131  1.00 7.13  ? 1147 GLU A N    13 
ATOM   8240  C  CA   . GLU A 1 45 ? -11.351 1.756   -0.568  1.00 7.94  ? 1147 GLU A CA   13 
ATOM   8241  C  C    . GLU A 1 45 ? -12.293 0.933   -1.442  1.00 8.95  ? 1147 GLU A C    13 
ATOM   8242  O  O    . GLU A 1 45 ? -12.349 -0.295  -1.336  1.00 9.87  ? 1147 GLU A O    13 
ATOM   8243  C  CB   . GLU A 1 45 ? -11.876 1.838   0.870   1.00 7.79  ? 1147 GLU A CB   13 
ATOM   8244  C  CG   . GLU A 1 45 ? -13.147 2.657   1.020   1.00 7.90  ? 1147 GLU A CG   13 
ATOM   8245  C  CD   . GLU A 1 45 ? -13.643 2.699   2.449   1.00 8.00  ? 1147 GLU A CD   13 
ATOM   8246  O  OE1  . GLU A 1 45 ? -13.081 3.464   3.258   1.00 8.08  ? 1147 GLU A OE1  13 
ATOM   8247  O  OE2  . GLU A 1 45 ? -14.600 1.966   2.774   1.00 8.23  ? 1147 GLU A OE2  13 
ATOM   8248  H  H    . GLU A 1 45 ? -11.634 3.850   -0.719  1.00 6.60  ? 1147 GLU A H    13 
ATOM   8249  H  HA   . GLU A 1 45 ? -10.384 1.274   -0.560  1.00 8.20  ? 1147 GLU A HA   13 
ATOM   8250  H  HB2  . GLU A 1 45 ? -12.077 0.838   1.223   1.00 8.33  ? 1147 GLU A HB2  13 
ATOM   8251  H  HB3  . GLU A 1 45 ? -11.114 2.282   1.493   1.00 7.37  ? 1147 GLU A HB3  13 
ATOM   8252  H  HG2  . GLU A 1 45 ? -12.951 3.668   0.693   1.00 7.80  ? 1147 GLU A HG2  13 
ATOM   8253  H  HG3  . GLU A 1 45 ? -13.916 2.222   0.399   1.00 8.35  ? 1147 GLU A HG3  13 
ATOM   8254  N  N    . THR A 1 46 ? -13.031 1.622   -2.305  1.00 8.94  ? 1148 THR A N    13 
ATOM   8255  C  CA   . THR A 1 46 ? -13.881 0.966   -3.279  1.00 10.03 ? 1148 THR A CA   13 
ATOM   8256  C  C    . THR A 1 46 ? -13.037 0.408   -4.422  1.00 10.71 ? 1148 THR A C    13 
ATOM   8257  O  O    . THR A 1 46 ? -12.655 1.133   -5.343  1.00 11.12 ? 1148 THR A O    13 
ATOM   8258  C  CB   . THR A 1 46 ? -14.946 1.936   -3.832  1.00 10.21 ? 1148 THR A CB   13 
ATOM   8259  O  OG1  . THR A 1 46 ? -14.367 3.234   -4.048  1.00 9.58  ? 1148 THR A OG1  13 
ATOM   8260  C  CG2  . THR A 1 46 ? -16.124 2.055   -2.876  1.00 11.01 ? 1148 THR A CG2  13 
ATOM   8261  H  H    . THR A 1 46 ? -12.996 2.601   -2.287  1.00 8.30  ? 1148 THR A H    13 
ATOM   8262  H  HA   . THR A 1 46 ? -14.387 0.149   -2.785  1.00 10.45 ? 1148 THR A HA   13 
ATOM   8263  H  HB   . THR A 1 46 ? -15.305 1.551   -4.775  1.00 10.48 ? 1148 THR A HB   13 
ATOM   8264  H  HG1  . THR A 1 46 ? -14.340 3.417   -4.995  1.00 9.43  ? 1148 THR A HG1  13 
ATOM   8265  H  HG21 . THR A 1 46 ? -15.776 2.417   -1.920  1.00 11.19 ? 1148 THR A HG21 13 
ATOM   8266  H  HG22 . THR A 1 46 ? -16.583 1.086   -2.748  1.00 11.07 ? 1148 THR A HG22 13 
ATOM   8267  H  HG23 . THR A 1 46 ? -16.848 2.746   -3.282  1.00 11.53 ? 1148 THR A HG23 13 
HETATM 8268  CA CA   . CA  B 2 .  ? -1.455  -2.879  -5.542  1.00 0.28  ? 1201 CA  A CA   13 
ATOM   8269  N  N    . THR A 1 1  ? 11.879  -7.149  12.282  1.00 12.23 ? 1103 THR A N    14 
ATOM   8270  C  CA   . THR A 1 1  ? 11.578  -6.817  13.689  1.00 11.73 ? 1103 THR A CA   14 
ATOM   8271  C  C    . THR A 1 1  ? 10.889  -5.457  13.789  1.00 10.83 ? 1103 THR A C    14 
ATOM   8272  O  O    . THR A 1 1  ? 9.899   -5.310  14.504  1.00 10.67 ? 1103 THR A O    14 
ATOM   8273  C  CB   . THR A 1 1  ? 12.864  -6.805  14.541  1.00 11.83 ? 1103 THR A CB   14 
ATOM   8274  O  OG1  . THR A 1 1  ? 13.615  -8.007  14.304  1.00 12.26 ? 1103 THR A OG1  14 
ATOM   8275  C  CG2  . THR A 1 1  ? 12.536  -6.697  16.024  1.00 12.04 ? 1103 THR A CG2  14 
ATOM   8276  H  H1   . THR A 1 1  ? 12.563  -6.472  11.891  1.00 12.23 ? 1103 THR A H1   14 
ATOM   8277  H  H2   . THR A 1 1  ? 11.010  -7.111  11.713  1.00 12.55 ? 1103 THR A H2   14 
ATOM   8278  H  H3   . THR A 1 1  ? 12.280  -8.106  12.219  1.00 12.44 ? 1103 THR A H3   14 
ATOM   8279  H  HA   . THR A 1 1  ? 10.915  -7.573  14.083  1.00 12.16 ? 1103 THR A HA   14 
ATOM   8280  H  HB   . THR A 1 1  ? 13.461  -5.952  14.256  1.00 11.67 ? 1103 THR A HB   14 
ATOM   8281  H  HG1  . THR A 1 1  ? 14.189  -7.879  13.536  1.00 12.30 ? 1103 THR A HG1  14 
ATOM   8282  H  HG21 . THR A 1 1  ? 11.987  -5.785  16.205  1.00 12.31 ? 1103 THR A HG21 14 
ATOM   8283  H  HG22 . THR A 1 1  ? 13.453  -6.686  16.594  1.00 12.05 ? 1103 THR A HG22 14 
ATOM   8284  H  HG23 . THR A 1 1  ? 11.937  -7.544  16.321  1.00 12.10 ? 1103 THR A HG23 14 
ATOM   8285  N  N    . HIS A 1 2  ? 11.402  -4.465  13.060  1.00 10.41 ? 1104 HIS A N    14 
ATOM   8286  C  CA   . HIS A 1 2  ? 10.815  -3.129  13.077  1.00 9.72  ? 1104 HIS A CA   14 
ATOM   8287  C  C    . HIS A 1 2  ? 11.402  -2.256  11.970  1.00 8.65  ? 1104 HIS A C    14 
ATOM   8288  O  O    . HIS A 1 2  ? 10.689  -1.461  11.360  1.00 8.32  ? 1104 HIS A O    14 
ATOM   8289  C  CB   . HIS A 1 2  ? 11.029  -2.458  14.440  1.00 10.05 ? 1104 HIS A CB   14 
ATOM   8290  C  CG   . HIS A 1 2  ? 10.369  -1.117  14.560  1.00 10.43 ? 1104 HIS A CG   14 
ATOM   8291  N  ND1  . HIS A 1 2  ? 11.044  0.074   14.399  1.00 10.71 ? 1104 HIS A ND1  14 
ATOM   8292  C  CD2  . HIS A 1 2  ? 9.083   -0.785  14.824  1.00 10.84 ? 1104 HIS A CD2  14 
ATOM   8293  C  CE1  . HIS A 1 2  ? 10.202  1.078   14.559  1.00 11.25 ? 1104 HIS A CE1  14 
ATOM   8294  N  NE2  . HIS A 1 2  ? 9.008   0.584   14.816  1.00 11.34 ? 1104 HIS A NE2  14 
ATOM   8295  H  H    . HIS A 1 2  ? 12.184  -4.636  12.492  1.00 10.71 ? 1104 HIS A H    14 
ATOM   8296  H  HA   . HIS A 1 2  ? 9.755   -3.234  12.906  1.00 9.96  ? 1104 HIS A HA   14 
ATOM   8297  H  HB2  . HIS A 1 2  ? 10.628  -3.095  15.213  1.00 10.50 ? 1104 HIS A HB2  14 
ATOM   8298  H  HB3  . HIS A 1 2  ? 12.088  -2.324  14.605  1.00 9.81  ? 1104 HIS A HB3  14 
ATOM   8299  H  HD1  . HIS A 1 2  ? 12.004  0.171   14.197  1.00 10.68 ? 1104 HIS A HD1  14 
ATOM   8300  H  HD2  . HIS A 1 2  ? 8.268   -1.471  15.007  1.00 10.94 ? 1104 HIS A HD2  14 
ATOM   8301  H  HE1  . HIS A 1 2  ? 10.449  2.127   14.491  1.00 11.71 ? 1104 HIS A HE1  14 
ATOM   8302  H  HE2  . HIS A 1 2  ? 8.226   1.114   15.086  1.00 11.83 ? 1104 HIS A HE2  14 
ATOM   8303  N  N    . ALA A 1 3  ? 12.702  -2.403  11.729  1.00 8.30  ? 1105 ALA A N    14 
ATOM   8304  C  CA   . ALA A 1 3  ? 13.397  -1.617  10.713  1.00 7.41  ? 1105 ALA A CA   14 
ATOM   8305  C  C    . ALA A 1 3  ? 12.733  -1.759  9.345   1.00 6.47  ? 1105 ALA A C    14 
ATOM   8306  O  O    . ALA A 1 3  ? 12.587  -2.871  8.829   1.00 6.54  ? 1105 ALA A O    14 
ATOM   8307  C  CB   . ALA A 1 3  ? 14.859  -2.033  10.635  1.00 7.70  ? 1105 ALA A CB   14 
ATOM   8308  H  H    . ALA A 1 3  ? 13.214  -3.047  12.260  1.00 8.79  ? 1105 ALA A H    14 
ATOM   8309  H  HA   . ALA A 1 3  ? 13.360  -0.580  11.012  1.00 7.45  ? 1105 ALA A HA   14 
ATOM   8310  H  HB1  . ALA A 1 3  ? 14.924  -3.067  10.331  1.00 7.93  ? 1105 ALA A HB1  14 
ATOM   8311  H  HB2  . ALA A 1 3  ? 15.319  -1.914  11.604  1.00 7.73  ? 1105 ALA A HB2  14 
ATOM   8312  H  HB3  . ALA A 1 3  ? 15.372  -1.414  9.915   1.00 7.95  ? 1105 ALA A HB3  14 
ATOM   8313  N  N    . PRO A 1 4  ? 12.308  -0.635  8.754   1.00 5.80  ? 1106 PRO A N    14 
ATOM   8314  C  CA   . PRO A 1 4  ? 11.654  -0.627  7.449   1.00 4.97  ? 1106 PRO A CA   14 
ATOM   8315  C  C    . PRO A 1 4  ? 12.655  -0.749  6.306   1.00 4.25  ? 1106 PRO A C    14 
ATOM   8316  O  O    . PRO A 1 4  ? 13.815  -0.351  6.435   1.00 4.22  ? 1106 PRO A O    14 
ATOM   8317  C  CB   . PRO A 1 4  ? 10.964  0.737   7.417   1.00 4.84  ? 1106 PRO A CB   14 
ATOM   8318  C  CG   . PRO A 1 4  ? 11.820  1.613   8.267   1.00 5.55  ? 1106 PRO A CG   14 
ATOM   8319  C  CD   . PRO A 1 4  ? 12.429  0.724   9.320   1.00 6.09  ? 1106 PRO A CD   14 
ATOM   8320  H  HA   . PRO A 1 4  ? 10.916  -1.411  7.369   1.00 5.32  ? 1106 PRO A HA   14 
ATOM   8321  H  HB2  . PRO A 1 4  ? 10.918  1.096   6.399   1.00 4.32  ? 1106 PRO A HB2  14 
ATOM   8322  H  HB3  . PRO A 1 4  ? 9.966   0.650   7.820   1.00 5.12  ? 1106 PRO A HB3  14 
ATOM   8323  H  HG2  . PRO A 1 4  ? 12.594  2.065   7.664   1.00 5.52  ? 1106 PRO A HG2  14 
ATOM   8324  H  HG3  . PRO A 1 4  ? 11.212  2.377   8.730   1.00 6.00  ? 1106 PRO A HG3  14 
ATOM   8325  H  HD2  . PRO A 1 4  ? 13.466  0.981   9.474   1.00 6.19  ? 1106 PRO A HD2  14 
ATOM   8326  H  HD3  . PRO A 1 4  ? 11.878  0.805   10.244  1.00 6.80  ? 1106 PRO A HD3  14 
ATOM   8327  N  N    . ALA A 1 5  ? 12.208  -1.307  5.191   1.00 4.09  ? 1107 ALA A N    14 
ATOM   8328  C  CA   . ALA A 1 5  ? 13.068  -1.478  4.031   1.00 3.77  ? 1107 ALA A CA   14 
ATOM   8329  C  C    . ALA A 1 5  ? 13.178  -0.175  3.251   1.00 2.63  ? 1107 ALA A C    14 
ATOM   8330  O  O    . ALA A 1 5  ? 12.176  0.370   2.785   1.00 2.62  ? 1107 ALA A O    14 
ATOM   8331  C  CB   . ALA A 1 5  ? 12.551  -2.597  3.137   1.00 4.73  ? 1107 ALA A CB   14 
ATOM   8332  H  H    . ALA A 1 5  ? 11.273  -1.599  5.143   1.00 4.51  ? 1107 ALA A H    14 
ATOM   8333  H  HA   . ALA A 1 5  ? 14.051  -1.756  4.384   1.00 4.04  ? 1107 ALA A HA   14 
ATOM   8334  H  HB1  . ALA A 1 5  ? 13.221  -2.730  2.301   1.00 5.01  ? 1107 ALA A HB1  14 
ATOM   8335  H  HB2  . ALA A 1 5  ? 11.567  -2.343  2.773   1.00 4.95  ? 1107 ALA A HB2  14 
ATOM   8336  H  HB3  . ALA A 1 5  ? 12.497  -3.513  3.705   1.00 5.29  ? 1107 ALA A HB3  14 
ATOM   8337  N  N    . SER A 1 6  ? 14.392  0.329   3.129   1.00 2.16  ? 1108 SER A N    14 
ATOM   8338  C  CA   . SER A 1 6  ? 14.631  1.575   2.423   1.00 1.43  ? 1108 SER A CA   14 
ATOM   8339  C  C    . SER A 1 6  ? 14.500  1.374   0.915   1.00 1.29  ? 1108 SER A C    14 
ATOM   8340  O  O    . SER A 1 6  ? 15.380  0.803   0.272   1.00 1.97  ? 1108 SER A O    14 
ATOM   8341  C  CB   . SER A 1 6  ? 16.016  2.106   2.782   1.00 2.09  ? 1108 SER A CB   14 
ATOM   8342  O  OG   . SER A 1 6  ? 16.989  1.076   2.702   1.00 2.97  ? 1108 SER A OG   14 
ATOM   8343  H  H    . SER A 1 6  ? 15.153  -0.151  3.516   1.00 2.71  ? 1108 SER A H    14 
ATOM   8344  H  HA   . SER A 1 6  ? 13.888  2.287   2.746   1.00 1.32  ? 1108 SER A HA   14 
ATOM   8345  H  HB2  . SER A 1 6  ? 16.285  2.893   2.096   1.00 2.36  ? 1108 SER A HB2  14 
ATOM   8346  H  HB3  . SER A 1 6  ? 16.002  2.494   3.789   1.00 2.13  ? 1108 SER A HB3  14 
ATOM   8347  H  HG   . SER A 1 6  ? 17.451  1.004   3.547   1.00 3.32  ? 1108 SER A HG   14 
ATOM   8348  N  N    . CYS A 1 7  ? 13.387  1.824   0.364   1.00 0.72  ? 1109 CYS A N    14 
ATOM   8349  C  CA   . CYS A 1 7  ? 13.125  1.682   -1.058  1.00 0.49  ? 1109 CYS A CA   14 
ATOM   8350  C  C    . CYS A 1 7  ? 13.382  2.992   -1.795  1.00 0.46  ? 1109 CYS A C    14 
ATOM   8351  O  O    . CYS A 1 7  ? 14.002  3.913   -1.251  1.00 0.62  ? 1109 CYS A O    14 
ATOM   8352  C  CB   . CYS A 1 7  ? 11.687  1.210   -1.277  1.00 0.33  ? 1109 CYS A CB   14 
ATOM   8353  S  SG   . CYS A 1 7  ? 11.309  -0.377  -0.462  1.00 0.47  ? 1109 CYS A SG   14 
ATOM   8354  H  H    . CYS A 1 7  ? 12.713  2.258   0.933   1.00 0.94  ? 1109 CYS A H    14 
ATOM   8355  H  HA   . CYS A 1 7  ? 13.798  0.934   -1.446  1.00 0.60  ? 1109 CYS A HA   14 
ATOM   8356  H  HB2  . CYS A 1 7  ? 11.006  1.953   -0.888  1.00 0.41  ? 1109 CYS A HB2  14 
ATOM   8357  H  HB3  . CYS A 1 7  ? 11.511  1.088   -2.336  1.00 0.29  ? 1109 CYS A HB3  14 
ATOM   8358  N  N    . LEU A 1 8  ? 12.926  3.059   -3.035  1.00 0.34  ? 1110 LEU A N    14 
ATOM   8359  C  CA   . LEU A 1 8  ? 13.085  4.247   -3.862  1.00 0.32  ? 1110 LEU A CA   14 
ATOM   8360  C  C    . LEU A 1 8  ? 12.186  5.372   -3.358  1.00 0.29  ? 1110 LEU A C    14 
ATOM   8361  O  O    . LEU A 1 8  ? 11.355  5.160   -2.474  1.00 0.30  ? 1110 LEU A O    14 
ATOM   8362  C  CB   . LEU A 1 8  ? 12.707  3.901   -5.300  1.00 0.28  ? 1110 LEU A CB   14 
ATOM   8363  C  CG   . LEU A 1 8  ? 13.455  4.636   -6.408  1.00 0.38  ? 1110 LEU A CG   14 
ATOM   8364  C  CD1  . LEU A 1 8  ? 14.953  4.372   -6.327  1.00 0.52  ? 1110 LEU A CD1  14 
ATOM   8365  C  CD2  . LEU A 1 8  ? 12.905  4.202   -7.759  1.00 0.39  ? 1110 LEU A CD2  14 
ATOM   8366  H  H    . LEU A 1 8  ? 12.472  2.276   -3.415  1.00 0.34  ? 1110 LEU A H    14 
ATOM   8367  H  HA   . LEU A 1 8  ? 14.115  4.560   -3.824  1.00 0.40  ? 1110 LEU A HA   14 
ATOM   8368  H  HB2  . LEU A 1 8  ? 12.852  2.844   -5.437  1.00 0.32  ? 1110 LEU A HB2  14 
ATOM   8369  H  HB3  . LEU A 1 8  ? 11.652  4.107   -5.422  1.00 0.22  ? 1110 LEU A HB3  14 
ATOM   8370  H  HG   . LEU A 1 8  ? 13.294  5.698   -6.304  1.00 0.41  ? 1110 LEU A HG   14 
ATOM   8371  H  HD11 . LEU A 1 8  ? 15.134  3.309   -6.377  1.00 1.05  ? 1110 LEU A HD11 14 
ATOM   8372  H  HD12 . LEU A 1 8  ? 15.337  4.758   -5.395  1.00 1.29  ? 1110 LEU A HD12 14 
ATOM   8373  H  HD13 . LEU A 1 8  ? 15.450  4.860   -7.150  1.00 1.07  ? 1110 LEU A HD13 14 
ATOM   8374  H  HD21 . LEU A 1 8  ? 13.454  4.689   -8.549  1.00 1.11  ? 1110 LEU A HD21 14 
ATOM   8375  H  HD22 . LEU A 1 8  ? 11.860  4.475   -7.824  1.00 1.05  ? 1110 LEU A HD22 14 
ATOM   8376  H  HD23 . LEU A 1 8  ? 12.998  3.129   -7.857  1.00 0.97  ? 1110 LEU A HD23 14 
ATOM   8377  N  N    . ASP A 1 9  ? 12.333  6.554   -3.929  1.00 0.35  ? 1111 ASP A N    14 
ATOM   8378  C  CA   . ASP A 1 9  ? 11.476  7.673   -3.565  1.00 0.38  ? 1111 ASP A CA   14 
ATOM   8379  C  C    . ASP A 1 9  ? 10.100  7.516   -4.198  1.00 0.32  ? 1111 ASP A C    14 
ATOM   8380  O  O    . ASP A 1 9  ? 9.083   7.838   -3.586  1.00 0.42  ? 1111 ASP A O    14 
ATOM   8381  C  CB   . ASP A 1 9  ? 12.108  9.005   -3.970  1.00 0.51  ? 1111 ASP A CB   14 
ATOM   8382  C  CG   . ASP A 1 9  ? 13.207  9.429   -3.022  1.00 1.37  ? 1111 ASP A CG   14 
ATOM   8383  O  OD1  . ASP A 1 9  ? 12.890  10.032  -1.977  1.00 1.53  ? 1111 ASP A OD1  14 
ATOM   8384  O  OD2  . ASP A 1 9  ? 14.392  9.160   -3.312  1.00 2.32  ? 1111 ASP A OD2  14 
ATOM   8385  H  H    . ASP A 1 9  ? 13.028  6.683   -4.608  1.00 0.40  ? 1111 ASP A H    14 
ATOM   8386  H  HA   . ASP A 1 9  ? 11.361  7.657   -2.491  1.00 0.44  ? 1111 ASP A HA   14 
ATOM   8387  H  HB2  . ASP A 1 9  ? 12.530  8.913   -4.959  1.00 0.94  ? 1111 ASP A HB2  14 
ATOM   8388  H  HB3  . ASP A 1 9  ? 11.348  9.770   -3.978  1.00 1.01  ? 1111 ASP A HB3  14 
ATOM   8389  N  N    . THR A 1 10 ? 10.072  7.002   -5.419  1.00 0.28  ? 1112 THR A N    14 
ATOM   8390  C  CA   . THR A 1 10 ? 8.814   6.717   -6.091  1.00 0.31  ? 1112 THR A CA   14 
ATOM   8391  C  C    . THR A 1 10 ? 8.365   5.283   -5.828  1.00 0.24  ? 1112 THR A C    14 
ATOM   8392  O  O    . THR A 1 10 ? 7.388   4.805   -6.412  1.00 0.30  ? 1112 THR A O    14 
ATOM   8393  C  CB   . THR A 1 10 ? 8.913   6.957   -7.608  1.00 0.42  ? 1112 THR A CB   14 
ATOM   8394  O  OG1  . THR A 1 10 ? 10.100  6.346   -8.128  1.00 0.45  ? 1112 THR A OG1  14 
ATOM   8395  C  CG2  . THR A 1 10 ? 8.916   8.446   -7.919  1.00 0.52  ? 1112 THR A CG2  14 
ATOM   8396  H  H    . THR A 1 10 ? 10.915  6.827   -5.889  1.00 0.31  ? 1112 THR A H    14 
ATOM   8397  H  HA   . THR A 1 10 ? 8.070   7.391   -5.691  1.00 0.36  ? 1112 THR A HA   14 
ATOM   8398  H  HB   . THR A 1 10 ? 8.052   6.509   -8.083  1.00 0.48  ? 1112 THR A HB   14 
ATOM   8399  H  HG1  . THR A 1 10 ? 10.724  7.037   -8.395  1.00 0.95  ? 1112 THR A HG1  14 
ATOM   8400  H  HG21 . THR A 1 10 ? 8.957   8.590   -8.987  1.00 1.19  ? 1112 THR A HG21 14 
ATOM   8401  H  HG22 . THR A 1 10 ? 9.779   8.906   -7.460  1.00 1.09  ? 1112 THR A HG22 14 
ATOM   8402  H  HG23 . THR A 1 10 ? 8.017   8.897   -7.528  1.00 1.17  ? 1112 THR A HG23 14 
ATOM   8403  N  N    . GLN A 1 11 ? 9.091   4.588   -4.960  1.00 0.18  ? 1113 GLN A N    14 
ATOM   8404  C  CA   . GLN A 1 11 ? 8.698   3.260   -4.539  1.00 0.17  ? 1113 GLN A CA   14 
ATOM   8405  C  C    . GLN A 1 11 ? 8.031   3.288   -3.180  1.00 0.17  ? 1113 GLN A C    14 
ATOM   8406  O  O    . GLN A 1 11 ? 8.212   4.217   -2.395  1.00 0.23  ? 1113 GLN A O    14 
ATOM   8407  C  CB   . GLN A 1 11 ? 9.895   2.325   -4.491  1.00 0.17  ? 1113 GLN A CB   14 
ATOM   8408  C  CG   . GLN A 1 11 ? 10.312  1.821   -5.854  1.00 0.23  ? 1113 GLN A CG   14 
ATOM   8409  C  CD   . GLN A 1 11 ? 11.376  0.750   -5.773  1.00 0.35  ? 1113 GLN A CD   14 
ATOM   8410  O  OE1  . GLN A 1 11 ? 12.183  0.731   -4.840  1.00 1.02  ? 1113 GLN A OE1  14 
ATOM   8411  N  NE2  . GLN A 1 11 ? 11.387  -0.148  -6.740  1.00 0.67  ? 1113 GLN A NE2  14 
ATOM   8412  H  H    . GLN A 1 11 ? 9.918   4.973   -4.602  1.00 0.20  ? 1113 GLN A H    14 
ATOM   8413  H  HA   . GLN A 1 11 ? 7.990   2.882   -5.262  1.00 0.22  ? 1113 GLN A HA   14 
ATOM   8414  H  HB2  . GLN A 1 11 ? 10.731  2.850   -4.051  1.00 0.16  ? 1113 GLN A HB2  14 
ATOM   8415  H  HB3  . GLN A 1 11 ? 9.653   1.477   -3.874  1.00 0.20  ? 1113 GLN A HB3  14 
ATOM   8416  H  HG2  . GLN A 1 11 ? 9.447   1.419   -6.346  1.00 0.31  ? 1113 GLN A HG2  14 
ATOM   8417  H  HG3  . GLN A 1 11 ? 10.699  2.650   -6.430  1.00 0.22  ? 1113 GLN A HG3  14 
ATOM   8418  H  HE21 . GLN A 1 11 ? 10.708  -0.074  -7.450  1.00 1.21  ? 1113 GLN A HE21 14 
ATOM   8419  H  HE22 . GLN A 1 11 ? 12.074  -0.848  -6.718  1.00 0.65  ? 1113 GLN A HE22 14 
ATOM   8420  N  N    . TYR A 1 12 ? 7.260   2.258   -2.924  1.00 0.15  ? 1114 TYR A N    14 
ATOM   8421  C  CA   . TYR A 1 12 ? 6.602   2.084   -1.648  1.00 0.16  ? 1114 TYR A CA   14 
ATOM   8422  C  C    . TYR A 1 12 ? 7.184   0.879   -0.941  1.00 0.15  ? 1114 TYR A C    14 
ATOM   8423  O  O    . TYR A 1 12 ? 7.597   -0.089  -1.582  1.00 0.15  ? 1114 TYR A O    14 
ATOM   8424  C  CB   . TYR A 1 12 ? 5.101   1.885   -1.841  1.00 0.18  ? 1114 TYR A CB   14 
ATOM   8425  C  CG   . TYR A 1 12 ? 4.330   1.676   -0.555  1.00 0.22  ? 1114 TYR A CG   14 
ATOM   8426  C  CD1  . TYR A 1 12 ? 4.160   2.721   0.348   1.00 0.33  ? 1114 TYR A CD1  14 
ATOM   8427  C  CD2  . TYR A 1 12 ? 3.763   0.448   -0.248  1.00 0.21  ? 1114 TYR A CD2  14 
ATOM   8428  C  CE1  . TYR A 1 12 ? 3.448   2.545   1.518   1.00 0.39  ? 1114 TYR A CE1  14 
ATOM   8429  C  CE2  . TYR A 1 12 ? 3.051   0.264   0.922   1.00 0.26  ? 1114 TYR A CE2  14 
ATOM   8430  C  CZ   . TYR A 1 12 ? 2.933   1.267   1.815   1.00 0.34  ? 1114 TYR A CZ   14 
ATOM   8431  O  OH   . TYR A 1 12 ? 2.177   1.139   2.959   1.00 0.41  ? 1114 TYR A OH   14 
ATOM   8432  H  H    . TYR A 1 12 ? 7.139   1.574   -3.623  1.00 0.16  ? 1114 TYR A H    14 
ATOM   8433  H  HA   . TYR A 1 12 ? 6.774   2.967   -1.052  1.00 0.18  ? 1114 TYR A HA   14 
ATOM   8434  H  HB2  . TYR A 1 12 ? 4.689   2.745   -2.344  1.00 0.23  ? 1114 TYR A HB2  14 
ATOM   8435  H  HB3  . TYR A 1 12 ? 4.954   1.014   -2.450  1.00 0.18  ? 1114 TYR A HB3  14 
ATOM   8436  H  HD1  . TYR A 1 12 ? 4.596   3.684   0.123   1.00 0.40  ? 1114 TYR A HD1  14 
ATOM   8437  H  HD2  . TYR A 1 12 ? 3.887   -0.374  -0.937  1.00 0.23  ? 1114 TYR A HD2  14 
ATOM   8438  H  HE1  . TYR A 1 12 ? 3.328   3.368   2.206   1.00 0.50  ? 1114 TYR A HE1  14 
ATOM   8439  H  HE2  . TYR A 1 12 ? 2.619   -0.701  1.144   1.00 0.29  ? 1114 TYR A HE2  14 
ATOM   8440  H  HH   . TYR A 1 12 ? 1.557   1.874   3.064   1.00 0.89  ? 1114 TYR A HH   14 
ATOM   8441  N  N    . THR A 1 13 ? 7.205   0.944   0.370   1.00 0.18  ? 1115 THR A N    14 
ATOM   8442  C  CA   . THR A 1 13 ? 7.702   -0.148  1.174   1.00 0.20  ? 1115 THR A CA   14 
ATOM   8443  C  C    . THR A 1 13 ? 6.538   -0.925  1.760   1.00 0.23  ? 1115 THR A C    14 
ATOM   8444  O  O    . THR A 1 13 ? 5.833   -0.437  2.647   1.00 0.31  ? 1115 THR A O    14 
ATOM   8445  C  CB   . THR A 1 13 ? 8.608   0.346   2.316   1.00 0.26  ? 1115 THR A CB   14 
ATOM   8446  O  OG1  . THR A 1 13 ? 9.569   1.284   1.805   1.00 0.30  ? 1115 THR A OG1  14 
ATOM   8447  C  CG2  . THR A 1 13 ? 9.334   -0.825  2.965   1.00 0.27  ? 1115 THR A CG2  14 
ATOM   8448  H  H    . THR A 1 13 ? 6.853   1.742   0.807   1.00 0.22  ? 1115 THR A H    14 
ATOM   8449  H  HA   . THR A 1 13 ? 8.279   -0.803  0.536   1.00 0.19  ? 1115 THR A HA   14 
ATOM   8450  H  HB   . THR A 1 13 ? 7.996   0.833   3.060   1.00 0.31  ? 1115 THR A HB   14 
ATOM   8451  H  HG1  . THR A 1 13 ? 10.462  0.967   2.001   1.00 0.82  ? 1115 THR A HG1  14 
ATOM   8452  H  HG21 . THR A 1 13 ? 9.916   -0.469  3.801   1.00 1.01  ? 1115 THR A HG21 14 
ATOM   8453  H  HG22 . THR A 1 13 ? 9.991   -1.282  2.242   1.00 1.02  ? 1115 THR A HG22 14 
ATOM   8454  H  HG23 . THR A 1 13 ? 8.616   -1.558  3.309   1.00 1.10  ? 1115 THR A HG23 14 
ATOM   8455  N  N    . CYS A 1 14 ? 6.321   -2.117  1.236   1.00 0.26  ? 1116 CYS A N    14 
ATOM   8456  C  CA   . CYS A 1 14 ? 5.255   -2.978  1.712   1.00 0.34  ? 1116 CYS A CA   14 
ATOM   8457  C  C    . CYS A 1 14 ? 5.490   -3.381  3.161   1.00 0.40  ? 1116 CYS A C    14 
ATOM   8458  O  O    . CYS A 1 14 ? 6.616   -3.306  3.659   1.00 0.37  ? 1116 CYS A O    14 
ATOM   8459  C  CB   . CYS A 1 14 ? 5.163   -4.233  0.849   1.00 0.45  ? 1116 CYS A CB   14 
ATOM   8460  S  SG   . CYS A 1 14 ? 4.922   -3.905  -0.922  1.00 0.65  ? 1116 CYS A SG   14 
ATOM   8461  H  H    . CYS A 1 14 ? 6.896   -2.425  0.496   1.00 0.28  ? 1116 CYS A H    14 
ATOM   8462  H  HA   . CYS A 1 14 ? 4.327   -2.433  1.643   1.00 0.38  ? 1116 CYS A HA   14 
ATOM   8463  H  HB2  . CYS A 1 14 ? 6.074   -4.801  0.956   1.00 0.50  ? 1116 CYS A HB2  14 
ATOM   8464  H  HB3  . CYS A 1 14 ? 4.331   -4.832  1.190   1.00 0.54  ? 1116 CYS A HB3  14 
ATOM   8465  N  N    . ASP A 1 15 ? 4.431   -3.826  3.822   1.00 0.56  ? 1117 ASP A N    14 
ATOM   8466  C  CA   . ASP A 1 15 ? 4.537   -4.330  5.187   1.00 0.69  ? 1117 ASP A CA   14 
ATOM   8467  C  C    . ASP A 1 15 ? 5.496   -5.513  5.228   1.00 0.65  ? 1117 ASP A C    14 
ATOM   8468  O  O    . ASP A 1 15 ? 6.203   -5.727  6.210   1.00 0.71  ? 1117 ASP A O    14 
ATOM   8469  C  CB   . ASP A 1 15 ? 3.161   -4.752  5.702   1.00 0.93  ? 1117 ASP A CB   14 
ATOM   8470  C  CG   . ASP A 1 15 ? 3.189   -5.217  7.141   1.00 1.83  ? 1117 ASP A CG   14 
ATOM   8471  O  OD1  . ASP A 1 15 ? 3.237   -4.355  8.044   1.00 2.62  ? 1117 ASP A OD1  14 
ATOM   8472  O  OD2  . ASP A 1 15 ? 3.141   -6.444  7.375   1.00 2.09  ? 1117 ASP A OD2  14 
ATOM   8473  H  H    . ASP A 1 15 ? 3.551   -3.809  3.387   1.00 0.63  ? 1117 ASP A H    14 
ATOM   8474  H  HA   . ASP A 1 15 ? 4.925   -3.537  5.810   1.00 0.70  ? 1117 ASP A HA   14 
ATOM   8475  H  HB2  . ASP A 1 15 ? 2.486   -3.913  5.630   1.00 1.35  ? 1117 ASP A HB2  14 
ATOM   8476  H  HB3  . ASP A 1 15 ? 2.789   -5.559  5.088   1.00 0.70  ? 1117 ASP A HB3  14 
ATOM   8477  N  N    . ASN A 1 16 ? 5.540   -6.251  4.120   1.00 0.69  ? 1118 ASN A N    14 
ATOM   8478  C  CA   . ASN A 1 16 ? 6.419   -7.408  3.984   1.00 0.75  ? 1118 ASN A CA   14 
ATOM   8479  C  C    . ASN A 1 16 ? 7.858   -6.985  3.685   1.00 0.59  ? 1118 ASN A C    14 
ATOM   8480  O  O    . ASN A 1 16 ? 8.686   -7.814  3.308   1.00 0.65  ? 1118 ASN A O    14 
ATOM   8481  C  CB   . ASN A 1 16 ? 5.927   -8.332  2.861   1.00 0.98  ? 1118 ASN A CB   14 
ATOM   8482  C  CG   . ASN A 1 16 ? 4.491   -8.756  3.016   1.00 1.77  ? 1118 ASN A CG   14 
ATOM   8483  O  OD1  . ASN A 1 16 ? 3.577   -8.088  2.522   1.00 2.75  ? 1118 ASN A OD1  14 
ATOM   8484  N  ND2  . ASN A 1 16 ? 4.276   -9.868  3.675   1.00 2.02  ? 1118 ASN A ND2  14 
ATOM   8485  H  H    . ASN A 1 16 ? 4.946   -6.017  3.376   1.00 0.75  ? 1118 ASN A H    14 
ATOM   8486  H  HA   . ASN A 1 16 ? 6.401   -7.950  4.915   1.00 0.85  ? 1118 ASN A HA   14 
ATOM   8487  H  HB2  . ASN A 1 16 ? 6.010   -7.824  1.924   1.00 1.24  ? 1118 ASN A HB2  14 
ATOM   8488  H  HB3  . ASN A 1 16 ? 6.543   -9.219  2.839   1.00 1.41  ? 1118 ASN A HB3  14 
ATOM   8489  H  HD21 . ASN A 1 16 ? 5.049   -10.359 4.029   1.00 1.91  ? 1118 ASN A HD21 14 
ATOM   8490  H  HD22 . ASN A 1 16 ? 3.352   -10.161 3.781   1.00 2.74  ? 1118 ASN A HD22 14 
ATOM   8491  N  N    . HIS A 1 17 ? 8.143   -5.689  3.855   1.00 0.46  ? 1119 HIS A N    14 
ATOM   8492  C  CA   . HIS A 1 17 ? 9.471   -5.127  3.591   1.00 0.41  ? 1119 HIS A CA   14 
ATOM   8493  C  C    . HIS A 1 17 ? 9.847   -5.305  2.121   1.00 0.44  ? 1119 HIS A C    14 
ATOM   8494  O  O    . HIS A 1 17 ? 10.938  -5.773  1.799   1.00 0.79  ? 1119 HIS A O    14 
ATOM   8495  C  CB   . HIS A 1 17 ? 10.539  -5.782  4.485   1.00 0.51  ? 1119 HIS A CB   14 
ATOM   8496  C  CG   . HIS A 1 17 ? 10.326  -5.582  5.956   1.00 0.63  ? 1119 HIS A CG   14 
ATOM   8497  N  ND1  . HIS A 1 17 ? 9.728   -6.525  6.767   1.00 0.94  ? 1119 HIS A ND1  14 
ATOM   8498  C  CD2  . HIS A 1 17 ? 10.649  -4.547  6.765   1.00 0.78  ? 1119 HIS A CD2  14 
ATOM   8499  C  CE1  . HIS A 1 17 ? 9.692   -6.075  8.005   1.00 1.05  ? 1119 HIS A CE1  14 
ATOM   8500  N  NE2  . HIS A 1 17 ? 10.244  -4.877  8.033   1.00 0.93  ? 1119 HIS A NE2  14 
ATOM   8501  H  H    . HIS A 1 17 ? 7.432   -5.088  4.174   1.00 0.47  ? 1119 HIS A H    14 
ATOM   8502  H  HA   . HIS A 1 17 ? 9.430   -4.064  3.809   1.00 0.38  ? 1119 HIS A HA   14 
ATOM   8503  H  HB2  . HIS A 1 17 ? 10.547  -6.845  4.299   1.00 0.60  ? 1119 HIS A HB2  14 
ATOM   8504  H  HB3  . HIS A 1 17 ? 11.507  -5.374  4.233   1.00 0.55  ? 1119 HIS A HB3  14 
ATOM   8505  H  HD1  . HIS A 1 17 ? 9.374   -7.396  6.478   1.00 1.18  ? 1119 HIS A HD1  14 
ATOM   8506  H  HD2  . HIS A 1 17 ? 11.139  -3.631  6.466   1.00 1.00  ? 1119 HIS A HD2  14 
ATOM   8507  H  HE1  . HIS A 1 17 ? 9.281   -6.601  8.855   1.00 1.35  ? 1119 HIS A HE1  14 
ATOM   8508  H  HE2  . HIS A 1 17 ? 10.164  -4.245  8.781   1.00 1.09  ? 1119 HIS A HE2  14 
ATOM   8509  N  N    . GLN A 1 18 ? 8.936   -4.925  1.235   1.00 0.40  ? 1120 GLN A N    14 
ATOM   8510  C  CA   . GLN A 1 18 ? 9.148   -5.092  -0.198  1.00 0.38  ? 1120 GLN A CA   14 
ATOM   8511  C  C    . GLN A 1 18 ? 9.036   -3.747  -0.911  1.00 0.29  ? 1120 GLN A C    14 
ATOM   8512  O  O    . GLN A 1 18 ? 8.268   -2.884  -0.494  1.00 0.39  ? 1120 GLN A O    14 
ATOM   8513  C  CB   . GLN A 1 18 ? 8.130   -6.087  -0.768  1.00 0.49  ? 1120 GLN A CB   14 
ATOM   8514  C  CG   . GLN A 1 18 ? 8.306   -6.372  -2.253  1.00 0.50  ? 1120 GLN A CG   14 
ATOM   8515  C  CD   . GLN A 1 18 ? 9.687   -6.900  -2.585  1.00 1.05  ? 1120 GLN A CD   14 
ATOM   8516  O  OE1  . GLN A 1 18 ? 10.605  -6.132  -2.876  1.00 1.91  ? 1120 GLN A OE1  14 
ATOM   8517  N  NE2  . GLN A 1 18 ? 9.849   -8.210  -2.534  1.00 1.51  ? 1120 GLN A NE2  14 
ATOM   8518  H  H    . GLN A 1 18 ? 8.110   -4.507  1.549   1.00 0.63  ? 1120 GLN A H    14 
ATOM   8519  H  HA   . GLN A 1 18 ? 10.143  -5.482  -0.344  1.00 0.42  ? 1120 GLN A HA   14 
ATOM   8520  H  HB2  . GLN A 1 18 ? 8.222   -7.020  -0.233  1.00 0.62  ? 1120 GLN A HB2  14 
ATOM   8521  H  HB3  . GLN A 1 18 ? 7.136   -5.693  -0.614  1.00 0.52  ? 1120 GLN A HB3  14 
ATOM   8522  H  HG2  . GLN A 1 18 ? 7.574   -7.105  -2.556  1.00 0.87  ? 1120 GLN A HG2  14 
ATOM   8523  H  HG3  . GLN A 1 18 ? 8.146   -5.456  -2.802  1.00 0.86  ? 1120 GLN A HG3  14 
ATOM   8524  H  HE21 . GLN A 1 18 ? 9.076   -8.764  -2.286  1.00 1.83  ? 1120 GLN A HE21 14 
ATOM   8525  H  HE22 . GLN A 1 18 ? 10.733  -8.576  -2.748  1.00 1.99  ? 1120 GLN A HE22 14 
ATOM   8526  N  N    . CYS A 1 19 ? 9.801   -3.582  -1.978  1.00 0.21  ? 1121 CYS A N    14 
ATOM   8527  C  CA   . CYS A 1 19 ? 9.827   -2.333  -2.717  1.00 0.21  ? 1121 CYS A CA   14 
ATOM   8528  C  C    . CYS A 1 19 ? 9.008   -2.436  -4.000  1.00 0.20  ? 1121 CYS A C    14 
ATOM   8529  O  O    . CYS A 1 19 ? 9.422   -3.081  -4.966  1.00 0.34  ? 1121 CYS A O    14 
ATOM   8530  C  CB   . CYS A 1 19 ? 11.270  -1.953  -3.044  1.00 0.34  ? 1121 CYS A CB   14 
ATOM   8531  S  SG   . CYS A 1 19 ? 12.323  -1.738  -1.572  1.00 0.42  ? 1121 CYS A SG   14 
ATOM   8532  H  H    . CYS A 1 19 ? 10.363  -4.328  -2.284  1.00 0.29  ? 1121 CYS A H    14 
ATOM   8533  H  HA   . CYS A 1 19 ? 9.396   -1.567  -2.090  1.00 0.24  ? 1121 CYS A HA   14 
ATOM   8534  H  HB2  . CYS A 1 19 ? 11.709  -2.730  -3.653  1.00 0.39  ? 1121 CYS A HB2  14 
ATOM   8535  H  HB3  . CYS A 1 19 ? 11.277  -1.023  -3.594  1.00 0.41  ? 1121 CYS A HB3  14 
ATOM   8536  N  N    . ILE A 1 20 ? 7.838   -1.814  -3.995  1.00 0.15  ? 1122 ILE A N    14 
ATOM   8537  C  CA   . ILE A 1 20 ? 6.998   -1.755  -5.183  1.00 0.14  ? 1122 ILE A CA   14 
ATOM   8538  C  C    . ILE A 1 20 ? 6.865   -0.314  -5.649  1.00 0.14  ? 1122 ILE A C    14 
ATOM   8539  O  O    . ILE A 1 20 ? 7.336   0.597   -4.983  1.00 0.18  ? 1122 ILE A O    14 
ATOM   8540  C  CB   . ILE A 1 20 ? 5.590   -2.328  -4.934  1.00 0.14  ? 1122 ILE A CB   14 
ATOM   8541  C  CG1  . ILE A 1 20 ? 4.856   -1.505  -3.875  1.00 0.13  ? 1122 ILE A CG1  14 
ATOM   8542  C  CG2  . ILE A 1 20 ? 5.671   -3.793  -4.522  1.00 0.19  ? 1122 ILE A CG2  14 
ATOM   8543  C  CD1  . ILE A 1 20 ? 3.382   -1.819  -3.790  1.00 0.17  ? 1122 ILE A CD1  14 
ATOM   8544  H  H    . ILE A 1 20 ? 7.536   -1.370  -3.172  1.00 0.22  ? 1122 ILE A H    14 
ATOM   8545  H  HA   . ILE A 1 20 ? 7.469   -2.336  -5.960  1.00 0.17  ? 1122 ILE A HA   14 
ATOM   8546  H  HB   . ILE A 1 20 ? 5.040   -2.274  -5.861  1.00 0.16  ? 1122 ILE A HB   14 
ATOM   8547  H  HG12 . ILE A 1 20 ? 5.293   -1.702  -2.908  1.00 0.15  ? 1122 ILE A HG12 14 
ATOM   8548  H  HG13 . ILE A 1 20 ? 4.961   -0.455  -4.106  1.00 0.14  ? 1122 ILE A HG13 14 
ATOM   8549  H  HG21 . ILE A 1 20 ? 6.140   -4.364  -5.310  1.00 0.98  ? 1122 ILE A HG21 14 
ATOM   8550  H  HG22 . ILE A 1 20 ? 4.676   -4.172  -4.344  1.00 1.05  ? 1122 ILE A HG22 14 
ATOM   8551  H  HG23 . ILE A 1 20 ? 6.257   -3.879  -3.618  1.00 0.97  ? 1122 ILE A HG23 14 
ATOM   8552  H  HD11 . ILE A 1 20 ? 3.250   -2.853  -3.511  1.00 1.07  ? 1122 ILE A HD11 14 
ATOM   8553  H  HD12 . ILE A 1 20 ? 2.923   -1.644  -4.751  1.00 0.99  ? 1122 ILE A HD12 14 
ATOM   8554  H  HD13 . ILE A 1 20 ? 2.920   -1.184  -3.049  1.00 1.03  ? 1122 ILE A HD13 14 
ATOM   8555  N  N    . SER A 1 21 ? 6.225   -0.104  -6.784  1.00 0.16  ? 1123 SER A N    14 
ATOM   8556  C  CA   . SER A 1 21 ? 5.988   1.242   -7.276  1.00 0.17  ? 1123 SER A CA   14 
ATOM   8557  C  C    . SER A 1 21 ? 4.817   1.877   -6.532  1.00 0.15  ? 1123 SER A C    14 
ATOM   8558  O  O    . SER A 1 21 ? 3.820   1.215   -6.241  1.00 0.17  ? 1123 SER A O    14 
ATOM   8559  C  CB   . SER A 1 21 ? 5.696   1.215   -8.776  1.00 0.24  ? 1123 SER A CB   14 
ATOM   8560  O  OG   . SER A 1 21 ? 5.389   2.515   -9.259  1.00 0.33  ? 1123 SER A OG   14 
ATOM   8561  H  H    . SER A 1 21 ? 5.906   -0.870  -7.304  1.00 0.20  ? 1123 SER A H    14 
ATOM   8562  H  HA   . SER A 1 21 ? 6.877   1.827   -7.097  1.00 0.19  ? 1123 SER A HA   14 
ATOM   8563  H  HB2  . SER A 1 21 ? 6.564   0.845   -9.302  1.00 0.27  ? 1123 SER A HB2  14 
ATOM   8564  H  HB3  . SER A 1 21 ? 4.855   0.565   -8.966  1.00 0.24  ? 1123 SER A HB3  14 
ATOM   8565  H  HG   . SER A 1 21 ? 4.489   2.525   -9.607  1.00 0.63  ? 1123 SER A HG   14 
ATOM   8566  N  N    . LYS A 1 22 ? 4.943   3.169   -6.233  1.00 0.17  ? 1124 LYS A N    14 
ATOM   8567  C  CA   . LYS A 1 22 ? 3.885   3.908   -5.552  1.00 0.19  ? 1124 LYS A CA   14 
ATOM   8568  C  C    . LYS A 1 22 ? 2.633   4.004   -6.416  1.00 0.22  ? 1124 LYS A C    14 
ATOM   8569  O  O    . LYS A 1 22 ? 1.540   4.259   -5.913  1.00 0.25  ? 1124 LYS A O    14 
ATOM   8570  C  CB   . LYS A 1 22 ? 4.354   5.312   -5.167  1.00 0.23  ? 1124 LYS A CB   14 
ATOM   8571  C  CG   . LYS A 1 22 ? 5.265   5.340   -3.954  1.00 0.25  ? 1124 LYS A CG   14 
ATOM   8572  C  CD   . LYS A 1 22 ? 5.606   6.765   -3.550  1.00 0.25  ? 1124 LYS A CD   14 
ATOM   8573  C  CE   . LYS A 1 22 ? 6.373   6.806   -2.238  1.00 0.30  ? 1124 LYS A CE   14 
ATOM   8574  N  NZ   . LYS A 1 22 ? 5.569   6.277   -1.104  1.00 1.24  ? 1124 LYS A NZ   14 
ATOM   8575  H  H    . LYS A 1 22 ? 5.774   3.639   -6.475  1.00 0.20  ? 1124 LYS A H    14 
ATOM   8576  H  HA   . LYS A 1 22 ? 3.639   3.366   -4.651  1.00 0.19  ? 1124 LYS A HA   14 
ATOM   8577  H  HB2  . LYS A 1 22 ? 4.888   5.740   -6.001  1.00 0.30  ? 1124 LYS A HB2  14 
ATOM   8578  H  HB3  . LYS A 1 22 ? 3.489   5.922   -4.955  1.00 0.30  ? 1124 LYS A HB3  14 
ATOM   8579  H  HG2  . LYS A 1 22 ? 4.769   4.851   -3.130  1.00 0.37  ? 1124 LYS A HG2  14 
ATOM   8580  H  HG3  . LYS A 1 22 ? 6.178   4.813   -4.190  1.00 0.37  ? 1124 LYS A HG3  14 
ATOM   8581  H  HD2  . LYS A 1 22 ? 6.210   7.213   -4.323  1.00 0.32  ? 1124 LYS A HD2  14 
ATOM   8582  H  HD3  . LYS A 1 22 ? 4.690   7.326   -3.437  1.00 0.33  ? 1124 LYS A HD3  14 
ATOM   8583  H  HE2  . LYS A 1 22 ? 7.267   6.209   -2.341  1.00 0.93  ? 1124 LYS A HE2  14 
ATOM   8584  H  HE3  . LYS A 1 22 ? 6.648   7.829   -2.027  1.00 0.95  ? 1124 LYS A HE3  14 
ATOM   8585  H  HZ1  . LYS A 1 22 ? 5.256   5.308   -1.304  1.00 1.76  ? 1124 LYS A HZ1  14 
ATOM   8586  H  HZ2  . LYS A 1 22 ? 4.729   6.872   -0.952  1.00 1.77  ? 1124 LYS A HZ2  14 
ATOM   8587  H  HZ3  . LYS A 1 22 ? 6.137   6.273   -0.232  1.00 1.88  ? 1124 LYS A HZ3  14 
ATOM   8588  N  N    . ASN A 1 23 ? 2.798   3.793   -7.718  1.00 0.24  ? 1125 ASN A N    14 
ATOM   8589  C  CA   . ASN A 1 23 ? 1.665   3.812   -8.638  1.00 0.28  ? 1125 ASN A CA   14 
ATOM   8590  C  C    . ASN A 1 23 ? 0.899   2.496   -8.590  1.00 0.26  ? 1125 ASN A C    14 
ATOM   8591  O  O    . ASN A 1 23 ? -0.170  2.365   -9.181  1.00 0.32  ? 1125 ASN A O    14 
ATOM   8592  C  CB   . ASN A 1 23 ? 2.132   4.100   -10.065 1.00 0.36  ? 1125 ASN A CB   14 
ATOM   8593  C  CG   . ASN A 1 23 ? 2.387   5.576   -10.308 1.00 1.03  ? 1125 ASN A CG   14 
ATOM   8594  O  OD1  . ASN A 1 23 ? 2.717   6.328   -9.389  1.00 1.75  ? 1125 ASN A OD1  14 
ATOM   8595  N  ND2  . ASN A 1 23 ? 2.238   6.001   -11.551 1.00 1.69  ? 1125 ASN A ND2  14 
ATOM   8596  H  H    . ASN A 1 23 ? 3.702   3.639   -8.066  1.00 0.25  ? 1125 ASN A H    14 
ATOM   8597  H  HA   . ASN A 1 23 ? 1.005   4.605   -8.323  1.00 0.31  ? 1125 ASN A HA   14 
ATOM   8598  H  HB2  . ASN A 1 23 ? 3.046   3.560   -10.252 1.00 0.82  ? 1125 ASN A HB2  14 
ATOM   8599  H  HB3  . ASN A 1 23 ? 1.374   3.767   -10.757 1.00 0.82  ? 1125 ASN A HB3  14 
ATOM   8600  H  HD21 . ASN A 1 23 ? 1.977   5.348   -12.237 1.00 1.99  ? 1125 ASN A HD21 14 
ATOM   8601  H  HD22 . ASN A 1 23 ? 2.388   6.951   -11.736 1.00 2.22  ? 1125 ASN A HD22 14 
ATOM   8602  N  N    . TRP A 1 24 ? 1.451   1.519   -7.882  1.00 0.22  ? 1126 TRP A N    14 
ATOM   8603  C  CA   . TRP A 1 24 ? 0.787   0.236   -7.708  1.00 0.22  ? 1126 TRP A CA   14 
ATOM   8604  C  C    . TRP A 1 24 ? -0.024  0.248   -6.423  1.00 0.20  ? 1126 TRP A C    14 
ATOM   8605  O  O    . TRP A 1 24 ? -0.902  -0.582  -6.223  1.00 0.26  ? 1126 TRP A O    14 
ATOM   8606  C  CB   . TRP A 1 24 ? 1.806   -0.905  -7.643  1.00 0.25  ? 1126 TRP A CB   14 
ATOM   8607  C  CG   . TRP A 1 24 ? 2.648   -1.059  -8.874  1.00 0.31  ? 1126 TRP A CG   14 
ATOM   8608  C  CD1  . TRP A 1 24 ? 2.540   -0.367  -10.045 1.00 0.37  ? 1126 TRP A CD1  14 
ATOM   8609  C  CD2  . TRP A 1 24 ? 3.728   -1.979  -9.050  1.00 0.38  ? 1126 TRP A CD2  14 
ATOM   8610  N  NE1  . TRP A 1 24 ? 3.496   -0.792  -10.933 1.00 0.45  ? 1126 TRP A NE1  14 
ATOM   8611  C  CE2  . TRP A 1 24 ? 4.237   -1.783  -10.347 1.00 0.45  ? 1126 TRP A CE2  14 
ATOM   8612  C  CE3  . TRP A 1 24 ? 4.317   -2.948  -8.235  1.00 0.44  ? 1126 TRP A CE3  14 
ATOM   8613  C  CZ2  . TRP A 1 24 ? 5.308   -2.520  -10.845 1.00 0.54  ? 1126 TRP A CZ2  14 
ATOM   8614  C  CZ3  . TRP A 1 24 ? 5.379   -3.678  -8.730  1.00 0.55  ? 1126 TRP A CZ3  14 
ATOM   8615  C  CH2  . TRP A 1 24 ? 5.866   -3.460  -10.024 1.00 0.58  ? 1126 TRP A CH2  14 
ATOM   8616  H  H    . TRP A 1 24 ? 2.327   1.666   -7.461  1.00 0.23  ? 1126 TRP A H    14 
ATOM   8617  H  HA   . TRP A 1 24 ? 0.122   0.078   -8.544  1.00 0.25  ? 1126 TRP A HA   14 
ATOM   8618  H  HB2  . TRP A 1 24 ? 2.471   -0.732  -6.811  1.00 0.27  ? 1126 TRP A HB2  14 
ATOM   8619  H  HB3  . TRP A 1 24 ? 1.279   -1.832  -7.480  1.00 0.28  ? 1126 TRP A HB3  14 
ATOM   8620  H  HD1  . TRP A 1 24 ? 1.808   0.406   -10.231 1.00 0.40  ? 1126 TRP A HD1  14 
ATOM   8621  H  HE1  . TRP A 1 24 ? 3.626   -0.444  -11.842 1.00 0.53  ? 1126 TRP A HE1  14 
ATOM   8622  H  HE3  . TRP A 1 24 ? 3.953   -3.133  -7.234  1.00 0.45  ? 1126 TRP A HE3  14 
ATOM   8623  H  HZ2  . TRP A 1 24 ? 5.696   -2.362  -11.841 1.00 0.61  ? 1126 TRP A HZ2  14 
ATOM   8624  H  HZ3  . TRP A 1 24 ? 5.847   -4.431  -8.114  1.00 0.62  ? 1126 TRP A HZ3  14 
ATOM   8625  H  HH2  . TRP A 1 24 ? 6.697   -4.055  -10.372 1.00 0.67  ? 1126 TRP A HH2  14 
ATOM   8626  N  N    . VAL A 1 25 ? 0.286   1.193   -5.556  1.00 0.19  ? 1127 VAL A N    14 
ATOM   8627  C  CA   . VAL A 1 25 ? -0.370  1.291   -4.262  1.00 0.18  ? 1127 VAL A CA   14 
ATOM   8628  C  C    . VAL A 1 25 ? -1.855  1.594   -4.423  1.00 0.19  ? 1127 VAL A C    14 
ATOM   8629  O  O    . VAL A 1 25 ? -2.233  2.592   -5.039  1.00 0.23  ? 1127 VAL A O    14 
ATOM   8630  C  CB   . VAL A 1 25 ? 0.291   2.377   -3.387  1.00 0.21  ? 1127 VAL A CB   14 
ATOM   8631  C  CG1  . VAL A 1 25 ? -0.422  2.517   -2.049  1.00 0.24  ? 1127 VAL A CG1  14 
ATOM   8632  C  CG2  . VAL A 1 25 ? 1.761   2.056   -3.175  1.00 0.24  ? 1127 VAL A CG2  14 
ATOM   8633  H  H    . VAL A 1 25 ? 0.973   1.846   -5.793  1.00 0.21  ? 1127 VAL A H    14 
ATOM   8634  H  HA   . VAL A 1 25 ? -0.261  0.339   -3.763  1.00 0.19  ? 1127 VAL A HA   14 
ATOM   8635  H  HB   . VAL A 1 25 ? 0.224   3.321   -3.908  1.00 0.23  ? 1127 VAL A HB   14 
ATOM   8636  H  HG11 . VAL A 1 25 ? -0.392  1.575   -1.524  1.00 1.01  ? 1127 VAL A HG11 14 
ATOM   8637  H  HG12 . VAL A 1 25 ? -1.450  2.804   -2.217  1.00 1.02  ? 1127 VAL A HG12 14 
ATOM   8638  H  HG13 . VAL A 1 25 ? 0.071   3.276   -1.458  1.00 1.00  ? 1127 VAL A HG13 14 
ATOM   8639  H  HG21 . VAL A 1 25 ? 2.223   2.847   -2.604  1.00 1.05  ? 1127 VAL A HG21 14 
ATOM   8640  H  HG22 . VAL A 1 25 ? 2.251   1.969   -4.134  1.00 1.06  ? 1127 VAL A HG22 14 
ATOM   8641  H  HG23 . VAL A 1 25 ? 1.852   1.123   -2.638  1.00 1.01  ? 1127 VAL A HG23 14 
ATOM   8642  N  N    . CYS A 1 26 ? -2.682  0.696   -3.891  1.00 0.19  ? 1128 CYS A N    14 
ATOM   8643  C  CA   . CYS A 1 26 ? -4.133  0.870   -3.867  1.00 0.26  ? 1128 CYS A CA   14 
ATOM   8644  C  C    . CYS A 1 26 ? -4.709  0.913   -5.281  1.00 0.27  ? 1128 CYS A C    14 
ATOM   8645  O  O    . CYS A 1 26 ? -5.583  1.724   -5.593  1.00 0.37  ? 1128 CYS A O    14 
ATOM   8646  C  CB   . CYS A 1 26 ? -4.491  2.140   -3.106  1.00 0.32  ? 1128 CYS A CB   14 
ATOM   8647  S  SG   . CYS A 1 26 ? -5.997  2.013   -2.092  1.00 0.58  ? 1128 CYS A SG   14 
ATOM   8648  H  H    . CYS A 1 26 ? -2.300  -0.116  -3.492  1.00 0.19  ? 1128 CYS A H    14 
ATOM   8649  H  HA   . CYS A 1 26 ? -4.555  0.023   -3.348  1.00 0.28  ? 1128 CYS A HA   14 
ATOM   8650  H  HB2  . CYS A 1 26 ? -3.674  2.396   -2.455  1.00 0.36  ? 1128 CYS A HB2  14 
ATOM   8651  H  HB3  . CYS A 1 26 ? -4.639  2.931   -3.811  1.00 0.36  ? 1128 CYS A HB3  14 
ATOM   8652  N  N    . ASP A 1 27 ? -4.228  0.014   -6.125  1.00 0.25  ? 1129 ASP A N    14 
ATOM   8653  C  CA   . ASP A 1 27 ? -4.675  -0.065  -7.511  1.00 0.30  ? 1129 ASP A CA   14 
ATOM   8654  C  C    . ASP A 1 27 ? -5.650  -1.228  -7.670  1.00 0.37  ? 1129 ASP A C    14 
ATOM   8655  O  O    . ASP A 1 27 ? -5.847  -1.743  -8.769  1.00 0.41  ? 1129 ASP A O    14 
ATOM   8656  C  CB   . ASP A 1 27 ? -3.474  -0.247  -8.448  1.00 0.31  ? 1129 ASP A CB   14 
ATOM   8657  C  CG   . ASP A 1 27 ? -2.977  -1.678  -8.504  1.00 0.35  ? 1129 ASP A CG   14 
ATOM   8658  O  OD1  . ASP A 1 27 ? -2.691  -2.257  -7.437  1.00 0.31  ? 1129 ASP A OD1  14 
ATOM   8659  O  OD2  . ASP A 1 27 ? -2.859  -2.225  -9.617  1.00 0.46  ? 1129 ASP A OD2  14 
ATOM   8660  H  H    . ASP A 1 27 ? -3.563  -0.633  -5.800  1.00 0.24  ? 1129 ASP A H    14 
ATOM   8661  H  HA   . ASP A 1 27 ? -5.183  0.858   -7.755  1.00 0.33  ? 1129 ASP A HA   14 
ATOM   8662  H  HB2  . ASP A 1 27 ? -3.752  0.052   -9.446  1.00 0.36  ? 1129 ASP A HB2  14 
ATOM   8663  H  HB3  . ASP A 1 27 ? -2.664  0.380   -8.105  1.00 0.29  ? 1129 ASP A HB3  14 
ATOM   8664  N  N    . THR A 1 28 ? -6.241  -1.623  -6.539  1.00 0.45  ? 1130 THR A N    14 
ATOM   8665  C  CA   . THR A 1 28 ? -7.174  -2.752  -6.437  1.00 0.56  ? 1130 THR A CA   14 
ATOM   8666  C  C    . THR A 1 28 ? -6.534  -4.067  -6.883  1.00 0.61  ? 1130 THR A C    14 
ATOM   8667  O  O    . THR A 1 28 ? -7.214  -4.974  -7.362  1.00 0.73  ? 1130 THR A O    14 
ATOM   8668  C  CB   . THR A 1 28 ? -8.520  -2.517  -7.182  1.00 0.59  ? 1130 THR A CB   14 
ATOM   8669  O  OG1  . THR A 1 28 ? -8.323  -2.255  -8.576  1.00 0.56  ? 1130 THR A OG1  14 
ATOM   8670  C  CG2  . THR A 1 28 ? -9.281  -1.360  -6.554  1.00 0.65  ? 1130 THR A CG2  14 
ATOM   8671  H  H    . THR A 1 28 ? -6.025  -1.135  -5.715  1.00 0.46  ? 1130 THR A H    14 
ATOM   8672  H  HA   . THR A 1 28 ? -7.408  -2.852  -5.387  1.00 0.64  ? 1130 THR A HA   14 
ATOM   8673  H  HB   . THR A 1 28 ? -9.121  -3.408  -7.081  1.00 0.67  ? 1130 THR A HB   14 
ATOM   8674  H  HG1  . THR A 1 28 ? -7.380  -2.318  -8.782  1.00 0.53  ? 1130 THR A HG1  14 
ATOM   8675  H  HG21 . THR A 1 28 ? -10.207 -1.208  -7.085  1.00 1.34  ? 1130 THR A HG21 14 
ATOM   8676  H  HG22 . THR A 1 28 ? -8.682  -0.463  -6.610  1.00 1.09  ? 1130 THR A HG22 14 
ATOM   8677  H  HG23 . THR A 1 28 ? -9.491  -1.587  -5.521  1.00 1.21  ? 1130 THR A HG23 14 
ATOM   8678  N  N    . ASP A 1 29 ? -5.221  -4.159  -6.713  1.00 0.59  ? 1131 ASP A N    14 
ATOM   8679  C  CA   . ASP A 1 29 ? -4.491  -5.384  -6.998  1.00 0.69  ? 1131 ASP A CA   14 
ATOM   8680  C  C    . ASP A 1 29 ? -3.385  -5.587  -5.969  1.00 0.67  ? 1131 ASP A C    14 
ATOM   8681  O  O    . ASP A 1 29 ? -2.609  -4.674  -5.697  1.00 0.53  ? 1131 ASP A O    14 
ATOM   8682  C  CB   . ASP A 1 29 ? -3.895  -5.321  -8.398  1.00 0.75  ? 1131 ASP A CB   14 
ATOM   8683  C  CG   . ASP A 1 29 ? -3.289  -6.639  -8.827  1.00 0.92  ? 1131 ASP A CG   14 
ATOM   8684  O  OD1  . ASP A 1 29 ? -4.026  -7.644  -8.906  1.00 1.21  ? 1131 ASP A OD1  14 
ATOM   8685  O  OD2  . ASP A 1 29 ? -2.070  -6.680  -9.092  1.00 0.92  ? 1131 ASP A OD2  14 
ATOM   8686  H  H    . ASP A 1 29 ? -4.725  -3.373  -6.410  1.00 0.55  ? 1131 ASP A H    14 
ATOM   8687  H  HA   . ASP A 1 29 ? -5.184  -6.211  -6.941  1.00 0.81  ? 1131 ASP A HA   14 
ATOM   8688  H  HB2  . ASP A 1 29 ? -4.672  -5.052  -9.095  1.00 0.81  ? 1131 ASP A HB2  14 
ATOM   8689  H  HB3  . ASP A 1 29 ? -3.123  -4.566  -8.420  1.00 0.68  ? 1131 ASP A HB3  14 
ATOM   8690  N  N    . ASN A 1 30 ? -3.318  -6.773  -5.389  1.00 0.94  ? 1132 ASN A N    14 
ATOM   8691  C  CA   . ASN A 1 30 ? -2.333  -7.056  -4.347  1.00 1.00  ? 1132 ASN A CA   14 
ATOM   8692  C  C    . ASN A 1 30 ? -0.950  -7.282  -4.946  1.00 0.91  ? 1132 ASN A C    14 
ATOM   8693  O  O    . ASN A 1 30 ? -0.672  -8.343  -5.502  1.00 1.06  ? 1132 ASN A O    14 
ATOM   8694  C  CB   . ASN A 1 30 ? -2.746  -8.285  -3.530  1.00 1.29  ? 1132 ASN A CB   14 
ATOM   8695  C  CG   . ASN A 1 30 ? -3.921  -8.021  -2.607  1.00 1.72  ? 1132 ASN A CG   14 
ATOM   8696  O  OD1  . ASN A 1 30 ? -4.768  -7.172  -2.880  1.00 2.58  ? 1132 ASN A OD1  14 
ATOM   8697  N  ND2  . ASN A 1 30 ? -3.980  -8.753  -1.505  1.00 2.07  ? 1132 ASN A ND2  14 
ATOM   8698  H  H    . ASN A 1 30 ? -3.942  -7.478  -5.664  1.00 1.15  ? 1132 ASN A H    14 
ATOM   8699  H  HA   . ASN A 1 30 ? -2.291  -6.200  -3.692  1.00 0.97  ? 1132 ASN A HA   14 
ATOM   8700  H  HB2  . ASN A 1 30 ? -3.019  -9.082  -4.207  1.00 1.52  ? 1132 ASN A HB2  14 
ATOM   8701  H  HB3  . ASN A 1 30 ? -1.907  -8.606  -2.930  1.00 1.97  ? 1132 ASN A HB3  14 
ATOM   8702  H  HD21 . ASN A 1 30 ? -3.272  -9.415  -1.350  1.00 2.11  ? 1132 ASN A HD21 14 
ATOM   8703  H  HD22 . ASN A 1 30 ? -4.733  -8.612  -0.894  1.00 2.73  ? 1132 ASN A HD22 14 
ATOM   8704  N  N    . ASP A 1 31 ? -0.082  -6.282  -4.833  1.00 0.86  ? 1133 ASP A N    14 
ATOM   8705  C  CA   . ASP A 1 31 ? 1.278   -6.399  -5.354  1.00 0.77  ? 1133 ASP A CA   14 
ATOM   8706  C  C    . ASP A 1 31 ? 2.191   -6.991  -4.298  1.00 0.78  ? 1133 ASP A C    14 
ATOM   8707  O  O    . ASP A 1 31 ? 2.986   -7.889  -4.577  1.00 1.28  ? 1133 ASP A O    14 
ATOM   8708  C  CB   . ASP A 1 31 ? 1.831   -5.045  -5.806  1.00 0.67  ? 1133 ASP A CB   14 
ATOM   8709  C  CG   . ASP A 1 31 ? 1.063   -4.454  -6.967  1.00 0.58  ? 1133 ASP A CG   14 
ATOM   8710  O  OD1  . ASP A 1 31 ? 1.404   -4.751  -8.129  1.00 1.09  ? 1133 ASP A OD1  14 
ATOM   8711  O  OD2  . ASP A 1 31 ? 0.115   -3.682  -6.721  1.00 1.00  ? 1133 ASP A OD2  14 
ATOM   8712  H  H    . ASP A 1 31 ? -0.355  -5.455  -4.382  1.00 1.05  ? 1133 ASP A H    14 
ATOM   8713  H  HA   . ASP A 1 31 ? 1.251   -7.065  -6.199  1.00 0.87  ? 1133 ASP A HA   14 
ATOM   8714  H  HB2  . ASP A 1 31 ? 1.785   -4.353  -4.982  1.00 1.04  ? 1133 ASP A HB2  14 
ATOM   8715  H  HB3  . ASP A 1 31 ? 2.860   -5.169  -6.106  1.00 1.05  ? 1133 ASP A HB3  14 
ATOM   8716  N  N    . CYS A 1 32 ? 2.063   -6.483  -3.081  1.00 0.76  ? 1134 CYS A N    14 
ATOM   8717  C  CA   . CYS A 1 32 ? 2.855   -6.969  -1.963  1.00 0.78  ? 1134 CYS A CA   14 
ATOM   8718  C  C    . CYS A 1 32 ? 2.392   -8.362  -1.550  1.00 0.85  ? 1134 CYS A C    14 
ATOM   8719  O  O    . CYS A 1 32 ? 1.298   -8.790  -1.931  1.00 1.57  ? 1134 CYS A O    14 
ATOM   8720  C  CB   . CYS A 1 32 ? 2.733   -6.014  -0.776  1.00 0.82  ? 1134 CYS A CB   14 
ATOM   8721  S  SG   . CYS A 1 32 ? 2.945   -4.256  -1.208  1.00 1.16  ? 1134 CYS A SG   14 
ATOM   8722  H  H    . CYS A 1 32 ? 1.422   -5.753  -2.932  1.00 1.11  ? 1134 CYS A H    14 
ATOM   8723  H  HA   . CYS A 1 32 ? 3.887   -7.018  -2.277  1.00 0.88  ? 1134 CYS A HA   14 
ATOM   8724  H  HB2  . CYS A 1 32 ? 1.755   -6.125  -0.334  1.00 1.25  ? 1134 CYS A HB2  14 
ATOM   8725  H  HB3  . CYS A 1 32 ? 3.485   -6.266  -0.044  1.00 1.22  ? 1134 CYS A HB3  14 
ATOM   8726  N  N    . GLY A 1 33 ? 3.214   -9.057  -0.766  1.00 1.17  ? 1135 GLY A N    14 
ATOM   8727  C  CA   . GLY A 1 33 ? 2.893   -10.412 -0.342  1.00 1.22  ? 1135 GLY A CA   14 
ATOM   8728  C  C    . GLY A 1 33 ? 1.493   -10.541 0.231   1.00 1.18  ? 1135 GLY A C    14 
ATOM   8729  O  O    . GLY A 1 33 ? 0.719   -11.405 -0.190  1.00 1.68  ? 1135 GLY A O    14 
ATOM   8730  H  H    . GLY A 1 33 ? 4.061   -8.650  -0.480  1.00 1.82  ? 1135 GLY A H    14 
ATOM   8731  H  HA2  . GLY A 1 33 ? 2.981   -11.070 -1.193  1.00 1.26  ? 1135 GLY A HA2  14 
ATOM   8732  H  HA3  . GLY A 1 33 ? 3.607   -10.718 0.408   1.00 1.39  ? 1135 GLY A HA3  14 
ATOM   8733  N  N    . ASP A 1 34 ? 1.157   -9.680  1.183   1.00 1.02  ? 1136 ASP A N    14 
ATOM   8734  C  CA   . ASP A 1 34 ? -0.167  -9.704  1.798   1.00 1.11  ? 1136 ASP A CA   14 
ATOM   8735  C  C    . ASP A 1 34 ? -1.032  -8.553  1.301   1.00 0.93  ? 1136 ASP A C    14 
ATOM   8736  O  O    . ASP A 1 34 ? -2.044  -8.217  1.916   1.00 1.35  ? 1136 ASP A O    14 
ATOM   8737  C  CB   . ASP A 1 34 ? -0.060  -9.649  3.319   1.00 1.44  ? 1136 ASP A CB   14 
ATOM   8738  C  CG   . ASP A 1 34 ? 0.554   -10.901 3.906   1.00 2.10  ? 1136 ASP A CG   14 
ATOM   8739  O  OD1  . ASP A 1 34 ? -0.184  -11.887 4.124   1.00 2.47  ? 1136 ASP A OD1  14 
ATOM   8740  O  OD2  . ASP A 1 34 ? 1.777   -10.910 4.153   1.00 2.85  ? 1136 ASP A OD2  14 
ATOM   8741  H  H    . ASP A 1 34 ? 1.821   -9.025  1.493   1.00 1.22  ? 1136 ASP A H    14 
ATOM   8742  H  HA   . ASP A 1 34 ? -0.636  -10.630 1.523   1.00 1.27  ? 1136 ASP A HA   14 
ATOM   8743  H  HB2  . ASP A 1 34 ? 0.554   -8.811  3.590   1.00 1.68  ? 1136 ASP A HB2  14 
ATOM   8744  H  HB3  . ASP A 1 34 ? -1.046  -9.520  3.741   1.00 1.84  ? 1136 ASP A HB3  14 
ATOM   8745  N  N    . GLY A 1 35 ? -0.634  -7.959  0.179   1.00 0.62  ? 1137 GLY A N    14 
ATOM   8746  C  CA   . GLY A 1 35 ? -1.367  -6.831  -0.372  1.00 0.49  ? 1137 GLY A CA   14 
ATOM   8747  C  C    . GLY A 1 35 ? -1.447  -5.665  0.594   1.00 0.36  ? 1137 GLY A C    14 
ATOM   8748  O  O    . GLY A 1 35 ? -2.491  -5.025  0.728   1.00 0.36  ? 1137 GLY A O    14 
ATOM   8749  H  H    . GLY A 1 35 ? 0.154   -8.305  -0.292  1.00 0.82  ? 1137 GLY A H    14 
ATOM   8750  H  HA2  . GLY A 1 35 ? -0.875  -6.502  -1.276  1.00 0.51  ? 1137 GLY A HA2  14 
ATOM   8751  H  HA3  . GLY A 1 35 ? -2.368  -7.152  -0.616  1.00 0.72  ? 1137 GLY A HA3  14 
ATOM   8752  N  N    . SER A 1 36 ? -0.338  -5.387  1.266   1.00 0.32  ? 1138 SER A N    14 
ATOM   8753  C  CA   . SER A 1 36 ? -0.289  -4.334  2.267   1.00 0.28  ? 1138 SER A CA   14 
ATOM   8754  C  C    . SER A 1 36 ? -0.471  -2.960  1.631   1.00 0.25  ? 1138 SER A C    14 
ATOM   8755  O  O    . SER A 1 36 ? -0.946  -2.024  2.272   1.00 0.40  ? 1138 SER A O    14 
ATOM   8756  C  CB   . SER A 1 36 ? 1.037   -4.398  3.019   1.00 0.33  ? 1138 SER A CB   14 
ATOM   8757  O  OG   . SER A 1 36 ? 2.137   -4.340  2.124   1.00 0.44  ? 1138 SER A OG   14 
ATOM   8758  H  H    . SER A 1 36 ? 0.469   -5.912  1.092   1.00 0.37  ? 1138 SER A H    14 
ATOM   8759  H  HA   . SER A 1 36 ? -1.095  -4.506  2.964   1.00 0.33  ? 1138 SER A HA   14 
ATOM   8760  H  HB2  . SER A 1 36 ? 1.100   -3.568  3.704   1.00 0.40  ? 1138 SER A HB2  14 
ATOM   8761  H  HB3  . SER A 1 36 ? 1.090   -5.325  3.573   1.00 0.39  ? 1138 SER A HB3  14 
ATOM   8762  H  HG   . SER A 1 36 ? 2.013   -3.604  1.510   1.00 1.17  ? 1138 SER A HG   14 
ATOM   8763  N  N    . ASP A 1 37 ? -0.122  -2.855  0.355   1.00 0.18  ? 1139 ASP A N    14 
ATOM   8764  C  CA   . ASP A 1 37 ? -0.224  -1.596  -0.373  1.00 0.18  ? 1139 ASP A CA   14 
ATOM   8765  C  C    . ASP A 1 37 ? -1.686  -1.241  -0.625  1.00 0.20  ? 1139 ASP A C    14 
ATOM   8766  O  O    . ASP A 1 37 ? -2.014  -0.110  -0.978  1.00 0.29  ? 1139 ASP A O    14 
ATOM   8767  C  CB   . ASP A 1 37 ? 0.528   -1.692  -1.701  1.00 0.19  ? 1139 ASP A CB   14 
ATOM   8768  C  CG   . ASP A 1 37 ? -0.097  -2.685  -2.663  1.00 0.26  ? 1139 ASP A CG   14 
ATOM   8769  O  OD1  . ASP A 1 37 ? -0.060  -3.907  -2.388  1.00 0.33  ? 1139 ASP A OD1  14 
ATOM   8770  O  OD2  . ASP A 1 37 ? -0.629  -2.247  -3.701  1.00 0.32  ? 1139 ASP A OD2  14 
ATOM   8771  H  H    . ASP A 1 37 ? 0.203   -3.651  -0.120  1.00 0.26  ? 1139 ASP A H    14 
ATOM   8772  H  HA   . ASP A 1 37 ? 0.226   -0.823  0.233   1.00 0.20  ? 1139 ASP A HA   14 
ATOM   8773  H  HB2  . ASP A 1 37 ? 0.536   -0.722  -2.174  1.00 0.22  ? 1139 ASP A HB2  14 
ATOM   8774  H  HB3  . ASP A 1 37 ? 1.545   -1.998  -1.509  1.00 0.19  ? 1139 ASP A HB3  14 
ATOM   8775  N  N    . GLU A 1 38 ? -2.558  -2.219  -0.440  1.00 0.22  ? 1140 GLU A N    14 
ATOM   8776  C  CA   . GLU A 1 38 ? -3.987  -2.019  -0.613  1.00 0.27  ? 1140 GLU A CA   14 
ATOM   8777  C  C    . GLU A 1 38 ? -4.681  -1.892  0.749   1.00 0.31  ? 1140 GLU A C    14 
ATOM   8778  O  O    . GLU A 1 38 ? -5.819  -1.434  0.833   1.00 0.44  ? 1140 GLU A O    14 
ATOM   8779  C  CB   . GLU A 1 38 ? -4.588  -3.213  -1.361  1.00 0.29  ? 1140 GLU A CB   14 
ATOM   8780  C  CG   . GLU A 1 38 ? -3.944  -3.512  -2.705  1.00 0.29  ? 1140 GLU A CG   14 
ATOM   8781  C  CD   . GLU A 1 38 ? -4.277  -2.481  -3.758  1.00 0.28  ? 1140 GLU A CD   14 
ATOM   8782  O  OE1  . GLU A 1 38 ? -5.443  -2.037  -3.812  1.00 0.38  ? 1140 GLU A OE1  14 
ATOM   8783  O  OE2  . GLU A 1 38 ? -3.376  -2.114  -4.544  1.00 0.28  ? 1140 GLU A OE2  14 
ATOM   8784  H  H    . GLU A 1 38 ? -2.229  -3.108  -0.188  1.00 0.24  ? 1140 GLU A H    14 
ATOM   8785  H  HA   . GLU A 1 38 ? -4.145  -1.109  -1.191  1.00 0.30  ? 1140 GLU A HA   14 
ATOM   8786  H  HB2  . GLU A 1 38 ? -4.490  -4.091  -0.742  1.00 0.32  ? 1140 GLU A HB2  14 
ATOM   8787  H  HB3  . GLU A 1 38 ? -5.636  -3.020  -1.527  1.00 0.33  ? 1140 GLU A HB3  14 
ATOM   8788  H  HG2  . GLU A 1 38 ? -2.872  -3.538  -2.577  1.00 0.29  ? 1140 GLU A HG2  14 
ATOM   8789  H  HG3  . GLU A 1 38 ? -4.287  -4.477  -3.046  1.00 0.33  ? 1140 GLU A HG3  14 
ATOM   8790  N  N    . LYS A 1 39 ? -3.996  -2.304  1.816   1.00 0.30  ? 1141 LYS A N    14 
ATOM   8791  C  CA   . LYS A 1 39 ? -4.634  -2.382  3.130   1.00 0.37  ? 1141 LYS A CA   14 
ATOM   8792  C  C    . LYS A 1 39 ? -4.584  -1.042  3.869   1.00 0.49  ? 1141 LYS A C    14 
ATOM   8793  O  O    . LYS A 1 39 ? -5.527  -0.681  4.574   1.00 0.57  ? 1141 LYS A O    14 
ATOM   8794  C  CB   . LYS A 1 39 ? -3.999  -3.490  3.991   1.00 0.47  ? 1141 LYS A CB   14 
ATOM   8795  C  CG   . LYS A 1 39 ? -2.675  -3.111  4.640   1.00 0.57  ? 1141 LYS A CG   14 
ATOM   8796  C  CD   . LYS A 1 39 ? -2.178  -4.194  5.579   1.00 0.76  ? 1141 LYS A CD   14 
ATOM   8797  C  CE   . LYS A 1 39 ? -0.883  -3.784  6.261   1.00 0.91  ? 1141 LYS A CE   14 
ATOM   8798  N  NZ   . LYS A 1 39 ? -1.023  -2.505  7.007   1.00 1.55  ? 1141 LYS A NZ   14 
ATOM   8799  H  H    . LYS A 1 39 ? -3.055  -2.559  1.718   1.00 0.32  ? 1141 LYS A H    14 
ATOM   8800  H  HA   . LYS A 1 39 ? -5.670  -2.633  2.965   1.00 0.39  ? 1141 LYS A HA   14 
ATOM   8801  H  HB2  . LYS A 1 39 ? -4.692  -3.756  4.774   1.00 0.56  ? 1141 LYS A HB2  14 
ATOM   8802  H  HB3  . LYS A 1 39 ? -3.833  -4.355  3.366   1.00 0.47  ? 1141 LYS A HB3  14 
ATOM   8803  H  HG2  . LYS A 1 39 ? -1.936  -2.954  3.872   1.00 0.50  ? 1141 LYS A HG2  14 
ATOM   8804  H  HG3  . LYS A 1 39 ? -2.811  -2.198  5.201   1.00 0.65  ? 1141 LYS A HG3  14 
ATOM   8805  H  HD2  . LYS A 1 39 ? -2.929  -4.377  6.332   1.00 0.88  ? 1141 LYS A HD2  14 
ATOM   8806  H  HD3  . LYS A 1 39 ? -2.005  -5.097  5.011   1.00 0.73  ? 1141 LYS A HD3  14 
ATOM   8807  H  HE2  . LYS A 1 39 ? -0.596  -4.561  6.947   1.00 1.15  ? 1141 LYS A HE2  14 
ATOM   8808  H  HE3  . LYS A 1 39 ? -0.116  -3.670  5.509   1.00 1.18  ? 1141 LYS A HE3  14 
ATOM   8809  H  HZ1  . LYS A 1 39 ? -1.855  -2.539  7.630   1.00 2.08  ? 1141 LYS A HZ1  14 
ATOM   8810  H  HZ2  . LYS A 1 39 ? -1.129  -1.710  6.345   1.00 1.99  ? 1141 LYS A HZ2  14 
ATOM   8811  H  HZ3  . LYS A 1 39 ? -0.177  -2.338  7.593   1.00 1.97  ? 1141 LYS A HZ3  14 
ATOM   8812  N  N    . ASN A 1 40 ? -3.496  -0.304  3.707   1.00 0.60  ? 1142 ASN A N    14 
ATOM   8813  C  CA   . ASN A 1 40 ? -3.337  0.970   4.402   1.00 0.81  ? 1142 ASN A CA   14 
ATOM   8814  C  C    . ASN A 1 40 ? -3.099  2.098   3.413   1.00 0.91  ? 1142 ASN A C    14 
ATOM   8815  O  O    . ASN A 1 40 ? -2.232  2.949   3.605   1.00 1.44  ? 1142 ASN A O    14 
ATOM   8816  C  CB   . ASN A 1 40 ? -2.197  0.902   5.425   1.00 1.07  ? 1142 ASN A CB   14 
ATOM   8817  C  CG   . ASN A 1 40 ? -0.881  0.437   4.829   1.00 1.37  ? 1142 ASN A CG   14 
ATOM   8818  O  OD1  . ASN A 1 40 ? -0.562  -0.751  4.854   1.00 2.05  ? 1142 ASN A OD1  14 
ATOM   8819  N  ND2  . ASN A 1 40 ? -0.116  1.367   4.289   1.00 1.92  ? 1142 ASN A ND2  14 
ATOM   8820  H  H    . ASN A 1 40 ? -2.784  -0.618  3.109   1.00 0.58  ? 1142 ASN A H    14 
ATOM   8821  H  HA   . ASN A 1 40 ? -4.259  1.168   4.925   1.00 0.86  ? 1142 ASN A HA   14 
ATOM   8822  H  HB2  . ASN A 1 40 ? -2.046  1.882   5.849   1.00 1.54  ? 1142 ASN A HB2  14 
ATOM   8823  H  HB3  . ASN A 1 40 ? -2.473  0.217   6.213   1.00 1.56  ? 1142 ASN A HB3  14 
ATOM   8824  H  HD21 . ASN A 1 40 ? -0.439  2.297   4.301   1.00 2.20  ? 1142 ASN A HD21 14 
ATOM   8825  H  HD22 . ASN A 1 40 ? 0.745   1.097   3.892   1.00 2.44  ? 1142 ASN A HD22 14 
ATOM   8826  N  N    . CYS A 1 41 ? -3.894  2.111   2.365   1.00 0.76  ? 1143 CYS A N    14 
ATOM   8827  C  CA   . CYS A 1 41 ? -3.751  3.082   1.315   1.00 0.99  ? 1143 CYS A CA   14 
ATOM   8828  C  C    . CYS A 1 41 ? -4.861  4.106   1.400   1.00 1.29  ? 1143 CYS A C    14 
ATOM   8829  O  O    . CYS A 1 41 ? -6.019  3.775   1.671   1.00 1.67  ? 1143 CYS A O    14 
ATOM   8830  C  CB   . CYS A 1 41 ? -3.794  2.394   -0.041  1.00 0.93  ? 1143 CYS A CB   14 
ATOM   8831  S  SG   . CYS A 1 41 ? -5.287  1.378   -0.304  1.00 1.10  ? 1143 CYS A SG   14 
ATOM   8832  H  H    . CYS A 1 41 ? -4.618  1.469   2.306   1.00 0.89  ? 1143 CYS A H    14 
ATOM   8833  H  HA   . CYS A 1 41 ? -2.800  3.576   1.436   1.00 1.23  ? 1143 CYS A HA   14 
ATOM   8834  H  HB2  . CYS A 1 41 ? -3.767  3.147   -0.811  1.00 0.98  ? 1143 CYS A HB2  14 
ATOM   8835  H  HB3  . CYS A 1 41 ? -2.932  1.748   -0.140  1.00 1.29  ? 1143 CYS A HB3  14 
ATOM   8836  N  N    . ASN A 1 42 ? -4.501  5.345   1.188   1.00 1.87  ? 1144 ASN A N    14 
ATOM   8837  C  CA   . ASN A 1 42 ? -5.477  6.416   1.130   1.00 2.36  ? 1144 ASN A CA   14 
ATOM   8838  C  C    . ASN A 1 42 ? -6.165  6.390   -0.227  1.00 3.05  ? 1144 ASN A C    14 
ATOM   8839  O  O    . ASN A 1 42 ? -5.511  6.255   -1.264  1.00 3.73  ? 1144 ASN A O    14 
ATOM   8840  C  CB   . ASN A 1 42 ? -4.816  7.783   1.378   1.00 3.11  ? 1144 ASN A CB   14 
ATOM   8841  C  CG   . ASN A 1 42 ? -4.084  8.333   0.164   1.00 3.87  ? 1144 ASN A CG   14 
ATOM   8842  O  OD1  . ASN A 1 42 ? -2.933  7.987   -0.094  1.00 4.27  ? 1144 ASN A OD1  14 
ATOM   8843  N  ND2  . ASN A 1 42 ? -4.741  9.219   -0.571  1.00 4.59  ? 1144 ASN A ND2  14 
ATOM   8844  H  H    . ASN A 1 42 ? -3.551  5.543   1.065   1.00 2.27  ? 1144 ASN A H    14 
ATOM   8845  H  HA   . ASN A 1 42 ? -6.212  6.233   1.898   1.00 2.42  ? 1144 ASN A HA   14 
ATOM   8846  H  HB2  . ASN A 1 42 ? -5.577  8.493   1.662   1.00 3.41  ? 1144 ASN A HB2  14 
ATOM   8847  H  HB3  . ASN A 1 42 ? -4.107  7.684   2.187   1.00 3.38  ? 1144 ASN A HB3  14 
ATOM   8848  H  HD21 . ASN A 1 42 ? -5.649  9.468   -0.296  1.00 4.61  ? 1144 ASN A HD21 14 
ATOM   8849  H  HD22 . ASN A 1 42 ? -4.291  9.592   -1.356  1.00 5.30  ? 1144 ASN A HD22 14 
ATOM   8850  N  N    . SER A 1 43 ? -7.481  6.468   -0.223  1.00 3.53  ? 1145 SER A N    14 
ATOM   8851  C  CA   . SER A 1 43 ? -8.224  6.527   -1.463  1.00 4.69  ? 1145 SER A CA   14 
ATOM   8852  C  C    . SER A 1 43 ? -8.074  7.902   -2.092  1.00 5.23  ? 1145 SER A C    14 
ATOM   8853  O  O    . SER A 1 43 ? -8.389  8.921   -1.472  1.00 5.32  ? 1145 SER A O    14 
ATOM   8854  C  CB   . SER A 1 43 ? -9.695  6.188   -1.227  1.00 5.40  ? 1145 SER A CB   14 
ATOM   8855  O  OG   . SER A 1 43 ? -10.171 6.773   -0.023  1.00 5.26  ? 1145 SER A OG   14 
ATOM   8856  H  H    . SER A 1 43 ? -7.964  6.481   0.631   1.00 3.45  ? 1145 SER A H    14 
ATOM   8857  H  HA   . SER A 1 43 ? -7.799  5.795   -2.135  1.00 5.07  ? 1145 SER A HA   14 
ATOM   8858  H  HB2  . SER A 1 43 ? -10.285 6.563   -2.050  1.00 6.23  ? 1145 SER A HB2  14 
ATOM   8859  H  HB3  . SER A 1 43 ? -9.805  5.118   -1.165  1.00 5.56  ? 1145 SER A HB3  14 
ATOM   8860  H  HG   . SER A 1 43 ? -10.113 6.126   0.692   1.00 5.21  ? 1145 SER A HG   14 
ATOM   8861  N  N    . THR A 1 44 ? -7.571  7.929   -3.310  1.00 5.97  ? 1146 THR A N    14 
ATOM   8862  C  CA   . THR A 1 44 ? -7.336  9.177   -4.012  1.00 6.81  ? 1146 THR A CA   14 
ATOM   8863  C  C    . THR A 1 44 ? -8.624  9.714   -4.622  1.00 7.34  ? 1146 THR A C    14 
ATOM   8864  O  O    . THR A 1 44 ? -8.765  9.810   -5.842  1.00 8.15  ? 1146 THR A O    14 
ATOM   8865  C  CB   . THR A 1 44 ? -6.262  8.998   -5.097  1.00 7.69  ? 1146 THR A CB   14 
ATOM   8866  O  OG1  . THR A 1 44 ? -6.396  7.704   -5.702  1.00 7.92  ? 1146 THR A OG1  14 
ATOM   8867  C  CG2  . THR A 1 44 ? -4.867  9.150   -4.509  1.00 7.74  ? 1146 THR A CG2  14 
ATOM   8868  H  H    . THR A 1 44 ? -7.355  7.081   -3.757  1.00 6.16  ? 1146 THR A H    14 
ATOM   8869  H  HA   . THR A 1 44 ? -6.972  9.897   -3.293  1.00 6.75  ? 1146 THR A HA   14 
ATOM   8870  H  HB   . THR A 1 44 ? -6.403  9.755   -5.853  1.00 8.40  ? 1146 THR A HB   14 
ATOM   8871  H  HG1  . THR A 1 44 ? -7.237  7.656   -6.174  1.00 8.03  ? 1146 THR A HG1  14 
ATOM   8872  H  HG21 . THR A 1 44 ? -4.131  9.019   -5.288  1.00 7.71  ? 1146 THR A HG21 14 
ATOM   8873  H  HG22 . THR A 1 44 ? -4.716  8.404   -3.742  1.00 7.80  ? 1146 THR A HG22 14 
ATOM   8874  H  HG23 . THR A 1 44 ? -4.764  10.134  -4.078  1.00 8.03  ? 1146 THR A HG23 14 
ATOM   8875  N  N    . GLU A 1 45 ? -9.561  10.055  -3.750  1.00 7.13  ? 1147 GLU A N    14 
ATOM   8876  C  CA   . GLU A 1 45 ? -10.831 10.598  -4.151  1.00 7.94  ? 1147 GLU A CA   14 
ATOM   8877  C  C    . GLU A 1 45 ? -10.656 12.048  -4.579  1.00 8.95  ? 1147 GLU A C    14 
ATOM   8878  O  O    . GLU A 1 45 ? -11.237 12.495  -5.564  1.00 9.87  ? 1147 GLU A O    14 
ATOM   8879  C  CB   . GLU A 1 45 ? -11.805 10.482  -2.982  1.00 7.79  ? 1147 GLU A CB   14 
ATOM   8880  C  CG   . GLU A 1 45 ? -13.119 11.178  -3.220  1.00 7.90  ? 1147 GLU A CG   14 
ATOM   8881  C  CD   . GLU A 1 45 ? -13.890 10.580  -4.374  1.00 8.00  ? 1147 GLU A CD   14 
ATOM   8882  O  OE1  . GLU A 1 45 ? -14.316 9.413   -4.261  1.00 8.23  ? 1147 GLU A OE1  14 
ATOM   8883  O  OE2  . GLU A 1 45 ? -14.084 11.281  -5.392  1.00 8.08  ? 1147 GLU A OE2  14 
ATOM   8884  H  H    . GLU A 1 45 ? -9.387  9.943   -2.794  1.00 6.60  ? 1147 GLU A H    14 
ATOM   8885  H  HA   . GLU A 1 45 ? -11.200 10.022  -4.986  1.00 8.20  ? 1147 GLU A HA   14 
ATOM   8886  H  HB2  . GLU A 1 45 ? -12.005 9.438   -2.798  1.00 8.33  ? 1147 GLU A HB2  14 
ATOM   8887  H  HB3  . GLU A 1 45 ? -11.348 10.911  -2.105  1.00 7.37  ? 1147 GLU A HB3  14 
ATOM   8888  H  HG2  . GLU A 1 45 ? -13.719 11.115  -2.325  1.00 7.80  ? 1147 GLU A HG2  14 
ATOM   8889  H  HG3  . GLU A 1 45 ? -12.905 12.209  -3.441  1.00 8.35  ? 1147 GLU A HG3  14 
ATOM   8890  N  N    . THR A 1 46 ? -9.815  12.767  -3.855  1.00 8.94  ? 1148 THR A N    14 
ATOM   8891  C  CA   . THR A 1 46 ? -9.549  14.162  -4.163  1.00 10.03 ? 1148 THR A CA   14 
ATOM   8892  C  C    . THR A 1 46 ? -8.354  14.254  -5.109  1.00 10.71 ? 1148 THR A C    14 
ATOM   8893  O  O    . THR A 1 46 ? -7.383  14.964  -4.857  1.00 11.12 ? 1148 THR A O    14 
ATOM   8894  C  CB   . THR A 1 46 ? -9.277  14.970  -2.880  1.00 10.21 ? 1148 THR A CB   14 
ATOM   8895  O  OG1  . THR A 1 46 ? -10.221 14.593  -1.868  1.00 9.58  ? 1148 THR A OG1  14 
ATOM   8896  C  CG2  . THR A 1 46 ? -9.393  16.465  -3.143  1.00 11.01 ? 1148 THR A CG2  14 
ATOM   8897  H  H    . THR A 1 46 ? -9.346  12.344  -3.102  1.00 8.30  ? 1148 THR A H    14 
ATOM   8898  H  HA   . THR A 1 46 ? -10.422 14.571  -4.654  1.00 10.45 ? 1148 THR A HA   14 
ATOM   8899  H  HB   . THR A 1 46 ? -8.276  14.752  -2.536  1.00 10.48 ? 1148 THR A HB   14 
ATOM   8900  H  HG1  . THR A 1 46 ? -10.057 13.680  -1.604  1.00 9.43  ? 1148 THR A HG1  14 
ATOM   8901  H  HG21 . THR A 1 46 ? -9.215  17.007  -2.225  1.00 11.19 ? 1148 THR A HG21 14 
ATOM   8902  H  HG22 . THR A 1 46 ? -10.386 16.692  -3.507  1.00 11.07 ? 1148 THR A HG22 14 
ATOM   8903  H  HG23 . THR A 1 46 ? -8.663  16.758  -3.882  1.00 11.53 ? 1148 THR A HG23 14 
HETATM 8904  CA CA   . CA  B 2 .  ? -1.507  -2.690  -5.644  1.00 0.28  ? 1201 CA  A CA   14 
ATOM   8905  N  N    . THR A 1 1  ? 18.015  -9.689  0.192   1.00 12.23 ? 1103 THR A N    15 
ATOM   8906  C  CA   . THR A 1 1  ? 18.818  -8.659  0.875   1.00 11.73 ? 1103 THR A CA   15 
ATOM   8907  C  C    . THR A 1 1  ? 18.626  -8.729  2.387   1.00 10.83 ? 1103 THR A C    15 
ATOM   8908  O  O    . THR A 1 1  ? 17.547  -8.434  2.905   1.00 10.67 ? 1103 THR A O    15 
ATOM   8909  C  CB   . THR A 1 1  ? 18.444  -7.255  0.367   1.00 11.83 ? 1103 THR A CB   15 
ATOM   8910  O  OG1  . THR A 1 1  ? 17.018  -7.139  0.251   1.00 12.26 ? 1103 THR A OG1  15 
ATOM   8911  C  CG2  . THR A 1 1  ? 19.094  -6.976  -0.981  1.00 12.04 ? 1103 THR A CG2  15 
ATOM   8912  H  H1   . THR A 1 1  ? 18.278  -10.633 0.532   1.00 12.23 ? 1103 THR A H1   15 
ATOM   8913  H  H2   . THR A 1 1  ? 18.172  -9.643  -0.831  1.00 12.55 ? 1103 THR A H2   15 
ATOM   8914  H  H3   . THR A 1 1  ? 17.006  -9.533  0.384   1.00 12.44 ? 1103 THR A H3   15 
ATOM   8915  H  HA   . THR A 1 1  ? 19.860  -8.836  0.649   1.00 12.16 ? 1103 THR A HA   15 
ATOM   8916  H  HB   . THR A 1 1  ? 18.799  -6.525  1.079   1.00 11.67 ? 1103 THR A HB   15 
ATOM   8917  H  HG1  . THR A 1 1  ? 16.718  -6.370  0.750   1.00 12.30 ? 1103 THR A HG1  15 
ATOM   8918  H  HG21 . THR A 1 1  ? 20.168  -7.028  -0.880  1.00 12.31 ? 1103 THR A HG21 15 
ATOM   8919  H  HG22 . THR A 1 1  ? 18.812  -5.990  -1.319  1.00 12.05 ? 1103 THR A HG22 15 
ATOM   8920  H  HG23 . THR A 1 1  ? 18.764  -7.711  -1.700  1.00 12.10 ? 1103 THR A HG23 15 
ATOM   8921  N  N    . HIS A 1 2  ? 19.677  -9.134  3.090   1.00 10.41 ? 1104 HIS A N    15 
ATOM   8922  C  CA   . HIS A 1 2  ? 19.631  -9.250  4.541   1.00 9.72  ? 1104 HIS A CA   15 
ATOM   8923  C  C    . HIS A 1 2  ? 19.752  -7.875  5.190   1.00 8.65  ? 1104 HIS A C    15 
ATOM   8924  O  O    . HIS A 1 2  ? 19.169  -7.620  6.241   1.00 8.32  ? 1104 HIS A O    15 
ATOM   8925  C  CB   . HIS A 1 2  ? 20.751  -10.172 5.035   1.00 10.05 ? 1104 HIS A CB   15 
ATOM   8926  C  CG   . HIS A 1 2  ? 20.723  -10.426 6.513   1.00 10.43 ? 1104 HIS A CG   15 
ATOM   8927  N  ND1  . HIS A 1 2  ? 21.745  -10.056 7.360   1.00 10.71 ? 1104 HIS A ND1  15 
ATOM   8928  C  CD2  . HIS A 1 2  ? 19.795  -11.029 7.291   1.00 10.84 ? 1104 HIS A CD2  15 
ATOM   8929  C  CE1  . HIS A 1 2  ? 21.449  -10.423 8.591   1.00 11.25 ? 1104 HIS A CE1  15 
ATOM   8930  N  NE2  . HIS A 1 2  ? 20.270  -11.015 8.578   1.00 11.34 ? 1104 HIS A NE2  15 
ATOM   8931  H  H    . HIS A 1 2  ? 20.509  -9.358  2.618   1.00 10.71 ? 1104 HIS A H    15 
ATOM   8932  H  HA   . HIS A 1 2  ? 18.679  -9.680  4.810   1.00 9.96  ? 1104 HIS A HA   15 
ATOM   8933  H  HB2  . HIS A 1 2  ? 20.668  -11.125 4.535   1.00 10.50 ? 1104 HIS A HB2  15 
ATOM   8934  H  HB3  . HIS A 1 2  ? 21.706  -9.727  4.792   1.00 9.81  ? 1104 HIS A HB3  15 
ATOM   8935  H  HD1  . HIS A 1 2  ? 22.574  -9.593  7.096   1.00 10.68 ? 1104 HIS A HD1  15 
ATOM   8936  H  HD2  . HIS A 1 2  ? 18.853  -11.441 6.962   1.00 10.94 ? 1104 HIS A HD2  15 
ATOM   8937  H  HE1  . HIS A 1 2  ? 22.066  -10.264 9.462   1.00 11.71 ? 1104 HIS A HE1  15 
ATOM   8938  H  HE2  . HIS A 1 2  ? 19.908  -11.553 9.319   1.00 11.83 ? 1104 HIS A HE2  15 
ATOM   8939  N  N    . ALA A 1 3  ? 20.505  -6.995  4.552   1.00 8.30  ? 1105 ALA A N    15 
ATOM   8940  C  CA   . ALA A 1 3  ? 20.694  -5.645  5.056   1.00 7.41  ? 1105 ALA A CA   15 
ATOM   8941  C  C    . ALA A 1 3  ? 19.547  -4.749  4.609   1.00 6.47  ? 1105 ALA A C    15 
ATOM   8942  O  O    . ALA A 1 3  ? 19.252  -4.664  3.413   1.00 6.54  ? 1105 ALA A O    15 
ATOM   8943  C  CB   . ALA A 1 3  ? 22.022  -5.088  4.574   1.00 7.70  ? 1105 ALA A CB   15 
ATOM   8944  H  H    . ALA A 1 3  ? 20.937  -7.254  3.711   1.00 8.79  ? 1105 ALA A H    15 
ATOM   8945  H  HA   . ALA A 1 3  ? 20.714  -5.689  6.135   1.00 7.45  ? 1105 ALA A HA   15 
ATOM   8946  H  HB1  . ALA A 1 3  ? 22.823  -5.738  4.893   1.00 7.93  ? 1105 ALA A HB1  15 
ATOM   8947  H  HB2  . ALA A 1 3  ? 22.170  -4.102  4.988   1.00 7.73  ? 1105 ALA A HB2  15 
ATOM   8948  H  HB3  . ALA A 1 3  ? 22.016  -5.028  3.496   1.00 7.95  ? 1105 ALA A HB3  15 
ATOM   8949  N  N    . PRO A 1 4  ? 18.876  -4.085  5.568   1.00 5.80  ? 1106 PRO A N    15 
ATOM   8950  C  CA   . PRO A 1 4  ? 17.757  -3.179  5.282   1.00 4.97  ? 1106 PRO A CA   15 
ATOM   8951  C  C    . PRO A 1 4  ? 18.129  -2.101  4.270   1.00 4.25  ? 1106 PRO A C    15 
ATOM   8952  O  O    . PRO A 1 4  ? 19.183  -1.466  4.376   1.00 4.22  ? 1106 PRO A O    15 
ATOM   8953  C  CB   . PRO A 1 4  ? 17.449  -2.542  6.638   1.00 4.84  ? 1106 PRO A CB   15 
ATOM   8954  C  CG   . PRO A 1 4  ? 17.964  -3.510  7.645   1.00 5.55  ? 1106 PRO A CG   15 
ATOM   8955  C  CD   . PRO A 1 4  ? 19.154  -4.174  7.015   1.00 6.09  ? 1106 PRO A CD   15 
ATOM   8956  H  HA   . PRO A 1 4  ? 16.891  -3.718  4.929   1.00 5.32  ? 1106 PRO A HA   15 
ATOM   8957  H  HB2  . PRO A 1 4  ? 17.952  -1.589  6.713   1.00 4.32  ? 1106 PRO A HB2  15 
ATOM   8958  H  HB3  . PRO A 1 4  ? 16.383  -2.399  6.738   1.00 5.12  ? 1106 PRO A HB3  15 
ATOM   8959  H  HG2  . PRO A 1 4  ? 18.259  -2.986  8.542   1.00 5.52  ? 1106 PRO A HG2  15 
ATOM   8960  H  HG3  . PRO A 1 4  ? 17.205  -4.243  7.872   1.00 6.00  ? 1106 PRO A HG3  15 
ATOM   8961  H  HD2  . PRO A 1 4  ? 20.060  -3.643  7.266   1.00 6.19  ? 1106 PRO A HD2  15 
ATOM   8962  H  HD3  . PRO A 1 4  ? 19.220  -5.204  7.331   1.00 6.80  ? 1106 PRO A HD3  15 
ATOM   8963  N  N    . ALA A 1 5  ? 17.267  -1.905  3.284   1.00 4.09  ? 1107 ALA A N    15 
ATOM   8964  C  CA   . ALA A 1 5  ? 17.504  -0.917  2.250   1.00 3.77  ? 1107 ALA A CA   15 
ATOM   8965  C  C    . ALA A 1 5  ? 16.271  -0.054  2.043   1.00 2.63  ? 1107 ALA A C    15 
ATOM   8966  O  O    . ALA A 1 5  ? 15.154  -0.563  1.940   1.00 2.62  ? 1107 ALA A O    15 
ATOM   8967  C  CB   . ALA A 1 5  ? 17.899  -1.598  0.948   1.00 4.73  ? 1107 ALA A CB   15 
ATOM   8968  H  H    . ALA A 1 5  ? 16.442  -2.438  3.255   1.00 4.51  ? 1107 ALA A H    15 
ATOM   8969  H  HA   . ALA A 1 5  ? 18.325  -0.290  2.567   1.00 4.04  ? 1107 ALA A HA   15 
ATOM   8970  H  HB1  . ALA A 1 5  ? 18.116  -0.849  0.202   1.00 5.01  ? 1107 ALA A HB1  15 
ATOM   8971  H  HB2  . ALA A 1 5  ? 17.086  -2.220  0.607   1.00 4.95  ? 1107 ALA A HB2  15 
ATOM   8972  H  HB3  . ALA A 1 5  ? 18.774  -2.207  1.112   1.00 5.29  ? 1107 ALA A HB3  15 
ATOM   8973  N  N    . SER A 1 6  ? 16.478  1.251   1.997   1.00 2.16  ? 1108 SER A N    15 
ATOM   8974  C  CA   . SER A 1 6  ? 15.399  2.190   1.757   1.00 1.43  ? 1108 SER A CA   15 
ATOM   8975  C  C    . SER A 1 6  ? 14.974  2.139   0.295   1.00 1.29  ? 1108 SER A C    15 
ATOM   8976  O  O    . SER A 1 6  ? 15.811  2.211   -0.606  1.00 1.97  ? 1108 SER A O    15 
ATOM   8977  C  CB   . SER A 1 6  ? 15.853  3.594   2.144   1.00 2.09  ? 1108 SER A CB   15 
ATOM   8978  O  OG   . SER A 1 6  ? 17.155  3.862   1.647   1.00 2.97  ? 1108 SER A OG   15 
ATOM   8979  H  H    . SER A 1 6  ? 17.387  1.596   2.124   1.00 2.71  ? 1108 SER A H    15 
ATOM   8980  H  HA   . SER A 1 6  ? 14.562  1.904   2.376   1.00 1.32  ? 1108 SER A HA   15 
ATOM   8981  H  HB2  . SER A 1 6  ? 15.166  4.318   1.732   1.00 2.36  ? 1108 SER A HB2  15 
ATOM   8982  H  HB3  . SER A 1 6  ? 15.866  3.684   3.221   1.00 2.13  ? 1108 SER A HB3  15 
ATOM   8983  H  HG   . SER A 1 6  ? 17.687  4.266   2.347   1.00 3.32  ? 1108 SER A HG   15 
ATOM   8984  N  N    . CYS A 1 7  ? 13.677  1.999   0.066   1.00 0.72  ? 1109 CYS A N    15 
ATOM   8985  C  CA   . CYS A 1 7  ? 13.144  1.894   -1.284  1.00 0.49  ? 1109 CYS A CA   15 
ATOM   8986  C  C    . CYS A 1 7  ? 13.315  3.204   -2.051  1.00 0.46  ? 1109 CYS A C    15 
ATOM   8987  O  O    . CYS A 1 7  ? 13.782  4.207   -1.504  1.00 0.62  ? 1109 CYS A O    15 
ATOM   8988  C  CB   . CYS A 1 7  ? 11.664  1.501   -1.241  1.00 0.33  ? 1109 CYS A CB   15 
ATOM   8989  S  SG   . CYS A 1 7  ? 11.324  -0.007  -0.275  1.00 0.47  ? 1109 CYS A SG   15 
ATOM   8990  H  H    . CYS A 1 7  ? 13.058  1.962   0.826   1.00 0.94  ? 1109 CYS A H    15 
ATOM   8991  H  HA   . CYS A 1 7  ? 13.696  1.120   -1.795  1.00 0.60  ? 1109 CYS A HA   15 
ATOM   8992  H  HB2  . CYS A 1 7  ? 11.096  2.307   -0.804  1.00 0.41  ? 1109 CYS A HB2  15 
ATOM   8993  H  HB3  . CYS A 1 7  ? 11.317  1.330   -2.249  1.00 0.29  ? 1109 CYS A HB3  15 
ATOM   8994  N  N    . LEU A 1 8  ? 12.947  3.181   -3.322  1.00 0.34  ? 1110 LEU A N    15 
ATOM   8995  C  CA   . LEU A 1 8  ? 13.021  4.357   -4.179  1.00 0.32  ? 1110 LEU A CA   15 
ATOM   8996  C  C    . LEU A 1 8  ? 12.128  5.469   -3.640  1.00 0.29  ? 1110 LEU A C    15 
ATOM   8997  O  O    . LEU A 1 8  ? 11.207  5.205   -2.863  1.00 0.30  ? 1110 LEU A O    15 
ATOM   8998  C  CB   . LEU A 1 8  ? 12.548  3.972   -5.578  1.00 0.28  ? 1110 LEU A CB   15 
ATOM   8999  C  CG   . LEU A 1 8  ? 13.191  4.696   -6.753  1.00 0.38  ? 1110 LEU A CG   15 
ATOM   9000  C  CD1  . LEU A 1 8  ? 14.691  4.448   -6.787  1.00 0.52  ? 1110 LEU A CD1  15 
ATOM   9001  C  CD2  . LEU A 1 8  ? 12.540  4.229   -8.047  1.00 0.39  ? 1110 LEU A CD2  15 
ATOM   9002  H  H    . LEU A 1 8  ? 12.618  2.339   -3.703  1.00 0.34  ? 1110 LEU A H    15 
ATOM   9003  H  HA   . LEU A 1 8  ? 14.042  4.696   -4.222  1.00 0.40  ? 1110 LEU A HA   15 
ATOM   9004  H  HB2  . LEU A 1 8  ? 12.707  2.916   -5.704  1.00 0.32  ? 1110 LEU A HB2  15 
ATOM   9005  H  HB3  . LEU A 1 8  ? 11.483  4.152   -5.623  1.00 0.22  ? 1110 LEU A HB3  15 
ATOM   9006  H  HG   . LEU A 1 8  ? 13.025  5.756   -6.656  1.00 0.41  ? 1110 LEU A HG   15 
ATOM   9007  H  HD11 . LEU A 1 8  ? 14.880  3.388   -6.857  1.00 1.05  ? 1110 LEU A HD11 15 
ATOM   9008  H  HD12 . LEU A 1 8  ? 15.141  4.835   -5.886  1.00 1.29  ? 1110 LEU A HD12 15 
ATOM   9009  H  HD13 . LEU A 1 8  ? 15.119  4.947   -7.644  1.00 1.07  ? 1110 LEU A HD13 15 
ATOM   9010  H  HD21 . LEU A 1 8  ? 13.023  4.704   -8.886  1.00 1.11  ? 1110 LEU A HD21 15 
ATOM   9011  H  HD22 . LEU A 1 8  ? 11.492  4.492   -8.037  1.00 1.05  ? 1110 LEU A HD22 15 
ATOM   9012  H  HD23 . LEU A 1 8  ? 12.637  3.155   -8.132  1.00 0.97  ? 1110 LEU A HD23 15 
ATOM   9013  N  N    . ASP A 1 9  ? 12.378  6.702   -4.055  1.00 0.35  ? 1111 ASP A N    15 
ATOM   9014  C  CA   . ASP A 1 9  ? 11.508  7.813   -3.677  1.00 0.38  ? 1111 ASP A CA   15 
ATOM   9015  C  C    . ASP A 1 9  ? 10.100  7.565   -4.194  1.00 0.32  ? 1111 ASP A C    15 
ATOM   9016  O  O    . ASP A 1 9  ? 9.115   7.842   -3.513  1.00 0.42  ? 1111 ASP A O    15 
ATOM   9017  C  CB   . ASP A 1 9  ? 12.030  9.141   -4.229  1.00 0.51  ? 1111 ASP A CB   15 
ATOM   9018  C  CG   . ASP A 1 9  ? 13.207  9.685   -3.450  1.00 1.37  ? 1111 ASP A CG   15 
ATOM   9019  O  OD1  . ASP A 1 9  ? 14.325  9.147   -3.593  1.00 1.53  ? 1111 ASP A OD1  15 
ATOM   9020  O  OD2  . ASP A 1 9  ? 13.022  10.671  -2.701  1.00 2.32  ? 1111 ASP A OD2  15 
ATOM   9021  H  H    . ASP A 1 9  ? 13.165  6.873   -4.618  1.00 0.40  ? 1111 ASP A H    15 
ATOM   9022  H  HA   . ASP A 1 9  ? 11.481  7.862   -2.598  1.00 0.44  ? 1111 ASP A HA   15 
ATOM   9023  H  HB2  . ASP A 1 9  ? 12.338  8.999   -5.251  1.00 0.94  ? 1111 ASP A HB2  15 
ATOM   9024  H  HB3  . ASP A 1 9  ? 11.234  9.871   -4.197  1.00 1.01  ? 1111 ASP A HB3  15 
ATOM   9025  N  N    . THR A 1 10 ? 10.019  7.016   -5.397  1.00 0.28  ? 1112 THR A N    15 
ATOM   9026  C  CA   . THR A 1 10 ? 8.742   6.718   -6.017  1.00 0.31  ? 1112 THR A CA   15 
ATOM   9027  C  C    . THR A 1 10 ? 8.314   5.277   -5.751  1.00 0.24  ? 1112 THR A C    15 
ATOM   9028  O  O    . THR A 1 10 ? 7.351   4.786   -6.342  1.00 0.30  ? 1112 THR A O    15 
ATOM   9029  C  CB   . THR A 1 10 ? 8.795   6.972   -7.531  1.00 0.42  ? 1112 THR A CB   15 
ATOM   9030  O  OG1  . THR A 1 10 ? 9.995   6.409   -8.078  1.00 0.45  ? 1112 THR A OG1  15 
ATOM   9031  C  CG2  . THR A 1 10 ? 8.750   8.462   -7.828  1.00 0.52  ? 1112 THR A CG2  15 
ATOM   9032  H  H    . THR A 1 10 ? 10.843  6.813   -5.887  1.00 0.31  ? 1112 THR A H    15 
ATOM   9033  H  HA   . THR A 1 10 ? 8.005   7.383   -5.590  1.00 0.36  ? 1112 THR A HA   15 
ATOM   9034  H  HB   . THR A 1 10 ? 7.940   6.500   -7.993  1.00 0.48  ? 1112 THR A HB   15 
ATOM   9035  H  HG1  . THR A 1 10 ? 10.680  7.088   -8.107  1.00 0.95  ? 1112 THR A HG1  15 
ATOM   9036  H  HG21 . THR A 1 10 ? 9.577   8.951   -7.335  1.00 1.19  ? 1112 THR A HG21 15 
ATOM   9037  H  HG22 . THR A 1 10 ? 7.820   8.874   -7.466  1.00 1.09  ? 1112 THR A HG22 15 
ATOM   9038  H  HG23 . THR A 1 10 ? 8.823   8.618   -8.893  1.00 1.17  ? 1112 THR A HG23 15 
ATOM   9039  N  N    . GLN A 1 11 ? 9.035   4.591   -4.870  1.00 0.18  ? 1113 GLN A N    15 
ATOM   9040  C  CA   . GLN A 1 11 ? 8.641   3.261   -4.457  1.00 0.17  ? 1113 GLN A CA   15 
ATOM   9041  C  C    . GLN A 1 11 ? 8.007   3.268   -3.080  1.00 0.17  ? 1113 GLN A C    15 
ATOM   9042  O  O    . GLN A 1 11 ? 8.217   4.180   -2.276  1.00 0.23  ? 1113 GLN A O    15 
ATOM   9043  C  CB   . GLN A 1 11 ? 9.824   2.306   -4.467  1.00 0.17  ? 1113 GLN A CB   15 
ATOM   9044  C  CG   . GLN A 1 11 ? 10.181  1.820   -5.856  1.00 0.23  ? 1113 GLN A CG   15 
ATOM   9045  C  CD   . GLN A 1 11 ? 11.261  0.758   -5.844  1.00 0.35  ? 1113 GLN A CD   15 
ATOM   9046  O  OE1  . GLN A 1 11 ? 12.111  0.724   -4.951  1.00 1.02  ? 1113 GLN A OE1  15 
ATOM   9047  N  NE2  . GLN A 1 11 ? 11.241  -0.109  -6.839  1.00 0.67  ? 1113 GLN A NE2  15 
ATOM   9048  H  H    . GLN A 1 11 ? 9.855   4.981   -4.500  1.00 0.20  ? 1113 GLN A H    15 
ATOM   9049  H  HA   . GLN A 1 11 ? 7.908   2.906   -5.168  1.00 0.22  ? 1113 GLN A HA   15 
ATOM   9050  H  HB2  . GLN A 1 11 ? 10.684  2.808   -4.045  1.00 0.16  ? 1113 GLN A HB2  15 
ATOM   9051  H  HB3  . GLN A 1 11 ? 9.584   1.452   -3.859  1.00 0.20  ? 1113 GLN A HB3  15 
ATOM   9052  H  HG2  . GLN A 1 11 ? 9.296   1.411   -6.310  1.00 0.31  ? 1113 GLN A HG2  15 
ATOM   9053  H  HG3  . GLN A 1 11 ? 10.527  2.659   -6.441  1.00 0.22  ? 1113 GLN A HG3  15 
ATOM   9054  H  HE21 . GLN A 1 11 ? 10.538  -0.019  -7.520  1.00 1.21  ? 1113 GLN A HE21 15 
ATOM   9055  H  HE22 . GLN A 1 11 ? 11.932  -0.803  -6.863  1.00 0.65  ? 1113 GLN A HE22 15 
ATOM   9056  N  N    . TYR A 1 12 ? 7.225   2.241   -2.833  1.00 0.15  ? 1114 TYR A N    15 
ATOM   9057  C  CA   . TYR A 1 12 ? 6.557   2.055   -1.561  1.00 0.16  ? 1114 TYR A CA   15 
ATOM   9058  C  C    . TYR A 1 12 ? 7.160   0.862   -0.833  1.00 0.15  ? 1114 TYR A C    15 
ATOM   9059  O  O    . TYR A 1 12 ? 7.693   -0.053  -1.462  1.00 0.15  ? 1114 TYR A O    15 
ATOM   9060  C  CB   . TYR A 1 12 ? 5.065   1.834   -1.798  1.00 0.18  ? 1114 TYR A CB   15 
ATOM   9061  C  CG   . TYR A 1 12 ? 4.257   1.576   -0.549  1.00 0.22  ? 1114 TYR A CG   15 
ATOM   9062  C  CD1  . TYR A 1 12 ? 3.954   2.612   0.326   1.00 0.33  ? 1114 TYR A CD1  15 
ATOM   9063  C  CD2  . TYR A 1 12 ? 3.798   0.306   -0.245  1.00 0.21  ? 1114 TYR A CD2  15 
ATOM   9064  C  CE1  . TYR A 1 12 ? 3.214   2.387   1.468   1.00 0.39  ? 1114 TYR A CE1  15 
ATOM   9065  C  CE2  . TYR A 1 12 ? 3.056   0.071   0.896   1.00 0.26  ? 1114 TYR A CE2  15 
ATOM   9066  C  CZ   . TYR A 1 12 ? 2.773   1.086   1.748   1.00 0.34  ? 1114 TYR A CZ   15 
ATOM   9067  O  OH   . TYR A 1 12 ? 2.018   0.891   2.885   1.00 0.41  ? 1114 TYR A OH   15 
ATOM   9068  H  H    . TYR A 1 12 ? 7.093   1.569   -3.543  1.00 0.16  ? 1114 TYR A H    15 
ATOM   9069  H  HA   . TYR A 1 12 ? 6.700   2.946   -0.968  1.00 0.18  ? 1114 TYR A HA   15 
ATOM   9070  H  HB2  . TYR A 1 12 ? 4.654   2.705   -2.282  1.00 0.23  ? 1114 TYR A HB2  15 
ATOM   9071  H  HB3  . TYR A 1 12 ? 4.946   0.984   -2.445  1.00 0.18  ? 1114 TYR A HB3  15 
ATOM   9072  H  HD1  . TYR A 1 12 ? 4.305   3.608   0.101   1.00 0.40  ? 1114 TYR A HD1  15 
ATOM   9073  H  HD2  . TYR A 1 12 ? 4.029   -0.510  -0.915  1.00 0.23  ? 1114 TYR A HD2  15 
ATOM   9074  H  HE1  . TYR A 1 12 ? 2.990   3.205   2.135   1.00 0.50  ? 1114 TYR A HE1  15 
ATOM   9075  H  HE2  . TYR A 1 12 ? 2.707   -0.926  1.117   1.00 0.29  ? 1114 TYR A HE2  15 
ATOM   9076  H  HH   . TYR A 1 12 ? 2.283   0.054   3.282   1.00 0.89  ? 1114 TYR A HH   15 
ATOM   9077  N  N    . THR A 1 13 ? 7.061   0.876   0.481   1.00 0.18  ? 1115 THR A N    15 
ATOM   9078  C  CA   . THR A 1 13 ? 7.610   -0.185  1.305   1.00 0.20  ? 1115 THR A CA   15 
ATOM   9079  C  C    . THR A 1 13 ? 6.483   -1.057  1.854   1.00 0.23  ? 1115 THR A C    15 
ATOM   9080  O  O    . THR A 1 13 ? 5.794   -0.669  2.800   1.00 0.31  ? 1115 THR A O    15 
ATOM   9081  C  CB   . THR A 1 13 ? 8.424   0.395   2.477   1.00 0.26  ? 1115 THR A CB   15 
ATOM   9082  O  OG1  . THR A 1 13 ? 9.234   1.485   2.011   1.00 0.30  ? 1115 THR A OG1  15 
ATOM   9083  C  CG2  . THR A 1 13 ? 9.318   -0.668  3.101   1.00 0.27  ? 1115 THR A CG2  15 
ATOM   9084  H  H    . THR A 1 13 ? 6.587   1.616   0.910   1.00 0.22  ? 1115 THR A H    15 
ATOM   9085  H  HA   . THR A 1 13 ? 8.263   -0.788  0.693   1.00 0.19  ? 1115 THR A HA   15 
ATOM   9086  H  HB   . THR A 1 13 ? 7.739   0.759   3.229   1.00 0.31  ? 1115 THR A HB   15 
ATOM   9087  H  HG1  . THR A 1 13 ? 8.705   2.292   2.004   1.00 0.82  ? 1115 THR A HG1  15 
ATOM   9088  H  HG21 . THR A 1 13 ? 8.710   -1.484  3.462   1.00 1.01  ? 1115 THR A HG21 15 
ATOM   9089  H  HG22 . THR A 1 13 ? 9.868   -0.238  3.925   1.00 1.02  ? 1115 THR A HG22 15 
ATOM   9090  H  HG23 . THR A 1 13 ? 10.013  -1.036  2.359   1.00 1.10  ? 1115 THR A HG23 15 
ATOM   9091  N  N    . CYS A 1 14 ? 6.288   -2.218  1.240   1.00 0.26  ? 1116 CYS A N    15 
ATOM   9092  C  CA   . CYS A 1 14 ? 5.229   -3.135  1.645   1.00 0.34  ? 1116 CYS A CA   15 
ATOM   9093  C  C    . CYS A 1 14 ? 5.497   -3.716  3.031   1.00 0.40  ? 1116 CYS A C    15 
ATOM   9094  O  O    . CYS A 1 14 ? 6.583   -3.530  3.586   1.00 0.37  ? 1116 CYS A O    15 
ATOM   9095  C  CB   . CYS A 1 14 ? 5.096   -4.274  0.635   1.00 0.45  ? 1116 CYS A CB   15 
ATOM   9096  S  SG   . CYS A 1 14 ? 4.872   -3.730  -1.090  1.00 0.65  ? 1116 CYS A SG   15 
ATOM   9097  H  H    . CYS A 1 14 ? 6.870   -2.463  0.484   1.00 0.28  ? 1116 CYS A H    15 
ATOM   9098  H  HA   . CYS A 1 14 ? 4.303   -2.581  1.672   1.00 0.38  ? 1116 CYS A HA   15 
ATOM   9099  H  HB2  . CYS A 1 14 ? 5.988   -4.878  0.673   1.00 0.50  ? 1116 CYS A HB2  15 
ATOM   9100  H  HB3  . CYS A 1 14 ? 4.247   -4.882  0.902   1.00 0.54  ? 1116 CYS A HB3  15 
ATOM   9101  N  N    . ASP A 1 15 ? 4.518   -4.432  3.570   1.00 0.56  ? 1117 ASP A N    15 
ATOM   9102  C  CA   . ASP A 1 15 ? 4.605   -5.001  4.916   1.00 0.69  ? 1117 ASP A CA   15 
ATOM   9103  C  C    . ASP A 1 15 ? 5.889   -5.807  5.108   1.00 0.65  ? 1117 ASP A C    15 
ATOM   9104  O  O    . ASP A 1 15 ? 6.594   -5.636  6.100   1.00 0.71  ? 1117 ASP A O    15 
ATOM   9105  C  CB   . ASP A 1 15 ? 3.380   -5.878  5.187   1.00 0.93  ? 1117 ASP A CB   15 
ATOM   9106  C  CG   . ASP A 1 15 ? 3.432   -6.576  6.532   1.00 1.83  ? 1117 ASP A CG   15 
ATOM   9107  O  OD1  . ASP A 1 15 ? 3.500   -5.880  7.566   1.00 2.62  ? 1117 ASP A OD1  15 
ATOM   9108  O  OD2  . ASP A 1 15 ? 3.373   -7.824  6.565   1.00 2.09  ? 1117 ASP A OD2  15 
ATOM   9109  H  H    . ASP A 1 15 ? 3.699   -4.583  3.046   1.00 0.63  ? 1117 ASP A H    15 
ATOM   9110  H  HA   . ASP A 1 15 ? 4.606   -4.182  5.618   1.00 0.70  ? 1117 ASP A HA   15 
ATOM   9111  H  HB2  . ASP A 1 15 ? 2.494   -5.261  5.162   1.00 1.35  ? 1117 ASP A HB2  15 
ATOM   9112  H  HB3  . ASP A 1 15 ? 3.308   -6.630  4.415   1.00 0.70  ? 1117 ASP A HB3  15 
ATOM   9113  N  N    . ASN A 1 16 ? 6.211   -6.651  4.138   1.00 0.69  ? 1118 ASN A N    15 
ATOM   9114  C  CA   . ASN A 1 16 ? 7.400   -7.495  4.225   1.00 0.75  ? 1118 ASN A CA   15 
ATOM   9115  C  C    . ASN A 1 16 ? 8.607   -6.828  3.572   1.00 0.59  ? 1118 ASN A C    15 
ATOM   9116  O  O    . ASN A 1 16 ? 9.459   -7.499  2.989   1.00 0.65  ? 1118 ASN A O    15 
ATOM   9117  C  CB   . ASN A 1 16 ? 7.144   -8.860  3.580   1.00 0.98  ? 1118 ASN A CB   15 
ATOM   9118  C  CG   . ASN A 1 16 ? 6.220   -9.730  4.409   1.00 1.77  ? 1118 ASN A CG   15 
ATOM   9119  O  OD1  . ASN A 1 16 ? 6.668   -10.482 5.275   1.00 2.75  ? 1118 ASN A OD1  15 
ATOM   9120  N  ND2  . ASN A 1 16 ? 4.925   -9.643  4.147   1.00 2.02  ? 1118 ASN A ND2  15 
ATOM   9121  H  H    . ASN A 1 16 ? 5.637   -6.711  3.345   1.00 0.75  ? 1118 ASN A H    15 
ATOM   9122  H  HA   . ASN A 1 16 ? 7.617   -7.643  5.272   1.00 0.85  ? 1118 ASN A HA   15 
ATOM   9123  H  HB2  . ASN A 1 16 ? 6.693   -8.712  2.610   1.00 1.24  ? 1118 ASN A HB2  15 
ATOM   9124  H  HB3  . ASN A 1 16 ? 8.085   -9.376  3.460   1.00 1.41  ? 1118 ASN A HB3  15 
ATOM   9125  H  HD21 . ASN A 1 16 ? 4.634   -9.026  3.440   1.00 1.91  ? 1118 ASN A HD21 15 
ATOM   9126  H  HD22 . ASN A 1 16 ? 4.309   -10.196 4.671   1.00 2.74  ? 1118 ASN A HD22 15 
ATOM   9127  N  N    . HIS A 1 17 ? 8.662   -5.501  3.665   1.00 0.46  ? 1119 HIS A N    15 
ATOM   9128  C  CA   . HIS A 1 17 ? 9.806   -4.716  3.189   1.00 0.41  ? 1119 HIS A CA   15 
ATOM   9129  C  C    . HIS A 1 17 ? 9.999   -4.846  1.677   1.00 0.44  ? 1119 HIS A C    15 
ATOM   9130  O  O    . HIS A 1 17 ? 11.117  -4.730  1.177   1.00 0.79  ? 1119 HIS A O    15 
ATOM   9131  C  CB   . HIS A 1 17 ? 11.098  -5.128  3.911   1.00 0.51  ? 1119 HIS A CB   15 
ATOM   9132  C  CG   . HIS A 1 17 ? 11.057  -4.947  5.399   1.00 0.63  ? 1119 HIS A CG   15 
ATOM   9133  N  ND1  . HIS A 1 17 ? 11.433  -5.931  6.288   1.00 0.94  ? 1119 HIS A ND1  15 
ATOM   9134  C  CD2  . HIS A 1 17 ? 10.695  -3.882  6.154   1.00 0.78  ? 1119 HIS A CD2  15 
ATOM   9135  C  CE1  . HIS A 1 17 ? 11.306  -5.481  7.520   1.00 1.05  ? 1119 HIS A CE1  15 
ATOM   9136  N  NE2  . HIS A 1 17 ? 10.860  -4.241  7.468   1.00 0.93  ? 1119 HIS A NE2  15 
ATOM   9137  H  H    . HIS A 1 17 ? 7.899   -5.025  4.068   1.00 0.47  ? 1119 HIS A H    15 
ATOM   9138  H  HA   . HIS A 1 17 ? 9.602   -3.680  3.418   1.00 0.38  ? 1119 HIS A HA   15 
ATOM   9139  H  HB2  . HIS A 1 17 ? 11.293  -6.172  3.713   1.00 0.60  ? 1119 HIS A HB2  15 
ATOM   9140  H  HB3  . HIS A 1 17 ? 11.917  -4.538  3.527   1.00 0.55  ? 1119 HIS A HB3  15 
ATOM   9141  H  HD1  . HIS A 1 17 ? 11.746  -6.834  6.052   1.00 1.18  ? 1119 HIS A HD1  15 
ATOM   9142  H  HD2  . HIS A 1 17 ? 10.344  -2.928  5.789   1.00 1.00  ? 1119 HIS A HD2  15 
ATOM   9143  H  HE1  . HIS A 1 17 ? 11.530  -6.033  8.421   1.00 1.35  ? 1119 HIS A HE1  15 
ATOM   9144  H  HE2  . HIS A 1 17 ? 10.529  -3.733  8.241   1.00 1.09  ? 1119 HIS A HE2  15 
ATOM   9145  N  N    . GLN A 1 18 ? 8.914   -5.084  0.950   1.00 0.40  ? 1120 GLN A N    15 
ATOM   9146  C  CA   . GLN A 1 18 ? 8.983   -5.179  -0.504  1.00 0.38  ? 1120 GLN A CA   15 
ATOM   9147  C  C    . GLN A 1 18 ? 8.822   -3.797  -1.122  1.00 0.29  ? 1120 GLN A C    15 
ATOM   9148  O  O    . GLN A 1 18 ? 7.863   -3.088  -0.832  1.00 0.39  ? 1120 GLN A O    15 
ATOM   9149  C  CB   . GLN A 1 18 ? 7.901   -6.131  -1.029  1.00 0.49  ? 1120 GLN A CB   15 
ATOM   9150  C  CG   . GLN A 1 18 ? 7.851   -6.262  -2.548  1.00 0.50  ? 1120 GLN A CG   15 
ATOM   9151  C  CD   . GLN A 1 18 ? 9.120   -6.847  -3.139  1.00 1.05  ? 1120 GLN A CD   15 
ATOM   9152  O  OE1  . GLN A 1 18 ? 9.268   -8.063  -3.234  1.00 1.91  ? 1120 GLN A OE1  15 
ATOM   9153  N  NE2  . GLN A 1 18 ? 10.029  -5.989  -3.576  1.00 1.51  ? 1120 GLN A NE2  15 
ATOM   9154  H  H    . GLN A 1 18 ? 8.051   -5.194  1.399   1.00 0.63  ? 1120 GLN A H    15 
ATOM   9155  H  HA   . GLN A 1 18 ? 9.956   -5.568  -0.766  1.00 0.42  ? 1120 GLN A HA   15 
ATOM   9156  H  HB2  . GLN A 1 18 ? 8.076   -7.112  -0.615  1.00 0.62  ? 1120 GLN A HB2  15 
ATOM   9157  H  HB3  . GLN A 1 18 ? 6.939   -5.779  -0.691  1.00 0.52  ? 1120 GLN A HB3  15 
ATOM   9158  H  HG2  . GLN A 1 18 ? 7.025   -6.904  -2.811  1.00 0.87  ? 1120 GLN A HG2  15 
ATOM   9159  H  HG3  . GLN A 1 18 ? 7.691   -5.283  -2.974  1.00 0.86  ? 1120 GLN A HG3  15 
ATOM   9160  H  HE21 . GLN A 1 18 ? 9.837   -5.033  -3.502  1.00 1.83  ? 1120 GLN A HE21 15 
ATOM   9161  H  HE22 . GLN A 1 18 ? 10.856  -6.349  -3.963  1.00 1.99  ? 1120 GLN A HE22 15 
ATOM   9162  N  N    . CYS A 1 19 ? 9.777   -3.407  -1.946  1.00 0.21  ? 1121 CYS A N    15 
ATOM   9163  C  CA   . CYS A 1 19 ? 9.723   -2.116  -2.613  1.00 0.21  ? 1121 CYS A CA   15 
ATOM   9164  C  C    . CYS A 1 19 ? 8.963   -2.220  -3.935  1.00 0.20  ? 1121 CYS A C    15 
ATOM   9165  O  O    . CYS A 1 19 ? 9.500   -2.706  -4.932  1.00 0.34  ? 1121 CYS A O    15 
ATOM   9166  C  CB   . CYS A 1 19 ? 11.138  -1.591  -2.864  1.00 0.34  ? 1121 CYS A CB   15 
ATOM   9167  S  SG   . CYS A 1 19 ? 12.174  -1.494  -1.365  1.00 0.42  ? 1121 CYS A SG   15 
ATOM   9168  H  H    . CYS A 1 19 ? 10.551  -3.993  -2.097  1.00 0.29  ? 1121 CYS A H    15 
ATOM   9169  H  HA   . CYS A 1 19 ? 9.201   -1.428  -1.965  1.00 0.24  ? 1121 CYS A HA   15 
ATOM   9170  H  HB2  . CYS A 1 19 ? 11.637  -2.244  -3.565  1.00 0.39  ? 1121 CYS A HB2  15 
ATOM   9171  H  HB3  . CYS A 1 19 ? 11.076  -0.599  -3.287  1.00 0.41  ? 1121 CYS A HB3  15 
ATOM   9172  N  N    . ILE A 1 20 ? 7.708   -1.792  -3.929  1.00 0.15  ? 1122 ILE A N    15 
ATOM   9173  C  CA   . ILE A 1 20 ? 6.914   -1.732  -5.151  1.00 0.14  ? 1122 ILE A CA   15 
ATOM   9174  C  C    . ILE A 1 20 ? 6.828   -0.295  -5.637  1.00 0.14  ? 1122 ILE A C    15 
ATOM   9175  O  O    . ILE A 1 20 ? 7.255   0.619   -4.944  1.00 0.18  ? 1122 ILE A O    15 
ATOM   9176  C  CB   . ILE A 1 20 ? 5.479   -2.264  -4.958  1.00 0.14  ? 1122 ILE A CB   15 
ATOM   9177  C  CG1  . ILE A 1 20 ? 4.733   -1.428  -3.916  1.00 0.13  ? 1122 ILE A CG1  15 
ATOM   9178  C  CG2  . ILE A 1 20 ? 5.504   -3.732  -4.560  1.00 0.19  ? 1122 ILE A CG2  15 
ATOM   9179  C  CD1  . ILE A 1 20 ? 3.243   -1.681  -3.890  1.00 0.17  ? 1122 ILE A CD1  15 
ATOM   9180  H  H    . ILE A 1 20 ? 7.308   -1.497  -3.082  1.00 0.22  ? 1122 ILE A H    15 
ATOM   9181  H  HA   . ILE A 1 20 ? 7.402   -2.331  -5.903  1.00 0.17  ? 1122 ILE A HA   15 
ATOM   9182  H  HB   . ILE A 1 20 ? 4.964   -2.184  -5.903  1.00 0.16  ? 1122 ILE A HB   15 
ATOM   9183  H  HG12 . ILE A 1 20 ? 5.123   -1.659  -2.941  1.00 0.15  ? 1122 ILE A HG12 15 
ATOM   9184  H  HG13 . ILE A 1 20 ? 4.890   -0.380  -4.125  1.00 0.14  ? 1122 ILE A HG13 15 
ATOM   9185  H  HG21 . ILE A 1 20 ? 5.968   -4.310  -5.346  1.00 0.98  ? 1122 ILE A HG21 15 
ATOM   9186  H  HG22 . ILE A 1 20 ? 4.494   -4.081  -4.405  1.00 1.05  ? 1122 ILE A HG22 15 
ATOM   9187  H  HG23 . ILE A 1 20 ? 6.068   -3.848  -3.647  1.00 0.97  ? 1122 ILE A HG23 15 
ATOM   9188  H  HD11 . ILE A 1 20 ? 2.814   -1.400  -4.838  1.00 1.07  ? 1122 ILE A HD11 15 
ATOM   9189  H  HD12 . ILE A 1 20 ? 2.789   -1.096  -3.098  1.00 0.99  ? 1122 ILE A HD12 15 
ATOM   9190  H  HD13 . ILE A 1 20 ? 3.060   -2.730  -3.710  1.00 1.03  ? 1122 ILE A HD13 15 
ATOM   9191  N  N    . SER A 1 21 ? 6.276   -0.096  -6.816  1.00 0.16  ? 1123 SER A N    15 
ATOM   9192  C  CA   . SER A 1 21 ? 6.060   1.245   -7.330  1.00 0.17  ? 1123 SER A CA   15 
ATOM   9193  C  C    . SER A 1 21 ? 4.890   1.894   -6.605  1.00 0.15  ? 1123 SER A C    15 
ATOM   9194  O  O    . SER A 1 21 ? 3.906   1.231   -6.276  1.00 0.17  ? 1123 SER A O    15 
ATOM   9195  C  CB   . SER A 1 21 ? 5.777   1.202   -8.832  1.00 0.24  ? 1123 SER A CB   15 
ATOM   9196  O  OG   . SER A 1 21 ? 5.404   2.484   -9.316  1.00 0.33  ? 1123 SER A OG   15 
ATOM   9197  H  H    . SER A 1 21 ? 6.002   -0.868  -7.352  1.00 0.20  ? 1123 SER A H    15 
ATOM   9198  H  HA   . SER A 1 21 ? 6.953   1.823   -7.150  1.00 0.19  ? 1123 SER A HA   15 
ATOM   9199  H  HB2  . SER A 1 21 ? 6.664   0.878   -9.356  1.00 0.27  ? 1123 SER A HB2  15 
ATOM   9200  H  HB3  . SER A 1 21 ? 4.971   0.509   -9.026  1.00 0.24  ? 1123 SER A HB3  15 
ATOM   9201  H  HG   . SER A 1 21 ? 4.580   2.414   -9.811  1.00 0.63  ? 1123 SER A HG   15 
ATOM   9202  N  N    . LYS A 1 22 ? 4.993   3.197   -6.360  1.00 0.17  ? 1124 LYS A N    15 
ATOM   9203  C  CA   . LYS A 1 22 ? 3.910   3.934   -5.727  1.00 0.19  ? 1124 LYS A CA   15 
ATOM   9204  C  C    . LYS A 1 22 ? 2.693   4.006   -6.647  1.00 0.22  ? 1124 LYS A C    15 
ATOM   9205  O  O    . LYS A 1 22 ? 1.591   4.326   -6.202  1.00 0.25  ? 1124 LYS A O    15 
ATOM   9206  C  CB   . LYS A 1 22 ? 4.357   5.342   -5.328  1.00 0.23  ? 1124 LYS A CB   15 
ATOM   9207  C  CG   . LYS A 1 22 ? 5.170   5.376   -4.044  1.00 0.25  ? 1124 LYS A CG   15 
ATOM   9208  C  CD   . LYS A 1 22 ? 5.541   6.799   -3.658  1.00 0.25  ? 1124 LYS A CD   15 
ATOM   9209  C  CE   . LYS A 1 22 ? 6.298   6.842   -2.340  1.00 0.30  ? 1124 LYS A CE   15 
ATOM   9210  N  NZ   . LYS A 1 22 ? 5.464   6.380   -1.201  1.00 1.24  ? 1124 LYS A NZ   15 
ATOM   9211  H  H    . LYS A 1 22 ? 5.821   3.672   -6.606  1.00 0.20  ? 1124 LYS A H    15 
ATOM   9212  H  HA   . LYS A 1 22 ? 3.637   3.392   -4.833  1.00 0.19  ? 1124 LYS A HA   15 
ATOM   9213  H  HB2  . LYS A 1 22 ? 4.959   5.754   -6.124  1.00 0.30  ? 1124 LYS A HB2  15 
ATOM   9214  H  HB3  . LYS A 1 22 ? 3.483   5.961   -5.193  1.00 0.30  ? 1124 LYS A HB3  15 
ATOM   9215  H  HG2  . LYS A 1 22 ? 4.587   4.940   -3.250  1.00 0.37  ? 1124 LYS A HG2  15 
ATOM   9216  H  HG3  . LYS A 1 22 ? 6.074   4.803   -4.184  1.00 0.37  ? 1124 LYS A HG3  15 
ATOM   9217  H  HD2  . LYS A 1 22 ? 6.164   7.221   -4.432  1.00 0.32  ? 1124 LYS A HD2  15 
ATOM   9218  H  HD3  . LYS A 1 22 ? 4.637   7.383   -3.562  1.00 0.33  ? 1124 LYS A HD3  15 
ATOM   9219  H  HE2  . LYS A 1 22 ? 7.168   6.205   -2.418  1.00 0.93  ? 1124 LYS A HE2  15 
ATOM   9220  H  HE3  . LYS A 1 22 ? 6.614   7.858   -2.155  1.00 0.95  ? 1124 LYS A HE3  15 
ATOM   9221  H  HZ1  . LYS A 1 22 ? 5.111   5.419   -1.378  1.00 1.76  ? 1124 LYS A HZ1  15 
ATOM   9222  H  HZ2  . LYS A 1 22 ? 4.652   7.013   -1.071  1.00 1.77  ? 1124 LYS A HZ2  15 
ATOM   9223  H  HZ3  . LYS A 1 22 ? 6.025   6.375   -0.326  1.00 1.88  ? 1124 LYS A HZ3  15 
ATOM   9224  N  N    . ASN A 1 23 ? 2.893   3.700   -7.931  1.00 0.24  ? 1125 ASN A N    15 
ATOM   9225  C  CA   . ASN A 1 23 ? 1.778   3.615   -8.876  1.00 0.28  ? 1125 ASN A CA   15 
ATOM   9226  C  C    . ASN A 1 23 ? 0.978   2.344   -8.638  1.00 0.26  ? 1125 ASN A C    15 
ATOM   9227  O  O    . ASN A 1 23 ? -0.135  2.193   -9.134  1.00 0.32  ? 1125 ASN A O    15 
ATOM   9228  C  CB   . ASN A 1 23 ? 2.269   3.636   -10.327 1.00 0.36  ? 1125 ASN A CB   15 
ATOM   9229  C  CG   . ASN A 1 23 ? 2.847   4.974   -10.741 1.00 1.03  ? 1125 ASN A CG   15 
ATOM   9230  O  OD1  . ASN A 1 23 ? 4.044   5.211   -10.603 1.00 1.75  ? 1125 ASN A OD1  15 
ATOM   9231  N  ND2  . ASN A 1 23 ? 2.002   5.857   -11.249 1.00 1.69  ? 1125 ASN A ND2  15 
ATOM   9232  H  H    . ASN A 1 23 ? 3.808   3.539   -8.248  1.00 0.25  ? 1125 ASN A H    15 
ATOM   9233  H  HA   . ASN A 1 23 ? 1.138   4.467   -8.709  1.00 0.31  ? 1125 ASN A HA   15 
ATOM   9234  H  HB2  . ASN A 1 23 ? 3.034   2.886   -10.452 1.00 0.82  ? 1125 ASN A HB2  15 
ATOM   9235  H  HB3  . ASN A 1 23 ? 1.441   3.406   -10.982 1.00 0.82  ? 1125 ASN A HB3  15 
ATOM   9236  H  HD21 . ASN A 1 23 ? 1.056   5.601   -11.328 1.00 1.99  ? 1125 ASN A HD21 15 
ATOM   9237  H  HD22 . ASN A 1 23 ? 2.353   6.727   -11.531 1.00 2.22  ? 1125 ASN A HD22 15 
ATOM   9238  N  N    . TRP A 1 24 ? 1.554   1.429   -7.871  1.00 0.22  ? 1126 TRP A N    15 
ATOM   9239  C  CA   . TRP A 1 24 ? 0.920   0.147   -7.602  1.00 0.22  ? 1126 TRP A CA   15 
ATOM   9240  C  C    . TRP A 1 24 ? 0.190   0.171   -6.268  1.00 0.20  ? 1126 TRP A C    15 
ATOM   9241  O  O    . TRP A 1 24 ? -0.567  -0.738  -5.952  1.00 0.26  ? 1126 TRP A O    15 
ATOM   9242  C  CB   . TRP A 1 24 ? 1.961   -0.973  -7.587  1.00 0.25  ? 1126 TRP A CB   15 
ATOM   9243  C  CG   . TRP A 1 24 ? 2.631   -1.208  -8.908  1.00 0.31  ? 1126 TRP A CG   15 
ATOM   9244  C  CD1  . TRP A 1 24 ? 2.360   -0.585  -10.092 1.00 0.37  ? 1126 TRP A CD1  15 
ATOM   9245  C  CD2  . TRP A 1 24 ? 3.681   -2.142  -9.180  1.00 0.38  ? 1126 TRP A CD2  15 
ATOM   9246  N  NE1  . TRP A 1 24 ? 3.182   -1.066  -11.078 1.00 0.45  ? 1126 TRP A NE1  15 
ATOM   9247  C  CE2  . TRP A 1 24 ? 4.003   -2.025  -10.543 1.00 0.45  ? 1126 TRP A CE2  15 
ATOM   9248  C  CE3  . TRP A 1 24 ? 4.385   -3.064  -8.401  1.00 0.44  ? 1126 TRP A CE3  15 
ATOM   9249  C  CZ2  . TRP A 1 24 ? 4.996   -2.793  -11.145 1.00 0.54  ? 1126 TRP A CZ2  15 
ATOM   9250  C  CZ3  . TRP A 1 24 ? 5.370   -3.827  -8.997  1.00 0.55  ? 1126 TRP A CZ3  15 
ATOM   9251  C  CH2  . TRP A 1 24 ? 5.668   -3.687  -10.357 1.00 0.58  ? 1126 TRP A CH2  15 
ATOM   9252  H  H    . TRP A 1 24 ? 2.430   1.621   -7.472  1.00 0.23  ? 1126 TRP A H    15 
ATOM   9253  H  HA   . TRP A 1 24 ? 0.206   -0.045  -8.389  1.00 0.25  ? 1126 TRP A HA   15 
ATOM   9254  H  HB2  . TRP A 1 24 ? 2.728   -0.731  -6.868  1.00 0.27  ? 1126 TRP A HB2  15 
ATOM   9255  H  HB3  . TRP A 1 24 ? 1.478   -1.888  -7.288  1.00 0.28  ? 1126 TRP A HB3  15 
ATOM   9256  H  HD1  . TRP A 1 24 ? 1.607   0.179   -10.218 1.00 0.40  ? 1126 TRP A HD1  15 
ATOM   9257  H  HE1  . TRP A 1 24 ? 3.180   -0.773  -12.015 1.00 0.53  ? 1126 TRP A HE1  15 
ATOM   9258  H  HE3  . TRP A 1 24 ? 4.168   -3.188  -7.351  1.00 0.45  ? 1126 TRP A HE3  15 
ATOM   9259  H  HZ2  . TRP A 1 24 ? 5.239   -2.696  -12.193 1.00 0.61  ? 1126 TRP A HZ2  15 
ATOM   9260  H  HZ3  . TRP A 1 24 ? 5.922   -4.545  -8.409  1.00 0.62  ? 1126 TRP A HZ3  15 
ATOM   9261  H  HH2  . TRP A 1 24 ? 6.447   -4.305  -10.783 1.00 0.67  ? 1126 TRP A HH2  15 
ATOM   9262  N  N    . VAL A 1 25 ? 0.428   1.209   -5.488  1.00 0.19  ? 1127 VAL A N    15 
ATOM   9263  C  CA   . VAL A 1 25 ? -0.175  1.322   -4.165  1.00 0.18  ? 1127 VAL A CA   15 
ATOM   9264  C  C    . VAL A 1 25 ? -1.651  1.663   -4.260  1.00 0.19  ? 1127 VAL A C    15 
ATOM   9265  O  O    . VAL A 1 25 ? -2.025  2.714   -4.793  1.00 0.23  ? 1127 VAL A O    15 
ATOM   9266  C  CB   . VAL A 1 25 ? 0.542   2.382   -3.310  1.00 0.21  ? 1127 VAL A CB   15 
ATOM   9267  C  CG1  . VAL A 1 25 ? -0.090  2.493   -1.927  1.00 0.24  ? 1127 VAL A CG1  15 
ATOM   9268  C  CG2  . VAL A 1 25 ? 2.015   2.048   -3.195  1.00 0.24  ? 1127 VAL A CG2  15 
ATOM   9269  H  H    . VAL A 1 25 ? 1.022   1.914   -5.806  1.00 0.21  ? 1127 VAL A H    15 
ATOM   9270  H  HA   . VAL A 1 25 ? -0.075  0.365   -3.675  1.00 0.19  ? 1127 VAL A HA   15 
ATOM   9271  H  HB   . VAL A 1 25 ? 0.451   3.338   -3.804  1.00 0.23  ? 1127 VAL A HB   15 
ATOM   9272  H  HG11 . VAL A 1 25 ? -1.128  2.773   -2.028  1.00 1.01  ? 1127 VAL A HG11 15 
ATOM   9273  H  HG12 . VAL A 1 25 ? 0.432   3.242   -1.352  1.00 1.02  ? 1127 VAL A HG12 15 
ATOM   9274  H  HG13 . VAL A 1 25 ? -0.021  1.540   -1.423  1.00 1.00  ? 1127 VAL A HG13 15 
ATOM   9275  H  HG21 . VAL A 1 25 ? 2.132   1.130   -2.637  1.00 1.05  ? 1127 VAL A HG21 15 
ATOM   9276  H  HG22 . VAL A 1 25 ? 2.528   2.848   -2.683  1.00 1.06  ? 1127 VAL A HG22 15 
ATOM   9277  H  HG23 . VAL A 1 25 ? 2.434   1.923   -4.182  1.00 1.01  ? 1127 VAL A HG23 15 
ATOM   9278  N  N    . CYS A 1 26 ? -2.477  0.758   -3.743  1.00 0.19  ? 1128 CYS A N    15 
ATOM   9279  C  CA   . CYS A 1 26 ? -3.924  0.915   -3.771  1.00 0.26  ? 1128 CYS A CA   15 
ATOM   9280  C  C    . CYS A 1 26 ? -4.400  1.041   -5.213  1.00 0.27  ? 1128 CYS A C    15 
ATOM   9281  O  O    . CYS A 1 26 ? -5.056  2.011   -5.600  1.00 0.37  ? 1128 CYS A O    15 
ATOM   9282  C  CB   . CYS A 1 26 ? -4.366  2.121   -2.932  1.00 0.32  ? 1128 CYS A CB   15 
ATOM   9283  S  SG   . CYS A 1 26 ? -6.177  2.365   -2.859  1.00 0.58  ? 1128 CYS A SG   15 
ATOM   9284  H  H    . CYS A 1 26 ? -2.095  -0.055  -3.341  1.00 0.19  ? 1128 CYS A H    15 
ATOM   9285  H  HA   . CYS A 1 26 ? -4.355  0.018   -3.348  1.00 0.28  ? 1128 CYS A HA   15 
ATOM   9286  H  HB2  . CYS A 1 26 ? -4.012  1.994   -1.922  1.00 0.36  ? 1128 CYS A HB2  15 
ATOM   9287  H  HB3  . CYS A 1 26 ? -3.929  3.015   -3.347  1.00 0.36  ? 1128 CYS A HB3  15 
ATOM   9288  N  N    . ASP A 1 27 ? -4.029  0.059   -6.013  1.00 0.25  ? 1129 ASP A N    15 
ATOM   9289  C  CA   . ASP A 1 27 ? -4.444  0.008   -7.404  1.00 0.30  ? 1129 ASP A CA   15 
ATOM   9290  C  C    . ASP A 1 27 ? -5.376  -1.176  -7.607  1.00 0.37  ? 1129 ASP A C    15 
ATOM   9291  O  O    . ASP A 1 27 ? -5.651  -1.584  -8.737  1.00 0.41  ? 1129 ASP A O    15 
ATOM   9292  C  CB   . ASP A 1 27 ? -3.226  -0.090  -8.331  1.00 0.31  ? 1129 ASP A CB   15 
ATOM   9293  C  CG   . ASP A 1 27 ? -2.613  -1.478  -8.379  1.00 0.35  ? 1129 ASP A CG   15 
ATOM   9294  O  OD1  . ASP A 1 27 ? -2.423  -2.097  -7.308  1.00 0.31  ? 1129 ASP A OD1  15 
ATOM   9295  O  OD2  . ASP A 1 27 ? -2.302  -1.945  -9.494  1.00 0.46  ? 1129 ASP A OD2  15 
ATOM   9296  H  H    . ASP A 1 27 ? -3.461  -0.663  -5.653  1.00 0.24  ? 1129 ASP A H    15 
ATOM   9297  H  HA   . ASP A 1 27 ? -4.984  0.919   -7.623  1.00 0.33  ? 1129 ASP A HA   15 
ATOM   9298  H  HB2  . ASP A 1 27 ? -3.525  0.181   -9.332  1.00 0.36  ? 1129 ASP A HB2  15 
ATOM   9299  H  HB3  . ASP A 1 27 ? -2.470  0.604   -7.991  1.00 0.29  ? 1129 ASP A HB3  15 
ATOM   9300  N  N    . THR A 1 28 ? -5.847  -1.715  -6.480  1.00 0.45  ? 1130 THR A N    15 
ATOM   9301  C  CA   . THR A 1 28 ? -6.750  -2.864  -6.430  1.00 0.56  ? 1130 THR A CA   15 
ATOM   9302  C  C    . THR A 1 28 ? -6.154  -4.077  -7.142  1.00 0.61  ? 1130 THR A C    15 
ATOM   9303  O  O    . THR A 1 28 ? -6.878  -4.929  -7.665  1.00 0.73  ? 1130 THR A O    15 
ATOM   9304  C  CB   . THR A 1 28 ? -8.167  -2.544  -6.978  1.00 0.59  ? 1130 THR A CB   15 
ATOM   9305  O  OG1  . THR A 1 28 ? -8.123  -2.131  -8.349  1.00 0.56  ? 1130 THR A OG1  15 
ATOM   9306  C  CG2  . THR A 1 28 ? -8.824  -1.453  -6.147  1.00 0.65  ? 1130 THR A CG2  15 
ATOM   9307  H  H    . THR A 1 28 ? -5.556  -1.324  -5.623  1.00 0.46  ? 1130 THR A H    15 
ATOM   9308  H  HA   . THR A 1 28 ? -6.860  -3.124  -5.385  1.00 0.64  ? 1130 THR A HA   15 
ATOM   9309  H  HB   . THR A 1 28 ? -8.770  -3.435  -6.904  1.00 0.67  ? 1130 THR A HB   15 
ATOM   9310  H  HG1  . THR A 1 28 ? -7.225  -2.245  -8.689  1.00 0.53  ? 1130 THR A HG1  15 
ATOM   9311  H  HG21 . THR A 1 28 ? -8.884  -1.771  -5.117  1.00 1.34  ? 1130 THR A HG21 15 
ATOM   9312  H  HG22 . THR A 1 28 ? -9.819  -1.263  -6.523  1.00 1.09  ? 1130 THR A HG22 15 
ATOM   9313  H  HG23 . THR A 1 28 ? -8.237  -0.549  -6.211  1.00 1.21  ? 1130 THR A HG23 15 
ATOM   9314  N  N    . ASP A 1 29 ? -4.830  -4.155  -7.140  1.00 0.59  ? 1131 ASP A N    15 
ATOM   9315  C  CA   . ASP A 1 29 ? -4.125  -5.277  -7.742  1.00 0.69  ? 1131 ASP A CA   15 
ATOM   9316  C  C    . ASP A 1 29 ? -3.021  -5.748  -6.804  1.00 0.67  ? 1131 ASP A C    15 
ATOM   9317  O  O    . ASP A 1 29 ? -2.375  -4.936  -6.130  1.00 0.53  ? 1131 ASP A O    15 
ATOM   9318  C  CB   . ASP A 1 29 ? -3.545  -4.878  -9.102  1.00 0.75  ? 1131 ASP A CB   15 
ATOM   9319  C  CG   . ASP A 1 29 ? -3.162  -6.080  -9.941  1.00 0.92  ? 1131 ASP A CG   15 
ATOM   9320  O  OD1  . ASP A 1 29 ? -4.068  -6.803  -10.418 1.00 1.21  ? 1131 ASP A OD1  15 
ATOM   9321  O  OD2  . ASP A 1 29 ? -1.951  -6.304  -10.139 1.00 0.92  ? 1131 ASP A OD2  15 
ATOM   9322  H  H    . ASP A 1 29 ? -4.311  -3.434  -6.720  1.00 0.55  ? 1131 ASP A H    15 
ATOM   9323  H  HA   . ASP A 1 29 ? -4.833  -6.080  -7.879  1.00 0.81  ? 1131 ASP A HA   15 
ATOM   9324  H  HB2  . ASP A 1 29 ? -4.280  -4.304  -9.645  1.00 0.81  ? 1131 ASP A HB2  15 
ATOM   9325  H  HB3  . ASP A 1 29 ? -2.663  -4.274  -8.947  1.00 0.68  ? 1131 ASP A HB3  15 
ATOM   9326  N  N    . ASN A 1 30 ? -2.816  -7.057  -6.748  1.00 0.94  ? 1132 ASN A N    15 
ATOM   9327  C  CA   . ASN A 1 30 ? -1.875  -7.652  -5.805  1.00 1.00  ? 1132 ASN A CA   15 
ATOM   9328  C  C    . ASN A 1 30 ? -0.432  -7.506  -6.284  1.00 0.91  ? 1132 ASN A C    15 
ATOM   9329  O  O    . ASN A 1 30 ? -0.054  -8.044  -7.325  1.00 1.06  ? 1132 ASN A O    15 
ATOM   9330  C  CB   . ASN A 1 30 ? -2.205  -9.131  -5.597  1.00 1.29  ? 1132 ASN A CB   15 
ATOM   9331  C  CG   . ASN A 1 30 ? -1.256  -9.807  -4.630  1.00 1.72  ? 1132 ASN A CG   15 
ATOM   9332  O  OD1  . ASN A 1 30 ? -0.208  -10.316 -5.024  1.00 2.58  ? 1132 ASN A OD1  15 
ATOM   9333  N  ND2  . ASN A 1 30 ? -1.616  -9.817  -3.359  1.00 2.07  ? 1132 ASN A ND2  15 
ATOM   9334  H  H    . ASN A 1 30 ? -3.309  -7.644  -7.361  1.00 1.15  ? 1132 ASN A H    15 
ATOM   9335  H  HA   . ASN A 1 30 ? -1.981  -7.135  -4.863  1.00 0.97  ? 1132 ASN A HA   15 
ATOM   9336  H  HB2  . ASN A 1 30 ? -3.208  -9.218  -5.206  1.00 1.52  ? 1132 ASN A HB2  15 
ATOM   9337  H  HB3  . ASN A 1 30 ? -2.147  -9.643  -6.546  1.00 1.97  ? 1132 ASN A HB3  15 
ATOM   9338  H  HD21 . ASN A 1 30 ? -2.464  -9.389  -3.111  1.00 2.11  ? 1132 ASN A HD21 15 
ATOM   9339  H  HD22 . ASN A 1 30 ? -1.024  -10.265 -2.714  1.00 2.73  ? 1132 ASN A HD22 15 
ATOM   9340  N  N    . ASP A 1 31 ? 0.361   -6.775  -5.512  1.00 0.86  ? 1133 ASP A N    15 
ATOM   9341  C  CA   . ASP A 1 31 ? 1.775   -6.568  -5.821  1.00 0.77  ? 1133 ASP A CA   15 
ATOM   9342  C  C    . ASP A 1 31 ? 2.644   -6.777  -4.583  1.00 0.78  ? 1133 ASP A C    15 
ATOM   9343  O  O    . ASP A 1 31 ? 3.724   -7.358  -4.675  1.00 1.28  ? 1133 ASP A O    15 
ATOM   9344  C  CB   . ASP A 1 31 ? 2.012   -5.168  -6.408  1.00 0.67  ? 1133 ASP A CB   15 
ATOM   9345  C  CG   . ASP A 1 31 ? 0.916   -4.194  -6.047  1.00 0.58  ? 1133 ASP A CG   15 
ATOM   9346  O  OD1  . ASP A 1 31 ? 0.662   -3.982  -4.848  1.00 1.00  ? 1133 ASP A OD1  15 
ATOM   9347  O  OD2  . ASP A 1 31 ? 0.321   -3.592  -6.951  1.00 1.09  ? 1133 ASP A OD2  15 
ATOM   9348  H  H    . ASP A 1 31 ? -0.015  -6.348  -4.714  1.00 1.05  ? 1133 ASP A H    15 
ATOM   9349  H  HA   . ASP A 1 31 ? 2.054   -7.304  -6.562  1.00 0.87  ? 1133 ASP A HA   15 
ATOM   9350  H  HB2  . ASP A 1 31 ? 2.947   -4.776  -6.031  1.00 1.04  ? 1133 ASP A HB2  15 
ATOM   9351  H  HB3  . ASP A 1 31 ? 2.066   -5.239  -7.485  1.00 1.05  ? 1133 ASP A HB3  15 
ATOM   9352  N  N    . CYS A 1 32 ? 2.172   -6.324  -3.424  1.00 0.76  ? 1134 CYS A N    15 
ATOM   9353  C  CA   . CYS A 1 32 ? 2.908   -6.513  -2.168  1.00 0.78  ? 1134 CYS A CA   15 
ATOM   9354  C  C    . CYS A 1 32 ? 2.775   -7.939  -1.625  1.00 0.85  ? 1134 CYS A C    15 
ATOM   9355  O  O    . CYS A 1 32 ? 2.738   -8.138  -0.413  1.00 1.57  ? 1134 CYS A O    15 
ATOM   9356  C  CB   . CYS A 1 32 ? 2.416   -5.535  -1.098  1.00 0.82  ? 1134 CYS A CB   15 
ATOM   9357  S  SG   . CYS A 1 32 ? 2.864   -3.796  -1.386  1.00 1.16  ? 1134 CYS A SG   15 
ATOM   9358  H  H    . CYS A 1 32 ? 1.329   -5.821  -3.413  1.00 1.11  ? 1134 CYS A H    15 
ATOM   9359  H  HA   . CYS A 1 32 ? 3.950   -6.316  -2.366  1.00 0.88  ? 1134 CYS A HA   15 
ATOM   9360  H  HB2  . CYS A 1 32 ? 1.339   -5.588  -1.047  1.00 1.25  ? 1134 CYS A HB2  15 
ATOM   9361  H  HB3  . CYS A 1 32 ? 2.828   -5.828  -0.143  1.00 1.22  ? 1134 CYS A HB3  15 
ATOM   9362  N  N    . GLY A 1 33 ? 2.708   -8.928  -2.510  1.00 1.17  ? 1135 GLY A N    15 
ATOM   9363  C  CA   . GLY A 1 33 ? 2.568   -10.308 -2.076  1.00 1.22  ? 1135 GLY A CA   15 
ATOM   9364  C  C    . GLY A 1 33 ? 1.174   -10.614 -1.558  1.00 1.18  ? 1135 GLY A C    15 
ATOM   9365  O  O    . GLY A 1 33 ? 0.405   -11.324 -2.204  1.00 1.68  ? 1135 GLY A O    15 
ATOM   9366  H  H    . GLY A 1 33 ? 2.768   -8.721  -3.468  1.00 1.82  ? 1135 GLY A H    15 
ATOM   9367  H  HA2  . GLY A 1 33 ? 2.781   -10.959 -2.911  1.00 1.26  ? 1135 GLY A HA2  15 
ATOM   9368  H  HA3  . GLY A 1 33 ? 3.282   -10.502 -1.291  1.00 1.39  ? 1135 GLY A HA3  15 
ATOM   9369  N  N    . ASP A 1 34 ? 0.850   -10.080 -0.391  1.00 1.02  ? 1136 ASP A N    15 
ATOM   9370  C  CA   . ASP A 1 34 ? -0.477  -10.242 0.189   1.00 1.11  ? 1136 ASP A CA   15 
ATOM   9371  C  C    . ASP A 1 34 ? -1.370  -9.071  -0.205  1.00 0.93  ? 1136 ASP A C    15 
ATOM   9372  O  O    . ASP A 1 34 ? -2.485  -9.264  -0.686  1.00 1.35  ? 1136 ASP A O    15 
ATOM   9373  C  CB   . ASP A 1 34 ? -0.393  -10.354 1.710   1.00 1.44  ? 1136 ASP A CB   15 
ATOM   9374  C  CG   . ASP A 1 34 ? -1.754  -10.442 2.368   1.00 2.10  ? 1136 ASP A CG   15 
ATOM   9375  O  OD1  . ASP A 1 34 ? -2.321  -9.385  2.712   1.00 2.85  ? 1136 ASP A OD1  15 
ATOM   9376  O  OD2  . ASP A 1 34 ? -2.258  -11.568 2.561   1.00 2.47  ? 1136 ASP A OD2  15 
ATOM   9377  H  H    . ASP A 1 34 ? 1.524   -9.558  0.096   1.00 1.22  ? 1136 ASP A H    15 
ATOM   9378  H  HA   . ASP A 1 34 ? -0.901  -11.149 -0.205  1.00 1.27  ? 1136 ASP A HA   15 
ATOM   9379  H  HB2  . ASP A 1 34 ? 0.168   -11.238 1.970   1.00 1.68  ? 1136 ASP A HB2  15 
ATOM   9380  H  HB3  . ASP A 1 34 ? 0.114   -9.489  2.094   1.00 1.84  ? 1136 ASP A HB3  15 
ATOM   9381  N  N    . GLY A 1 35 ? -0.863  -7.858  -0.014  1.00 0.62  ? 1137 GLY A N    15 
ATOM   9382  C  CA   . GLY A 1 35 ? -1.591  -6.676  -0.435  1.00 0.49  ? 1137 GLY A CA   15 
ATOM   9383  C  C    . GLY A 1 35 ? -1.614  -5.591  0.624   1.00 0.36  ? 1137 GLY A C    15 
ATOM   9384  O  O    . GLY A 1 35 ? -2.634  -4.936  0.831   1.00 0.36  ? 1137 GLY A O    15 
ATOM   9385  H  H    . GLY A 1 35 ? 0.007   -7.767  0.432   1.00 0.82  ? 1137 GLY A H    15 
ATOM   9386  H  HA2  . GLY A 1 35 ? -1.128  -6.281  -1.326  1.00 0.51  ? 1137 GLY A HA2  15 
ATOM   9387  H  HA3  . GLY A 1 35 ? -2.607  -6.957  -0.666  1.00 0.72  ? 1137 GLY A HA3  15 
ATOM   9388  N  N    . SER A 1 36 ? -0.484  -5.391  1.292   1.00 0.32  ? 1138 SER A N    15 
ATOM   9389  C  CA   . SER A 1 36 ? -0.386  -4.387  2.342   1.00 0.28  ? 1138 SER A CA   15 
ATOM   9390  C  C    . SER A 1 36 ? -0.533  -2.976  1.768   1.00 0.25  ? 1138 SER A C    15 
ATOM   9391  O  O    . SER A 1 36 ? -0.957  -2.049  2.463   1.00 0.40  ? 1138 SER A O    15 
ATOM   9392  C  CB   . SER A 1 36 ? 0.948   -4.532  3.075   1.00 0.33  ? 1138 SER A CB   15 
ATOM   9393  O  OG   . SER A 1 36 ? 2.040   -4.362  2.186   1.00 0.44  ? 1138 SER A OG   15 
ATOM   9394  H  H    . SER A 1 36 ? 0.303   -5.938  1.084   1.00 0.37  ? 1138 SER A H    15 
ATOM   9395  H  HA   . SER A 1 36 ? -1.191  -4.562  3.041   1.00 0.33  ? 1138 SER A HA   15 
ATOM   9396  H  HB2  . SER A 1 36 ? 1.013   -3.788  3.853   1.00 0.40  ? 1138 SER A HB2  15 
ATOM   9397  H  HB3  . SER A 1 36 ? 1.008   -5.517  3.514   1.00 0.39  ? 1138 SER A HB3  15 
ATOM   9398  H  HG   . SER A 1 36 ? 2.215   -3.415  2.082   1.00 1.17  ? 1138 SER A HG   15 
ATOM   9399  N  N    . ASP A 1 37 ? -0.198  -2.828  0.490   1.00 0.18  ? 1139 ASP A N    15 
ATOM   9400  C  CA   . ASP A 1 37 ? -0.326  -1.552  -0.205  1.00 0.18  ? 1139 ASP A CA   15 
ATOM   9401  C  C    . ASP A 1 37 ? -1.798  -1.193  -0.375  1.00 0.20  ? 1139 ASP A C    15 
ATOM   9402  O  O    . ASP A 1 37 ? -2.167  -0.021  -0.416  1.00 0.29  ? 1139 ASP A O    15 
ATOM   9403  C  CB   . ASP A 1 37 ? 0.339   -1.629  -1.574  1.00 0.19  ? 1139 ASP A CB   15 
ATOM   9404  C  CG   . ASP A 1 37 ? -0.476  -2.435  -2.559  1.00 0.26  ? 1139 ASP A CG   15 
ATOM   9405  O  OD1  . ASP A 1 37 ? -0.615  -3.663  -2.367  1.00 0.33  ? 1139 ASP A OD1  15 
ATOM   9406  O  OD2  . ASP A 1 37 ? -1.007  -1.835  -3.515  1.00 0.32  ? 1139 ASP A OD2  15 
ATOM   9407  H  H    . ASP A 1 37 ? 0.137   -3.604  -0.007  1.00 0.26  ? 1139 ASP A H    15 
ATOM   9408  H  HA   . ASP A 1 37 ? 0.165   -0.792  0.384   1.00 0.20  ? 1139 ASP A HA   15 
ATOM   9409  H  HB2  . ASP A 1 37 ? 0.460   -0.631  -1.966  1.00 0.22  ? 1139 ASP A HB2  15 
ATOM   9410  H  HB3  . ASP A 1 37 ? 1.309   -2.093  -1.473  1.00 0.19  ? 1139 ASP A HB3  15 
ATOM   9411  N  N    . GLU A 1 38 ? -2.633  -2.218  -0.471  1.00 0.22  ? 1140 GLU A N    15 
ATOM   9412  C  CA   . GLU A 1 38 ? -4.065  -2.031  -0.626  1.00 0.27  ? 1140 GLU A CA   15 
ATOM   9413  C  C    . GLU A 1 38 ? -4.731  -1.860  0.737   1.00 0.31  ? 1140 GLU A C    15 
ATOM   9414  O  O    . GLU A 1 38 ? -5.671  -1.082  0.888   1.00 0.44  ? 1140 GLU A O    15 
ATOM   9415  C  CB   . GLU A 1 38 ? -4.685  -3.235  -1.343  1.00 0.29  ? 1140 GLU A CB   15 
ATOM   9416  C  CG   . GLU A 1 38 ? -4.028  -3.585  -2.673  1.00 0.29  ? 1140 GLU A CG   15 
ATOM   9417  C  CD   . GLU A 1 38 ? -4.260  -2.547  -3.752  1.00 0.28  ? 1140 GLU A CD   15 
ATOM   9418  O  OE1  . GLU A 1 38 ? -5.287  -1.843  -3.703  1.00 0.38  ? 1140 GLU A OE1  15 
ATOM   9419  O  OE2  . GLU A 1 38 ? -3.414  -2.434  -4.668  1.00 0.28  ? 1140 GLU A OE2  15 
ATOM   9420  H  H    . GLU A 1 38 ? -2.271  -3.131  -0.457  1.00 0.24  ? 1140 GLU A H    15 
ATOM   9421  H  HA   . GLU A 1 38 ? -4.226  -1.141  -1.218  1.00 0.30  ? 1140 GLU A HA   15 
ATOM   9422  H  HB2  . GLU A 1 38 ? -4.609  -4.096  -0.697  1.00 0.32  ? 1140 GLU A HB2  15 
ATOM   9423  H  HB3  . GLU A 1 38 ? -5.729  -3.028  -1.526  1.00 0.33  ? 1140 GLU A HB3  15 
ATOM   9424  H  HG2  . GLU A 1 38 ? -2.965  -3.677  -2.516  1.00 0.29  ? 1140 GLU A HG2  15 
ATOM   9425  H  HG3  . GLU A 1 38 ? -4.422  -4.532  -3.015  1.00 0.33  ? 1140 GLU A HG3  15 
ATOM   9426  N  N    . LYS A 1 39 ? -4.226  -2.587  1.735   1.00 0.30  ? 1141 LYS A N    15 
ATOM   9427  C  CA   . LYS A 1 39 ? -4.859  -2.626  3.053   1.00 0.37  ? 1141 LYS A CA   15 
ATOM   9428  C  C    . LYS A 1 39 ? -4.790  -1.269  3.755   1.00 0.49  ? 1141 LYS A C    15 
ATOM   9429  O  O    . LYS A 1 39 ? -5.710  -0.898  4.480   1.00 0.57  ? 1141 LYS A O    15 
ATOM   9430  C  CB   . LYS A 1 39 ? -4.230  -3.718  3.938   1.00 0.47  ? 1141 LYS A CB   15 
ATOM   9431  C  CG   . LYS A 1 39 ? -2.927  -3.320  4.619   1.00 0.57  ? 1141 LYS A CG   15 
ATOM   9432  C  CD   . LYS A 1 39 ? -2.382  -4.454  5.467   1.00 0.76  ? 1141 LYS A CD   15 
ATOM   9433  C  CE   . LYS A 1 39 ? -1.091  -4.064  6.165   1.00 0.91  ? 1141 LYS A CE   15 
ATOM   9434  N  NZ   . LYS A 1 39 ? -1.294  -2.988  7.171   1.00 1.55  ? 1141 LYS A NZ   15 
ATOM   9435  H  H    . LYS A 1 39 ? -3.420  -3.125  1.573   1.00 0.32  ? 1141 LYS A H    15 
ATOM   9436  H  HA   . LYS A 1 39 ? -5.899  -2.871  2.899   1.00 0.39  ? 1141 LYS A HA   15 
ATOM   9437  H  HB2  . LYS A 1 39 ? -4.935  -3.989  4.706   1.00 0.56  ? 1141 LYS A HB2  15 
ATOM   9438  H  HB3  . LYS A 1 39 ? -4.035  -4.587  3.324   1.00 0.47  ? 1141 LYS A HB3  15 
ATOM   9439  H  HG2  . LYS A 1 39 ? -2.197  -3.061  3.869   1.00 0.50  ? 1141 LYS A HG2  15 
ATOM   9440  H  HG3  . LYS A 1 39 ? -3.109  -2.468  5.254   1.00 0.65  ? 1141 LYS A HG3  15 
ATOM   9441  H  HD2  . LYS A 1 39 ? -3.117  -4.717  6.214   1.00 0.88  ? 1141 LYS A HD2  15 
ATOM   9442  H  HD3  . LYS A 1 39 ? -2.194  -5.306  4.832   1.00 0.73  ? 1141 LYS A HD3  15 
ATOM   9443  H  HE2  . LYS A 1 39 ? -0.694  -4.933  6.660   1.00 1.15  ? 1141 LYS A HE2  15 
ATOM   9444  H  HE3  . LYS A 1 39 ? -0.385  -3.722  5.423   1.00 1.18  ? 1141 LYS A HE3  15 
ATOM   9445  H  HZ1  . LYS A 1 39 ? -0.389  -2.748  7.623   1.00 2.08  ? 1141 LYS A HZ1  15 
ATOM   9446  H  HZ2  . LYS A 1 39 ? -1.964  -3.301  7.905   1.00 1.99  ? 1141 LYS A HZ2  15 
ATOM   9447  H  HZ3  . LYS A 1 39 ? -1.675  -2.135  6.716   1.00 1.97  ? 1141 LYS A HZ3  15 
ATOM   9448  N  N    . ASN A 1 40 ? -3.720  -0.516  3.516   1.00 0.60  ? 1142 ASN A N    15 
ATOM   9449  C  CA   . ASN A 1 40 ? -3.555  0.786   4.162   1.00 0.81  ? 1142 ASN A CA   15 
ATOM   9450  C  C    . ASN A 1 40 ? -4.405  1.839   3.460   1.00 0.91  ? 1142 ASN A C    15 
ATOM   9451  O  O    . ASN A 1 40 ? -4.508  2.978   3.913   1.00 1.44  ? 1142 ASN A O    15 
ATOM   9452  C  CB   . ASN A 1 40 ? -2.084  1.226   4.177   1.00 1.07  ? 1142 ASN A CB   15 
ATOM   9453  C  CG   . ASN A 1 40 ? -1.563  1.630   2.809   1.00 1.37  ? 1142 ASN A CG   15 
ATOM   9454  O  OD1  . ASN A 1 40 ? -1.705  2.776   2.390   1.00 2.05  ? 1142 ASN A OD1  15 
ATOM   9455  N  ND2  . ASN A 1 40 ? -0.930  0.702   2.114   1.00 1.92  ? 1142 ASN A ND2  15 
ATOM   9456  H  H    . ASN A 1 40 ? -3.030  -0.842  2.900   1.00 0.58  ? 1142 ASN A H    15 
ATOM   9457  H  HA   . ASN A 1 40 ? -3.901  0.692   5.181   1.00 0.86  ? 1142 ASN A HA   15 
ATOM   9458  H  HB2  . ASN A 1 40 ? -1.976  2.070   4.839   1.00 1.54  ? 1142 ASN A HB2  15 
ATOM   9459  H  HB3  . ASN A 1 40 ? -1.478  0.411   4.543   1.00 1.56  ? 1142 ASN A HB3  15 
ATOM   9460  H  HD21 . ASN A 1 40 ? -0.825  -0.192  2.512   1.00 2.20  ? 1142 ASN A HD21 15 
ATOM   9461  H  HD22 . ASN A 1 40 ? -0.598  0.941   1.224   1.00 2.44  ? 1142 ASN A HD22 15 
ATOM   9462  N  N    . CYS A 1 41 ? -5.026  1.443   2.358   1.00 0.76  ? 1143 CYS A N    15 
ATOM   9463  C  CA   . CYS A 1 41 ? -5.863  2.348   1.587   1.00 0.99  ? 1143 CYS A CA   15 
ATOM   9464  C  C    . CYS A 1 41 ? -7.285  2.350   2.143   1.00 1.29  ? 1143 CYS A C    15 
ATOM   9465  O  O    . CYS A 1 41 ? -8.140  3.099   1.669   1.00 1.67  ? 1143 CYS A O    15 
ATOM   9466  C  CB   . CYS A 1 41 ? -5.860  1.927   0.116   1.00 0.93  ? 1143 CYS A CB   15 
ATOM   9467  S  SG   . CYS A 1 41 ? -6.495  3.188   -1.034  1.00 1.10  ? 1143 CYS A SG   15 
ATOM   9468  H  H    . CYS A 1 41 ? -4.922  0.515   2.056   1.00 0.89  ? 1143 CYS A H    15 
ATOM   9469  H  HA   . CYS A 1 41 ? -5.450  3.341   1.673   1.00 1.23  ? 1143 CYS A HA   15 
ATOM   9470  H  HB2  . CYS A 1 41 ? -4.849  1.695   -0.179  1.00 0.98  ? 1143 CYS A HB2  15 
ATOM   9471  H  HB3  . CYS A 1 41 ? -6.471  1.042   0.004   1.00 1.29  ? 1143 CYS A HB3  15 
ATOM   9472  N  N    . ASN A 1 42 ? -7.504  1.508   3.165   1.00 1.87  ? 1144 ASN A N    15 
ATOM   9473  C  CA   . ASN A 1 42 ? -8.767  1.438   3.918   1.00 2.36  ? 1144 ASN A CA   15 
ATOM   9474  C  C    . ASN A 1 42 ? -10.001 1.591   3.032   1.00 3.05  ? 1144 ASN A C    15 
ATOM   9475  O  O    . ASN A 1 42 ? -10.755 2.556   3.167   1.00 3.73  ? 1144 ASN A O    15 
ATOM   9476  C  CB   . ASN A 1 42 ? -8.794  2.455   5.080   1.00 3.11  ? 1144 ASN A CB   15 
ATOM   9477  C  CG   . ASN A 1 42 ? -8.443  3.881   4.679   1.00 3.87  ? 1144 ASN A CG   15 
ATOM   9478  O  OD1  . ASN A 1 42 ? -9.314  4.683   4.337   1.00 4.27  ? 1144 ASN A OD1  15 
ATOM   9479  N  ND2  . ASN A 1 42 ? -7.163  4.215   4.743   1.00 4.59  ? 1144 ASN A ND2  15 
ATOM   9480  H  H    . ASN A 1 42 ? -6.777  0.905   3.426   1.00 2.27  ? 1144 ASN A H    15 
ATOM   9481  H  HA   . ASN A 1 42 ? -8.806  0.449   4.350   1.00 2.42  ? 1144 ASN A HA   15 
ATOM   9482  H  HB2  . ASN A 1 42 ? -9.783  2.466   5.508   1.00 3.41  ? 1144 ASN A HB2  15 
ATOM   9483  H  HB3  . ASN A 1 42 ? -8.092  2.135   5.836   1.00 3.38  ? 1144 ASN A HB3  15 
ATOM   9484  H  HD21 . ASN A 1 42 ? -6.519  3.533   5.043   1.00 4.61  ? 1144 ASN A HD21 15 
ATOM   9485  H  HD22 . ASN A 1 42 ? -6.907  5.123   4.484   1.00 5.30  ? 1144 ASN A HD22 15 
ATOM   9486  N  N    . SER A 1 43 ? -10.191 0.603   2.149   1.00 3.53  ? 1145 SER A N    15 
ATOM   9487  C  CA   . SER A 1 43 ? -11.307 0.537   1.193   1.00 4.69  ? 1145 SER A CA   15 
ATOM   9488  C  C    . SER A 1 43 ? -11.323 1.730   0.237   1.00 5.23  ? 1145 SER A C    15 
ATOM   9489  O  O    . SER A 1 43 ? -11.175 2.885   0.638   1.00 5.32  ? 1145 SER A O    15 
ATOM   9490  C  CB   . SER A 1 43 ? -12.666 0.369   1.897   1.00 5.40  ? 1145 SER A CB   15 
ATOM   9491  O  OG   . SER A 1 43 ? -12.990 1.470   2.733   1.00 5.26  ? 1145 SER A OG   15 
ATOM   9492  H  H    . SER A 1 43 ? -9.538  -0.128  2.135   1.00 3.45  ? 1145 SER A H    15 
ATOM   9493  H  HA   . SER A 1 43 ? -11.137 -0.347  0.593   1.00 5.07  ? 1145 SER A HA   15 
ATOM   9494  H  HB2  . SER A 1 43 ? -13.440 0.270   1.149   1.00 6.23  ? 1145 SER A HB2  15 
ATOM   9495  H  HB3  . SER A 1 43 ? -12.641 -0.526  2.497   1.00 5.56  ? 1145 SER A HB3  15 
ATOM   9496  H  HG   . SER A 1 43 ? -12.194 2.011   2.868   1.00 5.21  ? 1145 SER A HG   15 
ATOM   9497  N  N    . THR A 1 44 ? -11.508 1.435   -1.038  1.00 5.97  ? 1146 THR A N    15 
ATOM   9498  C  CA   . THR A 1 44 ? -11.472 2.453   -2.072  1.00 6.81  ? 1146 THR A CA   15 
ATOM   9499  C  C    . THR A 1 44 ? -12.660 3.399   -1.959  1.00 7.34  ? 1146 THR A C    15 
ATOM   9500  O  O    . THR A 1 44 ? -13.772 3.077   -2.385  1.00 8.15  ? 1146 THR A O    15 
ATOM   9501  C  CB   . THR A 1 44 ? -11.447 1.818   -3.474  1.00 7.69  ? 1146 THR A CB   15 
ATOM   9502  O  OG1  . THR A 1 44 ? -12.516 0.871   -3.602  1.00 7.92  ? 1146 THR A OG1  15 
ATOM   9503  C  CG2  . THR A 1 44 ? -10.116 1.129   -3.733  1.00 7.74  ? 1146 THR A CG2  15 
ATOM   9504  H  H    . THR A 1 44 ? -11.688 0.504   -1.293  1.00 6.16  ? 1146 THR A H    15 
ATOM   9505  H  HA   . THR A 1 44 ? -10.565 3.027   -1.945  1.00 6.75  ? 1146 THR A HA   15 
ATOM   9506  H  HB   . THR A 1 44 ? -11.579 2.598   -4.210  1.00 8.40  ? 1146 THR A HB   15 
ATOM   9507  H  HG1  . THR A 1 44 ? -13.338 1.282   -3.299  1.00 8.03  ? 1146 THR A HG1  15 
ATOM   9508  H  HG21 . THR A 1 44 ? -9.317  1.852   -3.668  1.00 7.71  ? 1146 THR A HG21 15 
ATOM   9509  H  HG22 . THR A 1 44 ? -10.124 0.690   -4.720  1.00 7.80  ? 1146 THR A HG22 15 
ATOM   9510  H  HG23 . THR A 1 44 ? -9.962  0.356   -2.995  1.00 8.03  ? 1146 THR A HG23 15 
ATOM   9511  N  N    . GLU A 1 45 ? -12.414 4.545   -1.336  1.00 7.13  ? 1147 GLU A N    15 
ATOM   9512  C  CA   . GLU A 1 45 ? -13.367 5.629   -1.289  1.00 7.94  ? 1147 GLU A CA   15 
ATOM   9513  C  C    . GLU A 1 45 ? -13.817 5.980   -2.698  1.00 8.95  ? 1147 GLU A C    15 
ATOM   9514  O  O    . GLU A 1 45 ? -14.998 6.201   -2.958  1.00 9.87  ? 1147 GLU A O    15 
ATOM   9515  C  CB   . GLU A 1 45 ? -12.696 6.833   -0.646  1.00 7.79  ? 1147 GLU A CB   15 
ATOM   9516  C  CG   . GLU A 1 45 ? -13.646 7.941   -0.286  1.00 7.90  ? 1147 GLU A CG   15 
ATOM   9517  C  CD   . GLU A 1 45 ? -12.921 9.175   0.197   1.00 8.00  ? 1147 GLU A CD   15 
ATOM   9518  O  OE1  . GLU A 1 45 ? -12.415 9.937   -0.654  1.00 8.08  ? 1147 GLU A OE1  15 
ATOM   9519  O  OE2  . GLU A 1 45 ? -12.831 9.377   1.425   1.00 8.23  ? 1147 GLU A OE2  15 
ATOM   9520  H  H    . GLU A 1 45 ? -11.562 4.661   -0.868  1.00 6.60  ? 1147 GLU A H    15 
ATOM   9521  H  HA   . GLU A 1 45 ? -14.215 5.325   -0.698  1.00 8.20  ? 1147 GLU A HA   15 
ATOM   9522  H  HB2  . GLU A 1 45 ? -12.193 6.514   0.254   1.00 8.33  ? 1147 GLU A HB2  15 
ATOM   9523  H  HB3  . GLU A 1 45 ? -11.963 7.227   -1.333  1.00 7.37  ? 1147 GLU A HB3  15 
ATOM   9524  H  HG2  . GLU A 1 45 ? -14.236 8.197   -1.155  1.00 7.80  ? 1147 GLU A HG2  15 
ATOM   9525  H  HG3  . GLU A 1 45 ? -14.288 7.582   0.498   1.00 8.35  ? 1147 GLU A HG3  15 
ATOM   9526  N  N    . THR A 1 46 ? -12.852 6.014   -3.599  1.00 8.94  ? 1148 THR A N    15 
ATOM   9527  C  CA   . THR A 1 46 ? -13.105 6.275   -5.000  1.00 10.03 ? 1148 THR A CA   15 
ATOM   9528  C  C    . THR A 1 46 ? -12.545 5.128   -5.833  1.00 10.71 ? 1148 THR A C    15 
ATOM   9529  O  O    . THR A 1 46 ? -12.354 4.028   -5.316  1.00 11.12 ? 1148 THR A O    15 
ATOM   9530  C  CB   . THR A 1 46 ? -12.466 7.609   -5.434  1.00 10.21 ? 1148 THR A CB   15 
ATOM   9531  O  OG1  . THR A 1 46 ? -11.089 7.641   -5.040  1.00 9.58  ? 1148 THR A OG1  15 
ATOM   9532  C  CG2  . THR A 1 46 ? -13.201 8.791   -4.821  1.00 11.01 ? 1148 THR A CG2  15 
ATOM   9533  H  H    . THR A 1 46 ? -11.929 5.837   -3.312  1.00 8.30  ? 1148 THR A H    15 
ATOM   9534  H  HA   . THR A 1 46 ? -14.173 6.336   -5.145  1.00 10.45 ? 1148 THR A HA   15 
ATOM   9535  H  HB   . THR A 1 46 ? -12.525 7.686   -6.508  1.00 10.48 ? 1148 THR A HB   15 
ATOM   9536  H  HG1  . THR A 1 46 ? -10.987 8.235   -4.286  1.00 9.43  ? 1148 THR A HG1  15 
ATOM   9537  H  HG21 . THR A 1 46 ? -13.167 8.717   -3.744  1.00 11.19 ? 1148 THR A HG21 15 
ATOM   9538  H  HG22 . THR A 1 46 ? -14.230 8.786   -5.150  1.00 11.07 ? 1148 THR A HG22 15 
ATOM   9539  H  HG23 . THR A 1 46 ? -12.728 9.711   -5.134  1.00 11.53 ? 1148 THR A HG23 15 
HETATM 9540  CA CA   . CA  B 2 .  ? -1.347  -2.875  -5.455  1.00 0.28  ? 1201 CA  A CA   15 
ATOM   9541  N  N    . THR A 1 1  ? 23.281  7.906   12.939  1.00 12.23 ? 1103 THR A N    16 
ATOM   9542  C  CA   . THR A 1 1  ? 21.880  7.515   12.689  1.00 11.73 ? 1103 THR A CA   16 
ATOM   9543  C  C    . THR A 1 1  ? 21.803  6.363   11.686  1.00 10.83 ? 1103 THR A C    16 
ATOM   9544  O  O    . THR A 1 1  ? 21.558  5.219   12.071  1.00 10.67 ? 1103 THR A O    16 
ATOM   9545  C  CB   . THR A 1 1  ? 21.059  8.714   12.176  1.00 11.83 ? 1103 THR A CB   16 
ATOM   9546  O  OG1  . THR A 1 1  ? 21.189  9.815   13.087  1.00 12.26 ? 1103 THR A OG1  16 
ATOM   9547  C  CG2  . THR A 1 1  ? 19.591  8.349   12.028  1.00 12.04 ? 1103 THR A CG2  16 
ATOM   9548  H  H1   . THR A 1 1  ? 23.816  7.098   13.307  1.00 12.23 ? 1103 THR A H1   16 
ATOM   9549  H  H2   . THR A 1 1  ? 23.316  8.675   13.639  1.00 12.55 ? 1103 THR A H2   16 
ATOM   9550  H  H3   . THR A 1 1  ? 23.728  8.236   12.061  1.00 12.44 ? 1103 THR A H3   16 
ATOM   9551  H  HA   . THR A 1 1  ? 21.449  7.188   13.625  1.00 12.16 ? 1103 THR A HA   16 
ATOM   9552  H  HB   . THR A 1 1  ? 21.443  9.010   11.210  1.00 11.67 ? 1103 THR A HB   16 
ATOM   9553  H  HG1  . THR A 1 1  ? 21.008  10.640  12.620  1.00 12.30 ? 1103 THR A HG1  16 
ATOM   9554  H  HG21 . THR A 1 1  ? 19.492  7.529   11.332  1.00 12.31 ? 1103 THR A HG21 16 
ATOM   9555  H  HG22 . THR A 1 1  ? 19.043  9.203   11.659  1.00 12.05 ? 1103 THR A HG22 16 
ATOM   9556  H  HG23 . THR A 1 1  ? 19.195  8.056   12.989  1.00 12.10 ? 1103 THR A HG23 16 
ATOM   9557  N  N    . HIS A 1 2  ? 22.034  6.665   10.405  1.00 10.41 ? 1104 HIS A N    16 
ATOM   9558  C  CA   . HIS A 1 2  ? 21.976  5.661   9.339   1.00 9.72  ? 1104 HIS A CA   16 
ATOM   9559  C  C    . HIS A 1 2  ? 20.643  4.923   9.342   1.00 8.65  ? 1104 HIS A C    16 
ATOM   9560  O  O    . HIS A 1 2  ? 20.598  3.696   9.430   1.00 8.32  ? 1104 HIS A O    16 
ATOM   9561  C  CB   . HIS A 1 2  ? 23.134  4.662   9.455   1.00 10.05 ? 1104 HIS A CB   16 
ATOM   9562  C  CG   . HIS A 1 2  ? 24.465  5.244   9.102   1.00 10.43 ? 1104 HIS A CG   16 
ATOM   9563  N  ND1  . HIS A 1 2  ? 25.488  5.401   10.011  1.00 10.71 ? 1104 HIS A ND1  16 
ATOM   9564  C  CD2  . HIS A 1 2  ? 24.942  5.705   7.921   1.00 10.84 ? 1104 HIS A CD2  16 
ATOM   9565  C  CE1  . HIS A 1 2  ? 26.533  5.934   9.407   1.00 11.25 ? 1104 HIS A CE1  16 
ATOM   9566  N  NE2  . HIS A 1 2  ? 26.228  6.128   8.139   1.00 11.34 ? 1104 HIS A NE2  16 
ATOM   9567  H  H    . HIS A 1 2  ? 22.254  7.592   10.167  1.00 10.71 ? 1104 HIS A H    16 
ATOM   9568  H  HA   . HIS A 1 2  ? 22.070  6.185   8.402   1.00 9.96  ? 1104 HIS A HA   16 
ATOM   9569  H  HB2  . HIS A 1 2  ? 23.190  4.303   10.473  1.00 10.50 ? 1104 HIS A HB2  16 
ATOM   9570  H  HB3  . HIS A 1 2  ? 22.948  3.828   8.794   1.00 9.81  ? 1104 HIS A HB3  16 
ATOM   9571  H  HD1  . HIS A 1 2  ? 25.453  5.156   10.964  1.00 10.68 ? 1104 HIS A HD1  16 
ATOM   9572  H  HD2  . HIS A 1 2  ? 24.407  5.733   6.982   1.00 10.94 ? 1104 HIS A HD2  16 
ATOM   9573  H  HE1  . HIS A 1 2  ? 27.477  6.170   9.870   1.00 11.71 ? 1104 HIS A HE1  16 
ATOM   9574  H  HE2  . HIS A 1 2  ? 26.853  6.440   7.446   1.00 11.83 ? 1104 HIS A HE2  16 
ATOM   9575  N  N    . ALA A 1 3  ? 19.560  5.679   9.243   1.00 8.30  ? 1105 ALA A N    16 
ATOM   9576  C  CA   . ALA A 1 3  ? 18.230  5.097   9.212   1.00 7.41  ? 1105 ALA A CA   16 
ATOM   9577  C  C    . ALA A 1 3  ? 17.926  4.558   7.821   1.00 6.47  ? 1105 ALA A C    16 
ATOM   9578  O  O    . ALA A 1 3  ? 18.262  5.189   6.816   1.00 6.54  ? 1105 ALA A O    16 
ATOM   9579  C  CB   . ALA A 1 3  ? 17.192  6.129   9.626   1.00 7.70  ? 1105 ALA A CB   16 
ATOM   9580  H  H    . ALA A 1 3  ? 19.659  6.652   9.173   1.00 8.79  ? 1105 ALA A H    16 
ATOM   9581  H  HA   . ALA A 1 3  ? 18.202  4.283   9.922   1.00 7.45  ? 1105 ALA A HA   16 
ATOM   9582  H  HB1  . ALA A 1 3  ? 17.190  6.942   8.915   1.00 7.93  ? 1105 ALA A HB1  16 
ATOM   9583  H  HB2  . ALA A 1 3  ? 17.433  6.510   10.607  1.00 7.73  ? 1105 ALA A HB2  16 
ATOM   9584  H  HB3  . ALA A 1 3  ? 16.215  5.668   9.649   1.00 7.95  ? 1105 ALA A HB3  16 
ATOM   9585  N  N    . PRO A 1 4  ? 17.313  3.368   7.743   1.00 5.80  ? 1106 PRO A N    16 
ATOM   9586  C  CA   . PRO A 1 4  ? 16.970  2.739   6.466   1.00 4.97  ? 1106 PRO A CA   16 
ATOM   9587  C  C    . PRO A 1 4  ? 15.918  3.532   5.698   1.00 4.25  ? 1106 PRO A C    16 
ATOM   9588  O  O    . PRO A 1 4  ? 14.842  3.836   6.224   1.00 4.22  ? 1106 PRO A O    16 
ATOM   9589  C  CB   . PRO A 1 4  ? 16.418  1.368   6.872   1.00 4.84  ? 1106 PRO A CB   16 
ATOM   9590  C  CG   . PRO A 1 4  ? 15.976  1.533   8.284   1.00 5.55  ? 1106 PRO A CG   16 
ATOM   9591  C  CD   . PRO A 1 4  ? 16.907  2.542   8.894   1.00 6.09  ? 1106 PRO A CD   16 
ATOM   9592  H  HA   . PRO A 1 4  ? 17.844  2.609   5.845   1.00 5.32  ? 1106 PRO A HA   16 
ATOM   9593  H  HB2  . PRO A 1 4  ? 15.592  1.104   6.227   1.00 4.32  ? 1106 PRO A HB2  16 
ATOM   9594  H  HB3  . PRO A 1 4  ? 17.196  0.624   6.789   1.00 5.12  ? 1106 PRO A HB3  16 
ATOM   9595  H  HG2  . PRO A 1 4  ? 14.959  1.897   8.310   1.00 5.52  ? 1106 PRO A HG2  16 
ATOM   9596  H  HG3  . PRO A 1 4  ? 16.050  0.591   8.805   1.00 6.00  ? 1106 PRO A HG3  16 
ATOM   9597  H  HD2  . PRO A 1 4  ? 16.390  3.135   9.632   1.00 6.19  ? 1106 PRO A HD2  16 
ATOM   9598  H  HD3  . PRO A 1 4  ? 17.762  2.049   9.333   1.00 6.80  ? 1106 PRO A HD3  16 
ATOM   9599  N  N    . ALA A 1 5  ? 16.236  3.876   4.459   1.00 4.09  ? 1107 ALA A N    16 
ATOM   9600  C  CA   . ALA A 1 5  ? 15.310  4.606   3.609   1.00 3.77  ? 1107 ALA A CA   16 
ATOM   9601  C  C    . ALA A 1 5  ? 14.200  3.681   3.129   1.00 2.63  ? 1107 ALA A C    16 
ATOM   9602  O  O    . ALA A 1 5  ? 14.446  2.511   2.826   1.00 2.62  ? 1107 ALA A O    16 
ATOM   9603  C  CB   . ALA A 1 5  ? 16.044  5.219   2.429   1.00 4.73  ? 1107 ALA A CB   16 
ATOM   9604  H  H    . ALA A 1 5  ? 17.115  3.624   4.102   1.00 4.51  ? 1107 ALA A H    16 
ATOM   9605  H  HA   . ALA A 1 5  ? 14.875  5.405   4.194   1.00 4.04  ? 1107 ALA A HA   16 
ATOM   9606  H  HB1  . ALA A 1 5  ? 15.354  5.800   1.837   1.00 5.01  ? 1107 ALA A HB1  16 
ATOM   9607  H  HB2  . ALA A 1 5  ? 16.465  4.433   1.821   1.00 4.95  ? 1107 ALA A HB2  16 
ATOM   9608  H  HB3  . ALA A 1 5  ? 16.836  5.858   2.790   1.00 5.29  ? 1107 ALA A HB3  16 
ATOM   9609  N  N    . SER A 1 6  ? 12.987  4.203   3.068   1.00 2.16  ? 1108 SER A N    16 
ATOM   9610  C  CA   . SER A 1 6  ? 11.833  3.410   2.684   1.00 1.43  ? 1108 SER A CA   16 
ATOM   9611  C  C    . SER A 1 6  ? 11.756  3.247   1.168   1.00 1.29  ? 1108 SER A C    16 
ATOM   9612  O  O    . SER A 1 6  ? 10.953  3.902   0.500   1.00 1.97  ? 1108 SER A O    16 
ATOM   9613  C  CB   . SER A 1 6  ? 10.558  4.052   3.234   1.00 2.09  ? 1108 SER A CB   16 
ATOM   9614  O  OG   . SER A 1 6  ? 10.554  5.454   3.009   1.00 2.97  ? 1108 SER A OG   16 
ATOM   9615  H  H    . SER A 1 6  ? 12.863  5.154   3.277   1.00 2.71  ? 1108 SER A H    16 
ATOM   9616  H  HA   . SER A 1 6  ? 11.946  2.433   3.128   1.00 1.32  ? 1108 SER A HA   16 
ATOM   9617  H  HB2  . SER A 1 6  ? 9.701   3.619   2.741   1.00 2.36  ? 1108 SER A HB2  16 
ATOM   9618  H  HB3  . SER A 1 6  ? 10.494  3.869   4.296   1.00 2.13  ? 1108 SER A HB3  16 
ATOM   9619  H  HG   . SER A 1 6  ? 10.327  5.625   2.084   1.00 3.32  ? 1108 SER A HG   16 
ATOM   9620  N  N    . CYS A 1 7  ? 12.607  2.369   0.640   1.00 0.72  ? 1109 CYS A N    16 
ATOM   9621  C  CA   . CYS A 1 7  ? 12.647  2.068   -0.786  1.00 0.49  ? 1109 CYS A CA   16 
ATOM   9622  C  C    . CYS A 1 7  ? 12.971  3.309   -1.615  1.00 0.46  ? 1109 CYS A C    16 
ATOM   9623  O  O    . CYS A 1 7  ? 13.474  4.312   -1.096  1.00 0.62  ? 1109 CYS A O    16 
ATOM   9624  C  CB   . CYS A 1 7  ? 11.317  1.454   -1.220  1.00 0.33  ? 1109 CYS A CB   16 
ATOM   9625  S  SG   . CYS A 1 7  ? 10.913  -0.110  -0.374  1.00 0.47  ? 1109 CYS A SG   16 
ATOM   9626  H  H    . CYS A 1 7  ? 13.225  1.901   1.233   1.00 0.94  ? 1109 CYS A H    16 
ATOM   9627  H  HA   . CYS A 1 7  ? 13.426  1.343   -0.950  1.00 0.60  ? 1109 CYS A HA   16 
ATOM   9628  H  HB2  . CYS A 1 7  ? 10.525  2.152   -1.004  1.00 0.41  ? 1109 CYS A HB2  16 
ATOM   9629  H  HB3  . CYS A 1 7  ? 11.343  1.259   -2.282  1.00 0.29  ? 1109 CYS A HB3  16 
ATOM   9630  N  N    . LEU A 1 8  ? 12.726  3.211   -2.911  1.00 0.34  ? 1110 LEU A N    16 
ATOM   9631  C  CA   . LEU A 1 8  ? 12.923  4.315   -3.834  1.00 0.32  ? 1110 LEU A CA   16 
ATOM   9632  C  C    . LEU A 1 8  ? 12.027  5.492   -3.457  1.00 0.29  ? 1110 LEU A C    16 
ATOM   9633  O  O    . LEU A 1 8  ? 11.051  5.325   -2.726  1.00 0.30  ? 1110 LEU A O    16 
ATOM   9634  C  CB   . LEU A 1 8  ? 12.567  3.833   -5.235  1.00 0.28  ? 1110 LEU A CB   16 
ATOM   9635  C  CG   . LEU A 1 8  ? 13.481  4.297   -6.366  1.00 0.38  ? 1110 LEU A CG   16 
ATOM   9636  C  CD1  . LEU A 1 8  ? 14.866  3.696   -6.212  1.00 0.52  ? 1110 LEU A CD1  16 
ATOM   9637  C  CD2  . LEU A 1 8  ? 12.881  3.920   -7.711  1.00 0.39  ? 1110 LEU A CD2  16 
ATOM   9638  H  H    . LEU A 1 8  ? 12.417  2.352   -3.267  1.00 0.34  ? 1110 LEU A H    16 
ATOM   9639  H  HA   . LEU A 1 8  ? 13.956  4.617   -3.803  1.00 0.40  ? 1110 LEU A HA   16 
ATOM   9640  H  HB2  . LEU A 1 8  ? 12.569  2.755   -5.217  1.00 0.32  ? 1110 LEU A HB2  16 
ATOM   9641  H  HB3  . LEU A 1 8  ? 11.561  4.158   -5.458  1.00 0.22  ? 1110 LEU A HB3  16 
ATOM   9642  H  HG   . LEU A 1 8  ? 13.577  5.371   -6.327  1.00 0.41  ? 1110 LEU A HG   16 
ATOM   9643  H  HD11 . LEU A 1 8  ? 15.299  4.021   -5.280  1.00 1.05  ? 1110 LEU A HD11 16 
ATOM   9644  H  HD12 . LEU A 1 8  ? 15.492  4.017   -7.031  1.00 1.29  ? 1110 LEU A HD12 16 
ATOM   9645  H  HD13 . LEU A 1 8  ? 14.793  2.618   -6.216  1.00 1.07  ? 1110 LEU A HD13 16 
ATOM   9646  H  HD21 . LEU A 1 8  ? 12.727  2.853   -7.748  1.00 1.11  ? 1110 LEU A HD21 16 
ATOM   9647  H  HD22 . LEU A 1 8  ? 13.554  4.216   -8.503  1.00 1.05  ? 1110 LEU A HD22 16 
ATOM   9648  H  HD23 . LEU A 1 8  ? 11.935  4.425   -7.836  1.00 0.97  ? 1110 LEU A HD23 16 
ATOM   9649  N  N    . ASP A 1 9  ? 12.342  6.674   -3.970  1.00 0.35  ? 1111 ASP A N    16 
ATOM   9650  C  CA   . ASP A 1 9  ? 11.509  7.851   -3.727  1.00 0.38  ? 1111 ASP A CA   16 
ATOM   9651  C  C    . ASP A 1 9  ? 10.145  7.672   -4.377  1.00 0.32  ? 1111 ASP A C    16 
ATOM   9652  O  O    . ASP A 1 9  ? 9.154   8.262   -3.952  1.00 0.42  ? 1111 ASP A O    16 
ATOM   9653  C  CB   . ASP A 1 9  ? 12.175  9.125   -4.259  1.00 0.51  ? 1111 ASP A CB   16 
ATOM   9654  C  CG   . ASP A 1 9  ? 13.389  9.537   -3.454  1.00 1.37  ? 1111 ASP A CG   16 
ATOM   9655  O  OD1  . ASP A 1 9  ? 13.229  10.281  -2.462  1.00 1.53  ? 1111 ASP A OD1  16 
ATOM   9656  O  OD2  . ASP A 1 9  ? 14.509  9.116   -3.807  1.00 2.32  ? 1111 ASP A OD2  16 
ATOM   9657  H  H    . ASP A 1 9  ? 13.150  6.760   -4.521  1.00 0.40  ? 1111 ASP A H    16 
ATOM   9658  H  HA   . ASP A 1 9  ? 11.375  7.945   -2.659  1.00 0.44  ? 1111 ASP A HA   16 
ATOM   9659  H  HB2  . ASP A 1 9  ? 12.486  8.962   -5.279  1.00 0.94  ? 1111 ASP A HB2  16 
ATOM   9660  H  HB3  . ASP A 1 9  ? 11.458  9.933   -4.234  1.00 1.01  ? 1111 ASP A HB3  16 
ATOM   9661  N  N    . THR A 1 10 ? 10.106  6.854   -5.417  1.00 0.28  ? 1112 THR A N    16 
ATOM   9662  C  CA   . THR A 1 10 ? 8.863   6.534   -6.094  1.00 0.31  ? 1112 THR A CA   16 
ATOM   9663  C  C    . THR A 1 10 ? 8.390   5.128   -5.746  1.00 0.24  ? 1112 THR A C    16 
ATOM   9664  O  O    . THR A 1 10 ? 7.463   4.604   -6.366  1.00 0.30  ? 1112 THR A O    16 
ATOM   9665  C  CB   . THR A 1 10 ? 9.016   6.654   -7.620  1.00 0.42  ? 1112 THR A CB   16 
ATOM   9666  O  OG1  . THR A 1 10 ? 10.243  6.041   -8.039  1.00 0.45  ? 1112 THR A OG1  16 
ATOM   9667  C  CG2  . THR A 1 10 ? 8.993   8.111   -8.048  1.00 0.52  ? 1112 THR A CG2  16 
ATOM   9668  H  H    . THR A 1 10 ? 10.941  6.464   -5.750  1.00 0.31  ? 1112 THR A H    16 
ATOM   9669  H  HA   . THR A 1 10 ? 8.115   7.244   -5.771  1.00 0.36  ? 1112 THR A HA   16 
ATOM   9670  H  HB   . THR A 1 10 ? 8.186   6.144   -8.088  1.00 0.48  ? 1112 THR A HB   16 
ATOM   9671  H  HG1  . THR A 1 10 ? 10.048  5.232   -8.532  1.00 0.95  ? 1112 THR A HG1  16 
ATOM   9672  H  HG21 . THR A 1 10 ? 8.042   8.547   -7.788  1.00 1.19  ? 1112 THR A HG21 16 
ATOM   9673  H  HG22 . THR A 1 10 ? 9.137   8.172   -9.115  1.00 1.09  ? 1112 THR A HG22 16 
ATOM   9674  H  HG23 . THR A 1 10 ? 9.785   8.646   -7.546  1.00 1.17  ? 1112 THR A HG23 16 
ATOM   9675  N  N    . GLN A 1 11 ? 9.025   4.509   -4.758  1.00 0.18  ? 1113 GLN A N    16 
ATOM   9676  C  CA   . GLN A 1 11 ? 8.632   3.182   -4.347  1.00 0.17  ? 1113 GLN A CA   16 
ATOM   9677  C  C    . GLN A 1 11 ? 8.090   3.157   -2.935  1.00 0.17  ? 1113 GLN A C    16 
ATOM   9678  O  O    . GLN A 1 11 ? 8.426   3.988   -2.095  1.00 0.23  ? 1113 GLN A O    16 
ATOM   9679  C  CB   . GLN A 1 11 ? 9.793   2.202   -4.472  1.00 0.17  ? 1113 GLN A CB   16 
ATOM   9680  C  CG   . GLN A 1 11 ? 10.050  1.767   -5.901  1.00 0.23  ? 1113 GLN A CG   16 
ATOM   9681  C  CD   . GLN A 1 11 ? 10.775  0.435   -5.998  1.00 0.35  ? 1113 GLN A CD   16 
ATOM   9682  O  OE1  . GLN A 1 11 ? 10.148  -0.619  -6.065  1.00 1.02  ? 1113 GLN A OE1  16 
ATOM   9683  N  NE2  . GLN A 1 11 ? 12.097  0.469   -6.017  1.00 0.67  ? 1113 GLN A NE2  16 
ATOM   9684  H  H    . GLN A 1 11 ? 9.770   4.950   -4.300  1.00 0.20  ? 1113 GLN A H    16 
ATOM   9685  H  HA   . GLN A 1 11 ? 7.839   2.866   -5.008  1.00 0.22  ? 1113 GLN A HA   16 
ATOM   9686  H  HB2  . GLN A 1 11 ? 10.687  2.674   -4.093  1.00 0.16  ? 1113 GLN A HB2  16 
ATOM   9687  H  HB3  . GLN A 1 11 ? 9.579   1.333   -3.880  1.00 0.20  ? 1113 GLN A HB3  16 
ATOM   9688  H  HG2  . GLN A 1 11 ? 9.102   1.681   -6.395  1.00 0.31  ? 1113 GLN A HG2  16 
ATOM   9689  H  HG3  . GLN A 1 11 ? 10.644  2.521   -6.394  1.00 0.22  ? 1113 GLN A HG3  16 
ATOM   9690  H  HE21 . GLN A 1 11 ? 12.540  1.338   -5.973  1.00 1.21  ? 1113 GLN A HE21 16 
ATOM   9691  H  HE22 . GLN A 1 11 ? 12.582  -0.384  -6.068  1.00 0.65  ? 1113 GLN A HE22 16 
ATOM   9692  N  N    . TYR A 1 12 ? 7.234   2.187   -2.710  1.00 0.15  ? 1114 TYR A N    16 
ATOM   9693  C  CA   . TYR A 1 12 ? 6.610   1.965   -1.423  1.00 0.16  ? 1114 TYR A CA   16 
ATOM   9694  C  C    . TYR A 1 12 ? 7.254   0.772   -0.741  1.00 0.15  ? 1114 TYR A C    16 
ATOM   9695  O  O    . TYR A 1 12 ? 7.716   -0.157  -1.402  1.00 0.15  ? 1114 TYR A O    16 
ATOM   9696  C  CB   . TYR A 1 12 ? 5.112   1.710   -1.608  1.00 0.18  ? 1114 TYR A CB   16 
ATOM   9697  C  CG   . TYR A 1 12 ? 4.372   1.322   -0.343  1.00 0.22  ? 1114 TYR A CG   16 
ATOM   9698  C  CD1  . TYR A 1 12 ? 4.208   2.219   0.704   1.00 0.33  ? 1114 TYR A CD1  16 
ATOM   9699  C  CD2  . TYR A 1 12 ? 3.840   0.046   -0.204  1.00 0.21  ? 1114 TYR A CD2  16 
ATOM   9700  C  CE1  . TYR A 1 12 ? 3.536   1.853   1.855   1.00 0.39  ? 1114 TYR A CE1  16 
ATOM   9701  C  CE2  . TYR A 1 12 ? 3.166   -0.325  0.941   1.00 0.26  ? 1114 TYR A CE2  16 
ATOM   9702  C  CZ   . TYR A 1 12 ? 3.017   0.581   1.967   1.00 0.34  ? 1114 TYR A CZ   16 
ATOM   9703  O  OH   . TYR A 1 12 ? 2.352   0.207   3.112   1.00 0.41  ? 1114 TYR A OH   16 
ATOM   9704  H  H    . TYR A 1 12 ? 7.024   1.573   -3.454  1.00 0.16  ? 1114 TYR A H    16 
ATOM   9705  H  HA   . TYR A 1 12 ? 6.753   2.844   -0.818  1.00 0.18  ? 1114 TYR A HA   16 
ATOM   9706  H  HB2  . TYR A 1 12 ? 4.646   2.594   -2.009  1.00 0.23  ? 1114 TYR A HB2  16 
ATOM   9707  H  HB3  . TYR A 1 12 ? 4.997   0.905   -2.305  1.00 0.18  ? 1114 TYR A HB3  16 
ATOM   9708  H  HD1  . TYR A 1 12 ? 4.615   3.215   0.611   1.00 0.40  ? 1114 TYR A HD1  16 
ATOM   9709  H  HD2  . TYR A 1 12 ? 3.958   -0.663  -1.009  1.00 0.23  ? 1114 TYR A HD2  16 
ATOM   9710  H  HE1  . TYR A 1 12 ? 3.418   2.563   2.659   1.00 0.50  ? 1114 TYR A HE1  16 
ATOM   9711  H  HE2  . TYR A 1 12 ? 2.760   -1.323  1.031   1.00 0.29  ? 1114 TYR A HE2  16 
ATOM   9712  H  HH   . TYR A 1 12 ? 1.613   0.816   3.271   1.00 0.89  ? 1114 TYR A HH   16 
ATOM   9713  N  N    . THR A 1 13 ? 7.270   0.805   0.573   1.00 0.18  ? 1115 THR A N    16 
ATOM   9714  C  CA   . THR A 1 13 ? 7.815   -0.287  1.354   1.00 0.20  ? 1115 THR A CA   16 
ATOM   9715  C  C    . THR A 1 13 ? 6.684   -1.139  1.898   1.00 0.23  ? 1115 THR A C    16 
ATOM   9716  O  O    . THR A 1 13 ? 5.997   -0.752  2.848   1.00 0.31  ? 1115 THR A O    16 
ATOM   9717  C  CB   . THR A 1 13 ? 8.680   0.217   2.522   1.00 0.26  ? 1115 THR A CB   16 
ATOM   9718  O  OG1  . THR A 1 13 ? 9.566   1.238   2.056   1.00 0.30  ? 1115 THR A OG1  16 
ATOM   9719  C  CG2  . THR A 1 13 ? 9.494   -0.925  3.124   1.00 0.27  ? 1115 THR A CG2  16 
ATOM   9720  H  H    . THR A 1 13 ? 6.878   1.576   1.027   1.00 0.22  ? 1115 THR A H    16 
ATOM   9721  H  HA   . THR A 1 13 ? 8.430   -0.892  0.703   1.00 0.19  ? 1115 THR A HA   16 
ATOM   9722  H  HB   . THR A 1 13 ? 8.034   0.624   3.286   1.00 0.31  ? 1115 THR A HB   16 
ATOM   9723  H  HG1  . THR A 1 13 ? 9.664   1.159   1.101   1.00 0.82  ? 1115 THR A HG1  16 
ATOM   9724  H  HG21 . THR A 1 13 ? 10.049  -0.562  3.975   1.00 1.01  ? 1115 THR A HG21 16 
ATOM   9725  H  HG22 . THR A 1 13 ? 10.181  -1.304  2.382   1.00 1.02  ? 1115 THR A HG22 16 
ATOM   9726  H  HG23 . THR A 1 13 ? 8.830   -1.720  3.437   1.00 1.10  ? 1115 THR A HG23 16 
ATOM   9727  N  N    . CYS A 1 14 ? 6.479   -2.279  1.275   1.00 0.26  ? 1116 CYS A N    16 
ATOM   9728  C  CA   . CYS A 1 14 ? 5.432   -3.192  1.678   1.00 0.34  ? 1116 CYS A CA   16 
ATOM   9729  C  C    . CYS A 1 14 ? 5.746   -3.804  3.042   1.00 0.40  ? 1116 CYS A C    16 
ATOM   9730  O  O    . CYS A 1 14 ? 6.890   -3.741  3.500   1.00 0.37  ? 1116 CYS A O    16 
ATOM   9731  C  CB   . CYS A 1 14 ? 5.260   -4.277  0.616   1.00 0.45  ? 1116 CYS A CB   16 
ATOM   9732  S  SG   . CYS A 1 14 ? 4.916   -3.619  -1.048  1.00 0.65  ? 1116 CYS A SG   16 
ATOM   9733  H  H    . CYS A 1 14 ? 7.052   -2.516  0.509   1.00 0.28  ? 1116 CYS A H    16 
ATOM   9734  H  HA   . CYS A 1 14 ? 4.515   -2.629  1.754   1.00 0.38  ? 1116 CYS A HA   16 
ATOM   9735  H  HB2  . CYS A 1 14 ? 6.168   -4.865  0.553   1.00 0.50  ? 1116 CYS A HB2  16 
ATOM   9736  H  HB3  . CYS A 1 14 ? 4.438   -4.920  0.895   1.00 0.54  ? 1116 CYS A HB3  16 
ATOM   9737  N  N    . ASP A 1 15 ? 4.746   -4.382  3.691   1.00 0.56  ? 1117 ASP A N    16 
ATOM   9738  C  CA   . ASP A 1 15 ? 4.923   -4.949  5.028   1.00 0.69  ? 1117 ASP A CA   16 
ATOM   9739  C  C    . ASP A 1 15 ? 6.032   -5.999  5.036   1.00 0.65  ? 1117 ASP A C    16 
ATOM   9740  O  O    . ASP A 1 15 ? 6.835   -6.070  5.968   1.00 0.71  ? 1117 ASP A O    16 
ATOM   9741  C  CB   . ASP A 1 15 ? 3.610   -5.561  5.521   1.00 0.93  ? 1117 ASP A CB   16 
ATOM   9742  C  CG   . ASP A 1 15 ? 3.738   -6.203  6.886   1.00 1.83  ? 1117 ASP A CG   16 
ATOM   9743  O  OD1  . ASP A 1 15 ? 3.574   -5.495  7.902   1.00 2.62  ? 1117 ASP A OD1  16 
ATOM   9744  O  OD2  . ASP A 1 15 ? 4.021   -7.418  6.950   1.00 2.09  ? 1117 ASP A OD2  16 
ATOM   9745  H  H    . ASP A 1 15 ? 3.859   -4.423  3.266   1.00 0.63  ? 1117 ASP A H    16 
ATOM   9746  H  HA   . ASP A 1 15 ? 5.204   -4.144  5.691   1.00 0.70  ? 1117 ASP A HA   16 
ATOM   9747  H  HB2  . ASP A 1 15 ? 2.863   -4.783  5.583   1.00 1.35  ? 1117 ASP A HB2  16 
ATOM   9748  H  HB3  . ASP A 1 15 ? 3.282   -6.309  4.816   1.00 0.70  ? 1117 ASP A HB3  16 
ATOM   9749  N  N    . ASN A 1 16 ? 6.104   -6.768  3.960   1.00 0.69  ? 1118 ASN A N    16 
ATOM   9750  C  CA   . ASN A 1 16 ? 7.108   -7.818  3.812   1.00 0.75  ? 1118 ASN A CA   16 
ATOM   9751  C  C    . ASN A 1 16 ? 8.448   -7.243  3.352   1.00 0.59  ? 1118 ASN A C    16 
ATOM   9752  O  O    . ASN A 1 16 ? 9.310   -7.970  2.861   1.00 0.65  ? 1118 ASN A O    16 
ATOM   9753  C  CB   . ASN A 1 16 ? 6.622   -8.878  2.815   1.00 0.98  ? 1118 ASN A CB   16 
ATOM   9754  C  CG   . ASN A 1 16 ? 6.357   -8.310  1.431   1.00 1.77  ? 1118 ASN A CG   16 
ATOM   9755  O  OD1  . ASN A 1 16 ? 6.008   -7.138  1.283   1.00 2.75  ? 1118 ASN A OD1  16 
ATOM   9756  N  ND2  . ASN A 1 16 ? 6.512   -9.134  0.408   1.00 2.02  ? 1118 ASN A ND2  16 
ATOM   9757  H  H    . ASN A 1 16 ? 5.462   -6.625  3.232   1.00 0.75  ? 1118 ASN A H    16 
ATOM   9758  H  HA   . ASN A 1 16 ? 7.243   -8.281  4.776   1.00 0.85  ? 1118 ASN A HA   16 
ATOM   9759  H  HB2  . ASN A 1 16 ? 7.370   -9.651  2.729   1.00 1.24  ? 1118 ASN A HB2  16 
ATOM   9760  H  HB3  . ASN A 1 16 ? 5.704   -9.314  3.186   1.00 1.41  ? 1118 ASN A HB3  16 
ATOM   9761  H  HD21 . ASN A 1 16 ? 6.786   -10.059 0.594   1.00 1.91  ? 1118 ASN A HD21 16 
ATOM   9762  H  HD22 . ASN A 1 16 ? 6.337   -8.789  -0.496  1.00 2.74  ? 1118 ASN A HD22 16 
ATOM   9763  N  N    . HIS A 1 17 ? 8.608   -5.929  3.518   1.00 0.46  ? 1119 HIS A N    16 
ATOM   9764  C  CA   . HIS A 1 17 ? 9.847   -5.223  3.173   1.00 0.41  ? 1119 HIS A CA   16 
ATOM   9765  C  C    . HIS A 1 17 ? 10.121  -5.296  1.674   1.00 0.44  ? 1119 HIS A C    16 
ATOM   9766  O  O    . HIS A 1 17 ? 11.269  -5.234  1.235   1.00 0.79  ? 1119 HIS A O    16 
ATOM   9767  C  CB   . HIS A 1 17 ? 11.043  -5.784  3.956   1.00 0.51  ? 1119 HIS A CB   16 
ATOM   9768  C  CG   . HIS A 1 17 ? 10.879  -5.722  5.445   1.00 0.63  ? 1119 HIS A CG   16 
ATOM   9769  N  ND1  . HIS A 1 17 ? 10.483  -6.804  6.201   1.00 0.94  ? 1119 HIS A ND1  16 
ATOM   9770  C  CD2  . HIS A 1 17 ? 11.056  -4.703  6.318   1.00 0.78  ? 1119 HIS A CD2  16 
ATOM   9771  C  CE1  . HIS A 1 17 ? 10.421  -6.454  7.469   1.00 1.05  ? 1119 HIS A CE1  16 
ATOM   9772  N  NE2  . HIS A 1 17 ? 10.765  -5.185  7.570   1.00 0.93  ? 1119 HIS A NE2  16 
ATOM   9773  H  H    . HIS A 1 17 ? 7.860   -5.409  3.888   1.00 0.47  ? 1119 HIS A H    16 
ATOM   9774  H  HA   . HIS A 1 17 ? 9.712   -4.182  3.442   1.00 0.38  ? 1119 HIS A HA   16 
ATOM   9775  H  HB2  . HIS A 1 17 ? 11.190  -6.817  3.683   1.00 0.60  ? 1119 HIS A HB2  16 
ATOM   9776  H  HB3  . HIS A 1 17 ? 11.928  -5.220  3.697   1.00 0.55  ? 1119 HIS A HB3  16 
ATOM   9777  H  HD1  . HIS A 1 17 ? 10.286  -7.705  5.858   1.00 1.18  ? 1119 HIS A HD1  16 
ATOM   9778  H  HD2  . HIS A 1 17 ? 11.368  -3.697  6.073   1.00 1.00  ? 1119 HIS A HD2  16 
ATOM   9779  H  HE1  . HIS A 1 17 ? 10.136  -7.096  8.287   1.00 1.35  ? 1119 HIS A HE1  16 
ATOM   9780  H  HE2  . HIS A 1 17 ? 10.665  -4.637  8.381   1.00 1.09  ? 1119 HIS A HE2  16 
ATOM   9781  N  N    . GLN A 1 18 ? 9.058   -5.433  0.899   1.00 0.40  ? 1120 GLN A N    16 
ATOM   9782  C  CA   . GLN A 1 18 ? 9.160   -5.457  -0.551  1.00 0.38  ? 1120 GLN A CA   16 
ATOM   9783  C  C    . GLN A 1 18 ? 8.900   -4.066  -1.113  1.00 0.29  ? 1120 GLN A C    16 
ATOM   9784  O  O    . GLN A 1 18 ? 8.030   -3.353  -0.626  1.00 0.39  ? 1120 GLN A O    16 
ATOM   9785  C  CB   . GLN A 1 18 ? 8.166   -6.471  -1.126  1.00 0.49  ? 1120 GLN A CB   16 
ATOM   9786  C  CG   . GLN A 1 18 ? 7.969   -6.366  -2.627  1.00 0.50  ? 1120 GLN A CG   16 
ATOM   9787  C  CD   . GLN A 1 18 ? 7.203   -7.542  -3.198  1.00 1.05  ? 1120 GLN A CD   16 
ATOM   9788  O  OE1  . GLN A 1 18 ? 6.384   -8.159  -2.517  1.00 1.91  ? 1120 GLN A OE1  16 
ATOM   9789  N  NE2  . GLN A 1 18 ? 7.458   -7.857  -4.456  1.00 1.51  ? 1120 GLN A NE2  16 
ATOM   9790  H  H    . GLN A 1 18 ? 8.176   -5.517  1.313   1.00 0.63  ? 1120 GLN A H    16 
ATOM   9791  H  HA   . GLN A 1 18 ? 10.164  -5.758  -0.811  1.00 0.42  ? 1120 GLN A HA   16 
ATOM   9792  H  HB2  . GLN A 1 18 ? 8.517   -7.467  -0.902  1.00 0.62  ? 1120 GLN A HB2  16 
ATOM   9793  H  HB3  . GLN A 1 18 ? 7.207   -6.325  -0.650  1.00 0.52  ? 1120 GLN A HB3  16 
ATOM   9794  H  HG2  . GLN A 1 18 ? 7.421   -5.461  -2.843  1.00 0.87  ? 1120 GLN A HG2  16 
ATOM   9795  H  HG3  . GLN A 1 18 ? 8.936   -6.319  -3.099  1.00 0.86  ? 1120 GLN A HG3  16 
ATOM   9796  H  HE21 . GLN A 1 18 ? 8.121   -7.321  -4.943  1.00 1.83  ? 1120 GLN A HE21 16 
ATOM   9797  H  HE22 . GLN A 1 18 ? 6.972   -8.609  -4.854  1.00 1.99  ? 1120 GLN A HE22 16 
ATOM   9798  N  N    . CYS A 1 19 ? 9.663   -3.673  -2.117  1.00 0.21  ? 1121 CYS A N    16 
ATOM   9799  C  CA   . CYS A 1 19 ? 9.501   -2.358  -2.711  1.00 0.21  ? 1121 CYS A CA   16 
ATOM   9800  C  C    . CYS A 1 19 ? 8.720   -2.443  -4.016  1.00 0.20  ? 1121 CYS A C    16 
ATOM   9801  O  O    . CYS A 1 19 ? 9.125   -3.134  -4.954  1.00 0.34  ? 1121 CYS A O    16 
ATOM   9802  C  CB   . CYS A 1 19 ? 10.866  -1.711  -2.956  1.00 0.34  ? 1121 CYS A CB   16 
ATOM   9803  S  SG   . CYS A 1 19 ? 11.885  -1.527  -1.454  1.00 0.42  ? 1121 CYS A SG   16 
ATOM   9804  H  H    . CYS A 1 19 ? 10.348  -4.280  -2.470  1.00 0.29  ? 1121 CYS A H    16 
ATOM   9805  H  HA   . CYS A 1 19 ? 8.946   -1.748  -2.013  1.00 0.24  ? 1121 CYS A HA   16 
ATOM   9806  H  HB2  . CYS A 1 19 ? 11.421  -2.316  -3.657  1.00 0.39  ? 1121 CYS A HB2  16 
ATOM   9807  H  HB3  . CYS A 1 19 ? 10.718  -0.728  -3.377  1.00 0.41  ? 1121 CYS A HB3  16 
ATOM   9808  N  N    . ILE A 1 20 ? 7.588   -1.759  -4.057  1.00 0.15  ? 1122 ILE A N    16 
ATOM   9809  C  CA   . ILE A 1 20 ? 6.799   -1.640  -5.275  1.00 0.14  ? 1122 ILE A CA   16 
ATOM   9810  C  C    . ILE A 1 20 ? 6.699   -0.175  -5.667  1.00 0.14  ? 1122 ILE A C    16 
ATOM   9811  O  O    . ILE A 1 20 ? 7.050   0.696   -4.883  1.00 0.18  ? 1122 ILE A O    16 
ATOM   9812  C  CB   . ILE A 1 20 ? 5.374   -2.196  -5.104  1.00 0.14  ? 1122 ILE A CB   16 
ATOM   9813  C  CG1  . ILE A 1 20 ? 4.618   -1.394  -4.045  1.00 0.13  ? 1122 ILE A CG1  16 
ATOM   9814  C  CG2  . ILE A 1 20 ? 5.421   -3.674  -4.738  1.00 0.19  ? 1122 ILE A CG2  16 
ATOM   9815  C  CD1  . ILE A 1 20 ? 3.143   -1.710  -3.992  1.00 0.17  ? 1122 ILE A CD1  16 
ATOM   9816  H  H    . ILE A 1 20 ? 7.274   -1.312  -3.241  1.00 0.22  ? 1122 ILE A H    16 
ATOM   9817  H  HA   . ILE A 1 20 ? 7.293   -2.189  -6.059  1.00 0.17  ? 1122 ILE A HA   16 
ATOM   9818  H  HB   . ILE A 1 20 ? 4.861   -2.102  -6.048  1.00 0.16  ? 1122 ILE A HB   16 
ATOM   9819  H  HG12 . ILE A 1 20 ? 5.040   -1.608  -3.079  1.00 0.15  ? 1122 ILE A HG12 16 
ATOM   9820  H  HG13 . ILE A 1 20 ? 4.726   -0.339  -4.254  1.00 0.14  ? 1122 ILE A HG13 16 
ATOM   9821  H  HG21 . ILE A 1 20 ? 5.890   -4.228  -5.538  1.00 0.98  ? 1122 ILE A HG21 16 
ATOM   9822  H  HG22 . ILE A 1 20 ? 4.416   -4.040  -4.588  1.00 1.05  ? 1122 ILE A HG22 16 
ATOM   9823  H  HG23 . ILE A 1 20 ? 5.991   -3.801  -3.830  1.00 0.97  ? 1122 ILE A HG23 16 
ATOM   9824  H  HD11 . ILE A 1 20 ? 3.009   -2.765  -3.799  1.00 1.07  ? 1122 ILE A HD11 16 
ATOM   9825  H  HD12 . ILE A 1 20 ? 2.688   -1.459  -4.938  1.00 0.99  ? 1122 ILE A HD12 16 
ATOM   9826  H  HD13 . ILE A 1 20 ? 2.678   -1.138  -3.201  1.00 1.03  ? 1122 ILE A HD13 16 
ATOM   9827  N  N    . SER A 1 21 ? 6.225   0.099   -6.864  1.00 0.16  ? 1123 SER A N    16 
ATOM   9828  C  CA   . SER A 1 21 ? 6.010   1.474   -7.283  1.00 0.17  ? 1123 SER A CA   16 
ATOM   9829  C  C    . SER A 1 21 ? 4.793   2.031   -6.569  1.00 0.15  ? 1123 SER A C    16 
ATOM   9830  O  O    . SER A 1 21 ? 3.798   1.332   -6.380  1.00 0.17  ? 1123 SER A O    16 
ATOM   9831  C  CB   . SER A 1 21 ? 5.813   1.555   -8.799  1.00 0.24  ? 1123 SER A CB   16 
ATOM   9832  O  OG   . SER A 1 21 ? 5.520   2.885   -9.206  1.00 0.33  ? 1123 SER A OG   16 
ATOM   9833  H  H    . SER A 1 21 ? 6.003   -0.634  -7.472  1.00 0.20  ? 1123 SER A H    16 
ATOM   9834  H  HA   . SER A 1 21 ? 6.877   2.054   -7.002  1.00 0.19  ? 1123 SER A HA   16 
ATOM   9835  H  HB2  . SER A 1 21 ? 6.716   1.231   -9.295  1.00 0.27  ? 1123 SER A HB2  16 
ATOM   9836  H  HB3  . SER A 1 21 ? 4.993   0.913   -9.088  1.00 0.24  ? 1123 SER A HB3  16 
ATOM   9837  H  HG   . SER A 1 21 ? 4.615   2.929   -9.534  1.00 0.63  ? 1123 SER A HG   16 
ATOM   9838  N  N    . LYS A 1 22 ? 4.878   3.295   -6.172  1.00 0.17  ? 1124 LYS A N    16 
ATOM   9839  C  CA   . LYS A 1 22 ? 3.793   3.940   -5.449  1.00 0.19  ? 1124 LYS A CA   16 
ATOM   9840  C  C    . LYS A 1 22 ? 2.557   4.059   -6.335  1.00 0.22  ? 1124 LYS A C    16 
ATOM   9841  O  O    . LYS A 1 22 ? 1.439   4.204   -5.844  1.00 0.25  ? 1124 LYS A O    16 
ATOM   9842  C  CB   . LYS A 1 22 ? 4.220   5.319   -4.951  1.00 0.23  ? 1124 LYS A CB   16 
ATOM   9843  C  CG   . LYS A 1 22 ? 5.452   5.297   -4.061  1.00 0.25  ? 1124 LYS A CG   16 
ATOM   9844  C  CD   . LYS A 1 22 ? 5.672   6.649   -3.396  1.00 0.25  ? 1124 LYS A CD   16 
ATOM   9845  C  CE   . LYS A 1 22 ? 6.732   6.584   -2.304  1.00 0.30  ? 1124 LYS A CE   16 
ATOM   9846  N  NZ   . LYS A 1 22 ? 6.254   5.854   -1.098  1.00 1.24  ? 1124 LYS A NZ   16 
ATOM   9847  H  H    . LYS A 1 22 ? 5.696   3.807   -6.371  1.00 0.20  ? 1124 LYS A H    16 
ATOM   9848  H  HA   . LYS A 1 22 ? 3.553   3.319   -4.598  1.00 0.19  ? 1124 LYS A HA   16 
ATOM   9849  H  HB2  . LYS A 1 22 ? 4.433   5.944   -5.804  1.00 0.30  ? 1124 LYS A HB2  16 
ATOM   9850  H  HB3  . LYS A 1 22 ? 3.407   5.755   -4.392  1.00 0.30  ? 1124 LYS A HB3  16 
ATOM   9851  H  HG2  . LYS A 1 22 ? 5.339   4.534   -3.309  1.00 0.37  ? 1124 LYS A HG2  16 
ATOM   9852  H  HG3  . LYS A 1 22 ? 6.313   5.068   -4.671  1.00 0.37  ? 1124 LYS A HG3  16 
ATOM   9853  H  HD2  . LYS A 1 22 ? 5.991   7.356   -4.146  1.00 0.32  ? 1124 LYS A HD2  16 
ATOM   9854  H  HD3  . LYS A 1 22 ? 4.740   6.981   -2.962  1.00 0.33  ? 1124 LYS A HD3  16 
ATOM   9855  H  HE2  . LYS A 1 22 ? 7.600   6.077   -2.695  1.00 0.93  ? 1124 LYS A HE2  16 
ATOM   9856  H  HE3  . LYS A 1 22 ? 7.001   7.591   -2.021  1.00 0.95  ? 1124 LYS A HE3  16 
ATOM   9857  H  HZ1  . LYS A 1 22 ? 5.940   4.898   -1.355  1.00 1.76  ? 1124 LYS A HZ1  16 
ATOM   9858  H  HZ2  . LYS A 1 22 ? 5.458   6.360   -0.663  1.00 1.77  ? 1124 LYS A HZ2  16 
ATOM   9859  H  HZ3  . LYS A 1 22 ? 7.020   5.776   -0.399  1.00 1.88  ? 1124 LYS A HZ3  16 
ATOM   9860  N  N    . ASN A 1 23 ? 2.768   3.978   -7.648  1.00 0.24  ? 1125 ASN A N    16 
ATOM   9861  C  CA   . ASN A 1 23 ? 1.664   3.985   -8.607  1.00 0.28  ? 1125 ASN A CA   16 
ATOM   9862  C  C    . ASN A 1 23 ? 0.867   2.684   -8.512  1.00 0.26  ? 1125 ASN A C    16 
ATOM   9863  O  O    . ASN A 1 23 ? -0.291  2.616   -8.915  1.00 0.32  ? 1125 ASN A O    16 
ATOM   9864  C  CB   . ASN A 1 23 ? 2.202   4.180   -10.029 1.00 0.36  ? 1125 ASN A CB   16 
ATOM   9865  C  CG   . ASN A 1 23 ? 1.107   4.251   -11.079 1.00 1.03  ? 1125 ASN A CG   16 
ATOM   9866  O  OD1  . ASN A 1 23 ? 0.528   5.310   -11.318 1.00 1.75  ? 1125 ASN A OD1  16 
ATOM   9867  N  ND2  . ASN A 1 23 ? 0.834   3.131   -11.731 1.00 1.69  ? 1125 ASN A ND2  16 
ATOM   9868  H  H    . ASN A 1 23 ? 3.689   3.931   -7.979  1.00 0.25  ? 1125 ASN A H    16 
ATOM   9869  H  HA   . ASN A 1 23 ? 1.014   4.812   -8.360  1.00 0.31  ? 1125 ASN A HA   16 
ATOM   9870  H  HB2  . ASN A 1 23 ? 2.769   5.095   -10.070 1.00 0.82  ? 1125 ASN A HB2  16 
ATOM   9871  H  HB3  . ASN A 1 23 ? 2.851   3.352   -10.271 1.00 0.82  ? 1125 ASN A HB3  16 
ATOM   9872  H  HD21 . ASN A 1 23 ? 1.343   2.325   -11.505 1.00 1.99  ? 1125 ASN A HD21 16 
ATOM   9873  H  HD22 . ASN A 1 23 ? 0.136   3.154   -12.420 1.00 2.22  ? 1125 ASN A HD22 16 
ATOM   9874  N  N    . TRP A 1 24 ? 1.496   1.656   -7.954  1.00 0.22  ? 1126 TRP A N    16 
ATOM   9875  C  CA   . TRP A 1 24 ? 0.871   0.345   -7.830  1.00 0.22  ? 1126 TRP A CA   16 
ATOM   9876  C  C    . TRP A 1 24 ? 0.069   0.258   -6.538  1.00 0.20  ? 1126 TRP A C    16 
ATOM   9877  O  O    . TRP A 1 24 ? -0.716  -0.665  -6.338  1.00 0.26  ? 1126 TRP A O    16 
ATOM   9878  C  CB   . TRP A 1 24 ? 1.934   -0.758  -7.835  1.00 0.25  ? 1126 TRP A CB   16 
ATOM   9879  C  CG   . TRP A 1 24 ? 2.782   -0.802  -9.073  1.00 0.31  ? 1126 TRP A CG   16 
ATOM   9880  C  CD1  . TRP A 1 24 ? 2.704   0.019   -10.163 1.00 0.37  ? 1126 TRP A CD1  16 
ATOM   9881  C  CD2  . TRP A 1 24 ? 3.847   -1.722  -9.342  1.00 0.38  ? 1126 TRP A CD2  16 
ATOM   9882  N  NE1  . TRP A 1 24 ? 3.655   -0.334  -11.087 1.00 0.45  ? 1126 TRP A NE1  16 
ATOM   9883  C  CE2  . TRP A 1 24 ? 4.367   -1.402  -10.608 1.00 0.45  ? 1126 TRP A CE2  16 
ATOM   9884  C  CE3  . TRP A 1 24 ? 4.408   -2.788  -8.633  1.00 0.44  ? 1126 TRP A CE3  16 
ATOM   9885  C  CZ2  . TRP A 1 24 ? 5.424   -2.104  -11.179 1.00 0.54  ? 1126 TRP A CZ2  16 
ATOM   9886  C  CZ3  . TRP A 1 24 ? 5.455   -3.487  -9.202  1.00 0.55  ? 1126 TRP A CZ3  16 
ATOM   9887  C  CH2  . TRP A 1 24 ? 5.954   -3.143  -10.464 1.00 0.58  ? 1126 TRP A CH2  16 
ATOM   9888  H  H    . TRP A 1 24 ? 2.405   1.784   -7.604  1.00 0.23  ? 1126 TRP A H    16 
ATOM   9889  H  HA   . TRP A 1 24 ? 0.206   0.205   -8.670  1.00 0.25  ? 1126 TRP A HA   16 
ATOM   9890  H  HB2  . TRP A 1 24 ? 2.592   -0.615  -6.990  1.00 0.27  ? 1126 TRP A HB2  16 
ATOM   9891  H  HB3  . TRP A 1 24 ? 1.441   -1.710  -7.734  1.00 0.28  ? 1126 TRP A HB3  16 
ATOM   9892  H  HD1  . TRP A 1 24 ? 1.995   0.827   -10.267 1.00 0.40  ? 1126 TRP A HD1  16 
ATOM   9893  H  HE1  . TRP A 1 24 ? 3.800   0.106   -11.954 1.00 0.53  ? 1126 TRP A HE1  16 
ATOM   9894  H  HE3  . TRP A 1 24 ? 4.037   -3.068  -7.659  1.00 0.45  ? 1126 TRP A HE3  16 
ATOM   9895  H  HZ2  . TRP A 1 24 ? 5.819   -1.851  -12.151 1.00 0.61  ? 1126 TRP A HZ2  16 
ATOM   9896  H  HZ3  . TRP A 1 24 ? 5.902   -4.314  -8.669  1.00 0.62  ? 1126 TRP A HZ3  16 
ATOM   9897  H  HH2  . TRP A 1 24 ? 6.774   -3.716  -10.869 1.00 0.67  ? 1126 TRP A HH2  16 
ATOM   9898  N  N    . VAL A 1 25 ? 0.290   1.218   -5.660  1.00 0.19  ? 1127 VAL A N    16 
ATOM   9899  C  CA   . VAL A 1 25 ? -0.391  1.254   -4.374  1.00 0.18  ? 1127 VAL A CA   16 
ATOM   9900  C  C    . VAL A 1 25 ? -1.881  1.518   -4.549  1.00 0.19  ? 1127 VAL A C    16 
ATOM   9901  O  O    . VAL A 1 25 ? -2.278  2.512   -5.164  1.00 0.23  ? 1127 VAL A O    16 
ATOM   9902  C  CB   . VAL A 1 25 ? 0.220   2.324   -3.444  1.00 0.21  ? 1127 VAL A CB   16 
ATOM   9903  C  CG1  . VAL A 1 25 ? -0.549  2.418   -2.135  1.00 0.24  ? 1127 VAL A CG1  16 
ATOM   9904  C  CG2  . VAL A 1 25 ? 1.686   2.019   -3.179  1.00 0.24  ? 1127 VAL A CG2  16 
ATOM   9905  H  H    . VAL A 1 25 ? 0.928   1.922   -5.882  1.00 0.21  ? 1127 VAL A H    16 
ATOM   9906  H  HA   . VAL A 1 25 ? -0.269  0.288   -3.909  1.00 0.19  ? 1127 VAL A HA   16 
ATOM   9907  H  HB   . VAL A 1 25 ? 0.159   3.281   -3.941  1.00 0.23  ? 1127 VAL A HB   16 
ATOM   9908  H  HG11 . VAL A 1 25 ? -1.588  2.628   -2.343  1.00 1.01  ? 1127 VAL A HG11 16 
ATOM   9909  H  HG12 . VAL A 1 25 ? -0.136  3.213   -1.533  1.00 1.02  ? 1127 VAL A HG12 16 
ATOM   9910  H  HG13 . VAL A 1 25 ? -0.471  1.483   -1.601  1.00 1.00  ? 1127 VAL A HG13 16 
ATOM   9911  H  HG21 . VAL A 1 25 ? 2.123   2.820   -2.602  1.00 1.05  ? 1127 VAL A HG21 16 
ATOM   9912  H  HG22 . VAL A 1 25 ? 2.209   1.925   -4.119  1.00 1.06  ? 1127 VAL A HG22 16 
ATOM   9913  H  HG23 . VAL A 1 25 ? 1.769   1.094   -2.629  1.00 1.01  ? 1127 VAL A HG23 16 
ATOM   9914  N  N    . CYS A 1 26 ? -2.686  0.606   -4.015  1.00 0.19  ? 1128 CYS A N    16 
ATOM   9915  C  CA   . CYS A 1 26 ? -4.139  0.692   -4.097  1.00 0.26  ? 1128 CYS A CA   16 
ATOM   9916  C  C    . CYS A 1 26 ? -4.588  0.689   -5.553  1.00 0.27  ? 1128 CYS A C    16 
ATOM   9917  O  O    . CYS A 1 26 ? -5.282  1.596   -6.020  1.00 0.37  ? 1128 CYS A O    16 
ATOM   9918  C  CB   . CYS A 1 26 ? -4.663  1.930   -3.365  1.00 0.32  ? 1128 CYS A CB   16 
ATOM   9919  S  SG   . CYS A 1 26 ? -6.484  2.058   -3.335  1.00 0.58  ? 1128 CYS A SG   16 
ATOM   9920  H  H    . CYS A 1 26 ? -2.284  -0.164  -3.555  1.00 0.19  ? 1128 CYS A H    16 
ATOM   9921  H  HA   . CYS A 1 26 ? -4.540  -0.189  -3.618  1.00 0.28  ? 1128 CYS A HA   16 
ATOM   9922  H  HB2  . CYS A 1 26 ? -4.318  1.907   -2.342  1.00 0.36  ? 1128 CYS A HB2  16 
ATOM   9923  H  HB3  . CYS A 1 26 ? -4.278  2.812   -3.848  1.00 0.36  ? 1128 CYS A HB3  16 
ATOM   9924  N  N    . ASP A 1 27 ? -4.170  -0.339  -6.269  1.00 0.25  ? 1129 ASP A N    16 
ATOM   9925  C  CA   . ASP A 1 27 ? -4.551  -0.511  -7.664  1.00 0.30  ? 1129 ASP A CA   16 
ATOM   9926  C  C    . ASP A 1 27 ? -5.372  -1.787  -7.809  1.00 0.37  ? 1129 ASP A C    16 
ATOM   9927  O  O    . ASP A 1 27 ? -5.527  -2.324  -8.907  1.00 0.41  ? 1129 ASP A O    16 
ATOM   9928  C  CB   . ASP A 1 27 ? -3.308  -0.566  -8.563  1.00 0.31  ? 1129 ASP A CB   16 
ATOM   9929  C  CG   . ASP A 1 27 ? -2.619  -1.917  -8.548  1.00 0.35  ? 1129 ASP A CG   16 
ATOM   9930  O  OD1  . ASP A 1 27 ? -2.431  -2.489  -7.451  1.00 0.31  ? 1129 ASP A OD1  16 
ATOM   9931  O  OD2  . ASP A 1 27 ? -2.258  -2.407  -9.639  1.00 0.46  ? 1129 ASP A OD2  16 
ATOM   9932  H  H    . ASP A 1 27 ? -3.587  -1.012  -5.839  1.00 0.24  ? 1129 ASP A H    16 
ATOM   9933  H  HA   . ASP A 1 27 ? -5.161  0.333   -7.949  1.00 0.33  ? 1129 ASP A HA   16 
ATOM   9934  H  HB2  . ASP A 1 27 ? -3.597  -0.346  -9.578  1.00 0.36  ? 1129 ASP A HB2  16 
ATOM   9935  H  HB3  . ASP A 1 27 ? -2.601  0.180   -8.228  1.00 0.29  ? 1129 ASP A HB3  16 
ATOM   9936  N  N    . THR A 1 28 ? -5.878  -2.257  -6.666  1.00 0.45  ? 1130 THR A N    16 
ATOM   9937  C  CA   . THR A 1 28 ? -6.685  -3.478  -6.554  1.00 0.56  ? 1130 THR A CA   16 
ATOM   9938  C  C    . THR A 1 28 ? -5.939  -4.716  -7.058  1.00 0.61  ? 1130 THR A C    16 
ATOM   9939  O  O    . THR A 1 28 ? -6.551  -5.722  -7.422  1.00 0.73  ? 1130 THR A O    16 
ATOM   9940  C  CB   . THR A 1 28 ? -8.075  -3.362  -7.239  1.00 0.59  ? 1130 THR A CB   16 
ATOM   9941  O  OG1  . THR A 1 28 ? -7.957  -2.991  -8.619  1.00 0.56  ? 1130 THR A OG1  16 
ATOM   9942  C  CG2  . THR A 1 28 ? -8.944  -2.346  -6.515  1.00 0.65  ? 1130 THR A CG2  16 
ATOM   9943  H  H    . THR A 1 28 ? -5.684  -1.761  -5.840  1.00 0.46  ? 1130 THR A H    16 
ATOM   9944  H  HA   . THR A 1 28 ? -6.865  -3.623  -5.496  1.00 0.64  ? 1130 THR A HA   16 
ATOM   9945  H  HB   . THR A 1 28 ? -8.561  -4.324  -7.180  1.00 0.67  ? 1130 THR A HB   16 
ATOM   9946  H  HG1  . THR A 1 28 ? -7.027  -3.033  -8.875  1.00 0.53  ? 1130 THR A HG1  16 
ATOM   9947  H  HG21 . THR A 1 28 ? -9.091  -2.660  -5.492  1.00 1.34  ? 1130 THR A HG21 16 
ATOM   9948  H  HG22 . THR A 1 28 ? -9.901  -2.273  -7.011  1.00 1.09  ? 1130 THR A HG22 16 
ATOM   9949  H  HG23 . THR A 1 28 ? -8.457  -1.382  -6.529  1.00 1.21  ? 1130 THR A HG23 16 
ATOM   9950  N  N    . ASP A 1 29 ? -4.615  -4.638  -7.065  1.00 0.59  ? 1131 ASP A N    16 
ATOM   9951  C  CA   . ASP A 1 29 ? -3.787  -5.787  -7.393  1.00 0.69  ? 1131 ASP A CA   16 
ATOM   9952  C  C    . ASP A 1 29 ? -2.743  -6.000  -6.309  1.00 0.67  ? 1131 ASP A C    16 
ATOM   9953  O  O    . ASP A 1 29 ? -2.144  -5.039  -5.812  1.00 0.53  ? 1131 ASP A O    16 
ATOM   9954  C  CB   . ASP A 1 29 ? -3.106  -5.607  -8.747  1.00 0.75  ? 1131 ASP A CB   16 
ATOM   9955  C  CG   . ASP A 1 29 ? -2.332  -6.844  -9.162  1.00 0.92  ? 1131 ASP A CG   16 
ATOM   9956  O  OD1  . ASP A 1 29 ? -2.939  -7.932  -9.238  1.00 1.21  ? 1131 ASP A OD1  16 
ATOM   9957  O  OD2  . ASP A 1 29 ? -1.116  -6.739  -9.419  1.00 0.92  ? 1131 ASP A OD2  16 
ATOM   9958  H  H    . ASP A 1 29 ? -4.181  -3.783  -6.854  1.00 0.55  ? 1131 ASP A H    16 
ATOM   9959  H  HA   . ASP A 1 29 ? -4.428  -6.655  -7.433  1.00 0.81  ? 1131 ASP A HA   16 
ATOM   9960  H  HB2  . ASP A 1 29 ? -3.855  -5.401  -9.494  1.00 0.81  ? 1131 ASP A HB2  16 
ATOM   9961  H  HB3  . ASP A 1 29 ? -2.419  -4.775  -8.690  1.00 0.68  ? 1131 ASP A HB3  16 
ATOM   9962  N  N    . ASN A 1 30 ? -2.536  -7.252  -5.936  1.00 0.94  ? 1132 ASN A N    16 
ATOM   9963  C  CA   . ASN A 1 30 ? -1.621  -7.583  -4.856  1.00 1.00  ? 1132 ASN A CA   16 
ATOM   9964  C  C    . ASN A 1 30 ? -0.183  -7.656  -5.361  1.00 0.91  ? 1132 ASN A C    16 
ATOM   9965  O  O    . ASN A 1 30 ? 0.310   -8.716  -5.744  1.00 1.06  ? 1132 ASN A O    16 
ATOM   9966  C  CB   . ASN A 1 30 ? -2.023  -8.902  -4.197  1.00 1.29  ? 1132 ASN A CB   16 
ATOM   9967  C  CG   . ASN A 1 30 ? -1.182  -9.210  -2.974  1.00 1.72  ? 1132 ASN A CG   16 
ATOM   9968  O  OD1  . ASN A 1 30 ? -0.668  -8.303  -2.319  1.00 2.58  ? 1132 ASN A OD1  16 
ATOM   9969  N  ND2  . ASN A 1 30 ? -1.043  -10.484 -2.655  1.00 2.07  ? 1132 ASN A ND2  16 
ATOM   9970  H  H    . ASN A 1 30 ? -3.006  -7.976  -6.402  1.00 1.15  ? 1132 ASN A H    16 
ATOM   9971  H  HA   . ASN A 1 30 ? -1.687  -6.794  -4.122  1.00 0.97  ? 1132 ASN A HA   16 
ATOM   9972  H  HB2  . ASN A 1 30 ? -3.061  -8.848  -3.895  1.00 1.52  ? 1132 ASN A HB2  16 
ATOM   9973  H  HB3  . ASN A 1 30 ? -1.901  -9.707  -4.907  1.00 1.97  ? 1132 ASN A HB3  16 
ATOM   9974  H  HD21 . ASN A 1 30 ? -1.484  -11.154 -3.217  1.00 2.11  ? 1132 ASN A HD21 16 
ATOM   9975  H  HD22 . ASN A 1 30 ? -0.508  -10.709 -1.860  1.00 2.73  ? 1132 ASN A HD22 16 
ATOM   9976  N  N    . ASP A 1 31 ? 0.474   -6.509  -5.359  1.00 0.86  ? 1133 ASP A N    16 
ATOM   9977  C  CA   . ASP A 1 31 ? 1.862   -6.395  -5.790  1.00 0.77  ? 1133 ASP A CA   16 
ATOM   9978  C  C    . ASP A 1 31 ? 2.793   -6.465  -4.591  1.00 0.78  ? 1133 ASP A C    16 
ATOM   9979  O  O    . ASP A 1 31 ? 3.942   -6.892  -4.705  1.00 1.28  ? 1133 ASP A O    16 
ATOM   9980  C  CB   . ASP A 1 31 ? 2.079   -5.081  -6.556  1.00 0.67  ? 1133 ASP A CB   16 
ATOM   9981  C  CG   . ASP A 1 31 ? 1.042   -4.038  -6.209  1.00 0.58  ? 1133 ASP A CG   16 
ATOM   9982  O  OD1  . ASP A 1 31 ? 0.820   -3.772  -5.015  1.00 1.00  ? 1133 ASP A OD1  16 
ATOM   9983  O  OD2  . ASP A 1 31 ? 0.472   -3.423  -7.123  1.00 1.09  ? 1133 ASP A OD2  16 
ATOM   9984  H  H    . ASP A 1 31 ? 0.011   -5.699  -5.050  1.00 1.05  ? 1133 ASP A H    16 
ATOM   9985  H  HA   . ASP A 1 31 ? 2.075   -7.225  -6.446  1.00 0.87  ? 1133 ASP A HA   16 
ATOM   9986  H  HB2  . ASP A 1 31 ? 3.054   -4.681  -6.312  1.00 1.04  ? 1133 ASP A HB2  16 
ATOM   9987  H  HB3  . ASP A 1 31 ? 2.029   -5.275  -7.617  1.00 1.05  ? 1133 ASP A HB3  16 
ATOM   9988  N  N    . CYS A 1 32 ? 2.290   -6.046  -3.438  1.00 0.76  ? 1134 CYS A N    16 
ATOM   9989  C  CA   . CYS A 1 32 ? 3.043   -6.143  -2.193  1.00 0.78  ? 1134 CYS A CA   16 
ATOM   9990  C  C    . CYS A 1 32 ? 3.132   -7.582  -1.702  1.00 0.85  ? 1134 CYS A C    16 
ATOM   9991  O  O    . CYS A 1 32 ? 3.916   -7.889  -0.806  1.00 1.57  ? 1134 CYS A O    16 
ATOM   9992  C  CB   . CYS A 1 32 ? 2.400   -5.286  -1.104  1.00 0.82  ? 1134 CYS A CB   16 
ATOM   9993  S  SG   . CYS A 1 32 ? 2.892   -3.538  -1.134  1.00 1.16  ? 1134 CYS A SG   16 
ATOM   9994  H  H    . CYS A 1 32 ? 1.397   -5.635  -3.428  1.00 1.11  ? 1134 CYS A H    16 
ATOM   9995  H  HA   . CYS A 1 32 ? 4.041   -5.778  -2.381  1.00 0.88  ? 1134 CYS A HA   16 
ATOM   9996  H  HB2  . CYS A 1 32 ? 1.326   -5.323  -1.214  1.00 1.25  ? 1134 CYS A HB2  16 
ATOM   9997  H  HB3  . CYS A 1 32 ? 2.669   -5.686  -0.137  1.00 1.22  ? 1134 CYS A HB3  16 
ATOM   9998  N  N    . GLY A 1 33 ? 2.309   -8.458  -2.263  1.00 1.17  ? 1135 GLY A N    16 
ATOM   9999  C  CA   . GLY A 1 33 ? 2.266   -9.833  -1.801  1.00 1.22  ? 1135 GLY A CA   16 
ATOM   10000 C  C    . GLY A 1 33 ? 1.468   -9.967  -0.518  1.00 1.18  ? 1135 GLY A C    16 
ATOM   10001 O  O    . GLY A 1 33 ? 0.587   -10.817 -0.404  1.00 1.68  ? 1135 GLY A O    16 
ATOM   10002 H  H    . GLY A 1 33 ? 1.727   -8.170  -2.997  1.00 1.82  ? 1135 GLY A H    16 
ATOM   10003 H  HA2  . GLY A 1 33 ? 1.812   -10.448 -2.565  1.00 1.26  ? 1135 GLY A HA2  16 
ATOM   10004 H  HA3  . GLY A 1 33 ? 3.274   -10.176 -1.624  1.00 1.39  ? 1135 GLY A HA3  16 
ATOM   10005 N  N    . ASP A 1 34 ? 1.782   -9.113  0.444   1.00 1.02  ? 1136 ASP A N    16 
ATOM   10006 C  CA   . ASP A 1 34 ? 1.053   -9.058  1.704   1.00 1.11  ? 1136 ASP A CA   16 
ATOM   10007 C  C    . ASP A 1 34 ? -0.223  -8.227  1.546   1.00 0.93  ? 1136 ASP A C    16 
ATOM   10008 O  O    . ASP A 1 34 ? -1.120  -8.265  2.389   1.00 1.35  ? 1136 ASP A O    16 
ATOM   10009 C  CB   . ASP A 1 34 ? 1.951   -8.455  2.788   1.00 1.44  ? 1136 ASP A CB   16 
ATOM   10010 C  CG   . ASP A 1 34 ? 1.313   -8.447  4.163   1.00 2.10  ? 1136 ASP A CG   16 
ATOM   10011 O  OD1  . ASP A 1 34 ? 1.366   -9.481  4.853   1.00 2.47  ? 1136 ASP A OD1  16 
ATOM   10012 O  OD2  . ASP A 1 34 ? 0.737   -7.406  4.550   1.00 2.85  ? 1136 ASP A OD2  16 
ATOM   10013 H  H    . ASP A 1 34 ? 2.546   -8.511  0.308   1.00 1.22  ? 1136 ASP A H    16 
ATOM   10014 H  HA   . ASP A 1 34 ? 0.786   -10.062 1.984   1.00 1.27  ? 1136 ASP A HA   16 
ATOM   10015 H  HB2  . ASP A 1 34 ? 2.866   -9.026  2.843   1.00 1.68  ? 1136 ASP A HB2  16 
ATOM   10016 H  HB3  . ASP A 1 34 ? 2.186   -7.441  2.516   1.00 1.84  ? 1136 ASP A HB3  16 
ATOM   10017 N  N    . GLY A 1 35 ? -0.304  -7.495  0.439   1.00 0.62  ? 1137 GLY A N    16 
ATOM   10018 C  CA   . GLY A 1 35 ? -1.445  -6.629  0.192   1.00 0.49  ? 1137 GLY A CA   16 
ATOM   10019 C  C    . GLY A 1 35 ? -1.383  -5.362  1.016   1.00 0.36  ? 1137 GLY A C    16 
ATOM   10020 O  O    . GLY A 1 35 ? -2.375  -4.647  1.159   1.00 0.36  ? 1137 GLY A O    16 
ATOM   10021 H  H    . GLY A 1 35 ? 0.405   -7.566  -0.231  1.00 0.82  ? 1137 GLY A H    16 
ATOM   10022 H  HA2  . GLY A 1 35 ? -1.465  -6.365  -0.856  1.00 0.51  ? 1137 GLY A HA2  16 
ATOM   10023 H  HA3  . GLY A 1 35 ? -2.352  -7.162  0.436   1.00 0.72  ? 1137 GLY A HA3  16 
ATOM   10024 N  N    . SER A 1 36 ? -0.200  -5.077  1.539   1.00 0.32  ? 1138 SER A N    16 
ATOM   10025 C  CA   . SER A 1 36 ? -0.006  -3.969  2.458   1.00 0.28  ? 1138 SER A CA   16 
ATOM   10026 C  C    . SER A 1 36 ? -0.161  -2.611  1.773   1.00 0.25  ? 1138 SER A C    16 
ATOM   10027 O  O    . SER A 1 36 ? -0.351  -1.596  2.437   1.00 0.40  ? 1138 SER A O    16 
ATOM   10028 C  CB   . SER A 1 36 ? 1.368   -4.098  3.113   1.00 0.33  ? 1138 SER A CB   16 
ATOM   10029 O  OG   . SER A 1 36 ? 2.379   -4.300  2.137   1.00 0.44  ? 1138 SER A OG   16 
ATOM   10030 H  H    . SER A 1 36 ? 0.568   -5.637  1.309   1.00 0.37  ? 1138 SER A H    16 
ATOM   10031 H  HA   . SER A 1 36 ? -0.762  -4.049  3.223   1.00 0.33  ? 1138 SER A HA   16 
ATOM   10032 H  HB2  . SER A 1 36 ? 1.590   -3.200  3.663   1.00 0.40  ? 1138 SER A HB2  16 
ATOM   10033 H  HB3  . SER A 1 36 ? 1.365   -4.941  3.786   1.00 0.39  ? 1138 SER A HB3  16 
ATOM   10034 H  HG   . SER A 1 36 ? 2.363   -3.571  1.505   1.00 1.17  ? 1138 SER A HG   16 
ATOM   10035 N  N    . ASP A 1 37 ? -0.096  -2.595  0.450   1.00 0.18  ? 1139 ASP A N    16 
ATOM   10036 C  CA   . ASP A 1 37 ? -0.271  -1.357  -0.297  1.00 0.18  ? 1139 ASP A CA   16 
ATOM   10037 C  C    . ASP A 1 37 ? -1.755  -1.050  -0.452  1.00 0.20  ? 1139 ASP A C    16 
ATOM   10038 O  O    . ASP A 1 37 ? -2.164  0.108   -0.515  1.00 0.29  ? 1139 ASP A O    16 
ATOM   10039 C  CB   . ASP A 1 37 ? 0.385   -1.462  -1.673  1.00 0.19  ? 1139 ASP A CB   16 
ATOM   10040 C  CG   . ASP A 1 37 ? -0.393  -2.345  -2.623  1.00 0.26  ? 1139 ASP A CG   16 
ATOM   10041 O  OD1  . ASP A 1 37 ? -0.497  -3.565  -2.366  1.00 0.33  ? 1139 ASP A OD1  16 
ATOM   10042 O  OD2  . ASP A 1 37 ? -0.921  -1.814  -3.624  1.00 0.32  ? 1139 ASP A OD2  16 
ATOM   10043 H  H    . ASP A 1 37 ? 0.065   -3.431  -0.039  1.00 0.26  ? 1139 ASP A H    16 
ATOM   10044 H  HA   . ASP A 1 37 ? 0.200   -0.560  0.260   1.00 0.20  ? 1139 ASP A HA   16 
ATOM   10045 H  HB2  . ASP A 1 37 ? 0.457   -0.477  -2.106  1.00 0.22  ? 1139 ASP A HB2  16 
ATOM   10046 H  HB3  . ASP A 1 37 ? 1.377   -1.874  -1.559  1.00 0.19  ? 1139 ASP A HB3  16 
ATOM   10047 N  N    . GLU A 1 38 ? -2.559  -2.102  -0.487  1.00 0.22  ? 1140 GLU A N    16 
ATOM   10048 C  CA   . GLU A 1 38 ? -3.996  -1.960  -0.668  1.00 0.27  ? 1140 GLU A CA   16 
ATOM   10049 C  C    . GLU A 1 38 ? -4.672  -1.734  0.684   1.00 0.31  ? 1140 GLU A C    16 
ATOM   10050 O  O    . GLU A 1 38 ? -5.701  -1.061  0.774   1.00 0.44  ? 1140 GLU A O    16 
ATOM   10051 C  CB   . GLU A 1 38 ? -4.578  -3.216  -1.329  1.00 0.29  ? 1140 GLU A CB   16 
ATOM   10052 C  CG   . GLU A 1 38 ? -3.906  -3.619  -2.640  1.00 0.29  ? 1140 GLU A CG   16 
ATOM   10053 C  CD   . GLU A 1 38 ? -4.196  -2.673  -3.793  1.00 0.28  ? 1140 GLU A CD   16 
ATOM   10054 O  OE1  . GLU A 1 38 ? -5.301  -2.097  -3.837  1.00 0.38  ? 1140 GLU A OE1  16 
ATOM   10055 O  OE2  . GLU A 1 38 ? -3.318  -2.510  -4.673  1.00 0.28  ? 1140 GLU A OE2  16 
ATOM   10056 H  H    . GLU A 1 38 ? -2.175  -3.000  -0.390  1.00 0.24  ? 1140 GLU A H    16 
ATOM   10057 H  HA   . GLU A 1 38 ? -4.173  -1.103  -1.306  1.00 0.30  ? 1140 GLU A HA   16 
ATOM   10058 H  HB2  . GLU A 1 38 ? -4.488  -4.041  -0.639  1.00 0.32  ? 1140 GLU A HB2  16 
ATOM   10059 H  HB3  . GLU A 1 38 ? -5.627  -3.044  -1.528  1.00 0.33  ? 1140 GLU A HB3  16 
ATOM   10060 H  HG2  . GLU A 1 38 ? -2.838  -3.643  -2.483  1.00 0.29  ? 1140 GLU A HG2  16 
ATOM   10061 H  HG3  . GLU A 1 38 ? -4.248  -4.608  -2.911  1.00 0.33  ? 1140 GLU A HG3  16 
ATOM   10062 N  N    . LYS A 1 39 ? -4.071  -2.294  1.735   1.00 0.30  ? 1141 LYS A N    16 
ATOM   10063 C  CA   . LYS A 1 39 ? -4.655  -2.258  3.076   1.00 0.37  ? 1141 LYS A CA   16 
ATOM   10064 C  C    . LYS A 1 39 ? -4.813  -0.825  3.585   1.00 0.49  ? 1141 LYS A C    16 
ATOM   10065 O  O    . LYS A 1 39 ? -5.809  -0.493  4.225   1.00 0.57  ? 1141 LYS A O    16 
ATOM   10066 C  CB   . LYS A 1 39 ? -3.800  -3.066  4.070   1.00 0.47  ? 1141 LYS A CB   16 
ATOM   10067 C  CG   . LYS A 1 39 ? -2.507  -2.373  4.483   1.00 0.57  ? 1141 LYS A CG   16 
ATOM   10068 C  CD   . LYS A 1 39 ? -1.750  -3.152  5.542   1.00 0.76  ? 1141 LYS A CD   16 
ATOM   10069 C  CE   . LYS A 1 39 ? -0.505  -2.401  5.993   1.00 0.91  ? 1141 LYS A CE   16 
ATOM   10070 N  NZ   . LYS A 1 39 ? -0.838  -1.180  6.772   1.00 1.55  ? 1141 LYS A NZ   16 
ATOM   10071 H  H    . LYS A 1 39 ? -3.218  -2.761  1.599   1.00 0.32  ? 1141 LYS A H    16 
ATOM   10072 H  HA   . LYS A 1 39 ? -5.635  -2.710  3.016   1.00 0.39  ? 1141 LYS A HA   16 
ATOM   10073 H  HB2  . LYS A 1 39 ? -4.382  -3.249  4.960   1.00 0.56  ? 1141 LYS A HB2  16 
ATOM   10074 H  HB3  . LYS A 1 39 ? -3.546  -4.014  3.619   1.00 0.47  ? 1141 LYS A HB3  16 
ATOM   10075 H  HG2  . LYS A 1 39 ? -1.874  -2.267  3.615   1.00 0.50  ? 1141 LYS A HG2  16 
ATOM   10076 H  HG3  . LYS A 1 39 ? -2.746  -1.396  4.874   1.00 0.65  ? 1141 LYS A HG3  16 
ATOM   10077 H  HD2  . LYS A 1 39 ? -2.395  -3.301  6.395   1.00 0.88  ? 1141 LYS A HD2  16 
ATOM   10078 H  HD3  . LYS A 1 39 ? -1.458  -4.110  5.137   1.00 0.73  ? 1141 LYS A HD3  16 
ATOM   10079 H  HE2  . LYS A 1 39 ? 0.088   -3.056  6.606   1.00 1.15  ? 1141 LYS A HE2  16 
ATOM   10080 H  HE3  . LYS A 1 39 ? 0.062   -2.117  5.119   1.00 1.18  ? 1141 LYS A HE3  16 
ATOM   10081 H  HZ1  . LYS A 1 39 ? 0.026   -0.638  6.978   1.00 2.08  ? 1141 LYS A HZ1  16 
ATOM   10082 H  HZ2  . LYS A 1 39 ? -1.288  -1.441  7.673   1.00 1.99  ? 1141 LYS A HZ2  16 
ATOM   10083 H  HZ3  . LYS A 1 39 ? -1.492  -0.576  6.238   1.00 1.97  ? 1141 LYS A HZ3  16 
ATOM   10084 N  N    . ASN A 1 40 ? -3.838  0.025   3.286   1.00 0.60  ? 1142 ASN A N    16 
ATOM   10085 C  CA   . ASN A 1 40 ? -3.835  1.381   3.816   1.00 0.81  ? 1142 ASN A CA   16 
ATOM   10086 C  C    . ASN A 1 40 ? -4.328  2.382   2.783   1.00 0.91  ? 1142 ASN A C    16 
ATOM   10087 O  O    . ASN A 1 40 ? -3.893  3.530   2.755   1.00 1.44  ? 1142 ASN A O    16 
ATOM   10088 C  CB   . ASN A 1 40 ? -2.440  1.768   4.349   1.00 1.07  ? 1142 ASN A CB   16 
ATOM   10089 C  CG   . ASN A 1 40 ? -1.299  1.608   3.348   1.00 1.37  ? 1142 ASN A CG   16 
ATOM   10090 O  OD1  . ASN A 1 40 ? -0.193  1.226   3.724   1.00 2.05  ? 1142 ASN A OD1  16 
ATOM   10091 N  ND2  . ASN A 1 40 ? -1.534  1.928   2.085   1.00 1.92  ? 1142 ASN A ND2  16 
ATOM   10092 H  H    . ASN A 1 40 ? -3.111  -0.264  2.695   1.00 0.58  ? 1142 ASN A H    16 
ATOM   10093 H  HA   . ASN A 1 40 ? -4.528  1.395   4.645   1.00 0.86  ? 1142 ASN A HA   16 
ATOM   10094 H  HB2  . ASN A 1 40 ? -2.463  2.800   4.658   1.00 1.54  ? 1142 ASN A HB2  16 
ATOM   10095 H  HB3  . ASN A 1 40 ? -2.219  1.155   5.210   1.00 1.56  ? 1142 ASN A HB3  16 
ATOM   10096 H  HD21 . ASN A 1 40 ? -2.425  2.256   1.848   1.00 2.20  ? 1142 ASN A HD21 16 
ATOM   10097 H  HD22 . ASN A 1 40 ? -0.800  1.837   1.438   1.00 2.44  ? 1142 ASN A HD22 16 
ATOM   10098 N  N    . CYS A 1 41 ? -5.232  1.940   1.926   1.00 0.76  ? 1143 CYS A N    16 
ATOM   10099 C  CA   . CYS A 1 41 ? -5.835  2.830   0.949   1.00 0.99  ? 1143 CYS A CA   16 
ATOM   10100 C  C    . CYS A 1 41 ? -7.038  3.531   1.569   1.00 1.29  ? 1143 CYS A C    16 
ATOM   10101 O  O    . CYS A 1 41 ? -8.183  3.300   1.179   1.00 1.67  ? 1143 CYS A O    16 
ATOM   10102 C  CB   . CYS A 1 41 ? -6.253  2.056   -0.305  1.00 0.93  ? 1143 CYS A CB   16 
ATOM   10103 S  SG   . CYS A 1 41 ? -6.880  3.113   -1.651  1.00 1.10  ? 1143 CYS A SG   16 
ATOM   10104 H  H    . CYS A 1 41 ? -5.505  0.997   1.952   1.00 0.89  ? 1143 CYS A H    16 
ATOM   10105 H  HA   . CYS A 1 41 ? -5.099  3.573   0.679   1.00 1.23  ? 1143 CYS A HA   16 
ATOM   10106 H  HB2  . CYS A 1 41 ? -5.401  1.512   -0.684  1.00 0.98  ? 1143 CYS A HB2  16 
ATOM   10107 H  HB3  . CYS A 1 41 ? -7.034  1.358   -0.044  1.00 1.29  ? 1143 CYS A HB3  16 
ATOM   10108 N  N    . ASN A 1 42 ? -6.776  4.368   2.560   1.00 1.87  ? 1144 ASN A N    16 
ATOM   10109 C  CA   . ASN A 1 42 ? -7.833  5.093   3.245   1.00 2.36  ? 1144 ASN A CA   16 
ATOM   10110 C  C    . ASN A 1 42 ? -7.771  6.576   2.915   1.00 3.05  ? 1144 ASN A C    16 
ATOM   10111 O  O    . ASN A 1 42 ? -6.689  7.150   2.782   1.00 3.73  ? 1144 ASN A O    16 
ATOM   10112 C  CB   . ASN A 1 42 ? -7.762  4.884   4.767   1.00 3.11  ? 1144 ASN A CB   16 
ATOM   10113 C  CG   . ASN A 1 42 ? -6.464  5.373   5.396   1.00 3.87  ? 1144 ASN A CG   16 
ATOM   10114 O  OD1  . ASN A 1 42 ? -5.390  5.292   4.797   1.00 4.27  ? 1144 ASN A OD1  16 
ATOM   10115 N  ND2  . ASN A 1 42 ? -6.556  5.895   6.609   1.00 4.59  ? 1144 ASN A ND2  16 
ATOM   10116 H  H    . ASN A 1 42 ? -5.844  4.508   2.839   1.00 2.27  ? 1144 ASN A H    16 
ATOM   10117 H  HA   . ASN A 1 42 ? -8.773  4.706   2.886   1.00 2.42  ? 1144 ASN A HA   16 
ATOM   10118 H  HB2  . ASN A 1 42 ? -8.579  5.416   5.231   1.00 3.41  ? 1144 ASN A HB2  16 
ATOM   10119 H  HB3  . ASN A 1 42 ? -7.865  3.830   4.977   1.00 3.38  ? 1144 ASN A HB3  16 
ATOM   10120 H  HD21 . ASN A 1 42 ? -7.448  5.941   7.031   1.00 4.61  ? 1144 ASN A HD21 16 
ATOM   10121 H  HD22 . ASN A 1 42 ? -5.735  6.214   7.042   1.00 5.30  ? 1144 ASN A HD22 16 
ATOM   10122 N  N    . SER A 1 43 ? -8.940  7.179   2.770   1.00 3.53  ? 1145 SER A N    16 
ATOM   10123 C  CA   . SER A 1 43 ? -9.047  8.597   2.466   1.00 4.69  ? 1145 SER A CA   16 
ATOM   10124 C  C    . SER A 1 43 ? -10.461 9.085   2.739   1.00 5.23  ? 1145 SER A C    16 
ATOM   10125 O  O    . SER A 1 43 ? -10.681 9.972   3.566   1.00 5.32  ? 1145 SER A O    16 
ATOM   10126 C  CB   . SER A 1 43 ? -8.657  8.859   1.007   1.00 5.40  ? 1145 SER A CB   16 
ATOM   10127 O  OG   . SER A 1 43 ? -9.388  8.028   0.117   1.00 5.26  ? 1145 SER A OG   16 
ATOM   10128 H  H    . SER A 1 43 ? -9.762  6.653   2.875   1.00 3.45  ? 1145 SER A H    16 
ATOM   10129 H  HA   . SER A 1 43 ? -8.372  9.129   3.109   1.00 5.07  ? 1145 SER A HA   16 
ATOM   10130 H  HB2  . SER A 1 43 ? -8.861  9.891   0.763   1.00 6.23  ? 1145 SER A HB2  16 
ATOM   10131 H  HB3  . SER A 1 43 ? -7.602  8.662   0.878   1.00 5.56  ? 1145 SER A HB3  16 
ATOM   10132 H  HG   . SER A 1 43 ? -8.840  7.275   -0.141  1.00 5.21  ? 1145 SER A HG   16 
ATOM   10133 N  N    . THR A 1 44 ? -11.416 8.478   2.061   1.00 5.97  ? 1146 THR A N    16 
ATOM   10134 C  CA   . THR A 1 44 ? -12.807 8.866   2.177   1.00 6.81  ? 1146 THR A CA   16 
ATOM   10135 C  C    . THR A 1 44 ? -13.513 8.070   3.271   1.00 7.34  ? 1146 THR A C    16 
ATOM   10136 O  O    . THR A 1 44 ? -14.618 7.560   3.076   1.00 8.15  ? 1146 THR A O    16 
ATOM   10137 C  CB   . THR A 1 44 ? -13.515 8.676   0.826   1.00 7.69  ? 1146 THR A CB   16 
ATOM   10138 O  OG1  . THR A 1 44 ? -13.385 7.316   0.389   1.00 7.92  ? 1146 THR A OG1  16 
ATOM   10139 C  CG2  . THR A 1 44 ? -12.896 9.599   -0.210  1.00 7.74  ? 1146 THR A CG2  16 
ATOM   10140 H  H    . THR A 1 44 ? -11.176 7.747   1.451   1.00 6.16  ? 1146 THR A H    16 
ATOM   10141 H  HA   . THR A 1 44 ? -12.841 9.912   2.432   1.00 6.75  ? 1146 THR A HA   16 
ATOM   10142 H  HB   . THR A 1 44 ? -14.561 8.923   0.936   1.00 8.40  ? 1146 THR A HB   16 
ATOM   10143 H  HG1  . THR A 1 44 ? -13.887 6.740   0.980   1.00 8.03  ? 1146 THR A HG1  16 
ATOM   10144 H  HG21 . THR A 1 44 ? -11.827 9.428   -0.248  1.00 7.71  ? 1146 THR A HG21 16 
ATOM   10145 H  HG22 . THR A 1 44 ? -13.086 10.626  0.064   1.00 7.80  ? 1146 THR A HG22 16 
ATOM   10146 H  HG23 . THR A 1 44 ? -13.329 9.397   -1.179  1.00 8.03  ? 1146 THR A HG23 16 
ATOM   10147 N  N    . GLU A 1 45 ? -12.863 7.975   4.425   1.00 7.13  ? 1147 GLU A N    16 
ATOM   10148 C  CA   . GLU A 1 45 ? -13.401 7.215   5.543   1.00 7.94  ? 1147 GLU A CA   16 
ATOM   10149 C  C    . GLU A 1 45 ? -14.286 8.094   6.421   1.00 8.95  ? 1147 GLU A C    16 
ATOM   10150 O  O    . GLU A 1 45 ? -15.164 7.597   7.124   1.00 9.87  ? 1147 GLU A O    16 
ATOM   10151 C  CB   . GLU A 1 45 ? -12.265 6.601   6.369   1.00 7.79  ? 1147 GLU A CB   16 
ATOM   10152 C  CG   . GLU A 1 45 ? -11.298 7.622   6.948   1.00 7.90  ? 1147 GLU A CG   16 
ATOM   10153 C  CD   . GLU A 1 45 ? -10.189 6.981   7.754   1.00 8.00  ? 1147 GLU A CD   16 
ATOM   10154 O  OE1  . GLU A 1 45 ? -10.482 6.407   8.825   1.00 8.23  ? 1147 GLU A OE1  16 
ATOM   10155 O  OE2  . GLU A 1 45 ? -9.018  7.057   7.328   1.00 8.08  ? 1147 GLU A OE2  16 
ATOM   10156 H  H    . GLU A 1 45 ? -11.998 8.426   4.524   1.00 6.60  ? 1147 GLU A H    16 
ATOM   10157 H  HA   . GLU A 1 45 ? -14.004 6.418   5.135   1.00 8.20  ? 1147 GLU A HA   16 
ATOM   10158 H  HB2  . GLU A 1 45 ? -12.695 6.043   7.187   1.00 8.33  ? 1147 GLU A HB2  16 
ATOM   10159 H  HB3  . GLU A 1 45 ? -11.705 5.924   5.742   1.00 7.37  ? 1147 GLU A HB3  16 
ATOM   10160 H  HG2  . GLU A 1 45 ? -10.855 8.179   6.137   1.00 7.80  ? 1147 GLU A HG2  16 
ATOM   10161 H  HG3  . GLU A 1 45 ? -11.847 8.296   7.590   1.00 8.35  ? 1147 GLU A HG3  16 
ATOM   10162 N  N    . THR A 1 46 ? -14.063 9.401   6.373   1.00 8.94  ? 1148 THR A N    16 
ATOM   10163 C  CA   . THR A 1 46 ? -14.860 10.328  7.162   1.00 10.03 ? 1148 THR A CA   16 
ATOM   10164 C  C    . THR A 1 46 ? -15.989 10.925  6.326   1.00 10.71 ? 1148 THR A C    16 
ATOM   10165 O  O    . THR A 1 46 ? -16.970 11.440  6.860   1.00 11.12 ? 1148 THR A O    16 
ATOM   10166 C  CB   . THR A 1 46 ? -13.992 11.446  7.777   1.00 10.21 ? 1148 THR A CB   16 
ATOM   10167 O  OG1  . THR A 1 46 ? -13.005 11.894  6.836   1.00 9.58  ? 1148 THR A OG1  16 
ATOM   10168 C  CG2  . THR A 1 46 ? -13.304 10.959  9.042   1.00 11.01 ? 1148 THR A CG2  16 
ATOM   10169 H  H    . THR A 1 46 ? -13.352 9.749   5.792   1.00 8.30  ? 1148 THR A H    16 
ATOM   10170 H  HA   . THR A 1 46 ? -15.299 9.764   7.973   1.00 10.45 ? 1148 THR A HA   16 
ATOM   10171 H  HB   . THR A 1 46 ? -14.633 12.275  8.035   1.00 10.48 ? 1148 THR A HB   16 
ATOM   10172 H  HG1  . THR A 1 46 ? -12.123 11.679  7.176   1.00 9.43  ? 1148 THR A HG1  16 
ATOM   10173 H  HG21 . THR A 1 46 ? -12.690 10.100  8.811   1.00 11.19 ? 1148 THR A HG21 16 
ATOM   10174 H  HG22 . THR A 1 46 ? -14.048 10.683  9.774   1.00 11.07 ? 1148 THR A HG22 16 
ATOM   10175 H  HG23 . THR A 1 46 ? -12.684 11.747  9.440   1.00 11.53 ? 1148 THR A HG23 16 
HETATM 10176 CA CA   . CA  B 2 .  ? -1.243  -2.809  -5.572  1.00 0.28  ? 1201 CA  A CA   16 
ATOM   10177 N  N    . THR A 1 1  ? 27.901  -1.564  8.961   1.00 12.23 ? 1103 THR A N    17 
ATOM   10178 C  CA   . THR A 1 1  ? 26.717  -2.407  9.234   1.00 11.73 ? 1103 THR A CA   17 
ATOM   10179 C  C    . THR A 1 1  ? 25.422  -1.622  9.026   1.00 10.83 ? 1103 THR A C    17 
ATOM   10180 O  O    . THR A 1 1  ? 24.696  -1.332  9.975   1.00 10.67 ? 1103 THR A O    17 
ATOM   10181 C  CB   . THR A 1 1  ? 26.754  -2.972  10.671  1.00 11.83 ? 1103 THR A CB   17 
ATOM   10182 O  OG1  . THR A 1 1  ? 27.130  -1.949  11.609  1.00 12.26 ? 1103 THR A OG1  17 
ATOM   10183 C  CG2  . THR A 1 1  ? 27.724  -4.138  10.772  1.00 12.04 ? 1103 THR A CG2  17 
ATOM   10184 H  H1   . THR A 1 1  ? 28.773  -2.111  9.103   1.00 12.23 ? 1103 THR A H1   17 
ATOM   10185 H  H2   . THR A 1 1  ? 27.910  -0.748  9.600   1.00 12.55 ? 1103 THR A H2   17 
ATOM   10186 H  H3   . THR A 1 1  ? 27.875  -1.221  7.981   1.00 12.44 ? 1103 THR A H3   17 
ATOM   10187 H  HA   . THR A 1 1  ? 26.732  -3.239  8.545   1.00 12.16 ? 1103 THR A HA   17 
ATOM   10188 H  HB   . THR A 1 1  ? 25.766  -3.327  10.923  1.00 11.67 ? 1103 THR A HB   17 
ATOM   10189 H  HG1  . THR A 1 1  ? 28.086  -1.822  11.583  1.00 12.30 ? 1103 THR A HG1  17 
ATOM   10190 H  HG21 . THR A 1 1  ? 27.404  -4.931  10.114  1.00 12.31 ? 1103 THR A HG21 17 
ATOM   10191 H  HG22 . THR A 1 1  ? 27.745  -4.500  11.788  1.00 12.05 ? 1103 THR A HG22 17 
ATOM   10192 H  HG23 . THR A 1 1  ? 28.711  -3.809  10.487  1.00 12.10 ? 1103 THR A HG23 17 
ATOM   10193 N  N    . HIS A 1 2  ? 25.135  -1.274  7.778   1.00 10.41 ? 1104 HIS A N    17 
ATOM   10194 C  CA   . HIS A 1 2  ? 23.929  -0.525  7.459   1.00 9.72  ? 1104 HIS A CA   17 
ATOM   10195 C  C    . HIS A 1 2  ? 22.810  -1.465  7.041   1.00 8.65  ? 1104 HIS A C    17 
ATOM   10196 O  O    . HIS A 1 2  ? 23.014  -2.370  6.231   1.00 8.32  ? 1104 HIS A O    17 
ATOM   10197 C  CB   . HIS A 1 2  ? 24.189  0.496   6.347   1.00 10.05 ? 1104 HIS A CB   17 
ATOM   10198 C  CG   . HIS A 1 2  ? 25.045  1.648   6.771   1.00 10.43 ? 1104 HIS A CG   17 
ATOM   10199 N  ND1  . HIS A 1 2  ? 26.222  1.986   6.140   1.00 10.71 ? 1104 HIS A ND1  17 
ATOM   10200 C  CD2  . HIS A 1 2  ? 24.881  2.552   7.764   1.00 10.84 ? 1104 HIS A CD2  17 
ATOM   10201 C  CE1  . HIS A 1 2  ? 26.744  3.045   6.728   1.00 11.25 ? 1104 HIS A CE1  17 
ATOM   10202 N  NE2  . HIS A 1 2  ? 25.950  3.410   7.715   1.00 11.34 ? 1104 HIS A NE2  17 
ATOM   10203 H  H    . HIS A 1 2  ? 25.742  -1.539  7.051   1.00 10.71 ? 1104 HIS A H    17 
ATOM   10204 H  HA   . HIS A 1 2  ? 23.623  0.000   8.352   1.00 9.96  ? 1104 HIS A HA   17 
ATOM   10205 H  HB2  . HIS A 1 2  ? 24.685  0.001   5.526   1.00 10.50 ? 1104 HIS A HB2  17 
ATOM   10206 H  HB3  . HIS A 1 2  ? 23.244  0.891   6.003   1.00 9.81  ? 1104 HIS A HB3  17 
ATOM   10207 H  HD1  . HIS A 1 2  ? 26.615  1.521   5.368   1.00 10.68 ? 1104 HIS A HD1  17 
ATOM   10208 H  HD2  . HIS A 1 2  ? 24.059  2.591   8.463   1.00 10.94 ? 1104 HIS A HD2  17 
ATOM   10209 H  HE1  . HIS A 1 2  ? 27.666  3.533   6.448   1.00 11.71 ? 1104 HIS A HE1  17 
ATOM   10210 H  HE2  . HIS A 1 2  ? 26.012  4.263   8.199   1.00 11.83 ? 1104 HIS A HE2  17 
ATOM   10211 N  N    . ALA A 1 3  ? 21.634  -1.246  7.603   1.00 8.30  ? 1105 ALA A N    17 
ATOM   10212 C  CA   . ALA A 1 3  ? 20.462  -2.038  7.268   1.00 7.41  ? 1105 ALA A CA   17 
ATOM   10213 C  C    . ALA A 1 3  ? 19.619  -1.303  6.233   1.00 6.47  ? 1105 ALA A C    17 
ATOM   10214 O  O    . ALA A 1 3  ? 19.536  -0.073  6.258   1.00 6.54  ? 1105 ALA A O    17 
ATOM   10215 C  CB   . ALA A 1 3  ? 19.646  -2.318  8.522   1.00 7.70  ? 1105 ALA A CB   17 
ATOM   10216 H  H    . ALA A 1 3  ? 21.544  -0.522  8.256   1.00 8.79  ? 1105 ALA A H    17 
ATOM   10217 H  HA   . ALA A 1 3  ? 20.796  -2.979  6.858   1.00 7.45  ? 1105 ALA A HA   17 
ATOM   10218 H  HB1  . ALA A 1 3  ? 18.794  -2.932  8.266   1.00 7.93  ? 1105 ALA A HB1  17 
ATOM   10219 H  HB2  . ALA A 1 3  ? 19.301  -1.385  8.943   1.00 7.73  ? 1105 ALA A HB2  17 
ATOM   10220 H  HB3  . ALA A 1 3  ? 20.259  -2.834  9.244   1.00 7.95  ? 1105 ALA A HB3  17 
ATOM   10221 N  N    . PRO A 1 4  ? 19.000  -2.040  5.295   1.00 5.80  ? 1106 PRO A N    17 
ATOM   10222 C  CA   . PRO A 1 4  ? 18.154  -1.448  4.254   1.00 4.97  ? 1106 PRO A CA   17 
ATOM   10223 C  C    . PRO A 1 4  ? 16.974  -0.680  4.839   1.00 4.25  ? 1106 PRO A C    17 
ATOM   10224 O  O    . PRO A 1 4  ? 16.248  -1.190  5.697   1.00 4.22  ? 1106 PRO A O    17 
ATOM   10225 C  CB   . PRO A 1 4  ? 17.653  -2.654  3.451   1.00 4.84  ? 1106 PRO A CB   17 
ATOM   10226 C  CG   . PRO A 1 4  ? 18.603  -3.756  3.768   1.00 5.55  ? 1106 PRO A CG   17 
ATOM   10227 C  CD   . PRO A 1 4  ? 19.080  -3.507  5.169   1.00 6.09  ? 1106 PRO A CD   17 
ATOM   10228 H  HA   . PRO A 1 4  ? 18.721  -0.794  3.611   1.00 5.32  ? 1106 PRO A HA   17 
ATOM   10229 H  HB2  . PRO A 1 4  ? 16.648  -2.899  3.759   1.00 4.32  ? 1106 PRO A HB2  17 
ATOM   10230 H  HB3  . PRO A 1 4  ? 17.663  -2.415  2.398   1.00 5.12  ? 1106 PRO A HB3  17 
ATOM   10231 H  HG2  . PRO A 1 4  ? 18.094  -4.706  3.708   1.00 5.52  ? 1106 PRO A HG2  17 
ATOM   10232 H  HG3  . PRO A 1 4  ? 19.434  -3.732  3.080   1.00 6.00  ? 1106 PRO A HG3  17 
ATOM   10233 H  HD2  . PRO A 1 4  ? 18.428  -3.990  5.882   1.00 6.19  ? 1106 PRO A HD2  17 
ATOM   10234 H  HD3  . PRO A 1 4  ? 20.096  -3.850  5.288   1.00 6.80  ? 1106 PRO A HD3  17 
ATOM   10235 N  N    . ALA A 1 5  ? 16.798  0.547   4.377   1.00 4.09  ? 1107 ALA A N    17 
ATOM   10236 C  CA   . ALA A 1 5  ? 15.714  1.396   4.839   1.00 3.77  ? 1107 ALA A CA   17 
ATOM   10237 C  C    . ALA A 1 5  ? 14.561  1.383   3.843   1.00 2.63  ? 1107 ALA A C    17 
ATOM   10238 O  O    . ALA A 1 5  ? 14.477  0.486   2.998   1.00 2.62  ? 1107 ALA A O    17 
ATOM   10239 C  CB   . ALA A 1 5  ? 16.216  2.817   5.056   1.00 4.73  ? 1107 ALA A CB   17 
ATOM   10240 H  H    . ALA A 1 5  ? 17.417  0.893   3.698   1.00 4.51  ? 1107 ALA A H    17 
ATOM   10241 H  HA   . ALA A 1 5  ? 15.364  1.011   5.786   1.00 4.04  ? 1107 ALA A HA   17 
ATOM   10242 H  HB1  . ALA A 1 5  ? 16.522  3.239   4.110   1.00 5.01  ? 1107 ALA A HB1  17 
ATOM   10243 H  HB2  . ALA A 1 5  ? 17.057  2.800   5.730   1.00 4.95  ? 1107 ALA A HB2  17 
ATOM   10244 H  HB3  . ALA A 1 5  ? 15.426  3.419   5.480   1.00 5.29  ? 1107 ALA A HB3  17 
ATOM   10245 N  N    . SER A 1 6  ? 13.681  2.370   3.949   1.00 2.16  ? 1108 SER A N    17 
ATOM   10246 C  CA   . SER A 1 6  ? 12.540  2.501   3.053   1.00 1.43  ? 1108 SER A CA   17 
ATOM   10247 C  C    . SER A 1 6  ? 12.974  2.512   1.585   1.00 1.29  ? 1108 SER A C    17 
ATOM   10248 O  O    . SER A 1 6  ? 14.105  2.891   1.256   1.00 1.97  ? 1108 SER A O    17 
ATOM   10249 C  CB   . SER A 1 6  ? 11.779  3.779   3.398   1.00 2.09  ? 1108 SER A CB   17 
ATOM   10250 O  OG   . SER A 1 6  ? 12.678  4.861   3.575   1.00 2.97  ? 1108 SER A OG   17 
ATOM   10251 H  H    . SER A 1 6  ? 13.799  3.037   4.656   1.00 2.71  ? 1108 SER A H    17 
ATOM   10252 H  HA   . SER A 1 6  ? 11.891  1.654   3.217   1.00 1.32  ? 1108 SER A HA   17 
ATOM   10253 H  HB2  . SER A 1 6  ? 11.097  4.017   2.597   1.00 2.36  ? 1108 SER A HB2  17 
ATOM   10254 H  HB3  . SER A 1 6  ? 11.225  3.632   4.313   1.00 2.13  ? 1108 SER A HB3  17 
ATOM   10255 H  HG   . SER A 1 6  ? 13.334  4.848   2.863   1.00 3.32  ? 1108 SER A HG   17 
ATOM   10256 N  N    . CYS A 1 7  ? 12.072  2.091   0.714   1.00 0.72  ? 1109 CYS A N    17 
ATOM   10257 C  CA   . CYS A 1 7  ? 12.361  1.970   -0.708  1.00 0.49  ? 1109 CYS A CA   17 
ATOM   10258 C  C    . CYS A 1 7  ? 12.470  3.338   -1.386  1.00 0.46  ? 1109 CYS A C    17 
ATOM   10259 O  O    . CYS A 1 7  ? 12.461  4.379   -0.722  1.00 0.62  ? 1109 CYS A O    17 
ATOM   10260 C  CB   . CYS A 1 7  ? 11.279  1.121   -1.377  1.00 0.33  ? 1109 CYS A CB   17 
ATOM   10261 S  SG   . CYS A 1 7  ? 11.038  -0.509  -0.595  1.00 0.47  ? 1109 CYS A SG   17 
ATOM   10262 H  H    . CYS A 1 7  ? 11.174  1.847   1.038   1.00 0.94  ? 1109 CYS A H    17 
ATOM   10263 H  HA   . CYS A 1 7  ? 13.306  1.463   -0.812  1.00 0.60  ? 1109 CYS A HA   17 
ATOM   10264 H  HB2  . CYS A 1 7  ? 10.338  1.649   -1.333  1.00 0.41  ? 1109 CYS A HB2  17 
ATOM   10265 H  HB3  . CYS A 1 7  ? 11.547  0.955   -2.410  1.00 0.29  ? 1109 CYS A HB3  17 
ATOM   10266 N  N    . LEU A 1 8  ? 12.592  3.313   -2.711  1.00 0.34  ? 1110 LEU A N    17 
ATOM   10267 C  CA   . LEU A 1 8  ? 12.726  4.512   -3.534  1.00 0.32  ? 1110 LEU A CA   17 
ATOM   10268 C  C    . LEU A 1 8  ? 11.649  5.548   -3.204  1.00 0.29  ? 1110 LEU A C    17 
ATOM   10269 O  O    . LEU A 1 8  ? 10.592  5.212   -2.670  1.00 0.30  ? 1110 LEU A O    17 
ATOM   10270 C  CB   . LEU A 1 8  ? 12.586  4.091   -4.990  1.00 0.28  ? 1110 LEU A CB   17 
ATOM   10271 C  CG   . LEU A 1 8  ? 13.495  4.787   -5.996  1.00 0.38  ? 1110 LEU A CG   17 
ATOM   10272 C  CD1  . LEU A 1 8  ? 14.957  4.470   -5.716  1.00 0.52  ? 1110 LEU A CD1  17 
ATOM   10273 C  CD2  . LEU A 1 8  ? 13.115  4.359   -7.403  1.00 0.39  ? 1110 LEU A CD2  17 
ATOM   10274 H  H    . LEU A 1 8  ? 12.603  2.441   -3.162  1.00 0.34  ? 1110 LEU A H    17 
ATOM   10275 H  HA   . LEU A 1 8  ? 13.704  4.937   -3.374  1.00 0.40  ? 1110 LEU A HA   17 
ATOM   10276 H  HB2  . LEU A 1 8  ? 12.766  3.028   -5.046  1.00 0.32  ? 1110 LEU A HB2  17 
ATOM   10277 H  HB3  . LEU A 1 8  ? 11.563  4.266   -5.285  1.00 0.22  ? 1110 LEU A HB3  17 
ATOM   10278 H  HG   . LEU A 1 8  ? 13.361  5.855   -5.920  1.00 0.41  ? 1110 LEU A HG   17 
ATOM   10279 H  HD11 . LEU A 1 8  ? 15.110  3.402   -5.773  1.00 1.05  ? 1110 LEU A HD11 17 
ATOM   10280 H  HD12 . LEU A 1 8  ? 15.221  4.821   -4.730  1.00 1.29  ? 1110 LEU A HD12 17 
ATOM   10281 H  HD13 . LEU A 1 8  ? 15.578  4.962   -6.450  1.00 1.07  ? 1110 LEU A HD13 17 
ATOM   10282 H  HD21 . LEU A 1 8  ? 12.105  4.678   -7.617  1.00 1.11  ? 1110 LEU A HD21 17 
ATOM   10283 H  HD22 . LEU A 1 8  ? 13.170  3.282   -7.478  1.00 1.05  ? 1110 LEU A HD22 17 
ATOM   10284 H  HD23 . LEU A 1 8  ? 13.793  4.806   -8.114  1.00 0.97  ? 1110 LEU A HD23 17 
ATOM   10285 N  N    . ASP A 1 9  ? 11.908  6.805   -3.549  1.00 0.35  ? 1111 ASP A N    17 
ATOM   10286 C  CA   . ASP A 1 9  ? 10.958  7.880   -3.276  1.00 0.38  ? 1111 ASP A CA   17 
ATOM   10287 C  C    . ASP A 1 9  ? 9.719   7.732   -4.154  1.00 0.32  ? 1111 ASP A C    17 
ATOM   10288 O  O    . ASP A 1 9  ? 8.649   8.247   -3.834  1.00 0.42  ? 1111 ASP A O    17 
ATOM   10289 C  CB   . ASP A 1 9  ? 11.603  9.251   -3.493  1.00 0.51  ? 1111 ASP A CB   17 
ATOM   10290 C  CG   . ASP A 1 9  ? 10.782  10.375  -2.887  1.00 1.37  ? 1111 ASP A CG   17 
ATOM   10291 O  OD1  . ASP A 1 9  ? 10.798  10.519  -1.647  1.00 1.53  ? 1111 ASP A OD1  17 
ATOM   10292 O  OD2  . ASP A 1 9  ? 10.130  11.129  -3.646  1.00 2.32  ? 1111 ASP A OD2  17 
ATOM   10293 H  H    . ASP A 1 9  ? 12.764  7.018   -3.987  1.00 0.40  ? 1111 ASP A H    17 
ATOM   10294 H  HA   . ASP A 1 9  ? 10.658  7.798   -2.242  1.00 0.44  ? 1111 ASP A HA   17 
ATOM   10295 H  HB2  . ASP A 1 9  ? 12.583  9.256   -3.039  1.00 0.94  ? 1111 ASP A HB2  17 
ATOM   10296 H  HB3  . ASP A 1 9  ? 11.702  9.430   -4.554  1.00 1.01  ? 1111 ASP A HB3  17 
ATOM   10297 N  N    . THR A 1 10 ? 9.874   7.022   -5.266  1.00 0.28  ? 1112 THR A N    17 
ATOM   10298 C  CA   . THR A 1 10 ? 8.745   6.679   -6.119  1.00 0.31  ? 1112 THR A CA   17 
ATOM   10299 C  C    . THR A 1 10 ? 8.313   5.234   -5.891  1.00 0.24  ? 1112 THR A C    17 
ATOM   10300 O  O    . THR A 1 10 ? 7.416   4.723   -6.563  1.00 0.30  ? 1112 THR A O    17 
ATOM   10301 C  CB   . THR A 1 10 ? 9.070   6.891   -7.609  1.00 0.42  ? 1112 THR A CB   17 
ATOM   10302 O  OG1  . THR A 1 10 ? 10.364  6.348   -7.917  1.00 0.45  ? 1112 THR A OG1  17 
ATOM   10303 C  CG2  . THR A 1 10 ? 9.034   8.368   -7.965  1.00 0.52  ? 1112 THR A CG2  17 
ATOM   10304 H  H    . THR A 1 10 ? 10.774  6.734   -5.527  1.00 0.31  ? 1112 THR A H    17 
ATOM   10305 H  HA   . THR A 1 10 ? 7.923   7.331   -5.855  1.00 0.36  ? 1112 THR A HA   17 
ATOM   10306 H  HB   . THR A 1 10 ? 8.324   6.377   -8.201  1.00 0.48  ? 1112 THR A HB   17 
ATOM   10307 H  HG1  . THR A 1 10 ? 10.289  5.390   -8.039  1.00 0.95  ? 1112 THR A HG1  17 
ATOM   10308 H  HG21 . THR A 1 10 ? 8.051   8.764   -7.757  1.00 1.19  ? 1112 THR A HG21 17 
ATOM   10309 H  HG22 . THR A 1 10 ? 9.256   8.492   -9.014  1.00 1.09  ? 1112 THR A HG22 17 
ATOM   10310 H  HG23 . THR A 1 10 ? 9.767   8.898   -7.376  1.00 1.17  ? 1112 THR A HG23 17 
ATOM   10311 N  N    . GLN A 1 11 ? 8.966   4.573   -4.941  1.00 0.18  ? 1113 GLN A N    17 
ATOM   10312 C  CA   . GLN A 1 11 ? 8.604   3.223   -4.564  1.00 0.17  ? 1113 GLN A CA   17 
ATOM   10313 C  C    . GLN A 1 11 ? 7.903   3.201   -3.223  1.00 0.17  ? 1113 GLN A C    17 
ATOM   10314 O  O    . GLN A 1 11 ? 7.965   4.156   -2.450  1.00 0.23  ? 1113 GLN A O    17 
ATOM   10315 C  CB   . GLN A 1 11 ? 9.836   2.332   -4.498  1.00 0.17  ? 1113 GLN A CB   17 
ATOM   10316 C  CG   . GLN A 1 11 ? 10.345  1.915   -5.858  1.00 0.23  ? 1113 GLN A CG   17 
ATOM   10317 C  CD   . GLN A 1 11 ? 11.415  0.847   -5.778  1.00 0.35  ? 1113 GLN A CD   17 
ATOM   10318 O  OE1  . GLN A 1 11 ? 12.154  0.767   -4.797  1.00 1.02  ? 1113 GLN A OE1  17 
ATOM   10319 N  NE2  . GLN A 1 11 ? 11.510  0.025   -6.810  1.00 0.67  ? 1113 GLN A NE2  17 
ATOM   10320 H  H    . GLN A 1 11 ? 9.713   5.005   -4.478  1.00 0.20  ? 1113 GLN A H    17 
ATOM   10321 H  HA   . GLN A 1 11 ? 7.933   2.838   -5.316  1.00 0.22  ? 1113 GLN A HA   17 
ATOM   10322 H  HB2  . GLN A 1 11 ? 10.624  2.868   -3.990  1.00 0.16  ? 1113 GLN A HB2  17 
ATOM   10323 H  HB3  . GLN A 1 11 ? 9.598   1.446   -3.934  1.00 0.20  ? 1113 GLN A HB3  17 
ATOM   10324 H  HG2  . GLN A 1 11 ? 9.518   1.537   -6.423  1.00 0.31  ? 1113 GLN A HG2  17 
ATOM   10325 H  HG3  . GLN A 1 11 ? 10.756  2.780   -6.357  1.00 0.22  ? 1113 GLN A HG3  17 
ATOM   10326 H  HE21 . GLN A 1 11 ? 10.892  0.151   -7.564  1.00 1.21  ? 1113 GLN A HE21 17 
ATOM   10327 H  HE22 . GLN A 1 11 ? 12.193  -0.677  -6.780  1.00 0.65  ? 1113 GLN A HE22 17 
ATOM   10328 N  N    . TYR A 1 12 ? 7.242   2.100   -2.960  1.00 0.15  ? 1114 TYR A N    17 
ATOM   10329 C  CA   . TYR A 1 12 ? 6.561   1.897   -1.697  1.00 0.16  ? 1114 TYR A CA   17 
ATOM   10330 C  C    . TYR A 1 12 ? 7.184   0.722   -0.966  1.00 0.15  ? 1114 TYR A C    17 
ATOM   10331 O  O    . TYR A 1 12 ? 7.683   -0.214  -1.591  1.00 0.15  ? 1114 TYR A O    17 
ATOM   10332 C  CB   . TYR A 1 12 ? 5.076   1.646   -1.937  1.00 0.18  ? 1114 TYR A CB   17 
ATOM   10333 C  CG   . TYR A 1 12 ? 4.241   1.521   -0.680  1.00 0.22  ? 1114 TYR A CG   17 
ATOM   10334 C  CD1  . TYR A 1 12 ? 4.007   2.620   0.137   1.00 0.33  ? 1114 TYR A CD1  17 
ATOM   10335 C  CD2  . TYR A 1 12 ? 3.669   0.305   -0.324  1.00 0.21  ? 1114 TYR A CD2  17 
ATOM   10336 C  CE1  . TYR A 1 12 ? 3.229   2.510   1.273   1.00 0.39  ? 1114 TYR A CE1  17 
ATOM   10337 C  CE2  . TYR A 1 12 ? 2.893   0.188   0.811   1.00 0.26  ? 1114 TYR A CE2  17 
ATOM   10338 C  CZ   . TYR A 1 12 ? 2.677   1.292   1.606   1.00 0.34  ? 1114 TYR A CZ   17 
ATOM   10339 O  OH   . TYR A 1 12 ? 1.894   1.181   2.732   1.00 0.41  ? 1114 TYR A OH   17 
ATOM   10340 H  H    . TYR A 1 12 ? 7.214   1.388   -3.647  1.00 0.16  ? 1114 TYR A H    17 
ATOM   10341 H  HA   . TYR A 1 12 ? 6.680   2.790   -1.101  1.00 0.18  ? 1114 TYR A HA   17 
ATOM   10342 H  HB2  . TYR A 1 12 ? 4.672   2.456   -2.522  1.00 0.23  ? 1114 TYR A HB2  17 
ATOM   10343 H  HB3  . TYR A 1 12 ? 4.971   0.728   -2.488  1.00 0.18  ? 1114 TYR A HB3  17 
ATOM   10344 H  HD1  . TYR A 1 12 ? 4.445   3.573   -0.125  1.00 0.40  ? 1114 TYR A HD1  17 
ATOM   10345 H  HD2  . TYR A 1 12 ? 3.842   -0.559  -0.948  1.00 0.23  ? 1114 TYR A HD2  17 
ATOM   10346 H  HE1  . TYR A 1 12 ? 3.059   3.375   1.897   1.00 0.50  ? 1114 TYR A HE1  17 
ATOM   10347 H  HE2  . TYR A 1 12 ? 2.460   -0.767  1.072   1.00 0.29  ? 1114 TYR A HE2  17 
ATOM   10348 H  HH   . TYR A 1 12 ? 1.999   0.296   3.106   1.00 0.89  ? 1114 TYR A HH   17 
ATOM   10349 N  N    . THR A 1 13 ? 7.155   0.781   0.350   1.00 0.18  ? 1115 THR A N    17 
ATOM   10350 C  CA   . THR A 1 13 ? 7.752   -0.252  1.173   1.00 0.20  ? 1115 THR A CA   17 
ATOM   10351 C  C    . THR A 1 13 ? 6.664   -1.125  1.788   1.00 0.23  ? 1115 THR A C    17 
ATOM   10352 O  O    . THR A 1 13 ? 5.985   -0.724  2.737   1.00 0.31  ? 1115 THR A O    17 
ATOM   10353 C  CB   . THR A 1 13 ? 8.625   0.359   2.285   1.00 0.26  ? 1115 THR A CB   17 
ATOM   10354 O  OG1  . THR A 1 13 ? 9.484   1.366   1.729   1.00 0.30  ? 1115 THR A OG1  17 
ATOM   10355 C  CG2  . THR A 1 13 ? 9.470   -0.713  2.958   1.00 0.27  ? 1115 THR A CG2  17 
ATOM   10356 H  H    . THR A 1 13 ? 6.692   1.529   0.781   1.00 0.22  ? 1115 THR A H    17 
ATOM   10357 H  HA   . THR A 1 13 ? 8.380   -0.864  0.542   1.00 0.19  ? 1115 THR A HA   17 
ATOM   10358 H  HB   . THR A 1 13 ? 7.980   0.810   3.025   1.00 0.31  ? 1115 THR A HB   17 
ATOM   10359 H  HG1  . THR A 1 13 ? 8.966   1.940   1.153   1.00 0.82  ? 1115 THR A HG1  17 
ATOM   10360 H  HG21 . THR A 1 13 ? 8.824   -1.448  3.414   1.00 1.01  ? 1115 THR A HG21 17 
ATOM   10361 H  HG22 . THR A 1 13 ? 10.090  -0.259  3.716   1.00 1.02  ? 1115 THR A HG22 17 
ATOM   10362 H  HG23 . THR A 1 13 ? 10.096  -1.192  2.219   1.00 1.10  ? 1115 THR A HG23 17 
ATOM   10363 N  N    . CYS A 1 14 ? 6.494   -2.308  1.223   1.00 0.26  ? 1116 CYS A N    17 
ATOM   10364 C  CA   . CYS A 1 14 ? 5.452   -3.229  1.648   1.00 0.34  ? 1116 CYS A CA   17 
ATOM   10365 C  C    . CYS A 1 14 ? 5.775   -3.852  3.011   1.00 0.40  ? 1116 CYS A C    17 
ATOM   10366 O  O    . CYS A 1 14 ? 6.863   -3.636  3.554   1.00 0.37  ? 1116 CYS A O    17 
ATOM   10367 C  CB   . CYS A 1 14 ? 5.279   -4.322  0.597   1.00 0.45  ? 1116 CYS A CB   17 
ATOM   10368 S  SG   . CYS A 1 14 ? 5.033   -3.694  -1.096  1.00 0.65  ? 1116 CYS A SG   17 
ATOM   10369 H  H    . CYS A 1 14 ? 7.086   -2.570  0.481   1.00 0.28  ? 1116 CYS A H    17 
ATOM   10370 H  HA   . CYS A 1 14 ? 4.531   -2.673  1.730   1.00 0.38  ? 1116 CYS A HA   17 
ATOM   10371 H  HB2  . CYS A 1 14 ? 6.163   -4.941  0.589   1.00 0.50  ? 1116 CYS A HB2  17 
ATOM   10372 H  HB3  . CYS A 1 14 ? 4.424   -4.928  0.854   1.00 0.54  ? 1116 CYS A HB3  17 
ATOM   10373 N  N    . ASP A 1 15 ? 4.840   -4.631  3.547   1.00 0.56  ? 1117 ASP A N    17 
ATOM   10374 C  CA   . ASP A 1 15 ? 4.969   -5.193  4.895   1.00 0.69  ? 1117 ASP A CA   17 
ATOM   10375 C  C    . ASP A 1 15 ? 6.244   -6.019  5.053   1.00 0.65  ? 1117 ASP A C    17 
ATOM   10376 O  O    . ASP A 1 15 ? 6.982   -5.850  6.024   1.00 0.71  ? 1117 ASP A O    17 
ATOM   10377 C  CB   . ASP A 1 15 ? 3.742   -6.045  5.251   1.00 0.93  ? 1117 ASP A CB   17 
ATOM   10378 C  CG   . ASP A 1 15 ? 3.574   -7.262  4.362   1.00 1.83  ? 1117 ASP A CG   17 
ATOM   10379 O  OD1  . ASP A 1 15 ? 3.235   -7.094  3.170   1.00 2.09  ? 1117 ASP A OD1  17 
ATOM   10380 O  OD2  . ASP A 1 15 ? 3.792   -8.394  4.848   1.00 2.62  ? 1117 ASP A OD2  17 
ATOM   10381 H  H    . ASP A 1 15 ? 4.035   -4.838  3.022   1.00 0.63  ? 1117 ASP A H    17 
ATOM   10382 H  HA   . ASP A 1 15 ? 5.019   -4.363  5.581   1.00 0.70  ? 1117 ASP A HA   17 
ATOM   10383 H  HB2  . ASP A 1 15 ? 3.836   -6.384  6.271   1.00 1.35  ? 1117 ASP A HB2  17 
ATOM   10384 H  HB3  . ASP A 1 15 ? 2.857   -5.433  5.164   1.00 0.70  ? 1117 ASP A HB3  17 
ATOM   10385 N  N    . ASN A 1 16 ? 6.528   -6.877  4.086   1.00 0.69  ? 1118 ASN A N    17 
ATOM   10386 C  CA   . ASN A 1 16 ? 7.695   -7.749  4.164   1.00 0.75  ? 1118 ASN A CA   17 
ATOM   10387 C  C    . ASN A 1 16 ? 8.919   -7.047  3.578   1.00 0.59  ? 1118 ASN A C    17 
ATOM   10388 O  O    . ASN A 1 16 ? 9.860   -7.690  3.115   1.00 0.65  ? 1118 ASN A O    17 
ATOM   10389 C  CB   . ASN A 1 16 ? 7.424   -9.059  3.428   1.00 0.98  ? 1118 ASN A CB   17 
ATOM   10390 C  CG   . ASN A 1 16 ? 8.324   -10.195 3.884   1.00 1.77  ? 1118 ASN A CG   17 
ATOM   10391 O  OD1  . ASN A 1 16 ? 9.405   -10.415 3.337   1.00 2.75  ? 1118 ASN A OD1  17 
ATOM   10392 N  ND2  . ASN A 1 16 ? 7.880   -10.929 4.893   1.00 2.02  ? 1118 ASN A ND2  17 
ATOM   10393 H  H    . ASN A 1 16 ? 5.938   -6.932  3.303   1.00 0.75  ? 1118 ASN A H    17 
ATOM   10394 H  HA   . ASN A 1 16 ? 7.880   -7.964  5.198   1.00 0.85  ? 1118 ASN A HA   17 
ATOM   10395 H  HB2  . ASN A 1 16 ? 6.399   -9.351  3.590   1.00 1.24  ? 1118 ASN A HB2  17 
ATOM   10396 H  HB3  . ASN A 1 16 ? 7.585   -8.900  2.378   1.00 1.41  ? 1118 ASN A HB3  17 
ATOM   10397 H  HD21 . ASN A 1 16 ? 7.007   -10.697 5.286   1.00 1.91  ? 1118 ASN A HD21 17 
ATOM   10398 H  HD22 . ASN A 1 16 ? 8.434   -11.672 5.207   1.00 2.74  ? 1118 ASN A HD22 17 
ATOM   10399 N  N    . HIS A 1 17 ? 8.891   -5.716  3.605   1.00 0.46  ? 1119 HIS A N    17 
ATOM   10400 C  CA   . HIS A 1 17 ? 9.976   -4.891  3.073   1.00 0.41  ? 1119 HIS A CA   17 
ATOM   10401 C  C    . HIS A 1 17 ? 10.168  -5.134  1.582   1.00 0.44  ? 1119 HIS A C    17 
ATOM   10402 O  O    . HIS A 1 17 ? 11.294  -5.206  1.088   1.00 0.79  ? 1119 HIS A O    17 
ATOM   10403 C  CB   . HIS A 1 17 ? 11.287  -5.140  3.828   1.00 0.51  ? 1119 HIS A CB   17 
ATOM   10404 C  CG   . HIS A 1 17 ? 11.272  -4.631  5.236   1.00 0.63  ? 1119 HIS A CG   17 
ATOM   10405 N  ND1  . HIS A 1 17 ? 11.549  -5.422  6.329   1.00 0.94  ? 1119 HIS A ND1  17 
ATOM   10406 C  CD2  . HIS A 1 17 ? 11.021  -3.394  5.723   1.00 0.78  ? 1119 HIS A CD2  17 
ATOM   10407 C  CE1  . HIS A 1 17 ? 11.468  -4.693  7.426   1.00 1.05  ? 1119 HIS A CE1  17 
ATOM   10408 N  NE2  . HIS A 1 17 ? 11.150  -3.458  7.087   1.00 0.93  ? 1119 HIS A NE2  17 
ATOM   10409 H  H    . HIS A 1 17 ? 8.106   -5.270  3.994   1.00 0.47  ? 1119 HIS A H    17 
ATOM   10410 H  HA   . HIS A 1 17 ? 9.691   -3.857  3.212   1.00 0.38  ? 1119 HIS A HA   17 
ATOM   10411 H  HB2  . HIS A 1 17 ? 11.477  -6.202  3.861   1.00 0.60  ? 1119 HIS A HB2  17 
ATOM   10412 H  HB3  . HIS A 1 17 ? 12.095  -4.650  3.305   1.00 0.55  ? 1119 HIS A HB3  17 
ATOM   10413 H  HD1  . HIS A 1 17 ? 11.768  -6.381  6.306   1.00 1.18  ? 1119 HIS A HD1  17 
ATOM   10414 H  HD2  . HIS A 1 17 ? 10.766  -2.518  5.145   1.00 1.00  ? 1119 HIS A HD2  17 
ATOM   10415 H  HE1  . HIS A 1 17 ? 11.636  -5.047  8.432   1.00 1.35  ? 1119 HIS A HE1  17 
ATOM   10416 H  HE2  . HIS A 1 17 ? 11.248  -2.677  7.676   1.00 1.09  ? 1119 HIS A HE2  17 
ATOM   10417 N  N    . GLN A 1 18 ? 9.060   -5.276  0.874   1.00 0.40  ? 1120 GLN A N    17 
ATOM   10418 C  CA   . GLN A 1 18 ? 9.089   -5.415  -0.573  1.00 0.38  ? 1120 GLN A CA   17 
ATOM   10419 C  C    . GLN A 1 18 ? 8.945   -4.042  -1.218  1.00 0.29  ? 1120 GLN A C    17 
ATOM   10420 O  O    . GLN A 1 18 ? 8.156   -3.218  -0.759  1.00 0.39  ? 1120 GLN A O    17 
ATOM   10421 C  CB   . GLN A 1 18 ? 7.971   -6.356  -1.032  1.00 0.49  ? 1120 GLN A CB   17 
ATOM   10422 C  CG   . GLN A 1 18 ? 7.863   -6.508  -2.539  1.00 0.50  ? 1120 GLN A CG   17 
ATOM   10423 C  CD   . GLN A 1 18 ? 6.858   -7.570  -2.945  1.00 1.05  ? 1120 GLN A CD   17 
ATOM   10424 O  OE1  . GLN A 1 18 ? 5.888   -7.833  -2.232  1.00 1.91  ? 1120 GLN A OE1  17 
ATOM   10425 N  NE2  . GLN A 1 18 ? 7.076   -8.185  -4.096  1.00 1.51  ? 1120 GLN A NE2  17 
ATOM   10426 H  H    . GLN A 1 18 ? 8.196   -5.287  1.336   1.00 0.63  ? 1120 GLN A H    17 
ATOM   10427 H  HA   . GLN A 1 18 ? 10.044  -5.834  -0.848  1.00 0.42  ? 1120 GLN A HA   17 
ATOM   10428 H  HB2  . GLN A 1 18 ? 8.144   -7.333  -0.607  1.00 0.62  ? 1120 GLN A HB2  17 
ATOM   10429 H  HB3  . GLN A 1 18 ? 7.030   -5.982  -0.666  1.00 0.52  ? 1120 GLN A HB3  17 
ATOM   10430 H  HG2  . GLN A 1 18 ? 7.556   -5.563  -2.963  1.00 0.87  ? 1120 GLN A HG2  17 
ATOM   10431 H  HG3  . GLN A 1 18 ? 8.831   -6.780  -2.929  1.00 0.86  ? 1120 GLN A HG3  17 
ATOM   10432 H  HE21 . GLN A 1 18 ? 7.863   -7.926  -4.620  1.00 1.83  ? 1120 GLN A HE21 17 
ATOM   10433 H  HE22 . GLN A 1 18 ? 6.441   -8.876  -4.379  1.00 1.99  ? 1120 GLN A HE22 17 
ATOM   10434 N  N    . CYS A 1 19 ? 9.724   -3.787  -2.255  1.00 0.21  ? 1121 CYS A N    17 
ATOM   10435 C  CA   . CYS A 1 19 ? 9.702   -2.494  -2.918  1.00 0.21  ? 1121 CYS A CA   17 
ATOM   10436 C  C    . CYS A 1 19 ? 8.895   -2.550  -4.208  1.00 0.20  ? 1121 CYS A C    17 
ATOM   10437 O  O    . CYS A 1 19 ? 9.355   -3.082  -5.220  1.00 0.34  ? 1121 CYS A O    17 
ATOM   10438 C  CB   . CYS A 1 19 ? 11.128  -2.025  -3.215  1.00 0.34  ? 1121 CYS A CB   17 
ATOM   10439 S  SG   . CYS A 1 19 ? 12.152  -1.771  -1.728  1.00 0.42  ? 1121 CYS A SG   17 
ATOM   10440 H  H    . CYS A 1 19 ? 10.330  -4.484  -2.585  1.00 0.29  ? 1121 CYS A H    17 
ATOM   10441 H  HA   . CYS A 1 19 ? 9.236   -1.788  -2.246  1.00 0.24  ? 1121 CYS A HA   17 
ATOM   10442 H  HB2  . CYS A 1 19 ? 11.621  -2.763  -3.829  1.00 0.39  ? 1121 CYS A HB2  17 
ATOM   10443 H  HB3  . CYS A 1 19 ? 11.087  -1.088  -3.751  1.00 0.41  ? 1121 CYS A HB3  17 
ATOM   10444 N  N    . ILE A 1 20 ? 7.683   -2.019  -4.161  1.00 0.15  ? 1122 ILE A N    17 
ATOM   10445 C  CA   . ILE A 1 20 ? 6.864   -1.877  -5.356  1.00 0.14  ? 1122 ILE A CA   17 
ATOM   10446 C  C    . ILE A 1 20 ? 6.843   -0.419  -5.777  1.00 0.14  ? 1122 ILE A C    17 
ATOM   10447 O  O    . ILE A 1 20 ? 7.359   0.439   -5.067  1.00 0.18  ? 1122 ILE A O    17 
ATOM   10448 C  CB   . ILE A 1 20 ? 5.411   -2.351  -5.137  1.00 0.14  ? 1122 ILE A CB   17 
ATOM   10449 C  CG1  . ILE A 1 20 ? 4.720   -1.495  -4.073  1.00 0.13  ? 1122 ILE A CG1  17 
ATOM   10450 C  CG2  . ILE A 1 20 ? 5.387   -3.822  -4.747  1.00 0.19  ? 1122 ILE A CG2  17 
ATOM   10451 C  CD1  . ILE A 1 20 ? 3.223   -1.696  -4.012  1.00 0.17  ? 1122 ILE A CD1  17 
ATOM   10452 H  H    . ILE A 1 20 ? 7.332   -1.700  -3.300  1.00 0.22  ? 1122 ILE A H    17 
ATOM   10453 H  HA   . ILE A 1 20 ? 7.304   -2.470  -6.143  1.00 0.17  ? 1122 ILE A HA   17 
ATOM   10454 H  HB   . ILE A 1 20 ? 4.880   -2.246  -6.071  1.00 0.16  ? 1122 ILE A HB   17 
ATOM   10455 H  HG12 . ILE A 1 20 ? 5.126   -1.742  -3.106  1.00 0.15  ? 1122 ILE A HG12 17 
ATOM   10456 H  HG13 . ILE A 1 20 ? 4.909   -0.452  -4.282  1.00 0.14  ? 1122 ILE A HG13 17 
ATOM   10457 H  HG21 . ILE A 1 20 ? 5.816   -4.413  -5.543  1.00 0.98  ? 1122 ILE A HG21 17 
ATOM   10458 H  HG22 . ILE A 1 20 ? 4.367   -4.133  -4.578  1.00 1.05  ? 1122 ILE A HG22 17 
ATOM   10459 H  HG23 . ILE A 1 20 ? 5.961   -3.963  -3.844  1.00 0.97  ? 1122 ILE A HG23 17 
ATOM   10460 H  HD11 . ILE A 1 20 ? 2.779   -1.358  -4.936  1.00 1.07  ? 1122 ILE A HD11 17 
ATOM   10461 H  HD12 . ILE A 1 20 ? 2.812   -1.133  -3.183  1.00 0.99  ? 1122 ILE A HD12 17 
ATOM   10462 H  HD13 . ILE A 1 20 ? 3.009   -2.745  -3.874  1.00 1.03  ? 1122 ILE A HD13 17 
ATOM   10463 N  N    . SER A 1 21 ? 6.261   -0.135  -6.925  1.00 0.16  ? 1123 SER A N    17 
ATOM   10464 C  CA   . SER A 1 21 ? 6.086   1.240   -7.356  1.00 0.17  ? 1123 SER A CA   17 
ATOM   10465 C  C    . SER A 1 21 ? 4.949   1.881   -6.576  1.00 0.15  ? 1123 SER A C    17 
ATOM   10466 O  O    . SER A 1 21 ? 3.960   1.221   -6.254  1.00 0.17  ? 1123 SER A O    17 
ATOM   10467 C  CB   . SER A 1 21 ? 5.778   1.298   -8.854  1.00 0.24  ? 1123 SER A CB   17 
ATOM   10468 O  OG   . SER A 1 21 ? 5.431   2.618   -9.252  1.00 0.33  ? 1123 SER A OG   17 
ATOM   10469 H  H    . SER A 1 21 ? 5.934   -0.865  -7.491  1.00 0.20  ? 1123 SER A H    17 
ATOM   10470 H  HA   . SER A 1 21 ? 7.002   1.777   -7.158  1.00 0.19  ? 1123 SER A HA   17 
ATOM   10471 H  HB2  . SER A 1 21 ? 6.648   0.986   -9.410  1.00 0.27  ? 1123 SER A HB2  17 
ATOM   10472 H  HB3  . SER A 1 21 ? 4.951   0.638   -9.076  1.00 0.24  ? 1123 SER A HB3  17 
ATOM   10473 H  HG   . SER A 1 21 ? 4.630   2.590   -9.788  1.00 0.63  ? 1123 SER A HG   17 
ATOM   10474 N  N    . LYS A 1 22 ? 5.082   3.171   -6.281  1.00 0.17  ? 1124 LYS A N    17 
ATOM   10475 C  CA   . LYS A 1 22 ? 4.017   3.904   -5.611  1.00 0.19  ? 1124 LYS A CA   17 
ATOM   10476 C  C    . LYS A 1 22 ? 2.773   3.967   -6.493  1.00 0.22  ? 1124 LYS A C    17 
ATOM   10477 O  O    . LYS A 1 22 ? 1.672   4.226   -6.010  1.00 0.25  ? 1124 LYS A O    17 
ATOM   10478 C  CB   . LYS A 1 22 ? 4.460   5.321   -5.238  1.00 0.23  ? 1124 LYS A CB   17 
ATOM   10479 C  CG   . LYS A 1 22 ? 5.264   5.393   -3.952  1.00 0.25  ? 1124 LYS A CG   17 
ATOM   10480 C  CD   . LYS A 1 22 ? 5.560   6.834   -3.561  1.00 0.25  ? 1124 LYS A CD   17 
ATOM   10481 C  CE   . LYS A 1 22 ? 6.313   6.913   -2.243  1.00 0.30  ? 1124 LYS A CE   17 
ATOM   10482 N  NZ   . LYS A 1 22 ? 6.586   8.319   -1.841  1.00 1.24  ? 1124 LYS A NZ   17 
ATOM   10483 H  H    . LYS A 1 22 ? 5.916   3.640   -6.520  1.00 0.20  ? 1124 LYS A H    17 
ATOM   10484 H  HA   . LYS A 1 22 ? 3.775   3.363   -4.705  1.00 0.19  ? 1124 LYS A HA   17 
ATOM   10485 H  HB2  . LYS A 1 22 ? 5.067   5.717   -6.038  1.00 0.30  ? 1124 LYS A HB2  17 
ATOM   10486 H  HB3  . LYS A 1 22 ? 3.583   5.941   -5.125  1.00 0.30  ? 1124 LYS A HB3  17 
ATOM   10487 H  HG2  . LYS A 1 22 ? 4.700   4.925   -3.159  1.00 0.37  ? 1124 LYS A HG2  17 
ATOM   10488 H  HG3  . LYS A 1 22 ? 6.196   4.868   -4.093  1.00 0.37  ? 1124 LYS A HG3  17 
ATOM   10489 H  HD2  . LYS A 1 22 ? 6.161   7.289   -4.333  1.00 0.32  ? 1124 LYS A HD2  17 
ATOM   10490 H  HD3  . LYS A 1 22 ? 4.626   7.370   -3.465  1.00 0.33  ? 1124 LYS A HD3  17 
ATOM   10491 H  HE2  . LYS A 1 22 ? 5.721   6.437   -1.475  1.00 0.93  ? 1124 LYS A HE2  17 
ATOM   10492 H  HE3  . LYS A 1 22 ? 7.251   6.389   -2.348  1.00 0.95  ? 1124 LYS A HE3  17 
ATOM   10493 H  HZ1  . LYS A 1 22 ? 7.160   8.794   -2.567  1.00 1.76  ? 1124 LYS A HZ1  17 
ATOM   10494 H  HZ2  . LYS A 1 22 ? 7.105   8.339   -0.941  1.00 1.77  ? 1124 LYS A HZ2  17 
ATOM   10495 H  HZ3  . LYS A 1 22 ? 5.692   8.839   -1.724  1.00 1.88  ? 1124 LYS A HZ3  17 
ATOM   10496 N  N    . ASN A 1 23 ? 2.956   3.718   -7.789  1.00 0.24  ? 1125 ASN A N    17 
ATOM   10497 C  CA   . ASN A 1 23 ? 1.837   3.704   -8.726  1.00 0.28  ? 1125 ASN A CA   17 
ATOM   10498 C  C    . ASN A 1 23 ? 1.064   2.398   -8.612  1.00 0.26  ? 1125 ASN A C    17 
ATOM   10499 O  O    . ASN A 1 23 ? -0.046  2.271   -9.130  1.00 0.32  ? 1125 ASN A O    17 
ATOM   10500 C  CB   . ASN A 1 23 ? 2.324   3.900   -10.164 1.00 0.36  ? 1125 ASN A CB   17 
ATOM   10501 C  CG   . ASN A 1 23 ? 2.994   5.244   -10.378 1.00 1.03  ? 1125 ASN A CG   17 
ATOM   10502 O  OD1  . ASN A 1 23 ? 2.669   6.229   -9.715  1.00 1.75  ? 1125 ASN A OD1  17 
ATOM   10503 N  ND2  . ASN A 1 23 ? 3.936   5.294   -11.304 1.00 1.69  ? 1125 ASN A ND2  17 
ATOM   10504 H  H    . ASN A 1 23 ? 3.864   3.545   -8.118  1.00 0.25  ? 1125 ASN A H    17 
ATOM   10505 H  HA   . ASN A 1 23 ? 1.179   4.520   -8.465  1.00 0.31  ? 1125 ASN A HA   17 
ATOM   10506 H  HB2  . ASN A 1 23 ? 3.034   3.123   -10.404 1.00 0.82  ? 1125 ASN A HB2  17 
ATOM   10507 H  HB3  . ASN A 1 23 ? 1.480   3.828   -10.835 1.00 0.82  ? 1125 ASN A HB3  17 
ATOM   10508 H  HD21 . ASN A 1 23 ? 4.148   4.471   -11.797 1.00 1.99  ? 1125 ASN A HD21 17 
ATOM   10509 H  HD22 . ASN A 1 23 ? 4.380   6.153   -11.469 1.00 2.22  ? 1125 ASN A HD22 17 
ATOM   10510 N  N    . TRP A 1 24 ? 1.652   1.427   -7.924  1.00 0.22  ? 1126 TRP A N    17 
ATOM   10511 C  CA   . TRP A 1 24 ? 1.005   0.137   -7.718  1.00 0.22  ? 1126 TRP A CA   17 
ATOM   10512 C  C    . TRP A 1 24 ? 0.246   0.127   -6.401  1.00 0.20  ? 1126 TRP A C    17 
ATOM   10513 O  O    . TRP A 1 24 ? -0.508  -0.791  -6.121  1.00 0.26  ? 1126 TRP A O    17 
ATOM   10514 C  CB   . TRP A 1 24 ? 2.028   -1.002  -7.719  1.00 0.25  ? 1126 TRP A CB   17 
ATOM   10515 C  CG   . TRP A 1 24 ? 2.683   -1.248  -9.047  1.00 0.31  ? 1126 TRP A CG   17 
ATOM   10516 C  CD1  . TRP A 1 24 ? 2.474   -0.567  -10.213 1.00 0.37  ? 1126 TRP A CD1  17 
ATOM   10517 C  CD2  . TRP A 1 24 ? 3.651   -2.259  -9.343  1.00 0.38  ? 1126 TRP A CD2  17 
ATOM   10518 N  NE1  . TRP A 1 24 ? 3.257   -1.091  -11.211 1.00 0.45  ? 1126 TRP A NE1  17 
ATOM   10519 C  CE2  . TRP A 1 24 ? 3.988   -2.131  -10.703 1.00 0.45  ? 1126 TRP A CE2  17 
ATOM   10520 C  CE3  . TRP A 1 24 ? 4.269   -3.261  -8.588  1.00 0.44  ? 1126 TRP A CE3  17 
ATOM   10521 C  CZ2  . TRP A 1 24 ? 4.911   -2.967  -11.322 1.00 0.54  ? 1126 TRP A CZ2  17 
ATOM   10522 C  CZ3  . TRP A 1 24 ? 5.185   -4.090  -9.205  1.00 0.55  ? 1126 TRP A CZ3  17 
ATOM   10523 C  CH2  . TRP A 1 24 ? 5.500   -3.937  -10.560 1.00 0.58  ? 1126 TRP A CH2  17 
ATOM   10524 H  H    . TRP A 1 24 ? 2.540   1.583   -7.533  1.00 0.23  ? 1126 TRP A H    17 
ATOM   10525 H  HA   . TRP A 1 24 ? 0.303   -0.016  -8.526  1.00 0.25  ? 1126 TRP A HA   17 
ATOM   10526 H  HB2  . TRP A 1 24 ? 2.805   -0.786  -7.001  1.00 0.27  ? 1126 TRP A HB2  17 
ATOM   10527 H  HB3  . TRP A 1 24 ? 1.527   -1.910  -7.423  1.00 0.28  ? 1126 TRP A HB3  17 
ATOM   10528 H  HD1  . TRP A 1 24 ? 1.790   0.263   -10.319 1.00 0.40  ? 1126 TRP A HD1  17 
ATOM   10529 H  HE1  . TRP A 1 24 ? 3.285   -0.774  -12.142 1.00 0.53  ? 1126 TRP A HE1  17 
ATOM   10530 H  HE3  . TRP A 1 24 ? 4.037   -3.395  -7.542  1.00 0.45  ? 1126 TRP A HE3  17 
ATOM   10531 H  HZ2  . TRP A 1 24 ? 5.166   -2.862  -12.366 1.00 0.61  ? 1126 TRP A HZ2  17 
ATOM   10532 H  HZ3  . TRP A 1 24 ? 5.671   -4.870  -8.638  1.00 0.62  ? 1126 TRP A HZ3  17 
ATOM   10533 H  HH2  . TRP A 1 24 ? 6.222   -4.608  -11.003 1.00 0.67  ? 1126 TRP A HH2  17 
ATOM   10534 N  N    . VAL A 1 25 ? 0.453   1.149   -5.596  1.00 0.19  ? 1127 VAL A N    17 
ATOM   10535 C  CA   . VAL A 1 25 ? -0.196  1.241   -4.296  1.00 0.18  ? 1127 VAL A CA   17 
ATOM   10536 C  C    . VAL A 1 25 ? -1.663  1.600   -4.446  1.00 0.19  ? 1127 VAL A C    17 
ATOM   10537 O  O    . VAL A 1 25 ? -2.000  2.588   -5.106  1.00 0.23  ? 1127 VAL A O    17 
ATOM   10538 C  CB   . VAL A 1 25 ? 0.495   2.292   -3.403  1.00 0.21  ? 1127 VAL A CB   17 
ATOM   10539 C  CG1  . VAL A 1 25 ? -0.165  2.373   -2.033  1.00 0.24  ? 1127 VAL A CG1  17 
ATOM   10540 C  CG2  . VAL A 1 25 ? 1.972   1.979   -3.267  1.00 0.24  ? 1127 VAL A CG2  17 
ATOM   10541 H  H    . VAL A 1 25 ? 1.057   1.862   -5.880  1.00 0.21  ? 1127 VAL A H    17 
ATOM   10542 H  HA   . VAL A 1 25 ? -0.124  0.278   -3.816  1.00 0.19  ? 1127 VAL A HA   17 
ATOM   10543 H  HB   . VAL A 1 25 ? 0.397   3.255   -3.880  1.00 0.23  ? 1127 VAL A HB   17 
ATOM   10544 H  HG11 . VAL A 1 25 ? -0.096  1.415   -1.542  1.00 1.01  ? 1127 VAL A HG11 17 
ATOM   10545 H  HG12 . VAL A 1 25 ? -1.205  2.644   -2.150  1.00 1.02  ? 1127 VAL A HG12 17 
ATOM   10546 H  HG13 . VAL A 1 25 ? 0.336   3.122   -1.435  1.00 1.00  ? 1127 VAL A HG13 17 
ATOM   10547 H  HG21 . VAL A 1 25 ? 2.419   1.925   -4.249  1.00 1.05  ? 1127 VAL A HG21 17 
ATOM   10548 H  HG22 . VAL A 1 25 ? 2.094   1.032   -2.763  1.00 1.06  ? 1127 VAL A HG22 17 
ATOM   10549 H  HG23 . VAL A 1 25 ? 2.454   2.757   -2.695  1.00 1.01  ? 1127 VAL A HG23 17 
ATOM   10550 N  N    . CYS A 1 26 ? -2.526  0.781   -3.843  1.00 0.19  ? 1128 CYS A N    17 
ATOM   10551 C  CA   . CYS A 1 26 ? -3.960  1.021   -3.869  1.00 0.26  ? 1128 CYS A CA   17 
ATOM   10552 C  C    . CYS A 1 26 ? -4.450  1.057   -5.317  1.00 0.27  ? 1128 CYS A C    17 
ATOM   10553 O  O    . CYS A 1 26 ? -5.049  2.028   -5.788  1.00 0.37  ? 1128 CYS A O    17 
ATOM   10554 C  CB   . CYS A 1 26 ? -4.266  2.318   -3.104  1.00 0.32  ? 1128 CYS A CB   17 
ATOM   10555 S  SG   . CYS A 1 26 ? -5.957  2.990   -3.285  1.00 0.58  ? 1128 CYS A SG   17 
ATOM   10556 H  H    . CYS A 1 26 ? -2.181  -0.008  -3.368  1.00 0.19  ? 1128 CYS A H    17 
ATOM   10557 H  HA   . CYS A 1 26 ? -4.440  0.195   -3.366  1.00 0.28  ? 1128 CYS A HA   17 
ATOM   10558 H  HB2  . CYS A 1 26 ? -4.108  2.137   -2.053  1.00 0.36  ? 1128 CYS A HB2  17 
ATOM   10559 H  HB3  . CYS A 1 26 ? -3.575  3.073   -3.428  1.00 0.36  ? 1128 CYS A HB3  17 
ATOM   10560 N  N    . ASP A 1 27 ? -4.154  -0.019  -6.029  1.00 0.25  ? 1129 ASP A N    17 
ATOM   10561 C  CA   . ASP A 1 27 ? -4.546  -0.151  -7.423  1.00 0.30  ? 1129 ASP A CA   17 
ATOM   10562 C  C    . ASP A 1 27 ? -5.393  -1.408  -7.607  1.00 0.37  ? 1129 ASP A C    17 
ATOM   10563 O  O    . ASP A 1 27 ? -5.600  -1.874  -8.726  1.00 0.41  ? 1129 ASP A O    17 
ATOM   10564 C  CB   . ASP A 1 27 ? -3.303  -0.207  -8.322  1.00 0.31  ? 1129 ASP A CB   17 
ATOM   10565 C  CG   . ASP A 1 27 ? -2.696  -1.593  -8.411  1.00 0.35  ? 1129 ASP A CG   17 
ATOM   10566 O  OD1  . ASP A 1 27 ? -2.417  -2.202  -7.355  1.00 0.31  ? 1129 ASP A OD1  17 
ATOM   10567 O  OD2  . ASP A 1 27 ? -2.491  -2.076  -9.543  1.00 0.46  ? 1129 ASP A OD2  17 
ATOM   10568 H  H    . ASP A 1 27 ? -3.646  -0.749  -5.600  1.00 0.24  ? 1129 ASP A H    17 
ATOM   10569 H  HA   . ASP A 1 27 ? -5.138  0.713   -7.689  1.00 0.33  ? 1129 ASP A HA   17 
ATOM   10570 H  HB2  . ASP A 1 27 ? -3.570  0.111   -9.317  1.00 0.36  ? 1129 ASP A HB2  17 
ATOM   10571 H  HB3  . ASP A 1 27 ? -2.555  0.467   -7.926  1.00 0.29  ? 1129 ASP A HB3  17 
ATOM   10572 N  N    . THR A 1 28 ? -5.870  -1.942  -6.482  1.00 0.45  ? 1130 THR A N    17 
ATOM   10573 C  CA   . THR A 1 28 ? -6.685  -3.162  -6.428  1.00 0.56  ? 1130 THR A CA   17 
ATOM   10574 C  C    . THR A 1 28 ? -5.952  -4.364  -7.027  1.00 0.61  ? 1130 THR A C    17 
ATOM   10575 O  O    . THR A 1 28 ? -6.568  -5.279  -7.578  1.00 0.73  ? 1130 THR A O    17 
ATOM   10576 C  CB   . THR A 1 28 ? -8.088  -2.995  -7.081  1.00 0.59  ? 1130 THR A CB   17 
ATOM   10577 O  OG1  . THR A 1 28 ? -7.993  -2.632  -8.466  1.00 0.56  ? 1130 THR A OG1  17 
ATOM   10578 C  CG2  . THR A 1 28 ? -8.902  -1.944  -6.340  1.00 0.65  ? 1130 THR A CG2  17 
ATOM   10579 H  H    . THR A 1 28 ? -5.649  -1.499  -5.629  1.00 0.46  ? 1130 THR A H    17 
ATOM   10580 H  HA   . THR A 1 28 ? -6.846  -3.374  -5.378  1.00 0.64  ? 1130 THR A HA   17 
ATOM   10581 H  HB   . THR A 1 28 ? -8.609  -3.937  -7.006  1.00 0.67  ? 1130 THR A HB   17 
ATOM   10582 H  HG1  . THR A 1 28 ? -7.066  -2.683  -8.746  1.00 0.53  ? 1130 THR A HG1  17 
ATOM   10583 H  HG21 . THR A 1 28 ? -8.365  -1.007  -6.341  1.00 1.34  ? 1130 THR A HG21 17 
ATOM   10584 H  HG22 . THR A 1 28 ? -9.066  -2.265  -5.322  1.00 1.09  ? 1130 THR A HG22 17 
ATOM   10585 H  HG23 . THR A 1 28 ? -9.854  -1.813  -6.834  1.00 1.21  ? 1130 THR A HG23 17 
ATOM   10586 N  N    . ASP A 1 29 ? -4.629  -4.352  -6.911  1.00 0.59  ? 1131 ASP A N    17 
ATOM   10587 C  CA   . ASP A 1 29 ? -3.804  -5.480  -7.320  1.00 0.69  ? 1131 ASP A CA   17 
ATOM   10588 C  C    . ASP A 1 29 ? -2.859  -5.858  -6.189  1.00 0.67  ? 1131 ASP A C    17 
ATOM   10589 O  O    . ASP A 1 29 ? -2.257  -4.986  -5.557  1.00 0.53  ? 1131 ASP A O    17 
ATOM   10590 C  CB   . ASP A 1 29 ? -3.002  -5.142  -8.576  1.00 0.75  ? 1131 ASP A CB   17 
ATOM   10591 C  CG   . ASP A 1 29 ? -2.216  -6.327  -9.101  1.00 0.92  ? 1131 ASP A CG   17 
ATOM   10592 O  OD1  . ASP A 1 29 ? -2.835  -7.294  -9.590  1.00 1.21  ? 1131 ASP A OD1  17 
ATOM   10593 O  OD2  . ASP A 1 29 ? -0.969  -6.303  -9.024  1.00 0.92  ? 1131 ASP A OD2  17 
ATOM   10594 H  H    . ASP A 1 29 ? -4.190  -3.552  -6.546  1.00 0.55  ? 1131 ASP A H    17 
ATOM   10595 H  HA   . ASP A 1 29 ? -4.457  -6.314  -7.527  1.00 0.81  ? 1131 ASP A HA   17 
ATOM   10596 H  HB2  . ASP A 1 29 ? -3.680  -4.810  -9.345  1.00 0.81  ? 1131 ASP A HB2  17 
ATOM   10597 H  HB3  . ASP A 1 29 ? -2.309  -4.346  -8.347  1.00 0.68  ? 1131 ASP A HB3  17 
ATOM   10598 N  N    . ASN A 1 30 ? -2.736  -7.148  -5.926  1.00 0.94  ? 1132 ASN A N    17 
ATOM   10599 C  CA   . ASN A 1 30 ? -1.928  -7.623  -4.810  1.00 1.00  ? 1132 ASN A CA   17 
ATOM   10600 C  C    . ASN A 1 30 ? -0.460  -7.740  -5.216  1.00 0.91  ? 1132 ASN A C    17 
ATOM   10601 O  O    . ASN A 1 30 ? 0.024   -8.817  -5.559  1.00 1.06  ? 1132 ASN A O    17 
ATOM   10602 C  CB   . ASN A 1 30 ? -2.460  -8.965  -4.305  1.00 1.29  ? 1132 ASN A CB   17 
ATOM   10603 C  CG   . ASN A 1 30 ? -1.794  -9.410  -3.019  1.00 1.72  ? 1132 ASN A CG   17 
ATOM   10604 O  OD1  . ASN A 1 30 ? -2.234  -9.063  -1.923  1.00 2.58  ? 1132 ASN A OD1  17 
ATOM   10605 N  ND2  . ASN A 1 30 ? -0.731  -10.184 -3.142  1.00 2.07  ? 1132 ASN A ND2  17 
ATOM   10606 H  H    . ASN A 1 30 ? -3.190  -7.800  -6.502  1.00 1.15  ? 1132 ASN A H    17 
ATOM   10607 H  HA   . ASN A 1 30 ? -2.007  -6.895  -4.017  1.00 0.97  ? 1132 ASN A HA   17 
ATOM   10608 H  HB2  . ASN A 1 30 ? -3.523  -8.880  -4.126  1.00 1.52  ? 1132 ASN A HB2  17 
ATOM   10609 H  HB3  . ASN A 1 30 ? -2.287  -9.720  -5.058  1.00 1.97  ? 1132 ASN A HB3  17 
ATOM   10610 H  HD21 . ASN A 1 30 ? -0.434  -10.424 -4.052  1.00 2.11  ? 1132 ASN A HD21 17 
ATOM   10611 H  HD22 . ASN A 1 30 ? -0.288  -10.497 -2.323  1.00 2.73  ? 1132 ASN A HD22 17 
ATOM   10612 N  N    . ASP A 1 31 ? 0.240   -6.617  -5.171  1.00 0.86  ? 1133 ASP A N    17 
ATOM   10613 C  CA   . ASP A 1 31 ? 1.646   -6.556  -5.560  1.00 0.77  ? 1133 ASP A CA   17 
ATOM   10614 C  C    . ASP A 1 31 ? 2.555   -6.628  -4.340  1.00 0.78  ? 1133 ASP A C    17 
ATOM   10615 O  O    . ASP A 1 31 ? 3.664   -7.158  -4.421  1.00 1.28  ? 1133 ASP A O    17 
ATOM   10616 C  CB   . ASP A 1 31 ? 1.930   -5.274  -6.359  1.00 0.67  ? 1133 ASP A CB   17 
ATOM   10617 C  CG   . ASP A 1 31 ? 0.911   -4.195  -6.089  1.00 0.58  ? 1133 ASP A CG   17 
ATOM   10618 O  OD1  . ASP A 1 31 ? 0.703   -3.829  -4.919  1.00 1.00  ? 1133 ASP A OD1  17 
ATOM   10619 O  OD2  . ASP A 1 31 ? 0.339   -3.658  -7.045  1.00 1.09  ? 1133 ASP A OD2  17 
ATOM   10620 H  H    . ASP A 1 31 ? -0.204  -5.794  -4.868  1.00 1.05  ? 1133 ASP A H    17 
ATOM   10621 H  HA   . ASP A 1 31 ? 1.847   -7.409  -6.190  1.00 0.87  ? 1133 ASP A HA   17 
ATOM   10622 H  HB2  . ASP A 1 31 ? 2.905   -4.889  -6.088  1.00 1.04  ? 1133 ASP A HB2  17 
ATOM   10623 H  HB3  . ASP A 1 31 ? 1.917   -5.504  -7.413  1.00 1.05  ? 1133 ASP A HB3  17 
ATOM   10624 N  N    . CYS A 1 32 ? 2.082   -6.113  -3.211  1.00 0.76  ? 1134 CYS A N    17 
ATOM   10625 C  CA   . CYS A 1 32 ? 2.851   -6.150  -1.966  1.00 0.78  ? 1134 CYS A CA   17 
ATOM   10626 C  C    . CYS A 1 32 ? 2.811   -7.520  -1.292  1.00 0.85  ? 1134 CYS A C    17 
ATOM   10627 O  O    . CYS A 1 32 ? 3.190   -7.645  -0.130  1.00 1.57  ? 1134 CYS A O    17 
ATOM   10628 C  CB   . CYS A 1 32 ? 2.345   -5.094  -0.980  1.00 0.82  ? 1134 CYS A CB   17 
ATOM   10629 S  SG   . CYS A 1 32 ? 3.028   -3.429  -1.243  1.00 1.16  ? 1134 CYS A SG   17 
ATOM   10630 H  H    . CYS A 1 32 ? 1.205   -5.668  -3.218  1.00 1.11  ? 1134 CYS A H    17 
ATOM   10631 H  HA   . CYS A 1 32 ? 3.877   -5.923  -2.213  1.00 0.88  ? 1134 CYS A HA   17 
ATOM   10632 H  HB2  . CYS A 1 32 ? 1.272   -5.021  -1.064  1.00 1.25  ? 1134 CYS A HB2  17 
ATOM   10633 H  HB3  . CYS A 1 32 ? 2.599   -5.399  0.024   1.00 1.22  ? 1134 CYS A HB3  17 
ATOM   10634 N  N    . GLY A 1 33 ? 2.345   -8.540  -2.005  1.00 1.17  ? 1135 GLY A N    17 
ATOM   10635 C  CA   . GLY A 1 33 ? 2.314   -9.885  -1.453  1.00 1.22  ? 1135 GLY A CA   17 
ATOM   10636 C  C    . GLY A 1 33 ? 1.171   -10.089 -0.477  1.00 1.18  ? 1135 GLY A C    17 
ATOM   10637 O  O    . GLY A 1 33 ? 0.252   -10.864 -0.738  1.00 1.68  ? 1135 GLY A O    17 
ATOM   10638 H  H    . GLY A 1 33 ? 2.024   -8.381  -2.917  1.00 1.82  ? 1135 GLY A H    17 
ATOM   10639 H  HA2  . GLY A 1 33 ? 2.215   -10.593 -2.262  1.00 1.26  ? 1135 GLY A HA2  17 
ATOM   10640 H  HA3  . GLY A 1 33 ? 3.247   -10.071 -0.939  1.00 1.39  ? 1135 GLY A HA3  17 
ATOM   10641 N  N    . ASP A 1 34 ? 1.230   -9.399  0.649   1.00 1.02  ? 1136 ASP A N    17 
ATOM   10642 C  CA   . ASP A 1 34 ? 0.160   -9.445  1.637   1.00 1.11  ? 1136 ASP A CA   17 
ATOM   10643 C  C    . ASP A 1 34 ? -0.930  -8.439  1.289   1.00 0.93  ? 1136 ASP A C    17 
ATOM   10644 O  O    . ASP A 1 34 ? -2.080  -8.578  1.697   1.00 1.35  ? 1136 ASP A O    17 
ATOM   10645 C  CB   . ASP A 1 34 ? 0.716   -9.173  3.034   1.00 1.44  ? 1136 ASP A CB   17 
ATOM   10646 C  CG   . ASP A 1 34 ? -0.365  -9.021  4.086   1.00 2.10  ? 1136 ASP A CG   17 
ATOM   10647 O  OD1  . ASP A 1 34 ? -1.205  -9.935  4.225   1.00 2.85  ? 1136 ASP A OD1  17 
ATOM   10648 O  OD2  . ASP A 1 34 ? -0.376  -7.981  4.783   1.00 2.47  ? 1136 ASP A OD2  17 
ATOM   10649 H  H    . ASP A 1 34 ? 2.028   -8.852  0.831   1.00 1.22  ? 1136 ASP A H    17 
ATOM   10650 H  HA   . ASP A 1 34 ? -0.262  -10.435 1.619   1.00 1.27  ? 1136 ASP A HA   17 
ATOM   10651 H  HB2  . ASP A 1 34 ? 1.357   -9.992  3.324   1.00 1.68  ? 1136 ASP A HB2  17 
ATOM   10652 H  HB3  . ASP A 1 34 ? 1.295   -8.265  3.006   1.00 1.84  ? 1136 ASP A HB3  17 
ATOM   10653 N  N    . GLY A 1 35 ? -0.563  -7.440  0.502   1.00 0.62  ? 1137 GLY A N    17 
ATOM   10654 C  CA   . GLY A 1 35 ? -1.511  -6.412  0.121   1.00 0.49  ? 1137 GLY A CA   17 
ATOM   10655 C  C    . GLY A 1 35 ? -1.433  -5.215  1.040   1.00 0.36  ? 1137 GLY A C    17 
ATOM   10656 O  O    . GLY A 1 35 ? -2.408  -4.490  1.219   1.00 0.36  ? 1137 GLY A O    17 
ATOM   10657 H  H    . GLY A 1 35 ? 0.356   -7.405  0.176   1.00 0.82  ? 1137 GLY A H    17 
ATOM   10658 H  HA2  . GLY A 1 35 ? -1.299  -6.095  -0.889  1.00 0.51  ? 1137 GLY A HA2  17 
ATOM   10659 H  HA3  . GLY A 1 35 ? -2.510  -6.821  0.160   1.00 0.72  ? 1137 GLY A HA3  17 
ATOM   10660 N  N    . SER A 1 36 ? -0.253  -5.002  1.607   1.00 0.32  ? 1138 SER A N    17 
ATOM   10661 C  CA   . SER A 1 36 ? -0.019  -3.904  2.534   1.00 0.28  ? 1138 SER A CA   17 
ATOM   10662 C  C    . SER A 1 36 ? -0.009  -2.549  1.821   1.00 0.25  ? 1138 SER A C    17 
ATOM   10663 O  O    . SER A 1 36 ? 0.164   -1.508  2.453   1.00 0.40  ? 1138 SER A O    17 
ATOM   10664 C  CB   . SER A 1 36 ? 1.301   -4.149  3.260   1.00 0.33  ? 1138 SER A CB   17 
ATOM   10665 O  OG   . SER A 1 36 ? 2.236   -4.794  2.404   1.00 0.44  ? 1138 SER A OG   17 
ATOM   10666 H  H    . SER A 1 36 ? 0.489   -5.605  1.401   1.00 0.37  ? 1138 SER A H    17 
ATOM   10667 H  HA   . SER A 1 36 ? -0.820  -3.904  3.262   1.00 0.33  ? 1138 SER A HA   17 
ATOM   10668 H  HB2  . SER A 1 36 ? 1.715   -3.206  3.583   1.00 0.40  ? 1138 SER A HB2  17 
ATOM   10669 H  HB3  . SER A 1 36 ? 1.125   -4.779  4.119   1.00 0.39  ? 1138 SER A HB3  17 
ATOM   10670 H  HG   . SER A 1 36 ? 2.412   -5.695  2.735   1.00 1.17  ? 1138 SER A HG   17 
ATOM   10671 N  N    . ASP A 1 37 ? -0.193  -2.579  0.507   1.00 0.18  ? 1139 ASP A N    17 
ATOM   10672 C  CA   . ASP A 1 37 ? -0.324  -1.365  -0.291  1.00 0.18  ? 1139 ASP A CA   17 
ATOM   10673 C  C    . ASP A 1 37 ? -1.799  -1.073  -0.543  1.00 0.20  ? 1139 ASP A C    17 
ATOM   10674 O  O    . ASP A 1 37 ? -2.186  0.052   -0.861  1.00 0.29  ? 1139 ASP A O    17 
ATOM   10675 C  CB   . ASP A 1 37 ? 0.384   -1.536  -1.629  1.00 0.19  ? 1139 ASP A CB   17 
ATOM   10676 C  CG   . ASP A 1 37 ? -0.407  -2.409  -2.576  1.00 0.26  ? 1139 ASP A CG   17 
ATOM   10677 O  OD1  . ASP A 1 37 ? -0.495  -3.636  -2.338  1.00 0.33  ? 1139 ASP A OD1  17 
ATOM   10678 O  OD2  . ASP A 1 37 ? -0.966  -1.866  -3.552  1.00 0.32  ? 1139 ASP A OD2  17 
ATOM   10679 H  H    . ASP A 1 37 ? -0.235  -3.445  0.053   1.00 0.26  ? 1139 ASP A H    17 
ATOM   10680 H  HA   . ASP A 1 37 ? 0.127   -0.546  0.248   1.00 0.20  ? 1139 ASP A HA   17 
ATOM   10681 H  HB2  . ASP A 1 37 ? 0.521   -0.568  -2.086  1.00 0.22  ? 1139 ASP A HB2  17 
ATOM   10682 H  HB3  . ASP A 1 37 ? 1.349   -1.994  -1.465  1.00 0.19  ? 1139 ASP A HB3  17 
ATOM   10683 N  N    . GLU A 1 38 ? -2.618  -2.110  -0.415  1.00 0.22  ? 1140 GLU A N    17 
ATOM   10684 C  CA   . GLU A 1 38 ? -4.048  -1.998  -0.656  1.00 0.27  ? 1140 GLU A CA   17 
ATOM   10685 C  C    . GLU A 1 38 ? -4.793  -1.818  0.663   1.00 0.31  ? 1140 GLU A C    17 
ATOM   10686 O  O    . GLU A 1 38 ? -5.902  -1.288  0.697   1.00 0.44  ? 1140 GLU A O    17 
ATOM   10687 C  CB   . GLU A 1 38 ? -4.570  -3.254  -1.363  1.00 0.29  ? 1140 GLU A CB   17 
ATOM   10688 C  CG   . GLU A 1 38 ? -3.891  -3.564  -2.691  1.00 0.29  ? 1140 GLU A CG   17 
ATOM   10689 C  CD   . GLU A 1 38 ? -4.212  -2.559  -3.779  1.00 0.28  ? 1140 GLU A CD   17 
ATOM   10690 O  OE1  . GLU A 1 38 ? -5.275  -1.908  -3.708  1.00 0.38  ? 1140 GLU A OE1  17 
ATOM   10691 O  OE2  . GLU A 1 38 ? -3.407  -2.425  -4.727  1.00 0.28  ? 1140 GLU A OE2  17 
ATOM   10692 H  H    . GLU A 1 38 ? -2.247  -2.978  -0.155  1.00 0.24  ? 1140 GLU A H    17 
ATOM   10693 H  HA   . GLU A 1 38 ? -4.218  -1.130  -1.286  1.00 0.30  ? 1140 GLU A HA   17 
ATOM   10694 H  HB2  . GLU A 1 38 ? -4.428  -4.101  -0.708  1.00 0.32  ? 1140 GLU A HB2  17 
ATOM   10695 H  HB3  . GLU A 1 38 ? -5.627  -3.131  -1.546  1.00 0.33  ? 1140 GLU A HB3  17 
ATOM   10696 H  HG2  . GLU A 1 38 ? -2.822  -3.570  -2.537  1.00 0.29  ? 1140 GLU A HG2  17 
ATOM   10697 H  HG3  . GLU A 1 38 ? -4.209  -4.542  -3.020  1.00 0.33  ? 1140 GLU A HG3  17 
ATOM   10698 N  N    . LYS A 1 39 ? -4.169  -2.262  1.753   1.00 0.30  ? 1141 LYS A N    17 
ATOM   10699 C  CA   . LYS A 1 39 ? -4.776  -2.186  3.083   1.00 0.37  ? 1141 LYS A CA   17 
ATOM   10700 C  C    . LYS A 1 39 ? -5.009  -0.733  3.487   1.00 0.49  ? 1141 LYS A C    17 
ATOM   10701 O  O    . LYS A 1 39 ? -5.836  -0.429  4.349   1.00 0.57  ? 1141 LYS A O    17 
ATOM   10702 C  CB   . LYS A 1 39 ? -3.881  -2.873  4.117   1.00 0.47  ? 1141 LYS A CB   17 
ATOM   10703 C  CG   . LYS A 1 39 ? -2.619  -2.096  4.461   1.00 0.57  ? 1141 LYS A CG   17 
ATOM   10704 C  CD   . LYS A 1 39 ? -1.812  -2.805  5.534   1.00 0.76  ? 1141 LYS A CD   17 
ATOM   10705 C  CE   . LYS A 1 39 ? -0.530  -2.061  5.859   1.00 0.91  ? 1141 LYS A CE   17 
ATOM   10706 N  NZ   . LYS A 1 39 ? 0.096   -2.563  7.109   1.00 1.55  ? 1141 LYS A NZ   17 
ATOM   10707 H  H    . LYS A 1 39 ? -3.280  -2.665  1.658   1.00 0.32  ? 1141 LYS A H    17 
ATOM   10708 H  HA   . LYS A 1 39 ? -5.728  -2.694  3.043   1.00 0.39  ? 1141 LYS A HA   17 
ATOM   10709 H  HB2  . LYS A 1 39 ? -4.445  -3.016  5.025   1.00 0.56  ? 1141 LYS A HB2  17 
ATOM   10710 H  HB3  . LYS A 1 39 ? -3.588  -3.840  3.734   1.00 0.47  ? 1141 LYS A HB3  17 
ATOM   10711 H  HG2  . LYS A 1 39 ? -2.015  -1.986  3.573   1.00 0.50  ? 1141 LYS A HG2  17 
ATOM   10712 H  HG3  . LYS A 1 39 ? -2.903  -1.118  4.825   1.00 0.65  ? 1141 LYS A HG3  17 
ATOM   10713 H  HD2  . LYS A 1 39 ? -2.409  -2.877  6.430   1.00 0.88  ? 1141 LYS A HD2  17 
ATOM   10714 H  HD3  . LYS A 1 39 ? -1.563  -3.796  5.185   1.00 0.73  ? 1141 LYS A HD3  17 
ATOM   10715 H  HE2  . LYS A 1 39 ? 0.164   -2.192  5.041   1.00 1.15  ? 1141 LYS A HE2  17 
ATOM   10716 H  HE3  . LYS A 1 39 ? -0.756  -1.013  5.972   1.00 1.18  ? 1141 LYS A HE3  17 
ATOM   10717 H  HZ1  . LYS A 1 39 ? 0.350   -3.567  7.008   1.00 2.08  ? 1141 LYS A HZ1  17 
ATOM   10718 H  HZ2  . LYS A 1 39 ? -0.566  -2.466  7.904   1.00 1.99  ? 1141 LYS A HZ2  17 
ATOM   10719 H  HZ3  . LYS A 1 39 ? 0.956   -2.018  7.326   1.00 1.97  ? 1141 LYS A HZ3  17 
ATOM   10720 N  N    . ASN A 1 40 ? -4.254  0.151   2.863   1.00 0.60  ? 1142 ASN A N    17 
ATOM   10721 C  CA   . ASN A 1 40 ? -4.359  1.578   3.105   1.00 0.81  ? 1142 ASN A CA   17 
ATOM   10722 C  C    . ASN A 1 40 ? -4.802  2.287   1.829   1.00 0.91  ? 1142 ASN A C    17 
ATOM   10723 O  O    . ASN A 1 40 ? -4.377  3.401   1.532   1.00 1.44  ? 1142 ASN A O    17 
ATOM   10724 C  CB   . ASN A 1 40 ? -3.017  2.131   3.614   1.00 1.07  ? 1142 ASN A CB   17 
ATOM   10725 C  CG   . ASN A 1 40 ? -1.846  1.838   2.687   1.00 1.37  ? 1142 ASN A CG   17 
ATOM   10726 O  OD1  . ASN A 1 40 ? -1.835  0.840   1.972   1.00 2.05  ? 1142 ASN A OD1  17 
ATOM   10727 N  ND2  . ASN A 1 40 ? -0.843  2.697   2.712   1.00 1.92  ? 1142 ASN A ND2  17 
ATOM   10728 H  H    . ASN A 1 40 ? -3.590  -0.167  2.211   1.00 0.58  ? 1142 ASN A H    17 
ATOM   10729 H  HA   . ASN A 1 40 ? -5.113  1.729   3.863   1.00 0.86  ? 1142 ASN A HA   17 
ATOM   10730 H  HB2  . ASN A 1 40 ? -3.098  3.197   3.726   1.00 1.54  ? 1142 ASN A HB2  17 
ATOM   10731 H  HB3  . ASN A 1 40 ? -2.803  1.693   4.579   1.00 1.56  ? 1142 ASN A HB3  17 
ATOM   10732 H  HD21 . ASN A 1 40 ? -0.906  3.468   3.318   1.00 2.20  ? 1142 ASN A HD21 17 
ATOM   10733 H  HD22 . ASN A 1 40 ? -0.075  2.526   2.128   1.00 2.44  ? 1142 ASN A HD22 17 
ATOM   10734 N  N    . CYS A 1 41 ? -5.666  1.616   1.078   1.00 0.76  ? 1143 CYS A N    17 
ATOM   10735 C  CA   . CYS A 1 41 ? -6.182  2.147   -0.180  1.00 0.99  ? 1143 CYS A CA   17 
ATOM   10736 C  C    . CYS A 1 41 ? -7.351  3.096   0.075   1.00 1.29  ? 1143 CYS A C    17 
ATOM   10737 O  O    . CYS A 1 41 ? -7.596  4.025   -0.696  1.00 1.67  ? 1143 CYS A O    17 
ATOM   10738 C  CB   . CYS A 1 41 ? -6.616  0.988   -1.086  1.00 0.93  ? 1143 CYS A CB   17 
ATOM   10739 S  SG   . CYS A 1 41 ? -7.184  1.467   -2.752  1.00 1.10  ? 1143 CYS A SG   17 
ATOM   10740 H  H    . CYS A 1 41 ? -5.956  0.722   1.370   1.00 0.89  ? 1143 CYS A H    17 
ATOM   10741 H  HA   . CYS A 1 41 ? -5.389  2.695   -0.661  1.00 1.23  ? 1143 CYS A HA   17 
ATOM   10742 H  HB2  . CYS A 1 41 ? -5.783  0.315   -1.211  1.00 0.98  ? 1143 CYS A HB2  17 
ATOM   10743 H  HB3  . CYS A 1 41 ? -7.426  0.456   -0.605  1.00 1.29  ? 1143 CYS A HB3  17 
ATOM   10744 N  N    . ASN A 1 42 ? -8.063  2.868   1.169   1.00 1.87  ? 1144 ASN A N    17 
ATOM   10745 C  CA   . ASN A 1 42 ? -9.203  3.702   1.527   1.00 2.36  ? 1144 ASN A CA   17 
ATOM   10746 C  C    . ASN A 1 42 ? -8.810  4.723   2.587   1.00 3.05  ? 1144 ASN A C    17 
ATOM   10747 O  O    . ASN A 1 42 ? -9.600  5.592   2.955   1.00 3.73  ? 1144 ASN A O    17 
ATOM   10748 C  CB   . ASN A 1 42 ? -10.366 2.841   2.036   1.00 3.11  ? 1144 ASN A CB   17 
ATOM   10749 C  CG   . ASN A 1 42 ? -10.022 2.060   3.293   1.00 3.87  ? 1144 ASN A CG   17 
ATOM   10750 O  OD1  . ASN A 1 42 ? -8.875  1.655   3.505   1.00 4.27  ? 1144 ASN A OD1  17 
ATOM   10751 N  ND2  . ASN A 1 42 ? -11.015 1.841   4.140   1.00 4.59  ? 1144 ASN A ND2  17 
ATOM   10752 H  H    . ASN A 1 42 ? -7.820  2.118   1.753   1.00 2.27  ? 1144 ASN A H    17 
ATOM   10753 H  HA   . ASN A 1 42 ? -9.519  4.228   0.638   1.00 2.42  ? 1144 ASN A HA   17 
ATOM   10754 H  HB2  . ASN A 1 42 ? -11.207 3.480   2.255   1.00 3.41  ? 1144 ASN A HB2  17 
ATOM   10755 H  HB3  . ASN A 1 42 ? -10.646 2.139   1.264   1.00 3.38  ? 1144 ASN A HB3  17 
ATOM   10756 H  HD21 . ASN A 1 42 ? -11.903 2.190   3.911   1.00 4.61  ? 1144 ASN A HD21 17 
ATOM   10757 H  HD22 . ASN A 1 42 ? -10.826 1.341   4.962   1.00 5.30  ? 1144 ASN A HD22 17 
ATOM   10758 N  N    . SER A 1 43 ? -7.587  4.610   3.076   1.00 3.53  ? 1145 SER A N    17 
ATOM   10759 C  CA   . SER A 1 43 ? -7.079  5.512   4.091   1.00 4.69  ? 1145 SER A CA   17 
ATOM   10760 C  C    . SER A 1 43 ? -5.930  6.349   3.537   1.00 5.23  ? 1145 SER A C    17 
ATOM   10761 O  O    . SER A 1 43 ? -5.250  5.942   2.594   1.00 5.32  ? 1145 SER A O    17 
ATOM   10762 C  CB   . SER A 1 43 ? -6.630  4.708   5.312   1.00 5.40  ? 1145 SER A CB   17 
ATOM   10763 O  OG   . SER A 1 43 ? -6.014  3.492   4.919   1.00 5.26  ? 1145 SER A OG   17 
ATOM   10764 H  H    . SER A 1 43 ? -7.005  3.898   2.743   1.00 3.45  ? 1145 SER A H    17 
ATOM   10765 H  HA   . SER A 1 43 ? -7.882  6.173   4.380   1.00 5.07  ? 1145 SER A HA   17 
ATOM   10766 H  HB2  . SER A 1 43 ? -5.920  5.288   5.881   1.00 6.23  ? 1145 SER A HB2  17 
ATOM   10767 H  HB3  . SER A 1 43 ? -7.487  4.482   5.927   1.00 5.56  ? 1145 SER A HB3  17 
ATOM   10768 H  HG   . SER A 1 43 ? -6.190  2.817   5.584   1.00 5.21  ? 1145 SER A HG   17 
ATOM   10769 N  N    . THR A 1 44 ? -5.738  7.528   4.107   1.00 5.97  ? 1146 THR A N    17 
ATOM   10770 C  CA   . THR A 1 44 ? -4.683  8.426   3.675   1.00 6.81  ? 1146 THR A CA   17 
ATOM   10771 C  C    . THR A 1 44 ? -3.335  7.989   4.230   1.00 7.34  ? 1146 THR A C    17 
ATOM   10772 O  O    . THR A 1 44 ? -3.096  8.051   5.436   1.00 8.15  ? 1146 THR A O    17 
ATOM   10773 C  CB   . THR A 1 44 ? -4.978  9.874   4.111   1.00 7.69  ? 1146 THR A CB   17 
ATOM   10774 O  OG1  . THR A 1 44 ? -5.363  9.897   5.493   1.00 7.92  ? 1146 THR A OG1  17 
ATOM   10775 C  CG2  . THR A 1 44 ? -6.082  10.483  3.261   1.00 7.74  ? 1146 THR A CG2  17 
ATOM   10776 H  H    . THR A 1 44 ? -6.325  7.806   4.841   1.00 6.16  ? 1146 THR A H    17 
ATOM   10777 H  HA   . THR A 1 44 ? -4.642  8.399   2.596   1.00 6.75  ? 1146 THR A HA   17 
ATOM   10778 H  HB   . THR A 1 44 ? -4.081  10.462  3.986   1.00 8.40  ? 1146 THR A HB   17 
ATOM   10779 H  HG1  . THR A 1 44 ? -4.783  9.308   5.994   1.00 8.03  ? 1146 THR A HG1  17 
ATOM   10780 H  HG21 . THR A 1 44 ? -6.273  11.493  3.592   1.00 7.71  ? 1146 THR A HG21 17 
ATOM   10781 H  HG22 . THR A 1 44 ? -6.980  9.894   3.364   1.00 7.80  ? 1146 THR A HG22 17 
ATOM   10782 H  HG23 . THR A 1 44 ? -5.775  10.494  2.226   1.00 8.03  ? 1146 THR A HG23 17 
ATOM   10783 N  N    . GLU A 1 45 ? -2.464  7.536   3.343   1.00 7.13  ? 1147 GLU A N    17 
ATOM   10784 C  CA   . GLU A 1 45 ? -1.123  7.115   3.719   1.00 7.94  ? 1147 GLU A CA   17 
ATOM   10785 C  C    . GLU A 1 45 ? -0.214  8.332   3.816   1.00 8.95  ? 1147 GLU A C    17 
ATOM   10786 O  O    . GLU A 1 45 ? 0.784   8.328   4.541   1.00 9.87  ? 1147 GLU A O    17 
ATOM   10787 C  CB   . GLU A 1 45 ? -0.555  6.117   2.698   1.00 7.79  ? 1147 GLU A CB   17 
ATOM   10788 C  CG   . GLU A 1 45 ? -0.253  6.712   1.325   1.00 7.90  ? 1147 GLU A CG   17 
ATOM   10789 C  CD   . GLU A 1 45 ? -1.496  7.111   0.553   1.00 8.00  ? 1147 GLU A CD   17 
ATOM   10790 O  OE1  . GLU A 1 45 ? -2.040  8.205   0.808   1.00 8.23  ? 1147 GLU A OE1  17 
ATOM   10791 O  OE2  . GLU A 1 45 ? -1.931  6.333   -0.313  1.00 8.08  ? 1147 GLU A OE2  17 
ATOM   10792 H  H    . GLU A 1 45 ? -2.726  7.494   2.394   1.00 6.60  ? 1147 GLU A H    17 
ATOM   10793 H  HA   . GLU A 1 45 ? -1.180  6.642   4.686   1.00 8.20  ? 1147 GLU A HA   17 
ATOM   10794 H  HB2  . GLU A 1 45 ? 0.362   5.705   3.092   1.00 8.33  ? 1147 GLU A HB2  17 
ATOM   10795 H  HB3  . GLU A 1 45 ? -1.267  5.314   2.567   1.00 7.37  ? 1147 GLU A HB3  17 
ATOM   10796 H  HG2  . GLU A 1 45 ? 0.359   7.591   1.459   1.00 7.80  ? 1147 GLU A HG2  17 
ATOM   10797 H  HG3  . GLU A 1 45 ? 0.293   5.982   0.745   1.00 8.35  ? 1147 GLU A HG3  17 
ATOM   10798 N  N    . THR A 1 46 ? -0.591  9.373   3.089   1.00 8.94  ? 1148 THR A N    17 
ATOM   10799 C  CA   . THR A 1 46 ? 0.162   10.613  3.045   1.00 10.03 ? 1148 THR A CA   17 
ATOM   10800 C  C    . THR A 1 46 ? -0.049  11.443  4.312   1.00 10.71 ? 1148 THR A C    17 
ATOM   10801 O  O    . THR A 1 46 ? -0.487  12.593  4.257   1.00 11.12 ? 1148 THR A O    17 
ATOM   10802 C  CB   . THR A 1 46 ? -0.241  11.427  1.802   1.00 10.21 ? 1148 THR A CB   17 
ATOM   10803 O  OG1  . THR A 1 46 ? -1.671  11.437  1.667   1.00 9.58  ? 1148 THR A OG1  17 
ATOM   10804 C  CG2  . THR A 1 46 ? 0.386   10.841  0.549   1.00 11.01 ? 1148 THR A CG2  17 
ATOM   10805 H  H    . THR A 1 46 ? -1.408  9.299   2.545   1.00 8.30  ? 1148 THR A H    17 
ATOM   10806 H  HA   . THR A 1 46 ? 1.208   10.362  2.962   1.00 10.45 ? 1148 THR A HA   17 
ATOM   10807 H  HB   . THR A 1 46 ? 0.111   12.438  1.923   1.00 10.48 ? 1148 THR A HB   17 
ATOM   10808 H  HG1  . THR A 1 46 ? -1.906  11.266  0.744   1.00 9.43  ? 1148 THR A HG1  17 
ATOM   10809 H  HG21 . THR A 1 46 ? 0.109   11.439  -0.305  1.00 11.19 ? 1148 THR A HG21 17 
ATOM   10810 H  HG22 . THR A 1 46 ? 0.031   9.830   0.408   1.00 11.07 ? 1148 THR A HG22 17 
ATOM   10811 H  HG23 . THR A 1 46 ? 1.461   10.834  0.651   1.00 11.53 ? 1148 THR A HG23 17 
HETATM 10812 CA CA   . CA  B 2 .  ? -1.304  -2.826  -5.502  1.00 0.28  ? 1201 CA  A CA   17 
ATOM   10813 N  N    . THR A 1 1  ? 16.754  10.771  13.941  1.00 12.23 ? 1103 THR A N    18 
ATOM   10814 C  CA   . THR A 1 1  ? 16.336  9.597   14.737  1.00 11.73 ? 1103 THR A CA   18 
ATOM   10815 C  C    . THR A 1 1  ? 16.384  8.323   13.886  1.00 10.83 ? 1103 THR A C    18 
ATOM   10816 O  O    . THR A 1 1  ? 15.491  7.473   13.961  1.00 10.67 ? 1103 THR A O    18 
ATOM   10817 C  CB   . THR A 1 1  ? 14.913  9.808   15.322  1.00 11.83 ? 1103 THR A CB   18 
ATOM   10818 O  OG1  . THR A 1 1  ? 14.529  8.692   16.138  1.00 12.26 ? 1103 THR A OG1  18 
ATOM   10819 C  CG2  . THR A 1 1  ? 13.880  10.014  14.220  1.00 12.04 ? 1103 THR A CG2  18 
ATOM   10820 H  H1   . THR A 1 1  ? 16.127  10.887  13.118  1.00 12.23 ? 1103 THR A H1   18 
ATOM   10821 H  H2   . THR A 1 1  ? 17.729  10.649  13.603  1.00 12.55 ? 1103 THR A H2   18 
ATOM   10822 H  H3   . THR A 1 1  ? 16.705  11.633  14.520  1.00 12.44 ? 1103 THR A H3   18 
ATOM   10823 H  HA   . THR A 1 1  ? 17.027  9.486   15.561  1.00 12.16 ? 1103 THR A HA   18 
ATOM   10824 H  HB   . THR A 1 1  ? 14.930  10.694  15.939  1.00 11.67 ? 1103 THR A HB   18 
ATOM   10825 H  HG1  . THR A 1 1  ? 14.563  7.883   15.605  1.00 12.30 ? 1103 THR A HG1  18 
ATOM   10826 H  HG21 . THR A 1 1  ? 12.907  10.163  14.663  1.00 12.31 ? 1103 THR A HG21 18 
ATOM   10827 H  HG22 . THR A 1 1  ? 13.854  9.143   13.584  1.00 12.05 ? 1103 THR A HG22 18 
ATOM   10828 H  HG23 . THR A 1 1  ? 14.145  10.879  13.635  1.00 12.10 ? 1103 THR A HG23 18 
ATOM   10829 N  N    . HIS A 1 2  ? 17.453  8.194   13.094  1.00 10.41 ? 1104 HIS A N    18 
ATOM   10830 C  CA   . HIS A 1 2  ? 17.632  7.074   12.171  1.00 9.72  ? 1104 HIS A CA   18 
ATOM   10831 C  C    . HIS A 1 2  ? 16.581  7.106   11.069  1.00 8.65  ? 1104 HIS A C    18 
ATOM   10832 O  O    . HIS A 1 2  ? 15.418  6.772   11.294  1.00 8.32  ? 1104 HIS A O    18 
ATOM   10833 C  CB   . HIS A 1 2  ? 17.586  5.721   12.899  1.00 10.05 ? 1104 HIS A CB   18 
ATOM   10834 C  CG   . HIS A 1 2  ? 17.787  4.546   11.987  1.00 10.43 ? 1104 HIS A CG   18 
ATOM   10835 N  ND1  . HIS A 1 2  ? 16.752  3.901   11.343  1.00 10.71 ? 1104 HIS A ND1  18 
ATOM   10836 C  CD2  . HIS A 1 2  ? 18.918  3.912   11.597  1.00 10.84 ? 1104 HIS A CD2  18 
ATOM   10837 C  CE1  . HIS A 1 2  ? 17.237  2.928   10.598  1.00 11.25 ? 1104 HIS A CE1  18 
ATOM   10838 N  NE2  . HIS A 1 2  ? 18.549  2.912   10.731  1.00 11.34 ? 1104 HIS A NE2  18 
ATOM   10839 H  H    . HIS A 1 2  ? 18.153  8.882   13.131  1.00 10.71 ? 1104 HIS A H    18 
ATOM   10840 H  HA   . HIS A 1 2  ? 18.605  7.186   11.714  1.00 9.96  ? 1104 HIS A HA   18 
ATOM   10841 H  HB2  . HIS A 1 2  ? 18.362  5.696   13.649  1.00 10.50 ? 1104 HIS A HB2  18 
ATOM   10842 H  HB3  . HIS A 1 2  ? 16.624  5.612   13.378  1.00 9.81  ? 1104 HIS A HB3  18 
ATOM   10843 H  HD1  . HIS A 1 2  ? 15.797  4.129   11.420  1.00 10.68 ? 1104 HIS A HD1  18 
ATOM   10844 H  HD2  . HIS A 1 2  ? 19.923  4.144   11.916  1.00 10.94 ? 1104 HIS A HD2  18 
ATOM   10845 H  HE1  . HIS A 1 2  ? 16.657  2.255   9.983   1.00 11.71 ? 1104 HIS A HE1  18 
ATOM   10846 H  HE2  . HIS A 1 2  ? 19.166  2.419   10.143  1.00 11.83 ? 1104 HIS A HE2  18 
ATOM   10847 N  N    . ALA A 1 3  ? 17.000  7.512   9.881   1.00 8.30  ? 1105 ALA A N    18 
ATOM   10848 C  CA   . ALA A 1 3  ? 16.125  7.502   8.722   1.00 7.41  ? 1105 ALA A CA   18 
ATOM   10849 C  C    . ALA A 1 3  ? 15.731  6.069   8.388   1.00 6.47  ? 1105 ALA A C    18 
ATOM   10850 O  O    . ALA A 1 3  ? 16.599  5.221   8.163   1.00 6.54  ? 1105 ALA A O    18 
ATOM   10851 C  CB   . ALA A 1 3  ? 16.814  8.154   7.533   1.00 7.70  ? 1105 ALA A CB   18 
ATOM   10852 H  H    . ALA A 1 3  ? 17.926  7.824   9.779   1.00 8.79  ? 1105 ALA A H    18 
ATOM   10853 H  HA   . ALA A 1 3  ? 15.238  8.071   8.961   1.00 7.45  ? 1105 ALA A HA   18 
ATOM   10854 H  HB1  . ALA A 1 3  ? 17.100  9.161   7.792   1.00 7.93  ? 1105 ALA A HB1  18 
ATOM   10855 H  HB2  . ALA A 1 3  ? 16.136  8.176   6.693   1.00 7.73  ? 1105 ALA A HB2  18 
ATOM   10856 H  HB3  . ALA A 1 3  ? 17.693  7.585   7.270   1.00 7.95  ? 1105 ALA A HB3  18 
ATOM   10857 N  N    . PRO A 1 4  ? 14.421  5.772   8.383   1.00 5.80  ? 1106 PRO A N    18 
ATOM   10858 C  CA   . PRO A 1 4  ? 13.920  4.433   8.070   1.00 4.97  ? 1106 PRO A CA   18 
ATOM   10859 C  C    . PRO A 1 4  ? 14.424  3.954   6.719   1.00 4.25  ? 1106 PRO A C    18 
ATOM   10860 O  O    . PRO A 1 4  ? 14.426  4.713   5.748   1.00 4.22  ? 1106 PRO A O    18 
ATOM   10861 C  CB   . PRO A 1 4  ? 12.399  4.609   8.042   1.00 4.84  ? 1106 PRO A CB   18 
ATOM   10862 C  CG   . PRO A 1 4  ? 12.137  5.820   8.868   1.00 5.55  ? 1106 PRO A CG   18 
ATOM   10863 C  CD   . PRO A 1 4  ? 13.329  6.715   8.680   1.00 6.09  ? 1106 PRO A CD   18 
ATOM   10864 H  HA   . PRO A 1 4  ? 14.192  3.718   8.832   1.00 5.32  ? 1106 PRO A HA   18 
ATOM   10865 H  HB2  . PRO A 1 4  ? 12.069  4.746   7.022   1.00 4.32  ? 1106 PRO A HB2  18 
ATOM   10866 H  HB3  . PRO A 1 4  ? 11.925  3.734   8.464   1.00 5.12  ? 1106 PRO A HB3  18 
ATOM   10867 H  HG2  . PRO A 1 4  ? 11.240  6.313   8.523   1.00 5.52  ? 1106 PRO A HG2  18 
ATOM   10868 H  HG3  . PRO A 1 4  ? 12.038  5.542   9.907   1.00 6.00  ? 1106 PRO A HG3  18 
ATOM   10869 H  HD2  . PRO A 1 4  ? 13.168  7.391   7.851   1.00 6.19  ? 1106 PRO A HD2  18 
ATOM   10870 H  HD3  . PRO A 1 4  ? 13.532  7.267   9.585   1.00 6.80  ? 1106 PRO A HD3  18 
ATOM   10871 N  N    . ALA A 1 5  ? 14.862  2.706   6.662   1.00 4.09  ? 1107 ALA A N    18 
ATOM   10872 C  CA   . ALA A 1 5  ? 15.395  2.139   5.434   1.00 3.77  ? 1107 ALA A CA   18 
ATOM   10873 C  C    . ALA A 1 5  ? 14.267  1.781   4.473   1.00 2.63  ? 1107 ALA A C    18 
ATOM   10874 O  O    . ALA A 1 5  ? 14.037  0.612   4.163   1.00 2.62  ? 1107 ALA A O    18 
ATOM   10875 C  CB   . ALA A 1 5  ? 16.253  0.921   5.742   1.00 4.73  ? 1107 ALA A CB   18 
ATOM   10876 H  H    . ALA A 1 5  ? 14.819  2.147   7.468   1.00 4.51  ? 1107 ALA A H    18 
ATOM   10877 H  HA   . ALA A 1 5  ? 16.024  2.885   4.970   1.00 4.04  ? 1107 ALA A HA   18 
ATOM   10878 H  HB1  . ALA A 1 5  ? 17.036  1.198   6.432   1.00 5.01  ? 1107 ALA A HB1  18 
ATOM   10879 H  HB2  . ALA A 1 5  ? 16.692  0.552   4.828   1.00 4.95  ? 1107 ALA A HB2  18 
ATOM   10880 H  HB3  . ALA A 1 5  ? 15.639  0.151   6.183   1.00 5.29  ? 1107 ALA A HB3  18 
ATOM   10881 N  N    . SER A 1 6  ? 13.560  2.801   4.017   1.00 2.16  ? 1108 SER A N    18 
ATOM   10882 C  CA   . SER A 1 6  ? 12.466  2.619   3.089   1.00 1.43  ? 1108 SER A CA   18 
ATOM   10883 C  C    . SER A 1 6  ? 12.983  2.465   1.664   1.00 1.29  ? 1108 SER A C    18 
ATOM   10884 O  O    . SER A 1 6  ? 14.178  2.628   1.403   1.00 1.97  ? 1108 SER A O    18 
ATOM   10885 C  CB   . SER A 1 6  ? 11.493  3.793   3.198   1.00 2.09  ? 1108 SER A CB   18 
ATOM   10886 O  OG   . SER A 1 6  ? 12.188  5.028   3.303   1.00 2.97  ? 1108 SER A OG   18 
ATOM   10887 H  H    . SER A 1 6  ? 13.783  3.711   4.318   1.00 2.71  ? 1108 SER A H    18 
ATOM   10888 H  HA   . SER A 1 6  ? 11.947  1.714   3.366   1.00 1.32  ? 1108 SER A HA   18 
ATOM   10889 H  HB2  . SER A 1 6  ? 10.870  3.819   2.318   1.00 2.36  ? 1108 SER A HB2  18 
ATOM   10890 H  HB3  . SER A 1 6  ? 10.875  3.667   4.073   1.00 2.13  ? 1108 SER A HB3  18 
ATOM   10891 H  HG   . SER A 1 6  ? 12.743  5.151   2.523   1.00 3.32  ? 1108 SER A HG   18 
ATOM   10892 N  N    . CYS A 1 7  ? 12.083  2.147   0.754   1.00 0.72  ? 1109 CYS A N    18 
ATOM   10893 C  CA   . CYS A 1 7  ? 12.435  1.910   -0.637  1.00 0.49  ? 1109 CYS A CA   18 
ATOM   10894 C  C    . CYS A 1 7  ? 12.667  3.218   -1.390  1.00 0.46  ? 1109 CYS A C    18 
ATOM   10895 O  O    . CYS A 1 7  ? 12.812  4.285   -0.783  1.00 0.62  ? 1109 CYS A O    18 
ATOM   10896 C  CB   . CYS A 1 7  ? 11.330  1.086   -1.298  1.00 0.33  ? 1109 CYS A CB   18 
ATOM   10897 S  SG   . CYS A 1 7  ? 10.990  -0.486  -0.436  1.00 0.47  ? 1109 CYS A SG   18 
ATOM   10898 H  H    . CYS A 1 7  ? 11.139  2.063   1.025   1.00 0.94  ? 1109 CYS A H    18 
ATOM   10899 H  HA   . CYS A 1 7  ? 13.347  1.340   -0.663  1.00 0.60  ? 1109 CYS A HA   18 
ATOM   10900 H  HB2  . CYS A 1 7  ? 10.416  1.661   -1.309  1.00 0.41  ? 1109 CYS A HB2  18 
ATOM   10901 H  HB3  . CYS A 1 7  ? 11.618  0.851   -2.312  1.00 0.29  ? 1109 CYS A HB3  18 
ATOM   10902 N  N    . LEU A 1 8  ? 12.736  3.111   -2.709  1.00 0.34  ? 1110 LEU A N    18 
ATOM   10903 C  CA   . LEU A 1 8  ? 12.944  4.247   -3.599  1.00 0.32  ? 1110 LEU A CA   18 
ATOM   10904 C  C    . LEU A 1 8  ? 11.946  5.368   -3.311  1.00 0.29  ? 1110 LEU A C    18 
ATOM   10905 O  O    . LEU A 1 8  ? 10.870  5.130   -2.762  1.00 0.30  ? 1110 LEU A O    18 
ATOM   10906 C  CB   . LEU A 1 8  ? 12.749  3.764   -5.027  1.00 0.28  ? 1110 LEU A CB   18 
ATOM   10907 C  CG   . LEU A 1 8  ? 13.614  4.413   -6.099  1.00 0.38  ? 1110 LEU A CG   18 
ATOM   10908 C  CD1  . LEU A 1 8  ? 15.083  4.084   -5.880  1.00 0.52  ? 1110 LEU A CD1  18 
ATOM   10909 C  CD2  . LEU A 1 8  ? 13.160  3.941   -7.468  1.00 0.39  ? 1110 LEU A CD2  18 
ATOM   10910 H  H    . LEU A 1 8  ? 12.651  2.218   -3.109  1.00 0.34  ? 1110 LEU A H    18 
ATOM   10911 H  HA   . LEU A 1 8  ? 13.948  4.611   -3.472  1.00 0.40  ? 1110 LEU A HA   18 
ATOM   10912 H  HB2  . LEU A 1 8  ? 12.928  2.699   -5.041  1.00 0.32  ? 1110 LEU A HB2  18 
ATOM   10913 H  HB3  . LEU A 1 8  ? 11.714  3.928   -5.293  1.00 0.22  ? 1110 LEU A HB3  18 
ATOM   10914 H  HG   . LEU A 1 8  ? 13.496  5.485   -6.054  1.00 0.41  ? 1110 LEU A HG   18 
ATOM   10915 H  HD11 . LEU A 1 8  ? 15.223  3.015   -5.936  1.00 1.05  ? 1110 LEU A HD11 18 
ATOM   10916 H  HD12 . LEU A 1 8  ? 15.391  4.437   -4.909  1.00 1.29  ? 1110 LEU A HD12 18 
ATOM   10917 H  HD13 . LEU A 1 8  ? 15.675  4.564   -6.642  1.00 1.07  ? 1110 LEU A HD13 18 
ATOM   10918 H  HD21 . LEU A 1 8  ? 13.787  4.378   -8.229  1.00 1.11  ? 1110 LEU A HD21 18 
ATOM   10919 H  HD22 . LEU A 1 8  ? 12.134  4.241   -7.629  1.00 1.05  ? 1110 LEU A HD22 18 
ATOM   10920 H  HD23 . LEU A 1 8  ? 13.228  2.863   -7.518  1.00 0.97  ? 1110 LEU A HD23 18 
ATOM   10921 N  N    . ASP A 1 9  ? 12.296  6.586   -3.708  1.00 0.35  ? 1111 ASP A N    18 
ATOM   10922 C  CA   . ASP A 1 9  ? 11.417  7.738   -3.522  1.00 0.38  ? 1111 ASP A CA   18 
ATOM   10923 C  C    . ASP A 1 9  ? 10.157  7.595   -4.365  1.00 0.32  ? 1111 ASP A C    18 
ATOM   10924 O  O    . ASP A 1 9  ? 9.112   8.152   -4.038  1.00 0.42  ? 1111 ASP A O    18 
ATOM   10925 C  CB   . ASP A 1 9  ? 12.133  9.042   -3.885  1.00 0.51  ? 1111 ASP A CB   18 
ATOM   10926 C  CG   . ASP A 1 9  ? 13.278  9.371   -2.946  1.00 1.37  ? 1111 ASP A CG   18 
ATOM   10927 O  OD1  . ASP A 1 9  ? 13.018  9.806   -1.805  1.00 1.53  ? 1111 ASP A OD1  18 
ATOM   10928 O  OD2  . ASP A 1 9  ? 14.447  9.204   -3.349  1.00 2.32  ? 1111 ASP A OD2  18 
ATOM   10929 H  H    . ASP A 1 9  ? 13.175  6.716   -4.132  1.00 0.40  ? 1111 ASP A H    18 
ATOM   10930 H  HA   . ASP A 1 9  ? 11.134  7.772   -2.480  1.00 0.44  ? 1111 ASP A HA   18 
ATOM   10931 H  HB2  . ASP A 1 9  ? 12.531  8.958   -4.885  1.00 0.94  ? 1111 ASP A HB2  18 
ATOM   10932 H  HB3  . ASP A 1 9  ? 11.423  9.855   -3.854  1.00 1.01  ? 1111 ASP A HB3  18 
ATOM   10933 N  N    . THR A 1 10 ? 10.264  6.855   -5.459  1.00 0.28  ? 1112 THR A N    18 
ATOM   10934 C  CA   . THR A 1 10 ? 9.115   6.565   -6.300  1.00 0.31  ? 1112 THR A CA   18 
ATOM   10935 C  C    . THR A 1 10 ? 8.556   5.178   -5.989  1.00 0.24  ? 1112 THR A C    18 
ATOM   10936 O  O    . THR A 1 10 ? 7.560   4.744   -6.571  1.00 0.30  ? 1112 THR A O    18 
ATOM   10937 C  CB   . THR A 1 10 ? 9.487   6.653   -7.789  1.00 0.42  ? 1112 THR A CB   18 
ATOM   10938 O  OG1  . THR A 1 10 ? 10.728  5.975   -8.024  1.00 0.45  ? 1112 THR A OG1  18 
ATOM   10939 C  CG2  . THR A 1 10 ? 9.599   8.102   -8.234  1.00 0.52  ? 1112 THR A CG2  18 
ATOM   10940 H  H    . THR A 1 10 ? 11.142  6.506   -5.716  1.00 0.31  ? 1112 THR A H    18 
ATOM   10941 H  HA   . THR A 1 10 ? 8.356   7.304   -6.093  1.00 0.36  ? 1112 THR A HA   18 
ATOM   10942 H  HB   . THR A 1 10 ? 8.709   6.174   -8.366  1.00 0.48  ? 1112 THR A HB   18 
ATOM   10943 H  HG1  . THR A 1 10 ? 10.581  5.247   -8.642  1.00 0.95  ? 1112 THR A HG1  18 
ATOM   10944 H  HG21 . THR A 1 10 ? 8.646   8.592   -8.110  1.00 1.19  ? 1112 THR A HG21 18 
ATOM   10945 H  HG22 . THR A 1 10 ? 9.889   8.137   -9.275  1.00 1.09  ? 1112 THR A HG22 18 
ATOM   10946 H  HG23 . THR A 1 10 ? 10.344  8.605   -7.636  1.00 1.17  ? 1112 THR A HG23 18 
ATOM   10947 N  N    . GLN A 1 11 ? 9.204   4.486   -5.060  1.00 0.18  ? 1113 GLN A N    18 
ATOM   10948 C  CA   . GLN A 1 11 ? 8.756   3.176   -4.637  1.00 0.17  ? 1113 GLN A CA   18 
ATOM   10949 C  C    . GLN A 1 11 ? 7.999   3.256   -3.328  1.00 0.17  ? 1113 GLN A C    18 
ATOM   10950 O  O    . GLN A 1 11 ? 8.093   4.236   -2.590  1.00 0.23  ? 1113 GLN A O    18 
ATOM   10951 C  CB   . GLN A 1 11 ? 9.936   2.225   -4.465  1.00 0.17  ? 1113 GLN A CB   18 
ATOM   10952 C  CG   . GLN A 1 11 ? 10.446  1.638   -5.765  1.00 0.23  ? 1113 GLN A CG   18 
ATOM   10953 C  CD   . GLN A 1 11 ? 11.516  0.589   -5.539  1.00 0.35  ? 1113 GLN A CD   18 
ATOM   10954 O  OE1  . GLN A 1 11 ? 12.256  0.645   -4.557  1.00 1.02  ? 1113 GLN A OE1  18 
ATOM   10955 N  NE2  . GLN A 1 11 ? 11.614  -0.370  -6.444  1.00 0.67  ? 1113 GLN A NE2  18 
ATOM   10956 H  H    . GLN A 1 11 ? 9.999   4.872   -4.638  1.00 0.20  ? 1113 GLN A H    18 
ATOM   10957 H  HA   . GLN A 1 11 ? 8.100   2.786   -5.399  1.00 0.22  ? 1113 GLN A HA   18 
ATOM   10958 H  HB2  . GLN A 1 11 ? 10.746  2.764   -3.998  1.00 0.16  ? 1113 GLN A HB2  18 
ATOM   10959 H  HB3  . GLN A 1 11 ? 9.642   1.417   -3.817  1.00 0.20  ? 1113 GLN A HB3  18 
ATOM   10960 H  HG2  . GLN A 1 11 ? 9.622   1.190   -6.282  1.00 0.31  ? 1113 GLN A HG2  18 
ATOM   10961 H  HG3  . GLN A 1 11 ? 10.860  2.432   -6.369  1.00 0.22  ? 1113 GLN A HG3  18 
ATOM   10962 H  HE21 . GLN A 1 11 ? 10.994  -0.355  -7.206  1.00 1.21  ? 1113 GLN A HE21 18 
ATOM   10963 H  HE22 . GLN A 1 11 ? 12.304  -1.059  -6.317  1.00 0.65  ? 1113 GLN A HE22 18 
ATOM   10964 N  N    . TYR A 1 12 ? 7.254   2.213   -3.057  1.00 0.15  ? 1114 TYR A N    18 
ATOM   10965 C  CA   . TYR A 1 12 ? 6.540   2.075   -1.808  1.00 0.16  ? 1114 TYR A CA   18 
ATOM   10966 C  C    . TYR A 1 12 ? 7.203   0.997   -0.978  1.00 0.15  ? 1114 TYR A C    18 
ATOM   10967 O  O    . TYR A 1 12 ? 7.776   0.051   -1.520  1.00 0.15  ? 1114 TYR A O    18 
ATOM   10968 C  CB   . TYR A 1 12 ? 5.082   1.706   -2.070  1.00 0.18  ? 1114 TYR A CB   18 
ATOM   10969 C  CG   . TYR A 1 12 ? 4.252   1.507   -0.820  1.00 0.22  ? 1114 TYR A CG   18 
ATOM   10970 C  CD1  . TYR A 1 12 ? 3.868   2.586   -0.032  1.00 0.33  ? 1114 TYR A CD1  18 
ATOM   10971 C  CD2  . TYR A 1 12 ? 3.844   0.235   -0.435  1.00 0.21  ? 1114 TYR A CD2  18 
ATOM   10972 C  CE1  . TYR A 1 12 ? 3.108   2.399   1.108   1.00 0.39  ? 1114 TYR A CE1  18 
ATOM   10973 C  CE2  . TYR A 1 12 ? 3.085   0.042   0.701   1.00 0.26  ? 1114 TYR A CE2  18 
ATOM   10974 C  CZ   . TYR A 1 12 ? 2.718   1.127   1.467   1.00 0.34  ? 1114 TYR A CZ   18 
ATOM   10975 O  OH   . TYR A 1 12 ? 1.966   0.938   2.602   1.00 0.41  ? 1114 TYR A OH   18 
ATOM   10976 H  H    . TYR A 1 12 ? 7.192   1.490   -3.726  1.00 0.16  ? 1114 TYR A H    18 
ATOM   10977 H  HA   . TYR A 1 12 ? 6.586   3.014   -1.281  1.00 0.18  ? 1114 TYR A HA   18 
ATOM   10978 H  HB2  . TYR A 1 12 ? 4.618   2.482   -2.658  1.00 0.23  ? 1114 TYR A HB2  18 
ATOM   10979 H  HB3  . TYR A 1 12 ? 5.063   0.784   -2.620  1.00 0.18  ? 1114 TYR A HB3  18 
ATOM   10980 H  HD1  . TYR A 1 12 ? 4.178   3.580   -0.317  1.00 0.40  ? 1114 TYR A HD1  18 
ATOM   10981 H  HD2  . TYR A 1 12 ? 4.133   -0.613  -1.037  1.00 0.23  ? 1114 TYR A HD2  18 
ATOM   10982 H  HE1  . TYR A 1 12 ? 2.818   3.249   1.708   1.00 0.50  ? 1114 TYR A HE1  18 
ATOM   10983 H  HE2  . TYR A 1 12 ? 2.778   -0.955  0.983   1.00 0.29  ? 1114 TYR A HE2  18 
ATOM   10984 H  HH   . TYR A 1 12 ? 2.339   0.211   3.114   1.00 0.89  ? 1114 TYR A HH   18 
ATOM   10985 N  N    . THR A 1 13 ? 7.122   1.145   0.324   1.00 0.18  ? 1115 THR A N    18 
ATOM   10986 C  CA   . THR A 1 13 ? 7.708   0.181   1.231   1.00 0.20  ? 1115 THR A CA   18 
ATOM   10987 C  C    . THR A 1 13 ? 6.602   -0.599  1.929   1.00 0.23  ? 1115 THR A C    18 
ATOM   10988 O  O    . THR A 1 13 ? 5.946   -0.092  2.843   1.00 0.31  ? 1115 THR A O    18 
ATOM   10989 C  CB   . THR A 1 13 ? 8.604   0.867   2.278   1.00 0.26  ? 1115 THR A CB   18 
ATOM   10990 O  OG1  . THR A 1 13 ? 9.431   1.854   1.639   1.00 0.30  ? 1115 THR A OG1  18 
ATOM   10991 C  CG2  . THR A 1 13 ? 9.484   -0.156  2.984   1.00 0.27  ? 1115 THR A CG2  18 
ATOM   10992 H  H    . THR A 1 13 ? 6.629   1.907   0.684   1.00 0.22  ? 1115 THR A H    18 
ATOM   10993 H  HA   . THR A 1 13 ? 8.312   -0.502  0.652   1.00 0.19  ? 1115 THR A HA   18 
ATOM   10994 H  HB   . THR A 1 13 ? 7.975   1.349   3.012   1.00 0.31  ? 1115 THR A HB   18 
ATOM   10995 H  HG1  . THR A 1 13 ? 8.877   2.430   1.094   1.00 0.82  ? 1115 THR A HG1  18 
ATOM   10996 H  HG21 . THR A 1 13 ? 8.863   -0.893  3.469   1.00 1.01  ? 1115 THR A HG21 18 
ATOM   10997 H  HG22 . THR A 1 13 ? 10.095  0.342   3.721   1.00 1.02  ? 1115 THR A HG22 18 
ATOM   10998 H  HG23 . THR A 1 13 ? 10.120  -0.645  2.258   1.00 1.10  ? 1115 THR A HG23 18 
ATOM   10999 N  N    . CYS A 1 14 ? 6.380   -1.820  1.471   1.00 0.26  ? 1116 CYS A N    18 
ATOM   11000 C  CA   . CYS A 1 14 ? 5.318   -2.659  2.004   1.00 0.34  ? 1116 CYS A CA   18 
ATOM   11001 C  C    . CYS A 1 14 ? 5.614   -3.065  3.446   1.00 0.40  ? 1116 CYS A C    18 
ATOM   11002 O  O    . CYS A 1 14 ? 6.730   -2.870  3.929   1.00 0.37  ? 1116 CYS A O    18 
ATOM   11003 C  CB   . CYS A 1 14 ? 5.152   -3.900  1.127   1.00 0.45  ? 1116 CYS A CB   18 
ATOM   11004 S  SG   . CYS A 1 14 ? 4.964   -3.533  -0.649  1.00 0.65  ? 1116 CYS A SG   18 
ATOM   11005 H  H    . CYS A 1 14 ? 6.946   -2.168  0.743   1.00 0.28  ? 1116 CYS A H    18 
ATOM   11006 H  HA   . CYS A 1 14 ? 4.402   -2.089  1.983   1.00 0.38  ? 1116 CYS A HA   18 
ATOM   11007 H  HB2  . CYS A 1 14 ? 6.020   -4.531  1.244   1.00 0.50  ? 1116 CYS A HB2  18 
ATOM   11008 H  HB3  . CYS A 1 14 ? 4.275   -4.441  1.447   1.00 0.54  ? 1116 CYS A HB3  18 
ATOM   11009 N  N    . ASP A 1 15 ? 4.630   -3.637  4.131   1.00 0.56  ? 1117 ASP A N    18 
ATOM   11010 C  CA   . ASP A 1 15 ? 4.816   -4.041  5.525   1.00 0.69  ? 1117 ASP A CA   18 
ATOM   11011 C  C    . ASP A 1 15 ? 5.925   -5.086  5.633   1.00 0.65  ? 1117 ASP A C    18 
ATOM   11012 O  O    . ASP A 1 15 ? 6.734   -5.063  6.560   1.00 0.71  ? 1117 ASP A O    18 
ATOM   11013 C  CB   . ASP A 1 15 ? 3.511   -4.590  6.108   1.00 0.93  ? 1117 ASP A CB   18 
ATOM   11014 C  CG   . ASP A 1 15 ? 3.650   -5.010  7.559   1.00 1.83  ? 1117 ASP A CG   18 
ATOM   11015 O  OD1  . ASP A 1 15 ? 3.653   -4.126  8.438   1.00 2.62  ? 1117 ASP A OD1  18 
ATOM   11016 O  OD2  . ASP A 1 15 ? 3.765   -6.228  7.828   1.00 2.09  ? 1117 ASP A OD2  18 
ATOM   11017 H  H    . ASP A 1 15 ? 3.764   -3.791  3.695   1.00 0.63  ? 1117 ASP A H    18 
ATOM   11018 H  HA   . ASP A 1 15 ? 5.111   -3.166  6.084   1.00 0.70  ? 1117 ASP A HA   18 
ATOM   11019 H  HB2  . ASP A 1 15 ? 2.750   -3.826  6.045   1.00 1.35  ? 1117 ASP A HB2  18 
ATOM   11020 H  HB3  . ASP A 1 15 ? 3.200   -5.448  5.532   1.00 0.70  ? 1117 ASP A HB3  18 
ATOM   11021 N  N    . ASN A 1 16 ? 5.982   -5.972  4.647   1.00 0.69  ? 1118 ASN A N    18 
ATOM   11022 C  CA   . ASN A 1 16 ? 7.013   -7.006  4.594   1.00 0.75  ? 1118 ASN A CA   18 
ATOM   11023 C  C    . ASN A 1 16 ? 8.284   -6.466  3.935   1.00 0.59  ? 1118 ASN A C    18 
ATOM   11024 O  O    . ASN A 1 16 ? 9.165   -7.230  3.539   1.00 0.65  ? 1118 ASN A O    18 
ATOM   11025 C  CB   . ASN A 1 16 ? 6.504   -8.239  3.834   1.00 0.98  ? 1118 ASN A CB   18 
ATOM   11026 C  CG   . ASN A 1 16 ? 6.201   -7.956  2.373   1.00 1.77  ? 1118 ASN A CG   18 
ATOM   11027 O  OD1  . ASN A 1 16 ? 5.835   -6.838  2.002   1.00 2.75  ? 1118 ASN A OD1  18 
ATOM   110