data_2M9A
# 
_entry.id   2M9A 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2M9A         
RCSB  RCSB103370   
BMRB  19288        
WWPDB D_1000103370 
# 
loop_
_pdbx_database_related.db_id 
_pdbx_database_related.db_name 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
19288        BMRB        unspecified . 
NESG-HR7784A TargetTrack unspecified . 
# 
_pdbx_database_status.deposit_site                    BMRB 
_pdbx_database_status.entry_id                        2M9A 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2013-06-05 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  REL 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Pederson, K.'                                    1  
'Shastry, R.'                                     2  
'Kohan, E.'                                       3  
'Janjua, H.'                                      4  
'Xiao, R.'                                        5  
'Acton, T.B.'                                     6  
'Everett, J.K.'                                   7  
'Montelione, G.T.'                                8  
'Prestegard, J.H.'                                9  
'Northeast Structural Genomics Consortium (NESG)' 10 
# 
_citation.id                        primary 
_citation.title                     'Solution Structure of Hr7784A' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Pederson, K.'     1 
primary 'Montelione, G.T.' 2 
primary 'Prestegard, J.H.' 3 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'E3 ubiquitin-protein ligase ZFP91' 11500.263 1 ? ? 'UNP residues 370-456' ? 
2 non-polymer syn 'ZINC ION'                          65.409    3 ? ? ?                      ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Zinc finger protein 757, Zinc finger protein 91 homolog, Zfp-91' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MGHHHHHHSHMRDYICEYCARAFKSSHNLAVHRMIHTGEKPLQCEICGFTCRQKASLNWHMKKHDADSFYQFSCNICGKK
FEKKDSVVAHKAKSHPEV
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MGHHHHHHSHMRDYICEYCARAFKSSHNLAVHRMIHTGEKPLQCEICGFTCRQKASLNWHMKKHDADSFYQFSCNICGKK
FEKKDSVVAHKAKSHPEV
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         NESG-HR7784A 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  MET n 
1 2  GLY n 
1 3  HIS n 
1 4  HIS n 
1 5  HIS n 
1 6  HIS n 
1 7  HIS n 
1 8  HIS n 
1 9  SER n 
1 10 HIS n 
1 11 MET n 
1 12 ARG n 
1 13 ASP n 
1 14 TYR n 
1 15 ILE n 
1 16 CYS n 
1 17 GLU n 
1 18 TYR n 
1 19 CYS n 
1 20 ALA n 
1 21 ARG n 
1 22 ALA n 
1 23 PHE n 
1 24 LYS n 
1 25 SER n 
1 26 SER n 
1 27 HIS n 
1 28 ASN n 
1 29 LEU n 
1 30 ALA n 
1 31 VAL n 
1 32 HIS n 
1 33 ARG n 
1 34 MET n 
1 35 ILE n 
1 36 HIS n 
1 37 THR n 
1 38 GLY n 
1 39 GLU n 
1 40 LYS n 
1 41 PRO n 
1 42 LEU n 
1 43 GLN n 
1 44 CYS n 
1 45 GLU n 
1 46 ILE n 
1 47 CYS n 
1 48 GLY n 
1 49 PHE n 
1 50 THR n 
1 51 CYS n 
1 52 ARG n 
1 53 GLN n 
1 54 LYS n 
1 55 ALA n 
1 56 SER n 
1 57 LEU n 
1 58 ASN n 
1 59 TRP n 
1 60 HIS n 
1 61 MET n 
1 62 LYS n 
1 63 LYS n 
1 64 HIS n 
1 65 ASP n 
1 66 ALA n 
1 67 ASP n 
1 68 SER n 
1 69 PHE n 
1 70 TYR n 
1 71 GLN n 
1 72 PHE n 
1 73 SER n 
1 74 CYS n 
1 75 ASN n 
1 76 ILE n 
1 77 CYS n 
1 78 GLY n 
1 79 LYS n 
1 80 LYS n 
1 81 PHE n 
1 82 GLU n 
1 83 LYS n 
1 84 LYS n 
1 85 ASP n 
1 86 SER n 
1 87 VAL n 
1 88 VAL n 
1 89 ALA n 
1 90 HIS n 
1 91 LYS n 
1 92 ALA n 
1 93 LYS n 
1 94 SER n 
1 95 HIS n 
1 96 PRO n 
1 97 GLU n 
1 98 VAL n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'FKSG11, ZFP91, ZNF757' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               pET15_NESG 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ZFP91_HUMAN 
_struct_ref.pdbx_db_accession          Q96JP5 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;RDYICEYCARAFKSSHNLAVHRMIHTGEKPLQCEICGFTCRQKASLNWHMKKHDADSFYQFSCNICGKKFEKKDSVVAHK
AKSHPEV
;
_struct_ref.pdbx_align_begin           370 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2M9A 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 12 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 98 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q96JP5 
_struct_ref_seq.db_align_beg                  370 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  456 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       12 
_struct_ref_seq.pdbx_auth_seq_align_end       98 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2M9A MET A 1  ? UNP Q96JP5 ? ? 'EXPRESSION TAG' 1  1  
1 2M9A GLY A 2  ? UNP Q96JP5 ? ? 'EXPRESSION TAG' 2  2  
1 2M9A HIS A 3  ? UNP Q96JP5 ? ? 'EXPRESSION TAG' 3  3  
1 2M9A HIS A 4  ? UNP Q96JP5 ? ? 'EXPRESSION TAG' 4  4  
1 2M9A HIS A 5  ? UNP Q96JP5 ? ? 'EXPRESSION TAG' 5  5  
1 2M9A HIS A 6  ? UNP Q96JP5 ? ? 'EXPRESSION TAG' 6  6  
1 2M9A HIS A 7  ? UNP Q96JP5 ? ? 'EXPRESSION TAG' 7  7  
1 2M9A HIS A 8  ? UNP Q96JP5 ? ? 'EXPRESSION TAG' 8  8  
1 2M9A SER A 9  ? UNP Q96JP5 ? ? 'EXPRESSION TAG' 9  9  
1 2M9A HIS A 10 ? UNP Q96JP5 ? ? 'EXPRESSION TAG' 10 10 
1 2M9A MET A 11 ? UNP Q96JP5 ? ? 'EXPRESSION TAG' 11 11 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
ZN  non-polymer         . 'ZINC ION'      ? 'Zn 2'           65.409  
# 
loop_
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.type 
1 1  1 '2D 1H-15N HSQC'              
1 2  1 '2D 1H-13C HSQC aromatic'     
1 3  1 '3D CBCA(CO)NH'               
1 4  1 '3D HNCACB'                   
1 5  1 '3D HNCO'                     
1 6  1 '3D H(CCO)NH'                 
1 7  1 '3D HCCH-TOCSY'               
1 8  1 '3D 1H-15N NOESY'             
1 9  1 '3D 1H-13C NOESY aliphatic'   
1 10 1 '3D 1H-13C NOESY aromatic'    
1 11 1 '2D CB(CGCD)HD'               
1 12 1 '2D CB(CGCDCE)HE'             
1 13 2 '2D 1H-15N J-modulation HSQC' 
1 14 3 '2D 1H-15N J-modulation HSQC' 
1 15 1 '2D 1H-15N J-modulation HSQC' 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      100 
_pdbx_nmr_exptl_sample_conditions.pH                  6.5 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature         298 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
loop_
_pdbx_nmr_sample_details.contents 
_pdbx_nmr_sample_details.solution_id 
_pdbx_nmr_sample_details.solvent_system 
;1.17 mM [U-100% 13C; U-100% 15N] HR7784A, 20 mM MES, 100 mM sodium chloride, 5 mM calcium chloride, 10 mM DTT, 0.02 % sodium azide, 50 uM DSS, 95% H2O/5% D2O
;
1 '95% H2O/5% D2O' 
;0.66 mM [U-100% 15N] HR7784A, 20 mM MES, 100 mM sodium chloride, 5 mM calcium chloride, 10 mM DTT, 4.2 % C12E5, 0.02 % sodium azide, 50 uM DSS, 95% H2O/5% D2O
;
2 '95% H2O/5% D2O' 
;0.66 mM [U-100% 13C; U-100% 15N] HR7784A, 20 mM MES, 100 mM sodium chloride, 5 mM calcium chloride, 10 mM DTT, 0.02 % sodium azide, 50 uM DSS, 5 % positively charged polyacrylamide gel, 95% H2O/5% D2O
;
3 '95% H2O/5% D2O' 
# 
_pdbx_nmr_spectrometer.field_strength    600 
_pdbx_nmr_spectrometer.manufacturer      Varian 
_pdbx_nmr_spectrometer.model             INOVA 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.type              'Varian INOVA' 
# 
_pdbx_nmr_refine.entry_id           2M9A 
_pdbx_nmr_refine.method             'simulated annealing' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the least restraint violations' 
_pdbx_nmr_ensemble.conformers_calculated_total_number            50 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.entry_id                                      2M9A 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.entry_id             2M9A 
_pdbx_nmr_representative.selection_criteria   'fewest violations' 
# 
loop_
_pdbx_nmr_software.authors 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.ordinal 
'Guntert, Mumenthaler and Wuthrich'                 'structure solution'        CYANA   3.0   1 
'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing                  NMRPipe ?     2 
Goddard                                             'chemical shift assignment' SPARKY  3.113 3 
Goddard                                             'peak picking'              SPARKY  3.113 4 
'Brunger, Adams, Clore, Gros, Nilges and Read'      refinement                  CNS     1.3   5 
'Bhattacharya and Montelione'                       'data analysis'             PSVS    1.4   6 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.crystals_number            ? 
_exptl.details                    
;The NESG target Hr7784A contains three C2H2 zinc finger motifs between residues 370 and 456 of the Homo sapiens E3 ubiquitin-protein ligase ZFP91. Correlation time measurements using cross-correlation based NMR spin relaxation experiments suggest that the three zinc finger motifs are connected by flexible loops and not restricted with respect to one another. Residual dipolar couplings also indicate that the three domains are oriented independently. Therefore the positions of domains with respect to one another in the structures reported are not significant.
;
_exptl.entry_id                   2M9A 
_exptl.method                     'SOLUTION NMR' 
_exptl.method_details             ? 
# 
_struct.entry_id                  2M9A 
_struct.title                     
;Solution NMR Structure of E3 ubiquitin-protein ligase ZFP91 from Homo sapiens, Northeast Structural Genomics Consortium (NESG) Target HR7784A
;
_struct.pdbx_descriptor           'E3 ubiquitin-protein ligase ZFP91 (E.C.6.3.2.-)' 
_struct.pdbx_model_details        'fewest violations, model1' 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2M9A 
_struct_keywords.pdbx_keywords   'METAL BINDING PROTEIN' 
_struct_keywords.text            
'PSI:Biology, C2H2, Hr7784A, PSI-Biology, Northeast Structural Genomics Consortium, NESG, METAL BINDING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 2 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 SER A 25 ? ARG A 33 ? SER A 25 ARG A 33 1 ? 9  
HELX_P HELX_P2 2 MET A 34 ? HIS A 36 ? MET A 34 HIS A 36 5 ? 3  
HELX_P HELX_P3 3 GLN A 53 ? ALA A 66 ? GLN A 53 ALA A 66 1 ? 14 
HELX_P HELX_P4 4 LYS A 83 ? HIS A 95 ? LYS A 83 HIS A 95 1 ? 13 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A HIS 60 NE2 ? ? ? 1_555 D ZN . ZN ? ? A HIS 60 A ZN 102 1_555 ? ? ? ? ? ? ? 2.048 ? 
metalc2  metalc ? ? A HIS 90 NE2 ? ? ? 1_555 C ZN . ZN ? ? A HIS 90 A ZN 103 1_555 ? ? ? ? ? ? ? 2.053 ? 
metalc3  metalc ? ? A HIS 64 NE2 ? ? ? 1_555 D ZN . ZN ? ? A HIS 64 A ZN 102 1_555 ? ? ? ? ? ? ? 2.071 ? 
metalc4  metalc ? ? A HIS 95 NE2 ? ? ? 1_555 C ZN . ZN ? ? A HIS 95 A ZN 103 1_555 ? ? ? ? ? ? ? 2.083 ? 
metalc5  metalc ? ? A HIS 32 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 32 A ZN 101 1_555 ? ? ? ? ? ? ? 2.099 ? 
metalc6  metalc ? ? A HIS 36 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 36 A ZN 101 1_555 ? ? ? ? ? ? ? 2.100 ? 
metalc7  metalc ? ? A CYS 16 SG  ? ? ? 1_555 B ZN . ZN ? ? A CYS 16 A ZN 101 1_555 ? ? ? ? ? ? ? 2.327 ? 
metalc8  metalc ? ? A CYS 19 SG  ? ? ? 1_555 B ZN . ZN ? ? A CYS 19 A ZN 101 1_555 ? ? ? ? ? ? ? 2.332 ? 
metalc9  metalc ? ? A CYS 77 SG  ? ? ? 1_555 C ZN . ZN ? ? A CYS 77 A ZN 103 1_555 ? ? ? ? ? ? ? 2.332 ? 
metalc10 metalc ? ? A CYS 47 SG  ? ? ? 1_555 D ZN . ZN ? ? A CYS 47 A ZN 102 1_555 ? ? ? ? ? ? ? 2.332 ? 
metalc11 metalc ? ? A CYS 74 SG  ? ? ? 1_555 C ZN . ZN ? ? A CYS 74 A ZN 103 1_555 ? ? ? ? ? ? ? 2.334 ? 
metalc12 metalc ? ? A CYS 44 SG  ? ? ? 1_555 D ZN . ZN ? ? A CYS 44 A ZN 102 1_555 ? ? ? ? ? ? ? 2.336 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   2 
_struct_sheet.details          ? 
# 
_struct_sheet_order.sheet_id     A 
_struct_sheet_order.range_id_1   1 
_struct_sheet_order.range_id_2   2 
_struct_sheet_order.offset       ? 
_struct_sheet_order.sense        anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LEU A 42 ? GLN A 43 ? LEU A 42 GLN A 43 
A 2 THR A 50 ? CYS A 51 ? THR A 50 CYS A 51 
# 
_pdbx_struct_sheet_hbond.sheet_id                A 
_pdbx_struct_sheet_hbond.range_id_1              1 
_pdbx_struct_sheet_hbond.range_id_2              2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id   N 
_pdbx_struct_sheet_hbond.range_1_label_comp_id   LEU 
_pdbx_struct_sheet_hbond.range_1_label_asym_id   A 
_pdbx_struct_sheet_hbond.range_1_label_seq_id    42 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id    N 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id    LEU 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id    A 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id     42 
_pdbx_struct_sheet_hbond.range_2_label_atom_id   O 
_pdbx_struct_sheet_hbond.range_2_label_comp_id   CYS 
_pdbx_struct_sheet_hbond.range_2_label_asym_id   A 
_pdbx_struct_sheet_hbond.range_2_label_seq_id    51 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id    O 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id    CYS 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id    A 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id     51 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 101' 
AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 103' 
AC3 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 102' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4 CYS A 16 ? CYS A 16 . ? 1_555 ? 
2  AC1 4 CYS A 19 ? CYS A 19 . ? 1_555 ? 
3  AC1 4 HIS A 32 ? HIS A 32 . ? 1_555 ? 
4  AC1 4 HIS A 36 ? HIS A 36 . ? 1_555 ? 
5  AC2 4 CYS A 74 ? CYS A 74 . ? 1_555 ? 
6  AC2 4 CYS A 77 ? CYS A 77 . ? 1_555 ? 
7  AC2 4 HIS A 90 ? HIS A 90 . ? 1_555 ? 
8  AC2 4 HIS A 95 ? HIS A 95 . ? 1_555 ? 
9  AC3 4 CYS A 44 ? CYS A 44 . ? 1_555 ? 
10 AC3 4 CYS A 47 ? CYS A 47 . ? 1_555 ? 
11 AC3 4 HIS A 60 ? HIS A 60 . ? 1_555 ? 
12 AC3 4 HIS A 64 ? HIS A 64 . ? 1_555 ? 
# 
_atom_sites.entry_id                    2M9A 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
H  
N  
O  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N    . HIS A 1 10 ? 16.372  -9.648  19.363  1.00 0.00 ? 10  HIS A N    1  
ATOM   2     C  CA   . HIS A 1 10 ? 16.872  -9.593  17.977  1.00 0.00 ? 10  HIS A CA   1  
ATOM   3     C  C    . HIS A 1 10 ? 17.264  -11.002 17.498  1.00 0.00 ? 10  HIS A C    1  
ATOM   4     O  O    . HIS A 1 10 ? 18.421  -11.418 17.642  1.00 0.00 ? 10  HIS A O    1  
ATOM   5     C  CB   . HIS A 1 10 ? 18.065  -8.604  17.851  1.00 0.00 ? 10  HIS A CB   1  
ATOM   6     C  CG   . HIS A 1 10 ? 17.697  -7.146  18.011  1.00 0.00 ? 10  HIS A CG   1  
ATOM   7     N  ND1  . HIS A 1 10 ? 18.214  -6.345  19.008  1.00 0.00 ? 10  HIS A ND1  1  
ATOM   8     C  CD2  . HIS A 1 10 ? 16.890  -6.343  17.270  1.00 0.00 ? 10  HIS A CD2  1  
ATOM   9     C  CE1  . HIS A 1 10 ? 17.743  -5.120  18.875  1.00 0.00 ? 10  HIS A CE1  1  
ATOM   10    N  NE2  . HIS A 1 10 ? 16.938  -5.091  17.831  1.00 0.00 ? 10  HIS A NE2  1  
ATOM   11    H  H    . HIS A 1 10 ? 17.115  -9.993  20.002  1.00 0.00 ? 10  HIS A H    1  
ATOM   12    H  HA   . HIS A 1 10 ? 16.057  -9.234  17.358  1.00 0.00 ? 10  HIS A HA   1  
ATOM   13    H  HB2  . HIS A 1 10 ? 18.806  -8.844  18.605  1.00 0.00 ? 10  HIS A HB2  1  
ATOM   14    H  HB3  . HIS A 1 10 ? 18.522  -8.720  16.871  1.00 0.00 ? 10  HIS A HB3  1  
ATOM   15    H  HD1  . HIS A 1 10 ? 18.831  -6.636  19.715  1.00 0.00 ? 10  HIS A HD1  1  
ATOM   16    H  HD2  . HIS A 1 10 ? 16.312  -6.634  16.404  1.00 0.00 ? 10  HIS A HD2  1  
ATOM   17    H  HE1  . HIS A 1 10 ? 17.984  -4.282  19.510  1.00 0.00 ? 10  HIS A HE1  1  
ATOM   18    H  HE2  . HIS A 1 10 ? 16.334  -4.349  17.610  1.00 0.00 ? 10  HIS A HE2  1  
ATOM   19    N  N    . MET A 1 11 ? 16.270  -11.757 16.986  1.00 0.00 ? 11  MET A N    1  
ATOM   20    C  CA   . MET A 1 11 ? 16.483  -13.066 16.315  1.00 0.00 ? 11  MET A CA   1  
ATOM   21    C  C    . MET A 1 11 ? 15.577  -13.151 15.079  1.00 0.00 ? 11  MET A C    1  
ATOM   22    O  O    . MET A 1 11 ? 16.047  -13.367 13.961  1.00 0.00 ? 11  MET A O    1  
ATOM   23    C  CB   . MET A 1 11 ? 16.236  -14.280 17.276  1.00 0.00 ? 11  MET A CB   1  
ATOM   24    C  CG   . MET A 1 11 ? 17.356  -14.535 18.300  1.00 0.00 ? 11  MET A CG   1  
ATOM   25    S  SD   . MET A 1 11 ? 17.103  -16.040 19.278  1.00 0.00 ? 11  MET A SD   1  
ATOM   26    C  CE   . MET A 1 11 ? 15.689  -15.600 20.283  1.00 0.00 ? 11  MET A CE   1  
ATOM   27    H  H    . MET A 1 11 ? 15.351  -11.419 17.061  1.00 0.00 ? 11  MET A H    1  
ATOM   28    H  HA   . MET A 1 11 ? 17.512  -13.100 15.969  1.00 0.00 ? 11  MET A HA   1  
ATOM   29    H  HB2  . MET A 1 11 ? 15.316  -14.107 17.825  1.00 0.00 ? 11  MET A HB2  1  
ATOM   30    H  HB3  . MET A 1 11 ? 16.112  -15.186 16.685  1.00 0.00 ? 11  MET A HB3  1  
ATOM   31    H  HG2  . MET A 1 11 ? 18.299  -14.633 17.774  1.00 0.00 ? 11  MET A HG2  1  
ATOM   32    H  HG3  . MET A 1 11 ? 17.417  -13.683 18.973  1.00 0.00 ? 11  MET A HG3  1  
ATOM   33    H  HE1  . MET A 1 11 ? 15.934  -14.752 20.911  1.00 0.00 ? 11  MET A HE1  1  
ATOM   34    H  HE2  . MET A 1 11 ? 15.414  -16.441 20.902  1.00 0.00 ? 11  MET A HE2  1  
ATOM   35    H  HE3  . MET A 1 11 ? 14.860  -15.338 19.642  1.00 0.00 ? 11  MET A HE3  1  
ATOM   36    N  N    . ARG A 1 12 ? 14.267  -12.955 15.293  1.00 0.00 ? 12  ARG A N    1  
ATOM   37    C  CA   . ARG A 1 12 ? 13.260  -12.921 14.204  1.00 0.00 ? 12  ARG A CA   1  
ATOM   38    C  C    . ARG A 1 12 ? 12.878  -11.464 13.907  1.00 0.00 ? 12  ARG A C    1  
ATOM   39    O  O    . ARG A 1 12 ? 11.772  -11.162 13.455  1.00 0.00 ? 12  ARG A O    1  
ATOM   40    C  CB   . ARG A 1 12 ? 12.001  -13.770 14.573  1.00 0.00 ? 12  ARG A CB   1  
ATOM   41    C  CG   . ARG A 1 12 ? 12.236  -15.307 14.693  1.00 0.00 ? 12  ARG A CG   1  
ATOM   42    C  CD   . ARG A 1 12 ? 12.889  -15.750 16.020  1.00 0.00 ? 12  ARG A CD   1  
ATOM   43    N  NE   . ARG A 1 12 ? 13.272  -17.181 16.002  1.00 0.00 ? 12  ARG A NE   1  
ATOM   44    C  CZ   . ARG A 1 12 ? 13.693  -17.888 17.063  1.00 0.00 ? 12  ARG A CZ   1  
ATOM   45    N  NH1  . ARG A 1 12 ? 13.736  -17.354 18.277  1.00 0.00 ? 12  ARG A NH1  1  
ATOM   46    N  NH2  . ARG A 1 12 ? 14.074  -19.146 16.902  1.00 0.00 ? 12  ARG A NH2  1  
ATOM   47    H  H    . ARG A 1 12 ? 13.965  -12.816 16.210  1.00 0.00 ? 12  ARG A H    1  
ATOM   48    H  HA   . ARG A 1 12 ? 13.712  -13.322 13.307  1.00 0.00 ? 12  ARG A HA   1  
ATOM   49    H  HB2  . ARG A 1 12 ? 11.605  -13.413 15.515  1.00 0.00 ? 12  ARG A HB2  1  
ATOM   50    H  HB3  . ARG A 1 12 ? 11.248  -13.609 13.807  1.00 0.00 ? 12  ARG A HB3  1  
ATOM   51    H  HG2  . ARG A 1 12 ? 11.280  -15.812 14.602  1.00 0.00 ? 12  ARG A HG2  1  
ATOM   52    H  HG3  . ARG A 1 12 ? 12.869  -15.623 13.869  1.00 0.00 ? 12  ARG A HG3  1  
ATOM   53    H  HD2  . ARG A 1 12 ? 13.780  -15.157 16.191  1.00 0.00 ? 12  ARG A HD2  1  
ATOM   54    H  HD3  . ARG A 1 12 ? 12.186  -15.581 16.827  1.00 0.00 ? 12  ARG A HD3  1  
ATOM   55    H  HE   . ARG A 1 12 ? 13.229  -17.633 15.133  1.00 0.00 ? 12  ARG A HE   1  
ATOM   56    H  HH11 . ARG A 1 12 ? 13.433  -16.409 18.422  1.00 0.00 ? 12  ARG A HH11 1  
ATOM   57    H  HH12 . ARG A 1 12 ? 14.061  -17.894 19.057  1.00 0.00 ? 12  ARG A HH12 1  
ATOM   58    H  HH21 . ARG A 1 12 ? 14.033  -19.575 15.994  1.00 0.00 ? 12  ARG A HH21 1  
ATOM   59    H  HH22 . ARG A 1 12 ? 14.399  -19.678 17.688  1.00 0.00 ? 12  ARG A HH22 1  
ATOM   60    N  N    . ASP A 1 13 ? 13.856  -10.575 14.119  1.00 0.00 ? 13  ASP A N    1  
ATOM   61    C  CA   . ASP A 1 13 ? 13.684  -9.120  14.046  1.00 0.00 ? 13  ASP A CA   1  
ATOM   62    C  C    . ASP A 1 13 ? 14.633  -8.573  12.987  1.00 0.00 ? 13  ASP A C    1  
ATOM   63    O  O    . ASP A 1 13 ? 15.744  -8.114  13.282  1.00 0.00 ? 13  ASP A O    1  
ATOM   64    C  CB   . ASP A 1 13 ? 13.967  -8.467  15.411  1.00 0.00 ? 13  ASP A CB   1  
ATOM   65    C  CG   . ASP A 1 13 ? 13.161  -9.084  16.559  1.00 0.00 ? 13  ASP A CG   1  
ATOM   66    O  OD1  . ASP A 1 13 ? 13.638  -10.076 17.165  1.00 0.00 ? 13  ASP A OD1  1  
ATOM   67    O  OD2  . ASP A 1 13 ? 12.053  -8.592  16.866  1.00 0.00 ? 13  ASP A OD2  1  
ATOM   68    H  H    . ASP A 1 13 ? 14.748  -10.916 14.302  1.00 0.00 ? 13  ASP A H    1  
ATOM   69    H  HA   . ASP A 1 13 ? 12.659  -8.901  13.749  1.00 0.00 ? 13  ASP A HA   1  
ATOM   70    H  HB2  . ASP A 1 13 ? 15.024  -8.573  15.634  1.00 0.00 ? 13  ASP A HB2  1  
ATOM   71    H  HB3  . ASP A 1 13 ? 13.731  -7.412  15.338  1.00 0.00 ? 13  ASP A HB3  1  
ATOM   72    N  N    . TYR A 1 14 ? 14.186  -8.691  11.754  1.00 0.00 ? 14  TYR A N    1  
ATOM   73    C  CA   . TYR A 1 14 ? 14.950  -8.352  10.554  1.00 0.00 ? 14  TYR A CA   1  
ATOM   74    C  C    . TYR A 1 14 ? 14.944  -6.832  10.341  1.00 0.00 ? 14  TYR A C    1  
ATOM   75    O  O    . TYR A 1 14 ? 13.896  -6.239  10.031  1.00 0.00 ? 14  TYR A O    1  
ATOM   76    C  CB   . TYR A 1 14 ? 14.348  -9.100  9.339   1.00 0.00 ? 14  TYR A CB   1  
ATOM   77    C  CG   . TYR A 1 14 ? 14.448  -10.634 9.443   1.00 0.00 ? 14  TYR A CG   1  
ATOM   78    C  CD1  . TYR A 1 14 ? 13.525  -11.370 10.190  1.00 0.00 ? 14  TYR A CD1  1  
ATOM   79    C  CD2  . TYR A 1 14 ? 15.469  -11.340 8.801   1.00 0.00 ? 14  TYR A CD2  1  
ATOM   80    C  CE1  . TYR A 1 14 ? 13.613  -12.746 10.286  1.00 0.00 ? 14  TYR A CE1  1  
ATOM   81    C  CE2  . TYR A 1 14 ? 15.558  -12.713 8.894   1.00 0.00 ? 14  TYR A CE2  1  
ATOM   82    C  CZ   . TYR A 1 14 ? 14.630  -13.411 9.636   1.00 0.00 ? 14  TYR A CZ   1  
ATOM   83    O  OH   . TYR A 1 14 ? 14.716  -14.786 9.720   1.00 0.00 ? 14  TYR A OH   1  
ATOM   84    H  H    . TYR A 1 14 ? 13.276  -9.006  11.637  1.00 0.00 ? 14  TYR A H    1  
ATOM   85    H  HA   . TYR A 1 14 ? 15.976  -8.692  10.700  1.00 0.00 ? 14  TYR A HA   1  
ATOM   86    H  HB2  . TYR A 1 14 ? 13.298  -8.836  9.238   1.00 0.00 ? 14  TYR A HB2  1  
ATOM   87    H  HB3  . TYR A 1 14 ? 14.867  -8.789  8.440   1.00 0.00 ? 14  TYR A HB3  1  
ATOM   88    H  HD1  . TYR A 1 14 ? 12.727  -10.845 10.702  1.00 0.00 ? 14  TYR A HD1  1  
ATOM   89    H  HD2  . TYR A 1 14 ? 16.199  -10.797 8.215   1.00 0.00 ? 14  TYR A HD2  1  
ATOM   90    H  HE1  . TYR A 1 14 ? 12.883  -13.294 10.868  1.00 0.00 ? 14  TYR A HE1  1  
ATOM   91    H  HE2  . TYR A 1 14 ? 16.358  -13.238 8.389   1.00 0.00 ? 14  TYR A HE2  1  
ATOM   92    H  HH   . TYR A 1 14 ? 13.863  -15.176 9.503   1.00 0.00 ? 14  TYR A HH   1  
ATOM   93    N  N    . ILE A 1 15 ? 16.117  -6.212  10.542  1.00 0.00 ? 15  ILE A N    1  
ATOM   94    C  CA   . ILE A 1 15 ? 16.293  -4.754  10.474  1.00 0.00 ? 15  ILE A CA   1  
ATOM   95    C  C    . ILE A 1 15 ? 17.099  -4.400  9.210   1.00 0.00 ? 15  ILE A C    1  
ATOM   96    O  O    . ILE A 1 15 ? 18.160  -4.975  8.964   1.00 0.00 ? 15  ILE A O    1  
ATOM   97    C  CB   . ILE A 1 15 ? 17.043  -4.186  11.745  1.00 0.00 ? 15  ILE A CB   1  
ATOM   98    C  CG1  . ILE A 1 15 ? 16.414  -4.710  13.074  1.00 0.00 ? 15  ILE A CG1  1  
ATOM   99    C  CG2  . ILE A 1 15 ? 17.097  -2.632  11.717  1.00 0.00 ? 15  ILE A CG2  1  
ATOM   100   C  CD1  . ILE A 1 15 ? 14.965  -4.346  13.264  1.00 0.00 ? 15  ILE A CD1  1  
ATOM   101   H  H    . ILE A 1 15 ? 16.911  -6.762  10.700  1.00 0.00 ? 15  ILE A H    1  
ATOM   102   H  HA   . ILE A 1 15 ? 15.311  -4.283  10.418  1.00 0.00 ? 15  ILE A HA   1  
ATOM   103   H  HB   . ILE A 1 15 ? 18.053  -4.538  11.703  1.00 0.00 ? 15  ILE A HB   1  
ATOM   104   H  HG12 . ILE A 1 15 ? 16.481  -5.790  13.100  1.00 0.00 ? 15  ILE A HG12 1  
ATOM   105   H  HG13 . ILE A 1 15 ? 16.968  -4.307  13.914  1.00 0.00 ? 15  ILE A HG13 1  
ATOM   106   H  HG21 . ILE A 1 15 ? 17.575  -2.262  12.615  1.00 0.00 ? 15  ILE A HG21 1  
ATOM   107   H  HG22 . ILE A 1 15 ? 16.090  -2.226  11.652  1.00 0.00 ? 15  ILE A HG22 1  
ATOM   108   H  HG23 . ILE A 1 15 ? 17.663  -2.302  10.852  1.00 0.00 ? 15  ILE A HG23 1  
ATOM   109   H  HD11 . ILE A 1 15 ? 14.617  -4.721  14.213  1.00 0.00 ? 15  ILE A HD11 1  
ATOM   110   H  HD12 . ILE A 1 15 ? 14.380  -4.782  12.467  1.00 0.00 ? 15  ILE A HD12 1  
ATOM   111   H  HD13 . ILE A 1 15 ? 14.862  -3.274  13.239  1.00 0.00 ? 15  ILE A HD13 1  
ATOM   112   N  N    . CYS A 1 16 ? 16.605  -3.418  8.446   1.00 0.00 ? 16  CYS A N    1  
ATOM   113   C  CA   . CYS A 1 16 ? 17.240  -2.924  7.214   1.00 0.00 ? 16  CYS A CA   1  
ATOM   114   C  C    . CYS A 1 16 ? 18.196  -1.778  7.569   1.00 0.00 ? 16  CYS A C    1  
ATOM   115   O  O    . CYS A 1 16 ? 18.196  -0.724  6.920   1.00 0.00 ? 16  CYS A O    1  
ATOM   116   C  CB   . CYS A 1 16 ? 16.162  -2.448  6.227   1.00 0.00 ? 16  CYS A CB   1  
ATOM   117   S  SG   . CYS A 1 16 ? 16.780  -2.035  4.572   1.00 0.00 ? 16  CYS A SG   1  
ATOM   118   H  H    . CYS A 1 16 ? 15.792  -2.993  8.739   1.00 0.00 ? 16  CYS A H    1  
ATOM   119   H  HA   . CYS A 1 16 ? 17.808  -3.730  6.761   1.00 0.00 ? 16  CYS A HA   1  
ATOM   120   H  HB2  . CYS A 1 16 ? 15.418  -3.216  6.112   1.00 0.00 ? 16  CYS A HB2  1  
ATOM   121   H  HB3  . CYS A 1 16 ? 15.686  -1.557  6.632   1.00 0.00 ? 16  CYS A HB3  1  
ATOM   122   N  N    . GLU A 1 17 ? 19.084  -2.091  8.531   1.00 0.00 ? 17  GLU A N    1  
ATOM   123   C  CA   . GLU A 1 17 ? 20.050  -1.171  9.192   1.00 0.00 ? 17  GLU A CA   1  
ATOM   124   C  C    . GLU A 1 17 ? 19.420  0.083   9.883   1.00 0.00 ? 17  GLU A C    1  
ATOM   125   O  O    . GLU A 1 17 ? 19.666  0.343   11.065  1.00 0.00 ? 17  GLU A O    1  
ATOM   126   C  CB   . GLU A 1 17 ? 21.170  -0.753  8.179   1.00 0.00 ? 17  GLU A CB   1  
ATOM   127   C  CG   . GLU A 1 17 ? 22.108  -1.900  7.707   1.00 0.00 ? 17  GLU A CG   1  
ATOM   128   C  CD   . GLU A 1 17 ? 21.406  -3.025  6.902   1.00 0.00 ? 17  GLU A CD   1  
ATOM   129   O  OE1  . GLU A 1 17 ? 21.138  -2.835  5.689   1.00 0.00 ? 17  GLU A OE1  1  
ATOM   130   O  OE2  . GLU A 1 17 ? 21.089  -4.091  7.486   1.00 0.00 ? 17  GLU A OE2  1  
ATOM   131   H  H    . GLU A 1 17 ? 19.218  -3.036  8.660   1.00 0.00 ? 17  GLU A H    1  
ATOM   132   H  HA   . GLU A 1 17 ? 20.525  -1.758  9.972   1.00 0.00 ? 17  GLU A HA   1  
ATOM   133   H  HB2  . GLU A 1 17 ? 20.698  -0.324  7.304   1.00 0.00 ? 17  GLU A HB2  1  
ATOM   134   H  HB3  . GLU A 1 17 ? 21.791  0.014   8.639   1.00 0.00 ? 17  GLU A HB3  1  
ATOM   135   H  HG2  . GLU A 1 17 ? 22.880  -1.464  7.078   1.00 0.00 ? 17  GLU A HG2  1  
ATOM   136   H  HG3  . GLU A 1 17 ? 22.585  -2.333  8.582   1.00 0.00 ? 17  GLU A HG3  1  
ATOM   137   N  N    . TYR A 1 18 ? 18.612  0.843   9.135   1.00 0.00 ? 18  TYR A N    1  
ATOM   138   C  CA   . TYR A 1 18 ? 18.150  2.188   9.495   1.00 0.00 ? 18  TYR A CA   1  
ATOM   139   C  C    . TYR A 1 18 ? 16.651  2.308   9.232   1.00 0.00 ? 18  TYR A C    1  
ATOM   140   O  O    . TYR A 1 18 ? 15.891  2.804   10.056  1.00 0.00 ? 18  TYR A O    1  
ATOM   141   C  CB   . TYR A 1 18 ? 18.921  3.246   8.668   1.00 0.00 ? 18  TYR A CB   1  
ATOM   142   C  CG   . TYR A 1 18 ? 20.319  3.521   9.200   1.00 0.00 ? 18  TYR A CG   1  
ATOM   143   C  CD1  . TYR A 1 18 ? 20.509  3.771   10.557  1.00 0.00 ? 18  TYR A CD1  1  
ATOM   144   C  CD2  . TYR A 1 18 ? 21.440  3.522   8.372   1.00 0.00 ? 18  TYR A CD2  1  
ATOM   145   C  CE1  . TYR A 1 18 ? 21.752  4.017   11.064  1.00 0.00 ? 18  TYR A CE1  1  
ATOM   146   C  CE2  . TYR A 1 18 ? 22.692  3.771   8.880   1.00 0.00 ? 18  TYR A CE2  1  
ATOM   147   C  CZ   . TYR A 1 18 ? 22.846  4.012   10.225  1.00 0.00 ? 18  TYR A CZ   1  
ATOM   148   O  OH   . TYR A 1 18 ? 24.099  4.262   10.733  1.00 0.00 ? 18  TYR A OH   1  
ATOM   149   H  H    . TYR A 1 18 ? 18.231  0.443   8.352   1.00 0.00 ? 18  TYR A H    1  
ATOM   150   H  HA   . TYR A 1 18 ? 18.345  2.357   10.559  1.00 0.00 ? 18  TYR A HA   1  
ATOM   151   H  HB2  . TYR A 1 18 ? 19.005  2.908   7.640   1.00 0.00 ? 18  TYR A HB2  1  
ATOM   152   H  HB3  . TYR A 1 18 ? 18.381  4.175   8.677   1.00 0.00 ? 18  TYR A HB3  1  
ATOM   153   H  HD1  . TYR A 1 18 ? 19.653  3.773   11.219  1.00 0.00 ? 18  TYR A HD1  1  
ATOM   154   H  HD2  . TYR A 1 18 ? 21.318  3.329   7.316   1.00 0.00 ? 18  TYR A HD2  1  
ATOM   155   H  HE1  . TYR A 1 18 ? 21.867  4.202   12.118  1.00 0.00 ? 18  TYR A HE1  1  
ATOM   156   H  HE2  . TYR A 1 18 ? 23.550  3.771   8.224   1.00 0.00 ? 18  TYR A HE2  1  
ATOM   157   H  HH   . TYR A 1 18 ? 24.198  3.795   11.566  1.00 0.00 ? 18  TYR A HH   1  
ATOM   158   N  N    . CYS A 1 19 ? 16.251  1.814   8.060   1.00 0.00 ? 19  CYS A N    1  
ATOM   159   C  CA   . CYS A 1 19 ? 14.921  2.038   7.476   1.00 0.00 ? 19  CYS A CA   1  
ATOM   160   C  C    . CYS A 1 19 ? 14.051  0.768   7.547   1.00 0.00 ? 19  CYS A C    1  
ATOM   161   O  O    . CYS A 1 19 ? 13.295  0.462   6.620   1.00 0.00 ? 19  CYS A O    1  
ATOM   162   C  CB   . CYS A 1 19 ? 15.132  2.552   6.037   1.00 0.00 ? 19  CYS A CB   1  
ATOM   163   S  SG   . CYS A 1 19 ? 16.516  1.746   5.183   1.00 0.00 ? 19  CYS A SG   1  
ATOM   164   H  H    . CYS A 1 19 ? 16.880  1.248   7.560   1.00 0.00 ? 19  CYS A H    1  
ATOM   165   H  HA   . CYS A 1 19 ? 14.416  2.814   8.049   1.00 0.00 ? 19  CYS A HA   1  
ATOM   166   H  HB2  . CYS A 1 19 ? 14.241  2.385   5.446   1.00 0.00 ? 19  CYS A HB2  1  
ATOM   167   H  HB3  . CYS A 1 19 ? 15.347  3.616   6.060   1.00 0.00 ? 19  CYS A HB3  1  
ATOM   168   N  N    . ALA A 1 20 ? 14.184  0.021   8.657   1.00 0.00 ? 20  ALA A N    1  
ATOM   169   C  CA   . ALA A 1 20 ? 13.176  -0.951  9.097   1.00 0.00 ? 20  ALA A CA   1  
ATOM   170   C  C    . ALA A 1 20 ? 13.081  -0.929  10.617  1.00 0.00 ? 20  ALA A C    1  
ATOM   171   O  O    . ALA A 1 20 ? 14.094  -1.127  11.299  1.00 0.00 ? 20  ALA A O    1  
ATOM   172   C  CB   . ALA A 1 20 ? 13.491  -2.362  8.619   1.00 0.00 ? 20  ALA A CB   1  
ATOM   173   H  H    . ALA A 1 20 ? 15.005  0.106   9.187   1.00 0.00 ? 20  ALA A H    1  
ATOM   174   H  HA   . ALA A 1 20 ? 12.224  -0.654  8.677   1.00 0.00 ? 20  ALA A HA   1  
ATOM   175   H  HB1  . ALA A 1 20 ? 13.583  -2.370  7.541   1.00 0.00 ? 20  ALA A HB1  1  
ATOM   176   H  HB2  . ALA A 1 20 ? 12.693  -3.033  8.912   1.00 0.00 ? 20  ALA A HB2  1  
ATOM   177   H  HB3  . ALA A 1 20 ? 14.425  -2.698  9.060   1.00 0.00 ? 20  ALA A HB3  1  
ATOM   178   N  N    . ARG A 1 21 ? 11.864  -0.668  11.123  1.00 0.00 ? 21  ARG A N    1  
ATOM   179   C  CA   . ARG A 1 21 ? 11.591  -0.681  12.567  1.00 0.00 ? 21  ARG A CA   1  
ATOM   180   C  C    . ARG A 1 21 ? 11.724  -2.119  13.117  1.00 0.00 ? 21  ARG A C    1  
ATOM   181   O  O    . ARG A 1 21 ? 12.494  -2.334  14.059  1.00 0.00 ? 21  ARG A O    1  
ATOM   182   C  CB   . ARG A 1 21 ? 10.213  -0.023  12.884  1.00 0.00 ? 21  ARG A CB   1  
ATOM   183   C  CG   . ARG A 1 21 ? 8.972   -0.681  12.239  1.00 0.00 ? 21  ARG A CG   1  
ATOM   184   C  CD   . ARG A 1 21 ? 7.658   0.061   12.547  1.00 0.00 ? 21  ARG A CD   1  
ATOM   185   N  NE   . ARG A 1 21 ? 7.442   0.226   14.003  1.00 0.00 ? 21  ARG A NE   1  
ATOM   186   C  CZ   . ARG A 1 21 ? 6.322   -0.078  14.670  1.00 0.00 ? 21  ARG A CZ   1  
ATOM   187   N  NH1  . ARG A 1 21 ? 5.288   -0.635  14.051  1.00 0.00 ? 21  ARG A NH1  1  
ATOM   188   N  NH2  . ARG A 1 21 ? 6.244   0.165   15.964  1.00 0.00 ? 21  ARG A NH2  1  
ATOM   189   H  H    . ARG A 1 21 ? 11.181  -0.359  10.497  1.00 0.00 ? 21  ARG A H    1  
ATOM   190   H  HA   . ARG A 1 21 ? 12.369  -0.076  13.033  1.00 0.00 ? 21  ARG A HA   1  
ATOM   191   H  HB2  . ARG A 1 21 ? 10.069  -0.025  13.960  1.00 0.00 ? 21  ARG A HB2  1  
ATOM   192   H  HB3  . ARG A 1 21 ? 10.249  1.014   12.557  1.00 0.00 ? 21  ARG A HB3  1  
ATOM   193   H  HG2  . ARG A 1 21 ? 9.111   -0.706  11.167  1.00 0.00 ? 21  ARG A HG2  1  
ATOM   194   H  HG3  . ARG A 1 21 ? 8.892   -1.698  12.607  1.00 0.00 ? 21  ARG A HG3  1  
ATOM   195   H  HD2  . ARG A 1 21 ? 7.695   1.048   12.094  1.00 0.00 ? 21  ARG A HD2  1  
ATOM   196   H  HD3  . ARG A 1 21 ? 6.828   -0.497  12.112  1.00 0.00 ? 21  ARG A HD3  1  
ATOM   197   H  HE   . ARG A 1 21 ? 8.187   0.613   14.508  1.00 0.00 ? 21  ARG A HE   1  
ATOM   198   H  HH11 . ARG A 1 21 ? 5.332   -0.843  13.069  1.00 0.00 ? 21  ARG A HH11 1  
ATOM   199   H  HH12 . ARG A 1 21 ? 4.451   -0.843  14.559  1.00 0.00 ? 21  ARG A HH12 1  
ATOM   200   H  HH21 . ARG A 1 21 ? 7.023   0.571   16.453  1.00 0.00 ? 21  ARG A HH21 1  
ATOM   201   H  HH22 . ARG A 1 21 ? 5.400   -0.043  16.461  1.00 0.00 ? 21  ARG A HH22 1  
ATOM   202   N  N    . ALA A 1 22 ? 10.974  -3.089  12.540  1.00 0.00 ? 22  ALA A N    1  
ATOM   203   C  CA   . ALA A 1 22 ? 11.252  -4.530  12.665  1.00 0.00 ? 22  ALA A CA   1  
ATOM   204   C  C    . ALA A 1 22 ? 10.319  -5.316  11.739  1.00 0.00 ? 22  ALA A C    1  
ATOM   205   O  O    . ALA A 1 22 ? 9.104   -5.098  11.750  1.00 0.00 ? 22  ALA A O    1  
ATOM   206   C  CB   . ALA A 1 22 ? 11.073  -5.021  14.114  1.00 0.00 ? 22  ALA A CB   1  
ATOM   207   H  H    . ALA A 1 22 ? 10.150  -2.844  12.090  1.00 0.00 ? 22  ALA A H    1  
ATOM   208   H  HA   . ALA A 1 22 ? 12.290  -4.699  12.365  1.00 0.00 ? 22  ALA A HA   1  
ATOM   209   H  HB1  . ALA A 1 22 ? 11.746  -4.477  14.765  1.00 0.00 ? 22  ALA A HB1  1  
ATOM   210   H  HB2  . ALA A 1 22 ? 11.297  -6.078  14.179  1.00 0.00 ? 22  ALA A HB2  1  
ATOM   211   H  HB3  . ALA A 1 22 ? 10.054  -4.846  14.436  1.00 0.00 ? 22  ALA A HB3  1  
ATOM   212   N  N    . PHE A 1 23 ? 10.892  -6.222  10.938  1.00 0.00 ? 23  PHE A N    1  
ATOM   213   C  CA   . PHE A 1 23 ? 10.127  -7.193  10.133  1.00 0.00 ? 23  PHE A CA   1  
ATOM   214   C  C    . PHE A 1 23 ? 10.347  -8.593  10.715  1.00 0.00 ? 23  PHE A C    1  
ATOM   215   O  O    . PHE A 1 23 ? 11.356  -8.841  11.369  1.00 0.00 ? 23  PHE A O    1  
ATOM   216   C  CB   . PHE A 1 23 ? 10.557  -7.151  8.648   1.00 0.00 ? 23  PHE A CB   1  
ATOM   217   C  CG   . PHE A 1 23 ? 10.137  -5.873  7.912   1.00 0.00 ? 23  PHE A CG   1  
ATOM   218   C  CD1  . PHE A 1 23 ? 8.856   -5.743  7.376   1.00 0.00 ? 23  PHE A CD1  1  
ATOM   219   C  CD2  . PHE A 1 23 ? 11.023  -4.816  7.740   1.00 0.00 ? 23  PHE A CD2  1  
ATOM   220   C  CE1  . PHE A 1 23 ? 8.482   -4.602  6.692   1.00 0.00 ? 23  PHE A CE1  1  
ATOM   221   C  CE2  . PHE A 1 23 ? 10.646  -3.675  7.055   1.00 0.00 ? 23  PHE A CE2  1  
ATOM   222   C  CZ   . PHE A 1 23 ? 9.380   -3.570  6.529   1.00 0.00 ? 23  PHE A CZ   1  
ATOM   223   H  H    . PHE A 1 23 ? 11.872  -6.267  10.910  1.00 0.00 ? 23  PHE A H    1  
ATOM   224   H  HA   . PHE A 1 23 ? 9.067   -6.950  10.205  1.00 0.00 ? 23  PHE A HA   1  
ATOM   225   H  HB2  . PHE A 1 23 ? 11.640  -7.237  8.590   1.00 0.00 ? 23  PHE A HB2  1  
ATOM   226   H  HB3  . PHE A 1 23 ? 10.119  -7.995  8.126   1.00 0.00 ? 23  PHE A HB3  1  
ATOM   227   H  HD1  . PHE A 1 23 ? 8.145   -6.554  7.496   1.00 0.00 ? 23  PHE A HD1  1  
ATOM   228   H  HD2  . PHE A 1 23 ? 12.024  -4.886  8.149   1.00 0.00 ? 23  PHE A HD2  1  
ATOM   229   H  HE1  . PHE A 1 23 ? 7.482   -4.521  6.282   1.00 0.00 ? 23  PHE A HE1  1  
ATOM   230   H  HE2  . PHE A 1 23 ? 11.354  -2.867  6.921   1.00 0.00 ? 23  PHE A HE2  1  
ATOM   231   H  HZ   . PHE A 1 23 ? 9.087   -2.675  5.991   1.00 0.00 ? 23  PHE A HZ   1  
ATOM   232   N  N    . LYS A 1 24 ? 9.395   -9.502  10.491  1.00 0.00 ? 24  LYS A N    1  
ATOM   233   C  CA   . LYS A 1 24 ? 9.477   -10.882 11.015  1.00 0.00 ? 24  LYS A CA   1  
ATOM   234   C  C    . LYS A 1 24 ? 9.953   -11.886 9.949   1.00 0.00 ? 24  LYS A C    1  
ATOM   235   O  O    . LYS A 1 24 ? 10.007  -13.091 10.215  1.00 0.00 ? 24  LYS A O    1  
ATOM   236   C  CB   . LYS A 1 24 ? 8.114   -11.294 11.615  1.00 0.00 ? 24  LYS A CB   1  
ATOM   237   C  CG   . LYS A 1 24 ? 6.916   -11.225 10.642  1.00 0.00 ? 24  LYS A CG   1  
ATOM   238   C  CD   . LYS A 1 24 ? 5.567   -11.653 11.292  1.00 0.00 ? 24  LYS A CD   1  
ATOM   239   C  CE   . LYS A 1 24 ? 5.002   -10.636 12.319  1.00 0.00 ? 24  LYS A CE   1  
ATOM   240   N  NZ   . LYS A 1 24 ? 5.841   -10.466 13.539  1.00 0.00 ? 24  LYS A NZ   1  
ATOM   241   H  H    . LYS A 1 24 ? 8.597   -9.236  9.984   1.00 0.00 ? 24  LYS A H    1  
ATOM   242   H  HA   . LYS A 1 24 ? 10.217  -10.897 11.815  1.00 0.00 ? 24  LYS A HA   1  
ATOM   243   H  HB2  . LYS A 1 24 ? 8.186   -12.309 11.995  1.00 0.00 ? 24  LYS A HB2  1  
ATOM   244   H  HB3  . LYS A 1 24 ? 7.905   -10.634 12.452  1.00 0.00 ? 24  LYS A HB3  1  
ATOM   245   H  HG2  . LYS A 1 24 ? 6.821   -10.203 10.280  1.00 0.00 ? 24  LYS A HG2  1  
ATOM   246   H  HG3  . LYS A 1 24 ? 7.118   -11.874 9.795   1.00 0.00 ? 24  LYS A HG3  1  
ATOM   247   H  HD2  . LYS A 1 24 ? 4.831   -11.777 10.503  1.00 0.00 ? 24  LYS A HD2  1  
ATOM   248   H  HD3  . LYS A 1 24 ? 5.703   -12.609 11.786  1.00 0.00 ? 24  LYS A HD3  1  
ATOM   249   H  HE2  . LYS A 1 24 ? 4.913   -9.674  11.839  1.00 0.00 ? 24  LYS A HE2  1  
ATOM   250   H  HE3  . LYS A 1 24 ? 4.014   -10.964 12.627  1.00 0.00 ? 24  LYS A HE3  1  
ATOM   251   H  HZ1  . LYS A 1 24 ? 6.743   -10.010 13.294  1.00 0.00 ? 24  LYS A HZ1  1  
ATOM   252   H  HZ2  . LYS A 1 24 ? 6.041   -11.390 13.976  1.00 0.00 ? 24  LYS A HZ2  1  
ATOM   253   H  HZ3  . LYS A 1 24 ? 5.348   -9.871  14.235  1.00 0.00 ? 24  LYS A HZ3  1  
ATOM   254   N  N    . SER A 1 25 ? 10.334  -11.386 8.758   1.00 0.00 ? 25  SER A N    1  
ATOM   255   C  CA   . SER A 1 25 ? 10.843  -12.216 7.662   1.00 0.00 ? 25  SER A CA   1  
ATOM   256   C  C    . SER A 1 25 ? 11.796  -11.382 6.783   1.00 0.00 ? 25  SER A C    1  
ATOM   257   O  O    . SER A 1 25 ? 11.567  -10.185 6.555   1.00 0.00 ? 25  SER A O    1  
ATOM   258   C  CB   . SER A 1 25 ? 9.674   -12.787 6.832   1.00 0.00 ? 25  SER A CB   1  
ATOM   259   O  OG   . SER A 1 25 ? 10.119  -13.440 5.655   1.00 0.00 ? 25  SER A OG   1  
ATOM   260   H  H    . SER A 1 25 ? 10.281  -10.419 8.592   1.00 0.00 ? 25  SER A H    1  
ATOM   261   H  HA   . SER A 1 25 ? 11.407  -13.042 8.097   1.00 0.00 ? 25  SER A HA   1  
ATOM   262   H  HB2  . SER A 1 25 ? 9.124   -13.499 7.429   1.00 0.00 ? 25  SER A HB2  1  
ATOM   263   H  HB3  . SER A 1 25 ? 9.009   -11.983 6.546   1.00 0.00 ? 25  SER A HB3  1  
ATOM   264   H  HG   . SER A 1 25 ? 10.340  -14.354 5.857   1.00 0.00 ? 25  SER A HG   1  
ATOM   265   N  N    . SER A 1 26 ? 12.894  -12.041 6.357   1.00 0.00 ? 26  SER A N    1  
ATOM   266   C  CA   . SER A 1 26 ? 13.896  -11.486 5.428   1.00 0.00 ? 26  SER A CA   1  
ATOM   267   C  C    . SER A 1 26 ? 13.247  -10.938 4.139   1.00 0.00 ? 26  SER A C    1  
ATOM   268   O  O    . SER A 1 26 ? 13.660  -9.891  3.620   1.00 0.00 ? 26  SER A O    1  
ATOM   269   C  CB   . SER A 1 26 ? 14.955  -12.564 5.085   1.00 0.00 ? 26  SER A CB   1  
ATOM   270   O  OG   . SER A 1 26 ? 15.994  -12.039 4.268   1.00 0.00 ? 26  SER A OG   1  
ATOM   271   H  H    . SER A 1 26 ? 13.045  -12.923 6.746   1.00 0.00 ? 26  SER A H    1  
ATOM   272   H  HA   . SER A 1 26 ? 14.393  -10.665 5.940   1.00 0.00 ? 26  SER A HA   1  
ATOM   273   H  HB2  . SER A 1 26 ? 15.401  -12.934 6.001   1.00 0.00 ? 26  SER A HB2  1  
ATOM   274   H  HB3  . SER A 1 26 ? 14.483  -13.386 4.563   1.00 0.00 ? 26  SER A HB3  1  
ATOM   275   H  HG   . SER A 1 26 ? 16.457  -11.343 4.748   1.00 0.00 ? 26  SER A HG   1  
ATOM   276   N  N    . HIS A 1 27 ? 12.221  -11.652 3.633   1.00 0.00 ? 27  HIS A N    1  
ATOM   277   C  CA   . HIS A 1 27 ? 11.489  -11.244 2.417   1.00 0.00 ? 27  HIS A CA   1  
ATOM   278   C  C    . HIS A 1 27 ? 10.637  -9.985  2.671   1.00 0.00 ? 27  HIS A C    1  
ATOM   279   O  O    . HIS A 1 27 ? 10.568  -9.120  1.806   1.00 0.00 ? 27  HIS A O    1  
ATOM   280   C  CB   . HIS A 1 27 ? 10.600  -12.390 1.876   1.00 0.00 ? 27  HIS A CB   1  
ATOM   281   C  CG   . HIS A 1 27 ? 9.786   -12.015 0.658   1.00 0.00 ? 27  HIS A CG   1  
ATOM   282   N  ND1  . HIS A 1 27 ? 8.408   -11.995 0.647   1.00 0.00 ? 27  HIS A ND1  1  
ATOM   283   C  CD2  . HIS A 1 27 ? 10.173  -11.615 -0.577  1.00 0.00 ? 27  HIS A CD2  1  
ATOM   284   C  CE1  . HIS A 1 27 ? 7.986   -11.598 -0.537  1.00 0.00 ? 27  HIS A CE1  1  
ATOM   285   N  NE2  . HIS A 1 27 ? 9.034   -11.359 -1.298  1.00 0.00 ? 27  HIS A NE2  1  
ATOM   286   H  H    . HIS A 1 27 ? 11.949  -12.475 4.093   1.00 0.00 ? 27  HIS A H    1  
ATOM   287   H  HA   . HIS A 1 27 ? 12.239  -11.006 1.663   1.00 0.00 ? 27  HIS A HA   1  
ATOM   288   H  HB2  . HIS A 1 27 ? 11.230  -13.225 1.599   1.00 0.00 ? 27  HIS A HB2  1  
ATOM   289   H  HB3  . HIS A 1 27 ? 9.921   -12.709 2.656   1.00 0.00 ? 27  HIS A HB3  1  
ATOM   290   H  HD1  . HIS A 1 27 ? 7.821   -12.264 1.393   1.00 0.00 ? 27  HIS A HD1  1  
ATOM   291   H  HD2  . HIS A 1 27 ? 11.187  -11.515 -0.932  1.00 0.00 ? 27  HIS A HD2  1  
ATOM   292   H  HE1  . HIS A 1 27 ? 6.953   -11.489 -0.828  1.00 0.00 ? 27  HIS A HE1  1  
ATOM   293   H  HE2  . HIS A 1 27 ? 8.997   -11.292 -2.274  1.00 0.00 ? 27  HIS A HE2  1  
ATOM   294   N  N    . ASN A 1 28 ? 10.006  -9.896  3.856   1.00 0.00 ? 28  ASN A N    1  
ATOM   295   C  CA   . ASN A 1 28 ? 9.162   -8.728  4.250   1.00 0.00 ? 28  ASN A CA   1  
ATOM   296   C  C    . ASN A 1 28 ? 9.968   -7.418  4.177   1.00 0.00 ? 28  ASN A C    1  
ATOM   297   O  O    . ASN A 1 28 ? 9.516   -6.410  3.624   1.00 0.00 ? 28  ASN A O    1  
ATOM   298   C  CB   . ASN A 1 28 ? 8.617   -8.923  5.694   1.00 0.00 ? 28  ASN A CB   1  
ATOM   299   C  CG   . ASN A 1 28 ? 7.606   -10.062 5.833   1.00 0.00 ? 28  ASN A CG   1  
ATOM   300   O  OD1  . ASN A 1 28 ? 7.559   -10.977 5.015   1.00 0.00 ? 28  ASN A OD1  1  
ATOM   301   N  ND2  . ASN A 1 28 ? 6.811   -10.029 6.889   1.00 0.00 ? 28  ASN A ND2  1  
ATOM   302   H  H    . ASN A 1 28 ? 10.104  -10.632 4.488   1.00 0.00 ? 28  ASN A H    1  
ATOM   303   H  HA   . ASN A 1 28 ? 8.326   -8.664  3.559   1.00 0.00 ? 28  ASN A HA   1  
ATOM   304   H  HB2  . ASN A 1 28 ? 9.454   -9.130  6.360   1.00 0.00 ? 28  ASN A HB2  1  
ATOM   305   H  HB3  . ASN A 1 28 ? 8.142   -8.004  6.024   1.00 0.00 ? 28  ASN A HB3  1  
ATOM   306   H  HD21 . ASN A 1 28 ? 6.901   -9.284  7.512   1.00 0.00 ? 28  ASN A HD21 1  
ATOM   307   H  HD22 . ASN A 1 28 ? 6.169   -10.764 7.010   1.00 0.00 ? 28  ASN A HD22 1  
ATOM   308   N  N    . LEU A 1 29 ? 11.168  -7.464  4.762   1.00 0.00 ? 29  LEU A N    1  
ATOM   309   C  CA   . LEU A 1 29 ? 12.137  -6.352  4.720   1.00 0.00 ? 29  LEU A CA   1  
ATOM   310   C  C    . LEU A 1 29 ? 12.598  -6.089  3.272   1.00 0.00 ? 29  LEU A C    1  
ATOM   311   O  O    . LEU A 1 29 ? 12.779  -4.932  2.879   1.00 0.00 ? 29  LEU A O    1  
ATOM   312   C  CB   . LEU A 1 29 ? 13.316  -6.664  5.714   1.00 0.00 ? 29  LEU A CB   1  
ATOM   313   C  CG   . LEU A 1 29 ? 14.727  -7.034  5.119   1.00 0.00 ? 29  LEU A CG   1  
ATOM   314   C  CD1  . LEU A 1 29 ? 15.566  -5.778  4.801   1.00 0.00 ? 29  LEU A CD1  1  
ATOM   315   C  CD2  . LEU A 1 29 ? 15.503  -7.986  6.047   1.00 0.00 ? 29  LEU A CD2  1  
ATOM   316   H  H    . LEU A 1 29 ? 11.385  -8.254  5.303   1.00 0.00 ? 29  LEU A H    1  
ATOM   317   H  HA   . LEU A 1 29 ? 11.611  -5.464  5.067   1.00 0.00 ? 29  LEU A HA   1  
ATOM   318   H  HB2  . LEU A 1 29 ? 13.441  -5.795  6.359   1.00 0.00 ? 29  LEU A HB2  1  
ATOM   319   H  HB3  . LEU A 1 29 ? 12.984  -7.489  6.350   1.00 0.00 ? 29  LEU A HB3  1  
ATOM   320   H  HG   . LEU A 1 29 ? 14.580  -7.557  4.178   1.00 0.00 ? 29  LEU A HG   1  
ATOM   321   H  HD11 . LEU A 1 29 ? 15.772  -5.234  5.714   1.00 0.00 ? 29  LEU A HD11 1  
ATOM   322   H  HD12 . LEU A 1 29 ? 15.024  -5.136  4.117   1.00 0.00 ? 29  LEU A HD12 1  
ATOM   323   H  HD13 . LEU A 1 29 ? 16.503  -6.069  4.342   1.00 0.00 ? 29  LEU A HD13 1  
ATOM   324   H  HD21 . LEU A 1 29 ? 16.456  -8.235  5.599   1.00 0.00 ? 29  LEU A HD21 1  
ATOM   325   H  HD22 . LEU A 1 29 ? 14.934  -8.894  6.194   1.00 0.00 ? 29  LEU A HD22 1  
ATOM   326   H  HD23 . LEU A 1 29 ? 15.671  -7.509  7.005   1.00 0.00 ? 29  LEU A HD23 1  
ATOM   327   N  N    . ALA A 1 30 ? 12.772  -7.182  2.498   1.00 0.00 ? 30  ALA A N    1  
ATOM   328   C  CA   . ALA A 1 30 ? 13.191  -7.130  1.082   1.00 0.00 ? 30  ALA A CA   1  
ATOM   329   C  C    . ALA A 1 30 ? 12.127  -6.452  0.182   1.00 0.00 ? 30  ALA A C    1  
ATOM   330   O  O    . ALA A 1 30 ? 12.465  -5.879  -0.866  1.00 0.00 ? 30  ALA A O    1  
ATOM   331   C  CB   . ALA A 1 30 ? 13.539  -8.532  0.562   1.00 0.00 ? 30  ALA A CB   1  
ATOM   332   H  H    . ALA A 1 30 ? 12.625  -8.058  2.912   1.00 0.00 ? 30  ALA A H    1  
ATOM   333   H  HA   . ALA A 1 30 ? 14.098  -6.534  1.040   1.00 0.00 ? 30  ALA A HA   1  
ATOM   334   H  HB1  . ALA A 1 30 ? 12.654  -9.156  0.561   1.00 0.00 ? 30  ALA A HB1  1  
ATOM   335   H  HB2  . ALA A 1 30 ? 14.288  -8.982  1.202   1.00 0.00 ? 30  ALA A HB2  1  
ATOM   336   H  HB3  . ALA A 1 30 ? 13.930  -8.465  -0.446  1.00 0.00 ? 30  ALA A HB3  1  
ATOM   337   N  N    . VAL A 1 31 ? 10.846  -6.545  0.602   1.00 0.00 ? 31  VAL A N    1  
ATOM   338   C  CA   . VAL A 1 31 ? 9.711   -5.859  -0.048  1.00 0.00 ? 31  VAL A CA   1  
ATOM   339   C  C    . VAL A 1 31 ? 9.904   -4.316  -0.004  1.00 0.00 ? 31  VAL A C    1  
ATOM   340   O  O    . VAL A 1 31 ? 9.729   -3.629  -1.019  1.00 0.00 ? 31  VAL A O    1  
ATOM   341   C  CB   . VAL A 1 31 ? 8.342   -6.306  0.611   1.00 0.00 ? 31  VAL A CB   1  
ATOM   342   C  CG1  . VAL A 1 31 ? 7.144   -5.500  0.083   1.00 0.00 ? 31  VAL A CG1  1  
ATOM   343   C  CG2  . VAL A 1 31 ? 8.086   -7.819  0.395   1.00 0.00 ? 31  VAL A CG2  1  
ATOM   344   H  H    . VAL A 1 31 ? 10.657  -7.105  1.383   1.00 0.00 ? 31  VAL A H    1  
ATOM   345   H  HA   . VAL A 1 31 ? 9.696   -6.172  -1.088  1.00 0.00 ? 31  VAL A HA   1  
ATOM   346   H  HB   . VAL A 1 31 ? 8.412   -6.134  1.684   1.00 0.00 ? 31  VAL A HB   1  
ATOM   347   H  HG11 . VAL A 1 31 ? 7.280   -4.452  0.314   1.00 0.00 ? 31  VAL A HG11 1  
ATOM   348   H  HG12 . VAL A 1 31 ? 6.226   -5.850  0.547   1.00 0.00 ? 31  VAL A HG12 1  
ATOM   349   H  HG13 . VAL A 1 31 ? 7.071   -5.620  -0.989  1.00 0.00 ? 31  VAL A HG13 1  
ATOM   350   H  HG21 . VAL A 1 31 ? 7.994   -8.024  -0.665  1.00 0.00 ? 31  VAL A HG21 1  
ATOM   351   H  HG22 . VAL A 1 31 ? 7.172   -8.114  0.896   1.00 0.00 ? 31  VAL A HG22 1  
ATOM   352   H  HG23 . VAL A 1 31 ? 8.908   -8.393  0.797   1.00 0.00 ? 31  VAL A HG23 1  
ATOM   353   N  N    . HIS A 1 32 ? 10.305  -3.795  1.172   1.00 0.00 ? 32  HIS A N    1  
ATOM   354   C  CA   . HIS A 1 32 ? 10.675  -2.371  1.338   1.00 0.00 ? 32  HIS A CA   1  
ATOM   355   C  C    . HIS A 1 32 ? 12.011  -2.072  0.616   1.00 0.00 ? 32  HIS A C    1  
ATOM   356   O  O    . HIS A 1 32 ? 12.205  -0.984  0.058   1.00 0.00 ? 32  HIS A O    1  
ATOM   357   C  CB   . HIS A 1 32 ? 10.754  -2.002  2.875   1.00 0.00 ? 32  HIS A CB   1  
ATOM   358   C  CG   . HIS A 1 32 ? 11.887  -1.059  3.232   1.00 0.00 ? 32  HIS A CG   1  
ATOM   359   N  ND1  . HIS A 1 32 ? 11.831  0.308   3.096   1.00 0.00 ? 32  HIS A ND1  1  
ATOM   360   C  CD2  . HIS A 1 32 ? 13.169  -1.350  3.586   1.00 0.00 ? 32  HIS A CD2  1  
ATOM   361   C  CE1  . HIS A 1 32 ? 13.054  0.793   3.345   1.00 0.00 ? 32  HIS A CE1  1  
ATOM   362   N  NE2  . HIS A 1 32 ? 13.904  -0.171  3.644   1.00 0.00 ? 32  HIS A NE2  1  
ATOM   363   H  H    . HIS A 1 32 ? 10.342  -4.380  1.955   1.00 0.00 ? 32  HIS A H    1  
ATOM   364   H  HA   . HIS A 1 32 ? 9.902   -1.770  0.868   1.00 0.00 ? 32  HIS A HA   1  
ATOM   365   H  HB2  . HIS A 1 32 ? 9.826   -1.530  3.177   1.00 0.00 ? 32  HIS A HB2  1  
ATOM   366   H  HB3  . HIS A 1 32 ? 10.882  -2.905  3.461   1.00 0.00 ? 32  HIS A HB3  1  
ATOM   367   H  HD1  . HIS A 1 32 ? 11.041  0.834   2.854   1.00 0.00 ? 32  HIS A HD1  1  
ATOM   368   H  HD2  . HIS A 1 32 ? 13.563  -2.348  3.740   1.00 0.00 ? 32  HIS A HD2  1  
ATOM   369   H  HE1  . HIS A 1 32 ? 13.314  1.843   3.311   1.00 0.00 ? 32  HIS A HE1  1  
ATOM   370   N  N    . ARG A 1 33 ? 12.924  -3.056  0.667   1.00 0.00 ? 33  ARG A N    1  
ATOM   371   C  CA   . ARG A 1 33 ? 14.318  -2.913  0.236   1.00 0.00 ? 33  ARG A CA   1  
ATOM   372   C  C    . ARG A 1 33 ? 14.453  -2.741  -1.303  1.00 0.00 ? 33  ARG A C    1  
ATOM   373   O  O    . ARG A 1 33 ? 15.561  -2.661  -1.794  1.00 0.00 ? 33  ARG A O    1  
ATOM   374   C  CB   . ARG A 1 33 ? 15.138  -4.137  0.765   1.00 0.00 ? 33  ARG A CB   1  
ATOM   375   C  CG   . ARG A 1 33 ? 16.651  -3.902  0.936   1.00 0.00 ? 33  ARG A CG   1  
ATOM   376   C  CD   . ARG A 1 33 ? 17.411  -5.112  1.488   1.00 0.00 ? 33  ARG A CD   1  
ATOM   377   N  NE   . ARG A 1 33 ? 18.819  -4.761  1.790   1.00 0.00 ? 33  ARG A NE   1  
ATOM   378   C  CZ   . ARG A 1 33 ? 19.437  -4.942  2.978   1.00 0.00 ? 33  ARG A CZ   1  
ATOM   379   N  NH1  . ARG A 1 33 ? 18.814  -5.533  3.982   1.00 0.00 ? 33  ARG A NH1  1  
ATOM   380   N  NH2  . ARG A 1 33 ? 20.686  -4.543  3.139   1.00 0.00 ? 33  ARG A NH2  1  
ATOM   381   H  H    . ARG A 1 33 ? 12.654  -3.904  1.060   1.00 0.00 ? 33  ARG A H    1  
ATOM   382   H  HA   . ARG A 1 33 ? 14.712  -2.014  0.703   1.00 0.00 ? 33  ARG A HA   1  
ATOM   383   H  HB2  . ARG A 1 33 ? 14.738  -4.423  1.734   1.00 0.00 ? 33  ARG A HB2  1  
ATOM   384   H  HB3  . ARG A 1 33 ? 14.997  -4.974  0.087   1.00 0.00 ? 33  ARG A HB3  1  
ATOM   385   H  HG2  . ARG A 1 33 ? 17.072  -3.642  -0.028  1.00 0.00 ? 33  ARG A HG2  1  
ATOM   386   H  HG3  . ARG A 1 33 ? 16.788  -3.069  1.613   1.00 0.00 ? 33  ARG A HG3  1  
ATOM   387   H  HD2  . ARG A 1 33 ? 16.912  -5.462  2.390   1.00 0.00 ? 33  ARG A HD2  1  
ATOM   388   H  HD3  . ARG A 1 33 ? 17.394  -5.902  0.746   1.00 0.00 ? 33  ARG A HD3  1  
ATOM   389   H  HE   . ARG A 1 33 ? 19.338  -4.352  1.061   1.00 0.00 ? 33  ARG A HE   1  
ATOM   390   H  HH11 . ARG A 1 33 ? 17.881  -5.870  3.872   1.00 0.00 ? 33  ARG A HH11 1  
ATOM   391   H  HH12 . ARG A 1 33 ? 19.290  -5.655  4.860   1.00 0.00 ? 33  ARG A HH12 1  
ATOM   392   H  HH21 . ARG A 1 33 ? 21.187  -4.117  2.377   1.00 0.00 ? 33  ARG A HH21 1  
ATOM   393   H  HH22 . ARG A 1 33 ? 21.142  -4.656  4.026   1.00 0.00 ? 33  ARG A HH22 1  
ATOM   394   N  N    . MET A 1 34 ? 13.308  -2.600  -2.029  1.00 0.00 ? 34  MET A N    1  
ATOM   395   C  CA   . MET A 1 34 ? 13.228  -2.294  -3.501  1.00 0.00 ? 34  MET A CA   1  
ATOM   396   C  C    . MET A 1 34 ? 14.172  -1.142  -3.983  1.00 0.00 ? 34  MET A C    1  
ATOM   397   O  O    . MET A 1 34 ? 14.404  -0.989  -5.185  1.00 0.00 ? 34  MET A O    1  
ATOM   398   C  CB   . MET A 1 34 ? 11.780  -1.893  -3.858  1.00 0.00 ? 34  MET A CB   1  
ATOM   399   C  CG   . MET A 1 34 ? 11.262  -0.652  -3.106  1.00 0.00 ? 34  MET A CG   1  
ATOM   400   S  SD   . MET A 1 34 ? 9.709   -0.011  -3.769  1.00 0.00 ? 34  MET A SD   1  
ATOM   401   C  CE   . MET A 1 34 ? 10.224  0.715   -5.328  1.00 0.00 ? 34  MET A CE   1  
ATOM   402   H  H    . MET A 1 34 ? 12.477  -2.796  -1.550  1.00 0.00 ? 34  MET A H    1  
ATOM   403   H  HA   . MET A 1 34 ? 13.482  -3.202  -4.034  1.00 0.00 ? 34  MET A HA   1  
ATOM   404   H  HB2  . MET A 1 34 ? 11.722  -1.694  -4.917  1.00 0.00 ? 34  MET A HB2  1  
ATOM   405   H  HB3  . MET A 1 34 ? 11.122  -2.723  -3.631  1.00 0.00 ? 34  MET A HB3  1  
ATOM   406   H  HG2  . MET A 1 34 ? 11.103  -0.914  -2.066  1.00 0.00 ? 34  MET A HG2  1  
ATOM   407   H  HG3  . MET A 1 34 ? 12.006  0.135   -3.158  1.00 0.00 ? 34  MET A HG3  1  
ATOM   408   H  HE1  . MET A 1 34 ? 9.367   1.137   -5.830  1.00 0.00 ? 34  MET A HE1  1  
ATOM   409   H  HE2  . MET A 1 34 ? 10.668  -0.047  -5.951  1.00 0.00 ? 34  MET A HE2  1  
ATOM   410   H  HE3  . MET A 1 34 ? 10.949  1.494   -5.139  1.00 0.00 ? 34  MET A HE3  1  
ATOM   411   N  N    . ILE A 1 35 ? 14.680  -0.361  -3.028  1.00 0.00 ? 35  ILE A N    1  
ATOM   412   C  CA   . ILE A 1 35 ? 15.614  0.726   -3.253  1.00 0.00 ? 35  ILE A CA   1  
ATOM   413   C  C    . ILE A 1 35 ? 17.063  0.152   -3.292  1.00 0.00 ? 35  ILE A C    1  
ATOM   414   O  O    . ILE A 1 35 ? 17.784  0.364   -4.275  1.00 0.00 ? 35  ILE A O    1  
ATOM   415   C  CB   . ILE A 1 35 ? 15.406  1.861   -2.149  1.00 0.00 ? 35  ILE A CB   1  
ATOM   416   C  CG1  . ILE A 1 35 ? 16.641  2.800   -2.022  1.00 0.00 ? 35  ILE A CG1  1  
ATOM   417   C  CG2  . ILE A 1 35 ? 15.004  1.277   -0.771  1.00 0.00 ? 35  ILE A CG2  1  
ATOM   418   C  CD1  . ILE A 1 35 ? 16.941  3.656   -3.244  1.00 0.00 ? 35  ILE A CD1  1  
ATOM   419   H  H    . ILE A 1 35 ? 14.487  -0.624  -2.129  1.00 0.00 ? 35  ILE A H    1  
ATOM   420   H  HA   . ILE A 1 35 ? 15.394  1.159   -4.230  1.00 0.00 ? 35  ILE A HA   1  
ATOM   421   H  HB   . ILE A 1 35 ? 14.561  2.464   -2.478  1.00 0.00 ? 35  ILE A HB   1  
ATOM   422   H  HG12 . ILE A 1 35 ? 16.489  3.473   -1.190  1.00 0.00 ? 35  ILE A HG12 1  
ATOM   423   H  HG13 . ILE A 1 35 ? 17.514  2.191   -1.820  1.00 0.00 ? 35  ILE A HG13 1  
ATOM   424   H  HG21 . ILE A 1 35 ? 14.853  2.080   -0.058  1.00 0.00 ? 35  ILE A HG21 1  
ATOM   425   H  HG22 . ILE A 1 35 ? 15.787  0.625   -0.415  1.00 0.00 ? 35  ILE A HG22 1  
ATOM   426   H  HG23 . ILE A 1 35 ? 14.086  0.709   -0.867  1.00 0.00 ? 35  ILE A HG23 1  
ATOM   427   H  HD11 . ILE A 1 35 ? 16.086  4.276   -3.478  1.00 0.00 ? 35  ILE A HD11 1  
ATOM   428   H  HD12 . ILE A 1 35 ? 17.169  3.018   -4.089  1.00 0.00 ? 35  ILE A HD12 1  
ATOM   429   H  HD13 . ILE A 1 35 ? 17.789  4.281   -3.030  1.00 0.00 ? 35  ILE A HD13 1  
ATOM   430   N  N    . HIS A 1 36 ? 17.470  -0.590  -2.236  1.00 0.00 ? 36  HIS A N    1  
ATOM   431   C  CA   . HIS A 1 36 ? 18.870  -1.090  -2.068  1.00 0.00 ? 36  HIS A CA   1  
ATOM   432   C  C    . HIS A 1 36 ? 19.066  -2.628  -2.299  1.00 0.00 ? 36  HIS A C    1  
ATOM   433   O  O    . HIS A 1 36 ? 20.193  -3.106  -2.170  1.00 0.00 ? 36  HIS A O    1  
ATOM   434   C  CB   . HIS A 1 36 ? 19.474  -0.633  -0.674  1.00 0.00 ? 36  HIS A CB   1  
ATOM   435   C  CG   . HIS A 1 36 ? 18.511  -0.017  0.329   1.00 0.00 ? 36  HIS A CG   1  
ATOM   436   N  ND1  . HIS A 1 36 ? 18.543  1.305   0.704   1.00 0.00 ? 36  HIS A ND1  1  
ATOM   437   C  CD2  . HIS A 1 36 ? 17.522  -0.575  1.080   1.00 0.00 ? 36  HIS A CD2  1  
ATOM   438   C  CE1  . HIS A 1 36 ? 17.611  1.498   1.643   1.00 0.00 ? 36  HIS A CE1  1  
ATOM   439   N  NE2  . HIS A 1 36 ? 16.956  0.384   1.914   1.00 0.00 ? 36  HIS A NE2  1  
ATOM   440   H  H    . HIS A 1 36 ? 16.810  -0.840  -1.557  1.00 0.00 ? 36  HIS A H    1  
ATOM   441   H  HA   . HIS A 1 36 ? 19.464  -0.608  -2.847  1.00 0.00 ? 36  HIS A HA   1  
ATOM   442   H  HB2  . HIS A 1 36 ? 19.937  -1.481  -0.179  1.00 0.00 ? 36  HIS A HB2  1  
ATOM   443   H  HB3  . HIS A 1 36 ? 20.250  0.100   -0.860  1.00 0.00 ? 36  HIS A HB3  1  
ATOM   444   H  HD1  . HIS A 1 36 ? 19.153  1.987   0.355   1.00 0.00 ? 36  HIS A HD1  1  
ATOM   445   H  HD2  . HIS A 1 36 ? 17.193  -1.592  1.027   1.00 0.00 ? 36  HIS A HD2  1  
ATOM   446   H  HE1  . HIS A 1 36 ? 17.409  2.448   2.109   1.00 0.00 ? 36  HIS A HE1  1  
ATOM   447   N  N    . THR A 1 37 ? 18.016  -3.397  -2.666  1.00 0.00 ? 37  THR A N    1  
ATOM   448   C  CA   . THR A 1 37 ? 18.064  -4.894  -2.582  1.00 0.00 ? 37  THR A CA   1  
ATOM   449   C  C    . THR A 1 37 ? 18.764  -5.568  -3.794  1.00 0.00 ? 37  THR A C    1  
ATOM   450   O  O    . THR A 1 37 ? 19.542  -6.510  -3.612  1.00 0.00 ? 37  THR A O    1  
ATOM   451   C  CB   . THR A 1 37 ? 16.641  -5.517  -2.372  1.00 0.00 ? 37  THR A CB   1  
ATOM   452   O  OG1  . THR A 1 37 ? 16.736  -6.908  -2.046  1.00 0.00 ? 37  THR A OG1  1  
ATOM   453   C  CG2  . THR A 1 37 ? 15.715  -5.333  -3.581  1.00 0.00 ? 37  THR A CG2  1  
ATOM   454   H  H    . THR A 1 37 ? 17.208  -2.961  -3.011  1.00 0.00 ? 37  THR A H    1  
ATOM   455   H  HA   . THR A 1 37 ? 18.644  -5.137  -1.694  1.00 0.00 ? 37  THR A HA   1  
ATOM   456   H  HB   . THR A 1 37 ? 16.184  -5.014  -1.525  1.00 0.00 ? 37  THR A HB   1  
ATOM   457   H  HG1  . THR A 1 37 ? 16.804  -7.429  -2.858  1.00 0.00 ? 37  THR A HG1  1  
ATOM   458   H  HG21 . THR A 1 37 ? 16.137  -5.830  -4.448  1.00 0.00 ? 37  THR A HG21 1  
ATOM   459   H  HG22 . THR A 1 37 ? 15.599  -4.279  -3.796  1.00 0.00 ? 37  THR A HG22 1  
ATOM   460   H  HG23 . THR A 1 37 ? 14.744  -5.760  -3.365  1.00 0.00 ? 37  THR A HG23 1  
ATOM   461   N  N    . GLY A 1 38 ? 18.500  -5.079  -5.019  1.00 0.00 ? 38  GLY A N    1  
ATOM   462   C  CA   . GLY A 1 38 ? 19.018  -5.689  -6.253  1.00 0.00 ? 38  GLY A CA   1  
ATOM   463   C  C    . GLY A 1 38 ? 17.973  -6.475  -7.050  1.00 0.00 ? 38  GLY A C    1  
ATOM   464   O  O    . GLY A 1 38 ? 18.058  -6.540  -8.282  1.00 0.00 ? 38  GLY A O    1  
ATOM   465   H  H    . GLY A 1 38 ? 17.997  -4.253  -5.109  1.00 0.00 ? 38  GLY A H    1  
ATOM   466   H  HA2  . GLY A 1 38 ? 19.404  -4.894  -6.878  1.00 0.00 ? 38  GLY A HA2  1  
ATOM   467   H  HA3  . GLY A 1 38 ? 19.839  -6.357  -6.015  1.00 0.00 ? 38  GLY A HA3  1  
ATOM   468   N  N    . GLU A 1 39 ? 16.991  -7.076  -6.353  1.00 0.00 ? 39  GLU A N    1  
ATOM   469   C  CA   . GLU A 1 39 ? 15.913  -7.858  -6.995  1.00 0.00 ? 39  GLU A CA   1  
ATOM   470   C  C    . GLU A 1 39 ? 14.782  -6.925  -7.456  1.00 0.00 ? 39  GLU A C    1  
ATOM   471   O  O    . GLU A 1 39 ? 14.349  -6.987  -8.606  1.00 0.00 ? 39  GLU A O    1  
ATOM   472   C  CB   . GLU A 1 39 ? 15.339  -8.929  -6.029  1.00 0.00 ? 39  GLU A CB   1  
ATOM   473   C  CG   . GLU A 1 39 ? 16.325  -10.015 -5.541  1.00 0.00 ? 39  GLU A CG   1  
ATOM   474   C  CD   . GLU A 1 39 ? 17.351  -9.515  -4.510  1.00 0.00 ? 39  GLU A CD   1  
ATOM   475   O  OE1  . GLU A 1 39 ? 17.030  -9.477  -3.307  1.00 0.00 ? 39  GLU A OE1  1  
ATOM   476   O  OE2  . GLU A 1 39 ? 18.481  -9.148  -4.898  1.00 0.00 ? 39  GLU A OE2  1  
ATOM   477   H  H    . GLU A 1 39 ? 17.021  -7.044  -5.376  1.00 0.00 ? 39  GLU A H    1  
ATOM   478   H  HA   . GLU A 1 39 ? 16.334  -8.360  -7.866  1.00 0.00 ? 39  GLU A HA   1  
ATOM   479   H  HB2  . GLU A 1 39 ? 14.941  -8.424  -5.157  1.00 0.00 ? 39  GLU A HB2  1  
ATOM   480   H  HB3  . GLU A 1 39 ? 14.515  -9.433  -6.529  1.00 0.00 ? 39  GLU A HB3  1  
ATOM   481   H  HG2  . GLU A 1 39 ? 15.749  -10.820 -5.090  1.00 0.00 ? 39  GLU A HG2  1  
ATOM   482   H  HG3  . GLU A 1 39 ? 16.854  -10.417 -6.402  1.00 0.00 ? 39  GLU A HG3  1  
ATOM   483   N  N    . LYS A 1 40 ? 14.326  -6.082  -6.506  1.00 0.00 ? 40  LYS A N    1  
ATOM   484   C  CA   . LYS A 1 40 ? 13.272  -5.068  -6.690  1.00 0.00 ? 40  LYS A CA   1  
ATOM   485   C  C    . LYS A 1 40 ? 11.888  -5.724  -6.946  1.00 0.00 ? 40  LYS A C    1  
ATOM   486   O  O    . LYS A 1 40 ? 11.612  -6.163  -8.071  1.00 0.00 ? 40  LYS A O    1  
ATOM   487   C  CB   . LYS A 1 40 ? 13.638  -4.047  -7.817  1.00 0.00 ? 40  LYS A CB   1  
ATOM   488   C  CG   . LYS A 1 40 ? 14.970  -3.282  -7.598  1.00 0.00 ? 40  LYS A CG   1  
ATOM   489   C  CD   . LYS A 1 40 ? 15.234  -2.219  -8.694  1.00 0.00 ? 40  LYS A CD   1  
ATOM   490   C  CE   . LYS A 1 40 ? 16.567  -1.467  -8.499  1.00 0.00 ? 40  LYS A CE   1  
ATOM   491   N  NZ   . LYS A 1 40 ? 16.756  -0.380  -9.498  1.00 0.00 ? 40  LYS A NZ   1  
ATOM   492   H  H    . LYS A 1 40 ? 14.711  -6.166  -5.619  1.00 0.00 ? 40  LYS A H    1  
ATOM   493   H  HA   . LYS A 1 40 ? 13.216  -4.523  -5.756  1.00 0.00 ? 40  LYS A HA   1  
ATOM   494   H  HB2  . LYS A 1 40 ? 13.712  -4.584  -8.756  1.00 0.00 ? 40  LYS A HB2  1  
ATOM   495   H  HB3  . LYS A 1 40 ? 12.833  -3.319  -7.897  1.00 0.00 ? 40  LYS A HB3  1  
ATOM   496   H  HG2  . LYS A 1 40 ? 14.928  -2.786  -6.632  1.00 0.00 ? 40  LYS A HG2  1  
ATOM   497   H  HG3  . LYS A 1 40 ? 15.787  -3.999  -7.593  1.00 0.00 ? 40  LYS A HG3  1  
ATOM   498   H  HD2  . LYS A 1 40 ? 15.246  -2.705  -9.663  1.00 0.00 ? 40  LYS A HD2  1  
ATOM   499   H  HD3  . LYS A 1 40 ? 14.418  -1.496  -8.679  1.00 0.00 ? 40  LYS A HD3  1  
ATOM   500   H  HE2  . LYS A 1 40 ? 16.581  -1.023  -7.514  1.00 0.00 ? 40  LYS A HE2  1  
ATOM   501   H  HE3  . LYS A 1 40 ? 17.386  -2.168  -8.589  1.00 0.00 ? 40  LYS A HE3  1  
ATOM   502   H  HZ1  . LYS A 1 40 ? 16.017  0.342   -9.386  1.00 0.00 ? 40  LYS A HZ1  1  
ATOM   503   H  HZ2  . LYS A 1 40 ? 16.703  -0.765  -10.462 1.00 0.00 ? 40  LYS A HZ2  1  
ATOM   504   H  HZ3  . LYS A 1 40 ? 17.688  0.071   -9.369  1.00 0.00 ? 40  LYS A HZ3  1  
ATOM   505   N  N    . PRO A 1 41 ? 11.003  -5.823  -5.893  1.00 0.00 ? 41  PRO A N    1  
ATOM   506   C  CA   . PRO A 1 41 ? 9.576   -6.245  -6.064  1.00 0.00 ? 41  PRO A CA   1  
ATOM   507   C  C    . PRO A 1 41 ? 8.735   -5.163  -6.801  1.00 0.00 ? 41  PRO A C    1  
ATOM   508   O  O    . PRO A 1 41 ? 9.255   -4.465  -7.678  1.00 0.00 ? 41  PRO A O    1  
ATOM   509   C  CB   . PRO A 1 41 ? 9.118   -6.489  -4.597  1.00 0.00 ? 41  PRO A CB   1  
ATOM   510   C  CG   . PRO A 1 41 ? 9.970   -5.564  -3.790  1.00 0.00 ? 41  PRO A CG   1  
ATOM   511   C  CD   . PRO A 1 41 ? 11.325  -5.567  -4.461  1.00 0.00 ? 41  PRO A CD   1  
ATOM   512   H  HA   . PRO A 1 41 ? 9.505   -7.175  -6.631  1.00 0.00 ? 41  PRO A HA   1  
ATOM   513   H  HB2  . PRO A 1 41 ? 8.063   -6.270  -4.481  1.00 0.00 ? 41  PRO A HB2  1  
ATOM   514   H  HB3  . PRO A 1 41 ? 9.296   -7.531  -4.328  1.00 0.00 ? 41  PRO A HB3  1  
ATOM   515   H  HG2  . PRO A 1 41 ? 9.543   -4.563  -3.793  1.00 0.00 ? 41  PRO A HG2  1  
ATOM   516   H  HG3  . PRO A 1 41 ? 10.051  -5.923  -2.769  1.00 0.00 ? 41  PRO A HG3  1  
ATOM   517   H  HD2  . PRO A 1 41 ? 11.807  -4.606  -4.339  1.00 0.00 ? 41  PRO A HD2  1  
ATOM   518   H  HD3  . PRO A 1 41 ? 11.957  -6.356  -4.060  1.00 0.00 ? 41  PRO A HD3  1  
ATOM   519   N  N    . LEU A 1 42 ? 7.430   -5.041  -6.477  1.00 0.00 ? 42  LEU A N    1  
ATOM   520   C  CA   . LEU A 1 42 ? 6.509   -4.127  -7.192  1.00 0.00 ? 42  LEU A CA   1  
ATOM   521   C  C    . LEU A 1 42 ? 5.727   -3.227  -6.216  1.00 0.00 ? 42  LEU A C    1  
ATOM   522   O  O    . LEU A 1 42 ? 4.929   -3.722  -5.413  1.00 0.00 ? 42  LEU A O    1  
ATOM   523   C  CB   . LEU A 1 42 ? 5.521   -4.965  -8.036  1.00 0.00 ? 42  LEU A CB   1  
ATOM   524   C  CG   . LEU A 1 42 ? 6.154   -5.829  -9.179  1.00 0.00 ? 42  LEU A CG   1  
ATOM   525   C  CD1  . LEU A 1 42 ? 5.099   -6.701  -9.885  1.00 0.00 ? 42  LEU A CD1  1  
ATOM   526   C  CD2  . LEU A 1 42 ? 6.906   -4.940  -10.198 1.00 0.00 ? 42  LEU A CD2  1  
ATOM   527   H  H    . LEU A 1 42 ? 7.069   -5.576  -5.744  1.00 0.00 ? 42  LEU A H    1  
ATOM   528   H  HA   . LEU A 1 42 ? 7.088   -3.492  -7.861  1.00 0.00 ? 42  LEU A HA   1  
ATOM   529   H  HB2  . LEU A 1 42 ? 4.979   -5.622  -7.349  1.00 0.00 ? 42  LEU A HB2  1  
ATOM   530   H  HB3  . LEU A 1 42 ? 4.799   -4.291  -8.486  1.00 0.00 ? 42  LEU A HB3  1  
ATOM   531   H  HG   . LEU A 1 42 ? 6.884   -6.504  -8.735  1.00 0.00 ? 42  LEU A HG   1  
ATOM   532   H  HD11 . LEU A 1 42 ? 5.573   -7.288  -10.662 1.00 0.00 ? 42  LEU A HD11 1  
ATOM   533   H  HD12 . LEU A 1 42 ? 4.332   -6.075  -10.326 1.00 0.00 ? 42  LEU A HD12 1  
ATOM   534   H  HD13 . LEU A 1 42 ? 4.643   -7.373  -9.169  1.00 0.00 ? 42  LEU A HD13 1  
ATOM   535   H  HD21 . LEU A 1 42 ? 6.223   -4.234  -10.650 1.00 0.00 ? 42  LEU A HD21 1  
ATOM   536   H  HD22 . LEU A 1 42 ? 7.343   -5.561  -10.969 1.00 0.00 ? 42  LEU A HD22 1  
ATOM   537   H  HD23 . LEU A 1 42 ? 7.699   -4.400  -9.694  1.00 0.00 ? 42  LEU A HD23 1  
ATOM   538   N  N    . GLN A 1 43 ? 5.947   -1.901  -6.317  1.00 0.00 ? 43  GLN A N    1  
ATOM   539   C  CA   . GLN A 1 43 ? 5.221   -0.886  -5.538  1.00 0.00 ? 43  GLN A CA   1  
ATOM   540   C  C    . GLN A 1 43 ? 4.273   -0.113  -6.468  1.00 0.00 ? 43  GLN A C    1  
ATOM   541   O  O    . GLN A 1 43 ? 4.604   0.156   -7.632  1.00 0.00 ? 43  GLN A O    1  
ATOM   542   C  CB   . GLN A 1 43 ? 6.200   0.125   -4.864  1.00 0.00 ? 43  GLN A CB   1  
ATOM   543   C  CG   . GLN A 1 43 ? 5.501   1.196   -3.984  1.00 0.00 ? 43  GLN A CG   1  
ATOM   544   C  CD   . GLN A 1 43 ? 6.416   2.323   -3.489  1.00 0.00 ? 43  GLN A CD   1  
ATOM   545   O  OE1  . GLN A 1 43 ? 7.612   2.139   -3.279  1.00 0.00 ? 43  GLN A OE1  1  
ATOM   546   N  NE2  . GLN A 1 43 ? 5.850   3.506   -3.306  1.00 0.00 ? 43  GLN A NE2  1  
ATOM   547   H  H    . GLN A 1 43 ? 6.599   -1.583  -6.968  1.00 0.00 ? 43  GLN A H    1  
ATOM   548   H  HA   . GLN A 1 43 ? 4.641   -1.388  -4.766  1.00 0.00 ? 43  GLN A HA   1  
ATOM   549   H  HB2  . GLN A 1 43 ? 6.891   -0.424  -4.240  1.00 0.00 ? 43  GLN A HB2  1  
ATOM   550   H  HB3  . GLN A 1 43 ? 6.765   0.637   -5.640  1.00 0.00 ? 43  GLN A HB3  1  
ATOM   551   H  HG2  . GLN A 1 43 ? 4.694   1.642   -4.558  1.00 0.00 ? 43  GLN A HG2  1  
ATOM   552   H  HG3  . GLN A 1 43 ? 5.074   0.700   -3.120  1.00 0.00 ? 43  GLN A HG3  1  
ATOM   553   H  HE21 . GLN A 1 43 ? 4.896   3.598   -3.500  1.00 0.00 ? 43  GLN A HE21 1  
ATOM   554   H  HE22 . GLN A 1 43 ? 6.408   4.239   -2.973  1.00 0.00 ? 43  GLN A HE22 1  
ATOM   555   N  N    . CYS A 1 44 ? 3.096   0.222   -5.930  1.00 0.00 ? 44  CYS A N    1  
ATOM   556   C  CA   . CYS A 1 44 ? 2.129   1.127   -6.544  1.00 0.00 ? 44  CYS A CA   1  
ATOM   557   C  C    . CYS A 1 44 ? 2.732   2.539   -6.645  1.00 0.00 ? 44  CYS A C    1  
ATOM   558   O  O    . CYS A 1 44 ? 2.961   3.204   -5.624  1.00 0.00 ? 44  CYS A O    1  
ATOM   559   C  CB   . CYS A 1 44 ? 0.845   1.126   -5.698  1.00 0.00 ? 44  CYS A CB   1  
ATOM   560   S  SG   . CYS A 1 44 ? -0.393  2.408   -6.107  1.00 0.00 ? 44  CYS A SG   1  
ATOM   561   H  H    . CYS A 1 44 ? 2.871   -0.165  -5.072  1.00 0.00 ? 44  CYS A H    1  
ATOM   562   H  HA   . CYS A 1 44 ? 1.898   0.757   -7.540  1.00 0.00 ? 44  CYS A HA   1  
ATOM   563   H  HB2  . CYS A 1 44 ? 0.347   0.173   -5.808  1.00 0.00 ? 44  CYS A HB2  1  
ATOM   564   H  HB3  . CYS A 1 44 ? 1.109   1.249   -4.648  1.00 0.00 ? 44  CYS A HB3  1  
ATOM   565   N  N    . GLU A 1 45 ? 2.983   2.969   -7.895  1.00 0.00 ? 45  GLU A N    1  
ATOM   566   C  CA   . GLU A 1 45 ? 3.676   4.240   -8.237  1.00 0.00 ? 45  GLU A CA   1  
ATOM   567   C  C    . GLU A 1 45 ? 2.719   5.467   -8.132  1.00 0.00 ? 45  GLU A C    1  
ATOM   568   O  O    . GLU A 1 45 ? 2.898   6.490   -8.798  1.00 0.00 ? 45  GLU A O    1  
ATOM   569   C  CB   . GLU A 1 45 ? 4.255   4.082   -9.685  1.00 0.00 ? 45  GLU A CB   1  
ATOM   570   C  CG   . GLU A 1 45 ? 5.258   5.165   -10.162 1.00 0.00 ? 45  GLU A CG   1  
ATOM   571   C  CD   . GLU A 1 45 ? 6.606   5.141   -9.422  1.00 0.00 ? 45  GLU A CD   1  
ATOM   572   O  OE1  . GLU A 1 45 ? 6.723   5.759   -8.338  1.00 0.00 ? 45  GLU A OE1  1  
ATOM   573   O  OE2  . GLU A 1 45 ? 7.563   4.501   -9.921  1.00 0.00 ? 45  GLU A OE2  1  
ATOM   574   H  H    . GLU A 1 45 ? 2.717   2.384   -8.635  1.00 0.00 ? 45  GLU A H    1  
ATOM   575   H  HA   . GLU A 1 45 ? 4.496   4.374   -7.540  1.00 0.00 ? 45  GLU A HA   1  
ATOM   576   H  HB2  . GLU A 1 45 ? 4.756   3.124   -9.748  1.00 0.00 ? 45  GLU A HB2  1  
ATOM   577   H  HB3  . GLU A 1 45 ? 3.421   4.067   -10.382 1.00 0.00 ? 45  GLU A HB3  1  
ATOM   578   H  HG2  . GLU A 1 45 ? 5.437   5.020   -11.224 1.00 0.00 ? 45  GLU A HG2  1  
ATOM   579   H  HG3  . GLU A 1 45 ? 4.804   6.143   -10.025 1.00 0.00 ? 45  GLU A HG3  1  
ATOM   580   N  N    . ILE A 1 46 ? 1.719   5.375   -7.240  1.00 0.00 ? 46  ILE A N    1  
ATOM   581   C  CA   . ILE A 1 46 ? 0.640   6.371   -7.088  1.00 0.00 ? 46  ILE A CA   1  
ATOM   582   C  C    . ILE A 1 46 ? 0.684   6.937   -5.647  1.00 0.00 ? 46  ILE A C    1  
ATOM   583   O  O    . ILE A 1 46 ? 0.213   8.041   -5.370  1.00 0.00 ? 46  ILE A O    1  
ATOM   584   C  CB   . ILE A 1 46 ? -0.780  5.707   -7.335  1.00 0.00 ? 46  ILE A CB   1  
ATOM   585   C  CG1  . ILE A 1 46 ? -1.034  5.351   -8.846  1.00 0.00 ? 46  ILE A CG1  1  
ATOM   586   C  CG2  . ILE A 1 46 ? -1.936  6.583   -6.784  1.00 0.00 ? 46  ILE A CG2  1  
ATOM   587   C  CD1  . ILE A 1 46 ? -0.299  4.139   -9.382  1.00 0.00 ? 46  ILE A CD1  1  
ATOM   588   H  H    . ILE A 1 46 ? 1.720   4.652   -6.589  1.00 0.00 ? 46  ILE A H    1  
ATOM   589   H  HA   . ILE A 1 46 ? 0.786   7.181   -7.807  1.00 0.00 ? 46  ILE A HA   1  
ATOM   590   H  HB   . ILE A 1 46 ? -0.784  4.783   -6.762  1.00 0.00 ? 46  ILE A HB   1  
ATOM   591   H  HG12 . ILE A 1 46 ? -2.087  5.155   -8.995  1.00 0.00 ? 46  ILE A HG12 1  
ATOM   592   H  HG13 . ILE A 1 46 ? -0.753  6.197   -9.461  1.00 0.00 ? 46  ILE A HG13 1  
ATOM   593   H  HG21 . ILE A 1 46 ? -1.843  6.659   -5.705  1.00 0.00 ? 46  ILE A HG21 1  
ATOM   594   H  HG22 . ILE A 1 46 ? -2.890  6.136   -7.026  1.00 0.00 ? 46  ILE A HG22 1  
ATOM   595   H  HG23 . ILE A 1 46 ? -1.887  7.575   -7.218  1.00 0.00 ? 46  ILE A HG23 1  
ATOM   596   H  HD11 . ILE A 1 46 ? -0.558  3.267   -8.799  1.00 0.00 ? 46  ILE A HD11 1  
ATOM   597   H  HD12 . ILE A 1 46 ? 0.765   4.308   -9.329  1.00 0.00 ? 46  ILE A HD12 1  
ATOM   598   H  HD13 . ILE A 1 46 ? -0.583  3.976   -10.413 1.00 0.00 ? 46  ILE A HD13 1  
ATOM   599   N  N    . CYS A 1 47 ? 1.401   6.222   -4.772  1.00 0.00 ? 47  CYS A N    1  
ATOM   600   C  CA   . CYS A 1 47 ? 1.194   6.278   -3.339  1.00 0.00 ? 47  CYS A CA   1  
ATOM   601   C  C    . CYS A 1 47 ? 2.309   5.379   -2.785  1.00 0.00 ? 47  CYS A C    1  
ATOM   602   O  O    . CYS A 1 47 ? 3.469   5.497   -3.222  1.00 0.00 ? 47  CYS A O    1  
ATOM   603   C  CB   . CYS A 1 47 ? -0.297  5.871   -2.939  1.00 0.00 ? 47  CYS A CB   1  
ATOM   604   S  SG   . CYS A 1 47 ? -0.636  4.084   -2.681  1.00 0.00 ? 47  CYS A SG   1  
ATOM   605   H  H    . CYS A 1 47 ? 2.257   5.873   -5.070  1.00 0.00 ? 47  CYS A H    1  
ATOM   606   H  HA   . CYS A 1 47 ? 1.396   7.296   -3.013  1.00 0.00 ? 47  CYS A HA   1  
ATOM   607   H  HB2  . CYS A 1 47 ? -0.552  6.358   -2.011  1.00 0.00 ? 47  CYS A HB2  1  
ATOM   608   H  HB3  . CYS A 1 47 ? -0.980  6.232   -3.704  1.00 0.00 ? 47  CYS A HB3  1  
ATOM   609   N  N    . GLY A 1 48 ? 2.003   4.506   -1.859  1.00 0.00 ? 48  GLY A N    1  
ATOM   610   C  CA   . GLY A 1 48 ? 2.922   3.461   -1.418  1.00 0.00 ? 48  GLY A CA   1  
ATOM   611   C  C    . GLY A 1 48 ? 2.126   2.218   -1.061  1.00 0.00 ? 48  GLY A C    1  
ATOM   612   O  O    . GLY A 1 48 ? 1.145   2.355   -0.318  1.00 0.00 ? 48  GLY A O    1  
ATOM   613   H  H    . GLY A 1 48 ? 1.104   4.468   -1.536  1.00 0.00 ? 48  GLY A H    1  
ATOM   614   H  HA2  . GLY A 1 48 ? 3.621   3.240   -2.228  1.00 0.00 ? 48  GLY A HA2  1  
ATOM   615   H  HA3  . GLY A 1 48 ? 3.466   3.801   -0.549  1.00 0.00 ? 48  GLY A HA3  1  
ATOM   616   N  N    . PHE A 1 49 ? 2.505   1.017   -1.545  1.00 0.00 ? 49  PHE A N    1  
ATOM   617   C  CA   . PHE A 1 49 ? 1.766   -0.231  -1.354  1.00 0.00 ? 49  PHE A CA   1  
ATOM   618   C  C    . PHE A 1 49 ? 2.595   -1.215  -2.164  1.00 0.00 ? 49  PHE A C    1  
ATOM   619   O  O    . PHE A 1 49 ? 2.635   -1.095  -3.389  1.00 0.00 ? 49  PHE A O    1  
ATOM   620   C  CB   . PHE A 1 49 ? 0.298   -0.178  -1.884  1.00 0.00 ? 49  PHE A CB   1  
ATOM   621   C  CG   . PHE A 1 49 ? -0.487  -1.494  -1.743  1.00 0.00 ? 49  PHE A CG   1  
ATOM   622   C  CD1  . PHE A 1 49 ? -0.369  -2.512  -2.697  1.00 0.00 ? 49  PHE A CD1  1  
ATOM   623   C  CD2  . PHE A 1 49 ? -1.336  -1.713  -0.660  1.00 0.00 ? 49  PHE A CD2  1  
ATOM   624   C  CE1  . PHE A 1 49 ? -1.079  -3.694  -2.576  1.00 0.00 ? 49  PHE A CE1  1  
ATOM   625   C  CE2  . PHE A 1 49 ? -2.047  -2.894  -0.539  1.00 0.00 ? 49  PHE A CE2  1  
ATOM   626   C  CZ   . PHE A 1 49 ? -1.913  -3.886  -1.492  1.00 0.00 ? 49  PHE A CZ   1  
ATOM   627   H  H    . PHE A 1 49 ? 3.378   0.834   -1.964  1.00 0.00 ? 49  PHE A H    1  
ATOM   628   H  HA   . PHE A 1 49 ? 1.791   -0.494  -0.301  1.00 0.00 ? 49  PHE A HA   1  
ATOM   629   H  HB2  . PHE A 1 49 ? -0.240  0.590   -1.339  1.00 0.00 ? 49  PHE A HB2  1  
ATOM   630   H  HB3  . PHE A 1 49 ? 0.311   0.094   -2.932  1.00 0.00 ? 49  PHE A HB3  1  
ATOM   631   H  HD1  . PHE A 1 49 ? 0.289   -2.361  -3.547  1.00 0.00 ? 49  PHE A HD1  1  
ATOM   632   H  HD2  . PHE A 1 49 ? -1.447  -0.942  0.090   1.00 0.00 ? 49  PHE A HD2  1  
ATOM   633   H  HE1  . PHE A 1 49 ? -0.971  -4.472  -3.324  1.00 0.00 ? 49  PHE A HE1  1  
ATOM   634   H  HE2  . PHE A 1 49 ? -2.703  -3.046  0.308   1.00 0.00 ? 49  PHE A HE2  1  
ATOM   635   H  HZ   . PHE A 1 49 ? -2.470  -4.811  -1.393  1.00 0.00 ? 49  PHE A HZ   1  
ATOM   636   N  N    . THR A 1 50 ? 3.238   -2.181  -1.524  1.00 0.00 ? 50  THR A N    1  
ATOM   637   C  CA   . THR A 1 50 ? 4.262   -2.985  -2.170  1.00 0.00 ? 50  THR A CA   1  
ATOM   638   C  C    . THR A 1 50 ? 3.944   -4.461  -1.950  1.00 0.00 ? 50  THR A C    1  
ATOM   639   O  O    . THR A 1 50 ? 3.517   -4.864  -0.855  1.00 0.00 ? 50  THR A O    1  
ATOM   640   C  CB   . THR A 1 50 ? 5.681   -2.644  -1.620  1.00 0.00 ? 50  THR A CB   1  
ATOM   641   O  OG1  . THR A 1 50 ? 5.807   -1.217  -1.468  1.00 0.00 ? 50  THR A OG1  1  
ATOM   642   C  CG2  . THR A 1 50 ? 6.794   -3.154  -2.561  1.00 0.00 ? 50  THR A CG2  1  
ATOM   643   H  H    . THR A 1 50 ? 3.005   -2.392  -0.610  1.00 0.00 ? 50  THR A H    1  
ATOM   644   H  HA   . THR A 1 50 ? 4.251   -2.753  -3.240  1.00 0.00 ? 50  THR A HA   1  
ATOM   645   H  HB   . THR A 1 50 ? 5.803   -3.114  -0.656  1.00 0.00 ? 50  THR A HB   1  
ATOM   646   H  HG1  . THR A 1 50 ? 6.573   -0.912  -1.960  1.00 0.00 ? 50  THR A HG1  1  
ATOM   647   H  HG21 . THR A 1 50 ? 7.765   -2.882  -2.165  1.00 0.00 ? 50  THR A HG21 1  
ATOM   648   H  HG22 . THR A 1 50 ? 6.674   -2.713  -3.542  1.00 0.00 ? 50  THR A HG22 1  
ATOM   649   H  HG23 . THR A 1 50 ? 6.734   -4.233  -2.647  1.00 0.00 ? 50  THR A HG23 1  
ATOM   650   N  N    . CYS A 1 51 ? 4.160   -5.246  -2.993  1.00 0.00 ? 51  CYS A N    1  
ATOM   651   C  CA   . CYS A 1 51 ? 3.805   -6.667  -3.021  1.00 0.00 ? 51  CYS A CA   1  
ATOM   652   C  C    . CYS A 1 51 ? 4.698   -7.442  -3.999  1.00 0.00 ? 51  CYS A C    1  
ATOM   653   O  O    . CYS A 1 51 ? 5.409   -6.852  -4.827  1.00 0.00 ? 51  CYS A O    1  
ATOM   654   C  CB   . CYS A 1 51 ? 2.323   -6.799  -3.405  1.00 0.00 ? 51  CYS A CB   1  
ATOM   655   S  SG   . CYS A 1 51 ? 1.907   -5.968  -4.945  1.00 0.00 ? 51  CYS A SG   1  
ATOM   656   H  H    . CYS A 1 51 ? 4.557   -4.837  -3.786  1.00 0.00 ? 51  CYS A H    1  
ATOM   657   H  HA   . CYS A 1 51 ? 3.951   -7.079  -2.028  1.00 0.00 ? 51  CYS A HA   1  
ATOM   658   H  HB2  . CYS A 1 51 ? 2.065   -7.842  -3.516  1.00 0.00 ? 51  CYS A HB2  1  
ATOM   659   H  HB3  . CYS A 1 51 ? 1.713   -6.364  -2.625  1.00 0.00 ? 51  CYS A HB3  1  
ATOM   660   H  HG   . CYS A 1 51 ? 3.018   -5.429  -5.429  1.00 0.00 ? 51  CYS A HG   1  
ATOM   661   N  N    . ARG A 1 52 ? 4.646   -8.776  -3.877  1.00 0.00 ? 52  ARG A N    1  
ATOM   662   C  CA   . ARG A 1 52 ? 5.485   -9.703  -4.646  1.00 0.00 ? 52  ARG A CA   1  
ATOM   663   C  C    . ARG A 1 52 ? 4.813   -10.090 -5.982  1.00 0.00 ? 52  ARG A C    1  
ATOM   664   O  O    . ARG A 1 52 ? 5.504   -10.349 -6.970  1.00 0.00 ? 52  ARG A O    1  
ATOM   665   C  CB   . ARG A 1 52 ? 5.768   -10.961 -3.774  1.00 0.00 ? 52  ARG A CB   1  
ATOM   666   C  CG   . ARG A 1 52 ? 4.502   -11.775 -3.391  1.00 0.00 ? 52  ARG A CG   1  
ATOM   667   C  CD   . ARG A 1 52 ? 4.721   -12.754 -2.225  1.00 0.00 ? 52  ARG A CD   1  
ATOM   668   N  NE   . ARG A 1 52 ? 5.823   -13.694 -2.461  1.00 0.00 ? 52  ARG A NE   1  
ATOM   669   C  CZ   . ARG A 1 52 ? 6.026   -14.832 -1.783  1.00 0.00 ? 52  ARG A CZ   1  
ATOM   670   N  NH1  . ARG A 1 52 ? 5.126   -15.289 -0.916  1.00 0.00 ? 52  ARG A NH1  1  
ATOM   671   N  NH2  . ARG A 1 52 ? 7.116   -15.523 -2.015  1.00 0.00 ? 52  ARG A NH2  1  
ATOM   672   H  H    . ARG A 1 52 ? 4.016   -9.154  -3.227  1.00 0.00 ? 52  ARG A H    1  
ATOM   673   H  HA   . ARG A 1 52 ? 6.431   -9.206  -4.856  1.00 0.00 ? 52  ARG A HA   1  
ATOM   674   H  HB2  . ARG A 1 52 ? 6.449   -11.616 -4.314  1.00 0.00 ? 52  ARG A HB2  1  
ATOM   675   H  HB3  . ARG A 1 52 ? 6.260   -10.638 -2.862  1.00 0.00 ? 52  ARG A HB3  1  
ATOM   676   H  HG2  . ARG A 1 52 ? 3.719   -11.082 -3.112  1.00 0.00 ? 52  ARG A HG2  1  
ATOM   677   H  HG3  . ARG A 1 52 ? 4.176   -12.336 -4.264  1.00 0.00 ? 52  ARG A HG3  1  
ATOM   678   H  HD2  . ARG A 1 52 ? 4.942   -12.186 -1.325  1.00 0.00 ? 52  ARG A HD2  1  
ATOM   679   H  HD3  . ARG A 1 52 ? 3.804   -13.316 -2.071  1.00 0.00 ? 52  ARG A HD3  1  
ATOM   680   H  HE   . ARG A 1 52 ? 6.492   -13.437 -3.141  1.00 0.00 ? 52  ARG A HE   1  
ATOM   681   H  HH11 . ARG A 1 52 ? 4.275   -14.781 -0.749  1.00 0.00 ? 52  ARG A HH11 1  
ATOM   682   H  HH12 . ARG A 1 52 ? 5.301   -16.141 -0.416  1.00 0.00 ? 52  ARG A HH12 1  
ATOM   683   H  HH21 . ARG A 1 52 ? 7.791   -15.194 -2.686  1.00 0.00 ? 52  ARG A HH21 1  
ATOM   684   H  HH22 . ARG A 1 52 ? 7.286   -16.377 -1.515  1.00 0.00 ? 52  ARG A HH22 1  
ATOM   685   N  N    . GLN A 1 53 ? 3.462   -10.126 -5.998  1.00 0.00 ? 53  GLN A N    1  
ATOM   686   C  CA   . GLN A 1 53 ? 2.664   -10.569 -7.168  1.00 0.00 ? 53  GLN A CA   1  
ATOM   687   C  C    . GLN A 1 53 ? 2.126   -9.325  -7.915  1.00 0.00 ? 53  GLN A C    1  
ATOM   688   O  O    . GLN A 1 53 ? 1.701   -8.354  -7.282  1.00 0.00 ? 53  GLN A O    1  
ATOM   689   C  CB   . GLN A 1 53 ? 1.511   -11.522 -6.691  1.00 0.00 ? 53  GLN A CB   1  
ATOM   690   C  CG   . GLN A 1 53 ? 1.149   -12.678 -7.653  1.00 0.00 ? 53  GLN A CG   1  
ATOM   691   C  CD   . GLN A 1 53 ? 0.380   -12.254 -8.902  1.00 0.00 ? 53  GLN A CD   1  
ATOM   692   O  OE1  . GLN A 1 53 ? 0.969   -11.905 -9.925  1.00 0.00 ? 53  GLN A OE1  1  
ATOM   693   N  NE2  . GLN A 1 53 ? -0.943  -12.299 -8.834  1.00 0.00 ? 53  GLN A NE2  1  
ATOM   694   H  H    . GLN A 1 53 ? 2.983   -9.838  -5.193  1.00 0.00 ? 53  GLN A H    1  
ATOM   695   H  HA   . GLN A 1 53 ? 3.324   -11.119 -7.838  1.00 0.00 ? 53  GLN A HA   1  
ATOM   696   H  HB2  . GLN A 1 53 ? 1.806   -11.970 -5.747  1.00 0.00 ? 53  GLN A HB2  1  
ATOM   697   H  HB3  . GLN A 1 53 ? 0.614   -10.937 -6.511  1.00 0.00 ? 53  GLN A HB3  1  
ATOM   698   H  HG2  . GLN A 1 53 ? 2.065   -13.162 -7.968  1.00 0.00 ? 53  GLN A HG2  1  
ATOM   699   H  HG3  . GLN A 1 53 ? 0.550   -13.404 -7.109  1.00 0.00 ? 53  GLN A HG3  1  
ATOM   700   H  HE21 . GLN A 1 53 ? -1.358  -12.593 -7.992  1.00 0.00 ? 53  GLN A HE21 1  
ATOM   701   H  HE22 . GLN A 1 53 ? -1.453  -12.058 -9.633  1.00 0.00 ? 53  GLN A HE22 1  
ATOM   702   N  N    . LYS A 1 54 ? 2.178   -9.359  -9.265  1.00 0.00 ? 54  LYS A N    1  
ATOM   703   C  CA   . LYS A 1 54 ? 1.822   -8.203  -10.112 1.00 0.00 ? 54  LYS A CA   1  
ATOM   704   C  C    . LYS A 1 54 ? 0.345   -7.786  -9.985  1.00 0.00 ? 54  LYS A C    1  
ATOM   705   O  O    . LYS A 1 54 ? 0.042   -6.597  -10.044 1.00 0.00 ? 54  LYS A O    1  
ATOM   706   C  CB   . LYS A 1 54 ? 2.260   -8.438  -11.594 1.00 0.00 ? 54  LYS A CB   1  
ATOM   707   C  CG   . LYS A 1 54 ? 1.716   -9.712  -12.320 1.00 0.00 ? 54  LYS A CG   1  
ATOM   708   C  CD   . LYS A 1 54 ? 0.277   -9.574  -12.892 1.00 0.00 ? 54  LYS A CD   1  
ATOM   709   C  CE   . LYS A 1 54 ? 0.127   -8.389  -13.867 1.00 0.00 ? 54  LYS A CE   1  
ATOM   710   N  NZ   . LYS A 1 54 ? 1.078   -8.455  -15.005 1.00 0.00 ? 54  LYS A NZ   1  
ATOM   711   H  H    . LYS A 1 54 ? 2.518   -10.174 -9.691  1.00 0.00 ? 54  LYS A H    1  
ATOM   712   H  HA   . LYS A 1 54 ? 2.414   -7.372  -9.729  1.00 0.00 ? 54  LYS A HA   1  
ATOM   713   H  HB2  . LYS A 1 54 ? 1.981   -7.571  -12.176 1.00 0.00 ? 54  LYS A HB2  1  
ATOM   714   H  HB3  . LYS A 1 54 ? 3.347   -8.498  -11.604 1.00 0.00 ? 54  LYS A HB3  1  
ATOM   715   H  HG2  . LYS A 1 54 ? 2.385   -9.954  -13.141 1.00 0.00 ? 54  LYS A HG2  1  
ATOM   716   H  HG3  . LYS A 1 54 ? 1.731   -10.536 -11.614 1.00 0.00 ? 54  LYS A HG3  1  
ATOM   717   H  HD2  . LYS A 1 54 ? 0.015   -10.490 -13.412 1.00 0.00 ? 54  LYS A HD2  1  
ATOM   718   H  HD3  . LYS A 1 54 ? -0.413  -9.434  -12.066 1.00 0.00 ? 54  LYS A HD3  1  
ATOM   719   H  HE2  . LYS A 1 54 ? -0.878  -8.387  -14.263 1.00 0.00 ? 54  LYS A HE2  1  
ATOM   720   H  HE3  . LYS A 1 54 ? 0.296   -7.467  -13.326 1.00 0.00 ? 54  LYS A HE3  1  
ATOM   721   H  HZ1  . LYS A 1 54 ? 2.057   -8.433  -14.659 1.00 0.00 ? 54  LYS A HZ1  1  
ATOM   722   H  HZ2  . LYS A 1 54 ? 0.928   -7.645  -15.639 1.00 0.00 ? 54  LYS A HZ2  1  
ATOM   723   H  HZ3  . LYS A 1 54 ? 0.934   -9.331  -15.546 1.00 0.00 ? 54  LYS A HZ3  1  
ATOM   724   N  N    . ALA A 1 55 ? -0.556  -8.765  -9.822  1.00 0.00 ? 55  ALA A N    1  
ATOM   725   C  CA   . ALA A 1 55 ? -2.013  -8.496  -9.707  1.00 0.00 ? 55  ALA A CA   1  
ATOM   726   C  C    . ALA A 1 55 ? -2.384  -7.683  -8.437  1.00 0.00 ? 55  ALA A C    1  
ATOM   727   O  O    . ALA A 1 55 ? -3.190  -6.745  -8.517  1.00 0.00 ? 55  ALA A O    1  
ATOM   728   C  CB   . ALA A 1 55 ? -2.804  -9.804  -9.764  1.00 0.00 ? 55  ALA A CB   1  
ATOM   729   H  H    . ALA A 1 55 ? -0.223  -9.687  -9.860  1.00 0.00 ? 55  ALA A H    1  
ATOM   730   H  HA   . ALA A 1 55 ? -2.299  -7.911  -10.581 1.00 0.00 ? 55  ALA A HA   1  
ATOM   731   H  HB1  . ALA A 1 55 ? -2.560  -10.417 -8.906  1.00 0.00 ? 55  ALA A HB1  1  
ATOM   732   H  HB2  . ALA A 1 55 ? -2.551  -10.346 -10.670 1.00 0.00 ? 55  ALA A HB2  1  
ATOM   733   H  HB3  . ALA A 1 55 ? -3.865  -9.592  -9.764  1.00 0.00 ? 55  ALA A HB3  1  
ATOM   734   N  N    . SER A 1 56 ? -1.781  -8.042  -7.285  1.00 0.00 ? 56  SER A N    1  
ATOM   735   C  CA   . SER A 1 56 ? -2.137  -7.448  -5.967  1.00 0.00 ? 56  SER A CA   1  
ATOM   736   C  C    . SER A 1 56 ? -2.033  -5.895  -5.940  1.00 0.00 ? 56  SER A C    1  
ATOM   737   O  O    . SER A 1 56 ? -2.969  -5.224  -5.477  1.00 0.00 ? 56  SER A O    1  
ATOM   738   C  CB   . SER A 1 56 ? -1.328  -8.113  -4.824  1.00 0.00 ? 56  SER A CB   1  
ATOM   739   O  OG   . SER A 1 56 ? 0.013   -8.345  -5.197  1.00 0.00 ? 56  SER A OG   1  
ATOM   740   H  H    . SER A 1 56 ? -1.109  -8.749  -7.326  1.00 0.00 ? 56  SER A H    1  
ATOM   741   H  HA   . SER A 1 56 ? -3.186  -7.694  -5.807  1.00 0.00 ? 56  SER A HA   1  
ATOM   742   H  HB2  . SER A 1 56 ? -1.328  -7.481  -3.946  1.00 0.00 ? 56  SER A HB2  1  
ATOM   743   H  HB3  . SER A 1 56 ? -1.776  -9.066  -4.572  1.00 0.00 ? 56  SER A HB3  1  
ATOM   744   H  HG   . SER A 1 56 ? 0.366   -7.572  -5.647  1.00 0.00 ? 56  SER A HG   1  
ATOM   745   N  N    . LEU A 1 57 ? -0.916  -5.314  -6.437  1.00 0.00 ? 57  LEU A N    1  
ATOM   746   C  CA   . LEU A 1 57 ? -0.798  -3.849  -6.568  1.00 0.00 ? 57  LEU A CA   1  
ATOM   747   C  C    . LEU A 1 57 ? -1.598  -3.337  -7.775  1.00 0.00 ? 57  LEU A C    1  
ATOM   748   O  O    . LEU A 1 57 ? -2.160  -2.256  -7.696  1.00 0.00 ? 57  LEU A O    1  
ATOM   749   C  CB   . LEU A 1 57 ? 0.677   -3.356  -6.671  1.00 0.00 ? 57  LEU A CB   1  
ATOM   750   C  CG   . LEU A 1 57 ? 1.433   -3.650  -8.014  1.00 0.00 ? 57  LEU A CG   1  
ATOM   751   C  CD1  . LEU A 1 57 ? 2.579   -2.649  -8.250  1.00 0.00 ? 57  LEU A CD1  1  
ATOM   752   C  CD2  . LEU A 1 57 ? 1.953   -5.097  -8.067  1.00 0.00 ? 57  LEU A CD2  1  
ATOM   753   H  H    . LEU A 1 57 ? -0.174  -5.874  -6.711  1.00 0.00 ? 57  LEU A H    1  
ATOM   754   H  HA   . LEU A 1 57 ? -1.242  -3.416  -5.672  1.00 0.00 ? 57  LEU A HA   1  
ATOM   755   H  HB2  . LEU A 1 57 ? 0.669   -2.289  -6.512  1.00 0.00 ? 57  LEU A HB2  1  
ATOM   756   H  HB3  . LEU A 1 57 ? 1.240   -3.803  -5.859  1.00 0.00 ? 57  LEU A HB3  1  
ATOM   757   H  HG   . LEU A 1 57 ? 0.736   -3.527  -8.839  1.00 0.00 ? 57  LEU A HG   1  
ATOM   758   H  HD11 . LEU A 1 57 ? 3.316   -2.736  -7.460  1.00 0.00 ? 57  LEU A HD11 1  
ATOM   759   H  HD12 . LEU A 1 57 ? 2.185   -1.641  -8.263  1.00 0.00 ? 57  LEU A HD12 1  
ATOM   760   H  HD13 . LEU A 1 57 ? 3.047   -2.856  -9.203  1.00 0.00 ? 57  LEU A HD13 1  
ATOM   761   H  HD21 . LEU A 1 57 ? 2.439   -5.273  -9.017  1.00 0.00 ? 57  LEU A HD21 1  
ATOM   762   H  HD22 . LEU A 1 57 ? 1.126   -5.790  -7.961  1.00 0.00 ? 57  LEU A HD22 1  
ATOM   763   H  HD23 . LEU A 1 57 ? 2.664   -5.263  -7.266  1.00 0.00 ? 57  LEU A HD23 1  
ATOM   764   N  N    . ASN A 1 58 ? -1.610  -4.106  -8.891  1.00 0.00 ? 58  ASN A N    1  
ATOM   765   C  CA   . ASN A 1 58 ? -2.277  -3.712  -10.160 1.00 0.00 ? 58  ASN A CA   1  
ATOM   766   C  C    . ASN A 1 58 ? -3.742  -3.309  -9.967  1.00 0.00 ? 58  ASN A C    1  
ATOM   767   O  O    . ASN A 1 58 ? -4.193  -2.280  -10.494 1.00 0.00 ? 58  ASN A O    1  
ATOM   768   C  CB   . ASN A 1 58 ? -2.161  -4.860  -11.197 1.00 0.00 ? 58  ASN A CB   1  
ATOM   769   C  CG   . ASN A 1 58 ? -2.960  -4.647  -12.488 1.00 0.00 ? 58  ASN A CG   1  
ATOM   770   O  OD1  . ASN A 1 58 ? -2.473  -4.030  -13.438 1.00 0.00 ? 58  ASN A OD1  1  
ATOM   771   N  ND2  . ASN A 1 58 ? -4.187  -5.158  -12.531 1.00 0.00 ? 58  ASN A ND2  1  
ATOM   772   H  H    . ASN A 1 58 ? -1.109  -4.950  -8.888  1.00 0.00 ? 58  ASN A H    1  
ATOM   773   H  HA   . ASN A 1 58 ? -1.742  -2.859  -10.535 1.00 0.00 ? 58  ASN A HA   1  
ATOM   774   H  HB2  . ASN A 1 58 ? -1.116  -4.976  -11.466 1.00 0.00 ? 58  ASN A HB2  1  
ATOM   775   H  HB3  . ASN A 1 58 ? -2.494  -5.783  -10.734 1.00 0.00 ? 58  ASN A HB3  1  
ATOM   776   H  HD21 . ASN A 1 58 ? -4.523  -5.633  -11.742 1.00 0.00 ? 58  ASN A HD21 1  
ATOM   777   H  HD22 . ASN A 1 58 ? -4.704  -5.047  -13.353 1.00 0.00 ? 58  ASN A HD22 1  
ATOM   778   N  N    . TRP A 1 59 ? -4.464  -4.103  -9.182  1.00 0.00 ? 59  TRP A N    1  
ATOM   779   C  CA   . TRP A 1 59 ? -5.893  -3.880  -8.951  1.00 0.00 ? 59  TRP A CA   1  
ATOM   780   C  C    . TRP A 1 59 ? -6.081  -2.799  -7.892  1.00 0.00 ? 59  TRP A C    1  
ATOM   781   O  O    . TRP A 1 59 ? -7.034  -2.028  -7.962  1.00 0.00 ? 59  TRP A O    1  
ATOM   782   C  CB   . TRP A 1 59 ? -6.625  -5.173  -8.565  1.00 0.00 ? 59  TRP A CB   1  
ATOM   783   C  CG   . TRP A 1 59 ? -6.687  -6.176  -9.690  1.00 0.00 ? 59  TRP A CG   1  
ATOM   784   C  CD1  . TRP A 1 59 ? -5.928  -7.299  -9.847  1.00 0.00 ? 59  TRP A CD1  1  
ATOM   785   C  CD2  . TRP A 1 59 ? -7.555  -6.115  -10.834 1.00 0.00 ? 59  TRP A CD2  1  
ATOM   786   N  NE1  . TRP A 1 59 ? -6.297  -7.959  -10.987 1.00 0.00 ? 59  TRP A NE1  1  
ATOM   787   C  CE2  . TRP A 1 59 ? -7.287  -7.250  -11.617 1.00 0.00 ? 59  TRP A CE2  1  
ATOM   788   C  CE3  . TRP A 1 59 ? -8.538  -5.218  -11.267 1.00 0.00 ? 59  TRP A CE3  1  
ATOM   789   C  CZ2  . TRP A 1 59 ? -7.969  -7.521  -12.801 1.00 0.00 ? 59  TRP A CZ2  1  
ATOM   790   C  CZ3  . TRP A 1 59 ? -9.213  -5.484  -12.447 1.00 0.00 ? 59  TRP A CZ3  1  
ATOM   791   C  CH2  . TRP A 1 59 ? -8.925  -6.627  -13.201 1.00 0.00 ? 59  TRP A CH2  1  
ATOM   792   H  H    . TRP A 1 59 ? -4.009  -4.779  -8.646  1.00 0.00 ? 59  TRP A H    1  
ATOM   793   H  HA   . TRP A 1 59 ? -6.323  -3.508  -9.884  1.00 0.00 ? 59  TRP A HA   1  
ATOM   794   H  HB2  . TRP A 1 59 ? -6.130  -5.628  -7.717  1.00 0.00 ? 59  TRP A HB2  1  
ATOM   795   H  HB3  . TRP A 1 59 ? -7.647  -4.927  -8.289  1.00 0.00 ? 59  TRP A HB3  1  
ATOM   796   H  HD1  . TRP A 1 59 ? -5.166  -7.623  -9.151  1.00 0.00 ? 59  TRP A HD1  1  
ATOM   797   H  HE1  . TRP A 1 59 ? -5.906  -8.801  -11.301 1.00 0.00 ? 59  TRP A HE1  1  
ATOM   798   H  HE3  . TRP A 1 59 ? -8.774  -4.327  -10.703 1.00 0.00 ? 59  TRP A HE3  1  
ATOM   799   H  HZ2  . TRP A 1 59 ? -7.756  -8.403  -13.393 1.00 0.00 ? 59  TRP A HZ2  1  
ATOM   800   H  HZ3  . TRP A 1 59 ? -9.982  -4.800  -12.797 1.00 0.00 ? 59  TRP A HZ3  1  
ATOM   801   H  HH2  . TRP A 1 59 ? -9.479  -6.799  -14.119 1.00 0.00 ? 59  TRP A HH2  1  
ATOM   802   N  N    . HIS A 1 60 ? -5.199  -2.779  -6.871  1.00 0.00 ? 60  HIS A N    1  
ATOM   803   C  CA   . HIS A 1 60 ? -5.067  -1.632  -5.954  1.00 0.00 ? 60  HIS A CA   1  
ATOM   804   C  C    . HIS A 1 60 ? -4.822  -0.273  -6.697  1.00 0.00 ? 60  HIS A C    1  
ATOM   805   O  O    . HIS A 1 60 ? -5.245  0.779   -6.205  1.00 0.00 ? 60  HIS A O    1  
ATOM   806   C  CB   . HIS A 1 60 ? -3.959  -1.956  -4.903  1.00 0.00 ? 60  HIS A CB   1  
ATOM   807   C  CG   . HIS A 1 60 ? -3.460  -0.782  -4.137  1.00 0.00 ? 60  HIS A CG   1  
ATOM   808   N  ND1  . HIS A 1 60 ? -4.110  -0.184  -3.091  1.00 0.00 ? 60  HIS A ND1  1  
ATOM   809   C  CD2  . HIS A 1 60 ? -2.384  -0.031  -4.391  1.00 0.00 ? 60  HIS A CD2  1  
ATOM   810   C  CE1  . HIS A 1 60 ? -3.417  0.910   -2.772  1.00 0.00 ? 60  HIS A CE1  1  
ATOM   811   N  NE2  . HIS A 1 60 ? -2.349  1.061   -3.547  1.00 0.00 ? 60  HIS A NE2  1  
ATOM   812   H  H    . HIS A 1 60 ? -4.731  -3.603  -6.606  1.00 0.00 ? 60  HIS A H    1  
ATOM   813   H  HA   . HIS A 1 60 ? -6.014  -1.552  -5.431  1.00 0.00 ? 60  HIS A HA   1  
ATOM   814   H  HB2  . HIS A 1 60 ? -4.344  -2.655  -4.188  1.00 0.00 ? 60  HIS A HB2  1  
ATOM   815   H  HB3  . HIS A 1 60 ? -3.113  -2.411  -5.407  1.00 0.00 ? 60  HIS A HB3  1  
ATOM   816   H  HD1  . HIS A 1 60 ? -4.931  -0.500  -2.650  1.00 0.00 ? 60  HIS A HD1  1  
ATOM   817   H  HD2  . HIS A 1 60 ? -1.645  -0.249  -5.137  1.00 0.00 ? 60  HIS A HD2  1  
ATOM   818   H  HE1  . HIS A 1 60 ? -3.685  1.590   -1.971  1.00 0.00 ? 60  HIS A HE1  1  
ATOM   819   N  N    . MET A 1 61 ? -4.109  -0.286  -7.841  1.00 0.00 ? 61  MET A N    1  
ATOM   820   C  CA   . MET A 1 61 ? -3.919  0.931   -8.679  1.00 0.00 ? 61  MET A CA   1  
ATOM   821   C  C    . MET A 1 61 ? -5.228  1.288   -9.415  1.00 0.00 ? 61  MET A C    1  
ATOM   822   O  O    . MET A 1 61 ? -5.566  2.468   -9.570  1.00 0.00 ? 61  MET A O    1  
ATOM   823   C  CB   . MET A 1 61 ? -2.733  0.769   -9.671  1.00 0.00 ? 61  MET A CB   1  
ATOM   824   C  CG   . MET A 1 61 ? -1.370  0.526   -8.992  1.00 0.00 ? 61  MET A CG   1  
ATOM   825   S  SD   . MET A 1 61 ? 0.045   0.663   -10.116 1.00 0.00 ? 61  MET A SD   1  
ATOM   826   C  CE   . MET A 1 61 ? -0.278  -0.640  -11.304 1.00 0.00 ? 61  MET A CE   1  
ATOM   827   H  H    . MET A 1 61 ? -3.705  -1.118  -8.130  1.00 0.00 ? 61  MET A H    1  
ATOM   828   H  HA   . MET A 1 61 ? -3.690  1.752   -7.999  1.00 0.00 ? 61  MET A HA   1  
ATOM   829   H  HB2  . MET A 1 61 ? -2.937  -0.060  -10.326 1.00 0.00 ? 61  MET A HB2  1  
ATOM   830   H  HB3  . MET A 1 61 ? -2.651  1.674   -10.266 1.00 0.00 ? 61  MET A HB3  1  
ATOM   831   H  HG2  . MET A 1 61 ? -1.232  1.256   -8.202  1.00 0.00 ? 61  MET A HG2  1  
ATOM   832   H  HG3  . MET A 1 61 ? -1.365  -0.462  -8.553  1.00 0.00 ? 61  MET A HG3  1  
ATOM   833   H  HE1  . MET A 1 61 ? -1.228  -0.460  -11.791 1.00 0.00 ? 61  MET A HE1  1  
ATOM   834   H  HE2  . MET A 1 61 ? -0.311  -1.597  -10.799 1.00 0.00 ? 61  MET A HE2  1  
ATOM   835   H  HE3  . MET A 1 61 ? 0.507   -0.652  -12.043 1.00 0.00 ? 61  MET A HE3  1  
ATOM   836   N  N    . LYS A 1 62 ? -5.949  0.243   -9.862  1.00 0.00 ? 62  LYS A N    1  
ATOM   837   C  CA   . LYS A 1 62 ? -7.313  0.365   -10.433 1.00 0.00 ? 62  LYS A CA   1  
ATOM   838   C  C    . LYS A 1 62 ? -8.300  1.003   -9.409  1.00 0.00 ? 62  LYS A C    1  
ATOM   839   O  O    . LYS A 1 62 ? -9.231  1.723   -9.780  1.00 0.00 ? 62  LYS A O    1  
ATOM   840   C  CB   . LYS A 1 62 ? -7.818  -1.049  -10.883 1.00 0.00 ? 62  LYS A CB   1  
ATOM   841   C  CG   . LYS A 1 62 ? -9.118  -1.085  -11.741 1.00 0.00 ? 62  LYS A CG   1  
ATOM   842   C  CD   . LYS A 1 62 ? -8.856  -1.063  -13.278 1.00 0.00 ? 62  LYS A CD   1  
ATOM   843   C  CE   . LYS A 1 62 ? -8.053  0.162   -13.754 1.00 0.00 ? 62  LYS A CE   1  
ATOM   844   N  NZ   . LYS A 1 62 ? -7.855  0.180   -15.223 1.00 0.00 ? 62  LYS A NZ   1  
ATOM   845   H  H    . LYS A 1 62 ? -5.522  -0.637  -9.868  1.00 0.00 ? 62  LYS A H    1  
ATOM   846   H  HA   . LYS A 1 62 ? -7.241  1.011   -11.304 1.00 0.00 ? 62  LYS A HA   1  
ATOM   847   H  HB2  . LYS A 1 62 ? -7.028  -1.527  -11.448 1.00 0.00 ? 62  LYS A HB2  1  
ATOM   848   H  HB3  . LYS A 1 62 ? -7.988  -1.640  -9.992  1.00 0.00 ? 62  LYS A HB3  1  
ATOM   849   H  HG2  . LYS A 1 62 ? -9.661  -1.996  -11.504 1.00 0.00 ? 62  LYS A HG2  1  
ATOM   850   H  HG3  . LYS A 1 62 ? -9.745  -0.233  -11.475 1.00 0.00 ? 62  LYS A HG3  1  
ATOM   851   H  HD2  . LYS A 1 62 ? -8.302  -1.957  -13.544 1.00 0.00 ? 62  LYS A HD2  1  
ATOM   852   H  HD3  . LYS A 1 62 ? -9.814  -1.081  -13.794 1.00 0.00 ? 62  LYS A HD3  1  
ATOM   853   H  HE2  . LYS A 1 62 ? -8.578  1.057   -13.464 1.00 0.00 ? 62  LYS A HE2  1  
ATOM   854   H  HE3  . LYS A 1 62 ? -7.081  0.144   -13.274 1.00 0.00 ? 62  LYS A HE3  1  
ATOM   855   H  HZ1  . LYS A 1 62 ? -7.321  1.025   -15.499 1.00 0.00 ? 62  LYS A HZ1  1  
ATOM   856   H  HZ2  . LYS A 1 62 ? -8.773  0.188   -15.711 1.00 0.00 ? 62  LYS A HZ2  1  
ATOM   857   H  HZ3  . LYS A 1 62 ? -7.325  -0.663  -15.527 1.00 0.00 ? 62  LYS A HZ3  1  
ATOM   858   N  N    . LYS A 1 63 ? -8.071  0.687   -8.129  1.00 0.00 ? 63  LYS A N    1  
ATOM   859   C  CA   . LYS A 1 63 ? -8.789  1.299   -6.984  1.00 0.00 ? 63  LYS A CA   1  
ATOM   860   C  C    . LYS A 1 63 ? -8.661  2.841   -6.956  1.00 0.00 ? 63  LYS A C    1  
ATOM   861   O  O    . LYS A 1 63 ? -9.551  3.516   -6.460  1.00 0.00 ? 63  LYS A O    1  
ATOM   862   C  CB   . LYS A 1 63 ? -8.353  0.693   -5.627  1.00 0.00 ? 63  LYS A CB   1  
ATOM   863   C  CG   . LYS A 1 63 ? -8.650  -0.809  -5.465  1.00 0.00 ? 63  LYS A CG   1  
ATOM   864   C  CD   . LYS A 1 63 ? -10.149 -1.155  -5.614  1.00 0.00 ? 63  LYS A CD   1  
ATOM   865   C  CE   . LYS A 1 63 ? -10.404 -2.662  -5.500  1.00 0.00 ? 63  LYS A CE   1  
ATOM   866   N  NZ   . LYS A 1 63 ? -9.914  -3.215  -4.212  1.00 0.00 ? 63  LYS A NZ   1  
ATOM   867   H  H    . LYS A 1 63 ? -7.435  -0.047  -7.999  1.00 0.00 ? 63  LYS A H    1  
ATOM   868   H  HA   . LYS A 1 63 ? -9.842  1.068   -7.131  1.00 0.00 ? 63  LYS A HA   1  
ATOM   869   H  HB2  . LYS A 1 63 ? -7.285  0.837   -5.513  1.00 0.00 ? 63  LYS A HB2  1  
ATOM   870   H  HB3  . LYS A 1 63 ? -8.857  1.225   -4.825  1.00 0.00 ? 63  LYS A HB3  1  
ATOM   871   H  HG2  . LYS A 1 63 ? -8.096  -1.354  -6.222  1.00 0.00 ? 63  LYS A HG2  1  
ATOM   872   H  HG3  . LYS A 1 63 ? -8.313  -1.126  -4.486  1.00 0.00 ? 63  LYS A HG3  1  
ATOM   873   H  HD2  . LYS A 1 63 ? -10.709 -0.641  -4.841  1.00 0.00 ? 63  LYS A HD2  1  
ATOM   874   H  HD3  . LYS A 1 63 ? -10.494 -0.816  -6.588  1.00 0.00 ? 63  LYS A HD3  1  
ATOM   875   H  HE2  . LYS A 1 63 ? -11.463 -2.850  -5.576  1.00 0.00 ? 63  LYS A HE2  1  
ATOM   876   H  HE3  . LYS A 1 63 ? -9.892  -3.170  -6.309  1.00 0.00 ? 63  LYS A HE3  1  
ATOM   877   H  HZ1  . LYS A 1 63 ? -10.186 -4.212  -4.128  1.00 0.00 ? 63  LYS A HZ1  1  
ATOM   878   H  HZ2  . LYS A 1 63 ? -10.325 -2.688  -3.413  1.00 0.00 ? 63  LYS A HZ2  1  
ATOM   879   H  HZ3  . LYS A 1 63 ? -8.880  -3.146  -4.159  1.00 0.00 ? 63  LYS A HZ3  1  
ATOM   880   N  N    . HIS A 1 64 ? -7.556  3.389   -7.487  1.00 0.00 ? 64  HIS A N    1  
ATOM   881   C  CA   . HIS A 1 64 ? -7.334  4.851   -7.536  1.00 0.00 ? 64  HIS A CA   1  
ATOM   882   C  C    . HIS A 1 64 ? -7.906  5.446   -8.835  1.00 0.00 ? 64  HIS A C    1  
ATOM   883   O  O    . HIS A 1 64 ? -8.258  6.634   -8.856  1.00 0.00 ? 64  HIS A O    1  
ATOM   884   C  CB   . HIS A 1 64 ? -5.833  5.206   -7.492  1.00 0.00 ? 64  HIS A CB   1  
ATOM   885   C  CG   . HIS A 1 64 ? -5.059  4.734   -6.295  1.00 0.00 ? 64  HIS A CG   1  
ATOM   886   N  ND1  . HIS A 1 64 ? -5.208  5.243   -5.022  1.00 0.00 ? 64  HIS A ND1  1  
ATOM   887   C  CD2  . HIS A 1 64 ? -4.006  3.880   -6.235  1.00 0.00 ? 64  HIS A CD2  1  
ATOM   888   C  CE1  . HIS A 1 64 ? -4.248  4.706   -4.257  1.00 0.00 ? 64  HIS A CE1  1  
ATOM   889   N  NE2  . HIS A 1 64 ? -3.497  3.882   -4.952  1.00 0.00 ? 64  HIS A NE2  1  
ATOM   890   H  H    . HIS A 1 64 ? -6.898  2.807   -7.913  1.00 0.00 ? 64  HIS A H    1  
ATOM   891   H  HA   . HIS A 1 64 ? -7.832  5.308   -6.683  1.00 0.00 ? 64  HIS A HA   1  
ATOM   892   H  HB2  . HIS A 1 64 ? -5.349  4.786   -8.368  1.00 0.00 ? 64  HIS A HB2  1  
ATOM   893   H  HB3  . HIS A 1 64 ? -5.730  6.290   -7.534  1.00 0.00 ? 64  HIS A HB3  1  
ATOM   894   H  HD1  . HIS A 1 64 ? -5.897  5.880   -4.723  1.00 0.00 ? 64  HIS A HD1  1  
ATOM   895   H  HD2  . HIS A 1 64 ? -3.612  3.289   -7.062  1.00 0.00 ? 64  HIS A HD2  1  
ATOM   896   H  HE1  . HIS A 1 64 ? -4.108  4.920   -3.207  1.00 0.00 ? 64  HIS A HE1  1  
ATOM   897   N  N    . ASP A 1 65 ? -8.023  4.588   -9.888  1.00 0.00 ? 65  ASP A N    1  
ATOM   898   C  CA   . ASP A 1 65 ? -8.188  5.020   -11.304 1.00 0.00 ? 65  ASP A CA   1  
ATOM   899   C  C    . ASP A 1 65 ? -9.363  6.002   -11.465 1.00 0.00 ? 65  ASP A C    1  
ATOM   900   O  O    . ASP A 1 65 ? -9.184  7.179   -11.810 1.00 0.00 ? 65  ASP A O    1  
ATOM   901   C  CB   . ASP A 1 65 ? -8.380  3.770   -12.203 1.00 0.00 ? 65  ASP A CB   1  
ATOM   902   C  CG   . ASP A 1 65 ? -8.654  4.094   -13.688 1.00 0.00 ? 65  ASP A CG   1  
ATOM   903   O  OD1  . ASP A 1 65 ? -7.690  4.332   -14.445 1.00 0.00 ? 65  ASP A OD1  1  
ATOM   904   O  OD2  . ASP A 1 65 ? -9.836  4.105   -14.097 1.00 0.00 ? 65  ASP A OD2  1  
ATOM   905   H  H    . ASP A 1 65 ? -8.074  3.633   -9.690  1.00 0.00 ? 65  ASP A H    1  
ATOM   906   H  HA   . ASP A 1 65 ? -7.276  5.525   -11.598 1.00 0.00 ? 65  ASP A HA   1  
ATOM   907   H  HB2  . ASP A 1 65 ? -7.484  3.161   -12.142 1.00 0.00 ? 65  ASP A HB2  1  
ATOM   908   H  HB3  . ASP A 1 65 ? -9.209  3.188   -11.813 1.00 0.00 ? 65  ASP A HB3  1  
ATOM   909   N  N    . ALA A 1 66 ? -10.556 5.483   -11.191 1.00 0.00 ? 66  ALA A N    1  
ATOM   910   C  CA   . ALA A 1 66 ? -11.803 6.259   -11.124 1.00 0.00 ? 66  ALA A CA   1  
ATOM   911   C  C    . ALA A 1 66 ? -12.292 6.320   -9.660  1.00 0.00 ? 66  ALA A C    1  
ATOM   912   O  O    . ALA A 1 66 ? -13.434 6.708   -9.384  1.00 0.00 ? 66  ALA A O    1  
ATOM   913   C  CB   . ALA A 1 66 ? -12.828 5.628   -12.071 1.00 0.00 ? 66  ALA A CB   1  
ATOM   914   H  H    . ALA A 1 66 ? -10.607 4.530   -10.971 1.00 0.00 ? 66  ALA A H    1  
ATOM   915   H  HA   . ALA A 1 66 ? -11.604 7.275   -11.455 1.00 0.00 ? 66  ALA A HA   1  
ATOM   916   H  HB1  . ALA A 1 66 ? -13.737 6.214   -12.068 1.00 0.00 ? 66  ALA A HB1  1  
ATOM   917   H  HB2  . ALA A 1 66 ? -13.052 4.616   -11.755 1.00 0.00 ? 66  ALA A HB2  1  
ATOM   918   H  HB3  . ALA A 1 66 ? -12.423 5.604   -13.075 1.00 0.00 ? 66  ALA A HB3  1  
ATOM   919   N  N    . ASP A 1 67 ? -11.357 5.982   -8.745  1.00 0.00 ? 67  ASP A N    1  
ATOM   920   C  CA   . ASP A 1 67 ? -11.580 5.826   -7.303  1.00 0.00 ? 67  ASP A CA   1  
ATOM   921   C  C    . ASP A 1 67 ? -12.662 4.774   -6.982  1.00 0.00 ? 67  ASP A C    1  
ATOM   922   O  O    . ASP A 1 67 ? -13.798 5.085   -6.623  1.00 0.00 ? 67  ASP A O    1  
ATOM   923   C  CB   . ASP A 1 67 ? -11.831 7.178   -6.605  1.00 0.00 ? 67  ASP A CB   1  
ATOM   924   C  CG   . ASP A 1 67 ? -11.864 7.129   -5.069  1.00 0.00 ? 67  ASP A CG   1  
ATOM   925   O  OD1  . ASP A 1 67 ? -11.121 6.316   -4.455  1.00 0.00 ? 67  ASP A OD1  1  
ATOM   926   O  OD2  . ASP A 1 67 ? -12.603 7.932   -4.457  1.00 0.00 ? 67  ASP A OD2  1  
ATOM   927   H  H    . ASP A 1 67 ? -10.442 5.858   -9.066  1.00 0.00 ? 67  ASP A H    1  
ATOM   928   H  HA   . ASP A 1 67 ? -10.641 5.434   -6.916  1.00 0.00 ? 67  ASP A HA   1  
ATOM   929   H  HB2  . ASP A 1 67 ? -11.041 7.864   -6.887  1.00 0.00 ? 67  ASP A HB2  1  
ATOM   930   H  HB3  . ASP A 1 67 ? -12.774 7.579   -6.961  1.00 0.00 ? 67  ASP A HB3  1  
ATOM   931   N  N    . SER A 1 68 ? -12.283 3.516   -7.206  1.00 0.00 ? 68  SER A N    1  
ATOM   932   C  CA   . SER A 1 68 ? -13.015 2.337   -6.717  1.00 0.00 ? 68  SER A CA   1  
ATOM   933   C  C    . SER A 1 68 ? -12.679 2.052   -5.232  1.00 0.00 ? 68  SER A C    1  
ATOM   934   O  O    . SER A 1 68 ? -13.317 1.207   -4.593  1.00 0.00 ? 68  SER A O    1  
ATOM   935   C  CB   . SER A 1 68 ? -12.690 1.121   -7.608  1.00 0.00 ? 68  SER A CB   1  
ATOM   936   O  OG   . SER A 1 68 ? -13.181 1.316   -8.927  1.00 0.00 ? 68  SER A OG   1  
ATOM   937   H  H    . SER A 1 68 ? -11.469 3.379   -7.735  1.00 0.00 ? 68  SER A H    1  
ATOM   938   H  HA   . SER A 1 68 ? -14.078 2.547   -6.792  1.00 0.00 ? 68  SER A HA   1  
ATOM   939   H  HB2  . SER A 1 68 ? -11.618 0.979   -7.653  1.00 0.00 ? 68  SER A HB2  1  
ATOM   940   H  HB3  . SER A 1 68 ? -13.149 0.233   -7.196  1.00 0.00 ? 68  SER A HB3  1  
ATOM   941   H  HG   . SER A 1 68 ? -12.551 0.960   -9.568  1.00 0.00 ? 68  SER A HG   1  
ATOM   942   N  N    . PHE A 1 69 ? -11.670 2.767   -4.698  1.00 0.00 ? 69  PHE A N    1  
ATOM   943   C  CA   . PHE A 1 69 ? -11.195 2.611   -3.308  1.00 0.00 ? 69  PHE A CA   1  
ATOM   944   C  C    . PHE A 1 69 ? -12.209 3.250   -2.347  1.00 0.00 ? 69  PHE A C    1  
ATOM   945   O  O    . PHE A 1 69 ? -12.491 2.705   -1.270  1.00 0.00 ? 69  PHE A O    1  
ATOM   946   C  CB   . PHE A 1 69 ? -9.791  3.283   -3.151  1.00 0.00 ? 69  PHE A CB   1  
ATOM   947   C  CG   . PHE A 1 69 ? -8.892  2.719   -2.036  1.00 0.00 ? 69  PHE A CG   1  
ATOM   948   C  CD1  . PHE A 1 69 ? -9.295  2.729   -0.701  1.00 0.00 ? 69  PHE A CD1  1  
ATOM   949   C  CD2  . PHE A 1 69 ? -7.635  2.171   -2.334  1.00 0.00 ? 69  PHE A CD2  1  
ATOM   950   C  CE1  . PHE A 1 69 ? -8.484  2.213   0.292   1.00 0.00 ? 69  PHE A CE1  1  
ATOM   951   C  CE2  . PHE A 1 69 ? -6.829  1.655   -1.337  1.00 0.00 ? 69  PHE A CE2  1  
ATOM   952   C  CZ   . PHE A 1 69 ? -7.252  1.678   -0.027  1.00 0.00 ? 69  PHE A CZ   1  
ATOM   953   H  H    . PHE A 1 69 ? -11.243 3.450   -5.251  1.00 0.00 ? 69  PHE A H    1  
ATOM   954   H  HA   . PHE A 1 69 ? -11.117 1.548   -3.093  1.00 0.00 ? 69  PHE A HA   1  
ATOM   955   H  HB2  . PHE A 1 69 ? -9.255  3.175   -4.089  1.00 0.00 ? 69  PHE A HB2  1  
ATOM   956   H  HB3  . PHE A 1 69 ? -9.922  4.347   -2.966  1.00 0.00 ? 69  PHE A HB3  1  
ATOM   957   H  HD1  . PHE A 1 69 ? -10.260 3.146   -0.439  1.00 0.00 ? 69  PHE A HD1  1  
ATOM   958   H  HD2  . PHE A 1 69 ? -7.295  2.152   -3.363  1.00 0.00 ? 69  PHE A HD2  1  
ATOM   959   H  HE1  . PHE A 1 69 ? -8.814  2.230   1.324   1.00 0.00 ? 69  PHE A HE1  1  
ATOM   960   H  HE2  . PHE A 1 69 ? -5.861  1.235   -1.583  1.00 0.00 ? 69  PHE A HE2  1  
ATOM   961   H  HZ   . PHE A 1 69 ? -6.616  1.271   0.754   1.00 0.00 ? 69  PHE A HZ   1  
ATOM   962   N  N    . TYR A 1 70 ? -12.747 4.419   -2.742  1.00 0.00 ? 70  TYR A N    1  
ATOM   963   C  CA   . TYR A 1 70 ? -13.723 5.164   -1.936  1.00 0.00 ? 70  TYR A CA   1  
ATOM   964   C  C    . TYR A 1 70 ? -14.991 5.439   -2.781  1.00 0.00 ? 70  TYR A C    1  
ATOM   965   O  O    . TYR A 1 70 ? -15.845 4.552   -2.915  1.00 0.00 ? 70  TYR A O    1  
ATOM   966   C  CB   . TYR A 1 70 ? -13.117 6.489   -1.387  1.00 0.00 ? 70  TYR A CB   1  
ATOM   967   C  CG   . TYR A 1 70 ? -11.848 6.338   -0.527  1.00 0.00 ? 70  TYR A CG   1  
ATOM   968   C  CD1  . TYR A 1 70 ? -11.928 5.971   0.817   1.00 0.00 ? 70  TYR A CD1  1  
ATOM   969   C  CD2  . TYR A 1 70 ? -10.573 6.570   -1.063  1.00 0.00 ? 70  TYR A CD2  1  
ATOM   970   C  CE1  . TYR A 1 70 ? -10.794 5.842   1.593   1.00 0.00 ? 70  TYR A CE1  1  
ATOM   971   C  CE2  . TYR A 1 70 ? -9.439  6.439   -0.287  1.00 0.00 ? 70  TYR A CE2  1  
ATOM   972   C  CZ   . TYR A 1 70 ? -9.553  6.076   1.037   1.00 0.00 ? 70  TYR A CZ   1  
ATOM   973   O  OH   . TYR A 1 70 ? -8.424  5.943   1.818   1.00 0.00 ? 70  TYR A OH   1  
ATOM   974   H  H    . TYR A 1 70 ? -12.492 4.799   -3.618  1.00 0.00 ? 70  TYR A H    1  
ATOM   975   H  HA   . TYR A 1 70 ? -14.014 4.544   -1.095  1.00 0.00 ? 70  TYR A HA   1  
ATOM   976   H  HB2  . TYR A 1 70 ? -12.878 7.133   -2.225  1.00 0.00 ? 70  TYR A HB2  1  
ATOM   977   H  HB3  . TYR A 1 70 ? -13.870 6.985   -0.785  1.00 0.00 ? 70  TYR A HB3  1  
ATOM   978   H  HD1  . TYR A 1 70 ? -12.903 5.787   1.257   1.00 0.00 ? 70  TYR A HD1  1  
ATOM   979   H  HD2  . TYR A 1 70 ? -10.482 6.857   -2.106  1.00 0.00 ? 70  TYR A HD2  1  
ATOM   980   H  HE1  . TYR A 1 70 ? -10.883 5.556   2.637   1.00 0.00 ? 70  TYR A HE1  1  
ATOM   981   H  HE2  . TYR A 1 70 ? -8.462  6.625   -0.719  1.00 0.00 ? 70  TYR A HE2  1  
ATOM   982   H  HH   . TYR A 1 70 ? -7.878  6.729   1.729   1.00 0.00 ? 70  TYR A HH   1  
ATOM   983   N  N    . GLN A 1 71 ? -15.096 6.648   -3.389  1.00 0.00 ? 71  GLN A N    1  
ATOM   984   C  CA   . GLN A 1 71 ? -16.304 7.090   -4.114  1.00 0.00 ? 71  GLN A CA   1  
ATOM   985   C  C    . GLN A 1 71 ? -15.983 7.346   -5.599  1.00 0.00 ? 71  GLN A C    1  
ATOM   986   O  O    . GLN A 1 71 ? -16.213 6.465   -6.434  1.00 0.00 ? 71  GLN A O    1  
ATOM   987   C  CB   . GLN A 1 71 ? -16.912 8.359   -3.466  1.00 0.00 ? 71  GLN A CB   1  
ATOM   988   C  CG   . GLN A 1 71 ? -17.279 8.221   -1.980  1.00 0.00 ? 71  GLN A CG   1  
ATOM   989   C  CD   . GLN A 1 71 ? -17.890 9.506   -1.407  1.00 0.00 ? 71  GLN A CD   1  
ATOM   990   O  OE1  . GLN A 1 71 ? -17.182 10.358  -0.874  1.00 0.00 ? 71  GLN A OE1  1  
ATOM   991   N  NE2  . GLN A 1 71 ? -19.203 9.670   -1.542  1.00 0.00 ? 71  GLN A NE2  1  
ATOM   992   H  H    . GLN A 1 71 ? -14.334 7.255   -3.361  1.00 0.00 ? 71  GLN A H    1  
ATOM   993   H  HA   . GLN A 1 71 ? -17.044 6.298   -4.060  1.00 0.00 ? 71  GLN A HA   1  
ATOM   994   H  HB2  . GLN A 1 71 ? -16.196 9.170   -3.563  1.00 0.00 ? 71  GLN A HB2  1  
ATOM   995   H  HB3  . GLN A 1 71 ? -17.811 8.633   -4.013  1.00 0.00 ? 71  GLN A HB3  1  
ATOM   996   H  HG2  . GLN A 1 71 ? -17.993 7.413   -1.864  1.00 0.00 ? 71  GLN A HG2  1  
ATOM   997   H  HG3  . GLN A 1 71 ? -16.377 7.984   -1.426  1.00 0.00 ? 71  GLN A HG3  1  
ATOM   998   H  HE21 . GLN A 1 71 ? -19.714 8.973   -2.005  1.00 0.00 ? 71  GLN A HE21 1  
ATOM   999   H  HE22 . GLN A 1 71 ? -19.607 10.485  -1.176  1.00 0.00 ? 71  GLN A HE22 1  
ATOM   1000  N  N    . PHE A 1 72 ? -15.440 8.555   -5.917  1.00 0.00 ? 72  PHE A N    1  
ATOM   1001  C  CA   . PHE A 1 72 ? -15.119 8.986   -7.286  1.00 0.00 ? 72  PHE A CA   1  
ATOM   1002  C  C    . PHE A 1 72 ? -14.006 10.044  -7.170  1.00 0.00 ? 72  PHE A C    1  
ATOM   1003  O  O    . PHE A 1 72 ? -14.133 11.007  -6.416  1.00 0.00 ? 72  PHE A O    1  
ATOM   1004  C  CB   . PHE A 1 72 ? -16.349 9.634   -8.009  1.00 0.00 ? 72  PHE A CB   1  
ATOM   1005  C  CG   . PHE A 1 72 ? -17.626 8.789   -8.019  1.00 0.00 ? 72  PHE A CG   1  
ATOM   1006  C  CD1  . PHE A 1 72 ? -17.788 7.752   -8.930  1.00 0.00 ? 72  PHE A CD1  1  
ATOM   1007  C  CD2  . PHE A 1 72 ? -18.650 9.012   -7.095  1.00 0.00 ? 72  PHE A CD2  1  
ATOM   1008  C  CE1  . PHE A 1 72 ? -18.929 6.966   -8.930  1.00 0.00 ? 72  PHE A CE1  1  
ATOM   1009  C  CE2  . PHE A 1 72 ? -19.788 8.225   -7.094  1.00 0.00 ? 72  PHE A CE2  1  
ATOM   1010  C  CZ   . PHE A 1 72 ? -19.927 7.202   -8.016  1.00 0.00 ? 72  PHE A CZ   1  
ATOM   1011  H  H    . PHE A 1 72 ? -15.153 9.145   -5.203  1.00 0.00 ? 72  PHE A H    1  
ATOM   1012  H  HA   . PHE A 1 72 ? -14.767 8.124   -7.855  1.00 0.00 ? 72  PHE A HA   1  
ATOM   1013  H  HB2  . PHE A 1 72 ? -16.581 10.582  -7.526  1.00 0.00 ? 72  PHE A HB2  1  
ATOM   1014  H  HB3  . PHE A 1 72 ? -16.081 9.843   -9.041  1.00 0.00 ? 72  PHE A HB3  1  
ATOM   1015  H  HD1  . PHE A 1 72 ? -17.004 7.557   -9.653  1.00 0.00 ? 72  PHE A HD1  1  
ATOM   1016  H  HD2  . PHE A 1 72 ? -18.547 9.815   -6.370  1.00 0.00 ? 72  PHE A HD2  1  
ATOM   1017  H  HE1  . PHE A 1 72 ? -19.037 6.165   -9.653  1.00 0.00 ? 72  PHE A HE1  1  
ATOM   1018  H  HE2  . PHE A 1 72 ? -20.572 8.406   -6.370  1.00 0.00 ? 72  PHE A HE2  1  
ATOM   1019  H  HZ   . PHE A 1 72 ? -20.820 6.585   -8.015  1.00 0.00 ? 72  PHE A HZ   1  
ATOM   1020  N  N    . SER A 1 73 ? -12.945 9.846   -7.933  1.00 0.00 ? 73  SER A N    1  
ATOM   1021  C  CA   . SER A 1 73 ? -11.783 10.752  -8.038  1.00 0.00 ? 73  SER A CA   1  
ATOM   1022  C  C    . SER A 1 73 ? -11.056 10.453  -9.342  1.00 0.00 ? 73  SER A C    1  
ATOM   1023  O  O    . SER A 1 73 ? -11.274 9.413   -9.961  1.00 0.00 ? 73  SER A O    1  
ATOM   1024  C  CB   . SER A 1 73 ? -10.790 10.551  -6.860  1.00 0.00 ? 73  SER A CB   1  
ATOM   1025  O  OG   . SER A 1 73 ? -11.423 10.670  -5.608  1.00 0.00 ? 73  SER A OG   1  
ATOM   1026  H  H    . SER A 1 73 ? -12.926 9.005   -8.416  1.00 0.00 ? 73  SER A H    1  
ATOM   1027  H  HA   . SER A 1 73 ? -12.131 11.785  -8.056  1.00 0.00 ? 73  SER A HA   1  
ATOM   1028  H  HB2  . SER A 1 73 ? -10.349 9.560   -6.917  1.00 0.00 ? 73  SER A HB2  1  
ATOM   1029  H  HB3  . SER A 1 73 ? -10.005 11.288  -6.918  1.00 0.00 ? 73  SER A HB3  1  
ATOM   1030  H  HG   . SER A 1 73 ? -11.853 9.830   -5.396  1.00 0.00 ? 73  SER A HG   1  
ATOM   1031  N  N    . CYS A 1 74 ? -10.175 11.364  -9.737  1.00 0.00 ? 74  CYS A N    1  
ATOM   1032  C  CA   . CYS A 1 74 ? -9.198  11.120  -10.802 1.00 0.00 ? 74  CYS A CA   1  
ATOM   1033  C  C    . CYS A 1 74 ? -7.890  10.676  -10.149 1.00 0.00 ? 74  CYS A C    1  
ATOM   1034  O  O    . CYS A 1 74 ? -7.397  11.373  -9.265  1.00 0.00 ? 74  CYS A O    1  
ATOM   1035  C  CB   . CYS A 1 74 ? -8.991  12.390  -11.645 1.00 0.00 ? 74  CYS A CB   1  
ATOM   1036  S  SG   . CYS A 1 74 ? -7.668  12.241  -12.887 1.00 0.00 ? 74  CYS A SG   1  
ATOM   1037  H  H    . CYS A 1 74 ? -10.152 12.216  -9.264  1.00 0.00 ? 74  CYS A H    1  
ATOM   1038  H  HA   . CYS A 1 74 ? -9.565  10.322  -11.448 1.00 0.00 ? 74  CYS A HA   1  
ATOM   1039  H  HB2  . CYS A 1 74 ? -9.906  12.623  -12.170 1.00 0.00 ? 74  CYS A HB2  1  
ATOM   1040  H  HB3  . CYS A 1 74 ? -8.739  13.222  -10.991 1.00 0.00 ? 74  CYS A HB3  1  
ATOM   1041  N  N    . ASN A 1 75 ? -7.360  9.504   -10.547 1.00 0.00 ? 75  ASN A N    1  
ATOM   1042  C  CA   . ASN A 1 75 ? -6.061  9.002   -10.044 1.00 0.00 ? 75  ASN A CA   1  
ATOM   1043  C  C    . ASN A 1 75 ? -4.937  10.035  -10.241 1.00 0.00 ? 75  ASN A C    1  
ATOM   1044  O  O    . ASN A 1 75 ? -4.081  10.224  -9.373  1.00 0.00 ? 75  ASN A O    1  
ATOM   1045  C  CB   . ASN A 1 75 ? -5.673  7.691   -10.778 1.00 0.00 ? 75  ASN A CB   1  
ATOM   1046  C  CG   . ASN A 1 75 ? -4.324  7.104   -10.325 1.00 0.00 ? 75  ASN A CG   1  
ATOM   1047  O  OD1  . ASN A 1 75 ? -3.945  7.218   -9.165  1.00 0.00 ? 75  ASN A OD1  1  
ATOM   1048  N  ND2  . ASN A 1 75 ? -3.567  6.510   -11.240 1.00 0.00 ? 75  ASN A ND2  1  
ATOM   1049  H  H    . ASN A 1 75 ? -7.869  8.935   -11.169 1.00 0.00 ? 75  ASN A H    1  
ATOM   1050  H  HA   . ASN A 1 75 ? -6.172  8.798   -8.987  1.00 0.00 ? 75  ASN A HA   1  
ATOM   1051  H  HB2  . ASN A 1 75 ? -6.435  6.950   -10.586 1.00 0.00 ? 75  ASN A HB2  1  
ATOM   1052  H  HB3  . ASN A 1 75 ? -5.632  7.878   -11.845 1.00 0.00 ? 75  ASN A HB3  1  
ATOM   1053  H  HD21 . ASN A 1 75 ? -3.897  6.471   -12.160 1.00 0.00 ? 75  ASN A HD21 1  
ATOM   1054  H  HD22 . ASN A 1 75 ? -2.716  6.119   -10.953 1.00 0.00 ? 75  ASN A HD22 1  
ATOM   1055  N  N    . ILE A 1 76 ? -4.976  10.713  -11.389 1.00 0.00 ? 76  ILE A N    1  
ATOM   1056  C  CA   . ILE A 1 76 ? -3.849  11.499  -11.865 1.00 0.00 ? 76  ILE A CA   1  
ATOM   1057  C  C    . ILE A 1 76 ? -3.866  12.926  -11.277 1.00 0.00 ? 76  ILE A C    1  
ATOM   1058  O  O    . ILE A 1 76 ? -2.842  13.371  -10.758 1.00 0.00 ? 76  ILE A O    1  
ATOM   1059  C  CB   . ILE A 1 76 ? -3.800  11.509  -13.443 1.00 0.00 ? 76  ILE A CB   1  
ATOM   1060  C  CG1  . ILE A 1 76 ? -3.870  10.030  -13.994 1.00 0.00 ? 76  ILE A CG1  1  
ATOM   1061  C  CG2  . ILE A 1 76 ? -2.542  12.248  -13.966 1.00 0.00 ? 76  ILE A CG2  1  
ATOM   1062  C  CD1  . ILE A 1 76 ? -3.441  9.824   -15.440 1.00 0.00 ? 76  ILE A CD1  1  
ATOM   1063  H  H    . ILE A 1 76 ? -5.784  10.689  -11.920 1.00 0.00 ? 76  ILE A H    1  
ATOM   1064  H  HA   . ILE A 1 76 ? -2.937  11.004  -11.521 1.00 0.00 ? 76  ILE A HA   1  
ATOM   1065  H  HB   . ILE A 1 76 ? -4.675  12.056  -13.798 1.00 0.00 ? 76  ILE A HB   1  
ATOM   1066  H  HG12 . ILE A 1 76 ? -3.235  9.398   -13.391 1.00 0.00 ? 76  ILE A HG12 1  
ATOM   1067  H  HG13 . ILE A 1 76 ? -4.897  9.678   -13.912 1.00 0.00 ? 76  ILE A HG13 1  
ATOM   1068  H  HG21 . ILE A 1 76 ? -1.649  11.726  -13.639 1.00 0.00 ? 76  ILE A HG21 1  
ATOM   1069  H  HG22 . ILE A 1 76 ? -2.518  13.260  -13.583 1.00 0.00 ? 76  ILE A HG22 1  
ATOM   1070  H  HG23 . ILE A 1 76 ? -2.557  12.283  -15.049 1.00 0.00 ? 76  ILE A HG23 1  
ATOM   1071  H  HD11 . ILE A 1 76 ? -2.398  10.087  -15.554 1.00 0.00 ? 76  ILE A HD11 1  
ATOM   1072  H  HD12 . ILE A 1 76 ? -4.042  10.433  -16.094 1.00 0.00 ? 76  ILE A HD12 1  
ATOM   1073  H  HD13 . ILE A 1 76 ? -3.570  8.781   -15.706 1.00 0.00 ? 76  ILE A HD13 1  
ATOM   1074  N  N    . CYS A 1 77 ? -5.022  13.642  -11.300 1.00 0.00 ? 77  CYS A N    1  
ATOM   1075  C  CA   . CYS A 1 77 ? -5.054  15.055  -10.840 1.00 0.00 ? 77  CYS A CA   1  
ATOM   1076  C  C    . CYS A 1 77 ? -6.141  15.310  -9.776  1.00 0.00 ? 77  CYS A C    1  
ATOM   1077  O  O    . CYS A 1 77 ? -6.309  16.452  -9.345  1.00 0.00 ? 77  CYS A O    1  
ATOM   1078  C  CB   . CYS A 1 77 ? -5.204  16.024  -12.043 1.00 0.00 ? 77  CYS A CB   1  
ATOM   1079  S  SG   . CYS A 1 77 ? -6.827  15.983  -12.869 1.00 0.00 ? 77  CYS A SG   1  
ATOM   1080  H  H    . CYS A 1 77 ? -5.853  13.217  -11.600 1.00 0.00 ? 77  CYS A H    1  
ATOM   1081  H  HA   . CYS A 1 77 ? -4.099  15.265  -10.365 1.00 0.00 ? 77  CYS A HA   1  
ATOM   1082  H  HB2  . CYS A 1 77 ? -5.043  17.037  -11.704 1.00 0.00 ? 77  CYS A HB2  1  
ATOM   1083  H  HB3  . CYS A 1 77 ? -4.452  15.785  -12.789 1.00 0.00 ? 77  CYS A HB3  1  
ATOM   1084  N  N    . GLY A 1 78 ? -6.863  14.238  -9.348  1.00 0.00 ? 78  GLY A N    1  
ATOM   1085  C  CA   . GLY A 1 78 ? -7.850  14.315  -8.251  1.00 0.00 ? 78  GLY A CA   1  
ATOM   1086  C  C    . GLY A 1 78 ? -8.895  15.403  -8.411  1.00 0.00 ? 78  GLY A C    1  
ATOM   1087  O  O    . GLY A 1 78 ? -9.278  16.043  -7.430  1.00 0.00 ? 78  GLY A O    1  
ATOM   1088  H  H    . GLY A 1 78 ? -6.694  13.364  -9.752  1.00 0.00 ? 78  GLY A H    1  
ATOM   1089  H  HA2  . GLY A 1 78 ? -8.363  13.366  -8.194  1.00 0.00 ? 78  GLY A HA2  1  
ATOM   1090  H  HA3  . GLY A 1 78 ? -7.317  14.466  -7.319  1.00 0.00 ? 78  GLY A HA3  1  
ATOM   1091  N  N    . LYS A 1 79 ? -9.345  15.615  -9.660  1.00 0.00 ? 79  LYS A N    1  
ATOM   1092  C  CA   . LYS A 1 79 ? -10.297 16.690  -9.995  1.00 0.00 ? 79  LYS A CA   1  
ATOM   1093  C  C    . LYS A 1 79 ? -11.661 16.473  -9.291  1.00 0.00 ? 79  LYS A C    1  
ATOM   1094  O  O    . LYS A 1 79 ? -12.328 17.451  -8.949  1.00 0.00 ? 79  LYS A O    1  
ATOM   1095  C  CB   . LYS A 1 79 ? -10.456 16.758  -11.545 1.00 0.00 ? 79  LYS A CB   1  
ATOM   1096  C  CG   . LYS A 1 79 ? -10.619 18.181  -12.142 1.00 0.00 ? 79  LYS A CG   1  
ATOM   1097  C  CD   . LYS A 1 79 ? -11.842 18.994  -11.623 1.00 0.00 ? 79  LYS A CD   1  
ATOM   1098  C  CE   . LYS A 1 79 ? -13.212 18.414  -12.043 1.00 0.00 ? 79  LYS A CE   1  
ATOM   1099  N  NZ   . LYS A 1 79 ? -13.462 18.576  -13.493 1.00 0.00 ? 79  LYS A NZ   1  
ATOM   1100  H  H    . LYS A 1 79 ? -8.949  15.103  -10.394 1.00 0.00 ? 79  LYS A H    1  
ATOM   1101  H  HA   . LYS A 1 79 ? -9.874  17.628  -9.650  1.00 0.00 ? 79  LYS A HA   1  
ATOM   1102  H  HB2  . LYS A 1 79 ? -9.573  16.318  -12.002 1.00 0.00 ? 79  LYS A HB2  1  
ATOM   1103  H  HB3  . LYS A 1 79 ? -11.302 16.161  -11.840 1.00 0.00 ? 79  LYS A HB3  1  
ATOM   1104  H  HG2  . LYS A 1 79 ? -9.717  18.733  -11.909 1.00 0.00 ? 79  LYS A HG2  1  
ATOM   1105  H  HG3  . LYS A 1 79 ? -10.688 18.081  -13.213 1.00 0.00 ? 79  LYS A HG3  1  
ATOM   1106  H  HD2  . LYS A 1 79 ? -11.801 19.029  -10.538 1.00 0.00 ? 79  LYS A HD2  1  
ATOM   1107  H  HD3  . LYS A 1 79 ? -11.764 20.011  -12.002 1.00 0.00 ? 79  LYS A HD3  1  
ATOM   1108  H  HE2  . LYS A 1 79 ? -13.243 17.356  -11.805 1.00 0.00 ? 79  LYS A HE2  1  
ATOM   1109  H  HE3  . LYS A 1 79 ? -13.998 18.919  -11.498 1.00 0.00 ? 79  LYS A HE3  1  
ATOM   1110  H  HZ1  . LYS A 1 79 ? -12.738 18.074  -14.038 1.00 0.00 ? 79  LYS A HZ1  1  
ATOM   1111  H  HZ2  . LYS A 1 79 ? -13.434 19.586  -13.746 1.00 0.00 ? 79  LYS A HZ2  1  
ATOM   1112  H  HZ3  . LYS A 1 79 ? -14.395 18.196  -13.736 1.00 0.00 ? 79  LYS A HZ3  1  
ATOM   1113  N  N    . LYS A 1 80 ? -12.025 15.184  -9.055  1.00 0.00 ? 80  LYS A N    1  
ATOM   1114  C  CA   . LYS A 1 80 ? -13.278 14.764  -8.397  1.00 0.00 ? 80  LYS A CA   1  
ATOM   1115  C  C    . LYS A 1 80 ? -14.452 14.926  -9.374  1.00 0.00 ? 80  LYS A C    1  
ATOM   1116  O  O    . LYS A 1 80 ? -14.670 16.009  -9.923  1.00 0.00 ? 80  LYS A O    1  
ATOM   1117  C  CB   . LYS A 1 80 ? -13.545 15.519  -7.051  1.00 0.00 ? 80  LYS A CB   1  
ATOM   1118  C  CG   . LYS A 1 80 ? -12.380 15.464  -6.026  1.00 0.00 ? 80  LYS A CG   1  
ATOM   1119  C  CD   . LYS A 1 80 ? -12.126 14.052  -5.459  1.00 0.00 ? 80  LYS A CD   1  
ATOM   1120  C  CE   . LYS A 1 80 ? -13.290 13.564  -4.590  1.00 0.00 ? 80  LYS A CE   1  
ATOM   1121  N  NZ   . LYS A 1 80 ? -13.047 12.212  -4.051  1.00 0.00 ? 80  LYS A NZ   1  
ATOM   1122  H  H    . LYS A 1 80 ? -11.429 14.479  -9.347  1.00 0.00 ? 80  LYS A H    1  
ATOM   1123  H  HA   . LYS A 1 80 ? -13.160 13.704  -8.182  1.00 0.00 ? 80  LYS A HA   1  
ATOM   1124  H  HB2  . LYS A 1 80 ? -13.733 16.567  -7.275  1.00 0.00 ? 80  LYS A HB2  1  
ATOM   1125  H  HB3  . LYS A 1 80 ? -14.437 15.104  -6.585  1.00 0.00 ? 80  LYS A HB3  1  
ATOM   1126  H  HG2  . LYS A 1 80 ? -11.471 15.806  -6.516  1.00 0.00 ? 80  LYS A HG2  1  
ATOM   1127  H  HG3  . LYS A 1 80 ? -12.607 16.141  -5.203  1.00 0.00 ? 80  LYS A HG3  1  
ATOM   1128  H  HD2  . LYS A 1 80 ? -11.975 13.353  -6.282  1.00 0.00 ? 80  LYS A HD2  1  
ATOM   1129  H  HD3  . LYS A 1 80 ? -11.226 14.079  -4.854  1.00 0.00 ? 80  LYS A HD3  1  
ATOM   1130  H  HE2  . LYS A 1 80 ? -13.430 14.244  -3.762  1.00 0.00 ? 80  LYS A HE2  1  
ATOM   1131  H  HE3  . LYS A 1 80 ? -14.196 13.537  -5.187  1.00 0.00 ? 80  LYS A HE3  1  
ATOM   1132  H  HZ1  . LYS A 1 80 ? -12.152 12.190  -3.530  1.00 0.00 ? 80  LYS A HZ1  1  
ATOM   1133  H  HZ2  . LYS A 1 80 ? -13.000 11.521  -4.827  1.00 0.00 ? 80  LYS A HZ2  1  
ATOM   1134  H  HZ3  . LYS A 1 80 ? -13.817 11.940  -3.409  1.00 0.00 ? 80  LYS A HZ3  1  
ATOM   1135  N  N    . PHE A 1 81 ? -15.163 13.819  -9.630  1.00 0.00 ? 81  PHE A N    1  
ATOM   1136  C  CA   . PHE A 1 81 ? -16.294 13.773  -10.596 1.00 0.00 ? 81  PHE A CA   1  
ATOM   1137  C  C    . PHE A 1 81 ? -17.539 13.106  -9.984  1.00 0.00 ? 81  PHE A C    1  
ATOM   1138  O  O    . PHE A 1 81 ? -17.455 12.423  -8.961  1.00 0.00 ? 81  PHE A O    1  
ATOM   1139  C  CB   . PHE A 1 81 ? -15.863 13.024  -11.883 1.00 0.00 ? 81  PHE A CB   1  
ATOM   1140  C  CG   . PHE A 1 81 ? -14.745 13.730  -12.649 1.00 0.00 ? 81  PHE A CG   1  
ATOM   1141  C  CD1  . PHE A 1 81 ? -15.041 14.696  -13.610 1.00 0.00 ? 81  PHE A CD1  1  
ATOM   1142  C  CD2  . PHE A 1 81 ? -13.403 13.460  -12.380 1.00 0.00 ? 81  PHE A CD2  1  
ATOM   1143  C  CE1  . PHE A 1 81 ? -14.036 15.359  -14.281 1.00 0.00 ? 81  PHE A CE1  1  
ATOM   1144  C  CE2  . PHE A 1 81 ? -12.404 14.122  -13.055 1.00 0.00 ? 81  PHE A CE2  1  
ATOM   1145  C  CZ   . PHE A 1 81 ? -12.723 15.074  -14.001 1.00 0.00 ? 81  PHE A CZ   1  
ATOM   1146  H  H    . PHE A 1 81 ? -14.909 12.998  -9.169  1.00 0.00 ? 81  PHE A H    1  
ATOM   1147  H  HA   . PHE A 1 81 ? -16.560 14.794  -10.862 1.00 0.00 ? 81  PHE A HA   1  
ATOM   1148  H  HB2  . PHE A 1 81 ? -15.527 12.024  -11.620 1.00 0.00 ? 81  PHE A HB2  1  
ATOM   1149  H  HB3  . PHE A 1 81 ? -16.720 12.930  -12.546 1.00 0.00 ? 81  PHE A HB3  1  
ATOM   1150  H  HD1  . PHE A 1 81 ? -16.076 14.923  -13.838 1.00 0.00 ? 81  PHE A HD1  1  
ATOM   1151  H  HD2  . PHE A 1 81 ? -13.147 12.714  -11.633 1.00 0.00 ? 81  PHE A HD2  1  
ATOM   1152  H  HE1  . PHE A 1 81 ? -14.281 16.109  -15.025 1.00 0.00 ? 81  PHE A HE1  1  
ATOM   1153  H  HE2  . PHE A 1 81 ? -11.363 13.903  -12.839 1.00 0.00 ? 81  PHE A HE2  1  
ATOM   1154  H  HZ   . PHE A 1 81 ? -11.930 15.598  -14.530 1.00 0.00 ? 81  PHE A HZ   1  
ATOM   1155  N  N    . GLU A 1 82 ? -18.693 13.336  -10.633 1.00 0.00 ? 82  GLU A N    1  
ATOM   1156  C  CA   . GLU A 1 82 ? -19.988 12.748  -10.259 1.00 0.00 ? 82  GLU A CA   1  
ATOM   1157  C  C    . GLU A 1 82 ? -19.976 11.215  -10.377 1.00 0.00 ? 82  GLU A C    1  
ATOM   1158  O  O    . GLU A 1 82 ? -20.458 10.505  -9.483  1.00 0.00 ? 82  GLU A O    1  
ATOM   1159  C  CB   . GLU A 1 82 ? -21.091 13.346  -11.181 1.00 0.00 ? 82  GLU A CB   1  
ATOM   1160  C  CG   . GLU A 1 82 ? -22.533 12.904  -10.877 1.00 0.00 ? 82  GLU A CG   1  
ATOM   1161  C  CD   . GLU A 1 82 ? -23.003 13.303  -9.466  1.00 0.00 ? 82  GLU A CD   1  
ATOM   1162  O  OE1  . GLU A 1 82 ? -23.308 14.497  -9.245  1.00 0.00 ? 82  GLU A OE1  1  
ATOM   1163  O  OE2  . GLU A 1 82 ? -23.058 12.431  -8.574  1.00 0.00 ? 82  GLU A OE2  1  
ATOM   1164  H  H    . GLU A 1 82 ? -18.692 13.981  -11.374 1.00 0.00 ? 82  GLU A H    1  
ATOM   1165  H  HA   . GLU A 1 82 ? -20.199 13.026  -9.236  1.00 0.00 ? 82  GLU A HA   1  
ATOM   1166  H  HB2  . GLU A 1 82 ? -21.051 14.427  -11.101 1.00 0.00 ? 82  GLU A HB2  1  
ATOM   1167  H  HB3  . GLU A 1 82 ? -20.865 13.078  -12.210 1.00 0.00 ? 82  GLU A HB3  1  
ATOM   1168  H  HG2  . GLU A 1 82 ? -23.196 13.358  -11.610 1.00 0.00 ? 82  GLU A HG2  1  
ATOM   1169  H  HG3  . GLU A 1 82 ? -22.590 11.822  -10.985 1.00 0.00 ? 82  GLU A HG3  1  
ATOM   1170  N  N    . LYS A 1 83 ? -19.411 10.716  -11.486 1.00 0.00 ? 83  LYS A N    1  
ATOM   1171  C  CA   . LYS A 1 83 ? -19.428 9.294   -11.827 1.00 0.00 ? 83  LYS A CA   1  
ATOM   1172  C  C    . LYS A 1 83 ? -18.081 8.892   -12.435 1.00 0.00 ? 83  LYS A C    1  
ATOM   1173  O  O    . LYS A 1 83 ? -17.349 9.738   -12.964 1.00 0.00 ? 83  LYS A O    1  
ATOM   1174  C  CB   . LYS A 1 83 ? -20.619 9.009   -12.789 1.00 0.00 ? 83  LYS A CB   1  
ATOM   1175  C  CG   . LYS A 1 83 ? -20.565 9.769   -14.143 1.00 0.00 ? 83  LYS A CG   1  
ATOM   1176  C  CD   . LYS A 1 83 ? -21.963 10.155  -14.694 1.00 0.00 ? 83  LYS A CD   1  
ATOM   1177  C  CE   . LYS A 1 83 ? -22.900 8.951   -14.929 1.00 0.00 ? 83  LYS A CE   1  
ATOM   1178  N  NZ   . LYS A 1 83 ? -22.383 8.035   -15.970 1.00 0.00 ? 83  LYS A NZ   1  
ATOM   1179  H  H    . LYS A 1 83 ? -18.956 11.329  -12.092 1.00 0.00 ? 83  LYS A H    1  
ATOM   1180  H  HA   . LYS A 1 83 ? -19.570 8.725   -10.908 1.00 0.00 ? 83  LYS A HA   1  
ATOM   1181  H  HB2  . LYS A 1 83 ? -20.655 7.943   -12.993 1.00 0.00 ? 83  LYS A HB2  1  
ATOM   1182  H  HB3  . LYS A 1 83 ? -21.534 9.286   -12.275 1.00 0.00 ? 83  LYS A HB3  1  
ATOM   1183  H  HG2  . LYS A 1 83 ? -19.987 10.681  -14.008 1.00 0.00 ? 83  LYS A HG2  1  
ATOM   1184  H  HG3  . LYS A 1 83 ? -20.051 9.143   -14.873 1.00 0.00 ? 83  LYS A HG3  1  
ATOM   1185  H  HD2  . LYS A 1 83 ? -22.442 10.825  -13.985 1.00 0.00 ? 83  LYS A HD2  1  
ATOM   1186  H  HD3  . LYS A 1 83 ? -21.829 10.687  -15.634 1.00 0.00 ? 83  LYS A HD3  1  
ATOM   1187  H  HE2  . LYS A 1 83 ? -23.012 8.400   -14.007 1.00 0.00 ? 83  LYS A HE2  1  
ATOM   1188  H  HE3  . LYS A 1 83 ? -23.872 9.321   -15.242 1.00 0.00 ? 83  LYS A HE3  1  
ATOM   1189  H  HZ1  . LYS A 1 83 ? -23.088 7.300   -16.178 1.00 0.00 ? 83  LYS A HZ1  1  
ATOM   1190  H  HZ2  . LYS A 1 83 ? -21.513 7.576   -15.643 1.00 0.00 ? 83  LYS A HZ2  1  
ATOM   1191  H  HZ3  . LYS A 1 83 ? -22.179 8.561   -16.847 1.00 0.00 ? 83  LYS A HZ3  1  
ATOM   1192  N  N    . LYS A 1 84 ? -17.771 7.597   -12.338 1.00 0.00 ? 84  LYS A N    1  
ATOM   1193  C  CA   . LYS A 1 84 ? -16.523 7.011   -12.853 1.00 0.00 ? 84  LYS A CA   1  
ATOM   1194  C  C    . LYS A 1 84 ? -16.402 7.201   -14.368 1.00 0.00 ? 84  LYS A C    1  
ATOM   1195  O  O    . LYS A 1 84 ? -15.302 7.333   -14.891 1.00 0.00 ? 84  LYS A O    1  
ATOM   1196  C  CB   . LYS A 1 84 ? -16.437 5.512   -12.487 1.00 0.00 ? 84  LYS A CB   1  
ATOM   1197  C  CG   . LYS A 1 84 ? -16.364 5.247   -10.969 1.00 0.00 ? 84  LYS A CG   1  
ATOM   1198  C  CD   . LYS A 1 84 ? -16.200 3.757   -10.616 1.00 0.00 ? 84  LYS A CD   1  
ATOM   1199  C  CE   . LYS A 1 84 ? -16.141 3.519   -9.096  1.00 0.00 ? 84  LYS A CE   1  
ATOM   1200  N  NZ   . LYS A 1 84 ? -16.015 2.081   -8.761  1.00 0.00 ? 84  LYS A NZ   1  
ATOM   1201  H  H    . LYS A 1 84 ? -18.413 7.008   -11.900 1.00 0.00 ? 84  LYS A H    1  
ATOM   1202  H  HA   . LYS A 1 84 ? -15.698 7.535   -12.374 1.00 0.00 ? 84  LYS A HA   1  
ATOM   1203  H  HB2  . LYS A 1 84 ? -17.312 5.003   -12.885 1.00 0.00 ? 84  LYS A HB2  1  
ATOM   1204  H  HB3  . LYS A 1 84 ? -15.555 5.089   -12.950 1.00 0.00 ? 84  LYS A HB3  1  
ATOM   1205  H  HG2  . LYS A 1 84 ? -15.518 5.793   -10.563 1.00 0.00 ? 84  LYS A HG2  1  
ATOM   1206  H  HG3  . LYS A 1 84 ? -17.275 5.616   -10.514 1.00 0.00 ? 84  LYS A HG3  1  
ATOM   1207  H  HD2  . LYS A 1 84 ? -17.041 3.206   -11.023 1.00 0.00 ? 84  LYS A HD2  1  
ATOM   1208  H  HD3  . LYS A 1 84 ? -15.282 3.385   -11.068 1.00 0.00 ? 84  LYS A HD3  1  
ATOM   1209  H  HE2  . LYS A 1 84 ? -15.288 4.038   -8.684  1.00 0.00 ? 84  LYS A HE2  1  
ATOM   1210  H  HE3  . LYS A 1 84 ? -17.048 3.899   -8.642  1.00 0.00 ? 84  LYS A HE3  1  
ATOM   1211  H  HZ1  . LYS A 1 84 ? -16.826 1.553   -9.147  1.00 0.00 ? 84  LYS A HZ1  1  
ATOM   1212  H  HZ2  . LYS A 1 84 ? -15.993 1.953   -7.733  1.00 0.00 ? 84  LYS A HZ2  1  
ATOM   1213  H  HZ3  . LYS A 1 84 ? -15.141 1.693   -9.172  1.00 0.00 ? 84  LYS A HZ3  1  
ATOM   1214  N  N    . ASP A 1 85 ? -17.556 7.213   -15.050 1.00 0.00 ? 85  ASP A N    1  
ATOM   1215  C  CA   . ASP A 1 85 ? -17.646 7.500   -16.494 1.00 0.00 ? 85  ASP A CA   1  
ATOM   1216  C  C    . ASP A 1 85 ? -17.026 8.856   -16.841 1.00 0.00 ? 85  ASP A C    1  
ATOM   1217  O  O    . ASP A 1 85 ? -16.287 8.973   -17.822 1.00 0.00 ? 85  ASP A O    1  
ATOM   1218  C  CB   . ASP A 1 85 ? -19.119 7.458   -16.954 1.00 0.00 ? 85  ASP A CB   1  
ATOM   1219  C  CG   . ASP A 1 85 ? -19.785 6.105   -16.677 1.00 0.00 ? 85  ASP A CG   1  
ATOM   1220  O  OD1  . ASP A 1 85 ? -20.336 5.925   -15.565 1.00 0.00 ? 85  ASP A OD1  1  
ATOM   1221  O  OD2  . ASP A 1 85 ? -19.745 5.218   -17.555 1.00 0.00 ? 85  ASP A OD2  1  
ATOM   1222  H  H    . ASP A 1 85 ? -18.383 6.982   -14.571 1.00 0.00 ? 85  ASP A H    1  
ATOM   1223  H  HA   . ASP A 1 85 ? -17.094 6.724   -17.017 1.00 0.00 ? 85  ASP A HA   1  
ATOM   1224  H  HB2  . ASP A 1 85 ? -19.675 8.233   -16.436 1.00 0.00 ? 85  ASP A HB2  1  
ATOM   1225  H  HB3  . ASP A 1 85 ? -19.169 7.655   -18.020 1.00 0.00 ? 85  ASP A HB3  1  
ATOM   1226  N  N    . SER A 1 86 ? -17.314 9.874   -16.009 1.00 0.00 ? 86  SER A N    1  
ATOM   1227  C  CA   . SER A 1 86 ? -16.751 11.215  -16.165 1.00 0.00 ? 86  SER A CA   1  
ATOM   1228  C  C    . SER A 1 86 ? -15.218 11.209  -15.969 1.00 0.00 ? 86  SER A C    1  
ATOM   1229  O  O    . SER A 1 86 ? -14.512 11.993  -16.599 1.00 0.00 ? 86  SER A O    1  
ATOM   1230  C  CB   . SER A 1 86 ? -17.424 12.179  -15.167 1.00 0.00 ? 86  SER A CB   1  
ATOM   1231  O  OG   . SER A 1 86 ? -18.833 12.212  -15.342 1.00 0.00 ? 86  SER A OG   1  
ATOM   1232  H  H    . SER A 1 86 ? -17.934 9.730   -15.263 1.00 0.00 ? 86  SER A H    1  
ATOM   1233  H  HA   . SER A 1 86 ? -16.976 11.545  -17.170 1.00 0.00 ? 86  SER A HA   1  
ATOM   1234  H  HB2  . SER A 1 86 ? -17.213 11.857  -14.156 1.00 0.00 ? 86  SER A HB2  1  
ATOM   1235  H  HB3  . SER A 1 86 ? -17.029 13.175  -15.311 1.00 0.00 ? 86  SER A HB3  1  
ATOM   1236  H  HG   . SER A 1 86 ? -19.168 13.070  -15.056 1.00 0.00 ? 86  SER A HG   1  
ATOM   1237  N  N    . VAL A 1 87 ? -14.718 10.303  -15.110 1.00 0.00 ? 87  VAL A N    1  
ATOM   1238  C  CA   . VAL A 1 87 ? -13.285 10.229  -14.766 1.00 0.00 ? 87  VAL A CA   1  
ATOM   1239  C  C    . VAL A 1 87 ? -12.489 9.590   -15.914 1.00 0.00 ? 87  VAL A C    1  
ATOM   1240  O  O    . VAL A 1 87 ? -11.439 10.089  -16.315 1.00 0.00 ? 87  VAL A O    1  
ATOM   1241  C  CB   . VAL A 1 87 ? -13.025 9.396   -13.456 1.00 0.00 ? 87  VAL A CB   1  
ATOM   1242  C  CG1  . VAL A 1 87 ? -11.532 9.441   -13.080 1.00 0.00 ? 87  VAL A CG1  1  
ATOM   1243  C  CG2  . VAL A 1 87 ? -13.908 9.864   -12.272 1.00 0.00 ? 87  VAL A CG2  1  
ATOM   1244  H  H    . VAL A 1 87 ? -15.317 9.632   -14.747 1.00 0.00 ? 87  VAL A H    1  
ATOM   1245  H  HA   . VAL A 1 87 ? -12.925 11.244  -14.610 1.00 0.00 ? 87  VAL A HA   1  
ATOM   1246  H  HB   . VAL A 1 87 ? -13.278 8.356   -13.666 1.00 0.00 ? 87  VAL A HB   1  
ATOM   1247  H  HG11 . VAL A 1 87 ? -10.937 9.026   -13.884 1.00 0.00 ? 87  VAL A HG11 1  
ATOM   1248  H  HG12 . VAL A 1 87 ? -11.362 8.860   -12.182 1.00 0.00 ? 87  VAL A HG12 1  
ATOM   1249  H  HG13 . VAL A 1 87 ? -11.231 10.466  -12.902 1.00 0.00 ? 87  VAL A HG13 1  
ATOM   1250  H  HG21 . VAL A 1 87 ? -14.955 9.763   -12.530 1.00 0.00 ? 87  VAL A HG21 1  
ATOM   1251  H  HG22 . VAL A 1 87 ? -13.697 10.900  -12.044 1.00 0.00 ? 87  VAL A HG22 1  
ATOM   1252  H  HG23 . VAL A 1 87 ? -13.698 9.259   -11.395 1.00 0.00 ? 87  VAL A HG23 1  
ATOM   1253  N  N    . VAL A 1 88 ? -13.041 8.480   -16.418 1.00 0.00 ? 88  VAL A N    1  
ATOM   1254  C  CA   . VAL A 1 88 ? -12.411 7.618   -17.438 1.00 0.00 ? 88  VAL A CA   1  
ATOM   1255  C  C    . VAL A 1 88 ? -12.407 8.351   -18.782 1.00 0.00 ? 88  VAL A C    1  
ATOM   1256  O  O    . VAL A 1 88 ? -11.422 8.301   -19.534 1.00 0.00 ? 88  VAL A O    1  
ATOM   1257  C  CB   . VAL A 1 88 ? -13.158 6.226   -17.552 1.00 0.00 ? 88  VAL A CB   1  
ATOM   1258  C  CG1  . VAL A 1 88 ? -12.606 5.359   -18.718 1.00 0.00 ? 88  VAL A CG1  1  
ATOM   1259  C  CG2  . VAL A 1 88 ? -13.079 5.443   -16.212 1.00 0.00 ? 88  VAL A CG2  1  
ATOM   1260  H  H    . VAL A 1 88 ? -13.935 8.256   -16.124 1.00 0.00 ? 88  VAL A H    1  
ATOM   1261  H  HA   . VAL A 1 88 ? -11.386 7.434   -17.132 1.00 0.00 ? 88  VAL A HA   1  
ATOM   1262  H  HB   . VAL A 1 88 ? -14.211 6.429   -17.755 1.00 0.00 ? 88  VAL A HB   1  
ATOM   1263  H  HG11 . VAL A 1 88 ? -11.549 5.178   -18.569 1.00 0.00 ? 88  VAL A HG11 1  
ATOM   1264  H  HG12 . VAL A 1 88 ? -12.746 5.876   -19.661 1.00 0.00 ? 88  VAL A HG12 1  
ATOM   1265  H  HG13 . VAL A 1 88 ? -13.130 4.412   -18.755 1.00 0.00 ? 88  VAL A HG13 1  
ATOM   1266  H  HG21 . VAL A 1 88 ? -13.516 6.031   -15.415 1.00 0.00 ? 88  VAL A HG21 1  
ATOM   1267  H  HG22 . VAL A 1 88 ? -12.043 5.236   -15.975 1.00 0.00 ? 88  VAL A HG22 1  
ATOM   1268  H  HG23 . VAL A 1 88 ? -13.618 4.505   -16.299 1.00 0.00 ? 88  VAL A HG23 1  
ATOM   1269  N  N    . ALA A 1 89 ? -13.514 9.080   -19.031 1.00 0.00 ? 89  ALA A N    1  
ATOM   1270  C  CA   . ALA A 1 89 ? -13.666 9.924   -20.219 1.00 0.00 ? 89  ALA A CA   1  
ATOM   1271  C  C    . ALA A 1 89 ? -12.664 11.082  -20.158 1.00 0.00 ? 89  ALA A C    1  
ATOM   1272  O  O    . ALA A 1 89 ? -12.030 11.429  -21.154 1.00 0.00 ? 89  ALA A O    1  
ATOM   1273  C  CB   . ALA A 1 89 ? -15.103 10.455  -20.337 1.00 0.00 ? 89  ALA A CB   1  
ATOM   1274  H  H    . ALA A 1 89 ? -14.241 9.076   -18.364 1.00 0.00 ? 89  ALA A H    1  
ATOM   1275  H  HA   . ALA A 1 89 ? -13.455 9.314   -21.090 1.00 0.00 ? 89  ALA A HA   1  
ATOM   1276  H  HB1  . ALA A 1 89 ? -15.207 11.051  -21.238 1.00 0.00 ? 89  ALA A HB1  1  
ATOM   1277  H  HB2  . ALA A 1 89 ? -15.340 11.067  -19.476 1.00 0.00 ? 89  ALA A HB2  1  
ATOM   1278  H  HB3  . ALA A 1 89 ? -15.793 9.621   -20.380 1.00 0.00 ? 89  ALA A HB3  1  
ATOM   1279  N  N    . HIS A 1 90 ? -12.509 11.647  -18.946 1.00 0.00 ? 90  HIS A N    1  
ATOM   1280  C  CA   . HIS A 1 90 ? -11.587 12.771  -18.689 1.00 0.00 ? 90  HIS A CA   1  
ATOM   1281  C  C    . HIS A 1 90 ? -10.114 12.335  -18.773 1.00 0.00 ? 90  HIS A C    1  
ATOM   1282  O  O    . HIS A 1 90 ? -9.277  13.093  -19.220 1.00 0.00 ? 90  HIS A O    1  
ATOM   1283  C  CB   . HIS A 1 90 ? -11.911 13.408  -17.302 1.00 0.00 ? 90  HIS A CB   1  
ATOM   1284  C  CG   . HIS A 1 90 ? -10.759 14.053  -16.578 1.00 0.00 ? 90  HIS A CG   1  
ATOM   1285  N  ND1  . HIS A 1 90 ? -10.332 15.340  -16.776 1.00 0.00 ? 90  HIS A ND1  1  
ATOM   1286  C  CD2  . HIS A 1 90 ? -9.960  13.541  -15.608 1.00 0.00 ? 90  HIS A CD2  1  
ATOM   1287  C  CE1  . HIS A 1 90 ? -9.320  15.563  -15.940 1.00 0.00 ? 90  HIS A CE1  1  
ATOM   1288  N  NE2  . HIS A 1 90 ? -9.055  14.502  -15.210 1.00 0.00 ? 90  HIS A NE2  1  
ATOM   1289  H  H    . HIS A 1 90 ? -13.041 11.290  -18.185 1.00 0.00 ? 90  HIS A H    1  
ATOM   1290  H  HA   . HIS A 1 90 ? -11.764 13.517  -19.455 1.00 0.00 ? 90  HIS A HA   1  
ATOM   1291  H  HB2  . HIS A 1 90 ? -12.671 14.167  -17.428 1.00 0.00 ? 90  HIS A HB2  1  
ATOM   1292  H  HB3  . HIS A 1 90 ? -12.312 12.637  -16.649 1.00 0.00 ? 90  HIS A HB3  1  
ATOM   1293  H  HD1  . HIS A 1 90 ? -10.697 15.976  -17.429 1.00 0.00 ? 90  HIS A HD1  1  
ATOM   1294  H  HD2  . HIS A 1 90 ? -9.999  12.533  -15.224 1.00 0.00 ? 90  HIS A HD2  1  
ATOM   1295  H  HE1  . HIS A 1 90 ? -8.788  16.500  -15.865 1.00 0.00 ? 90  HIS A HE1  1  
ATOM   1296  N  N    . LYS A 1 91 ? -9.808  11.129  -18.297 1.00 0.00 ? 91  LYS A N    1  
ATOM   1297  C  CA   . LYS A 1 91 ? -8.428  10.629  -18.179 1.00 0.00 ? 91  LYS A CA   1  
ATOM   1298  C  C    . LYS A 1 91 ? -7.874  10.296  -19.574 1.00 0.00 ? 91  LYS A C    1  
ATOM   1299  O  O    . LYS A 1 91 ? -6.709  10.576  -19.885 1.00 0.00 ? 91  LYS A O    1  
ATOM   1300  C  CB   . LYS A 1 91 ? -8.388  9.407   -17.220 1.00 0.00 ? 91  LYS A CB   1  
ATOM   1301  C  CG   . LYS A 1 91 ? -7.002  8.746   -17.067 1.00 0.00 ? 91  LYS A CG   1  
ATOM   1302  C  CD   . LYS A 1 91 ? -6.984  7.588   -16.036 1.00 0.00 ? 91  LYS A CD   1  
ATOM   1303  C  CE   . LYS A 1 91 ? -5.753  6.677   -16.189 1.00 0.00 ? 91  LYS A CE   1  
ATOM   1304  N  NZ   . LYS A 1 91 ? -5.734  6.000   -17.508 1.00 0.00 ? 91  LYS A NZ   1  
ATOM   1305  H  H    . LYS A 1 91 ? -10.537 10.535  -18.069 1.00 0.00 ? 91  LYS A H    1  
ATOM   1306  H  HA   . LYS A 1 91 ? -7.824  11.430  -17.752 1.00 0.00 ? 91  LYS A HA   1  
ATOM   1307  H  HB2  . LYS A 1 91 ? -8.720  9.729   -16.238 1.00 0.00 ? 91  LYS A HB2  1  
ATOM   1308  H  HB3  . LYS A 1 91 ? -9.082  8.662   -17.589 1.00 0.00 ? 91  LYS A HB3  1  
ATOM   1309  H  HG2  . LYS A 1 91 ? -6.707  8.357   -18.035 1.00 0.00 ? 91  LYS A HG2  1  
ATOM   1310  H  HG3  . LYS A 1 91 ? -6.287  9.504   -16.762 1.00 0.00 ? 91  LYS A HG3  1  
ATOM   1311  H  HD2  . LYS A 1 91 ? -6.985  8.006   -15.035 1.00 0.00 ? 91  LYS A HD2  1  
ATOM   1312  H  HD3  . LYS A 1 91 ? -7.877  6.986   -16.165 1.00 0.00 ? 91  LYS A HD3  1  
ATOM   1313  H  HE2  . LYS A 1 91 ? -4.853  7.271   -16.093 1.00 0.00 ? 91  LYS A HE2  1  
ATOM   1314  H  HE3  . LYS A 1 91 ? -5.769  5.923   -15.410 1.00 0.00 ? 91  LYS A HE3  1  
ATOM   1315  H  HZ1  . LYS A 1 91 ? -5.728  6.703   -18.275 1.00 0.00 ? 91  LYS A HZ1  1  
ATOM   1316  H  HZ2  . LYS A 1 91 ? -6.576  5.398   -17.614 1.00 0.00 ? 91  LYS A HZ2  1  
ATOM   1317  H  HZ3  . LYS A 1 91 ? -4.886  5.406   -17.594 1.00 0.00 ? 91  LYS A HZ3  1  
ATOM   1318  N  N    . ALA A 1 92 ? -8.755  9.736   -20.417 1.00 0.00 ? 92  ALA A N    1  
ATOM   1319  C  CA   . ALA A 1 92 ? -8.442  9.383   -21.805 1.00 0.00 ? 92  ALA A CA   1  
ATOM   1320  C  C    . ALA A 1 92 ? -8.179  10.635  -22.676 1.00 0.00 ? 92  ALA A C    1  
ATOM   1321  O  O    . ALA A 1 92 ? -7.510  10.544  -23.710 1.00 0.00 ? 92  ALA A O    1  
ATOM   1322  C  CB   . ALA A 1 92 ? -9.587  8.544   -22.388 1.00 0.00 ? 92  ALA A CB   1  
ATOM   1323  H  H    . ALA A 1 92 ? -9.654  9.547   -20.086 1.00 0.00 ? 92  ALA A H    1  
ATOM   1324  H  HA   . ALA A 1 92 ? -7.550  8.770   -21.795 1.00 0.00 ? 92  ALA A HA   1  
ATOM   1325  H  HB1  . ALA A 1 92 ? -9.748  7.670   -21.770 1.00 0.00 ? 92  ALA A HB1  1  
ATOM   1326  H  HB2  . ALA A 1 92 ? -9.340  8.227   -23.394 1.00 0.00 ? 92  ALA A HB2  1  
ATOM   1327  H  HB3  . ALA A 1 92 ? -10.496 9.134   -22.412 1.00 0.00 ? 92  ALA A HB3  1  
ATOM   1328  N  N    . LYS A 1 93 ? -8.714  11.803  -22.249 1.00 0.00 ? 93  LYS A N    1  
ATOM   1329  C  CA   . LYS A 1 93 ? -8.598  13.069  -23.026 1.00 0.00 ? 93  LYS A CA   1  
ATOM   1330  C  C    . LYS A 1 93 ? -7.529  14.017  -22.441 1.00 0.00 ? 93  LYS A C    1  
ATOM   1331  O  O    . LYS A 1 93 ? -6.658  14.510  -23.162 1.00 0.00 ? 93  LYS A O    1  
ATOM   1332  C  CB   . LYS A 1 93 ? -9.981  13.772  -23.086 1.00 0.00 ? 93  LYS A CB   1  
ATOM   1333  C  CG   . LYS A 1 93 ? -11.067 12.928  -23.790 1.00 0.00 ? 93  LYS A CG   1  
ATOM   1334  C  CD   . LYS A 1 93 ? -12.459 13.594  -23.792 1.00 0.00 ? 93  LYS A CD   1  
ATOM   1335  C  CE   . LYS A 1 93 ? -13.537 12.683  -24.413 1.00 0.00 ? 93  LYS A CE   1  
ATOM   1336  N  NZ   . LYS A 1 93 ? -14.879 13.312  -24.412 1.00 0.00 ? 93  LYS A NZ   1  
ATOM   1337  H  H    . LYS A 1 93 ? -9.216  11.811  -21.391 1.00 0.00 ? 93  LYS A H    1  
ATOM   1338  H  HA   . LYS A 1 93 ? -8.306  12.812  -24.045 1.00 0.00 ? 93  LYS A HA   1  
ATOM   1339  H  HB2  . LYS A 1 93 ? -10.314 13.982  -22.073 1.00 0.00 ? 93  LYS A HB2  1  
ATOM   1340  H  HB3  . LYS A 1 93 ? -9.876  14.715  -23.622 1.00 0.00 ? 93  LYS A HB3  1  
ATOM   1341  H  HG2  . LYS A 1 93 ? -10.765 12.761  -24.817 1.00 0.00 ? 93  LYS A HG2  1  
ATOM   1342  H  HG3  . LYS A 1 93 ? -11.140 11.970  -23.283 1.00 0.00 ? 93  LYS A HG3  1  
ATOM   1343  H  HD2  . LYS A 1 93 ? -12.740 13.820  -22.770 1.00 0.00 ? 93  LYS A HD2  1  
ATOM   1344  H  HD3  . LYS A 1 93 ? -12.408 14.516  -24.360 1.00 0.00 ? 93  LYS A HD3  1  
ATOM   1345  H  HE2  . LYS A 1 93 ? -13.271 12.461  -25.438 1.00 0.00 ? 93  LYS A HE2  1  
ATOM   1346  H  HE3  . LYS A 1 93 ? -13.589 11.756  -23.851 1.00 0.00 ? 93  LYS A HE3  1  
ATOM   1347  H  HZ1  . LYS A 1 93 ? -15.592 12.639  -24.763 1.00 0.00 ? 93  LYS A HZ1  1  
ATOM   1348  H  HZ2  . LYS A 1 93 ? -14.882 14.148  -25.025 1.00 0.00 ? 93  LYS A HZ2  1  
ATOM   1349  H  HZ3  . LYS A 1 93 ? -15.139 13.599  -23.450 1.00 0.00 ? 93  LYS A HZ3  1  
ATOM   1350  N  N    . SER A 1 94 ? -7.599  14.239  -21.123 1.00 0.00 ? 94  SER A N    1  
ATOM   1351  C  CA   . SER A 1 94 ? -6.803  15.250  -20.411 1.00 0.00 ? 94  SER A CA   1  
ATOM   1352  C  C    . SER A 1 94 ? -5.448  14.684  -19.952 1.00 0.00 ? 94  SER A C    1  
ATOM   1353  O  O    . SER A 1 94 ? -4.601  15.428  -19.452 1.00 0.00 ? 94  SER A O    1  
ATOM   1354  C  CB   . SER A 1 94 ? -7.604  15.786  -19.196 1.00 0.00 ? 94  SER A CB   1  
ATOM   1355  O  OG   . SER A 1 94 ? -6.950  16.873  -18.551 1.00 0.00 ? 94  SER A OG   1  
ATOM   1356  H  H    . SER A 1 94 ? -8.191  13.691  -20.606 1.00 0.00 ? 94  SER A H    1  
ATOM   1357  H  HA   . SER A 1 94 ? -6.621  16.069  -21.091 1.00 0.00 ? 94  SER A HA   1  
ATOM   1358  H  HB2  . SER A 1 94 ? -8.574  16.129  -19.525 1.00 0.00 ? 94  SER A HB2  1  
ATOM   1359  H  HB3  . SER A 1 94 ? -7.740  14.991  -18.474 1.00 0.00 ? 94  SER A HB3  1  
ATOM   1360  H  HG   . SER A 1 94 ? -6.129  17.076  -19.014 1.00 0.00 ? 94  SER A HG   1  
ATOM   1361  N  N    . HIS A 1 95 ? -5.242  13.362  -20.122 1.00 0.00 ? 95  HIS A N    1  
ATOM   1362  C  CA   . HIS A 1 95 ? -3.980  12.693  -19.742 1.00 0.00 ? 95  HIS A CA   1  
ATOM   1363  C  C    . HIS A 1 95 ? -3.555  11.690  -20.841 1.00 0.00 ? 95  HIS A C    1  
ATOM   1364  O  O    . HIS A 1 95 ? -3.617  10.469  -20.631 1.00 0.00 ? 95  HIS A O    1  
ATOM   1365  C  CB   . HIS A 1 95 ? -4.112  11.982  -18.363 1.00 0.00 ? 95  HIS A CB   1  
ATOM   1366  C  CG   . HIS A 1 95 ? -4.607  12.850  -17.229 1.00 0.00 ? 95  HIS A CG   1  
ATOM   1367  N  ND1  . HIS A 1 95 ? -4.022  14.039  -16.843 1.00 0.00 ? 95  HIS A ND1  1  
ATOM   1368  C  CD2  . HIS A 1 95 ? -5.655  12.664  -16.386 1.00 0.00 ? 95  HIS A CD2  1  
ATOM   1369  C  CE1  . HIS A 1 95 ? -4.711  14.521  -15.804 1.00 0.00 ? 95  HIS A CE1  1  
ATOM   1370  N  NE2  . HIS A 1 95 ? -5.715  13.722  -15.489 1.00 0.00 ? 95  HIS A NE2  1  
ATOM   1371  H  H    . HIS A 1 95 ? -5.944  12.828  -20.553 1.00 0.00 ? 95  HIS A H    1  
ATOM   1372  H  HA   . HIS A 1 95 ? -3.202  13.451  -19.670 1.00 0.00 ? 95  HIS A HA   1  
ATOM   1373  H  HB2  . HIS A 1 95 ? -4.802  11.148  -18.458 1.00 0.00 ? 95  HIS A HB2  1  
ATOM   1374  H  HB3  . HIS A 1 95 ? -3.142  11.591  -18.074 1.00 0.00 ? 95  HIS A HB3  1  
ATOM   1375  H  HD1  . HIS A 1 95 ? -3.253  14.472  -17.277 1.00 0.00 ? 95  HIS A HD1  1  
ATOM   1376  H  HD2  . HIS A 1 95 ? -6.324  11.815  -16.385 1.00 0.00 ? 95  HIS A HD2  1  
ATOM   1377  H  HE1  . HIS A 1 95 ? -4.476  15.443  -15.288 1.00 0.00 ? 95  HIS A HE1  1  
ATOM   1378  N  N    . PRO A 1 96 ? -3.176  12.182  -22.071 1.00 0.00 ? 96  PRO A N    1  
ATOM   1379  C  CA   . PRO A 1 96 ? -2.535  11.326  -23.092 1.00 0.00 ? 96  PRO A CA   1  
ATOM   1380  C  C    . PRO A 1 96 ? -1.089  10.967  -22.674 1.00 0.00 ? 96  PRO A C    1  
ATOM   1381  O  O    . PRO A 1 96 ? -0.613  9.854   -22.909 1.00 0.00 ? 96  PRO A O    1  
ATOM   1382  C  CB   . PRO A 1 96 ? -2.584  12.197  -24.379 1.00 0.00 ? 96  PRO A CB   1  
ATOM   1383  C  CG   . PRO A 1 96 ? -2.621  13.612  -23.882 1.00 0.00 ? 96  PRO A CG   1  
ATOM   1384  C  CD   . PRO A 1 96 ? -3.384  13.571  -22.575 1.00 0.00 ? 96  PRO A CD   1  
ATOM   1385  H  HA   . PRO A 1 96 ? -3.099  10.407  -23.243 1.00 0.00 ? 96  PRO A HA   1  
ATOM   1386  H  HB2  . PRO A 1 96 ? -1.708  12.013  -24.994 1.00 0.00 ? 96  PRO A HB2  1  
ATOM   1387  H  HB3  . PRO A 1 96 ? -3.476  11.954  -24.948 1.00 0.00 ? 96  PRO A HB3  1  
ATOM   1388  H  HG2  . PRO A 1 96 ? -1.606  13.976  -23.721 1.00 0.00 ? 96  PRO A HG2  1  
ATOM   1389  H  HG3  . PRO A 1 96 ? -3.125  14.249  -24.601 1.00 0.00 ? 96  PRO A HG3  1  
ATOM   1390  H  HD2  . PRO A 1 96 ? -2.988  14.300  -21.878 1.00 0.00 ? 96  PRO A HD2  1  
ATOM   1391  H  HD3  . PRO A 1 96 ? -4.444  13.759  -22.738 1.00 0.00 ? 96  PRO A HD3  1  
ATOM   1392  N  N    . GLU A 1 97 ? -0.404  11.947  -22.052 1.00 0.00 ? 97  GLU A N    1  
ATOM   1393  C  CA   . GLU A 1 97 ? 0.922   11.810  -21.475 1.00 0.00 ? 97  GLU A CA   1  
ATOM   1394  C  C    . GLU A 1 97 ? 0.855   12.401  -20.062 1.00 0.00 ? 97  GLU A C    1  
ATOM   1395  O  O    . GLU A 1 97 ? 0.813   13.626  -19.899 1.00 0.00 ? 97  GLU A O    1  
ATOM   1396  C  CB   . GLU A 1 97 ? 1.985   12.549  -22.337 1.00 0.00 ? 97  GLU A CB   1  
ATOM   1397  C  CG   . GLU A 1 97 ? 1.966   12.178  -23.833 1.00 0.00 ? 97  GLU A CG   1  
ATOM   1398  C  CD   . GLU A 1 97 ? 3.016   12.931  -24.662 1.00 0.00 ? 97  GLU A CD   1  
ATOM   1399  O  OE1  . GLU A 1 97 ? 3.023   14.182  -24.625 1.00 0.00 ? 97  GLU A OE1  1  
ATOM   1400  O  OE2  . GLU A 1 97 ? 3.839   12.288  -25.357 1.00 0.00 ? 97  GLU A OE2  1  
ATOM   1401  H  H    . GLU A 1 97 ? -0.813  12.809  -21.987 1.00 0.00 ? 97  GLU A H    1  
ATOM   1402  H  HA   . GLU A 1 97 ? 1.168   10.759  -21.417 1.00 0.00 ? 97  GLU A HA   1  
ATOM   1403  H  HB2  . GLU A 1 97 ? 1.818   13.620  -22.256 1.00 0.00 ? 97  GLU A HB2  1  
ATOM   1404  H  HB3  . GLU A 1 97 ? 2.976   12.326  -21.942 1.00 0.00 ? 97  GLU A HB3  1  
ATOM   1405  H  HG2  . GLU A 1 97 ? 2.137   11.111  -23.921 1.00 0.00 ? 97  GLU A HG2  1  
ATOM   1406  H  HG3  . GLU A 1 97 ? 0.981   12.406  -24.236 1.00 0.00 ? 97  GLU A HG3  1  
ATOM   1407  N  N    . VAL A 1 98 ? 0.732   11.508  -19.072 1.00 0.00 ? 98  VAL A N    1  
ATOM   1408  C  CA   . VAL A 1 98 ? 0.696   11.858  -17.633 1.00 0.00 ? 98  VAL A CA   1  
ATOM   1409  C  C    . VAL A 1 98 ? 1.947   12.699  -17.204 1.00 0.00 ? 98  VAL A C    1  
ATOM   1410  O  O    . VAL A 1 98 ? 3.095   12.207  -17.338 1.00 0.00 ? 98  VAL A O    1  
ATOM   1411  C  CB   . VAL A 1 98 ? 0.502   10.566  -16.723 1.00 0.00 ? 98  VAL A CB   1  
ATOM   1412  C  CG1  . VAL A 1 98 ? 1.486   9.428   -17.094 1.00 0.00 ? 98  VAL A CG1  1  
ATOM   1413  C  CG2  . VAL A 1 98 ? 0.609   10.918  -15.216 1.00 0.00 ? 98  VAL A CG2  1  
ATOM   1414  O  OXT  . VAL A 1 98 ? 1.776   13.861  -16.759 1.00 0.00 ? 98  VAL A OXT  1  
ATOM   1415  H  H    . VAL A 1 98 ? 0.635   10.573  -19.328 1.00 0.00 ? 98  VAL A H    1  
ATOM   1416  H  HA   . VAL A 1 98 ? -0.190  12.474  -17.502 1.00 0.00 ? 98  VAL A HA   1  
ATOM   1417  H  HB   . VAL A 1 98 ? -0.509  10.191  -16.900 1.00 0.00 ? 98  VAL A HB   1  
ATOM   1418  H  HG11 . VAL A 1 98 ? 2.504   9.764   -16.941 1.00 0.00 ? 98  VAL A HG11 1  
ATOM   1419  H  HG12 . VAL A 1 98 ? 1.356   9.158   -18.137 1.00 0.00 ? 98  VAL A HG12 1  
ATOM   1420  H  HG13 . VAL A 1 98 ? 1.299   8.558   -16.477 1.00 0.00 ? 98  VAL A HG13 1  
ATOM   1421  H  HG21 . VAL A 1 98 ? 0.428   10.036  -14.610 1.00 0.00 ? 98  VAL A HG21 1  
ATOM   1422  H  HG22 . VAL A 1 98 ? -0.122  11.676  -14.960 1.00 0.00 ? 98  VAL A HG22 1  
ATOM   1423  H  HG23 . VAL A 1 98 ? 1.600   11.296  -15.002 1.00 0.00 ? 98  VAL A HG23 1  
HETATM 1424  ZN ZN   . ZN  B 2 .  ? 15.995  -0.009  3.739   1.00 0.00 ? 101 ZN  A ZN   1  
HETATM 1425  ZN ZN   . ZN  C 2 .  ? -7.303  14.132  -14.205 1.00 0.00 ? 103 ZN  A ZN   1  
HETATM 1426  ZN ZN   . ZN  D 2 .  ? -1.802  2.883   -4.305  1.00 0.00 ? 102 ZN  A ZN   1  
ATOM   1427  N  N    . HIS A 1 10 ? 18.921  -9.186  17.212  1.00 0.00 ? 10  HIS A N    2  
ATOM   1428  C  CA   . HIS A 1 10 ? 17.761  -9.161  16.301  1.00 0.00 ? 10  HIS A CA   2  
ATOM   1429  C  C    . HIS A 1 10 ? 17.619  -10.551 15.666  1.00 0.00 ? 10  HIS A C    2  
ATOM   1430  O  O    . HIS A 1 10 ? 17.975  -10.768 14.502  1.00 0.00 ? 10  HIS A O    2  
ATOM   1431  C  CB   . HIS A 1 10 ? 17.922  -8.039  15.236  1.00 0.00 ? 10  HIS A CB   2  
ATOM   1432  C  CG   . HIS A 1 10 ? 17.894  -6.647  15.804  1.00 0.00 ? 10  HIS A CG   2  
ATOM   1433  N  ND1  . HIS A 1 10 ? 16.732  -5.918  15.962  1.00 0.00 ? 10  HIS A ND1  2  
ATOM   1434  C  CD2  . HIS A 1 10 ? 18.887  -5.856  16.271  1.00 0.00 ? 10  HIS A CD2  2  
ATOM   1435  C  CE1  . HIS A 1 10 ? 17.016  -4.746  16.493  1.00 0.00 ? 10  HIS A CE1  2  
ATOM   1436  N  NE2  . HIS A 1 10 ? 18.317  -4.686  16.689  1.00 0.00 ? 10  HIS A NE2  2  
ATOM   1437  H  H    . HIS A 1 10 ? 18.773  -9.903  17.946  1.00 0.00 ? 10  HIS A H    2  
ATOM   1438  H  HA   . HIS A 1 10 ? 16.875  -8.961  16.897  1.00 0.00 ? 10  HIS A HA   2  
ATOM   1439  H  HB2  . HIS A 1 10 ? 18.867  -8.172  14.725  1.00 0.00 ? 10  HIS A HB2  2  
ATOM   1440  H  HB3  . HIS A 1 10 ? 17.124  -8.110  14.506  1.00 0.00 ? 10  HIS A HB3  2  
ATOM   1441  H  HD1  . HIS A 1 10 ? 15.832  -6.222  15.727  1.00 0.00 ? 10  HIS A HD1  2  
ATOM   1442  H  HD2  . HIS A 1 10 ? 19.936  -6.112  16.320  1.00 0.00 ? 10  HIS A HD2  2  
ATOM   1443  H  HE1  . HIS A 1 10 ? 16.297  -3.974  16.742  1.00 0.00 ? 10  HIS A HE1  2  
ATOM   1444  H  HE2  . HIS A 1 10 ? 18.772  -3.996  17.217  1.00 0.00 ? 10  HIS A HE2  2  
ATOM   1445  N  N    . MET A 1 11 ? 17.155  -11.510 16.491  1.00 0.00 ? 11  MET A N    2  
ATOM   1446  C  CA   . MET A 1 11 ? 16.981  -12.924 16.112  1.00 0.00 ? 11  MET A CA   2  
ATOM   1447  C  C    . MET A 1 11 ? 15.538  -13.162 15.636  1.00 0.00 ? 11  MET A C    2  
ATOM   1448  O  O    . MET A 1 11 ? 15.310  -13.886 14.661  1.00 0.00 ? 11  MET A O    2  
ATOM   1449  C  CB   . MET A 1 11 ? 17.327  -13.839 17.319  1.00 0.00 ? 11  MET A CB   2  
ATOM   1450  C  CG   . MET A 1 11 ? 18.805  -13.760 17.763  1.00 0.00 ? 11  MET A CG   2  
ATOM   1451  S  SD   . MET A 1 11 ? 19.312  -12.096 18.282  1.00 0.00 ? 11  MET A SD   2  
ATOM   1452  C  CE   . MET A 1 11 ? 21.060  -12.324 18.633  1.00 0.00 ? 11  MET A CE   2  
ATOM   1453  H  H    . MET A 1 11 ? 16.920  -11.250 17.407  1.00 0.00 ? 11  MET A H    2  
ATOM   1454  H  HA   . MET A 1 11 ? 17.664  -13.145 15.294  1.00 0.00 ? 11  MET A HA   2  
ATOM   1455  H  HB2  . MET A 1 11 ? 16.706  -13.556 18.161  1.00 0.00 ? 11  MET A HB2  2  
ATOM   1456  H  HB3  . MET A 1 11 ? 17.106  -14.872 17.059  1.00 0.00 ? 11  MET A HB3  2  
ATOM   1457  H  HG2  . MET A 1 11 ? 18.970  -14.447 18.587  1.00 0.00 ? 11  MET A HG2  2  
ATOM   1458  H  HG3  . MET A 1 11 ? 19.428  -14.065 16.927  1.00 0.00 ? 11  MET A HG3  2  
ATOM   1459  H  HE1  . MET A 1 11 ? 21.481  -11.384 18.965  1.00 0.00 ? 11  MET A HE1  2  
ATOM   1460  H  HE2  . MET A 1 11 ? 21.569  -12.649 17.737  1.00 0.00 ? 11  MET A HE2  2  
ATOM   1461  H  HE3  . MET A 1 11 ? 21.187  -13.065 19.410  1.00 0.00 ? 11  MET A HE3  2  
ATOM   1462  N  N    . ARG A 1 12 ? 14.579  -12.522 16.330  1.00 0.00 ? 12  ARG A N    2  
ATOM   1463  C  CA   . ARG A 1 12 ? 13.124  -12.581 16.009  1.00 0.00 ? 12  ARG A CA   2  
ATOM   1464  C  C    . ARG A 1 12 ? 12.643  -11.233 15.425  1.00 0.00 ? 12  ARG A C    2  
ATOM   1465  O  O    . ARG A 1 12 ? 11.446  -10.910 15.414  1.00 0.00 ? 12  ARG A O    2  
ATOM   1466  C  CB   . ARG A 1 12 ? 12.319  -12.965 17.287  1.00 0.00 ? 12  ARG A CB   2  
ATOM   1467  C  CG   . ARG A 1 12 ? 12.397  -11.927 18.427  1.00 0.00 ? 12  ARG A CG   2  
ATOM   1468  C  CD   . ARG A 1 12 ? 11.661  -12.374 19.701  1.00 0.00 ? 12  ARG A CD   2  
ATOM   1469  N  NE   . ARG A 1 12 ? 12.295  -13.555 20.310  1.00 0.00 ? 12  ARG A NE   2  
ATOM   1470  C  CZ   . ARG A 1 12 ? 11.664  -14.529 20.976  1.00 0.00 ? 12  ARG A CZ   2  
ATOM   1471  N  NH1  . ARG A 1 12 ? 10.335  -14.536 21.083  1.00 0.00 ? 12  ARG A NH1  2  
ATOM   1472  N  NH2  . ARG A 1 12 ? 12.381  -15.491 21.539  1.00 0.00 ? 12  ARG A NH2  2  
ATOM   1473  H  H    . ARG A 1 12 ? 14.860  -11.978 17.098  1.00 0.00 ? 12  ARG A H    2  
ATOM   1474  H  HA   . ARG A 1 12 ? 12.975  -13.333 15.253  1.00 0.00 ? 12  ARG A HA   2  
ATOM   1475  H  HB2  . ARG A 1 12 ? 11.275  -13.095 17.016  1.00 0.00 ? 12  ARG A HB2  2  
ATOM   1476  H  HB3  . ARG A 1 12 ? 12.694  -13.915 17.662  1.00 0.00 ? 12  ARG A HB3  2  
ATOM   1477  H  HG2  . ARG A 1 12 ? 13.441  -11.764 18.675  1.00 0.00 ? 12  ARG A HG2  2  
ATOM   1478  H  HG3  . ARG A 1 12 ? 11.966  -10.990 18.081  1.00 0.00 ? 12  ARG A HG3  2  
ATOM   1479  H  HD2  . ARG A 1 12 ? 11.681  -11.562 20.420  1.00 0.00 ? 12  ARG A HD2  2  
ATOM   1480  H  HD3  . ARG A 1 12 ? 10.630  -12.605 19.453  1.00 0.00 ? 12  ARG A HD3  2  
ATOM   1481  H  HE   . ARG A 1 12 ? 13.270  -13.610 20.234  1.00 0.00 ? 12  ARG A HE   2  
ATOM   1482  H  HH11 . ARG A 1 12 ? 9.787   -13.812 20.649  1.00 0.00 ? 12  ARG A HH11 2  
ATOM   1483  H  HH12 . ARG A 1 12 ? 9.871   -15.267 21.593  1.00 0.00 ? 12  ARG A HH12 2  
ATOM   1484  H  HH21 . ARG A 1 12 ? 13.383  -15.491 21.453  1.00 0.00 ? 12  ARG A HH21 2  
ATOM   1485  H  HH22 . ARG A 1 12 ? 11.929  -16.231 22.049  1.00 0.00 ? 12  ARG A HH22 2  
ATOM   1486  N  N    . ASP A 1 13 ? 13.604  -10.499 14.866  1.00 0.00 ? 13  ASP A N    2  
ATOM   1487  C  CA   . ASP A 1 13 ? 13.434  -9.129  14.379  1.00 0.00 ? 13  ASP A CA   2  
ATOM   1488  C  C    . ASP A 1 13 ? 14.301  -8.974  13.142  1.00 0.00 ? 13  ASP A C    2  
ATOM   1489  O  O    . ASP A 1 13 ? 15.523  -8.847  13.246  1.00 0.00 ? 13  ASP A O    2  
ATOM   1490  C  CB   . ASP A 1 13 ? 13.851  -8.085  15.451  1.00 0.00 ? 13  ASP A CB   2  
ATOM   1491  C  CG   . ASP A 1 13 ? 12.894  -7.999  16.659  1.00 0.00 ? 13  ASP A CG   2  
ATOM   1492  O  OD1  . ASP A 1 13 ? 11.854  -7.318  16.549  1.00 0.00 ? 13  ASP A OD1  2  
ATOM   1493  O  OD2  . ASP A 1 13 ? 13.189  -8.599  17.717  1.00 0.00 ? 13  ASP A OD2  2  
ATOM   1494  H  H    . ASP A 1 13 ? 14.474  -10.921 14.739  1.00 0.00 ? 13  ASP A H    2  
ATOM   1495  H  HA   . ASP A 1 13 ? 12.385  -8.977  14.107  1.00 0.00 ? 13  ASP A HA   2  
ATOM   1496  H  HB2  . ASP A 1 13 ? 14.839  -8.348  15.816  1.00 0.00 ? 13  ASP A HB2  2  
ATOM   1497  H  HB3  . ASP A 1 13 ? 13.908  -7.104  14.985  1.00 0.00 ? 13  ASP A HB3  2  
ATOM   1498  N  N    . TYR A 1 14 ? 13.669  -9.065  11.985  1.00 0.00 ? 14  TYR A N    2  
ATOM   1499  C  CA   . TYR A 1 14 ? 14.336  -8.929  10.685  1.00 0.00 ? 14  TYR A CA   2  
ATOM   1500  C  C    . TYR A 1 14 ? 14.387  -7.452  10.313  1.00 0.00 ? 14  TYR A C    2  
ATOM   1501  O  O    . TYR A 1 14 ? 13.371  -6.850  9.941   1.00 0.00 ? 14  TYR A O    2  
ATOM   1502  C  CB   . TYR A 1 14 ? 13.602  -9.760  9.607   1.00 0.00 ? 14  TYR A CB   2  
ATOM   1503  C  CG   . TYR A 1 14 ? 13.668  -11.272 9.858   1.00 0.00 ? 14  TYR A CG   2  
ATOM   1504  C  CD1  . TYR A 1 14 ? 12.848  -11.883 10.813  1.00 0.00 ? 14  TYR A CD1  2  
ATOM   1505  C  CD2  . TYR A 1 14 ? 14.558  -12.084 9.153   1.00 0.00 ? 14  TYR A CD2  2  
ATOM   1506  C  CE1  . TYR A 1 14 ? 12.912  -13.241 11.040  1.00 0.00 ? 14  TYR A CE1  2  
ATOM   1507  C  CE2  . TYR A 1 14 ? 14.619  -13.439 9.379   1.00 0.00 ? 14  TYR A CE2  2  
ATOM   1508  C  CZ   . TYR A 1 14 ? 13.797  -14.013 10.320  1.00 0.00 ? 14  TYR A CZ   2  
ATOM   1509  O  OH   . TYR A 1 14 ? 13.852  -15.368 10.534  1.00 0.00 ? 14  TYR A OH   2  
ATOM   1510  H  H    . TYR A 1 14 ? 12.704  -9.201  11.997  1.00 0.00 ? 14  TYR A H    2  
ATOM   1511  H  HA   . TYR A 1 14 ? 15.354  -9.304  10.785  1.00 0.00 ? 14  TYR A HA   2  
ATOM   1512  H  HB2  . TYR A 1 14 ? 12.554  -9.468  9.580   1.00 0.00 ? 14  TYR A HB2  2  
ATOM   1513  H  HB3  . TYR A 1 14 ? 14.043  -9.559  8.639   1.00 0.00 ? 14  TYR A HB3  2  
ATOM   1514  H  HD1  . TYR A 1 14 ? 12.149  -11.277 11.377  1.00 0.00 ? 14  TYR A HD1  2  
ATOM   1515  H  HD2  . TYR A 1 14 ? 15.203  -11.639 8.406   1.00 0.00 ? 14  TYR A HD2  2  
ATOM   1516  H  HE1  . TYR A 1 14 ? 12.264  -13.695 11.775  1.00 0.00 ? 14  TYR A HE1  2  
ATOM   1517  H  HE2  . TYR A 1 14 ? 15.320  -14.050 8.815   1.00 0.00 ? 14  TYR A HE2  2  
ATOM   1518  H  HH   . TYR A 1 14 ? 12.954  -15.722 10.536  1.00 0.00 ? 14  TYR A HH   2  
ATOM   1519  N  N    . ILE A 1 15 ? 15.577  -6.866  10.455  1.00 0.00 ? 15  ILE A N    2  
ATOM   1520  C  CA   . ILE A 1 15 ? 15.806  -5.432  10.279  1.00 0.00 ? 15  ILE A CA   2  
ATOM   1521  C  C    . ILE A 1 15 ? 16.644  -5.226  9.018   1.00 0.00 ? 15  ILE A C    2  
ATOM   1522  O  O    . ILE A 1 15 ? 17.633  -5.935  8.812   1.00 0.00 ? 15  ILE A O    2  
ATOM   1523  C  CB   . ILE A 1 15 ? 16.545  -4.794  11.521  1.00 0.00 ? 15  ILE A CB   2  
ATOM   1524  C  CG1  . ILE A 1 15 ? 15.865  -5.210  12.850  1.00 0.00 ? 15  ILE A CG1  2  
ATOM   1525  C  CG2  . ILE A 1 15 ? 16.642  -3.249  11.393  1.00 0.00 ? 15  ILE A CG2  2  
ATOM   1526  C  CD1  . ILE A 1 15 ? 14.425  -4.820  12.962  1.00 0.00 ? 15  ILE A CD1  2  
ATOM   1527  H  H    . ILE A 1 15 ? 16.360  -7.432  10.635  1.00 0.00 ? 15  ILE A H    2  
ATOM   1528  H  HA   . ILE A 1 15 ? 14.843  -4.932  10.152  1.00 0.00 ? 15  ILE A HA   2  
ATOM   1529  H  HB   . ILE A 1 15 ? 17.549  -5.172  11.535  1.00 0.00 ? 15  ILE A HB   2  
ATOM   1530  H  HG12 . ILE A 1 15 ? 15.910  -6.287  12.955  1.00 0.00 ? 15  ILE A HG12 2  
ATOM   1531  H  HG13 . ILE A 1 15 ? 16.394  -4.760  13.683  1.00 0.00 ? 15  ILE A HG13 2  
ATOM   1532  H  HG21 . ILE A 1 15 ? 15.647  -2.817  11.337  1.00 0.00 ? 15  ILE A HG21 2  
ATOM   1533  H  HG22 . ILE A 1 15 ? 17.187  -2.992  10.490  1.00 0.00 ? 15  ILE A HG22 2  
ATOM   1534  H  HG23 . ILE A 1 15 ? 17.165  -2.837  12.247  1.00 0.00 ? 15  ILE A HG23 2  
ATOM   1535  H  HD11 . ILE A 1 15 ? 14.053  -5.131  13.923  1.00 0.00 ? 15  ILE A HD11 2  
ATOM   1536  H  HD12 . ILE A 1 15 ? 13.864  -5.308  12.183  1.00 0.00 ? 15  ILE A HD12 2  
ATOM   1537  H  HD13 . ILE A 1 15 ? 14.330  -3.749  12.866  1.00 0.00 ? 15  ILE A HD13 2  
ATOM   1538  N  N    . CYS A 1 16 ? 16.217  -4.277  8.180   1.00 0.00 ? 16  CYS A N    2  
ATOM   1539  C  CA   . CYS A 1 16 ? 16.946  -3.862  6.973   1.00 0.00 ? 16  CYS A CA   2  
ATOM   1540  C  C    . CYS A 1 16 ? 18.386  -3.444  7.319   1.00 0.00 ? 16  CYS A C    2  
ATOM   1541  O  O    . CYS A 1 16 ? 19.332  -4.002  6.756   1.00 0.00 ? 16  CYS A O    2  
ATOM   1542  C  CB   . CYS A 1 16 ? 16.167  -2.715  6.294   1.00 0.00 ? 16  CYS A CB   2  
ATOM   1543  S  SG   . CYS A 1 16 ? 16.864  -2.137  4.728   1.00 0.00 ? 16  CYS A SG   2  
ATOM   1544  H  H    . CYS A 1 16 ? 15.363  -3.855  8.370   1.00 0.00 ? 16  CYS A H    2  
ATOM   1545  H  HA   . CYS A 1 16 ? 16.988  -4.709  6.298   1.00 0.00 ? 16  CYS A HA   2  
ATOM   1546  H  HB2  . CYS A 1 16 ? 15.152  -3.038  6.085   1.00 0.00 ? 16  CYS A HB2  2  
ATOM   1547  H  HB3  . CYS A 1 16 ? 16.131  -1.861  6.959   1.00 0.00 ? 16  CYS A HB3  2  
ATOM   1548  N  N    . GLU A 1 17 ? 18.512  -2.509  8.298   1.00 0.00 ? 17  GLU A N    2  
ATOM   1549  C  CA   . GLU A 1 17 ? 19.804  -2.001  8.830   1.00 0.00 ? 17  GLU A CA   2  
ATOM   1550  C  C    . GLU A 1 17 ? 19.517  -0.815  9.782   1.00 0.00 ? 17  GLU A C    2  
ATOM   1551  O  O    . GLU A 1 17 ? 19.941  -0.817  10.939  1.00 0.00 ? 17  GLU A O    2  
ATOM   1552  C  CB   . GLU A 1 17 ? 20.785  -1.580  7.672   1.00 0.00 ? 17  GLU A CB   2  
ATOM   1553  C  CG   . GLU A 1 17 ? 22.202  -1.091  8.085   1.00 0.00 ? 17  GLU A CG   2  
ATOM   1554  C  CD   . GLU A 1 17 ? 22.303  0.431   8.335   1.00 0.00 ? 17  GLU A CD   2  
ATOM   1555  O  OE1  . GLU A 1 17 ? 22.095  1.207   7.373   1.00 0.00 ? 17  GLU A OE1  2  
ATOM   1556  O  OE2  . GLU A 1 17 ? 22.591  0.854   9.477   1.00 0.00 ? 17  GLU A OE2  2  
ATOM   1557  H  H    . GLU A 1 17 ? 17.696  -2.167  8.702   1.00 0.00 ? 17  GLU A H    2  
ATOM   1558  H  HA   . GLU A 1 17 ? 20.253  -2.809  9.401   1.00 0.00 ? 17  GLU A HA   2  
ATOM   1559  H  HB2  . GLU A 1 17 ? 20.917  -2.439  7.026   1.00 0.00 ? 17  GLU A HB2  2  
ATOM   1560  H  HB3  . GLU A 1 17 ? 20.307  -0.800  7.086   1.00 0.00 ? 17  GLU A HB3  2  
ATOM   1561  H  HG2  . GLU A 1 17 ? 22.497  -1.618  8.985   1.00 0.00 ? 17  GLU A HG2  2  
ATOM   1562  H  HG3  . GLU A 1 17 ? 22.902  -1.348  7.293   1.00 0.00 ? 17  GLU A HG3  2  
ATOM   1563  N  N    . TYR A 1 18 ? 18.772  0.175   9.259   1.00 0.00 ? 18  TYR A N    2  
ATOM   1564  C  CA   . TYR A 1 18 ? 18.463  1.443   9.960   1.00 0.00 ? 18  TYR A CA   2  
ATOM   1565  C  C    . TYR A 1 18 ? 17.012  1.807   9.650   1.00 0.00 ? 18  TYR A C    2  
ATOM   1566  O  O    . TYR A 1 18 ? 16.218  2.153   10.521  1.00 0.00 ? 18  TYR A O    2  
ATOM   1567  C  CB   . TYR A 1 18 ? 19.419  2.584   9.523   1.00 0.00 ? 18  TYR A CB   2  
ATOM   1568  C  CG   . TYR A 1 18 ? 19.350  3.809   10.449  1.00 0.00 ? 18  TYR A CG   2  
ATOM   1569  C  CD1  . TYR A 1 18 ? 19.536  3.660   11.821  1.00 0.00 ? 18  TYR A CD1  2  
ATOM   1570  C  CD2  . TYR A 1 18 ? 19.073  5.089   9.971   1.00 0.00 ? 18  TYR A CD2  2  
ATOM   1571  C  CE1  . TYR A 1 18 ? 19.457  4.733   12.678  1.00 0.00 ? 18  TYR A CE1  2  
ATOM   1572  C  CE2  . TYR A 1 18 ? 18.990  6.173   10.827  1.00 0.00 ? 18  TYR A CE2  2  
ATOM   1573  C  CZ   . TYR A 1 18 ? 19.180  5.993   12.182  1.00 0.00 ? 18  TYR A CZ   2  
ATOM   1574  O  OH   . TYR A 1 18 ? 19.110  7.075   13.043  1.00 0.00 ? 18  TYR A OH   2  
ATOM   1575  H  H    . TYR A 1 18 ? 18.284  -0.023  8.439   1.00 0.00 ? 18  TYR A H    2  
ATOM   1576  H  HA   . TYR A 1 18 ? 18.564  1.285   11.042  1.00 0.00 ? 18  TYR A HA   2  
ATOM   1577  H  HB2  . TYR A 1 18 ? 20.432  2.212   9.529   1.00 0.00 ? 18  TYR A HB2  2  
ATOM   1578  H  HB3  . TYR A 1 18 ? 19.174  2.899   8.509   1.00 0.00 ? 18  TYR A HB3  2  
ATOM   1579  H  HD1  . TYR A 1 18 ? 19.760  2.677   12.223  1.00 0.00 ? 18  TYR A HD1  2  
ATOM   1580  H  HD2  . TYR A 1 18 ? 18.924  5.229   8.904   1.00 0.00 ? 18  TYR A HD2  2  
ATOM   1581  H  HE1  . TYR A 1 18 ? 19.602  4.576   13.735  1.00 0.00 ? 18  TYR A HE1  2  
ATOM   1582  H  HE2  . TYR A 1 18 ? 18.764  7.157   10.430  1.00 0.00 ? 18  TYR A HE2  2  
ATOM   1583  H  HH   . TYR A 1 18 ? 19.861  7.052   13.646  1.00 0.00 ? 18  TYR A HH   2  
ATOM   1584  N  N    . CYS A 1 19 ? 16.693  1.683   8.353   1.00 0.00 ? 19  CYS A N    2  
ATOM   1585  C  CA   . CYS A 1 19 ? 15.357  1.944   7.801   1.00 0.00 ? 19  CYS A CA   2  
ATOM   1586  C  C    . CYS A 1 19 ? 14.507  0.664   7.873   1.00 0.00 ? 19  CYS A C    2  
ATOM   1587  O  O    . CYS A 1 19 ? 14.198  0.029   6.857   1.00 0.00 ? 19  CYS A O    2  
ATOM   1588  C  CB   . CYS A 1 19 ? 15.470  2.499   6.360   1.00 0.00 ? 19  CYS A CB   2  
ATOM   1589  S  SG   . CYS A 1 19 ? 16.724  1.662   5.348   1.00 0.00 ? 19  CYS A SG   2  
ATOM   1590  H  H    . CYS A 1 19 ? 17.390  1.340   7.753   1.00 0.00 ? 19  CYS A H    2  
ATOM   1591  H  HA   . CYS A 1 19 ? 14.876  2.700   8.424   1.00 0.00 ? 19  CYS A HA   2  
ATOM   1592  H  HB2  . CYS A 1 19 ? 14.520  2.397   5.854   1.00 0.00 ? 19  CYS A HB2  2  
ATOM   1593  H  HB3  . CYS A 1 19 ? 15.735  3.551   6.405   1.00 0.00 ? 19  CYS A HB3  2  
ATOM   1594  N  N    . ALA A 1 20 ? 14.246  0.242   9.118   1.00 0.00 ? 20  ALA A N    2  
ATOM   1595  C  CA   . ALA A 1 20 ? 13.242  -0.777  9.445   1.00 0.00 ? 20  ALA A CA   2  
ATOM   1596  C  C    . ALA A 1 20 ? 12.788  -0.655  10.905  1.00 0.00 ? 20  ALA A C    2  
ATOM   1597  O  O    . ALA A 1 20 ? 13.613  -0.475  11.806  1.00 0.00 ? 20  ALA A O    2  
ATOM   1598  C  CB   . ALA A 1 20 ? 13.764  -2.195  9.179   1.00 0.00 ? 20  ALA A CB   2  
ATOM   1599  H  H    . ALA A 1 20 ? 14.774  0.617   9.842   1.00 0.00 ? 20  ALA A H    2  
ATOM   1600  H  HA   . ALA A 1 20 ? 12.390  -0.610  8.802   1.00 0.00 ? 20  ALA A HA   2  
ATOM   1601  H  HB1  . ALA A 1 20 ? 12.980  -2.921  9.371   1.00 0.00 ? 20  ALA A HB1  2  
ATOM   1602  H  HB2  . ALA A 1 20 ? 14.609  -2.407  9.823   1.00 0.00 ? 20  ALA A HB2  2  
ATOM   1603  H  HB3  . ALA A 1 20 ? 14.077  -2.279  8.148   1.00 0.00 ? 20  ALA A HB3  2  
ATOM   1604  N  N    . ARG A 1 21 ? 11.464  -0.714  11.109  1.00 0.00 ? 21  ARG A N    2  
ATOM   1605  C  CA   . ARG A 1 21 ? 10.872  -0.907  12.441  1.00 0.00 ? 21  ARG A CA   2  
ATOM   1606  C  C    . ARG A 1 21 ? 11.190  -2.343  12.930  1.00 0.00 ? 21  ARG A C    2  
ATOM   1607  O  O    . ARG A 1 21 ? 12.142  -2.524  13.702  1.00 0.00 ? 21  ARG A O    2  
ATOM   1608  C  CB   . ARG A 1 21 ? 9.337   -0.572  12.433  1.00 0.00 ? 21  ARG A CB   2  
ATOM   1609  C  CG   . ARG A 1 21 ? 8.558   -0.941  11.141  1.00 0.00 ? 21  ARG A CG   2  
ATOM   1610  C  CD   . ARG A 1 21 ? 7.049   -0.615  11.234  1.00 0.00 ? 21  ARG A CD   2  
ATOM   1611  N  NE   . ARG A 1 21 ? 6.802   0.742   11.767  1.00 0.00 ? 21  ARG A NE   2  
ATOM   1612  C  CZ   . ARG A 1 21 ? 6.164   1.745   11.134  1.00 0.00 ? 21  ARG A CZ   2  
ATOM   1613  N  NH1  . ARG A 1 21 ? 5.751   1.618   9.873   1.00 0.00 ? 21  ARG A NH1  2  
ATOM   1614  N  NH2  . ARG A 1 21 ? 5.992   2.891   11.762  1.00 0.00 ? 21  ARG A NH2  2  
ATOM   1615  H  H    . ARG A 1 21 ? 10.892  -0.538  10.335  1.00 0.00 ? 21  ARG A H    2  
ATOM   1616  H  HA   . ARG A 1 21 ? 11.371  -0.207  13.114  1.00 0.00 ? 21  ARG A HA   2  
ATOM   1617  H  HB2  . ARG A 1 21 ? 8.864   -1.081  13.266  1.00 0.00 ? 21  ARG A HB2  2  
ATOM   1618  H  HB3  . ARG A 1 21 ? 9.227   0.495   12.589  1.00 0.00 ? 21  ARG A HB3  2  
ATOM   1619  H  HG2  . ARG A 1 21 ? 8.983   -0.386  10.311  1.00 0.00 ? 21  ARG A HG2  2  
ATOM   1620  H  HG3  . ARG A 1 21 ? 8.679   -2.003  10.949  1.00 0.00 ? 21  ARG A HG3  2  
ATOM   1621  H  HD2  . ARG A 1 21 ? 6.606   -0.703  10.245  1.00 0.00 ? 21  ARG A HD2  2  
ATOM   1622  H  HD3  . ARG A 1 21 ? 6.577   -1.333  11.892  1.00 0.00 ? 21  ARG A HD3  2  
ATOM   1623  H  HE   . ARG A 1 21 ? 7.113   0.913   12.686  1.00 0.00 ? 21  ARG A HE   2  
ATOM   1624  H  HH11 . ARG A 1 21 ? 5.905   0.764   9.366   1.00 0.00 ? 21  ARG A HH11 2  
ATOM   1625  H  HH12 . ARG A 1 21 ? 5.270   2.376   9.428   1.00 0.00 ? 21  ARG A HH12 2  
ATOM   1626  H  HH21 . ARG A 1 21 ? 6.322   3.008   12.704  1.00 0.00 ? 21  ARG A HH21 2  
ATOM   1627  H  HH22 . ARG A 1 21 ? 5.520   3.653   11.308  1.00 0.00 ? 21  ARG A HH22 2  
ATOM   1628  N  N    . ALA A 1 22 ? 10.416  -3.339  12.473  1.00 0.00 ? 22  ALA A N    2  
ATOM   1629  C  CA   . ALA A 1 22 ? 10.770  -4.761  12.582  1.00 0.00 ? 22  ALA A CA   2  
ATOM   1630  C  C    . ALA A 1 22 ? 9.849   -5.573  11.675  1.00 0.00 ? 22  ALA A C    2  
ATOM   1631  O  O    . ALA A 1 22 ? 8.623   -5.473  11.786  1.00 0.00 ? 22  ALA A O    2  
ATOM   1632  C  CB   . ALA A 1 22 ? 10.670  -5.256  14.038  1.00 0.00 ? 22  ALA A CB   2  
ATOM   1633  H  H    . ALA A 1 22 ? 9.544   -3.127  12.098  1.00 0.00 ? 22  ALA A H    2  
ATOM   1634  H  HA   . ALA A 1 22 ? 11.799  -4.883  12.249  1.00 0.00 ? 22  ALA A HA   2  
ATOM   1635  H  HB1  . ALA A 1 22 ? 10.977  -6.293  14.094  1.00 0.00 ? 22  ALA A HB1  2  
ATOM   1636  H  HB2  . ALA A 1 22 ? 9.651   -5.162  14.389  1.00 0.00 ? 22  ALA A HB2  2  
ATOM   1637  H  HB3  . ALA A 1 22 ? 11.318  -4.659  14.665  1.00 0.00 ? 22  ALA A HB3  2  
ATOM   1638  N  N    . PHE A 1 23 ? 10.442  -6.360  10.778  1.00 0.00 ? 23  PHE A N    2  
ATOM   1639  C  CA   . PHE A 1 23 ? 9.710   -7.220  9.841   1.00 0.00 ? 23  PHE A CA   2  
ATOM   1640  C  C    . PHE A 1 23 ? 9.753   -8.668  10.339  1.00 0.00 ? 23  PHE A C    2  
ATOM   1641  O  O    . PHE A 1 23 ? 10.708  -9.067  11.017  1.00 0.00 ? 23  PHE A O    2  
ATOM   1642  C  CB   . PHE A 1 23 ? 10.327  -7.110  8.428   1.00 0.00 ? 23  PHE A CB   2  
ATOM   1643  C  CG   . PHE A 1 23 ? 10.158  -5.734  7.764   1.00 0.00 ? 23  PHE A CG   2  
ATOM   1644  C  CD1  . PHE A 1 23 ? 9.020   -5.441  7.016   1.00 0.00 ? 23  PHE A CD1  2  
ATOM   1645  C  CD2  . PHE A 1 23 ? 11.140  -4.746  7.862   1.00 0.00 ? 23  PHE A CD2  2  
ATOM   1646  C  CE1  . PHE A 1 23 ? 8.867   -4.220  6.387   1.00 0.00 ? 23  PHE A CE1  2  
ATOM   1647  C  CE2  . PHE A 1 23 ? 10.984  -3.520  7.234   1.00 0.00 ? 23  PHE A CE2  2  
ATOM   1648  C  CZ   . PHE A 1 23 ? 9.848   -3.259  6.498   1.00 0.00 ? 23  PHE A CZ   2  
ATOM   1649  H  H    . PHE A 1 23 ? 11.421  -6.384  10.760  1.00 0.00 ? 23  PHE A H    2  
ATOM   1650  H  HA   . PHE A 1 23 ? 8.670   -6.890  9.805   1.00 0.00 ? 23  PHE A HA   2  
ATOM   1651  H  HB2  . PHE A 1 23 ? 11.390  -7.325  8.486   1.00 0.00 ? 23  PHE A HB2  2  
ATOM   1652  H  HB3  . PHE A 1 23 ? 9.867   -7.852  7.781   1.00 0.00 ? 23  PHE A HB3  2  
ATOM   1653  H  HD1  . PHE A 1 23 ? 8.243   -6.186  6.923   1.00 0.00 ? 23  PHE A HD1  2  
ATOM   1654  H  HD2  . PHE A 1 23 ? 12.037  -4.942  8.438   1.00 0.00 ? 23  PHE A HD2  2  
ATOM   1655  H  HE1  . PHE A 1 23 ? 7.975   -4.016  5.810   1.00 0.00 ? 23  PHE A HE1  2  
ATOM   1656  H  HE2  . PHE A 1 23 ? 11.756  -2.767  7.320   1.00 0.00 ? 23  PHE A HE2  2  
ATOM   1657  H  HZ   . PHE A 1 23 ? 9.727   -2.302  6.005   1.00 0.00 ? 23  PHE A HZ   2  
ATOM   1658  N  N    . LYS A 1 24 ? 8.711   -9.444  10.011  1.00 0.00 ? 24  LYS A N    2  
ATOM   1659  C  CA   . LYS A 1 24 ? 8.612   -10.860 10.409  1.00 0.00 ? 24  LYS A CA   2  
ATOM   1660  C  C    . LYS A 1 24 ? 9.519   -11.768 9.557   1.00 0.00 ? 24  LYS A C    2  
ATOM   1661  O  O    . LYS A 1 24 ? 9.792   -12.908 9.945   1.00 0.00 ? 24  LYS A O    2  
ATOM   1662  C  CB   . LYS A 1 24 ? 7.145   -11.348 10.308  1.00 0.00 ? 24  LYS A CB   2  
ATOM   1663  C  CG   . LYS A 1 24 ? 6.543   -11.360 8.873   1.00 0.00 ? 24  LYS A CG   2  
ATOM   1664  C  CD   . LYS A 1 24 ? 5.144   -12.025 8.800   1.00 0.00 ? 24  LYS A CD   2  
ATOM   1665  C  CE   . LYS A 1 24 ? 5.165   -13.494 9.267   1.00 0.00 ? 24  LYS A CE   2  
ATOM   1666  N  NZ   . LYS A 1 24 ? 3.845   -14.149 9.137   1.00 0.00 ? 24  LYS A NZ   2  
ATOM   1667  H  H    . LYS A 1 24 ? 7.962   -9.051  9.515   1.00 0.00 ? 24  LYS A H    2  
ATOM   1668  H  HA   . LYS A 1 24 ? 8.933   -10.932 11.447  1.00 0.00 ? 24  LYS A HA   2  
ATOM   1669  H  HB2  . LYS A 1 24 ? 7.093   -12.360 10.707  1.00 0.00 ? 24  LYS A HB2  2  
ATOM   1670  H  HB3  . LYS A 1 24 ? 6.526   -10.711 10.930  1.00 0.00 ? 24  LYS A HB3  2  
ATOM   1671  H  HG2  . LYS A 1 24 ? 6.454   -10.338 8.528   1.00 0.00 ? 24  LYS A HG2  2  
ATOM   1672  H  HG3  . LYS A 1 24 ? 7.222   -11.896 8.212   1.00 0.00 ? 24  LYS A HG3  2  
ATOM   1673  H  HD2  . LYS A 1 24 ? 4.452   -11.472 9.428   1.00 0.00 ? 24  LYS A HD2  2  
ATOM   1674  H  HD3  . LYS A 1 24 ? 4.790   -11.990 7.772   1.00 0.00 ? 24  LYS A HD3  2  
ATOM   1675  H  HE2  . LYS A 1 24 ? 5.879   -14.041 8.667   1.00 0.00 ? 24  LYS A HE2  2  
ATOM   1676  H  HE3  . LYS A 1 24 ? 5.468   -13.530 10.305  1.00 0.00 ? 24  LYS A HE3  2  
ATOM   1677  H  HZ1  . LYS A 1 24 ? 3.529   -14.123 8.148   1.00 0.00 ? 24  LYS A HZ1  2  
ATOM   1678  H  HZ2  . LYS A 1 24 ? 3.136   -13.659 9.726   1.00 0.00 ? 24  LYS A HZ2  2  
ATOM   1679  H  HZ3  . LYS A 1 24 ? 3.912   -15.139 9.441   1.00 0.00 ? 24  LYS A HZ3  2  
ATOM   1680  N  N    . SER A 1 25 ? 9.975   -11.267 8.393   1.00 0.00 ? 25  SER A N    2  
ATOM   1681  C  CA   . SER A 1 25 ? 10.749  -12.061 7.426   1.00 0.00 ? 25  SER A CA   2  
ATOM   1682  C  C    . SER A 1 25 ? 11.778  -11.177 6.695   1.00 0.00 ? 25  SER A C    2  
ATOM   1683  O  O    . SER A 1 25 ? 11.582  -9.964  6.539   1.00 0.00 ? 25  SER A O    2  
ATOM   1684  C  CB   . SER A 1 25 ? 9.795   -12.741 6.402   1.00 0.00 ? 25  SER A CB   2  
ATOM   1685  O  OG   . SER A 1 25 ? 10.514  -13.431 5.385   1.00 0.00 ? 25  SER A OG   2  
ATOM   1686  H  H    . SER A 1 25 ? 9.802   -10.329 8.169   1.00 0.00 ? 25  SER A H    2  
ATOM   1687  H  HA   . SER A 1 25 ? 11.289  -12.834 7.971   1.00 0.00 ? 25  SER A HA   2  
ATOM   1688  H  HB2  . SER A 1 25 ? 9.167   -13.454 6.916   1.00 0.00 ? 25  SER A HB2  2  
ATOM   1689  H  HB3  . SER A 1 25 ? 9.170   -11.993 5.932   1.00 0.00 ? 25  SER A HB3  2  
ATOM   1690  H  HG   . SER A 1 25 ? 11.112  -14.074 5.790   1.00 0.00 ? 25  SER A HG   2  
ATOM   1691  N  N    . SER A 1 26 ? 12.891  -11.817 6.300   1.00 0.00 ? 26  SER A N    2  
ATOM   1692  C  CA   . SER A 1 26 ? 13.908  -11.230 5.409   1.00 0.00 ? 26  SER A CA   2  
ATOM   1693  C  C    . SER A 1 26 ? 13.297  -10.817 4.050   1.00 0.00 ? 26  SER A C    2  
ATOM   1694  O  O    . SER A 1 26 ? 13.714  -9.835  3.447   1.00 0.00 ? 26  SER A O    2  
ATOM   1695  C  CB   . SER A 1 26 ? 15.057  -12.237 5.202   1.00 0.00 ? 26  SER A CB   2  
ATOM   1696  O  OG   . SER A 1 26 ? 14.576  -13.466 4.678   1.00 0.00 ? 26  SER A OG   2  
ATOM   1697  H  H    . SER A 1 26 ? 13.052  -12.701 6.685   1.00 0.00 ? 26  SER A H    2  
ATOM   1698  H  HA   . SER A 1 26 ? 14.301  -10.346 5.898   1.00 0.00 ? 26  SER A HA   2  
ATOM   1699  H  HB2  . SER A 1 26 ? 15.790  -11.830 4.514   1.00 0.00 ? 26  SER A HB2  2  
ATOM   1700  H  HB3  . SER A 1 26 ? 15.539  -12.434 6.151   1.00 0.00 ? 26  SER A HB3  2  
ATOM   1701  H  HG   . SER A 1 26 ? 14.952  -13.607 3.800   1.00 0.00 ? 26  SER A HG   2  
ATOM   1702  N  N    . HIS A 1 27 ? 12.311  -11.596 3.590   1.00 0.00 ? 27  HIS A N    2  
ATOM   1703  C  CA   . HIS A 1 27 ? 11.569  -11.329 2.343   1.00 0.00 ? 27  HIS A CA   2  
ATOM   1704  C  C    . HIS A 1 27 ? 10.589  -10.157 2.526   1.00 0.00 ? 27  HIS A C    2  
ATOM   1705  O  O    . HIS A 1 27 ? 10.369  -9.378  1.595   1.00 0.00 ? 27  HIS A O    2  
ATOM   1706  C  CB   . HIS A 1 27 ? 10.866  -12.615 1.847   1.00 0.00 ? 27  HIS A CB   2  
ATOM   1707  C  CG   . HIS A 1 27 ? 11.856  -13.663 1.404   1.00 0.00 ? 27  HIS A CG   2  
ATOM   1708  N  ND1  . HIS A 1 27 ? 12.126  -13.915 0.080   1.00 0.00 ? 27  HIS A ND1  2  
ATOM   1709  C  CD2  . HIS A 1 27 ? 12.687  -14.468 2.111   1.00 0.00 ? 27  HIS A CD2  2  
ATOM   1710  C  CE1  . HIS A 1 27 ? 13.074  -14.820 -0.013  1.00 0.00 ? 27  HIS A CE1  2  
ATOM   1711  N  NE2  . HIS A 1 27 ? 13.439  -15.173 1.204   1.00 0.00 ? 27  HIS A NE2  2  
ATOM   1712  H  H    . HIS A 1 27 ? 12.068  -12.388 4.111   1.00 0.00 ? 27  HIS A H    2  
ATOM   1713  H  HA   . HIS A 1 27 ? 12.301  -11.032 1.590   1.00 0.00 ? 27  HIS A HA   2  
ATOM   1714  H  HB2  . HIS A 1 27 ? 10.264  -13.025 2.643   1.00 0.00 ? 27  HIS A HB2  2  
ATOM   1715  H  HB3  . HIS A 1 27 ? 10.228  -12.382 1.001   1.00 0.00 ? 27  HIS A HB3  2  
ATOM   1716  H  HD1  . HIS A 1 27 ? 11.682  -13.490 -0.687  1.00 0.00 ? 27  HIS A HD1  2  
ATOM   1717  H  HD2  . HIS A 1 27 ? 12.753  -14.532 3.188   1.00 0.00 ? 27  HIS A HD2  2  
ATOM   1718  H  HE1  . HIS A 1 27 ? 13.487  -15.208 -0.935  1.00 0.00 ? 27  HIS A HE1  2  
ATOM   1719  H  HE2  . HIS A 1 27 ? 14.213  -15.736 1.419   1.00 0.00 ? 27  HIS A HE2  2  
ATOM   1720  N  N    . ASN A 1 28 ? 10.002  -10.058 3.731   1.00 0.00 ? 28  ASN A N    2  
ATOM   1721  C  CA   . ASN A 1 28 ? 9.119   -8.932  4.125   1.00 0.00 ? 28  ASN A CA   2  
ATOM   1722  C  C    . ASN A 1 28 ? 9.905   -7.597  4.060   1.00 0.00 ? 28  ASN A C    2  
ATOM   1723  O  O    . ASN A 1 28 ? 9.414   -6.600  3.529   1.00 0.00 ? 28  ASN A O    2  
ATOM   1724  C  CB   . ASN A 1 28 ? 8.582   -9.143  5.573   1.00 0.00 ? 28  ASN A CB   2  
ATOM   1725  C  CG   . ASN A 1 28 ? 7.323   -8.331  5.968   1.00 0.00 ? 28  ASN A CG   2  
ATOM   1726  O  OD1  . ASN A 1 28 ? 6.673   -8.659  6.961   1.00 0.00 ? 28  ASN A OD1  2  
ATOM   1727  N  ND2  . ASN A 1 28 ? 6.944   -7.299  5.214   1.00 0.00 ? 28  ASN A ND2  2  
ATOM   1728  H  H    . ASN A 1 28 ? 10.161  -10.773 4.379   1.00 0.00 ? 28  ASN A H    2  
ATOM   1729  H  HA   . ASN A 1 28 ? 8.285   -8.899  3.433   1.00 0.00 ? 28  ASN A HA   2  
ATOM   1730  H  HB2  . ASN A 1 28 ? 8.341   -10.189 5.696   1.00 0.00 ? 28  ASN A HB2  2  
ATOM   1731  H  HB3  . ASN A 1 28 ? 9.377   -8.894  6.280   1.00 0.00 ? 28  ASN A HB3  2  
ATOM   1732  H  HD21 . ASN A 1 28 ? 7.462   -7.076  4.420   1.00 0.00 ? 28  ASN A HD21 2  
ATOM   1733  H  HD22 . ASN A 1 28 ? 6.145   -6.800  5.492   1.00 0.00 ? 28  ASN A HD22 2  
ATOM   1734  N  N    . LEU A 1 29 ? 11.114  -7.597  4.663   1.00 0.00 ? 29  LEU A N    2  
ATOM   1735  C  CA   . LEU A 1 29 ? 12.029  -6.434  4.649   1.00 0.00 ? 29  LEU A CA   2  
ATOM   1736  C  C    . LEU A 1 29 ? 12.536  -6.164  3.230   1.00 0.00 ? 29  LEU A C    2  
ATOM   1737  O  O    . LEU A 1 29 ? 12.733  -5.004  2.855   1.00 0.00 ? 29  LEU A O    2  
ATOM   1738  C  CB   . LEU A 1 29 ? 13.187  -6.634  5.706   1.00 0.00 ? 29  LEU A CB   2  
ATOM   1739  C  CG   . LEU A 1 29 ? 14.550  -7.315  5.288   1.00 0.00 ? 29  LEU A CG   2  
ATOM   1740  C  CD1  . LEU A 1 29 ? 15.522  -6.375  4.524   1.00 0.00 ? 29  LEU A CD1  2  
ATOM   1741  C  CD2  . LEU A 1 29 ? 15.261  -7.925  6.519   1.00 0.00 ? 29  LEU A CD2  2  
ATOM   1742  H  H    . LEU A 1 29 ? 11.360  -8.382  5.195   1.00 0.00 ? 29  LEU A H    2  
ATOM   1743  H  HA   . LEU A 1 29 ? 11.437  -5.573  4.953   1.00 0.00 ? 29  LEU A HA   2  
ATOM   1744  H  HB2  . LEU A 1 29 ? 13.417  -5.670  6.148   1.00 0.00 ? 29  LEU A HB2  2  
ATOM   1745  H  HB3  . LEU A 1 29 ? 12.750  -7.248  6.489   1.00 0.00 ? 29  LEU A HB3  2  
ATOM   1746  H  HG   . LEU A 1 29 ? 14.325  -8.133  4.620   1.00 0.00 ? 29  LEU A HG   2  
ATOM   1747  H  HD11 . LEU A 1 29 ? 16.427  -6.915  4.280   1.00 0.00 ? 29  LEU A HD11 2  
ATOM   1748  H  HD12 . LEU A 1 29 ? 15.771  -5.517  5.132   1.00 0.00 ? 29  LEU A HD12 2  
ATOM   1749  H  HD13 . LEU A 1 29 ? 15.056  -6.038  3.606   1.00 0.00 ? 29  LEU A HD13 2  
ATOM   1750  H  HD21 . LEU A 1 29 ? 14.599  -8.630  7.006   1.00 0.00 ? 29  LEU A HD21 2  
ATOM   1751  H  HD22 . LEU A 1 29 ? 15.531  -7.146  7.222   1.00 0.00 ? 29  LEU A HD22 2  
ATOM   1752  H  HD23 . LEU A 1 29 ? 16.155  -8.445  6.200   1.00 0.00 ? 29  LEU A HD23 2  
ATOM   1753  N  N    . ALA A 1 30 ? 12.739  -7.256  2.463   1.00 0.00 ? 30  ALA A N    2  
ATOM   1754  C  CA   . ALA A 1 30 ? 13.202  -7.196  1.051   1.00 0.00 ? 30  ALA A CA   2  
ATOM   1755  C  C    . ALA A 1 30 ? 12.237  -6.380  0.163   1.00 0.00 ? 30  ALA A C    2  
ATOM   1756  O  O    . ALA A 1 30 ? 12.671  -5.726  -0.795  1.00 0.00 ? 30  ALA A O    2  
ATOM   1757  C  CB   . ALA A 1 30 ? 13.406  -8.601  0.464   1.00 0.00 ? 30  ALA A CB   2  
ATOM   1758  H  H    . ALA A 1 30 ? 12.586  -8.132  2.874   1.00 0.00 ? 30  ALA A H    2  
ATOM   1759  H  HA   . ALA A 1 30 ? 14.172  -6.700  1.061   1.00 0.00 ? 30  ALA A HA   2  
ATOM   1760  H  HB1  . ALA A 1 30 ? 13.823  -8.526  -0.535  1.00 0.00 ? 30  ALA A HB1  2  
ATOM   1761  H  HB2  . ALA A 1 30 ? 12.458  -9.118  0.417   1.00 0.00 ? 30  ALA A HB2  2  
ATOM   1762  H  HB3  . ALA A 1 30 ? 14.085  -9.167  1.092   1.00 0.00 ? 30  ALA A HB3  2  
ATOM   1763  N  N    . VAL A 1 31 ? 10.937  -6.416  0.519   1.00 0.00 ? 31  VAL A N    2  
ATOM   1764  C  CA   . VAL A 1 31 ? 9.873   -5.620  -0.134  1.00 0.00 ? 31  VAL A CA   2  
ATOM   1765  C  C    . VAL A 1 31 ? 10.193  -4.108  -0.092  1.00 0.00 ? 31  VAL A C    2  
ATOM   1766  O  O    . VAL A 1 31 ? 10.144  -3.422  -1.123  1.00 0.00 ? 31  VAL A O    2  
ATOM   1767  C  CB   . VAL A 1 31 ? 8.482   -5.909  0.555   1.00 0.00 ? 31  VAL A CB   2  
ATOM   1768  C  CG1  . VAL A 1 31 ? 7.408   -4.857  0.197   1.00 0.00 ? 31  VAL A CG1  2  
ATOM   1769  C  CG2  . VAL A 1 31 ? 7.997   -7.344  0.229   1.00 0.00 ? 31  VAL A CG2  2  
ATOM   1770  H  H    . VAL A 1 31 ? 10.686  -7.005  1.263   1.00 0.00 ? 31  VAL A H    2  
ATOM   1771  H  HA   . VAL A 1 31 ? 9.812   -5.934  -1.174  1.00 0.00 ? 31  VAL A HA   2  
ATOM   1772  H  HB   . VAL A 1 31 ? 8.637   -5.857  1.633   1.00 0.00 ? 31  VAL A HB   2  
ATOM   1773  H  HG11 . VAL A 1 31 ? 6.460   -5.133  0.644   1.00 0.00 ? 31  VAL A HG11 2  
ATOM   1774  H  HG12 . VAL A 1 31 ? 7.296   -4.796  -0.871  1.00 0.00 ? 31  VAL A HG12 2  
ATOM   1775  H  HG13 . VAL A 1 31 ? 7.707   -3.886  0.577   1.00 0.00 ? 31  VAL A HG13 2  
ATOM   1776  H  HG21 . VAL A 1 31 ? 8.733   -8.066  0.564   1.00 0.00 ? 31  VAL A HG21 2  
ATOM   1777  H  HG22 . VAL A 1 31 ? 7.857   -7.448  -0.838  1.00 0.00 ? 31  VAL A HG22 2  
ATOM   1778  H  HG23 . VAL A 1 31 ? 7.056   -7.536  0.732   1.00 0.00 ? 31  VAL A HG23 2  
ATOM   1779  N  N    . HIS A 1 32 ? 10.535  -3.607  1.109   1.00 0.00 ? 32  HIS A N    2  
ATOM   1780  C  CA   . HIS A 1 32 ? 10.906  -2.200  1.318   1.00 0.00 ? 32  HIS A CA   2  
ATOM   1781  C  C    . HIS A 1 32 ? 12.310  -1.945  0.737   1.00 0.00 ? 32  HIS A C    2  
ATOM   1782  O  O    . HIS A 1 32 ? 12.601  -0.866  0.202   1.00 0.00 ? 32  HIS A O    2  
ATOM   1783  C  CB   . HIS A 1 32 ? 10.811  -1.845  2.857   1.00 0.00 ? 32  HIS A CB   2  
ATOM   1784  C  CG   . HIS A 1 32 ? 11.936  -0.991  3.374   1.00 0.00 ? 32  HIS A CG   2  
ATOM   1785  N  ND1  . HIS A 1 32 ? 11.903  0.376   3.462   1.00 0.00 ? 32  HIS A ND1  2  
ATOM   1786  C  CD2  . HIS A 1 32 ? 13.186  -1.362  3.738   1.00 0.00 ? 32  HIS A CD2  2  
ATOM   1787  C  CE1  . HIS A 1 32 ? 13.115  0.791   3.842   1.00 0.00 ? 32  HIS A CE1  2  
ATOM   1788  N  NE2  . HIS A 1 32 ? 13.944  -0.224  4.020   1.00 0.00 ? 32  HIS A NE2  2  
ATOM   1789  H  H    . HIS A 1 32 ? 10.557  -4.206  1.878   1.00 0.00 ? 32  HIS A H    2  
ATOM   1790  H  HA   . HIS A 1 32 ? 10.198  -1.587  0.763   1.00 0.00 ? 32  HIS A HA   2  
ATOM   1791  H  HB2  . HIS A 1 32 ? 9.888   -1.315  3.044   1.00 0.00 ? 32  HIS A HB2  2  
ATOM   1792  H  HB3  . HIS A 1 32 ? 10.797  -2.761  3.443   1.00 0.00 ? 32  HIS A HB3  2  
ATOM   1793  H  HD1  . HIS A 1 32 ? 11.136  0.952   3.254   1.00 0.00 ? 32  HIS A HD1  2  
ATOM   1794  H  HD2  . HIS A 1 32 ? 13.551  -2.386  3.734   1.00 0.00 ? 32  HIS A HD2  2  
ATOM   1795  H  HE1  . HIS A 1 32 ? 13.380  1.826   3.998   1.00 0.00 ? 32  HIS A HE1  2  
ATOM   1796  N  N    . ARG A 1 33 ? 13.162  -2.980  0.857   1.00 0.00 ? 33  ARG A N    2  
ATOM   1797  C  CA   . ARG A 1 33 ? 14.582  -2.946  0.467   1.00 0.00 ? 33  ARG A CA   2  
ATOM   1798  C  C    . ARG A 1 33 ? 14.751  -2.726  -1.049  1.00 0.00 ? 33  ARG A C    2  
ATOM   1799  O  O    . ARG A 1 33 ? 15.858  -2.475  -1.481  1.00 0.00 ? 33  ARG A O    2  
ATOM   1800  C  CB   . ARG A 1 33 ? 15.264  -4.271  0.918   1.00 0.00 ? 33  ARG A CB   2  
ATOM   1801  C  CG   . ARG A 1 33 ? 16.809  -4.278  0.941   1.00 0.00 ? 33  ARG A CG   2  
ATOM   1802  C  CD   . ARG A 1 33 ? 17.396  -5.672  1.243   1.00 0.00 ? 33  ARG A CD   2  
ATOM   1803  N  NE   . ARG A 1 33 ? 18.865  -5.632  1.375   1.00 0.00 ? 33  ARG A NE   2  
ATOM   1804  C  CZ   . ARG A 1 33 ? 19.676  -6.708  1.384   1.00 0.00 ? 33  ARG A CZ   2  
ATOM   1805  N  NH1  . ARG A 1 33 ? 19.193  -7.927  1.177   1.00 0.00 ? 33  ARG A NH1  2  
ATOM   1806  N  NH2  . ARG A 1 33 ? 20.982  -6.541  1.578   1.00 0.00 ? 33  ARG A NH2  2  
ATOM   1807  H  H    . ARG A 1 33 ? 12.817  -3.808  1.241   1.00 0.00 ? 33  ARG A H    2  
ATOM   1808  H  HA   . ARG A 1 33 ? 15.046  -2.120  0.988   1.00 0.00 ? 33  ARG A HA   2  
ATOM   1809  H  HB2  . ARG A 1 33 ? 14.917  -4.506  1.921   1.00 0.00 ? 33  ARG A HB2  2  
ATOM   1810  H  HB3  . ARG A 1 33 ? 14.930  -5.068  0.258   1.00 0.00 ? 33  ARG A HB3  2  
ATOM   1811  H  HG2  . ARG A 1 33 ? 17.175  -3.951  -0.027  1.00 0.00 ? 33  ARG A HG2  2  
ATOM   1812  H  HG3  . ARG A 1 33 ? 17.147  -3.582  1.702   1.00 0.00 ? 33  ARG A HG3  2  
ATOM   1813  H  HD2  . ARG A 1 33 ? 16.974  -6.041  2.169   1.00 0.00 ? 33  ARG A HD2  2  
ATOM   1814  H  HD3  . ARG A 1 33 ? 17.129  -6.349  0.433   1.00 0.00 ? 33  ARG A HD3  2  
ATOM   1815  H  HE   . ARG A 1 33 ? 19.276  -4.748  1.498   1.00 0.00 ? 33  ARG A HE   2  
ATOM   1816  H  HH11 . ARG A 1 33 ? 18.213  -8.060  1.007   1.00 0.00 ? 33  ARG A HH11 2  
ATOM   1817  H  HH12 . ARG A 1 33 ? 19.805  -8.718  1.183   1.00 0.00 ? 33  ARG A HH12 2  
ATOM   1818  H  HH21 . ARG A 1 33 ? 21.356  -5.618  1.716   1.00 0.00 ? 33  ARG A HH21 2  
ATOM   1819  H  HH22 . ARG A 1 33 ? 21.598  -7.331  1.574   1.00 0.00 ? 33  ARG A HH22 2  
ATOM   1820  N  N    . MET A 1 34 ? 13.624  -2.760  -1.817  1.00 0.00 ? 34  MET A N    2  
ATOM   1821  C  CA   . MET A 1 34 ? 13.566  -2.558  -3.309  1.00 0.00 ? 34  MET A CA   2  
ATOM   1822  C  C    . MET A 1 34 ? 14.431  -1.368  -3.868  1.00 0.00 ? 34  MET A C    2  
ATOM   1823  O  O    . MET A 1 34 ? 14.697  -1.313  -5.076  1.00 0.00 ? 34  MET A O    2  
ATOM   1824  C  CB   . MET A 1 34 ? 12.085  -2.340  -3.734  1.00 0.00 ? 34  MET A CB   2  
ATOM   1825  C  CG   . MET A 1 34 ? 11.420  -1.087  -3.115  1.00 0.00 ? 34  MET A CG   2  
ATOM   1826  S  SD   . MET A 1 34 ? 9.791   -0.715  -3.824  1.00 0.00 ? 34  MET A SD   2  
ATOM   1827  C  CE   . MET A 1 34 ? 10.229  -0.368  -5.524  1.00 0.00 ? 34  MET A CE   2  
ATOM   1828  H  H    . MET A 1 34 ? 12.801  -3.042  -1.355  1.00 0.00 ? 34  MET A H    2  
ATOM   1829  H  HA   . MET A 1 34 ? 13.914  -3.476  -3.771  1.00 0.00 ? 34  MET A HA   2  
ATOM   1830  H  HB2  . MET A 1 34 ? 12.044  -2.250  -4.810  1.00 0.00 ? 34  MET A HB2  2  
ATOM   1831  H  HB3  . MET A 1 34 ? 11.501  -3.212  -3.446  1.00 0.00 ? 34  MET A HB3  2  
ATOM   1832  H  HG2  . MET A 1 34 ? 11.300  -1.245  -2.051  1.00 0.00 ? 34  MET A HG2  2  
ATOM   1833  H  HG3  . MET A 1 34 ? 12.062  -0.226  -3.271  1.00 0.00 ? 34  MET A HG3  2  
ATOM   1834  H  HE1  . MET A 1 34 ? 9.331   -0.176  -6.090  1.00 0.00 ? 34  MET A HE1  2  
ATOM   1835  H  HE2  . MET A 1 34 ? 10.746  -1.221  -5.940  1.00 0.00 ? 34  MET A HE2  2  
ATOM   1836  H  HE3  . MET A 1 34 ? 10.871  0.496   -5.564  1.00 0.00 ? 34  MET A HE3  2  
ATOM   1837  N  N    . ILE A 1 35 ? 14.872  -0.470  -2.969  1.00 0.00 ? 35  ILE A N    2  
ATOM   1838  C  CA   . ILE A 1 35 ? 15.757  0.651   -3.282  1.00 0.00 ? 35  ILE A CA   2  
ATOM   1839  C  C    . ILE A 1 35 ? 17.251  0.175   -3.240  1.00 0.00 ? 35  ILE A C    2  
ATOM   1840  O  O    . ILE A 1 35 ? 18.010  0.397   -4.191  1.00 0.00 ? 35  ILE A O    2  
ATOM   1841  C  CB   . ILE A 1 35 ? 15.464  1.874   -2.312  1.00 0.00 ? 35  ILE A CB   2  
ATOM   1842  C  CG1  . ILE A 1 35 ? 16.615  2.923   -2.331  1.00 0.00 ? 35  ILE A CG1  2  
ATOM   1843  C  CG2  . ILE A 1 35 ? 15.135  1.421   -0.865  1.00 0.00 ? 35  ILE A CG2  2  
ATOM   1844  C  CD1  . ILE A 1 35 ? 16.839  3.637   -3.663  1.00 0.00 ? 35  ILE A CD1  2  
ATOM   1845  H  H    . ILE A 1 35 ? 14.686  -0.682  -2.049  1.00 0.00 ? 35  ILE A H    2  
ATOM   1846  H  HA   . ILE A 1 35 ? 15.534  0.970   -4.304  1.00 0.00 ? 35  ILE A HA   2  
ATOM   1847  H  HB   . ILE A 1 35 ? 14.563  2.360   -2.686  1.00 0.00 ? 35  ILE A HB   2  
ATOM   1848  H  HG12 . ILE A 1 35 ? 16.415  3.684   -1.592  1.00 0.00 ? 35  ILE A HG12 2  
ATOM   1849  H  HG13 . ILE A 1 35 ? 17.536  2.422   -2.070  1.00 0.00 ? 35  ILE A HG13 2  
ATOM   1850  H  HG21 . ILE A 1 35 ? 14.271  0.763   -0.870  1.00 0.00 ? 35  ILE A HG21 2  
ATOM   1851  H  HG22 . ILE A 1 35 ? 14.916  2.284   -0.243  1.00 0.00 ? 35  ILE A HG22 2  
ATOM   1852  H  HG23 . ILE A 1 35 ? 15.983  0.895   -0.450  1.00 0.00 ? 35  ILE A HG23 2  
ATOM   1853  H  HD11 . ILE A 1 35 ? 15.942  4.161   -3.957  1.00 0.00 ? 35  ILE A HD11 2  
ATOM   1854  H  HD12 . ILE A 1 35 ? 17.103  2.916   -4.429  1.00 0.00 ? 35  ILE A HD12 2  
ATOM   1855  H  HD13 . ILE A 1 35 ? 17.647  4.349   -3.557  1.00 0.00 ? 35  ILE A HD13 2  
ATOM   1856  N  N    . HIS A 1 36 ? 17.643  -0.502  -2.139  1.00 0.00 ? 36  HIS A N    2  
ATOM   1857  C  CA   . HIS A 1 36 ? 19.035  -1.002  -1.886  1.00 0.00 ? 36  HIS A CA   2  
ATOM   1858  C  C    . HIS A 1 36 ? 19.171  -2.536  -2.143  1.00 0.00 ? 36  HIS A C    2  
ATOM   1859  O  O    . HIS A 1 36 ? 20.212  -3.121  -1.831  1.00 0.00 ? 36  HIS A O    2  
ATOM   1860  C  CB   . HIS A 1 36 ? 19.530  -0.634  -0.423  1.00 0.00 ? 36  HIS A CB   2  
ATOM   1861  C  CG   . HIS A 1 36 ? 18.499  -0.079  0.542   1.00 0.00 ? 36  HIS A CG   2  
ATOM   1862  N  ND1  . HIS A 1 36 ? 18.430  1.252   0.866   1.00 0.00 ? 36  HIS A ND1  2  
ATOM   1863  C  CD2  . HIS A 1 36 ? 17.540  -0.687  1.302   1.00 0.00 ? 36  HIS A CD2  2  
ATOM   1864  C  CE1  . HIS A 1 36 ? 17.475  1.407   1.779   1.00 0.00 ? 36  HIS A CE1  2  
ATOM   1865  N  NE2  . HIS A 1 36 ? 16.888  0.266   2.088   1.00 0.00 ? 36  HIS A NE2  2  
ATOM   1866  H  H    . HIS A 1 36 ? 16.967  -0.717  -1.473  1.00 0.00 ? 36  HIS A H    2  
ATOM   1867  H  HA   . HIS A 1 36 ? 19.691  -0.503  -2.601  1.00 0.00 ? 36  HIS A HA   2  
ATOM   1868  H  HB2  . HIS A 1 36 ? 19.962  -1.504  0.054   1.00 0.00 ? 36  HIS A HB2  2  
ATOM   1869  H  HB3  . HIS A 1 36 ? 20.313  0.111   -0.505  1.00 0.00 ? 36  HIS A HB3  2  
ATOM   1870  H  HD1  . HIS A 1 36 ? 18.992  1.965   0.498   1.00 0.00 ? 36  HIS A HD1  2  
ATOM   1871  H  HD2  . HIS A 1 36 ? 17.313  -1.741  1.307   1.00 0.00 ? 36  HIS A HD2  2  
ATOM   1872  H  HE1  . HIS A 1 36 ? 17.202  2.358   2.202   1.00 0.00 ? 36  HIS A HE1  2  
ATOM   1873  N  N    . THR A 1 37 ? 18.140  -3.154  -2.748  1.00 0.00 ? 37  THR A N    2  
ATOM   1874  C  CA   . THR A 1 37 ? 17.831  -4.603  -2.614  1.00 0.00 ? 37  THR A CA   2  
ATOM   1875  C  C    . THR A 1 37 ? 18.982  -5.584  -2.992  1.00 0.00 ? 37  THR A C    2  
ATOM   1876  O  O    . THR A 1 37 ? 19.503  -6.271  -2.097  1.00 0.00 ? 37  THR A O    2  
ATOM   1877  C  CB   . THR A 1 37 ? 16.486  -4.935  -3.380  1.00 0.00 ? 37  THR A CB   2  
ATOM   1878  O  OG1  . THR A 1 37 ? 16.163  -6.315  -3.269  1.00 0.00 ? 37  THR A OG1  2  
ATOM   1879  C  CG2  . THR A 1 37 ? 16.490  -4.506  -4.867  1.00 0.00 ? 37  THR A CG2  2  
ATOM   1880  H  H    . THR A 1 37 ? 17.550  -2.609  -3.302  1.00 0.00 ? 37  THR A H    2  
ATOM   1881  H  HA   . THR A 1 37 ? 17.620  -4.769  -1.557  1.00 0.00 ? 37  THR A HA   2  
ATOM   1882  H  HB   . THR A 1 37 ? 15.689  -4.387  -2.887  1.00 0.00 ? 37  THR A HB   2  
ATOM   1883  H  HG1  . THR A 1 37 ? 16.089  -6.557  -2.333  1.00 0.00 ? 37  THR A HG1  2  
ATOM   1884  H  HG21 . THR A 1 37 ? 16.728  -3.450  -4.941  1.00 0.00 ? 37  THR A HG21 2  
ATOM   1885  H  HG22 . THR A 1 37 ? 15.515  -4.675  -5.297  1.00 0.00 ? 37  THR A HG22 2  
ATOM   1886  H  HG23 . THR A 1 37 ? 17.222  -5.086  -5.420  1.00 0.00 ? 37  THR A HG23 2  
ATOM   1887  N  N    . GLY A 1 38 ? 19.371  -5.657  -4.278  1.00 0.00 ? 38  GLY A N    2  
ATOM   1888  C  CA   . GLY A 1 38 ? 20.402  -6.612  -4.720  1.00 0.00 ? 38  GLY A CA   2  
ATOM   1889  C  C    . GLY A 1 38 ? 19.913  -8.063  -4.670  1.00 0.00 ? 38  GLY A C    2  
ATOM   1890  O  O    . GLY A 1 38 ? 20.678  -8.974  -4.355  1.00 0.00 ? 38  GLY A O    2  
ATOM   1891  H  H    . GLY A 1 38 ? 18.908  -5.105  -4.935  1.00 0.00 ? 38  GLY A H    2  
ATOM   1892  H  HA2  . GLY A 1 38 ? 20.672  -6.377  -5.738  1.00 0.00 ? 38  GLY A HA2  2  
ATOM   1893  H  HA3  . GLY A 1 38 ? 21.282  -6.502  -4.093  1.00 0.00 ? 38  GLY A HA3  2  
ATOM   1894  N  N    . GLU A 1 39 ? 18.623  -8.242  -5.003  1.00 0.00 ? 39  GLU A N    2  
ATOM   1895  C  CA   . GLU A 1 39 ? 17.891  -9.531  -4.936  1.00 0.00 ? 39  GLU A CA   2  
ATOM   1896  C  C    . GLU A 1 39 ? 16.530  -9.350  -5.645  1.00 0.00 ? 39  GLU A C    2  
ATOM   1897  O  O    . GLU A 1 39 ? 15.974  -10.302 -6.202  1.00 0.00 ? 39  GLU A O    2  
ATOM   1898  C  CB   . GLU A 1 39 ? 17.704  -10.048 -3.470  1.00 0.00 ? 39  GLU A CB   2  
ATOM   1899  C  CG   . GLU A 1 39 ? 16.741  -9.224  -2.595  1.00 0.00 ? 39  GLU A CG   2  
ATOM   1900  C  CD   . GLU A 1 39 ? 16.578  -9.768  -1.168  1.00 0.00 ? 39  GLU A CD   2  
ATOM   1901  O  OE1  . GLU A 1 39 ? 16.094  -10.914 -1.016  1.00 0.00 ? 39  GLU A OE1  2  
ATOM   1902  O  OE2  . GLU A 1 39 ? 16.904  -9.050  -0.195  1.00 0.00 ? 39  GLU A OE2  2  
ATOM   1903  H  H    . GLU A 1 39 ? 18.169  -7.477  -5.407  1.00 0.00 ? 39  GLU A H    2  
ATOM   1904  H  HA   . GLU A 1 39 ? 18.468  -10.263 -5.501  1.00 0.00 ? 39  GLU A HA   2  
ATOM   1905  H  HB2  . GLU A 1 39 ? 17.330  -11.071 -3.502  1.00 0.00 ? 39  GLU A HB2  2  
ATOM   1906  H  HB3  . GLU A 1 39 ? 18.675  -10.057 -2.988  1.00 0.00 ? 39  GLU A HB3  2  
ATOM   1907  H  HG2  . GLU A 1 39 ? 17.111  -8.207  -2.545  1.00 0.00 ? 39  GLU A HG2  2  
ATOM   1908  H  HG3  . GLU A 1 39 ? 15.761  -9.208  -3.074  1.00 0.00 ? 39  GLU A HG3  2  
ATOM   1909  N  N    . LYS A 1 40 ? 16.017  -8.100  -5.581  1.00 0.00 ? 40  LYS A N    2  
ATOM   1910  C  CA   . LYS A 1 40 ? 14.931  -7.583  -6.434  1.00 0.00 ? 40  LYS A CA   2  
ATOM   1911  C  C    . LYS A 1 40 ? 13.567  -8.270  -6.183  1.00 0.00 ? 40  LYS A C    2  
ATOM   1912  O  O    . LYS A 1 40 ? 13.325  -9.376  -6.686  1.00 0.00 ? 40  LYS A O    2  
ATOM   1913  C  CB   . LYS A 1 40 ? 15.326  -7.676  -7.936  1.00 0.00 ? 40  LYS A CB   2  
ATOM   1914  C  CG   . LYS A 1 40 ? 16.605  -6.899  -8.316  1.00 0.00 ? 40  LYS A CG   2  
ATOM   1915  C  CD   . LYS A 1 40 ? 17.064  -7.195  -9.759  1.00 0.00 ? 40  LYS A CD   2  
ATOM   1916  C  CE   . LYS A 1 40 ? 17.405  -8.677  -9.973  1.00 0.00 ? 40  LYS A CE   2  
ATOM   1917  N  NZ   . LYS A 1 40 ? 17.861  -8.950  -11.351 1.00 0.00 ? 40  LYS A NZ   2  
ATOM   1918  H  H    . LYS A 1 40 ? 16.388  -7.501  -4.902  1.00 0.00 ? 40  LYS A H    2  
ATOM   1919  H  HA   . LYS A 1 40 ? 14.826  -6.535  -6.188  1.00 0.00 ? 40  LYS A HA   2  
ATOM   1920  H  HB2  . LYS A 1 40 ? 15.472  -8.720  -8.184  1.00 0.00 ? 40  LYS A HB2  2  
ATOM   1921  H  HB3  . LYS A 1 40 ? 14.511  -7.295  -8.547  1.00 0.00 ? 40  LYS A HB3  2  
ATOM   1922  H  HG2  . LYS A 1 40 ? 16.407  -5.835  -8.227  1.00 0.00 ? 40  LYS A HG2  2  
ATOM   1923  H  HG3  . LYS A 1 40 ? 17.401  -7.169  -7.625  1.00 0.00 ? 40  LYS A HG3  2  
ATOM   1924  H  HD2  . LYS A 1 40 ? 16.272  -6.909  -10.445 1.00 0.00 ? 40  LYS A HD2  2  
ATOM   1925  H  HD3  . LYS A 1 40 ? 17.945  -6.599  -9.976  1.00 0.00 ? 40  LYS A HD3  2  
ATOM   1926  H  HE2  . LYS A 1 40 ? 18.187  -8.965  -9.288  1.00 0.00 ? 40  LYS A HE2  2  
ATOM   1927  H  HE3  . LYS A 1 40 ? 16.522  -9.275  -9.777  1.00 0.00 ? 40  LYS A HE3  2  
ATOM   1928  H  HZ1  . LYS A 1 40 ? 17.082  -8.795  -12.021 1.00 0.00 ? 40  LYS A HZ1  2  
ATOM   1929  H  HZ2  . LYS A 1 40 ? 18.184  -9.936  -11.429 1.00 0.00 ? 40  LYS A HZ2  2  
ATOM   1930  H  HZ3  . LYS A 1 40 ? 18.647  -8.319  -11.601 1.00 0.00 ? 40  LYS A HZ3  2  
ATOM   1931  N  N    . PRO A 1 41 ? 12.662  -7.650  -5.369  1.00 0.00 ? 41  PRO A N    2  
ATOM   1932  C  CA   . PRO A 1 41 ? 11.223  -7.986  -5.395  1.00 0.00 ? 41  PRO A CA   2  
ATOM   1933  C  C    . PRO A 1 41 ? 10.541  -7.307  -6.609  1.00 0.00 ? 41  PRO A C    2  
ATOM   1934  O  O    . PRO A 1 41 ? 11.100  -6.388  -7.211  1.00 0.00 ? 41  PRO A O    2  
ATOM   1935  C  CB   . PRO A 1 41 ? 10.718  -7.424  -4.047  1.00 0.00 ? 41  PRO A CB   2  
ATOM   1936  C  CG   . PRO A 1 41 ? 11.591  -6.227  -3.808  1.00 0.00 ? 41  PRO A CG   2  
ATOM   1937  C  CD   . PRO A 1 41 ? 12.962  -6.611  -4.337  1.00 0.00 ? 41  PRO A CD   2  
ATOM   1938  H  HA   . PRO A 1 41 ? 11.058  -9.062  -5.438  1.00 0.00 ? 41  PRO A HA   2  
ATOM   1939  H  HB2  . PRO A 1 41 ? 9.667   -7.154  -4.117  1.00 0.00 ? 41  PRO A HB2  2  
ATOM   1940  H  HB3  . PRO A 1 41 ? 10.843  -8.173  -3.267  1.00 0.00 ? 41  PRO A HB3  2  
ATOM   1941  H  HG2  . PRO A 1 41 ? 11.198  -5.365  -4.346  1.00 0.00 ? 41  PRO A HG2  2  
ATOM   1942  H  HG3  . PRO A 1 41 ? 11.638  -6.007  -2.751  1.00 0.00 ? 41  PRO A HG3  2  
ATOM   1943  H  HD2  . PRO A 1 41 ? 13.454  -5.753  -4.778  1.00 0.00 ? 41  PRO A HD2  2  
ATOM   1944  H  HD3  . PRO A 1 41 ? 13.579  -7.026  -3.542  1.00 0.00 ? 41  PRO A HD3  2  
ATOM   1945  N  N    . LEU A 1 42 ? 9.339   -7.761  -6.954  1.00 0.00 ? 42  LEU A N    2  
ATOM   1946  C  CA   . LEU A 1 42 ? 8.585   -7.266  -8.117  1.00 0.00 ? 42  LEU A CA   2  
ATOM   1947  C  C    . LEU A 1 42 ? 7.468   -6.339  -7.634  1.00 0.00 ? 42  LEU A C    2  
ATOM   1948  O  O    . LEU A 1 42 ? 6.616   -6.770  -6.868  1.00 0.00 ? 42  LEU A O    2  
ATOM   1949  C  CB   . LEU A 1 42 ? 8.000   -8.475  -8.880  1.00 0.00 ? 42  LEU A CB   2  
ATOM   1950  C  CG   . LEU A 1 42 ? 9.046   -9.522  -9.383  1.00 0.00 ? 42  LEU A CG   2  
ATOM   1951  C  CD1  . LEU A 1 42 ? 8.348   -10.737 -10.023 1.00 0.00 ? 42  LEU A CD1  2  
ATOM   1952  C  CD2  . LEU A 1 42 ? 10.069  -8.877  -10.355 1.00 0.00 ? 42  LEU A CD2  2  
ATOM   1953  H  H    . LEU A 1 42 ? 8.921   -8.445  -6.402  1.00 0.00 ? 42  LEU A H    2  
ATOM   1954  H  HA   . LEU A 1 42 ? 9.255   -6.719  -8.776  1.00 0.00 ? 42  LEU A HA   2  
ATOM   1955  H  HB2  . LEU A 1 42 ? 7.299   -8.980  -8.212  1.00 0.00 ? 42  LEU A HB2  2  
ATOM   1956  H  HB3  . LEU A 1 42 ? 7.443   -8.108  -9.742  1.00 0.00 ? 42  LEU A HB3  2  
ATOM   1957  H  HG   . LEU A 1 42 ? 9.603   -9.894  -8.526  1.00 0.00 ? 42  LEU A HG   2  
ATOM   1958  H  HD11 . LEU A 1 42 ? 7.742   -10.420 -10.861 1.00 0.00 ? 42  LEU A HD11 2  
ATOM   1959  H  HD12 . LEU A 1 42 ? 7.717   -11.218 -9.285  1.00 0.00 ? 42  LEU A HD12 2  
ATOM   1960  H  HD13 . LEU A 1 42 ? 9.090   -11.447 -10.365 1.00 0.00 ? 42  LEU A HD13 2  
ATOM   1961  H  HD21 . LEU A 1 42 ? 10.783  -9.619  -10.676 1.00 0.00 ? 42  LEU A HD21 2  
ATOM   1962  H  HD22 . LEU A 1 42 ? 10.594  -8.076  -9.850  1.00 0.00 ? 42  LEU A HD22 2  
ATOM   1963  H  HD23 . LEU A 1 42 ? 9.554   -8.478  -11.221 1.00 0.00 ? 42  LEU A HD23 2  
ATOM   1964  N  N    . GLN A 1 43 ? 7.458   -5.082  -8.086  1.00 0.00 ? 43  GLN A N    2  
ATOM   1965  C  CA   . GLN A 1 43 ? 6.512   -4.059  -7.603  1.00 0.00 ? 43  GLN A CA   2  
ATOM   1966  C  C    . GLN A 1 43 ? 5.498   -3.739  -8.716  1.00 0.00 ? 43  GLN A C    2  
ATOM   1967  O  O    . GLN A 1 43 ? 5.852   -3.727  -9.903  1.00 0.00 ? 43  GLN A O    2  
ATOM   1968  C  CB   . GLN A 1 43 ? 7.299   -2.775  -7.144  1.00 0.00 ? 43  GLN A CB   2  
ATOM   1969  C  CG   . GLN A 1 43 ? 6.969   -2.279  -5.714  1.00 0.00 ? 43  GLN A CG   2  
ATOM   1970  C  CD   . GLN A 1 43 ? 5.686   -1.461  -5.586  1.00 0.00 ? 43  GLN A CD   2  
ATOM   1971  O  OE1  . GLN A 1 43 ? 4.754   -1.585  -6.374  1.00 0.00 ? 43  GLN A OE1  2  
ATOM   1972  N  NE2  . GLN A 1 43 ? 5.615   -0.639  -4.559  1.00 0.00 ? 43  GLN A NE2  2  
ATOM   1973  H  H    . GLN A 1 43 ? 8.069   -4.825  -8.804  1.00 0.00 ? 43  GLN A H    2  
ATOM   1974  H  HA   . GLN A 1 43 ? 5.967   -4.470  -6.752  1.00 0.00 ? 43  GLN A HA   2  
ATOM   1975  H  HB2  . GLN A 1 43 ? 8.363   -2.990  -7.177  1.00 0.00 ? 43  GLN A HB2  2  
ATOM   1976  H  HB3  . GLN A 1 43 ? 7.105   -1.962  -7.836  1.00 0.00 ? 43  GLN A HB3  2  
ATOM   1977  H  HG2  . GLN A 1 43 ? 6.876   -3.139  -5.062  1.00 0.00 ? 43  GLN A HG2  2  
ATOM   1978  H  HG3  . GLN A 1 43 ? 7.796   -1.671  -5.362  1.00 0.00 ? 43  GLN A HG3  2  
ATOM   1979  H  HE21 . GLN A 1 43 ? 6.376   -0.605  -3.936  1.00 0.00 ? 43  GLN A HE21 2  
ATOM   1980  H  HE22 . GLN A 1 43 ? 4.812   -0.098  -4.458  1.00 0.00 ? 43  GLN A HE22 2  
ATOM   1981  N  N    . CYS A 1 44 ? 4.244   -3.491  -8.314  1.00 0.00 ? 44  CYS A N    2  
ATOM   1982  C  CA   . CYS A 1 44 ? 3.161   -3.099  -9.221  1.00 0.00 ? 44  CYS A CA   2  
ATOM   1983  C  C    . CYS A 1 44 ? 3.421   -1.684  -9.740  1.00 0.00 ? 44  CYS A C    2  
ATOM   1984  O  O    . CYS A 1 44 ? 3.305   -0.709  -8.986  1.00 0.00 ? 44  CYS A O    2  
ATOM   1985  C  CB   . CYS A 1 44 ? 1.782   -3.148  -8.524  1.00 0.00 ? 44  CYS A CB   2  
ATOM   1986  S  SG   . CYS A 1 44 ? 0.420   -2.399  -9.488  1.00 0.00 ? 44  CYS A SG   2  
ATOM   1987  H  H    . CYS A 1 44 ? 4.056   -3.538  -7.360  1.00 0.00 ? 44  CYS A H    2  
ATOM   1988  H  HA   . CYS A 1 44 ? 3.157   -3.804  -10.053 1.00 0.00 ? 44  CYS A HA   2  
ATOM   1989  H  HB2  . CYS A 1 44 ? 1.515   -4.181  -8.333  1.00 0.00 ? 44  CYS A HB2  2  
ATOM   1990  H  HB3  . CYS A 1 44 ? 1.833   -2.620  -7.578  1.00 0.00 ? 44  CYS A HB3  2  
ATOM   1991  N  N    . GLU A 1 45 ? 3.757   -1.578  -11.027 1.00 0.00 ? 45  GLU A N    2  
ATOM   1992  C  CA   . GLU A 1 45 ? 4.084   -0.301  -11.686 1.00 0.00 ? 45  GLU A CA   2  
ATOM   1993  C  C    . GLU A 1 45 ? 2.802   0.365   -12.239 1.00 0.00 ? 45  GLU A C    2  
ATOM   1994  O  O    . GLU A 1 45 ? 2.800   0.970   -13.320 1.00 0.00 ? 45  GLU A O    2  
ATOM   1995  C  CB   . GLU A 1 45 ? 5.126   -0.579  -12.801 1.00 0.00 ? 45  GLU A CB   2  
ATOM   1996  C  CG   . GLU A 1 45 ? 6.458   -1.177  -12.281 1.00 0.00 ? 45  GLU A CG   2  
ATOM   1997  C  CD   . GLU A 1 45 ? 7.404   -1.633  -13.408 1.00 0.00 ? 45  GLU A CD   2  
ATOM   1998  O  OE1  . GLU A 1 45 ? 7.159   -2.716  -13.990 1.00 0.00 ? 45  GLU A OE1  2  
ATOM   1999  O  OE2  . GLU A 1 45 ? 8.382   -0.920  -13.724 1.00 0.00 ? 45  GLU A OE2  2  
ATOM   2000  H  H    . GLU A 1 45 ? 3.764   -2.391  -11.574 1.00 0.00 ? 45  GLU A H    2  
ATOM   2001  H  HA   . GLU A 1 45 ? 4.520   0.368   -10.949 1.00 0.00 ? 45  GLU A HA   2  
ATOM   2002  H  HB2  . GLU A 1 45 ? 4.692   -1.276  -13.512 1.00 0.00 ? 45  GLU A HB2  2  
ATOM   2003  H  HB3  . GLU A 1 45 ? 5.347   0.351   -13.320 1.00 0.00 ? 45  GLU A HB3  2  
ATOM   2004  H  HG2  . GLU A 1 45 ? 6.960   -0.427  -11.678 1.00 0.00 ? 45  GLU A HG2  2  
ATOM   2005  H  HG3  . GLU A 1 45 ? 6.231   -2.033  -11.650 1.00 0.00 ? 45  GLU A HG3  2  
ATOM   2006  N  N    . ILE A 1 46 ? 1.720   0.289   -11.441 1.00 0.00 ? 46  ILE A N    2  
ATOM   2007  C  CA   . ILE A 1 46 ? 0.389   0.837   -11.767 1.00 0.00 ? 46  ILE A CA   2  
ATOM   2008  C  C    . ILE A 1 46 ? -0.111  1.672   -10.547 1.00 0.00 ? 46  ILE A C    2  
ATOM   2009  O  O    . ILE A 1 46 ? -0.978  2.538   -10.686 1.00 0.00 ? 46  ILE A O    2  
ATOM   2010  C  CB   . ILE A 1 46 ? -0.676  -0.297  -12.101 1.00 0.00 ? 46  ILE A CB   2  
ATOM   2011  C  CG1  . ILE A 1 46 ? -0.251  -1.224  -13.315 1.00 0.00 ? 46  ILE A CG1  2  
ATOM   2012  C  CG2  . ILE A 1 46 ? -2.084  0.314   -12.357 1.00 0.00 ? 46  ILE A CG2  2  
ATOM   2013  C  CD1  . ILE A 1 46 ? 0.698   -2.370  -12.976 1.00 0.00 ? 46  ILE A CD1  2  
ATOM   2014  H  H    . ILE A 1 46 ? 1.825   -0.102  -10.552 1.00 0.00 ? 46  ILE A H    2  
ATOM   2015  H  HA   . ILE A 1 46 ? 0.482   1.495   -12.631 1.00 0.00 ? 46  ILE A HA   2  
ATOM   2016  H  HB   . ILE A 1 46 ? -0.754  -0.915  -11.209 1.00 0.00 ? 46  ILE A HB   2  
ATOM   2017  H  HG12 . ILE A 1 46 ? -1.133  -1.678  -13.746 1.00 0.00 ? 46  ILE A HG12 2  
ATOM   2018  H  HG13 . ILE A 1 46 ? 0.229   -0.619  -14.075 1.00 0.00 ? 46  ILE A HG13 2  
ATOM   2019  H  HG21 . ILE A 1 46 ? -2.428  0.832   -11.462 1.00 0.00 ? 46  ILE A HG21 2  
ATOM   2020  H  HG22 . ILE A 1 46 ? -2.788  -0.474  -12.598 1.00 0.00 ? 46  ILE A HG22 2  
ATOM   2021  H  HG23 . ILE A 1 46 ? -2.039  1.014   -13.179 1.00 0.00 ? 46  ILE A HG23 2  
ATOM   2022  H  HD11 . ILE A 1 46 ? 0.912   -2.922  -13.875 1.00 0.00 ? 46  ILE A HD11 2  
ATOM   2023  H  HD12 . ILE A 1 46 ? 0.239   -3.028  -12.252 1.00 0.00 ? 46  ILE A HD12 2  
ATOM   2024  H  HD13 . ILE A 1 46 ? 1.623   -1.979  -12.568 1.00 0.00 ? 46  ILE A HD13 2  
ATOM   2025  N  N    . CYS A 1 47 ? 0.580   1.521   -9.392  1.00 0.00 ? 47  CYS A N    2  
ATOM   2026  C  CA   . CYS A 1 47 ? 0.113   1.999   -8.096  1.00 0.00 ? 47  CYS A CA   2  
ATOM   2027  C  C    . CYS A 1 47 ? 1.298   1.681   -7.172  1.00 0.00 ? 47  CYS A C    2  
ATOM   2028  O  O    . CYS A 1 47 ? 2.419   2.123   -7.455  1.00 0.00 ? 47  CYS A O    2  
ATOM   2029  C  CB   . CYS A 1 47 ? -1.286  1.401   -7.657  1.00 0.00 ? 47  CYS A CB   2  
ATOM   2030  S  SG   . CYS A 1 47 ? -1.308  -0.261  -6.889  1.00 0.00 ? 47  CYS A SG   2  
ATOM   2031  H  H    . CYS A 1 47 ? 1.539   1.351   -9.437  1.00 0.00 ? 47  CYS A H    2  
ATOM   2032  H  HA   . CYS A 1 47 ? 0.038   3.087   -8.155  1.00 0.00 ? 47  CYS A HA   2  
ATOM   2033  H  HB2  . CYS A 1 47 ? -1.736  2.068   -6.935  1.00 0.00 ? 47  CYS A HB2  2  
ATOM   2034  H  HB3  . CYS A 1 47 ? -1.938  1.360   -8.525  1.00 0.00 ? 47  CYS A HB3  2  
ATOM   2035  N  N    . GLY A 1 48 ? 1.086   0.943   -6.108  1.00 0.00 ? 48  GLY A N    2  
ATOM   2036  C  CA   . GLY A 1 48 ? 2.165   0.299   -5.364  1.00 0.00 ? 48  GLY A CA   2  
ATOM   2037  C  C    . GLY A 1 48 ? 1.627   -0.986  -4.738  1.00 0.00 ? 48  GLY A C    2  
ATOM   2038  O  O    . GLY A 1 48 ? 0.537   -0.920  -4.158  1.00 0.00 ? 48  GLY A O    2  
ATOM   2039  H  H    . GLY A 1 48 ? 0.187   0.717   -5.862  1.00 0.00 ? 48  GLY A H    2  
ATOM   2040  H  HA2  . GLY A 1 48 ? 2.975   0.066   -6.059  1.00 0.00 ? 48  GLY A HA2  2  
ATOM   2041  H  HA3  . GLY A 1 48 ? 2.519   0.961   -4.590  1.00 0.00 ? 48  GLY A HA3  2  
ATOM   2042  N  N    . PHE A 1 49 ? 2.335   -2.141  -4.805  1.00 0.00 ? 49  PHE A N    2  
ATOM   2043  C  CA   . PHE A 1 49 ? 1.873   -3.441  -4.302  1.00 0.00 ? 49  PHE A CA   2  
ATOM   2044  C  C    . PHE A 1 49 ? 3.016   -4.371  -4.690  1.00 0.00 ? 49  PHE A C    2  
ATOM   2045  O  O    . PHE A 1 49 ? 3.259   -4.559  -5.887  1.00 0.00 ? 49  PHE A O    2  
ATOM   2046  C  CB   . PHE A 1 49 ? 0.547   -3.907  -4.967  1.00 0.00 ? 49  PHE A CB   2  
ATOM   2047  C  CG   . PHE A 1 49 ? 0.098   -5.335  -4.628  1.00 0.00 ? 49  PHE A CG   2  
ATOM   2048  C  CD1  . PHE A 1 49 ? 0.636   -6.440  -5.301  1.00 0.00 ? 49  PHE A CD1  2  
ATOM   2049  C  CD2  . PHE A 1 49 ? -0.868  -5.571  -3.662  1.00 0.00 ? 49  PHE A CD2  2  
ATOM   2050  C  CE1  . PHE A 1 49 ? 0.222   -7.722  -5.012  1.00 0.00 ? 49  PHE A CE1  2  
ATOM   2051  C  CE2  . PHE A 1 49 ? -1.286  -6.856  -3.373  1.00 0.00 ? 49  PHE A CE2  2  
ATOM   2052  C  CZ   . PHE A 1 49 ? -0.743  -7.931  -4.044  1.00 0.00 ? 49  PHE A CZ   2  
ATOM   2053  H  H    . PHE A 1 49 ? 3.259   -2.213  -5.133  1.00 0.00 ? 49  PHE A H    2  
ATOM   2054  H  HA   . PHE A 1 49 ? 1.772   -3.391  -3.221  1.00 0.00 ? 49  PHE A HA   2  
ATOM   2055  H  HB2  . PHE A 1 49 ? -0.245  -3.233  -4.664  1.00 0.00 ? 49  PHE A HB2  2  
ATOM   2056  H  HB3  . PHE A 1 49 ? 0.656   -3.838  -6.046  1.00 0.00 ? 49  PHE A HB3  2  
ATOM   2057  H  HD1  . PHE A 1 49 ? 1.399   -6.276  -6.062  1.00 0.00 ? 49  PHE A HD1  2  
ATOM   2058  H  HD2  . PHE A 1 49 ? -1.300  -4.739  -3.131  1.00 0.00 ? 49  PHE A HD2  2  
ATOM   2059  H  HE1  . PHE A 1 49 ? 0.655   -8.568  -5.540  1.00 0.00 ? 49  PHE A HE1  2  
ATOM   2060  H  HE2  . PHE A 1 49 ? -2.042  -7.018  -2.618  1.00 0.00 ? 49  PHE A HE2  2  
ATOM   2061  H  HZ   . PHE A 1 49 ? -1.069  -8.936  -3.813  1.00 0.00 ? 49  PHE A HZ   2  
ATOM   2062  N  N    . THR A 1 50 ? 3.708   -4.961  -3.727  1.00 0.00 ? 50  THR A N    2  
ATOM   2063  C  CA   . THR A 1 50 ? 4.927   -5.706  -4.006  1.00 0.00 ? 50  THR A CA   2  
ATOM   2064  C  C    . THR A 1 50 ? 4.681   -7.206  -3.781  1.00 0.00 ? 50  THR A C    2  
ATOM   2065  O  O    . THR A 1 50 ? 3.927   -7.609  -2.893  1.00 0.00 ? 50  THR A O    2  
ATOM   2066  C  CB   . THR A 1 50 ? 6.103   -5.225  -3.104  1.00 0.00 ? 50  THR A CB   2  
ATOM   2067  O  OG1  . THR A 1 50 ? 6.050   -3.796  -2.959  1.00 0.00 ? 50  THR A OG1  2  
ATOM   2068  C  CG2  . THR A 1 50 ? 7.481   -5.617  -3.665  1.00 0.00 ? 50  THR A CG2  2  
ATOM   2069  H  H    . THR A 1 50 ? 3.406   -4.913  -2.810  1.00 0.00 ? 50  THR A H    2  
ATOM   2070  H  HA   . THR A 1 50 ? 5.206   -5.531  -5.053  1.00 0.00 ? 50  THR A HA   2  
ATOM   2071  H  HB   . THR A 1 50 ? 5.990   -5.675  -2.126  1.00 0.00 ? 50  THR A HB   2  
ATOM   2072  H  HG1  . THR A 1 50 ? 6.912   -3.467  -2.669  1.00 0.00 ? 50  THR A HG1  2  
ATOM   2073  H  HG21 . THR A 1 50 ? 7.546   -6.694  -3.754  1.00 0.00 ? 50  THR A HG21 2  
ATOM   2074  H  HG22 . THR A 1 50 ? 8.261   -5.265  -2.998  1.00 0.00 ? 50  THR A HG22 2  
ATOM   2075  H  HG23 . THR A 1 50 ? 7.617   -5.168  -4.640  1.00 0.00 ? 50  THR A HG23 2  
ATOM   2076  N  N    . CYS A 1 51 ? 5.353   -7.983  -4.595  1.00 0.00 ? 51  CYS A N    2  
ATOM   2077  C  CA   . CYS A 1 51 ? 5.350   -9.441  -4.575  1.00 0.00 ? 51  CYS A CA   2  
ATOM   2078  C  C    . CYS A 1 51 ? 6.760   -9.922  -4.962  1.00 0.00 ? 51  CYS A C    2  
ATOM   2079  O  O    . CYS A 1 51 ? 7.699   -9.121  -5.008  1.00 0.00 ? 51  CYS A O    2  
ATOM   2080  C  CB   . CYS A 1 51 ? 4.274   -9.971  -5.551  1.00 0.00 ? 51  CYS A CB   2  
ATOM   2081  S  SG   . CYS A 1 51 ? 4.078   -11.759 -5.522  1.00 0.00 ? 51  CYS A SG   2  
ATOM   2082  H  H    . CYS A 1 51 ? 5.881   -7.536  -5.270  1.00 0.00 ? 51  CYS A H    2  
ATOM   2083  H  HA   . CYS A 1 51 ? 5.128   -9.785  -3.569  1.00 0.00 ? 51  CYS A HA   2  
ATOM   2084  H  HB2  . CYS A 1 51 ? 3.317   -9.546  -5.295  1.00 0.00 ? 51  CYS A HB2  2  
ATOM   2085  H  HB3  . CYS A 1 51 ? 4.529   -9.689  -6.563  1.00 0.00 ? 51  CYS A HB3  2  
ATOM   2086  H  HG   . CYS A 1 51 ? 2.923   -12.037 -4.926  1.00 0.00 ? 51  CYS A HG   2  
ATOM   2087  N  N    . ARG A 1 52 ? 6.918   -11.229 -5.183  1.00 0.00 ? 52  ARG A N    2  
ATOM   2088  C  CA   . ARG A 1 52 ? 8.177   -11.832 -5.659  1.00 0.00 ? 52  ARG A CA   2  
ATOM   2089  C  C    . ARG A 1 52 ? 7.910   -12.797 -6.839  1.00 0.00 ? 52  ARG A C    2  
ATOM   2090  O  O    . ARG A 1 52 ? 8.825   -13.129 -7.594  1.00 0.00 ? 52  ARG A O    2  
ATOM   2091  C  CB   . ARG A 1 52 ? 8.858   -12.574 -4.484  1.00 0.00 ? 52  ARG A CB   2  
ATOM   2092  C  CG   . ARG A 1 52 ? 7.972   -13.649 -3.798  1.00 0.00 ? 52  ARG A CG   2  
ATOM   2093  C  CD   . ARG A 1 52 ? 8.719   -14.407 -2.685  1.00 0.00 ? 52  ARG A CD   2  
ATOM   2094  N  NE   . ARG A 1 52 ? 9.926   -15.082 -3.202  1.00 0.00 ? 52  ARG A NE   2  
ATOM   2095  C  CZ   . ARG A 1 52 ? 10.682  -15.952 -2.529  1.00 0.00 ? 52  ARG A CZ   2  
ATOM   2096  N  NH1  . ARG A 1 52 ? 10.393  -16.303 -1.288  1.00 0.00 ? 52  ARG A NH1  2  
ATOM   2097  N  NH2  . ARG A 1 52 ? 11.750  -16.471 -3.106  1.00 0.00 ? 52  ARG A NH2  2  
ATOM   2098  H  H    . ARG A 1 52 ? 6.170   -11.824 -4.995  1.00 0.00 ? 52  ARG A H    2  
ATOM   2099  H  HA   . ARG A 1 52 ? 8.838   -11.038 -6.006  1.00 0.00 ? 52  ARG A HA   2  
ATOM   2100  H  HB2  . ARG A 1 52 ? 9.759   -13.054 -4.848  1.00 0.00 ? 52  ARG A HB2  2  
ATOM   2101  H  HB3  . ARG A 1 52 ? 9.140   -11.841 -3.732  1.00 0.00 ? 52  ARG A HB3  2  
ATOM   2102  H  HG2  . ARG A 1 52 ? 7.102   -13.163 -3.365  1.00 0.00 ? 52  ARG A HG2  2  
ATOM   2103  H  HG3  . ARG A 1 52 ? 7.636   -14.364 -4.546  1.00 0.00 ? 52  ARG A HG3  2  
ATOM   2104  H  HD2  . ARG A 1 52 ? 9.021   -13.701 -1.916  1.00 0.00 ? 52  ARG A HD2  2  
ATOM   2105  H  HD3  . ARG A 1 52 ? 8.050   -15.146 -2.251  1.00 0.00 ? 52  ARG A HD3  2  
ATOM   2106  H  HE   . ARG A 1 52 ? 10.188  -14.860 -4.121  1.00 0.00 ? 52  ARG A HE   2  
ATOM   2107  H  HH11 . ARG A 1 52 ? 9.590   -15.921 -0.829  1.00 0.00 ? 52  ARG A HH11 2  
ATOM   2108  H  HH12 . ARG A 1 52 ? 10.968  -16.972 -0.809  1.00 0.00 ? 52  ARG A HH12 2  
ATOM   2109  H  HH21 . ARG A 1 52 ? 11.993  -16.219 -4.047  1.00 0.00 ? 52  ARG A HH21 2  
ATOM   2110  H  HH22 . ARG A 1 52 ? 12.316  -17.129 -2.608  1.00 0.00 ? 52  ARG A HH22 2  
ATOM   2111  N  N    . GLN A 1 53 ? 6.649   -13.248 -6.959  1.00 0.00 ? 53  GLN A N    2  
ATOM   2112  C  CA   . GLN A 1 53 ? 6.200   -14.184 -8.007  1.00 0.00 ? 53  GLN A CA   2  
ATOM   2113  C  C    . GLN A 1 53 ? 5.448   -13.377 -9.091  1.00 0.00 ? 53  GLN A C    2  
ATOM   2114  O  O    . GLN A 1 53 ? 4.496   -12.661 -8.772  1.00 0.00 ? 53  GLN A O    2  
ATOM   2115  C  CB   . GLN A 1 53 ? 5.305   -15.279 -7.330  1.00 0.00 ? 53  GLN A CB   2  
ATOM   2116  C  CG   . GLN A 1 53 ? 5.077   -16.586 -8.130  1.00 0.00 ? 53  GLN A CG   2  
ATOM   2117  C  CD   . GLN A 1 53 ? 4.054   -16.465 -9.257  1.00 0.00 ? 53  GLN A CD   2  
ATOM   2118  O  OE1  . GLN A 1 53 ? 4.400   -16.191 -10.404 1.00 0.00 ? 53  GLN A OE1  2  
ATOM   2119  N  NE2  . GLN A 1 53 ? 2.785   -16.643 -8.923  1.00 0.00 ? 53  GLN A NE2  2  
ATOM   2120  H  H    . GLN A 1 53 ? 5.990   -12.948 -6.303  1.00 0.00 ? 53  GLN A H    2  
ATOM   2121  H  HA   . GLN A 1 53 ? 7.074   -14.657 -8.451  1.00 0.00 ? 53  GLN A HA   2  
ATOM   2122  H  HB2  . GLN A 1 53 ? 5.770   -15.558 -6.392  1.00 0.00 ? 53  GLN A HB2  2  
ATOM   2123  H  HB3  . GLN A 1 53 ? 4.335   -14.844 -7.105  1.00 0.00 ? 53  GLN A HB3  2  
ATOM   2124  H  HG2  . GLN A 1 53 ? 6.025   -16.897 -8.557  1.00 0.00 ? 53  GLN A HG2  2  
ATOM   2125  H  HG3  . GLN A 1 53 ? 4.740   -17.362 -7.447  1.00 0.00 ? 53  GLN A HG3  2  
ATOM   2126  H  HE21 . GLN A 1 53 ? 2.574   -16.843 -7.983  1.00 0.00 ? 53  GLN A HE21 2  
ATOM   2127  H  HE22 . GLN A 1 53 ? 2.109   -16.574 -9.623  1.00 0.00 ? 53  GLN A HE22 2  
ATOM   2128  N  N    . LYS A 1 54 ? 5.893   -13.508 -10.359 1.00 0.00 ? 54  LYS A N    2  
ATOM   2129  C  CA   . LYS A 1 54 ? 5.407   -12.697 -11.512 1.00 0.00 ? 54  LYS A CA   2  
ATOM   2130  C  C    . LYS A 1 54 ? 3.869   -12.715 -11.666 1.00 0.00 ? 54  LYS A C    2  
ATOM   2131  O  O    . LYS A 1 54 ? 3.229   -11.655 -11.687 1.00 0.00 ? 54  LYS A O    2  
ATOM   2132  C  CB   . LYS A 1 54 ? 6.061   -13.187 -12.837 1.00 0.00 ? 54  LYS A CB   2  
ATOM   2133  C  CG   . LYS A 1 54 ? 7.594   -13.014 -12.902 1.00 0.00 ? 54  LYS A CG   2  
ATOM   2134  C  CD   . LYS A 1 54 ? 8.224   -13.610 -14.188 1.00 0.00 ? 54  LYS A CD   2  
ATOM   2135  C  CE   . LYS A 1 54 ? 7.706   -12.953 -15.479 1.00 0.00 ? 54  LYS A CE   2  
ATOM   2136  N  NZ   . LYS A 1 54 ? 8.014   -11.498 -15.541 1.00 0.00 ? 54  LYS A NZ   2  
ATOM   2137  H  H    . LYS A 1 54 ? 6.586   -14.178 -10.527 1.00 0.00 ? 54  LYS A H    2  
ATOM   2138  H  HA   . LYS A 1 54 ? 5.722   -11.672 -11.335 1.00 0.00 ? 54  LYS A HA   2  
ATOM   2139  H  HB2  . LYS A 1 54 ? 5.834   -14.240 -12.966 1.00 0.00 ? 54  LYS A HB2  2  
ATOM   2140  H  HB3  . LYS A 1 54 ? 5.628   -12.638 -13.668 1.00 0.00 ? 54  LYS A HB3  2  
ATOM   2141  H  HG2  . LYS A 1 54 ? 7.830   -11.956 -12.857 1.00 0.00 ? 54  LYS A HG2  2  
ATOM   2142  H  HG3  . LYS A 1 54 ? 8.034   -13.507 -12.039 1.00 0.00 ? 54  LYS A HG3  2  
ATOM   2143  H  HD2  . LYS A 1 54 ? 9.298   -13.469 -14.143 1.00 0.00 ? 54  LYS A HD2  2  
ATOM   2144  H  HD3  . LYS A 1 54 ? 8.012   -14.675 -14.225 1.00 0.00 ? 54  LYS A HD3  2  
ATOM   2145  H  HE2  . LYS A 1 54 ? 8.169   -13.435 -16.329 1.00 0.00 ? 54  LYS A HE2  2  
ATOM   2146  H  HE3  . LYS A 1 54 ? 6.631   -13.084 -15.543 1.00 0.00 ? 54  LYS A HE3  2  
ATOM   2147  H  HZ1  . LYS A 1 54 ? 9.042   -11.345 -15.482 1.00 0.00 ? 54  LYS A HZ1  2  
ATOM   2148  H  HZ2  . LYS A 1 54 ? 7.553   -10.994 -14.755 1.00 0.00 ? 54  LYS A HZ2  2  
ATOM   2149  H  HZ3  . LYS A 1 54 ? 7.674   -11.101 -16.439 1.00 0.00 ? 54  LYS A HZ3  2  
ATOM   2150  N  N    . ALA A 1 55 ? 3.298   -13.925 -11.781 1.00 0.00 ? 55  ALA A N    2  
ATOM   2151  C  CA   . ALA A 1 55 ? 1.840   -14.117 -11.943 1.00 0.00 ? 55  ALA A CA   2  
ATOM   2152  C  C    . ALA A 1 55 ? 1.031   -13.406 -10.835 1.00 0.00 ? 55  ALA A C    2  
ATOM   2153  O  O    . ALA A 1 55 ? 0.008   -12.801 -11.117 1.00 0.00 ? 55  ALA A O    2  
ATOM   2154  C  CB   . ALA A 1 55 ? 1.494   -15.609 -11.994 1.00 0.00 ? 55  ALA A CB   2  
ATOM   2155  H  H    . ALA A 1 55 ? 3.890   -14.708 -11.779 1.00 0.00 ? 55  ALA A H    2  
ATOM   2156  H  HA   . ALA A 1 55 ? 1.565   -13.684 -12.901 1.00 0.00 ? 55  ALA A HA   2  
ATOM   2157  H  HB1  . ALA A 1 55 ? 0.434   -15.737 -12.174 1.00 0.00 ? 55  ALA A HB1  2  
ATOM   2158  H  HB2  . ALA A 1 55 ? 1.756   -16.074 -11.052 1.00 0.00 ? 55  ALA A HB2  2  
ATOM   2159  H  HB3  . ALA A 1 55 ? 2.052   -16.087 -12.791 1.00 0.00 ? 55  ALA A HB3  2  
ATOM   2160  N  N    . SER A 1 56 ? 1.543   -13.463 -9.599  1.00 0.00 ? 56  SER A N    2  
ATOM   2161  C  CA   . SER A 1 56 ? 0.872   -12.912 -8.404  1.00 0.00 ? 56  SER A CA   2  
ATOM   2162  C  C    . SER A 1 56 ? 0.489   -11.405 -8.541  1.00 0.00 ? 56  SER A C    2  
ATOM   2163  O  O    . SER A 1 56 ? -0.691  -11.060 -8.410  1.00 0.00 ? 56  SER A O    2  
ATOM   2164  C  CB   . SER A 1 56 ? 1.772   -13.143 -7.185  1.00 0.00 ? 56  SER A CB   2  
ATOM   2165  O  OG   . SER A 1 56 ? 1.138   -12.771 -5.977  1.00 0.00 ? 56  SER A OG   2  
ATOM   2166  H  H    . SER A 1 56 ? 2.389   -13.942 -9.488  1.00 0.00 ? 56  SER A H    2  
ATOM   2167  H  HA   . SER A 1 56 ? -0.043  -13.484 -8.259  1.00 0.00 ? 56  SER A HA   2  
ATOM   2168  H  HB2  . SER A 1 56 ? 2.033   -14.192 -7.124  1.00 0.00 ? 56  SER A HB2  2  
ATOM   2169  H  HB3  . SER A 1 56 ? 2.676   -12.561 -7.290  1.00 0.00 ? 56  SER A HB3  2  
ATOM   2170  H  HG   . SER A 1 56 ? 0.720   -13.541 -5.585  1.00 0.00 ? 56  SER A HG   2  
ATOM   2171  N  N    . LEU A 1 57 ? 1.473   -10.522 -8.843  1.00 0.00 ? 57  LEU A N    2  
ATOM   2172  C  CA   . LEU A 1 57 ? 1.205   -9.077  -9.071  1.00 0.00 ? 57  LEU A CA   2  
ATOM   2173  C  C    . LEU A 1 57 ? 0.527   -8.852  -10.444 1.00 0.00 ? 57  LEU A C    2  
ATOM   2174  O  O    . LEU A 1 57 ? -0.187  -7.858  -10.641 1.00 0.00 ? 57  LEU A O    2  
ATOM   2175  C  CB   . LEU A 1 57 ? 2.466   -8.165  -8.901  1.00 0.00 ? 57  LEU A CB   2  
ATOM   2176  C  CG   . LEU A 1 57 ? 3.667   -8.355  -9.892  1.00 0.00 ? 57  LEU A CG   2  
ATOM   2177  C  CD1  . LEU A 1 57 ? 4.570   -7.104  -9.909  1.00 0.00 ? 57  LEU A CD1  2  
ATOM   2178  C  CD2  . LEU A 1 57 ? 4.510   -9.601  -9.555  1.00 0.00 ? 57  LEU A CD2  2  
ATOM   2179  H  H    . LEU A 1 57 ? 2.386   -10.851 -8.906  1.00 0.00 ? 57  LEU A H    2  
ATOM   2180  H  HA   . LEU A 1 57 ? 0.482   -8.782  -8.312  1.00 0.00 ? 57  LEU A HA   2  
ATOM   2181  H  HB2  . LEU A 1 57 ? 2.131   -7.138  -8.984  1.00 0.00 ? 57  LEU A HB2  2  
ATOM   2182  H  HB3  . LEU A 1 57 ? 2.837   -8.302  -7.889  1.00 0.00 ? 57  LEU A HB3  2  
ATOM   2183  H  HG   . LEU A 1 57 ? 3.277   -8.484  -10.894 1.00 0.00 ? 57  LEU A HG   2  
ATOM   2184  H  HD11 . LEU A 1 57 ? 3.990   -6.243  -10.214 1.00 0.00 ? 57  LEU A HD11 2  
ATOM   2185  H  HD12 . LEU A 1 57 ? 5.377   -7.249  -10.612 1.00 0.00 ? 57  LEU A HD12 2  
ATOM   2186  H  HD13 . LEU A 1 57 ? 4.981   -6.929  -8.920  1.00 0.00 ? 57  LEU A HD13 2  
ATOM   2187  H  HD21 . LEU A 1 57 ? 5.355   -9.662  -10.230 1.00 0.00 ? 57  LEU A HD21 2  
ATOM   2188  H  HD22 . LEU A 1 57 ? 3.909   -10.494 -9.666  1.00 0.00 ? 57  LEU A HD22 2  
ATOM   2189  H  HD23 . LEU A 1 57 ? 4.872   -9.537  -8.536  1.00 0.00 ? 57  LEU A HD23 2  
ATOM   2190  N  N    . ASN A 1 58 ? 0.774   -9.777  -11.391 1.00 0.00 ? 58  ASN A N    2  
ATOM   2191  C  CA   . ASN A 1 58 ? 0.045   -9.846  -12.682 1.00 0.00 ? 58  ASN A CA   2  
ATOM   2192  C  C    . ASN A 1 58 ? -1.464  -10.128 -12.485 1.00 0.00 ? 58  ASN A C    2  
ATOM   2193  O  O    . ASN A 1 58 ? -2.288  -9.784  -13.336 1.00 0.00 ? 58  ASN A O    2  
ATOM   2194  C  CB   . ASN A 1 58 ? 0.699   -10.925 -13.591 1.00 0.00 ? 58  ASN A CB   2  
ATOM   2195  C  CG   . ASN A 1 58 ? -0.078  -11.257 -14.874 1.00 0.00 ? 58  ASN A CG   2  
ATOM   2196  O  OD1  . ASN A 1 58 ? 0.102   -10.620 -15.906 1.00 0.00 ? 58  ASN A OD1  2  
ATOM   2197  N  ND2  . ASN A 1 58 ? -0.955  -12.259 -14.804 1.00 0.00 ? 58  ASN A ND2  2  
ATOM   2198  H  H    . ASN A 1 58 ? 1.492   -10.429 -11.238 1.00 0.00 ? 58  ASN A H    2  
ATOM   2199  H  HA   . ASN A 1 58 ? 0.144   -8.880  -13.151 1.00 0.00 ? 58  ASN A HA   2  
ATOM   2200  H  HB2  . ASN A 1 58 ? 1.686   -10.583 -13.876 1.00 0.00 ? 58  ASN A HB2  2  
ATOM   2201  H  HB3  . ASN A 1 58 ? 0.809   -11.842 -13.013 1.00 0.00 ? 58  ASN A HB3  2  
ATOM   2202  H  HD21 . ASN A 1 58 ? -1.057  -12.728 -13.948 1.00 0.00 ? 58  ASN A HD21 2  
ATOM   2203  H  HD22 . ASN A 1 58 ? -1.468  -12.492 -15.610 1.00 0.00 ? 58  ASN A HD22 2  
ATOM   2204  N  N    . TRP A 1 59 ? -1.827  -10.761 -11.365 1.00 0.00 ? 59  TRP A N    2  
ATOM   2205  C  CA   . TRP A 1 59 ? -3.244  -10.999 -11.026 1.00 0.00 ? 59  TRP A CA   2  
ATOM   2206  C  C    . TRP A 1 59 ? -3.817  -9.744  -10.376 1.00 0.00 ? 59  TRP A C    2  
ATOM   2207  O  O    . TRP A 1 59 ? -4.973  -9.398  -10.596 1.00 0.00 ? 59  TRP A O    2  
ATOM   2208  C  CB   . TRP A 1 59 ? -3.445  -12.245 -10.127 1.00 0.00 ? 59  TRP A CB   2  
ATOM   2209  C  CG   . TRP A 1 59 ? -3.011  -13.553 -10.769 1.00 0.00 ? 59  TRP A CG   2  
ATOM   2210  C  CD1  . TRP A 1 59 ? -2.239  -14.532 -10.202 1.00 0.00 ? 59  TRP A CD1  2  
ATOM   2211  C  CD2  . TRP A 1 59 ? -3.317  -14.025 -12.104 1.00 0.00 ? 59  TRP A CD2  2  
ATOM   2212  N  NE1  . TRP A 1 59 ? -2.036  -15.555 -11.086 1.00 0.00 ? 59  TRP A NE1  2  
ATOM   2213  C  CE2  . TRP A 1 59 ? -2.693  -15.277 -12.253 1.00 0.00 ? 59  TRP A CE2  2  
ATOM   2214  C  CE3  . TRP A 1 59 ? -4.062  -13.519 -13.189 1.00 0.00 ? 59  TRP A CE3  2  
ATOM   2215  C  CZ2  . TRP A 1 59 ? -2.772  -16.017 -13.432 1.00 0.00 ? 59  TRP A CZ2  2  
ATOM   2216  C  CZ3  . TRP A 1 59 ? -4.142  -14.263 -14.352 1.00 0.00 ? 59  TRP A CZ3  2  
ATOM   2217  C  CH2  . TRP A 1 59 ? -3.505  -15.501 -14.462 1.00 0.00 ? 59  TRP A CH2  2  
ATOM   2218  H  H    . TRP A 1 59 ? -1.149  -10.974 -10.701 1.00 0.00 ? 59  TRP A H    2  
ATOM   2219  H  HA   . TRP A 1 59 ? -3.782  -11.166 -11.963 1.00 0.00 ? 59  TRP A HA   2  
ATOM   2220  H  HB2  . TRP A 1 59 ? -2.878  -12.109 -9.211  1.00 0.00 ? 59  TRP A HB2  2  
ATOM   2221  H  HB3  . TRP A 1 59 ? -4.493  -12.335 -9.876  1.00 0.00 ? 59  TRP A HB3  2  
ATOM   2222  H  HD1  . TRP A 1 59 ? -1.831  -14.478 -9.204  1.00 0.00 ? 59  TRP A HD1  2  
ATOM   2223  H  HE1  . TRP A 1 59 ? -1.511  -16.364 -10.909 1.00 0.00 ? 59  TRP A HE1  2  
ATOM   2224  H  HE3  . TRP A 1 59 ? -4.565  -12.560 -13.122 1.00 0.00 ? 59  TRP A HE3  2  
ATOM   2225  H  HZ2  . TRP A 1 59 ? -2.286  -16.979 -13.535 1.00 0.00 ? 59  TRP A HZ2  2  
ATOM   2226  H  HZ3  . TRP A 1 59 ? -4.711  -13.885 -15.193 1.00 0.00 ? 59  TRP A HZ3  2  
ATOM   2227  H  HH2  . TRP A 1 59 ? -3.592  -16.049 -15.393 1.00 0.00 ? 59  TRP A HH2  2  
ATOM   2228  N  N    . HIS A 1 60 ? -3.008  -9.092  -9.532  1.00 0.00 ? 60  HIS A N    2  
ATOM   2229  C  CA   . HIS A 1 60 ? -3.317  -7.766  -8.992  1.00 0.00 ? 60  HIS A CA   2  
ATOM   2230  C  C    . HIS A 1 60 ? -3.527  -6.670  -10.086 1.00 0.00 ? 60  HIS A C    2  
ATOM   2231  O  O    . HIS A 1 60 ? -4.293  -5.725  -9.855  1.00 0.00 ? 60  HIS A O    2  
ATOM   2232  C  CB   . HIS A 1 60 ? -2.217  -7.379  -7.978  1.00 0.00 ? 60  HIS A CB   2  
ATOM   2233  C  CG   . HIS A 1 60 ? -2.273  -5.964  -7.501  1.00 0.00 ? 60  HIS A CG   2  
ATOM   2234  N  ND1  . HIS A 1 60 ? -3.299  -5.405  -6.781  1.00 0.00 ? 60  HIS A ND1  2  
ATOM   2235  C  CD2  . HIS A 1 60 ? -1.417  -4.975  -7.751  1.00 0.00 ? 60  HIS A CD2  2  
ATOM   2236  C  CE1  . HIS A 1 60 ? -3.033  -4.097  -6.661  1.00 0.00 ? 60  HIS A CE1  2  
ATOM   2237  N  NE2  . HIS A 1 60 ? -1.885  -3.783  -7.246  1.00 0.00 ? 60  HIS A NE2  2  
ATOM   2238  H  H    . HIS A 1 60 ? -2.228  -9.541  -9.138  1.00 0.00 ? 60  HIS A H    2  
ATOM   2239  H  HA   . HIS A 1 60 ? -4.245  -7.870  -8.444  1.00 0.00 ? 60  HIS A HA   2  
ATOM   2240  H  HB2  . HIS A 1 60 ? -2.286  -8.012  -7.111  1.00 0.00 ? 60  HIS A HB2  2  
ATOM   2241  H  HB3  . HIS A 1 60 ? -1.250  -7.535  -8.444  1.00 0.00 ? 60  HIS A HB3  2  
ATOM   2242  H  HD1  . HIS A 1 60 ? -4.078  -5.876  -6.411  1.00 0.00 ? 60  HIS A HD1  2  
ATOM   2243  H  HD2  . HIS A 1 60 ? -0.470  -5.090  -8.257  1.00 0.00 ? 60  HIS A HD2  2  
ATOM   2244  H  HE1  . HIS A 1 60 ? -3.662  -3.395  -6.135  1.00 0.00 ? 60  HIS A HE1  2  
ATOM   2245  N  N    . MET A 1 61 ? -2.846  -6.757  -11.261 1.00 0.00 ? 61  MET A N    2  
ATOM   2246  C  CA   . MET A 1 61 ? -3.129  -5.807  -12.379 1.00 0.00 ? 61  MET A CA   2  
ATOM   2247  C  C    . MET A 1 61 ? -4.498  -6.120  -13.014 1.00 0.00 ? 61  MET A C    2  
ATOM   2248  O  O    . MET A 1 61 ? -5.172  -5.224  -13.517 1.00 0.00 ? 61  MET A O    2  
ATOM   2249  C  CB   . MET A 1 61 ? -1.994  -5.750  -13.450 1.00 0.00 ? 61  MET A CB   2  
ATOM   2250  C  CG   . MET A 1 61 ? -1.861  -6.949  -14.382 1.00 0.00 ? 61  MET A CG   2  
ATOM   2251  S  SD   . MET A 1 61 ? -0.530  -6.767  -15.581 1.00 0.00 ? 61  MET A SD   2  
ATOM   2252  C  CE   . MET A 1 61 ? -1.065  -5.319  -16.523 1.00 0.00 ? 61  MET A CE   2  
ATOM   2253  H  H    . MET A 1 61 ? -2.148  -7.438  -11.365 1.00 0.00 ? 61  MET A H    2  
ATOM   2254  H  HA   . MET A 1 61 ? -3.205  -4.814  -11.926 1.00 0.00 ? 61  MET A HA   2  
ATOM   2255  H  HB2  . MET A 1 61 ? -2.151  -4.882  -14.070 1.00 0.00 ? 61  MET A HB2  2  
ATOM   2256  H  HB3  . MET A 1 61 ? -1.049  -5.627  -12.936 1.00 0.00 ? 61  MET A HB3  2  
ATOM   2257  H  HG2  . MET A 1 61 ? -1.660  -7.825  -13.796 1.00 0.00 ? 61  MET A HG2  2  
ATOM   2258  H  HG3  . MET A 1 61 ? -2.785  -7.086  -14.923 1.00 0.00 ? 61  MET A HG3  2  
ATOM   2259  H  HE1  . MET A 1 61 ? -0.349  -5.106  -17.306 1.00 0.00 ? 61  MET A HE1  2  
ATOM   2260  H  HE2  . MET A 1 61 ? -1.138  -4.455  -15.875 1.00 0.00 ? 61  MET A HE2  2  
ATOM   2261  H  HE3  . MET A 1 61 ? -2.031  -5.518  -16.966 1.00 0.00 ? 61  MET A HE3  2  
ATOM   2262  N  N    . LYS A 1 62 ? -4.881  -7.406  -13.001 1.00 0.00 ? 62  LYS A N    2  
ATOM   2263  C  CA   . LYS A 1 62 ? -6.241  -7.850  -13.388 1.00 0.00 ? 62  LYS A CA   2  
ATOM   2264  C  C    . LYS A 1 62 ? -7.324  -7.232  -12.457 1.00 0.00 ? 62  LYS A C    2  
ATOM   2265  O  O    . LYS A 1 62 ? -8.449  -6.965  -12.889 1.00 0.00 ? 62  LYS A O    2  
ATOM   2266  C  CB   . LYS A 1 62 ? -6.328  -9.404  -13.404 1.00 0.00 ? 62  LYS A CB   2  
ATOM   2267  C  CG   . LYS A 1 62 ? -7.652  -9.973  -13.961 1.00 0.00 ? 62  LYS A CG   2  
ATOM   2268  C  CD   . LYS A 1 62 ? -7.868  -9.686  -15.469 1.00 0.00 ? 62  LYS A CD   2  
ATOM   2269  C  CE   . LYS A 1 62 ? -6.815  -10.352 -16.364 1.00 0.00 ? 62  LYS A CE   2  
ATOM   2270  N  NZ   . LYS A 1 62 ? -6.825  -11.836 -16.236 1.00 0.00 ? 62  LYS A NZ   2  
ATOM   2271  H  H    . LYS A 1 62 ? -4.212  -8.080  -12.791 1.00 0.00 ? 62  LYS A H    2  
ATOM   2272  H  HA   . LYS A 1 62 ? -6.419  -7.488  -14.397 1.00 0.00 ? 62  LYS A HA   2  
ATOM   2273  H  HB2  . LYS A 1 62 ? -5.509  -9.797  -14.001 1.00 0.00 ? 62  LYS A HB2  2  
ATOM   2274  H  HB3  . LYS A 1 62 ? -6.210  -9.772  -12.391 1.00 0.00 ? 62  LYS A HB3  2  
ATOM   2275  H  HG2  . LYS A 1 62 ? -7.668  -11.045 -13.807 1.00 0.00 ? 62  LYS A HG2  2  
ATOM   2276  H  HG3  . LYS A 1 62 ? -8.471  -9.531  -13.404 1.00 0.00 ? 62  LYS A HG3  2  
ATOM   2277  H  HD2  . LYS A 1 62 ? -8.844  -10.066 -15.754 1.00 0.00 ? 62  LYS A HD2  2  
ATOM   2278  H  HD3  . LYS A 1 62 ? -7.848  -8.612  -15.637 1.00 0.00 ? 62  LYS A HD3  2  
ATOM   2279  H  HE2  . LYS A 1 62 ? -7.007  -10.091 -17.399 1.00 0.00 ? 62  LYS A HE2  2  
ATOM   2280  H  HE3  . LYS A 1 62 ? -5.831  -9.987  -16.084 1.00 0.00 ? 62  LYS A HE3  2  
ATOM   2281  H  HZ1  . LYS A 1 62 ? -6.097  -12.251 -16.853 1.00 0.00 ? 62  LYS A HZ1  2  
ATOM   2282  H  HZ2  . LYS A 1 62 ? -7.757  -12.214 -16.506 1.00 0.00 ? 62  LYS A HZ2  2  
ATOM   2283  H  HZ3  . LYS A 1 62 ? -6.628  -12.115 -15.257 1.00 0.00 ? 62  LYS A HZ3  2  
ATOM   2284  N  N    . LYS A 1 63 ? -6.960  -7.024  -11.183 1.00 0.00 ? 63  LYS A N    2  
ATOM   2285  C  CA   . LYS A 1 63 ? -7.800  -6.260  -10.226 1.00 0.00 ? 63  LYS A CA   2  
ATOM   2286  C  C    . LYS A 1 63 ? -7.974  -4.783  -10.697 1.00 0.00 ? 63  LYS A C    2  
ATOM   2287  O  O    . LYS A 1 63 ? -9.042  -4.186  -10.509 1.00 0.00 ? 63  LYS A O    2  
ATOM   2288  C  CB   . LYS A 1 63 ? -7.226  -6.318  -8.782  1.00 0.00 ? 63  LYS A CB   2  
ATOM   2289  C  CG   . LYS A 1 63 ? -6.819  -7.732  -8.275  1.00 0.00 ? 63  LYS A CG   2  
ATOM   2290  C  CD   . LYS A 1 63 ? -7.918  -8.801  -8.415  1.00 0.00 ? 63  LYS A CD   2  
ATOM   2291  C  CE   . LYS A 1 63 ? -9.138  -8.540  -7.529  1.00 0.00 ? 63  LYS A CE   2  
ATOM   2292  N  NZ   . LYS A 1 63 ? -10.226 -9.503  -7.809  1.00 0.00 ? 63  LYS A NZ   2  
ATOM   2293  H  H    . LYS A 1 63 ? -6.146  -7.487  -10.901 1.00 0.00 ? 63  LYS A H    2  
ATOM   2294  H  HA   . LYS A 1 63 ? -8.780  -6.728  -10.223 1.00 0.00 ? 63  LYS A HA   2  
ATOM   2295  H  HB2  . LYS A 1 63 ? -6.347  -5.691  -8.743  1.00 0.00 ? 63  LYS A HB2  2  
ATOM   2296  H  HB3  . LYS A 1 63 ? -7.965  -5.914  -8.097  1.00 0.00 ? 63  LYS A HB3  2  
ATOM   2297  H  HG2  . LYS A 1 63 ? -5.964  -8.061  -8.849  1.00 0.00 ? 63  LYS A HG2  2  
ATOM   2298  H  HG3  . LYS A 1 63 ? -6.531  -7.658  -7.231  1.00 0.00 ? 63  LYS A HG3  2  
ATOM   2299  H  HD2  . LYS A 1 63 ? -8.241  -8.838  -9.450  1.00 0.00 ? 63  LYS A HD2  2  
ATOM   2300  H  HD3  . LYS A 1 63 ? -7.497  -9.771  -8.151  1.00 0.00 ? 63  LYS A HD3  2  
ATOM   2301  H  HE2  . LYS A 1 63 ? -8.852  -8.632  -6.490  1.00 0.00 ? 63  LYS A HE2  2  
ATOM   2302  H  HE3  . LYS A 1 63 ? -9.505  -7.537  -7.714  1.00 0.00 ? 63  LYS A HE3  2  
ATOM   2303  H  HZ1  . LYS A 1 63 ? -11.057 -9.287  -7.227  1.00 0.00 ? 63  LYS A HZ1  2  
ATOM   2304  H  HZ2  . LYS A 1 63 ? -9.910  -10.471 -7.597  1.00 0.00 ? 63  LYS A HZ2  2  
ATOM   2305  H  HZ3  . LYS A 1 63 ? -10.496 -9.455  -8.814  1.00 0.00 ? 63  LYS A HZ3  2  
ATOM   2306  N  N    . HIS A 1 64 ? -6.910  -4.203  -11.309 1.00 0.00 ? 64  HIS A N    2  
ATOM   2307  C  CA   . HIS A 1 64 ? -6.984  -2.882  -12.002 1.00 0.00 ? 64  HIS A CA   2  
ATOM   2308  C  C    . HIS A 1 64 ? -7.777  -2.979  -13.333 1.00 0.00 ? 64  HIS A C    2  
ATOM   2309  O  O    . HIS A 1 64 ? -8.386  -1.996  -13.772 1.00 0.00 ? 64  HIS A O    2  
ATOM   2310  C  CB   . HIS A 1 64 ? -5.565  -2.313  -12.286 1.00 0.00 ? 64  HIS A CB   2  
ATOM   2311  C  CG   . HIS A 1 64 ? -4.758  -1.953  -11.074 1.00 0.00 ? 64  HIS A CG   2  
ATOM   2312  N  ND1  . HIS A 1 64 ? -5.111  -0.958  -10.190 1.00 0.00 ? 64  HIS A ND1  2  
ATOM   2313  C  CD2  . HIS A 1 64 ? -3.537  -2.392  -10.665 1.00 0.00 ? 64  HIS A CD2  2  
ATOM   2314  C  CE1  . HIS A 1 64 ? -4.119  -0.815  -9.312  1.00 0.00 ? 64  HIS A CE1  2  
ATOM   2315  N  NE2  . HIS A 1 64 ? -3.139  -1.657  -9.559  1.00 0.00 ? 64  HIS A NE2  2  
ATOM   2316  H  H    . HIS A 1 64 ? -6.041  -4.649  -11.267 1.00 0.00 ? 64  HIS A H    2  
ATOM   2317  H  HA   . HIS A 1 64 ? -7.508  -2.195  -11.344 1.00 0.00 ? 64  HIS A HA   2  
ATOM   2318  H  HB2  . HIS A 1 64 ? -4.993  -3.045  -12.842 1.00 0.00 ? 64  HIS A HB2  2  
ATOM   2319  H  HB3  . HIS A 1 64 ? -5.649  -1.413  -12.893 1.00 0.00 ? 64  HIS A HB3  2  
ATOM   2320  H  HD1  . HIS A 1 64 ? -5.946  -0.442  -10.199 1.00 0.00 ? 64  HIS A HD1  2  
ATOM   2321  H  HD2  . HIS A 1 64 ? -2.963  -3.187  -11.117 1.00 0.00 ? 64  HIS A HD2  2  
ATOM   2322  H  HE1  . HIS A 1 64 ? -4.116  -0.099  -8.503  1.00 0.00 ? 64  HIS A HE1  2  
ATOM   2323  N  N    . ASP A 1 65 ? -7.804  -4.190  -13.930 1.00 0.00 ? 65  ASP A N    2  
ATOM   2324  C  CA   . ASP A 1 65 ? -8.477  -4.451  -15.228 1.00 0.00 ? 65  ASP A CA   2  
ATOM   2325  C  C    . ASP A 1 65 ? -9.978  -4.685  -14.971 1.00 0.00 ? 65  ASP A C    2  
ATOM   2326  O  O    . ASP A 1 65 ? -10.800 -4.656  -15.891 1.00 0.00 ? 65  ASP A O    2  
ATOM   2327  C  CB   . ASP A 1 65 ? -7.826  -5.678  -15.932 1.00 0.00 ? 65  ASP A CB   2  
ATOM   2328  C  CG   . ASP A 1 65 ? -8.437  -6.026  -17.306 1.00 0.00 ? 65  ASP A CG   2  
ATOM   2329  O  OD1  . ASP A 1 65 ? -8.149  -5.311  -18.293 1.00 0.00 ? 65  ASP A OD1  2  
ATOM   2330  O  OD2  . ASP A 1 65 ? -9.209  -7.013  -17.402 1.00 0.00 ? 65  ASP A OD2  2  
ATOM   2331  H  H    . ASP A 1 65 ? -7.467  -4.953  -13.421 1.00 0.00 ? 65  ASP A H    2  
ATOM   2332  H  HA   . ASP A 1 65 ? -8.369  -3.574  -15.860 1.00 0.00 ? 65  ASP A HA   2  
ATOM   2333  H  HB2  . ASP A 1 65 ? -6.770  -5.466  -16.076 1.00 0.00 ? 65  ASP A HB2  2  
ATOM   2334  H  HB3  . ASP A 1 65 ? -7.910  -6.542  -15.277 1.00 0.00 ? 65  ASP A HB3  2  
ATOM   2335  N  N    . ALA A 1 66 ? -10.316 -4.926  -13.692 1.00 0.00 ? 66  ALA A N    2  
ATOM   2336  C  CA   . ALA A 1 66 ? -11.698 -4.967  -13.219 1.00 0.00 ? 66  ALA A CA   2  
ATOM   2337  C  C    . ALA A 1 66 ? -12.306 -3.560  -13.297 1.00 0.00 ? 66  ALA A C    2  
ATOM   2338  O  O    . ALA A 1 66 ? -13.350 -3.374  -13.936 1.00 0.00 ? 66  ALA A O    2  
ATOM   2339  C  CB   . ALA A 1 66 ? -11.771 -5.531  -11.788 1.00 0.00 ? 66  ALA A CB   2  
ATOM   2340  H  H    . ALA A 1 66 ? -9.604  -5.071  -13.045 1.00 0.00 ? 66  ALA A H    2  
ATOM   2341  H  HA   . ALA A 1 66 ? -12.256 -5.630  -13.868 1.00 0.00 ? 66  ALA A HA   2  
ATOM   2342  H  HB1  . ALA A 1 66 ? -12.804 -5.576  -11.465 1.00 0.00 ? 66  ALA A HB1  2  
ATOM   2343  H  HB2  . ALA A 1 66 ? -11.217 -4.889  -11.114 1.00 0.00 ? 66  ALA A HB2  2  
ATOM   2344  H  HB3  . ALA A 1 66 ? -11.345 -6.526  -11.759 1.00 0.00 ? 66  ALA A HB3  2  
ATOM   2345  N  N    . ASP A 1 67 ? -11.641 -2.592  -12.607 1.00 0.00 ? 67  ASP A N    2  
ATOM   2346  C  CA   . ASP A 1 67 ? -11.973 -1.134  -12.623 1.00 0.00 ? 67  ASP A CA   2  
ATOM   2347  C  C    . ASP A 1 67 ? -13.226 -0.790  -11.766 1.00 0.00 ? 67  ASP A C    2  
ATOM   2348  O  O    . ASP A 1 67 ? -13.268 0.254   -11.098 1.00 0.00 ? 67  ASP A O    2  
ATOM   2349  C  CB   . ASP A 1 67 ? -12.091 -0.592  -14.087 1.00 0.00 ? 67  ASP A CB   2  
ATOM   2350  C  CG   . ASP A 1 67 ? -12.737 0.804   -14.197 1.00 0.00 ? 67  ASP A CG   2  
ATOM   2351  O  OD1  . ASP A 1 67 ? -12.045 1.813   -13.938 1.00 0.00 ? 67  ASP A OD1  2  
ATOM   2352  O  OD2  . ASP A 1 67 ? -13.934 0.893   -14.554 1.00 0.00 ? 67  ASP A OD2  2  
ATOM   2353  H  H    . ASP A 1 67 ? -10.894 -2.868  -12.034 1.00 0.00 ? 67  ASP A H    2  
ATOM   2354  H  HA   . ASP A 1 67 ? -11.121 -0.641  -12.156 1.00 0.00 ? 67  ASP A HA   2  
ATOM   2355  H  HB2  . ASP A 1 67 ? -11.094 -0.538  -14.518 1.00 0.00 ? 67  ASP A HB2  2  
ATOM   2356  H  HB3  . ASP A 1 67 ? -12.671 -1.294  -14.680 1.00 0.00 ? 67  ASP A HB3  2  
ATOM   2357  N  N    . SER A 1 68 ? -14.211 -1.693  -11.765 1.00 0.00 ? 68  SER A N    2  
ATOM   2358  C  CA   . SER A 1 68 ? -15.504 -1.532  -11.085 1.00 0.00 ? 68  SER A CA   2  
ATOM   2359  C  C    . SER A 1 68 ? -15.382 -1.403  -9.544  1.00 0.00 ? 68  SER A C    2  
ATOM   2360  O  O    . SER A 1 68 ? -16.360 -1.042  -8.889  1.00 0.00 ? 68  SER A O    2  
ATOM   2361  C  CB   . SER A 1 68 ? -16.397 -2.745  -11.453 1.00 0.00 ? 68  SER A CB   2  
ATOM   2362  O  OG   . SER A 1 68 ? -17.704 -2.646  -10.902 1.00 0.00 ? 68  SER A OG   2  
ATOM   2363  H  H    . SER A 1 68 ? -14.081 -2.507  -12.276 1.00 0.00 ? 68  SER A H    2  
ATOM   2364  H  HA   . SER A 1 68 ? -15.968 -0.629  -11.471 1.00 0.00 ? 68  SER A HA   2  
ATOM   2365  H  HB2  . SER A 1 68 ? -16.491 -2.817  -12.530 1.00 0.00 ? 68  SER A HB2  2  
ATOM   2366  H  HB3  . SER A 1 68 ? -15.934 -3.650  -11.080 1.00 0.00 ? 68  SER A HB3  2  
ATOM   2367  H  HG   . SER A 1 68 ? -17.831 -3.360  -10.260 1.00 0.00 ? 68  SER A HG   2  
ATOM   2368  N  N    . PHE A 1 69 ? -14.196 -1.731  -8.979  1.00 0.00 ? 69  PHE A N    2  
ATOM   2369  C  CA   . PHE A 1 69 ? -13.918 -1.570  -7.532  1.00 0.00 ? 69  PHE A CA   2  
ATOM   2370  C  C    . PHE A 1 69 ? -14.116 -0.116  -7.089  1.00 0.00 ? 69  PHE A C    2  
ATOM   2371  O  O    . PHE A 1 69 ? -14.810 0.145   -6.092  1.00 0.00 ? 69  PHE A O    2  
ATOM   2372  C  CB   . PHE A 1 69 ? -12.462 -1.994  -7.189  1.00 0.00 ? 69  PHE A CB   2  
ATOM   2373  C  CG   . PHE A 1 69 ? -12.225 -3.497  -7.188  1.00 0.00 ? 69  PHE A CG   2  
ATOM   2374  C  CD1  . PHE A 1 69 ? -12.730 -4.290  -6.158  1.00 0.00 ? 69  PHE A CD1  2  
ATOM   2375  C  CD2  . PHE A 1 69 ? -11.497 -4.118  -8.202  1.00 0.00 ? 69  PHE A CD2  2  
ATOM   2376  C  CE1  . PHE A 1 69 ? -12.516 -5.652  -6.140  1.00 0.00 ? 69  PHE A CE1  2  
ATOM   2377  C  CE2  . PHE A 1 69 ? -11.282 -5.482  -8.179  1.00 0.00 ? 69  PHE A CE2  2  
ATOM   2378  C  CZ   . PHE A 1 69 ? -11.793 -6.246  -7.147  1.00 0.00 ? 69  PHE A CZ   2  
ATOM   2379  H  H    . PHE A 1 69 ? -13.494 -2.095  -9.551  1.00 0.00 ? 69  PHE A H    2  
ATOM   2380  H  HA   . PHE A 1 69 ? -14.606 -2.204  -6.985  1.00 0.00 ? 69  PHE A HA   2  
ATOM   2381  H  HB2  . PHE A 1 69 ? -11.782 -1.545  -7.906  1.00 0.00 ? 69  PHE A HB2  2  
ATOM   2382  H  HB3  . PHE A 1 69 ? -12.203 -1.623  -6.198  1.00 0.00 ? 69  PHE A HB3  2  
ATOM   2383  H  HD1  . PHE A 1 69 ? -13.302 -3.829  -5.362  1.00 0.00 ? 69  PHE A HD1  2  
ATOM   2384  H  HD2  . PHE A 1 69 ? -11.096 -3.524  -9.016  1.00 0.00 ? 69  PHE A HD2  2  
ATOM   2385  H  HE1  . PHE A 1 69 ? -12.915 -6.253  -5.332  1.00 0.00 ? 69  PHE A HE1  2  
ATOM   2386  H  HE2  . PHE A 1 69 ? -10.715 -5.956  -8.968  1.00 0.00 ? 69  PHE A HE2  2  
ATOM   2387  H  HZ   . PHE A 1 69 ? -11.626 -7.317  -7.131  1.00 0.00 ? 69  PHE A HZ   2  
ATOM   2388  N  N    . TYR A 1 70 ? -13.560 0.804   -7.905  1.00 0.00 ? 70  TYR A N    2  
ATOM   2389  C  CA   . TYR A 1 70 ? -13.435 2.235   -7.574  1.00 0.00 ? 70  TYR A CA   2  
ATOM   2390  C  C    . TYR A 1 70 ? -13.024 2.424   -6.102  1.00 0.00 ? 70  TYR A C    2  
ATOM   2391  O  O    . TYR A 1 70 ? -13.828 2.844   -5.263  1.00 0.00 ? 70  TYR A O    2  
ATOM   2392  C  CB   . TYR A 1 70 ? -14.724 3.011   -7.946  1.00 0.00 ? 70  TYR A CB   2  
ATOM   2393  C  CG   . TYR A 1 70 ? -15.050 2.979   -9.451  1.00 0.00 ? 70  TYR A CG   2  
ATOM   2394  C  CD1  . TYR A 1 70 ? -14.188 3.568   -10.380 1.00 0.00 ? 70  TYR A CD1  2  
ATOM   2395  C  CD2  . TYR A 1 70 ? -16.196 2.348   -9.942  1.00 0.00 ? 70  TYR A CD2  2  
ATOM   2396  C  CE1  . TYR A 1 70 ? -14.461 3.541   -11.730 1.00 0.00 ? 70  TYR A CE1  2  
ATOM   2397  C  CE2  . TYR A 1 70 ? -16.472 2.318   -11.297 1.00 0.00 ? 70  TYR A CE2  2  
ATOM   2398  C  CZ   . TYR A 1 70 ? -15.597 2.915   -12.187 1.00 0.00 ? 70  TYR A CZ   2  
ATOM   2399  O  OH   . TYR A 1 70 ? -15.864 2.893   -13.541 1.00 0.00 ? 70  TYR A OH   2  
ATOM   2400  H  H    . TYR A 1 70 ? -13.234 0.506   -8.782  1.00 0.00 ? 70  TYR A H    2  
ATOM   2401  H  HA   . TYR A 1 70 ? -12.626 2.617   -8.187  1.00 0.00 ? 70  TYR A HA   2  
ATOM   2402  H  HB2  . TYR A 1 70 ? -15.565 2.587   -7.404  1.00 0.00 ? 70  TYR A HB2  2  
ATOM   2403  H  HB3  . TYR A 1 70 ? -14.611 4.046   -7.656  1.00 0.00 ? 70  TYR A HB3  2  
ATOM   2404  H  HD1  . TYR A 1 70 ? -13.291 4.065   -10.029 1.00 0.00 ? 70  TYR A HD1  2  
ATOM   2405  H  HD2  . TYR A 1 70 ? -16.882 1.884   -9.246  1.00 0.00 ? 70  TYR A HD2  2  
ATOM   2406  H  HE1  . TYR A 1 70 ? -13.777 4.008   -12.429 1.00 0.00 ? 70  TYR A HE1  2  
ATOM   2407  H  HE2  . TYR A 1 70 ? -17.364 1.823   -11.659 1.00 0.00 ? 70  TYR A HE2  2  
ATOM   2408  H  HH   . TYR A 1 70 ? -15.077 2.585   -14.011 1.00 0.00 ? 70  TYR A HH   2  
ATOM   2409  N  N    . GLN A 1 71 ? -11.766 2.049   -5.813  1.00 0.00 ? 71  GLN A N    2  
ATOM   2410  C  CA   . GLN A 1 71 ? -11.247 1.876   -4.438  1.00 0.00 ? 71  GLN A CA   2  
ATOM   2411  C  C    . GLN A 1 71 ? -11.353 3.173   -3.616  1.00 0.00 ? 71  GLN A C    2  
ATOM   2412  O  O    . GLN A 1 71 ? -11.641 3.142   -2.415  1.00 0.00 ? 71  GLN A O    2  
ATOM   2413  C  CB   . GLN A 1 71 ? -9.778  1.370   -4.504  1.00 0.00 ? 71  GLN A CB   2  
ATOM   2414  C  CG   . GLN A 1 71 ? -9.126  1.081   -3.136  1.00 0.00 ? 71  GLN A CG   2  
ATOM   2415  C  CD   . GLN A 1 71 ? -7.739  0.447   -3.260  1.00 0.00 ? 71  GLN A CD   2  
ATOM   2416  O  OE1  . GLN A 1 71 ? -7.602  -0.775  -3.270  1.00 0.00 ? 71  GLN A OE1  2  
ATOM   2417  N  NE2  . GLN A 1 71 ? -6.708  1.268   -3.402  1.00 0.00 ? 71  GLN A NE2  2  
ATOM   2418  H  H    . GLN A 1 71 ? -11.157 1.893   -6.558  1.00 0.00 ? 71  GLN A H    2  
ATOM   2419  H  HA   . GLN A 1 71 ? -11.854 1.110   -3.963  1.00 0.00 ? 71  GLN A HA   2  
ATOM   2420  H  HB2  . GLN A 1 71 ? -9.759  0.453   -5.088  1.00 0.00 ? 71  GLN A HB2  2  
ATOM   2421  H  HB3  . GLN A 1 71 ? -9.177  2.112   -5.019  1.00 0.00 ? 71  GLN A HB3  2  
ATOM   2422  H  HG2  . GLN A 1 71 ? -9.034  2.016   -2.588  1.00 0.00 ? 71  GLN A HG2  2  
ATOM   2423  H  HG3  . GLN A 1 71 ? -9.772  0.409   -2.579  1.00 0.00 ? 71  GLN A HG3  2  
ATOM   2424  H  HE21 . GLN A 1 71 ? -6.878  2.232   -3.429  1.00 0.00 ? 71  GLN A HE21 2  
ATOM   2425  H  HE22 . GLN A 1 71 ? -5.814  0.874   -3.470  1.00 0.00 ? 71  GLN A HE22 2  
ATOM   2426  N  N    . PHE A 1 72 ? -11.141 4.304   -4.291  1.00 0.00 ? 72  PHE A N    2  
ATOM   2427  C  CA   . PHE A 1 72 ? -11.265 5.647   -3.718  1.00 0.00 ? 72  PHE A CA   2  
ATOM   2428  C  C    . PHE A 1 72 ? -12.331 6.437   -4.482  1.00 0.00 ? 72  PHE A C    2  
ATOM   2429  O  O    . PHE A 1 72 ? -12.714 6.089   -5.608  1.00 0.00 ? 72  PHE A O    2  
ATOM   2430  C  CB   . PHE A 1 72 ? -9.898  6.393   -3.751  1.00 0.00 ? 72  PHE A CB   2  
ATOM   2431  C  CG   . PHE A 1 72 ? -8.919  5.927   -2.679  1.00 0.00 ? 72  PHE A CG   2  
ATOM   2432  C  CD1  . PHE A 1 72 ? -8.234  4.723   -2.806  1.00 0.00 ? 72  PHE A CD1  2  
ATOM   2433  C  CD2  . PHE A 1 72 ? -8.698  6.689   -1.529  1.00 0.00 ? 72  PHE A CD2  2  
ATOM   2434  C  CE1  . PHE A 1 72 ? -7.361  4.294   -1.829  1.00 0.00 ? 72  PHE A CE1  2  
ATOM   2435  C  CE2  . PHE A 1 72 ? -7.825  6.258   -0.557  1.00 0.00 ? 72  PHE A CE2  2  
ATOM   2436  C  CZ   . PHE A 1 72 ? -7.158  5.060   -0.706  1.00 0.00 ? 72  PHE A CZ   2  
ATOM   2437  H  H    . PHE A 1 72 ? -10.908 4.243   -5.230  1.00 0.00 ? 72  PHE A H    2  
ATOM   2438  H  HA   . PHE A 1 72 ? -11.593 5.555   -2.686  1.00 0.00 ? 72  PHE A HA   2  
ATOM   2439  H  HB2  . PHE A 1 72 ? -9.428  6.246   -4.720  1.00 0.00 ? 72  PHE A HB2  2  
ATOM   2440  H  HB3  . PHE A 1 72 ? -10.069 7.458   -3.617  1.00 0.00 ? 72  PHE A HB3  2  
ATOM   2441  H  HD1  . PHE A 1 72 ? -8.389  4.111   -3.691  1.00 0.00 ? 72  PHE A HD1  2  
ATOM   2442  H  HD2  . PHE A 1 72 ? -9.219  7.630   -1.401  1.00 0.00 ? 72  PHE A HD2  2  
ATOM   2443  H  HE1  . PHE A 1 72 ? -6.837  3.351   -1.947  1.00 0.00 ? 72  PHE A HE1  2  
ATOM   2444  H  HE2  . PHE A 1 72 ? -7.661  6.860   0.328   1.00 0.00 ? 72  PHE A HE2  2  
ATOM   2445  H  HZ   . PHE A 1 72 ? -6.471  4.725   0.061   1.00 0.00 ? 72  PHE A HZ   2  
ATOM   2446  N  N    . SER A 1 73 ? -12.816 7.479   -3.827  1.00 0.00 ? 73  SER A N    2  
ATOM   2447  C  CA   . SER A 1 73 ? -13.813 8.401   -4.345  1.00 0.00 ? 73  SER A CA   2  
ATOM   2448  C  C    . SER A 1 73 ? -13.525 9.807   -3.826  1.00 0.00 ? 73  SER A C    2  
ATOM   2449  O  O    . SER A 1 73 ? -12.735 10.002  -2.898  1.00 0.00 ? 73  SER A O    2  
ATOM   2450  C  CB   . SER A 1 73 ? -15.217 7.915   -3.925  1.00 0.00 ? 73  SER A CB   2  
ATOM   2451  O  OG   . SER A 1 73 ? -15.259 7.597   -2.539  1.00 0.00 ? 73  SER A OG   2  
ATOM   2452  H  H    . SER A 1 73 ? -12.511 7.612   -2.919  1.00 0.00 ? 73  SER A H    2  
ATOM   2453  H  HA   . SER A 1 73 ? -13.748 8.417   -5.425  1.00 0.00 ? 73  SER A HA   2  
ATOM   2454  H  HB2  . SER A 1 73 ? -15.954 8.678   -4.125  1.00 0.00 ? 73  SER A HB2  2  
ATOM   2455  H  HB3  . SER A 1 73 ? -15.466 7.020   -4.485  1.00 0.00 ? 73  SER A HB3  2  
ATOM   2456  H  HG   . SER A 1 73 ? -15.412 6.650   -2.438  1.00 0.00 ? 73  SER A HG   2  
ATOM   2457  N  N    . CYS A 1 74 ? -14.168 10.785  -4.456  1.00 0.00 ? 74  CYS A N    2  
ATOM   2458  C  CA   . CYS A 1 74 ? -14.099 12.188  -4.062  1.00 0.00 ? 74  CYS A CA   2  
ATOM   2459  C  C    . CYS A 1 74 ? -15.463 12.543  -3.484  1.00 0.00 ? 74  CYS A C    2  
ATOM   2460  O  O    . CYS A 1 74 ? -16.453 12.494  -4.202  1.00 0.00 ? 74  CYS A O    2  
ATOM   2461  C  CB   . CYS A 1 74 ? -13.759 13.068  -5.285  1.00 0.00 ? 74  CYS A CB   2  
ATOM   2462  S  SG   . CYS A 1 74 ? -13.950 14.850  -4.992  1.00 0.00 ? 74  CYS A SG   2  
ATOM   2463  H  H    . CYS A 1 74 ? -14.757 10.550  -5.195  1.00 0.00 ? 74  CYS A H    2  
ATOM   2464  H  HA   . CYS A 1 74 ? -13.330 12.318  -3.298  1.00 0.00 ? 74  CYS A HA   2  
ATOM   2465  H  HB2  . CYS A 1 74 ? -12.727 12.893  -5.570  1.00 0.00 ? 74  CYS A HB2  2  
ATOM   2466  H  HB3  . CYS A 1 74 ? -14.404 12.798  -6.109  1.00 0.00 ? 74  CYS A HB3  2  
ATOM   2467  N  N    . ASN A 1 75 ? -15.529 12.873  -2.186  1.00 0.00 ? 75  ASN A N    2  
ATOM   2468  C  CA   . ASN A 1 75 ? -16.815 13.147  -1.506  1.00 0.00 ? 75  ASN A CA   2  
ATOM   2469  C  C    . ASN A 1 75 ? -17.483 14.450  -2.028  1.00 0.00 ? 75  ASN A C    2  
ATOM   2470  O  O    . ASN A 1 75 ? -18.677 14.675  -1.815  1.00 0.00 ? 75  ASN A O    2  
ATOM   2471  C  CB   . ASN A 1 75 ? -16.603 13.196  0.034   1.00 0.00 ? 75  ASN A CB   2  
ATOM   2472  C  CG   . ASN A 1 75 ? -17.909 13.141  0.854   1.00 0.00 ? 75  ASN A CG   2  
ATOM   2473  O  OD1  . ASN A 1 75 ? -18.043 13.809  1.887   1.00 0.00 ? 75  ASN A OD1  2  
ATOM   2474  N  ND2  . ASN A 1 75 ? -18.863 12.312  0.439   1.00 0.00 ? 75  ASN A ND2  2  
ATOM   2475  H  H    . ASN A 1 75 ? -14.696 12.908  -1.664  1.00 0.00 ? 75  ASN A H    2  
ATOM   2476  H  HA   . ASN A 1 75 ? -17.478 12.320  -1.732  1.00 0.00 ? 75  ASN A HA   2  
ATOM   2477  H  HB2  . ASN A 1 75 ? -15.999 12.350  0.331   1.00 0.00 ? 75  ASN A HB2  2  
ATOM   2478  H  HB3  . ASN A 1 75 ? -16.073 14.107  0.290   1.00 0.00 ? 75  ASN A HB3  2  
ATOM   2479  H  HD21 . ASN A 1 75 ? -18.702 11.778  -0.366  1.00 0.00 ? 75  ASN A HD21 2  
ATOM   2480  H  HD22 . ASN A 1 75 ? -19.695 12.265  0.957   1.00 0.00 ? 75  ASN A HD22 2  
ATOM   2481  N  N    . ILE A 1 76 ? -16.700 15.280  -2.756  1.00 0.00 ? 76  ILE A N    2  
ATOM   2482  C  CA   . ILE A 1 76 ? -17.137 16.607  -3.221  1.00 0.00 ? 76  ILE A CA   2  
ATOM   2483  C  C    . ILE A 1 76 ? -17.811 16.543  -4.619  1.00 0.00 ? 76  ILE A C    2  
ATOM   2484  O  O    . ILE A 1 76 ? -18.785 17.255  -4.858  1.00 0.00 ? 76  ILE A O    2  
ATOM   2485  C  CB   . ILE A 1 76 ? -15.934 17.639  -3.240  1.00 0.00 ? 76  ILE A CB   2  
ATOM   2486  C  CG1  . ILE A 1 76 ? -15.006 17.422  -1.993  1.00 0.00 ? 76  ILE A CG1  2  
ATOM   2487  C  CG2  . ILE A 1 76 ? -16.457 19.096  -3.304  1.00 0.00 ? 76  ILE A CG2  2  
ATOM   2488  C  CD1  . ILE A 1 76 ? -13.977 18.505  -1.706  1.00 0.00 ? 76  ILE A CD1  2  
ATOM   2489  H  H    . ILE A 1 76 ? -15.798 14.995  -2.968  1.00 0.00 ? 76  ILE A H    2  
ATOM   2490  H  HA   . ILE A 1 76 ? -17.879 16.977  -2.508  1.00 0.00 ? 76  ILE A HA   2  
ATOM   2491  H  HB   . ILE A 1 76 ? -15.351 17.462  -4.142  1.00 0.00 ? 76  ILE A HB   2  
ATOM   2492  H  HG12 . ILE A 1 76 ? -15.617 17.332  -1.109  1.00 0.00 ? 76  ILE A HG12 2  
ATOM   2493  H  HG13 . ILE A 1 76 ? -14.452 16.497  -2.136  1.00 0.00 ? 76  ILE A HG13 2  
ATOM   2494  H  HG21 . ILE A 1 76 ? -17.079 19.226  -4.177  1.00 0.00 ? 76  ILE A HG21 2  
ATOM   2495  H  HG22 . ILE A 1 76 ? -15.618 19.782  -3.361  1.00 0.00 ? 76  ILE A HG22 2  
ATOM   2496  H  HG23 . ILE A 1 76 ? -17.035 19.315  -2.416  1.00 0.00 ? 76  ILE A HG23 2  
ATOM   2497  H  HD11 . ILE A 1 76 ? -14.477 19.451  -1.547  1.00 0.00 ? 76  ILE A HD11 2  
ATOM   2498  H  HD12 . ILE A 1 76 ? -13.292 18.594  -2.534  1.00 0.00 ? 76  ILE A HD12 2  
ATOM   2499  H  HD13 . ILE A 1 76 ? -13.424 18.243  -0.814  1.00 0.00 ? 76  ILE A HD13 2  
ATOM   2500  N  N    . CYS A 1 77 ? -17.298 15.697  -5.556  1.00 0.00 ? 77  CYS A N    2  
ATOM   2501  C  CA   . CYS A 1 77 ? -17.896 15.613  -6.924  1.00 0.00 ? 77  CYS A CA   2  
ATOM   2502  C  C    . CYS A 1 77 ? -18.015 14.171  -7.446  1.00 0.00 ? 77  CYS A C    2  
ATOM   2503  O  O    . CYS A 1 77 ? -18.511 13.963  -8.557  1.00 0.00 ? 77  CYS A O    2  
ATOM   2504  C  CB   . CYS A 1 77 ? -17.112 16.496  -7.926  1.00 0.00 ? 77  CYS A CB   2  
ATOM   2505  S  SG   . CYS A 1 77 ? -15.459 15.884  -8.385  1.00 0.00 ? 77  CYS A SG   2  
ATOM   2506  H  H    . CYS A 1 77 ? -16.518 15.143  -5.335  1.00 0.00 ? 77  CYS A H    2  
ATOM   2507  H  HA   . CYS A 1 77 ? -18.909 16.001  -6.856  1.00 0.00 ? 77  CYS A HA   2  
ATOM   2508  H  HB2  . CYS A 1 77 ? -17.689 16.582  -8.837  1.00 0.00 ? 77  CYS A HB2  2  
ATOM   2509  H  HB3  . CYS A 1 77 ? -16.993 17.484  -7.501  1.00 0.00 ? 77  CYS A HB3  2  
ATOM   2510  N  N    . GLY A 1 78 ? -17.548 13.186  -6.651  1.00 0.00 ? 78  GLY A N    2  
ATOM   2511  C  CA   . GLY A 1 78 ? -17.731 11.772  -6.962  1.00 0.00 ? 78  GLY A CA   2  
ATOM   2512  C  C    . GLY A 1 78 ? -16.985 11.315  -8.192  1.00 0.00 ? 78  GLY A C    2  
ATOM   2513  O  O    . GLY A 1 78 ? -17.513 10.534  -8.980  1.00 0.00 ? 78  GLY A O    2  
ATOM   2514  H  H    . GLY A 1 78 ? -17.071 13.421  -5.839  1.00 0.00 ? 78  GLY A H    2  
ATOM   2515  H  HA2  . GLY A 1 78 ? -17.377 11.198  -6.120  1.00 0.00 ? 78  GLY A HA2  2  
ATOM   2516  H  HA3  . GLY A 1 78 ? -18.788 11.574  -7.087  1.00 0.00 ? 78  GLY A HA3  2  
ATOM   2517  N  N    . LYS A 1 79 ? -15.759 11.832  -8.371  1.00 0.00 ? 79  LYS A N    2  
ATOM   2518  C  CA   . LYS A 1 79 ? -14.925 11.518  -9.532  1.00 0.00 ? 79  LYS A CA   2  
ATOM   2519  C  C    . LYS A 1 79 ? -14.498 10.016  -9.546  1.00 0.00 ? 79  LYS A C    2  
ATOM   2520  O  O    . LYS A 1 79 ? -14.487 9.397   -10.611 1.00 0.00 ? 79  LYS A O    2  
ATOM   2521  C  CB   . LYS A 1 79 ? -13.695 12.481  -9.513  1.00 0.00 ? 79  LYS A CB   2  
ATOM   2522  C  CG   . LYS A 1 79 ? -13.319 13.122  -10.875 1.00 0.00 ? 79  LYS A CG   2  
ATOM   2523  C  CD   . LYS A 1 79 ? -13.048 12.100  -12.007 1.00 0.00 ? 79  LYS A CD   2  
ATOM   2524  C  CE   . LYS A 1 79 ? -11.816 11.205  -11.751 1.00 0.00 ? 79  LYS A CE   2  
ATOM   2525  N  NZ   . LYS A 1 79 ? -11.746 10.083  -12.711 1.00 0.00 ? 79  LYS A NZ   2  
ATOM   2526  H  H    . LYS A 1 79 ? -15.435 12.525  -7.761  1.00 0.00 ? 79  LYS A H    2  
ATOM   2527  H  HA   . LYS A 1 79 ? -15.508 11.720  -10.422 1.00 0.00 ? 79  LYS A HA   2  
ATOM   2528  H  HB2  . LYS A 1 79 ? -13.895 13.295  -8.823  1.00 0.00 ? 79  LYS A HB2  2  
ATOM   2529  H  HB3  . LYS A 1 79 ? -12.841 11.947  -9.136  1.00 0.00 ? 79  LYS A HB3  2  
ATOM   2530  H  HG2  . LYS A 1 79 ? -14.139 13.759  -11.186 1.00 0.00 ? 79  LYS A HG2  2  
ATOM   2531  H  HG3  . LYS A 1 79 ? -12.440 13.733  -10.733 1.00 0.00 ? 79  LYS A HG3  2  
ATOM   2532  H  HD2  . LYS A 1 79 ? -13.922 11.463  -12.116 1.00 0.00 ? 79  LYS A HD2  2  
ATOM   2533  H  HD3  . LYS A 1 79 ? -12.899 12.645  -12.939 1.00 0.00 ? 79  LYS A HD3  2  
ATOM   2534  H  HE2  . LYS A 1 79 ? -10.919 11.802  -11.846 1.00 0.00 ? 79  LYS A HE2  2  
ATOM   2535  H  HE3  . LYS A 1 79 ? -11.869 10.799  -10.746 1.00 0.00 ? 79  LYS A HE3  2  
ATOM   2536  H  HZ1  . LYS A 1 79 ? -10.883 9.525   -12.550 1.00 0.00 ? 79  LYS A HZ1  2  
ATOM   2537  H  HZ2  . LYS A 1 79 ? -11.731 10.448  -13.686 1.00 0.00 ? 79  LYS A HZ2  2  
ATOM   2538  H  HZ3  . LYS A 1 79 ? -12.569 9.461   -12.598 1.00 0.00 ? 79  LYS A HZ3  2  
ATOM   2539  N  N    . LYS A 1 80 ? -14.153 9.475   -8.348  1.00 0.00 ? 80  LYS A N    2  
ATOM   2540  C  CA   . LYS A 1 80 ? -13.666 8.089   -8.151  1.00 0.00 ? 80  LYS A CA   2  
ATOM   2541  C  C    . LYS A 1 80 ? -12.230 7.928   -8.679  1.00 0.00 ? 80  LYS A C    2  
ATOM   2542  O  O    . LYS A 1 80 ? -11.967 8.105   -9.872  1.00 0.00 ? 80  LYS A O    2  
ATOM   2543  C  CB   . LYS A 1 80 ? -14.613 6.982   -8.738  1.00 0.00 ? 80  LYS A CB   2  
ATOM   2544  C  CG   . LYS A 1 80 ? -15.787 6.549   -7.826  1.00 0.00 ? 80  LYS A CG   2  
ATOM   2545  C  CD   . LYS A 1 80 ? -16.878 7.617   -7.647  1.00 0.00 ? 80  LYS A CD   2  
ATOM   2546  C  CE   . LYS A 1 80 ? -18.005 7.148   -6.717  1.00 0.00 ? 80  LYS A CE   2  
ATOM   2547  N  NZ   . LYS A 1 80 ? -19.096 8.146   -6.624  1.00 0.00 ? 80  LYS A NZ   2  
ATOM   2548  H  H    . LYS A 1 80 ? -14.198 10.041  -7.561  1.00 0.00 ? 80  LYS A H    2  
ATOM   2549  H  HA   . LYS A 1 80 ? -13.630 7.958   -7.077  1.00 0.00 ? 80  LYS A HA   2  
ATOM   2550  H  HB2  . LYS A 1 80 ? -15.026 7.341   -9.672  1.00 0.00 ? 80  LYS A HB2  2  
ATOM   2551  H  HB3  . LYS A 1 80 ? -14.027 6.091   -8.957  1.00 0.00 ? 80  LYS A HB3  2  
ATOM   2552  H  HG2  . LYS A 1 80 ? -16.246 5.665   -8.257  1.00 0.00 ? 80  LYS A HG2  2  
ATOM   2553  H  HG3  . LYS A 1 80 ? -15.383 6.291   -6.850  1.00 0.00 ? 80  LYS A HG3  2  
ATOM   2554  H  HD2  . LYS A 1 80 ? -16.434 8.518   -7.231  1.00 0.00 ? 80  LYS A HD2  2  
ATOM   2555  H  HD3  . LYS A 1 80 ? -17.302 7.851   -8.619  1.00 0.00 ? 80  LYS A HD3  2  
ATOM   2556  H  HE2  . LYS A 1 80 ? -18.420 6.222   -7.099  1.00 0.00 ? 80  LYS A HE2  2  
ATOM   2557  H  HE3  . LYS A 1 80 ? -17.604 6.975   -5.724  1.00 0.00 ? 80  LYS A HE3  2  
ATOM   2558  H  HZ1  . LYS A 1 80 ? -19.833 7.809   -5.972  1.00 0.00 ? 80  LYS A HZ1  2  
ATOM   2559  H  HZ2  . LYS A 1 80 ? -19.525 8.294   -7.561  1.00 0.00 ? 80  LYS A HZ2  2  
ATOM   2560  H  HZ3  . LYS A 1 80 ? -18.725 9.049   -6.270  1.00 0.00 ? 80  LYS A HZ3  2  
ATOM   2561  N  N    . PHE A 1 81 ? -11.308 7.616   -7.752  1.00 0.00 ? 81  PHE A N    2  
ATOM   2562  C  CA   . PHE A 1 81 ? -9.869  7.456   -8.044  1.00 0.00 ? 81  PHE A CA   2  
ATOM   2563  C  C    . PHE A 1 81 ? -9.358  6.090   -7.576  1.00 0.00 ? 81  PHE A C    2  
ATOM   2564  O  O    . PHE A 1 81 ? -10.019 5.395   -6.813  1.00 0.00 ? 81  PHE A O    2  
ATOM   2565  C  CB   . PHE A 1 81 ? -9.065  8.572   -7.350  1.00 0.00 ? 81  PHE A CB   2  
ATOM   2566  C  CG   . PHE A 1 81 ? -9.458  9.975   -7.793  1.00 0.00 ? 81  PHE A CG   2  
ATOM   2567  C  CD1  . PHE A 1 81 ? -8.838  10.563  -8.890  1.00 0.00 ? 81  PHE A CD1  2  
ATOM   2568  C  CD2  . PHE A 1 81 ? -10.451 10.695  -7.130  1.00 0.00 ? 81  PHE A CD2  2  
ATOM   2569  C  CE1  . PHE A 1 81 ? -9.179  11.824  -9.299  1.00 0.00 ? 81  PHE A CE1  2  
ATOM   2570  C  CE2  . PHE A 1 81 ? -10.790 11.956  -7.544  1.00 0.00 ? 81  PHE A CE2  2  
ATOM   2571  C  CZ   . PHE A 1 81 ? -10.156 12.516  -8.631  1.00 0.00 ? 81  PHE A CZ   2  
ATOM   2572  H  H    . PHE A 1 81 ? -11.611 7.499   -6.824  1.00 0.00 ? 81  PHE A H    2  
ATOM   2573  H  HA   . PHE A 1 81 ? -9.722  7.531   -9.121  1.00 0.00 ? 81  PHE A HA   2  
ATOM   2574  H  HB2  . PHE A 1 81 ? -9.204  8.500   -6.276  1.00 0.00 ? 81  PHE A HB2  2  
ATOM   2575  H  HB3  . PHE A 1 81 ? -8.010  8.440   -7.567  1.00 0.00 ? 81  PHE A HB3  2  
ATOM   2576  H  HD1  . PHE A 1 81 ? -8.063  10.018  -9.418  1.00 0.00 ? 81  PHE A HD1  2  
ATOM   2577  H  HD2  . PHE A 1 81 ? -10.964 10.254  -6.281  1.00 0.00 ? 81  PHE A HD2  2  
ATOM   2578  H  HE1  . PHE A 1 81 ? -8.685  12.270  -10.152 1.00 0.00 ? 81  PHE A HE1  2  
ATOM   2579  H  HE2  . PHE A 1 81 ? -11.558 12.511  -7.020  1.00 0.00 ? 81  PHE A HE2  2  
ATOM   2580  H  HZ   . PHE A 1 81 ? -10.426 13.512  -8.959  1.00 0.00 ? 81  PHE A HZ   2  
ATOM   2581  N  N    . GLU A 1 82 ? -8.183  5.710   -8.085  1.00 0.00 ? 82  GLU A N    2  
ATOM   2582  C  CA   . GLU A 1 82 ? -7.490  4.474   -7.702  1.00 0.00 ? 82  GLU A CA   2  
ATOM   2583  C  C    . GLU A 1 82 ? -6.860  4.564   -6.297  1.00 0.00 ? 82  GLU A C    2  
ATOM   2584  O  O    . GLU A 1 82 ? -6.992  3.634   -5.493  1.00 0.00 ? 82  GLU A O    2  
ATOM   2585  C  CB   . GLU A 1 82 ? -6.399  4.190   -8.762  1.00 0.00 ? 82  GLU A CB   2  
ATOM   2586  C  CG   . GLU A 1 82 ? -5.561  2.923   -8.534  1.00 0.00 ? 82  GLU A CG   2  
ATOM   2587  C  CD   . GLU A 1 82 ? -4.399  2.809   -9.530  1.00 0.00 ? 82  GLU A CD   2  
ATOM   2588  O  OE1  . GLU A 1 82 ? -3.326  3.365   -9.243  1.00 0.00 ? 82  GLU A OE1  2  
ATOM   2589  O  OE2  . GLU A 1 82 ? -4.568  2.201   -10.612 1.00 0.00 ? 82  GLU A OE2  2  
ATOM   2590  H  H    . GLU A 1 82 ? -7.791  6.244   -8.807  1.00 0.00 ? 82  GLU A H    2  
ATOM   2591  H  HA   . GLU A 1 82 ? -8.212  3.668   -7.718  1.00 0.00 ? 82  GLU A HA   2  
ATOM   2592  H  HB2  . GLU A 1 82 ? -6.875  4.102   -9.737  1.00 0.00 ? 82  GLU A HB2  2  
ATOM   2593  H  HB3  . GLU A 1 82 ? -5.726  5.042   -8.795  1.00 0.00 ? 82  GLU A HB3  2  
ATOM   2594  H  HG2  . GLU A 1 82 ? -5.161  2.943   -7.522  1.00 0.00 ? 82  GLU A HG2  2  
ATOM   2595  H  HG3  . GLU A 1 82 ? -6.203  2.056   -8.639  1.00 0.00 ? 82  GLU A HG3  2  
ATOM   2596  N  N    . LYS A 1 83 ? -6.186  5.697   -6.009  1.00 0.00 ? 83  LYS A N    2  
ATOM   2597  C  CA   . LYS A 1 83 ? -5.315  5.827   -4.829  1.00 0.00 ? 83  LYS A CA   2  
ATOM   2598  C  C    . LYS A 1 83 ? -5.351  7.252   -4.246  1.00 0.00 ? 83  LYS A C    2  
ATOM   2599  O  O    . LYS A 1 83 ? -5.776  8.195   -4.922  1.00 0.00 ? 83  LYS A O    2  
ATOM   2600  C  CB   . LYS A 1 83 ? -3.862  5.403   -5.207  1.00 0.00 ? 83  LYS A CB   2  
ATOM   2601  C  CG   . LYS A 1 83 ? -3.287  6.087   -6.472  1.00 0.00 ? 83  LYS A CG   2  
ATOM   2602  C  CD   . LYS A 1 83 ? -1.827  5.661   -6.754  1.00 0.00 ? 83  LYS A CD   2  
ATOM   2603  C  CE   . LYS A 1 83 ? -1.249  6.289   -8.035  1.00 0.00 ? 83  LYS A CE   2  
ATOM   2604  N  NZ   . LYS A 1 83 ? -1.812  5.676   -9.269  1.00 0.00 ? 83  LYS A NZ   2  
ATOM   2605  H  H    . LYS A 1 83 ? -6.276  6.466   -6.608  1.00 0.00 ? 83  LYS A H    2  
ATOM   2606  H  HA   . LYS A 1 83 ? -5.687  5.146   -4.065  1.00 0.00 ? 83  LYS A HA   2  
ATOM   2607  H  HB2  . LYS A 1 83 ? -3.207  5.623   -4.371  1.00 0.00 ? 83  LYS A HB2  2  
ATOM   2608  H  HB3  . LYS A 1 83 ? -3.852  4.331   -5.375  1.00 0.00 ? 83  LYS A HB3  2  
ATOM   2609  H  HG2  . LYS A 1 83 ? -3.902  5.816   -7.324  1.00 0.00 ? 83  LYS A HG2  2  
ATOM   2610  H  HG3  . LYS A 1 83 ? -3.323  7.166   -6.337  1.00 0.00 ? 83  LYS A HG3  2  
ATOM   2611  H  HD2  . LYS A 1 83 ? -1.209  5.958   -5.914  1.00 0.00 ? 83  LYS A HD2  2  
ATOM   2612  H  HD3  . LYS A 1 83 ? -1.793  4.580   -6.849  1.00 0.00 ? 83  LYS A HD3  2  
ATOM   2613  H  HE2  . LYS A 1 83 ? -1.465  7.349   -8.047  1.00 0.00 ? 83  LYS A HE2  2  
ATOM   2614  H  HE3  . LYS A 1 83 ? -0.175  6.148   -8.040  1.00 0.00 ? 83  LYS A HE3  2  
ATOM   2615  H  HZ1  . LYS A 1 83 ? -1.437  6.149   -10.112 1.00 0.00 ? 83  LYS A HZ1  2  
ATOM   2616  H  HZ2  . LYS A 1 83 ? -2.847  5.754   -9.270  1.00 0.00 ? 83  LYS A HZ2  2  
ATOM   2617  H  HZ3  . LYS A 1 83 ? -1.561  4.666   -9.318  1.00 0.00 ? 83  LYS A HZ3  2  
ATOM   2618  N  N    . LYS A 1 84 ? -4.872  7.367   -2.986  1.00 0.00 ? 84  LYS A N    2  
ATOM   2619  C  CA   . LYS A 1 84 ? -4.769  8.635   -2.213  1.00 0.00 ? 84  LYS A CA   2  
ATOM   2620  C  C    . LYS A 1 84 ? -4.085  9.750   -3.021  1.00 0.00 ? 84  LYS A C    2  
ATOM   2621  O  O    . LYS A 1 84 ? -4.498  10.914  -2.957  1.00 0.00 ? 84  LYS A O    2  
ATOM   2622  C  CB   . LYS A 1 84 ? -3.954  8.396   -0.912  1.00 0.00 ? 84  LYS A CB   2  
ATOM   2623  C  CG   . LYS A 1 84 ? -4.659  7.549   0.165   1.00 0.00 ? 84  LYS A CG   2  
ATOM   2624  C  CD   . LYS A 1 84 ? -3.766  7.283   1.405   1.00 0.00 ? 84  LYS A CD   2  
ATOM   2625  C  CE   . LYS A 1 84 ? -4.539  6.684   2.599   1.00 0.00 ? 84  LYS A CE   2  
ATOM   2626  N  NZ   . LYS A 1 84 ? -5.283  5.450   2.238   1.00 0.00 ? 84  LYS A NZ   2  
ATOM   2627  H  H    . LYS A 1 84 ? -4.570  6.552   -2.552  1.00 0.00 ? 84  LYS A H    2  
ATOM   2628  H  HA   . LYS A 1 84 ? -5.775  8.949   -1.952  1.00 0.00 ? 84  LYS A HA   2  
ATOM   2629  H  HB2  . LYS A 1 84 ? -3.031  7.899   -1.179  1.00 0.00 ? 84  LYS A HB2  2  
ATOM   2630  H  HB3  . LYS A 1 84 ? -3.708  9.356   -0.470  1.00 0.00 ? 84  LYS A HB3  2  
ATOM   2631  H  HG2  . LYS A 1 84 ? -5.556  8.069   0.481   1.00 0.00 ? 84  LYS A HG2  2  
ATOM   2632  H  HG3  . LYS A 1 84 ? -4.939  6.597   -0.275  1.00 0.00 ? 84  LYS A HG3  2  
ATOM   2633  H  HD2  . LYS A 1 84 ? -2.976  6.592   1.126   1.00 0.00 ? 84  LYS A HD2  2  
ATOM   2634  H  HD3  . LYS A 1 84 ? -3.312  8.221   1.719   1.00 0.00 ? 84  LYS A HD3  2  
ATOM   2635  H  HE2  . LYS A 1 84 ? -3.835  6.442   3.386   1.00 0.00 ? 84  LYS A HE2  2  
ATOM   2636  H  HE3  . LYS A 1 84 ? -5.243  7.417   2.971   1.00 0.00 ? 84  LYS A HE3  2  
ATOM   2637  H  HZ1  . LYS A 1 84 ? -6.071  5.675   1.599   1.00 0.00 ? 84  LYS A HZ1  2  
ATOM   2638  H  HZ2  . LYS A 1 84 ? -5.663  5.001   3.097   1.00 0.00 ? 84  LYS A HZ2  2  
ATOM   2639  H  HZ3  . LYS A 1 84 ? -4.651  4.776   1.764   1.00 0.00 ? 84  LYS A HZ3  2  
ATOM   2640  N  N    . ASP A 1 85 ? -3.045  9.352   -3.775  1.00 0.00 ? 85  ASP A N    2  
ATOM   2641  C  CA   . ASP A 1 85 ? -2.221  10.260  -4.595  1.00 0.00 ? 85  ASP A CA   2  
ATOM   2642  C  C    . ASP A 1 85 ? -3.092  11.107  -5.526  1.00 0.00 ? 85  ASP A C    2  
ATOM   2643  O  O    . ASP A 1 85 ? -2.932  12.324  -5.614  1.00 0.00 ? 85  ASP A O    2  
ATOM   2644  C  CB   . ASP A 1 85 ? -1.209  9.441   -5.432  1.00 0.00 ? 85  ASP A CB   2  
ATOM   2645  C  CG   . ASP A 1 85 ? -0.261  8.604   -4.565  1.00 0.00 ? 85  ASP A CG   2  
ATOM   2646  O  OD1  . ASP A 1 85 ? -0.628  7.468   -4.189  1.00 0.00 ? 85  ASP A OD1  2  
ATOM   2647  O  OD2  . ASP A 1 85 ? 0.843   9.082   -4.235  1.00 0.00 ? 85  ASP A OD2  2  
ATOM   2648  H  H    . ASP A 1 85 ? -2.801  8.403   -3.756  1.00 0.00 ? 85  ASP A H    2  
ATOM   2649  H  HA   . ASP A 1 85 ? -1.677  10.916  -3.925  1.00 0.00 ? 85  ASP A HA   2  
ATOM   2650  H  HB2  . ASP A 1 85 ? -1.755  8.772   -6.094  1.00 0.00 ? 85  ASP A HB2  2  
ATOM   2651  H  HB3  . ASP A 1 85 ? -0.617  10.118  -6.042  1.00 0.00 ? 85  ASP A HB3  2  
ATOM   2652  N  N    . SER A 1 86 ? -4.043  10.434  -6.192  1.00 0.00 ? 86  SER A N    2  
ATOM   2653  C  CA   . SER A 1 86 ? -4.952  11.065  -7.143  1.00 0.00 ? 86  SER A CA   2  
ATOM   2654  C  C    . SER A 1 86 ? -6.013  11.965  -6.446  1.00 0.00 ? 86  SER A C    2  
ATOM   2655  O  O    . SER A 1 86 ? -6.373  13.020  -6.964  1.00 0.00 ? 86  SER A O    2  
ATOM   2656  C  CB   . SER A 1 86 ? -5.612  9.953   -7.974  1.00 0.00 ? 86  SER A CB   2  
ATOM   2657  O  OG   . SER A 1 86 ? -4.640  9.070   -8.503  1.00 0.00 ? 86  SER A OG   2  
ATOM   2658  H  H    . SER A 1 86 ? -4.132  9.462   -6.056  1.00 0.00 ? 86  SER A H    2  
ATOM   2659  H  HA   . SER A 1 86 ? -4.350  11.673  -7.808  1.00 0.00 ? 86  SER A HA   2  
ATOM   2660  H  HB2  . SER A 1 86 ? -6.289  9.380   -7.355  1.00 0.00 ? 86  SER A HB2  2  
ATOM   2661  H  HB3  . SER A 1 86 ? -6.163  10.392  -8.796  1.00 0.00 ? 86  SER A HB3  2  
ATOM   2662  H  HG   . SER A 1 86 ? -3.869  9.580   -8.782  1.00 0.00 ? 86  SER A HG   2  
ATOM   2663  N  N    . VAL A 1 87 ? -6.472  11.531  -5.252  1.00 0.00 ? 87  VAL A N    2  
ATOM   2664  C  CA   . VAL A 1 87 ? -7.628  12.138  -4.534  1.00 0.00 ? 87  VAL A CA   2  
ATOM   2665  C  C    . VAL A 1 87 ? -7.243  13.480  -3.886  1.00 0.00 ? 87  VAL A C    2  
ATOM   2666  O  O    . VAL A 1 87 ? -7.908  14.505  -4.084  1.00 0.00 ? 87  VAL A O    2  
ATOM   2667  C  CB   . VAL A 1 87 ? -8.189  11.168  -3.411  1.00 0.00 ? 87  VAL A CB   2  
ATOM   2668  C  CG1  . VAL A 1 87 ? -9.435  11.758  -2.705  1.00 0.00 ? 87  VAL A CG1  2  
ATOM   2669  C  CG2  . VAL A 1 87 ? -8.497  9.773   -3.988  1.00 0.00 ? 87  VAL A CG2  2  
ATOM   2670  H  H    . VAL A 1 87 ? -5.981  10.812  -4.814  1.00 0.00 ? 87  VAL A H    2  
ATOM   2671  H  HA   . VAL A 1 87 ? -8.416  12.318  -5.260  1.00 0.00 ? 87  VAL A HA   2  
ATOM   2672  H  HB   . VAL A 1 87 ? -7.413  11.042  -2.651  1.00 0.00 ? 87  VAL A HB   2  
ATOM   2673  H  HG11 . VAL A 1 87 ? -9.186  12.705  -2.240  1.00 0.00 ? 87  VAL A HG11 2  
ATOM   2674  H  HG12 . VAL A 1 87 ? -9.792  11.073  -1.942  1.00 0.00 ? 87  VAL A HG12 2  
ATOM   2675  H  HG13 . VAL A 1 87 ? -10.218 11.917  -3.432  1.00 0.00 ? 87  VAL A HG13 2  
ATOM   2676  H  HG21 . VAL A 1 87 ? -9.268  9.848   -4.747  1.00 0.00 ? 87  VAL A HG21 2  
ATOM   2677  H  HG22 . VAL A 1 87 ? -8.841  9.116   -3.199  1.00 0.00 ? 87  VAL A HG22 2  
ATOM   2678  H  HG23 . VAL A 1 87 ? -7.605  9.350   -4.434  1.00 0.00 ? 87  VAL A HG23 2  
ATOM   2679  N  N    . VAL A 1 88 ? -6.140  13.432  -3.133  1.00 0.00 ? 88  VAL A N    2  
ATOM   2680  C  CA   . VAL A 1 88 ? -5.656  14.538  -2.282  1.00 0.00 ? 88  VAL A CA   2  
ATOM   2681  C  C    . VAL A 1 88 ? -5.098  15.652  -3.171  1.00 0.00 ? 88  VAL A C    2  
ATOM   2682  O  O    . VAL A 1 88 ? -5.264  16.847  -2.883  1.00 0.00 ? 88  VAL A O    2  
ATOM   2683  C  CB   . VAL A 1 88 ? -4.551  14.040  -1.264  1.00 0.00 ? 88  VAL A CB   2  
ATOM   2684  C  CG1  . VAL A 1 88 ? -4.025  15.193  -0.371  1.00 0.00 ? 88  VAL A CG1  2  
ATOM   2685  C  CG2  . VAL A 1 88 ? -5.086  12.859  -0.407  1.00 0.00 ? 88  VAL A CG2  2  
ATOM   2686  H  H    . VAL A 1 88 ? -5.607  12.628  -3.189  1.00 0.00 ? 88  VAL A H    2  
ATOM   2687  H  HA   . VAL A 1 88 ? -6.495  14.925  -1.715  1.00 0.00 ? 88  VAL A HA   2  
ATOM   2688  H  HB   . VAL A 1 88 ? -3.713  13.667  -1.850  1.00 0.00 ? 88  VAL A HB   2  
ATOM   2689  H  HG11 . VAL A 1 88 ? -3.270  14.817  0.313   1.00 0.00 ? 88  VAL A HG11 2  
ATOM   2690  H  HG12 . VAL A 1 88 ? -4.839  15.617  0.201   1.00 0.00 ? 88  VAL A HG12 2  
ATOM   2691  H  HG13 . VAL A 1 88 ? -3.587  15.967  -0.990  1.00 0.00 ? 88  VAL A HG13 2  
ATOM   2692  H  HG21 . VAL A 1 88 ? -5.377  12.039  -1.057  1.00 0.00 ? 88  VAL A HG21 2  
ATOM   2693  H  HG22 . VAL A 1 88 ? -5.950  13.177  0.163   1.00 0.00 ? 88  VAL A HG22 2  
ATOM   2694  H  HG23 . VAL A 1 88 ? -4.317  12.516  0.273   1.00 0.00 ? 88  VAL A HG23 2  
ATOM   2695  N  N    . ALA A 1 89 ? -4.488  15.221  -4.297  1.00 0.00 ? 89  ALA A N    2  
ATOM   2696  C  CA   . ALA A 1 89 ? -3.972  16.128  -5.330  1.00 0.00 ? 89  ALA A CA   2  
ATOM   2697  C  C    . ALA A 1 89 ? -5.142  16.888  -5.968  1.00 0.00 ? 89  ALA A C    2  
ATOM   2698  O  O    . ALA A 1 89 ? -5.099  18.108  -6.122  1.00 0.00 ? 89  ALA A O    2  
ATOM   2699  C  CB   . ALA A 1 89 ? -3.193  15.350  -6.406  1.00 0.00 ? 89  ALA A CB   2  
ATOM   2700  H  H    . ALA A 1 89 ? -4.413  14.245  -4.447  1.00 0.00 ? 89  ALA A H    2  
ATOM   2701  H  HA   . ALA A 1 89 ? -3.299  16.828  -4.852  1.00 0.00 ? 89  ALA A HA   2  
ATOM   2702  H  HB1  . ALA A 1 89 ? -2.371  14.817  -5.949  1.00 0.00 ? 89  ALA A HB1  2  
ATOM   2703  H  HB2  . ALA A 1 89 ? -2.803  16.038  -7.149  1.00 0.00 ? 89  ALA A HB2  2  
ATOM   2704  H  HB3  . ALA A 1 89 ? -3.850  14.638  -6.891  1.00 0.00 ? 89  ALA A HB3  2  
ATOM   2705  N  N    . HIS A 1 90 ? -6.214  16.135  -6.277  1.00 0.00 ? 90  HIS A N    2  
ATOM   2706  C  CA   . HIS A 1 90 ? -7.401  16.671  -6.979  1.00 0.00 ? 90  HIS A CA   2  
ATOM   2707  C  C    . HIS A 1 90 ? -8.243  17.590  -6.071  1.00 0.00 ? 90  HIS A C    2  
ATOM   2708  O  O    . HIS A 1 90 ? -8.860  18.525  -6.550  1.00 0.00 ? 90  HIS A O    2  
ATOM   2709  C  CB   . HIS A 1 90 ? -8.235  15.484  -7.539  1.00 0.00 ? 90  HIS A CB   2  
ATOM   2710  C  CG   . HIS A 1 90 ? -9.690  15.750  -7.827  1.00 0.00 ? 90  HIS A CG   2  
ATOM   2711  N  ND1  . HIS A 1 90 ? -10.189 16.166  -9.037  1.00 0.00 ? 90  HIS A ND1  2  
ATOM   2712  C  CD2  . HIS A 1 90 ? -10.763 15.547  -7.036  1.00 0.00 ? 90  HIS A CD2  2  
ATOM   2713  C  CE1  . HIS A 1 90 ? -11.522 16.194  -8.939  1.00 0.00 ? 90  HIS A CE1  2  
ATOM   2714  N  NE2  . HIS A 1 90 ? -11.919 15.816  -7.739  1.00 0.00 ? 90  HIS A NE2  2  
ATOM   2715  H  H    . HIS A 1 90 ? -6.221  15.173  -5.999  1.00 0.00 ? 90  HIS A H    2  
ATOM   2716  H  HA   . HIS A 1 90 ? -7.041  17.259  -7.821  1.00 0.00 ? 90  HIS A HA   2  
ATOM   2717  H  HB2  . HIS A 1 90 ? -7.789  15.148  -8.470  1.00 0.00 ? 90  HIS A HB2  2  
ATOM   2718  H  HB3  . HIS A 1 90 ? -8.187  14.661  -6.832  1.00 0.00 ? 90  HIS A HB3  2  
ATOM   2719  H  HD1  . HIS A 1 90 ? -9.663  16.387  -9.835  1.00 0.00 ? 90  HIS A HD1  2  
ATOM   2720  H  HD2  . HIS A 1 90 ? -10.732 15.264  -5.995  1.00 0.00 ? 90  HIS A HD2  2  
ATOM   2721  H  HE1  . HIS A 1 90 ? -12.185 16.487  -9.736  1.00 0.00 ? 90  HIS A HE1  2  
ATOM   2722  N  N    . LYS A 1 91 ? -8.288  17.282  -4.777  1.00 0.00 ? 91  LYS A N    2  
ATOM   2723  C  CA   . LYS A 1 91 ? -9.075  18.050  -3.792  1.00 0.00 ? 91  LYS A CA   2  
ATOM   2724  C  C    . LYS A 1 91 ? -8.398  19.401  -3.510  1.00 0.00 ? 91  LYS A C    2  
ATOM   2725  O  O    . LYS A 1 91 ? -9.047  20.452  -3.486  1.00 0.00 ? 91  LYS A O    2  
ATOM   2726  C  CB   . LYS A 1 91 ? -9.252  17.240  -2.477  1.00 0.00 ? 91  LYS A CB   2  
ATOM   2727  C  CG   . LYS A 1 91 ? -10.182 17.913  -1.448  1.00 0.00 ? 91  LYS A CG   2  
ATOM   2728  C  CD   . LYS A 1 91 ? -10.261 17.144  -0.114  1.00 0.00 ? 91  LYS A CD   2  
ATOM   2729  C  CE   . LYS A 1 91 ? -11.182 17.837  0.906   1.00 0.00 ? 91  LYS A CE   2  
ATOM   2730  N  NZ   . LYS A 1 91 ? -11.186 17.144  2.220   1.00 0.00 ? 91  LYS A NZ   2  
ATOM   2731  H  H    . LYS A 1 91 ? -7.754  16.536  -4.467  1.00 0.00 ? 91  LYS A H    2  
ATOM   2732  H  HA   . LYS A 1 91 ? -10.054 18.236  -4.225  1.00 0.00 ? 91  LYS A HA   2  
ATOM   2733  H  HB2  . LYS A 1 91 ? -9.672  16.267  -2.721  1.00 0.00 ? 91  LYS A HB2  2  
ATOM   2734  H  HB3  . LYS A 1 91 ? -8.277  17.093  -2.022  1.00 0.00 ? 91  LYS A HB3  2  
ATOM   2735  H  HG2  . LYS A 1 91 ? -9.814  18.914  -1.250  1.00 0.00 ? 91  LYS A HG2  2  
ATOM   2736  H  HG3  . LYS A 1 91 ? -11.180 17.979  -1.879  1.00 0.00 ? 91  LYS A HG3  2  
ATOM   2737  H  HD2  . LYS A 1 91 ? -10.643 16.146  -0.302  1.00 0.00 ? 91  LYS A HD2  2  
ATOM   2738  H  HD3  . LYS A 1 91 ? -9.262  17.068  0.309   1.00 0.00 ? 91  LYS A HD3  2  
ATOM   2739  H  HE2  . LYS A 1 91 ? -10.845 18.854  1.059   1.00 0.00 ? 91  LYS A HE2  2  
ATOM   2740  H  HE3  . LYS A 1 91 ? -12.194 17.851  0.518   1.00 0.00 ? 91  LYS A HE3  2  
ATOM   2741  H  HZ1  . LYS A 1 91 ? -10.231 17.151  2.633   1.00 0.00 ? 91  LYS A HZ1  2  
ATOM   2742  H  HZ2  . LYS A 1 91 ? -11.489 16.160  2.100   1.00 0.00 ? 91  LYS A HZ2  2  
ATOM   2743  H  HZ3  . LYS A 1 91 ? -11.842 17.624  2.878   1.00 0.00 ? 91  LYS A HZ3  2  
ATOM   2744  N  N    . ALA A 1 92 ? -7.067  19.338  -3.334  1.00 0.00 ? 92  ALA A N    2  
ATOM   2745  C  CA   . ALA A 1 92 ? -6.226  20.512  -3.053  1.00 0.00 ? 92  ALA A CA   2  
ATOM   2746  C  C    . ALA A 1 92 ? -6.210  21.514  -4.231  1.00 0.00 ? 92  ALA A C    2  
ATOM   2747  O  O    . ALA A 1 92 ? -5.914  22.704  -4.045  1.00 0.00 ? 92  ALA A O    2  
ATOM   2748  C  CB   . ALA A 1 92 ? -4.799  20.064  -2.702  1.00 0.00 ? 92  ALA A CB   2  
ATOM   2749  H  H    . ALA A 1 92 ? -6.639  18.462  -3.393  1.00 0.00 ? 92  ALA A H    2  
ATOM   2750  H  HA   . ALA A 1 92 ? -6.644  21.000  -2.186  1.00 0.00 ? 92  ALA A HA   2  
ATOM   2751  H  HB1  . ALA A 1 92 ? -4.352  19.568  -3.555  1.00 0.00 ? 92  ALA A HB1  2  
ATOM   2752  H  HB2  . ALA A 1 92 ? -4.826  19.377  -1.868  1.00 0.00 ? 92  ALA A HB2  2  
ATOM   2753  H  HB3  . ALA A 1 92 ? -4.198  20.926  -2.431  1.00 0.00 ? 92  ALA A HB3  2  
ATOM   2754  N  N    . LYS A 1 93 ? -6.520  21.029  -5.449  1.00 0.00 ? 93  LYS A N    2  
ATOM   2755  C  CA   . LYS A 1 93 ? -6.465  21.861  -6.675  1.00 0.00 ? 93  LYS A CA   2  
ATOM   2756  C  C    . LYS A 1 93 ? -7.875  22.233  -7.183  1.00 0.00 ? 93  LYS A C    2  
ATOM   2757  O  O    . LYS A 1 93 ? -8.165  23.414  -7.424  1.00 0.00 ? 93  LYS A O    2  
ATOM   2758  C  CB   . LYS A 1 93 ? -5.649  21.138  -7.788  1.00 0.00 ? 93  LYS A CB   2  
ATOM   2759  C  CG   . LYS A 1 93 ? -4.175  20.884  -7.405  1.00 0.00 ? 93  LYS A CG   2  
ATOM   2760  C  CD   . LYS A 1 93 ? -3.374  20.178  -8.517  1.00 0.00 ? 93  LYS A CD   2  
ATOM   2761  C  CE   . LYS A 1 93 ? -1.924  19.893  -8.104  1.00 0.00 ? 93  LYS A CE   2  
ATOM   2762  N  NZ   . LYS A 1 93 ? -1.151  19.258  -9.200  1.00 0.00 ? 93  LYS A NZ   2  
ATOM   2763  H  H    . LYS A 1 93 ? -6.796  20.080  -5.527  1.00 0.00 ? 93  LYS A H    2  
ATOM   2764  H  HA   . LYS A 1 93 ? -5.943  22.791  -6.430  1.00 0.00 ? 93  LYS A HA   2  
ATOM   2765  H  HB2  . LYS A 1 93 ? -6.117  20.180  -8.000  1.00 0.00 ? 93  LYS A HB2  2  
ATOM   2766  H  HB3  . LYS A 1 93 ? -5.665  21.744  -8.692  1.00 0.00 ? 93  LYS A HB3  2  
ATOM   2767  H  HG2  . LYS A 1 93 ? -3.700  21.833  -7.184  1.00 0.00 ? 93  LYS A HG2  2  
ATOM   2768  H  HG3  . LYS A 1 93 ? -4.154  20.262  -6.511  1.00 0.00 ? 93  LYS A HG3  2  
ATOM   2769  H  HD2  . LYS A 1 93 ? -3.857  19.235  -8.756  1.00 0.00 ? 93  LYS A HD2  2  
ATOM   2770  H  HD3  . LYS A 1 93 ? -3.370  20.807  -9.403  1.00 0.00 ? 93  LYS A HD3  2  
ATOM   2771  H  HE2  . LYS A 1 93 ? -1.439  20.823  -7.836  1.00 0.00 ? 93  LYS A HE2  2  
ATOM   2772  H  HE3  . LYS A 1 93 ? -1.923  19.229  -7.249  1.00 0.00 ? 93  LYS A HE3  2  
ATOM   2773  H  HZ1  . LYS A 1 93 ? -0.205  18.986  -8.861  1.00 0.00 ? 93  LYS A HZ1  2  
ATOM   2774  H  HZ2  . LYS A 1 93 ? -1.043  19.920  -9.994  1.00 0.00 ? 93  LYS A HZ2  2  
ATOM   2775  H  HZ3  . LYS A 1 93 ? -1.647  18.408  -9.540  1.00 0.00 ? 93  LYS A HZ3  2  
ATOM   2776  N  N    . SER A 1 94 ? -8.755  21.227  -7.317  1.00 0.00 ? 94  SER A N    2  
ATOM   2777  C  CA   . SER A 1 94 ? -10.054 21.365  -8.011  1.00 0.00 ? 94  SER A CA   2  
ATOM   2778  C  C    . SER A 1 94 ? -11.174 21.780  -7.036  1.00 0.00 ? 94  SER A C    2  
ATOM   2779  O  O    . SER A 1 94 ? -12.284 22.113  -7.470  1.00 0.00 ? 94  SER A O    2  
ATOM   2780  C  CB   . SER A 1 94 ? -10.423 20.041  -8.744  1.00 0.00 ? 94  SER A CB   2  
ATOM   2781  O  OG   . SER A 1 94 ? -11.631 20.158  -9.485  1.00 0.00 ? 94  SER A OG   2  
ATOM   2782  H  H    . SER A 1 94 ? -8.547  20.376  -6.902  1.00 0.00 ? 94  SER A H    2  
ATOM   2783  H  HA   . SER A 1 94 ? -9.942  22.140  -8.750  1.00 0.00 ? 94  SER A HA   2  
ATOM   2784  H  HB2  . SER A 1 94 ? -9.631  19.773  -9.434  1.00 0.00 ? 94  SER A HB2  2  
ATOM   2785  H  HB3  . SER A 1 94 ? -10.539 19.248  -8.019  1.00 0.00 ? 94  SER A HB3  2  
ATOM   2786  H  HG   . SER A 1 94 ? -11.924 21.076  -9.484  1.00 0.00 ? 94  SER A HG   2  
ATOM   2787  N  N    . HIS A 1 95 ? -10.878 21.765  -5.716  1.00 0.00 ? 95  HIS A N    2  
ATOM   2788  C  CA   . HIS A 1 95 ? -11.843 22.161  -4.660  1.00 0.00 ? 95  HIS A CA   2  
ATOM   2789  C  C    . HIS A 1 95 ? -11.135 23.002  -3.557  1.00 0.00 ? 95  HIS A C    2  
ATOM   2790  O  O    . HIS A 1 95 ? -11.072 22.567  -2.398  1.00 0.00 ? 95  HIS A O    2  
ATOM   2791  C  CB   . HIS A 1 95 ? -12.529 20.921  -4.018  1.00 0.00 ? 95  HIS A CB   2  
ATOM   2792  C  CG   . HIS A 1 95 ? -13.154 19.962  -4.984  1.00 0.00 ? 95  HIS A CG   2  
ATOM   2793  N  ND1  . HIS A 1 95 ? -14.116 20.304  -5.910  1.00 0.00 ? 95  HIS A ND1  2  
ATOM   2794  C  CD2  . HIS A 1 95 ? -12.934 18.642  -5.144  1.00 0.00 ? 95  HIS A CD2  2  
ATOM   2795  C  CE1  . HIS A 1 95 ? -14.441 19.196  -6.585  1.00 0.00 ? 95  HIS A CE1  2  
ATOM   2796  N  NE2  . HIS A 1 95 ? -13.744 18.168  -6.151  1.00 0.00 ? 95  HIS A NE2  2  
ATOM   2797  H  H    . HIS A 1 95 ? -9.973  21.512  -5.444  1.00 0.00 ? 95  HIS A H    2  
ATOM   2798  H  HA   . HIS A 1 95 ? -12.610 22.786  -5.110  1.00 0.00 ? 95  HIS A HA   2  
ATOM   2799  H  HB2  . HIS A 1 95 ? -11.795 20.367  -3.436  1.00 0.00 ? 95  HIS A HB2  2  
ATOM   2800  H  HB3  . HIS A 1 95 ? -13.311 21.259  -3.348  1.00 0.00 ? 95  HIS A HB3  2  
ATOM   2801  H  HD1  . HIS A 1 95 ? -14.502 21.198  -6.042  1.00 0.00 ? 95  HIS A HD1  2  
ATOM   2802  H  HD2  . HIS A 1 95 ? -12.271 18.028  -4.545  1.00 0.00 ? 95  HIS A HD2  2  
ATOM   2803  H  HE1  . HIS A 1 95 ? -15.175 19.151  -7.384  1.00 0.00 ? 95  HIS A HE1  2  
ATOM   2804  N  N    . PRO A 1 96 ? -10.575 24.214  -3.887  1.00 0.00 ? 96  PRO A N    2  
ATOM   2805  C  CA   . PRO A 1 96 ? -9.979  25.124  -2.872  1.00 0.00 ? 96  PRO A CA   2  
ATOM   2806  C  C    . PRO A 1 96 ? -11.051 25.681  -1.906  1.00 0.00 ? 96  PRO A C    2  
ATOM   2807  O  O    . PRO A 1 96 ? -10.753 26.045  -0.765  1.00 0.00 ? 96  PRO A O    2  
ATOM   2808  C  CB   . PRO A 1 96 ? -9.311  26.236  -3.728  1.00 0.00 ? 96  PRO A CB   2  
ATOM   2809  C  CG   . PRO A 1 96 ? -10.066 26.229  -5.022  1.00 0.00 ? 96  PRO A CG   2  
ATOM   2810  C  CD   . PRO A 1 96 ? -10.451 24.783  -5.257  1.00 0.00 ? 96  PRO A CD   2  
ATOM   2811  H  HA   . PRO A 1 96 ? -9.218  24.604  -2.290  1.00 0.00 ? 96  PRO A HA   2  
ATOM   2812  H  HB2  . PRO A 1 96 ? -9.386  27.198  -3.229  1.00 0.00 ? 96  PRO A HB2  2  
ATOM   2813  H  HB3  . PRO A 1 96 ? -8.264  25.994  -3.881  1.00 0.00 ? 96  PRO A HB3  2  
ATOM   2814  H  HG2  . PRO A 1 96 ? -10.951 26.858  -4.943  1.00 0.00 ? 96  PRO A HG2  2  
ATOM   2815  H  HG3  . PRO A 1 96 ? -9.433  26.587  -5.823  1.00 0.00 ? 96  PRO A HG3  2  
ATOM   2816  H  HD2  . PRO A 1 96 ? -11.393 24.720  -5.788  1.00 0.00 ? 96  PRO A HD2  2  
ATOM   2817  H  HD3  . PRO A 1 96 ? -9.676  24.258  -5.812  1.00 0.00 ? 96  PRO A HD3  2  
ATOM   2818  N  N    . GLU A 1 97 ? -12.299 25.732  -2.398  1.00 0.00 ? 97  GLU A N    2  
ATOM   2819  C  CA   . GLU A 1 97 ? -13.475 26.092  -1.629  1.00 0.00 ? 97  GLU A CA   2  
ATOM   2820  C  C    . GLU A 1 97 ? -14.492 24.936  -1.742  1.00 0.00 ? 97  GLU A C    2  
ATOM   2821  O  O    . GLU A 1 97 ? -15.256 24.830  -2.715  1.00 0.00 ? 97  GLU A O    2  
ATOM   2822  C  CB   . GLU A 1 97 ? -14.037 27.451  -2.152  1.00 0.00 ? 97  GLU A CB   2  
ATOM   2823  C  CG   . GLU A 1 97 ? -15.369 27.917  -1.527  1.00 0.00 ? 97  GLU A CG   2  
ATOM   2824  C  CD   . GLU A 1 97 ? -15.324 28.061  0.004   1.00 0.00 ? 97  GLU A CD   2  
ATOM   2825  O  OE1  . GLU A 1 97 ? -14.797 29.084  0.498   1.00 0.00 ? 97  GLU A OE1  2  
ATOM   2826  O  OE2  . GLU A 1 97 ? -15.836 27.168  0.721   1.00 0.00 ? 97  GLU A OE2  2  
ATOM   2827  H  H    . GLU A 1 97 ? -12.432 25.513  -3.325  1.00 0.00 ? 97  GLU A H    2  
ATOM   2828  H  HA   . GLU A 1 97 ? -13.189 26.210  -0.592  1.00 0.00 ? 97  GLU A HA   2  
ATOM   2829  H  HB2  . GLU A 1 97 ? -13.297 28.218  -1.966  1.00 0.00 ? 97  GLU A HB2  2  
ATOM   2830  H  HB3  . GLU A 1 97 ? -14.180 27.374  -3.229  1.00 0.00 ? 97  GLU A HB3  2  
ATOM   2831  H  HG2  . GLU A 1 97 ? -15.629 28.878  -1.958  1.00 0.00 ? 97  GLU A HG2  2  
ATOM   2832  H  HG3  . GLU A 1 97 ? -16.135 27.201  -1.796  1.00 0.00 ? 97  GLU A HG3  2  
ATOM   2833  N  N    . VAL A 1 98 ? -14.456 24.055  -0.739  1.00 0.00 ? 98  VAL A N    2  
ATOM   2834  C  CA   . VAL A 1 98 ? -15.365 22.894  -0.630  1.00 0.00 ? 98  VAL A CA   2  
ATOM   2835  C  C    . VAL A 1 98 ? -16.793 23.354  -0.211  1.00 0.00 ? 98  VAL A C    2  
ATOM   2836  O  O    . VAL A 1 98 ? -16.940 23.985  0.858   1.00 0.00 ? 98  VAL A O    2  
ATOM   2837  C  CB   . VAL A 1 98 ? -14.781 21.777  0.340   1.00 0.00 ? 98  VAL A CB   2  
ATOM   2838  C  CG1  . VAL A 1 98 ? -14.248 22.360  1.670   1.00 0.00 ? 98  VAL A CG1  2  
ATOM   2839  C  CG2  . VAL A 1 98 ? -15.813 20.640  0.595   1.00 0.00 ? 98  VAL A CG2  2  
ATOM   2840  O  OXT  . VAL A 1 98 ? -17.755 23.113  -0.975  1.00 0.00 ? 98  VAL A OXT  2  
ATOM   2841  H  H    . VAL A 1 98 ? -13.771 24.183  -0.057  1.00 0.00 ? 98  VAL A H    2  
ATOM   2842  H  HA   . VAL A 1 98 ? -15.424 22.453  -1.629  1.00 0.00 ? 98  VAL A HA   2  
ATOM   2843  H  HB   . VAL A 1 98 ? -13.932 21.331  -0.168  1.00 0.00 ? 98  VAL A HB   2  
ATOM   2844  H  HG11 . VAL A 1 98 ? -13.815 21.570  2.276   1.00 0.00 ? 98  VAL A HG11 2  
ATOM   2845  H  HG12 . VAL A 1 98 ? -15.054 22.830  2.220   1.00 0.00 ? 98  VAL A HG12 2  
ATOM   2846  H  HG13 . VAL A 1 98 ? -13.485 23.101  1.458   1.00 0.00 ? 98  VAL A HG13 2  
ATOM   2847  H  HG21 . VAL A 1 98 ? -15.359 19.863  1.197   1.00 0.00 ? 98  VAL A HG21 2  
ATOM   2848  H  HG22 . VAL A 1 98 ? -16.133 20.213  -0.350  1.00 0.00 ? 98  VAL A HG22 2  
ATOM   2849  H  HG23 . VAL A 1 98 ? -16.676 21.038  1.114   1.00 0.00 ? 98  VAL A HG23 2  
HETATM 2850  ZN ZN   . ZN  B 2 .  ? 16.034  -0.100  3.969   1.00 0.00 ? 101 ZN  A ZN   2  
HETATM 2851  ZN ZN   . ZN  C 2 .  ? -1.563  -2.061  -8.302  1.00 0.00 ? 102 ZN  A ZN   2  
HETATM 2852  ZN ZN   . ZN  D 2 .  ? -13.725 16.245  -6.856  1.00 0.00 ? 103 ZN  A ZN   2  
ATOM   2853  N  N    . HIS A 1 10 ? 16.240  -9.347  19.609  1.00 0.00 ? 10  HIS A N    3  
ATOM   2854  C  CA   . HIS A 1 10 ? 16.565  -9.772  18.223  1.00 0.00 ? 10  HIS A CA   3  
ATOM   2855  C  C    . HIS A 1 10 ? 16.470  -11.301 18.093  1.00 0.00 ? 10  HIS A C    3  
ATOM   2856  O  O    . HIS A 1 10 ? 17.406  -12.024 18.445  1.00 0.00 ? 10  HIS A O    3  
ATOM   2857  C  CB   . HIS A 1 10 ? 17.964  -9.249  17.773  1.00 0.00 ? 10  HIS A CB   3  
ATOM   2858  C  CG   . HIS A 1 10 ? 17.995  -7.777  17.436  1.00 0.00 ? 10  HIS A CG   3  
ATOM   2859  N  ND1  . HIS A 1 10 ? 18.394  -6.807  18.321  1.00 0.00 ? 10  HIS A ND1  3  
ATOM   2860  C  CD2  . HIS A 1 10 ? 17.671  -7.127  16.290  1.00 0.00 ? 10  HIS A CD2  3  
ATOM   2861  C  CE1  . HIS A 1 10 ? 18.313  -5.623  17.741  1.00 0.00 ? 10  HIS A CE1  3  
ATOM   2862  N  NE2  . HIS A 1 10 ? 17.876  -5.788  16.509  1.00 0.00 ? 10  HIS A NE2  3  
ATOM   2863  H  H    . HIS A 1 10 ? 16.931  -9.740  20.279  1.00 0.00 ? 10  HIS A H    3  
ATOM   2864  H  HA   . HIS A 1 10 ? 15.812  -9.334  17.579  1.00 0.00 ? 10  HIS A HA   3  
ATOM   2865  H  HB2  . HIS A 1 10 ? 18.684  -9.419  18.563  1.00 0.00 ? 10  HIS A HB2  3  
ATOM   2866  H  HB3  . HIS A 1 10 ? 18.286  -9.792  16.889  1.00 0.00 ? 10  HIS A HB3  3  
ATOM   2867  H  HD1  . HIS A 1 10 ? 18.695  -6.957  19.242  1.00 0.00 ? 10  HIS A HD1  3  
ATOM   2868  H  HD2  . HIS A 1 10 ? 17.316  -7.580  15.375  1.00 0.00 ? 10  HIS A HD2  3  
ATOM   2869  H  HE1  . HIS A 1 10 ? 18.565  -4.676  18.203  1.00 0.00 ? 10  HIS A HE1  3  
ATOM   2870  H  HE2  . HIS A 1 10 ? 17.937  -5.109  15.801  1.00 0.00 ? 10  HIS A HE2  3  
ATOM   2871  N  N    . MET A 1 11 ? 15.302  -11.779 17.618  1.00 0.00 ? 11  MET A N    3  
ATOM   2872  C  CA   . MET A 1 11 ? 15.020  -13.198 17.313  1.00 0.00 ? 11  MET A CA   3  
ATOM   2873  C  C    . MET A 1 11 ? 14.464  -13.299 15.886  1.00 0.00 ? 11  MET A C    3  
ATOM   2874  O  O    . MET A 1 11 ? 14.973  -14.042 15.049  1.00 0.00 ? 11  MET A O    3  
ATOM   2875  C  CB   . MET A 1 11 ? 13.998  -13.789 18.326  1.00 0.00 ? 11  MET A CB   3  
ATOM   2876  C  CG   . MET A 1 11 ? 14.481  -13.933 19.786  1.00 0.00 ? 11  MET A CG   3  
ATOM   2877  S  SD   . MET A 1 11 ? 15.424  -15.446 20.117  1.00 0.00 ? 11  MET A SD   3  
ATOM   2878  C  CE   . MET A 1 11 ? 17.060  -15.086 19.472  1.00 0.00 ? 11  MET A CE   3  
ATOM   2879  H  H    . MET A 1 11 ? 14.581  -11.134 17.459  1.00 0.00 ? 11  MET A H    3  
ATOM   2880  H  HA   . MET A 1 11 ? 15.949  -13.762 17.368  1.00 0.00 ? 11  MET A HA   3  
ATOM   2881  H  HB2  . MET A 1 11 ? 13.118  -13.158 18.328  1.00 0.00 ? 11  MET A HB2  3  
ATOM   2882  H  HB3  . MET A 1 11 ? 13.702  -14.777 17.985  1.00 0.00 ? 11  MET A HB3  3  
ATOM   2883  H  HG2  . MET A 1 11 ? 15.104  -13.087 20.041  1.00 0.00 ? 11  MET A HG2  3  
ATOM   2884  H  HG3  . MET A 1 11 ? 13.614  -13.931 20.439  1.00 0.00 ? 11  MET A HG3  3  
ATOM   2885  H  HE1  . MET A 1 11 ? 17.467  -14.232 19.994  1.00 0.00 ? 11  MET A HE1  3  
ATOM   2886  H  HE2  . MET A 1 11 ? 16.994  -14.868 18.418  1.00 0.00 ? 11  MET A HE2  3  
ATOM   2887  H  HE3  . MET A 1 11 ? 17.709  -15.939 19.618  1.00 0.00 ? 11  MET A HE3  3  
ATOM   2888  N  N    . ARG A 1 12 ? 13.398  -12.520 15.635  1.00 0.00 ? 12  ARG A N    3  
ATOM   2889  C  CA   . ARG A 1 12 ? 12.748  -12.389 14.317  1.00 0.00 ? 12  ARG A CA   3  
ATOM   2890  C  C    . ARG A 1 12 ? 12.687  -10.889 13.992  1.00 0.00 ? 12  ARG A C    3  
ATOM   2891  O  O    . ARG A 1 12 ? 11.618  -10.313 13.743  1.00 0.00 ? 12  ARG A O    3  
ATOM   2892  C  CB   . ARG A 1 12 ? 11.332  -13.053 14.350  1.00 0.00 ? 12  ARG A CB   3  
ATOM   2893  C  CG   . ARG A 1 12 ? 11.344  -14.589 14.555  1.00 0.00 ? 12  ARG A CG   3  
ATOM   2894  C  CD   . ARG A 1 12 ? 9.931   -15.196 14.604  1.00 0.00 ? 12  ARG A CD   3  
ATOM   2895  N  NE   . ARG A 1 12 ? 9.962   -16.669 14.642  1.00 0.00 ? 12  ARG A NE   3  
ATOM   2896  C  CZ   . ARG A 1 12 ? 8.889   -17.473 14.662  1.00 0.00 ? 12  ARG A CZ   3  
ATOM   2897  N  NH1  . ARG A 1 12 ? 7.661   -16.974 14.744  1.00 0.00 ? 12  ARG A NH1  3  
ATOM   2898  N  NH2  . ARG A 1 12 ? 9.066   -18.783 14.633  1.00 0.00 ? 12  ARG A NH2  3  
ATOM   2899  H  H    . ARG A 1 12 ? 13.036  -11.984 16.373  1.00 0.00 ? 12  ARG A H    3  
ATOM   2900  H  HA   . ARG A 1 12 ? 13.364  -12.882 13.567  1.00 0.00 ? 12  ARG A HA   3  
ATOM   2901  H  HB2  . ARG A 1 12 ? 10.759  -12.613 15.163  1.00 0.00 ? 12  ARG A HB2  3  
ATOM   2902  H  HB3  . ARG A 1 12 ? 10.824  -12.837 13.414  1.00 0.00 ? 12  ARG A HB3  3  
ATOM   2903  H  HG2  . ARG A 1 12 ? 11.893  -15.048 13.740  1.00 0.00 ? 12  ARG A HG2  3  
ATOM   2904  H  HG3  . ARG A 1 12 ? 11.855  -14.808 15.490  1.00 0.00 ? 12  ARG A HG3  3  
ATOM   2905  H  HD2  . ARG A 1 12 ? 9.426   -14.835 15.493  1.00 0.00 ? 12  ARG A HD2  3  
ATOM   2906  H  HD3  . ARG A 1 12 ? 9.381   -14.879 13.725  1.00 0.00 ? 12  ARG A HD3  3  
ATOM   2907  H  HE   . ARG A 1 12 ? 10.849  -17.088 14.621  1.00 0.00 ? 12  ARG A HE   3  
ATOM   2908  H  HH11 . ARG A 1 12 ? 7.524   -15.981 14.788  1.00 0.00 ? 12  ARG A HH11 3  
ATOM   2909  H  HH12 . ARG A 1 12 ? 6.867   -17.583 14.744  1.00 0.00 ? 12  ARG A HH12 3  
ATOM   2910  H  HH21 . ARG A 1 12 ? 9.997   -19.162 14.582  1.00 0.00 ? 12  ARG A HH21 3  
ATOM   2911  H  HH22 . ARG A 1 12 ? 8.280   -19.402 14.651  1.00 0.00 ? 12  ARG A HH22 3  
ATOM   2912  N  N    . ASP A 1 13 ? 13.874  -10.255 14.027  1.00 0.00 ? 13  ASP A N    3  
ATOM   2913  C  CA   . ASP A 1 13 ? 14.027  -8.799  13.941  1.00 0.00 ? 13  ASP A CA   3  
ATOM   2914  C  C    . ASP A 1 13 ? 15.063  -8.497  12.856  1.00 0.00 ? 13  ASP A C    3  
ATOM   2915  O  O    . ASP A 1 13 ? 16.262  -8.357  13.122  1.00 0.00 ? 13  ASP A O    3  
ATOM   2916  C  CB   . ASP A 1 13 ? 14.471  -8.201  15.298  1.00 0.00 ? 13  ASP A CB   3  
ATOM   2917  C  CG   . ASP A 1 13 ? 13.491  -8.436  16.470  1.00 0.00 ? 13  ASP A CG   3  
ATOM   2918  O  OD1  . ASP A 1 13 ? 13.332  -9.596  16.907  1.00 0.00 ? 13  ASP A OD1  3  
ATOM   2919  O  OD2  . ASP A 1 13 ? 12.907  -7.459  16.998  1.00 0.00 ? 13  ASP A OD2  3  
ATOM   2920  H  H    . ASP A 1 13 ? 14.693  -10.788 14.054  1.00 0.00 ? 13  ASP A H    3  
ATOM   2921  H  HA   . ASP A 1 13 ? 13.069  -8.360  13.649  1.00 0.00 ? 13  ASP A HA   3  
ATOM   2922  H  HB2  . ASP A 1 13 ? 15.424  -8.644  15.571  1.00 0.00 ? 13  ASP A HB2  3  
ATOM   2923  H  HB3  . ASP A 1 13 ? 14.614  -7.134  15.163  1.00 0.00 ? 13  ASP A HB3  3  
ATOM   2924  N  N    . TYR A 1 14 ? 14.574  -8.485  11.625  1.00 0.00 ? 14  TYR A N    3  
ATOM   2925  C  CA   . TYR A 1 14 ? 15.374  -8.257  10.415  1.00 0.00 ? 14  TYR A CA   3  
ATOM   2926  C  C    . TYR A 1 14 ? 15.239  -6.786  10.011  1.00 0.00 ? 14  TYR A C    3  
ATOM   2927  O  O    . TYR A 1 14 ? 14.137  -6.297  9.769   1.00 0.00 ? 14  TYR A O    3  
ATOM   2928  C  CB   . TYR A 1 14 ? 14.928  -9.224  9.288   1.00 0.00 ? 14  TYR A CB   3  
ATOM   2929  C  CG   . TYR A 1 14 ? 15.351  -10.687 9.529   1.00 0.00 ? 14  TYR A CG   3  
ATOM   2930  C  CD1  . TYR A 1 14 ? 14.639  -11.531 10.392  1.00 0.00 ? 14  TYR A CD1  3  
ATOM   2931  C  CD2  . TYR A 1 14 ? 16.482  -11.218 8.903   1.00 0.00 ? 14  TYR A CD2  3  
ATOM   2932  C  CE1  . TYR A 1 14 ? 15.037  -12.838 10.605  1.00 0.00 ? 14  TYR A CE1  3  
ATOM   2933  C  CE2  . TYR A 1 14 ? 16.881  -12.518 9.112   1.00 0.00 ? 14  TYR A CE2  3  
ATOM   2934  C  CZ   . TYR A 1 14 ? 16.162  -13.324 9.965   1.00 0.00 ? 14  TYR A CZ   3  
ATOM   2935  O  OH   . TYR A 1 14 ? 16.567  -14.625 10.172  1.00 0.00 ? 14  TYR A OH   3  
ATOM   2936  H  H    . TYR A 1 14 ? 13.615  -8.616  11.530  1.00 0.00 ? 14  TYR A H    3  
ATOM   2937  H  HA   . TYR A 1 14 ? 16.418  -8.461  10.656  1.00 0.00 ? 14  TYR A HA   3  
ATOM   2938  H  HB2  . TYR A 1 14 ? 13.846  -9.201  9.201   1.00 0.00 ? 14  TYR A HB2  3  
ATOM   2939  H  HB3  . TYR A 1 14 ? 15.356  -8.905  8.344   1.00 0.00 ? 14  TYR A HB3  3  
ATOM   2940  H  HD1  . TYR A 1 14 ? 13.757  -11.152 10.894  1.00 0.00 ? 14  TYR A HD1  3  
ATOM   2941  H  HD2  . TYR A 1 14 ? 17.053  -10.590 8.230   1.00 0.00 ? 14  TYR A HD2  3  
ATOM   2942  H  HE1  . TYR A 1 14 ? 14.474  -13.474 11.278  1.00 0.00 ? 14  TYR A HE1  3  
ATOM   2943  H  HE2  . TYR A 1 14 ? 17.765  -12.899 8.613   1.00 0.00 ? 14  TYR A HE2  3  
ATOM   2944  H  HH   . TYR A 1 14 ? 15.816  -15.213 10.053  1.00 0.00 ? 14  TYR A HH   3  
ATOM   2945  N  N    . ILE A 1 15 ? 16.383  -6.087  9.960   1.00 0.00 ? 15  ILE A N    3  
ATOM   2946  C  CA   . ILE A 1 15 ? 16.450  -4.614  9.912   1.00 0.00 ? 15  ILE A CA   3  
ATOM   2947  C  C    . ILE A 1 15 ? 17.135  -4.180  8.595   1.00 0.00 ? 15  ILE A C    3  
ATOM   2948  O  O    . ILE A 1 15 ? 17.871  -4.965  7.990   1.00 0.00 ? 15  ILE A O    3  
ATOM   2949  C  CB   . ILE A 1 15 ? 17.265  -4.052  11.159  1.00 0.00 ? 15  ILE A CB   3  
ATOM   2950  C  CG1  . ILE A 1 15 ? 16.936  -4.817  12.480  1.00 0.00 ? 15  ILE A CG1  3  
ATOM   2951  C  CG2  . ILE A 1 15 ? 17.033  -2.536  11.348  1.00 0.00 ? 15  ILE A CG2  3  
ATOM   2952  C  CD1  . ILE A 1 15 ? 15.525  -4.640  12.980  1.00 0.00 ? 15  ILE A CD1  3  
ATOM   2953  H  H    . ILE A 1 15 ? 17.231  -6.583  9.917   1.00 0.00 ? 15  ILE A H    3  
ATOM   2954  H  HA   . ILE A 1 15 ? 15.442  -4.212  9.938   1.00 0.00 ? 15  ILE A HA   3  
ATOM   2955  H  HB   . ILE A 1 15 ? 18.314  -4.190  10.959  1.00 0.00 ? 15  ILE A HB   3  
ATOM   2956  H  HG12 . ILE A 1 15 ? 17.087  -5.878  12.326  1.00 0.00 ? 15  ILE A HG12 3  
ATOM   2957  H  HG13 . ILE A 1 15 ? 17.606  -4.484  13.263  1.00 0.00 ? 15  ILE A HG13 3  
ATOM   2958  H  HG21 . ILE A 1 15 ? 15.986  -2.342  11.560  1.00 0.00 ? 15  ILE A HG21 3  
ATOM   2959  H  HG22 . ILE A 1 15 ? 17.311  -2.006  10.444  1.00 0.00 ? 15  ILE A HG22 3  
ATOM   2960  H  HG23 . ILE A 1 15 ? 17.637  -2.170  12.170  1.00 0.00 ? 15  ILE A HG23 3  
ATOM   2961  H  HD11 . ILE A 1 15 ? 15.335  -3.592  13.149  1.00 0.00 ? 15  ILE A HD11 3  
ATOM   2962  H  HD12 . ILE A 1 15 ? 15.402  -5.183  13.904  1.00 0.00 ? 15  ILE A HD12 3  
ATOM   2963  H  HD13 . ILE A 1 15 ? 14.833  -5.018  12.243  1.00 0.00 ? 15  ILE A HD13 3  
ATOM   2964  N  N    . CYS A 1 16 ? 16.889  -2.936  8.158   1.00 0.00 ? 16  CYS A N    3  
ATOM   2965  C  CA   . CYS A 1 16 ? 17.540  -2.352  6.954   1.00 0.00 ? 16  CYS A CA   3  
ATOM   2966  C  C    . CYS A 1 16 ? 18.761  -1.494  7.354   1.00 0.00 ? 16  CYS A C    3  
ATOM   2967  O  O    . CYS A 1 16 ? 19.505  -1.047  6.480   1.00 0.00 ? 16  CYS A O    3  
ATOM   2968  C  CB   . CYS A 1 16 ? 16.512  -1.517  6.160   1.00 0.00 ? 16  CYS A CB   3  
ATOM   2969  S  SG   . CYS A 1 16 ? 17.061  -0.837  4.579   1.00 0.00 ? 16  CYS A SG   3  
ATOM   2970  H  H    . CYS A 1 16 ? 16.259  -2.386  8.662   1.00 0.00 ? 16  CYS A H    3  
ATOM   2971  H  HA   . CYS A 1 16 ? 17.885  -3.173  6.320   1.00 0.00 ? 16  CYS A HA   3  
ATOM   2972  H  HB2  . CYS A 1 16 ? 15.651  -2.136  5.937   1.00 0.00 ? 16  CYS A HB2  3  
ATOM   2973  H  HB3  . CYS A 1 16 ? 16.184  -0.682  6.769   1.00 0.00 ? 16  CYS A HB3  3  
ATOM   2974  N  N    . GLU A 1 17 ? 18.865  -1.209  8.682   1.00 0.00 ? 17  GLU A N    3  
ATOM   2975  C  CA   . GLU A 1 17 ? 20.052  -0.633  9.375   1.00 0.00 ? 17  GLU A CA   3  
ATOM   2976  C  C    . GLU A 1 17 ? 19.903  0.895   9.555   1.00 0.00 ? 17  GLU A C    3  
ATOM   2977  O  O    . GLU A 1 17 ? 20.513  1.476   10.456  1.00 0.00 ? 17  GLU A O    3  
ATOM   2978  C  CB   . GLU A 1 17 ? 21.418  -1.019  8.706   1.00 0.00 ? 17  GLU A CB   3  
ATOM   2979  C  CG   . GLU A 1 17 ? 22.678  -0.670  9.528   1.00 0.00 ? 17  GLU A CG   3  
ATOM   2980  C  CD   . GLU A 1 17 ? 23.989  -0.962  8.766   1.00 0.00 ? 17  GLU A CD   3  
ATOM   2981  O  OE1  . GLU A 1 17 ? 24.309  -0.202  7.824   1.00 0.00 ? 17  GLU A OE1  3  
ATOM   2982  O  OE2  . GLU A 1 17 ? 24.686  -1.956  9.079   1.00 0.00 ? 17  GLU A OE2  3  
ATOM   2983  H  H    . GLU A 1 17 ? 18.051  -1.320  9.220   1.00 0.00 ? 17  GLU A H    3  
ATOM   2984  H  HA   . GLU A 1 17 ? 20.038  -1.069  10.368  1.00 0.00 ? 17  GLU A HA   3  
ATOM   2985  H  HB2  . GLU A 1 17 ? 21.425  -2.091  8.519   1.00 0.00 ? 17  GLU A HB2  3  
ATOM   2986  H  HB3  . GLU A 1 17 ? 21.487  -0.515  7.747   1.00 0.00 ? 17  GLU A HB3  3  
ATOM   2987  H  HG2  . GLU A 1 17 ? 22.648  0.386   9.778   1.00 0.00 ? 17  GLU A HG2  3  
ATOM   2988  H  HG3  . GLU A 1 17 ? 22.662  -1.246  10.445  1.00 0.00 ? 17  GLU A HG3  3  
ATOM   2989  N  N    . TYR A 1 18 ? 19.031  1.534   8.748   1.00 0.00 ? 18  TYR A N    3  
ATOM   2990  C  CA   . TYR A 1 18 ? 18.795  2.989   8.821   1.00 0.00 ? 18  TYR A CA   3  
ATOM   2991  C  C    . TYR A 1 18 ? 17.288  3.258   8.746   1.00 0.00 ? 18  TYR A C    3  
ATOM   2992  O  O    . TYR A 1 18 ? 16.707  3.938   9.590   1.00 0.00 ? 18  TYR A O    3  
ATOM   2993  C  CB   . TYR A 1 18 ? 19.548  3.738   7.692   1.00 0.00 ? 18  TYR A CB   3  
ATOM   2994  C  CG   . TYR A 1 18 ? 19.630  5.245   7.933   1.00 0.00 ? 18  TYR A CG   3  
ATOM   2995  C  CD1  . TYR A 1 18 ? 20.200  5.729   9.113   1.00 0.00 ? 18  TYR A CD1  3  
ATOM   2996  C  CD2  . TYR A 1 18 ? 19.138  6.177   7.019   1.00 0.00 ? 18  TYR A CD2  3  
ATOM   2997  C  CE1  . TYR A 1 18 ? 20.273  7.075   9.371   1.00 0.00 ? 18  TYR A CE1  3  
ATOM   2998  C  CE2  . TYR A 1 18 ? 19.211  7.531   7.275   1.00 0.00 ? 18  TYR A CE2  3  
ATOM   2999  C  CZ   . TYR A 1 18 ? 19.781  7.975   8.454   1.00 0.00 ? 18  TYR A CZ   3  
ATOM   3000  O  OH   . TYR A 1 18 ? 19.853  9.329   8.717   1.00 0.00 ? 18  TYR A OH   3  
ATOM   3001  H  H    . TYR A 1 18 ? 18.473  1.000   8.144   1.00 0.00 ? 18  TYR A H    3  
ATOM   3002  H  HA   . TYR A 1 18 ? 19.165  3.349   9.789   1.00 0.00 ? 18  TYR A HA   3  
ATOM   3003  H  HB2  . TYR A 1 18 ? 20.557  3.354   7.627   1.00 0.00 ? 18  TYR A HB2  3  
ATOM   3004  H  HB3  . TYR A 1 18 ? 19.048  3.562   6.743   1.00 0.00 ? 18  TYR A HB3  3  
ATOM   3005  H  HD1  . TYR A 1 18 ? 20.591  5.026   9.839   1.00 0.00 ? 18  TYR A HD1  3  
ATOM   3006  H  HD2  . TYR A 1 18 ? 18.690  5.827   6.097   1.00 0.00 ? 18  TYR A HD2  3  
ATOM   3007  H  HE1  . TYR A 1 18 ? 20.715  7.413   10.297  1.00 0.00 ? 18  TYR A HE1  3  
ATOM   3008  H  HE2  . TYR A 1 18 ? 18.823  8.240   6.556   1.00 0.00 ? 18  TYR A HE2  3  
ATOM   3009  H  HH   . TYR A 1 18 ? 19.001  9.731   8.528   1.00 0.00 ? 18  TYR A HH   3  
ATOM   3010  N  N    . CYS A 1 19 ? 16.663  2.669   7.717   1.00 0.00 ? 19  CYS A N    3  
ATOM   3011  C  CA   . CYS A 1 19 ? 15.221  2.814   7.439   1.00 0.00 ? 19  CYS A CA   3  
ATOM   3012  C  C    . CYS A 1 19 ? 14.533  1.444   7.448   1.00 0.00 ? 19  CYS A C    3  
ATOM   3013  O  O    . CYS A 1 19 ? 14.247  0.884   6.392   1.00 0.00 ? 19  CYS A O    3  
ATOM   3014  C  CB   . CYS A 1 19 ? 15.014  3.547   6.087   1.00 0.00 ? 19  CYS A CB   3  
ATOM   3015  S  SG   . CYS A 1 19 ? 16.109  2.964   4.747   1.00 0.00 ? 19  CYS A SG   3  
ATOM   3016  H  H    . CYS A 1 19 ? 17.197  2.107   7.115   1.00 0.00 ? 19  CYS A H    3  
ATOM   3017  H  HA   . CYS A 1 19 ? 14.772  3.415   8.228   1.00 0.00 ? 19  CYS A HA   3  
ATOM   3018  H  HB2  . CYS A 1 19 ? 13.994  3.420   5.748   1.00 0.00 ? 19  CYS A HB2  3  
ATOM   3019  H  HB3  . CYS A 1 19 ? 15.210  4.604   6.222   1.00 0.00 ? 19  CYS A HB3  3  
ATOM   3020  N  N    . ALA A 1 20 ? 14.375  0.867   8.652   1.00 0.00 ? 20  ALA A N    3  
ATOM   3021  C  CA   . ALA A 1 20 ? 13.440  -0.244  8.897   1.00 0.00 ? 20  ALA A CA   3  
ATOM   3022  C  C    . ALA A 1 20 ? 13.234  -0.523  10.382  1.00 0.00 ? 20  ALA A C    3  
ATOM   3023  O  O    . ALA A 1 20 ? 14.144  -0.374  11.210  1.00 0.00 ? 20  ALA A O    3  
ATOM   3024  C  CB   . ALA A 1 20 ? 13.855  -1.549  8.208   1.00 0.00 ? 20  ALA A CB   3  
ATOM   3025  H  H    . ALA A 1 20 ? 14.918  1.199   9.391   1.00 0.00 ? 20  ALA A H    3  
ATOM   3026  H  HA   . ALA A 1 20 ? 12.489  0.061   8.478   1.00 0.00 ? 20  ALA A HA   3  
ATOM   3027  H  HB1  . ALA A 1 20 ? 14.818  -1.877  8.583   1.00 0.00 ? 20  ALA A HB1  3  
ATOM   3028  H  HB2  . ALA A 1 20 ? 13.930  -1.383  7.142   1.00 0.00 ? 20  ALA A HB2  3  
ATOM   3029  H  HB3  . ALA A 1 20 ? 13.118  -2.321  8.391   1.00 0.00 ? 20  ALA A HB3  3  
ATOM   3030  N  N    . ARG A 1 21 ? 11.993  -0.926  10.678  1.00 0.00 ? 21  ARG A N    3  
ATOM   3031  C  CA   . ARG A 1 21 ? 11.632  -1.599  11.929  1.00 0.00 ? 21  ARG A CA   3  
ATOM   3032  C  C    . ARG A 1 21 ? 12.082  -3.082  11.864  1.00 0.00 ? 21  ARG A C    3  
ATOM   3033  O  O    . ARG A 1 21 ? 12.849  -3.479  10.971  1.00 0.00 ? 21  ARG A O    3  
ATOM   3034  C  CB   . ARG A 1 21 ? 10.099  -1.503  12.173  1.00 0.00 ? 21  ARG A CB   3  
ATOM   3035  C  CG   . ARG A 1 21 ? 9.228   -2.106  11.046  1.00 0.00 ? 21  ARG A CG   3  
ATOM   3036  C  CD   . ARG A 1 21 ? 7.738   -2.178  11.430  1.00 0.00 ? 21  ARG A CD   3  
ATOM   3037  N  NE   . ARG A 1 21 ? 7.503   -3.129  12.533  1.00 0.00 ? 21  ARG A NE   3  
ATOM   3038  C  CZ   . ARG A 1 21 ? 6.545   -3.021  13.468  1.00 0.00 ? 21  ARG A CZ   3  
ATOM   3039  N  NH1  . ARG A 1 21 ? 5.786   -1.937  13.554  1.00 0.00 ? 21  ARG A NH1  3  
ATOM   3040  N  NH2  . ARG A 1 21 ? 6.387   -3.993  14.343  1.00 0.00 ? 21  ARG A NH2  3  
ATOM   3041  H  H    . ARG A 1 21 ? 11.297  -0.743  10.015  1.00 0.00 ? 21  ARG A H    3  
ATOM   3042  H  HA   . ARG A 1 21 ? 12.150  -1.106  12.742  1.00 0.00 ? 21  ARG A HA   3  
ATOM   3043  H  HB2  . ARG A 1 21 ? 9.859   -2.019  13.102  1.00 0.00 ? 21  ARG A HB2  3  
ATOM   3044  H  HB3  . ARG A 1 21 ? 9.828   -0.457  12.285  1.00 0.00 ? 21  ARG A HB3  3  
ATOM   3045  H  HG2  . ARG A 1 21 ? 9.332   -1.492  10.159  1.00 0.00 ? 21  ARG A HG2  3  
ATOM   3046  H  HG3  . ARG A 1 21 ? 9.585   -3.111  10.827  1.00 0.00 ? 21  ARG A HG3  3  
ATOM   3047  H  HD2  . ARG A 1 21 ? 7.396   -1.191  11.731  1.00 0.00 ? 21  ARG A HD2  3  
ATOM   3048  H  HD3  . ARG A 1 21 ? 7.170   -2.501  10.567  1.00 0.00 ? 21  ARG A HD3  3  
ATOM   3049  H  HE   . ARG A 1 21 ? 8.068   -3.938  12.545  1.00 0.00 ? 21  ARG A HE   3  
ATOM   3050  H  HH11 . ARG A 1 21 ? 5.905   -1.183  12.907  1.00 0.00 ? 21  ARG A HH11 3  
ATOM   3051  H  HH12 . ARG A 1 21 ? 5.072   -1.877  14.261  1.00 0.00 ? 21  ARG A HH12 3  
ATOM   3052  H  HH21 . ARG A 1 21 ? 6.964   -4.811  14.293  1.00 0.00 ? 21  ARG A HH21 3  
ATOM   3053  H  HH22 . ARG A 1 21 ? 5.686   -3.923  15.060  1.00 0.00 ? 21  ARG A HH22 3  
ATOM   3054  N  N    . ALA A 1 22 ? 11.609  -3.884  12.825  1.00 0.00 ? 22  ALA A N    3  
ATOM   3055  C  CA   . ALA A 1 22 ? 11.851  -5.331  12.855  1.00 0.00 ? 22  ALA A CA   3  
ATOM   3056  C  C    . ALA A 1 22 ? 10.873  -6.043  11.906  1.00 0.00 ? 22  ALA A C    3  
ATOM   3057  O  O    . ALA A 1 22 ? 9.661   -5.827  11.980  1.00 0.00 ? 22  ALA A O    3  
ATOM   3058  C  CB   . ALA A 1 22 ? 11.711  -5.844  14.291  1.00 0.00 ? 22  ALA A CB   3  
ATOM   3059  H  H    . ALA A 1 22 ? 11.060  -3.481  13.527  1.00 0.00 ? 22  ALA A H    3  
ATOM   3060  H  HA   . ALA A 1 22 ? 12.874  -5.519  12.527  1.00 0.00 ? 22  ALA A HA   3  
ATOM   3061  H  HB1  . ALA A 1 22 ? 11.908  -6.908  14.323  1.00 0.00 ? 22  ALA A HB1  3  
ATOM   3062  H  HB2  . ALA A 1 22 ? 10.708  -5.656  14.657  1.00 0.00 ? 22  ALA A HB2  3  
ATOM   3063  H  HB3  . ALA A 1 22 ? 12.422  -5.334  14.930  1.00 0.00 ? 22  ALA A HB3  3  
ATOM   3064  N  N    . PHE A 1 23 ? 11.418  -6.839  10.978  1.00 0.00 ? 23  PHE A N    3  
ATOM   3065  C  CA   . PHE A 1 23 ? 10.632  -7.686  10.061  1.00 0.00 ? 23  PHE A CA   3  
ATOM   3066  C  C    . PHE A 1 23 ? 10.861  -9.158  10.420  1.00 0.00 ? 23  PHE A C    3  
ATOM   3067  O  O    . PHE A 1 23 ? 11.941  -9.518  10.899  1.00 0.00 ? 23  PHE A O    3  
ATOM   3068  C  CB   . PHE A 1 23 ? 11.046  -7.411  8.590   1.00 0.00 ? 23  PHE A CB   3  
ATOM   3069  C  CG   . PHE A 1 23 ? 10.647  -6.030  8.068   1.00 0.00 ? 23  PHE A CG   3  
ATOM   3070  C  CD1  . PHE A 1 23 ? 11.414  -4.902  8.351   1.00 0.00 ? 23  PHE A CD1  3  
ATOM   3071  C  CD2  . PHE A 1 23 ? 9.516   -5.863  7.276   1.00 0.00 ? 23  PHE A CD2  3  
ATOM   3072  C  CE1  . PHE A 1 23 ? 11.058  -3.665  7.861   1.00 0.00 ? 23  PHE A CE1  3  
ATOM   3073  C  CE2  . PHE A 1 23 ? 9.167   -4.625  6.784   1.00 0.00 ? 23  PHE A CE2  3  
ATOM   3074  C  CZ   . PHE A 1 23 ? 9.940   -3.526  7.078   1.00 0.00 ? 23  PHE A CZ   3  
ATOM   3075  H  H    . PHE A 1 23 ? 12.395  -6.852  10.895  1.00 0.00 ? 23  PHE A H    3  
ATOM   3076  H  HA   . PHE A 1 23 ? 9.574   -7.456  10.187  1.00 0.00 ? 23  PHE A HA   3  
ATOM   3077  H  HB2  . PHE A 1 23 ? 12.124  -7.497  8.503   1.00 0.00 ? 23  PHE A HB2  3  
ATOM   3078  H  HB3  . PHE A 1 23 ? 10.593  -8.156  7.943   1.00 0.00 ? 23  PHE A HB3  3  
ATOM   3079  H  HD1  . PHE A 1 23 ? 12.298  -5.000  8.966   1.00 0.00 ? 23  PHE A HD1  3  
ATOM   3080  H  HD2  . PHE A 1 23 ? 8.899   -6.722  7.042   1.00 0.00 ? 23  PHE A HD2  3  
ATOM   3081  H  HE1  . PHE A 1 23 ? 11.663  -2.803  8.089   1.00 0.00 ? 23  PHE A HE1  3  
ATOM   3082  H  HE2  . PHE A 1 23 ? 8.286   -4.519  6.165   1.00 0.00 ? 23  PHE A HE2  3  
ATOM   3083  H  HZ   . PHE A 1 23 ? 9.664   -2.554  6.693   1.00 0.00 ? 23  PHE A HZ   3  
ATOM   3084  N  N    . LYS A 1 24 ? 9.840   -9.999  10.195  1.00 0.00 ? 24  LYS A N    3  
ATOM   3085  C  CA   . LYS A 1 24 ? 9.904   -11.439 10.494  1.00 0.00 ? 24  LYS A CA   3  
ATOM   3086  C  C    . LYS A 1 24 ? 11.001  -12.145 9.667   1.00 0.00 ? 24  LYS A C    3  
ATOM   3087  O  O    . LYS A 1 24 ? 11.600  -13.125 10.124  1.00 0.00 ? 24  LYS A O    3  
ATOM   3088  C  CB   . LYS A 1 24 ? 8.520   -12.092 10.228  1.00 0.00 ? 24  LYS A CB   3  
ATOM   3089  C  CG   . LYS A 1 24 ? 8.080   -12.098 8.739   1.00 0.00 ? 24  LYS A CG   3  
ATOM   3090  C  CD   . LYS A 1 24 ? 6.679   -12.707 8.511   1.00 0.00 ? 24  LYS A CD   3  
ATOM   3091  C  CE   . LYS A 1 24 ? 5.544   -11.846 9.096   1.00 0.00 ? 24  LYS A CE   3  
ATOM   3092  N  NZ   . LYS A 1 24 ? 4.208   -12.421 8.795   1.00 0.00 ? 24  LYS A NZ   3  
ATOM   3093  H  H    . LYS A 1 24 ? 8.988   -9.637  9.865   1.00 0.00 ? 24  LYS A H    3  
ATOM   3094  H  HA   . LYS A 1 24 ? 10.140  -11.543 11.551  1.00 0.00 ? 24  LYS A HA   3  
ATOM   3095  H  HB2  . LYS A 1 24 ? 8.544   -13.120 10.582  1.00 0.00 ? 24  LYS A HB2  3  
ATOM   3096  H  HB3  . LYS A 1 24 ? 7.773   -11.553 10.801  1.00 0.00 ? 24  LYS A HB3  3  
ATOM   3097  H  HG2  . LYS A 1 24 ? 8.082   -11.076 8.367   1.00 0.00 ? 24  LYS A HG2  3  
ATOM   3098  H  HG3  . LYS A 1 24 ? 8.807   -12.673 8.170   1.00 0.00 ? 24  LYS A HG3  3  
ATOM   3099  H  HD2  . LYS A 1 24 ? 6.516   -12.810 7.444   1.00 0.00 ? 24  LYS A HD2  3  
ATOM   3100  H  HD3  . LYS A 1 24 ? 6.646   -13.690 8.968   1.00 0.00 ? 24  LYS A HD3  3  
ATOM   3101  H  HE2  . LYS A 1 24 ? 5.658   -11.779 10.170  1.00 0.00 ? 24  LYS A HE2  3  
ATOM   3102  H  HE3  . LYS A 1 24 ? 5.593   -10.850 8.670   1.00 0.00 ? 24  LYS A HE3  3  
ATOM   3103  H  HZ1  . LYS A 1 24 ? 4.068   -12.487 7.768   1.00 0.00 ? 24  LYS A HZ1  3  
ATOM   3104  H  HZ2  . LYS A 1 24 ? 3.458   -11.818 9.195   1.00 0.00 ? 24  LYS A HZ2  3  
ATOM   3105  H  HZ3  . LYS A 1 24 ? 4.123   -13.374 9.206   1.00 0.00 ? 24  LYS A HZ3  3  
ATOM   3106  N  N    . SER A 1 25 ? 11.270  -11.618 8.453   1.00 0.00 ? 25  SER A N    3  
ATOM   3107  C  CA   . SER A 1 25 ? 12.187  -12.243 7.485   1.00 0.00 ? 25  SER A CA   3  
ATOM   3108  C  C    . SER A 1 25 ? 12.959  -11.173 6.693   1.00 0.00 ? 25  SER A C    3  
ATOM   3109  O  O    . SER A 1 25 ? 12.483  -10.043 6.517   1.00 0.00 ? 25  SER A O    3  
ATOM   3110  C  CB   . SER A 1 25 ? 11.402  -13.170 6.515   1.00 0.00 ? 25  SER A CB   3  
ATOM   3111  O  OG   . SER A 1 25 ? 10.730  -14.210 7.210   1.00 0.00 ? 25  SER A OG   3  
ATOM   3112  H  H    . SER A 1 25 ? 10.853  -10.766 8.197   1.00 0.00 ? 25  SER A H    3  
ATOM   3113  H  HA   . SER A 1 25 ? 12.906  -12.845 8.038   1.00 0.00 ? 25  SER A HA   3  
ATOM   3114  H  HB2  . SER A 1 25 ? 10.663  -12.594 5.972   1.00 0.00 ? 25  SER A HB2  3  
ATOM   3115  H  HB3  . SER A 1 25 ? 12.087  -13.625 5.807   1.00 0.00 ? 25  SER A HB3  3  
ATOM   3116  H  HG   . SER A 1 25 ? 11.185  -14.381 8.044   1.00 0.00 ? 25  SER A HG   3  
ATOM   3117  N  N    . SER A 1 26 ? 14.177  -11.543 6.264   1.00 0.00 ? 26  SER A N    3  
ATOM   3118  C  CA   . SER A 1 26 ? 15.016  -10.726 5.365   1.00 0.00 ? 26  SER A CA   3  
ATOM   3119  C  C    . SER A 1 26 ? 14.285  -10.412 4.039   1.00 0.00 ? 26  SER A C    3  
ATOM   3120  O  O    . SER A 1 26 ? 14.433  -9.329  3.482   1.00 0.00 ? 26  SER A O    3  
ATOM   3121  C  CB   . SER A 1 26 ? 16.345  -11.453 5.075   1.00 0.00 ? 26  SER A CB   3  
ATOM   3122  O  OG   . SER A 1 26 ? 17.205  -10.660 4.270   1.00 0.00 ? 26  SER A OG   3  
ATOM   3123  H  H    . SER A 1 26 ? 14.542  -12.379 6.632   1.00 0.00 ? 26  SER A H    3  
ATOM   3124  H  HA   . SER A 1 26 ? 15.230  -9.791  5.880   1.00 0.00 ? 26  SER A HA   3  
ATOM   3125  H  HB2  . SER A 1 26 ? 16.851  -11.667 6.006   1.00 0.00 ? 26  SER A HB2  3  
ATOM   3126  H  HB3  . SER A 1 26 ? 16.148  -12.383 4.555   1.00 0.00 ? 26  SER A HB3  3  
ATOM   3127  H  HG   . SER A 1 26 ? 17.676  -10.030 4.830   1.00 0.00 ? 26  SER A HG   3  
ATOM   3128  N  N    . HIS A 1 27 ? 13.517  -11.396 3.549   1.00 0.00 ? 27  HIS A N    3  
ATOM   3129  C  CA   . HIS A 1 27 ? 12.678  -11.266 2.338   1.00 0.00 ? 27  HIS A CA   3  
ATOM   3130  C  C    . HIS A 1 27 ? 11.480  -10.319 2.564   1.00 0.00 ? 27  HIS A C    3  
ATOM   3131  O  O    . HIS A 1 27 ? 11.048  -9.632  1.634   1.00 0.00 ? 27  HIS A O    3  
ATOM   3132  C  CB   . HIS A 1 27 ? 12.218  -12.657 1.839   1.00 0.00 ? 27  HIS A CB   3  
ATOM   3133  C  CG   . HIS A 1 27 ? 13.233  -13.350 0.967   1.00 0.00 ? 27  HIS A CG   3  
ATOM   3134  N  ND1  . HIS A 1 27 ? 13.203  -13.291 -0.408  1.00 0.00 ? 27  HIS A ND1  3  
ATOM   3135  C  CD2  . HIS A 1 27 ? 14.302  -14.115 1.277   1.00 0.00 ? 27  HIS A CD2  3  
ATOM   3136  C  CE1  . HIS A 1 27 ? 14.202  -13.990 -0.899  1.00 0.00 ? 27  HIS A CE1  3  
ATOM   3137  N  NE2  . HIS A 1 27 ? 14.885  -14.500 0.102   1.00 0.00 ? 27  HIS A NE2  3  
ATOM   3138  H  H    . HIS A 1 27 ? 13.515  -12.255 4.021   1.00 0.00 ? 27  HIS A H    3  
ATOM   3139  H  HA   . HIS A 1 27 ? 13.302  -10.817 1.570   1.00 0.00 ? 27  HIS A HA   3  
ATOM   3140  H  HB2  . HIS A 1 27 ? 12.020  -13.297 2.689   1.00 0.00 ? 27  HIS A HB2  3  
ATOM   3141  H  HB3  . HIS A 1 27 ? 11.307  -12.560 1.262   1.00 0.00 ? 27  HIS A HB3  3  
ATOM   3142  H  HD1  . HIS A 1 27 ? 12.544  -12.802 -0.947  1.00 0.00 ? 27  HIS A HD1  3  
ATOM   3143  H  HD2  . HIS A 1 27 ? 14.636  -14.371 2.271   1.00 0.00 ? 27  HIS A HD2  3  
ATOM   3144  H  HE1  . HIS A 1 27 ? 14.420  -14.126 -1.949  1.00 0.00 ? 27  HIS A HE1  3  
ATOM   3145  H  HE2  . HIS A 1 27 ? 15.762  -14.932 0.019   1.00 0.00 ? 27  HIS A HE2  3  
ATOM   3146  N  N    . ASN A 1 28 ? 10.922  -10.338 3.785   1.00 0.00 ? 28  ASN A N    3  
ATOM   3147  C  CA   . ASN A 1 28 ? 9.840   -9.410  4.200   1.00 0.00 ? 28  ASN A CA   3  
ATOM   3148  C  C    . ASN A 1 28 ? 10.329  -7.946  4.149   1.00 0.00 ? 28  ASN A C    3  
ATOM   3149  O  O    . ASN A 1 28 ? 9.629   -7.049  3.669   1.00 0.00 ? 28  ASN A O    3  
ATOM   3150  C  CB   . ASN A 1 28 ? 9.377   -9.770  5.636   1.00 0.00 ? 28  ASN A CB   3  
ATOM   3151  C  CG   . ASN A 1 28 ? 8.156   -8.987  6.152   1.00 0.00 ? 28  ASN A CG   3  
ATOM   3152  O  OD1  . ASN A 1 28 ? 8.013   -8.778  7.358   1.00 0.00 ? 28  ASN A OD1  3  
ATOM   3153  N  ND2  . ASN A 1 28 ? 7.253   -8.570  5.272   1.00 0.00 ? 28  ASN A ND2  3  
ATOM   3154  H  H    . ASN A 1 28 ? 11.242  -10.996 4.434   1.00 0.00 ? 28  ASN A H    3  
ATOM   3155  H  HA   . ASN A 1 28 ? 9.007   -9.533  3.514   1.00 0.00 ? 28  ASN A HA   3  
ATOM   3156  H  HB2  . ASN A 1 28 ? 9.136   -10.823 5.674   1.00 0.00 ? 28  ASN A HB2  3  
ATOM   3157  H  HB3  . ASN A 1 28 ? 10.210  -9.575  6.316   1.00 0.00 ? 28  ASN A HB3  3  
ATOM   3158  H  HD21 . ASN A 1 28 ? 7.392   -8.764  4.324   1.00 0.00 ? 28  ASN A HD21 3  
ATOM   3159  H  HD22 . ASN A 1 28 ? 6.473   -8.084  5.613   1.00 0.00 ? 28  ASN A HD22 3  
ATOM   3160  N  N    . LEU A 1 29 ? 11.533  -7.727  4.694   1.00 0.00 ? 29  LEU A N    3  
ATOM   3161  C  CA   . LEU A 1 29 ? 12.239  -6.427  4.643   1.00 0.00 ? 29  LEU A CA   3  
ATOM   3162  C  C    . LEU A 1 29 ? 12.681  -6.102  3.197   1.00 0.00 ? 29  LEU A C    3  
ATOM   3163  O  O    . LEU A 1 29 ? 12.763  -4.926  2.821   1.00 0.00 ? 29  LEU A O    3  
ATOM   3164  C  CB   . LEU A 1 29 ? 13.425  -6.448  5.691   1.00 0.00 ? 29  LEU A CB   3  
ATOM   3165  C  CG   . LEU A 1 29 ? 14.907  -6.375  5.167   1.00 0.00 ? 29  LEU A CG   3  
ATOM   3166  C  CD1  . LEU A 1 29 ? 15.353  -4.930  4.821   1.00 0.00 ? 29  LEU A CD1  3  
ATOM   3167  C  CD2  . LEU A 1 29 ? 15.884  -7.029  6.173   1.00 0.00 ? 29  LEU A CD2  3  
ATOM   3168  H  H    . LEU A 1 29 ? 11.938  -8.457  5.208   1.00 0.00 ? 29  LEU A H    3  
ATOM   3169  H  HA   . LEU A 1 29 ? 11.524  -5.660  4.944   1.00 0.00 ? 29  LEU A HA   3  
ATOM   3170  H  HB2  . LEU A 1 29 ? 13.278  -5.621  6.387   1.00 0.00 ? 29  LEU A HB2  3  
ATOM   3171  H  HB3  . LEU A 1 29 ? 13.322  -7.369  6.267   1.00 0.00 ? 29  LEU A HB3  3  
ATOM   3172  H  HG   . LEU A 1 29 ? 14.967  -6.945  4.250   1.00 0.00 ? 29  LEU A HG   3  
ATOM   3173  H  HD11 . LEU A 1 29 ? 15.286  -4.298  5.697   1.00 0.00 ? 29  LEU A HD11 3  
ATOM   3174  H  HD12 . LEU A 1 29 ? 14.716  -4.533  4.041   1.00 0.00 ? 29  LEU A HD12 3  
ATOM   3175  H  HD13 . LEU A 1 29 ? 16.373  -4.945  4.465   1.00 0.00 ? 29  LEU A HD13 3  
ATOM   3176  H  HD21 . LEU A 1 29 ? 15.595  -8.060  6.339   1.00 0.00 ? 29  LEU A HD21 3  
ATOM   3177  H  HD22 . LEU A 1 29 ? 15.865  -6.498  7.116   1.00 0.00 ? 29  LEU A HD22 3  
ATOM   3178  H  HD23 . LEU A 1 29 ? 16.890  -7.009  5.772   1.00 0.00 ? 29  LEU A HD23 3  
ATOM   3179  N  N    . ALA A 1 30 ? 12.949  -7.158  2.397   1.00 0.00 ? 30  ALA A N    3  
ATOM   3180  C  CA   . ALA A 1 30 ? 13.305  -7.025  0.961   1.00 0.00 ? 30  ALA A CA   3  
ATOM   3181  C  C    . ALA A 1 30 ? 12.147  -6.393  0.142   1.00 0.00 ? 30  ALA A C    3  
ATOM   3182  O  O    . ALA A 1 30 ? 12.385  -5.786  -0.912  1.00 0.00 ? 30  ALA A O    3  
ATOM   3183  C  CB   . ALA A 1 30 ? 13.749  -8.364  0.347   1.00 0.00 ? 30  ALA A CB   3  
ATOM   3184  H  H    . ALA A 1 30 ? 12.920  -8.050  2.799   1.00 0.00 ? 30  ALA A H    3  
ATOM   3185  H  HA   . ALA A 1 30 ? 14.159  -6.351  0.914   1.00 0.00 ? 30  ALA A HA   3  
ATOM   3186  H  HB1  . ALA A 1 30 ? 14.097  -8.209  -0.668  1.00 0.00 ? 30  ALA A HB1  3  
ATOM   3187  H  HB2  . ALA A 1 30 ? 12.916  -9.054  0.336   1.00 0.00 ? 30  ALA A HB2  3  
ATOM   3188  H  HB3  . ALA A 1 30 ? 14.553  -8.792  0.937   1.00 0.00 ? 30  ALA A HB3  3  
ATOM   3189  N  N    . VAL A 1 31 ? 10.900  -6.566  0.630   1.00 0.00 ? 31  VAL A N    3  
ATOM   3190  C  CA   . VAL A 1 31 ? 9.719   -5.876  0.073   1.00 0.00 ? 31  VAL A CA   3  
ATOM   3191  C  C    . VAL A 1 31 ? 9.875   -4.334  0.224   1.00 0.00 ? 31  VAL A C    3  
ATOM   3192  O  O    . VAL A 1 31 ? 9.706   -3.593  -0.749  1.00 0.00 ? 31  VAL A O    3  
ATOM   3193  C  CB   . VAL A 1 31 ? 8.387   -6.386  0.742   1.00 0.00 ? 31  VAL A CB   3  
ATOM   3194  C  CG1  . VAL A 1 31 ? 7.144   -5.664  0.165   1.00 0.00 ? 31  VAL A CG1  3  
ATOM   3195  C  CG2  . VAL A 1 31 ? 8.252   -7.931  0.601   1.00 0.00 ? 31  VAL A CG2  3  
ATOM   3196  H  H    . VAL A 1 31 ? 10.785  -7.181  1.391   1.00 0.00 ? 31  VAL A H    3  
ATOM   3197  H  HA   . VAL A 1 31 ? 9.677   -6.108  -0.984  1.00 0.00 ? 31  VAL A HA   3  
ATOM   3198  H  HB   . VAL A 1 31 ? 8.440   -6.154  1.807   1.00 0.00 ? 31  VAL A HB   3  
ATOM   3199  H  HG11 . VAL A 1 31 ? 7.237   -4.594  0.316   1.00 0.00 ? 31  VAL A HG11 3  
ATOM   3200  H  HG12 . VAL A 1 31 ? 6.251   -6.015  0.668   1.00 0.00 ? 31  VAL A HG12 3  
ATOM   3201  H  HG13 . VAL A 1 31 ? 7.062   -5.870  -0.897  1.00 0.00 ? 31  VAL A HG13 3  
ATOM   3202  H  HG21 . VAL A 1 31 ? 9.095   -8.419  1.080   1.00 0.00 ? 31  VAL A HG21 3  
ATOM   3203  H  HG22 . VAL A 1 31 ? 8.233   -8.205  -0.446  1.00 0.00 ? 31  VAL A HG22 3  
ATOM   3204  H  HG23 . VAL A 1 31 ? 7.334   -8.266  1.074   1.00 0.00 ? 31  VAL A HG23 3  
ATOM   3205  N  N    . HIS A 1 32 ? 10.262  -3.872  1.438   1.00 0.00 ? 32  HIS A N    3  
ATOM   3206  C  CA   . HIS A 1 32 ? 10.608  -2.443  1.711   1.00 0.00 ? 32  HIS A CA   3  
ATOM   3207  C  C    . HIS A 1 32 ? 11.829  -2.014  0.868   1.00 0.00 ? 32  HIS A C    3  
ATOM   3208  O  O    . HIS A 1 32 ? 11.895  -0.888  0.359   1.00 0.00 ? 32  HIS A O    3  
ATOM   3209  C  CB   . HIS A 1 32 ? 10.905  -2.207  3.242   1.00 0.00 ? 32  HIS A CB   3  
ATOM   3210  C  CG   . HIS A 1 32 ? 11.854  -1.045  3.529   1.00 0.00 ? 32  HIS A CG   3  
ATOM   3211  N  ND1  . HIS A 1 32 ? 11.494  0.286   3.493   1.00 0.00 ? 32  HIS A ND1  3  
ATOM   3212  C  CD2  . HIS A 1 32 ? 13.200  -1.053  3.757   1.00 0.00 ? 32  HIS A CD2  3  
ATOM   3213  C  CE1  . HIS A 1 32 ? 12.599  1.023   3.682   1.00 0.00 ? 32  HIS A CE1  3  
ATOM   3214  N  NE2  . HIS A 1 32 ? 13.670  0.262   3.847   1.00 0.00 ? 32  HIS A NE2  3  
ATOM   3215  H  H    . HIS A 1 32 ? 10.331  -4.508  2.169   1.00 0.00 ? 32  HIS A H    3  
ATOM   3216  H  HA   . HIS A 1 32 ? 9.758   -1.835  1.414   1.00 0.00 ? 32  HIS A HA   3  
ATOM   3217  H  HB2  . HIS A 1 32 ? 9.978   -2.005  3.767   1.00 0.00 ? 32  HIS A HB2  3  
ATOM   3218  H  HB3  . HIS A 1 32 ? 11.348  -3.103  3.660   1.00 0.00 ? 32  HIS A HB3  3  
ATOM   3219  H  HD1  . HIS A 1 32 ? 10.591  0.636   3.335   1.00 0.00 ? 32  HIS A HD1  3  
ATOM   3220  H  HD2  . HIS A 1 32 ? 13.813  -1.940  3.836   1.00 0.00 ? 32  HIS A HD2  3  
ATOM   3221  H  HE1  . HIS A 1 32 ? 12.613  2.103   3.701   1.00 0.00 ? 32  HIS A HE1  3  
ATOM   3222  N  N    . ARG A 1 33 ? 12.780  -2.952  0.740   1.00 0.00 ? 33  ARG A N    3  
ATOM   3223  C  CA   . ARG A 1 33 ? 14.075  -2.750  0.059   1.00 0.00 ? 33  ARG A CA   3  
ATOM   3224  C  C    . ARG A 1 33 ? 13.904  -2.488  -1.461  1.00 0.00 ? 33  ARG A C    3  
ATOM   3225  O  O    . ARG A 1 33 ? 14.886  -2.283  -2.145  1.00 0.00 ? 33  ARG A O    3  
ATOM   3226  C  CB   . ARG A 1 33 ? 14.962  -3.998  0.316   1.00 0.00 ? 33  ARG A CB   3  
ATOM   3227  C  CG   . ARG A 1 33 ? 16.455  -3.879  -0.040  1.00 0.00 ? 33  ARG A CG   3  
ATOM   3228  C  CD   . ARG A 1 33 ? 17.178  -5.238  0.025   1.00 0.00 ? 33  ARG A CD   3  
ATOM   3229  N  NE   . ARG A 1 33 ? 18.618  -5.099  -0.252  1.00 0.00 ? 33  ARG A NE   3  
ATOM   3230  C  CZ   . ARG A 1 33 ? 19.413  -6.069  -0.728  1.00 0.00 ? 33  ARG A CZ   3  
ATOM   3231  N  NH1  . ARG A 1 33 ? 18.913  -7.235  -1.129  1.00 0.00 ? 33  ARG A NH1  3  
ATOM   3232  N  NH2  . ARG A 1 33 ? 20.717  -5.847  -0.835  1.00 0.00 ? 33  ARG A NH2  3  
ATOM   3233  H  H    . ARG A 1 33 ? 12.613  -3.823  1.148   1.00 0.00 ? 33  ARG A H    3  
ATOM   3234  H  HA   . ARG A 1 33 ? 14.554  -1.884  0.506   1.00 0.00 ? 33  ARG A HA   3  
ATOM   3235  H  HB2  . ARG A 1 33 ? 14.894  -4.259  1.373   1.00 0.00 ? 33  ARG A HB2  3  
ATOM   3236  H  HB3  . ARG A 1 33 ? 14.548  -4.823  -0.253  1.00 0.00 ? 33  ARG A HB3  3  
ATOM   3237  H  HG2  . ARG A 1 33 ? 16.547  -3.484  -1.045  1.00 0.00 ? 33  ARG A HG2  3  
ATOM   3238  H  HG3  . ARG A 1 33 ? 16.930  -3.192  0.658   1.00 0.00 ? 33  ARG A HG3  3  
ATOM   3239  H  HD2  . ARG A 1 33 ? 17.050  -5.666  1.017   1.00 0.00 ? 33  ARG A HD2  3  
ATOM   3240  H  HD3  . ARG A 1 33 ? 16.736  -5.909  -0.711  1.00 0.00 ? 33  ARG A HD3  3  
ATOM   3241  H  HE   . ARG A 1 33 ? 19.024  -4.236  -0.024  1.00 0.00 ? 33  ARG A HE   3  
ATOM   3242  H  HH11 . ARG A 1 33 ? 17.922  -7.410  -1.080  1.00 0.00 ? 33  ARG A HH11 3  
ATOM   3243  H  HH12 . ARG A 1 33 ? 19.518  -7.951  -1.480  1.00 0.00 ? 33  ARG A HH12 3  
ATOM   3244  H  HH21 . ARG A 1 33 ? 21.104  -4.966  -0.544  1.00 0.00 ? 33  ARG A HH21 3  
ATOM   3245  H  HH22 . ARG A 1 33 ? 21.325  -6.552  -1.211  1.00 0.00 ? 33  ARG A HH22 3  
ATOM   3246  N  N    . MET A 1 34 ? 12.633  -2.428  -1.949  1.00 0.00 ? 34  MET A N    3  
ATOM   3247  C  CA   . MET A 1 34 ? 12.260  -2.018  -3.344  1.00 0.00 ? 34  MET A CA   3  
ATOM   3248  C  C    . MET A 1 34 ? 13.021  -0.740  -3.843  1.00 0.00 ? 34  MET A C    3  
ATOM   3249  O  O    . MET A 1 34 ? 13.131  -0.503  -5.049  1.00 0.00 ? 34  MET A O    3  
ATOM   3250  C  CB   . MET A 1 34 ? 10.716  -1.758  -3.403  1.00 0.00 ? 34  MET A CB   3  
ATOM   3251  C  CG   . MET A 1 34 ? 10.241  -0.495  -2.626  1.00 0.00 ? 34  MET A CG   3  
ATOM   3252  S  SD   . MET A 1 34 ? 8.466   -0.144  -2.751  1.00 0.00 ? 34  MET A SD   3  
ATOM   3253  C  CE   . MET A 1 34 ? 7.753   -1.287  -1.573  1.00 0.00 ? 34  MET A CE   3  
ATOM   3254  H  H    . MET A 1 34 ? 11.923  -2.765  -1.352  1.00 0.00 ? 34  MET A H    3  
ATOM   3255  H  HA   . MET A 1 34 ? 12.502  -2.841  -4.004  1.00 0.00 ? 34  MET A HA   3  
ATOM   3256  H  HB2  . MET A 1 34 ? 10.430  -1.647  -4.436  1.00 0.00 ? 34  MET A HB2  3  
ATOM   3257  H  HB3  . MET A 1 34 ? 10.193  -2.621  -2.998  1.00 0.00 ? 34  MET A HB3  3  
ATOM   3258  H  HG2  . MET A 1 34 ? 10.483  -0.625  -1.583  1.00 0.00 ? 34  MET A HG2  3  
ATOM   3259  H  HG3  . MET A 1 34 ? 10.774  0.371   -3.000  1.00 0.00 ? 34  MET A HG3  3  
ATOM   3260  H  HE1  . MET A 1 34 ? 6.673   -1.190  -1.571  1.00 0.00 ? 34  MET A HE1  3  
ATOM   3261  H  HE2  . MET A 1 34 ? 8.131   -1.071  -0.587  1.00 0.00 ? 34  MET A HE2  3  
ATOM   3262  H  HE3  . MET A 1 34 ? 8.023   -2.293  -1.857  1.00 0.00 ? 34  MET A HE3  3  
ATOM   3263  N  N    . ILE A 1 35 ? 13.559  0.033   -2.882  1.00 0.00 ? 35  ILE A N    3  
ATOM   3264  C  CA   . ILE A 1 35 ? 14.339  1.241   -3.106  1.00 0.00 ? 35  ILE A CA   3  
ATOM   3265  C  C    . ILE A 1 35 ? 15.852  0.888   -3.322  1.00 0.00 ? 35  ILE A C    3  
ATOM   3266  O  O    . ILE A 1 35 ? 16.444  1.316   -4.316  1.00 0.00 ? 35  ILE A O    3  
ATOM   3267  C  CB   . ILE A 1 35 ? 14.090  2.270   -1.923  1.00 0.00 ? 35  ILE A CB   3  
ATOM   3268  C  CG1  . ILE A 1 35 ? 15.154  3.411   -1.896  1.00 0.00 ? 35  ILE A CG1  3  
ATOM   3269  C  CG2  . ILE A 1 35 ? 13.967  1.565   -0.551  1.00 0.00 ? 35  ILE A CG2  3  
ATOM   3270  C  CD1  . ILE A 1 35 ? 15.141  4.345   -3.099  1.00 0.00 ? 35  ILE A CD1  3  
ATOM   3271  H  H    . ILE A 1 35 ? 13.499  -0.303  -1.981  1.00 0.00 ? 35  ILE A H    3  
ATOM   3272  H  HA   . ILE A 1 35 ? 13.968  1.707   -4.021  1.00 0.00 ? 35  ILE A HA   3  
ATOM   3273  H  HB   . ILE A 1 35 ? 13.121  2.726   -2.111  1.00 0.00 ? 35  ILE A HB   3  
ATOM   3274  H  HG12 . ILE A 1 35 ? 15.000  4.020   -1.016  1.00 0.00 ? 35  ILE A HG12 3  
ATOM   3275  H  HG13 . ILE A 1 35 ? 16.137  2.960   -1.836  1.00 0.00 ? 35  ILE A HG13 3  
ATOM   3276  H  HG21 . ILE A 1 35 ? 14.884  1.036   -0.330  1.00 0.00 ? 35  ILE A HG21 3  
ATOM   3277  H  HG22 . ILE A 1 35 ? 13.148  0.854   -0.577  1.00 0.00 ? 35  ILE A HG22 3  
ATOM   3278  H  HG23 . ILE A 1 35 ? 13.779  2.292   0.229   1.00 0.00 ? 35  ILE A HG23 3  
ATOM   3279  H  HD11 . ILE A 1 35 ? 14.175  4.827   -3.173  1.00 0.00 ? 35  ILE A HD11 3  
ATOM   3280  H  HD12 . ILE A 1 35 ? 15.334  3.779   -3.998  1.00 0.00 ? 35  ILE A HD12 3  
ATOM   3281  H  HD13 . ILE A 1 35 ? 15.909  5.096   -2.977  1.00 0.00 ? 35  ILE A HD13 3  
ATOM   3282  N  N    . HIS A 1 36 ? 16.461  0.086   -2.409  1.00 0.00 ? 36  HIS A N    3  
ATOM   3283  C  CA   . HIS A 1 36 ? 17.944  -0.214  -2.420  1.00 0.00 ? 36  HIS A CA   3  
ATOM   3284  C  C    . HIS A 1 36 ? 18.255  -1.614  -3.009  1.00 0.00 ? 36  HIS A C    3  
ATOM   3285  O  O    . HIS A 1 36 ? 19.411  -2.056  -2.989  1.00 0.00 ? 36  HIS A O    3  
ATOM   3286  C  CB   . HIS A 1 36 ? 18.576  -0.131  -0.975  1.00 0.00 ? 36  HIS A CB   3  
ATOM   3287  C  CG   . HIS A 1 36 ? 17.745  0.579   0.058   1.00 0.00 ? 36  HIS A CG   3  
ATOM   3288  N  ND1  . HIS A 1 36 ? 17.732  1.936   0.240   1.00 0.00 ? 36  HIS A ND1  3  
ATOM   3289  C  CD2  . HIS A 1 36 ? 16.895  0.069   0.984   1.00 0.00 ? 36  HIS A CD2  3  
ATOM   3290  C  CE1  . HIS A 1 36 ? 16.900  2.203   1.253   1.00 0.00 ? 36  HIS A CE1  3  
ATOM   3291  N  NE2  . HIS A 1 36 ? 16.359  1.099   1.739   1.00 0.00 ? 36  HIS A NE2  3  
ATOM   3292  H  H    . HIS A 1 36 ? 15.915  -0.340  -1.718  1.00 0.00 ? 36  HIS A H    3  
ATOM   3293  H  HA   . HIS A 1 36 ? 18.427  0.526   -3.051  1.00 0.00 ? 36  HIS A HA   3  
ATOM   3294  H  HB2  . HIS A 1 36 ? 18.770  -1.131  -0.592  1.00 0.00 ? 36  HIS A HB2  3  
ATOM   3295  H  HB3  . HIS A 1 36 ? 19.527  0.389   -1.034  1.00 0.00 ? 36  HIS A HB3  3  
ATOM   3296  H  HD1  . HIS A 1 36 ? 18.231  2.598   -0.286  1.00 0.00 ? 36  HIS A HD1  3  
ATOM   3297  H  HD2  . HIS A 1 36 ? 16.667  -0.976  1.129   1.00 0.00 ? 36  HIS A HD2  3  
ATOM   3298  H  HE1  . HIS A 1 36 ? 16.697  3.199   1.626   1.00 0.00 ? 36  HIS A HE1  3  
ATOM   3299  N  N    . THR A 1 37 ? 17.221  -2.292  -3.512  1.00 0.00 ? 37  THR A N    3  
ATOM   3300  C  CA   . THR A 1 37 ? 17.252  -3.747  -3.800  1.00 0.00 ? 37  THR A CA   3  
ATOM   3301  C  C    . THR A 1 37 ? 18.346  -4.157  -4.816  1.00 0.00 ? 37  THR A C    3  
ATOM   3302  O  O    . THR A 1 37 ? 19.208  -4.991  -4.501  1.00 0.00 ? 37  THR A O    3  
ATOM   3303  C  CB   . THR A 1 37 ? 15.825  -4.243  -4.253  1.00 0.00 ? 37  THR A CB   3  
ATOM   3304  O  OG1  . THR A 1 37 ? 15.845  -5.604  -4.678  1.00 0.00 ? 37  THR A OG1  3  
ATOM   3305  C  CG2  . THR A 1 37 ? 15.212  -3.365  -5.355  1.00 0.00 ? 37  THR A CG2  3  
ATOM   3306  H  H    . THR A 1 37 ? 16.397  -1.795  -3.702  1.00 0.00 ? 37  THR A H    3  
ATOM   3307  H  HA   . THR A 1 37 ? 17.475  -4.245  -2.857  1.00 0.00 ? 37  THR A HA   3  
ATOM   3308  H  HB   . THR A 1 37 ? 15.170  -4.186  -3.389  1.00 0.00 ? 37  THR A HB   3  
ATOM   3309  H  HG1  . THR A 1 37 ? 16.015  -6.178  -3.915  1.00 0.00 ? 37  THR A HG1  3  
ATOM   3310  H  HG21 . THR A 1 37 ? 15.842  -3.392  -6.237  1.00 0.00 ? 37  THR A HG21 3  
ATOM   3311  H  HG22 . THR A 1 37 ? 15.131  -2.342  -5.004  1.00 0.00 ? 37  THR A HG22 3  
ATOM   3312  H  HG23 . THR A 1 37 ? 14.227  -3.734  -5.610  1.00 0.00 ? 37  THR A HG23 3  
ATOM   3313  N  N    . GLY A 1 38 ? 18.315  -3.568  -6.024  1.00 0.00 ? 38  GLY A N    3  
ATOM   3314  C  CA   . GLY A 1 38 ? 19.138  -4.023  -7.153  1.00 0.00 ? 38  GLY A CA   3  
ATOM   3315  C  C    . GLY A 1 38 ? 18.542  -5.256  -7.854  1.00 0.00 ? 38  GLY A C    3  
ATOM   3316  O  O    . GLY A 1 38 ? 18.711  -5.437  -9.062  1.00 0.00 ? 38  GLY A O    3  
ATOM   3317  H  H    . GLY A 1 38 ? 17.728  -2.802  -6.157  1.00 0.00 ? 38  GLY A H    3  
ATOM   3318  H  HA2  . GLY A 1 38 ? 19.204  -3.210  -7.865  1.00 0.00 ? 38  GLY A HA2  3  
ATOM   3319  H  HA3  . GLY A 1 38 ? 20.143  -4.258  -6.811  1.00 0.00 ? 38  GLY A HA3  3  
ATOM   3320  N  N    . GLU A 1 39 ? 17.849  -6.107  -7.068  1.00 0.00 ? 39  GLU A N    3  
ATOM   3321  C  CA   . GLU A 1 39 ? 17.113  -7.293  -7.536  1.00 0.00 ? 39  GLU A CA   3  
ATOM   3322  C  C    . GLU A 1 39 ? 15.836  -6.858  -8.281  1.00 0.00 ? 39  GLU A C    3  
ATOM   3323  O  O    . GLU A 1 39 ? 15.534  -7.366  -9.372  1.00 0.00 ? 39  GLU A O    3  
ATOM   3324  C  CB   . GLU A 1 39 ? 16.730  -8.147  -6.283  1.00 0.00 ? 39  GLU A CB   3  
ATOM   3325  C  CG   . GLU A 1 39 ? 17.870  -8.346  -5.257  1.00 0.00 ? 39  GLU A CG   3  
ATOM   3326  C  CD   . GLU A 1 39 ? 17.363  -8.808  -3.877  1.00 0.00 ? 39  GLU A CD   3  
ATOM   3327  O  OE1  . GLU A 1 39 ? 16.914  -7.948  -3.080  1.00 0.00 ? 39  GLU A OE1  3  
ATOM   3328  O  OE2  . GLU A 1 39 ? 17.408  -10.022 -3.584  1.00 0.00 ? 39  GLU A OE2  3  
ATOM   3329  H  H    . GLU A 1 39 ? 17.869  -5.979  -6.108  1.00 0.00 ? 39  GLU A H    3  
ATOM   3330  H  HA   . GLU A 1 39 ? 17.750  -7.877  -8.196  1.00 0.00 ? 39  GLU A HA   3  
ATOM   3331  H  HB2  . GLU A 1 39 ? 15.906  -7.660  -5.769  1.00 0.00 ? 39  GLU A HB2  3  
ATOM   3332  H  HB3  . GLU A 1 39 ? 16.395  -9.130  -6.609  1.00 0.00 ? 39  GLU A HB3  3  
ATOM   3333  H  HG2  . GLU A 1 39 ? 18.568  -9.080  -5.651  1.00 0.00 ? 39  GLU A HG2  3  
ATOM   3334  H  HG3  . GLU A 1 39 ? 18.399  -7.404  -5.134  1.00 0.00 ? 39  GLU A HG3  3  
ATOM   3335  N  N    . LYS A 1 40 ? 15.120  -5.894  -7.648  1.00 0.00 ? 40  LYS A N    3  
ATOM   3336  C  CA   . LYS A 1 40 ? 13.796  -5.405  -8.071  1.00 0.00 ? 40  LYS A CA   3  
ATOM   3337  C  C    . LYS A 1 40 ? 12.727  -6.506  -7.928  1.00 0.00 ? 40  LYS A C    3  
ATOM   3338  O  O    . LYS A 1 40 ? 12.634  -7.377  -8.792  1.00 0.00 ? 40  LYS A O    3  
ATOM   3339  C  CB   . LYS A 1 40 ? 13.807  -4.763  -9.502  1.00 0.00 ? 40  LYS A CB   3  
ATOM   3340  C  CG   . LYS A 1 40 ? 14.421  -3.340  -9.569  1.00 0.00 ? 40  LYS A CG   3  
ATOM   3341  C  CD   . LYS A 1 40 ? 13.606  -2.311  -8.741  1.00 0.00 ? 40  LYS A CD   3  
ATOM   3342  C  CE   . LYS A 1 40 ? 14.190  -0.886  -8.808  1.00 0.00 ? 40  LYS A CE   3  
ATOM   3343  N  NZ   . LYS A 1 40 ? 13.448  0.051   -7.930  1.00 0.00 ? 40  LYS A NZ   3  
ATOM   3344  H  H    . LYS A 1 40 ? 15.502  -5.500  -6.844  1.00 0.00 ? 40  LYS A H    3  
ATOM   3345  H  HA   . LYS A 1 40 ? 13.543  -4.624  -7.365  1.00 0.00 ? 40  LYS A HA   3  
ATOM   3346  H  HB2  . LYS A 1 40 ? 14.376  -5.406  -10.163 1.00 0.00 ? 40  LYS A HB2  3  
ATOM   3347  H  HB3  . LYS A 1 40 ? 12.788  -4.705  -9.880  1.00 0.00 ? 40  LYS A HB3  3  
ATOM   3348  H  HG2  . LYS A 1 40 ? 15.440  -3.369  -9.188  1.00 0.00 ? 40  LYS A HG2  3  
ATOM   3349  H  HG3  . LYS A 1 40 ? 14.440  -3.017  -10.603 1.00 0.00 ? 40  LYS A HG3  3  
ATOM   3350  H  HD2  . LYS A 1 40 ? 12.591  -2.285  -9.116  1.00 0.00 ? 40  LYS A HD2  3  
ATOM   3351  H  HD3  . LYS A 1 40 ? 13.592  -2.633  -7.703  1.00 0.00 ? 40  LYS A HD3  3  
ATOM   3352  H  HE2  . LYS A 1 40 ? 15.225  -0.907  -8.489  1.00 0.00 ? 40  LYS A HE2  3  
ATOM   3353  H  HE3  . LYS A 1 40 ? 14.137  -0.525  -9.827  1.00 0.00 ? 40  LYS A HE3  3  
ATOM   3354  H  HZ1  . LYS A 1 40 ? 13.852  1.006   -8.002  1.00 0.00 ? 40  LYS A HZ1  3  
ATOM   3355  H  HZ2  . LYS A 1 40 ? 13.510  -0.265  -6.940  1.00 0.00 ? 40  LYS A HZ2  3  
ATOM   3356  H  HZ3  . LYS A 1 40 ? 12.450  0.095   -8.207  1.00 0.00 ? 40  LYS A HZ3  3  
ATOM   3357  N  N    . PRO A 1 41 ? 11.918  -6.511  -6.807  1.00 0.00 ? 41  PRO A N    3  
ATOM   3358  C  CA   . PRO A 1 41 ? 10.790  -7.464  -6.629  1.00 0.00 ? 41  PRO A CA   3  
ATOM   3359  C  C    . PRO A 1 41 ? 9.617   -7.138  -7.590  1.00 0.00 ? 41  PRO A C    3  
ATOM   3360  O  O    . PRO A 1 41 ? 9.740   -6.278  -8.463  1.00 0.00 ? 41  PRO A O    3  
ATOM   3361  C  CB   . PRO A 1 41 ? 10.388  -7.301  -5.125  1.00 0.00 ? 41  PRO A CB   3  
ATOM   3362  C  CG   . PRO A 1 41 ? 11.478  -6.462  -4.503  1.00 0.00 ? 41  PRO A CG   3  
ATOM   3363  C  CD   . PRO A 1 41 ? 12.034  -5.613  -5.624  1.00 0.00 ? 41  PRO A CD   3  
ATOM   3364  H  HA   . PRO A 1 41 ? 11.117  -8.486  -6.813  1.00 0.00 ? 41  PRO A HA   3  
ATOM   3365  H  HB2  . PRO A 1 41 ? 9.418   -6.811  -5.042  1.00 0.00 ? 41  PRO A HB2  3  
ATOM   3366  H  HB3  . PRO A 1 41 ? 10.323  -8.276  -4.654  1.00 0.00 ? 41  PRO A HB3  3  
ATOM   3367  H  HG2  . PRO A 1 41 ? 11.071  -5.835  -3.714  1.00 0.00 ? 41  PRO A HG2  3  
ATOM   3368  H  HG3  . PRO A 1 41 ? 12.255  -7.104  -4.095  1.00 0.00 ? 41  PRO A HG3  3  
ATOM   3369  H  HD2  . PRO A 1 41 ? 11.442  -4.714  -5.764  1.00 0.00 ? 41  PRO A HD2  3  
ATOM   3370  H  HD3  . PRO A 1 41 ? 13.069  -5.353  -5.430  1.00 0.00 ? 41  PRO A HD3  3  
ATOM   3371  N  N    . LEU A 1 42 ? 8.470   -7.801  -7.403  1.00 0.00 ? 42  LEU A N    3  
ATOM   3372  C  CA   . LEU A 1 42 ? 7.335   -7.720  -8.339  1.00 0.00 ? 42  LEU A CA   3  
ATOM   3373  C  C    . LEU A 1 42 ? 6.318   -6.719  -7.779  1.00 0.00 ? 42  LEU A C    3  
ATOM   3374  O  O    . LEU A 1 42 ? 5.792   -6.926  -6.691  1.00 0.00 ? 42  LEU A O    3  
ATOM   3375  C  CB   . LEU A 1 42 ? 6.717   -9.134  -8.496  1.00 0.00 ? 42  LEU A CB   3  
ATOM   3376  C  CG   . LEU A 1 42 ? 7.732   -10.271 -8.863  1.00 0.00 ? 42  LEU A CG   3  
ATOM   3377  C  CD1  . LEU A 1 42 ? 7.068   -11.652 -8.812  1.00 0.00 ? 42  LEU A CD1  3  
ATOM   3378  C  CD2  . LEU A 1 42 ? 8.395   -10.017 -10.236 1.00 0.00 ? 42  LEU A CD2  3  
ATOM   3379  H  H    . LEU A 1 42 ? 8.348   -8.321  -6.583  1.00 0.00 ? 42  LEU A H    3  
ATOM   3380  H  HA   . LEU A 1 42 ? 7.696   -7.374  -9.310  1.00 0.00 ? 42  LEU A HA   3  
ATOM   3381  H  HB2  . LEU A 1 42 ? 6.230   -9.398  -7.557  1.00 0.00 ? 42  LEU A HB2  3  
ATOM   3382  H  HB3  . LEU A 1 42 ? 5.957   -9.091  -9.273  1.00 0.00 ? 42  LEU A HB3  3  
ATOM   3383  H  HG   . LEU A 1 42 ? 8.525   -10.277 -8.121  1.00 0.00 ? 42  LEU A HG   3  
ATOM   3384  H  HD11 . LEU A 1 42 ? 7.808   -12.416 -9.001  1.00 0.00 ? 42  LEU A HD11 3  
ATOM   3385  H  HD12 . LEU A 1 42 ? 6.285   -11.719 -9.558  1.00 0.00 ? 42  LEU A HD12 3  
ATOM   3386  H  HD13 . LEU A 1 42 ? 6.640   -11.808 -7.832  1.00 0.00 ? 42  LEU A HD13 3  
ATOM   3387  H  HD21 . LEU A 1 42 ? 7.639   -10.001 -11.014 1.00 0.00 ? 42  LEU A HD21 3  
ATOM   3388  H  HD22 . LEU A 1 42 ? 9.114   -10.798 -10.448 1.00 0.00 ? 42  LEU A HD22 3  
ATOM   3389  H  HD23 . LEU A 1 42 ? 8.906   -9.064  -10.216 1.00 0.00 ? 42  LEU A HD23 3  
ATOM   3390  N  N    . GLN A 1 43 ? 6.031   -5.638  -8.515  1.00 0.00 ? 43  GLN A N    3  
ATOM   3391  C  CA   . GLN A 1 43 ? 5.209   -4.526  -8.009  1.00 0.00 ? 43  GLN A CA   3  
ATOM   3392  C  C    . GLN A 1 43 ? 4.174   -4.070  -9.050  1.00 0.00 ? 43  GLN A C    3  
ATOM   3393  O  O    . GLN A 1 43 ? 4.442   -4.089  -10.261 1.00 0.00 ? 43  GLN A O    3  
ATOM   3394  C  CB   . GLN A 1 43 ? 6.126   -3.348  -7.588  1.00 0.00 ? 43  GLN A CB   3  
ATOM   3395  C  CG   . GLN A 1 43 ? 5.380   -2.083  -7.107  1.00 0.00 ? 43  GLN A CG   3  
ATOM   3396  C  CD   . GLN A 1 43 ? 6.303   -0.951  -6.659  1.00 0.00 ? 43  GLN A CD   3  
ATOM   3397  O  OE1  . GLN A 1 43 ? 7.391   -1.185  -6.132  1.00 0.00 ? 43  GLN A OE1  3  
ATOM   3398  N  NE2  . GLN A 1 43 ? 5.872   0.279   -6.887  1.00 0.00 ? 43  GLN A NE2  3  
ATOM   3399  H  H    . GLN A 1 43 ? 6.356   -5.590  -9.437  1.00 0.00 ? 43  GLN A H    3  
ATOM   3400  H  HA   . GLN A 1 43 ? 4.674   -4.875  -7.128  1.00 0.00 ? 43  GLN A HA   3  
ATOM   3401  H  HB2  . GLN A 1 43 ? 6.769   -3.688  -6.779  1.00 0.00 ? 43  GLN A HB2  3  
ATOM   3402  H  HB3  . GLN A 1 43 ? 6.753   -3.075  -8.431  1.00 0.00 ? 43  GLN A HB3  3  
ATOM   3403  H  HG2  . GLN A 1 43 ? 4.751   -1.721  -7.911  1.00 0.00 ? 43  GLN A HG2  3  
ATOM   3404  H  HG3  . GLN A 1 43 ? 4.750   -2.357  -6.265  1.00 0.00 ? 43  GLN A HG3  3  
ATOM   3405  H  HE21 . GLN A 1 43 ? 5.002   0.392   -7.329  1.00 0.00 ? 43  GLN A HE21 3  
ATOM   3406  H  HE22 . GLN A 1 43 ? 6.436   1.030   -6.604  1.00 0.00 ? 43  GLN A HE22 3  
ATOM   3407  N  N    . CYS A 1 44 ? 2.988   -3.676  -8.550  1.00 0.00 ? 44  CYS A N    3  
ATOM   3408  C  CA   . CYS A 1 44 ? 1.903   -3.099  -9.356  1.00 0.00 ? 44  CYS A CA   3  
ATOM   3409  C  C    . CYS A 1 44 ? 2.326   -1.753  -9.947  1.00 0.00 ? 44  CYS A C    3  
ATOM   3410  O  O    . CYS A 1 44 ? 2.429   -0.756  -9.223  1.00 0.00 ? 44  CYS A O    3  
ATOM   3411  C  CB   . CYS A 1 44 ? 0.631   -2.930  -8.493  1.00 0.00 ? 44  CYS A CB   3  
ATOM   3412  S  SG   . CYS A 1 44 ? -0.695  -1.860  -9.196  1.00 0.00 ? 44  CYS A SG   3  
ATOM   3413  H  H    . CYS A 1 44 ? 2.849   -3.774  -7.589  1.00 0.00 ? 44  CYS A H    3  
ATOM   3414  H  HA   . CYS A 1 44 ? 1.686   -3.794  -10.164 1.00 0.00 ? 44  CYS A HA   3  
ATOM   3415  H  HB2  . CYS A 1 44 ? 0.199   -3.912  -8.321  1.00 0.00 ? 44  CYS A HB2  3  
ATOM   3416  H  HB3  . CYS A 1 44 ? 0.908   -2.501  -7.538  1.00 0.00 ? 44  CYS A HB3  3  
ATOM   3417  N  N    . GLU A 1 45 ? 2.566   -1.746  -11.267 1.00 0.00 ? 45  GLU A N    3  
ATOM   3418  C  CA   . GLU A 1 45 ? 2.982   -0.548  -12.030 1.00 0.00 ? 45  GLU A CA   3  
ATOM   3419  C  C    . GLU A 1 45 ? 1.786   0.407   -12.345 1.00 0.00 ? 45  GLU A C    3  
ATOM   3420  O  O    . GLU A 1 45 ? 1.914   1.339   -13.146 1.00 0.00 ? 45  GLU A O    3  
ATOM   3421  C  CB   . GLU A 1 45 ? 3.720   -1.018  -13.331 1.00 0.00 ? 45  GLU A CB   3  
ATOM   3422  C  CG   . GLU A 1 45 ? 4.532   0.066   -14.078 1.00 0.00 ? 45  GLU A CG   3  
ATOM   3423  C  CD   . GLU A 1 45 ? 5.617   0.716   -13.201 1.00 0.00 ? 45  GLU A CD   3  
ATOM   3424  O  OE1  . GLU A 1 45 ? 6.704   0.122   -13.052 1.00 0.00 ? 45  GLU A OE1  3  
ATOM   3425  O  OE2  . GLU A 1 45 ? 5.379   1.813   -12.637 1.00 0.00 ? 45  GLU A OE2  3  
ATOM   3426  H  H    . GLU A 1 45 ? 2.524   -2.601  -11.742 1.00 0.00 ? 45  GLU A H    3  
ATOM   3427  H  HA   . GLU A 1 45 ? 3.692   -0.006  -11.415 1.00 0.00 ? 45  GLU A HA   3  
ATOM   3428  H  HB2  . GLU A 1 45 ? 4.413   -1.813  -13.065 1.00 0.00 ? 45  GLU A HB2  3  
ATOM   3429  H  HB3  . GLU A 1 45 ? 2.988   -1.431  -14.018 1.00 0.00 ? 45  GLU A HB3  3  
ATOM   3430  H  HG2  . GLU A 1 45 ? 5.008   -0.386  -14.944 1.00 0.00 ? 45  GLU A HG2  3  
ATOM   3431  H  HG3  . GLU A 1 45 ? 3.848   0.837   -14.428 1.00 0.00 ? 45  GLU A HG3  3  
ATOM   3432  N  N    . ILE A 1 46 ? 0.638   0.215   -11.664 1.00 0.00 ? 46  ILE A N    3  
ATOM   3433  C  CA   . ILE A 1 46 ? -0.543  1.072   -11.814 1.00 0.00 ? 46  ILE A CA   3  
ATOM   3434  C  C    . ILE A 1 46 ? -0.520  2.115   -10.688 1.00 0.00 ? 46  ILE A C    3  
ATOM   3435  O  O    . ILE A 1 46 ? -0.594  3.325   -10.929 1.00 0.00 ? 46  ILE A O    3  
ATOM   3436  C  CB   . ILE A 1 46 ? -1.876  0.233   -11.761 1.00 0.00 ? 46  ILE A CB   3  
ATOM   3437  C  CG1  . ILE A 1 46 ? -1.979  -0.752  -12.972 1.00 0.00 ? 46  ILE A CG1  3  
ATOM   3438  C  CG2  . ILE A 1 46 ? -3.107  1.155   -11.652 1.00 0.00 ? 46  ILE A CG2  3  
ATOM   3439  C  CD1  . ILE A 1 46 ? -1.848  -0.110  -14.342 1.00 0.00 ? 46  ILE A CD1  3  
ATOM   3440  H  H    . ILE A 1 46 ? 0.582   -0.491  -11.001 1.00 0.00 ? 46  ILE A H    3  
ATOM   3441  H  HA   . ILE A 1 46 ? -0.494  1.589   -12.777 1.00 0.00 ? 46  ILE A HA   3  
ATOM   3442  H  HB   . ILE A 1 46 ? -1.848  -0.368  -10.848 1.00 0.00 ? 46  ILE A HB   3  
ATOM   3443  H  HG12 . ILE A 1 46 ? -1.195  -1.493  -12.893 1.00 0.00 ? 46  ILE A HG12 3  
ATOM   3444  H  HG13 . ILE A 1 46 ? -2.936  -1.261  -12.937 1.00 0.00 ? 46  ILE A HG13 3  
ATOM   3445  H  HG21 . ILE A 1 46 ? -3.041  1.723   -10.721 1.00 0.00 ? 46  ILE A HG21 3  
ATOM   3446  H  HG22 . ILE A 1 46 ? -4.010  0.562   -11.640 1.00 0.00 ? 46  ILE A HG22 3  
ATOM   3447  H  HG23 . ILE A 1 46 ? -3.133  1.841   -12.488 1.00 0.00 ? 46  ILE A HG23 3  
ATOM   3448  H  HD11 . ILE A 1 46 ? -0.874  0.355   -14.428 1.00 0.00 ? 46  ILE A HD11 3  
ATOM   3449  H  HD12 . ILE A 1 46 ? -2.618  0.639   -14.473 1.00 0.00 ? 46  ILE A HD12 3  
ATOM   3450  H  HD13 . ILE A 1 46 ? -1.951  -0.867  -15.102 1.00 0.00 ? 46  ILE A HD13 3  
ATOM   3451  N  N    . CYS A 1 47 ? -0.411  1.615   -9.447  1.00 0.00 ? 47  CYS A N    3  
ATOM   3452  C  CA   . CYS A 1 47 ? -0.241  2.439   -8.262  1.00 0.00 ? 47  CYS A CA   3  
ATOM   3453  C  C    . CYS A 1 47 ? 1.095   1.994   -7.666  1.00 0.00 ? 47  CYS A C    3  
ATOM   3454  O  O    . CYS A 1 47 ? 2.150   2.304   -8.228  1.00 0.00 ? 47  CYS A O    3  
ATOM   3455  C  CB   . CYS A 1 47 ? -1.475  2.298   -7.303  1.00 0.00 ? 47  CYS A CB   3  
ATOM   3456  S  SG   . CYS A 1 47 ? -1.680  0.690   -6.437  1.00 0.00 ? 47  CYS A SG   3  
ATOM   3457  H  H    . CYS A 1 47 ? -0.417  0.643   -9.324  1.00 0.00 ? 47  CYS A H    3  
ATOM   3458  H  HA   . CYS A 1 47 ? -0.144  3.484   -8.565  1.00 0.00 ? 47  CYS A HA   3  
ATOM   3459  H  HB2  . CYS A 1 47 ? -1.404  3.057   -6.533  1.00 0.00 ? 47  CYS A HB2  3  
ATOM   3460  H  HB3  . CYS A 1 47 ? -2.385  2.464   -7.865  1.00 0.00 ? 47  CYS A HB3  3  
ATOM   3461  N  N    . GLY A 1 48 ? 1.071   1.274   -6.561  1.00 0.00 ? 48  GLY A N    3  
ATOM   3462  C  CA   . GLY A 1 48 ? 2.134   0.377   -6.146  1.00 0.00 ? 48  GLY A CA   3  
ATOM   3463  C  C    . GLY A 1 48 ? 1.518   -0.772  -5.351  1.00 0.00 ? 48  GLY A C    3  
ATOM   3464  O  O    . GLY A 1 48 ? 0.352   -0.651  -4.942  1.00 0.00 ? 48  GLY A O    3  
ATOM   3465  H  H    . GLY A 1 48 ? 0.305   1.290   -5.980  1.00 0.00 ? 48  GLY A H    3  
ATOM   3466  H  HA2  . GLY A 1 48 ? 2.620   -0.023  -7.030  1.00 0.00 ? 48  GLY A HA2  3  
ATOM   3467  H  HA3  . GLY A 1 48 ? 2.851   0.908   -5.535  1.00 0.00 ? 48  GLY A HA3  3  
ATOM   3468  N  N    . PHE A 1 49 ? 2.274   -1.857  -5.098  1.00 0.00 ? 49  PHE A N    3  
ATOM   3469  C  CA   . PHE A 1 49 ? 1.876   -3.007  -4.281  1.00 0.00 ? 49  PHE A CA   3  
ATOM   3470  C  C    . PHE A 1 49 ? 2.966   -4.011  -4.590  1.00 0.00 ? 49  PHE A C    3  
ATOM   3471  O  O    . PHE A 1 49 ? 3.019   -4.514  -5.715  1.00 0.00 ? 49  PHE A O    3  
ATOM   3472  C  CB   . PHE A 1 49 ? 0.480   -3.601  -4.650  1.00 0.00 ? 49  PHE A CB   3  
ATOM   3473  C  CG   . PHE A 1 49 ? 0.161   -4.929  -3.946  1.00 0.00 ? 49  PHE A CG   3  
ATOM   3474  C  CD1  . PHE A 1 49 ? -0.262  -4.951  -2.619  1.00 0.00 ? 49  PHE A CD1  3  
ATOM   3475  C  CD2  . PHE A 1 49 ? 0.305   -6.154  -4.611  1.00 0.00 ? 49  PHE A CD2  3  
ATOM   3476  C  CE1  . PHE A 1 49 ? -0.519  -6.148  -1.975  1.00 0.00 ? 49  PHE A CE1  3  
ATOM   3477  C  CE2  . PHE A 1 49 ? 0.044   -7.350  -3.969  1.00 0.00 ? 49  PHE A CE2  3  
ATOM   3478  C  CZ   . PHE A 1 49 ? -0.371  -7.347  -2.649  1.00 0.00 ? 49  PHE A CZ   3  
ATOM   3479  H  H    . PHE A 1 49 ? 3.217   -1.924  -5.382  1.00 0.00 ? 49  PHE A H    3  
ATOM   3480  H  HA   . PHE A 1 49 ? 1.912   -2.725  -3.222  1.00 0.00 ? 49  PHE A HA   3  
ATOM   3481  H  HB2  . PHE A 1 49 ? -0.286  -2.879  -4.382  1.00 0.00 ? 49  PHE A HB2  3  
ATOM   3482  H  HB3  . PHE A 1 49 ? 0.433   -3.760  -5.723  1.00 0.00 ? 49  PHE A HB3  3  
ATOM   3483  H  HD1  . PHE A 1 49 ? -0.380  -4.017  -2.084  1.00 0.00 ? 49  PHE A HD1  3  
ATOM   3484  H  HD2  . PHE A 1 49 ? 0.636   -6.155  -5.645  1.00 0.00 ? 49  PHE A HD2  3  
ATOM   3485  H  HE1  . PHE A 1 49 ? -0.844  -6.145  -0.941  1.00 0.00 ? 49  PHE A HE1  3  
ATOM   3486  H  HE2  . PHE A 1 49 ? 0.161   -8.291  -4.499  1.00 0.00 ? 49  PHE A HE2  3  
ATOM   3487  H  HZ   . PHE A 1 49 ? -0.575  -8.283  -2.143  1.00 0.00 ? 49  PHE A HZ   3  
ATOM   3488  N  N    . THR A 1 50 ? 3.824   -4.320  -3.626  1.00 0.00 ? 50  THR A N    3  
ATOM   3489  C  CA   . THR A 1 50 ? 5.021   -5.099  -3.888  1.00 0.00 ? 50  THR A CA   3  
ATOM   3490  C  C    . THR A 1 50 ? 4.924   -6.435  -3.149  1.00 0.00 ? 50  THR A C    3  
ATOM   3491  O  O    . THR A 1 50 ? 4.569   -6.496  -1.965  1.00 0.00 ? 50  THR A O    3  
ATOM   3492  C  CB   . THR A 1 50 ? 6.316   -4.338  -3.471  1.00 0.00 ? 50  THR A CB   3  
ATOM   3493  O  OG1  . THR A 1 50 ? 6.219   -2.955  -3.869  1.00 0.00 ? 50  THR A OG1  3  
ATOM   3494  C  CG2  . THR A 1 50 ? 7.581   -4.947  -4.109  1.00 0.00 ? 50  THR A CG2  3  
ATOM   3495  H  H    . THR A 1 50 ? 3.643   -4.050  -2.716  1.00 0.00 ? 50  THR A H    3  
ATOM   3496  H  HA   . THR A 1 50 ? 5.070   -5.274  -4.965  1.00 0.00 ? 50  THR A HA   3  
ATOM   3497  H  HB   . THR A 1 50 ? 6.415   -4.391  -2.402  1.00 0.00 ? 50  THR A HB   3  
ATOM   3498  H  HG1  . THR A 1 50 ? 6.943   -2.741  -4.473  1.00 0.00 ? 50  THR A HG1  3  
ATOM   3499  H  HG21 . THR A 1 50 ? 7.685   -5.984  -3.808  1.00 0.00 ? 50  THR A HG21 3  
ATOM   3500  H  HG22 . THR A 1 50 ? 8.456   -4.395  -3.792  1.00 0.00 ? 50  THR A HG22 3  
ATOM   3501  H  HG23 . THR A 1 50 ? 7.502   -4.891  -5.190  1.00 0.00 ? 50  THR A HG23 3  
ATOM   3502  N  N    . CYS A 1 51 ? 5.232   -7.470  -3.882  1.00 0.00 ? 51  CYS A N    3  
ATOM   3503  C  CA   . CYS A 1 51 ? 5.187   -8.859  -3.438  1.00 0.00 ? 51  CYS A CA   3  
ATOM   3504  C  C    . CYS A 1 51 ? 6.262   -9.660  -4.189  1.00 0.00 ? 51  CYS A C    3  
ATOM   3505  O  O    . CYS A 1 51 ? 6.954   -9.129  -5.071  1.00 0.00 ? 51  CYS A O    3  
ATOM   3506  C  CB   . CYS A 1 51 ? 3.767   -9.439  -3.694  1.00 0.00 ? 51  CYS A CB   3  
ATOM   3507  S  SG   . CYS A 1 51 ? 3.509   -11.125 -3.083  1.00 0.00 ? 51  CYS A SG   3  
ATOM   3508  H  H    . CYS A 1 51 ? 5.501   -7.281  -4.789  1.00 0.00 ? 51  CYS A H    3  
ATOM   3509  H  HA   . CYS A 1 51 ? 5.406   -8.896  -2.373  1.00 0.00 ? 51  CYS A HA   3  
ATOM   3510  H  HB2  . CYS A 1 51 ? 3.036   -8.809  -3.211  1.00 0.00 ? 51  CYS A HB2  3  
ATOM   3511  H  HB3  . CYS A 1 51 ? 3.571   -9.447  -4.761  1.00 0.00 ? 51  CYS A HB3  3  
ATOM   3512  H  HG   . CYS A 1 51 ? 2.566   -11.078 -2.149  1.00 0.00 ? 51  CYS A HG   3  
ATOM   3513  N  N    . ARG A 1 52 ? 6.406   -10.927 -3.817  1.00 0.00 ? 52  ARG A N    3  
ATOM   3514  C  CA   . ARG A 1 52 ? 7.337   -11.874 -4.462  1.00 0.00 ? 52  ARG A CA   3  
ATOM   3515  C  C    . ARG A 1 52 ? 6.581   -12.842 -5.387  1.00 0.00 ? 52  ARG A C    3  
ATOM   3516  O  O    . ARG A 1 52 ? 7.178   -13.737 -5.992  1.00 0.00 ? 52  ARG A O    3  
ATOM   3517  C  CB   . ARG A 1 52 ? 8.144   -12.613 -3.355  1.00 0.00 ? 52  ARG A CB   3  
ATOM   3518  C  CG   . ARG A 1 52 ? 7.317   -13.196 -2.169  1.00 0.00 ? 52  ARG A CG   3  
ATOM   3519  C  CD   . ARG A 1 52 ? 6.586   -14.504 -2.495  1.00 0.00 ? 52  ARG A CD   3  
ATOM   3520  N  NE   . ARG A 1 52 ? 5.687   -14.920 -1.411  1.00 0.00 ? 52  ARG A NE   3  
ATOM   3521  C  CZ   . ARG A 1 52 ? 4.682   -15.800 -1.535  1.00 0.00 ? 52  ARG A CZ   3  
ATOM   3522  N  NH1  . ARG A 1 52 ? 4.427   -16.382 -2.699  1.00 0.00 ? 52  ARG A NH1  3  
ATOM   3523  N  NH2  . ARG A 1 52 ? 3.923   -16.072 -0.498  1.00 0.00 ? 52  ARG A NH2  3  
ATOM   3524  H  H    . ARG A 1 52 ? 5.859   -11.251 -3.074  1.00 0.00 ? 52  ARG A H    3  
ATOM   3525  H  HA   . ARG A 1 52 ? 8.035   -11.309 -5.075  1.00 0.00 ? 52  ARG A HA   3  
ATOM   3526  H  HB2  . ARG A 1 52 ? 8.700   -13.425 -3.809  1.00 0.00 ? 52  ARG A HB2  3  
ATOM   3527  H  HB3  . ARG A 1 52 ? 8.862   -11.910 -2.941  1.00 0.00 ? 52  ARG A HB3  3  
ATOM   3528  H  HG2  . ARG A 1 52 ? 7.995   -13.388 -1.343  1.00 0.00 ? 52  ARG A HG2  3  
ATOM   3529  H  HG3  . ARG A 1 52 ? 6.589   -12.456 -1.853  1.00 0.00 ? 52  ARG A HG3  3  
ATOM   3530  H  HD2  . ARG A 1 52 ? 6.003   -14.364 -3.398  1.00 0.00 ? 52  ARG A HD2  3  
ATOM   3531  H  HD3  . ARG A 1 52 ? 7.321   -15.285 -2.664  1.00 0.00 ? 52  ARG A HD3  3  
ATOM   3532  H  HE   . ARG A 1 52 ? 5.848   -14.520 -0.524  1.00 0.00 ? 52  ARG A HE   3  
ATOM   3533  H  HH11 . ARG A 1 52 ? 4.992   -16.182 -3.504  1.00 0.00 ? 52  ARG A HH11 3  
ATOM   3534  H  HH12 . ARG A 1 52 ? 3.676   -17.042 -2.776  1.00 0.00 ? 52  ARG A HH12 3  
ATOM   3535  H  HH21 . ARG A 1 52 ? 4.101   -15.637 0.391   1.00 0.00 ? 52  ARG A HH21 3  
ATOM   3536  H  HH22 . ARG A 1 52 ? 3.164   -16.723 -0.587  1.00 0.00 ? 52  ARG A HH22 3  
ATOM   3537  N  N    . GLN A 1 53 ? 5.263   -12.630 -5.505  1.00 0.00 ? 53  GLN A N    3  
ATOM   3538  C  CA   . GLN A 1 53 ? 4.350   -13.515 -6.242  1.00 0.00 ? 53  GLN A CA   3  
ATOM   3539  C  C    . GLN A 1 53 ? 3.542   -12.668 -7.238  1.00 0.00 ? 53  GLN A C    3  
ATOM   3540  O  O    . GLN A 1 53 ? 2.642   -11.932 -6.832  1.00 0.00 ? 53  GLN A O    3  
ATOM   3541  C  CB   . GLN A 1 53 ? 3.428   -14.259 -5.227  1.00 0.00 ? 53  GLN A CB   3  
ATOM   3542  C  CG   . GLN A 1 53 ? 2.458   -15.294 -5.839  1.00 0.00 ? 53  GLN A CG   3  
ATOM   3543  C  CD   . GLN A 1 53 ? 1.772   -16.164 -4.784  1.00 0.00 ? 53  GLN A CD   3  
ATOM   3544  O  OE1  . GLN A 1 53 ? 2.261   -17.234 -4.416  1.00 0.00 ? 53  GLN A OE1  3  
ATOM   3545  N  NE2  . GLN A 1 53 ? 0.636   -15.709 -4.283  1.00 0.00 ? 53  GLN A NE2  3  
ATOM   3546  H  H    . GLN A 1 53 ? 4.886   -11.832 -5.087  1.00 0.00 ? 53  GLN A H    3  
ATOM   3547  H  HA   . GLN A 1 53 ? 4.942   -14.249 -6.791  1.00 0.00 ? 53  GLN A HA   3  
ATOM   3548  H  HB2  . GLN A 1 53 ? 4.063   -14.776 -4.516  1.00 0.00 ? 53  GLN A HB2  3  
ATOM   3549  H  HB3  . GLN A 1 53 ? 2.841   -13.522 -4.681  1.00 0.00 ? 53  GLN A HB3  3  
ATOM   3550  H  HG2  . GLN A 1 53 ? 1.691   -14.770 -6.404  1.00 0.00 ? 53  GLN A HG2  3  
ATOM   3551  H  HG3  . GLN A 1 53 ? 3.007   -15.940 -6.516  1.00 0.00 ? 53  GLN A HG3  3  
ATOM   3552  H  HE21 . GLN A 1 53 ? 0.295   -14.851 -4.614  1.00 0.00 ? 53  GLN A HE21 3  
ATOM   3553  H  HE22 . GLN A 1 53 ? 0.183   -16.244 -3.599  1.00 0.00 ? 53  GLN A HE22 3  
ATOM   3554  N  N    . LYS A 1 54 ? 3.917   -12.747 -8.531  1.00 0.00 ? 54  LYS A N    3  
ATOM   3555  C  CA   . LYS A 1 54 ? 3.292   -11.951 -9.617  1.00 0.00 ? 54  LYS A CA   3  
ATOM   3556  C  C    . LYS A 1 54 ? 1.776   -12.203 -9.738  1.00 0.00 ? 54  LYS A C    3  
ATOM   3557  O  O    . LYS A 1 54 ? 1.046   -11.333 -10.192 1.00 0.00 ? 54  LYS A O    3  
ATOM   3558  C  CB   . LYS A 1 54 ? 3.987   -12.205 -10.980 1.00 0.00 ? 54  LYS A CB   3  
ATOM   3559  C  CG   . LYS A 1 54 ? 3.900   -13.666 -11.501 1.00 0.00 ? 54  LYS A CG   3  
ATOM   3560  C  CD   . LYS A 1 54 ? 4.384   -13.824 -12.964 1.00 0.00 ? 54  LYS A CD   3  
ATOM   3561  C  CE   . LYS A 1 54 ? 3.528   -13.027 -13.962 1.00 0.00 ? 54  LYS A CE   3  
ATOM   3562  N  NZ   . LYS A 1 54 ? 3.982   -13.206 -15.361 1.00 0.00 ? 54  LYS A NZ   3  
ATOM   3563  H  H    . LYS A 1 54 ? 4.677   -13.330 -8.743  1.00 0.00 ? 54  LYS A H    3  
ATOM   3564  H  HA   . LYS A 1 54 ? 3.436   -10.906 -9.355  1.00 0.00 ? 54  LYS A HA   3  
ATOM   3565  H  HB2  . LYS A 1 54 ? 3.541   -11.546 -11.719 1.00 0.00 ? 54  LYS A HB2  3  
ATOM   3566  H  HB3  . LYS A 1 54 ? 5.036   -11.939 -10.884 1.00 0.00 ? 54  LYS A HB3  3  
ATOM   3567  H  HG2  . LYS A 1 54 ? 4.512   -14.300 -10.868 1.00 0.00 ? 54  LYS A HG2  3  
ATOM   3568  H  HG3  . LYS A 1 54 ? 2.869   -14.003 -11.435 1.00 0.00 ? 54  LYS A HG3  3  
ATOM   3569  H  HD2  . LYS A 1 54 ? 5.407   -13.477 -13.034 1.00 0.00 ? 54  LYS A HD2  3  
ATOM   3570  H  HD3  . LYS A 1 54 ? 4.350   -14.877 -13.237 1.00 0.00 ? 54  LYS A HD3  3  
ATOM   3571  H  HE2  . LYS A 1 54 ? 2.500   -13.357 -13.896 1.00 0.00 ? 54  LYS A HE2  3  
ATOM   3572  H  HE3  . LYS A 1 54 ? 3.581   -11.973 -13.715 1.00 0.00 ? 54  LYS A HE3  3  
ATOM   3573  H  HZ1  . LYS A 1 54 ? 3.908   -14.206 -15.634 1.00 0.00 ? 54  LYS A HZ1  3  
ATOM   3574  H  HZ2  . LYS A 1 54 ? 4.972   -12.903 -15.465 1.00 0.00 ? 54  LYS A HZ2  3  
ATOM   3575  H  HZ3  . LYS A 1 54 ? 3.390   -12.644 -15.999 1.00 0.00 ? 54  LYS A HZ3  3  
ATOM   3576  N  N    . ALA A 1 55 ? 1.346   -13.418 -9.357  1.00 0.00 ? 55  ALA A N    3  
ATOM   3577  C  CA   . ALA A 1 55 ? -0.084  -13.805 -9.285  1.00 0.00 ? 55  ALA A CA   3  
ATOM   3578  C  C    . ALA A 1 55 ? -0.899  -12.837 -8.388  1.00 0.00 ? 55  ALA A C    3  
ATOM   3579  O  O    . ALA A 1 55 ? -2.037  -12.476 -8.711  1.00 0.00 ? 55  ALA A O    3  
ATOM   3580  C  CB   . ALA A 1 55 ? -0.218  -15.255 -8.781  1.00 0.00 ? 55  ALA A CB   3  
ATOM   3581  H  H    . ALA A 1 55 ? 2.043   -14.082 -9.164  1.00 0.00 ? 55  ALA A H    3  
ATOM   3582  H  HA   . ALA A 1 55 ? -0.485  -13.768 -10.295 1.00 0.00 ? 55  ALA A HA   3  
ATOM   3583  H  HB1  . ALA A 1 55 ? -1.259  -15.558 -8.797  1.00 0.00 ? 55  ALA A HB1  3  
ATOM   3584  H  HB2  . ALA A 1 55 ? 0.159   -15.323 -7.768  1.00 0.00 ? 55  ALA A HB2  3  
ATOM   3585  H  HB3  . ALA A 1 55 ? 0.358   -15.923 -9.417  1.00 0.00 ? 55  ALA A HB3  3  
ATOM   3586  N  N    . SER A 1 56 ? -0.281  -12.423 -7.265  1.00 0.00 ? 56  SER A N    3  
ATOM   3587  C  CA   . SER A 1 56 ? -0.908  -11.543 -6.261  1.00 0.00 ? 56  SER A CA   3  
ATOM   3588  C  C    . SER A 1 56 ? -1.243  -10.156 -6.864  1.00 0.00 ? 56  SER A C    3  
ATOM   3589  O  O    . SER A 1 56 ? -2.405  -9.721  -6.845  1.00 0.00 ? 56  SER A O    3  
ATOM   3590  C  CB   . SER A 1 56 ? 0.028   -11.416 -5.030  1.00 0.00 ? 56  SER A CB   3  
ATOM   3591  O  OG   . SER A 1 56 ? -0.568  -10.682 -3.972  1.00 0.00 ? 56  SER A OG   3  
ATOM   3592  H  H    . SER A 1 56 ? 0.633   -12.744 -7.110  1.00 0.00 ? 56  SER A H    3  
ATOM   3593  H  HA   . SER A 1 56 ? -1.834  -12.016 -5.940  1.00 0.00 ? 56  SER A HA   3  
ATOM   3594  H  HB2  . SER A 1 56 ? 0.263   -12.400 -4.657  1.00 0.00 ? 56  SER A HB2  3  
ATOM   3595  H  HB3  . SER A 1 56 ? 0.946   -10.924 -5.325  1.00 0.00 ? 56  SER A HB3  3  
ATOM   3596  H  HG   . SER A 1 56 ? -1.522  -10.635 -4.107  1.00 0.00 ? 56  SER A HG   3  
ATOM   3597  N  N    . LEU A 1 57 ? -0.224  -9.496  -7.446  1.00 0.00 ? 57  LEU A N    3  
ATOM   3598  C  CA   . LEU A 1 57 ? -0.375  -8.155  -8.053  1.00 0.00 ? 57  LEU A CA   3  
ATOM   3599  C  C    . LEU A 1 57 ? -1.123  -8.206  -9.405  1.00 0.00 ? 57  LEU A C    3  
ATOM   3600  O  O    . LEU A 1 57 ? -1.696  -7.200  -9.814  1.00 0.00 ? 57  LEU A O    3  
ATOM   3601  C  CB   . LEU A 1 57 ? 0.986   -7.406  -8.207  1.00 0.00 ? 57  LEU A CB   3  
ATOM   3602  C  CG   . LEU A 1 57 ? 2.194   -8.240  -8.771  1.00 0.00 ? 57  LEU A CG   3  
ATOM   3603  C  CD1  . LEU A 1 57 ? 3.060   -7.408  -9.741  1.00 0.00 ? 57  LEU A CD1  3  
ATOM   3604  C  CD2  . LEU A 1 57 ? 3.054   -8.826  -7.623  1.00 0.00 ? 57  LEU A CD2  3  
ATOM   3605  H  H    . LEU A 1 57 ? 0.650   -9.931  -7.483  1.00 0.00 ? 57  LEU A H    3  
ATOM   3606  H  HA   . LEU A 1 57 ? -0.995  -7.579  -7.368  1.00 0.00 ? 57  LEU A HA   3  
ATOM   3607  H  HB2  . LEU A 1 57 ? 0.817   -6.562  -8.862  1.00 0.00 ? 57  LEU A HB2  3  
ATOM   3608  H  HB3  . LEU A 1 57 ? 1.266   -7.006  -7.235  1.00 0.00 ? 57  LEU A HB3  3  
ATOM   3609  H  HG   . LEU A 1 57 ? 1.808   -9.077  -9.341  1.00 0.00 ? 57  LEU A HG   3  
ATOM   3610  H  HD11 . LEU A 1 57 ? 3.473   -6.548  -9.225  1.00 0.00 ? 57  LEU A HD11 3  
ATOM   3611  H  HD12 . LEU A 1 57 ? 2.447   -7.063  -10.566 1.00 0.00 ? 57  LEU A HD12 3  
ATOM   3612  H  HD13 . LEU A 1 57 ? 3.864   -8.018  -10.126 1.00 0.00 ? 57  LEU A HD13 3  
ATOM   3613  H  HD21 . LEU A 1 57 ? 2.433   -9.452  -6.991  1.00 0.00 ? 57  LEU A HD21 3  
ATOM   3614  H  HD22 . LEU A 1 57 ? 3.481   -8.028  -7.027  1.00 0.00 ? 57  LEU A HD22 3  
ATOM   3615  H  HD23 . LEU A 1 57 ? 3.852   -9.430  -8.039  1.00 0.00 ? 57  LEU A HD23 3  
ATOM   3616  N  N    . ASN A 1 58 ? -1.032  -9.344  -10.122 1.00 0.00 ? 58  ASN A N    3  
ATOM   3617  C  CA   . ASN A 1 58 ? -1.807  -9.597  -11.370 1.00 0.00 ? 58  ASN A CA   3  
ATOM   3618  C  C    . ASN A 1 58 ? -3.307  -9.343  -11.181 1.00 0.00 ? 58  ASN A C    3  
ATOM   3619  O  O    . ASN A 1 58 ? -3.929  -8.628  -11.969 1.00 0.00 ? 58  ASN A O    3  
ATOM   3620  C  CB   . ASN A 1 58 ? -1.611  -11.058 -11.866 1.00 0.00 ? 58  ASN A CB   3  
ATOM   3621  C  CG   . ASN A 1 58 ? -2.369  -11.402 -13.168 1.00 0.00 ? 58  ASN A CG   3  
ATOM   3622  O  OD1  . ASN A 1 58 ? -2.500  -10.568 -14.076 1.00 0.00 ? 58  ASN A OD1  3  
ATOM   3623  N  ND2  . ASN A 1 58 ? -2.914  -12.612 -13.252 1.00 0.00 ? 58  ASN A ND2  3  
ATOM   3624  H  H    . ASN A 1 58 ? -0.342  -9.983  -9.875  1.00 0.00 ? 58  ASN A H    3  
ATOM   3625  H  HA   . ASN A 1 58 ? -1.432  -8.918  -12.119 1.00 0.00 ? 58  ASN A HA   3  
ATOM   3626  H  HB2  . ASN A 1 58 ? -0.563  -11.231 -12.045 1.00 0.00 ? 58  ASN A HB2  3  
ATOM   3627  H  HB3  . ASN A 1 58 ? -1.944  -11.730 -11.080 1.00 0.00 ? 58  ASN A HB3  3  
ATOM   3628  H  HD21 . ASN A 1 58 ? -2.816  -13.217 -12.486 1.00 0.00 ? 58  ASN A HD21 3  
ATOM   3629  H  HD22 . ASN A 1 58 ? -3.395  -12.854 -14.074 1.00 0.00 ? 58  ASN A HD22 3  
ATOM   3630  N  N    . TRP A 1 59 ? -3.894  -9.948  -10.149 1.00 0.00 ? 59  TRP A N    3  
ATOM   3631  C  CA   . TRP A 1 59 ? -5.339  -9.828  -9.893  1.00 0.00 ? 59  TRP A CA   3  
ATOM   3632  C  C    . TRP A 1 59 ? -5.662  -8.517  -9.156  1.00 0.00 ? 59  TRP A C    3  
ATOM   3633  O  O    . TRP A 1 59 ? -6.769  -7.988  -9.274  1.00 0.00 ? 59  TRP A O    3  
ATOM   3634  C  CB   . TRP A 1 59 ? -5.845  -11.076 -9.146  1.00 0.00 ? 59  TRP A CB   3  
ATOM   3635  C  CG   . TRP A 1 59 ? -5.739  -12.329 -9.998  1.00 0.00 ? 59  TRP A CG   3  
ATOM   3636  C  CD1  . TRP A 1 59 ? -4.776  -13.298 -9.934  1.00 0.00 ? 59  TRP A CD1  3  
ATOM   3637  C  CD2  . TRP A 1 59 ? -6.615  -12.720 -11.076 1.00 0.00 ? 59  TRP A CD2  3  
ATOM   3638  N  NE1  . TRP A 1 59 ? -5.009  -14.268 -10.870 1.00 0.00 ? 59  TRP A NE1  3  
ATOM   3639  C  CE2  . TRP A 1 59 ? -6.129  -13.941 -11.580 1.00 0.00 ? 59  TRP A CE2  3  
ATOM   3640  C  CE3  . TRP A 1 59 ? -7.777  -12.169 -11.645 1.00 0.00 ? 59  TRP A CE3  3  
ATOM   3641  C  CZ2  . TRP A 1 59 ? -6.746  -14.612 -12.635 1.00 0.00 ? 59  TRP A CZ2  3  
ATOM   3642  C  CZ3  . TRP A 1 59 ? -8.390  -12.835 -12.693 1.00 0.00 ? 59  TRP A CZ3  3  
ATOM   3643  C  CH2  . TRP A 1 59 ? -7.873  -14.050 -13.176 1.00 0.00 ? 59  TRP A CH2  3  
ATOM   3644  H  H    . TRP A 1 59 ? -3.361  -10.433 -9.484  1.00 0.00 ? 59  TRP A H    3  
ATOM   3645  H  HA   . TRP A 1 59 ? -5.839  -9.792  -10.868 1.00 0.00 ? 59  TRP A HA   3  
ATOM   3646  H  HB2  . TRP A 1 59 ? -5.268  -11.220 -8.237  1.00 0.00 ? 59  TRP A HB2  3  
ATOM   3647  H  HB3  . TRP A 1 59 ? -6.887  -10.942 -8.876  1.00 0.00 ? 59  TRP A HB3  3  
ATOM   3648  H  HD1  . TRP A 1 59 ? -3.958  -13.298 -9.227  1.00 0.00 ? 59  TRP A HD1  3  
ATOM   3649  H  HE1  . TRP A 1 59 ? -4.462  -15.066 -11.011 1.00 0.00 ? 59  TRP A HE1  3  
ATOM   3650  H  HE3  . TRP A 1 59 ? -8.183  -11.228 -11.294 1.00 0.00 ? 59  TRP A HE3  3  
ATOM   3651  H  HZ2  . TRP A 1 59 ? -6.363  -15.545 -13.019 1.00 0.00 ? 59  TRP A HZ2  3  
ATOM   3652  H  HZ3  . TRP A 1 59 ? -9.281  -12.419 -13.154 1.00 0.00 ? 59  TRP A HZ3  3  
ATOM   3653  H  HH2  . TRP A 1 59 ? -8.381  -14.537 -13.997 1.00 0.00 ? 59  TRP A HH2  3  
ATOM   3654  N  N    . HIS A 1 60 ? -4.723  -8.069  -8.308  1.00 0.00 ? 60  HIS A N    3  
ATOM   3655  C  CA   . HIS A 1 60 ? -4.693  -6.678  -7.799  1.00 0.00 ? 60  HIS A CA   3  
ATOM   3656  C  C    . HIS A 1 60 ? -4.835  -5.587  -8.912  1.00 0.00 ? 60  HIS A C    3  
ATOM   3657  O  O    . HIS A 1 60 ? -5.498  -4.578  -8.674  1.00 0.00 ? 60  HIS A O    3  
ATOM   3658  C  CB   . HIS A 1 60 ? -3.423  -6.441  -6.942  1.00 0.00 ? 60  HIS A CB   3  
ATOM   3659  C  CG   . HIS A 1 60 ? -3.220  -5.011  -6.503  1.00 0.00 ? 60  HIS A CG   3  
ATOM   3660  N  ND1  . HIS A 1 60 ? -4.036  -4.327  -5.639  1.00 0.00 ? 60  HIS A ND1  3  
ATOM   3661  C  CD2  . HIS A 1 60 ? -2.339  -4.122  -6.958  1.00 0.00 ? 60  HIS A CD2  3  
ATOM   3662  C  CE1  . HIS A 1 60 ? -3.630  -3.053  -5.626  1.00 0.00 ? 60  HIS A CE1  3  
ATOM   3663  N  NE2  . HIS A 1 60 ? -2.594  -2.860  -6.431  1.00 0.00 ? 60  HIS A NE2  3  
ATOM   3664  H  H    . HIS A 1 60 ? -4.172  -8.739  -7.857  1.00 0.00 ? 60  HIS A H    3  
ATOM   3665  H  HA   . HIS A 1 60 ? -5.554  -6.583  -7.140  1.00 0.00 ? 60  HIS A HA   3  
ATOM   3666  H  HB2  . HIS A 1 60 ? -3.465  -7.047  -6.056  1.00 0.00 ? 60  HIS A HB2  3  
ATOM   3667  H  HB3  . HIS A 1 60 ? -2.557  -6.737  -7.522  1.00 0.00 ? 60  HIS A HB3  3  
ATOM   3668  H  HD1  . HIS A 1 60 ? -4.778  -4.700  -5.115  1.00 0.00 ? 60  HIS A HD1  3  
ATOM   3669  H  HD2  . HIS A 1 60 ? -1.538  -4.351  -7.642  1.00 0.00 ? 60  HIS A HD2  3  
ATOM   3670  H  HE1  . HIS A 1 60 ? -4.092  -2.278  -5.045  1.00 0.00 ? 60  HIS A HE1  3  
ATOM   3671  N  N    . MET A 1 61 ? -4.159  -5.729  -10.081 1.00 0.00 ? 61  MET A N    3  
ATOM   3672  C  CA   . MET A 1 61 ? -4.370  -4.762  -11.207 1.00 0.00 ? 61  MET A CA   3  
ATOM   3673  C  C    . MET A 1 61 ? -5.752  -4.940  -11.854 1.00 0.00 ? 61  MET A C    3  
ATOM   3674  O  O    . MET A 1 61 ? -6.329  -3.980  -12.366 1.00 0.00 ? 61  MET A O    3  
ATOM   3675  C  CB   . MET A 1 61 ? -3.240  -4.801  -12.279 1.00 0.00 ? 61  MET A CB   3  
ATOM   3676  C  CG   . MET A 1 61 ? -3.316  -5.914  -13.328 1.00 0.00 ? 61  MET A CG   3  
ATOM   3677  S  SD   . MET A 1 61 ? -2.112  -5.694  -14.652 1.00 0.00 ? 61  MET A SD   3  
ATOM   3678  C  CE   . MET A 1 61 ? -2.619  -4.111  -15.345 1.00 0.00 ? 61  MET A CE   3  
ATOM   3679  H  H    . MET A 1 61 ? -3.455  -6.400  -10.150 1.00 0.00 ? 61  MET A H    3  
ATOM   3680  H  HA   . MET A 1 61 ? -4.359  -3.776  -10.759 1.00 0.00 ? 61  MET A HA   3  
ATOM   3681  H  HB2  . MET A 1 61 ? -3.241  -3.856  -12.811 1.00 0.00 ? 61  MET A HB2  3  
ATOM   3682  H  HB3  . MET A 1 61 ? -2.291  -4.891  -11.764 1.00 0.00 ? 61  MET A HB3  3  
ATOM   3683  H  HG2  . MET A 1 61 ? -3.121  -6.864  -12.852 1.00 0.00 ? 61  MET A HG2  3  
ATOM   3684  H  HG3  . MET A 1 61 ? -4.308  -5.928  -13.766 1.00 0.00 ? 61  MET A HG3  3  
ATOM   3685  H  HE1  . MET A 1 61 ? -1.971  -3.853  -16.172 1.00 0.00 ? 61  MET A HE1  3  
ATOM   3686  H  HE2  . MET A 1 61 ? -2.549  -3.342  -14.590 1.00 0.00 ? 61  MET A HE2  3  
ATOM   3687  H  HE3  . MET A 1 61 ? -3.641  -4.181  -15.696 1.00 0.00 ? 61  MET A HE3  3  
ATOM   3688  N  N    . LYS A 1 62 ? -6.248  -6.188  -11.855 1.00 0.00 ? 62  LYS A N    3  
ATOM   3689  C  CA   . LYS A 1 62 ? -7.638  -6.509  -12.252 1.00 0.00 ? 62  LYS A CA   3  
ATOM   3690  C  C    . LYS A 1 62 ? -8.668  -5.768  -11.355 1.00 0.00 ? 62  LYS A C    3  
ATOM   3691  O  O    . LYS A 1 62 ? -9.769  -5.472  -11.797 1.00 0.00 ? 62  LYS A O    3  
ATOM   3692  C  CB   . LYS A 1 62 ? -7.874  -8.043  -12.234 1.00 0.00 ? 62  LYS A CB   3  
ATOM   3693  C  CG   . LYS A 1 62 ? -9.227  -8.511  -12.820 1.00 0.00 ? 62  LYS A CG   3  
ATOM   3694  C  CD   . LYS A 1 62 ? -9.443  -8.066  -14.288 1.00 0.00 ? 62  LYS A CD   3  
ATOM   3695  C  CE   . LYS A 1 62 ? -8.367  -8.595  -15.253 1.00 0.00 ? 62  LYS A CE   3  
ATOM   3696  N  NZ   . LYS A 1 62 ? -8.271  -10.084 -15.251 1.00 0.00 ? 62  LYS A NZ   3  
ATOM   3697  H  H    . LYS A 1 62 ? -5.620  -6.908  -11.651 1.00 0.00 ? 62  LYS A H    3  
ATOM   3698  H  HA   . LYS A 1 62 ? -7.766  -6.150  -13.272 1.00 0.00 ? 62  LYS A HA   3  
ATOM   3699  H  HB2  . LYS A 1 62 ? -7.079  -8.526  -12.794 1.00 0.00 ? 62  LYS A HB2  3  
ATOM   3700  H  HB3  . LYS A 1 62 ? -7.819  -8.392  -11.210 1.00 0.00 ? 62  LYS A HB3  3  
ATOM   3701  H  HG2  . LYS A 1 62 ? -9.271  -9.593  -12.778 1.00 0.00 ? 62  LYS A HG2  3  
ATOM   3702  H  HG3  . LYS A 1 62 ? -10.026 -8.101  -12.210 1.00 0.00 ? 62  LYS A HG3  3  
ATOM   3703  H  HD2  . LYS A 1 62 ? -10.408 -8.429  -14.620 1.00 0.00 ? 62  LYS A HD2  3  
ATOM   3704  H  HD3  . LYS A 1 62 ? -9.448  -6.978  -14.330 1.00 0.00 ? 62  LYS A HD3  3  
ATOM   3705  H  HE2  . LYS A 1 62 ? -8.602  -8.266  -16.257 1.00 0.00 ? 62  LYS A HE2  3  
ATOM   3706  H  HE3  . LYS A 1 62 ? -7.409  -8.182  -14.964 1.00 0.00 ? 62  LYS A HE3  3  
ATOM   3707  H  HZ1  . LYS A 1 62 ? -9.200  -10.506 -15.451 1.00 0.00 ? 62  LYS A HZ1  3  
ATOM   3708  H  HZ2  . LYS A 1 62 ? -7.935  -10.427 -14.328 1.00 0.00 ? 62  LYS A HZ2  3  
ATOM   3709  H  HZ3  . LYS A 1 62 ? -7.600  -10.396 -15.985 1.00 0.00 ? 62  LYS A HZ3  3  
ATOM   3710  N  N    . LYS A 1 63 ? -8.275  -5.462  -10.104 1.00 0.00 ? 63  LYS A N    3  
ATOM   3711  C  CA   . LYS A 1 63 ? -9.094  -4.624  -9.189  1.00 0.00 ? 63  LYS A CA   3  
ATOM   3712  C  C    . LYS A 1 63 ? -9.263  -3.195  -9.764  1.00 0.00 ? 63  LYS A C    3  
ATOM   3713  O  O    . LYS A 1 63 ? -10.334 -2.590  -9.639  1.00 0.00 ? 63  LYS A O    3  
ATOM   3714  C  CB   . LYS A 1 63 ? -8.467  -4.544  -7.777  1.00 0.00 ? 63  LYS A CB   3  
ATOM   3715  C  CG   . LYS A 1 63 ? -8.281  -5.896  -7.070  1.00 0.00 ? 63  LYS A CG   3  
ATOM   3716  C  CD   . LYS A 1 63 ? -9.611  -6.625  -6.788  1.00 0.00 ? 63  LYS A CD   3  
ATOM   3717  C  CE   . LYS A 1 63 ? -9.399  -7.961  -6.057  1.00 0.00 ? 63  LYS A CE   3  
ATOM   3718  N  NZ   . LYS A 1 63 ? -8.570  -8.907  -6.854  1.00 0.00 ? 63  LYS A NZ   3  
ATOM   3719  H  H    . LYS A 1 63 ? -7.406  -5.817  -9.824  1.00 0.00 ? 63  LYS A H    3  
ATOM   3720  H  HA   . LYS A 1 63 ? -10.074 -5.088  -9.111  1.00 0.00 ? 63  LYS A HA   3  
ATOM   3721  H  HB2  . LYS A 1 63 ? -7.493  -4.074  -7.858  1.00 0.00 ? 63  LYS A HB2  3  
ATOM   3722  H  HB3  . LYS A 1 63 ? -9.097  -3.918  -7.149  1.00 0.00 ? 63  LYS A HB3  3  
ATOM   3723  H  HG2  . LYS A 1 63 ? -7.666  -6.531  -7.701  1.00 0.00 ? 63  LYS A HG2  3  
ATOM   3724  H  HG3  . LYS A 1 63 ? -7.762  -5.728  -6.130  1.00 0.00 ? 63  LYS A HG3  3  
ATOM   3725  H  HD2  . LYS A 1 63 ? -10.246 -5.987  -6.179  1.00 0.00 ? 63  LYS A HD2  3  
ATOM   3726  H  HD3  . LYS A 1 63 ? -10.109 -6.822  -7.733  1.00 0.00 ? 63  LYS A HD3  3  
ATOM   3727  H  HE2  . LYS A 1 63 ? -8.906  -7.777  -5.108  1.00 0.00 ? 63  LYS A HE2  3  
ATOM   3728  H  HE3  . LYS A 1 63 ? -10.363 -8.416  -5.869  1.00 0.00 ? 63  LYS A HE3  3  
ATOM   3729  H  HZ1  . LYS A 1 63 ? -8.562  -9.843  -6.401  1.00 0.00 ? 63  LYS A HZ1  3  
ATOM   3730  H  HZ2  . LYS A 1 63 ? -7.592  -8.563  -6.920  1.00 0.00 ? 63  LYS A HZ2  3  
ATOM   3731  H  HZ3  . LYS A 1 63 ? -8.955  -8.999  -7.816  1.00 0.00 ? 63  LYS A HZ3  3  
ATOM   3732  N  N    . HIS A 1 64 ? -8.192  -2.688  -10.418 1.00 0.00 ? 64  HIS A N    3  
ATOM   3733  C  CA   . HIS A 1 64 ? -8.184  -1.353  -11.069 1.00 0.00 ? 64  HIS A CA   3  
ATOM   3734  C  C    . HIS A 1 64 ? -8.913  -1.427  -12.423 1.00 0.00 ? 64  HIS A C    3  
ATOM   3735  O  O    . HIS A 1 64 ? -9.599  -0.492  -12.831 1.00 0.00 ? 64  HIS A O    3  
ATOM   3736  C  CB   . HIS A 1 64 ? -6.728  -0.841  -11.318 1.00 0.00 ? 64  HIS A CB   3  
ATOM   3737  C  CG   . HIS A 1 64 ? -5.849  -0.677  -10.102 1.00 0.00 ? 64  HIS A CG   3  
ATOM   3738  N  ND1  . HIS A 1 64 ? -5.994  0.343   -9.197  1.00 0.00 ? 64  HIS A ND1  3  
ATOM   3739  C  CD2  . HIS A 1 64 ? -4.718  -1.347  -9.727  1.00 0.00 ? 64  HIS A CD2  3  
ATOM   3740  C  CE1  . HIS A 1 64 ? -4.974  0.281   -8.335  1.00 0.00 ? 64  HIS A CE1  3  
ATOM   3741  N  NE2  . HIS A 1 64 ? -4.169  -0.731  -8.614  1.00 0.00 ? 64  HIS A NE2  3  
ATOM   3742  H  H    . HIS A 1 64 ? -7.401  -3.256  -10.512 1.00 0.00 ? 64  HIS A H    3  
ATOM   3743  H  HA   . HIS A 1 64 ? -8.714  -0.653  -10.427 1.00 0.00 ? 64  HIS A HA   3  
ATOM   3744  H  HB2  . HIS A 1 64 ? -6.219  -1.530  -11.986 1.00 0.00 ? 64  HIS A HB2  3  
ATOM   3745  H  HB3  . HIS A 1 64 ? -6.775  0.129   -11.809 1.00 0.00 ? 64  HIS A HB3  3  
ATOM   3746  H  HD1  . HIS A 1 64 ? -6.713  1.011   -9.195  1.00 0.00 ? 64  HIS A HD1  3  
ATOM   3747  H  HD2  . HIS A 1 64 ? -4.291  -2.196  -10.227 1.00 0.00 ? 64  HIS A HD2  3  
ATOM   3748  H  HE1  . HIS A 1 64 ? -4.833  0.971   -7.516  1.00 0.00 ? 64  HIS A HE1  3  
ATOM   3749  N  N    . ASP A 1 65 ? -8.789  -2.593  -13.069 1.00 0.00 ? 65  ASP A N    3  
ATOM   3750  C  CA   . ASP A 1 65 ? -9.229  -2.821  -14.459 1.00 0.00 ? 65  ASP A CA   3  
ATOM   3751  C  C    . ASP A 1 65 ? -10.723 -3.168  -14.504 1.00 0.00 ? 65  ASP A C    3  
ATOM   3752  O  O    . ASP A 1 65 ? -11.394 -2.987  -15.524 1.00 0.00 ? 65  ASP A O    3  
ATOM   3753  C  CB   . ASP A 1 65 ? -8.362  -3.953  -15.069 1.00 0.00 ? 65  ASP A CB   3  
ATOM   3754  C  CG   . ASP A 1 65 ? -8.644  -4.244  -16.552 1.00 0.00 ? 65  ASP A CG   3  
ATOM   3755  O  OD1  . ASP A 1 65 ? -8.576  -3.310  -17.382 1.00 0.00 ? 65  ASP A OD1  3  
ATOM   3756  O  OD2  . ASP A 1 65 ? -8.914  -5.415  -16.906 1.00 0.00 ? 65  ASP A OD2  3  
ATOM   3757  H  H    . ASP A 1 65 ? -8.443  -3.359  -12.567 1.00 0.00 ? 65  ASP A H    3  
ATOM   3758  H  HA   . ASP A 1 65 ? -9.066  -1.907  -15.027 1.00 0.00 ? 65  ASP A HA   3  
ATOM   3759  H  HB2  . ASP A 1 65 ? -7.316  -3.675  -14.981 1.00 0.00 ? 65  ASP A HB2  3  
ATOM   3760  H  HB3  . ASP A 1 65 ? -8.521  -4.861  -14.494 1.00 0.00 ? 65  ASP A HB3  3  
ATOM   3761  N  N    . ALA A 1 66 ? -11.231 -3.675  -13.381 1.00 0.00 ? 66  ALA A N    3  
ATOM   3762  C  CA   . ALA A 1 66 ? -12.636 -4.066  -13.220 1.00 0.00 ? 66  ALA A CA   3  
ATOM   3763  C  C    . ALA A 1 66 ? -13.393 -3.092  -12.314 1.00 0.00 ? 66  ALA A C    3  
ATOM   3764  O  O    . ALA A 1 66 ? -14.584 -3.310  -12.063 1.00 0.00 ? 66  ALA A O    3  
ATOM   3765  C  CB   . ALA A 1 66 ? -12.716 -5.491  -12.654 1.00 0.00 ? 66  ALA A CB   3  
ATOM   3766  H  H    . ALA A 1 66 ? -10.637 -3.778  -12.611 1.00 0.00 ? 66  ALA A H    3  
ATOM   3767  H  HA   . ALA A 1 66 ? -13.118 -4.068  -14.205 1.00 0.00 ? 66  ALA A HA   3  
ATOM   3768  H  HB1  . ALA A 1 66 ? -12.263 -5.521  -11.666 1.00 0.00 ? 66  ALA A HB1  3  
ATOM   3769  H  HB2  . ALA A 1 66 ? -12.188 -6.172  -13.306 1.00 0.00 ? 66  ALA A HB2  3  
ATOM   3770  H  HB3  . ALA A 1 66 ? -13.751 -5.797  -12.581 1.00 0.00 ? 66  ALA A HB3  3  
ATOM   3771  N  N    . ASP A 1 67 ? -12.690 -2.042  -11.797 1.00 0.00 ? 67  ASP A N    3  
ATOM   3772  C  CA   . ASP A 1 67 ? -13.243 -1.075  -10.805 1.00 0.00 ? 67  ASP A CA   3  
ATOM   3773  C  C    . ASP A 1 67 ? -13.742 -1.776  -9.518  1.00 0.00 ? 67  ASP A C    3  
ATOM   3774  O  O    . ASP A 1 67 ? -14.472 -1.187  -8.707  1.00 0.00 ? 67  ASP A O    3  
ATOM   3775  C  CB   . ASP A 1 67 ? -14.359 -0.188  -11.435 1.00 0.00 ? 67  ASP A CB   3  
ATOM   3776  C  CG   . ASP A 1 67 ? -13.853 0.680   -12.595 1.00 0.00 ? 67  ASP A CG   3  
ATOM   3777  O  OD1  . ASP A 1 67 ? -13.743 0.174   -13.732 1.00 0.00 ? 67  ASP A OD1  3  
ATOM   3778  O  OD2  . ASP A 1 67 ? -13.544 1.873   -12.377 1.00 0.00 ? 67  ASP A OD2  3  
ATOM   3779  H  H    . ASP A 1 67 ? -11.774 -1.882  -12.124 1.00 0.00 ? 67  ASP A H    3  
ATOM   3780  H  HA   . ASP A 1 67 ? -12.420 -0.433  -10.520 1.00 0.00 ? 67  ASP A HA   3  
ATOM   3781  H  HB2  . ASP A 1 67 ? -15.151 -0.829  -11.809 1.00 0.00 ? 67  ASP A HB2  3  
ATOM   3782  H  HB3  . ASP A 1 67 ? -14.775 0.458   -10.668 1.00 0.00 ? 67  ASP A HB3  3  
ATOM   3783  N  N    . SER A 1 68 ? -13.284 -3.025  -9.322  1.00 0.00 ? 68  SER A N    3  
ATOM   3784  C  CA   . SER A 1 68 ? -13.656 -3.874  -8.182  1.00 0.00 ? 68  SER A CA   3  
ATOM   3785  C  C    . SER A 1 68 ? -12.890 -3.474  -6.911  1.00 0.00 ? 68  SER A C    3  
ATOM   3786  O  O    . SER A 1 68 ? -13.204 -3.956  -5.823  1.00 0.00 ? 68  SER A O    3  
ATOM   3787  C  CB   . SER A 1 68 ? -13.379 -5.353  -8.534  1.00 0.00 ? 68  SER A CB   3  
ATOM   3788  O  OG   . SER A 1 68 ? -14.091 -5.733  -9.700  1.00 0.00 ? 68  SER A OG   3  
ATOM   3789  H  H    . SER A 1 68 ? -12.662 -3.389  -9.983  1.00 0.00 ? 68  SER A H    3  
ATOM   3790  H  HA   . SER A 1 68 ? -14.720 -3.751  -8.001  1.00 0.00 ? 68  SER A HA   3  
ATOM   3791  H  HB2  . SER A 1 68 ? -12.320 -5.494  -8.719  1.00 0.00 ? 68  SER A HB2  3  
ATOM   3792  H  HB3  . SER A 1 68 ? -13.688 -5.993  -7.716  1.00 0.00 ? 68  SER A HB3  3  
ATOM   3793  H  HG   . SER A 1 68 ? -14.591 -4.976  -10.027 1.00 0.00 ? 68  SER A HG   3  
ATOM   3794  N  N    . PHE A 1 69 ? -11.867 -2.611  -7.072  1.00 0.00 ? 69  PHE A N    3  
ATOM   3795  C  CA   . PHE A 1 69 ? -11.072 -2.090  -5.947  1.00 0.00 ? 69  PHE A CA   3  
ATOM   3796  C  C    . PHE A 1 69 ? -11.920 -1.098  -5.127  1.00 0.00 ? 69  PHE A C    3  
ATOM   3797  O  O    . PHE A 1 69 ? -11.877 -1.105  -3.894  1.00 0.00 ? 69  PHE A O    3  
ATOM   3798  C  CB   . PHE A 1 69 ? -9.779  -1.391  -6.469  1.00 0.00 ? 69  PHE A CB   3  
ATOM   3799  C  CG   . PHE A 1 69 ? -8.756  -1.075  -5.378  1.00 0.00 ? 69  PHE A CG   3  
ATOM   3800  C  CD1  . PHE A 1 69 ? -7.917  -2.077  -4.883  1.00 0.00 ? 69  PHE A CD1  3  
ATOM   3801  C  CD2  . PHE A 1 69 ? -8.641  0.204   -4.838  1.00 0.00 ? 69  PHE A CD2  3  
ATOM   3802  C  CE1  . PHE A 1 69 ? -7.002  -1.806  -3.888  1.00 0.00 ? 69  PHE A CE1  3  
ATOM   3803  C  CE2  . PHE A 1 69 ? -7.722  0.472   -3.843  1.00 0.00 ? 69  PHE A CE2  3  
ATOM   3804  C  CZ   . PHE A 1 69 ? -6.906  -0.532  -3.364  1.00 0.00 ? 69  PHE A CZ   3  
ATOM   3805  H  H    . PHE A 1 69 ? -11.646 -2.311  -7.975  1.00 0.00 ? 69  PHE A H    3  
ATOM   3806  H  HA   . PHE A 1 69 ? -10.792 -2.931  -5.316  1.00 0.00 ? 69  PHE A HA   3  
ATOM   3807  H  HB2  . PHE A 1 69 ? -9.297  -2.037  -7.193  1.00 0.00 ? 69  PHE A HB2  3  
ATOM   3808  H  HB3  . PHE A 1 69 ? -10.048 -0.464  -6.966  1.00 0.00 ? 69  PHE A HB3  3  
ATOM   3809  H  HD1  . PHE A 1 69 ? -7.989  -3.080  -5.289  1.00 0.00 ? 69  PHE A HD1  3  
ATOM   3810  H  HD2  . PHE A 1 69 ? -9.280  0.997   -5.203  1.00 0.00 ? 69  PHE A HD2  3  
ATOM   3811  H  HE1  . PHE A 1 69 ? -6.361  -2.597  -3.518  1.00 0.00 ? 69  PHE A HE1  3  
ATOM   3812  H  HE2  . PHE A 1 69 ? -7.644  1.474   -3.434  1.00 0.00 ? 69  PHE A HE2  3  
ATOM   3813  H  HZ   . PHE A 1 69 ? -6.187  -0.323  -2.585  1.00 0.00 ? 69  PHE A HZ   3  
ATOM   3814  N  N    . TYR A 1 70 ? -12.694 -0.248  -5.836  1.00 0.00 ? 70  TYR A N    3  
ATOM   3815  C  CA   . TYR A 1 70 ? -13.518 0.801   -5.210  1.00 0.00 ? 70  TYR A CA   3  
ATOM   3816  C  C    . TYR A 1 70 ? -14.822 0.185   -4.645  1.00 0.00 ? 70  TYR A C    3  
ATOM   3817  O  O    . TYR A 1 70 ? -14.846 -0.220  -3.481  1.00 0.00 ? 70  TYR A O    3  
ATOM   3818  C  CB   . TYR A 1 70 ? -13.775 1.937   -6.238  1.00 0.00 ? 70  TYR A CB   3  
ATOM   3819  C  CG   . TYR A 1 70 ? -14.373 3.224   -5.664  1.00 0.00 ? 70  TYR A CG   3  
ATOM   3820  C  CD1  . TYR A 1 70 ? -13.638 4.028   -4.791  1.00 0.00 ? 70  TYR A CD1  3  
ATOM   3821  C  CD2  . TYR A 1 70 ? -15.657 3.647   -6.014  1.00 0.00 ? 70  TYR A CD2  3  
ATOM   3822  C  CE1  . TYR A 1 70 ? -14.160 5.202   -4.292  1.00 0.00 ? 70  TYR A CE1  3  
ATOM   3823  C  CE2  . TYR A 1 70 ? -16.186 4.818   -5.517  1.00 0.00 ? 70  TYR A CE2  3  
ATOM   3824  C  CZ   . TYR A 1 70 ? -15.435 5.594   -4.655  1.00 0.00 ? 70  TYR A CZ   3  
ATOM   3825  O  OH   . TYR A 1 70 ? -15.962 6.768   -4.158  1.00 0.00 ? 70  TYR A OH   3  
ATOM   3826  H  H    . TYR A 1 70 ? -12.711 -0.317  -6.816  1.00 0.00 ? 70  TYR A H    3  
ATOM   3827  H  HA   . TYR A 1 70 ? -12.950 1.213   -4.377  1.00 0.00 ? 70  TYR A HA   3  
ATOM   3828  H  HB2  . TYR A 1 70 ? -12.832 2.207   -6.702  1.00 0.00 ? 70  TYR A HB2  3  
ATOM   3829  H  HB3  . TYR A 1 70 ? -14.440 1.567   -7.013  1.00 0.00 ? 70  TYR A HB3  3  
ATOM   3830  H  HD1  . TYR A 1 70 ? -12.635 3.718   -4.506  1.00 0.00 ? 70  TYR A HD1  3  
ATOM   3831  H  HD2  . TYR A 1 70 ? -16.242 3.036   -6.693  1.00 0.00 ? 70  TYR A HD2  3  
ATOM   3832  H  HE1  . TYR A 1 70 ? -13.569 5.809   -3.618  1.00 0.00 ? 70  TYR A HE1  3  
ATOM   3833  H  HE2  . TYR A 1 70 ? -17.183 5.120   -5.802  1.00 0.00 ? 70  TYR A HE2  3  
ATOM   3834  H  HH   . TYR A 1 70 ? -16.845 6.600   -3.809  1.00 0.00 ? 70  TYR A HH   3  
ATOM   3835  N  N    . GLN A 1 71 ? -15.888 0.056   -5.468  1.00 0.00 ? 71  GLN A N    3  
ATOM   3836  C  CA   . GLN A 1 71 ? -17.161 -0.572  -5.040  1.00 0.00 ? 71  GLN A CA   3  
ATOM   3837  C  C    . GLN A 1 71 ? -17.369 -1.900  -5.789  1.00 0.00 ? 71  GLN A C    3  
ATOM   3838  O  O    . GLN A 1 71 ? -16.803 -2.930  -5.395  1.00 0.00 ? 71  GLN A O    3  
ATOM   3839  C  CB   . GLN A 1 71 ? -18.368 0.406   -5.233  1.00 0.00 ? 71  GLN A CB   3  
ATOM   3840  C  CG   . GLN A 1 71 ? -18.325 1.689   -4.380  1.00 0.00 ? 71  GLN A CG   3  
ATOM   3841  C  CD   . GLN A 1 71 ? -18.298 1.421   -2.878  1.00 0.00 ? 71  GLN A CD   3  
ATOM   3842  O  OE1  . GLN A 1 71 ? -17.232 1.304   -2.271  1.00 0.00 ? 71  GLN A OE1  3  
ATOM   3843  N  NE2  . GLN A 1 71 ? -19.471 1.321   -2.273  1.00 0.00 ? 71  GLN A NE2  3  
ATOM   3844  H  H    . GLN A 1 71 ? -15.822 0.394   -6.383  1.00 0.00 ? 71  GLN A H    3  
ATOM   3845  H  HA   . GLN A 1 71 ? -17.089 -0.812  -3.980  1.00 0.00 ? 71  GLN A HA   3  
ATOM   3846  H  HB2  . GLN A 1 71 ? -18.404 0.704   -6.275  1.00 0.00 ? 71  GLN A HB2  3  
ATOM   3847  H  HB3  . GLN A 1 71 ? -19.290 -0.124  -5.001  1.00 0.00 ? 71  GLN A HB3  3  
ATOM   3848  H  HG2  . GLN A 1 71 ? -17.439 2.252   -4.646  1.00 0.00 ? 71  GLN A HG2  3  
ATOM   3849  H  HG3  . GLN A 1 71 ? -19.201 2.293   -4.610  1.00 0.00 ? 71  GLN A HG3  3  
ATOM   3850  H  HE21 . GLN A 1 71 ? -20.281 1.439   -2.814  1.00 0.00 ? 71  GLN A HE21 3  
ATOM   3851  H  HE22 . GLN A 1 71 ? -19.483 1.119   -1.316  1.00 0.00 ? 71  GLN A HE22 3  
ATOM   3852  N  N    . PHE A 1 72 ? -18.128 -1.863  -6.904  1.00 0.00 ? 72  PHE A N    3  
ATOM   3853  C  CA   . PHE A 1 72 ? -18.570 -3.041  -7.648  1.00 0.00 ? 72  PHE A CA   3  
ATOM   3854  C  C    . PHE A 1 72 ? -18.789 -2.573  -9.086  1.00 0.00 ? 72  PHE A C    3  
ATOM   3855  O  O    . PHE A 1 72 ? -19.462 -1.562  -9.320  1.00 0.00 ? 72  PHE A O    3  
ATOM   3856  C  CB   . PHE A 1 72 ? -19.925 -3.628  -7.120  1.00 0.00 ? 72  PHE A CB   3  
ATOM   3857  C  CG   . PHE A 1 72 ? -19.980 -3.971  -5.632  1.00 0.00 ? 72  PHE A CG   3  
ATOM   3858  C  CD1  . PHE A 1 72 ? -19.581 -5.221  -5.166  1.00 0.00 ? 72  PHE A CD1  3  
ATOM   3859  C  CD2  . PHE A 1 72 ? -20.423 -3.035  -4.698  1.00 0.00 ? 72  PHE A CD2  3  
ATOM   3860  C  CE1  . PHE A 1 72 ? -19.621 -5.519  -3.817  1.00 0.00 ? 72  PHE A CE1  3  
ATOM   3861  C  CE2  . PHE A 1 72 ? -20.458 -3.333  -3.354  1.00 0.00 ? 72  PHE A CE2  3  
ATOM   3862  C  CZ   . PHE A 1 72 ? -20.060 -4.576  -2.911  1.00 0.00 ? 72  PHE A CZ   3  
ATOM   3863  H  H    . PHE A 1 72 ? -18.323 -1.007  -7.315  1.00 0.00 ? 72  PHE A H    3  
ATOM   3864  H  HA   . PHE A 1 72 ? -17.789 -3.799  -7.615  1.00 0.00 ? 72  PHE A HA   3  
ATOM   3865  H  HB2  . PHE A 1 72 ? -20.724 -2.915  -7.318  1.00 0.00 ? 72  PHE A HB2  3  
ATOM   3866  H  HB3  . PHE A 1 72 ? -20.145 -4.534  -7.676  1.00 0.00 ? 72  PHE A HB3  3  
ATOM   3867  H  HD1  . PHE A 1 72 ? -19.235 -5.971  -5.869  1.00 0.00 ? 72  PHE A HD1  3  
ATOM   3868  H  HD2  . PHE A 1 72 ? -20.743 -2.057  -5.035  1.00 0.00 ? 72  PHE A HD2  3  
ATOM   3869  H  HE1  . PHE A 1 72 ? -19.314 -6.497  -3.470  1.00 0.00 ? 72  PHE A HE1  3  
ATOM   3870  H  HE2  . PHE A 1 72 ? -20.800 -2.588  -2.647  1.00 0.00 ? 72  PHE A HE2  3  
ATOM   3871  H  HZ   . PHE A 1 72 ? -20.084 -4.808  -1.853  1.00 0.00 ? 72  PHE A HZ   3  
ATOM   3872  N  N    . SER A 1 73 ? -18.262 -3.325  -10.024 1.00 0.00 ? 73  SER A N    3  
ATOM   3873  C  CA   . SER A 1 73 ? -18.448 -3.077  -11.450 1.00 0.00 ? 73  SER A CA   3  
ATOM   3874  C  C    . SER A 1 73 ? -18.200 -4.349  -12.251 1.00 0.00 ? 73  SER A C    3  
ATOM   3875  O  O    . SER A 1 73 ? -17.621 -5.318  -11.754 1.00 0.00 ? 73  SER A O    3  
ATOM   3876  C  CB   . SER A 1 73 ? -17.509 -1.941  -11.923 1.00 0.00 ? 73  SER A CB   3  
ATOM   3877  O  OG   . SER A 1 73 ? -17.719 -1.617  -13.287 1.00 0.00 ? 73  SER A OG   3  
ATOM   3878  H  H    . SER A 1 73 ? -17.689 -4.040  -9.739  1.00 0.00 ? 73  SER A H    3  
ATOM   3879  H  HA   . SER A 1 73 ? -19.480 -2.772  -11.608 1.00 0.00 ? 73  SER A HA   3  
ATOM   3880  H  HB2  . SER A 1 73 ? -17.691 -1.050  -11.337 1.00 0.00 ? 73  SER A HB2  3  
ATOM   3881  H  HB3  . SER A 1 73 ? -16.474 -2.240  -11.796 1.00 0.00 ? 73  SER A HB3  3  
ATOM   3882  H  HG   . SER A 1 73 ? -16.881 -1.327  -13.679 1.00 0.00 ? 73  SER A HG   3  
ATOM   3883  N  N    . CYS A 1 74 ? -18.640 -4.312  -13.509 1.00 0.00 ? 74  CYS A N    3  
ATOM   3884  C  CA   . CYS A 1 74 ? -18.363 -5.355  -14.491 1.00 0.00 ? 74  CYS A CA   3  
ATOM   3885  C  C    . CYS A 1 74 ? -17.069 -4.985  -15.207 1.00 0.00 ? 74  CYS A C    3  
ATOM   3886  O  O    . CYS A 1 74 ? -16.968 -3.887  -15.747 1.00 0.00 ? 74  CYS A O    3  
ATOM   3887  C  CB   . CYS A 1 74 ? -19.523 -5.494  -15.496 1.00 0.00 ? 74  CYS A CB   3  
ATOM   3888  S  SG   . CYS A 1 74 ? -19.145 -6.533  -16.942 1.00 0.00 ? 74  CYS A SG   3  
ATOM   3889  H  H    . CYS A 1 74 ? -19.119 -3.509  -13.796 1.00 0.00 ? 74  CYS A H    3  
ATOM   3890  H  HA   . CYS A 1 74 ? -18.233 -6.298  -13.965 1.00 0.00 ? 74  CYS A HA   3  
ATOM   3891  H  HB2  . CYS A 1 74 ? -20.374 -5.937  -14.996 1.00 0.00 ? 74  CYS A HB2  3  
ATOM   3892  H  HB3  . CYS A 1 74 ? -19.802 -4.513  -15.868 1.00 0.00 ? 74  CYS A HB3  3  
ATOM   3893  N  N    . ASN A 1 75 ? -16.099 -5.905  -15.198 1.00 0.00 ? 75  ASN A N    3  
ATOM   3894  C  CA   . ASN A 1 75 ? -14.758 -5.700  -15.808 1.00 0.00 ? 75  ASN A CA   3  
ATOM   3895  C  C    . ASN A 1 75 ? -14.825 -5.239  -17.287 1.00 0.00 ? 75  ASN A C    3  
ATOM   3896  O  O    . ASN A 1 75 ? -13.962 -4.497  -17.759 1.00 0.00 ? 75  ASN A O    3  
ATOM   3897  C  CB   . ASN A 1 75 ? -13.957 -7.029  -15.709 1.00 0.00 ? 75  ASN A CB   3  
ATOM   3898  C  CG   . ASN A 1 75 ? -12.505 -6.980  -16.236 1.00 0.00 ? 75  ASN A CG   3  
ATOM   3899  O  OD1  . ASN A 1 75 ? -11.985 -7.982  -16.730 1.00 0.00 ? 75  ASN A OD1  3  
ATOM   3900  N  ND2  . ASN A 1 75 ? -11.827 -5.842  -16.114 1.00 0.00 ? 75  ASN A ND2  3  
ATOM   3901  H  H    . ASN A 1 75 ? -16.278 -6.757  -14.744 1.00 0.00 ? 75  ASN A H    3  
ATOM   3902  H  HA   . ASN A 1 75 ? -14.245 -4.936  -15.226 1.00 0.00 ? 75  ASN A HA   3  
ATOM   3903  H  HB2  . ASN A 1 75 ? -13.914 -7.333  -14.669 1.00 0.00 ? 75  ASN A HB2  3  
ATOM   3904  H  HB3  . ASN A 1 75 ? -14.493 -7.794  -16.263 1.00 0.00 ? 75  ASN A HB3  3  
ATOM   3905  H  HD21 . ASN A 1 75 ? -12.271 -5.068  -15.703 1.00 0.00 ? 75  ASN A HD21 3  
ATOM   3906  H  HD22 . ASN A 1 75 ? -10.904 -5.825  -16.425 1.00 0.00 ? 75  ASN A HD22 3  
ATOM   3907  N  N    . ILE A 1 76 ? -15.879 -5.676  -17.987 1.00 0.00 ? 76  ILE A N    3  
ATOM   3908  C  CA   . ILE A 1 76 ? -15.940 -5.652  -19.457 1.00 0.00 ? 76  ILE A CA   3  
ATOM   3909  C  C    . ILE A 1 76 ? -16.830 -4.512  -20.016 1.00 0.00 ? 76  ILE A C    3  
ATOM   3910  O  O    . ILE A 1 76 ? -16.545 -3.999  -21.099 1.00 0.00 ? 76  ILE A O    3  
ATOM   3911  C  CB   . ILE A 1 76 ? -16.415 -7.065  -19.970 1.00 0.00 ? 76  ILE A CB   3  
ATOM   3912  C  CG1  . ILE A 1 76 ? -15.670 -8.182  -19.136 1.00 0.00 ? 76  ILE A CG1  3  
ATOM   3913  C  CG2  . ILE A 1 76 ? -16.207 -7.220  -21.502 1.00 0.00 ? 76  ILE A CG2  3  
ATOM   3914  C  CD1  . ILE A 1 76 ? -15.731 -9.584  -19.663 1.00 0.00 ? 76  ILE A CD1  3  
ATOM   3915  H  H    . ILE A 1 76 ? -16.622 -6.072  -17.504 1.00 0.00 ? 76  ILE A H    3  
ATOM   3916  H  HA   . ILE A 1 76 ? -14.923 -5.501  -19.829 1.00 0.00 ? 76  ILE A HA   3  
ATOM   3917  H  HB   . ILE A 1 76 ? -17.482 -7.151  -19.781 1.00 0.00 ? 76  ILE A HB   3  
ATOM   3918  H  HG12 . ILE A 1 76 ? -14.624 -7.932  -19.046 1.00 0.00 ? 76  ILE A HG12 3  
ATOM   3919  H  HG13 . ILE A 1 76 ? -16.108 -8.203  -18.137 1.00 0.00 ? 76  ILE A HG13 3  
ATOM   3920  H  HG21 . ILE A 1 76 ? -16.593 -8.178  -21.831 1.00 0.00 ? 76  ILE A HG21 3  
ATOM   3921  H  HG22 . ILE A 1 76 ? -15.152 -7.162  -21.744 1.00 0.00 ? 76  ILE A HG22 3  
ATOM   3922  H  HG23 . ILE A 1 76 ? -16.733 -6.429  -22.017 1.00 0.00 ? 76  ILE A HG23 3  
ATOM   3923  H  HD11 . ILE A 1 76 ? -15.309 -9.612  -20.656 1.00 0.00 ? 76  ILE A HD11 3  
ATOM   3924  H  HD12 . ILE A 1 76 ? -16.758 -9.910  -19.696 1.00 0.00 ? 76  ILE A HD12 3  
ATOM   3925  H  HD13 . ILE A 1 76 ? -15.167 -10.238 -19.017 1.00 0.00 ? 76  ILE A HD13 3  
ATOM   3926  N  N    . CYS A 1 77 ? -17.896 -4.097  -19.288 1.00 0.00 ? 77  CYS A N    3  
ATOM   3927  C  CA   . CYS A 1 77 ? -18.794 -3.009  -19.769 1.00 0.00 ? 77  CYS A CA   3  
ATOM   3928  C  C    . CYS A 1 77 ? -19.156 -2.018  -18.647 1.00 0.00 ? 77  CYS A C    3  
ATOM   3929  O  O    . CYS A 1 77 ? -19.852 -1.039  -18.900 1.00 0.00 ? 77  CYS A O    3  
ATOM   3930  C  CB   . CYS A 1 77 ? -20.062 -3.598  -20.449 1.00 0.00 ? 77  CYS A CB   3  
ATOM   3931  S  SG   . CYS A 1 77 ? -21.258 -4.394  -19.328 1.00 0.00 ? 77  CYS A SG   3  
ATOM   3932  H  H    . CYS A 1 77 ? -18.078 -4.515  -18.425 1.00 0.00 ? 77  CYS A H    3  
ATOM   3933  H  HA   . CYS A 1 77 ? -18.247 -2.436  -20.519 1.00 0.00 ? 77  CYS A HA   3  
ATOM   3934  H  HB2  . CYS A 1 77 ? -20.588 -2.805  -20.973 1.00 0.00 ? 77  CYS A HB2  3  
ATOM   3935  H  HB3  . CYS A 1 77 ? -19.757 -4.343  -21.172 1.00 0.00 ? 77  CYS A HB3  3  
ATOM   3936  N  N    . GLY A 1 78 ? -18.640 -2.253  -17.413 1.00 0.00 ? 78  GLY A N    3  
ATOM   3937  C  CA   . GLY A 1 78 ? -18.860 -1.347  -16.277 1.00 0.00 ? 78  GLY A CA   3  
ATOM   3938  C  C    . GLY A 1 78 ? -20.326 -1.149  -15.907 1.00 0.00 ? 78  GLY A C    3  
ATOM   3939  O  O    . GLY A 1 78 ? -20.717 -0.066  -15.478 1.00 0.00 ? 78  GLY A O    3  
ATOM   3940  H  H    . GLY A 1 78 ? -18.068 -3.027  -17.277 1.00 0.00 ? 78  GLY A H    3  
ATOM   3941  H  HA2  . GLY A 1 78 ? -18.345 -1.755  -15.421 1.00 0.00 ? 78  GLY A HA2  3  
ATOM   3942  H  HA3  . GLY A 1 78 ? -18.415 -0.389  -16.512 1.00 0.00 ? 78  GLY A HA3  3  
ATOM   3943  N  N    . LYS A 1 79 ? -21.119 -2.220  -16.074 1.00 0.00 ? 79  LYS A N    3  
ATOM   3944  C  CA   . LYS A 1 79 ? -22.587 -2.196  -15.959 1.00 0.00 ? 79  LYS A CA   3  
ATOM   3945  C  C    . LYS A 1 79 ? -23.063 -1.822  -14.531 1.00 0.00 ? 79  LYS A C    3  
ATOM   3946  O  O    . LYS A 1 79 ? -24.126 -1.217  -14.389 1.00 0.00 ? 79  LYS A O    3  
ATOM   3947  C  CB   . LYS A 1 79 ? -23.105 -3.597  -16.411 1.00 0.00 ? 79  LYS A CB   3  
ATOM   3948  C  CG   . LYS A 1 79 ? -24.465 -3.613  -17.142 1.00 0.00 ? 79  LYS A CG   3  
ATOM   3949  C  CD   . LYS A 1 79 ? -25.676 -3.282  -16.242 1.00 0.00 ? 79  LYS A CD   3  
ATOM   3950  C  CE   . LYS A 1 79 ? -26.993 -3.199  -17.023 1.00 0.00 ? 79  LYS A CE   3  
ATOM   3951  N  NZ   . LYS A 1 79 ? -28.115 -2.795  -16.143 1.00 0.00 ? 79  LYS A NZ   3  
ATOM   3952  H  H    . LYS A 1 79 ? -20.717 -3.049  -16.383 1.00 0.00 ? 79  LYS A H    3  
ATOM   3953  H  HA   . LYS A 1 79 ? -22.957 -1.455  -16.655 1.00 0.00 ? 79  LYS A HA   3  
ATOM   3954  H  HB2  . LYS A 1 79 ? -22.377 -4.033  -17.089 1.00 0.00 ? 79  LYS A HB2  3  
ATOM   3955  H  HB3  . LYS A 1 79 ? -23.172 -4.241  -15.549 1.00 0.00 ? 79  LYS A HB3  3  
ATOM   3956  H  HG2  . LYS A 1 79 ? -24.424 -2.891  -17.948 1.00 0.00 ? 79  LYS A HG2  3  
ATOM   3957  H  HG3  . LYS A 1 79 ? -24.601 -4.595  -17.566 1.00 0.00 ? 79  LYS A HG3  3  
ATOM   3958  H  HD2  . LYS A 1 79 ? -25.769 -4.055  -15.489 1.00 0.00 ? 79  LYS A HD2  3  
ATOM   3959  H  HD3  . LYS A 1 79 ? -25.503 -2.330  -15.751 1.00 0.00 ? 79  LYS A HD3  3  
ATOM   3960  H  HE2  . LYS A 1 79 ? -26.893 -2.463  -17.810 1.00 0.00 ? 79  LYS A HE2  3  
ATOM   3961  H  HE3  . LYS A 1 79 ? -27.219 -4.166  -17.463 1.00 0.00 ? 79  LYS A HE3  3  
ATOM   3962  H  HZ1  . LYS A 1 79 ? -27.891 -1.897  -15.672 1.00 0.00 ? 79  LYS A HZ1  3  
ATOM   3963  H  HZ2  . LYS A 1 79 ? -28.286 -3.522  -15.420 1.00 0.00 ? 79  LYS A HZ2  3  
ATOM   3964  H  HZ3  . LYS A 1 79 ? -28.981 -2.675  -16.704 1.00 0.00 ? 79  LYS A HZ3  3  
ATOM   3965  N  N    . LYS A 1 80 ? -22.257 -2.185  -13.500 1.00 0.00 ? 80  LYS A N    3  
ATOM   3966  C  CA   . LYS A 1 80 ? -22.495 -1.838  -12.080 1.00 0.00 ? 80  LYS A CA   3  
ATOM   3967  C  C    . LYS A 1 80 ? -23.638 -2.674  -11.486 1.00 0.00 ? 80  LYS A C    3  
ATOM   3968  O  O    . LYS A 1 80 ? -24.784 -2.581  -11.930 1.00 0.00 ? 80  LYS A O    3  
ATOM   3969  C  CB   . LYS A 1 80 ? -22.783 -0.317  -11.847 1.00 0.00 ? 80  LYS A CB   3  
ATOM   3970  C  CG   . LYS A 1 80 ? -21.709 0.665   -12.354 1.00 0.00 ? 80  LYS A CG   3  
ATOM   3971  C  CD   . LYS A 1 80 ? -20.320 0.422   -11.734 1.00 0.00 ? 80  LYS A CD   3  
ATOM   3972  C  CE   . LYS A 1 80 ? -19.295 1.494   -12.135 1.00 0.00 ? 80  LYS A CE   3  
ATOM   3973  N  NZ   . LYS A 1 80 ? -19.160 1.622   -13.605 1.00 0.00 ? 80  LYS A NZ   3  
ATOM   3974  H  H    . LYS A 1 80 ? -21.475 -2.731  -13.698 1.00 0.00 ? 80  LYS A H    3  
ATOM   3975  H  HA   . LYS A 1 80 ? -21.578 -2.099  -11.555 1.00 0.00 ? 80  LYS A HA   3  
ATOM   3976  H  HB2  . LYS A 1 80 ? -23.715 -0.064  -12.344 1.00 0.00 ? 80  LYS A HB2  3  
ATOM   3977  H  HB3  . LYS A 1 80 ? -22.915 -0.150  -10.780 1.00 0.00 ? 80  LYS A HB3  3  
ATOM   3978  H  HG2  . LYS A 1 80 ? -21.627 0.560   -13.432 1.00 0.00 ? 80  LYS A HG2  3  
ATOM   3979  H  HG3  . LYS A 1 80 ? -22.029 1.678   -12.121 1.00 0.00 ? 80  LYS A HG3  3  
ATOM   3980  H  HD2  . LYS A 1 80 ? -20.411 0.417   -10.653 1.00 0.00 ? 80  LYS A HD2  3  
ATOM   3981  H  HD3  . LYS A 1 80 ? -19.955 -0.549  -12.061 1.00 0.00 ? 80  LYS A HD3  3  
ATOM   3982  H  HE2  . LYS A 1 80 ? -19.606 2.451   -11.733 1.00 0.00 ? 80  LYS A HE2  3  
ATOM   3983  H  HE3  . LYS A 1 80 ? -18.327 1.234   -11.715 1.00 0.00 ? 80  LYS A HE3  3  
ATOM   3984  H  HZ1  . LYS A 1 80 ? -18.459 2.355   -13.837 1.00 0.00 ? 80  LYS A HZ1  3  
ATOM   3985  H  HZ2  . LYS A 1 80 ? -20.072 1.888   -14.032 1.00 0.00 ? 80  LYS A HZ2  3  
ATOM   3986  H  HZ3  . LYS A 1 80 ? -18.847 0.722   -14.019 1.00 0.00 ? 80  LYS A HZ3  3  
ATOM   3987  N  N    . PHE A 1 81 ? -23.302 -3.495  -10.481 1.00 0.00 ? 81  PHE A N    3  
ATOM   3988  C  CA   . PHE A 1 81 ? -24.272 -4.364  -9.768  1.00 0.00 ? 81  PHE A CA   3  
ATOM   3989  C  C    . PHE A 1 81 ? -24.107 -4.211  -8.250  1.00 0.00 ? 81  PHE A C    3  
ATOM   3990  O  O    . PHE A 1 81 ? -23.059 -3.765  -7.778  1.00 0.00 ? 81  PHE A O    3  
ATOM   3991  C  CB   . PHE A 1 81 ? -24.095 -5.845  -10.183 1.00 0.00 ? 81  PHE A CB   3  
ATOM   3992  C  CG   . PHE A 1 81 ? -24.376 -6.084  -11.657 1.00 0.00 ? 81  PHE A CG   3  
ATOM   3993  C  CD1  . PHE A 1 81 ? -23.377 -5.917  -12.616 1.00 0.00 ? 81  PHE A CD1  3  
ATOM   3994  C  CD2  . PHE A 1 81 ? -25.648 -6.438  -12.091 1.00 0.00 ? 81  PHE A CD2  3  
ATOM   3995  C  CE1  . PHE A 1 81 ? -23.644 -6.109  -13.943 1.00 0.00 ? 81  PHE A CE1  3  
ATOM   3996  C  CE2  . PHE A 1 81 ? -25.914 -6.623  -13.424 1.00 0.00 ? 81  PHE A CE2  3  
ATOM   3997  C  CZ   . PHE A 1 81 ? -24.914 -6.458  -14.350 1.00 0.00 ? 81  PHE A CZ   3  
ATOM   3998  H  H    . PHE A 1 81 ? -22.366 -3.514  -10.201 1.00 0.00 ? 81  PHE A H    3  
ATOM   3999  H  HA   . PHE A 1 81 ? -25.276 -4.042  -10.035 1.00 0.00 ? 81  PHE A HA   3  
ATOM   4000  H  HB2  . PHE A 1 81 ? -23.078 -6.157  -9.977  1.00 0.00 ? 81  PHE A HB2  3  
ATOM   4001  H  HB3  . PHE A 1 81 ? -24.773 -6.468  -9.606  1.00 0.00 ? 81  PHE A HB3  3  
ATOM   4002  H  HD1  . PHE A 1 81 ? -22.374 -5.628  -12.303 1.00 0.00 ? 81  PHE A HD1  3  
ATOM   4003  H  HD2  . PHE A 1 81 ? -26.438 -6.575  -11.363 1.00 0.00 ? 81  PHE A HD2  3  
ATOM   4004  H  HE1  . PHE A 1 81 ? -22.859 -5.980  -14.676 1.00 0.00 ? 81  PHE A HE1  3  
ATOM   4005  H  HE2  . PHE A 1 81 ? -26.912 -6.901  -13.746 1.00 0.00 ? 81  PHE A HE2  3  
ATOM   4006  H  HZ   . PHE A 1 81 ? -25.123 -6.602  -15.396 1.00 0.00 ? 81  PHE A HZ   3  
ATOM   4007  N  N    . GLU A 1 82 ? -25.156 -4.581  -7.502  1.00 0.00 ? 82  GLU A N    3  
ATOM   4008  C  CA   . GLU A 1 82 ? -25.194 -4.448  -6.039  1.00 0.00 ? 82  GLU A CA   3  
ATOM   4009  C  C    . GLU A 1 82 ? -24.255 -5.464  -5.347  1.00 0.00 ? 82  GLU A C    3  
ATOM   4010  O  O    . GLU A 1 82 ? -23.713 -5.181  -4.271  1.00 0.00 ? 82  GLU A O    3  
ATOM   4011  C  CB   . GLU A 1 82 ? -26.644 -4.628  -5.517  1.00 0.00 ? 82  GLU A CB   3  
ATOM   4012  C  CG   . GLU A 1 82 ? -27.703 -3.634  -6.063  1.00 0.00 ? 82  GLU A CG   3  
ATOM   4013  C  CD   . GLU A 1 82 ? -28.103 -3.848  -7.542  1.00 0.00 ? 82  GLU A CD   3  
ATOM   4014  O  OE1  . GLU A 1 82 ? -28.883 -4.787  -7.831  1.00 0.00 ? 82  GLU A OE1  3  
ATOM   4015  O  OE2  . GLU A 1 82 ? -27.627 -3.097  -8.420  1.00 0.00 ? 82  GLU A OE2  3  
ATOM   4016  H  H    . GLU A 1 82 ? -25.959 -4.918  -7.951  1.00 0.00 ? 82  GLU A H    3  
ATOM   4017  H  HA   . GLU A 1 82 ? -24.858 -3.443  -5.792  1.00 0.00 ? 82  GLU A HA   3  
ATOM   4018  H  HB2  . GLU A 1 82 ? -26.973 -5.631  -5.761  1.00 0.00 ? 82  GLU A HB2  3  
ATOM   4019  H  HB3  . GLU A 1 82 ? -26.630 -4.530  -4.435  1.00 0.00 ? 82  GLU A HB3  3  
ATOM   4020  H  HG2  . GLU A 1 82 ? -28.596 -3.726  -5.456  1.00 0.00 ? 82  GLU A HG2  3  
ATOM   4021  H  HG3  . GLU A 1 82 ? -27.315 -2.625  -5.945  1.00 0.00 ? 82  GLU A HG3  3  
ATOM   4022  N  N    . LYS A 1 83 ? -24.074 -6.647  -5.970  1.00 0.00 ? 83  LYS A N    3  
ATOM   4023  C  CA   . LYS A 1 83 ? -23.242 -7.715  -5.427  1.00 0.00 ? 83  LYS A CA   3  
ATOM   4024  C  C    . LYS A 1 83 ? -22.343 -8.268  -6.534  1.00 0.00 ? 83  LYS A C    3  
ATOM   4025  O  O    . LYS A 1 83 ? -22.717 -8.277  -7.720  1.00 0.00 ? 83  LYS A O    3  
ATOM   4026  C  CB   . LYS A 1 83 ? -24.138 -8.821  -4.794  1.00 0.00 ? 83  LYS A CB   3  
ATOM   4027  C  CG   . LYS A 1 83 ? -25.154 -9.475  -5.761  1.00 0.00 ? 83  LYS A CG   3  
ATOM   4028  C  CD   . LYS A 1 83 ? -26.058 -10.528 -5.073  1.00 0.00 ? 83  LYS A CD   3  
ATOM   4029  C  CE   . LYS A 1 83 ? -26.995 -9.921  -4.003  1.00 0.00 ? 83  LYS A CE   3  
ATOM   4030  N  NZ   . LYS A 1 83 ? -27.806 -10.959 -3.308  1.00 0.00 ? 83  LYS A NZ   3  
ATOM   4031  H  H    . LYS A 1 83 ? -24.515 -6.805  -6.832  1.00 0.00 ? 83  LYS A H    3  
ATOM   4032  H  HA   . LYS A 1 83 ? -22.610 -7.293  -4.646  1.00 0.00 ? 83  LYS A HA   3  
ATOM   4033  H  HB2  . LYS A 1 83 ? -23.500 -9.602  -4.390  1.00 0.00 ? 83  LYS A HB2  3  
ATOM   4034  H  HB3  . LYS A 1 83 ? -24.695 -8.379  -3.973  1.00 0.00 ? 83  LYS A HB3  3  
ATOM   4035  H  HG2  . LYS A 1 83 ? -25.786 -8.699  -6.178  1.00 0.00 ? 83  LYS A HG2  3  
ATOM   4036  H  HG3  . LYS A 1 83 ? -24.607 -9.955  -6.566  1.00 0.00 ? 83  LYS A HG3  3  
ATOM   4037  H  HD2  . LYS A 1 83 ? -26.666 -11.006 -5.833  1.00 0.00 ? 83  LYS A HD2  3  
ATOM   4038  H  HD3  . LYS A 1 83 ? -25.432 -11.280 -4.604  1.00 0.00 ? 83  LYS A HD3  3  
ATOM   4039  H  HE2  . LYS A 1 83 ? -26.405 -9.397  -3.264  1.00 0.00 ? 83  LYS A HE2  3  
ATOM   4040  H  HE3  . LYS A 1 83 ? -27.670 -9.216  -4.480  1.00 0.00 ? 83  LYS A HE3  3  
ATOM   4041  H  HZ1  . LYS A 1 83 ? -27.186 -11.595 -2.772  1.00 0.00 ? 83  LYS A HZ1  3  
ATOM   4042  H  HZ2  . LYS A 1 83 ? -28.343 -11.520 -4.003  1.00 0.00 ? 83  LYS A HZ2  3  
ATOM   4043  H  HZ3  . LYS A 1 83 ? -28.477 -10.506 -2.651  1.00 0.00 ? 83  LYS A HZ3  3  
ATOM   4044  N  N    . LYS A 1 84 ? -21.158 -8.705  -6.110  1.00 0.00 ? 84  LYS A N    3  
ATOM   4045  C  CA   . LYS A 1 84 ? -20.141 -9.333  -6.970  1.00 0.00 ? 84  LYS A CA   3  
ATOM   4046  C  C    . LYS A 1 84 ? -20.717 -10.562 -7.694  1.00 0.00 ? 84  LYS A C    3  
ATOM   4047  O  O    . LYS A 1 84 ? -20.363 -10.837 -8.836  1.00 0.00 ? 84  LYS A O    3  
ATOM   4048  C  CB   . LYS A 1 84 ? -18.933 -9.771  -6.107  1.00 0.00 ? 84  LYS A CB   3  
ATOM   4049  C  CG   . LYS A 1 84 ? -18.308 -8.656  -5.241  1.00 0.00 ? 84  LYS A CG   3  
ATOM   4050  C  CD   . LYS A 1 84 ? -17.112 -9.138  -4.390  1.00 0.00 ? 84  LYS A CD   3  
ATOM   4051  C  CE   . LYS A 1 84 ? -15.932 -9.600  -5.256  1.00 0.00 ? 84  LYS A CE   3  
ATOM   4052  N  NZ   . LYS A 1 84 ? -15.484 -8.514  -6.166  1.00 0.00 ? 84  LYS A NZ   3  
ATOM   4053  H  H    . LYS A 1 84 ? -20.956 -8.584  -5.165  1.00 0.00 ? 84  LYS A H    3  
ATOM   4054  H  HA   . LYS A 1 84 ? -19.815 -8.599  -7.704  1.00 0.00 ? 84  LYS A HA   3  
ATOM   4055  H  HB2  . LYS A 1 84 ? -19.260 -10.562 -5.439  1.00 0.00 ? 84  LYS A HB2  3  
ATOM   4056  H  HB3  . LYS A 1 84 ? -18.166 -10.167 -6.762  1.00 0.00 ? 84  LYS A HB3  3  
ATOM   4057  H  HG2  . LYS A 1 84 ? -17.966 -7.857  -5.892  1.00 0.00 ? 84  LYS A HG2  3  
ATOM   4058  H  HG3  . LYS A 1 84 ? -19.072 -8.262  -4.577  1.00 0.00 ? 84  LYS A HG3  3  
ATOM   4059  H  HD2  . LYS A 1 84 ? -16.775 -8.317  -3.765  1.00 0.00 ? 84  LYS A HD2  3  
ATOM   4060  H  HD3  . LYS A 1 84 ? -17.431 -9.958  -3.753  1.00 0.00 ? 84  LYS A HD3  3  
ATOM   4061  H  HE2  . LYS A 1 84 ? -15.106 -9.885  -4.615  1.00 0.00 ? 84  LYS A HE2  3  
ATOM   4062  H  HE3  . LYS A 1 84 ? -16.235 -10.455 -5.849  1.00 0.00 ? 84  LYS A HE3  3  
ATOM   4063  H  HZ1  . LYS A 1 84 ? -15.218 -7.671  -5.615  1.00 0.00 ? 84  LYS A HZ1  3  
ATOM   4064  H  HZ2  . LYS A 1 84 ? -16.244 -8.256  -6.825  1.00 0.00 ? 84  LYS A HZ2  3  
ATOM   4065  H  HZ3  . LYS A 1 84 ? -14.662 -8.828  -6.717  1.00 0.00 ? 84  LYS A HZ3  3  
ATOM   4066  N  N    . ASP A 1 85 ? -21.603 -11.283 -6.987  1.00 0.00 ? 85  ASP A N    3  
ATOM   4067  C  CA   . ASP A 1 85 ? -22.311 -12.462 -7.508  1.00 0.00 ? 85  ASP A CA   3  
ATOM   4068  C  C    . ASP A 1 85 ? -23.040 -12.135 -8.824  1.00 0.00 ? 85  ASP A C    3  
ATOM   4069  O  O    . ASP A 1 85 ? -22.926 -12.881 -9.802  1.00 0.00 ? 85  ASP A O    3  
ATOM   4070  C  CB   . ASP A 1 85 ? -23.317 -12.972 -6.447  1.00 0.00 ? 85  ASP A CB   3  
ATOM   4071  C  CG   . ASP A 1 85 ? -24.195 -14.140 -6.937  1.00 0.00 ? 85  ASP A CG   3  
ATOM   4072  O  OD1  . ASP A 1 85 ? -23.681 -15.273 -7.066  1.00 0.00 ? 85  ASP A OD1  3  
ATOM   4073  O  OD2  . ASP A 1 85 ? -25.396 -13.932 -7.206  1.00 0.00 ? 85  ASP A OD2  3  
ATOM   4074  H  H    . ASP A 1 85 ? -21.773 -11.018 -6.059  1.00 0.00 ? 85  ASP A H    3  
ATOM   4075  H  HA   . ASP A 1 85 ? -21.570 -13.239 -7.693  1.00 0.00 ? 85  ASP A HA   3  
ATOM   4076  H  HB2  . ASP A 1 85 ? -22.768 -13.302 -5.563  1.00 0.00 ? 85  ASP A HB2  3  
ATOM   4077  H  HB3  . ASP A 1 85 ? -23.957 -12.148 -6.158  1.00 0.00 ? 85  ASP A HB3  3  
ATOM   4078  N  N    . SER A 1 86 ? -23.753 -10.987 -8.844  1.00 0.00 ? 86  SER A N    3  
ATOM   4079  C  CA   . SER A 1 86 ? -24.556 -10.565 -9.995  1.00 0.00 ? 86  SER A CA   3  
ATOM   4080  C  C    . SER A 1 86 ? -23.647 -10.172 -11.187 1.00 0.00 ? 86  SER A C    3  
ATOM   4081  O  O    . SER A 1 86 ? -24.048 -10.304 -12.337 1.00 0.00 ? 86  SER A O    3  
ATOM   4082  C  CB   . SER A 1 86 ? -25.494 -9.403  -9.595  1.00 0.00 ? 86  SER A CB   3  
ATOM   4083  O  OG   . SER A 1 86 ? -26.422 -9.100  -10.620 1.00 0.00 ? 86  SER A OG   3  
ATOM   4084  H  H    . SER A 1 86 ? -23.731 -10.389 -8.060  1.00 0.00 ? 86  SER A H    3  
ATOM   4085  H  HA   . SER A 1 86 ? -25.169 -11.414 -10.287 1.00 0.00 ? 86  SER A HA   3  
ATOM   4086  H  HB2  . SER A 1 86 ? -26.053 -9.672  -8.704  1.00 0.00 ? 86  SER A HB2  3  
ATOM   4087  H  HB3  . SER A 1 86 ? -24.911 -8.516  -9.390  1.00 0.00 ? 86  SER A HB3  3  
ATOM   4088  H  HG   . SER A 1 86 ? -26.270 -9.676  -11.379 1.00 0.00 ? 86  SER A HG   3  
ATOM   4089  N  N    . VAL A 1 87 ? -22.420 -9.703  -10.874 1.00 0.00 ? 87  VAL A N    3  
ATOM   4090  C  CA   . VAL A 1 87 ? -21.419 -9.265  -11.876 1.00 0.00 ? 87  VAL A CA   3  
ATOM   4091  C  C    . VAL A 1 87 ? -20.874 -10.482 -12.640 1.00 0.00 ? 87  VAL A C    3  
ATOM   4092  O  O    . VAL A 1 87 ? -20.810 -10.483 -13.871 1.00 0.00 ? 87  VAL A O    3  
ATOM   4093  C  CB   . VAL A 1 87 ? -20.212 -8.502  -11.191 1.00 0.00 ? 87  VAL A CB   3  
ATOM   4094  C  CG1  . VAL A 1 87 ? -19.102 -8.148  -12.214 1.00 0.00 ? 87  VAL A CG1  3  
ATOM   4095  C  CG2  . VAL A 1 87 ? -20.690 -7.240  -10.425 1.00 0.00 ? 87  VAL A CG2  3  
ATOM   4096  H  H    . VAL A 1 87 ? -22.158 -9.713  -9.933  1.00 0.00 ? 87  VAL A H    3  
ATOM   4097  H  HA   . VAL A 1 87 ? -21.906 -8.591  -12.577 1.00 0.00 ? 87  VAL A HA   3  
ATOM   4098  H  HB   . VAL A 1 87 ? -19.774 -9.177  -10.456 1.00 0.00 ? 87  VAL A HB   3  
ATOM   4099  H  HG11 . VAL A 1 87 ? -19.516 -7.511  -12.989 1.00 0.00 ? 87  VAL A HG11 3  
ATOM   4100  H  HG12 . VAL A 1 87 ? -18.717 -9.051  -12.668 1.00 0.00 ? 87  VAL A HG12 3  
ATOM   4101  H  HG13 . VAL A 1 87 ? -18.294 -7.629  -11.715 1.00 0.00 ? 87  VAL A HG13 3  
ATOM   4102  H  HG21 . VAL A 1 87 ? -21.147 -6.541  -11.116 1.00 0.00 ? 87  VAL A HG21 3  
ATOM   4103  H  HG22 . VAL A 1 87 ? -19.845 -6.760  -9.940  1.00 0.00 ? 87  VAL A HG22 3  
ATOM   4104  H  HG23 . VAL A 1 87 ? -21.416 -7.520  -9.671  1.00 0.00 ? 87  VAL A HG23 3  
ATOM   4105  N  N    . VAL A 1 88 ? -20.526 -11.513 -11.856 1.00 0.00 ? 88  VAL A N    3  
ATOM   4106  C  CA   . VAL A 1 88 ? -19.892 -12.757 -12.334 1.00 0.00 ? 88  VAL A CA   3  
ATOM   4107  C  C    . VAL A 1 88 ? -20.932 -13.578 -13.102 1.00 0.00 ? 88  VAL A C    3  
ATOM   4108  O  O    . VAL A 1 88 ? -20.624 -14.191 -14.136 1.00 0.00 ? 88  VAL A O    3  
ATOM   4109  C  CB   . VAL A 1 88 ? -19.313 -13.598 -11.125 1.00 0.00 ? 88  VAL A CB   3  
ATOM   4110  C  CG1  . VAL A 1 88 ? -18.669 -14.927 -11.599 1.00 0.00 ? 88  VAL A CG1  3  
ATOM   4111  C  CG2  . VAL A 1 88 ? -18.298 -12.758 -10.310 1.00 0.00 ? 88  VAL A CG2  3  
ATOM   4112  H  H    . VAL A 1 88 ? -20.753 -11.446 -10.918 1.00 0.00 ? 88  VAL A H    3  
ATOM   4113  H  HA   . VAL A 1 88 ? -19.067 -12.494 -13.000 1.00 0.00 ? 88  VAL A HA   3  
ATOM   4114  H  HB   . VAL A 1 88 ? -20.140 -13.849 -10.460 1.00 0.00 ? 88  VAL A HB   3  
ATOM   4115  H  HG11 . VAL A 1 88 ? -19.410 -15.525 -12.119 1.00 0.00 ? 88  VAL A HG11 3  
ATOM   4116  H  HG12 . VAL A 1 88 ? -18.298 -15.489 -10.749 1.00 0.00 ? 88  VAL A HG12 3  
ATOM   4117  H  HG13 . VAL A 1 88 ? -17.846 -14.718 -12.273 1.00 0.00 ? 88  VAL A HG13 3  
ATOM   4118  H  HG21 . VAL A 1 88 ? -18.774 -11.849 -9.959  1.00 0.00 ? 88  VAL A HG21 3  
ATOM   4119  H  HG22 . VAL A 1 88 ? -17.452 -12.496 -10.931 1.00 0.00 ? 88  VAL A HG22 3  
ATOM   4120  H  HG23 . VAL A 1 88 ? -17.948 -13.325 -9.452  1.00 0.00 ? 88  VAL A HG23 3  
ATOM   4121  N  N    . ALA A 1 89 ? -22.184 -13.515 -12.603 1.00 0.00 ? 89  ALA A N    3  
ATOM   4122  C  CA   . ALA A 1 89 ? -23.329 -14.197 -13.207 1.00 0.00 ? 89  ALA A CA   3  
ATOM   4123  C  C    . ALA A 1 89 ? -23.666 -13.544 -14.553 1.00 0.00 ? 89  ALA A C    3  
ATOM   4124  O  O    . ALA A 1 89 ? -23.900 -14.236 -15.545 1.00 0.00 ? 89  ALA A O    3  
ATOM   4125  C  CB   . ALA A 1 89 ? -24.541 -14.165 -12.257 1.00 0.00 ? 89  ALA A CB   3  
ATOM   4126  H  H    . ALA A 1 89 ? -22.340 -12.951 -11.811 1.00 0.00 ? 89  ALA A H    3  
ATOM   4127  H  HA   . ALA A 1 89 ? -23.048 -15.236 -13.365 1.00 0.00 ? 89  ALA A HA   3  
ATOM   4128  H  HB1  . ALA A 1 89 ? -25.373 -14.698 -12.700 1.00 0.00 ? 89  ALA A HB1  3  
ATOM   4129  H  HB2  . ALA A 1 89 ? -24.831 -13.139 -12.070 1.00 0.00 ? 89  ALA A HB2  3  
ATOM   4130  H  HB3  . ALA A 1 89 ? -24.279 -14.635 -11.318 1.00 0.00 ? 89  ALA A HB3  3  
ATOM   4131  N  N    . HIS A 1 90 ? -23.605 -12.195 -14.574 1.00 0.00 ? 90  HIS A N    3  
ATOM   4132  C  CA   . HIS A 1 90 ? -23.894 -11.384 -15.786 1.00 0.00 ? 90  HIS A CA   3  
ATOM   4133  C  C    . HIS A 1 90 ? -22.773 -11.549 -16.825 1.00 0.00 ? 90  HIS A C    3  
ATOM   4134  O  O    . HIS A 1 90 ? -23.034 -11.530 -18.021 1.00 0.00 ? 90  HIS A O    3  
ATOM   4135  C  CB   . HIS A 1 90 ? -24.097 -9.878  -15.396 1.00 0.00 ? 90  HIS A CB   3  
ATOM   4136  C  CG   . HIS A 1 90 ? -23.642 -8.851  -16.419 1.00 0.00 ? 90  HIS A CG   3  
ATOM   4137  N  ND1  . HIS A 1 90 ? -24.444 -8.320  -17.403 1.00 0.00 ? 90  HIS A ND1  3  
ATOM   4138  C  CD2  . HIS A 1 90 ? -22.433 -8.246  -16.568 1.00 0.00 ? 90  HIS A CD2  3  
ATOM   4139  C  CE1  . HIS A 1 90 ? -23.720 -7.436  -18.097 1.00 0.00 ? 90  HIS A CE1  3  
ATOM   4140  N  NE2  . HIS A 1 90 ? -22.486 -7.357  -17.626 1.00 0.00 ? 90  HIS A NE2  3  
ATOM   4141  H  H    . HIS A 1 90 ? -23.335 -11.720 -13.742 1.00 0.00 ? 90  HIS A H    3  
ATOM   4142  H  HA   . HIS A 1 90 ? -24.820 -11.762 -16.221 1.00 0.00 ? 90  HIS A HA   3  
ATOM   4143  H  HB2  . HIS A 1 90 ? -25.149 -9.702  -15.215 1.00 0.00 ? 90  HIS A HB2  3  
ATOM   4144  H  HB3  . HIS A 1 90 ? -23.560 -9.675  -14.475 1.00 0.00 ? 90  HIS A HB3  3  
ATOM   4145  H  HD1  . HIS A 1 90 ? -25.384 -8.555  -17.571 1.00 0.00 ? 90  HIS A HD1  3  
ATOM   4146  H  HD2  . HIS A 1 90 ? -21.556 -8.433  -15.969 1.00 0.00 ? 90  HIS A HD2  3  
ATOM   4147  H  HE1  . HIS A 1 90 ? -24.098 -6.854  -18.925 1.00 0.00 ? 90  HIS A HE1  3  
ATOM   4148  N  N    . LYS A 1 91 ? -21.538 -11.700 -16.338 1.00 0.00 ? 91  LYS A N    3  
ATOM   4149  C  CA   . LYS A 1 91 ? -20.323 -11.754 -17.170 1.00 0.00 ? 91  LYS A CA   3  
ATOM   4150  C  C    . LYS A 1 91 ? -20.288 -13.080 -17.930 1.00 0.00 ? 91  LYS A C    3  
ATOM   4151  O  O    . LYS A 1 91 ? -19.901 -13.133 -19.097 1.00 0.00 ? 91  LYS A O    3  
ATOM   4152  C  CB   . LYS A 1 91 ? -19.051 -11.567 -16.289 1.00 0.00 ? 91  LYS A CB   3  
ATOM   4153  C  CG   . LYS A 1 91 ? -17.724 -11.345 -17.071 1.00 0.00 ? 91  LYS A CG   3  
ATOM   4154  C  CD   . LYS A 1 91 ? -16.972 -12.635 -17.475 1.00 0.00 ? 91  LYS A CD   3  
ATOM   4155  C  CE   . LYS A 1 91 ? -16.597 -13.510 -16.277 1.00 0.00 ? 91  LYS A CE   3  
ATOM   4156  N  NZ   . LYS A 1 91 ? -15.752 -14.652 -16.682 1.00 0.00 ? 91  LYS A NZ   3  
ATOM   4157  H  H    . LYS A 1 91 ? -21.446 -11.822 -15.382 1.00 0.00 ? 91  LYS A H    3  
ATOM   4158  H  HA   . LYS A 1 91 ? -20.371 -10.935 -17.887 1.00 0.00 ? 91  LYS A HA   3  
ATOM   4159  H  HB2  . LYS A 1 91 ? -19.207 -10.700 -15.650 1.00 0.00 ? 91  LYS A HB2  3  
ATOM   4160  H  HB3  . LYS A 1 91 ? -18.937 -12.436 -15.648 1.00 0.00 ? 91  LYS A HB3  3  
ATOM   4161  H  HG2  . LYS A 1 91 ? -17.963 -10.814 -17.984 1.00 0.00 ? 91  LYS A HG2  3  
ATOM   4162  H  HG3  . LYS A 1 91 ? -17.066 -10.725 -16.473 1.00 0.00 ? 91  LYS A HG3  3  
ATOM   4163  H  HD2  . LYS A 1 91 ? -17.602 -13.217 -18.138 1.00 0.00 ? 91  LYS A HD2  3  
ATOM   4164  H  HD3  . LYS A 1 91 ? -16.064 -12.360 -18.006 1.00 0.00 ? 91  LYS A HD3  3  
ATOM   4165  H  HE2  . LYS A 1 91 ? -16.049 -12.921 -15.556 1.00 0.00 ? 91  LYS A HE2  3  
ATOM   4166  H  HE3  . LYS A 1 91 ? -17.500 -13.896 -15.819 1.00 0.00 ? 91  LYS A HE3  3  
ATOM   4167  H  HZ1  . LYS A 1 91 ? -15.679 -15.333 -15.899 1.00 0.00 ? 91  LYS A HZ1  3  
ATOM   4168  H  HZ2  . LYS A 1 91 ? -14.797 -14.319 -16.922 1.00 0.00 ? 91  LYS A HZ2  3  
ATOM   4169  H  HZ3  . LYS A 1 91 ? -16.160 -15.127 -17.507 1.00 0.00 ? 91  LYS A HZ3  3  
ATOM   4170  N  N    . ALA A 1 92 ? -20.719 -14.142 -17.238 1.00 0.00 ? 92  ALA A N    3  
ATOM   4171  C  CA   . ALA A 1 92 ? -20.778 -15.493 -17.799 1.00 0.00 ? 92  ALA A CA   3  
ATOM   4172  C  C    . ALA A 1 92 ? -21.880 -15.618 -18.885 1.00 0.00 ? 92  ALA A C    3  
ATOM   4173  O  O    . ALA A 1 92 ? -21.866 -16.558 -19.688 1.00 0.00 ? 92  ALA A O    3  
ATOM   4174  C  CB   . ALA A 1 92 ? -20.995 -16.525 -16.680 1.00 0.00 ? 92  ALA A CB   3  
ATOM   4175  H  H    . ALA A 1 92 ? -21.007 -14.005 -16.317 1.00 0.00 ? 92  ALA A H    3  
ATOM   4176  H  HA   . ALA A 1 92 ? -19.812 -15.681 -18.251 1.00 0.00 ? 92  ALA A HA   3  
ATOM   4177  H  HB1  . ALA A 1 92 ? -20.214 -16.427 -15.936 1.00 0.00 ? 92  ALA A HB1  3  
ATOM   4178  H  HB2  . ALA A 1 92 ? -20.970 -17.528 -17.092 1.00 0.00 ? 92  ALA A HB2  3  
ATOM   4179  H  HB3  . ALA A 1 92 ? -21.957 -16.360 -16.208 1.00 0.00 ? 92  ALA A HB3  3  
ATOM   4180  N  N    . LYS A 1 93 ? -22.835 -14.660 -18.891 1.00 0.00 ? 93  LYS A N    3  
ATOM   4181  C  CA   . LYS A 1 93 ? -23.960 -14.629 -19.867 1.00 0.00 ? 93  LYS A CA   3  
ATOM   4182  C  C    . LYS A 1 93 ? -23.635 -13.696 -21.045 1.00 0.00 ? 93  LYS A C    3  
ATOM   4183  O  O    . LYS A 1 93 ? -23.759 -14.069 -22.217 1.00 0.00 ? 93  LYS A O    3  
ATOM   4184  C  CB   . LYS A 1 93 ? -25.258 -14.133 -19.170 1.00 0.00 ? 93  LYS A CB   3  
ATOM   4185  C  CG   . LYS A 1 93 ? -25.736 -15.022 -18.010 1.00 0.00 ? 93  LYS A CG   3  
ATOM   4186  C  CD   . LYS A 1 93 ? -26.933 -14.403 -17.259 1.00 0.00 ? 93  LYS A CD   3  
ATOM   4187  C  CE   . LYS A 1 93 ? -27.331 -15.206 -16.013 1.00 0.00 ? 93  LYS A CE   3  
ATOM   4188  N  NZ   . LYS A 1 93 ? -28.434 -14.550 -15.276 1.00 0.00 ? 93  LYS A NZ   3  
ATOM   4189  H  H    . LYS A 1 93 ? -22.783 -13.941 -18.217 1.00 0.00 ? 93  LYS A H    3  
ATOM   4190  H  HA   . LYS A 1 93 ? -24.127 -15.636 -20.246 1.00 0.00 ? 93  LYS A HA   3  
ATOM   4191  H  HB2  . LYS A 1 93 ? -25.084 -13.133 -18.779 1.00 0.00 ? 93  LYS A HB2  3  
ATOM   4192  H  HB3  . LYS A 1 93 ? -26.057 -14.078 -19.906 1.00 0.00 ? 93  LYS A HB3  3  
ATOM   4193  H  HG2  . LYS A 1 93 ? -26.032 -15.990 -18.408 1.00 0.00 ? 93  LYS A HG2  3  
ATOM   4194  H  HG3  . LYS A 1 93 ? -24.914 -15.159 -17.316 1.00 0.00 ? 93  LYS A HG3  3  
ATOM   4195  H  HD2  . LYS A 1 93 ? -26.673 -13.394 -16.948 1.00 0.00 ? 93  LYS A HD2  3  
ATOM   4196  H  HD3  . LYS A 1 93 ? -27.784 -14.356 -17.932 1.00 0.00 ? 93  LYS A HD3  3  
ATOM   4197  H  HE2  . LYS A 1 93 ? -27.655 -16.194 -16.315 1.00 0.00 ? 93  LYS A HE2  3  
ATOM   4198  H  HE3  . LYS A 1 93 ? -26.472 -15.294 -15.353 1.00 0.00 ? 93  LYS A HE3  3  
ATOM   4199  H  HZ1  . LYS A 1 93 ? -29.297 -14.543 -15.859 1.00 0.00 ? 93  LYS A HZ1  3  
ATOM   4200  H  HZ2  . LYS A 1 93 ? -28.176 -13.568 -15.055 1.00 0.00 ? 93  LYS A HZ2  3  
ATOM   4201  H  HZ3  . LYS A 1 93 ? -28.632 -15.054 -14.393 1.00 0.00 ? 93  LYS A HZ3  3  
ATOM   4202  N  N    . SER A 1 94 ? -23.199 -12.482 -20.697 1.00 0.00 ? 94  SER A N    3  
ATOM   4203  C  CA   . SER A 1 94 ? -23.015 -11.373 -21.634 1.00 0.00 ? 94  SER A CA   3  
ATOM   4204  C  C    . SER A 1 94 ? -21.664 -11.471 -22.353 1.00 0.00 ? 94  SER A C    3  
ATOM   4205  O  O    . SER A 1 94 ? -21.549 -11.088 -23.518 1.00 0.00 ? 94  SER A O    3  
ATOM   4206  C  CB   . SER A 1 94 ? -23.123 -10.023 -20.877 1.00 0.00 ? 94  SER A CB   3  
ATOM   4207  O  OG   . SER A 1 94 ? -22.996 -8.912  -21.750 1.00 0.00 ? 94  SER A OG   3  
ATOM   4208  H  H    . SER A 1 94 ? -22.977 -12.332 -19.775 1.00 0.00 ? 94  SER A H    3  
ATOM   4209  H  HA   . SER A 1 94 ? -23.810 -11.421 -22.363 1.00 0.00 ? 94  SER A HA   3  
ATOM   4210  H  HB2  . SER A 1 94 ? -24.083 -9.955  -20.386 1.00 0.00 ? 94  SER A HB2  3  
ATOM   4211  H  HB3  . SER A 1 94 ? -22.341 -9.961  -20.131 1.00 0.00 ? 94  SER A HB3  3  
ATOM   4212  H  HG   . SER A 1 94 ? -22.801 -9.223  -22.644 1.00 0.00 ? 94  SER A HG   3  
ATOM   4213  N  N    . HIS A 1 95 ? -20.644 -12.014 -21.657 1.00 0.00 ? 95  HIS A N    3  
ATOM   4214  C  CA   . HIS A 1 95 ? -19.245 -12.012 -22.150 1.00 0.00 ? 95  HIS A CA   3  
ATOM   4215  C  C    . HIS A 1 95 ? -18.553 -13.407 -21.927 1.00 0.00 ? 95  HIS A C    3  
ATOM   4216  O  O    . HIS A 1 95 ? -17.491 -13.467 -21.282 1.00 0.00 ? 95  HIS A O    3  
ATOM   4217  C  CB   . HIS A 1 95 ? -18.417 -10.888 -21.441 1.00 0.00 ? 95  HIS A CB   3  
ATOM   4218  C  CG   . HIS A 1 95 ? -19.132 -9.590  -21.131 1.00 0.00 ? 95  HIS A CG   3  
ATOM   4219  N  ND1  . HIS A 1 95 ? -19.470 -8.635  -22.065 1.00 0.00 ? 95  HIS A ND1  3  
ATOM   4220  C  CD2  . HIS A 1 95 ? -19.520 -9.081  -19.932 1.00 0.00 ? 95  HIS A CD2  3  
ATOM   4221  C  CE1  . HIS A 1 95 ? -20.043 -7.602  -21.422 1.00 0.00 ? 95  HIS A CE1  3  
ATOM   4222  N  NE2  . HIS A 1 95 ? -20.095 -7.833  -20.120 1.00 0.00 ? 95  HIS A NE2  3  
ATOM   4223  H  H    . HIS A 1 95 ? -20.844 -12.483 -20.821 1.00 0.00 ? 95  HIS A H    3  
ATOM   4224  H  HA   . HIS A 1 95 ? -19.252 -11.814 -23.219 1.00 0.00 ? 95  HIS A HA   3  
ATOM   4225  H  HB2  . HIS A 1 95 ? -18.041 -11.264 -20.497 1.00 0.00 ? 95  HIS A HB2  3  
ATOM   4226  H  HB3  . HIS A 1 95 ? -17.565 -10.642 -22.066 1.00 0.00 ? 95  HIS A HB3  3  
ATOM   4227  H  HD1  . HIS A 1 95 ? -19.312 -8.698  -23.036 1.00 0.00 ? 95  HIS A HD1  3  
ATOM   4228  H  HD2  . HIS A 1 95 ? -19.359 -9.539  -18.968 1.00 0.00 ? 95  HIS A HD2  3  
ATOM   4229  H  HE1  . HIS A 1 95 ? -20.395 -6.702  -21.904 1.00 0.00 ? 95  HIS A HE1  3  
ATOM   4230  N  N    . PRO A 1 96 ? -19.142 -14.565 -22.420 1.00 0.00 ? 96  PRO A N    3  
ATOM   4231  C  CA   . PRO A 1 96 ? -18.431 -15.877 -22.419 1.00 0.00 ? 96  PRO A CA   3  
ATOM   4232  C  C    . PRO A 1 96 ? -17.174 -15.838 -23.320 1.00 0.00 ? 96  PRO A C    3  
ATOM   4233  O  O    . PRO A 1 96 ? -16.128 -16.417 -22.996 1.00 0.00 ? 96  PRO A O    3  
ATOM   4234  C  CB   . PRO A 1 96 ? -19.491 -16.885 -22.965 1.00 0.00 ? 96  PRO A CB   3  
ATOM   4235  C  CG   . PRO A 1 96 ? -20.811 -16.184 -22.828 1.00 0.00 ? 96  PRO A CG   3  
ATOM   4236  C  CD   . PRO A 1 96 ? -20.515 -14.707 -22.962 1.00 0.00 ? 96  PRO A CD   3  
ATOM   4237  H  HA   . PRO A 1 96 ? -18.137 -16.159 -21.410 1.00 0.00 ? 96  PRO A HA   3  
ATOM   4238  H  HB2  . PRO A 1 96 ? -19.284 -17.133 -24.005 1.00 0.00 ? 96  PRO A HB2  3  
ATOM   4239  H  HB3  . PRO A 1 96 ? -19.468 -17.796 -22.377 1.00 0.00 ? 96  PRO A HB3  3  
ATOM   4240  H  HG2  . PRO A 1 96 ? -21.488 -16.507 -23.612 1.00 0.00 ? 96  PRO A HG2  3  
ATOM   4241  H  HG3  . PRO A 1 96 ? -21.247 -16.396 -21.854 1.00 0.00 ? 96  PRO A HG3  3  
ATOM   4242  H  HD2  . PRO A 1 96 ? -20.550 -14.384 -23.988 1.00 0.00 ? 96  PRO A HD2  3  
ATOM   4243  H  HD3  . PRO A 1 96 ? -21.216 -14.126 -22.372 1.00 0.00 ? 96  PRO A HD3  3  
ATOM   4244  N  N    . GLU A 1 97 ? -17.295 -15.111 -24.436 1.00 0.00 ? 97  GLU A N    3  
ATOM   4245  C  CA   . GLU A 1 97 ? -16.251 -14.929 -25.426 1.00 0.00 ? 97  GLU A CA   3  
ATOM   4246  C  C    . GLU A 1 97 ? -15.881 -13.440 -25.443 1.00 0.00 ? 97  GLU A C    3  
ATOM   4247  O  O    . GLU A 1 97 ? -16.584 -12.613 -26.031 1.00 0.00 ? 97  GLU A O    3  
ATOM   4248  C  CB   . GLU A 1 97 ? -16.756 -15.405 -26.818 1.00 0.00 ? 97  GLU A CB   3  
ATOM   4249  C  CG   . GLU A 1 97 ? -17.120 -16.909 -26.916 1.00 0.00 ? 97  GLU A CG   3  
ATOM   4250  C  CD   . GLU A 1 97 ? -15.919 -17.845 -26.700 1.00 0.00 ? 97  GLU A CD   3  
ATOM   4251  O  OE1  . GLU A 1 97 ? -15.104 -18.005 -27.639 1.00 0.00 ? 97  GLU A OE1  3  
ATOM   4252  O  OE2  . GLU A 1 97 ? -15.777 -18.424 -25.599 1.00 0.00 ? 97  GLU A OE2  3  
ATOM   4253  H  H    . GLU A 1 97 ? -18.120 -14.650 -24.591 1.00 0.00 ? 97  GLU A H    3  
ATOM   4254  H  HA   . GLU A 1 97 ? -15.387 -15.516 -25.140 1.00 0.00 ? 97  GLU A HA   3  
ATOM   4255  H  HB2  . GLU A 1 97 ? -17.643 -14.833 -27.078 1.00 0.00 ? 97  GLU A HB2  3  
ATOM   4256  H  HB3  . GLU A 1 97 ? -15.990 -15.198 -27.556 1.00 0.00 ? 97  GLU A HB3  3  
ATOM   4257  H  HG2  . GLU A 1 97 ? -17.884 -17.129 -26.175 1.00 0.00 ? 97  GLU A HG2  3  
ATOM   4258  H  HG3  . GLU A 1 97 ? -17.539 -17.100 -27.903 1.00 0.00 ? 97  GLU A HG3  3  
ATOM   4259  N  N    . VAL A 1 98 ? -14.812 -13.117 -24.730 1.00 0.00 ? 98  VAL A N    3  
ATOM   4260  C  CA   . VAL A 1 98 ? -14.236 -11.762 -24.657 1.00 0.00 ? 98  VAL A CA   3  
ATOM   4261  C  C    . VAL A 1 98 ? -12.698 -11.850 -24.869 1.00 0.00 ? 98  VAL A C    3  
ATOM   4262  O  O    . VAL A 1 98 ? -12.172 -11.233 -25.824 1.00 0.00 ? 98  VAL A O    3  
ATOM   4263  C  CB   . VAL A 1 98 ? -14.619 -11.036 -23.294 1.00 0.00 ? 98  VAL A CB   3  
ATOM   4264  C  CG1  . VAL A 1 98 ? -14.377 -11.937 -22.054 1.00 0.00 ? 98  VAL A CG1  3  
ATOM   4265  C  CG2  . VAL A 1 98 ? -13.889 -9.673  -23.146 1.00 0.00 ? 98  VAL A CG2  3  
ATOM   4266  O  OXT  . VAL A 1 98 ? -12.027 -12.578 -24.108 1.00 0.00 ? 98  VAL A OXT  3  
ATOM   4267  H  H    . VAL A 1 98 ? -14.392 -13.825 -24.214 1.00 0.00 ? 98  VAL A H    3  
ATOM   4268  H  HA   . VAL A 1 98 ? -14.659 -11.172 -25.476 1.00 0.00 ? 98  VAL A HA   3  
ATOM   4269  H  HB   . VAL A 1 98 ? -15.691 -10.826 -23.331 1.00 0.00 ? 98  VAL A HB   3  
ATOM   4270  H  HG11 . VAL A 1 98 ? -13.323 -12.183 -21.982 1.00 0.00 ? 98  VAL A HG11 3  
ATOM   4271  H  HG12 . VAL A 1 98 ? -14.946 -12.850 -22.148 1.00 0.00 ? 98  VAL A HG12 3  
ATOM   4272  H  HG13 . VAL A 1 98 ? -14.685 -11.420 -21.157 1.00 0.00 ? 98  VAL A HG13 3  
ATOM   4273  H  HG21 . VAL A 1 98 ? -14.164 -9.018  -23.966 1.00 0.00 ? 98  VAL A HG21 3  
ATOM   4274  H  HG22 . VAL A 1 98 ? -12.821 -9.826  -23.159 1.00 0.00 ? 98  VAL A HG22 3  
ATOM   4275  H  HG23 . VAL A 1 98 ? -14.167 -9.205  -22.205 1.00 0.00 ? 98  VAL A HG23 3  
HETATM 4276  ZN ZN   . ZN  B 2 .  ? 15.710  0.873   3.693   1.00 0.00 ? 101 ZN  A ZN   3  
HETATM 4277  ZN ZN   . ZN  C 2 .  ? -2.368  -1.199  -7.657  1.00 0.00 ? 102 ZN  A ZN   3  
HETATM 4278  ZN ZN   . ZN  D 2 .  ? -20.802 -6.586  -18.581 1.00 0.00 ? 103 ZN  A ZN   3  
ATOM   4279  N  N    . HIS A 1 10 ? 15.825  -8.590  18.687  1.00 0.00 ? 10  HIS A N    4  
ATOM   4280  C  CA   . HIS A 1 10 ? 17.211  -8.970  18.318  1.00 0.00 ? 10  HIS A CA   4  
ATOM   4281  C  C    . HIS A 1 10 ? 17.380  -10.518 18.292  1.00 0.00 ? 10  HIS A C    4  
ATOM   4282  O  O    . HIS A 1 10 ? 18.311  -11.055 18.919  1.00 0.00 ? 10  HIS A O    4  
ATOM   4283  C  CB   . HIS A 1 10 ? 18.233  -8.326  19.307  1.00 0.00 ? 10  HIS A CB   4  
ATOM   4284  C  CG   . HIS A 1 10 ? 18.206  -6.812  19.400  1.00 0.00 ? 10  HIS A CG   4  
ATOM   4285  N  ND1  . HIS A 1 10 ? 18.969  -5.991  18.593  1.00 0.00 ? 10  HIS A ND1  4  
ATOM   4286  C  CD2  . HIS A 1 10 ? 17.529  -5.982  20.227  1.00 0.00 ? 10  HIS A CD2  4  
ATOM   4287  C  CE1  . HIS A 1 10 ? 18.761  -4.731  18.921  1.00 0.00 ? 10  HIS A CE1  4  
ATOM   4288  N  NE2  . HIS A 1 10 ? 17.894  -4.701  19.909  1.00 0.00 ? 10  HIS A NE2  4  
ATOM   4289  H  H    . HIS A 1 10 ? 15.711  -7.557  18.648  1.00 0.00 ? 10  HIS A H    4  
ATOM   4290  H  HA   . HIS A 1 10 ? 17.393  -8.593  17.320  1.00 0.00 ? 10  HIS A HA   4  
ATOM   4291  H  HB2  . HIS A 1 10 ? 18.048  -8.715  20.302  1.00 0.00 ? 10  HIS A HB2  4  
ATOM   4292  H  HB3  . HIS A 1 10 ? 19.239  -8.615  19.014  1.00 0.00 ? 10  HIS A HB3  4  
ATOM   4293  H  HD1  . HIS A 1 10 ? 19.578  -6.288  17.888  1.00 0.00 ? 10  HIS A HD1  4  
ATOM   4294  H  HD2  . HIS A 1 10 ? 16.832  -6.272  20.998  1.00 0.00 ? 10  HIS A HD2  4  
ATOM   4295  H  HE1  . HIS A 1 10 ? 19.228  -3.867  18.454  1.00 0.00 ? 10  HIS A HE1  4  
ATOM   4296  H  HE2  . HIS A 1 10 ? 17.494  -3.893  20.290  1.00 0.00 ? 10  HIS A HE2  4  
ATOM   4297  N  N    . MET A 1 11 ? 16.500  -11.242 17.548  1.00 0.00 ? 11  MET A N    4  
ATOM   4298  C  CA   . MET A 1 11 ? 16.600  -12.723 17.384  1.00 0.00 ? 11  MET A CA   4  
ATOM   4299  C  C    . MET A 1 11 ? 15.717  -13.246 16.223  1.00 0.00 ? 11  MET A C    4  
ATOM   4300  O  O    . MET A 1 11 ? 16.138  -14.125 15.462  1.00 0.00 ? 11  MET A O    4  
ATOM   4301  C  CB   . MET A 1 11 ? 16.270  -13.477 18.710  1.00 0.00 ? 11  MET A CB   4  
ATOM   4302  C  CG   . MET A 1 11 ? 14.852  -13.270 19.253  1.00 0.00 ? 11  MET A CG   4  
ATOM   4303  S  SD   . MET A 1 11 ? 14.570  -14.148 20.805  1.00 0.00 ? 11  MET A SD   4  
ATOM   4304  C  CE   . MET A 1 11 ? 15.829  -13.444 21.878  1.00 0.00 ? 11  MET A CE   4  
ATOM   4305  H  H    . MET A 1 11 ? 15.784  -10.769 17.080  1.00 0.00 ? 11  MET A H    4  
ATOM   4306  H  HA   . MET A 1 11 ? 17.633  -12.938 17.122  1.00 0.00 ? 11  MET A HA   4  
ATOM   4307  H  HB2  . MET A 1 11 ? 16.416  -14.539 18.557  1.00 0.00 ? 11  MET A HB2  4  
ATOM   4308  H  HB3  . MET A 1 11 ? 16.968  -13.147 19.471  1.00 0.00 ? 11  MET A HB3  4  
ATOM   4309  H  HG2  . MET A 1 11 ? 14.683  -12.215 19.416  1.00 0.00 ? 11  MET A HG2  4  
ATOM   4310  H  HG3  . MET A 1 11 ? 14.144  -13.636 18.520  1.00 0.00 ? 11  MET A HG3  4  
ATOM   4311  H  HE1  . MET A 1 11 ? 16.810  -13.671 21.489  1.00 0.00 ? 11  MET A HE1  4  
ATOM   4312  H  HE2  . MET A 1 11 ? 15.735  -13.861 22.872  1.00 0.00 ? 11  MET A HE2  4  
ATOM   4313  H  HE3  . MET A 1 11 ? 15.705  -12.369 21.927  1.00 0.00 ? 11  MET A HE3  4  
ATOM   4314  N  N    . ARG A 1 12 ? 14.496  -12.706 16.098  1.00 0.00 ? 12  ARG A N    4  
ATOM   4315  C  CA   . ARG A 1 12 ? 13.523  -13.112 15.055  1.00 0.00 ? 12  ARG A CA   4  
ATOM   4316  C  C    . ARG A 1 12 ? 12.847  -11.813 14.566  1.00 0.00 ? 12  ARG A C    4  
ATOM   4317  O  O    . ARG A 1 12 ? 11.678  -11.537 14.873  1.00 0.00 ? 12  ARG A O    4  
ATOM   4318  C  CB   . ARG A 1 12 ? 12.501  -14.161 15.635  1.00 0.00 ? 12  ARG A CB   4  
ATOM   4319  C  CG   . ARG A 1 12 ? 11.742  -15.067 14.611  1.00 0.00 ? 12  ARG A CG   4  
ATOM   4320  C  CD   . ARG A 1 12 ? 10.900  -14.298 13.578  1.00 0.00 ? 12  ARG A CD   4  
ATOM   4321  N  NE   . ARG A 1 12 ? 9.966   -15.152 12.825  1.00 0.00 ? 12  ARG A NE   4  
ATOM   4322  C  CZ   . ARG A 1 12 ? 10.120  -15.565 11.556  1.00 0.00 ? 12  ARG A CZ   4  
ATOM   4323  N  NH1  . ARG A 1 12 ? 11.281  -15.421 10.920  1.00 0.00 ? 12  ARG A NH1  4  
ATOM   4324  N  NH2  . ARG A 1 12 ? 9.104   -16.147 10.945  1.00 0.00 ? 12  ARG A NH2  4  
ATOM   4325  H  H    . ARG A 1 12 ? 14.243  -11.988 16.714  1.00 0.00 ? 12  ARG A H    4  
ATOM   4326  H  HA   . ARG A 1 12 ? 14.070  -13.551 14.220  1.00 0.00 ? 12  ARG A HA   4  
ATOM   4327  H  HB2  . ARG A 1 12 ? 13.044  -14.823 16.298  1.00 0.00 ? 12  ARG A HB2  4  
ATOM   4328  H  HB3  . ARG A 1 12 ? 11.763  -13.628 16.227  1.00 0.00 ? 12  ARG A HB3  4  
ATOM   4329  H  HG2  . ARG A 1 12 ? 12.466  -15.666 14.076  1.00 0.00 ? 12  ARG A HG2  4  
ATOM   4330  H  HG3  . ARG A 1 12 ? 11.084  -15.732 15.165  1.00 0.00 ? 12  ARG A HG3  4  
ATOM   4331  H  HD2  . ARG A 1 12 ? 10.318  -13.547 14.101  1.00 0.00 ? 12  ARG A HD2  4  
ATOM   4332  H  HD3  . ARG A 1 12 ? 11.569  -13.794 12.885  1.00 0.00 ? 12  ARG A HD3  4  
ATOM   4333  H  HE   . ARG A 1 12 ? 9.127   -15.375 13.276  1.00 0.00 ? 12  ARG A HE   4  
ATOM   4334  H  HH11 . ARG A 1 12 ? 12.068  -15.005 11.390  1.00 0.00 ? 12  ARG A HH11 4  
ATOM   4335  H  HH12 . ARG A 1 12 ? 11.381  -15.731 9.975   1.00 0.00 ? 12  ARG A HH12 4  
ATOM   4336  H  HH21 . ARG A 1 12 ? 8.238   -16.290 11.427  1.00 0.00 ? 12  ARG A HH21 4  
ATOM   4337  H  HH22 . ARG A 1 12 ? 9.192   -16.444 9.990   1.00 0.00 ? 12  ARG A HH22 4  
ATOM   4338  N  N    . ASP A 1 13 ? 13.639  -10.999 13.857  1.00 0.00 ? 13  ASP A N    4  
ATOM   4339  C  CA   . ASP A 1 13 ? 13.259  -9.649  13.430  1.00 0.00 ? 13  ASP A CA   4  
ATOM   4340  C  C    . ASP A 1 13 ? 14.348  -9.104  12.498  1.00 0.00 ? 13  ASP A C    4  
ATOM   4341  O  O    . ASP A 1 13 ? 15.437  -8.743  12.939  1.00 0.00 ? 13  ASP A O    4  
ATOM   4342  C  CB   . ASP A 1 13 ? 13.019  -8.687  14.645  1.00 0.00 ? 13  ASP A CB   4  
ATOM   4343  C  CG   . ASP A 1 13 ? 14.137  -8.717  15.708  1.00 0.00 ? 13  ASP A CG   4  
ATOM   4344  O  OD1  . ASP A 1 13 ? 14.125  -9.631  16.567  1.00 0.00 ? 13  ASP A OD1  4  
ATOM   4345  O  OD2  . ASP A 1 13 ? 15.038  -7.852  15.686  1.00 0.00 ? 13  ASP A OD2  4  
ATOM   4346  H  H    . ASP A 1 13 ? 14.525  -11.326 13.597  1.00 0.00 ? 13  ASP A H    4  
ATOM   4347  H  HA   . ASP A 1 13 ? 12.330  -9.743  12.865  1.00 0.00 ? 13  ASP A HA   4  
ATOM   4348  H  HB2  . ASP A 1 13 ? 12.918  -7.670  14.273  1.00 0.00 ? 13  ASP A HB2  4  
ATOM   4349  H  HB3  . ASP A 1 13 ? 12.088  -8.962  15.123  1.00 0.00 ? 13  ASP A HB3  4  
ATOM   4350  N  N    . TYR A 1 14 ? 14.061  -9.105  11.198  1.00 0.00 ? 14  TYR A N    4  
ATOM   4351  C  CA   . TYR A 1 14 ? 14.994  -8.639  10.166  1.00 0.00 ? 14  TYR A CA   4  
ATOM   4352  C  C    . TYR A 1 14 ? 14.897  -7.121  9.993   1.00 0.00 ? 14  TYR A C    4  
ATOM   4353  O  O    . TYR A 1 14 ? 13.815  -6.573  9.743   1.00 0.00 ? 14  TYR A O    4  
ATOM   4354  C  CB   . TYR A 1 14 ? 14.725  -9.378  8.849   1.00 0.00 ? 14  TYR A CB   4  
ATOM   4355  C  CG   . TYR A 1 14 ? 15.111  -10.868 8.911   1.00 0.00 ? 14  TYR A CG   4  
ATOM   4356  C  CD1  . TYR A 1 14 ? 14.246  -11.816 9.461   1.00 0.00 ? 14  TYR A CD1  4  
ATOM   4357  C  CD2  . TYR A 1 14 ? 16.348  -11.321 8.436   1.00 0.00 ? 14  TYR A CD2  4  
ATOM   4358  C  CE1  . TYR A 1 14 ? 14.591  -13.145 9.521   1.00 0.00 ? 14  TYR A CE1  4  
ATOM   4359  C  CE2  . TYR A 1 14 ? 16.691  -12.652 8.500   1.00 0.00 ? 14  TYR A CE2  4  
ATOM   4360  C  CZ   . TYR A 1 14 ? 15.812  -13.554 9.043   1.00 0.00 ? 14  TYR A CZ   4  
ATOM   4361  O  OH   . TYR A 1 14 ? 16.156  -14.880 9.094   1.00 0.00 ? 14  TYR A OH   4  
ATOM   4362  H  H    . TYR A 1 14 ? 13.187  -9.438  10.921  1.00 0.00 ? 14  TYR A H    4  
ATOM   4363  H  HA   . TYR A 1 14 ? 16.002  -8.885  10.494  1.00 0.00 ? 14  TYR A HA   4  
ATOM   4364  H  HB2  . TYR A 1 14 ? 13.668  -9.308  8.620   1.00 0.00 ? 14  TYR A HB2  4  
ATOM   4365  H  HB3  . TYR A 1 14 ? 15.287  -8.912  8.045   1.00 0.00 ? 14  TYR A HB3  4  
ATOM   4366  H  HD1  . TYR A 1 14 ? 13.280  -11.492 9.834   1.00 0.00 ? 14  TYR A HD1  4  
ATOM   4367  H  HD2  . TYR A 1 14 ? 17.040  -10.609 7.999   1.00 0.00 ? 14  TYR A HD2  4  
ATOM   4368  H  HE1  . TYR A 1 14 ? 13.902  -13.865 9.945   1.00 0.00 ? 14  TYR A HE1  4  
ATOM   4369  H  HE2  . TYR A 1 14 ? 17.651  -12.982 8.125   1.00 0.00 ? 14  TYR A HE2  4  
ATOM   4370  H  HH   . TYR A 1 14 ? 15.428  -15.410 8.751   1.00 0.00 ? 14  TYR A HH   4  
ATOM   4371  N  N    . ILE A 1 15 ? 16.053  -6.461  10.130  1.00 0.00 ? 15  ILE A N    4  
ATOM   4372  C  CA   . ILE A 1 15 ? 16.167  -5.004  10.159  1.00 0.00 ? 15  ILE A CA   4  
ATOM   4373  C  C    . ILE A 1 15 ? 16.968  -4.575  8.913   1.00 0.00 ? 15  ILE A C    4  
ATOM   4374  O  O    . ILE A 1 15 ? 17.806  -5.331  8.417   1.00 0.00 ? 15  ILE A O    4  
ATOM   4375  C  CB   . ILE A 1 15 ? 16.908  -4.499  11.472  1.00 0.00 ? 15  ILE A CB   4  
ATOM   4376  C  CG1  . ILE A 1 15 ? 16.550  -5.357  12.730  1.00 0.00 ? 15  ILE A CG1  4  
ATOM   4377  C  CG2  . ILE A 1 15 ? 16.623  -2.999  11.728  1.00 0.00 ? 15  ILE A CG2  4  
ATOM   4378  C  CD1  . ILE A 1 15 ? 15.106  -5.311  13.150  1.00 0.00 ? 15  ILE A CD1  4  
ATOM   4379  H  H    . ILE A 1 15 ? 16.885  -6.984  10.168  1.00 0.00 ? 15  ILE A H    4  
ATOM   4380  H  HA   . ILE A 1 15 ? 15.169  -4.562  10.124  1.00 0.00 ? 15  ILE A HA   4  
ATOM   4381  H  HB   . ILE A 1 15 ? 17.964  -4.591  11.308  1.00 0.00 ? 15  ILE A HB   4  
ATOM   4382  H  HG12 . ILE A 1 15 ? 16.790  -6.392  12.526  1.00 0.00 ? 15  ILE A HG12 4  
ATOM   4383  H  HG13 . ILE A 1 15 ? 17.147  -5.024  13.571  1.00 0.00 ? 15  ILE A HG13 4  
ATOM   4384  H  HG21 . ILE A 1 15 ? 16.951  -2.414  10.873  1.00 0.00 ? 15  ILE A HG21 4  
ATOM   4385  H  HG22 . ILE A 1 15 ? 17.158  -2.666  12.608  1.00 0.00 ? 15  ILE A HG22 4  
ATOM   4386  H  HG23 . ILE A 1 15 ? 15.562  -2.845  11.876  1.00 0.00 ? 15  ILE A HG23 4  
ATOM   4387  H  HD11 . ILE A 1 15 ? 14.840  -4.296  13.389  1.00 0.00 ? 15  ILE A HD11 4  
ATOM   4388  H  HD12 . ILE A 1 15 ? 14.963  -5.941  14.012  1.00 0.00 ? 15  ILE A HD12 4  
ATOM   4389  H  HD13 . ILE A 1 15 ? 14.489  -5.664  12.337  1.00 0.00 ? 15  ILE A HD13 4  
ATOM   4390  N  N    . CYS A 1 16 ? 16.696  -3.367  8.416   1.00 0.00 ? 16  CYS A N    4  
ATOM   4391  C  CA   . CYS A 1 16 ? 17.431  -2.775  7.268   1.00 0.00 ? 16  CYS A CA   4  
ATOM   4392  C  C    . CYS A 1 16 ? 18.726  -2.104  7.776   1.00 0.00 ? 16  CYS A C    4  
ATOM   4393  O  O    . CYS A 1 16 ? 19.625  -1.792  6.987   1.00 0.00 ? 16  CYS A O    4  
ATOM   4394  C  CB   . CYS A 1 16 ? 16.518  -1.772  6.525   1.00 0.00 ? 16  CYS A CB   4  
ATOM   4395  S  SG   . CYS A 1 16 ? 17.124  -1.191  4.916   1.00 0.00 ? 16  CYS A SG   4  
ATOM   4396  H  H    . CYS A 1 16 ? 15.988  -2.847  8.835   1.00 0.00 ? 16  CYS A H    4  
ATOM   4397  H  HA   . CYS A 1 16 ? 17.700  -3.578  6.588   1.00 0.00 ? 16  CYS A HA   4  
ATOM   4398  H  HB2  . CYS A 1 16 ? 15.562  -2.236  6.343   1.00 0.00 ? 16  CYS A HB2  4  
ATOM   4399  H  HB3  . CYS A 1 16 ? 16.364  -0.896  7.149   1.00 0.00 ? 16  CYS A HB3  4  
ATOM   4400  N  N    . GLU A 1 17 ? 18.734  -1.824  9.108   1.00 0.00 ? 17  GLU A N    4  
ATOM   4401  C  CA   . GLU A 1 17 ? 19.893  -1.306  9.880   1.00 0.00 ? 17  GLU A CA   4  
ATOM   4402  C  C    . GLU A 1 17 ? 20.093  0.212   9.618   1.00 0.00 ? 17  GLU A C    4  
ATOM   4403  O  O    . GLU A 1 17 ? 20.981  0.854   10.193  1.00 0.00 ? 17  GLU A O    4  
ATOM   4404  C  CB   . GLU A 1 17 ? 21.193  -2.144  9.608   1.00 0.00 ? 17  GLU A CB   4  
ATOM   4405  C  CG   . GLU A 1 17 ? 22.340  -1.904  10.616  1.00 0.00 ? 17  GLU A CG   4  
ATOM   4406  C  CD   . GLU A 1 17 ? 23.635  -2.679  10.294  1.00 0.00 ? 17  GLU A CD   4  
ATOM   4407  O  OE1  . GLU A 1 17 ? 24.344  -2.291  9.338   1.00 0.00 ? 17  GLU A OE1  4  
ATOM   4408  O  OE2  . GLU A 1 17 ? 23.956  -3.668  10.991  1.00 0.00 ? 17  GLU A OE2  4  
ATOM   4409  H  H    . GLU A 1 17 ? 17.882  -1.909  9.581   1.00 0.00 ? 17  GLU A H    4  
ATOM   4410  H  HA   . GLU A 1 17 ? 19.628  -1.419  10.924  1.00 0.00 ? 17  GLU A HA   4  
ATOM   4411  H  HB2  . GLU A 1 17 ? 20.939  -3.198  9.631   1.00 0.00 ? 17  GLU A HB2  4  
ATOM   4412  H  HB3  . GLU A 1 17 ? 21.556  -1.904  8.612   1.00 0.00 ? 17  GLU A HB3  4  
ATOM   4413  H  HG2  . GLU A 1 17 ? 22.571  -0.841  10.628  1.00 0.00 ? 17  GLU A HG2  4  
ATOM   4414  H  HG3  . GLU A 1 17 ? 21.991  -2.188  11.605  1.00 0.00 ? 17  GLU A HG3  4  
ATOM   4415  N  N    . TYR A 1 18 ? 19.213  0.780   8.776   1.00 0.00 ? 18  TYR A N    4  
ATOM   4416  C  CA   . TYR A 1 18 ? 19.270  2.181   8.350   1.00 0.00 ? 18  TYR A CA   4  
ATOM   4417  C  C    . TYR A 1 18 ? 17.852  2.767   8.402   1.00 0.00 ? 18  TYR A C    4  
ATOM   4418  O  O    . TYR A 1 18 ? 17.610  3.829   8.986   1.00 0.00 ? 18  TYR A O    4  
ATOM   4419  C  CB   . TYR A 1 18 ? 19.862  2.276   6.919   1.00 0.00 ? 18  TYR A CB   4  
ATOM   4420  C  CG   . TYR A 1 18 ? 20.310  3.687   6.539   1.00 0.00 ? 18  TYR A CG   4  
ATOM   4421  C  CD1  . TYR A 1 18 ? 21.016  4.464   7.452   1.00 0.00 ? 18  TYR A CD1  4  
ATOM   4422  C  CD2  . TYR A 1 18 ? 20.038  4.240   5.286   1.00 0.00 ? 18  TYR A CD2  4  
ATOM   4423  C  CE1  . TYR A 1 18 ? 21.426  5.730   7.145   1.00 0.00 ? 18  TYR A CE1  4  
ATOM   4424  C  CE2  . TYR A 1 18 ? 20.451  5.519   4.970   1.00 0.00 ? 18  TYR A CE2  4  
ATOM   4425  C  CZ   . TYR A 1 18 ? 21.147  6.263   5.901   1.00 0.00 ? 18  TYR A CZ   4  
ATOM   4426  O  OH   . TYR A 1 18 ? 21.553  7.552   5.594   1.00 0.00 ? 18  TYR A OH   4  
ATOM   4427  H  H    . TYR A 1 18 ? 18.455  0.244   8.469   1.00 0.00 ? 18  TYR A H    4  
ATOM   4428  H  HA   . TYR A 1 18 ? 19.914  2.747   9.041   1.00 0.00 ? 18  TYR A HA   4  
ATOM   4429  H  HB2  . TYR A 1 18 ? 20.729  1.630   6.851   1.00 0.00 ? 18  TYR A HB2  4  
ATOM   4430  H  HB3  . TYR A 1 18 ? 19.122  1.936   6.194   1.00 0.00 ? 18  TYR A HB3  4  
ATOM   4431  H  HD1  . TYR A 1 18 ? 21.241  4.056   8.428   1.00 0.00 ? 18  TYR A HD1  4  
ATOM   4432  H  HD2  . TYR A 1 18 ? 19.491  3.656   4.559   1.00 0.00 ? 18  TYR A HD2  4  
ATOM   4433  H  HE1  . TYR A 1 18 ? 21.964  6.301   7.884   1.00 0.00 ? 18  TYR A HE1  4  
ATOM   4434  H  HE2  . TYR A 1 18 ? 20.232  5.933   3.997   1.00 0.00 ? 18  TYR A HE2  4  
ATOM   4435  H  HH   . TYR A 1 18 ? 20.813  8.033   5.209   1.00 0.00 ? 18  TYR A HH   4  
ATOM   4436  N  N    . CYS A 1 19 ? 16.926  2.024   7.773   1.00 0.00 ? 19  CYS A N    4  
ATOM   4437  C  CA   . CYS A 1 19 ? 15.508  2.396   7.654   1.00 0.00 ? 19  CYS A CA   4  
ATOM   4438  C  C    . CYS A 1 19 ? 14.613  1.146   7.730   1.00 0.00 ? 19  CYS A C    4  
ATOM   4439  O  O    . CYS A 1 19 ? 14.207  0.610   6.705   1.00 0.00 ? 19  CYS A O    4  
ATOM   4440  C  CB   . CYS A 1 19 ? 15.297  3.178   6.332   1.00 0.00 ? 19  CYS A CB   4  
ATOM   4441  S  SG   . CYS A 1 19 ? 16.358  2.612   4.966   1.00 0.00 ? 19  CYS A SG   4  
ATOM   4442  H  H    . CYS A 1 19 ? 17.225  1.202   7.331   1.00 0.00 ? 19  CYS A H    4  
ATOM   4443  H  HA   . CYS A 1 19 ? 15.248  3.046   8.490   1.00 0.00 ? 19  CYS A HA   4  
ATOM   4444  H  HB2  . CYS A 1 19 ? 14.269  3.085   6.004   1.00 0.00 ? 19  CYS A HB2  4  
ATOM   4445  H  HB3  . CYS A 1 19 ? 15.515  4.226   6.495   1.00 0.00 ? 19  CYS A HB3  4  
ATOM   4446  N  N    . ALA A 1 20 ? 14.425  0.633   8.959   1.00 0.00 ? 20  ALA A N    4  
ATOM   4447  C  CA   . ALA A 1 20 ? 13.409  -0.388  9.279   1.00 0.00 ? 20  ALA A CA   4  
ATOM   4448  C  C    . ALA A 1 20 ? 13.257  -0.553  10.793  1.00 0.00 ? 20  ALA A C    4  
ATOM   4449  O  O    . ALA A 1 20 ? 14.249  -0.572  11.529  1.00 0.00 ? 20  ALA A O    4  
ATOM   4450  C  CB   . ALA A 1 20 ? 13.721  -1.755  8.648   1.00 0.00 ? 20  ALA A CB   4  
ATOM   4451  H  H    . ALA A 1 20 ? 15.014  0.943   9.672   1.00 0.00 ? 20  ALA A H    4  
ATOM   4452  H  HA   . ALA A 1 20 ? 12.468  -0.032  8.867   1.00 0.00 ? 20  ALA A HA   4  
ATOM   4453  H  HB1  . ALA A 1 20 ? 13.815  -1.642  7.575   1.00 0.00 ? 20  ALA A HB1  4  
ATOM   4454  H  HB2  . ALA A 1 20 ? 12.921  -2.455  8.858   1.00 0.00 ? 20  ALA A HB2  4  
ATOM   4455  H  HB3  . ALA A 1 20 ? 14.652  -2.143  9.044   1.00 0.00 ? 20  ALA A HB3  4  
ATOM   4456  N  N    . ARG A 1 21 ? 11.996  -0.658  11.226  1.00 0.00 ? 21  ARG A N    4  
ATOM   4457  C  CA   . ARG A 1 21 ? 11.651  -1.064  12.593  1.00 0.00 ? 21  ARG A CA   4  
ATOM   4458  C  C    . ARG A 1 21 ? 11.982  -2.564  12.781  1.00 0.00 ? 21  ARG A C    4  
ATOM   4459  O  O    . ARG A 1 21 ? 13.016  -2.881  13.380  1.00 0.00 ? 21  ARG A O    4  
ATOM   4460  C  CB   . ARG A 1 21 ? 10.160  -0.701  12.932  1.00 0.00 ? 21  ARG A CB   4  
ATOM   4461  C  CG   . ARG A 1 21 ? 9.140   -0.878  11.779  1.00 0.00 ? 21  ARG A CG   4  
ATOM   4462  C  CD   . ARG A 1 21 ? 7.709   -0.510  12.197  1.00 0.00 ? 21  ARG A CD   4  
ATOM   4463  N  NE   . ARG A 1 21 ? 6.819   -0.342  11.035  1.00 0.00 ? 21  ARG A NE   4  
ATOM   4464  C  CZ   . ARG A 1 21 ? 5.829   0.561   10.951  1.00 0.00 ? 21  ARG A CZ   4  
ATOM   4465  N  NH1  . ARG A 1 21 ? 5.508   1.312   11.995  1.00 0.00 ? 21  ARG A NH1  4  
ATOM   4466  N  NH2  . ARG A 1 21 ? 5.150   0.682   9.833   1.00 0.00 ? 21  ARG A NH2  4  
ATOM   4467  H  H    . ARG A 1 21 ? 11.289  -0.403  10.602  1.00 0.00 ? 21  ARG A H    4  
ATOM   4468  H  HA   . ARG A 1 21 ? 12.298  -0.495  13.266  1.00 0.00 ? 21  ARG A HA   4  
ATOM   4469  H  HB2  . ARG A 1 21 ? 9.828   -1.314  13.761  1.00 0.00 ? 21  ARG A HB2  4  
ATOM   4470  H  HB3  . ARG A 1 21 ? 10.126  0.341   13.250  1.00 0.00 ? 21  ARG A HB3  4  
ATOM   4471  H  HG2  . ARG A 1 21 ? 9.435   -0.239  10.950  1.00 0.00 ? 21  ARG A HG2  4  
ATOM   4472  H  HG3  . ARG A 1 21 ? 9.156   -1.909  11.448  1.00 0.00 ? 21  ARG A HG3  4  
ATOM   4473  H  HD2  . ARG A 1 21 ? 7.311   -1.301  12.827  1.00 0.00 ? 21  ARG A HD2  4  
ATOM   4474  H  HD3  . ARG A 1 21 ? 7.738   0.416   12.766  1.00 0.00 ? 21  ARG A HD3  4  
ATOM   4475  H  HE   . ARG A 1 21 ? 7.005   -0.908  10.252  1.00 0.00 ? 21  ARG A HE   4  
ATOM   4476  H  HH11 . ARG A 1 21 ? 6.016   1.223   12.857  1.00 0.00 ? 21  ARG A HH11 4  
ATOM   4477  H  HH12 . ARG A 1 21 ? 4.771   1.988   11.922  1.00 0.00 ? 21  ARG A HH12 4  
ATOM   4478  H  HH21 . ARG A 1 21 ? 5.387   0.117   9.039   1.00 0.00 ? 21  ARG A HH21 4  
ATOM   4479  H  HH22 . ARG A 1 21 ? 4.408   1.350   9.760   1.00 0.00 ? 21  ARG A HH22 4  
ATOM   4480  N  N    . ALA A 1 22 ? 11.122  -3.469  12.267  1.00 0.00 ? 22  ALA A N    4  
ATOM   4481  C  CA   . ALA A 1 22 ? 11.405  -4.917  12.205  1.00 0.00 ? 22  ALA A CA   4  
ATOM   4482  C  C    . ALA A 1 22 ? 10.451  -5.601  11.224  1.00 0.00 ? 22  ALA A C    4  
ATOM   4483  O  O    . ALA A 1 22 ? 9.318   -5.150  11.035  1.00 0.00 ? 22  ALA A O    4  
ATOM   4484  C  CB   . ALA A 1 22 ? 11.275  -5.544  13.596  1.00 0.00 ? 22  ALA A CB   4  
ATOM   4485  H  H    . ALA A 1 22 ? 10.234  -3.176  11.995  1.00 0.00 ? 22  ALA A H    4  
ATOM   4486  H  HA   . ALA A 1 22 ? 12.429  -5.054  11.851  1.00 0.00 ? 22  ALA A HA   4  
ATOM   4487  H  HB1  . ALA A 1 22 ? 11.503  -6.604  13.547  1.00 0.00 ? 22  ALA A HB1  4  
ATOM   4488  H  HB2  . ALA A 1 22 ? 10.268  -5.412  13.965  1.00 0.00 ? 22  ALA A HB2  4  
ATOM   4489  H  HB3  . ALA A 1 22 ? 11.967  -5.064  14.275  1.00 0.00 ? 22  ALA A HB3  4  
ATOM   4490  N  N    . PHE A 1 23 ? 10.928  -6.682  10.586  1.00 0.00 ? 23  PHE A N    4  
ATOM   4491  C  CA   . PHE A 1 23 ? 10.116  -7.513  9.683   1.00 0.00 ? 23  PHE A CA   4  
ATOM   4492  C  C    . PHE A 1 23 ? 10.192  -8.981  10.103  1.00 0.00 ? 23  PHE A C    4  
ATOM   4493  O  O    . PHE A 1 23 ? 11.178  -9.408  10.712  1.00 0.00 ? 23  PHE A O    4  
ATOM   4494  C  CB   . PHE A 1 23 ? 10.599  -7.355  8.230   1.00 0.00 ? 23  PHE A CB   4  
ATOM   4495  C  CG   . PHE A 1 23 ? 10.380  -5.962  7.645   1.00 0.00 ? 23  PHE A CG   4  
ATOM   4496  C  CD1  . PHE A 1 23 ? 9.203   -5.643  6.970   1.00 0.00 ? 23  PHE A CD1  4  
ATOM   4497  C  CD2  . PHE A 1 23 ? 11.367  -4.984  7.735   1.00 0.00 ? 23  PHE A CD2  4  
ATOM   4498  C  CE1  . PHE A 1 23 ? 9.022   -4.395  6.413   1.00 0.00 ? 23  PHE A CE1  4  
ATOM   4499  C  CE2  . PHE A 1 23 ? 11.182  -3.741  7.181   1.00 0.00 ? 23  PHE A CE2  4  
ATOM   4500  C  CZ   . PHE A 1 23 ? 10.015  -3.444  6.514   1.00 0.00 ? 23  PHE A CZ   4  
ATOM   4501  H  H    . PHE A 1 23 ? 11.875  -6.921  10.701  1.00 0.00 ? 23  PHE A H    4  
ATOM   4502  H  HA   . PHE A 1 23 ? 9.076   -7.191  9.750   1.00 0.00 ? 23  PHE A HA   4  
ATOM   4503  H  HB2  . PHE A 1 23 ? 11.659  -7.578  8.185   1.00 0.00 ? 23  PHE A HB2  4  
ATOM   4504  H  HB3  . PHE A 1 23 ? 10.075  -8.069  7.599   1.00 0.00 ? 23  PHE A HB3  4  
ATOM   4505  H  HD1  . PHE A 1 23 ? 8.419   -6.386  6.882   1.00 0.00 ? 23  PHE A HD1  4  
ATOM   4506  H  HD2  . PHE A 1 23 ? 12.291  -5.209  8.254   1.00 0.00 ? 23  PHE A HD2  4  
ATOM   4507  H  HE1  . PHE A 1 23 ? 8.101   -4.160  5.892   1.00 0.00 ? 23  PHE A HE1  4  
ATOM   4508  H  HE2  . PHE A 1 23 ? 11.965  -3.005  7.251   1.00 0.00 ? 23  PHE A HE2  4  
ATOM   4509  H  HZ   . PHE A 1 23 ? 9.874   -2.460  6.079   1.00 0.00 ? 23  PHE A HZ   4  
ATOM   4510  N  N    . LYS A 1 24 ? 9.132   -9.734  9.784   1.00 0.00 ? 24  LYS A N    4  
ATOM   4511  C  CA   . LYS A 1 24 ? 9.054   -11.182 10.039  1.00 0.00 ? 24  LYS A CA   4  
ATOM   4512  C  C    . LYS A 1 24 ? 10.145  -11.973 9.279   1.00 0.00 ? 24  LYS A C    4  
ATOM   4513  O  O    . LYS A 1 24 ? 10.651  -12.969 9.794   1.00 0.00 ? 24  LYS A O    4  
ATOM   4514  C  CB   . LYS A 1 24 ? 7.626   -11.692 9.678   1.00 0.00 ? 24  LYS A CB   4  
ATOM   4515  C  CG   . LYS A 1 24 ? 6.495   -11.073 10.544  1.00 0.00 ? 24  LYS A CG   4  
ATOM   4516  C  CD   . LYS A 1 24 ? 5.064   -11.491 10.104  1.00 0.00 ? 24  LYS A CD   4  
ATOM   4517  C  CE   . LYS A 1 24 ? 4.826   -13.014 10.137  1.00 0.00 ? 24  LYS A CE   4  
ATOM   4518  N  NZ   . LYS A 1 24 ? 5.038   -13.589 11.485  1.00 0.00 ? 24  LYS A NZ   4  
ATOM   4519  H  H    . LYS A 1 24 ? 8.338   -9.295  9.420   1.00 0.00 ? 24  LYS A H    4  
ATOM   4520  H  HA   . LYS A 1 24 ? 9.211   -11.331 11.102  1.00 0.00 ? 24  LYS A HA   4  
ATOM   4521  H  HB2  . LYS A 1 24 ? 7.425   -11.456 8.638   1.00 0.00 ? 24  LYS A HB2  4  
ATOM   4522  H  HB3  . LYS A 1 24 ? 7.597   -12.771 9.801   1.00 0.00 ? 24  LYS A HB3  4  
ATOM   4523  H  HG2  . LYS A 1 24 ? 6.640   -11.377 11.577  1.00 0.00 ? 24  LYS A HG2  4  
ATOM   4524  H  HG3  . LYS A 1 24 ? 6.573   -9.991  10.489  1.00 0.00 ? 24  LYS A HG3  4  
ATOM   4525  H  HD2  . LYS A 1 24 ? 4.347   -11.019 10.769  1.00 0.00 ? 24  LYS A HD2  4  
ATOM   4526  H  HD3  . LYS A 1 24 ? 4.890   -11.131 9.097   1.00 0.00 ? 24  LYS A HD3  4  
ATOM   4527  H  HE2  . LYS A 1 24 ? 3.811   -13.227 9.828   1.00 0.00 ? 24  LYS A HE2  4  
ATOM   4528  H  HE3  . LYS A 1 24 ? 5.510   -13.494 9.446   1.00 0.00 ? 24  LYS A HE3  4  
ATOM   4529  H  HZ1  . LYS A 1 24 ? 4.423   -13.121 12.178  1.00 0.00 ? 24  LYS A HZ1  4  
ATOM   4530  H  HZ2  . LYS A 1 24 ? 6.025   -13.457 11.772  1.00 0.00 ? 24  LYS A HZ2  4  
ATOM   4531  H  HZ3  . LYS A 1 24 ? 4.829   -14.608 11.483  1.00 0.00 ? 24  LYS A HZ3  4  
ATOM   4532  N  N    . SER A 1 25 ? 10.538  -11.505 8.082   1.00 0.00 ? 25  SER A N    4  
ATOM   4533  C  CA   . SER A 1 25 ? 11.556  -12.187 7.258   1.00 0.00 ? 25  SER A CA   4  
ATOM   4534  C  C    . SER A 1 25 ? 12.377  -11.175 6.442   1.00 0.00 ? 25  SER A C    4  
ATOM   4535  O  O    . SER A 1 25 ? 11.977  -10.018 6.280   1.00 0.00 ? 25  SER A O    4  
ATOM   4536  C  CB   . SER A 1 25 ? 10.891  -13.220 6.326   1.00 0.00 ? 25  SER A CB   4  
ATOM   4537  O  OG   . SER A 1 25 ? 9.990   -12.607 5.423   1.00 0.00 ? 25  SER A OG   4  
ATOM   4538  H  H    . SER A 1 25 ? 10.151  -10.677 7.740   1.00 0.00 ? 25  SER A H    4  
ATOM   4539  H  HA   . SER A 1 25 ? 12.240  -12.710 7.926   1.00 0.00 ? 25  SER A HA   4  
ATOM   4540  H  HB2  . SER A 1 25 ? 11.650  -13.735 5.754   1.00 0.00 ? 25  SER A HB2  4  
ATOM   4541  H  HB3  . SER A 1 25 ? 10.345  -13.944 6.919   1.00 0.00 ? 25  SER A HB3  4  
ATOM   4542  H  HG   . SER A 1 25 ? 9.092   -12.890 5.630   1.00 0.00 ? 25  SER A HG   4  
ATOM   4543  N  N    . SER A 1 26 ? 13.564  -11.626 6.001   1.00 0.00 ? 26  SER A N    4  
ATOM   4544  C  CA   . SER A 1 26 ? 14.452  -10.863 5.097   1.00 0.00 ? 26  SER A CA   4  
ATOM   4545  C  C    . SER A 1 26 ? 13.746  -10.465 3.782   1.00 0.00 ? 26  SER A C    4  
ATOM   4546  O  O    . SER A 1 26 ? 14.024  -9.401  3.229   1.00 0.00 ? 26  SER A O    4  
ATOM   4547  C  CB   . SER A 1 26 ? 15.723  -11.688 4.801   1.00 0.00 ? 26  SER A CB   4  
ATOM   4548  O  OG   . SER A 1 26 ? 15.391  -12.961 4.275   1.00 0.00 ? 26  SER A OG   4  
ATOM   4549  H  H    . SER A 1 26 ? 13.876  -12.476 6.377   1.00 0.00 ? 26  SER A H    4  
ATOM   4550  H  HA   . SER A 1 26 ? 14.747  -9.956  5.619   1.00 0.00 ? 26  SER A HA   4  
ATOM   4551  H  HB2  . SER A 1 26 ? 16.346  -11.167 4.083   1.00 0.00 ? 26  SER A HB2  4  
ATOM   4552  H  HB3  . SER A 1 26 ? 16.283  -11.832 5.716   1.00 0.00 ? 26  SER A HB3  4  
ATOM   4553  H  HG   . SER A 1 26 ? 16.185  -13.374 3.916   1.00 0.00 ? 26  SER A HG   4  
ATOM   4554  N  N    . HIS A 1 27 ? 12.866  -11.353 3.278   1.00 0.00 ? 27  HIS A N    4  
ATOM   4555  C  CA   . HIS A 1 27 ? 12.047  -11.112 2.065   1.00 0.00 ? 27  HIS A CA   4  
ATOM   4556  C  C    . HIS A 1 27 ? 10.864  -10.155 2.331   1.00 0.00 ? 27  HIS A C    4  
ATOM   4557  O  O    . HIS A 1 27 ? 10.484  -9.380  1.441   1.00 0.00 ? 27  HIS A O    4  
ATOM   4558  C  CB   . HIS A 1 27 ? 11.595  -12.445 1.431   1.00 0.00 ? 27  HIS A CB   4  
ATOM   4559  C  CG   . HIS A 1 27 ? 12.728  -13.198 0.781   1.00 0.00 ? 27  HIS A CG   4  
ATOM   4560  N  ND1  . HIS A 1 27 ? 13.088  -14.478 1.132   1.00 0.00 ? 27  HIS A ND1  4  
ATOM   4561  C  CD2  . HIS A 1 27 ? 13.588  -12.827 -0.199  1.00 0.00 ? 27  HIS A CD2  4  
ATOM   4562  C  CE1  . HIS A 1 27 ? 14.112  -14.864 0.404   1.00 0.00 ? 27  HIS A CE1  4  
ATOM   4563  N  NE2  . HIS A 1 27 ? 14.437  -13.879 -0.412  1.00 0.00 ? 27  HIS A NE2  4  
ATOM   4564  H  H    . HIS A 1 27 ? 12.762  -12.208 3.743   1.00 0.00 ? 27  HIS A H    4  
ATOM   4565  H  HA   . HIS A 1 27 ? 12.699  -10.612 1.350   1.00 0.00 ? 27  HIS A HA   4  
ATOM   4566  H  HB2  . HIS A 1 27 ? 11.160  -13.078 2.193   1.00 0.00 ? 27  HIS A HB2  4  
ATOM   4567  H  HB3  . HIS A 1 27 ? 10.849  -12.253 0.667   1.00 0.00 ? 27  HIS A HB3  4  
ATOM   4568  H  HD1  . HIS A 1 27 ? 12.653  -15.023 1.823   1.00 0.00 ? 27  HIS A HD1  4  
ATOM   4569  H  HD2  . HIS A 1 27 ? 13.605  -11.874 -0.712  1.00 0.00 ? 27  HIS A HD2  4  
ATOM   4570  H  HE1  . HIS A 1 27 ? 14.595  -15.830 0.457   1.00 0.00 ? 27  HIS A HE1  4  
ATOM   4571  H  HE2  . HIS A 1 27 ? 15.160  -13.905 -1.077  1.00 0.00 ? 27  HIS A HE2  4  
ATOM   4572  N  N    . ASN A 1 28 ? 10.267  -10.243 3.534   1.00 0.00 ? 28  ASN A N    4  
ATOM   4573  C  CA   . ASN A 1 28 ? 9.269   -9.249  4.027   1.00 0.00 ? 28  ASN A CA   4  
ATOM   4574  C  C    . ASN A 1 28 ? 9.897   -7.834  3.975   1.00 0.00 ? 28  ASN A C    4  
ATOM   4575  O  O    . ASN A 1 28 ? 9.302   -6.872  3.497   1.00 0.00 ? 28  ASN A O    4  
ATOM   4576  C  CB   . ASN A 1 28 ? 8.899   -9.576  5.500   1.00 0.00 ? 28  ASN A CB   4  
ATOM   4577  C  CG   . ASN A 1 28 ? 7.644   -8.888  6.082   1.00 0.00 ? 28  ASN A CG   4  
ATOM   4578  O  OD1  . ASN A 1 28 ? 7.083   -9.379  7.063   1.00 0.00 ? 28  ASN A OD1  4  
ATOM   4579  N  ND2  . ASN A 1 28 ? 7.169   -7.780  5.507   1.00 0.00 ? 28  ASN A ND2  4  
ATOM   4580  H  H    . ASN A 1 28 ? 10.504  -10.998 4.118   1.00 0.00 ? 28  ASN A H    4  
ATOM   4581  H  HA   . ASN A 1 28 ? 8.383   -9.295  3.398   1.00 0.00 ? 28  ASN A HA   4  
ATOM   4582  H  HB2  . ASN A 1 28 ? 8.747   -10.644 5.584   1.00 0.00 ? 28  ASN A HB2  4  
ATOM   4583  H  HB3  . ASN A 1 28 ? 9.755   -9.307  6.131   1.00 0.00 ? 28  ASN A HB3  4  
ATOM   4584  H  HD21 . ASN A 1 28 ? 7.622   -7.420  4.723   1.00 0.00 ? 28  ASN A HD21 4  
ATOM   4585  H  HD22 . ASN A 1 28 ? 6.377   -7.357  5.907   1.00 0.00 ? 28  ASN A HD22 4  
ATOM   4586  N  N    . LEU A 1 29 ? 11.093  -7.757  4.551   1.00 0.00 ? 29  LEU A N    4  
ATOM   4587  C  CA   . LEU A 1 29 ? 11.975  -6.588  4.509   1.00 0.00 ? 29  LEU A CA   4  
ATOM   4588  C  C    . LEU A 1 29 ? 12.372  -6.201  3.075   1.00 0.00 ? 29  LEU A C    4  
ATOM   4589  O  O    . LEU A 1 29 ? 12.411  -5.023  2.768   1.00 0.00 ? 29  LEU A O    4  
ATOM   4590  C  CB   . LEU A 1 29 ? 13.203  -6.875  5.426   1.00 0.00 ? 29  LEU A CB   4  
ATOM   4591  C  CG   . LEU A 1 29 ? 14.547  -6.146  5.112   1.00 0.00 ? 29  LEU A CG   4  
ATOM   4592  C  CD1  . LEU A 1 29 ? 14.448  -4.630  5.394   1.00 0.00 ? 29  LEU A CD1  4  
ATOM   4593  C  CD2  . LEU A 1 29 ? 15.710  -6.801  5.885   1.00 0.00 ? 29  LEU A CD2  4  
ATOM   4594  H  H    . LEU A 1 29 ? 11.378  -8.519  5.094   1.00 0.00 ? 29  LEU A H    4  
ATOM   4595  H  HA   . LEU A 1 29 ? 11.419  -5.756  4.937   1.00 0.00 ? 29  LEU A HA   4  
ATOM   4596  H  HB2  . LEU A 1 29 ? 12.915  -6.587  6.438   1.00 0.00 ? 29  LEU A HB2  4  
ATOM   4597  H  HB3  . LEU A 1 29 ? 13.373  -7.951  5.425   1.00 0.00 ? 29  LEU A HB3  4  
ATOM   4598  H  HG   . LEU A 1 29 ? 14.762  -6.256  4.055   1.00 0.00 ? 29  LEU A HG   4  
ATOM   4599  H  HD11 . LEU A 1 29 ? 14.217  -4.460  6.439   1.00 0.00 ? 29  LEU A HD11 4  
ATOM   4600  H  HD12 . LEU A 1 29 ? 13.664  -4.198  4.780   1.00 0.00 ? 29  LEU A HD12 4  
ATOM   4601  H  HD13 . LEU A 1 29 ? 15.385  -4.154  5.151   1.00 0.00 ? 29  LEU A HD13 4  
ATOM   4602  H  HD21 . LEU A 1 29 ? 16.631  -6.284  5.664   1.00 0.00 ? 29  LEU A HD21 4  
ATOM   4603  H  HD22 . LEU A 1 29 ? 15.805  -7.838  5.583   1.00 0.00 ? 29  LEU A HD22 4  
ATOM   4604  H  HD23 . LEU A 1 29 ? 15.517  -6.755  6.951   1.00 0.00 ? 29  LEU A HD23 4  
ATOM   4605  N  N    . ALA A 1 30 ? 12.648  -7.204  2.226   1.00 0.00 ? 30  ALA A N    4  
ATOM   4606  C  CA   . ALA A 1 30 ? 12.991  -6.999  0.791   1.00 0.00 ? 30  ALA A CA   4  
ATOM   4607  C  C    . ALA A 1 30 ? 11.897  -6.210  0.024   1.00 0.00 ? 30  ALA A C    4  
ATOM   4608  O  O    . ALA A 1 30 ? 12.189  -5.536  -0.974  1.00 0.00 ? 30  ALA A O    4  
ATOM   4609  C  CB   . ALA A 1 30 ? 13.305  -8.326  0.095   1.00 0.00 ? 30  ALA A CB   4  
ATOM   4610  H  H    . ALA A 1 30 ? 12.655  -8.106  2.600   1.00 0.00 ? 30  ALA A H    4  
ATOM   4611  H  HA   . ALA A 1 30 ? 13.899  -6.405  0.776   1.00 0.00 ? 30  ALA A HA   4  
ATOM   4612  H  HB1  . ALA A 1 30 ? 14.074  -8.855  0.643   1.00 0.00 ? 30  ALA A HB1  4  
ATOM   4613  H  HB2  . ALA A 1 30 ? 13.651  -8.140  -0.914  1.00 0.00 ? 30  ALA A HB2  4  
ATOM   4614  H  HB3  . ALA A 1 30 ? 12.411  -8.938  0.057   1.00 0.00 ? 30  ALA A HB3  4  
ATOM   4615  N  N    . VAL A 1 31 ? 10.643  -6.312  0.509   1.00 0.00 ? 31  VAL A N    4  
ATOM   4616  C  CA   . VAL A 1 31 ? 9.499   -5.522  0.007   1.00 0.00 ? 31  VAL A CA   4  
ATOM   4617  C  C    . VAL A 1 31 ? 9.759   -4.005  0.190   1.00 0.00 ? 31  VAL A C    4  
ATOM   4618  O  O    . VAL A 1 31 ? 9.527   -3.223  -0.725  1.00 0.00 ? 31  VAL A O    4  
ATOM   4619  C  CB   . VAL A 1 31 ? 8.160   -5.947  0.725   1.00 0.00 ? 31  VAL A CB   4  
ATOM   4620  C  CG1  . VAL A 1 31 ? 6.962   -5.057  0.316   1.00 0.00 ? 31  VAL A CG1  4  
ATOM   4621  C  CG2  . VAL A 1 31 ? 7.855   -7.446  0.466   1.00 0.00 ? 31  VAL A CG2  4  
ATOM   4622  H  H    . VAL A 1 31 ? 10.492  -6.925  1.262   1.00 0.00 ? 31  VAL A H    4  
ATOM   4623  H  HA   . VAL A 1 31 ? 9.394   -5.735  -1.053  1.00 0.00 ? 31  VAL A HA   4  
ATOM   4624  H  HB   . VAL A 1 31 ? 8.306   -5.820  1.796   1.00 0.00 ? 31  VAL A HB   4  
ATOM   4625  H  HG11 . VAL A 1 31 ? 6.820   -5.110  -0.757  1.00 0.00 ? 31  VAL A HG11 4  
ATOM   4626  H  HG12 . VAL A 1 31 ? 7.153   -4.032  0.597   1.00 0.00 ? 31  VAL A HG12 4  
ATOM   4627  H  HG13 . VAL A 1 31 ? 6.062   -5.401  0.811   1.00 0.00 ? 31  VAL A HG13 4  
ATOM   4628  H  HG21 . VAL A 1 31 ? 8.672   -8.051  0.836   1.00 0.00 ? 31  VAL A HG21 4  
ATOM   4629  H  HG22 . VAL A 1 31 ? 7.735   -7.619  -0.596  1.00 0.00 ? 31  VAL A HG22 4  
ATOM   4630  H  HG23 . VAL A 1 31 ? 6.943   -7.728  0.978   1.00 0.00 ? 31  VAL A HG23 4  
ATOM   4631  N  N    . HIS A 1 32 ? 10.259  -3.615  1.377   1.00 0.00 ? 32  HIS A N    4  
ATOM   4632  C  CA   . HIS A 1 32 ? 10.708  -2.229  1.662   1.00 0.00 ? 32  HIS A CA   4  
ATOM   4633  C  C    . HIS A 1 32 ? 12.027  -1.921  0.930   1.00 0.00 ? 32  HIS A C    4  
ATOM   4634  O  O    . HIS A 1 32 ? 12.182  -0.868  0.303   1.00 0.00 ? 32  HIS A O    4  
ATOM   4635  C  CB   . HIS A 1 32 ? 10.865  -2.006  3.211   1.00 0.00 ? 32  HIS A CB   4  
ATOM   4636  C  CG   . HIS A 1 32 ? 11.908  -0.970  3.597   1.00 0.00 ? 32  HIS A CG   4  
ATOM   4637  N  ND1  . HIS A 1 32 ? 11.706  0.386   3.528   1.00 0.00 ? 32  HIS A ND1  4  
ATOM   4638  C  CD2  . HIS A 1 32 ? 13.218  -1.136  3.946   1.00 0.00 ? 32  HIS A CD2  4  
ATOM   4639  C  CE1  . HIS A 1 32 ? 12.863  0.989   3.811   1.00 0.00 ? 32  HIS A CE1  4  
ATOM   4640  N  NE2  . HIS A 1 32 ? 13.822  0.120   4.067   1.00 0.00 ? 32  HIS A NE2  4  
ATOM   4641  H  H    . HIS A 1 32 ? 10.316  -4.272  2.098   1.00 0.00 ? 32  HIS A H    4  
ATOM   4642  H  HA   . HIS A 1 32 ? 9.951   -1.557  1.276   1.00 0.00 ? 32  HIS A HA   4  
ATOM   4643  H  HB2  . HIS A 1 32 ? 9.916   -1.682  3.624   1.00 0.00 ? 32  HIS A HB2  4  
ATOM   4644  H  HB3  . HIS A 1 32 ? 11.140  -2.944  3.684   1.00 0.00 ? 32  HIS A HB3  4  
ATOM   4645  H  HD1  . HIS A 1 32 ? 10.860  0.836   3.312   1.00 0.00 ? 32  HIS A HD1  4  
ATOM   4646  H  HD2  . HIS A 1 32 ? 13.707  -2.091  4.110   1.00 0.00 ? 32  HIS A HD2  4  
ATOM   4647  H  HE1  . HIS A 1 32 ? 12.996  2.060   3.845   1.00 0.00 ? 32  HIS A HE1  4  
ATOM   4648  N  N    . ARG A 1 33 ? 12.959  -2.878  1.030   1.00 0.00 ? 33  ARG A N    4  
ATOM   4649  C  CA   . ARG A 1 33 ? 14.334  -2.794  0.521   1.00 0.00 ? 33  ARG A CA   4  
ATOM   4650  C  C    . ARG A 1 33 ? 14.360  -2.661  -1.016  1.00 0.00 ? 33  ARG A C    4  
ATOM   4651  O  O    . ARG A 1 33 ? 15.412  -2.419  -1.566  1.00 0.00 ? 33  ARG A O    4  
ATOM   4652  C  CB   . ARG A 1 33 ? 15.110  -4.059  0.997   1.00 0.00 ? 33  ARG A CB   4  
ATOM   4653  C  CG   . ARG A 1 33 ? 16.649  -4.047  0.836   1.00 0.00 ? 33  ARG A CG   4  
ATOM   4654  C  CD   . ARG A 1 33 ? 17.275  -5.449  1.039   1.00 0.00 ? 33  ARG A CD   4  
ATOM   4655  N  NE   . ARG A 1 33 ? 18.731  -5.443  0.779   1.00 0.00 ? 33  ARG A NE   4  
ATOM   4656  C  CZ   . ARG A 1 33 ? 19.417  -6.365  0.073   1.00 0.00 ? 33  ARG A CZ   4  
ATOM   4657  N  NH1  . ARG A 1 33 ? 18.805  -7.389  -0.517  1.00 0.00 ? 33  ARG A NH1  4  
ATOM   4658  N  NH2  . ARG A 1 33 ? 20.726  -6.236  -0.052  1.00 0.00 ? 33  ARG A NH2  4  
ATOM   4659  H  H    . ARG A 1 33 ? 12.712  -3.688  1.492   1.00 0.00 ? 33  ARG A H    4  
ATOM   4660  H  HA   . ARG A 1 33 ? 14.797  -1.912  0.956   1.00 0.00 ? 33  ARG A HA   4  
ATOM   4661  H  HB2  . ARG A 1 33 ? 14.894  -4.217  2.050   1.00 0.00 ? 33  ARG A HB2  4  
ATOM   4662  H  HB3  . ARG A 1 33 ? 14.721  -4.907  0.445   1.00 0.00 ? 33  ARG A HB3  4  
ATOM   4663  H  HG2  . ARG A 1 33 ? 16.898  -3.698  -0.161  1.00 0.00 ? 33  ARG A HG2  4  
ATOM   4664  H  HG3  . ARG A 1 33 ? 17.073  -3.363  1.565   1.00 0.00 ? 33  ARG A HG3  4  
ATOM   4665  H  HD2  . ARG A 1 33 ? 17.110  -5.765  2.066   1.00 0.00 ? 33  ARG A HD2  4  
ATOM   4666  H  HD3  . ARG A 1 33 ? 16.791  -6.154  0.369   1.00 0.00 ? 33  ARG A HD3  4  
ATOM   4667  H  HE   . ARG A 1 33 ? 19.238  -4.695  1.166   1.00 0.00 ? 33  ARG A HE   4  
ATOM   4668  H  HH11 . ARG A 1 33 ? 17.808  -7.492  -0.450  1.00 0.00 ? 33  ARG A HH11 4  
ATOM   4669  H  HH12 . ARG A 1 33 ? 19.338  -8.065  -1.030  1.00 0.00 ? 33  ARG A HH12 4  
ATOM   4670  H  HH21 . ARG A 1 33 ? 21.202  -5.455  0.372   1.00 0.00 ? 33  ARG A HH21 4  
ATOM   4671  H  HH22 . ARG A 1 33 ? 21.252  -6.912  -0.572  1.00 0.00 ? 33  ARG A HH22 4  
ATOM   4672  N  N    . MET A 1 34 ? 13.170  -2.748  -1.672  1.00 0.00 ? 34  MET A N    4  
ATOM   4673  C  CA   . MET A 1 34 ? 12.970  -2.517  -3.140  1.00 0.00 ? 34  MET A CA   4  
ATOM   4674  C  C    . MET A 1 34 ? 13.648  -1.217  -3.697  1.00 0.00 ? 34  MET A C    4  
ATOM   4675  O  O    . MET A 1 34 ? 13.748  -1.038  -4.912  1.00 0.00 ? 34  MET A O    4  
ATOM   4676  C  CB   . MET A 1 34 ? 11.464  -2.486  -3.464  1.00 0.00 ? 34  MET A CB   4  
ATOM   4677  C  CG   . MET A 1 34 ? 10.704  -1.271  -2.907  1.00 0.00 ? 34  MET A CG   4  
ATOM   4678  S  SD   . MET A 1 34 ? 8.951   -1.325  -3.314  1.00 0.00 ? 34  MET A SD   4  
ATOM   4679  C  CE   . MET A 1 34 ? 8.985   -1.348  -5.103  1.00 0.00 ? 34  MET A CE   4  
ATOM   4680  H  H    . MET A 1 34 ? 12.409  -3.061  -1.138  1.00 0.00 ? 34  MET A H    4  
ATOM   4681  H  HA   . MET A 1 34 ? 13.407  -3.366  -3.651  1.00 0.00 ? 34  MET A HA   4  
ATOM   4682  H  HB2  . MET A 1 34 ? 11.342  -2.496  -4.538  1.00 0.00 ? 34  MET A HB2  4  
ATOM   4683  H  HB3  . MET A 1 34 ? 11.002  -3.382  -3.062  1.00 0.00 ? 34  MET A HB3  4  
ATOM   4684  H  HG2  . MET A 1 34 ? 10.806  -1.254  -1.826  1.00 0.00 ? 34  MET A HG2  4  
ATOM   4685  H  HG3  . MET A 1 34 ? 11.127  -0.359  -3.322  1.00 0.00 ? 34  MET A HG3  4  
ATOM   4686  H  HE1  . MET A 1 34 ? 7.975   -1.379  -5.487  1.00 0.00 ? 34  MET A HE1  4  
ATOM   4687  H  HE2  . MET A 1 34 ? 9.520   -2.223  -5.441  1.00 0.00 ? 34  MET A HE2  4  
ATOM   4688  H  HE3  . MET A 1 34 ? 9.478   -0.457  -5.465  1.00 0.00 ? 34  MET A HE3  4  
ATOM   4689  N  N    . ILE A 1 35 ? 14.087  -0.336  -2.789  1.00 0.00 ? 35  ILE A N    4  
ATOM   4690  C  CA   . ILE A 1 35 ? 14.858  0.860   -3.099  1.00 0.00 ? 35  ILE A CA   4  
ATOM   4691  C  C    . ILE A 1 35 ? 16.374  0.486   -3.219  1.00 0.00 ? 35  ILE A C    4  
ATOM   4692  O  O    . ILE A 1 35 ? 17.006  0.800   -4.229  1.00 0.00 ? 35  ILE A O    4  
ATOM   4693  C  CB   . ILE A 1 35 ? 14.577  2.000   -2.016  1.00 0.00 ? 35  ILE A CB   4  
ATOM   4694  C  CG1  . ILE A 1 35 ? 15.705  3.079   -1.963  1.00 0.00 ? 35  ILE A CG1  4  
ATOM   4695  C  CG2  . ILE A 1 35 ? 14.308  1.417   -0.606  1.00 0.00 ? 35  ILE A CG2  4  
ATOM   4696  C  CD1  . ILE A 1 35 ? 15.839  3.953   -3.204  1.00 0.00 ? 35  ILE A CD1  4  
ATOM   4697  H  H    . ILE A 1 35 ? 13.978  -0.587  -1.871  1.00 0.00 ? 35  ILE A H    4  
ATOM   4698  H  HA   . ILE A 1 35 ? 14.521  1.225   -4.071  1.00 0.00 ? 35  ILE A HA   4  
ATOM   4699  H  HB   . ILE A 1 35 ? 13.654  2.493   -2.312  1.00 0.00 ? 35  ILE A HB   4  
ATOM   4700  H  HG12 . ILE A 1 35 ? 15.524  3.742   -1.126  1.00 0.00 ? 35  ILE A HG12 4  
ATOM   4701  H  HG13 . ILE A 1 35 ? 16.649  2.576   -1.807  1.00 0.00 ? 35  ILE A HG13 4  
ATOM   4702  H  HG21 . ILE A 1 35 ? 13.460  0.743   -0.647  1.00 0.00 ? 35  ILE A HG21 4  
ATOM   4703  H  HG22 . ILE A 1 35 ? 14.093  2.215   0.095   1.00 0.00 ? 35  ILE A HG22 4  
ATOM   4704  H  HG23 . ILE A 1 35 ? 15.178  0.870   -0.267  1.00 0.00 ? 35  ILE A HG23 4  
ATOM   4705  H  HD11 . ILE A 1 35 ? 14.920  4.502   -3.365  1.00 0.00 ? 35  ILE A HD11 4  
ATOM   4706  H  HD12 . ILE A 1 35 ? 16.044  3.335   -4.070  1.00 0.00 ? 35  ILE A HD12 4  
ATOM   4707  H  HD13 . ILE A 1 35 ? 16.651  4.648   -3.063  1.00 0.00 ? 35  ILE A HD13 4  
ATOM   4708  N  N    . HIS A 1 36 ? 16.940  -0.196  -2.188  1.00 0.00 ? 36  HIS A N    4  
ATOM   4709  C  CA   . HIS A 1 36 ? 18.409  -0.523  -2.107  1.00 0.00 ? 36  HIS A CA   4  
ATOM   4710  C  C    . HIS A 1 36 ? 18.756  -2.012  -2.415  1.00 0.00 ? 36  HIS A C    4  
ATOM   4711  O  O    . HIS A 1 36 ? 19.935  -2.375  -2.347  1.00 0.00 ? 36  HIS A O    4  
ATOM   4712  C  CB   . HIS A 1 36 ? 19.022  -0.124  -0.705  1.00 0.00 ? 36  HIS A CB   4  
ATOM   4713  C  CG   . HIS A 1 36 ? 18.061  0.436   0.313   1.00 0.00 ? 36  HIS A CG   4  
ATOM   4714  N  ND1  . HIS A 1 36 ? 17.887  1.775   0.515   1.00 0.00 ? 36  HIS A ND1  4  
ATOM   4715  C  CD2  . HIS A 1 36 ? 17.249  -0.187  1.222   1.00 0.00 ? 36  HIS A CD2  4  
ATOM   4716  C  CE1  . HIS A 1 36 ? 17.014  1.935   1.502   1.00 0.00 ? 36  HIS A CE1  4  
ATOM   4717  N  NE2  . HIS A 1 36 ? 16.588  0.778   1.979   1.00 0.00 ? 36  HIS A NE2  4  
ATOM   4718  H  H    . HIS A 1 36 ? 16.360  -0.511  -1.464  1.00 0.00 ? 36  HIS A H    4  
ATOM   4719  H  HA   . HIS A 1 36 ? 18.907  0.075   -2.870  1.00 0.00 ? 36  HIS A HA   4  
ATOM   4720  H  HB2  . HIS A 1 36 ? 19.499  -0.986  -0.243  1.00 0.00 ? 36  HIS A HB2  4  
ATOM   4721  H  HB3  . HIS A 1 36 ? 19.790  0.625   -0.861  1.00 0.00 ? 36  HIS A HB3  4  
ATOM   4722  H  HD1  . HIS A 1 36 ? 18.325  2.498   0.019   1.00 0.00 ? 36  HIS A HD1  4  
ATOM   4723  H  HD2  . HIS A 1 36 ? 17.125  -1.254  1.341   1.00 0.00 ? 36  HIS A HD2  4  
ATOM   4724  H  HE1  . HIS A 1 36 ? 16.693  2.895   1.877   1.00 0.00 ? 36  HIS A HE1  4  
ATOM   4725  N  N    . THR A 1 37 ? 17.768  -2.857  -2.746  1.00 0.00 ? 37  THR A N    4  
ATOM   4726  C  CA   . THR A 1 37 ? 17.948  -4.336  -2.736  1.00 0.00 ? 37  THR A CA   4  
ATOM   4727  C  C    . THR A 1 37 ? 18.857  -4.849  -3.868  1.00 0.00 ? 37  THR A C    4  
ATOM   4728  O  O    . THR A 1 37 ? 19.793  -5.617  -3.620  1.00 0.00 ? 37  THR A O    4  
ATOM   4729  C  CB   . THR A 1 37 ? 16.573  -5.106  -2.768  1.00 0.00 ? 37  THR A CB   4  
ATOM   4730  O  OG1  . THR A 1 37 ? 16.793  -6.530  -2.779  1.00 0.00 ? 37  THR A OG1  4  
ATOM   4731  C  CG2  . THR A 1 37 ? 15.695  -4.699  -3.962  1.00 0.00 ? 37  THR A CG2  4  
ATOM   4732  H  H    . THR A 1 37 ? 16.903  -2.486  -3.023  1.00 0.00 ? 37  THR A H    4  
ATOM   4733  H  HA   . THR A 1 37 ? 18.429  -4.588  -1.789  1.00 0.00 ? 37  THR A HA   4  
ATOM   4734  H  HB   . THR A 1 37 ? 16.028  -4.859  -1.853  1.00 0.00 ? 37  THR A HB   4  
ATOM   4735  H  HG1  . THR A 1 37 ? 15.958  -6.989  -2.921  1.00 0.00 ? 37  THR A HG1  4  
ATOM   4736  H  HG21 . THR A 1 37 ? 16.192  -4.957  -4.891  1.00 0.00 ? 37  THR A HG21 4  
ATOM   4737  H  HG22 . THR A 1 37 ? 15.520  -3.629  -3.940  1.00 0.00 ? 37  THR A HG22 4  
ATOM   4738  H  HG23 . THR A 1 37 ? 14.745  -5.212  -3.909  1.00 0.00 ? 37  THR A HG23 4  
ATOM   4739  N  N    . GLY A 1 38 ? 18.583  -4.415  -5.110  1.00 0.00 ? 38  GLY A N    4  
ATOM   4740  C  CA   . GLY A 1 38 ? 19.131  -5.056  -6.307  1.00 0.00 ? 38  GLY A CA   4  
ATOM   4741  C  C    . GLY A 1 38 ? 18.301  -6.272  -6.753  1.00 0.00 ? 38  GLY A C    4  
ATOM   4742  O  O    . GLY A 1 38 ? 18.240  -6.573  -7.949  1.00 0.00 ? 38  GLY A O    4  
ATOM   4743  H  H    . GLY A 1 38 ? 18.031  -3.626  -5.229  1.00 0.00 ? 38  GLY A H    4  
ATOM   4744  H  HA2  . GLY A 1 38 ? 19.142  -4.323  -7.104  1.00 0.00 ? 38  GLY A HA2  4  
ATOM   4745  H  HA3  . GLY A 1 38 ? 20.150  -5.376  -6.123  1.00 0.00 ? 38  GLY A HA3  4  
ATOM   4746  N  N    . GLU A 1 39 ? 17.659  -6.973  -5.782  1.00 0.00 ? 39  GLU A N    4  
ATOM   4747  C  CA   . GLU A 1 39 ? 16.738  -8.098  -6.028  1.00 0.00 ? 39  GLU A CA   4  
ATOM   4748  C  C    . GLU A 1 39 ? 15.295  -7.598  -5.832  1.00 0.00 ? 39  GLU A C    4  
ATOM   4749  O  O    . GLU A 1 39 ? 14.715  -7.777  -4.746  1.00 0.00 ? 39  GLU A O    4  
ATOM   4750  C  CB   . GLU A 1 39 ? 17.033  -9.263  -5.024  1.00 0.00 ? 39  GLU A CB   4  
ATOM   4751  C  CG   . GLU A 1 39 ? 18.508  -9.668  -4.896  1.00 0.00 ? 39  GLU A CG   4  
ATOM   4752  C  CD   . GLU A 1 39 ? 18.723  -10.725 -3.806  1.00 0.00 ? 39  GLU A CD   4  
ATOM   4753  O  OE1  . GLU A 1 39 ? 18.545  -11.931 -4.091  1.00 0.00 ? 39  GLU A OE1  4  
ATOM   4754  O  OE2  . GLU A 1 39 ? 19.022  -10.354 -2.645  1.00 0.00 ? 39  GLU A OE2  4  
ATOM   4755  H  H    . GLU A 1 39 ? 17.841  -6.774  -4.849  1.00 0.00 ? 39  GLU A H    4  
ATOM   4756  H  HA   . GLU A 1 39 ? 16.869  -8.462  -7.044  1.00 0.00 ? 39  GLU A HA   4  
ATOM   4757  H  HB2  . GLU A 1 39 ? 16.689  -8.970  -4.035  1.00 0.00 ? 39  GLU A HB2  4  
ATOM   4758  H  HB3  . GLU A 1 39 ? 16.467  -10.143 -5.336  1.00 0.00 ? 39  GLU A HB3  4  
ATOM   4759  H  HG2  . GLU A 1 39 ? 18.846  -10.062 -5.851  1.00 0.00 ? 39  GLU A HG2  4  
ATOM   4760  H  HG3  . GLU A 1 39 ? 19.096  -8.786  -4.656  1.00 0.00 ? 39  GLU A HG3  4  
ATOM   4761  N  N    . LYS A 1 40 ? 14.781  -6.865  -6.830  1.00 0.00 ? 40  LYS A N    4  
ATOM   4762  C  CA   . LYS A 1 40 ? 13.393  -6.340  -6.825  1.00 0.00 ? 40  LYS A CA   4  
ATOM   4763  C  C    . LYS A 1 40 ? 12.346  -7.463  -6.560  1.00 0.00 ? 40  LYS A C    4  
ATOM   4764  O  O    . LYS A 1 40 ? 12.431  -8.543  -7.161  1.00 0.00 ? 40  LYS A O    4  
ATOM   4765  C  CB   . LYS A 1 40 ? 13.076  -5.607  -8.166  1.00 0.00 ? 40  LYS A CB   4  
ATOM   4766  C  CG   . LYS A 1 40 ? 13.390  -6.426  -9.432  1.00 0.00 ? 40  LYS A CG   4  
ATOM   4767  C  CD   . LYS A 1 40 ? 13.033  -5.683  -10.739 1.00 0.00 ? 40  LYS A CD   4  
ATOM   4768  C  CE   . LYS A 1 40 ? 13.526  -6.420  -11.995 1.00 0.00 ? 40  LYS A CE   4  
ATOM   4769  N  NZ   . LYS A 1 40 ? 13.041  -7.824  -12.069 1.00 0.00 ? 40  LYS A NZ   4  
ATOM   4770  H  H    . LYS A 1 40 ? 15.360  -6.633  -7.581  1.00 0.00 ? 40  LYS A H    4  
ATOM   4771  H  HA   . LYS A 1 40 ? 13.338  -5.610  -6.022  1.00 0.00 ? 40  LYS A HA   4  
ATOM   4772  H  HB2  . LYS A 1 40 ? 12.020  -5.340  -8.183  1.00 0.00 ? 40  LYS A HB2  4  
ATOM   4773  H  HB3  . LYS A 1 40 ? 13.656  -4.689  -8.202  1.00 0.00 ? 40  LYS A HB3  4  
ATOM   4774  H  HG2  . LYS A 1 40 ? 14.447  -6.657  -9.434  1.00 0.00 ? 40  LYS A HG2  4  
ATOM   4775  H  HG3  . LYS A 1 40 ? 12.827  -7.354  -9.392  1.00 0.00 ? 40  LYS A HG3  4  
ATOM   4776  H  HD2  . LYS A 1 40 ? 11.957  -5.577  -10.799 1.00 0.00 ? 40  LYS A HD2  4  
ATOM   4777  H  HD3  . LYS A 1 40 ? 13.483  -4.692  -10.717 1.00 0.00 ? 40  LYS A HD3  4  
ATOM   4778  H  HE2  . LYS A 1 40 ? 13.180  -5.890  -12.875 1.00 0.00 ? 40  LYS A HE2  4  
ATOM   4779  H  HE3  . LYS A 1 40 ? 14.609  -6.426  -11.995 1.00 0.00 ? 40  LYS A HE3  4  
ATOM   4780  H  HZ1  . LYS A 1 40 ? 12.002  -7.846  -12.017 1.00 0.00 ? 40  LYS A HZ1  4  
ATOM   4781  H  HZ2  . LYS A 1 40 ? 13.432  -8.386  -11.285 1.00 0.00 ? 40  LYS A HZ2  4  
ATOM   4782  H  HZ3  . LYS A 1 40 ? 13.340  -8.258  -12.966 1.00 0.00 ? 40  LYS A HZ3  4  
ATOM   4783  N  N    . PRO A 1 41 ? 11.375  -7.243  -5.611  1.00 0.00 ? 41  PRO A N    4  
ATOM   4784  C  CA   . PRO A 1 41 ? 10.229  -8.161  -5.415  1.00 0.00 ? 41  PRO A CA   4  
ATOM   4785  C  C    . PRO A 1 41 ? 9.186   -8.002  -6.542  1.00 0.00 ? 41  PRO A C    4  
ATOM   4786  O  O    . PRO A 1 41 ? 9.416   -7.281  -7.526  1.00 0.00 ? 41  PRO A O    4  
ATOM   4787  C  CB   . PRO A 1 41 ? 9.676   -7.734  -4.028  1.00 0.00 ? 41  PRO A CB   4  
ATOM   4788  C  CG   . PRO A 1 41 ? 9.993   -6.275  -3.942  1.00 0.00 ? 41  PRO A CG   4  
ATOM   4789  C  CD   . PRO A 1 41 ? 11.336  -6.116  -4.636  1.00 0.00 ? 41  PRO A CD   4  
ATOM   4790  H  HA   . PRO A 1 41 ? 10.551  -9.198  -5.384  1.00 0.00 ? 41  PRO A HA   4  
ATOM   4791  H  HB2  . PRO A 1 41 ? 8.607   -7.922  -3.963  1.00 0.00 ? 41  PRO A HB2  4  
ATOM   4792  H  HB3  . PRO A 1 41 ? 10.181  -8.293  -3.244  1.00 0.00 ? 41  PRO A HB3  4  
ATOM   4793  H  HG2  . PRO A 1 41 ? 9.225   -5.695  -4.452  1.00 0.00 ? 41  PRO A HG2  4  
ATOM   4794  H  HG3  . PRO A 1 41 ? 10.059  -5.966  -2.905  1.00 0.00 ? 41  PRO A HG3  4  
ATOM   4795  H  HD2  . PRO A 1 41 ? 11.388  -5.167  -5.148  1.00 0.00 ? 41  PRO A HD2  4  
ATOM   4796  H  HD3  . PRO A 1 41 ? 12.151  -6.200  -3.921  1.00 0.00 ? 41  PRO A HD3  4  
ATOM   4797  N  N    . LEU A 1 42 ? 8.040   -8.672  -6.394  1.00 0.00 ? 42  LEU A N    4  
ATOM   4798  C  CA   . LEU A 1 42 ? 6.972   -8.669  -7.406  1.00 0.00 ? 42  LEU A CA   4  
ATOM   4799  C  C    . LEU A 1 42 ? 5.856   -7.730  -6.928  1.00 0.00 ? 42  LEU A C    4  
ATOM   4800  O  O    . LEU A 1 42 ? 5.026   -8.103  -6.093  1.00 0.00 ? 42  LEU A O    4  
ATOM   4801  C  CB   . LEU A 1 42 ? 6.473   -10.118 -7.621  1.00 0.00 ? 42  LEU A CB   4  
ATOM   4802  C  CG   . LEU A 1 42 ? 7.580   -11.142 -8.043  1.00 0.00 ? 42  LEU A CG   4  
ATOM   4803  C  CD1  . LEU A 1 42 ? 7.051   -12.587 -8.037  1.00 0.00 ? 42  LEU A CD1  4  
ATOM   4804  C  CD2  . LEU A 1 42 ? 8.196   -10.771 -9.416  1.00 0.00 ? 42  LEU A CD2  4  
ATOM   4805  H  H    . LEU A 1 42 ? 7.875   -9.151  -5.556  1.00 0.00 ? 42  LEU A H    4  
ATOM   4806  H  HA   . LEU A 1 42 ? 7.377   -8.288  -8.346  1.00 0.00 ? 42  LEU A HA   4  
ATOM   4807  H  HB2  . LEU A 1 42 ? 6.020   -10.459 -6.691  1.00 0.00 ? 42  LEU A HB2  4  
ATOM   4808  H  HB3  . LEU A 1 42 ? 5.703   -10.110 -8.387  1.00 0.00 ? 42  LEU A HB3  4  
ATOM   4809  H  HG   . LEU A 1 42 ? 8.381   -11.102 -7.312  1.00 0.00 ? 42  LEU A HG   4  
ATOM   4810  H  HD11 . LEU A 1 42 ? 7.849   -13.269 -8.307  1.00 0.00 ? 42  LEU A HD11 4  
ATOM   4811  H  HD12 . LEU A 1 42 ? 6.242   -12.691 -8.746  1.00 0.00 ? 42  LEU A HD12 4  
ATOM   4812  H  HD13 . LEU A 1 42 ? 6.692   -12.842 -7.048  1.00 0.00 ? 42  LEU A HD13 4  
ATOM   4813  H  HD21 . LEU A 1 42 ? 7.434   -10.790 -10.187 1.00 0.00 ? 42  LEU A HD21 4  
ATOM   4814  H  HD22 . LEU A 1 42 ? 8.974   -11.480 -9.665  1.00 0.00 ? 42  LEU A HD22 4  
ATOM   4815  H  HD23 . LEU A 1 42 ? 8.629   -9.779  -9.366  1.00 0.00 ? 42  LEU A HD23 4  
ATOM   4816  N  N    . GLN A 1 43 ? 5.856   -6.503  -7.462  1.00 0.00 ? 43  GLN A N    4  
ATOM   4817  C  CA   . GLN A 1 43 ? 5.057   -5.382  -6.936  1.00 0.00 ? 43  GLN A CA   4  
ATOM   4818  C  C    . GLN A 1 43 ? 4.106   -4.900  -8.053  1.00 0.00 ? 43  GLN A C    4  
ATOM   4819  O  O    . GLN A 1 43 ? 4.527   -4.729  -9.204  1.00 0.00 ? 43  GLN A O    4  
ATOM   4820  C  CB   . GLN A 1 43 ? 6.023   -4.240  -6.466  1.00 0.00 ? 43  GLN A CB   4  
ATOM   4821  C  CG   . GLN A 1 43 ? 5.492   -3.259  -5.387  1.00 0.00 ? 43  GLN A CG   4  
ATOM   4822  C  CD   . GLN A 1 43 ? 4.249   -2.463  -5.792  1.00 0.00 ? 43  GLN A CD   4  
ATOM   4823  O  OE1  . GLN A 1 43 ? 3.118   -2.856  -5.512  1.00 0.00 ? 43  GLN A OE1  4  
ATOM   4824  N  NE2  . GLN A 1 43 ? 4.444   -1.360  -6.488  1.00 0.00 ? 43  GLN A NE2  4  
ATOM   4825  H  H    . GLN A 1 43 ? 6.371   -6.349  -8.283  1.00 0.00 ? 43  GLN A H    4  
ATOM   4826  H  HA   . GLN A 1 43 ? 4.469   -5.732  -6.089  1.00 0.00 ? 43  GLN A HA   4  
ATOM   4827  H  HB2  . GLN A 1 43 ? 6.916   -4.700  -6.055  1.00 0.00 ? 43  GLN A HB2  4  
ATOM   4828  H  HB3  . GLN A 1 43 ? 6.322   -3.657  -7.337  1.00 0.00 ? 43  GLN A HB3  4  
ATOM   4829  H  HG2  . GLN A 1 43 ? 5.253   -3.827  -4.496  1.00 0.00 ? 43  GLN A HG2  4  
ATOM   4830  H  HG3  . GLN A 1 43 ? 6.283   -2.556  -5.139  1.00 0.00 ? 43  GLN A HG3  4  
ATOM   4831  H  HE21 . GLN A 1 43 ? 5.363   -1.109  -6.713  1.00 0.00 ? 43  GLN A HE21 4  
ATOM   4832  H  HE22 . GLN A 1 43 ? 3.658   -0.834  -6.758  1.00 0.00 ? 43  GLN A HE22 4  
ATOM   4833  N  N    . CYS A 1 44 ? 2.833   -4.687  -7.694  1.00 0.00 ? 44  CYS A N    4  
ATOM   4834  C  CA   . CYS A 1 44 ? 1.800   -4.175  -8.604  1.00 0.00 ? 44  CYS A CA   4  
ATOM   4835  C  C    . CYS A 1 44 ? 2.006   -2.665  -8.848  1.00 0.00 ? 44  CYS A C    4  
ATOM   4836  O  O    . CYS A 1 44 ? 1.704   -1.846  -7.973  1.00 0.00 ? 44  CYS A O    4  
ATOM   4837  C  CB   . CYS A 1 44 ? 0.390   -4.419  -8.010  1.00 0.00 ? 44  CYS A CB   4  
ATOM   4838  S  SG   . CYS A 1 44 ? -0.972  -3.618  -8.937  1.00 0.00 ? 44  CYS A SG   4  
ATOM   4839  H  H    . CYS A 1 44 ? 2.586   -4.862  -6.768  1.00 0.00 ? 44  CYS A H    4  
ATOM   4840  H  HA   . CYS A 1 44 ? 1.878   -4.717  -9.543  1.00 0.00 ? 44  CYS A HA   4  
ATOM   4841  H  HB2  . CYS A 1 44 ? 0.180   -5.479  -7.993  1.00 0.00 ? 44  CYS A HB2  4  
ATOM   4842  H  HB3  . CYS A 1 44 ? 0.357   -4.045  -6.991  1.00 0.00 ? 44  CYS A HB3  4  
ATOM   4843  N  N    . GLU A 1 45 ? 2.487   -2.291  -10.047 1.00 0.00 ? 45  GLU A N    4  
ATOM   4844  C  CA   . GLU A 1 45 ? 2.734   -0.877  -10.423 1.00 0.00 ? 45  GLU A CA   4  
ATOM   4845  C  C    . GLU A 1 45 ? 1.448   -0.238  -11.006 1.00 0.00 ? 45  GLU A C    4  
ATOM   4846  O  O    . GLU A 1 45 ? 1.477   0.540   -11.962 1.00 0.00 ? 45  GLU A O    4  
ATOM   4847  C  CB   . GLU A 1 45 ? 3.957   -0.760  -11.400 1.00 0.00 ? 45  GLU A CB   4  
ATOM   4848  C  CG   . GLU A 1 45 ? 3.837   -1.498  -12.761 1.00 0.00 ? 45  GLU A CG   4  
ATOM   4849  C  CD   . GLU A 1 45 ? 4.079   -3.014  -12.661 1.00 0.00 ? 45  GLU A CD   4  
ATOM   4850  O  OE1  . GLU A 1 45 ? 5.254   -3.426  -12.582 1.00 0.00 ? 45  GLU A OE1  4  
ATOM   4851  O  OE2  . GLU A 1 45 ? 3.103   -3.791  -12.628 1.00 0.00 ? 45  GLU A OE2  4  
ATOM   4852  H  H    . GLU A 1 45 ? 2.687   -2.989  -10.701 1.00 0.00 ? 45  GLU A H    4  
ATOM   4853  H  HA   . GLU A 1 45 ? 2.981   -0.327  -9.514  1.00 0.00 ? 45  GLU A HA   4  
ATOM   4854  H  HB2  . GLU A 1 45 ? 4.135   0.289   -11.605 1.00 0.00 ? 45  GLU A HB2  4  
ATOM   4855  H  HB3  . GLU A 1 45 ? 4.832   -1.149  -10.887 1.00 0.00 ? 45  GLU A HB3  4  
ATOM   4856  H  HG2  . GLU A 1 45 ? 2.844   -1.321  -13.166 1.00 0.00 ? 45  GLU A HG2  4  
ATOM   4857  H  HG3  . GLU A 1 45 ? 4.565   -1.075  -13.451 1.00 0.00 ? 45  GLU A HG3  4  
ATOM   4858  N  N    . ILE A 1 46 ? 0.314   -0.541  -10.354 1.00 0.00 ? 46  ILE A N    4  
ATOM   4859  C  CA   . ILE A 1 46 ? -1.033  -0.070  -10.734 1.00 0.00 ? 46  ILE A CA   4  
ATOM   4860  C  C    . ILE A 1 46 ? -1.673  0.573   -9.458  1.00 0.00 ? 46  ILE A C    4  
ATOM   4861  O  O    . ILE A 1 46 ? -2.750  1.172   -9.491  1.00 0.00 ? 46  ILE A O    4  
ATOM   4862  C  CB   . ILE A 1 46 ? -1.956  -1.235  -11.294 1.00 0.00 ? 46  ILE A CB   4  
ATOM   4863  C  CG1  . ILE A 1 46 ? -1.306  -2.036  -12.492 1.00 0.00 ? 46  ILE A CG1  4  
ATOM   4864  C  CG2  . ILE A 1 46 ? -3.336  -0.683  -11.742 1.00 0.00 ? 46  ILE A CG2  4  
ATOM   4865  C  CD1  . ILE A 1 46 ? -0.324  -3.136  -12.116 1.00 0.00 ? 46  ILE A CD1  4  
ATOM   4866  H  H    . ILE A 1 46 ? 0.366   -1.041  -9.513  1.00 0.00 ? 46  ILE A H    4  
ATOM   4867  H  HA   . ILE A 1 46 ? -0.928  0.698   -11.499 1.00 0.00 ? 46  ILE A HA   4  
ATOM   4868  H  HB   . ILE A 1 46 ? -2.126  -1.919  -10.466 1.00 0.00 ? 46  ILE A HB   4  
ATOM   4869  H  HG12 . ILE A 1 46 ? -2.083  -2.517  -13.070 1.00 0.00 ? 46  ILE A HG12 4  
ATOM   4870  H  HG13 . ILE A 1 46 ? -0.782  -1.337  -13.136 1.00 0.00 ? 46  ILE A HG13 4  
ATOM   4871  H  HG21 . ILE A 1 46 ? -3.948  -1.485  -12.133 1.00 0.00 ? 46  ILE A HG21 4  
ATOM   4872  H  HG22 . ILE A 1 46 ? -3.203  0.073   -12.504 1.00 0.00 ? 46  ILE A HG22 4  
ATOM   4873  H  HG23 . ILE A 1 46 ? -3.837  -0.242  -10.886 1.00 0.00 ? 46  ILE A HG23 4  
ATOM   4874  H  HD11 . ILE A 1 46 ? -0.817  -3.863  -11.486 1.00 0.00 ? 46  ILE A HD11 4  
ATOM   4875  H  HD12 . ILE A 1 46 ? 0.516   -2.711  -11.585 1.00 0.00 ? 46  ILE A HD12 4  
ATOM   4876  H  HD13 . ILE A 1 46 ? 0.032   -3.623  -13.014 1.00 0.00 ? 46  ILE A HD13 4  
ATOM   4877  N  N    . CYS A 1 47 ? -0.902  0.504   -8.352  1.00 0.00 ? 47  CYS A N    4  
ATOM   4878  C  CA   . CYS A 1 47 ? -1.324  0.802   -6.985  1.00 0.00 ? 47  CYS A CA   4  
ATOM   4879  C  C    . CYS A 1 47 ? -0.115  0.409   -6.113  1.00 0.00 ? 47  CYS A C    4  
ATOM   4880  O  O    . CYS A 1 47 ? 1.027   0.723   -6.480  1.00 0.00 ? 47  CYS A O    4  
ATOM   4881  C  CB   . CYS A 1 47 ? -2.669  0.090   -6.589  1.00 0.00 ? 47  CYS A CB   4  
ATOM   4882  S  SG   . CYS A 1 47 ? -2.548  -1.666  -6.077  1.00 0.00 ? 47  CYS A SG   4  
ATOM   4883  H  H    . CYS A 1 47 ? 0.051   0.470   -8.504  1.00 0.00 ? 47  CYS A H    4  
ATOM   4884  H  HA   . CYS A 1 47 ? -1.447  1.881   -6.912  1.00 0.00 ? 47  CYS A HA   4  
ATOM   4885  H  HB2  . CYS A 1 47 ? -3.108  0.623   -5.760  1.00 0.00 ? 47  CYS A HB2  4  
ATOM   4886  H  HB3  . CYS A 1 47 ? -3.354  0.147   -7.429  1.00 0.00 ? 47  CYS A HB3  4  
ATOM   4887  N  N    . GLY A 1 48 ? -0.332  -0.256  -4.988  1.00 0.00 ? 48  GLY A N    4  
ATOM   4888  C  CA   . GLY A 1 48 ? 0.739   -0.837  -4.187  1.00 0.00 ? 48  GLY A CA   4  
ATOM   4889  C  C    . GLY A 1 48 ? 0.225   -2.142  -3.595  1.00 0.00 ? 48  GLY A C    4  
ATOM   4890  O  O    . GLY A 1 48 ? -0.829  -2.117  -2.950  1.00 0.00 ? 48  GLY A O    4  
ATOM   4891  H  H    . GLY A 1 48 ? -1.231  -0.479  -4.734  1.00 0.00 ? 48  GLY A H    4  
ATOM   4892  H  HA2  . GLY A 1 48 ? 1.602   -1.031  -4.825  1.00 0.00 ? 48  GLY A HA2  4  
ATOM   4893  H  HA3  . GLY A 1 48 ? 1.015   -0.159  -3.394  1.00 0.00 ? 48  GLY A HA3  4  
ATOM   4894  N  N    . PHE A 1 49 ? 0.928   -3.276  -3.765  1.00 0.00 ? 49  PHE A N    4  
ATOM   4895  C  CA   . PHE A 1 49 ? 0.425   -4.616  -3.478  1.00 0.00 ? 49  PHE A CA   4  
ATOM   4896  C  C    . PHE A 1 49 ? 1.611   -5.490  -3.853  1.00 0.00 ? 49  PHE A C    4  
ATOM   4897  O  O    . PHE A 1 49 ? 1.950   -5.573  -5.040  1.00 0.00 ? 49  PHE A O    4  
ATOM   4898  C  CB   . PHE A 1 49 ? -0.832  -4.980  -4.333  1.00 0.00 ? 49  PHE A CB   4  
ATOM   4899  C  CG   . PHE A 1 49 ? -1.321  -6.431  -4.195  1.00 0.00 ? 49  PHE A CG   4  
ATOM   4900  C  CD1  . PHE A 1 49 ? -0.785  -7.449  -4.987  1.00 0.00 ? 49  PHE A CD1  4  
ATOM   4901  C  CD2  . PHE A 1 49 ? -2.316  -6.771  -3.281  1.00 0.00 ? 49  PHE A CD2  4  
ATOM   4902  C  CE1  . PHE A 1 49 ? -1.228  -8.753  -4.866  1.00 0.00 ? 49  PHE A CE1  4  
ATOM   4903  C  CE2  . PHE A 1 49 ? -2.756  -8.075  -3.164  1.00 0.00 ? 49  PHE A CE2  4  
ATOM   4904  C  CZ   . PHE A 1 49 ? -2.213  -9.067  -3.954  1.00 0.00 ? 49  PHE A CZ   4  
ATOM   4905  H  H    . PHE A 1 49 ? 1.897   -3.298  -3.943  1.00 0.00 ? 49  PHE A H    4  
ATOM   4906  H  HA   . PHE A 1 49 ? 0.211   -4.702  -2.412  1.00 0.00 ? 49  PHE A HA   4  
ATOM   4907  H  HB2  . PHE A 1 49 ? -1.646  -4.326  -4.045  1.00 0.00 ? 49  PHE A HB2  4  
ATOM   4908  H  HB3  . PHE A 1 49 ? -0.606  -4.799  -5.379  1.00 0.00 ? 49  PHE A HB3  4  
ATOM   4909  H  HD1  . PHE A 1 49 ? -0.010  -7.202  -5.706  1.00 0.00 ? 49  PHE A HD1  4  
ATOM   4910  H  HD2  . PHE A 1 49 ? -2.752  -6.002  -2.656  1.00 0.00 ? 49  PHE A HD2  4  
ATOM   4911  H  HE1  . PHE A 1 49 ? -0.796  -9.532  -5.490  1.00 0.00 ? 49  PHE A HE1  4  
ATOM   4912  H  HE2  . PHE A 1 49 ? -3.530  -8.323  -2.450  1.00 0.00 ? 49  PHE A HE2  4  
ATOM   4913  H  HZ   . PHE A 1 49 ? -2.557  -10.090 -3.856  1.00 0.00 ? 49  PHE A HZ   4  
ATOM   4914  N  N    . THR A 1 50 ? 2.252   -6.135  -2.882  1.00 0.00 ? 50  THR A N    4  
ATOM   4915  C  CA   . THR A 1 50 ? 3.515   -6.815  -3.128  1.00 0.00 ? 50  THR A CA   4  
ATOM   4916  C  C    . THR A 1 50 ? 3.398   -8.283  -2.729  1.00 0.00 ? 50  THR A C    4  
ATOM   4917  O  O    . THR A 1 50 ? 2.704   -8.642  -1.763  1.00 0.00 ? 50  THR A O    4  
ATOM   4918  C  CB   . THR A 1 50 ? 4.695   -6.151  -2.360  1.00 0.00 ? 50  THR A CB   4  
ATOM   4919  O  OG1  . THR A 1 50 ? 4.555   -4.729  -2.401  1.00 0.00 ? 50  THR A OG1  4  
ATOM   4920  C  CG2  . THR A 1 50 ? 6.067   -6.537  -2.955  1.00 0.00 ? 50  THR A CG2  4  
ATOM   4921  H  H    . THR A 1 50 ? 1.876   -6.163  -1.985  1.00 0.00 ? 50  THR A H    4  
ATOM   4922  H  HA   . THR A 1 50 ? 3.728   -6.744  -4.198  1.00 0.00 ? 50  THR A HA   4  
ATOM   4923  H  HB   . THR A 1 50 ? 4.668   -6.469  -1.328  1.00 0.00 ? 50  THR A HB   4  
ATOM   4924  H  HG1  . THR A 1 50 ? 3.676   -4.488  -2.094  1.00 0.00 ? 50  THR A HG1  4  
ATOM   4925  H  HG21 . THR A 1 50 ? 6.859   -6.063  -2.386  1.00 0.00 ? 50  THR A HG21 4  
ATOM   4926  H  HG22 . THR A 1 50 ? 6.130   -6.208  -3.986  1.00 0.00 ? 50  THR A HG22 4  
ATOM   4927  H  HG23 . THR A 1 50 ? 6.188   -7.610  -2.916  1.00 0.00 ? 50  THR A HG23 4  
ATOM   4928  N  N    . CYS A 1 51 ? 4.083   -9.099  -3.498  1.00 0.00 ? 51  CYS A N    4  
ATOM   4929  C  CA   . CYS A 1 51 ? 4.078   -10.547 -3.365  1.00 0.00 ? 51  CYS A CA   4  
ATOM   4930  C  C    . CYS A 1 51 ? 5.441   -11.132 -3.756  1.00 0.00 ? 51  CYS A C    4  
ATOM   4931  O  O    . CYS A 1 51 ? 6.329   -10.430 -4.260  1.00 0.00 ? 51  CYS A O    4  
ATOM   4932  C  CB   . CYS A 1 51 ? 2.957   -11.125 -4.258  1.00 0.00 ? 51  CYS A CB   4  
ATOM   4933  S  SG   . CYS A 1 51 ? 1.298   -10.544 -3.840  1.00 0.00 ? 51  CYS A SG   4  
ATOM   4934  H  H    . CYS A 1 51 ? 4.600   -8.697  -4.216  1.00 0.00 ? 51  CYS A H    4  
ATOM   4935  H  HA   . CYS A 1 51 ? 3.875   -10.802 -2.329  1.00 0.00 ? 51  CYS A HA   4  
ATOM   4936  H  HB2  . CYS A 1 51 ? 3.142   -10.851 -5.287  1.00 0.00 ? 51  CYS A HB2  4  
ATOM   4937  H  HB3  . CYS A 1 51 ? 2.952   -12.205 -4.176  1.00 0.00 ? 51  CYS A HB3  4  
ATOM   4938  H  HG   . CYS A 1 51 ? 1.330   -10.041 -2.610  1.00 0.00 ? 51  CYS A HG   4  
ATOM   4939  N  N    . ARG A 1 52 ? 5.582   -12.427 -3.488  1.00 0.00 ? 52  ARG A N    4  
ATOM   4940  C  CA   . ARG A 1 52 ? 6.704   -13.258 -3.950  1.00 0.00 ? 52  ARG A CA   4  
ATOM   4941  C  C    . ARG A 1 52 ? 6.157   -14.368 -4.872  1.00 0.00 ? 52  ARG A C    4  
ATOM   4942  O  O    . ARG A 1 52 ? 6.924   -15.116 -5.484  1.00 0.00 ? 52  ARG A O    4  
ATOM   4943  C  CB   . ARG A 1 52 ? 7.521   -13.848 -2.754  1.00 0.00 ? 52  ARG A CB   4  
ATOM   4944  C  CG   . ARG A 1 52 ? 6.743   -14.737 -1.742  1.00 0.00 ? 52  ARG A CG   4  
ATOM   4945  C  CD   . ARG A 1 52 ? 5.791   -13.948 -0.816  1.00 0.00 ? 52  ARG A CD   4  
ATOM   4946  N  NE   . ARG A 1 52 ? 6.467   -12.817 -0.160  1.00 0.00 ? 52  ARG A NE   4  
ATOM   4947  C  CZ   . ARG A 1 52 ? 5.876   -11.720 0.346   1.00 0.00 ? 52  ARG A CZ   4  
ATOM   4948  N  NH1  . ARG A 1 52 ? 4.553   -11.578 0.317   1.00 0.00 ? 52  ARG A NH1  4  
ATOM   4949  N  NH2  . ARG A 1 52 ? 6.627   -10.765 0.866   1.00 0.00 ? 52  ARG A NH2  4  
ATOM   4950  H  H    . ARG A 1 52 ? 4.884   -12.859 -2.955  1.00 0.00 ? 52  ARG A H    4  
ATOM   4951  H  HA   . ARG A 1 52 ? 7.367   -12.632 -4.546  1.00 0.00 ? 52  ARG A HA   4  
ATOM   4952  H  HB2  . ARG A 1 52 ? 8.331   -14.446 -3.160  1.00 0.00 ? 52  ARG A HB2  4  
ATOM   4953  H  HB3  . ARG A 1 52 ? 7.963   -13.021 -2.204  1.00 0.00 ? 52  ARG A HB3  4  
ATOM   4954  H  HG2  . ARG A 1 52 ? 6.158   -15.465 -2.295  1.00 0.00 ? 52  ARG A HG2  4  
ATOM   4955  H  HG3  . ARG A 1 52 ? 7.462   -15.269 -1.126  1.00 0.00 ? 52  ARG A HG3  4  
ATOM   4956  H  HD2  . ARG A 1 52 ? 4.964   -13.567 -1.407  1.00 0.00 ? 52  ARG A HD2  4  
ATOM   4957  H  HD3  . ARG A 1 52 ? 5.403   -14.618 -0.056  1.00 0.00 ? 52  ARG A HD3  4  
ATOM   4958  H  HE   . ARG A 1 52 ? 7.441   -12.871 -0.102  1.00 0.00 ? 52  ARG A HE   4  
ATOM   4959  H  HH11 . ARG A 1 52 ? 3.974   -12.292 -0.073  1.00 0.00 ? 52  ARG A HH11 4  
ATOM   4960  H  HH12 . ARG A 1 52 ? 4.131   -10.748 0.695   1.00 0.00 ? 52  ARG A HH12 4  
ATOM   4961  H  HH21 . ARG A 1 52 ? 7.625   -10.864 0.881   1.00 0.00 ? 52  ARG A HH21 4  
ATOM   4962  H  HH22 . ARG A 1 52 ? 6.203   -9.936  1.246   1.00 0.00 ? 52  ARG A HH22 4  
ATOM   4963  N  N    . GLN A 1 53 ? 4.812   -14.459 -4.949  1.00 0.00 ? 53  GLN A N    4  
ATOM   4964  C  CA   . GLN A 1 53 ? 4.094   -15.280 -5.928  1.00 0.00 ? 53  GLN A CA   4  
ATOM   4965  C  C    . GLN A 1 53 ? 3.557   -14.343 -7.025  1.00 0.00 ? 53  GLN A C    4  
ATOM   4966  O  O    . GLN A 1 53 ? 2.687   -13.512 -6.749  1.00 0.00 ? 53  GLN A O    4  
ATOM   4967  C  CB   . GLN A 1 53 ? 2.920   -16.054 -5.247  1.00 0.00 ? 53  GLN A CB   4  
ATOM   4968  C  CG   . GLN A 1 53 ? 3.335   -16.996 -4.103  1.00 0.00 ? 53  GLN A CG   4  
ATOM   4969  C  CD   . GLN A 1 53 ? 4.331   -18.069 -4.534  1.00 0.00 ? 53  GLN A CD   4  
ATOM   4970  O  OE1  . GLN A 1 53 ? 5.546   -17.887 -4.447  1.00 0.00 ? 53  GLN A OE1  4  
ATOM   4971  N  NE2  . GLN A 1 53 ? 3.823   -19.188 -5.020  1.00 0.00 ? 53  GLN A NE2  4  
ATOM   4972  H  H    . GLN A 1 53 ? 4.277   -13.935 -4.323  1.00 0.00 ? 53  GLN A H    4  
ATOM   4973  H  HA   . GLN A 1 53 ? 4.787   -15.997 -6.371  1.00 0.00 ? 53  GLN A HA   4  
ATOM   4974  H  HB2  . GLN A 1 53 ? 2.217   -15.334 -4.842  1.00 0.00 ? 53  GLN A HB2  4  
ATOM   4975  H  HB3  . GLN A 1 53 ? 2.407   -16.645 -6.002  1.00 0.00 ? 53  GLN A HB3  4  
ATOM   4976  H  HG2  . GLN A 1 53 ? 3.782   -16.405 -3.312  1.00 0.00 ? 53  GLN A HG2  4  
ATOM   4977  H  HG3  . GLN A 1 53 ? 2.448   -17.484 -3.709  1.00 0.00 ? 53  GLN A HG3  4  
ATOM   4978  H  HE21 . GLN A 1 53 ? 2.847   -19.266 -5.074  1.00 0.00 ? 53  GLN A HE21 4  
ATOM   4979  H  HE22 . GLN A 1 53 ? 4.438   -19.888 -5.313  1.00 0.00 ? 53  GLN A HE22 4  
ATOM   4980  N  N    . LYS A 1 54 ? 4.116   -14.464 -8.249  1.00 0.00 ? 54  LYS A N    4  
ATOM   4981  C  CA   . LYS A 1 54 ? 3.724   -13.640 -9.413  1.00 0.00 ? 54  LYS A CA   4  
ATOM   4982  C  C    . LYS A 1 54 ? 2.227   -13.798 -9.730  1.00 0.00 ? 54  LYS A C    4  
ATOM   4983  O  O    . LYS A 1 54 ? 1.581   -12.837 -10.148 1.00 0.00 ? 54  LYS A O    4  
ATOM   4984  C  CB   . LYS A 1 54 ? 4.586   -13.988 -10.656 1.00 0.00 ? 54  LYS A CB   4  
ATOM   4985  C  CG   . LYS A 1 54 ? 4.505   -15.468 -11.120 1.00 0.00 ? 54  LYS A CG   4  
ATOM   4986  C  CD   . LYS A 1 54 ? 5.241   -15.717 -12.455 1.00 0.00 ? 54  LYS A CD   4  
ATOM   4987  C  CE   . LYS A 1 54 ? 4.601   -14.949 -13.623 1.00 0.00 ? 54  LYS A CE   4  
ATOM   4988  N  NZ   . LYS A 1 54 ? 5.393   -15.082 -14.866 1.00 0.00 ? 54  LYS A NZ   4  
ATOM   4989  H  H    . LYS A 1 54 ? 4.829   -15.119 -8.358  1.00 0.00 ? 54  LYS A H    4  
ATOM   4990  H  HA   . LYS A 1 54 ? 3.908   -12.602 -9.144  1.00 0.00 ? 54  LYS A HA   4  
ATOM   4991  H  HB2  . LYS A 1 54 ? 4.283   -13.350 -11.479 1.00 0.00 ? 54  LYS A HB2  4  
ATOM   4992  H  HB3  . LYS A 1 54 ? 5.624   -13.769 -10.419 1.00 0.00 ? 54  LYS A HB3  4  
ATOM   4993  H  HG2  . LYS A 1 54 ? 4.952   -16.099 -10.358 1.00 0.00 ? 54  LYS A HG2  4  
ATOM   4994  H  HG3  . LYS A 1 54 ? 3.460   -15.747 -11.237 1.00 0.00 ? 54  LYS A HG3  4  
ATOM   4995  H  HD2  . LYS A 1 54 ? 6.278   -15.407 -12.355 1.00 0.00 ? 54  LYS A HD2  4  
ATOM   4996  H  HD3  . LYS A 1 54 ? 5.216   -16.780 -12.680 1.00 0.00 ? 54  LYS A HD3  4  
ATOM   4997  H  HE2  . LYS A 1 54 ? 3.607   -15.339 -13.803 1.00 0.00 ? 54  LYS A HE2  4  
ATOM   4998  H  HE3  . LYS A 1 54 ? 4.533   -13.899 -13.371 1.00 0.00 ? 54  LYS A HE3  4  
ATOM   4999  H  HZ1  . LYS A 1 54 ? 4.918   -14.595 -15.650 1.00 0.00 ? 54  LYS A HZ1  4  
ATOM   5000  H  HZ2  . LYS A 1 54 ? 5.508   -16.085 -15.115 1.00 0.00 ? 54  LYS A HZ2  4  
ATOM   5001  H  HZ3  . LYS A 1 54 ? 6.336   -14.662 -14.732 1.00 0.00 ? 54  LYS A HZ3  4  
ATOM   5002  N  N    . ALA A 1 55 ? 1.709   -15.020 -9.492  1.00 0.00 ? 55  ALA A N    4  
ATOM   5003  C  CA   . ALA A 1 55 ? 0.286   -15.370 -9.664  1.00 0.00 ? 55  ALA A CA   4  
ATOM   5004  C  C    . ALA A 1 55 ? -0.648  -14.436 -8.873  1.00 0.00 ? 55  ALA A C    4  
ATOM   5005  O  O    . ALA A 1 55 ? -1.663  -13.988 -9.404  1.00 0.00 ? 55  ALA A O    4  
ATOM   5006  C  CB   . ALA A 1 55 ? 0.043   -16.836 -9.262  1.00 0.00 ? 55  ALA A CB   4  
ATOM   5007  H  H    . ALA A 1 55 ? 2.342   -15.720 -9.230  1.00 0.00 ? 55  ALA A H    4  
ATOM   5008  H  HA   . ALA A 1 55 ? 0.056   -15.274 -10.720 1.00 0.00 ? 55  ALA A HA   4  
ATOM   5009  H  HB1  . ALA A 1 55 ? -0.991  -17.102 -9.456  1.00 0.00 ? 55  ALA A HB1  4  
ATOM   5010  H  HB2  . ALA A 1 55 ? 0.252   -16.970 -8.208  1.00 0.00 ? 55  ALA A HB2  4  
ATOM   5011  H  HB3  . ALA A 1 55 ? 0.689   -17.487 -9.837  1.00 0.00 ? 55  ALA A HB3  4  
ATOM   5012  N  N    . SER A 1 56 ? -0.256  -14.133 -7.623  1.00 0.00 ? 56  SER A N    4  
ATOM   5013  C  CA   . SER A 1 56 ? -1.044  -13.294 -6.688  1.00 0.00 ? 56  SER A CA   4  
ATOM   5014  C  C    . SER A 1 56 ? -1.393  -11.906 -7.288  1.00 0.00 ? 56  SER A C    4  
ATOM   5015  O  O    . SER A 1 56 ? -2.568  -11.513 -7.319  1.00 0.00 ? 56  SER A O    4  
ATOM   5016  C  CB   . SER A 1 56 ? -0.277  -13.133 -5.362  1.00 0.00 ? 56  SER A CB   4  
ATOM   5017  O  OG   . SER A 1 56 ? -1.056  -12.467 -4.379  1.00 0.00 ? 56  SER A OG   4  
ATOM   5018  H  H    . SER A 1 56 ? 0.585   -14.530 -7.313  1.00 0.00 ? 56  SER A H    4  
ATOM   5019  H  HA   . SER A 1 56 ? -1.972  -13.823 -6.485  1.00 0.00 ? 56  SER A HA   4  
ATOM   5020  H  HB2  . SER A 1 56 ? -0.008  -14.108 -4.979  1.00 0.00 ? 56  SER A HB2  4  
ATOM   5021  H  HB3  . SER A 1 56 ? 0.625   -12.558 -5.534  1.00 0.00 ? 56  SER A HB3  4  
ATOM   5022  H  HG   . SER A 1 56 ? -0.908  -11.515 -4.443  1.00 0.00 ? 56  SER A HG   4  
ATOM   5023  N  N    . LEU A 1 57 ? -0.369  -11.169 -7.756  1.00 0.00 ? 57  LEU A N    4  
ATOM   5024  C  CA   . LEU A 1 57 ? -0.553  -9.865  -8.416  1.00 0.00 ? 57  LEU A CA   4  
ATOM   5025  C  C    . LEU A 1 57 ? -1.077  -10.029 -9.866  1.00 0.00 ? 57  LEU A C    4  
ATOM   5026  O  O    . LEU A 1 57 ? -1.719  -9.117  -10.391 1.00 0.00 ? 57  LEU A O    4  
ATOM   5027  C  CB   . LEU A 1 57 ? 0.720   -8.955  -8.351  1.00 0.00 ? 57  LEU A CB   4  
ATOM   5028  C  CG   . LEU A 1 57 ? 2.067   -9.513  -8.933  1.00 0.00 ? 57  LEU A CG   4  
ATOM   5029  C  CD1  . LEU A 1 57 ? 3.002   -8.364  -9.372  1.00 0.00 ? 57  LEU A CD1  4  
ATOM   5030  C  CD2  . LEU A 1 57 ? 2.802   -10.416 -7.917  1.00 0.00 ? 57  LEU A CD2  4  
ATOM   5031  H  H    . LEU A 1 57 ? 0.523   -11.521 -7.673  1.00 0.00 ? 57  LEU A H    4  
ATOM   5032  H  HA   . LEU A 1 57 ? -1.340  -9.353  -7.861  1.00 0.00 ? 57  LEU A HA   4  
ATOM   5033  H  HB2  . LEU A 1 57 ? 0.489   -8.034  -8.875  1.00 0.00 ? 57  LEU A HB2  4  
ATOM   5034  H  HB3  . LEU A 1 57 ? 0.886   -8.693  -7.308  1.00 0.00 ? 57  LEU A HB3  4  
ATOM   5035  H  HG   . LEU A 1 57 ? 1.851   -10.112 -9.809  1.00 0.00 ? 57  LEU A HG   4  
ATOM   5036  H  HD11 . LEU A 1 57 ? 3.919   -8.773  -9.776  1.00 0.00 ? 57  LEU A HD11 4  
ATOM   5037  H  HD12 . LEU A 1 57 ? 3.236   -7.731  -8.525  1.00 0.00 ? 57  LEU A HD12 4  
ATOM   5038  H  HD13 . LEU A 1 57 ? 2.515   -7.772  -10.135 1.00 0.00 ? 57  LEU A HD13 4  
ATOM   5039  H  HD21 . LEU A 1 57 ? 2.197   -11.281 -7.688  1.00 0.00 ? 57  LEU A HD21 4  
ATOM   5040  H  HD22 . LEU A 1 57 ? 2.998   -9.866  -7.006  1.00 0.00 ? 57  LEU A HD22 4  
ATOM   5041  H  HD23 . LEU A 1 57 ? 3.740   -10.746 -8.343  1.00 0.00 ? 57  LEU A HD23 4  
ATOM   5042  N  N    . ASN A 1 58 ? -0.765  -11.174 -10.509 1.00 0.00 ? 58  ASN A N    4  
ATOM   5043  C  CA   . ASN A 1 58 ? -1.235  -11.507 -11.882 1.00 0.00 ? 58  ASN A CA   4  
ATOM   5044  C  C    . ASN A 1 58 ? -2.768  -11.445 -12.031 1.00 0.00 ? 58  ASN A C    4  
ATOM   5045  O  O    . ASN A 1 58 ? -3.271  -10.918 -13.029 1.00 0.00 ? 58  ASN A O    4  
ATOM   5046  C  CB   . ASN A 1 58 ? -0.724  -12.912 -12.303 1.00 0.00 ? 58  ASN A CB   4  
ATOM   5047  C  CG   . ASN A 1 58 ? -0.892  -13.236 -13.792 1.00 0.00 ? 58  ASN A CG   4  
ATOM   5048  O  OD1  . ASN A 1 58 ? -0.730  -12.372 -14.645 1.00 0.00 ? 58  ASN A OD1  4  
ATOM   5049  N  ND2  . ASN A 1 58 ? -1.219  -14.487 -14.113 1.00 0.00 ? 58  ASN A ND2  4  
ATOM   5050  H  H    . ASN A 1 58 ? -0.126  -11.784 -10.098 1.00 0.00 ? 58  ASN A H    4  
ATOM   5051  H  HA   . ASN A 1 58 ? -0.803  -10.774 -12.541 1.00 0.00 ? 58  ASN A HA   4  
ATOM   5052  H  HB2  . ASN A 1 58 ? 0.333   -12.977 -12.072 1.00 0.00 ? 58  ASN A HB2  4  
ATOM   5053  H  HB3  . ASN A 1 58 ? -1.245  -13.664 -11.722 1.00 0.00 ? 58  ASN A HB3  4  
ATOM   5054  H  HD21 . ASN A 1 58 ? -1.329  -15.138 -13.388 1.00 0.00 ? 58  ASN A HD21 4  
ATOM   5055  H  HD22 . ASN A 1 58 ? -1.343  -14.706 -15.062 1.00 0.00 ? 58  ASN A HD22 4  
ATOM   5056  N  N    . TRP A 1 59 ? -3.517  -12.006 -11.068 1.00 0.00 ? 59  TRP A N    4  
ATOM   5057  C  CA   . TRP A 1 59 ? -4.997  -11.941 -11.092 1.00 0.00 ? 59  TRP A CA   4  
ATOM   5058  C  C    . TRP A 1 59 ? -5.484  -10.596 -10.516 1.00 0.00 ? 59  TRP A C    4  
ATOM   5059  O  O    . TRP A 1 59 ? -6.485  -10.048 -10.961 1.00 0.00 ? 59  TRP A O    4  
ATOM   5060  C  CB   . TRP A 1 59 ? -5.660  -13.161 -10.380 1.00 0.00 ? 59  TRP A CB   4  
ATOM   5061  C  CG   . TRP A 1 59 ? -5.389  -13.296 -8.894  1.00 0.00 ? 59  TRP A CG   4  
ATOM   5062  C  CD1  . TRP A 1 59 ? -4.405  -14.027 -8.301  1.00 0.00 ? 59  TRP A CD1  4  
ATOM   5063  C  CD2  . TRP A 1 59 ? -6.137  -12.700 -7.819  1.00 0.00 ? 59  TRP A CD2  4  
ATOM   5064  N  NE1  . TRP A 1 59 ? -4.471  -13.899 -6.939  1.00 0.00 ? 59  TRP A NE1  4  
ATOM   5065  C  CE2  . TRP A 1 59 ? -5.526  -13.090 -6.618  1.00 0.00 ? 59  TRP A CE2  4  
ATOM   5066  C  CE3  . TRP A 1 59 ? -7.254  -11.862 -7.764  1.00 0.00 ? 59  TRP A CE3  4  
ATOM   5067  C  CZ2  . TRP A 1 59 ? -5.989  -12.677 -5.375  1.00 0.00 ? 59  TRP A CZ2  4  
ATOM   5068  C  CZ3  . TRP A 1 59 ? -7.717  -11.449 -6.531  1.00 0.00 ? 59  TRP A CZ3  4  
ATOM   5069  C  CH2  . TRP A 1 59 ? -7.085  -11.856 -5.349  1.00 0.00 ? 59  TRP A CH2  4  
ATOM   5070  H  H    . TRP A 1 59 ? -3.083  -12.390 -10.284 1.00 0.00 ? 59  TRP A H    4  
ATOM   5071  H  HA   . TRP A 1 59 ? -5.296  -11.965 -12.139 1.00 0.00 ? 59  TRP A HA   4  
ATOM   5072  H  HB2  . TRP A 1 59 ? -6.732  -13.104 -10.511 1.00 0.00 ? 59  TRP A HB2  4  
ATOM   5073  H  HB3  . TRP A 1 59 ? -5.310  -14.070 -10.860 1.00 0.00 ? 59  TRP A HB3  4  
ATOM   5074  H  HD1  . TRP A 1 59 ? -3.667  -14.606 -8.838  1.00 0.00 ? 59  TRP A HD1  4  
ATOM   5075  H  HE1  . TRP A 1 59 ? -3.859  -14.319 -6.297  1.00 0.00 ? 59  TRP A HE1  4  
ATOM   5076  H  HE3  . TRP A 1 59 ? -7.753  -11.541 -8.675  1.00 0.00 ? 59  TRP A HE3  4  
ATOM   5077  H  HZ2  . TRP A 1 59 ? -5.508  -12.983 -4.458  1.00 0.00 ? 59  TRP A HZ2  4  
ATOM   5078  H  HZ3  . TRP A 1 59 ? -8.582  -10.798 -6.469  1.00 0.00 ? 59  TRP A HZ3  4  
ATOM   5079  H  HH2  . TRP A 1 59 ? -7.480  -11.509 -4.406  1.00 0.00 ? 59  TRP A HH2  4  
ATOM   5080  N  N    . HIS A 1 60 ? -4.818  -10.133 -9.444  1.00 0.00 ? 60  HIS A N    4  
ATOM   5081  C  CA   . HIS A 1 60 ? -5.030  -8.786  -8.870  1.00 0.00 ? 60  HIS A CA   4  
ATOM   5082  C  C    . HIS A 1 60 ? -5.029  -7.611  -9.908  1.00 0.00 ? 60  HIS A C    4  
ATOM   5083  O  O    . HIS A 1 60 ? -5.775  -6.640  -9.717  1.00 0.00 ? 60  HIS A O    4  
ATOM   5084  C  CB   . HIS A 1 60 ? -3.990  -8.581  -7.740  1.00 0.00 ? 60  HIS A CB   4  
ATOM   5085  C  CG   . HIS A 1 60 ? -3.898  -7.198  -7.190  1.00 0.00 ? 60  HIS A CG   4  
ATOM   5086  N  ND1  . HIS A 1 60 ? -4.802  -6.617  -6.341  1.00 0.00 ? 60  HIS A ND1  4  
ATOM   5087  C  CD2  . HIS A 1 60 ? -2.982  -6.265  -7.448  1.00 0.00 ? 60  HIS A CD2  4  
ATOM   5088  C  CE1  . HIS A 1 60 ? -4.406  -5.360  -6.135  1.00 0.00 ? 60  HIS A CE1  4  
ATOM   5089  N  NE2  . HIS A 1 60 ? -3.301  -5.089  -6.799  1.00 0.00 ? 60  HIS A NE2  4  
ATOM   5090  H  H    . HIS A 1 60 ? -4.324  -10.774 -8.889  1.00 0.00 ? 60  HIS A H    4  
ATOM   5091  H  HA   . HIS A 1 60 ? -6.013  -8.807  -8.409  1.00 0.00 ? 60  HIS A HA   4  
ATOM   5092  H  HB2  . HIS A 1 60 ? -4.218  -9.232  -6.918  1.00 0.00 ? 60  HIS A HB2  4  
ATOM   5093  H  HB3  . HIS A 1 60 ? -3.011  -8.845  -8.121  1.00 0.00 ? 60  HIS A HB3  4  
ATOM   5094  H  HD1  . HIS A 1 60 ? -5.600  -7.040  -5.957  1.00 0.00 ? 60  HIS A HD1  4  
ATOM   5095  H  HD2  . HIS A 1 60 ? -2.102  -6.418  -8.049  1.00 0.00 ? 60  HIS A HD2  4  
ATOM   5096  H  HE1  . HIS A 1 60 ? -4.911  -4.659  -5.489  1.00 0.00 ? 60  HIS A HE1  4  
ATOM   5097  N  N    . MET A 1 61 ? -4.204  -7.676  -10.975 1.00 0.00 ? 61  MET A N    4  
ATOM   5098  C  CA   . MET A 1 61 ? -4.244  -6.644  -12.051 1.00 0.00 ? 61  MET A CA   4  
ATOM   5099  C  C    . MET A 1 61 ? -5.544  -6.758  -12.882 1.00 0.00 ? 61  MET A C    4  
ATOM   5100  O  O    . MET A 1 61 ? -6.122  -5.746  -13.281 1.00 0.00 ? 61  MET A O    4  
ATOM   5101  C  CB   . MET A 1 61 ? -2.988  -6.708  -12.960 1.00 0.00 ? 61  MET A CB   4  
ATOM   5102  C  CG   . MET A 1 61 ? -2.894  -7.913  -13.893 1.00 0.00 ? 61  MET A CG   4  
ATOM   5103  S  SD   . MET A 1 61 ? -1.357  -7.937  -14.836 1.00 0.00 ? 61  MET A SD   4  
ATOM   5104  C  CE   . MET A 1 61 ? -0.138  -8.233  -13.553 1.00 0.00 ? 61  MET A CE   4  
ATOM   5105  H  H    . MET A 1 61 ? -3.529  -8.384  -11.011 1.00 0.00 ? 61  MET A H    4  
ATOM   5106  H  HA   . MET A 1 61 ? -4.251  -5.674  -11.556 1.00 0.00 ? 61  MET A HA   4  
ATOM   5107  H  HB2  . MET A 1 61 ? -2.953  -5.812  -13.571 1.00 0.00 ? 61  MET A HB2  4  
ATOM   5108  H  HB3  . MET A 1 61 ? -2.111  -6.713  -12.321 1.00 0.00 ? 61  MET A HB3  4  
ATOM   5109  H  HG2  . MET A 1 61 ? -2.956  -8.819  -13.305 1.00 0.00 ? 61  MET A HG2  4  
ATOM   5110  H  HG3  . MET A 1 61 ? -3.725  -7.888  -14.590 1.00 0.00 ? 61  MET A HG3  4  
ATOM   5111  H  HE1  . MET A 1 61 ? 0.849   -8.275  -13.993 1.00 0.00 ? 61  MET A HE1  4  
ATOM   5112  H  HE2  . MET A 1 61 ? -0.350  -9.172  -13.067 1.00 0.00 ? 61  MET A HE2  4  
ATOM   5113  H  HE3  . MET A 1 61 ? -0.174  -7.434  -12.826 1.00 0.00 ? 61  MET A HE3  4  
ATOM   5114  N  N    . LYS A 1 62 ? -5.993  -8.006  -13.121 1.00 0.00 ? 62  LYS A N    4  
ATOM   5115  C  CA   . LYS A 1 62 ? -7.301  -8.307  -13.749 1.00 0.00 ? 62  LYS A CA   4  
ATOM   5116  C  C    . LYS A 1 62 ? -8.449  -7.671  -12.946 1.00 0.00 ? 62  LYS A C    4  
ATOM   5117  O  O    . LYS A 1 62 ? -9.430  -7.201  -13.519 1.00 0.00 ? 62  LYS A O    4  
ATOM   5118  C  CB   . LYS A 1 62 ? -7.500  -9.842  -13.809 1.00 0.00 ? 62  LYS A CB   4  
ATOM   5119  C  CG   . LYS A 1 62 ? -8.831  -10.335 -14.409 1.00 0.00 ? 62  LYS A CG   4  
ATOM   5120  C  CD   . LYS A 1 62 ? -9.074  -11.848 -14.150 1.00 0.00 ? 62  LYS A CD   4  
ATOM   5121  C  CE   . LYS A 1 62 ? -7.900  -12.737 -14.601 1.00 0.00 ? 62  LYS A CE   4  
ATOM   5122  N  NZ   . LYS A 1 62 ? -7.594  -12.562 -16.045 1.00 0.00 ? 62  LYS A NZ   4  
ATOM   5123  H  H    . LYS A 1 62 ? -5.398  -8.746  -12.894 1.00 0.00 ? 62  LYS A H    4  
ATOM   5124  H  HA   . LYS A 1 62 ? -7.292  -7.899  -14.752 1.00 0.00 ? 62  LYS A HA   4  
ATOM   5125  H  HB2  . LYS A 1 62 ? -6.693  -10.269 -14.391 1.00 0.00 ? 62  LYS A HB2  4  
ATOM   5126  H  HB3  . LYS A 1 62 ? -7.425  -10.233 -12.801 1.00 0.00 ? 62  LYS A HB3  4  
ATOM   5127  H  HG2  . LYS A 1 62 ? -9.649  -9.769  -13.970 1.00 0.00 ? 62  LYS A HG2  4  
ATOM   5128  H  HG3  . LYS A 1 62 ? -8.817  -10.155 -15.482 1.00 0.00 ? 62  LYS A HG3  4  
ATOM   5129  H  HD2  . LYS A 1 62 ? -9.229  -12.000 -13.085 1.00 0.00 ? 62  LYS A HD2  4  
ATOM   5130  H  HD3  . LYS A 1 62 ? -9.970  -12.153 -14.679 1.00 0.00 ? 62  LYS A HD3  4  
ATOM   5131  H  HE2  . LYS A 1 62 ? -7.017  -12.491 -14.019 1.00 0.00 ? 62  LYS A HE2  4  
ATOM   5132  H  HE3  . LYS A 1 62 ? -8.160  -13.772 -14.424 1.00 0.00 ? 62  LYS A HE3  4  
ATOM   5133  H  HZ1  . LYS A 1 62 ? -6.794  -13.166 -16.322 1.00 0.00 ? 62  LYS A HZ1  4  
ATOM   5134  H  HZ2  . LYS A 1 62 ? -7.351  -11.574 -16.244 1.00 0.00 ? 62  LYS A HZ2  4  
ATOM   5135  H  HZ3  . LYS A 1 62 ? -8.424  -12.825 -16.617 1.00 0.00 ? 62  LYS A HZ3  4  
ATOM   5136  N  N    . LYS A 1 63 ? -8.292  -7.680  -11.613 1.00 0.00 ? 63  LYS A N    4  
ATOM   5137  C  CA   . LYS A 1 63 ? -9.243  -7.051  -10.684 1.00 0.00 ? 63  LYS A CA   4  
ATOM   5138  C  C    . LYS A 1 63 ? -9.354  -5.535  -10.925 1.00 0.00 ? 63  LYS A C    4  
ATOM   5139  O  O    . LYS A 1 63 ? -10.425 -4.972  -10.746 1.00 0.00 ? 63  LYS A O    4  
ATOM   5140  C  CB   . LYS A 1 63 ? -8.883  -7.330  -9.209  1.00 0.00 ? 63  LYS A CB   4  
ATOM   5141  C  CG   . LYS A 1 63 ? -8.840  -8.819  -8.821  1.00 0.00 ? 63  LYS A CG   4  
ATOM   5142  C  CD   . LYS A 1 63 ? -10.144 -9.599  -9.138  1.00 0.00 ? 63  LYS A CD   4  
ATOM   5143  C  CE   . LYS A 1 63 ? -11.404 -8.995  -8.490  1.00 0.00 ? 63  LYS A CE   4  
ATOM   5144  N  NZ   . LYS A 1 63 ? -11.280 -8.854  -7.017  1.00 0.00 ? 63  LYS A NZ   4  
ATOM   5145  H  H    . LYS A 1 63 ? -7.514  -8.169  -11.271 1.00 0.00 ? 63  LYS A H    4  
ATOM   5146  H  HA   . LYS A 1 63 ? -10.216 -7.496  -10.886 1.00 0.00 ? 63  LYS A HA   4  
ATOM   5147  H  HB2  . LYS A 1 63 ? -7.905  -6.902  -9.001  1.00 0.00 ? 63  LYS A HB2  4  
ATOM   5148  H  HB3  . LYS A 1 63 ? -9.613  -6.838  -8.574  1.00 0.00 ? 63  LYS A HB3  4  
ATOM   5149  H  HG2  . LYS A 1 63 ? -8.022  -9.291  -9.359  1.00 0.00 ? 63  LYS A HG2  4  
ATOM   5150  H  HG3  . LYS A 1 63 ? -8.639  -8.890  -7.757  1.00 0.00 ? 63  LYS A HG3  4  
ATOM   5151  H  HD2  . LYS A 1 63 ? -10.285 -9.622  -10.214 1.00 0.00 ? 63  LYS A HD2  4  
ATOM   5152  H  HD3  . LYS A 1 63 ? -10.025 -10.618 -8.783  1.00 0.00 ? 63  LYS A HD3  4  
ATOM   5153  H  HE2  . LYS A 1 63 ? -11.594 -8.018  -8.919  1.00 0.00 ? 63  LYS A HE2  4  
ATOM   5154  H  HE3  . LYS A 1 63 ? -12.247 -9.641  -8.704  1.00 0.00 ? 63  LYS A HE3  4  
ATOM   5155  H  HZ1  . LYS A 1 63 ? -12.161 -8.466  -6.625  1.00 0.00 ? 63  LYS A HZ1  4  
ATOM   5156  H  HZ2  . LYS A 1 63 ? -10.502 -8.204  -6.781  1.00 0.00 ? 63  LYS A HZ2  4  
ATOM   5157  H  HZ3  . LYS A 1 63 ? -11.092 -9.775  -6.578  1.00 0.00 ? 63  LYS A HZ3  4  
ATOM   5158  N  N    . HIS A 1 64 ? -8.249  -4.898  -11.375 1.00 0.00 ? 64  HIS A N    4  
ATOM   5159  C  CA   . HIS A 1 64 ? -8.225  -3.450  -11.725 1.00 0.00 ? 64  HIS A CA   4  
ATOM   5160  C  C    . HIS A 1 64 ? -8.951  -3.173  -13.058 1.00 0.00 ? 64  HIS A C    4  
ATOM   5161  O  O    . HIS A 1 64 ? -9.206  -2.015  -13.398 1.00 0.00 ? 64  HIS A O    4  
ATOM   5162  C  CB   . HIS A 1 64 ? -6.768  -2.915  -11.843 1.00 0.00 ? 64  HIS A CB   4  
ATOM   5163  C  CG   . HIS A 1 64 ? -6.018  -2.716  -10.559 1.00 0.00 ? 64  HIS A CG   4  
ATOM   5164  N  ND1  . HIS A 1 64 ? -6.191  -1.616  -9.746  1.00 0.00 ? 64  HIS A ND1  4  
ATOM   5165  C  CD2  . HIS A 1 64 ? -4.977  -3.407  -10.032 1.00 0.00 ? 64  HIS A CD2  4  
ATOM   5166  C  CE1  . HIS A 1 64 ? -5.262  -1.657  -8.794  1.00 0.00 ? 64  HIS A CE1  4  
ATOM   5167  N  NE2  . HIS A 1 64 ? -4.499  -2.716  -8.926  1.00 0.00 ? 64  HIS A NE2  4  
ATOM   5168  H  H    . HIS A 1 64 ? -7.434  -5.423  -11.522 1.00 0.00 ? 64  HIS A H    4  
ATOM   5169  H  HA   . HIS A 1 64 ? -8.749  -2.912  -10.938 1.00 0.00 ? 64  HIS A HA   4  
ATOM   5170  H  HB2  . HIS A 1 64 ? -6.191  -3.604  -12.449 1.00 0.00 ? 64  HIS A HB2  4  
ATOM   5171  H  HB3  . HIS A 1 64 ? -6.786  -1.953  -12.355 1.00 0.00 ? 64  HIS A HB3  4  
ATOM   5172  H  HD1  . HIS A 1 64 ? -6.880  -0.924  -9.852  1.00 0.00 ? 64  HIS A HD1  4  
ATOM   5173  H  HD2  . HIS A 1 64 ? -4.583  -4.349  -10.401 1.00 0.00 ? 64  HIS A HD2  4  
ATOM   5174  H  HE1  . HIS A 1 64 ? -5.144  -0.913  -8.023  1.00 0.00 ? 64  HIS A HE1  4  
ATOM   5175  N  N    . ASP A 1 65 ? -9.234  -4.235  -13.814 1.00 0.00 ? 65  ASP A N    4  
ATOM   5176  C  CA   . ASP A 1 65 ? -9.981  -4.154  -15.079 1.00 0.00 ? 65  ASP A CA   4  
ATOM   5177  C  C    . ASP A 1 65 ? -11.423 -4.648  -14.844 1.00 0.00 ? 65  ASP A C    4  
ATOM   5178  O  O    . ASP A 1 65 ? -12.329 -4.345  -15.623 1.00 0.00 ? 65  ASP A O    4  
ATOM   5179  C  CB   . ASP A 1 65 ? -9.269  -5.004  -16.160 1.00 0.00 ? 65  ASP A CB   4  
ATOM   5180  C  CG   . ASP A 1 65 ? -10.009 -5.035  -17.512 1.00 0.00 ? 65  ASP A CG   4  
ATOM   5181  O  OD1  . ASP A 1 65 ? -9.990  -4.018  -18.235 1.00 0.00 ? 65  ASP A OD1  4  
ATOM   5182  O  OD2  . ASP A 1 65 ? -10.628 -6.068  -17.852 1.00 0.00 ? 65  ASP A OD2  4  
ATOM   5183  H  H    . ASP A 1 65 ? -9.028  -5.123  -13.465 1.00 0.00 ? 65  ASP A H    4  
ATOM   5184  H  HA   . ASP A 1 65 ? -10.013 -3.115  -15.402 1.00 0.00 ? 65  ASP A HA   4  
ATOM   5185  H  HB2  . ASP A 1 65 ? -8.275  -4.599  -16.328 1.00 0.00 ? 65  ASP A HB2  4  
ATOM   5186  H  HB3  . ASP A 1 65 ? -9.164  -6.019  -15.789 1.00 0.00 ? 65  ASP A HB3  4  
ATOM   5187  N  N    . ALA A 1 66 ? -11.622 -5.384  -13.725 1.00 0.00 ? 66  ALA A N    4  
ATOM   5188  C  CA   . ALA A 1 66 ? -12.881 -6.092  -13.414 1.00 0.00 ? 66  ALA A CA   4  
ATOM   5189  C  C    . ALA A 1 66 ? -13.771 -5.250  -12.489 1.00 0.00 ? 66  ALA A C    4  
ATOM   5190  O  O    . ALA A 1 66 ? -15.001 -5.346  -12.541 1.00 0.00 ? 66  ALA A O    4  
ATOM   5191  C  CB   . ALA A 1 66 ? -12.587 -7.462  -12.768 1.00 0.00 ? 66  ALA A CB   4  
ATOM   5192  H  H    . ALA A 1 66 ? -10.913 -5.398  -13.052 1.00 0.00 ? 66  ALA A H    4  
ATOM   5193  H  HA   . ALA A 1 66 ? -13.415 -6.270  -14.345 1.00 0.00 ? 66  ALA A HA   4  
ATOM   5194  H  HB1  . ALA A 1 66 ? -11.958 -8.050  -13.427 1.00 0.00 ? 66  ALA A HB1  4  
ATOM   5195  H  HB2  . ALA A 1 66 ? -13.512 -7.996  -12.592 1.00 0.00 ? 66  ALA A HB2  4  
ATOM   5196  H  HB3  . ALA A 1 66 ? -12.071 -7.319  -11.826 1.00 0.00 ? 66  ALA A HB3  4  
ATOM   5197  N  N    . ASP A 1 67 ? -13.144 -4.404  -11.649 1.00 0.00 ? 67  ASP A N    4  
ATOM   5198  C  CA   . ASP A 1 67 ? -13.866 -3.621  -10.626 1.00 0.00 ? 67  ASP A CA   4  
ATOM   5199  C  C    . ASP A 1 67 ? -14.469 -2.332  -11.230 1.00 0.00 ? 67  ASP A C    4  
ATOM   5200  O  O    . ASP A 1 67 ? -15.212 -1.609  -10.552 1.00 0.00 ? 67  ASP A O    4  
ATOM   5201  C  CB   . ASP A 1 67 ? -12.915 -3.290  -9.443  1.00 0.00 ? 67  ASP A CB   4  
ATOM   5202  C  CG   . ASP A 1 67 ? -11.926 -2.140  -9.721  1.00 0.00 ? 67  ASP A CG   4  
ATOM   5203  O  OD1  . ASP A 1 67 ? -11.200 -2.184  -10.731 1.00 0.00 ? 67  ASP A OD1  4  
ATOM   5204  O  OD2  . ASP A 1 67 ? -11.854 -1.194  -8.909  1.00 0.00 ? 67  ASP A OD2  4  
ATOM   5205  H  H    . ASP A 1 67 ? -12.162 -4.277  -11.728 1.00 0.00 ? 67  ASP A H    4  
ATOM   5206  H  HA   . ASP A 1 67 ? -14.680 -4.231  -10.250 1.00 0.00 ? 67  ASP A HA   4  
ATOM   5207  H  HB2  . ASP A 1 67 ? -13.512 -3.032  -8.572  1.00 0.00 ? 67  ASP A HB2  4  
ATOM   5208  H  HB3  . ASP A 1 67 ? -12.338 -4.176  -9.202  1.00 0.00 ? 67  ASP A HB3  4  
ATOM   5209  N  N    . SER A 1 68 ? -14.156 -2.075  -12.519 1.00 0.00 ? 68  SER A N    4  
ATOM   5210  C  CA   . SER A 1 68 ? -14.520 -0.840  -13.218 1.00 0.00 ? 68  SER A CA   4  
ATOM   5211  C  C    . SER A 1 68 ? -15.984 -0.907  -13.698 1.00 0.00 ? 68  SER A C    4  
ATOM   5212  O  O    . SER A 1 68 ? -16.807 -0.093  -13.284 1.00 0.00 ? 68  SER A O    4  
ATOM   5213  C  CB   . SER A 1 68 ? -13.537 -0.597  -14.390 1.00 0.00 ? 68  SER A CB   4  
ATOM   5214  O  OG   . SER A 1 68 ? -13.449 -1.731  -15.240 1.00 0.00 ? 68  SER A OG   4  
ATOM   5215  H  H    . SER A 1 68 ? -13.713 -2.767  -13.041 1.00 0.00 ? 68  SER A H    4  
ATOM   5216  H  HA   . SER A 1 68 ? -14.425 -0.015  -12.516 1.00 0.00 ? 68  SER A HA   4  
ATOM   5217  H  HB2  . SER A 1 68 ? -13.868 0.249   -14.980 1.00 0.00 ? 68  SER A HB2  4  
ATOM   5218  H  HB3  . SER A 1 68 ? -12.551 -0.388  -13.996 1.00 0.00 ? 68  SER A HB3  4  
ATOM   5219  H  HG   . SER A 1 68 ? -12.526 -1.901  -15.452 1.00 0.00 ? 68  SER A HG   4  
ATOM   5220  N  N    . PHE A 1 69 ? -16.298 -1.874  -14.582 1.00 0.00 ? 69  PHE A N    4  
ATOM   5221  C  CA   . PHE A 1 69 ? -17.679 -2.086  -15.099 1.00 0.00 ? 69  PHE A CA   4  
ATOM   5222  C  C    . PHE A 1 69 ? -18.145 -3.535  -14.876 1.00 0.00 ? 69  PHE A C    4  
ATOM   5223  O  O    . PHE A 1 69 ? -19.334 -3.776  -14.626 1.00 0.00 ? 69  PHE A O    4  
ATOM   5224  C  CB   . PHE A 1 69 ? -17.755 -1.739  -16.620 1.00 0.00 ? 69  PHE A CB   4  
ATOM   5225  C  CG   . PHE A 1 69 ? -17.386 -0.294  -16.970 1.00 0.00 ? 69  PHE A CG   4  
ATOM   5226  C  CD1  . PHE A 1 69 ? -16.068 0.059   -17.252 1.00 0.00 ? 69  PHE A CD1  4  
ATOM   5227  C  CD2  . PHE A 1 69 ? -18.353 0.712   -17.004 1.00 0.00 ? 69  PHE A CD2  4  
ATOM   5228  C  CE1  . PHE A 1 69 ? -15.730 1.363   -17.558 1.00 0.00 ? 69  PHE A CE1  4  
ATOM   5229  C  CE2  . PHE A 1 69 ? -18.014 2.014   -17.312 1.00 0.00 ? 69  PHE A CE2  4  
ATOM   5230  C  CZ   . PHE A 1 69 ? -16.703 2.342   -17.586 1.00 0.00 ? 69  PHE A CZ   4  
ATOM   5231  H  H    . PHE A 1 69 ? -15.581 -2.435  -14.940 1.00 0.00 ? 69  PHE A H    4  
ATOM   5232  H  HA   . PHE A 1 69 ? -18.352 -1.426  -14.558 1.00 0.00 ? 69  PHE A HA   4  
ATOM   5233  H  HB2  . PHE A 1 69 ? -17.085 -2.395  -17.167 1.00 0.00 ? 69  PHE A HB2  4  
ATOM   5234  H  HB3  . PHE A 1 69 ? -18.766 -1.915  -16.971 1.00 0.00 ? 69  PHE A HB3  4  
ATOM   5235  H  HD1  . PHE A 1 69 ? -15.300 -0.703  -17.232 1.00 0.00 ? 69  PHE A HD1  4  
ATOM   5236  H  HD2  . PHE A 1 69 ? -19.385 0.465   -16.793 1.00 0.00 ? 69  PHE A HD2  4  
ATOM   5237  H  HE1  . PHE A 1 69 ? -14.700 1.618   -17.776 1.00 0.00 ? 69  PHE A HE1  4  
ATOM   5238  H  HE2  . PHE A 1 69 ? -18.778 2.781   -17.334 1.00 0.00 ? 69  PHE A HE2  4  
ATOM   5239  H  HZ   . PHE A 1 69 ? -16.440 3.366   -17.824 1.00 0.00 ? 69  PHE A HZ   4  
ATOM   5240  N  N    . TYR A 1 70 ? -17.190 -4.482  -14.945 1.00 0.00 ? 70  TYR A N    4  
ATOM   5241  C  CA   . TYR A 1 70 ? -17.460 -5.938  -14.987 1.00 0.00 ? 70  TYR A CA   4  
ATOM   5242  C  C    . TYR A 1 70 ? -18.232 -6.433  -13.739 1.00 0.00 ? 70  TYR A C    4  
ATOM   5243  O  O    . TYR A 1 70 ? -19.030 -7.374  -13.836 1.00 0.00 ? 70  TYR A O    4  
ATOM   5244  C  CB   . TYR A 1 70 ? -16.115 -6.693  -15.166 1.00 0.00 ? 70  TYR A CB   4  
ATOM   5245  C  CG   . TYR A 1 70 ? -16.222 -8.211  -15.386 1.00 0.00 ? 70  TYR A CG   4  
ATOM   5246  C  CD1  . TYR A 1 70 ? -16.666 -8.726  -16.601 1.00 0.00 ? 70  TYR A CD1  4  
ATOM   5247  C  CD2  . TYR A 1 70 ? -15.874 -9.122  -14.385 1.00 0.00 ? 70  TYR A CD2  4  
ATOM   5248  C  CE1  . TYR A 1 70 ? -16.762 -10.088 -16.809 1.00 0.00 ? 70  TYR A CE1  4  
ATOM   5249  C  CE2  . TYR A 1 70 ? -15.971 -10.482 -14.589 1.00 0.00 ? 70  TYR A CE2  4  
ATOM   5250  C  CZ   . TYR A 1 70 ? -16.415 -10.959 -15.803 1.00 0.00 ? 70  TYR A CZ   4  
ATOM   5251  O  OH   . TYR A 1 70 ? -16.513 -12.317 -16.013 1.00 0.00 ? 70  TYR A OH   4  
ATOM   5252  H  H    . TYR A 1 70 ? -16.257 -4.190  -14.975 1.00 0.00 ? 70  TYR A H    4  
ATOM   5253  H  HA   . TYR A 1 70 ? -18.074 -6.122  -15.864 1.00 0.00 ? 70  TYR A HA   4  
ATOM   5254  H  HB2  . TYR A 1 70 ? -15.595 -6.274  -16.022 1.00 0.00 ? 70  TYR A HB2  4  
ATOM   5255  H  HB3  . TYR A 1 70 ? -15.505 -6.519  -14.288 1.00 0.00 ? 70  TYR A HB3  4  
ATOM   5256  H  HD1  . TYR A 1 70 ? -16.943 -8.042  -17.396 1.00 0.00 ? 70  TYR A HD1  4  
ATOM   5257  H  HD2  . TYR A 1 70 ? -15.523 -8.744  -13.432 1.00 0.00 ? 70  TYR A HD2  4  
ATOM   5258  H  HE1  . TYR A 1 70 ? -17.113 -10.463 -17.760 1.00 0.00 ? 70  TYR A HE1  4  
ATOM   5259  H  HE2  . TYR A 1 70 ? -15.696 -11.168 -13.798 1.00 0.00 ? 70  TYR A HE2  4  
ATOM   5260  H  HH   . TYR A 1 70 ? -16.164 -12.532 -16.892 1.00 0.00 ? 70  TYR A HH   4  
ATOM   5261  N  N    . GLN A 1 71 ? -17.993 -5.791  -12.572 1.00 0.00 ? 71  GLN A N    4  
ATOM   5262  C  CA   . GLN A 1 71 ? -18.783 -6.057  -11.354 1.00 0.00 ? 71  GLN A CA   4  
ATOM   5263  C  C    . GLN A 1 71 ? -20.122 -5.296  -11.449 1.00 0.00 ? 71  GLN A C    4  
ATOM   5264  O  O    . GLN A 1 71 ? -21.136 -5.859  -11.863 1.00 0.00 ? 71  GLN A O    4  
ATOM   5265  C  CB   . GLN A 1 71 ? -18.015 -5.663  -10.051 1.00 0.00 ? 71  GLN A CB   4  
ATOM   5266  C  CG   . GLN A 1 71 ? -16.623 -6.301  -9.875  1.00 0.00 ? 71  GLN A CG   4  
ATOM   5267  C  CD   . GLN A 1 71 ? -16.572 -7.799  -10.177 1.00 0.00 ? 71  GLN A CD   4  
ATOM   5268  O  OE1  . GLN A 1 71 ? -16.802 -8.633  -9.303  1.00 0.00 ? 71  GLN A OE1  4  
ATOM   5269  N  NE2  . GLN A 1 71 ? -16.241 -8.152  -11.411 1.00 0.00 ? 71  GLN A NE2  4  
ATOM   5270  H  H    . GLN A 1 71 ? -17.276 -5.123  -12.538 1.00 0.00 ? 71  GLN A H    4  
ATOM   5271  H  HA   . GLN A 1 71 ? -18.996 -7.121  -11.318 1.00 0.00 ? 71  GLN A HA   4  
ATOM   5272  H  HB2  . GLN A 1 71 ? -17.889 -4.585  -10.038 1.00 0.00 ? 71  GLN A HB2  4  
ATOM   5273  H  HB3  . GLN A 1 71 ? -18.624 -5.942  -9.193  1.00 0.00 ? 71  GLN A HB3  4  
ATOM   5274  H  HG2  . GLN A 1 71 ? -15.919 -5.797  -10.524 1.00 0.00 ? 71  GLN A HG2  4  
ATOM   5275  H  HG3  . GLN A 1 71 ? -16.314 -6.152  -8.845  1.00 0.00 ? 71  GLN A HG3  4  
ATOM   5276  H  HE21 . GLN A 1 71 ? -16.045 -7.438  -12.056 1.00 0.00 ? 71  GLN A HE21 4  
ATOM   5277  H  HE22 . GLN A 1 71 ? -16.222 -9.107  -11.632 1.00 0.00 ? 71  GLN A HE22 4  
ATOM   5278  N  N    . PHE A 1 72 ? -20.092 -3.994  -11.111 1.00 0.00 ? 72  PHE A N    4  
ATOM   5279  C  CA   . PHE A 1 72 ? -21.247 -3.101  -11.093 1.00 0.00 ? 72  PHE A CA   4  
ATOM   5280  C  C    . PHE A 1 72 ? -20.685 -1.699  -11.288 1.00 0.00 ? 72  PHE A C    4  
ATOM   5281  O  O    . PHE A 1 72 ? -19.668 -1.350  -10.693 1.00 0.00 ? 72  PHE A O    4  
ATOM   5282  C  CB   . PHE A 1 72 ? -22.041 -3.132  -9.744  1.00 0.00 ? 72  PHE A CB   4  
ATOM   5283  C  CG   . PHE A 1 72 ? -22.560 -4.506  -9.320  1.00 0.00 ? 72  PHE A CG   4  
ATOM   5284  C  CD1  . PHE A 1 72 ? -23.766 -5.009  -9.807  1.00 0.00 ? 72  PHE A CD1  4  
ATOM   5285  C  CD2  . PHE A 1 72 ? -21.813 -5.311  -8.463  1.00 0.00 ? 72  PHE A CD2  4  
ATOM   5286  C  CE1  . PHE A 1 72 ? -24.204 -6.271  -9.444  1.00 0.00 ? 72  PHE A CE1  4  
ATOM   5287  C  CE2  . PHE A 1 72 ? -22.246 -6.568  -8.111  1.00 0.00 ? 72  PHE A CE2  4  
ATOM   5288  C  CZ   . PHE A 1 72 ? -23.443 -7.051  -8.598  1.00 0.00 ? 72  PHE A CZ   4  
ATOM   5289  H  H    . PHE A 1 72 ? -19.238 -3.583  -10.919 1.00 0.00 ? 72  PHE A H    4  
ATOM   5290  H  HA   . PHE A 1 72 ? -21.904 -3.360  -11.923 1.00 0.00 ? 72  PHE A HA   4  
ATOM   5291  H  HB2  . PHE A 1 72 ? -21.404 -2.757  -8.945  1.00 0.00 ? 72  PHE A HB2  4  
ATOM   5292  H  HB3  . PHE A 1 72 ? -22.898 -2.466  -9.828  1.00 0.00 ? 72  PHE A HB3  4  
ATOM   5293  H  HD1  . PHE A 1 72 ? -24.367 -4.401  -10.470 1.00 0.00 ? 72  PHE A HD1  4  
ATOM   5294  H  HD2  . PHE A 1 72 ? -20.874 -4.940  -8.071  1.00 0.00 ? 72  PHE A HD2  4  
ATOM   5295  H  HE1  . PHE A 1 72 ? -25.141 -6.647  -9.829  1.00 0.00 ? 72  PHE A HE1  4  
ATOM   5296  H  HE2  . PHE A 1 72 ? -21.639 -7.181  -7.450  1.00 0.00 ? 72  PHE A HE2  4  
ATOM   5297  H  HZ   . PHE A 1 72 ? -23.785 -8.044  -8.322  1.00 0.00 ? 72  PHE A HZ   4  
ATOM   5298  N  N    . SER A 1 73 ? -21.347 -0.919  -12.111 1.00 0.00 ? 73  SER A N    4  
ATOM   5299  C  CA   . SER A 1 73 ? -20.963 0.459   -12.385 1.00 0.00 ? 73  SER A CA   4  
ATOM   5300  C  C    . SER A 1 73 ? -22.141 1.263   -12.896 1.00 0.00 ? 73  SER A C    4  
ATOM   5301  O  O    . SER A 1 73 ? -23.184 0.718   -13.286 1.00 0.00 ? 73  SER A O    4  
ATOM   5302  C  CB   . SER A 1 73 ? -19.845 0.502   -13.438 1.00 0.00 ? 73  SER A CB   4  
ATOM   5303  O  OG   . SER A 1 73 ? -20.282 -0.043  -14.667 1.00 0.00 ? 73  SER A OG   4  
ATOM   5304  H  H    . SER A 1 73 ? -22.097 -1.299  -12.581 1.00 0.00 ? 73  SER A H    4  
ATOM   5305  H  HA   . SER A 1 73 ? -20.602 0.908   -11.459 1.00 0.00 ? 73  SER A HA   4  
ATOM   5306  H  HB2  . SER A 1 73 ? -19.530 1.528   -13.606 1.00 0.00 ? 73  SER A HB2  4  
ATOM   5307  H  HB3  . SER A 1 73 ? -18.999 -0.073  -13.087 1.00 0.00 ? 73  SER A HB3  4  
ATOM   5308  H  HG   . SER A 1 73 ? -20.338 -0.998  -14.593 1.00 0.00 ? 73  SER A HG   4  
ATOM   5309  N  N    . CYS A 1 74 ? -21.939 2.572   -12.884 1.00 0.00 ? 74  CYS A N    4  
ATOM   5310  C  CA   . CYS A 1 74 ? -22.715 3.495   -13.696 1.00 0.00 ? 74  CYS A CA   4  
ATOM   5311  C  C    . CYS A 1 74 ? -21.916 3.689   -14.978 1.00 0.00 ? 74  CYS A C    4  
ATOM   5312  O  O    . CYS A 1 74 ? -20.800 4.165   -14.910 1.00 0.00 ? 74  CYS A O    4  
ATOM   5313  C  CB   . CYS A 1 74 ? -22.919 4.826   -12.957 1.00 0.00 ? 74  CYS A CB   4  
ATOM   5314  S  SG   . CYS A 1 74 ? -23.626 6.153   -13.982 1.00 0.00 ? 74  CYS A SG   4  
ATOM   5315  H  H    . CYS A 1 74 ? -21.190 2.917   -12.356 1.00 0.00 ? 74  CYS A H    4  
ATOM   5316  H  HA   . CYS A 1 74 ? -23.681 3.050   -13.932 1.00 0.00 ? 74  CYS A HA   4  
ATOM   5317  H  HB2  . CYS A 1 74 ? -23.590 4.671   -12.121 1.00 0.00 ? 74  CYS A HB2  4  
ATOM   5318  H  HB3  . CYS A 1 74 ? -21.965 5.176   -12.582 1.00 0.00 ? 74  CYS A HB3  4  
ATOM   5319  N  N    . ASN A 1 75 ? -22.466 3.302   -16.133 1.00 0.00 ? 75  ASN A N    4  
ATOM   5320  C  CA   . ASN A 1 75 ? -21.720 3.339   -17.416 1.00 0.00 ? 75  ASN A CA   4  
ATOM   5321  C  C    . ASN A 1 75 ? -21.409 4.780   -17.871 1.00 0.00 ? 75  ASN A C    4  
ATOM   5322  O  O    . ASN A 1 75 ? -20.645 4.983   -18.816 1.00 0.00 ? 75  ASN A O    4  
ATOM   5323  C  CB   . ASN A 1 75 ? -22.507 2.592   -18.515 1.00 0.00 ? 75  ASN A CB   4  
ATOM   5324  C  CG   . ASN A 1 75 ? -22.777 1.143   -18.142 1.00 0.00 ? 75  ASN A CG   4  
ATOM   5325  O  OD1  . ASN A 1 75 ? -23.822 0.812   -17.579 1.00 0.00 ? 75  ASN A OD1  4  
ATOM   5326  N  ND2  . ASN A 1 75 ? -21.823 0.277   -18.411 1.00 0.00 ? 75  ASN A ND2  4  
ATOM   5327  H  H    . ASN A 1 75 ? -23.391 2.970   -16.136 1.00 0.00 ? 75  ASN A H    4  
ATOM   5328  H  HA   . ASN A 1 75 ? -20.774 2.823   -17.259 1.00 0.00 ? 75  ASN A HA   4  
ATOM   5329  H  HB2  . ASN A 1 75 ? -23.459 3.083   -18.690 1.00 0.00 ? 75  ASN A HB2  4  
ATOM   5330  H  HB3  . ASN A 1 75 ? -21.945 2.600   -19.443 1.00 0.00 ? 75  ASN A HB3  4  
ATOM   5331  H  HD21 . ASN A 1 75 ? -21.007 0.609   -18.840 1.00 0.00 ? 75  ASN A HD21 4  
ATOM   5332  H  HD22 . ASN A 1 75 ? -21.971 -0.657  -18.183 1.00 0.00 ? 75  ASN A HD22 4  
ATOM   5333  N  N    . ILE A 1 76 ? -22.004 5.775   -17.182 1.00 0.00 ? 76  ILE A N    4  
ATOM   5334  C  CA   . ILE A 1 76 ? -21.863 7.194   -17.535 1.00 0.00 ? 76  ILE A CA   4  
ATOM   5335  C  C    . ILE A 1 76 ? -20.764 7.890   -16.699 1.00 0.00 ? 76  ILE A C    4  
ATOM   5336  O  O    . ILE A 1 76 ? -20.051 8.740   -17.227 1.00 0.00 ? 76  ILE A O    4  
ATOM   5337  C  CB   . ILE A 1 76 ? -23.238 7.959   -17.377 1.00 0.00 ? 76  ILE A CB   4  
ATOM   5338  C  CG1  . ILE A 1 76 ? -24.419 7.045   -17.866 1.00 0.00 ? 76  ILE A CG1  4  
ATOM   5339  C  CG2  . ILE A 1 76 ? -23.225 9.324   -18.123 1.00 0.00 ? 76  ILE A CG2  4  
ATOM   5340  C  CD1  . ILE A 1 76 ? -25.764 7.713   -18.005 1.00 0.00 ? 76  ILE A CD1  4  
ATOM   5341  H  H    . ILE A 1 76 ? -22.588 5.546   -16.437 1.00 0.00 ? 76  ILE A H    4  
ATOM   5342  H  HA   . ILE A 1 76 ? -21.573 7.241   -18.579 1.00 0.00 ? 76  ILE A HA   4  
ATOM   5343  H  HB   . ILE A 1 76 ? -23.383 8.168   -16.319 1.00 0.00 ? 76  ILE A HB   4  
ATOM   5344  H  HG12 . ILE A 1 76 ? -24.177 6.617   -18.828 1.00 0.00 ? 76  ILE A HG12 4  
ATOM   5345  H  HG13 . ILE A 1 76 ? -24.545 6.239   -17.146 1.00 0.00 ? 76  ILE A HG13 4  
ATOM   5346  H  HG21 . ILE A 1 76 ? -24.157 9.845   -17.936 1.00 0.00 ? 76  ILE A HG21 4  
ATOM   5347  H  HG22 . ILE A 1 76 ? -23.113 9.165   -19.187 1.00 0.00 ? 76  ILE A HG22 4  
ATOM   5348  H  HG23 . ILE A 1 76 ? -22.404 9.931   -17.762 1.00 0.00 ? 76  ILE A HG23 4  
ATOM   5349  H  HD11 . ILE A 1 76 ? -25.699 8.532   -18.708 1.00 0.00 ? 76  ILE A HD11 4  
ATOM   5350  H  HD12 . ILE A 1 76 ? -26.087 8.086   -17.045 1.00 0.00 ? 76  ILE A HD12 4  
ATOM   5351  H  HD13 . ILE A 1 76 ? -26.484 6.993   -18.365 1.00 0.00 ? 76  ILE A HD13 4  
ATOM   5352  N  N    . CYS A 1 77 ? -20.617 7.545   -15.393 1.00 0.00 ? 77  CYS A N    4  
ATOM   5353  C  CA   . CYS A 1 77 ? -19.620 8.228   -14.517 1.00 0.00 ? 77  CYS A CA   4  
ATOM   5354  C  C    . CYS A 1 77 ? -18.884 7.264   -13.567 1.00 0.00 ? 77  CYS A C    4  
ATOM   5355  O  O    . CYS A 1 77 ? -18.151 7.717   -12.687 1.00 0.00 ? 77  CYS A O    4  
ATOM   5356  C  CB   . CYS A 1 77 ? -20.305 9.360   -13.721 1.00 0.00 ? 77  CYS A CB   4  
ATOM   5357  S  SG   . CYS A 1 77 ? -21.407 8.809   -12.378 1.00 0.00 ? 77  CYS A SG   4  
ATOM   5358  H  H    . CYS A 1 77 ? -21.190 6.844   -15.015 1.00 0.00 ? 77  CYS A H    4  
ATOM   5359  H  HA   . CYS A 1 77 ? -18.864 8.678   -15.155 1.00 0.00 ? 77  CYS A HA   4  
ATOM   5360  H  HB2  . CYS A 1 77 ? -19.545 9.980   -13.276 1.00 0.00 ? 77  CYS A HB2  4  
ATOM   5361  H  HB3  . CYS A 1 77 ? -20.898 9.968   -14.398 1.00 0.00 ? 77  CYS A HB3  4  
ATOM   5362  N  N    . GLY A 1 78 ? -19.083 5.949   -13.763 1.00 0.00 ? 78  GLY A N    4  
ATOM   5363  C  CA   . GLY A 1 78 ? -18.354 4.894   -13.045 1.00 0.00 ? 78  GLY A CA   4  
ATOM   5364  C  C    . GLY A 1 78 ? -18.405 4.999   -11.531 1.00 0.00 ? 78  GLY A C    4  
ATOM   5365  O  O    . GLY A 1 78 ? -17.373 4.880   -10.867 1.00 0.00 ? 78  GLY A O    4  
ATOM   5366  H  H    . GLY A 1 78 ? -19.727 5.682   -14.438 1.00 0.00 ? 78  GLY A H    4  
ATOM   5367  H  HA2  . GLY A 1 78 ? -18.783 3.948   -13.329 1.00 0.00 ? 78  GLY A HA2  4  
ATOM   5368  H  HA3  . GLY A 1 78 ? -17.323 4.909   -13.370 1.00 0.00 ? 78  GLY A HA3  4  
ATOM   5369  N  N    . LYS A 1 79 ? -19.598 5.307   -10.993 1.00 0.00 ? 79  LYS A N    4  
ATOM   5370  C  CA   . LYS A 1 79 ? -19.804 5.426   -9.546  1.00 0.00 ? 79  LYS A CA   4  
ATOM   5371  C  C    . LYS A 1 79 ? -19.643 4.080   -8.794  1.00 0.00 ? 79  LYS A C    4  
ATOM   5372  O  O    . LYS A 1 79 ? -19.074 4.080   -7.707  1.00 0.00 ? 79  LYS A O    4  
ATOM   5373  C  CB   . LYS A 1 79 ? -21.194 6.071   -9.298  1.00 0.00 ? 79  LYS A CB   4  
ATOM   5374  C  CG   . LYS A 1 79 ? -21.369 6.774   -7.927  1.00 0.00 ? 79  LYS A CG   4  
ATOM   5375  C  CD   . LYS A 1 79 ? -21.629 5.815   -6.736  1.00 0.00 ? 79  LYS A CD   4  
ATOM   5376  C  CE   . LYS A 1 79 ? -21.607 6.521   -5.370  1.00 0.00 ? 79  LYS A CE   4  
ATOM   5377  N  NZ   . LYS A 1 79 ? -20.253 7.026   -5.029  1.00 0.00 ? 79  LYS A NZ   4  
ATOM   5378  H  H    . LYS A 1 79 ? -20.324 5.595   -11.580 1.00 0.00 ? 79  LYS A H    4  
ATOM   5379  H  HA   . LYS A 1 79 ? -19.050 6.112   -9.169  1.00 0.00 ? 79  LYS A HA   4  
ATOM   5380  H  HB2  . LYS A 1 79 ? -21.366 6.817   -10.069 1.00 0.00 ? 79  LYS A HB2  4  
ATOM   5381  H  HB3  . LYS A 1 79 ? -21.956 5.307   -9.396  1.00 0.00 ? 79  LYS A HB3  4  
ATOM   5382  H  HG2  . LYS A 1 79 ? -20.473 7.344   -7.726  1.00 0.00 ? 79  LYS A HG2  4  
ATOM   5383  H  HG3  . LYS A 1 79 ? -22.200 7.458   -8.012  1.00 0.00 ? 79  LYS A HG3  4  
ATOM   5384  H  HD2  . LYS A 1 79 ? -22.600 5.355   -6.870  1.00 0.00 ? 79  LYS A HD2  4  
ATOM   5385  H  HD3  . LYS A 1 79 ? -20.875 5.038   -6.736  1.00 0.00 ? 79  LYS A HD3  4  
ATOM   5386  H  HE2  . LYS A 1 79 ? -22.297 7.353   -5.387  1.00 0.00 ? 79  LYS A HE2  4  
ATOM   5387  H  HE3  . LYS A 1 79 ? -21.917 5.818   -4.606  1.00 0.00 ? 79  LYS A HE3  4  
ATOM   5388  H  HZ1  . LYS A 1 79 ? -19.583 6.232   -4.945  1.00 0.00 ? 79  LYS A HZ1  4  
ATOM   5389  H  HZ2  . LYS A 1 79 ? -20.271 7.544   -4.126  1.00 0.00 ? 79  LYS A HZ2  4  
ATOM   5390  H  HZ3  . LYS A 1 79 ? -19.911 7.667   -5.773  1.00 0.00 ? 79  LYS A HZ3  4  
ATOM   5391  N  N    . LYS A 1 80 ? -20.136 2.959   -9.384  1.00 0.00 ? 80  LYS A N    4  
ATOM   5392  C  CA   . LYS A 1 80 ? -20.180 1.613   -8.736  1.00 0.00 ? 80  LYS A CA   4  
ATOM   5393  C  C    . LYS A 1 80 ? -21.243 1.603   -7.624  1.00 0.00 ? 80  LYS A C    4  
ATOM   5394  O  O    . LYS A 1 80 ? -21.150 2.349   -6.646  1.00 0.00 ? 80  LYS A O    4  
ATOM   5395  C  CB   . LYS A 1 80 ? -18.813 1.097   -8.141  1.00 0.00 ? 80  LYS A CB   4  
ATOM   5396  C  CG   . LYS A 1 80 ? -17.710 0.704   -9.152  1.00 0.00 ? 80  LYS A CG   4  
ATOM   5397  C  CD   . LYS A 1 80 ? -17.153 1.902   -9.937  1.00 0.00 ? 80  LYS A CD   4  
ATOM   5398  C  CE   . LYS A 1 80 ? -15.873 1.572   -10.707 1.00 0.00 ? 80  LYS A CE   4  
ATOM   5399  N  NZ   . LYS A 1 80 ? -15.269 2.774   -11.333 1.00 0.00 ? 80  LYS A NZ   4  
ATOM   5400  H  H    . LYS A 1 80 ? -20.508 3.034   -10.276 1.00 0.00 ? 80  LYS A H    4  
ATOM   5401  H  HA   . LYS A 1 80 ? -20.501 0.925   -9.515  1.00 0.00 ? 80  LYS A HA   4  
ATOM   5402  H  HB2  . LYS A 1 80 ? -18.417 1.873   -7.497  1.00 0.00 ? 80  LYS A HB2  4  
ATOM   5403  H  HB3  . LYS A 1 80 ? -19.015 0.225   -7.521  1.00 0.00 ? 80  LYS A HB3  4  
ATOM   5404  H  HG2  . LYS A 1 80 ? -16.899 0.239   -8.606  1.00 0.00 ? 80  LYS A HG2  4  
ATOM   5405  H  HG3  . LYS A 1 80 ? -18.125 -0.010  -9.851  1.00 0.00 ? 80  LYS A HG3  4  
ATOM   5406  H  HD2  . LYS A 1 80 ? -17.910 2.241   -10.645 1.00 0.00 ? 80  LYS A HD2  4  
ATOM   5407  H  HD3  . LYS A 1 80 ? -16.942 2.709   -9.238  1.00 0.00 ? 80  LYS A HD3  4  
ATOM   5408  H  HE2  . LYS A 1 80 ? -15.146 1.138   -10.029 1.00 0.00 ? 80  LYS A HE2  4  
ATOM   5409  H  HE3  . LYS A 1 80 ? -16.101 0.855   -11.482 1.00 0.00 ? 80  LYS A HE3  4  
ATOM   5410  H  HZ1  . LYS A 1 80 ? -14.445 2.504   -11.906 1.00 0.00 ? 80  LYS A HZ1  4  
ATOM   5411  H  HZ2  . LYS A 1 80 ? -14.960 3.439   -10.600 1.00 0.00 ? 80  LYS A HZ2  4  
ATOM   5412  H  HZ3  . LYS A 1 80 ? -15.962 3.249   -11.945 1.00 0.00 ? 80  LYS A HZ3  4  
ATOM   5413  N  N    . PHE A 1 81 ? -22.253 0.750   -7.798  1.00 0.00 ? 81  PHE A N    4  
ATOM   5414  C  CA   . PHE A 1 81 ? -23.335 0.549   -6.814  1.00 0.00 ? 81  PHE A CA   4  
ATOM   5415  C  C    . PHE A 1 81 ? -23.430 -0.928  -6.430  1.00 0.00 ? 81  PHE A C    4  
ATOM   5416  O  O    . PHE A 1 81 ? -22.763 -1.781  -7.023  1.00 0.00 ? 81  PHE A O    4  
ATOM   5417  C  CB   . PHE A 1 81 ? -24.685 1.031   -7.394  1.00 0.00 ? 81  PHE A CB   4  
ATOM   5418  C  CG   . PHE A 1 81 ? -24.765 2.539   -7.615  1.00 0.00 ? 81  PHE A CG   4  
ATOM   5419  C  CD1  . PHE A 1 81 ? -24.251 3.125   -8.770  1.00 0.00 ? 81  PHE A CD1  4  
ATOM   5420  C  CD2  . PHE A 1 81 ? -25.375 3.365   -6.674  1.00 0.00 ? 81  PHE A CD2  4  
ATOM   5421  C  CE1  . PHE A 1 81 ? -24.337 4.481   -8.968  1.00 0.00 ? 81  PHE A CE1  4  
ATOM   5422  C  CE2  . PHE A 1 81 ? -25.459 4.724   -6.876  1.00 0.00 ? 81  PHE A CE2  4  
ATOM   5423  C  CZ   . PHE A 1 81 ? -24.949 5.279   -8.024  1.00 0.00 ? 81  PHE A CZ   4  
ATOM   5424  H  H    . PHE A 1 81 ? -22.264 0.217   -8.616  1.00 0.00 ? 81  PHE A H    4  
ATOM   5425  H  HA   . PHE A 1 81 ? -23.108 1.124   -5.915  1.00 0.00 ? 81  PHE A HA   4  
ATOM   5426  H  HB2  . PHE A 1 81 ? -24.858 0.539   -8.348  1.00 0.00 ? 81  PHE A HB2  4  
ATOM   5427  H  HB3  . PHE A 1 81 ? -25.488 0.744   -6.717  1.00 0.00 ? 81  PHE A HB3  4  
ATOM   5428  H  HD1  . PHE A 1 81 ? -23.761 2.503   -9.513  1.00 0.00 ? 81  PHE A HD1  4  
ATOM   5429  H  HD2  . PHE A 1 81 ? -25.785 2.932   -5.767  1.00 0.00 ? 81  PHE A HD2  4  
ATOM   5430  H  HE1  . PHE A 1 81 ? -23.935 4.923   -9.873  1.00 0.00 ? 81  PHE A HE1  4  
ATOM   5431  H  HE2  . PHE A 1 81 ? -25.933 5.356   -6.135  1.00 0.00 ? 81  PHE A HE2  4  
ATOM   5432  H  HZ   . PHE A 1 81 ? -25.015 6.350   -8.180  1.00 0.00 ? 81  PHE A HZ   4  
ATOM   5433  N  N    . GLU A 1 82 ? -24.242 -1.208  -5.401  1.00 0.00 ? 82  GLU A N    4  
ATOM   5434  C  CA   . GLU A 1 82 ? -24.561 -2.576  -4.977  1.00 0.00 ? 82  GLU A CA   4  
ATOM   5435  C  C    . GLU A 1 82 ? -25.336 -3.339  -6.074  1.00 0.00 ? 82  GLU A C    4  
ATOM   5436  O  O    . GLU A 1 82 ? -25.054 -4.502  -6.344  1.00 0.00 ? 82  GLU A O    4  
ATOM   5437  C  CB   . GLU A 1 82 ? -25.355 -2.548  -3.640  1.00 0.00 ? 82  GLU A CB   4  
ATOM   5438  C  CG   . GLU A 1 82 ? -26.669 -1.729  -3.675  1.00 0.00 ? 82  GLU A CG   4  
ATOM   5439  C  CD   . GLU A 1 82 ? -27.480 -1.813  -2.371  1.00 0.00 ? 82  GLU A CD   4  
ATOM   5440  O  OE1  . GLU A 1 82 ? -27.906 -2.928  -2.008  1.00 0.00 ? 82  GLU A OE1  4  
ATOM   5441  O  OE2  . GLU A 1 82 ? -27.714 -0.768  -1.719  1.00 0.00 ? 82  GLU A OE2  4  
ATOM   5442  H  H    . GLU A 1 82 ? -24.592 -0.469  -4.864  1.00 0.00 ? 82  GLU A H    4  
ATOM   5443  H  HA   . GLU A 1 82 ? -23.621 -3.084  -4.807  1.00 0.00 ? 82  GLU A HA   4  
ATOM   5444  H  HB2  . GLU A 1 82 ? -25.596 -3.569  -3.359  1.00 0.00 ? 82  GLU A HB2  4  
ATOM   5445  H  HB3  . GLU A 1 82 ? -24.712 -2.128  -2.871  1.00 0.00 ? 82  GLU A HB3  4  
ATOM   5446  H  HG2  . GLU A 1 82 ? -26.420 -0.690  -3.880  1.00 0.00 ? 82  GLU A HG2  4  
ATOM   5447  H  HG3  . GLU A 1 82 ? -27.286 -2.099  -4.489  1.00 0.00 ? 82  GLU A HG3  4  
ATOM   5448  N  N    . LYS A 1 83 ? -26.286 -2.651  -6.720  1.00 0.00 ? 83  LYS A N    4  
ATOM   5449  C  CA   . LYS A 1 83 ? -27.148 -3.239  -7.740  1.00 0.00 ? 83  LYS A CA   4  
ATOM   5450  C  C    . LYS A 1 83 ? -27.391 -2.221  -8.853  1.00 0.00 ? 83  LYS A C    4  
ATOM   5451  O  O    . LYS A 1 83 ? -27.266 -1.007  -8.647  1.00 0.00 ? 83  LYS A O    4  
ATOM   5452  C  CB   . LYS A 1 83 ? -28.486 -3.699  -7.099  1.00 0.00 ? 83  LYS A CB   4  
ATOM   5453  C  CG   . LYS A 1 83 ? -29.298 -2.571  -6.402  1.00 0.00 ? 83  LYS A CG   4  
ATOM   5454  C  CD   . LYS A 1 83 ? -30.545 -3.087  -5.643  1.00 0.00 ? 83  LYS A CD   4  
ATOM   5455  C  CE   . LYS A 1 83 ? -30.190 -4.029  -4.482  1.00 0.00 ? 83  LYS A CE   4  
ATOM   5456  N  NZ   . LYS A 1 83 ? -31.392 -4.523  -3.768  1.00 0.00 ? 83  LYS A NZ   4  
ATOM   5457  H  H    . LYS A 1 83 ? -26.412 -1.707  -6.497  1.00 0.00 ? 83  LYS A H    4  
ATOM   5458  H  HA   . LYS A 1 83 ? -26.641 -4.104  -8.167  1.00 0.00 ? 83  LYS A HA   4  
ATOM   5459  H  HB2  . LYS A 1 83 ? -29.108 -4.133  -7.875  1.00 0.00 ? 83  LYS A HB2  4  
ATOM   5460  H  HB3  . LYS A 1 83 ? -28.268 -4.470  -6.365  1.00 0.00 ? 83  LYS A HB3  4  
ATOM   5461  H  HG2  . LYS A 1 83 ? -28.653 -2.059  -5.698  1.00 0.00 ? 83  LYS A HG2  4  
ATOM   5462  H  HG3  . LYS A 1 83 ? -29.622 -1.861  -7.158  1.00 0.00 ? 83  LYS A HG3  4  
ATOM   5463  H  HD2  . LYS A 1 83 ? -31.087 -2.237  -5.245  1.00 0.00 ? 83  LYS A HD2  4  
ATOM   5464  H  HD3  . LYS A 1 83 ? -31.185 -3.616  -6.342  1.00 0.00 ? 83  LYS A HD3  4  
ATOM   5465  H  HE2  . LYS A 1 83 ? -29.651 -4.882  -4.872  1.00 0.00 ? 83  LYS A HE2  4  
ATOM   5466  H  HE3  . LYS A 1 83 ? -29.558 -3.500  -3.776  1.00 0.00 ? 83  LYS A HE3  4  
ATOM   5467  H  HZ1  . LYS A 1 83 ? -31.115 -5.210  -3.039  1.00 0.00 ? 83  LYS A HZ1  4  
ATOM   5468  H  HZ2  . LYS A 1 83 ? -32.043 -4.989  -4.434  1.00 0.00 ? 83  LYS A HZ2  4  
ATOM   5469  H  HZ3  . LYS A 1 83 ? -31.889 -3.733  -3.311  1.00 0.00 ? 83  LYS A HZ3  4  
ATOM   5470  N  N    . LYS A 1 84 ? -27.747 -2.735  -10.026 1.00 0.00 ? 84  LYS A N    4  
ATOM   5471  C  CA   . LYS A 1 84 ? -28.038 -1.921  -11.209 1.00 0.00 ? 84  LYS A CA   4  
ATOM   5472  C  C    . LYS A 1 84 ? -29.319 -1.091  -11.025 1.00 0.00 ? 84  LYS A C    4  
ATOM   5473  O  O    . LYS A 1 84 ? -29.500 -0.080  -11.698 1.00 0.00 ? 84  LYS A O    4  
ATOM   5474  C  CB   . LYS A 1 84 ? -28.128 -2.816  -12.464 1.00 0.00 ? 84  LYS A CB   4  
ATOM   5475  C  CG   . LYS A 1 84 ? -26.833 -3.594  -12.793 1.00 0.00 ? 84  LYS A CG   4  
ATOM   5476  C  CD   . LYS A 1 84 ? -25.601 -2.668  -12.912 1.00 0.00 ? 84  LYS A CD   4  
ATOM   5477  C  CE   . LYS A 1 84 ? -24.326 -3.433  -13.277 1.00 0.00 ? 84  LYS A CE   4  
ATOM   5478  N  NZ   . LYS A 1 84 ? -24.437 -4.088  -14.606 1.00 0.00 ? 84  LYS A NZ   4  
ATOM   5479  H  H    . LYS A 1 84 ? -27.813 -3.704  -10.102 1.00 0.00 ? 84  LYS A H    4  
ATOM   5480  H  HA   . LYS A 1 84 ? -27.209 -1.229  -11.338 1.00 0.00 ? 84  LYS A HA   4  
ATOM   5481  H  HB2  . LYS A 1 84 ? -28.924 -3.539  -12.316 1.00 0.00 ? 84  LYS A HB2  4  
ATOM   5482  H  HB3  . LYS A 1 84 ? -28.380 -2.199  -13.318 1.00 0.00 ? 84  LYS A HB3  4  
ATOM   5483  H  HG2  . LYS A 1 84 ? -26.647 -4.321  -12.006 1.00 0.00 ? 84  LYS A HG2  4  
ATOM   5484  H  HG3  . LYS A 1 84 ? -26.973 -4.120  -13.732 1.00 0.00 ? 84  LYS A HG3  4  
ATOM   5485  H  HD2  . LYS A 1 84 ? -25.793 -1.935  -13.686 1.00 0.00 ? 84  LYS A HD2  4  
ATOM   5486  H  HD3  . LYS A 1 84 ? -25.447 -2.159  -11.969 1.00 0.00 ? 84  LYS A HD3  4  
ATOM   5487  H  HE2  . LYS A 1 84 ? -23.496 -2.737  -13.303 1.00 0.00 ? 84  LYS A HE2  4  
ATOM   5488  H  HE3  . LYS A 1 84 ? -24.134 -4.190  -12.523 1.00 0.00 ? 84  LYS A HE3  4  
ATOM   5489  H  HZ1  . LYS A 1 84 ? -23.532 -4.527  -14.865 1.00 0.00 ? 84  LYS A HZ1  4  
ATOM   5490  H  HZ2  . LYS A 1 84 ? -24.689 -3.386  -15.331 1.00 0.00 ? 84  LYS A HZ2  4  
ATOM   5491  H  HZ3  . LYS A 1 84 ? -25.171 -4.822  -14.582 1.00 0.00 ? 84  LYS A HZ3  4  
ATOM   5492  N  N    . ASP A 1 85 ? -30.201 -1.524  -10.105 1.00 0.00 ? 85  ASP A N    4  
ATOM   5493  C  CA   . ASP A 1 85 ? -31.375 -0.732  -9.700  1.00 0.00 ? 85  ASP A CA   4  
ATOM   5494  C  C    . ASP A 1 85 ? -30.944 0.614   -9.107  1.00 0.00 ? 85  ASP A C    4  
ATOM   5495  O  O    . ASP A 1 85 ? -31.506 1.651   -9.453  1.00 0.00 ? 85  ASP A O    4  
ATOM   5496  C  CB   . ASP A 1 85 ? -32.251 -1.504  -8.686  1.00 0.00 ? 85  ASP A CB   4  
ATOM   5497  C  CG   . ASP A 1 85 ? -32.829 -2.806  -9.261  1.00 0.00 ? 85  ASP A CG   4  
ATOM   5498  O  OD1  . ASP A 1 85 ? -33.532 -2.743  -10.295 1.00 0.00 ? 85  ASP A OD1  4  
ATOM   5499  O  OD2  . ASP A 1 85 ? -32.593 -3.887  -8.686  1.00 0.00 ? 85  ASP A OD2  4  
ATOM   5500  H  H    . ASP A 1 85 ? -30.078 -2.418  -9.719  1.00 0.00 ? 85  ASP A H    4  
ATOM   5501  H  HA   . ASP A 1 85 ? -31.961 -0.542  -10.597 1.00 0.00 ? 85  ASP A HA   4  
ATOM   5502  H  HB2  . ASP A 1 85 ? -31.651 -1.737  -7.810  1.00 0.00 ? 85  ASP A HB2  4  
ATOM   5503  H  HB3  . ASP A 1 85 ? -33.076 -0.872  -8.377  1.00 0.00 ? 85  ASP A HB3  4  
ATOM   5504  N  N    . SER A 1 86 ? -29.913 0.587   -8.240  1.00 0.00 ? 86  SER A N    4  
ATOM   5505  C  CA   . SER A 1 86 ? -29.340 1.796   -7.635  1.00 0.00 ? 86  SER A CA   4  
ATOM   5506  C  C    . SER A 1 86 ? -28.656 2.694   -8.700  1.00 0.00 ? 86  SER A C    4  
ATOM   5507  O  O    . SER A 1 86 ? -28.620 3.920   -8.558  1.00 0.00 ? 86  SER A O    4  
ATOM   5508  C  CB   . SER A 1 86 ? -28.354 1.395   -6.522  1.00 0.00 ? 86  SER A CB   4  
ATOM   5509  O  OG   . SER A 1 86 ? -28.982 0.571   -5.554  1.00 0.00 ? 86  SER A OG   4  
ATOM   5510  H  H    . SER A 1 86 ? -29.517 -0.274  -7.984  1.00 0.00 ? 86  SER A H    4  
ATOM   5511  H  HA   . SER A 1 86 ? -30.155 2.346   -7.190  1.00 0.00 ? 86  SER A HA   4  
ATOM   5512  H  HB2  . SER A 1 86 ? -27.523 0.846   -6.946  1.00 0.00 ? 86  SER A HB2  4  
ATOM   5513  H  HB3  . SER A 1 86 ? -27.978 2.283   -6.028  1.00 0.00 ? 86  SER A HB3  4  
ATOM   5514  H  HG   . SER A 1 86 ? -29.614 1.092   -5.050  1.00 0.00 ? 86  SER A HG   4  
ATOM   5515  N  N    . VAL A 1 87 ? -28.146 2.054   -9.768  1.00 0.00 ? 87  VAL A N    4  
ATOM   5516  C  CA   . VAL A 1 87 ? -27.438 2.729   -10.876 1.00 0.00 ? 87  VAL A CA   4  
ATOM   5517  C  C    . VAL A 1 87 ? -28.424 3.532   -11.723 1.00 0.00 ? 87  VAL A C    4  
ATOM   5518  O  O    . VAL A 1 87 ? -28.188 4.700   -12.023 1.00 0.00 ? 87  VAL A O    4  
ATOM   5519  C  CB   . VAL A 1 87 ? -26.703 1.675   -11.809 1.00 0.00 ? 87  VAL A CB   4  
ATOM   5520  C  CG1  . VAL A 1 87 ? -26.131 2.322   -13.094 1.00 0.00 ? 87  VAL A CG1  4  
ATOM   5521  C  CG2  . VAL A 1 87 ? -25.601 0.902   -11.053 1.00 0.00 ? 87  VAL A CG2  4  
ATOM   5522  H  H    . VAL A 1 87 ? -28.299 1.094   -9.839  1.00 0.00 ? 87  VAL A H    4  
ATOM   5523  H  HA   . VAL A 1 87 ? -26.702 3.403   -10.454 1.00 0.00 ? 87  VAL A HA   4  
ATOM   5524  H  HB   . VAL A 1 87 ? -27.453 0.945   -12.125 1.00 0.00 ? 87  VAL A HB   4  
ATOM   5525  H  HG11 . VAL A 1 87 ? -25.624 1.571   -13.689 1.00 0.00 ? 87  VAL A HG11 4  
ATOM   5526  H  HG12 . VAL A 1 87 ? -25.431 3.101   -12.830 1.00 0.00 ? 87  VAL A HG12 4  
ATOM   5527  H  HG13 . VAL A 1 87 ? -26.937 2.751   -13.679 1.00 0.00 ? 87  VAL A HG13 4  
ATOM   5528  H  HG21 . VAL A 1 87 ? -24.827 1.587   -10.735 1.00 0.00 ? 87  VAL A HG21 4  
ATOM   5529  H  HG22 . VAL A 1 87 ? -25.166 0.149   -11.702 1.00 0.00 ? 87  VAL A HG22 4  
ATOM   5530  H  HG23 . VAL A 1 87 ? -26.023 0.419   -10.184 1.00 0.00 ? 87  VAL A HG23 4  
ATOM   5531  N  N    . VAL A 1 88 ? -29.516 2.860   -12.096 1.00 0.00 ? 88  VAL A N    4  
ATOM   5532  C  CA   . VAL A 1 88 ? -30.556 3.380   -12.999 1.00 0.00 ? 88  VAL A CA   4  
ATOM   5533  C  C    . VAL A 1 88 ? -31.418 4.414   -12.263 1.00 0.00 ? 88  VAL A C    4  
ATOM   5534  O  O    . VAL A 1 88 ? -31.875 5.401   -12.856 1.00 0.00 ? 88  VAL A O    4  
ATOM   5535  C  CB   . VAL A 1 88 ? -31.427 2.212   -13.585 1.00 0.00 ? 88  VAL A CB   4  
ATOM   5536  C  CG1  . VAL A 1 88 ? -32.592 2.729   -14.461 1.00 0.00 ? 88  VAL A CG1  4  
ATOM   5537  C  CG2  . VAL A 1 88 ? -30.543 1.226   -14.391 1.00 0.00 ? 88  VAL A CG2  4  
ATOM   5538  H  H    . VAL A 1 88 ? -29.656 1.992   -11.692 1.00 0.00 ? 88  VAL A H    4  
ATOM   5539  H  HA   . VAL A 1 88 ? -30.055 3.876   -13.827 1.00 0.00 ? 88  VAL A HA   4  
ATOM   5540  H  HB   . VAL A 1 88 ? -31.856 1.668   -12.743 1.00 0.00 ? 88  VAL A HB   4  
ATOM   5541  H  HG11 . VAL A 1 88 ? -33.155 1.892   -14.869 1.00 0.00 ? 88  VAL A HG11 4  
ATOM   5542  H  HG12 . VAL A 1 88 ? -32.204 3.323   -15.279 1.00 0.00 ? 88  VAL A HG12 4  
ATOM   5543  H  HG13 . VAL A 1 88 ? -33.257 3.340   -13.865 1.00 0.00 ? 88  VAL A HG13 4  
ATOM   5544  H  HG21 . VAL A 1 88 ? -29.764 0.836   -13.750 1.00 0.00 ? 88  VAL A HG21 4  
ATOM   5545  H  HG22 . VAL A 1 88 ? -30.093 1.741   -15.228 1.00 0.00 ? 88  VAL A HG22 4  
ATOM   5546  H  HG23 . VAL A 1 88 ? -31.146 0.403   -14.757 1.00 0.00 ? 88  VAL A HG23 4  
ATOM   5547  N  N    . ALA A 1 89 ? -31.591 4.181   -10.945 1.00 0.00 ? 89  ALA A N    4  
ATOM   5548  C  CA   . ALA A 1 89 ? -32.271 5.132   -10.050 1.00 0.00 ? 89  ALA A CA   4  
ATOM   5549  C  C    . ALA A 1 89 ? -31.452 6.432   -9.951  1.00 0.00 ? 89  ALA A C    4  
ATOM   5550  O  O    . ALA A 1 89 ? -32.004 7.539   -9.896  1.00 0.00 ? 89  ALA A O    4  
ATOM   5551  C  CB   . ALA A 1 89 ? -32.489 4.519   -8.654  1.00 0.00 ? 89  ALA A CB   4  
ATOM   5552  H  H    . ALA A 1 89 ? -31.218 3.356   -10.563 1.00 0.00 ? 89  ALA A H    4  
ATOM   5553  H  HA   . ALA A 1 89 ? -33.241 5.351   -10.477 1.00 0.00 ? 89  ALA A HA   4  
ATOM   5554  H  HB1  . ALA A 1 89 ? -33.061 3.604   -8.743  1.00 0.00 ? 89  ALA A HB1  4  
ATOM   5555  H  HB2  . ALA A 1 89 ? -33.031 5.213   -8.023  1.00 0.00 ? 89  ALA A HB2  4  
ATOM   5556  H  HB3  . ALA A 1 89 ? -31.533 4.294   -8.194  1.00 0.00 ? 89  ALA A HB3  4  
ATOM   5557  N  N    . HIS A 1 90 ? -30.120 6.262   -9.931  1.00 0.00 ? 90  HIS A N    4  
ATOM   5558  C  CA   . HIS A 1 90 ? -29.160 7.380   -9.960  1.00 0.00 ? 90  HIS A CA   4  
ATOM   5559  C  C    . HIS A 1 90 ? -29.082 8.017   -11.369 1.00 0.00 ? 90  HIS A C    4  
ATOM   5560  O  O    . HIS A 1 90 ? -28.932 9.216   -11.488 1.00 0.00 ? 90  HIS A O    4  
ATOM   5561  C  CB   . HIS A 1 90 ? -27.770 6.865   -9.459  1.00 0.00 ? 90  HIS A CB   4  
ATOM   5562  C  CG   . HIS A 1 90 ? -26.548 7.534   -10.036 1.00 0.00 ? 90  HIS A CG   4  
ATOM   5563  N  ND1  . HIS A 1 90 ? -25.922 8.621   -9.484  1.00 0.00 ? 90  HIS A ND1  4  
ATOM   5564  C  CD2  . HIS A 1 90 ? -25.814 7.191   -11.121 1.00 0.00 ? 90  HIS A CD2  4  
ATOM   5565  C  CE1  . HIS A 1 90 ? -24.848 8.899   -10.235 1.00 0.00 ? 90  HIS A CE1  4  
ATOM   5566  N  NE2  . HIS A 1 90 ? -24.744 8.051   -11.242 1.00 0.00 ? 90  HIS A NE2  4  
ATOM   5567  H  H    . HIS A 1 90 ? -29.760 5.330   -9.906  1.00 0.00 ? 90  HIS A H    4  
ATOM   5568  H  HA   . HIS A 1 90 ? -29.519 8.137   -9.264  1.00 0.00 ? 90  HIS A HA   4  
ATOM   5569  H  HB2  . HIS A 1 90 ? -27.717 6.993   -8.383  1.00 0.00 ? 90  HIS A HB2  4  
ATOM   5570  H  HB3  . HIS A 1 90 ? -27.687 5.803   -9.668  1.00 0.00 ? 90  HIS A HB3  4  
ATOM   5571  H  HD1  . HIS A 1 90 ? -26.208 9.109   -8.683  1.00 0.00 ? 90  HIS A HD1  4  
ATOM   5572  H  HD2  . HIS A 1 90 ? -26.038 6.382   -11.804 1.00 0.00 ? 90  HIS A HD2  4  
ATOM   5573  H  HE1  . HIS A 1 90 ? -24.162 9.703   -10.042 1.00 0.00 ? 90  HIS A HE1  4  
ATOM   5574  N  N    . LYS A 1 91 ? -29.208 7.186   -12.408 1.00 0.00 ? 91  LYS A N    4  
ATOM   5575  C  CA   . LYS A 1 91 ? -28.946 7.561   -13.818 1.00 0.00 ? 91  LYS A CA   4  
ATOM   5576  C  C    . LYS A 1 91 ? -30.029 8.508   -14.351 1.00 0.00 ? 91  LYS A C    4  
ATOM   5577  O  O    . LYS A 1 91 ? -29.726 9.530   -14.974 1.00 0.00 ? 91  LYS A O    4  
ATOM   5578  C  CB   . LYS A 1 91 ? -28.879 6.282   -14.701 1.00 0.00 ? 91  LYS A CB   4  
ATOM   5579  C  CG   . LYS A 1 91 ? -28.759 6.558   -16.214 1.00 0.00 ? 91  LYS A CG   4  
ATOM   5580  C  CD   . LYS A 1 91 ? -28.777 5.275   -17.077 1.00 0.00 ? 91  LYS A CD   4  
ATOM   5581  C  CE   . LYS A 1 91 ? -28.799 5.590   -18.589 1.00 0.00 ? 91  LYS A CE   4  
ATOM   5582  N  NZ   . LYS A 1 91 ? -28.746 4.361   -19.420 1.00 0.00 ? 91  LYS A NZ   4  
ATOM   5583  H  H    . LYS A 1 91 ? -29.522 6.291   -12.228 1.00 0.00 ? 91  LYS A H    4  
ATOM   5584  H  HA   . LYS A 1 91 ? -27.986 8.062   -13.861 1.00 0.00 ? 91  LYS A HA   4  
ATOM   5585  H  HB2  . LYS A 1 91 ? -28.024 5.687   -14.391 1.00 0.00 ? 91  LYS A HB2  4  
ATOM   5586  H  HB3  . LYS A 1 91 ? -29.780 5.700   -14.530 1.00 0.00 ? 91  LYS A HB3  4  
ATOM   5587  H  HG2  . LYS A 1 91 ? -29.589 7.188   -16.516 1.00 0.00 ? 91  LYS A HG2  4  
ATOM   5588  H  HG3  . LYS A 1 91 ? -27.831 7.090   -16.393 1.00 0.00 ? 91  LYS A HG3  4  
ATOM   5589  H  HD2  . LYS A 1 91 ? -27.893 4.690   -16.853 1.00 0.00 ? 91  LYS A HD2  4  
ATOM   5590  H  HD3  . LYS A 1 91 ? -29.661 4.696   -16.831 1.00 0.00 ? 91  LYS A HD3  4  
ATOM   5591  H  HE2  . LYS A 1 91 ? -29.708 6.123   -18.827 1.00 0.00 ? 91  LYS A HE2  4  
ATOM   5592  H  HE3  . LYS A 1 91 ? -27.944 6.212   -18.839 1.00 0.00 ? 91  LYS A HE3  4  
ATOM   5593  H  HZ1  . LYS A 1 91 ? -29.575 3.761   -19.232 1.00 0.00 ? 91  LYS A HZ1  4  
ATOM   5594  H  HZ2  . LYS A 1 91 ? -27.889 3.821   -19.201 1.00 0.00 ? 91  LYS A HZ2  4  
ATOM   5595  H  HZ3  . LYS A 1 91 ? -28.734 4.610   -20.431 1.00 0.00 ? 91  LYS A HZ3  4  
ATOM   5596  N  N    . ALA A 1 92 ? -31.287 8.143   -14.087 1.00 0.00 ? 92  ALA A N    4  
ATOM   5597  C  CA   . ALA A 1 92 ? -32.467 8.901   -14.528 1.00 0.00 ? 92  ALA A CA   4  
ATOM   5598  C  C    . ALA A 1 92 ? -32.517 10.301  -13.886 1.00 0.00 ? 92  ALA A C    4  
ATOM   5599  O  O    . ALA A 1 92 ? -33.185 11.200  -14.394 1.00 0.00 ? 92  ALA A O    4  
ATOM   5600  C  CB   . ALA A 1 92 ? -33.741 8.112   -14.205 1.00 0.00 ? 92  ALA A CB   4  
ATOM   5601  H  H    . ALA A 1 92 ? -31.425 7.326   -13.568 1.00 0.00 ? 92  ALA A H    4  
ATOM   5602  H  HA   . ALA A 1 92 ? -32.401 9.008   -15.601 1.00 0.00 ? 92  ALA A HA   4  
ATOM   5603  H  HB1  . ALA A 1 92 ? -34.608 8.641   -14.583 1.00 0.00 ? 92  ALA A HB1  4  
ATOM   5604  H  HB2  . ALA A 1 92 ? -33.839 7.991   -13.132 1.00 0.00 ? 92  ALA A HB2  4  
ATOM   5605  H  HB3  . ALA A 1 92 ? -33.691 7.136   -14.667 1.00 0.00 ? 92  ALA A HB3  4  
ATOM   5606  N  N    . LYS A 1 93 ? -31.800 10.464  -12.759 1.00 0.00 ? 93  LYS A N    4  
ATOM   5607  C  CA   . LYS A 1 93 ? -31.763 11.731  -12.003 1.00 0.00 ? 93  LYS A CA   4  
ATOM   5608  C  C    . LYS A 1 93 ? -30.493 12.540  -12.341 1.00 0.00 ? 93  LYS A C    4  
ATOM   5609  O  O    . LYS A 1 93 ? -30.567 13.733  -12.643 1.00 0.00 ? 93  LYS A O    4  
ATOM   5610  C  CB   . LYS A 1 93 ? -31.833 11.432  -10.481 1.00 0.00 ? 93  LYS A CB   4  
ATOM   5611  C  CG   . LYS A 1 93 ? -33.153 10.763  -10.026 1.00 0.00 ? 93  LYS A CG   4  
ATOM   5612  C  CD   . LYS A 1 93 ? -34.384 11.681  -10.223 1.00 0.00 ? 93  LYS A CD   4  
ATOM   5613  C  CE   . LYS A 1 93 ? -35.700 11.052  -9.726  1.00 0.00 ? 93  LYS A CE   4  
ATOM   5614  N  NZ   . LYS A 1 93 ? -36.077 9.849   -10.510 1.00 0.00 ? 93  LYS A NZ   4  
ATOM   5615  H  H    . LYS A 1 93 ? -31.267 9.694   -12.422 1.00 0.00 ? 93  LYS A H    4  
ATOM   5616  H  HA   . LYS A 1 93 ? -32.635 12.322  -12.281 1.00 0.00 ? 93  LYS A HA   4  
ATOM   5617  H  HB2  . LYS A 1 93 ? -31.013 10.771  -10.218 1.00 0.00 ? 93  LYS A HB2  4  
ATOM   5618  H  HB3  . LYS A 1 93 ? -31.716 12.364  -9.933  1.00 0.00 ? 93  LYS A HB3  4  
ATOM   5619  H  HG2  . LYS A 1 93 ? -33.300 9.853   -10.600 1.00 0.00 ? 93  LYS A HG2  4  
ATOM   5620  H  HG3  . LYS A 1 93 ? -33.070 10.505  -8.972  1.00 0.00 ? 93  LYS A HG3  4  
ATOM   5621  H  HD2  . LYS A 1 93 ? -34.220 12.609  -9.684  1.00 0.00 ? 93  LYS A HD2  4  
ATOM   5622  H  HD3  . LYS A 1 93 ? -34.486 11.909  -11.283 1.00 0.00 ? 93  LYS A HD3  4  
ATOM   5623  H  HE2  . LYS A 1 93 ? -35.591 10.772  -8.689  1.00 0.00 ? 93  LYS A HE2  4  
ATOM   5624  H  HE3  . LYS A 1 93 ? -36.493 11.785  -9.813  1.00 0.00 ? 93  LYS A HE3  4  
ATOM   5625  H  HZ1  . LYS A 1 93 ? -36.955 9.435   -10.133 1.00 0.00 ? 93  LYS A HZ1  4  
ATOM   5626  H  HZ2  . LYS A 1 93 ? -35.325 9.139   -10.460 1.00 0.00 ? 93  LYS A HZ2  4  
ATOM   5627  H  HZ3  . LYS A 1 93 ? -36.231 10.104  -11.507 1.00 0.00 ? 93  LYS A HZ3  4  
ATOM   5628  N  N    . SER A 1 94 ? -29.341 11.860  -12.323 1.00 0.00 ? 94  SER A N    4  
ATOM   5629  C  CA   . SER A 1 94 ? -28.015 12.487  -12.408 1.00 0.00 ? 94  SER A CA   4  
ATOM   5630  C  C    . SER A 1 94 ? -27.596 12.740  -13.867 1.00 0.00 ? 94  SER A C    4  
ATOM   5631  O  O    . SER A 1 94 ? -26.735 13.589  -14.134 1.00 0.00 ? 94  SER A O    4  
ATOM   5632  C  CB   . SER A 1 94 ? -26.975 11.599  -11.687 1.00 0.00 ? 94  SER A CB   4  
ATOM   5633  O  OG   . SER A 1 94 ? -25.695 12.193  -11.646 1.00 0.00 ? 94  SER A OG   4  
ATOM   5634  H  H    . SER A 1 94 ? -29.384 10.900  -12.268 1.00 0.00 ? 94  SER A H    4  
ATOM   5635  H  HA   . SER A 1 94 ? -28.068 13.436  -11.893 1.00 0.00 ? 94  SER A HA   4  
ATOM   5636  H  HB2  . SER A 1 94 ? -27.294 11.427  -10.668 1.00 0.00 ? 94  SER A HB2  4  
ATOM   5637  H  HB3  . SER A 1 94 ? -26.894 10.648  -12.194 1.00 0.00 ? 94  SER A HB3  4  
ATOM   5638  H  HG   . SER A 1 94 ? -25.750 13.036  -11.185 1.00 0.00 ? 94  SER A HG   4  
ATOM   5639  N  N    . HIS A 1 95 ? -28.227 12.019  -14.817 1.00 0.00 ? 95  HIS A N    4  
ATOM   5640  C  CA   . HIS A 1 95 ? -27.874 12.095  -16.256 1.00 0.00 ? 95  HIS A CA   4  
ATOM   5641  C  C    . HIS A 1 95 ? -29.165 12.147  -17.126 1.00 0.00 ? 95  HIS A C    4  
ATOM   5642  O  O    . HIS A 1 95 ? -29.467 11.186  -17.843 1.00 0.00 ? 95  HIS A O    4  
ATOM   5643  C  CB   . HIS A 1 95 ? -26.976 10.890  -16.680 1.00 0.00 ? 95  HIS A CB   4  
ATOM   5644  C  CG   . HIS A 1 95 ? -25.826 10.583  -15.758 1.00 0.00 ? 95  HIS A CG   4  
ATOM   5645  N  ND1  . HIS A 1 95 ? -24.737 11.400  -15.566 1.00 0.00 ? 95  HIS A ND1  4  
ATOM   5646  C  CD2  . HIS A 1 95 ? -25.615 9.491   -14.974 1.00 0.00 ? 95  HIS A CD2  4  
ATOM   5647  C  CE1  . HIS A 1 95 ? -23.917 10.793  -14.691 1.00 0.00 ? 95  HIS A CE1  4  
ATOM   5648  N  NE2  . HIS A 1 95 ? -24.410 9.631   -14.305 1.00 0.00 ? 95  HIS A NE2  4  
ATOM   5649  H  H    . HIS A 1 95 ? -28.984 11.466  -14.555 1.00 0.00 ? 95  HIS A H    4  
ATOM   5650  H  HA   . HIS A 1 95 ? -27.321 13.016  -16.430 1.00 0.00 ? 95  HIS A HA   4  
ATOM   5651  H  HB2  . HIS A 1 95 ? -27.584 9.994   -16.752 1.00 0.00 ? 95  HIS A HB2  4  
ATOM   5652  H  HB3  . HIS A 1 95 ? -26.554 11.091  -17.661 1.00 0.00 ? 95  HIS A HB3  4  
ATOM   5653  H  HD1  . HIS A 1 95 ? -24.590 12.275  -15.987 1.00 0.00 ? 95  HIS A HD1  4  
ATOM   5654  H  HD2  . HIS A 1 95 ? -26.243 8.605   -14.942 1.00 0.00 ? 95  HIS A HD2  4  
ATOM   5655  H  HE1  . HIS A 1 95 ? -22.983 11.203  -14.354 1.00 0.00 ? 95  HIS A HE1  4  
ATOM   5656  N  N    . PRO A 1 96 ? -29.992 13.251  -17.023 1.00 0.00 ? 96  PRO A N    4  
ATOM   5657  C  CA   . PRO A 1 96 ? -31.118 13.521  -17.965 1.00 0.00 ? 96  PRO A CA   4  
ATOM   5658  C  C    . PRO A 1 96 ? -30.699 13.449  -19.451 1.00 0.00 ? 96  PRO A C    4  
ATOM   5659  O  O    . PRO A 1 96 ? -31.434 12.928  -20.301 1.00 0.00 ? 96  PRO A O    4  
ATOM   5660  C  CB   . PRO A 1 96 ? -31.551 14.965  -17.583 1.00 0.00 ? 96  PRO A CB   4  
ATOM   5661  C  CG   . PRO A 1 96 ? -31.229 15.073  -16.126 1.00 0.00 ? 96  PRO A CG   4  
ATOM   5662  C  CD   . PRO A 1 96 ? -29.958 14.269  -15.935 1.00 0.00 ? 96  PRO A CD   4  
ATOM   5663  H  HA   . PRO A 1 96 ? -31.940 12.836  -17.792 1.00 0.00 ? 96  PRO A HA   4  
ATOM   5664  H  HB2  . PRO A 1 96 ? -30.994 15.696  -18.166 1.00 0.00 ? 96  PRO A HB2  4  
ATOM   5665  H  HB3  . PRO A 1 96 ? -32.613 15.096  -17.767 1.00 0.00 ? 96  PRO A HB3  4  
ATOM   5666  H  HG2  . PRO A 1 96 ? -31.071 16.112  -15.852 1.00 0.00 ? 96  PRO A HG2  4  
ATOM   5667  H  HG3  . PRO A 1 96 ? -32.037 14.654  -15.532 1.00 0.00 ? 96  PRO A HG3  4  
ATOM   5668  H  HD2  . PRO A 1 96 ? -29.083 14.889  -16.025 1.00 0.00 ? 96  PRO A HD2  4  
ATOM   5669  H  HD3  . PRO A 1 96 ? -29.965 13.786  -14.962 1.00 0.00 ? 96  PRO A HD3  4  
ATOM   5670  N  N    . GLU A 1 97 ? -29.490 13.963  -19.737 1.00 0.00 ? 97  GLU A N    4  
ATOM   5671  C  CA   . GLU A 1 97 ? -28.924 14.042  -21.070 1.00 0.00 ? 97  GLU A CA   4  
ATOM   5672  C  C    . GLU A 1 97 ? -27.792 13.024  -21.186 1.00 0.00 ? 97  GLU A C    4  
ATOM   5673  O  O    . GLU A 1 97 ? -26.674 13.247  -20.696 1.00 0.00 ? 97  GLU A O    4  
ATOM   5674  C  CB   . GLU A 1 97 ? -28.405 15.478  -21.343 1.00 0.00 ? 97  GLU A CB   4  
ATOM   5675  C  CG   . GLU A 1 97 ? -29.491 16.566  -21.268 1.00 0.00 ? 97  GLU A CG   4  
ATOM   5676  C  CD   . GLU A 1 97 ? -28.939 17.962  -21.581 1.00 0.00 ? 97  GLU A CD   4  
ATOM   5677  O  OE1  . GLU A 1 97 ? -28.793 18.295  -22.776 1.00 0.00 ? 97  GLU A OE1  4  
ATOM   5678  O  OE2  . GLU A 1 97 ? -28.623 18.721  -20.642 1.00 0.00 ? 97  GLU A OE2  4  
ATOM   5679  H  H    . GLU A 1 97 ? -28.945 14.280  -19.017 1.00 0.00 ? 97  GLU A H    4  
ATOM   5680  H  HA   . GLU A 1 97 ? -29.696 13.808  -21.791 1.00 0.00 ? 97  GLU A HA   4  
ATOM   5681  H  HB2  . GLU A 1 97 ? -27.636 15.719  -20.613 1.00 0.00 ? 97  GLU A HB2  4  
ATOM   5682  H  HB3  . GLU A 1 97 ? -27.959 15.510  -22.336 1.00 0.00 ? 97  GLU A HB3  4  
ATOM   5683  H  HG2  . GLU A 1 97 ? -30.280 16.329  -21.982 1.00 0.00 ? 97  GLU A HG2  4  
ATOM   5684  H  HG3  . GLU A 1 97 ? -29.920 16.564  -20.270 1.00 0.00 ? 97  GLU A HG3  4  
ATOM   5685  N  N    . VAL A 1 98 ? -28.134 11.884  -21.775 1.00 0.00 ? 98  VAL A N    4  
ATOM   5686  C  CA   . VAL A 1 98 ? -27.182 10.844  -22.190 1.00 0.00 ? 98  VAL A CA   4  
ATOM   5687  C  C    . VAL A 1 98 ? -27.719 10.129  -23.464 1.00 0.00 ? 98  VAL A C    4  
ATOM   5688  O  O    . VAL A 1 98 ? -26.979 10.026  -24.468 1.00 0.00 ? 98  VAL A O    4  
ATOM   5689  C  CB   . VAL A 1 98 ? -26.863 9.824   -21.025 1.00 0.00 ? 98  VAL A CB   4  
ATOM   5690  C  CG1  . VAL A 1 98 ? -28.142 9.172   -20.437 1.00 0.00 ? 98  VAL A CG1  4  
ATOM   5691  C  CG2  . VAL A 1 98 ? -25.823 8.761   -21.483 1.00 0.00 ? 98  VAL A CG2  4  
ATOM   5692  O  OXT  . VAL A 1 98 ? -28.912 9.752   -23.492 1.00 0.00 ? 98  VAL A OXT  4  
ATOM   5693  H  H    . VAL A 1 98 ? -29.086 11.718  -21.900 1.00 0.00 ? 98  VAL A H    4  
ATOM   5694  H  HA   . VAL A 1 98 ? -26.249 11.356  -22.450 1.00 0.00 ? 98  VAL A HA   4  
ATOM   5695  H  HB   . VAL A 1 98 ? -26.406 10.399  -20.221 1.00 0.00 ? 98  VAL A HB   4  
ATOM   5696  H  HG11 . VAL A 1 98 ? -27.879 8.504   -19.626 1.00 0.00 ? 98  VAL A HG11 4  
ATOM   5697  H  HG12 . VAL A 1 98 ? -28.657 8.612   -21.207 1.00 0.00 ? 98  VAL A HG12 4  
ATOM   5698  H  HG13 . VAL A 1 98 ? -28.805 9.943   -20.060 1.00 0.00 ? 98  VAL A HG13 4  
ATOM   5699  H  HG21 . VAL A 1 98 ? -25.584 8.106   -20.657 1.00 0.00 ? 98  VAL A HG21 4  
ATOM   5700  H  HG22 . VAL A 1 98 ? -24.919 9.253   -21.818 1.00 0.00 ? 98  VAL A HG22 4  
ATOM   5701  H  HG23 . VAL A 1 98 ? -26.232 8.175   -22.295 1.00 0.00 ? 98  VAL A HG23 4  
HETATM 5702  ZN ZN   . ZN  B 2 .  ? 15.897  0.545   3.929   1.00 0.00 ? 101 ZN  A ZN   4  
HETATM 5703  ZN ZN   . ZN  C 2 .  ? -2.922  -3.285  -7.693  1.00 0.00 ? 102 ZN  A ZN   4  
HETATM 5704  ZN ZN   . ZN  D 2 .  ? -23.606 8.260   -12.964 1.00 0.00 ? 103 ZN  A ZN   4  
ATOM   5705  N  N    . HIS A 1 10 ? 17.307  -9.248  20.611  1.00 0.00 ? 10  HIS A N    5  
ATOM   5706  C  CA   . HIS A 1 10 ? 16.695  -9.578  19.307  1.00 0.00 ? 10  HIS A CA   5  
ATOM   5707  C  C    . HIS A 1 10 ? 16.652  -11.092 19.130  1.00 0.00 ? 10  HIS A C    5  
ATOM   5708  O  O    . HIS A 1 10 ? 17.638  -11.780 19.418  1.00 0.00 ? 10  HIS A O    5  
ATOM   5709  C  CB   . HIS A 1 10 ? 17.474  -8.925  18.148  1.00 0.00 ? 10  HIS A CB   5  
ATOM   5710  C  CG   . HIS A 1 10 ? 17.495  -7.423  18.186  1.00 0.00 ? 10  HIS A CG   5  
ATOM   5711  N  ND1  . HIS A 1 10 ? 16.365  -6.665  18.016  1.00 0.00 ? 10  HIS A ND1  5  
ATOM   5712  C  CD2  . HIS A 1 10 ? 18.507  -6.541  18.374  1.00 0.00 ? 10  HIS A CD2  5  
ATOM   5713  C  CE1  . HIS A 1 10 ? 16.673  -5.395  18.098  1.00 0.00 ? 10  HIS A CE1  5  
ATOM   5714  N  NE2  . HIS A 1 10 ? 17.967  -5.286  18.314  1.00 0.00 ? 10  HIS A NE2  5  
ATOM   5715  H  H    . HIS A 1 10 ? 18.261  -9.656  20.672  1.00 0.00 ? 10  HIS A H    5  
ATOM   5716  H  HA   . HIS A 1 10 ? 15.673  -9.194  19.316  1.00 0.00 ? 10  HIS A HA   5  
ATOM   5717  H  HB2  . HIS A 1 10 ? 18.497  -9.273  18.166  1.00 0.00 ? 10  HIS A HB2  5  
ATOM   5718  H  HB3  . HIS A 1 10 ? 17.019  -9.218  17.211  1.00 0.00 ? 10  HIS A HB3  5  
ATOM   5719  H  HD1  . HIS A 1 10 ? 15.461  -7.009  17.857  1.00 0.00 ? 10  HIS A HD1  5  
ATOM   5720  H  HD2  . HIS A 1 10 ? 19.550  -6.786  18.541  1.00 0.00 ? 10  HIS A HD2  5  
ATOM   5721  H  HE1  . HIS A 1 10 ? 15.979  -4.573  18.014  1.00 0.00 ? 10  HIS A HE1  5  
ATOM   5722  H  HE2  . HIS A 1 10 ? 18.480  -4.456  18.202  1.00 0.00 ? 10  HIS A HE2  5  
ATOM   5723  N  N    . MET A 1 11 ? 15.511  -11.598 18.641  1.00 0.00 ? 11  MET A N    5  
ATOM   5724  C  CA   . MET A 1 11 ? 15.273  -13.039 18.418  1.00 0.00 ? 11  MET A CA   5  
ATOM   5725  C  C    . MET A 1 11 ? 14.780  -13.245 16.980  1.00 0.00 ? 11  MET A C    5  
ATOM   5726  O  O    . MET A 1 11 ? 15.355  -14.031 16.213  1.00 0.00 ? 11  MET A O    5  
ATOM   5727  C  CB   . MET A 1 11 ? 14.234  -13.588 19.448  1.00 0.00 ? 11  MET A CB   5  
ATOM   5728  C  CG   . MET A 1 11 ? 14.672  -13.474 20.925  1.00 0.00 ? 11  MET A CG   5  
ATOM   5729  S  SD   . MET A 1 11 ? 13.392  -13.965 22.107  1.00 0.00 ? 11  MET A SD   5  
ATOM   5730  C  CE   . MET A 1 11 ? 13.149  -15.692 21.702  1.00 0.00 ? 11  MET A CE   5  
ATOM   5731  H  H    . MET A 1 11 ? 14.791  -10.972 18.409  1.00 0.00 ? 11  MET A H    5  
ATOM   5732  H  HA   . MET A 1 11 ? 16.212  -13.575 18.543  1.00 0.00 ? 11  MET A HA   5  
ATOM   5733  H  HB2  . MET A 1 11 ? 13.308  -13.036 19.332  1.00 0.00 ? 11  MET A HB2  5  
ATOM   5734  H  HB3  . MET A 1 11 ? 14.041  -14.634 19.235  1.00 0.00 ? 11  MET A HB3  5  
ATOM   5735  H  HG2  . MET A 1 11 ? 15.541  -14.097 21.079  1.00 0.00 ? 11  MET A HG2  5  
ATOM   5736  H  HG3  . MET A 1 11 ? 14.944  -12.440 21.131  1.00 0.00 ? 11  MET A HG3  5  
ATOM   5737  H  HE1  . MET A 1 11 ? 12.392  -16.114 22.353  1.00 0.00 ? 11  MET A HE1  5  
ATOM   5738  H  HE2  . MET A 1 11 ? 14.075  -16.227 21.842  1.00 0.00 ? 11  MET A HE2  5  
ATOM   5739  H  HE3  . MET A 1 11 ? 12.827  -15.783 20.676  1.00 0.00 ? 11  MET A HE3  5  
ATOM   5740  N  N    . ARG A 1 12 ? 13.707  -12.519 16.621  1.00 0.00 ? 12  ARG A N    5  
ATOM   5741  C  CA   . ARG A 1 12 ? 13.123  -12.556 15.270  1.00 0.00 ? 12  ARG A CA   5  
ATOM   5742  C  C    . ARG A 1 12 ? 13.025  -11.111 14.735  1.00 0.00 ? 12  ARG A C    5  
ATOM   5743  O  O    . ARG A 1 12 ? 11.984  -10.446 14.864  1.00 0.00 ? 12  ARG A O    5  
ATOM   5744  C  CB   . ARG A 1 12 ? 11.735  -13.265 15.296  1.00 0.00 ? 12  ARG A CB   5  
ATOM   5745  C  CG   . ARG A 1 12 ? 11.144  -13.581 13.905  1.00 0.00 ? 12  ARG A CG   5  
ATOM   5746  C  CD   . ARG A 1 12 ? 12.035  -14.537 13.096  1.00 0.00 ? 12  ARG A CD   5  
ATOM   5747  N  NE   . ARG A 1 12 ? 11.395  -14.985 11.846  1.00 0.00 ? 12  ARG A NE   5  
ATOM   5748  C  CZ   . ARG A 1 12 ? 11.773  -16.050 11.125  1.00 0.00 ? 12  ARG A CZ   5  
ATOM   5749  N  NH1  . ARG A 1 12 ? 12.820  -16.780 11.492  1.00 0.00 ? 12  ARG A NH1  5  
ATOM   5750  N  NH2  . ARG A 1 12 ? 11.098  -16.375 10.037  1.00 0.00 ? 12  ARG A NH2  5  
ATOM   5751  H  H    . ARG A 1 12 ? 13.292  -11.935 17.290  1.00 0.00 ? 12  ARG A H    5  
ATOM   5752  H  HA   . ARG A 1 12 ? 13.796  -13.121 14.620  1.00 0.00 ? 12  ARG A HA   5  
ATOM   5753  H  HB2  . ARG A 1 12 ? 11.830  -14.199 15.844  1.00 0.00 ? 12  ARG A HB2  5  
ATOM   5754  H  HB3  . ARG A 1 12 ? 11.029  -12.636 15.828  1.00 0.00 ? 12  ARG A HB3  5  
ATOM   5755  H  HG2  . ARG A 1 12 ? 10.169  -14.037 14.036  1.00 0.00 ? 12  ARG A HG2  5  
ATOM   5756  H  HG3  . ARG A 1 12 ? 11.029  -12.650 13.356  1.00 0.00 ? 12  ARG A HG3  5  
ATOM   5757  H  HD2  . ARG A 1 12 ? 12.959  -14.025 12.847  1.00 0.00 ? 12  ARG A HD2  5  
ATOM   5758  H  HD3  . ARG A 1 12 ? 12.266  -15.406 13.705  1.00 0.00 ? 12  ARG A HD3  5  
ATOM   5759  H  HE   . ARG A 1 12 ? 10.628  -14.461 11.525  1.00 0.00 ? 12  ARG A HE   5  
ATOM   5760  H  HH11 . ARG A 1 12 ? 13.342  -16.540 12.313  1.00 0.00 ? 12  ARG A HH11 5  
ATOM   5761  H  HH12 . ARG A 1 12 ? 13.094  -17.578 10.947  1.00 0.00 ? 12  ARG A HH12 5  
ATOM   5762  H  HH21 . ARG A 1 12 ? 10.303  -15.825 9.761   1.00 0.00 ? 12  ARG A HH21 5  
ATOM   5763  H  HH22 . ARG A 1 12 ? 11.382  -17.161 9.481   1.00 0.00 ? 12  ARG A HH22 5  
ATOM   5764  N  N    . ASP A 1 13 ? 14.149  -10.624 14.185  1.00 0.00 ? 13  ASP A N    5  
ATOM   5765  C  CA   . ASP A 1 13 ? 14.322  -9.238  13.736  1.00 0.00 ? 13  ASP A CA   5  
ATOM   5766  C  C    . ASP A 1 13 ? 15.187  -9.260  12.473  1.00 0.00 ? 13  ASP A C    5  
ATOM   5767  O  O    . ASP A 1 13 ? 16.403  -9.480  12.541  1.00 0.00 ? 13  ASP A O    5  
ATOM   5768  C  CB   . ASP A 1 13 ? 15.014  -8.341  14.808  1.00 0.00 ? 13  ASP A CB   5  
ATOM   5769  C  CG   . ASP A 1 13 ? 14.206  -8.130  16.100  1.00 0.00 ? 13  ASP A CG   5  
ATOM   5770  O  OD1  . ASP A 1 13 ? 14.189  -9.042  16.958  1.00 0.00 ? 13  ASP A OD1  5  
ATOM   5771  O  OD2  . ASP A 1 13 ? 13.631  -7.033  16.298  1.00 0.00 ? 13  ASP A OD2  5  
ATOM   5772  H  H    . ASP A 1 13 ? 14.893  -11.239 14.031  1.00 0.00 ? 13  ASP A H    5  
ATOM   5773  H  HA   . ASP A 1 13 ? 13.347  -8.819  13.494  1.00 0.00 ? 13  ASP A HA   5  
ATOM   5774  H  HB2  . ASP A 1 13 ? 15.963  -8.786  15.072  1.00 0.00 ? 13  ASP A HB2  5  
ATOM   5775  H  HB3  . ASP A 1 13 ? 15.210  -7.370  14.361  1.00 0.00 ? 13  ASP A HB3  5  
ATOM   5776  N  N    . TYR A 1 14 ? 14.533  -9.115  11.328  1.00 0.00 ? 14  TYR A N    5  
ATOM   5777  C  CA   . TYR A 1 14 ? 15.194  -8.928  10.024  1.00 0.00 ? 14  TYR A CA   5  
ATOM   5778  C  C    . TYR A 1 14 ? 15.175  -7.440  9.683   1.00 0.00 ? 14  TYR A C    5  
ATOM   5779  O  O    . TYR A 1 14 ? 14.101  -6.848  9.506   1.00 0.00 ? 14  TYR A O    5  
ATOM   5780  C  CB   . TYR A 1 14 ? 14.501  -9.771  8.926   1.00 0.00 ? 14  TYR A CB   5  
ATOM   5781  C  CG   . TYR A 1 14 ? 14.684  -11.285 9.125   1.00 0.00 ? 14  TYR A CG   5  
ATOM   5782  C  CD1  . TYR A 1 14 ? 13.797  -12.029 9.906   1.00 0.00 ? 14  TYR A CD1  5  
ATOM   5783  C  CD2  . TYR A 1 14 ? 15.757  -11.967 8.543   1.00 0.00 ? 14  TYR A CD2  5  
ATOM   5784  C  CE1  . TYR A 1 14 ? 13.977  -13.386 10.100  1.00 0.00 ? 14  TYR A CE1  5  
ATOM   5785  C  CE2  . TYR A 1 14 ? 15.939  -13.325 8.737   1.00 0.00 ? 14  TYR A CE2  5  
ATOM   5786  C  CZ   . TYR A 1 14 ? 15.044  -14.031 9.512   1.00 0.00 ? 14  TYR A CZ   5  
ATOM   5787  O  OH   . TYR A 1 14 ? 15.216  -15.388 9.697   1.00 0.00 ? 14  TYR A OH   5  
ATOM   5788  H  H    . TYR A 1 14 ? 13.558  -9.132  11.359  1.00 0.00 ? 14  TYR A H    5  
ATOM   5789  H  HA   . TYR A 1 14 ? 16.227  -9.253  10.115  1.00 0.00 ? 14  TYR A HA   5  
ATOM   5790  H  HB2  . TYR A 1 14 ? 13.436  -9.550  8.924   1.00 0.00 ? 14  TYR A HB2  5  
ATOM   5791  H  HB3  . TYR A 1 14 ? 14.907  -9.505  7.954   1.00 0.00 ? 14  TYR A HB3  5  
ATOM   5792  H  HD1  . TYR A 1 14 ? 12.953  -11.527 10.369  1.00 0.00 ? 14  TYR A HD1  5  
ATOM   5793  H  HD2  . TYR A 1 14 ? 16.459  -11.417 7.925   1.00 0.00 ? 14  TYR A HD2  5  
ATOM   5794  H  HE1  . TYR A 1 14 ? 13.276  -13.938 10.708  1.00 0.00 ? 14  TYR A HE1  5  
ATOM   5795  H  HE2  . TYR A 1 14 ? 16.783  -13.828 8.279   1.00 0.00 ? 14  TYR A HE2  5  
ATOM   5796  H  HH   . TYR A 1 14 ? 16.117  -15.562 9.989   1.00 0.00 ? 14  TYR A HH   5  
ATOM   5797  N  N    . ILE A 1 15 ? 16.370  -6.836  9.619   1.00 0.00 ? 15  ILE A N    5  
ATOM   5798  C  CA   . ILE A 1 15 ? 16.537  -5.384  9.504   1.00 0.00 ? 15  ILE A CA   5  
ATOM   5799  C  C    . ILE A 1 15 ? 17.282  -5.072  8.201   1.00 0.00 ? 15  ILE A C    5  
ATOM   5800  O  O    . ILE A 1 15 ? 18.267  -5.742  7.862   1.00 0.00 ? 15  ILE A O    5  
ATOM   5801  C  CB   . ILE A 1 15 ? 17.327  -4.782  10.738  1.00 0.00 ? 15  ILE A CB   5  
ATOM   5802  C  CG1  . ILE A 1 15 ? 16.728  -5.275  12.087  1.00 0.00 ? 15  ILE A CG1  5  
ATOM   5803  C  CG2  . ILE A 1 15 ? 17.373  -3.229  10.687  1.00 0.00 ? 15  ILE A CG2  5  
ATOM   5804  C  CD1  . ILE A 1 15 ? 15.288  -4.904  12.300  1.00 0.00 ? 15  ILE A CD1  5  
ATOM   5805  H  H    . ILE A 1 15 ? 17.176  -7.390  9.594   1.00 0.00 ? 15  ILE A H    5  
ATOM   5806  H  HA   . ILE A 1 15 ? 15.552  -4.920  9.469   1.00 0.00 ? 15  ILE A HA   5  
ATOM   5807  H  HB   . ILE A 1 15 ? 18.336  -5.132  10.682  1.00 0.00 ? 15  ILE A HB   5  
ATOM   5808  H  HG12 . ILE A 1 15 ? 16.790  -6.356  12.130  1.00 0.00 ? 15  ILE A HG12 5  
ATOM   5809  H  HG13 . ILE A 1 15 ? 17.300  -4.862  12.908  1.00 0.00 ? 15  ILE A HG13 5  
ATOM   5810  H  HG21 . ILE A 1 15 ? 17.856  -2.910  9.772   1.00 0.00 ? 15  ILE A HG21 5  
ATOM   5811  H  HG22 . ILE A 1 15 ? 17.929  -2.847  11.533  1.00 0.00 ? 15  ILE A HG22 5  
ATOM   5812  H  HG23 . ILE A 1 15 ? 16.364  -2.826  10.712  1.00 0.00 ? 15  ILE A HG23 5  
ATOM   5813  H  HD11 . ILE A 1 15 ? 14.687  -5.355  11.526  1.00 0.00 ? 15  ILE A HD11 5  
ATOM   5814  H  HD12 . ILE A 1 15 ? 15.188  -3.831  12.256  1.00 0.00 ? 15  ILE A HD12 5  
ATOM   5815  H  HD13 . ILE A 1 15 ? 14.968  -5.261  13.262  1.00 0.00 ? 15  ILE A HD13 5  
ATOM   5816  N  N    . CYS A 1 16 ? 16.769  -4.080  7.467   1.00 0.00 ? 16  CYS A N    5  
ATOM   5817  C  CA   . CYS A 1 16 ? 17.407  -3.524  6.269   1.00 0.00 ? 16  CYS A CA   5  
ATOM   5818  C  C    . CYS A 1 16 ? 18.823  -2.994  6.599   1.00 0.00 ? 16  CYS A C    5  
ATOM   5819  O  O    . CYS A 1 16 ? 19.797  -3.391  5.943   1.00 0.00 ? 16  CYS A O    5  
ATOM   5820  C  CB   . CYS A 1 16 ? 16.491  -2.413  5.692   1.00 0.00 ? 16  CYS A CB   5  
ATOM   5821  S  SG   . CYS A 1 16 ? 17.045  -1.641  4.142   1.00 0.00 ? 16  CYS A SG   5  
ATOM   5822  H  H    . CYS A 1 16 ? 15.906  -3.718  7.733   1.00 0.00 ? 16  CYS A H    5  
ATOM   5823  H  HA   . CYS A 1 16 ? 17.499  -4.323  5.535   1.00 0.00 ? 16  CYS A HA   5  
ATOM   5824  H  HB2  . CYS A 1 16 ? 15.510  -2.824  5.498   1.00 0.00 ? 16  CYS A HB2  5  
ATOM   5825  H  HB3  . CYS A 1 16 ? 16.391  -1.622  6.429   1.00 0.00 ? 16  CYS A HB3  5  
ATOM   5826  N  N    . GLU A 1 17 ? 18.901  -2.141  7.658   1.00 0.00 ? 17  GLU A N    5  
ATOM   5827  C  CA   . GLU A 1 17 ? 20.153  -1.524  8.192   1.00 0.00 ? 17  GLU A CA   5  
ATOM   5828  C  C    . GLU A 1 17 ? 19.787  -0.371  9.150   1.00 0.00 ? 17  GLU A C    5  
ATOM   5829  O  O    . GLU A 1 17 ? 20.202  -0.343  10.313  1.00 0.00 ? 17  GLU A O    5  
ATOM   5830  C  CB   . GLU A 1 17 ? 21.083  -0.973  7.059   1.00 0.00 ? 17  GLU A CB   5  
ATOM   5831  C  CG   . GLU A 1 17 ? 22.294  -0.145  7.526   1.00 0.00 ? 17  GLU A CG   5  
ATOM   5832  C  CD   . GLU A 1 17 ? 23.131  0.391   6.353   1.00 0.00 ? 17  GLU A CD   5  
ATOM   5833  O  OE1  . GLU A 1 17 ? 22.648  1.297   5.635   1.00 0.00 ? 17  GLU A OE1  5  
ATOM   5834  O  OE2  . GLU A 1 17 ? 24.271  -0.081  6.141   1.00 0.00 ? 17  GLU A OE2  5  
ATOM   5835  H  H    . GLU A 1 17 ? 18.072  -1.933  8.126   1.00 0.00 ? 17  GLU A H    5  
ATOM   5836  H  HA   . GLU A 1 17 ? 20.684  -2.291  8.748   1.00 0.00 ? 17  GLU A HA   5  
ATOM   5837  H  HB2  . GLU A 1 17 ? 21.456  -1.814  6.484   1.00 0.00 ? 17  GLU A HB2  5  
ATOM   5838  H  HB3  . GLU A 1 17 ? 20.487  -0.355  6.397   1.00 0.00 ? 17  GLU A HB3  5  
ATOM   5839  H  HG2  . GLU A 1 17 ? 21.937  0.700   8.109   1.00 0.00 ? 17  GLU A HG2  5  
ATOM   5840  H  HG3  . GLU A 1 17 ? 22.919  -0.768  8.160   1.00 0.00 ? 17  GLU A HG3  5  
ATOM   5841  N  N    . TYR A 1 18 ? 18.973  0.552   8.626   1.00 0.00 ? 18  TYR A N    5  
ATOM   5842  C  CA   . TYR A 1 18 ? 18.669  1.849   9.253   1.00 0.00 ? 18  TYR A CA   5  
ATOM   5843  C  C    . TYR A 1 18 ? 17.175  2.114   9.105   1.00 0.00 ? 18  TYR A C    5  
ATOM   5844  O  O    . TYR A 1 18 ? 16.462  2.408   10.063  1.00 0.00 ? 18  TYR A O    5  
ATOM   5845  C  CB   . TYR A 1 18 ? 19.477  2.995   8.592   1.00 0.00 ? 18  TYR A CB   5  
ATOM   5846  C  CG   . TYR A 1 18 ? 19.279  4.337   9.306   1.00 0.00 ? 18  TYR A CG   5  
ATOM   5847  C  CD1  . TYR A 1 18 ? 19.647  4.482   10.642  1.00 0.00 ? 18  TYR A CD1  5  
ATOM   5848  C  CD2  . TYR A 1 18 ? 18.679  5.431   8.674   1.00 0.00 ? 18  TYR A CD2  5  
ATOM   5849  C  CE1  . TYR A 1 18 ? 19.438  5.662   11.317  1.00 0.00 ? 18  TYR A CE1  5  
ATOM   5850  C  CE2  . TYR A 1 18 ? 18.463  6.615   9.349   1.00 0.00 ? 18  TYR A CE2  5  
ATOM   5851  C  CZ   . TYR A 1 18 ? 18.842  6.727   10.672  1.00 0.00 ? 18  TYR A CZ   5  
ATOM   5852  O  OH   . TYR A 1 18 ? 18.614  7.909   11.354  1.00 0.00 ? 18  TYR A OH   5  
ATOM   5853  H  H    . TYR A 1 18 ? 18.448  0.284   7.854   1.00 0.00 ? 18  TYR A H    5  
ATOM   5854  H  HA   . TYR A 1 18 ? 18.917  1.803   10.320  1.00 0.00 ? 18  TYR A HA   5  
ATOM   5855  H  HB2  . TYR A 1 18 ? 20.527  2.751   8.620   1.00 0.00 ? 18  TYR A HB2  5  
ATOM   5856  H  HB3  . TYR A 1 18 ? 19.172  3.106   7.554   1.00 0.00 ? 18  TYR A HB3  5  
ATOM   5857  H  HD1  . TYR A 1 18 ? 20.117  3.650   11.154  1.00 0.00 ? 18  TYR A HD1  5  
ATOM   5858  H  HD2  . TYR A 1 18 ? 18.382  5.343   7.637   1.00 0.00 ? 18  TYR A HD2  5  
ATOM   5859  H  HE1  . TYR A 1 18 ? 19.734  5.739   12.353  1.00 0.00 ? 18  TYR A HE1  5  
ATOM   5860  H  HE2  . TYR A 1 18 ? 17.997  7.451   8.840   1.00 0.00 ? 18  TYR A HE2  5  
ATOM   5861  H  HH   . TYR A 1 18 ? 17.717  8.217   11.172  1.00 0.00 ? 18  TYR A HH   5  
ATOM   5862  N  N    . CYS A 1 19 ? 16.725  1.982   7.854   1.00 0.00 ? 19  CYS A N    5  
ATOM   5863  C  CA   . CYS A 1 19 ? 15.325  2.183   7.461   1.00 0.00 ? 19  CYS A CA   5  
ATOM   5864  C  C    . CYS A 1 19 ? 14.581  0.846   7.553   1.00 0.00 ? 19  CYS A C    5  
ATOM   5865  O  O    . CYS A 1 19 ? 14.141  0.277   6.554   1.00 0.00 ? 19  CYS A O    5  
ATOM   5866  C  CB   . CYS A 1 19 ? 15.256  2.824   6.049   1.00 0.00 ? 19  CYS A CB   5  
ATOM   5867  S  SG   . CYS A 1 19 ? 16.478  2.174   4.874   1.00 0.00 ? 19  CYS A SG   5  
ATOM   5868  H  H    . CYS A 1 19 ? 17.368  1.683   7.171   1.00 0.00 ? 19  CYS A H    5  
ATOM   5869  H  HA   . CYS A 1 19 ? 14.862  2.870   8.174   1.00 0.00 ? 19  CYS A HA   5  
ATOM   5870  H  HB2  . CYS A 1 19 ? 14.277  2.661   5.618   1.00 0.00 ? 19  CYS A HB2  5  
ATOM   5871  H  HB3  . CYS A 1 19 ? 15.429  3.890   6.134   1.00 0.00 ? 19  CYS A HB3  5  
ATOM   5872  N  N    . ALA A 1 20 ? 14.544  0.306   8.783   1.00 0.00 ? 20  ALA A N    5  
ATOM   5873  C  CA   . ALA A 1 20 ? 13.711  -0.835  9.136   1.00 0.00 ? 20  ALA A CA   5  
ATOM   5874  C  C    . ALA A 1 20 ? 13.374  -0.828  10.631  1.00 0.00 ? 20  ALA A C    5  
ATOM   5875  O  O    . ALA A 1 20 ? 14.265  -0.696  11.480  1.00 0.00 ? 20  ALA A O    5  
ATOM   5876  C  CB   . ALA A 1 20 ? 14.375  -2.154  8.742   1.00 0.00 ? 20  ALA A CB   5  
ATOM   5877  H  H    . ALA A 1 20 ? 15.119  0.682   9.470   1.00 0.00 ? 20  ALA A H    5  
ATOM   5878  H  HA   . ALA A 1 20 ? 12.791  -0.743  8.569   1.00 0.00 ? 20  ALA A HA   5  
ATOM   5879  H  HB1  . ALA A 1 20 ? 14.575  -2.149  7.679   1.00 0.00 ? 20  ALA A HB1  5  
ATOM   5880  H  HB2  . ALA A 1 20 ? 13.718  -2.987  8.972   1.00 0.00 ? 20  ALA A HB2  5  
ATOM   5881  H  HB3  . ALA A 1 20 ? 15.307  -2.275  9.274   1.00 0.00 ? 20  ALA A HB3  5  
ATOM   5882  N  N    . ARG A 1 21 ? 12.074  -0.950  10.922  1.00 0.00 ? 21  ARG A N    5  
ATOM   5883  C  CA   . ARG A 1 21 ? 11.565  -1.182  12.279  1.00 0.00 ? 21  ARG A CA   5  
ATOM   5884  C  C    . ARG A 1 21 ? 11.962  -2.622  12.691  1.00 0.00 ? 21  ARG A C    5  
ATOM   5885  O  O    . ARG A 1 21 ? 12.935  -2.817  13.427  1.00 0.00 ? 21  ARG A O    5  
ATOM   5886  C  CB   . ARG A 1 21 ? 10.020  -1.007  12.297  1.00 0.00 ? 21  ARG A CB   5  
ATOM   5887  C  CG   . ARG A 1 21 ? 9.484   0.236   11.553  1.00 0.00 ? 21  ARG A CG   5  
ATOM   5888  C  CD   . ARG A 1 21 ? 7.985   0.119   11.226  1.00 0.00 ? 21  ARG A CD   5  
ATOM   5889  N  NE   . ARG A 1 21 ? 7.132   0.054   12.430  1.00 0.00 ? 21  ARG A NE   5  
ATOM   5890  C  CZ   . ARG A 1 21 ? 5.911   -0.509  12.479  1.00 0.00 ? 21  ARG A CZ   5  
ATOM   5891  N  NH1  . ARG A 1 21 ? 5.413   -1.160  11.429  1.00 0.00 ? 21  ARG A NH1  5  
ATOM   5892  N  NH2  . ARG A 1 21 ? 5.207   -0.452  13.600  1.00 0.00 ? 21  ARG A NH2  5  
ATOM   5893  H  H    . ARG A 1 21 ? 11.439  -0.803  10.188  1.00 0.00 ? 21  ARG A H    5  
ATOM   5894  H  HA   . ARG A 1 21 ? 12.028  -0.464  12.953  1.00 0.00 ? 21  ARG A HA   5  
ATOM   5895  H  HB2  . ARG A 1 21 ? 9.568   -1.884  11.842  1.00 0.00 ? 21  ARG A HB2  5  
ATOM   5896  H  HB3  . ARG A 1 21 ? 9.689   -0.953  13.331  1.00 0.00 ? 21  ARG A HB3  5  
ATOM   5897  H  HG2  . ARG A 1 21 ? 9.642   1.116   12.169  1.00 0.00 ? 21  ARG A HG2  5  
ATOM   5898  H  HG3  . ARG A 1 21 ? 10.034  0.356   10.624  1.00 0.00 ? 21  ARG A HG3  5  
ATOM   5899  H  HD2  . ARG A 1 21 ? 7.694   0.974   10.645  1.00 0.00 ? 21  ARG A HD2  5  
ATOM   5900  H  HD3  . ARG A 1 21 ? 7.828   -0.778  10.630  1.00 0.00 ? 21  ARG A HD3  5  
ATOM   5901  H  HE   . ARG A 1 21 ? 7.474   0.495   13.237  1.00 0.00 ? 21  ARG A HE   5  
ATOM   5902  H  HH11 . ARG A 1 21 ? 5.942   -1.230  10.579  1.00 0.00 ? 21  ARG A HH11 5  
ATOM   5903  H  HH12 . ARG A 1 21 ? 4.502   -1.575  11.478  1.00 0.00 ? 21  ARG A HH12 5  
ATOM   5904  H  HH21 . ARG A 1 21 ? 5.580   0.023   14.407  1.00 0.00 ? 21  ARG A HH21 5  
ATOM   5905  H  HH22 . ARG A 1 21 ? 4.295   -0.863  13.645  1.00 0.00 ? 21  ARG A HH22 5  
ATOM   5906  N  N    . ALA A 1 22 ? 11.190  -3.616  12.198  1.00 0.00 ? 22  ALA A N    5  
ATOM   5907  C  CA   . ALA A 1 22 ? 11.584  -5.037  12.173  1.00 0.00 ? 22  ALA A CA   5  
ATOM   5908  C  C    . ALA A 1 22 ? 10.652  -5.785  11.220  1.00 0.00 ? 22  ALA A C    5  
ATOM   5909  O  O    . ALA A 1 22 ? 9.458   -5.480  11.148  1.00 0.00 ? 22  ALA A O    5  
ATOM   5910  C  CB   . ALA A 1 22 ? 11.552  -5.665  13.582  1.00 0.00 ? 22  ALA A CB   5  
ATOM   5911  H  H    . ALA A 1 22 ? 10.274  -3.400  11.899  1.00 0.00 ? 22  ALA A H    5  
ATOM   5912  H  HA   . ALA A 1 22 ? 12.603  -5.102  11.786  1.00 0.00 ? 22  ALA A HA   5  
ATOM   5913  H  HB1  . ALA A 1 22 ? 11.855  -6.705  13.533  1.00 0.00 ? 22  ALA A HB1  5  
ATOM   5914  H  HB2  . ALA A 1 22 ? 10.552  -5.602  13.988  1.00 0.00 ? 22  ALA A HB2  5  
ATOM   5915  H  HB3  . ALA A 1 22 ? 12.231  -5.128  14.232  1.00 0.00 ? 22  ALA A HB3  5  
ATOM   5916  N  N    . PHE A 1 23 ? 11.215  -6.722  10.452  1.00 0.00 ? 23  PHE A N    5  
ATOM   5917  C  CA   . PHE A 1 23 ? 10.455  -7.601  9.546   1.00 0.00 ? 23  PHE A CA   5  
ATOM   5918  C  C    . PHE A 1 23 ? 10.604  -9.053  10.016  1.00 0.00 ? 23  PHE A C    5  
ATOM   5919  O  O    . PHE A 1 23 ? 11.650  -9.431  10.551  1.00 0.00 ? 23  PHE A O    5  
ATOM   5920  C  CB   . PHE A 1 23 ? 10.959  -7.429  8.090   1.00 0.00 ? 23  PHE A CB   5  
ATOM   5921  C  CG   . PHE A 1 23 ? 10.761  -6.016  7.526   1.00 0.00 ? 23  PHE A CG   5  
ATOM   5922  C  CD1  . PHE A 1 23 ? 11.724  -5.021  7.718   1.00 0.00 ? 23  PHE A CD1  5  
ATOM   5923  C  CD2  . PHE A 1 23 ? 9.617   -5.683  6.802   1.00 0.00 ? 23  PHE A CD2  5  
ATOM   5924  C  CE1  . PHE A 1 23 ? 11.544  -3.751  7.203   1.00 0.00 ? 23  PHE A CE1  5  
ATOM   5925  C  CE2  . PHE A 1 23 ? 9.442   -4.414  6.291   1.00 0.00 ? 23  PHE A CE2  5  
ATOM   5926  C  CZ   . PHE A 1 23 ? 10.406  -3.449  6.491   1.00 0.00 ? 23  PHE A CZ   5  
ATOM   5927  H  H    . PHE A 1 23 ? 12.189  -6.819  10.481  1.00 0.00 ? 23  PHE A H    5  
ATOM   5928  H  HA   . PHE A 1 23 ? 9.402   -7.326  9.595   1.00 0.00 ? 23  PHE A HA   5  
ATOM   5929  H  HB2  . PHE A 1 23 ? 12.019  -7.662  8.045   1.00 0.00 ? 23  PHE A HB2  5  
ATOM   5930  H  HB3  . PHE A 1 23 ? 10.428  -8.123  7.446   1.00 0.00 ? 23  PHE A HB3  5  
ATOM   5931  H  HD1  . PHE A 1 23 ? 12.624  -5.252  8.274   1.00 0.00 ? 23  PHE A HD1  5  
ATOM   5932  H  HD2  . PHE A 1 23 ? 8.856   -6.433  6.636   1.00 0.00 ? 23  PHE A HD2  5  
ATOM   5933  H  HE1  . PHE A 1 23 ? 12.298  -2.990  7.360   1.00 0.00 ? 23  PHE A HE1  5  
ATOM   5934  H  HE2  . PHE A 1 23 ? 8.545   -4.174  5.732   1.00 0.00 ? 23  PHE A HE2  5  
ATOM   5935  H  HZ   . PHE A 1 23 ? 10.266  -2.451  6.092   1.00 0.00 ? 23  PHE A HZ   5  
ATOM   5936  N  N    . LYS A 1 24 ? 9.541   -9.854  9.855   1.00 0.00 ? 24  LYS A N    5  
ATOM   5937  C  CA   . LYS A 1 24 ? 9.533   -11.270 10.277  1.00 0.00 ? 24  LYS A CA   5  
ATOM   5938  C  C    . LYS A 1 24 ? 10.270  -12.180 9.268   1.00 0.00 ? 24  LYS A C    5  
ATOM   5939  O  O    . LYS A 1 24 ? 10.519  -13.359 9.558   1.00 0.00 ? 24  LYS A O    5  
ATOM   5940  C  CB   . LYS A 1 24 ? 8.065   -11.743 10.491  1.00 0.00 ? 24  LYS A CB   5  
ATOM   5941  C  CG   . LYS A 1 24 ? 7.206   -10.906 11.496  1.00 0.00 ? 24  LYS A CG   5  
ATOM   5942  C  CD   . LYS A 1 24 ? 7.641   -11.014 12.993  1.00 0.00 ? 24  LYS A CD   5  
ATOM   5943  C  CE   . LYS A 1 24 ? 8.806   -10.080 13.401  1.00 0.00 ? 24  LYS A CE   5  
ATOM   5944  N  NZ   . LYS A 1 24 ? 9.104   -10.167 14.851  1.00 0.00 ? 24  LYS A NZ   5  
ATOM   5945  H  H    . LYS A 1 24 ? 8.714   -9.486  9.475   1.00 0.00 ? 24  LYS A H    5  
ATOM   5946  H  HA   . LYS A 1 24 ? 10.054  -11.335 11.228  1.00 0.00 ? 24  LYS A HA   5  
ATOM   5947  H  HB2  . LYS A 1 24 ? 7.558   -11.719 9.531   1.00 0.00 ? 24  LYS A HB2  5  
ATOM   5948  H  HB3  . LYS A 1 24 ? 8.078   -12.773 10.839  1.00 0.00 ? 24  LYS A HB3  5  
ATOM   5949  H  HG2  . LYS A 1 24 ? 7.242   -9.863  11.203  1.00 0.00 ? 24  LYS A HG2  5  
ATOM   5950  H  HG3  . LYS A 1 24 ? 6.175   -11.246 11.415  1.00 0.00 ? 24  LYS A HG3  5  
ATOM   5951  H  HD2  . LYS A 1 24 ? 6.787   -10.776 13.618  1.00 0.00 ? 24  LYS A HD2  5  
ATOM   5952  H  HD3  . LYS A 1 24 ? 7.934   -12.040 13.194  1.00 0.00 ? 24  LYS A HD3  5  
ATOM   5953  H  HE2  . LYS A 1 24 ? 9.695   -10.359 12.854  1.00 0.00 ? 24  LYS A HE2  5  
ATOM   5954  H  HE3  . LYS A 1 24 ? 8.547   -9.056  13.161  1.00 0.00 ? 24  LYS A HE3  5  
ATOM   5955  H  HZ1  . LYS A 1 24 ? 8.286   -9.843  15.407  1.00 0.00 ? 24  LYS A HZ1  5  
ATOM   5956  H  HZ2  . LYS A 1 24 ? 9.925   -9.579  15.087  1.00 0.00 ? 24  LYS A HZ2  5  
ATOM   5957  H  HZ3  . LYS A 1 24 ? 9.314   -11.153 15.112  1.00 0.00 ? 24  LYS A HZ3  5  
ATOM   5958  N  N    . SER A 1 25 ? 10.633  -11.630 8.090   1.00 0.00 ? 25  SER A N    5  
ATOM   5959  C  CA   . SER A 1 25 ? 11.357  -12.370 7.040   1.00 0.00 ? 25  SER A CA   5  
ATOM   5960  C  C    . SER A 1 25 ? 12.307  -11.434 6.268   1.00 0.00 ? 25  SER A C    5  
ATOM   5961  O  O    . SER A 1 25 ? 12.040  -10.230 6.127   1.00 0.00 ? 25  SER A O    5  
ATOM   5962  C  CB   . SER A 1 25 ? 10.355  -13.050 6.077   1.00 0.00 ? 25  SER A CB   5  
ATOM   5963  O  OG   . SER A 1 25 ? 9.551   -14.003 6.756   1.00 0.00 ? 25  SER A OG   5  
ATOM   5964  H  H    . SER A 1 25 ? 10.414  -10.693 7.915   1.00 0.00 ? 25  SER A H    5  
ATOM   5965  H  HA   . SER A 1 25 ? 11.956  -13.141 7.524   1.00 0.00 ? 25  SER A HA   5  
ATOM   5966  H  HB2  . SER A 1 25 ? 9.700   -12.306 5.644   1.00 0.00 ? 25  SER A HB2  5  
ATOM   5967  H  HB3  . SER A 1 25 ? 10.892  -13.555 5.286   1.00 0.00 ? 25  SER A HB3  5  
ATOM   5968  H  HG   . SER A 1 25 ? 9.995   -14.291 7.568   1.00 0.00 ? 25  SER A HG   5  
ATOM   5969  N  N    . SER A 1 26 ? 13.441  -12.006 5.826   1.00 0.00 ? 26  SER A N    5  
ATOM   5970  C  CA   . SER A 1 26 ? 14.454  -11.308 5.000   1.00 0.00 ? 26  SER A CA   5  
ATOM   5971  C  C    . SER A 1 26 ? 13.874  -10.854 3.640   1.00 0.00 ? 26  SER A C    5  
ATOM   5972  O  O    . SER A 1 26 ? 14.269  -9.813  3.102   1.00 0.00 ? 26  SER A O    5  
ATOM   5973  C  CB   . SER A 1 26 ? 15.680  -12.234 4.785   1.00 0.00 ? 26  SER A CB   5  
ATOM   5974  O  OG   . SER A 1 26 ? 16.741  -11.559 4.125   1.00 0.00 ? 26  SER A OG   5  
ATOM   5975  H  H    . SER A 1 26 ? 13.628  -12.918 6.132   1.00 0.00 ? 26  SER A H    5  
ATOM   5976  H  HA   . SER A 1 26 ? 14.773  -10.430 5.556   1.00 0.00 ? 26  SER A HA   5  
ATOM   5977  H  HB2  . SER A 1 26 ? 16.043  -12.584 5.743   1.00 0.00 ? 26  SER A HB2  5  
ATOM   5978  H  HB3  . SER A 1 26 ? 15.387  -13.090 4.186   1.00 0.00 ? 26  SER A HB3  5  
ATOM   5979  H  HG   . SER A 1 26 ? 16.541  -11.480 3.184   1.00 0.00 ? 26  SER A HG   5  
ATOM   5980  N  N    . HIS A 1 27 ? 12.953  -11.654 3.082   1.00 0.00 ? 27  HIS A N    5  
ATOM   5981  C  CA   . HIS A 1 27 ? 12.268  -11.311 1.818   1.00 0.00 ? 27  HIS A CA   5  
ATOM   5982  C  C    . HIS A 1 27 ? 11.240  -10.183 2.053   1.00 0.00 ? 27  HIS A C    5  
ATOM   5983  O  O    . HIS A 1 27 ? 10.964  -9.382  1.155   1.00 0.00 ? 27  HIS A O    5  
ATOM   5984  C  CB   . HIS A 1 27 ? 11.588  -12.539 1.179   1.00 0.00 ? 27  HIS A CB   5  
ATOM   5985  C  CG   . HIS A 1 27 ? 11.223  -12.339 -0.273  1.00 0.00 ? 27  HIS A CG   5  
ATOM   5986  N  ND1  . HIS A 1 27 ? 10.246  -11.462 -0.702  1.00 0.00 ? 27  HIS A ND1  5  
ATOM   5987  C  CD2  . HIS A 1 27 ? 11.763  -12.860 -1.393  1.00 0.00 ? 27  HIS A CD2  5  
ATOM   5988  C  CE1  . HIS A 1 27 ? 10.210  -11.450 -2.016  1.00 0.00 ? 27  HIS A CE1  5  
ATOM   5989  N  NE2  . HIS A 1 27 ? 11.119  -12.290 -2.461  1.00 0.00 ? 27  HIS A NE2  5  
ATOM   5990  H  H    . HIS A 1 27 ? 12.735  -12.499 3.525   1.00 0.00 ? 27  HIS A H    5  
ATOM   5991  H  HA   . HIS A 1 27 ? 13.034  -10.936 1.133   1.00 0.00 ? 27  HIS A HA   5  
ATOM   5992  H  HB2  . HIS A 1 27 ? 12.258  -13.386 1.239   1.00 0.00 ? 27  HIS A HB2  5  
ATOM   5993  H  HB3  . HIS A 1 27 ? 10.681  -12.775 1.722   1.00 0.00 ? 27  HIS A HB3  5  
ATOM   5994  H  HD1  . HIS A 1 27 ? 9.671   -10.916 -0.122  1.00 0.00 ? 27  HIS A HD1  5  
ATOM   5995  H  HD2  . HIS A 1 27 ? 12.554  -13.596 -1.441  1.00 0.00 ? 27  HIS A HD2  5  
ATOM   5996  H  HE1  . HIS A 1 27 ? 9.547   -10.851 -2.627  1.00 0.00 ? 27  HIS A HE1  5  
ATOM   5997  H  HE2  . HIS A 1 27 ? 11.436  -12.331 -3.389  1.00 0.00 ? 27  HIS A HE2  5  
ATOM   5998  N  N    . ASN A 1 28 ? 10.623  -10.189 3.244   1.00 0.00 ? 28  ASN A N    5  
ATOM   5999  C  CA   . ASN A 1 28 ? 9.659   -9.147  3.673   1.00 0.00 ? 28  ASN A CA   5  
ATOM   6000  C  C    . ASN A 1 28 ? 10.319  -7.750  3.688   1.00 0.00 ? 28  ASN A C    5  
ATOM   6001  O  O    . ASN A 1 28 ? 9.710   -6.763  3.270   1.00 0.00 ? 28  ASN A O    5  
ATOM   6002  C  CB   . ASN A 1 28 ? 9.125   -9.483  5.086   1.00 0.00 ? 28  ASN A CB   5  
ATOM   6003  C  CG   . ASN A 1 28 ? 7.925   -8.644  5.547   1.00 0.00 ? 28  ASN A CG   5  
ATOM   6004  O  OD1  . ASN A 1 28 ? 7.777   -8.377  6.735   1.00 0.00 ? 28  ASN A OD1  5  
ATOM   6005  N  ND2  . ASN A 1 28 ? 7.041   -8.241  4.631   1.00 0.00 ? 28  ASN A ND2  5  
ATOM   6006  H  H    . ASN A 1 28 ? 10.816  -10.925 3.861   1.00 0.00 ? 28  ASN A H    5  
ATOM   6007  H  HA   . ASN A 1 28 ? 8.831   -9.149  2.969   1.00 0.00 ? 28  ASN A HA   5  
ATOM   6008  H  HB2  . ASN A 1 28 ? 8.826   -10.521 5.114   1.00 0.00 ? 28  ASN A HB2  5  
ATOM   6009  H  HB3  . ASN A 1 28 ? 9.945   -9.336  5.799   1.00 0.00 ? 28  ASN A HB3  5  
ATOM   6010  H  HD21 . ASN A 1 28 ? 7.180   -8.492  3.698   1.00 0.00 ? 28  ASN A HD21 5  
ATOM   6011  H  HD22 . ASN A 1 28 ? 6.278   -7.700  4.935   1.00 0.00 ? 28  ASN A HD22 5  
ATOM   6012  N  N    . LEU A 1 29 ? 11.560  -7.693  4.207   1.00 0.00 ? 29  LEU A N    5  
ATOM   6013  C  CA   . LEU A 1 29 ? 12.384  -6.462  4.207   1.00 0.00 ? 29  LEU A CA   5  
ATOM   6014  C  C    . LEU A 1 29 ? 12.748  -6.074  2.765   1.00 0.00 ? 29  LEU A C    5  
ATOM   6015  O  O    . LEU A 1 29 ? 12.847  -4.886  2.445   1.00 0.00 ? 29  LEU A O    5  
ATOM   6016  C  CB   . LEU A 1 29 ? 13.635  -6.657  5.150   1.00 0.00 ? 29  LEU A CB   5  
ATOM   6017  C  CG   . LEU A 1 29 ? 15.025  -7.098  4.542   1.00 0.00 ? 29  LEU A CG   5  
ATOM   6018  C  CD1  . LEU A 1 29 ? 15.813  -5.943  3.856   1.00 0.00 ? 29  LEU A CD1  5  
ATOM   6019  C  CD2  . LEU A 1 29 ? 15.901  -7.796  5.608   1.00 0.00 ? 29  LEU A CD2  5  
ATOM   6020  H  H    . LEU A 1 29 ? 11.905  -8.489  4.662   1.00 0.00 ? 29  LEU A H    5  
ATOM   6021  H  HA   . LEU A 1 29 ? 11.762  -5.668  4.618   1.00 0.00 ? 29  LEU A HA   5  
ATOM   6022  H  HB2  . LEU A 1 29 ? 13.795  -5.734  5.705   1.00 0.00 ? 29  LEU A HB2  5  
ATOM   6023  H  HB3  . LEU A 1 29 ? 13.337  -7.420  5.873   1.00 0.00 ? 29  LEU A HB3  5  
ATOM   6024  H  HG   . LEU A 1 29 ? 14.826  -7.827  3.771   1.00 0.00 ? 29  LEU A HG   5  
ATOM   6025  H  HD11 . LEU A 1 29 ? 16.755  -6.322  3.481   1.00 0.00 ? 29  LEU A HD11 5  
ATOM   6026  H  HD12 . LEU A 1 29 ? 16.005  -5.151  4.565   1.00 0.00 ? 29  LEU A HD12 5  
ATOM   6027  H  HD13 . LEU A 1 29 ? 15.239  -5.549  3.026   1.00 0.00 ? 29  LEU A HD13 5  
ATOM   6028  H  HD21 . LEU A 1 29 ? 15.365  -8.643  6.017   1.00 0.00 ? 29  LEU A HD21 5  
ATOM   6029  H  HD22 . LEU A 1 29 ? 16.137  -7.104  6.407   1.00 0.00 ? 29  LEU A HD22 5  
ATOM   6030  H  HD23 . LEU A 1 29 ? 16.817  -8.143  5.152   1.00 0.00 ? 29  LEU A HD23 5  
ATOM   6031  N  N    . ALA A 1 30 ? 12.951  -7.101  1.912   1.00 0.00 ? 30  ALA A N    5  
ATOM   6032  C  CA   . ALA A 1 30 ? 13.235  -6.921  0.469   1.00 0.00 ? 30  ALA A CA   5  
ATOM   6033  C  C    . ALA A 1 30 ? 12.077  -6.200  -0.275  1.00 0.00 ? 30  ALA A C    5  
ATOM   6034  O  O    . ALA A 1 30 ? 12.302  -5.534  -1.293  1.00 0.00 ? 30  ALA A O    5  
ATOM   6035  C  CB   . ALA A 1 30 ? 13.587  -8.257  -0.203  1.00 0.00 ? 30  ALA A CB   5  
ATOM   6036  H  H    . ALA A 1 30 ? 12.930  -8.010  2.283   1.00 0.00 ? 30  ALA A H    5  
ATOM   6037  H  HA   . ALA A 1 30 ? 14.117  -6.292  0.410   1.00 0.00 ? 30  ALA A HA   5  
ATOM   6038  H  HB1  . ALA A 1 30 ? 14.405  -8.728  0.331   1.00 0.00 ? 30  ALA A HB1  5  
ATOM   6039  H  HB2  . ALA A 1 30 ? 13.884  -8.087  -1.230  1.00 0.00 ? 30  ALA A HB2  5  
ATOM   6040  H  HB3  . ALA A 1 30 ? 12.728  -8.912  -0.181  1.00 0.00 ? 30  ALA A HB3  5  
ATOM   6041  N  N    . VAL A 1 31 ? 10.843  -6.355  0.241   1.00 0.00 ? 31  VAL A N    5  
ATOM   6042  C  CA   . VAL A 1 31 ? 9.655   -5.615  -0.254  1.00 0.00 ? 31  VAL A CA   5  
ATOM   6043  C  C    . VAL A 1 31 ? 9.822   -4.084  -0.036  1.00 0.00 ? 31  VAL A C    5  
ATOM   6044  O  O    . VAL A 1 31 ? 9.630   -3.293  -0.971  1.00 0.00 ? 31  VAL A O    5  
ATOM   6045  C  CB   . VAL A 1 31 ? 8.344   -6.134  0.439   1.00 0.00 ? 31  VAL A CB   5  
ATOM   6046  C  CG1  . VAL A 1 31 ? 7.110   -5.292  0.048   1.00 0.00 ? 31  VAL A CG1  5  
ATOM   6047  C  CG2  . VAL A 1 31 ? 8.126   -7.636  0.128   1.00 0.00 ? 31  VAL A CG2  5  
ATOM   6048  H  H    . VAL A 1 31 ? 10.731  -6.990  0.977   1.00 0.00 ? 31  VAL A H    5  
ATOM   6049  H  HA   . VAL A 1 31 ? 9.570   -5.805  -1.320  1.00 0.00 ? 31  VAL A HA   5  
ATOM   6050  H  HB   . VAL A 1 31 ? 8.480   -6.035  1.516   1.00 0.00 ? 31  VAL A HB   5  
ATOM   6051  H  HG11 . VAL A 1 31 ? 7.251   -4.264  0.366   1.00 0.00 ? 31  VAL A HG11 5  
ATOM   6052  H  HG12 . VAL A 1 31 ? 6.226   -5.688  0.526   1.00 0.00 ? 31  VAL A HG12 5  
ATOM   6053  H  HG13 . VAL A 1 31 ? 6.978   -5.317  -1.025  1.00 0.00 ? 31  VAL A HG13 5  
ATOM   6054  H  HG21 . VAL A 1 31 ? 8.976   -8.209  0.478   1.00 0.00 ? 31  VAL A HG21 5  
ATOM   6055  H  HG22 . VAL A 1 31 ? 8.014   -7.780  -0.939  1.00 0.00 ? 31  VAL A HG22 5  
ATOM   6056  H  HG23 . VAL A 1 31 ? 7.233   -7.989  0.631   1.00 0.00 ? 31  VAL A HG23 5  
ATOM   6057  N  N    . HIS A 1 32 ? 10.212  -3.697  1.195   1.00 0.00 ? 32  HIS A N    5  
ATOM   6058  C  CA   . HIS A 1 32 ? 10.540  -2.288  1.553   1.00 0.00 ? 32  HIS A CA   5  
ATOM   6059  C  C    . HIS A 1 32 ? 11.751  -1.803  0.727   1.00 0.00 ? 32  HIS A C    5  
ATOM   6060  O  O    . HIS A 1 32 ? 11.844  -0.631  0.349   1.00 0.00 ? 32  HIS A O    5  
ATOM   6061  C  CB   . HIS A 1 32 ? 10.827  -2.163  3.100   1.00 0.00 ? 32  HIS A CB   5  
ATOM   6062  C  CG   . HIS A 1 32 ? 11.897  -1.147  3.456   1.00 0.00 ? 32  HIS A CG   5  
ATOM   6063  N  ND1  . HIS A 1 32 ? 11.683  0.208   3.520   1.00 0.00 ? 32  HIS A ND1  5  
ATOM   6064  C  CD2  . HIS A 1 32 ? 13.236  -1.320  3.628   1.00 0.00 ? 32  HIS A CD2  5  
ATOM   6065  C  CE1  . HIS A 1 32 ? 12.865  0.805   3.709   1.00 0.00 ? 32  HIS A CE1  5  
ATOM   6066  N  NE2  . HIS A 1 32 ? 13.846  -0.079  3.779   1.00 0.00 ? 32  HIS A NE2  5  
ATOM   6067  H  H    . HIS A 1 32 ? 10.290  -4.376  1.888   1.00 0.00 ? 32  HIS A H    5  
ATOM   6068  H  HA   . HIS A 1 32 ? 9.679   -1.672  1.300   1.00 0.00 ? 32  HIS A HA   5  
ATOM   6069  H  HB2  . HIS A 1 32 ? 9.914   -1.871  3.614   1.00 0.00 ? 32  HIS A HB2  5  
ATOM   6070  H  HB3  . HIS A 1 32 ? 11.140  -3.125  3.490   1.00 0.00 ? 32  HIS A HB3  5  
ATOM   6071  H  HD1  . HIS A 1 32 ? 10.818  0.661   3.429   1.00 0.00 ? 32  HIS A HD1  5  
ATOM   6072  H  HD2  . HIS A 1 32 ? 13.752  -2.270  3.612   1.00 0.00 ? 32  HIS A HD2  5  
ATOM   6073  H  HE1  . HIS A 1 32 ? 12.998  1.874   3.796   1.00 0.00 ? 32  HIS A HE1  5  
ATOM   6074  N  N    . ARG A 1 33 ? 12.671  -2.742  0.481   1.00 0.00 ? 33  ARG A N    5  
ATOM   6075  C  CA   . ARG A 1 33 ? 13.943  -2.513  -0.224  1.00 0.00 ? 33  ARG A CA   5  
ATOM   6076  C  C    . ARG A 1 33 ? 13.726  -2.135  -1.718  1.00 0.00 ? 33  ARG A C    5  
ATOM   6077  O  O    . ARG A 1 33 ? 14.688  -1.925  -2.425  1.00 0.00 ? 33  ARG A O    5  
ATOM   6078  C  CB   . ARG A 1 33 ? 14.805  -3.792  -0.053  1.00 0.00 ? 33  ARG A CB   5  
ATOM   6079  C  CG   . ARG A 1 33 ? 16.284  -3.728  -0.476  1.00 0.00 ? 33  ARG A CG   5  
ATOM   6080  C  CD   . ARG A 1 33 ? 16.978  -5.092  -0.308  1.00 0.00 ? 33  ARG A CD   5  
ATOM   6081  N  NE   . ARG A 1 33 ? 18.365  -5.082  -0.799  1.00 0.00 ? 33  ARG A NE   5  
ATOM   6082  C  CZ   . ARG A 1 33 ? 19.189  -6.142  -0.797  1.00 0.00 ? 33  ARG A CZ   5  
ATOM   6083  N  NH1  . ARG A 1 33 ? 18.796  -7.303  -0.283  1.00 0.00 ? 33  ARG A NH1  5  
ATOM   6084  N  NH2  . ARG A 1 33 ? 20.403  -6.024  -1.308  1.00 0.00 ? 33  ARG A NH2  5  
ATOM   6085  H  H    . ARG A 1 33 ? 12.498  -3.639  0.831   1.00 0.00 ? 33  ARG A H    5  
ATOM   6086  H  HA   . ARG A 1 33 ? 14.447  -1.686  0.269   1.00 0.00 ? 33  ARG A HA   5  
ATOM   6087  H  HB2  . ARG A 1 33 ? 14.780  -4.075  0.995   1.00 0.00 ? 33  ARG A HB2  5  
ATOM   6088  H  HB3  . ARG A 1 33 ? 14.327  -4.586  -0.620  1.00 0.00 ? 33  ARG A HB3  5  
ATOM   6089  H  HG2  . ARG A 1 33 ? 16.346  -3.426  -1.515  1.00 0.00 ? 33  ARG A HG2  5  
ATOM   6090  H  HG3  . ARG A 1 33 ? 16.790  -2.997  0.143   1.00 0.00 ? 33  ARG A HG3  5  
ATOM   6091  H  HD2  . ARG A 1 33 ? 16.983  -5.358  0.742   1.00 0.00 ? 33  ARG A HD2  5  
ATOM   6092  H  HD3  . ARG A 1 33 ? 16.419  -5.843  -0.861  1.00 0.00 ? 33  ARG A HD3  5  
ATOM   6093  H  HE   . ARG A 1 33 ? 18.703  -4.234  -1.164  1.00 0.00 ? 33  ARG A HE   5  
ATOM   6094  H  HH11 . ARG A 1 33 ? 17.880  -7.396  0.109   1.00 0.00 ? 33  ARG A HH11 5  
ATOM   6095  H  HH12 . ARG A 1 33 ? 19.414  -8.094  -0.285  1.00 0.00 ? 33  ARG A HH12 5  
ATOM   6096  H  HH21 . ARG A 1 33 ? 20.704  -5.146  -1.692  1.00 0.00 ? 33  ARG A HH21 5  
ATOM   6097  H  HH22 . ARG A 1 33 ? 21.030  -6.808  -1.314  1.00 0.00 ? 33  ARG A HH22 5  
ATOM   6098  N  N    . MET A 1 34 ? 12.444  -1.975  -2.155  1.00 0.00 ? 34  MET A N    5  
ATOM   6099  C  CA   . MET A 1 34 ? 12.039  -1.419  -3.496  1.00 0.00 ? 34  MET A CA   5  
ATOM   6100  C  C    . MET A 1 34 ? 12.783  -0.109  -3.909  1.00 0.00 ? 34  MET A C    5  
ATOM   6101  O  O    . MET A 1 34 ? 12.761  0.285   -5.079  1.00 0.00 ? 34  MET A O    5  
ATOM   6102  C  CB   . MET A 1 34 ? 10.509  -1.152  -3.493  1.00 0.00 ? 34  MET A CB   5  
ATOM   6103  C  CG   . MET A 1 34 ? 10.012  -0.188  -2.402  1.00 0.00 ? 34  MET A CG   5  
ATOM   6104  S  SD   . MET A 1 34 ? 8.221   0.033   -2.431  1.00 0.00 ? 34  MET A SD   5  
ATOM   6105  C  CE   . MET A 1 34 ? 7.964   1.036   -0.964  1.00 0.00 ? 34  MET A CE   5  
ATOM   6106  H  H    . MET A 1 34 ? 11.736  -2.322  -1.566  1.00 0.00 ? 34  MET A H    5  
ATOM   6107  H  HA   . MET A 1 34 ? 12.252  -2.184  -4.240  1.00 0.00 ? 34  MET A HA   5  
ATOM   6108  H  HB2  . MET A 1 34 ? 10.229  -0.747  -4.452  1.00 0.00 ? 34  MET A HB2  5  
ATOM   6109  H  HB3  . MET A 1 34 ? 9.990   -2.100  -3.363  1.00 0.00 ? 34  MET A HB3  5  
ATOM   6110  H  HG2  . MET A 1 34 ? 10.296  -0.578  -1.430  1.00 0.00 ? 34  MET A HG2  5  
ATOM   6111  H  HG3  . MET A 1 34 ? 10.481  0.780   -2.547  1.00 0.00 ? 34  MET A HG3  5  
ATOM   6112  H  HE1  . MET A 1 34 ? 6.906   1.218   -0.843  1.00 0.00 ? 34  MET A HE1  5  
ATOM   6113  H  HE2  . MET A 1 34 ? 8.480   1.980   -1.072  1.00 0.00 ? 34  MET A HE2  5  
ATOM   6114  H  HE3  . MET A 1 34 ? 8.339   0.513   -0.096  1.00 0.00 ? 34  MET A HE3  5  
ATOM   6115  N  N    . ILE A 1 35 ? 13.431  0.526   -2.930  1.00 0.00 ? 35  ILE A N    5  
ATOM   6116  C  CA   . ILE A 1 35 ? 14.294  1.689   -3.105  1.00 0.00 ? 35  ILE A CA   5  
ATOM   6117  C  C    . ILE A 1 35 ? 15.747  1.234   -3.478  1.00 0.00 ? 35  ILE A C    5  
ATOM   6118  O  O    . ILE A 1 35 ? 16.307  1.716   -4.469  1.00 0.00 ? 35  ILE A O    5  
ATOM   6119  C  CB   . ILE A 1 35 ? 14.237  2.615   -1.800  1.00 0.00 ? 35  ILE A CB   5  
ATOM   6120  C  CG1  . ILE A 1 35 ? 15.475  3.561   -1.676  1.00 0.00 ? 35  ILE A CG1  5  
ATOM   6121  C  CG2  . ILE A 1 35 ? 14.019  1.794   -0.504  1.00 0.00 ? 35  ILE A CG2  5  
ATOM   6122  C  CD1  . ILE A 1 35 ? 15.580  4.640   -2.747  1.00 0.00 ? 35  ILE A CD1  5  
ATOM   6123  H  H    . ILE A 1 35 ? 13.384  0.120   -2.061  1.00 0.00 ? 35  ILE A H    5  
ATOM   6124  H  HA   . ILE A 1 35 ? 13.900  2.270   -3.944  1.00 0.00 ? 35  ILE A HA   5  
ATOM   6125  H  HB   . ILE A 1 35 ? 13.356  3.245   -1.898  1.00 0.00 ? 35  ILE A HB   5  
ATOM   6126  H  HG12 . ILE A 1 35 ? 15.449  4.064   -0.720  1.00 0.00 ? 35  ILE A HG12 5  
ATOM   6127  H  HG13 . ILE A 1 35 ? 16.378  2.962   -1.725  1.00 0.00 ? 35  ILE A HG13 5  
ATOM   6128  H  HG21 . ILE A 1 35 ? 14.829  1.090   -0.379  1.00 0.00 ? 35  ILE A HG21 5  
ATOM   6129  H  HG22 . ILE A 1 35 ? 13.084  1.247   -0.573  1.00 0.00 ? 35  ILE A HG22 5  
ATOM   6130  H  HG23 . ILE A 1 35 ? 13.981  2.453   0.355   1.00 0.00 ? 35  ILE A HG23 5  
ATOM   6131  H  HD11 . ILE A 1 35 ? 14.706  5.281   -2.711  1.00 0.00 ? 35  ILE A HD11 5  
ATOM   6132  H  HD12 . ILE A 1 35 ? 15.649  4.181   -3.724  1.00 0.00 ? 35  ILE A HD12 5  
ATOM   6133  H  HD13 . ILE A 1 35 ? 16.464  5.233   -2.570  1.00 0.00 ? 35  ILE A HD13 5  
ATOM   6134  N  N    . HIS A 1 36 ? 16.331  0.281   -2.707  1.00 0.00 ? 36  HIS A N    5  
ATOM   6135  C  CA   . HIS A 1 36 ? 17.784  -0.089  -2.810  1.00 0.00 ? 36  HIS A CA   5  
ATOM   6136  C  C    . HIS A 1 36 ? 18.025  -1.394  -3.615  1.00 0.00 ? 36  HIS A C    5  
ATOM   6137  O  O    . HIS A 1 36 ? 19.175  -1.721  -3.918  1.00 0.00 ? 36  HIS A O    5  
ATOM   6138  C  CB   . HIS A 1 36 ? 18.439  -0.270  -1.384  1.00 0.00 ? 36  HIS A CB   5  
ATOM   6139  C  CG   . HIS A 1 36 ? 17.713  0.366   -0.226  1.00 0.00 ? 36  HIS A CG   5  
ATOM   6140  N  ND1  . HIS A 1 36 ? 17.892  1.665   0.171   1.00 0.00 ? 36  HIS A ND1  5  
ATOM   6141  C  CD2  . HIS A 1 36 ? 16.836  -0.174  0.657   1.00 0.00 ? 36  HIS A CD2  5  
ATOM   6142  C  CE1  . HIS A 1 36 ? 17.146  1.865   1.259   1.00 0.00 ? 36  HIS A CE1  5  
ATOM   6143  N  NE2  . HIS A 1 36 ? 16.477  0.774   1.601   1.00 0.00 ? 36  HIS A NE2  5  
ATOM   6144  H  H    . HIS A 1 36 ? 15.777  -0.197  -2.064  1.00 0.00 ? 36  HIS A H    5  
ATOM   6145  H  HA   . HIS A 1 36 ? 18.299  0.721   -3.326  1.00 0.00 ? 36  HIS A HA   5  
ATOM   6146  H  HB2  . HIS A 1 36 ? 18.536  -1.326  -1.151  1.00 0.00 ? 36  HIS A HB2  5  
ATOM   6147  H  HB3  . HIS A 1 36 ? 19.436  0.154   -1.402  1.00 0.00 ? 36  HIS A HB3  5  
ATOM   6148  H  HD1  . HIS A 1 36 ? 18.466  2.331   -0.266  1.00 0.00 ? 36  HIS A HD1  5  
ATOM   6149  H  HD2  . HIS A 1 36 ? 16.474  -1.190  0.645   1.00 0.00 ? 36  HIS A HD2  5  
ATOM   6150  H  HE1  . HIS A 1 36 ? 17.084  2.803   1.783   1.00 0.00 ? 36  HIS A HE1  5  
ATOM   6151  N  N    . THR A 1 37 ? 16.955  -2.145  -3.932  1.00 0.00 ? 37  THR A N    5  
ATOM   6152  C  CA   . THR A 1 37 ? 17.066  -3.577  -4.332  1.00 0.00 ? 37  THR A CA   5  
ATOM   6153  C  C    . THR A 1 37 ? 17.651  -3.786  -5.741  1.00 0.00 ? 37  THR A C    5  
ATOM   6154  O  O    . THR A 1 37 ? 18.463  -4.699  -5.946  1.00 0.00 ? 37  THR A O    5  
ATOM   6155  C  CB   . THR A 1 37 ? 15.683  -4.330  -4.217  1.00 0.00 ? 37  THR A CB   5  
ATOM   6156  O  OG1  . THR A 1 37 ? 15.811  -5.702  -4.635  1.00 0.00 ? 37  THR A OG1  5  
ATOM   6157  C  CG2  . THR A 1 37 ? 14.567  -3.653  -5.030  1.00 0.00 ? 37  THR A CG2  5  
ATOM   6158  H  H    . THR A 1 37 ? 16.070  -1.725  -3.918  1.00 0.00 ? 37  THR A H    5  
ATOM   6159  H  HA   . THR A 1 37 ? 17.740  -4.049  -3.619  1.00 0.00 ? 37  THR A HA   5  
ATOM   6160  H  HB   . THR A 1 37 ? 15.387  -4.326  -3.168  1.00 0.00 ? 37  THR A HB   5  
ATOM   6161  H  HG1  . THR A 1 37 ? 14.933  -6.095  -4.725  1.00 0.00 ? 37  THR A HG1  5  
ATOM   6162  H  HG21 . THR A 1 37 ? 14.833  -3.636  -6.081  1.00 0.00 ? 37  THR A HG21 5  
ATOM   6163  H  HG22 . THR A 1 37 ? 14.425  -2.640  -4.680  1.00 0.00 ? 37  THR A HG22 5  
ATOM   6164  H  HG23 . THR A 1 37 ? 13.642  -4.204  -4.903  1.00 0.00 ? 37  THR A HG23 5  
ATOM   6165  N  N    . GLY A 1 38 ? 17.223  -2.959  -6.715  1.00 0.00 ? 38  GLY A N    5  
ATOM   6166  C  CA   . GLY A 1 38 ? 17.459  -3.236  -8.139  1.00 0.00 ? 38  GLY A CA   5  
ATOM   6167  C  C    . GLY A 1 38 ? 16.434  -4.218  -8.739  1.00 0.00 ? 38  GLY A C    5  
ATOM   6168  O  O    . GLY A 1 38 ? 16.115  -4.139  -9.933  1.00 0.00 ? 38  GLY A O    5  
ATOM   6169  H  H    . GLY A 1 38 ? 16.783  -2.119  -6.483  1.00 0.00 ? 38  GLY A H    5  
ATOM   6170  H  HA2  . GLY A 1 38 ? 17.398  -2.295  -8.666  1.00 0.00 ? 38  GLY A HA2  5  
ATOM   6171  H  HA3  . GLY A 1 38 ? 18.457  -3.646  -8.278  1.00 0.00 ? 38  GLY A HA3  5  
ATOM   6172  N  N    . GLU A 1 39 ? 15.909  -5.132  -7.900  1.00 0.00 ? 39  GLU A N    5  
ATOM   6173  C  CA   . GLU A 1 39 ? 14.909  -6.142  -8.268  1.00 0.00 ? 39  GLU A CA   5  
ATOM   6174  C  C    . GLU A 1 39 ? 13.568  -5.735  -7.638  1.00 0.00 ? 39  GLU A C    5  
ATOM   6175  O  O    . GLU A 1 39 ? 13.209  -6.220  -6.554  1.00 0.00 ? 39  GLU A O    5  
ATOM   6176  C  CB   . GLU A 1 39 ? 15.364  -7.533  -7.732  1.00 0.00 ? 39  GLU A CB   5  
ATOM   6177  C  CG   . GLU A 1 39 ? 16.801  -7.928  -8.109  1.00 0.00 ? 39  GLU A CG   5  
ATOM   6178  C  CD   . GLU A 1 39 ? 17.275  -9.196  -7.380  1.00 0.00 ? 39  GLU A CD   5  
ATOM   6179  O  OE1  . GLU A 1 39 ? 16.922  -10.312 -7.827  1.00 0.00 ? 39  GLU A OE1  5  
ATOM   6180  O  OE2  . GLU A 1 39 ? 17.980  -9.081  -6.348  1.00 0.00 ? 39  GLU A OE2  5  
ATOM   6181  H  H    . GLU A 1 39 ? 16.205  -5.152  -6.976  1.00 0.00 ? 39  GLU A H    5  
ATOM   6182  H  HA   . GLU A 1 39 ? 14.808  -6.183  -9.350  1.00 0.00 ? 39  GLU A HA   5  
ATOM   6183  H  HB2  . GLU A 1 39 ? 15.293  -7.529  -6.645  1.00 0.00 ? 39  GLU A HB2  5  
ATOM   6184  H  HB3  . GLU A 1 39 ? 14.687  -8.297  -8.115  1.00 0.00 ? 39  GLU A HB3  5  
ATOM   6185  H  HG2  . GLU A 1 39 ? 16.848  -8.097  -9.179  1.00 0.00 ? 39  GLU A HG2  5  
ATOM   6186  H  HG3  . GLU A 1 39 ? 17.467  -7.103  -7.856  1.00 0.00 ? 39  GLU A HG3  5  
ATOM   6187  N  N    . LYS A 1 40 ? 12.899  -4.753  -8.267  1.00 0.00 ? 40  LYS A N    5  
ATOM   6188  C  CA   . LYS A 1 40 ? 11.597  -4.200  -7.797  1.00 0.00 ? 40  LYS A CA   5  
ATOM   6189  C  C    . LYS A 1 40 ? 10.565  -5.324  -7.476  1.00 0.00 ? 40  LYS A C    5  
ATOM   6190  O  O    . LYS A 1 40 ? 10.431  -6.278  -8.259  1.00 0.00 ? 40  LYS A O    5  
ATOM   6191  C  CB   . LYS A 1 40 ? 11.032  -3.206  -8.855  1.00 0.00 ? 40  LYS A CB   5  
ATOM   6192  C  CG   . LYS A 1 40 ? 10.794  -3.826  -10.252 1.00 0.00 ? 40  LYS A CG   5  
ATOM   6193  C  CD   . LYS A 1 40 ? 10.464  -2.776  -11.342 1.00 0.00 ? 40  LYS A CD   5  
ATOM   6194  C  CE   . LYS A 1 40 ? 11.619  -1.787  -11.608 1.00 0.00 ? 40  LYS A CE   5  
ATOM   6195  N  NZ   . LYS A 1 40 ? 12.856  -2.475  -12.074 1.00 0.00 ? 40  LYS A NZ   5  
ATOM   6196  H  H    . LYS A 1 40 ? 13.312  -4.356  -9.063  1.00 0.00 ? 40  LYS A H    5  
ATOM   6197  H  HA   . LYS A 1 40 ? 11.808  -3.649  -6.884  1.00 0.00 ? 40  LYS A HA   5  
ATOM   6198  H  HB2  . LYS A 1 40 ? 10.090  -2.805  -8.494  1.00 0.00 ? 40  LYS A HB2  5  
ATOM   6199  H  HB3  . LYS A 1 40 ? 11.737  -2.387  -8.963  1.00 0.00 ? 40  LYS A HB3  5  
ATOM   6200  H  HG2  . LYS A 1 40 ? 11.681  -4.369  -10.549 1.00 0.00 ? 40  LYS A HG2  5  
ATOM   6201  H  HG3  . LYS A 1 40 ? 9.963   -4.526  -10.178 1.00 0.00 ? 40  LYS A HG3  5  
ATOM   6202  H  HD2  . LYS A 1 40 ? 10.240  -3.294  -12.268 1.00 0.00 ? 40  LYS A HD2  5  
ATOM   6203  H  HD3  . LYS A 1 40 ? 9.586   -2.216  -11.033 1.00 0.00 ? 40  LYS A HD3  5  
ATOM   6204  H  HE2  . LYS A 1 40 ? 11.312  -1.082  -12.369 1.00 0.00 ? 40  LYS A HE2  5  
ATOM   6205  H  HE3  . LYS A 1 40 ? 11.845  -1.247  -10.697 1.00 0.00 ? 40  LYS A HE3  5  
ATOM   6206  H  HZ1  . LYS A 1 40 ? 13.193  -3.147  -11.351 1.00 0.00 ? 40  LYS A HZ1  5  
ATOM   6207  H  HZ2  . LYS A 1 40 ? 13.606  -1.780  -12.253 1.00 0.00 ? 40  LYS A HZ2  5  
ATOM   6208  H  HZ3  . LYS A 1 40 ? 12.669  -2.997  -12.954 1.00 0.00 ? 40  LYS A HZ3  5  
ATOM   6209  N  N    . PRO A 1 41 ? 9.854   -5.262  -6.292  1.00 0.00 ? 41  PRO A N    5  
ATOM   6210  C  CA   . PRO A 1 41 ? 8.864   -6.291  -5.898  1.00 0.00 ? 41  PRO A CA   5  
ATOM   6211  C  C    . PRO A 1 41 ? 7.596   -6.217  -6.768  1.00 0.00 ? 41  PRO A C    5  
ATOM   6212  O  O    . PRO A 1 41 ? 7.490   -5.381  -7.674  1.00 0.00 ? 41  PRO A O    5  
ATOM   6213  C  CB   . PRO A 1 41 ? 8.584   -5.969  -4.403  1.00 0.00 ? 41  PRO A CB   5  
ATOM   6214  C  CG   . PRO A 1 41 ? 8.795   -4.494  -4.311  1.00 0.00 ? 41  PRO A CG   5  
ATOM   6215  C  CD   . PRO A 1 41 ? 9.946   -4.192  -5.263  1.00 0.00 ? 41  PRO A CD   5  
ATOM   6216  H  HA   . PRO A 1 41 ? 9.282   -7.289  -5.986  1.00 0.00 ? 41  PRO A HA   5  
ATOM   6217  H  HB2  . PRO A 1 41 ? 7.570   -6.251  -4.134  1.00 0.00 ? 41  PRO A HB2  5  
ATOM   6218  H  HB3  . PRO A 1 41 ? 9.286   -6.511  -3.770  1.00 0.00 ? 41  PRO A HB3  5  
ATOM   6219  H  HG2  . PRO A 1 41 ? 7.891   -3.967  -4.615  1.00 0.00 ? 41  PRO A HG2  5  
ATOM   6220  H  HG3  . PRO A 1 41 ? 9.060   -4.219  -3.296  1.00 0.00 ? 41  PRO A HG3  5  
ATOM   6221  H  HD2  . PRO A 1 41 ? 9.822   -3.219  -5.714  1.00 0.00 ? 41  PRO A HD2  5  
ATOM   6222  H  HD3  . PRO A 1 41 ? 10.896  -4.242  -4.741  1.00 0.00 ? 41  PRO A HD3  5  
ATOM   6223  N  N    . LEU A 1 42 ? 6.638   -7.087  -6.467  1.00 0.00 ? 42  LEU A N    5  
ATOM   6224  C  CA   . LEU A 1 42 ? 5.460   -7.304  -7.299  1.00 0.00 ? 42  LEU A CA   5  
ATOM   6225  C  C    . LEU A 1 42 ? 4.283   -6.567  -6.650  1.00 0.00 ? 42  LEU A C    5  
ATOM   6226  O  O    . LEU A 1 42 ? 3.589   -7.110  -5.786  1.00 0.00 ? 42  LEU A O    5  
ATOM   6227  C  CB   . LEU A 1 42 ? 5.192   -8.835  -7.461  1.00 0.00 ? 42  LEU A CB   5  
ATOM   6228  C  CG   . LEU A 1 42 ? 6.371   -9.692  -8.058  1.00 0.00 ? 42  LEU A CG   5  
ATOM   6229  C  CD1  . LEU A 1 42 ? 7.492   -9.960  -7.020  1.00 0.00 ? 42  LEU A CD1  5  
ATOM   6230  C  CD2  . LEU A 1 42 ? 5.858   -11.011 -8.682  1.00 0.00 ? 42  LEU A CD2  5  
ATOM   6231  H  H    . LEU A 1 42 ? 6.684   -7.566  -5.619  1.00 0.00 ? 42  LEU A H    5  
ATOM   6232  H  HA   . LEU A 1 42 ? 5.639   -6.875  -8.285  1.00 0.00 ? 42  LEU A HA   5  
ATOM   6233  H  HB2  . LEU A 1 42 ? 4.941   -9.239  -6.484  1.00 0.00 ? 42  LEU A HB2  5  
ATOM   6234  H  HB3  . LEU A 1 42 ? 4.325   -8.949  -8.105  1.00 0.00 ? 42  LEU A HB3  5  
ATOM   6235  H  HG   . LEU A 1 42 ? 6.829   -9.119  -8.852  1.00 0.00 ? 42  LEU A HG   5  
ATOM   6236  H  HD11 . LEU A 1 42 ? 7.884   -9.017  -6.664  1.00 0.00 ? 42  LEU A HD11 5  
ATOM   6237  H  HD12 . LEU A 1 42 ? 8.294   -10.522 -7.481  1.00 0.00 ? 42  LEU A HD12 5  
ATOM   6238  H  HD13 . LEU A 1 42 ? 7.095   -10.521 -6.183  1.00 0.00 ? 42  LEU A HD13 5  
ATOM   6239  H  HD21 . LEU A 1 42 ? 5.146   -10.787 -9.466  1.00 0.00 ? 42  LEU A HD21 5  
ATOM   6240  H  HD22 . LEU A 1 42 ? 5.375   -11.619 -7.925  1.00 0.00 ? 42  LEU A HD22 5  
ATOM   6241  H  HD23 . LEU A 1 42 ? 6.687   -11.564 -9.108  1.00 0.00 ? 42  LEU A HD23 5  
ATOM   6242  N  N    . GLN A 1 43 ? 4.103   -5.294  -7.043  1.00 0.00 ? 43  GLN A N    5  
ATOM   6243  C  CA   . GLN A 1 43 ? 3.133   -4.380  -6.419  1.00 0.00 ? 43  GLN A CA   5  
ATOM   6244  C  C    . GLN A 1 43 ? 2.136   -3.871  -7.467  1.00 0.00 ? 43  GLN A C    5  
ATOM   6245  O  O    . GLN A 1 43 ? 2.498   -3.621  -8.621  1.00 0.00 ? 43  GLN A O    5  
ATOM   6246  C  CB   . GLN A 1 43 ? 3.858   -3.174  -5.755  1.00 0.00 ? 43  GLN A CB   5  
ATOM   6247  C  CG   . GLN A 1 43 ? 2.920   -2.158  -5.051  1.00 0.00 ? 43  GLN A CG   5  
ATOM   6248  C  CD   . GLN A 1 43 ? 3.648   -0.966  -4.425  1.00 0.00 ? 43  GLN A CD   5  
ATOM   6249  O  OE1  . GLN A 1 43 ? 4.798   -1.073  -3.990  1.00 0.00 ? 43  GLN A OE1  5  
ATOM   6250  N  NE2  . GLN A 1 43 ? 2.979   0.185   -4.372  1.00 0.00 ? 43  GLN A NE2  5  
ATOM   6251  H  H    . GLN A 1 43 ? 4.616   -4.960  -7.810  1.00 0.00 ? 43  GLN A H    5  
ATOM   6252  H  HA   . GLN A 1 43 ? 2.586   -4.930  -5.649  1.00 0.00 ? 43  GLN A HA   5  
ATOM   6253  H  HB2  . GLN A 1 43 ? 4.554   -3.560  -5.016  1.00 0.00 ? 43  GLN A HB2  5  
ATOM   6254  H  HB3  . GLN A 1 43 ? 4.427   -2.646  -6.516  1.00 0.00 ? 43  GLN A HB3  5  
ATOM   6255  H  HG2  . GLN A 1 43 ? 2.208   -1.779  -5.777  1.00 0.00 ? 43  GLN A HG2  5  
ATOM   6256  H  HG3  . GLN A 1 43 ? 2.376   -2.677  -4.269  1.00 0.00 ? 43  GLN A HG3  5  
ATOM   6257  H  HE21 . GLN A 1 43 ? 2.072   0.208   -4.737  1.00 0.00 ? 43  GLN A HE21 5  
ATOM   6258  H  HE22 . GLN A 1 43 ? 3.428   0.965   -3.980  1.00 0.00 ? 43  GLN A HE22 5  
ATOM   6259  N  N    . CYS A 1 44 ? 0.884   -3.728  -7.028  1.00 0.00 ? 44  CYS A N    5  
ATOM   6260  C  CA   . CYS A 1 44 ? -0.202  -3.151  -7.806  1.00 0.00 ? 44  CYS A CA   5  
ATOM   6261  C  C    . CYS A 1 44 ? 0.031   -1.646  -7.984  1.00 0.00 ? 44  CYS A C    5  
ATOM   6262  O  O    . CYS A 1 44 ? -0.108  -0.874  -7.027  1.00 0.00 ? 44  CYS A O    5  
ATOM   6263  C  CB   . CYS A 1 44 ? -1.540  -3.394  -7.090  1.00 0.00 ? 44  CYS A CB   5  
ATOM   6264  S  SG   . CYS A 1 44 ? -2.994  -2.662  -7.908  1.00 0.00 ? 44  CYS A SG   5  
ATOM   6265  H  H    . CYS A 1 44 ? 0.690   -4.019  -6.130  1.00 0.00 ? 44  CYS A H    5  
ATOM   6266  H  HA   . CYS A 1 44 ? -0.225  -3.646  -8.776  1.00 0.00 ? 44  CYS A HA   5  
ATOM   6267  H  HB2  . CYS A 1 44 ? -1.717  -4.459  -7.022  1.00 0.00 ? 44  CYS A HB2  5  
ATOM   6268  H  HB3  . CYS A 1 44 ? -1.496  -2.980  -6.089  1.00 0.00 ? 44  CYS A HB3  5  
ATOM   6269  N  N    . GLU A 1 45 ? 0.386   -1.242  -9.213  1.00 0.00 ? 45  GLU A N    5  
ATOM   6270  C  CA   . GLU A 1 45 ? 0.650   0.163   -9.569  1.00 0.00 ? 45  GLU A CA   5  
ATOM   6271  C  C    . GLU A 1 45 ? -0.654  0.782   -10.122 1.00 0.00 ? 45  GLU A C    5  
ATOM   6272  O  O    . GLU A 1 45 ? -0.697  1.422   -11.181 1.00 0.00 ? 45  GLU A O    5  
ATOM   6273  C  CB   . GLU A 1 45 ? 1.825   0.230   -10.588 1.00 0.00 ? 45  GLU A CB   5  
ATOM   6274  C  CG   . GLU A 1 45 ? 2.377   1.651   -10.853 1.00 0.00 ? 45  GLU A CG   5  
ATOM   6275  C  CD   . GLU A 1 45 ? 3.510   1.685   -11.891 1.00 0.00 ? 45  GLU A CD   5  
ATOM   6276  O  OE1  . GLU A 1 45 ? 3.219   1.681   -13.107 1.00 0.00 ? 45  GLU A OE1  5  
ATOM   6277  O  OE2  . GLU A 1 45 ? 4.699   1.714   -11.493 1.00 0.00 ? 45  GLU A OE2  5  
ATOM   6278  H  H    . GLU A 1 45 ? 0.465   -1.914  -9.915  1.00 0.00 ? 45  GLU A H    5  
ATOM   6279  H  HA   . GLU A 1 45 ? 0.931   0.701   -8.664  1.00 0.00 ? 45  GLU A HA   5  
ATOM   6280  H  HB2  . GLU A 1 45 ? 2.632   -0.384  -10.217 1.00 0.00 ? 45  GLU A HB2  5  
ATOM   6281  H  HB3  . GLU A 1 45 ? 1.484   -0.181  -11.531 1.00 0.00 ? 45  GLU A HB3  5  
ATOM   6282  H  HG2  . GLU A 1 45 ? 1.564   2.276   -11.212 1.00 0.00 ? 45  GLU A HG2  5  
ATOM   6283  H  HG3  . GLU A 1 45 ? 2.737   2.063   -9.914  1.00 0.00 ? 45  GLU A HG3  5  
ATOM   6284  N  N    . ILE A 1 46 ? -1.727  0.547   -9.357  1.00 0.00 ? 46  ILE A N    5  
ATOM   6285  C  CA   . ILE A 1 46 ? -3.086  1.044   -9.609  1.00 0.00 ? 46  ILE A CA   5  
ATOM   6286  C  C    . ILE A 1 46 ? -3.576  1.778   -8.328  1.00 0.00 ? 46  ILE A C    5  
ATOM   6287  O  O    . ILE A 1 46 ? -4.535  2.553   -8.362  1.00 0.00 ? 46  ILE A O    5  
ATOM   6288  C  CB   . ILE A 1 46 ? -4.065  -0.160  -9.923  1.00 0.00 ? 46  ILE A CB   5  
ATOM   6289  C  CG1  . ILE A 1 46 ? -3.553  -1.032  -11.117 1.00 0.00 ? 46  ILE A CG1  5  
ATOM   6290  C  CG2  . ILE A 1 46 ? -5.515  0.324   -10.174 1.00 0.00 ? 46  ILE A CG2  5  
ATOM   6291  C  CD1  . ILE A 1 46 ? -3.390  -0.289  -12.433 1.00 0.00 ? 46  ILE A CD1  5  
ATOM   6292  H  H    . ILE A 1 46 ? -1.608  0.032   -8.544  1.00 0.00 ? 46  ILE A H    5  
ATOM   6293  H  HA   . ILE A 1 46 ? -3.073  1.729   -10.453 1.00 0.00 ? 46  ILE A HA   5  
ATOM   6294  H  HB   . ILE A 1 46 ? -4.090  -0.786  -9.031  1.00 0.00 ? 46  ILE A HB   5  
ATOM   6295  H  HG12 . ILE A 1 46 ? -2.583  -1.444  -10.865 1.00 0.00 ? 46  ILE A HG12 5  
ATOM   6296  H  HG13 . ILE A 1 46 ? -4.243  -1.854  -11.282 1.00 0.00 ? 46  ILE A HG13 5  
ATOM   6297  H  HG21 . ILE A 1 46 ? -6.152  -0.523  -10.398 1.00 0.00 ? 46  ILE A HG21 5  
ATOM   6298  H  HG22 . ILE A 1 46 ? -5.538  1.019   -11.003 1.00 0.00 ? 46  ILE A HG22 5  
ATOM   6299  H  HG23 . ILE A 1 46 ? -5.889  0.819   -9.281  1.00 0.00 ? 46  ILE A HG23 5  
ATOM   6300  H  HD11 . ILE A 1 46 ? -2.629  0.471   -12.318 1.00 0.00 ? 46  ILE A HD11 5  
ATOM   6301  H  HD12 . ILE A 1 46 ? -4.327  0.175   -12.719 1.00 0.00 ? 46  ILE A HD12 5  
ATOM   6302  H  HD13 . ILE A 1 46 ? -3.087  -0.985  -13.196 1.00 0.00 ? 46  ILE A HD13 5  
ATOM   6303  N  N    . CYS A 1 47 ? -2.797  1.632   -7.237  1.00 0.00 ? 47  CYS A N    5  
ATOM   6304  C  CA   . CYS A 1 47 ? -3.218  1.905   -5.871  1.00 0.00 ? 47  CYS A CA   5  
ATOM   6305  C  C    . CYS A 1 47 ? -1.961  1.565   -5.054  1.00 0.00 ? 47  CYS A C    5  
ATOM   6306  O  O    . CYS A 1 47 ? -0.896  2.137   -5.315  1.00 0.00 ? 47  CYS A O    5  
ATOM   6307  C  CB   . CYS A 1 47 ? -4.531  1.110   -5.485  1.00 0.00 ? 47  CYS A CB   5  
ATOM   6308  S  SG   . CYS A 1 47 ? -4.331  -0.638  -4.979  1.00 0.00 ? 47  CYS A SG   5  
ATOM   6309  H  H    . CYS A 1 47 ? -1.837  1.573   -7.368  1.00 0.00 ? 47  CYS A H    5  
ATOM   6310  H  HA   . CYS A 1 47 ? -3.393  2.979   -5.773  1.00 0.00 ? 47  CYS A HA   5  
ATOM   6311  H  HB2  . CYS A 1 47 ? -5.020  1.617   -4.666  1.00 0.00 ? 47  CYS A HB2  5  
ATOM   6312  H  HB3  . CYS A 1 47 ? -5.201  1.121   -6.337  1.00 0.00 ? 47  CYS A HB3  5  
ATOM   6313  N  N    . GLY A 1 48 ? -2.053  0.676   -4.099  1.00 0.00 ? 48  GLY A N    5  
ATOM   6314  C  CA   . GLY A 1 48 ? -0.901  -0.040  -3.563  1.00 0.00 ? 48  GLY A CA   5  
ATOM   6315  C  C    . GLY A 1 48 ? -1.351  -1.419  -3.087  1.00 0.00 ? 48  GLY A C    5  
ATOM   6316  O  O    . GLY A 1 48 ? -2.461  -1.499  -2.544  1.00 0.00 ? 48  GLY A O    5  
ATOM   6317  H  H    . GLY A 1 48 ? -2.920  0.409   -3.790  1.00 0.00 ? 48  GLY A H    5  
ATOM   6318  H  HA2  . GLY A 1 48 ? -0.157  -0.142  -4.350  1.00 0.00 ? 48  GLY A HA2  5  
ATOM   6319  H  HA3  . GLY A 1 48 ? -0.484  0.512   -2.734  1.00 0.00 ? 48  GLY A HA3  5  
ATOM   6320  N  N    . PHE A 1 49 ? -0.543  -2.505  -3.230  1.00 0.00 ? 49  PHE A N    5  
ATOM   6321  C  CA   . PHE A 1 49 ? -0.886  -3.864  -2.781  1.00 0.00 ? 49  PHE A CA   5  
ATOM   6322  C  C    . PHE A 1 49 ? 0.305   -4.685  -3.234  1.00 0.00 ? 49  PHE A C    5  
ATOM   6323  O  O    . PHE A 1 49 ? 0.491   -4.855  -4.439  1.00 0.00 ? 49  PHE A O    5  
ATOM   6324  C  CB   . PHE A 1 49 ? -2.196  -4.411  -3.421  1.00 0.00 ? 49  PHE A CB   5  
ATOM   6325  C  CG   . PHE A 1 49 ? -2.512  -5.876  -3.095  1.00 0.00 ? 49  PHE A CG   5  
ATOM   6326  C  CD1  . PHE A 1 49 ? -3.256  -6.217  -1.972  1.00 0.00 ? 49  PHE A CD1  5  
ATOM   6327  C  CD2  . PHE A 1 49 ? -2.057  -6.907  -3.919  1.00 0.00 ? 49  PHE A CD2  5  
ATOM   6328  C  CE1  . PHE A 1 49 ? -3.534  -7.539  -1.680  1.00 0.00 ? 49  PHE A CE1  5  
ATOM   6329  C  CE2  . PHE A 1 49 ? -2.333  -8.227  -3.627  1.00 0.00 ? 49  PHE A CE2  5  
ATOM   6330  C  CZ   . PHE A 1 49 ? -3.071  -8.543  -2.506  1.00 0.00 ? 49  PHE A CZ   5  
ATOM   6331  H  H    . PHE A 1 49 ? 0.385   -2.481  -3.562  1.00 0.00 ? 49  PHE A H    5  
ATOM   6332  H  HA   . PHE A 1 49 ? -0.955  -3.875  -1.697  1.00 0.00 ? 49  PHE A HA   5  
ATOM   6333  H  HB2  . PHE A 1 49 ? -3.026  -3.808  -3.076  1.00 0.00 ? 49  PHE A HB2  5  
ATOM   6334  H  HB3  . PHE A 1 49 ? -2.126  -4.310  -4.497  1.00 0.00 ? 49  PHE A HB3  5  
ATOM   6335  H  HD1  . PHE A 1 49 ? -3.620  -5.436  -1.319  1.00 0.00 ? 49  PHE A HD1  5  
ATOM   6336  H  HD2  . PHE A 1 49 ? -1.478  -6.659  -4.801  1.00 0.00 ? 49  PHE A HD2  5  
ATOM   6337  H  HE1  . PHE A 1 49 ? -4.115  -7.789  -0.800  1.00 0.00 ? 49  PHE A HE1  5  
ATOM   6338  H  HE2  . PHE A 1 49 ? -1.970  -9.015  -4.277  1.00 0.00 ? 49  PHE A HE2  5  
ATOM   6339  H  HZ   . PHE A 1 49 ? -3.286  -9.577  -2.271  1.00 0.00 ? 49  PHE A HZ   5  
ATOM   6340  N  N    . THR A 1 50 ? 1.106   -5.206  -2.315  1.00 0.00 ? 50  THR A N    5  
ATOM   6341  C  CA   . THR A 1 50 ? 2.366   -5.846  -2.680  1.00 0.00 ? 50  THR A CA   5  
ATOM   6342  C  C    . THR A 1 50 ? 2.347   -7.313  -2.241  1.00 0.00 ? 50  THR A C    5  
ATOM   6343  O  O    . THR A 1 50 ? 1.709   -7.674  -1.244  1.00 0.00 ? 50  THR A O    5  
ATOM   6344  C  CB   . THR A 1 50 ? 3.597   -5.112  -2.055  1.00 0.00 ? 50  THR A CB   5  
ATOM   6345  O  OG1  . THR A 1 50 ? 3.389   -3.688  -2.099  1.00 0.00 ? 50  THR A OG1  5  
ATOM   6346  C  CG2  . THR A 1 50 ? 4.911   -5.451  -2.801  1.00 0.00 ? 50  THR A CG2  5  
ATOM   6347  H  H    . THR A 1 50 ? 0.850   -5.185  -1.376  1.00 0.00 ? 50  THR A H    5  
ATOM   6348  H  HA   . THR A 1 50 ? 2.458   -5.792  -3.770  1.00 0.00 ? 50  THR A HA   5  
ATOM   6349  H  HB   . THR A 1 50 ? 3.698   -5.414  -1.023  1.00 0.00 ? 50  THR A HB   5  
ATOM   6350  H  HG1  . THR A 1 50 ? 2.624   -3.457  -1.548  1.00 0.00 ? 50  THR A HG1  5  
ATOM   6351  H  HG21 . THR A 1 50 ? 5.737   -4.919  -2.346  1.00 0.00 ? 50  THR A HG21 5  
ATOM   6352  H  HG22 . THR A 1 50 ? 4.834   -5.157  -3.840  1.00 0.00 ? 50  THR A HG22 5  
ATOM   6353  H  HG23 . THR A 1 50 ? 5.099   -6.518  -2.748  1.00 0.00 ? 50  THR A HG23 5  
ATOM   6354  N  N    . CYS A 1 51 ? 3.034   -8.135  -3.016  1.00 0.00 ? 51  CYS A N    5  
ATOM   6355  C  CA   . CYS A 1 51 ? 3.191   -9.572  -2.770  1.00 0.00 ? 51  CYS A CA   5  
ATOM   6356  C  C    . CYS A 1 51 ? 4.512   -10.074 -3.374  1.00 0.00 ? 51  CYS A C    5  
ATOM   6357  O  O    . CYS A 1 51 ? 5.196   -9.346  -4.108  1.00 0.00 ? 51  CYS A O    5  
ATOM   6358  C  CB   . CYS A 1 51 ? 1.998   -10.354 -3.370  1.00 0.00 ? 51  CYS A CB   5  
ATOM   6359  S  SG   . CYS A 1 51 ? 0.395   -9.994  -2.608  1.00 0.00 ? 51  CYS A SG   5  
ATOM   6360  H  H    . CYS A 1 51 ? 3.447   -7.747  -3.807  1.00 0.00 ? 51  CYS A H    5  
ATOM   6361  H  HA   . CYS A 1 51 ? 3.215   -9.735  -1.694  1.00 0.00 ? 51  CYS A HA   5  
ATOM   6362  H  HB2  . CYS A 1 51 ? 1.907   -10.123 -4.421  1.00 0.00 ? 51  CYS A HB2  5  
ATOM   6363  H  HB3  . CYS A 1 51 ? 2.173   -11.420 -3.260  1.00 0.00 ? 51  CYS A HB3  5  
ATOM   6364  H  HG   . CYS A 1 51 ? 0.232   -8.681  -2.578  1.00 0.00 ? 51  CYS A HG   5  
ATOM   6365  N  N    . ARG A 1 52 ? 4.878   -11.316 -3.020  1.00 0.00 ? 52  ARG A N    5  
ATOM   6366  C  CA   . ARG A 1 52 ? 5.987   -12.046 -3.651  1.00 0.00 ? 52  ARG A CA   5  
ATOM   6367  C  C    . ARG A 1 52 ? 5.496   -12.744 -4.935  1.00 0.00 ? 52  ARG A C    5  
ATOM   6368  O  O    . ARG A 1 52 ? 6.221   -12.820 -5.926  1.00 0.00 ? 52  ARG A O    5  
ATOM   6369  C  CB   . ARG A 1 52 ? 6.576   -13.095 -2.666  1.00 0.00 ? 52  ARG A CB   5  
ATOM   6370  C  CG   . ARG A 1 52 ? 7.782   -13.883 -3.235  1.00 0.00 ? 52  ARG A CG   5  
ATOM   6371  C  CD   . ARG A 1 52 ? 8.377   -14.909 -2.260  1.00 0.00 ? 52  ARG A CD   5  
ATOM   6372  N  NE   . ARG A 1 52 ? 9.638   -15.459 -2.787  1.00 0.00 ? 52  ARG A NE   5  
ATOM   6373  C  CZ   . ARG A 1 52 ? 10.578  -16.078 -2.071  1.00 0.00 ? 52  ARG A CZ   5  
ATOM   6374  N  NH1  . ARG A 1 52 ? 10.382  -16.355 -0.786  1.00 0.00 ? 52  ARG A NH1  5  
ATOM   6375  N  NH2  . ARG A 1 52 ? 11.710  -16.426 -2.651  1.00 0.00 ? 52  ARG A NH2  5  
ATOM   6376  H  H    . ARG A 1 52 ? 4.386   -11.756 -2.294  1.00 0.00 ? 52  ARG A H    5  
ATOM   6377  H  HA   . ARG A 1 52 ? 6.766   -11.331 -3.912  1.00 0.00 ? 52  ARG A HA   5  
ATOM   6378  H  HB2  . ARG A 1 52 ? 6.898   -12.577 -1.768  1.00 0.00 ? 52  ARG A HB2  5  
ATOM   6379  H  HB3  . ARG A 1 52 ? 5.796   -13.803 -2.394  1.00 0.00 ? 52  ARG A HB3  5  
ATOM   6380  H  HG2  . ARG A 1 52 ? 7.470   -14.405 -4.129  1.00 0.00 ? 52  ARG A HG2  5  
ATOM   6381  H  HG3  . ARG A 1 52 ? 8.557   -13.169 -3.499  1.00 0.00 ? 52  ARG A HG3  5  
ATOM   6382  H  HD2  . ARG A 1 52 ? 8.570   -14.427 -1.305  1.00 0.00 ? 52  ARG A HD2  5  
ATOM   6383  H  HD3  . ARG A 1 52 ? 7.672   -15.721 -2.117  1.00 0.00 ? 52  ARG A HD3  5  
ATOM   6384  H  HE   . ARG A 1 52 ? 9.812   -15.320 -3.747  1.00 0.00 ? 52  ARG A HE   5  
ATOM   6385  H  HH11 . ARG A 1 52 ? 9.522   -16.102 -0.339  1.00 0.00 ? 52  ARG A HH11 5  
ATOM   6386  H  HH12 . ARG A 1 52 ? 11.105  -16.799 -0.249  1.00 0.00 ? 52  ARG A HH12 5  
ATOM   6387  H  HH21 . ARG A 1 52 ? 11.867  -16.216 -3.619  1.00 0.00 ? 52  ARG A HH21 5  
ATOM   6388  H  HH22 . ARG A 1 52 ? 12.416  -16.910 -2.127  1.00 0.00 ? 52  ARG A HH22 5  
ATOM   6389  N  N    . GLN A 1 53 ? 4.249   -13.240 -4.893  1.00 0.00 ? 53  GLN A N    5  
ATOM   6390  C  CA   . GLN A 1 53 ? 3.661   -14.049 -5.972  1.00 0.00 ? 53  GLN A CA   5  
ATOM   6391  C  C    . GLN A 1 53 ? 2.901   -13.130 -6.939  1.00 0.00 ? 53  GLN A C    5  
ATOM   6392  O  O    . GLN A 1 53 ? 2.093   -12.304 -6.499  1.00 0.00 ? 53  GLN A O    5  
ATOM   6393  C  CB   . GLN A 1 53 ? 2.709   -15.131 -5.385  1.00 0.00 ? 53  GLN A CB   5  
ATOM   6394  C  CG   . GLN A 1 53 ? 3.279   -15.943 -4.195  1.00 0.00 ? 53  GLN A CG   5  
ATOM   6395  C  CD   . GLN A 1 53 ? 4.614   -16.653 -4.475  1.00 0.00 ? 53  GLN A CD   5  
ATOM   6396  O  OE1  . GLN A 1 53 ? 4.909   -17.046 -5.601  1.00 0.00 ? 53  GLN A OE1  5  
ATOM   6397  N  NE2  . GLN A 1 53 ? 5.429   -16.829 -3.442  1.00 0.00 ? 53  GLN A NE2  5  
ATOM   6398  H  H    . GLN A 1 53 ? 3.681   -13.005 -4.132  1.00 0.00 ? 53  GLN A H    5  
ATOM   6399  H  HA   . GLN A 1 53 ? 4.467   -14.544 -6.508  1.00 0.00 ? 53  GLN A HA   5  
ATOM   6400  H  HB2  . GLN A 1 53 ? 1.797   -14.645 -5.045  1.00 0.00 ? 53  GLN A HB2  5  
ATOM   6401  H  HB3  . GLN A 1 53 ? 2.445   -15.829 -6.176  1.00 0.00 ? 53  GLN A HB3  5  
ATOM   6402  H  HG2  . GLN A 1 53 ? 3.422   -15.268 -3.359  1.00 0.00 ? 53  GLN A HG2  5  
ATOM   6403  H  HG3  . GLN A 1 53 ? 2.550   -16.693 -3.910  1.00 0.00 ? 53  GLN A HG3  5  
ATOM   6404  H  HE21 . GLN A 1 53 ? 5.146   -16.499 -2.566  1.00 0.00 ? 53  GLN A HE21 5  
ATOM   6405  H  HE22 . GLN A 1 53 ? 6.278   -17.299 -3.595  1.00 0.00 ? 53  GLN A HE22 5  
ATOM   6406  N  N    . LYS A 1 54 ? 3.176   -13.277 -8.248  1.00 0.00 ? 54  LYS A N    5  
ATOM   6407  C  CA   . LYS A 1 54 ? 2.554   -12.458 -9.315  1.00 0.00 ? 54  LYS A CA   5  
ATOM   6408  C  C    . LYS A 1 54 ? 1.031   -12.666 -9.331  1.00 0.00 ? 54  LYS A C    5  
ATOM   6409  O  O    . LYS A 1 54 ? 0.280   -11.705 -9.483  1.00 0.00 ? 54  LYS A O    5  
ATOM   6410  C  CB   . LYS A 1 54 ? 3.190   -12.789 -10.704 1.00 0.00 ? 54  LYS A CB   5  
ATOM   6411  C  CG   . LYS A 1 54 ? 3.096   -11.675 -11.796 1.00 0.00 ? 54  LYS A CG   5  
ATOM   6412  C  CD   . LYS A 1 54 ? 1.682   -11.468 -12.400 1.00 0.00 ? 54  LYS A CD   5  
ATOM   6413  C  CE   . LYS A 1 54 ? 1.135   -12.717 -13.126 1.00 0.00 ? 54  LYS A CE   5  
ATOM   6414  N  NZ   . LYS A 1 54 ? 1.996   -13.131 -14.268 1.00 0.00 ? 54  LYS A NZ   5  
ATOM   6415  H  H    . LYS A 1 54 ? 3.842   -13.950 -8.498  1.00 0.00 ? 54  LYS A H    5  
ATOM   6416  H  HA   . LYS A 1 54 ? 2.755   -11.416 -9.077  1.00 0.00 ? 54  LYS A HA   5  
ATOM   6417  H  HB2  . LYS A 1 54 ? 4.243   -12.999 -10.551 1.00 0.00 ? 54  LYS A HB2  5  
ATOM   6418  H  HB3  . LYS A 1 54 ? 2.726   -13.687 -11.096 1.00 0.00 ? 54  LYS A HB3  5  
ATOM   6419  H  HG2  . LYS A 1 54 ? 3.417   -10.738 -11.360 1.00 0.00 ? 54  LYS A HG2  5  
ATOM   6420  H  HG3  . LYS A 1 54 ? 3.780   -11.929 -12.603 1.00 0.00 ? 54  LYS A HG3  5  
ATOM   6421  H  HD2  . LYS A 1 54 ? 1.000   -11.206 -11.601 1.00 0.00 ? 54  LYS A HD2  5  
ATOM   6422  H  HD3  . LYS A 1 54 ? 1.725   -10.644 -13.106 1.00 0.00 ? 54  LYS A HD3  5  
ATOM   6423  H  HE2  . LYS A 1 54 ? 1.074   -13.540 -12.423 1.00 0.00 ? 54  LYS A HE2  5  
ATOM   6424  H  HE3  . LYS A 1 54 ? 0.142   -12.498 -13.499 1.00 0.00 ? 54  LYS A HE3  5  
ATOM   6425  H  HZ1  . LYS A 1 54 ? 2.941   -13.413 -13.930 1.00 0.00 ? 54  LYS A HZ1  5  
ATOM   6426  H  HZ2  . LYS A 1 54 ? 2.105   -12.345 -14.938 1.00 0.00 ? 54  LYS A HZ2  5  
ATOM   6427  H  HZ3  . LYS A 1 54 ? 1.560   -13.935 -14.770 1.00 0.00 ? 54  LYS A HZ3  5  
ATOM   6428  N  N    . ALA A 1 55 ? 0.603   -13.928 -9.161  1.00 0.00 ? 55  ALA A N    5  
ATOM   6429  C  CA   . ALA A 1 55 ? -0.824  -14.313 -9.126  1.00 0.00 ? 55  ALA A CA   5  
ATOM   6430  C  C    . ALA A 1 55 ? -1.631  -13.482 -8.099  1.00 0.00 ? 55  ALA A C    5  
ATOM   6431  O  O    . ALA A 1 55 ? -2.722  -13.001 -8.413  1.00 0.00 ? 55  ALA A O    5  
ATOM   6432  C  CB   . ALA A 1 55 ? -0.951  -15.818 -8.832  1.00 0.00 ? 55  ALA A CB   5  
ATOM   6433  H  H    . ALA A 1 55 ? 1.283   -14.629 -9.090  1.00 0.00 ? 55  ALA A H    5  
ATOM   6434  H  HA   . ALA A 1 55 ? -1.230  -14.133 -10.119 1.00 0.00 ? 55  ALA A HA   5  
ATOM   6435  H  HB1  . ALA A 1 55 ? -1.991  -16.116 -8.873  1.00 0.00 ? 55  ALA A HB1  5  
ATOM   6436  H  HB2  . ALA A 1 55 ? -0.558  -16.031 -7.845  1.00 0.00 ? 55  ALA A HB2  5  
ATOM   6437  H  HB3  . ALA A 1 55 ? -0.390  -16.383 -9.566  1.00 0.00 ? 55  ALA A HB3  5  
ATOM   6438  N  N    . SER A 1 56 ? -1.044  -13.284 -6.907  1.00 0.00 ? 56  SER A N    5  
ATOM   6439  C  CA   . SER A 1 56 ? -1.684  -12.560 -5.787  1.00 0.00 ? 56  SER A CA   5  
ATOM   6440  C  C    . SER A 1 56 ? -2.223  -11.165 -6.213  1.00 0.00 ? 56  SER A C    5  
ATOM   6441  O  O    . SER A 1 56 ? -3.408  -10.860 -6.004  1.00 0.00 ? 56  SER A O    5  
ATOM   6442  C  CB   . SER A 1 56 ? -0.690  -12.434 -4.623  1.00 0.00 ? 56  SER A CB   5  
ATOM   6443  O  OG   . SER A 1 56 ? -0.180  -13.709 -4.230  1.00 0.00 ? 56  SER A OG   5  
ATOM   6444  H  H    . SER A 1 56 ? -0.164  -13.685 -6.777  1.00 0.00 ? 56  SER A H    5  
ATOM   6445  H  HA   . SER A 1 56 ? -2.524  -13.167 -5.459  1.00 0.00 ? 56  SER A HA   5  
ATOM   6446  H  HB2  . SER A 1 56 ? 0.148   -11.815 -4.928  1.00 0.00 ? 56  SER A HB2  5  
ATOM   6447  H  HB3  . SER A 1 56 ? -1.180  -11.978 -3.774  1.00 0.00 ? 56  SER A HB3  5  
ATOM   6448  H  HG   . SER A 1 56 ? -0.629  -14.005 -3.431  1.00 0.00 ? 56  SER A HG   5  
ATOM   6449  N  N    . LEU A 1 57 ? -1.348  -10.332 -6.822  1.00 0.00 ? 57  LEU A N    5  
ATOM   6450  C  CA   . LEU A 1 57 ? -1.751  -9.032  -7.373  1.00 0.00 ? 57  LEU A CA   5  
ATOM   6451  C  C    . LEU A 1 57 ? -2.488  -9.186  -8.726  1.00 0.00 ? 57  LEU A C    5  
ATOM   6452  O  O    . LEU A 1 57 ? -3.306  -8.344  -9.063  1.00 0.00 ? 57  LEU A O    5  
ATOM   6453  C  CB   . LEU A 1 57 ? -0.566  -8.019  -7.494  1.00 0.00 ? 57  LEU A CB   5  
ATOM   6454  C  CG   . LEU A 1 57 ? 0.638   -8.413  -8.415  1.00 0.00 ? 57  LEU A CG   5  
ATOM   6455  C  CD1  . LEU A 1 57 ? 1.356   -7.158  -8.968  1.00 0.00 ? 57  LEU A CD1  5  
ATOM   6456  C  CD2  . LEU A 1 57 ? 1.642   -9.317  -7.673  1.00 0.00 ? 57  LEU A CD2  5  
ATOM   6457  H  H    . LEU A 1 57 ? -0.430  -10.621 -6.919  1.00 0.00 ? 57  LEU A H    5  
ATOM   6458  H  HA   . LEU A 1 57 ? -2.465  -8.608  -6.669  1.00 0.00 ? 57  LEU A HA   5  
ATOM   6459  H  HB2  . LEU A 1 57 ? -0.976  -7.083  -7.859  1.00 0.00 ? 57  LEU A HB2  5  
ATOM   6460  H  HB3  . LEU A 1 57 ? -0.185  -7.832  -6.492  1.00 0.00 ? 57  LEU A HB3  5  
ATOM   6461  H  HG   . LEU A 1 57 ? 0.266   -8.971  -9.267  1.00 0.00 ? 57  LEU A HG   5  
ATOM   6462  H  HD11 . LEU A 1 57 ? 1.758   -6.570  -8.152  1.00 0.00 ? 57  LEU A HD11 5  
ATOM   6463  H  HD12 . LEU A 1 57 ? 0.652   -6.555  -9.527  1.00 0.00 ? 57  LEU A HD12 5  
ATOM   6464  H  HD13 . LEU A 1 57 ? 2.160   -7.459  -9.625  1.00 0.00 ? 57  LEU A HD13 5  
ATOM   6465  H  HD21 . LEU A 1 57 ? 2.485   -9.526  -8.319  1.00 0.00 ? 57  LEU A HD21 5  
ATOM   6466  H  HD22 . LEU A 1 57 ? 1.169   -10.253 -7.408  1.00 0.00 ? 57  LEU A HD22 5  
ATOM   6467  H  HD23 . LEU A 1 57 ? 1.994   -8.823  -6.775  1.00 0.00 ? 57  LEU A HD23 5  
ATOM   6468  N  N    . ASN A 1 58 ? -2.189  -10.249 -9.506  1.00 0.00 ? 58  ASN A N    5  
ATOM   6469  C  CA   . ASN A 1 58 ? -2.831  -10.491 -10.835 1.00 0.00 ? 58  ASN A CA   5  
ATOM   6470  C  C    . ASN A 1 58 ? -4.350  -10.688 -10.718 1.00 0.00 ? 58  ASN A C    5  
ATOM   6471  O  O    . ASN A 1 58 ? -5.105  -10.341 -11.631 1.00 0.00 ? 58  ASN A O    5  
ATOM   6472  C  CB   . ASN A 1 58 ? -2.206  -11.722 -11.546 1.00 0.00 ? 58  ASN A CB   5  
ATOM   6473  C  CG   . ASN A 1 58 ? -2.685  -11.915 -12.998 1.00 0.00 ? 58  ASN A CG   5  
ATOM   6474  O  OD1  . ASN A 1 58 ? -2.878  -10.946 -13.730 1.00 0.00 ? 58  ASN A OD1  5  
ATOM   6475  N  ND2  . ASN A 1 58 ? -2.919  -13.159 -13.408 1.00 0.00 ? 58  ASN A ND2  5  
ATOM   6476  H  H    . ASN A 1 58 ? -1.489  -10.859 -9.230  1.00 0.00 ? 58  ASN A H    5  
ATOM   6477  H  HA   . ASN A 1 58 ? -2.652  -9.617  -11.432 1.00 0.00 ? 58  ASN A HA   5  
ATOM   6478  H  HB2  . ASN A 1 58 ? -1.132  -11.602 -11.566 1.00 0.00 ? 58  ASN A HB2  5  
ATOM   6479  H  HB3  . ASN A 1 58 ? -2.440  -12.616 -10.977 1.00 0.00 ? 58  ASN A HB3  5  
ATOM   6480  H  HD21 . ASN A 1 58 ? -2.783  -13.890 -12.768 1.00 0.00 ? 58  ASN A HD21 5  
ATOM   6481  H  HD22 . ASN A 1 58 ? -3.216  -13.298 -14.334 1.00 0.00 ? 58  ASN A HD22 5  
ATOM   6482  N  N    . TRP A 1 59 ? -4.785  -11.242 -9.588  1.00 0.00 ? 59  TRP A N    5  
ATOM   6483  C  CA   . TRP A 1 59 ? -6.215  -11.404 -9.295  1.00 0.00 ? 59  TRP A CA   5  
ATOM   6484  C  C    . TRP A 1 59 ? -6.764  -10.064 -8.800  1.00 0.00 ? 59  TRP A C    5  
ATOM   6485  O  O    . TRP A 1 59 ? -7.802  -9.609  -9.262  1.00 0.00 ? 59  TRP A O    5  
ATOM   6486  C  CB   . TRP A 1 59 ? -6.465  -12.535 -8.262  1.00 0.00 ? 59  TRP A CB   5  
ATOM   6487  C  CG   . TRP A 1 59 ? -6.168  -13.932 -8.786  1.00 0.00 ? 59  TRP A CG   5  
ATOM   6488  C  CD1  . TRP A 1 59 ? -5.101  -14.733 -8.480  1.00 0.00 ? 59  TRP A CD1  5  
ATOM   6489  C  CD2  . TRP A 1 59 ? -6.969  -14.684 -9.708  1.00 0.00 ? 59  TRP A CD2  5  
ATOM   6490  N  NE1  . TRP A 1 59 ? -5.187  -15.920 -9.155  1.00 0.00 ? 59  TRP A NE1  5  
ATOM   6491  C  CE2  . TRP A 1 59 ? -6.320  -15.913 -9.921  1.00 0.00 ? 59  TRP A CE2  5  
ATOM   6492  C  CE3  . TRP A 1 59 ? -8.162  -14.426 -10.393 1.00 0.00 ? 59  TRP A CE3  5  
ATOM   6493  C  CZ2  . TRP A 1 59 ? -6.843  -16.893 -10.762 1.00 0.00 ? 59  TRP A CZ2  5  
ATOM   6494  C  CZ3  . TRP A 1 59 ? -8.676  -15.398 -11.225 1.00 0.00 ? 59  TRP A CZ3  5  
ATOM   6495  C  CH2  . TRP A 1 59 ? -8.011  -16.614 -11.412 1.00 0.00 ? 59  TRP A CH2  5  
ATOM   6496  H  H    . TRP A 1 59 ? -4.137  -11.458 -8.895  1.00 0.00 ? 59  TRP A H    5  
ATOM   6497  H  HA   . TRP A 1 59 ? -6.719  -11.658 -10.226 1.00 0.00 ? 59  TRP A HA   5  
ATOM   6498  H  HB2  . TRP A 1 59 ? -5.852  -12.362 -7.383  1.00 0.00 ? 59  TRP A HB2  5  
ATOM   6499  H  HB3  . TRP A 1 59 ? -7.507  -12.518 -7.962  1.00 0.00 ? 59  TRP A HB3  5  
ATOM   6500  H  HD1  . TRP A 1 59 ? -4.303  -14.452 -7.805  1.00 0.00 ? 59  TRP A HD1  5  
ATOM   6501  H  HE1  . TRP A 1 59 ? -4.538  -16.656 -9.098  1.00 0.00 ? 59  TRP A HE1  5  
ATOM   6502  H  HE3  . TRP A 1 59 ? -8.693  -13.491 -10.263 1.00 0.00 ? 59  TRP A HE3  5  
ATOM   6503  H  HZ2  . TRP A 1 59 ? -6.340  -17.841 -10.917 1.00 0.00 ? 59  TRP A HZ2  5  
ATOM   6504  H  HZ3  . TRP A 1 59 ? -9.605  -15.218 -11.761 1.00 0.00 ? 59  TRP A HZ3  5  
ATOM   6505  H  HH2  . TRP A 1 59 ? -8.448  -17.345 -12.077 1.00 0.00 ? 59  TRP A HH2  5  
ATOM   6506  N  N    . HIS A 1 60 ? -6.057  -9.463  -7.824  1.00 0.00 ? 60  HIS A N    5  
ATOM   6507  C  CA   . HIS A 1 60 ? -6.346  -8.109  -7.304  1.00 0.00 ? 60  HIS A CA   5  
ATOM   6508  C  C    . HIS A 1 60 ? -6.530  -6.989  -8.385  1.00 0.00 ? 60  HIS A C    5  
ATOM   6509  O  O    . HIS A 1 60 ? -7.344  -6.079  -8.176  1.00 0.00 ? 60  HIS A O    5  
ATOM   6510  C  CB   . HIS A 1 60 ? -5.248  -7.725  -6.283  1.00 0.00 ? 60  HIS A CB   5  
ATOM   6511  C  CG   . HIS A 1 60 ? -5.345  -6.322  -5.773  1.00 0.00 ? 60  HIS A CG   5  
ATOM   6512  N  ND1  . HIS A 1 60 ? -6.392  -5.816  -5.046  1.00 0.00 ? 60  HIS A ND1  5  
ATOM   6513  C  CD2  . HIS A 1 60 ? -4.532  -5.290  -6.015  1.00 0.00 ? 60  HIS A CD2  5  
ATOM   6514  C  CE1  . HIS A 1 60 ? -6.178  -4.503  -4.903  1.00 0.00 ? 60  HIS A CE1  5  
ATOM   6515  N  NE2  . HIS A 1 60 ? -5.052  -4.124  -5.489  1.00 0.00 ? 60  HIS A NE2  5  
ATOM   6516  H  H    . HIS A 1 60 ? -5.398  -9.983  -7.317  1.00 0.00 ? 60  HIS A H    5  
ATOM   6517  H  HA   . HIS A 1 60 ? -7.279  -8.194  -6.758  1.00 0.00 ? 60  HIS A HA   5  
ATOM   6518  H  HB2  . HIS A 1 60 ? -5.292  -8.385  -5.435  1.00 0.00 ? 60  HIS A HB2  5  
ATOM   6519  H  HB3  . HIS A 1 60 ? -4.280  -7.840  -6.760  1.00 0.00 ? 60  HIS A HB3  5  
ATOM   6520  H  HD1  . HIS A 1 60 ? -7.154  -6.319  -4.685  1.00 0.00 ? 60  HIS A HD1  5  
ATOM   6521  H  HD2  . HIS A 1 60 ? -3.591  -5.359  -6.538  1.00 0.00 ? 60  HIS A HD2  5  
ATOM   6522  H  HE1  . HIS A 1 60 ? -6.843  -3.834  -4.382  1.00 0.00 ? 60  HIS A HE1  5  
ATOM   6523  N  N    . MET A 1 61 ? -5.767  -7.008  -9.499  1.00 0.00 ? 61  MET A N    5  
ATOM   6524  C  CA   . MET A 1 61 ? -5.944  -6.003  -10.585 1.00 0.00 ? 61  MET A CA   5  
ATOM   6525  C  C    . MET A 1 61 ? -7.261  -6.257  -11.338 1.00 0.00 ? 61  MET A C    5  
ATOM   6526  O  O    . MET A 1 61 ? -7.931  -5.313  -11.775 1.00 0.00 ? 61  MET A O    5  
ATOM   6527  C  CB   . MET A 1 61 ? -4.722  -5.933  -11.566 1.00 0.00 ? 61  MET A CB   5  
ATOM   6528  C  CG   . MET A 1 61 ? -4.328  -7.239  -12.285 1.00 0.00 ? 61  MET A CG   5  
ATOM   6529  S  SD   . MET A 1 61 ? -5.512  -7.799  -13.533 1.00 0.00 ? 61  MET A SD   5  
ATOM   6530  C  CE   . MET A 1 61 ? -5.520  -6.432  -14.694 1.00 0.00 ? 61  MET A CE   5  
ATOM   6531  H  H    . MET A 1 61 ? -5.085  -7.693  -9.589  1.00 0.00 ? 61  MET A H    5  
ATOM   6532  H  HA   . MET A 1 61 ? -6.033  -5.031  -10.090 1.00 0.00 ? 61  MET A HA   5  
ATOM   6533  H  HB2  . MET A 1 61 ? -4.937  -5.191  -12.327 1.00 0.00 ? 61  MET A HB2  5  
ATOM   6534  H  HB3  . MET A 1 61 ? -3.859  -5.590  -11.003 1.00 0.00 ? 61  MET A HB3  5  
ATOM   6535  H  HG2  . MET A 1 61 ? -3.380  -7.094  -12.776 1.00 0.00 ? 61  MET A HG2  5  
ATOM   6536  H  HG3  . MET A 1 61 ? -4.219  -8.020  -11.538 1.00 0.00 ? 61  MET A HG3  5  
ATOM   6537  H  HE1  . MET A 1 61 ? -4.528  -6.301  -15.096 1.00 0.00 ? 61  MET A HE1  5  
ATOM   6538  H  HE2  . MET A 1 61 ? -5.828  -5.531  -14.186 1.00 0.00 ? 61  MET A HE2  5  
ATOM   6539  H  HE3  . MET A 1 61 ? -6.211  -6.643  -15.501 1.00 0.00 ? 61  MET A HE3  5  
ATOM   6540  N  N    . LYS A 1 62 ? -7.613  -7.545  -11.484 1.00 0.00 ? 62  LYS A N    5  
ATOM   6541  C  CA   . LYS A 1 62 ? -8.914  -7.977  -12.022 1.00 0.00 ? 62  LYS A CA   5  
ATOM   6542  C  C    . LYS A 1 62 ? -10.073 -7.607  -11.066 1.00 0.00 ? 62  LYS A C    5  
ATOM   6543  O  O    . LYS A 1 62 ? -11.192 -7.438  -11.506 1.00 0.00 ? 62  LYS A O    5  
ATOM   6544  C  CB   . LYS A 1 62 ? -8.882  -9.499  -12.339 1.00 0.00 ? 62  LYS A CB   5  
ATOM   6545  C  CG   . LYS A 1 62 ? -10.214 -10.075 -12.881 1.00 0.00 ? 62  LYS A CG   5  
ATOM   6546  C  CD   . LYS A 1 62 ? -10.037 -11.406 -13.641 1.00 0.00 ? 62  LYS A CD   5  
ATOM   6547  C  CE   . LYS A 1 62 ? -9.158  -11.234 -14.890 1.00 0.00 ? 62  LYS A CE   5  
ATOM   6548  N  NZ   . LYS A 1 62 ? -9.085  -12.464 -15.705 1.00 0.00 ? 62  LYS A NZ   5  
ATOM   6549  H  H    . LYS A 1 62 ? -6.942  -8.227  -11.285 1.00 0.00 ? 62  LYS A H    5  
ATOM   6550  H  HA   . LYS A 1 62 ? -9.063  -7.441  -12.954 1.00 0.00 ? 62  LYS A HA   5  
ATOM   6551  H  HB2  . LYS A 1 62 ? -8.105  -9.679  -13.072 1.00 0.00 ? 62  LYS A HB2  5  
ATOM   6552  H  HB3  . LYS A 1 62 ? -8.625  -10.036 -11.434 1.00 0.00 ? 62  LYS A HB3  5  
ATOM   6553  H  HG2  . LYS A 1 62 ? -10.885 -10.238 -12.045 1.00 0.00 ? 62  LYS A HG2  5  
ATOM   6554  H  HG3  . LYS A 1 62 ? -10.662 -9.344  -13.549 1.00 0.00 ? 62  LYS A HG3  5  
ATOM   6555  H  HD2  . LYS A 1 62 ? -9.577  -12.133 -12.983 1.00 0.00 ? 62  LYS A HD2  5  
ATOM   6556  H  HD3  . LYS A 1 62 ? -11.015 -11.768 -13.946 1.00 0.00 ? 62  LYS A HD3  5  
ATOM   6557  H  HE2  . LYS A 1 62 ? -9.569  -10.446 -15.504 1.00 0.00 ? 62  LYS A HE2  5  
ATOM   6558  H  HE3  . LYS A 1 62 ? -8.155  -10.961 -14.584 1.00 0.00 ? 62  LYS A HE3  5  
ATOM   6559  H  HZ1  . LYS A 1 62 ? -8.703  -13.252 -15.144 1.00 0.00 ? 62  LYS A HZ1  5  
ATOM   6560  H  HZ2  . LYS A 1 62 ? -8.467  -12.311 -16.528 1.00 0.00 ? 62  LYS A HZ2  5  
ATOM   6561  H  HZ3  . LYS A 1 62 ? -10.032 -12.724 -16.044 1.00 0.00 ? 62  LYS A HZ3  5  
ATOM   6562  N  N    . LYS A 1 63 ? -9.780  -7.531  -9.759  1.00 0.00 ? 63  LYS A N    5  
ATOM   6563  C  CA   . LYS A 1 63 ? -10.726 -6.983  -8.742  1.00 0.00 ? 63  LYS A CA   5  
ATOM   6564  C  C    . LYS A 1 63 ? -11.067 -5.490  -9.008  1.00 0.00 ? 63  LYS A C    5  
ATOM   6565  O  O    . LYS A 1 63 ? -12.193 -5.049  -8.723  1.00 0.00 ? 63  LYS A O    5  
ATOM   6566  C  CB   . LYS A 1 63 ? -10.201 -7.203  -7.293  1.00 0.00 ? 63  LYS A CB   5  
ATOM   6567  C  CG   . LYS A 1 63 ? -10.011 -8.695  -6.933  1.00 0.00 ? 63  LYS A CG   5  
ATOM   6568  C  CD   . LYS A 1 63 ? -9.508  -8.935  -5.490  1.00 0.00 ? 63  LYS A CD   5  
ATOM   6569  C  CE   . LYS A 1 63 ? -10.526 -8.523  -4.420  1.00 0.00 ? 63  LYS A CE   5  
ATOM   6570  N  NZ   . LYS A 1 63 ? -11.812 -9.246  -4.570  1.00 0.00 ? 63  LYS A NZ   5  
ATOM   6571  H  H    . LYS A 1 63 ? -8.953  -7.963  -9.498  1.00 0.00 ? 63  LYS A H    5  
ATOM   6572  H  HA   . LYS A 1 63 ? -11.647 -7.550  -8.852  1.00 0.00 ? 63  LYS A HA   5  
ATOM   6573  H  HB2  . LYS A 1 63 ? -9.248  -6.699  -7.183  1.00 0.00 ? 63  LYS A HB2  5  
ATOM   6574  H  HB3  . LYS A 1 63 ? -10.907 -6.771  -6.590  1.00 0.00 ? 63  LYS A HB3  5  
ATOM   6575  H  HG2  . LYS A 1 63 ? -10.959 -9.203  -7.058  1.00 0.00 ? 63  LYS A HG2  5  
ATOM   6576  H  HG3  . LYS A 1 63 ? -9.294  -9.126  -7.627  1.00 0.00 ? 63  LYS A HG3  5  
ATOM   6577  H  HD2  . LYS A 1 63 ? -9.295  -9.992  -5.367  1.00 0.00 ? 63  LYS A HD2  5  
ATOM   6578  H  HD3  . LYS A 1 63 ? -8.589  -8.374  -5.337  1.00 0.00 ? 63  LYS A HD3  5  
ATOM   6579  H  HE2  . LYS A 1 63 ? -10.121 -8.737  -3.441  1.00 0.00 ? 63  LYS A HE2  5  
ATOM   6580  H  HE3  . LYS A 1 63 ? -10.716 -7.459  -4.499  1.00 0.00 ? 63  LYS A HE3  5  
ATOM   6581  H  HZ1  . LYS A 1 63 ? -11.641 -10.269 -4.648  1.00 0.00 ? 63  LYS A HZ1  5  
ATOM   6582  H  HZ2  . LYS A 1 63 ? -12.312 -8.922  -5.421  1.00 0.00 ? 63  LYS A HZ2  5  
ATOM   6583  H  HZ3  . LYS A 1 63 ? -12.415 -9.071  -3.743  1.00 0.00 ? 63  LYS A HZ3  5  
ATOM   6584  N  N    . HIS A 1 64 ? -10.099 -4.723  -9.568  1.00 0.00 ? 64  HIS A N    5  
ATOM   6585  C  CA   . HIS A 1 64 ? -10.354 -3.335  -10.065 1.00 0.00 ? 64  HIS A CA   5  
ATOM   6586  C  C    . HIS A 1 64 ? -11.128 -3.344  -11.401 1.00 0.00 ? 64  HIS A C    5  
ATOM   6587  O  O    . HIS A 1 64 ? -11.784 -2.361  -11.753 1.00 0.00 ? 64  HIS A O    5  
ATOM   6588  C  CB   . HIS A 1 64 ? -9.032  -2.542  -10.289 1.00 0.00 ? 64  HIS A CB   5  
ATOM   6589  C  CG   . HIS A 1 64 ? -8.204  -2.224  -9.073  1.00 0.00 ? 64  HIS A CG   5  
ATOM   6590  N  ND1  . HIS A 1 64 ? -8.563  -1.294  -8.125  1.00 0.00 ? 64  HIS A ND1  5  
ATOM   6591  C  CD2  . HIS A 1 64 ? -6.950  -2.624  -8.742  1.00 0.00 ? 64  HIS A CD2  5  
ATOM   6592  C  CE1  . HIS A 1 64 ? -7.533  -1.143  -7.281  1.00 0.00 ? 64  HIS A CE1  5  
ATOM   6593  N  NE2  . HIS A 1 64 ? -6.526  -1.921  -7.620  1.00 0.00 ? 64  HIS A NE2  5  
ATOM   6594  H  H    . HIS A 1 64 ? -9.189  -5.086  -9.648  1.00 0.00 ? 64  HIS A H    5  
ATOM   6595  H  HA   . HIS A 1 64 ? -10.966 -2.823  -9.327  1.00 0.00 ? 64  HIS A HA   5  
ATOM   6596  H  HB2  . HIS A 1 64 ? -8.398  -3.104  -10.961 1.00 0.00 ? 64  HIS A HB2  5  
ATOM   6597  H  HB3  . HIS A 1 64 ? -9.267  -1.589  -10.766 1.00 0.00 ? 64  HIS A HB3  5  
ATOM   6598  H  HD1  . HIS A 1 64 ? -9.418  -0.815  -8.078  1.00 0.00 ? 64  HIS A HD1  5  
ATOM   6599  H  HD2  . HIS A 1 64 ? -6.362  -3.360  -9.272  1.00 0.00 ? 64  HIS A HD2  5  
ATOM   6600  H  HE1  . HIS A 1 64 ? -7.526  -0.470  -6.440  1.00 0.00 ? 64  HIS A HE1  5  
ATOM   6601  N  N    . ASP A 1 65 ? -11.052 -4.466  -12.122 1.00 0.00 ? 65  ASP A N    5  
ATOM   6602  C  CA   . ASP A 1 65 ? -11.640 -4.616  -13.472 1.00 0.00 ? 65  ASP A CA   5  
ATOM   6603  C  C    . ASP A 1 65 ? -13.035 -5.268  -13.335 1.00 0.00 ? 65  ASP A C    5  
ATOM   6604  O  O    . ASP A 1 65 ? -13.884 -5.175  -14.231 1.00 0.00 ? 65  ASP A O    5  
ATOM   6605  C  CB   . ASP A 1 65 ? -10.697 -5.481  -14.360 1.00 0.00 ? 65  ASP A CB   5  
ATOM   6606  C  CG   . ASP A 1 65 ? -11.192 -5.666  -15.814 1.00 0.00 ? 65  ASP A CG   5  
ATOM   6607  O  OD1  . ASP A 1 65 ? -11.112 -4.699  -16.604 1.00 0.00 ? 65  ASP A OD1  5  
ATOM   6608  O  OD2  . ASP A 1 65 ? -11.660 -6.774  -16.171 1.00 0.00 ? 65  ASP A OD2  5  
ATOM   6609  H  H    . ASP A 1 65 ? -10.702 -5.264  -11.682 1.00 0.00 ? 65  ASP A H    5  
ATOM   6610  H  HA   . ASP A 1 65 ? -11.754 -3.630  -13.921 1.00 0.00 ? 65  ASP A HA   5  
ATOM   6611  H  HB2  . ASP A 1 65 ? -9.717  -5.011  -14.389 1.00 0.00 ? 65  ASP A HB2  5  
ATOM   6612  H  HB3  . ASP A 1 65 ? -10.587 -6.459  -13.901 1.00 0.00 ? 65  ASP A HB3  5  
ATOM   6613  N  N    . ALA A 1 66 ? -13.250 -5.918  -12.173 1.00 0.00 ? 66  ALA A N    5  
ATOM   6614  C  CA   . ALA A 1 66 ? -14.506 -6.600  -11.813 1.00 0.00 ? 66  ALA A CA   5  
ATOM   6615  C  C    . ALA A 1 66 ? -15.559 -5.589  -11.365 1.00 0.00 ? 66  ALA A C    5  
ATOM   6616  O  O    . ALA A 1 66 ? -16.766 -5.891  -11.413 1.00 0.00 ? 66  ALA A O    5  
ATOM   6617  C  CB   . ALA A 1 66 ? -14.251 -7.636  -10.704 1.00 0.00 ? 66  ALA A CB   5  
ATOM   6618  H  H    . ALA A 1 66 ? -12.519 -5.946  -11.526 1.00 0.00 ? 66  ALA A H    5  
ATOM   6619  H  HA   . ALA A 1 66 ? -14.872 -7.126  -12.688 1.00 0.00 ? 66  ALA A HA   5  
ATOM   6620  H  HB1  . ALA A 1 66 ? -13.516 -8.352  -11.041 1.00 0.00 ? 66  ALA A HB1  5  
ATOM   6621  H  HB2  . ALA A 1 66 ? -15.170 -8.154  -10.459 1.00 0.00 ? 66  ALA A HB2  5  
ATOM   6622  H  HB3  . ALA A 1 66 ? -13.878 -7.136  -9.814  1.00 0.00 ? 66  ALA A HB3  5  
ATOM   6623  N  N    . ASP A 1 67 ? -15.080 -4.403  -10.899 1.00 0.00 ? 67  ASP A N    5  
ATOM   6624  C  CA   . ASP A 1 67 ? -15.945 -3.280  -10.521 1.00 0.00 ? 67  ASP A CA   5  
ATOM   6625  C  C    . ASP A 1 67 ? -16.817 -3.685  -9.310  1.00 0.00 ? 67  ASP A C    5  
ATOM   6626  O  O    . ASP A 1 67 ? -18.054 -3.646  -9.347  1.00 0.00 ? 67  ASP A O    5  
ATOM   6627  C  CB   . ASP A 1 67 ? -16.776 -2.804  -11.762 1.00 0.00 ? 67  ASP A CB   5  
ATOM   6628  C  CG   . ASP A 1 67 ? -17.470 -1.448  -11.568 1.00 0.00 ? 67  ASP A CG   5  
ATOM   6629  O  OD1  . ASP A 1 67 ? -16.837 -0.402  -11.827 1.00 0.00 ? 67  ASP A OD1  5  
ATOM   6630  O  OD2  . ASP A 1 67 ? -18.656 -1.421  -11.182 1.00 0.00 ? 67  ASP A OD2  5  
ATOM   6631  H  H    . ASP A 1 67 ? -14.097 -4.285  -10.806 1.00 0.00 ? 67  ASP A H    5  
ATOM   6632  H  HA   . ASP A 1 67 ? -15.287 -2.475  -10.207 1.00 0.00 ? 67  ASP A HA   5  
ATOM   6633  H  HB2  . ASP A 1 67 ? -16.109 -2.725  -12.616 1.00 0.00 ? 67  ASP A HB2  5  
ATOM   6634  H  HB3  . ASP A 1 67 ? -17.525 -3.556  -11.989 1.00 0.00 ? 67  ASP A HB3  5  
ATOM   6635  N  N    . SER A 1 68 ? -16.130 -4.149  -8.256  1.00 0.00 ? 68  SER A N    5  
ATOM   6636  C  CA   . SER A 1 68 ? -16.769 -4.663  -7.036  1.00 0.00 ? 68  SER A CA   5  
ATOM   6637  C  C    . SER A 1 68 ? -16.942 -3.532  -6.007  1.00 0.00 ? 68  SER A C    5  
ATOM   6638  O  O    . SER A 1 68 ? -18.062 -3.130  -5.699  1.00 0.00 ? 68  SER A O    5  
ATOM   6639  C  CB   . SER A 1 68 ? -15.951 -5.839  -6.463  1.00 0.00 ? 68  SER A CB   5  
ATOM   6640  O  OG   . SER A 1 68 ? -15.821 -6.871  -7.424  1.00 0.00 ? 68  SER A OG   5  
ATOM   6641  H  H    . SER A 1 68 ? -15.159 -4.074  -8.281  1.00 0.00 ? 68  SER A H    5  
ATOM   6642  H  HA   . SER A 1 68 ? -17.755 -5.036  -7.306  1.00 0.00 ? 68  SER A HA   5  
ATOM   6643  H  HB2  . SER A 1 68 ? -14.963 -5.499  -6.188  1.00 0.00 ? 68  SER A HB2  5  
ATOM   6644  H  HB3  . SER A 1 68 ? -16.450 -6.241  -5.587  1.00 0.00 ? 68  SER A HB3  5  
ATOM   6645  H  HG   . SER A 1 68 ? -16.694 -7.095  -7.771  1.00 0.00 ? 68  SER A HG   5  
ATOM   6646  N  N    . PHE A 1 69 ? -15.806 -3.021  -5.494  1.00 0.00 ? 69  PHE A N    5  
ATOM   6647  C  CA   . PHE A 1 69 ? -15.771 -1.938  -4.483  1.00 0.00 ? 69  PHE A CA   5  
ATOM   6648  C  C    . PHE A 1 69 ? -15.086 -0.679  -5.043  1.00 0.00 ? 69  PHE A C    5  
ATOM   6649  O  O    . PHE A 1 69 ? -14.869 0.296   -4.320  1.00 0.00 ? 69  PHE A O    5  
ATOM   6650  C  CB   . PHE A 1 69 ? -15.046 -2.437  -3.202  1.00 0.00 ? 69  PHE A CB   5  
ATOM   6651  C  CG   . PHE A 1 69 ? -15.764 -3.587  -2.493  1.00 0.00 ? 69  PHE A CG   5  
ATOM   6652  C  CD1  . PHE A 1 69 ? -16.778 -3.332  -1.572  1.00 0.00 ? 69  PHE A CD1  5  
ATOM   6653  C  CD2  . PHE A 1 69 ? -15.435 -4.916  -2.755  1.00 0.00 ? 69  PHE A CD2  5  
ATOM   6654  C  CE1  . PHE A 1 69 ? -17.436 -4.371  -0.934  1.00 0.00 ? 69  PHE A CE1  5  
ATOM   6655  C  CE2  . PHE A 1 69 ? -16.094 -5.950  -2.120  1.00 0.00 ? 69  PHE A CE2  5  
ATOM   6656  C  CZ   . PHE A 1 69 ? -17.093 -5.678  -1.209  1.00 0.00 ? 69  PHE A CZ   5  
ATOM   6657  H  H    . PHE A 1 69 ? -14.955 -3.395  -5.793  1.00 0.00 ? 69  PHE A H    5  
ATOM   6658  H  HA   . PHE A 1 69 ? -16.794 -1.671  -4.223  1.00 0.00 ? 69  PHE A HA   5  
ATOM   6659  H  HB2  . PHE A 1 69 ? -14.049 -2.771  -3.468  1.00 0.00 ? 69  PHE A HB2  5  
ATOM   6660  H  HB3  . PHE A 1 69 ? -14.954 -1.614  -2.497  1.00 0.00 ? 69  PHE A HB3  5  
ATOM   6661  H  HD1  . PHE A 1 69 ? -17.054 -2.309  -1.350  1.00 0.00 ? 69  PHE A HD1  5  
ATOM   6662  H  HD2  . PHE A 1 69 ? -14.649 -5.140  -3.468  1.00 0.00 ? 69  PHE A HD2  5  
ATOM   6663  H  HE1  . PHE A 1 69 ? -18.220 -4.157  -0.220  1.00 0.00 ? 69  PHE A HE1  5  
ATOM   6664  H  HE2  . PHE A 1 69 ? -15.826 -6.977  -2.337  1.00 0.00 ? 69  PHE A HE2  5  
ATOM   6665  H  HZ   . PHE A 1 69 ? -17.609 -6.488  -0.714  1.00 0.00 ? 69  PHE A HZ   5  
ATOM   6666  N  N    . TYR A 1 70 ? -14.768 -0.695  -6.342  1.00 0.00 ? 70  TYR A N    5  
ATOM   6667  C  CA   . TYR A 1 70 ? -14.052 0.407   -7.022  1.00 0.00 ? 70  TYR A CA   5  
ATOM   6668  C  C    . TYR A 1 70 ? -14.951 0.980   -8.121  1.00 0.00 ? 70  TYR A C    5  
ATOM   6669  O  O    . TYR A 1 70 ? -14.467 1.509   -9.123  1.00 0.00 ? 70  TYR A O    5  
ATOM   6670  C  CB   . TYR A 1 70 ? -12.717 -0.128  -7.609  1.00 0.00 ? 70  TYR A CB   5  
ATOM   6671  C  CG   . TYR A 1 70 ? -11.831 -0.814  -6.558  1.00 0.00 ? 70  TYR A CG   5  
ATOM   6672  C  CD1  . TYR A 1 70 ? -11.212 -0.062  -5.559  1.00 0.00 ? 70  TYR A CD1  5  
ATOM   6673  C  CD2  . TYR A 1 70 ? -11.655 -2.200  -6.539  1.00 0.00 ? 70  TYR A CD2  5  
ATOM   6674  C  CE1  . TYR A 1 70 ? -10.435 -0.663  -4.596  1.00 0.00 ? 70  TYR A CE1  5  
ATOM   6675  C  CE2  . TYR A 1 70 ? -10.879 -2.805  -5.568  1.00 0.00 ? 70  TYR A CE2  5  
ATOM   6676  C  CZ   . TYR A 1 70 ? -10.279 -2.033  -4.597  1.00 0.00 ? 70  TYR A CZ   5  
ATOM   6677  O  OH   . TYR A 1 70 ? -9.514  -2.634  -3.623  1.00 0.00 ? 70  TYR A OH   5  
ATOM   6678  H  H    . TYR A 1 70 ? -15.065 -1.449  -6.887  1.00 0.00 ? 70  TYR A H    5  
ATOM   6679  H  HA   . TYR A 1 70 ? -13.838 1.193   -6.303  1.00 0.00 ? 70  TYR A HA   5  
ATOM   6680  H  HB2  . TYR A 1 70 ? -12.925 -0.835  -8.412  1.00 0.00 ? 70  TYR A HB2  5  
ATOM   6681  H  HB3  . TYR A 1 70 ? -12.156 0.705   -8.026  1.00 0.00 ? 70  TYR A HB3  5  
ATOM   6682  H  HD1  . TYR A 1 70 ? -11.337 1.017   -5.556  1.00 0.00 ? 70  TYR A HD1  5  
ATOM   6683  H  HD2  . TYR A 1 70 ? -12.127 -2.801  -7.308  1.00 0.00 ? 70  TYR A HD2  5  
ATOM   6684  H  HE1  . TYR A 1 70 ? -9.957  -0.057  -3.834  1.00 0.00 ? 70  TYR A HE1  5  
ATOM   6685  H  HE2  . TYR A 1 70 ? -10.746 -3.875  -5.570  1.00 0.00 ? 70  TYR A HE2  5  
ATOM   6686  H  HH   . TYR A 1 70 ? -8.920  -3.281  -4.023  1.00 0.00 ? 70  TYR A HH   5  
ATOM   6687  N  N    . GLN A 1 71 ? -16.268 0.928   -7.867  1.00 0.00 ? 71  GLN A N    5  
ATOM   6688  C  CA   . GLN A 1 71 ? -17.304 1.163   -8.885  1.00 0.00 ? 71  GLN A CA   5  
ATOM   6689  C  C    . GLN A 1 71 ? -17.340 2.624   -9.331  1.00 0.00 ? 71  GLN A C    5  
ATOM   6690  O  O    . GLN A 1 71 ? -17.624 2.920   -10.493 1.00 0.00 ? 71  GLN A O    5  
ATOM   6691  C  CB   . GLN A 1 71 ? -18.687 0.730   -8.341  1.00 0.00 ? 71  GLN A CB   5  
ATOM   6692  C  CG   . GLN A 1 71 ? -18.744 -0.736  -7.891  1.00 0.00 ? 71  GLN A CG   5  
ATOM   6693  C  CD   . GLN A 1 71 ? -20.128 -1.184  -7.418  1.00 0.00 ? 71  GLN A CD   5  
ATOM   6694  O  OE1  . GLN A 1 71 ? -20.912 -0.393  -6.896  1.00 0.00 ? 71  GLN A OE1  5  
ATOM   6695  N  NE2  . GLN A 1 71 ? -20.421 -2.464  -7.585  1.00 0.00 ? 71  GLN A NE2  5  
ATOM   6696  H  H    . GLN A 1 71 ? -16.556 0.779   -6.942  1.00 0.00 ? 71  GLN A H    5  
ATOM   6697  H  HA   . GLN A 1 71 ? -17.065 0.547   -9.746  1.00 0.00 ? 71  GLN A HA   5  
ATOM   6698  H  HB2  . GLN A 1 71 ? -18.944 1.355   -7.489  1.00 0.00 ? 71  GLN A HB2  5  
ATOM   6699  H  HB3  . GLN A 1 71 ? -19.434 0.879   -9.115  1.00 0.00 ? 71  GLN A HB3  5  
ATOM   6700  H  HG2  . GLN A 1 71 ? -18.442 -1.362  -8.723  1.00 0.00 ? 71  GLN A HG2  5  
ATOM   6701  H  HG3  . GLN A 1 71 ? -18.045 -0.878  -7.074  1.00 0.00 ? 71  GLN A HG3  5  
ATOM   6702  H  HE21 . GLN A 1 71 ? -19.739 -3.040  -7.992  1.00 0.00 ? 71  GLN A HE21 5  
ATOM   6703  H  HE22 . GLN A 1 71 ? -21.303 -2.782  -7.305  1.00 0.00 ? 71  GLN A HE22 5  
ATOM   6704  N  N    . PHE A 1 72 ? -17.029 3.535   -8.402  1.00 0.00 ? 72  PHE A N    5  
ATOM   6705  C  CA   . PHE A 1 72 ? -17.069 4.971   -8.631  1.00 0.00 ? 72  PHE A CA   5  
ATOM   6706  C  C    . PHE A 1 72 ? -15.772 5.557   -8.073  1.00 0.00 ? 72  PHE A C    5  
ATOM   6707  O  O    . PHE A 1 72 ? -15.323 5.154   -7.004  1.00 0.00 ? 72  PHE A O    5  
ATOM   6708  C  CB   . PHE A 1 72 ? -18.291 5.600   -7.913  1.00 0.00 ? 72  PHE A CB   5  
ATOM   6709  C  CG   . PHE A 1 72 ? -19.624 4.937   -8.263  1.00 0.00 ? 72  PHE A CG   5  
ATOM   6710  C  CD1  . PHE A 1 72 ? -20.274 5.215   -9.465  1.00 0.00 ? 72  PHE A CD1  5  
ATOM   6711  C  CD2  . PHE A 1 72 ? -20.214 4.013   -7.394  1.00 0.00 ? 72  PHE A CD2  5  
ATOM   6712  C  CE1  . PHE A 1 72 ? -21.475 4.603   -9.779  1.00 0.00 ? 72  PHE A CE1  5  
ATOM   6713  C  CE2  . PHE A 1 72 ? -21.413 3.401   -7.713  1.00 0.00 ? 72  PHE A CE2  5  
ATOM   6714  C  CZ   . PHE A 1 72 ? -22.041 3.695   -8.905  1.00 0.00 ? 72  PHE A CZ   5  
ATOM   6715  H  H    . PHE A 1 72 ? -16.717 3.245   -7.525  1.00 0.00 ? 72  PHE A H    5  
ATOM   6716  H  HA   . PHE A 1 72 ? -17.130 5.165   -9.703  1.00 0.00 ? 72  PHE A HA   5  
ATOM   6717  H  HB2  . PHE A 1 72 ? -18.147 5.525   -6.837  1.00 0.00 ? 72  PHE A HB2  5  
ATOM   6718  H  HB3  . PHE A 1 72 ? -18.355 6.648   -8.173  1.00 0.00 ? 72  PHE A HB3  5  
ATOM   6719  H  HD1  . PHE A 1 72 ? -19.835 5.926   -10.155 1.00 0.00 ? 72  PHE A HD1  5  
ATOM   6720  H  HD2  . PHE A 1 72 ? -19.732 3.784   -6.451  1.00 0.00 ? 72  PHE A HD2  5  
ATOM   6721  H  HE1  . PHE A 1 72 ? -21.969 4.834   -10.713 1.00 0.00 ? 72  PHE A HE1  5  
ATOM   6722  H  HE2  . PHE A 1 72 ? -21.858 2.690   -7.029  1.00 0.00 ? 72  PHE A HE2  5  
ATOM   6723  H  HZ   . PHE A 1 72 ? -22.977 3.213   -9.161  1.00 0.00 ? 72  PHE A HZ   5  
ATOM   6724  N  N    . SER A 1 73 ? -15.186 6.491   -8.804  1.00 0.00 ? 73  SER A N    5  
ATOM   6725  C  CA   . SER A 1 73 ? -13.930 7.142   -8.434  1.00 0.00 ? 73  SER A CA   5  
ATOM   6726  C  C    . SER A 1 73 ? -13.812 8.512   -9.107  1.00 0.00 ? 73  SER A C    5  
ATOM   6727  O  O    . SER A 1 73 ? -14.544 8.819   -10.058 1.00 0.00 ? 73  SER A O    5  
ATOM   6728  C  CB   . SER A 1 73 ? -12.739 6.230   -8.811  1.00 0.00 ? 73  SER A CB   5  
ATOM   6729  O  OG   . SER A 1 73 ? -12.737 5.926   -10.195 1.00 0.00 ? 73  SER A OG   5  
ATOM   6730  H  H    . SER A 1 73 ? -15.603 6.727   -9.647  1.00 0.00 ? 73  SER A H    5  
ATOM   6731  H  HA   . SER A 1 73 ? -13.933 7.293   -7.355  1.00 0.00 ? 73  SER A HA   5  
ATOM   6732  H  HB2  . SER A 1 73 ? -11.805 6.721   -8.566  1.00 0.00 ? 73  SER A HB2  5  
ATOM   6733  H  HB3  . SER A 1 73 ? -12.802 5.301   -8.256  1.00 0.00 ? 73  SER A HB3  5  
ATOM   6734  H  HG   . SER A 1 73 ? -13.631 5.693   -10.476 1.00 0.00 ? 73  SER A HG   5  
ATOM   6735  N  N    . CYS A 1 74 ? -12.874 9.321   -8.611  1.00 0.00 ? 74  CYS A N    5  
ATOM   6736  C  CA   . CYS A 1 74 ? -12.626 10.673  -9.124  1.00 0.00 ? 74  CYS A CA   5  
ATOM   6737  C  C    . CYS A 1 74 ? -11.481 10.600  -10.135 1.00 0.00 ? 74  CYS A C    5  
ATOM   6738  O  O    . CYS A 1 74 ? -10.379 10.245  -9.775  1.00 0.00 ? 74  CYS A O    5  
ATOM   6739  C  CB   . CYS A 1 74 ? -12.291 11.643  -7.961  1.00 0.00 ? 74  CYS A CB   5  
ATOM   6740  S  SG   . CYS A 1 74 ? -11.868 13.343  -8.478  1.00 0.00 ? 74  CYS A SG   5  
ATOM   6741  H  H    . CYS A 1 74 ? -12.289 8.968   -7.915  1.00 0.00 ? 74  CYS A H    5  
ATOM   6742  H  HA   . CYS A 1 74 ? -13.523 11.027  -9.628  1.00 0.00 ? 74  CYS A HA   5  
ATOM   6743  H  HB2  . CYS A 1 74 ? -13.140 11.709  -7.297  1.00 0.00 ? 74  CYS A HB2  5  
ATOM   6744  H  HB3  . CYS A 1 74 ? -11.448 11.255  -7.407  1.00 0.00 ? 74  CYS A HB3  5  
ATOM   6745  N  N    . ASN A 1 75 ? -11.744 10.917  -11.406 1.00 0.00 ? 75  ASN A N    5  
ATOM   6746  C  CA   . ASN A 1 75 ? -10.703 10.913  -12.466 1.00 0.00 ? 75  ASN A CA   5  
ATOM   6747  C  C    . ASN A 1 75 ? -9.564  11.925  -12.153 1.00 0.00 ? 75  ASN A C    5  
ATOM   6748  O  O    . ASN A 1 75 ? -8.474  11.832  -12.715 1.00 0.00 ? 75  ASN A O    5  
ATOM   6749  C  CB   . ASN A 1 75 ? -11.350 11.220  -13.848 1.00 0.00 ? 75  ASN A CB   5  
ATOM   6750  C  CG   . ASN A 1 75 ? -10.391 11.186  -15.052 1.00 0.00 ? 75  ASN A CG   5  
ATOM   6751  O  OD1  . ASN A 1 75 ? -10.533 11.969  -15.989 1.00 0.00 ? 75  ASN A OD1  5  
ATOM   6752  N  ND2  . ASN A 1 75 ? -9.418  10.273  -15.056 1.00 0.00 ? 75  ASN A ND2  5  
ATOM   6753  H  H    . ASN A 1 75 ? -12.663 11.150  -11.650 1.00 0.00 ? 75  ASN A H    5  
ATOM   6754  H  HA   . ASN A 1 75 ? -10.279 9.918   -12.496 1.00 0.00 ? 75  ASN A HA   5  
ATOM   6755  H  HB2  . ASN A 1 75 ? -12.123 10.489  -14.042 1.00 0.00 ? 75  ASN A HB2  5  
ATOM   6756  H  HB3  . ASN A 1 75 ? -11.817 12.202  -13.802 1.00 0.00 ? 75  ASN A HB3  5  
ATOM   6757  H  HD21 . ASN A 1 75 ? -9.344  9.661   -14.296 1.00 0.00 ? 75  ASN A HD21 5  
ATOM   6758  H  HD22 . ASN A 1 75 ? -8.803  10.262  -15.819 1.00 0.00 ? 75  ASN A HD22 5  
ATOM   6759  N  N    . ILE A 1 76 ? -9.819  12.857  -11.208 1.00 0.00 ? 76  ILE A N    5  
ATOM   6760  C  CA   . ILE A 1 76 ? -8.867  13.917  -10.844 1.00 0.00 ? 76  ILE A CA   5  
ATOM   6761  C  C    . ILE A 1 76 ? -8.070  13.497  -9.585  1.00 0.00 ? 76  ILE A C    5  
ATOM   6762  O  O    . ILE A 1 76 ? -6.867  13.772  -9.491  1.00 0.00 ? 76  ILE A O    5  
ATOM   6763  C  CB   . ILE A 1 76 ? -9.591  15.308  -10.605 1.00 0.00 ? 76  ILE A CB   5  
ATOM   6764  C  CG1  . ILE A 1 76 ? -10.648 15.591  -11.744 1.00 0.00 ? 76  ILE A CG1  5  
ATOM   6765  C  CG2  . ILE A 1 76 ? -8.557  16.457  -10.470 1.00 0.00 ? 76  ILE A CG2  5  
ATOM   6766  C  CD1  . ILE A 1 76 ? -11.042 17.044  -11.966 1.00 0.00 ? 76  ILE A CD1  5  
ATOM   6767  H  H    . ILE A 1 76 ? -10.657 12.805  -10.718 1.00 0.00 ? 76  ILE A H    5  
ATOM   6768  H  HA   . ILE A 1 76 ? -8.169  14.041  -11.673 1.00 0.00 ? 76  ILE A HA   5  
ATOM   6769  H  HB   . ILE A 1 76 ? -10.122 15.242  -9.655  1.00 0.00 ? 76  ILE A HB   5  
ATOM   6770  H  HG12 . ILE A 1 76 ? -10.276 15.220  -12.686 1.00 0.00 ? 76  ILE A HG12 5  
ATOM   6771  H  HG13 . ILE A 1 76 ? -11.571 15.055  -11.495 1.00 0.00 ? 76  ILE A HG13 5  
ATOM   6772  H  HG21 . ILE A 1 76 ? -8.009  16.570  -11.396 1.00 0.00 ? 76  ILE A HG21 5  
ATOM   6773  H  HG22 . ILE A 1 76 ? -7.860  16.231  -9.671  1.00 0.00 ? 76  ILE A HG22 5  
ATOM   6774  H  HG23 . ILE A 1 76 ? -9.065  17.384  -10.240 1.00 0.00 ? 76  ILE A HG23 5  
ATOM   6775  H  HD11 . ILE A 1 76 ? -11.795 17.096  -12.739 1.00 0.00 ? 76  ILE A HD11 5  
ATOM   6776  H  HD12 . ILE A 1 76 ? -10.174 17.610  -12.271 1.00 0.00 ? 76  ILE A HD12 5  
ATOM   6777  H  HD13 . ILE A 1 76 ? -11.441 17.455  -11.053 1.00 0.00 ? 76  ILE A HD13 5  
ATOM   6778  N  N    . CYS A 1 77 ? -8.746  12.811  -8.618  1.00 0.00 ? 77  CYS A N    5  
ATOM   6779  C  CA   . CYS A 1 77 ? -8.103  12.376  -7.351  1.00 0.00 ? 77  CYS A CA   5  
ATOM   6780  C  C    . CYS A 1 77 ? -8.909  11.229  -6.687  1.00 0.00 ? 77  CYS A C    5  
ATOM   6781  O  O    . CYS A 1 77 ? -9.435  11.379  -5.581  1.00 0.00 ? 77  CYS A O    5  
ATOM   6782  C  CB   . CYS A 1 77 ? -7.924  13.581  -6.387  1.00 0.00 ? 77  CYS A CB   5  
ATOM   6783  S  SG   . CYS A 1 77 ? -9.434  14.162  -5.530  1.00 0.00 ? 77  CYS A SG   5  
ATOM   6784  H  H    . CYS A 1 77 ? -9.677  12.568  -8.774  1.00 0.00 ? 77  CYS A H    5  
ATOM   6785  H  HA   . CYS A 1 77 ? -7.121  11.988  -7.608  1.00 0.00 ? 77  CYS A HA   5  
ATOM   6786  H  HB2  . CYS A 1 77 ? -7.217  13.314  -5.613  1.00 0.00 ? 77  CYS A HB2  5  
ATOM   6787  H  HB3  . CYS A 1 77 ? -7.528  14.415  -6.943  1.00 0.00 ? 77  CYS A HB3  5  
ATOM   6788  N  N    . GLY A 1 78 ? -9.083  10.145  -7.482  1.00 0.00 ? 78  GLY A N    5  
ATOM   6789  C  CA   . GLY A 1 78 ? -9.708  8.843   -7.108  1.00 0.00 ? 78  GLY A CA   5  
ATOM   6790  C  C    . GLY A 1 78 ? -9.684  8.424   -5.637  1.00 0.00 ? 78  GLY A C    5  
ATOM   6791  O  O    . GLY A 1 78 ? -8.909  7.550   -5.235  1.00 0.00 ? 78  GLY A O    5  
ATOM   6792  H  H    . GLY A 1 78 ? -8.846  10.274  -8.432  1.00 0.00 ? 78  GLY A H    5  
ATOM   6793  H  HA2  . GLY A 1 78 ? -10.741 8.873   -7.425  1.00 0.00 ? 78  GLY A HA2  5  
ATOM   6794  H  HA3  . GLY A 1 78 ? -9.217  8.074   -7.689  1.00 0.00 ? 78  GLY A HA3  5  
ATOM   6795  N  N    . LYS A 1 79 ? -10.536 9.082   -4.837  1.00 0.00 ? 79  LYS A N    5  
ATOM   6796  C  CA   . LYS A 1 79 ? -10.802 8.716   -3.444  1.00 0.00 ? 79  LYS A CA   5  
ATOM   6797  C  C    . LYS A 1 79 ? -11.952 7.681   -3.333  1.00 0.00 ? 79  LYS A C    5  
ATOM   6798  O  O    . LYS A 1 79 ? -12.203 7.153   -2.244  1.00 0.00 ? 79  LYS A O    5  
ATOM   6799  C  CB   . LYS A 1 79 ? -11.104 10.034  -2.677  1.00 0.00 ? 79  LYS A CB   5  
ATOM   6800  C  CG   . LYS A 1 79 ? -10.759 10.038  -1.172  1.00 0.00 ? 79  LYS A CG   5  
ATOM   6801  C  CD   . LYS A 1 79 ? -11.918 9.585   -0.244  1.00 0.00 ? 79  LYS A CD   5  
ATOM   6802  C  CE   . LYS A 1 79 ? -13.153 10.506  -0.327  1.00 0.00 ? 79  LYS A CE   5  
ATOM   6803  N  NZ   . LYS A 1 79 ? -14.183 10.149  0.677   1.00 0.00 ? 79  LYS A NZ   5  
ATOM   6804  H  H    . LYS A 1 79 ? -10.900 9.930   -5.155  1.00 0.00 ? 79  LYS A H    5  
ATOM   6805  H  HA   . LYS A 1 79 ? -9.901  8.275   -3.039  1.00 0.00 ? 79  LYS A HA   5  
ATOM   6806  H  HB2  . LYS A 1 79 ? -10.529 10.834  -3.142  1.00 0.00 ? 79  LYS A HB2  5  
ATOM   6807  H  HB3  . LYS A 1 79 ? -12.160 10.281  -2.794  1.00 0.00 ? 79  LYS A HB3  5  
ATOM   6808  H  HG2  . LYS A 1 79 ? -9.915  9.379   -1.021  1.00 0.00 ? 79  LYS A HG2  5  
ATOM   6809  H  HG3  . LYS A 1 79 ? -10.460 11.043  -0.897  1.00 0.00 ? 79  LYS A HG3  5  
ATOM   6810  H  HD2  . LYS A 1 79 ? -12.212 8.583   -0.521  1.00 0.00 ? 79  LYS A HD2  5  
ATOM   6811  H  HD3  . LYS A 1 79 ? -11.553 9.575   0.781   1.00 0.00 ? 79  LYS A HD3  5  
ATOM   6812  H  HE2  . LYS A 1 79 ? -12.852 11.529  -0.152  1.00 0.00 ? 79  LYS A HE2  5  
ATOM   6813  H  HE3  . LYS A 1 79 ? -13.593 10.426  -1.314  1.00 0.00 ? 79  LYS A HE3  5  
ATOM   6814  H  HZ1  . LYS A 1 79 ? -13.807 10.273  1.642   1.00 0.00 ? 79  LYS A HZ1  5  
ATOM   6815  H  HZ2  . LYS A 1 79 ? -14.480 9.162   0.560   1.00 0.00 ? 79  LYS A HZ2  5  
ATOM   6816  H  HZ3  . LYS A 1 79 ? -15.013 10.759  0.565   1.00 0.00 ? 79  LYS A HZ3  5  
ATOM   6817  N  N    . LYS A 1 80 ? -12.646 7.416   -4.470  1.00 0.00 ? 80  LYS A N    5  
ATOM   6818  C  CA   . LYS A 1 80 ? -13.687 6.364   -4.596  1.00 0.00 ? 80  LYS A CA   5  
ATOM   6819  C  C    . LYS A 1 80 ? -14.931 6.743   -3.774  1.00 0.00 ? 80  LYS A C    5  
ATOM   6820  O  O    . LYS A 1 80 ? -14.911 6.691   -2.544  1.00 0.00 ? 80  LYS A O    5  
ATOM   6821  C  CB   . LYS A 1 80 ? -13.169 4.926   -4.226  1.00 0.00 ? 80  LYS A CB   5  
ATOM   6822  C  CG   . LYS A 1 80 ? -12.296 4.225   -5.298  1.00 0.00 ? 80  LYS A CG   5  
ATOM   6823  C  CD   . LYS A 1 80 ? -10.988 4.986   -5.604  1.00 0.00 ? 80  LYS A CD   5  
ATOM   6824  C  CE   . LYS A 1 80 ? -10.077 4.247   -6.593  1.00 0.00 ? 80  LYS A CE   5  
ATOM   6825  N  NZ   . LYS A 1 80 ? -9.688  2.901   -6.089  1.00 0.00 ? 80  LYS A NZ   5  
ATOM   6826  H  H    . LYS A 1 80 ? -12.473 7.974   -5.245  1.00 0.00 ? 80  LYS A H    5  
ATOM   6827  H  HA   . LYS A 1 80 ? -13.972 6.360   -5.644  1.00 0.00 ? 80  LYS A HA   5  
ATOM   6828  H  HB2  . LYS A 1 80 ? -12.591 4.992   -3.313  1.00 0.00 ? 80  LYS A HB2  5  
ATOM   6829  H  HB3  . LYS A 1 80 ? -14.026 4.286   -4.034  1.00 0.00 ? 80  LYS A HB3  5  
ATOM   6830  H  HG2  . LYS A 1 80 ? -12.042 3.231   -4.938  1.00 0.00 ? 80  LYS A HG2  5  
ATOM   6831  H  HG3  . LYS A 1 80 ? -12.873 4.129   -6.214  1.00 0.00 ? 80  LYS A HG3  5  
ATOM   6832  H  HD2  . LYS A 1 80 ? -11.236 5.963   -6.023  1.00 0.00 ? 80  LYS A HD2  5  
ATOM   6833  H  HD3  . LYS A 1 80 ? -10.446 5.133   -4.673  1.00 0.00 ? 80  LYS A HD3  5  
ATOM   6834  H  HE2  . LYS A 1 80 ? -10.593 4.132   -7.537  1.00 0.00 ? 80  LYS A HE2  5  
ATOM   6835  H  HE3  . LYS A 1 80 ? -9.178  4.834   -6.749  1.00 0.00 ? 80  LYS A HE3  5  
ATOM   6836  H  HZ1  . LYS A 1 80 ? -10.529 2.308   -5.963  1.00 0.00 ? 80  LYS A HZ1  5  
ATOM   6837  H  HZ2  . LYS A 1 80 ? -9.202  2.990   -5.174  1.00 0.00 ? 80  LYS A HZ2  5  
ATOM   6838  H  HZ3  . LYS A 1 80 ? -9.047  2.438   -6.764  1.00 0.00 ? 80  LYS A HZ3  5  
ATOM   6839  N  N    . PHE A 1 81 ? -16.006 7.131   -4.466  1.00 0.00 ? 81  PHE A N    5  
ATOM   6840  C  CA   . PHE A 1 81 ? -17.222 7.686   -3.826  1.00 0.00 ? 81  PHE A CA   5  
ATOM   6841  C  C    . PHE A 1 81 ? -18.409 6.719   -3.932  1.00 0.00 ? 81  PHE A C    5  
ATOM   6842  O  O    . PHE A 1 81 ? -18.352 5.727   -4.666  1.00 0.00 ? 81  PHE A O    5  
ATOM   6843  C  CB   . PHE A 1 81 ? -17.558 9.064   -4.457  1.00 0.00 ? 81  PHE A CB   5  
ATOM   6844  C  CG   . PHE A 1 81 ? -16.516 10.149  -4.159  1.00 0.00 ? 81  PHE A CG   5  
ATOM   6845  C  CD1  . PHE A 1 81 ? -15.304 10.198  -4.856  1.00 0.00 ? 81  PHE A CD1  5  
ATOM   6846  C  CD2  . PHE A 1 81 ? -16.736 11.104  -3.163  1.00 0.00 ? 81  PHE A CD2  5  
ATOM   6847  C  CE1  . PHE A 1 81 ? -14.358 11.160  -4.567  1.00 0.00 ? 81  PHE A CE1  5  
ATOM   6848  C  CE2  . PHE A 1 81 ? -15.784 12.063  -2.874  1.00 0.00 ? 81  PHE A CE2  5  
ATOM   6849  C  CZ   . PHE A 1 81 ? -14.599 12.092  -3.577  1.00 0.00 ? 81  PHE A CZ   5  
ATOM   6850  H  H    . PHE A 1 81 ? -15.992 7.022   -5.442  1.00 0.00 ? 81  PHE A H    5  
ATOM   6851  H  HA   . PHE A 1 81 ? -17.013 7.834   -2.769  1.00 0.00 ? 81  PHE A HA   5  
ATOM   6852  H  HB2  . PHE A 1 81 ? -17.633 8.953   -5.535  1.00 0.00 ? 81  PHE A HB2  5  
ATOM   6853  H  HB3  . PHE A 1 81 ? -18.516 9.404   -4.079  1.00 0.00 ? 81  PHE A HB3  5  
ATOM   6854  H  HD1  . PHE A 1 81 ? -15.112 9.470   -5.637  1.00 0.00 ? 81  PHE A HD1  5  
ATOM   6855  H  HD2  . PHE A 1 81 ? -17.665 11.090  -2.608  1.00 0.00 ? 81  PHE A HD2  5  
ATOM   6856  H  HE1  . PHE A 1 81 ? -13.426 11.183  -5.117  1.00 0.00 ? 81  PHE A HE1  5  
ATOM   6857  H  HE2  . PHE A 1 81 ? -15.971 12.798  -2.102  1.00 0.00 ? 81  PHE A HE2  5  
ATOM   6858  H  HZ   . PHE A 1 81 ? -13.852 12.848  -3.351  1.00 0.00 ? 81  PHE A HZ   5  
ATOM   6859  N  N    . GLU A 1 82 ? -19.476 7.022   -3.170  1.00 0.00 ? 82  GLU A N    5  
ATOM   6860  C  CA   . GLU A 1 82 ? -20.733 6.246   -3.160  1.00 0.00 ? 82  GLU A CA   5  
ATOM   6861  C  C    . GLU A 1 82 ? -21.401 6.195   -4.551  1.00 0.00 ? 82  GLU A C    5  
ATOM   6862  O  O    . GLU A 1 82 ? -22.081 5.220   -4.884  1.00 0.00 ? 82  GLU A O    5  
ATOM   6863  C  CB   . GLU A 1 82 ? -21.694 6.885   -2.119  1.00 0.00 ? 82  GLU A CB   5  
ATOM   6864  C  CG   . GLU A 1 82 ? -23.024 6.138   -1.896  1.00 0.00 ? 82  GLU A CG   5  
ATOM   6865  C  CD   . GLU A 1 82 ? -22.839 4.747   -1.256  1.00 0.00 ? 82  GLU A CD   5  
ATOM   6866  O  OE1  . GLU A 1 82 ? -22.834 4.652   -0.011  1.00 0.00 ? 82  GLU A OE1  5  
ATOM   6867  O  OE2  . GLU A 1 82 ? -22.683 3.749   -1.992  1.00 0.00 ? 82  GLU A OE2  5  
ATOM   6868  H  H    . GLU A 1 82 ? -19.385 7.732   -2.502  1.00 0.00 ? 82  GLU A H    5  
ATOM   6869  H  HA   . GLU A 1 82 ? -20.498 5.233   -2.844  1.00 0.00 ? 82  GLU A HA   5  
ATOM   6870  H  HB2  . GLU A 1 82 ? -21.178 6.935   -1.166  1.00 0.00 ? 82  GLU A HB2  5  
ATOM   6871  H  HB3  . GLU A 1 82 ? -21.924 7.896   -2.433  1.00 0.00 ? 82  GLU A HB3  5  
ATOM   6872  H  HG2  . GLU A 1 82 ? -23.653 6.744   -1.246  1.00 0.00 ? 82  GLU A HG2  5  
ATOM   6873  H  HG3  . GLU A 1 82 ? -23.527 6.025   -2.852  1.00 0.00 ? 82  GLU A HG3  5  
ATOM   6874  N  N    . LYS A 1 83 ? -21.166 7.238   -5.363  1.00 0.00 ? 83  LYS A N    5  
ATOM   6875  C  CA   . LYS A 1 83 ? -21.707 7.340   -6.718  1.00 0.00 ? 83  LYS A CA   5  
ATOM   6876  C  C    . LYS A 1 83 ? -20.955 8.404   -7.509  1.00 0.00 ? 83  LYS A C    5  
ATOM   6877  O  O    . LYS A 1 83 ? -20.258 9.250   -6.931  1.00 0.00 ? 83  LYS A O    5  
ATOM   6878  C  CB   . LYS A 1 83 ? -23.234 7.599   -6.698  1.00 0.00 ? 83  LYS A CB   5  
ATOM   6879  C  CG   . LYS A 1 83 ? -23.696 8.770   -5.807  1.00 0.00 ? 83  LYS A CG   5  
ATOM   6880  C  CD   . LYS A 1 83 ? -25.230 8.802   -5.637  1.00 0.00 ? 83  LYS A CD   5  
ATOM   6881  C  CE   . LYS A 1 83 ? -25.786 7.509   -5.001  1.00 0.00 ? 83  LYS A CE   5  
ATOM   6882  N  NZ   . LYS A 1 83 ? -27.264 7.505   -4.936  1.00 0.00 ? 83  LYS A NZ   5  
ATOM   6883  H  H    . LYS A 1 83 ? -20.568 7.938   -5.051  1.00 0.00 ? 83  LYS A H    5  
ATOM   6884  H  HA   . LYS A 1 83 ? -21.527 6.384   -7.203  1.00 0.00 ? 83  LYS A HA   5  
ATOM   6885  H  HB2  . LYS A 1 83 ? -23.571 7.796   -7.708  1.00 0.00 ? 83  LYS A HB2  5  
ATOM   6886  H  HB3  . LYS A 1 83 ? -23.722 6.692   -6.346  1.00 0.00 ? 83  LYS A HB3  5  
ATOM   6887  H  HG2  . LYS A 1 83 ? -23.236 8.674   -4.830  1.00 0.00 ? 83  LYS A HG2  5  
ATOM   6888  H  HG3  . LYS A 1 83 ? -23.371 9.704   -6.260  1.00 0.00 ? 83  LYS A HG3  5  
ATOM   6889  H  HD2  . LYS A 1 83 ? -25.491 9.642   -5.004  1.00 0.00 ? 83  LYS A HD2  5  
ATOM   6890  H  HD3  . LYS A 1 83 ? -25.686 8.940   -6.613  1.00 0.00 ? 83  LYS A HD3  5  
ATOM   6891  H  HE2  . LYS A 1 83 ? -25.471 6.656   -5.589  1.00 0.00 ? 83  LYS A HE2  5  
ATOM   6892  H  HE3  . LYS A 1 83 ? -25.393 7.409   -3.994  1.00 0.00 ? 83  LYS A HE3  5  
ATOM   6893  H  HZ1  . LYS A 1 83 ? -27.594 6.641   -4.464  1.00 0.00 ? 83  LYS A HZ1  5  
ATOM   6894  H  HZ2  . LYS A 1 83 ? -27.667 7.536   -5.896  1.00 0.00 ? 83  LYS A HZ2  5  
ATOM   6895  H  HZ3  . LYS A 1 83 ? -27.606 8.327   -4.402  1.00 0.00 ? 83  LYS A HZ3  5  
ATOM   6896  N  N    . LYS A 1 84 ? -21.083 8.337   -8.842  1.00 0.00 ? 84  LYS A N    5  
ATOM   6897  C  CA   . LYS A 1 84 ? -20.474 9.319   -9.751  1.00 0.00 ? 84  LYS A CA   5  
ATOM   6898  C  C    . LYS A 1 84 ? -21.116 10.697  -9.548  1.00 0.00 ? 84  LYS A C    5  
ATOM   6899  O  O    . LYS A 1 84 ? -20.473 11.719  -9.755  1.00 0.00 ? 84  LYS A O    5  
ATOM   6900  C  CB   . LYS A 1 84 ? -20.560 8.854   -11.228 1.00 0.00 ? 84  LYS A CB   5  
ATOM   6901  C  CG   . LYS A 1 84 ? -21.964 8.876   -11.873 1.00 0.00 ? 84  LYS A CG   5  
ATOM   6902  C  CD   . LYS A 1 84 ? -21.925 8.443   -13.357 1.00 0.00 ? 84  LYS A CD   5  
ATOM   6903  C  CE   . LYS A 1 84 ? -23.275 8.611   -14.069 1.00 0.00 ? 84  LYS A CE   5  
ATOM   6904  N  NZ   . LYS A 1 84 ? -24.360 7.819   -13.431 1.00 0.00 ? 84  LYS A NZ   5  
ATOM   6905  H  H    . LYS A 1 84 ? -21.585 7.599   -9.220  1.00 0.00 ? 84  LYS A H    5  
ATOM   6906  H  HA   . LYS A 1 84 ? -19.422 9.395   -9.479  1.00 0.00 ? 84  LYS A HA   5  
ATOM   6907  H  HB2  . LYS A 1 84 ? -19.910 9.484   -11.818 1.00 0.00 ? 84  LYS A HB2  5  
ATOM   6908  H  HB3  . LYS A 1 84 ? -20.182 7.836   -11.282 1.00 0.00 ? 84  LYS A HB3  5  
ATOM   6909  H  HG2  . LYS A 1 84 ? -22.614 8.201   -11.327 1.00 0.00 ? 84  LYS A HG2  5  
ATOM   6910  H  HG3  . LYS A 1 84 ? -22.369 9.886   -11.809 1.00 0.00 ? 84  LYS A HG3  5  
ATOM   6911  H  HD2  . LYS A 1 84 ? -21.184 9.039   -13.881 1.00 0.00 ? 84  LYS A HD2  5  
ATOM   6912  H  HD3  . LYS A 1 84 ? -21.633 7.398   -13.407 1.00 0.00 ? 84  LYS A HD3  5  
ATOM   6913  H  HE2  . LYS A 1 84 ? -23.555 9.655   -14.050 1.00 0.00 ? 84  LYS A HE2  5  
ATOM   6914  H  HE3  . LYS A 1 84 ? -23.173 8.291   -15.099 1.00 0.00 ? 84  LYS A HE3  5  
ATOM   6915  H  HZ1  . LYS A 1 84 ? -24.522 8.145   -12.455 1.00 0.00 ? 84  LYS A HZ1  5  
ATOM   6916  H  HZ2  . LYS A 1 84 ? -24.099 6.811   -13.405 1.00 0.00 ? 84  LYS A HZ2  5  
ATOM   6917  H  HZ3  . LYS A 1 84 ? -25.241 7.922   -13.970 1.00 0.00 ? 84  LYS A HZ3  5  
ATOM   6918  N  N    . ASP A 1 85 ? -22.383 10.691  -9.104  1.00 0.00 ? 85  ASP A N    5  
ATOM   6919  C  CA   . ASP A 1 85 ? -23.096 11.900  -8.661  1.00 0.00 ? 85  ASP A CA   5  
ATOM   6920  C  C    . ASP A 1 85 ? -22.359 12.591  -7.485  1.00 0.00 ? 85  ASP A C    5  
ATOM   6921  O  O    . ASP A 1 85 ? -22.272 13.823  -7.445  1.00 0.00 ? 85  ASP A O    5  
ATOM   6922  C  CB   . ASP A 1 85 ? -24.547 11.530  -8.270  1.00 0.00 ? 85  ASP A CB   5  
ATOM   6923  C  CG   . ASP A 1 85 ? -25.353 12.702  -7.685  1.00 0.00 ? 85  ASP A CG   5  
ATOM   6924  O  OD1  . ASP A 1 85 ? -25.653 13.656  -8.427  1.00 0.00 ? 85  ASP A OD1  5  
ATOM   6925  O  OD2  . ASP A 1 85 ? -25.683 12.677  -6.477  1.00 0.00 ? 85  ASP A OD2  5  
ATOM   6926  H  H    . ASP A 1 85 ? -22.867 9.840   -9.095  1.00 0.00 ? 85  ASP A H    5  
ATOM   6927  H  HA   . ASP A 1 85 ? -23.126 12.586  -9.504  1.00 0.00 ? 85  ASP A HA   5  
ATOM   6928  H  HB2  . ASP A 1 85 ? -25.066 11.165  -9.151  1.00 0.00 ? 85  ASP A HB2  5  
ATOM   6929  H  HB3  . ASP A 1 85 ? -24.511 10.727  -7.542  1.00 0.00 ? 85  ASP A HB3  5  
ATOM   6930  N  N    . SER A 1 86 ? -21.816 11.781  -6.542  1.00 0.00 ? 86  SER A N    5  
ATOM   6931  C  CA   . SER A 1 86 ? -20.987 12.282  -5.421  1.00 0.00 ? 86  SER A CA   5  
ATOM   6932  C  C    . SER A 1 86 ? -19.646 12.851  -5.934  1.00 0.00 ? 86  SER A C    5  
ATOM   6933  O  O    . SER A 1 86 ? -19.110 13.788  -5.351  1.00 0.00 ? 86  SER A O    5  
ATOM   6934  C  CB   . SER A 1 86 ? -20.706 11.157  -4.393  1.00 0.00 ? 86  SER A CB   5  
ATOM   6935  O  OG   . SER A 1 86 ? -21.898 10.578  -3.904  1.00 0.00 ? 86  SER A OG   5  
ATOM   6936  H  H    . SER A 1 86 ? -21.966 10.822  -6.597  1.00 0.00 ? 86  SER A H    5  
ATOM   6937  H  HA   . SER A 1 86 ? -21.547 13.069  -4.929  1.00 0.00 ? 86  SER A HA   5  
ATOM   6938  H  HB2  . SER A 1 86 ? -20.124 10.376  -4.855  1.00 0.00 ? 86  SER A HB2  5  
ATOM   6939  H  HB3  . SER A 1 86 ? -20.150 11.561  -3.551  1.00 0.00 ? 86  SER A HB3  5  
ATOM   6940  H  HG   . SER A 1 86 ? -22.657 10.952  -4.367  1.00 0.00 ? 86  SER A HG   5  
ATOM   6941  N  N    . VAL A 1 87 ? -19.133 12.270  -7.039  1.00 0.00 ? 87  VAL A N    5  
ATOM   6942  C  CA   . VAL A 1 87 ? -17.831 12.645  -7.636  1.00 0.00 ? 87  VAL A CA   5  
ATOM   6943  C  C    . VAL A 1 87 ? -17.938 14.013  -8.340  1.00 0.00 ? 87  VAL A C    5  
ATOM   6944  O  O    . VAL A 1 87 ? -17.035 14.841  -8.242  1.00 0.00 ? 87  VAL A O    5  
ATOM   6945  C  CB   . VAL A 1 87 ? -17.325 11.558  -8.665  1.00 0.00 ? 87  VAL A CB   5  
ATOM   6946  C  CG1  . VAL A 1 87 ? -16.022 12.004  -9.376  1.00 0.00 ? 87  VAL A CG1  5  
ATOM   6947  C  CG2  . VAL A 1 87 ? -17.139 10.187  -7.977  1.00 0.00 ? 87  VAL A CG2  5  
ATOM   6948  H  H    . VAL A 1 87 ? -19.670 11.603  -7.492  1.00 0.00 ? 87  VAL A H    5  
ATOM   6949  H  HA   . VAL A 1 87 ? -17.099 12.720  -6.831  1.00 0.00 ? 87  VAL A HA   5  
ATOM   6950  H  HB   . VAL A 1 87 ? -18.090 11.440  -9.426  1.00 0.00 ? 87  VAL A HB   5  
ATOM   6951  H  HG11 . VAL A 1 87 ? -15.696 11.233  -10.063 1.00 0.00 ? 87  VAL A HG11 5  
ATOM   6952  H  HG12 . VAL A 1 87 ? -15.243 12.179  -8.642  1.00 0.00 ? 87  VAL A HG12 5  
ATOM   6953  H  HG13 . VAL A 1 87 ? -16.200 12.917  -9.929  1.00 0.00 ? 87  VAL A HG13 5  
ATOM   6954  H  HG21 . VAL A 1 87 ? -16.390 10.267  -7.199  1.00 0.00 ? 87  VAL A HG21 5  
ATOM   6955  H  HG22 . VAL A 1 87 ? -16.818 9.448   -8.703  1.00 0.00 ? 87  VAL A HG22 5  
ATOM   6956  H  HG23 . VAL A 1 87 ? -18.076 9.867   -7.538  1.00 0.00 ? 87  VAL A HG23 5  
ATOM   6957  N  N    . VAL A 1 88 ? -19.069 14.214  -9.041  1.00 0.00 ? 88  VAL A N    5  
ATOM   6958  C  CA   . VAL A 1 88 ? -19.378 15.457  -9.792  1.00 0.00 ? 88  VAL A CA   5  
ATOM   6959  C  C    . VAL A 1 88 ? -19.719 16.572  -8.802  1.00 0.00 ? 88  VAL A C    5  
ATOM   6960  O  O    . VAL A 1 88 ? -19.359 17.740  -9.003  1.00 0.00 ? 88  VAL A O    5  
ATOM   6961  C  CB   . VAL A 1 88 ? -20.571 15.259  -10.809 1.00 0.00 ? 88  VAL A CB   5  
ATOM   6962  C  CG1  . VAL A 1 88 ? -20.875 16.559  -11.603 1.00 0.00 ? 88  VAL A CG1  5  
ATOM   6963  C  CG2  . VAL A 1 88 ? -20.288 14.093  -11.779 1.00 0.00 ? 88  VAL A CG2  5  
ATOM   6964  H  H    . VAL A 1 88 ? -19.739 13.516  -9.008  1.00 0.00 ? 88  VAL A H    5  
ATOM   6965  H  HA   . VAL A 1 88 ? -18.491 15.744  -10.351 1.00 0.00 ? 88  VAL A HA   5  
ATOM   6966  H  HB   . VAL A 1 88 ? -21.459 15.003  -10.232 1.00 0.00 ? 88  VAL A HB   5  
ATOM   6967  H  HG11 . VAL A 1 88 ? -21.716 16.400  -12.264 1.00 0.00 ? 88  VAL A HG11 5  
ATOM   6968  H  HG12 . VAL A 1 88 ? -20.008 16.839  -12.192 1.00 0.00 ? 88  VAL A HG12 5  
ATOM   6969  H  HG13 . VAL A 1 88 ? -21.108 17.363  -10.915 1.00 0.00 ? 88  VAL A HG13 5  
ATOM   6970  H  HG21 . VAL A 1 88 ? -19.397 14.306  -12.352 1.00 0.00 ? 88  VAL A HG21 5  
ATOM   6971  H  HG22 . VAL A 1 88 ? -21.127 13.954  -12.456 1.00 0.00 ? 88  VAL A HG22 5  
ATOM   6972  H  HG23 . VAL A 1 88 ? -20.135 13.183  -11.218 1.00 0.00 ? 88  VAL A HG23 5  
ATOM   6973  N  N    . ALA A 1 89 ? -20.399 16.173  -7.712  1.00 0.00 ? 89  ALA A N    5  
ATOM   6974  C  CA   . ALA A 1 89 ? -20.748 17.076  -6.610  1.00 0.00 ? 89  ALA A CA   5  
ATOM   6975  C  C    . ALA A 1 89 ? -19.466 17.547  -5.911  1.00 0.00 ? 89  ALA A C    5  
ATOM   6976  O  O    . ALA A 1 89 ? -19.319 18.717  -5.575  1.00 0.00 ? 89  ALA A O    5  
ATOM   6977  C  CB   . ALA A 1 89 ? -21.685 16.381  -5.612  1.00 0.00 ? 89  ALA A CB   5  
ATOM   6978  H  H    . ALA A 1 89 ? -20.641 15.224  -7.636  1.00 0.00 ? 89  ALA A H    5  
ATOM   6979  H  HA   . ALA A 1 89 ? -21.268 17.927  -7.034  1.00 0.00 ? 89  ALA A HA   5  
ATOM   6980  H  HB1  . ALA A 1 89 ? -22.577 16.046  -6.124  1.00 0.00 ? 89  ALA A HB1  5  
ATOM   6981  H  HB2  . ALA A 1 89 ? -21.966 17.071  -4.826  1.00 0.00 ? 89  ALA A HB2  5  
ATOM   6982  H  HB3  . ALA A 1 89 ? -21.186 15.524  -5.172  1.00 0.00 ? 89  ALA A HB3  5  
ATOM   6983  N  N    . HIS A 1 90 ? -18.531 16.593  -5.748  1.00 0.00 ? 90  HIS A N    5  
ATOM   6984  C  CA   . HIS A 1 90 ? -17.194 16.822  -5.149  1.00 0.00 ? 90  HIS A CA   5  
ATOM   6985  C  C    . HIS A 1 90 ? -16.294 17.629  -6.116  1.00 0.00 ? 90  HIS A C    5  
ATOM   6986  O  O    . HIS A 1 90 ? -15.461 18.422  -5.681  1.00 0.00 ? 90  HIS A O    5  
ATOM   6987  C  CB   . HIS A 1 90 ? -16.549 15.442  -4.783  1.00 0.00 ? 90  HIS A CB   5  
ATOM   6988  C  CG   . HIS A 1 90 ? -15.048 15.375  -4.869  1.00 0.00 ? 90  HIS A CG   5  
ATOM   6989  N  ND1  . HIS A 1 90 ? -14.198 15.818  -3.890  1.00 0.00 ? 90  HIS A ND1  5  
ATOM   6990  C  CD2  . HIS A 1 90 ? -14.260 14.898  -5.867  1.00 0.00 ? 90  HIS A CD2  5  
ATOM   6991  C  CE1  . HIS A 1 90 ? -12.951 15.598  -4.307  1.00 0.00 ? 90  HIS A CE1  5  
ATOM   6992  N  NE2  . HIS A 1 90 ? -12.933 15.033  -5.502  1.00 0.00 ? 90  HIS A NE2  5  
ATOM   6993  H  H    . HIS A 1 90 ? -18.748 15.676  -6.051  1.00 0.00 ? 90  HIS A H    5  
ATOM   6994  H  HA   . HIS A 1 90 ? -17.332 17.400  -4.239  1.00 0.00 ? 90  HIS A HA   5  
ATOM   6995  H  HB2  . HIS A 1 90 ? -16.820 15.178  -3.770  1.00 0.00 ? 90  HIS A HB2  5  
ATOM   6996  H  HB3  . HIS A 1 90 ? -16.948 14.680  -5.447  1.00 0.00 ? 90  HIS A HB3  5  
ATOM   6997  H  HD1  . HIS A 1 90 ? -14.457 16.224  -3.035  1.00 0.00 ? 90  HIS A HD1  5  
ATOM   6998  H  HD2  . HIS A 1 90 ? -14.607 14.544  -6.830  1.00 0.00 ? 90  HIS A HD2  5  
ATOM   6999  H  HE1  . HIS A 1 90 ? -12.068 15.856  -3.746  1.00 0.00 ? 90  HIS A HE1  5  
ATOM   7000  N  N    . LYS A 1 91 ? -16.476 17.393  -7.423  1.00 0.00 ? 91  LYS A N    5  
ATOM   7001  C  CA   . LYS A 1 91 ? -15.671 18.012  -8.498  1.00 0.00 ? 91  LYS A CA   5  
ATOM   7002  C  C    . LYS A 1 91 ? -16.028 19.500  -8.587  1.00 0.00 ? 91  LYS A C    5  
ATOM   7003  O  O    . LYS A 1 91 ? -15.191 20.341  -8.885  1.00 0.00 ? 91  LYS A O    5  
ATOM   7004  C  CB   . LYS A 1 91 ? -15.940 17.317  -9.866  1.00 0.00 ? 91  LYS A CB   5  
ATOM   7005  C  CG   . LYS A 1 91 ? -15.046 17.809  -11.029 1.00 0.00 ? 91  LYS A CG   5  
ATOM   7006  C  CD   . LYS A 1 91 ? -15.472 17.239  -12.404 1.00 0.00 ? 91  LYS A CD   5  
ATOM   7007  C  CE   . LYS A 1 91 ? -15.462 15.707  -12.465 1.00 0.00 ? 91  LYS A CE   5  
ATOM   7008  N  NZ   . LYS A 1 91 ? -15.750 15.210  -13.831 1.00 0.00 ? 91  LYS A NZ   5  
ATOM   7009  H  H    . LYS A 1 91 ? -17.205 16.810  -7.674  1.00 0.00 ? 91  LYS A H    5  
ATOM   7010  H  HA   . LYS A 1 91 ? -14.612 17.895  -8.244  1.00 0.00 ? 91  LYS A HA   5  
ATOM   7011  H  HB2  . LYS A 1 91 ? -15.785 16.246  -9.749  1.00 0.00 ? 91  LYS A HB2  5  
ATOM   7012  H  HB3  . LYS A 1 91 ? -16.978 17.478  -10.141 1.00 0.00 ? 91  LYS A HB3  5  
ATOM   7013  H  HG2  . LYS A 1 91 ? -15.099 18.892  -11.076 1.00 0.00 ? 91  LYS A HG2  5  
ATOM   7014  H  HG3  . LYS A 1 91 ? -14.019 17.515  -10.827 1.00 0.00 ? 91  LYS A HG3  5  
ATOM   7015  H  HD2  . LYS A 1 91 ? -16.477 17.587  -12.624 1.00 0.00 ? 91  LYS A HD2  5  
ATOM   7016  H  HD3  . LYS A 1 91 ? -14.798 17.626  -13.163 1.00 0.00 ? 91  LYS A HD3  5  
ATOM   7017  H  HE2  . LYS A 1 91 ? -14.487 15.343  -12.168 1.00 0.00 ? 91  LYS A HE2  5  
ATOM   7018  H  HE3  . LYS A 1 91 ? -16.212 15.318  -11.787 1.00 0.00 ? 91  LYS A HE3  5  
ATOM   7019  H  HZ1  . LYS A 1 91 ? -15.067 15.606  -14.509 1.00 0.00 ? 91  LYS A HZ1  5  
ATOM   7020  H  HZ2  . LYS A 1 91 ? -16.710 15.481  -14.120 1.00 0.00 ? 91  LYS A HZ2  5  
ATOM   7021  H  HZ3  . LYS A 1 91 ? -15.677 14.173  -13.855 1.00 0.00 ? 91  LYS A HZ3  5  
ATOM   7022  N  N    . ALA A 1 92 ? -17.305 19.790  -8.305  1.00 0.00 ? 92  ALA A N    5  
ATOM   7023  C  CA   . ALA A 1 92 ? -17.841 21.148  -8.248  1.00 0.00 ? 92  ALA A CA   5  
ATOM   7024  C  C    . ALA A 1 92 ? -17.174 21.964  -7.120  1.00 0.00 ? 92  ALA A C    5  
ATOM   7025  O  O    . ALA A 1 92 ? -16.971 23.176  -7.255  1.00 0.00 ? 92  ALA A O    5  
ATOM   7026  C  CB   . ALA A 1 92 ? -19.368 21.090  -8.052  1.00 0.00 ? 92  ALA A CB   5  
ATOM   7027  H  H    . ALA A 1 92 ? -17.909 19.048  -8.123  1.00 0.00 ? 92  ALA A H    5  
ATOM   7028  H  HA   . ALA A 1 92 ? -17.644 21.622  -9.203  1.00 0.00 ? 92  ALA A HA   5  
ATOM   7029  H  HB1  . ALA A 1 92 ? -19.783 22.090  -8.076  1.00 0.00 ? 92  ALA A HB1  5  
ATOM   7030  H  HB2  . ALA A 1 92 ? -19.593 20.634  -7.097  1.00 0.00 ? 92  ALA A HB2  5  
ATOM   7031  H  HB3  . ALA A 1 92 ? -19.817 20.496  -8.843  1.00 0.00 ? 92  ALA A HB3  5  
ATOM   7032  N  N    . LYS A 1 93 ? -16.807 21.276  -6.018  1.00 0.00 ? 93  LYS A N    5  
ATOM   7033  C  CA   . LYS A 1 93 ? -16.312 21.951  -4.786  1.00 0.00 ? 93  LYS A CA   5  
ATOM   7034  C  C    . LYS A 1 93 ? -14.779 22.035  -4.780  1.00 0.00 ? 93  LYS A C    5  
ATOM   7035  O  O    . LYS A 1 93 ? -14.201 23.105  -4.552  1.00 0.00 ? 93  LYS A O    5  
ATOM   7036  C  CB   . LYS A 1 93 ? -16.812 21.207  -3.513  1.00 0.00 ? 93  LYS A CB   5  
ATOM   7037  C  CG   . LYS A 1 93 ? -18.315 20.862  -3.521  1.00 0.00 ? 93  LYS A CG   5  
ATOM   7038  C  CD   . LYS A 1 93 ? -19.248 22.081  -3.758  1.00 0.00 ? 93  LYS A CD   5  
ATOM   7039  C  CE   . LYS A 1 93 ? -20.719 21.659  -3.950  1.00 0.00 ? 93  LYS A CE   5  
ATOM   7040  N  NZ   . LYS A 1 93 ? -21.230 20.883  -2.789  1.00 0.00 ? 93  LYS A NZ   5  
ATOM   7041  H  H    . LYS A 1 93 ? -16.860 20.282  -6.039  1.00 0.00 ? 93  LYS A H    5  
ATOM   7042  H  HA   . LYS A 1 93 ? -16.714 22.968  -4.771  1.00 0.00 ? 93  LYS A HA   5  
ATOM   7043  H  HB2  . LYS A 1 93 ? -16.257 20.275  -3.404  1.00 0.00 ? 93  LYS A HB2  5  
ATOM   7044  H  HB3  . LYS A 1 93 ? -16.610 21.827  -2.642  1.00 0.00 ? 93  LYS A HB3  5  
ATOM   7045  H  HG2  . LYS A 1 93 ? -18.489 20.142  -4.311  1.00 0.00 ? 93  LYS A HG2  5  
ATOM   7046  H  HG3  . LYS A 1 93 ? -18.572 20.401  -2.568  1.00 0.00 ? 93  LYS A HG3  5  
ATOM   7047  H  HD2  . LYS A 1 93 ? -19.187 22.748  -2.905  1.00 0.00 ? 93  LYS A HD2  5  
ATOM   7048  H  HD3  . LYS A 1 93 ? -18.918 22.614  -4.648  1.00 0.00 ? 93  LYS A HD3  5  
ATOM   7049  H  HE2  . LYS A 1 93 ? -21.329 22.545  -4.069  1.00 0.00 ? 93  LYS A HE2  5  
ATOM   7050  H  HE3  . LYS A 1 93 ? -20.801 21.049  -4.845  1.00 0.00 ? 93  LYS A HE3  5  
ATOM   7051  H  HZ1  . LYS A 1 93 ? -21.172 21.454  -1.921  1.00 0.00 ? 93  LYS A HZ1  5  
ATOM   7052  H  HZ2  . LYS A 1 93 ? -20.663 20.020  -2.660  1.00 0.00 ? 93  LYS A HZ2  5  
ATOM   7053  H  HZ3  . LYS A 1 93 ? -22.218 20.608  -2.946  1.00 0.00 ? 93  LYS A HZ3  5  
ATOM   7054  N  N    . SER A 1 94 ? -14.133 20.900  -5.064  1.00 0.00 ? 94  SER A N    5  
ATOM   7055  C  CA   . SER A 1 94 ? -12.686 20.733  -4.924  1.00 0.00 ? 94  SER A CA   5  
ATOM   7056  C  C    . SER A 1 94 ? -11.954 21.103  -6.225  1.00 0.00 ? 94  SER A C    5  
ATOM   7057  O  O    . SER A 1 94 ? -10.772 21.460  -6.197  1.00 0.00 ? 94  SER A O    5  
ATOM   7058  C  CB   . SER A 1 94 ? -12.367 19.272  -4.523  1.00 0.00 ? 94  SER A CB   5  
ATOM   7059  O  OG   . SER A 1 94 ? -10.982 19.079  -4.295  1.00 0.00 ? 94  SER A OG   5  
ATOM   7060  H  H    . SER A 1 94 ? -14.641 20.156  -5.403  1.00 0.00 ? 94  SER A H    5  
ATOM   7061  H  HA   . SER A 1 94 ? -12.349 21.387  -4.130  1.00 0.00 ? 94  SER A HA   5  
ATOM   7062  H  HB2  . SER A 1 94 ? -12.894 19.017  -3.613  1.00 0.00 ? 94  SER A HB2  5  
ATOM   7063  H  HB3  . SER A 1 94 ? -12.678 18.597  -5.312  1.00 0.00 ? 94  SER A HB3  5  
ATOM   7064  H  HG   . SER A 1 94 ? -10.607 19.868  -3.880  1.00 0.00 ? 94  SER A HG   5  
ATOM   7065  N  N    . HIS A 1 95 ? -12.668 21.029  -7.369  1.00 0.00 ? 95  HIS A N    5  
ATOM   7066  C  CA   . HIS A 1 95 ? -12.067 21.224  -8.712  1.00 0.00 ? 95  HIS A CA   5  
ATOM   7067  C  C    . HIS A 1 95 ? -12.929 22.201  -9.591  1.00 0.00 ? 95  HIS A C    5  
ATOM   7068  O  O    . HIS A 1 95 ? -13.189 21.883  -10.763 1.00 0.00 ? 95  HIS A O    5  
ATOM   7069  C  CB   . HIS A 1 95 ? -11.939 19.840  -9.431  1.00 0.00 ? 95  HIS A CB   5  
ATOM   7070  C  CG   . HIS A 1 95 ? -11.338 18.711  -8.625  1.00 0.00 ? 95  HIS A CG   5  
ATOM   7071  N  ND1  . HIS A 1 95 ? -10.147 18.783  -7.931  1.00 0.00 ? 95  HIS A ND1  5  
ATOM   7072  C  CD2  . HIS A 1 95 ? -11.800 17.449  -8.436  1.00 0.00 ? 95  HIS A CD2  5  
ATOM   7073  C  CE1  . HIS A 1 95 ? -9.933  17.582  -7.363  1.00 0.00 ? 95  HIS A CE1  5  
ATOM   7074  N  NE2  . HIS A 1 95 ? -10.912 16.739  -7.649  1.00 0.00 ? 95  HIS A NE2  5  
ATOM   7075  H  H    . HIS A 1 95 ? -13.631 20.867  -7.310  1.00 0.00 ? 95  HIS A H    5  
ATOM   7076  H  HA   . HIS A 1 95 ? -11.076 21.655  -8.596  1.00 0.00 ? 95  HIS A HA   5  
ATOM   7077  H  HB2  . HIS A 1 95 ? -12.926 19.518  -9.754  1.00 0.00 ? 95  HIS A HB2  5  
ATOM   7078  H  HB3  . HIS A 1 95 ? -11.325 19.968  -10.315 1.00 0.00 ? 95  HIS A HB3  5  
ATOM   7079  H  HD1  . HIS A 1 95 ? -9.564  19.569  -7.858  1.00 0.00 ? 95  HIS A HD1  5  
ATOM   7080  H  HD2  . HIS A 1 95 ? -12.716 17.044  -8.847  1.00 0.00 ? 95  HIS A HD2  5  
ATOM   7081  H  HE1  . HIS A 1 95 ? -9.078  17.340  -6.747  1.00 0.00 ? 95  HIS A HE1  5  
ATOM   7082  N  N    . PRO A 1 96 ? -13.385 23.410  -9.080  1.00 0.00 ? 96  PRO A N    5  
ATOM   7083  C  CA   . PRO A 1 96 ? -14.296 24.301  -9.858  1.00 0.00 ? 96  PRO A CA   5  
ATOM   7084  C  C    . PRO A 1 96 ? -13.608 24.912  -11.110 1.00 0.00 ? 96  PRO A C    5  
ATOM   7085  O  O    . PRO A 1 96 ? -14.269 25.226  -12.106 1.00 0.00 ? 96  PRO A O    5  
ATOM   7086  C  CB   . PRO A 1 96 ? -14.710 25.382  -8.825  1.00 0.00 ? 96  PRO A CB   5  
ATOM   7087  C  CG   . PRO A 1 96 ? -13.569 25.433  -7.855  1.00 0.00 ? 96  PRO A CG   5  
ATOM   7088  C  CD   . PRO A 1 96 ? -13.061 24.011  -7.752  1.00 0.00 ? 96  PRO A CD   5  
ATOM   7089  H  HA   . PRO A 1 96 ? -15.180 23.754  -10.185 1.00 0.00 ? 96  PRO A HA   5  
ATOM   7090  H  HB2  . PRO A 1 96 ? -14.862 26.340  -9.315  1.00 0.00 ? 96  PRO A HB2  5  
ATOM   7091  H  HB3  . PRO A 1 96 ? -15.630 25.083  -8.335  1.00 0.00 ? 96  PRO A HB3  5  
ATOM   7092  H  HG2  . PRO A 1 96 ? -12.789 26.092  -8.229  1.00 0.00 ? 96  PRO A HG2  5  
ATOM   7093  H  HG3  . PRO A 1 96 ? -13.915 25.784  -6.887  1.00 0.00 ? 96  PRO A HG3  5  
ATOM   7094  H  HD2  . PRO A 1 96 ? -11.994 23.993  -7.567  1.00 0.00 ? 96  PRO A HD2  5  
ATOM   7095  H  HD3  . PRO A 1 96 ? -13.581 23.475  -6.962  1.00 0.00 ? 96  PRO A HD3  5  
ATOM   7096  N  N    . GLU A 1 97 ? -12.269 25.051  -11.041 1.00 0.00 ? 97  GLU A N    5  
ATOM   7097  C  CA   . GLU A 1 97 ? -11.431 25.550  -12.125 1.00 0.00 ? 97  GLU A CA   5  
ATOM   7098  C  C    . GLU A 1 97 ? -10.153 24.684  -12.174 1.00 0.00 ? 97  GLU A C    5  
ATOM   7099  O  O    . GLU A 1 97 ? -9.267  24.819  -11.322 1.00 0.00 ? 97  GLU A O    5  
ATOM   7100  C  CB   . GLU A 1 97 ? -11.136 27.074  -11.910 1.00 0.00 ? 97  GLU A CB   5  
ATOM   7101  C  CG   . GLU A 1 97 ? -10.364 27.792  -13.050 1.00 0.00 ? 97  GLU A CG   5  
ATOM   7102  C  CD   . GLU A 1 97 ? -8.832  27.633  -12.978 1.00 0.00 ? 97  GLU A CD   5  
ATOM   7103  O  OE1  . GLU A 1 97 ? -8.202  28.294  -12.120 1.00 0.00 ? 97  GLU A OE1  5  
ATOM   7104  O  OE2  . GLU A 1 97 ? -8.251  26.835  -13.748 1.00 0.00 ? 97  GLU A OE2  5  
ATOM   7105  H  H    . GLU A 1 97 ? -11.826 24.800  -10.227 1.00 0.00 ? 97  GLU A H    5  
ATOM   7106  H  HA   . GLU A 1 97 ? -11.974 25.426  -13.055 1.00 0.00 ? 97  GLU A HA   5  
ATOM   7107  H  HB2  . GLU A 1 97 ? -12.088 27.585  -11.787 1.00 0.00 ? 97  GLU A HB2  5  
ATOM   7108  H  HB3  . GLU A 1 97 ? -10.575 27.191  -10.987 1.00 0.00 ? 97  GLU A HB3  5  
ATOM   7109  H  HG2  . GLU A 1 97 ? -10.716 27.402  -14.000 1.00 0.00 ? 97  GLU A HG2  5  
ATOM   7110  H  HG3  . GLU A 1 97 ? -10.596 28.852  -13.010 1.00 0.00 ? 97  GLU A HG3  5  
ATOM   7111  N  N    . VAL A 1 98 ? -10.114 23.743  -13.127 1.00 0.00 ? 98  VAL A N    5  
ATOM   7112  C  CA   . VAL A 1 98 ? -8.924  22.911  -13.421 1.00 0.00 ? 98  VAL A CA   5  
ATOM   7113  C  C    . VAL A 1 98 ? -8.907  22.545  -14.939 1.00 0.00 ? 98  VAL A C    5  
ATOM   7114  O  O    . VAL A 1 98 ? -9.738  21.724  -15.395 1.00 0.00 ? 98  VAL A O    5  
ATOM   7115  C  CB   . VAL A 1 98 ? -8.822  21.636  -12.472 1.00 0.00 ? 98  VAL A CB   5  
ATOM   7116  C  CG1  . VAL A 1 98 ? -10.144 20.832  -12.431 1.00 0.00 ? 98  VAL A CG1  5  
ATOM   7117  C  CG2  . VAL A 1 98 ? -7.598  20.744  -12.843 1.00 0.00 ? 98  VAL A CG2  5  
ATOM   7118  O  OXT  . VAL A 1 98 ? -8.076  23.109  -15.686 1.00 0.00 ? 98  VAL A OXT  5  
ATOM   7119  H  H    . VAL A 1 98 ? -10.924 23.599  -13.653 1.00 0.00 ? 98  VAL A H    5  
ATOM   7120  H  HA   . VAL A 1 98 ? -8.046  23.535  -13.216 1.00 0.00 ? 98  VAL A HA   5  
ATOM   7121  H  HB   . VAL A 1 98 ? -8.657  22.003  -11.461 1.00 0.00 ? 98  VAL A HB   5  
ATOM   7122  H  HG11 . VAL A 1 98 ? -10.388 20.480  -13.423 1.00 0.00 ? 98  VAL A HG11 5  
ATOM   7123  H  HG12 . VAL A 1 98 ? -10.947 21.472  -12.075 1.00 0.00 ? 98  VAL A HG12 5  
ATOM   7124  H  HG13 . VAL A 1 98 ? -10.047 19.985  -11.760 1.00 0.00 ? 98  VAL A HG13 5  
ATOM   7125  H  HG21 . VAL A 1 98 ? -6.690  21.337  -12.790 1.00 0.00 ? 98  VAL A HG21 5  
ATOM   7126  H  HG22 . VAL A 1 98 ? -7.708  20.359  -13.848 1.00 0.00 ? 98  VAL A HG22 5  
ATOM   7127  H  HG23 . VAL A 1 98 ? -7.517  19.913  -12.150 1.00 0.00 ? 98  VAL A HG23 5  
HETATM 7128  ZN ZN   . ZN  B 2 .  ? 15.888  0.322   3.541   1.00 0.00 ? 101 ZN  A ZN   5  
HETATM 7129  ZN ZN   . ZN  C 2 .  ? -4.829  -2.344  -6.494  1.00 0.00 ? 102 ZN  A ZN   5  
HETATM 7130  ZN ZN   . ZN  D 2 .  ? -11.303 14.882  -6.775  1.00 0.00 ? 103 ZN  A ZN   5  
ATOM   7131  N  N    . HIS A 1 10 ? 19.278  -14.606 16.169  1.00 0.00 ? 10  HIS A N    6  
ATOM   7132  C  CA   . HIS A 1 10 ? 18.995  -13.189 15.811  1.00 0.00 ? 10  HIS A CA   6  
ATOM   7133  C  C    . HIS A 1 10 ? 17.614  -13.039 15.126  1.00 0.00 ? 10  HIS A C    6  
ATOM   7134  O  O    . HIS A 1 10 ? 17.297  -11.966 14.588  1.00 0.00 ? 10  HIS A O    6  
ATOM   7135  C  CB   . HIS A 1 10 ? 20.129  -12.608 14.919  1.00 0.00 ? 10  HIS A CB   6  
ATOM   7136  C  CG   . HIS A 1 10 ? 20.141  -13.128 13.499  1.00 0.00 ? 10  HIS A CG   6  
ATOM   7137  N  ND1  . HIS A 1 10 ? 19.447  -12.515 12.479  1.00 0.00 ? 10  HIS A ND1  6  
ATOM   7138  C  CD2  . HIS A 1 10 ? 20.748  -14.202 12.936  1.00 0.00 ? 10  HIS A CD2  6  
ATOM   7139  C  CE1  . HIS A 1 10 ? 19.621  -13.184 11.363  1.00 0.00 ? 10  HIS A CE1  6  
ATOM   7140  N  NE2  . HIS A 1 10 ? 20.406  -14.211 11.608  1.00 0.00 ? 10  HIS A NE2  6  
ATOM   7141  H  H    . HIS A 1 10 ? 18.553  -14.958 16.825  1.00 0.00 ? 10  HIS A H    6  
ATOM   7142  H  HA   . HIS A 1 10 ? 18.962  -12.634 16.735  1.00 0.00 ? 10  HIS A HA   6  
ATOM   7143  H  HB2  . HIS A 1 10 ? 20.027  -11.530 14.869  1.00 0.00 ? 10  HIS A HB2  6  
ATOM   7144  H  HB3  . HIS A 1 10 ? 21.086  -12.845 15.371  1.00 0.00 ? 10  HIS A HB3  6  
ATOM   7145  H  HD1  . HIS A 1 10 ? 18.905  -11.696 12.564  1.00 0.00 ? 10  HIS A HD1  6  
ATOM   7146  H  HD2  . HIS A 1 10 ? 21.386  -14.915 13.437  1.00 0.00 ? 10  HIS A HD2  6  
ATOM   7147  H  HE1  . HIS A 1 10 ? 19.203  -12.923 10.401  1.00 0.00 ? 10  HIS A HE1  6  
ATOM   7148  H  HE2  . HIS A 1 10 ? 20.853  -14.743 10.914  1.00 0.00 ? 10  HIS A HE2  6  
ATOM   7149  N  N    . MET A 1 11 ? 16.803  -14.121 15.136  1.00 0.00 ? 11  MET A N    6  
ATOM   7150  C  CA   . MET A 1 11 ? 15.401  -14.092 14.661  1.00 0.00 ? 11  MET A CA   6  
ATOM   7151  C  C    . MET A 1 11 ? 14.547  -13.292 15.670  1.00 0.00 ? 11  MET A C    6  
ATOM   7152  O  O    . MET A 1 11 ? 13.873  -13.857 16.538  1.00 0.00 ? 11  MET A O    6  
ATOM   7153  C  CB   . MET A 1 11 ? 14.860  -15.546 14.456  1.00 0.00 ? 11  MET A CB   6  
ATOM   7154  C  CG   . MET A 1 11 ? 13.440  -15.642 13.860  1.00 0.00 ? 11  MET A CG   6  
ATOM   7155  S  SD   . MET A 1 11 ? 13.365  -15.117 12.130  1.00 0.00 ? 11  MET A SD   6  
ATOM   7156  C  CE   . MET A 1 11 ? 11.613  -15.225 11.756  1.00 0.00 ? 11  MET A CE   6  
ATOM   7157  H  H    . MET A 1 11 ? 17.158  -14.969 15.470  1.00 0.00 ? 11  MET A H    6  
ATOM   7158  H  HA   . MET A 1 11 ? 15.387  -13.573 13.701  1.00 0.00 ? 11  MET A HA   6  
ATOM   7159  H  HB2  . MET A 1 11 ? 15.535  -16.073 13.787  1.00 0.00 ? 11  MET A HB2  6  
ATOM   7160  H  HB3  . MET A 1 11 ? 14.866  -16.058 15.414  1.00 0.00 ? 11  MET A HB3  6  
ATOM   7161  H  HG2  . MET A 1 11 ? 13.105  -16.670 13.919  1.00 0.00 ? 11  MET A HG2  6  
ATOM   7162  H  HG3  . MET A 1 11 ? 12.773  -15.015 14.439  1.00 0.00 ? 11  MET A HG3  6  
ATOM   7163  H  HE1  . MET A 1 11 ? 11.266  -16.233 11.930  1.00 0.00 ? 11  MET A HE1  6  
ATOM   7164  H  HE2  . MET A 1 11 ? 11.451  -14.965 10.718  1.00 0.00 ? 11  MET A HE2  6  
ATOM   7165  H  HE3  . MET A 1 11 ? 11.065  -14.543 12.387  1.00 0.00 ? 11  MET A HE3  6  
ATOM   7166  N  N    . ARG A 1 12 ? 14.656  -11.957 15.576  1.00 0.00 ? 12  ARG A N    6  
ATOM   7167  C  CA   . ARG A 1 12 ? 14.033  -11.013 16.507  1.00 0.00 ? 12  ARG A CA   6  
ATOM   7168  C  C    . ARG A 1 12 ? 14.058  -9.621  15.865  1.00 0.00 ? 12  ARG A C    6  
ATOM   7169  O  O    . ARG A 1 12 ? 15.084  -8.927  15.943  1.00 0.00 ? 12  ARG A O    6  
ATOM   7170  C  CB   . ARG A 1 12 ? 14.797  -10.972 17.868  1.00 0.00 ? 12  ARG A CB   6  
ATOM   7171  C  CG   . ARG A 1 12 ? 14.165  -10.036 18.935  1.00 0.00 ? 12  ARG A CG   6  
ATOM   7172  C  CD   . ARG A 1 12 ? 15.174  -9.524  19.981  1.00 0.00 ? 12  ARG A CD   6  
ATOM   7173  N  NE   . ARG A 1 12 ? 15.825  -10.617 20.742  1.00 0.00 ? 12  ARG A NE   6  
ATOM   7174  C  CZ   . ARG A 1 12 ? 17.151  -10.791 20.869  1.00 0.00 ? 12  ARG A CZ   6  
ATOM   7175  N  NH1  . ARG A 1 12 ? 18.015  -10.032 20.196  1.00 0.00 ? 12  ARG A NH1  6  
ATOM   7176  N  NH2  . ARG A 1 12 ? 17.619  -11.752 21.657  1.00 0.00 ? 12  ARG A NH2  6  
ATOM   7177  H  H    . ARG A 1 12 ? 15.188  -11.584 14.838  1.00 0.00 ? 12  ARG A H    6  
ATOM   7178  H  HA   . ARG A 1 12 ? 13.003  -11.320 16.679  1.00 0.00 ? 12  ARG A HA   6  
ATOM   7179  H  HB2  . ARG A 1 12 ? 14.836  -11.980 18.275  1.00 0.00 ? 12  ARG A HB2  6  
ATOM   7180  H  HB3  . ARG A 1 12 ? 15.818  -10.648 17.681  1.00 0.00 ? 12  ARG A HB3  6  
ATOM   7181  H  HG2  . ARG A 1 12 ? 13.730  -9.179  18.436  1.00 0.00 ? 12  ARG A HG2  6  
ATOM   7182  H  HG3  . ARG A 1 12 ? 13.376  -10.579 19.448  1.00 0.00 ? 12  ARG A HG3  6  
ATOM   7183  H  HD2  . ARG A 1 12 ? 15.931  -8.925  19.478  1.00 0.00 ? 12  ARG A HD2  6  
ATOM   7184  H  HD3  . ARG A 1 12 ? 14.645  -8.889  20.683  1.00 0.00 ? 12  ARG A HD3  6  
ATOM   7185  H  HE   . ARG A 1 12 ? 15.226  -11.235 21.212  1.00 0.00 ? 12  ARG A HE   6  
ATOM   7186  H  HH11 . ARG A 1 12 ? 17.682  -9.319  19.571  1.00 0.00 ? 12  ARG A HH11 6  
ATOM   7187  H  HH12 . ARG A 1 12 ? 19.000  -10.173 20.301  1.00 0.00 ? 12  ARG A HH12 6  
ATOM   7188  H  HH21 . ARG A 1 12 ? 16.983  -12.357 22.152  1.00 0.00 ? 12  ARG A HH21 6  
ATOM   7189  H  HH22 . ARG A 1 12 ? 18.607  -11.885 21.757  1.00 0.00 ? 12  ARG A HH22 6  
ATOM   7190  N  N    . ASP A 1 13 ? 12.956  -9.270  15.174  1.00 0.00 ? 13  ASP A N    6  
ATOM   7191  C  CA   . ASP A 1 13 ? 12.711  -7.927  14.621  1.00 0.00 ? 13  ASP A CA   6  
ATOM   7192  C  C    . ASP A 1 13 ? 13.840  -7.488  13.672  1.00 0.00 ? 13  ASP A C    6  
ATOM   7193  O  O    . ASP A 1 13 ? 14.849  -6.914  14.098  1.00 0.00 ? 13  ASP A O    6  
ATOM   7194  C  CB   . ASP A 1 13 ? 12.491  -6.889  15.744  1.00 0.00 ? 13  ASP A CB   6  
ATOM   7195  C  CG   . ASP A 1 13 ? 11.293  -7.220  16.650  1.00 0.00 ? 13  ASP A CG   6  
ATOM   7196  O  OD1  . ASP A 1 13 ? 11.464  -7.972  17.637  1.00 0.00 ? 13  ASP A OD1  6  
ATOM   7197  O  OD2  . ASP A 1 13 ? 10.167  -6.757  16.369  1.00 0.00 ? 13  ASP A OD2  6  
ATOM   7198  H  H    . ASP A 1 13 ? 12.284  -9.956  15.002  1.00 0.00 ? 13  ASP A H    6  
ATOM   7199  H  HA   . ASP A 1 13 ? 11.795  -7.995  14.040  1.00 0.00 ? 13  ASP A HA   6  
ATOM   7200  H  HB2  . ASP A 1 13 ? 13.387  -6.839  16.351  1.00 0.00 ? 13  ASP A HB2  6  
ATOM   7201  H  HB3  . ASP A 1 13 ? 12.328  -5.916  15.296  1.00 0.00 ? 13  ASP A HB3  6  
ATOM   7202  N  N    . TYR A 1 14 ? 13.659  -7.818  12.399  1.00 0.00 ? 14  TYR A N    6  
ATOM   7203  C  CA   . TYR A 1 14 ? 14.639  -7.559  11.336  1.00 0.00 ? 14  TYR A CA   6  
ATOM   7204  C  C    . TYR A 1 14 ? 14.593  -6.093  10.908  1.00 0.00 ? 14  TYR A C    6  
ATOM   7205  O  O    . TYR A 1 14 ? 13.556  -5.585  10.459  1.00 0.00 ? 14  TYR A O    6  
ATOM   7206  C  CB   . TYR A 1 14 ? 14.387  -8.502  10.137  1.00 0.00 ? 14  TYR A CB   6  
ATOM   7207  C  CG   . TYR A 1 14 ? 14.801  -9.947  10.430  1.00 0.00 ? 14  TYR A CG   6  
ATOM   7208  C  CD1  . TYR A 1 14 ? 13.974  -10.809 11.147  1.00 0.00 ? 14  TYR A CD1  6  
ATOM   7209  C  CD2  . TYR A 1 14 ? 16.040  -10.436 10.018  1.00 0.00 ? 14  TYR A CD2  6  
ATOM   7210  C  CE1  . TYR A 1 14 ? 14.369  -12.099 11.436  1.00 0.00 ? 14  TYR A CE1  6  
ATOM   7211  C  CE2  . TYR A 1 14 ? 16.435  -11.721 10.309  1.00 0.00 ? 14  TYR A CE2  6  
ATOM   7212  C  CZ   . TYR A 1 14 ? 15.602  -12.549 11.013  1.00 0.00 ? 14  TYR A CZ   6  
ATOM   7213  O  OH   . TYR A 1 14 ? 15.998  -13.829 11.295  1.00 0.00 ? 14  TYR A OH   6  
ATOM   7214  H  H    . TYR A 1 14 ? 12.819  -8.248  12.159  1.00 0.00 ? 14  TYR A H    6  
ATOM   7215  H  HA   . TYR A 1 14 ? 15.627  -7.772  11.744  1.00 0.00 ? 14  TYR A HA   6  
ATOM   7216  H  HB2  . TYR A 1 14 ? 13.329  -8.490  9.889   1.00 0.00 ? 14  TYR A HB2  6  
ATOM   7217  H  HB3  . TYR A 1 14 ? 14.948  -8.158  9.278   1.00 0.00 ? 14  TYR A HB3  6  
ATOM   7218  H  HD1  . TYR A 1 14 ? 13.001  -10.455 11.480  1.00 0.00 ? 14  TYR A HD1  6  
ATOM   7219  H  HD2  . TYR A 1 14 ? 16.704  -9.788  9.453   1.00 0.00 ? 14  TYR A HD2  6  
ATOM   7220  H  HE1  . TYR A 1 14 ? 13.707  -12.752 11.994  1.00 0.00 ? 14  TYR A HE1  6  
ATOM   7221  H  HE2  . TYR A 1 14 ? 17.409  -12.071 9.978   1.00 0.00 ? 14  TYR A HE2  6  
ATOM   7222  H  HH   . TYR A 1 14 ? 15.268  -14.433 11.107  1.00 0.00 ? 14  TYR A HH   6  
ATOM   7223  N  N    . ILE A 1 15 ? 15.750  -5.429  11.034  1.00 0.00 ? 15  ILE A N    6  
ATOM   7224  C  CA   . ILE A 1 15 ? 15.881  -3.987  10.864  1.00 0.00 ? 15  ILE A CA   6  
ATOM   7225  C  C    . ILE A 1 15 ? 16.723  -3.701  9.605   1.00 0.00 ? 15  ILE A C    6  
ATOM   7226  O  O    . ILE A 1 15 ? 17.888  -4.093  9.524   1.00 0.00 ? 15  ILE A O    6  
ATOM   7227  C  CB   . ILE A 1 15 ? 16.547  -3.311  12.127  1.00 0.00 ? 15  ILE A CB   6  
ATOM   7228  C  CG1  . ILE A 1 15 ? 15.926  -3.822  13.461  1.00 0.00 ? 15  ILE A CG1  6  
ATOM   7229  C  CG2  . ILE A 1 15 ? 16.462  -1.769  12.046  1.00 0.00 ? 15  ILE A CG2  6  
ATOM   7230  C  CD1  . ILE A 1 15 ? 14.459  -3.515  13.630  1.00 0.00 ? 15  ILE A CD1  6  
ATOM   7231  H  H    . ILE A 1 15 ? 16.569  -5.945  11.195  1.00 0.00 ? 15  ILE A H    6  
ATOM   7232  H  HA   . ILE A 1 15 ? 14.884  -3.555  10.735  1.00 0.00 ? 15  ILE A HA   6  
ATOM   7233  H  HB   . ILE A 1 15 ? 17.587  -3.575  12.130  1.00 0.00 ? 15  ILE A HB   6  
ATOM   7234  H  HG12 . ILE A 1 15 ? 16.037  -4.897  13.513  1.00 0.00 ? 15  ILE A HG12 6  
ATOM   7235  H  HG13 . ILE A 1 15 ? 16.459  -3.373  14.289  1.00 0.00 ? 15  ILE A HG13 6  
ATOM   7236  H  HG21 . ILE A 1 15 ? 15.424  -1.452  12.012  1.00 0.00 ? 15  ILE A HG21 6  
ATOM   7237  H  HG22 . ILE A 1 15 ? 16.966  -1.421  11.154  1.00 0.00 ? 15  ILE A HG22 6  
ATOM   7238  H  HG23 . ILE A 1 15 ? 16.935  -1.332  12.914  1.00 0.00 ? 15  ILE A HG23 6  
ATOM   7239  H  HD11 . ILE A 1 15 ? 14.311  -2.448  13.587  1.00 0.00 ? 15  ILE A HD11 6  
ATOM   7240  H  HD12 . ILE A 1 15 ? 14.128  -3.888  14.585  1.00 0.00 ? 15  ILE A HD12 6  
ATOM   7241  H  HD13 . ILE A 1 15 ? 13.902  -3.990  12.840  1.00 0.00 ? 15  ILE A HD13 6  
ATOM   7242  N  N    . CYS A 1 16 ? 16.086  -3.039  8.627   1.00 0.00 ? 16  CYS A N    6  
ATOM   7243  C  CA   . CYS A 1 16 ? 16.736  -2.528  7.397   1.00 0.00 ? 16  CYS A CA   6  
ATOM   7244  C  C    . CYS A 1 16 ? 17.904  -1.548  7.730   1.00 0.00 ? 16  CYS A C    6  
ATOM   7245  O  O    . CYS A 1 16 ? 18.753  -1.304  6.865   1.00 0.00 ? 16  CYS A O    6  
ATOM   7246  C  CB   . CYS A 1 16 ? 15.669  -1.841  6.500   1.00 0.00 ? 16  CYS A CB   6  
ATOM   7247  S  SG   . CYS A 1 16 ? 16.248  -1.274  4.866   1.00 0.00 ? 16  CYS A SG   6  
ATOM   7248  H  H    . CYS A 1 16 ? 15.129  -2.911  8.732   1.00 0.00 ? 16  CYS A H    6  
ATOM   7249  H  HA   . CYS A 1 16 ? 17.141  -3.386  6.863   1.00 0.00 ? 16  CYS A HA   6  
ATOM   7250  H  HB2  . CYS A 1 16 ? 14.859  -2.534  6.313   1.00 0.00 ? 16  CYS A HB2  6  
ATOM   7251  H  HB3  . CYS A 1 16 ? 15.265  -0.975  7.016   1.00 0.00 ? 16  CYS A HB3  6  
ATOM   7252  N  N    . GLU A 1 17 ? 17.832  -0.931  8.957   1.00 0.00 ? 17  GLU A N    6  
ATOM   7253  C  CA   . GLU A 1 17 ? 18.940  -0.207  9.683   1.00 0.00 ? 17  GLU A CA   6  
ATOM   7254  C  C    . GLU A 1 17 ? 18.611  1.292   9.850   1.00 0.00 ? 17  GLU A C    6  
ATOM   7255  O  O    . GLU A 1 17 ? 19.074  1.943   10.796  1.00 0.00 ? 17  GLU A O    6  
ATOM   7256  C  CB   . GLU A 1 17 ? 20.360  -0.408  9.066   1.00 0.00 ? 17  GLU A CB   6  
ATOM   7257  C  CG   . GLU A 1 17 ? 21.522  0.182   9.889   1.00 0.00 ? 17  GLU A CG   6  
ATOM   7258  C  CD   . GLU A 1 17 ? 22.892  -0.004  9.211   1.00 0.00 ? 17  GLU A CD   6  
ATOM   7259  O  OE1  . GLU A 1 17 ? 23.190  0.732   8.240   1.00 0.00 ? 17  GLU A OE1  6  
ATOM   7260  O  OE2  . GLU A 1 17 ? 23.676  -0.893  9.630   1.00 0.00 ? 17  GLU A OE2  6  
ATOM   7261  H  H    . GLU A 1 17 ? 16.950  -0.915  9.384   1.00 0.00 ? 17  GLU A H    6  
ATOM   7262  H  HA   . GLU A 1 17 ? 18.950  -0.636  10.682  1.00 0.00 ? 17  GLU A HA   6  
ATOM   7263  H  HB2  . GLU A 1 17 ? 20.531  -1.473  8.949   1.00 0.00 ? 17  GLU A HB2  6  
ATOM   7264  H  HB3  . GLU A 1 17 ? 20.376  0.047   8.080   1.00 0.00 ? 17  GLU A HB3  6  
ATOM   7265  H  HG2  . GLU A 1 17 ? 21.340  1.248   10.033  1.00 0.00 ? 17  GLU A HG2  6  
ATOM   7266  H  HG3  . GLU A 1 17 ? 21.537  -0.297  10.863  1.00 0.00 ? 17  GLU A HG3  6  
ATOM   7267  N  N    . TYR A 1 18 ? 17.764  1.815   8.960   1.00 0.00 ? 18  TYR A N    6  
ATOM   7268  C  CA   . TYR A 1 18 ? 17.379  3.239   8.940   1.00 0.00 ? 18  TYR A CA   6  
ATOM   7269  C  C    . TYR A 1 18 ? 15.858  3.345   8.780   1.00 0.00 ? 18  TYR A C    6  
ATOM   7270  O  O    . TYR A 1 18 ? 15.174  4.067   9.515   1.00 0.00 ? 18  TYR A O    6  
ATOM   7271  C  CB   . TYR A 1 18 ? 18.094  3.993   7.792   1.00 0.00 ? 18  TYR A CB   6  
ATOM   7272  C  CG   . TYR A 1 18 ? 17.940  5.517   7.910   1.00 0.00 ? 18  TYR A CG   6  
ATOM   7273  C  CD1  . TYR A 1 18 ? 18.279  6.165   9.105   1.00 0.00 ? 18  TYR A CD1  6  
ATOM   7274  C  CD2  . TYR A 1 18 ? 17.442  6.300   6.869   1.00 0.00 ? 18  TYR A CD2  6  
ATOM   7275  C  CE1  . TYR A 1 18 ? 18.133  7.523   9.250   1.00 0.00 ? 18  TYR A CE1  6  
ATOM   7276  C  CE2  . TYR A 1 18 ? 17.293  7.667   7.016   1.00 0.00 ? 18  TYR A CE2  6  
ATOM   7277  C  CZ   . TYR A 1 18 ? 17.636  8.273   8.205   1.00 0.00 ? 18  TYR A CZ   6  
ATOM   7278  O  OH   . TYR A 1 18 ? 17.479  9.633   8.351   1.00 0.00 ? 18  TYR A OH   6  
ATOM   7279  H  H    . TYR A 1 18 ? 17.333  1.208   8.331   1.00 0.00 ? 18  TYR A H    6  
ATOM   7280  H  HA   . TYR A 1 18 ? 17.666  3.695   9.893   1.00 0.00 ? 18  TYR A HA   6  
ATOM   7281  H  HB2  . TYR A 1 18 ? 19.149  3.754   7.817   1.00 0.00 ? 18  TYR A HB2  6  
ATOM   7282  H  HB3  . TYR A 1 18 ? 17.687  3.671   6.837   1.00 0.00 ? 18  TYR A HB3  6  
ATOM   7283  H  HD1  . TYR A 1 18 ? 18.668  5.577   9.931   1.00 0.00 ? 18  TYR A HD1  6  
ATOM   7284  H  HD2  . TYR A 1 18 ? 17.166  5.823   5.934   1.00 0.00 ? 18  TYR A HD2  6  
ATOM   7285  H  HE1  . TYR A 1 18 ? 18.402  7.989   10.185  1.00 0.00 ? 18  TYR A HE1  6  
ATOM   7286  H  HE2  . TYR A 1 18 ? 16.906  8.255   6.195   1.00 0.00 ? 18  TYR A HE2  6  
ATOM   7287  H  HH   . TYR A 1 18 ? 16.645  9.903   7.943   1.00 0.00 ? 18  TYR A HH   6  
ATOM   7288  N  N    . CYS A 1 19 ? 15.351  2.596   7.798   1.00 0.00 ? 19  CYS A N    6  
ATOM   7289  C  CA   . CYS A 1 19 ? 13.915  2.567   7.444   1.00 0.00 ? 19  CYS A CA   6  
ATOM   7290  C  C    . CYS A 1 19 ? 13.329  1.177   7.721   1.00 0.00 ? 19  CYS A C    6  
ATOM   7291  O  O    . CYS A 1 19 ? 12.983  0.423   6.799   1.00 0.00 ? 19  CYS A O    6  
ATOM   7292  C  CB   . CYS A 1 19 ? 13.745  3.006   5.973   1.00 0.00 ? 19  CYS A CB   6  
ATOM   7293  S  SG   . CYS A 1 19 ? 15.102  2.445   4.912   1.00 0.00 ? 19  CYS A SG   6  
ATOM   7294  H  H    . CYS A 1 19 ? 15.975  2.028   7.287   1.00 0.00 ? 19  CYS A H    6  
ATOM   7295  H  HA   . CYS A 1 19 ? 13.387  3.280   8.079   1.00 0.00 ? 19  CYS A HA   6  
ATOM   7296  H  HB2  . CYS A 1 19 ? 12.824  2.612   5.563   1.00 0.00 ? 19  CYS A HB2  6  
ATOM   7297  H  HB3  . CYS A 1 19 ? 13.716  4.090   5.923   1.00 0.00 ? 19  CYS A HB3  6  
ATOM   7298  N  N    . ALA A 1 20 ? 13.334  0.811   9.015   1.00 0.00 ? 20  ALA A N    6  
ATOM   7299  C  CA   . ALA A 1 20 ? 12.545  -0.307  9.552   1.00 0.00 ? 20  ALA A CA   6  
ATOM   7300  C  C    . ALA A 1 20 ? 12.442  -0.197  11.069  1.00 0.00 ? 20  ALA A C    6  
ATOM   7301  O  O    . ALA A 1 20 ? 13.455  -0.345  11.759  1.00 0.00 ? 20  ALA A O    6  
ATOM   7302  C  CB   . ALA A 1 20 ? 13.149  -1.663  9.183   1.00 0.00 ? 20  ALA A CB   6  
ATOM   7303  H  H    . ALA A 1 20 ? 13.916  1.295   9.632   1.00 0.00 ? 20  ALA A H    6  
ATOM   7304  H  HA   . ALA A 1 20 ? 11.555  -0.247  9.121   1.00 0.00 ? 20  ALA A HA   6  
ATOM   7305  H  HB1  . ALA A 1 20 ? 14.147  -1.748  9.594   1.00 0.00 ? 20  ALA A HB1  6  
ATOM   7306  H  HB2  . ALA A 1 20 ? 13.201  -1.753  8.105   1.00 0.00 ? 20  ALA A HB2  6  
ATOM   7307  H  HB3  . ALA A 1 20 ? 12.532  -2.468  9.573   1.00 0.00 ? 20  ALA A HB3  6  
ATOM   7308  N  N    . ARG A 1 21 ? 11.225  0.057   11.587  1.00 0.00 ? 21  ARG A N    6  
ATOM   7309  C  CA   . ARG A 1 21 ? 10.999  -0.048  13.031  1.00 0.00 ? 21  ARG A CA   6  
ATOM   7310  C  C    . ARG A 1 21 ? 11.108  -1.538  13.423  1.00 0.00 ? 21  ARG A C    6  
ATOM   7311  O  O    . ARG A 1 21 ? 11.743  -1.863  14.434  1.00 0.00 ? 21  ARG A O    6  
ATOM   7312  C  CB   . ARG A 1 21 ? 9.656   0.586   13.494  1.00 0.00 ? 21  ARG A CB   6  
ATOM   7313  C  CG   . ARG A 1 21 ? 8.368   -0.084  12.957  1.00 0.00 ? 21  ARG A CG   6  
ATOM   7314  C  CD   . ARG A 1 21 ? 7.114   0.295   13.778  1.00 0.00 ? 21  ARG A CD   6  
ATOM   7315  N  NE   . ARG A 1 21 ? 7.290   -0.025  15.208  1.00 0.00 ? 21  ARG A NE   6  
ATOM   7316  C  CZ   . ARG A 1 21 ? 7.261   -1.257  15.747  1.00 0.00 ? 21  ARG A CZ   6  
ATOM   7317  N  NH1  . ARG A 1 21 ? 6.975   -2.325  15.008  1.00 0.00 ? 21  ARG A NH1  6  
ATOM   7318  N  NH2  . ARG A 1 21 ? 7.526   -1.409  17.038  1.00 0.00 ? 21  ARG A NH2  6  
ATOM   7319  H  H    . ARG A 1 21 ? 10.517  0.373   10.984  1.00 0.00 ? 21  ARG A H    6  
ATOM   7320  H  HA   . ARG A 1 21 ? 11.820  0.492   13.517  1.00 0.00 ? 21  ARG A HA   6  
ATOM   7321  H  HB2  . ARG A 1 21 ? 9.625   0.561   14.578  1.00 0.00 ? 21  ARG A HB2  6  
ATOM   7322  H  HB3  . ARG A 1 21 ? 9.646   1.627   13.182  1.00 0.00 ? 21  ARG A HB3  6  
ATOM   7323  H  HG2  . ARG A 1 21 ? 8.218   0.213   11.927  1.00 0.00 ? 21  ARG A HG2  6  
ATOM   7324  H  HG3  . ARG A 1 21 ? 8.490   -1.163  13.000  1.00 0.00 ? 21  ARG A HG3  6  
ATOM   7325  H  HD2  . ARG A 1 21 ? 6.935   1.362   13.682  1.00 0.00 ? 21  ARG A HD2  6  
ATOM   7326  H  HD3  . ARG A 1 21 ? 6.256   -0.245  13.394  1.00 0.00 ? 21  ARG A HD3  6  
ATOM   7327  H  HE   . ARG A 1 21 ? 7.473   0.735   15.806  1.00 0.00 ? 21  ARG A HE   6  
ATOM   7328  H  HH11 . ARG A 1 21 ? 6.771   -2.229  14.034  1.00 0.00 ? 21  ARG A HH11 6  
ATOM   7329  H  HH12 . ARG A 1 21 ? 6.963   -3.235  15.431  1.00 0.00 ? 21  ARG A HH12 6  
ATOM   7330  H  HH21 . ARG A 1 21 ? 7.742   -0.609  17.611  1.00 0.00 ? 21  ARG A HH21 6  
ATOM   7331  H  HH22 . ARG A 1 21 ? 7.511   -2.320  17.448  1.00 0.00 ? 21  ARG A HH22 6  
ATOM   7332  N  N    . ALA A 1 22 ? 10.462  -2.426  12.617  1.00 0.00 ? 22  ALA A N    6  
ATOM   7333  C  CA   . ALA A 1 22 ? 10.810  -3.859  12.529  1.00 0.00 ? 22  ALA A CA   6  
ATOM   7334  C  C    . ALA A 1 22 ? 10.024  -4.547  11.405  1.00 0.00 ? 22  ALA A C    6  
ATOM   7335  O  O    . ALA A 1 22 ? 8.891   -4.168  11.109  1.00 0.00 ? 22  ALA A O    6  
ATOM   7336  C  CB   . ALA A 1 22 ? 10.506  -4.565  13.845  1.00 0.00 ? 22  ALA A CB   6  
ATOM   7337  H  H    . ALA A 1 22 ? 9.640   -2.147  12.184  1.00 0.00 ? 22  ALA A H    6  
ATOM   7338  H  HA   . ALA A 1 22 ? 11.876  -3.942  12.325  1.00 0.00 ? 22  ALA A HA   6  
ATOM   7339  H  HB1  . ALA A 1 22 ? 11.082  -4.106  14.640  1.00 0.00 ? 22  ALA A HB1  6  
ATOM   7340  H  HB2  . ALA A 1 22 ? 10.773  -5.611  13.777  1.00 0.00 ? 22  ALA A HB2  6  
ATOM   7341  H  HB3  . ALA A 1 22 ? 9.453   -4.475  14.077  1.00 0.00 ? 22  ALA A HB3  6  
ATOM   7342  N  N    . PHE A 1 23 ? 10.639  -5.566  10.801  1.00 0.00 ? 23  PHE A N    6  
ATOM   7343  C  CA   . PHE A 1 23 ? 9.962   -6.527  9.918   1.00 0.00 ? 23  PHE A CA   6  
ATOM   7344  C  C    . PHE A 1 23 ? 10.085  -7.918  10.547  1.00 0.00 ? 23  PHE A C    6  
ATOM   7345  O  O    . PHE A 1 23 ? 11.075  -8.210  11.223  1.00 0.00 ? 23  PHE A O    6  
ATOM   7346  C  CB   . PHE A 1 23 ? 10.579  -6.525  8.498   1.00 0.00 ? 23  PHE A CB   6  
ATOM   7347  C  CG   . PHE A 1 23 ? 10.268  -5.273  7.671   1.00 0.00 ? 23  PHE A CG   6  
ATOM   7348  C  CD1  . PHE A 1 23 ? 9.113   -5.201  6.885   1.00 0.00 ? 23  PHE A CD1  6  
ATOM   7349  C  CD2  . PHE A 1 23 ? 11.130  -4.179  7.663   1.00 0.00 ? 23  PHE A CD2  6  
ATOM   7350  C  CE1  . PHE A 1 23 ? 8.839   -4.080  6.130   1.00 0.00 ? 23  PHE A CE1  6  
ATOM   7351  C  CE2  . PHE A 1 23 ? 10.848  -3.057  6.904   1.00 0.00 ? 23  PHE A CE2  6  
ATOM   7352  C  CZ   . PHE A 1 23 ? 9.705   -3.008  6.139   1.00 0.00 ? 23  PHE A CZ   6  
ATOM   7353  H  H    . PHE A 1 23 ? 11.597  -5.686  10.957  1.00 0.00 ? 23  PHE A H    6  
ATOM   7354  H  HA   . PHE A 1 23 ? 8.905   -6.270  9.855   1.00 0.00 ? 23  PHE A HA   6  
ATOM   7355  H  HB2  . PHE A 1 23 ? 11.656  -6.619  8.577   1.00 0.00 ? 23  PHE A HB2  6  
ATOM   7356  H  HB3  . PHE A 1 23 ? 10.204  -7.382  7.950   1.00 0.00 ? 23  PHE A HB3  6  
ATOM   7357  H  HD1  . PHE A 1 23 ? 8.425   -6.037  6.872   1.00 0.00 ? 23  PHE A HD1  6  
ATOM   7358  H  HD2  . PHE A 1 23 ? 12.035  -4.210  8.259   1.00 0.00 ? 23  PHE A HD2  6  
ATOM   7359  H  HE1  . PHE A 1 23 ? 7.944   -4.040  5.525   1.00 0.00 ? 23  PHE A HE1  6  
ATOM   7360  H  HE2  . PHE A 1 23 ? 11.533  -2.217  6.908   1.00 0.00 ? 23  PHE A HE2  6  
ATOM   7361  H  HZ   . PHE A 1 23 ? 9.489   -2.130  5.544   1.00 0.00 ? 23  PHE A HZ   6  
ATOM   7362  N  N    . LYS A 1 24 ? 9.075   -8.769  10.332  1.00 0.00 ? 24  LYS A N    6  
ATOM   7363  C  CA   . LYS A 1 24 ? 9.030   -10.129 10.904  1.00 0.00 ? 24  LYS A CA   6  
ATOM   7364  C  C    . LYS A 1 24 ? 10.141  -11.043 10.347  1.00 0.00 ? 24  LYS A C    6  
ATOM   7365  O  O    . LYS A 1 24 ? 10.562  -11.997 11.019  1.00 0.00 ? 24  LYS A O    6  
ATOM   7366  C  CB   . LYS A 1 24 ? 7.635   -10.756 10.650  1.00 0.00 ? 24  LYS A CB   6  
ATOM   7367  C  CG   . LYS A 1 24 ? 7.401   -12.126 11.330  1.00 0.00 ? 24  LYS A CG   6  
ATOM   7368  C  CD   . LYS A 1 24 ? 5.970   -12.682 11.136  1.00 0.00 ? 24  LYS A CD   6  
ATOM   7369  C  CE   . LYS A 1 24 ? 4.889   -11.751 11.714  1.00 0.00 ? 24  LYS A CE   6  
ATOM   7370  N  NZ   . LYS A 1 24 ? 3.531   -12.334 11.610  1.00 0.00 ? 24  LYS A NZ   6  
ATOM   7371  H  H    . LYS A 1 24 ? 8.295   -8.461  9.821   1.00 0.00 ? 24  LYS A H    6  
ATOM   7372  H  HA   . LYS A 1 24 ? 9.175   -10.034 11.976  1.00 0.00 ? 24  LYS A HA   6  
ATOM   7373  H  HB2  . LYS A 1 24 ? 6.877   -10.068 11.015  1.00 0.00 ? 24  LYS A HB2  6  
ATOM   7374  H  HB3  . LYS A 1 24 ? 7.496   -10.879 9.582   1.00 0.00 ? 24  LYS A HB3  6  
ATOM   7375  H  HG2  . LYS A 1 24 ? 8.106   -12.841 10.918  1.00 0.00 ? 24  LYS A HG2  6  
ATOM   7376  H  HG3  . LYS A 1 24 ? 7.596   -12.023 12.396  1.00 0.00 ? 24  LYS A HG3  6  
ATOM   7377  H  HD2  . LYS A 1 24 ? 5.785   -12.815 10.075  1.00 0.00 ? 24  LYS A HD2  6  
ATOM   7378  H  HD3  . LYS A 1 24 ? 5.902   -13.649 11.629  1.00 0.00 ? 24  LYS A HD3  6  
ATOM   7379  H  HE2  . LYS A 1 24 ? 5.099   -11.560 12.760  1.00 0.00 ? 24  LYS A HE2  6  
ATOM   7380  H  HE3  . LYS A 1 24 ? 4.904   -10.813 11.172  1.00 0.00 ? 24  LYS A HE3  6  
ATOM   7381  H  HZ1  . LYS A 1 24 ? 3.283   -12.491 10.612  1.00 0.00 ? 24  LYS A HZ1  6  
ATOM   7382  H  HZ2  . LYS A 1 24 ? 2.834   -11.689 12.028  1.00 0.00 ? 24  LYS A HZ2  6  
ATOM   7383  H  HZ3  . LYS A 1 24 ? 3.493   -13.242 12.111  1.00 0.00 ? 24  LYS A HZ3  6  
ATOM   7384  N  N    . SER A 1 25 ? 10.628  -10.748 9.133   1.00 0.00 ? 25  SER A N    6  
ATOM   7385  C  CA   . SER A 1 25 ? 11.611  -11.601 8.455   1.00 0.00 ? 25  SER A CA   6  
ATOM   7386  C  C    . SER A 1 25 ? 12.576  -10.782 7.590   1.00 0.00 ? 25  SER A C    6  
ATOM   7387  O  O    . SER A 1 25 ? 12.274  -9.647  7.199   1.00 0.00 ? 25  SER A O    6  
ATOM   7388  C  CB   . SER A 1 25 ? 10.885  -12.655 7.592   1.00 0.00 ? 25  SER A CB   6  
ATOM   7389  O  OG   . SER A 1 25 ? 10.047  -13.492 8.376   1.00 0.00 ? 25  SER A OG   6  
ATOM   7390  H  H    . SER A 1 25 ? 10.331  -9.930  8.685   1.00 0.00 ? 25  SER A H    6  
ATOM   7391  H  HA   . SER A 1 25 ? 12.187  -12.121 9.217   1.00 0.00 ? 25  SER A HA   6  
ATOM   7392  H  HB2  . SER A 1 25 ? 10.266  -12.165 6.852   1.00 0.00 ? 25  SER A HB2  6  
ATOM   7393  H  HB3  . SER A 1 25 ? 11.611  -13.284 7.090   1.00 0.00 ? 25  SER A HB3  6  
ATOM   7394  H  HG   . SER A 1 25 ? 10.434  -13.605 9.258   1.00 0.00 ? 25  SER A HG   6  
ATOM   7395  N  N    . SER A 1 26 ? 13.750  -11.380 7.342   1.00 0.00 ? 26  SER A N    6  
ATOM   7396  C  CA   . SER A 1 26 ? 14.751  -10.883 6.372   1.00 0.00 ? 26  SER A CA   6  
ATOM   7397  C  C    . SER A 1 26 ? 14.163  -10.795 4.944   1.00 0.00 ? 26  SER A C    6  
ATOM   7398  O  O    . SER A 1 26 ? 14.463  -9.862  4.195   1.00 0.00 ? 26  SER A O    6  
ATOM   7399  C  CB   . SER A 1 26 ? 15.979  -11.821 6.404   1.00 0.00 ? 26  SER A CB   6  
ATOM   7400  O  OG   . SER A 1 26 ? 15.590  -13.178 6.269   1.00 0.00 ? 26  SER A OG   6  
ATOM   7401  H  H    . SER A 1 26 ? 13.968  -12.172 7.880   1.00 0.00 ? 26  SER A H    6  
ATOM   7402  H  HA   . SER A 1 26 ? 15.059  -9.893  6.691   1.00 0.00 ? 26  SER A HA   6  
ATOM   7403  H  HB2  . SER A 1 26 ? 16.654  -11.571 5.598   1.00 0.00 ? 26  SER A HB2  6  
ATOM   7404  H  HB3  . SER A 1 26 ? 16.500  -11.707 7.350   1.00 0.00 ? 26  SER A HB3  6  
ATOM   7405  H  HG   . SER A 1 26 ? 16.303  -13.748 6.584   1.00 0.00 ? 26  SER A HG   6  
ATOM   7406  N  N    . HIS A 1 27 ? 13.310  -11.778 4.604   1.00 0.00 ? 27  HIS A N    6  
ATOM   7407  C  CA   . HIS A 1 27 ? 12.604  -11.845 3.304   1.00 0.00 ? 27  HIS A CA   6  
ATOM   7408  C  C    . HIS A 1 27 ? 11.550  -10.722 3.219   1.00 0.00 ? 27  HIS A C    6  
ATOM   7409  O  O    . HIS A 1 27 ? 11.365  -10.107 2.171   1.00 0.00 ? 27  HIS A O    6  
ATOM   7410  C  CB   . HIS A 1 27 ? 11.917  -13.223 3.127   1.00 0.00 ? 27  HIS A CB   6  
ATOM   7411  C  CG   . HIS A 1 27 ? 12.827  -14.428 3.236   1.00 0.00 ? 27  HIS A CG   6  
ATOM   7412  N  ND1  . HIS A 1 27 ? 13.020  -15.324 2.207   1.00 0.00 ? 27  HIS A ND1  6  
ATOM   7413  C  CD2  . HIS A 1 27 ? 13.545  -14.915 4.284   1.00 0.00 ? 27  HIS A CD2  6  
ATOM   7414  C  CE1  . HIS A 1 27 ? 13.813  -16.297 2.609   1.00 0.00 ? 27  HIS A CE1  6  
ATOM   7415  N  NE2  . HIS A 1 27 ? 14.142  -16.074 3.863   1.00 0.00 ? 27  HIS A NE2  6  
ATOM   7416  H  H    . HIS A 1 27 ? 13.155  -12.492 5.259   1.00 0.00 ? 27  HIS A H    6  
ATOM   7417  H  HA   . HIS A 1 27 ? 13.337  -11.705 2.514   1.00 0.00 ? 27  HIS A HA   6  
ATOM   7418  H  HB2  . HIS A 1 27 ? 11.149  -13.337 3.880   1.00 0.00 ? 27  HIS A HB2  6  
ATOM   7419  H  HB3  . HIS A 1 27 ? 11.446  -13.254 2.150   1.00 0.00 ? 27  HIS A HB3  6  
ATOM   7420  H  HD1  . HIS A 1 27 ? 12.636  -15.250 1.304   1.00 0.00 ? 27  HIS A HD1  6  
ATOM   7421  H  HD2  . HIS A 1 27 ? 13.624  -14.470 5.270   1.00 0.00 ? 27  HIS A HD2  6  
ATOM   7422  H  HE1  . HIS A 1 27 ? 14.127  -17.143 2.012   1.00 0.00 ? 27  HIS A HE1  6  
ATOM   7423  H  HE2  . HIS A 1 27 ? 14.711  -16.655 4.414   1.00 0.00 ? 27  HIS A HE2  6  
ATOM   7424  N  N    . ASN A 1 28 ? 10.878  -10.483 4.362   1.00 0.00 ? 28  ASN A N    6  
ATOM   7425  C  CA   . ASN A 1 28 ? 9.837   -9.440  4.522   1.00 0.00 ? 28  ASN A CA   6  
ATOM   7426  C  C    . ASN A 1 28 ? 10.423  -8.038  4.239   1.00 0.00 ? 28  ASN A C    6  
ATOM   7427  O  O    . ASN A 1 28 ? 9.880   -7.266  3.435   1.00 0.00 ? 28  ASN A O    6  
ATOM   7428  C  CB   . ASN A 1 28 ? 9.270   -9.526  5.970   1.00 0.00 ? 28  ASN A CB   6  
ATOM   7429  C  CG   . ASN A 1 28 ? 8.064   -8.634  6.295   1.00 0.00 ? 28  ASN A CG   6  
ATOM   7430  O  OD1  . ASN A 1 28 ? 7.877   -8.240  7.447   1.00 0.00 ? 28  ASN A OD1  6  
ATOM   7431  N  ND2  . ASN A 1 28 ? 7.227   -8.329  5.313   1.00 0.00 ? 28  ASN A ND2  6  
ATOM   7432  H  H    . ASN A 1 28 ? 11.097  -11.032 5.140   1.00 0.00 ? 28  ASN A H    6  
ATOM   7433  H  HA   . ASN A 1 28 ? 9.040   -9.650  3.814   1.00 0.00 ? 28  ASN A HA   6  
ATOM   7434  H  HB2  . ASN A 1 28 ? 8.970   -10.544 6.166   1.00 0.00 ? 28  ASN A HB2  6  
ATOM   7435  H  HB3  . ASN A 1 28 ? 10.074  -9.268  6.659   1.00 0.00 ? 28  ASN A HB3  6  
ATOM   7436  H  HD21 . ASN A 1 28 ? 7.406   -8.680  4.418   1.00 0.00 ? 28  ASN A HD21 6  
ATOM   7437  H  HD22 . ASN A 1 28 ? 6.463   -7.752  5.524   1.00 0.00 ? 28  ASN A HD22 6  
ATOM   7438  N  N    . LEU A 1 29 ? 11.550  -7.745  4.906   1.00 0.00 ? 29  LEU A N    6  
ATOM   7439  C  CA   . LEU A 1 29 ? 12.281  -6.469  4.764   1.00 0.00 ? 29  LEU A CA   6  
ATOM   7440  C  C    . LEU A 1 29 ? 12.872  -6.333  3.359   1.00 0.00 ? 29  LEU A C    6  
ATOM   7441  O  O    . LEU A 1 29 ? 12.950  -5.226  2.840   1.00 0.00 ? 29  LEU A O    6  
ATOM   7442  C  CB   . LEU A 1 29 ? 13.362  -6.340  5.909   1.00 0.00 ? 29  LEU A CB   6  
ATOM   7443  C  CG   . LEU A 1 29 ? 14.877  -6.681  5.609   1.00 0.00 ? 29  LEU A CG   6  
ATOM   7444  C  CD1  . LEU A 1 29 ? 15.647  -5.508  4.942   1.00 0.00 ? 29  LEU A CD1  6  
ATOM   7445  C  CD2  . LEU A 1 29 ? 15.605  -7.143  6.893   1.00 0.00 ? 29  LEU A CD2  6  
ATOM   7446  H  H    . LEU A 1 29 ? 11.870  -8.393  5.572   1.00 0.00 ? 29  LEU A H    6  
ATOM   7447  H  HA   . LEU A 1 29 ? 11.551  -5.671  4.896   1.00 0.00 ? 29  LEU A HA   6  
ATOM   7448  H  HB2  . LEU A 1 29 ? 13.323  -5.326  6.301   1.00 0.00 ? 29  LEU A HB2  6  
ATOM   7449  H  HB3  . LEU A 1 29 ? 13.030  -7.004  6.704   1.00 0.00 ? 29  LEU A HB3  6  
ATOM   7450  H  HG   . LEU A 1 29 ? 14.903  -7.510  4.909   1.00 0.00 ? 29  LEU A HG   6  
ATOM   7451  H  HD11 . LEU A 1 29 ? 15.634  -4.644  5.589   1.00 0.00 ? 29  LEU A HD11 6  
ATOM   7452  H  HD12 . LEU A 1 29 ? 15.179  -5.258  3.998   1.00 0.00 ? 29  LEU A HD12 6  
ATOM   7453  H  HD13 . LEU A 1 29 ? 16.670  -5.807  4.755   1.00 0.00 ? 29  LEU A HD13 6  
ATOM   7454  H  HD21 . LEU A 1 29 ? 15.119  -8.031  7.284   1.00 0.00 ? 29  LEU A HD21 6  
ATOM   7455  H  HD22 . LEU A 1 29 ? 15.573  -6.363  7.642   1.00 0.00 ? 29  LEU A HD22 6  
ATOM   7456  H  HD23 . LEU A 1 29 ? 16.635  -7.380  6.665   1.00 0.00 ? 29  LEU A HD23 6  
ATOM   7457  N  N    . ALA A 1 30 ? 13.280  -7.474  2.764   1.00 0.00 ? 30  ALA A N    6  
ATOM   7458  C  CA   . ALA A 1 30 ? 13.870  -7.535  1.398   1.00 0.00 ? 30  ALA A CA   6  
ATOM   7459  C  C    . ALA A 1 30 ? 12.912  -6.977  0.323   1.00 0.00 ? 30  ALA A C    6  
ATOM   7460  O  O    . ALA A 1 30 ? 13.359  -6.387  -0.665  1.00 0.00 ? 30  ALA A O    6  
ATOM   7461  C  CB   . ALA A 1 30 ? 14.276  -8.978  1.041   1.00 0.00 ? 30  ALA A CB   6  
ATOM   7462  H  H    . ALA A 1 30 ? 13.197  -8.303  3.282   1.00 0.00 ? 30  ALA A H    6  
ATOM   7463  H  HA   . ALA A 1 30 ? 14.776  -6.930  1.406   1.00 0.00 ? 30  ALA A HA   6  
ATOM   7464  H  HB1  . ALA A 1 30 ? 13.394  -9.608  0.999   1.00 0.00 ? 30  ALA A HB1  6  
ATOM   7465  H  HB2  . ALA A 1 30 ? 14.954  -9.365  1.792   1.00 0.00 ? 30  ALA A HB2  6  
ATOM   7466  H  HB3  . ALA A 1 30 ? 14.772  -8.989  0.078   1.00 0.00 ? 30  ALA A HB3  6  
ATOM   7467  N  N    . VAL A 1 31 ? 11.593  -7.168  0.542   1.00 0.00 ? 31  VAL A N    6  
ATOM   7468  C  CA   . VAL A 1 31 ? 10.548  -6.686  -0.388  1.00 0.00 ? 31  VAL A CA   6  
ATOM   7469  C  C    . VAL A 1 31 ? 10.489  -5.139  -0.376  1.00 0.00 ? 31  VAL A C    6  
ATOM   7470  O  O    . VAL A 1 31 ? 10.335  -4.509  -1.422  1.00 0.00 ? 31  VAL A O    6  
ATOM   7471  C  CB   . VAL A 1 31 ? 9.138   -7.295  -0.051  1.00 0.00 ? 31  VAL A CB   6  
ATOM   7472  C  CG1  . VAL A 1 31 ? 8.076   -6.919  -1.126  1.00 0.00 ? 31  VAL A CG1  6  
ATOM   7473  C  CG2  . VAL A 1 31 ? 9.230   -8.832  0.130   1.00 0.00 ? 31  VAL A CG2  6  
ATOM   7474  H  H    . VAL A 1 31 ? 11.333  -7.653  1.352   1.00 0.00 ? 31  VAL A H    6  
ATOM   7475  H  HA   . VAL A 1 31 ? 10.822  -7.013  -1.387  1.00 0.00 ? 31  VAL A HA   6  
ATOM   7476  H  HB   . VAL A 1 31 ? 8.815   -6.867  0.898   1.00 0.00 ? 31  VAL A HB   6  
ATOM   7477  H  HG11 . VAL A 1 31 ? 8.376   -7.302  -2.095  1.00 0.00 ? 31  VAL A HG11 6  
ATOM   7478  H  HG12 . VAL A 1 31 ? 7.984   -5.842  -1.183  1.00 0.00 ? 31  VAL A HG12 6  
ATOM   7479  H  HG13 . VAL A 1 31 ? 7.114   -7.339  -0.856  1.00 0.00 ? 31  VAL A HG13 6  
ATOM   7480  H  HG21 . VAL A 1 31 ? 8.249   -9.237  0.367   1.00 0.00 ? 31  VAL A HG21 6  
ATOM   7481  H  HG22 . VAL A 1 31 ? 9.911   -9.076  0.939   1.00 0.00 ? 31  VAL A HG22 6  
ATOM   7482  H  HG23 . VAL A 1 31 ? 9.586   -9.277  -0.786  1.00 0.00 ? 31  VAL A HG23 6  
ATOM   7483  N  N    . HIS A 1 32 ? 10.623  -4.550  0.821   1.00 0.00 ? 32  HIS A N    6  
ATOM   7484  C  CA   . HIS A 1 32 ? 10.683  -3.087  1.008   1.00 0.00 ? 32  HIS A CA   6  
ATOM   7485  C  C    . HIS A 1 32 ? 12.035  -2.552  0.492   1.00 0.00 ? 32  HIS A C    6  
ATOM   7486  O  O    . HIS A 1 32 ? 12.105  -1.483  -0.116  1.00 0.00 ? 32  HIS A O    6  
ATOM   7487  C  CB   . HIS A 1 32 ? 10.437  -2.739  2.526   1.00 0.00 ? 32  HIS A CB   6  
ATOM   7488  C  CG   . HIS A 1 32 ? 11.257  -1.584  3.072   1.00 0.00 ? 32  HIS A CG   6  
ATOM   7489  N  ND1  . HIS A 1 32 ? 10.856  -0.271  3.066   1.00 0.00 ? 32  HIS A ND1  6  
ATOM   7490  C  CD2  . HIS A 1 32 ? 12.518  -1.586  3.566   1.00 0.00 ? 32  HIS A CD2  6  
ATOM   7491  C  CE1  . HIS A 1 32 ? 11.864  0.466   3.542   1.00 0.00 ? 32  HIS A CE1  6  
ATOM   7492  N  NE2  . HIS A 1 32 ? 12.914  -0.278  3.857   1.00 0.00 ? 32  HIS A NE2  6  
ATOM   7493  H  H    . HIS A 1 32 ? 10.693  -5.113  1.616   1.00 0.00 ? 32  HIS A H    6  
ATOM   7494  H  HA   . HIS A 1 32 ? 9.895   -2.643  0.409   1.00 0.00 ? 32  HIS A HA   6  
ATOM   7495  H  HB2  . HIS A 1 32 ? 9.390   -2.487  2.670   1.00 0.00 ? 32  HIS A HB2  6  
ATOM   7496  H  HB3  . HIS A 1 32 ? 10.658  -3.610  3.136   1.00 0.00 ? 32  HIS A HB3  6  
ATOM   7497  H  HD1  . HIS A 1 32 ? 9.980   0.066   2.760   1.00 0.00 ? 32  HIS A HD1  6  
ATOM   7498  H  HD2  . HIS A 1 32 ? 13.134  -2.471  3.685   1.00 0.00 ? 32  HIS A HD2  6  
ATOM   7499  H  HE1  . HIS A 1 32 ? 11.828  1.536   3.653   1.00 0.00 ? 32  HIS A HE1  6  
ATOM   7500  N  N    . ARG A 1 33 ? 13.097  -3.335  0.763   1.00 0.00 ? 33  ARG A N    6  
ATOM   7501  C  CA   . ARG A 1 33 ? 14.499  -3.007  0.444   1.00 0.00 ? 33  ARG A CA   6  
ATOM   7502  C  C    . ARG A 1 33 ? 14.728  -2.907  -1.085  1.00 0.00 ? 33  ARG A C    6  
ATOM   7503  O  O    . ARG A 1 33 ? 15.775  -2.461  -1.503  1.00 0.00 ? 33  ARG A O    6  
ATOM   7504  C  CB   . ARG A 1 33 ? 15.431  -4.080  1.083   1.00 0.00 ? 33  ARG A CB   6  
ATOM   7505  C  CG   . ARG A 1 33 ? 16.945  -3.749  1.099   1.00 0.00 ? 33  ARG A CG   6  
ATOM   7506  C  CD   . ARG A 1 33 ? 17.814  -4.938  1.554   1.00 0.00 ? 33  ARG A CD   6  
ATOM   7507  N  NE   . ARG A 1 33 ? 19.261  -4.624  1.505   1.00 0.00 ? 33  ARG A NE   6  
ATOM   7508  C  CZ   . ARG A 1 33 ? 20.191  -5.315  0.819   1.00 0.00 ? 33  ARG A CZ   6  
ATOM   7509  N  NH1  . ARG A 1 33 ? 19.858  -6.355  0.062   1.00 0.00 ? 33  ARG A NH1  6  
ATOM   7510  N  NH2  . ARG A 1 33 ? 21.464  -4.945  0.891   1.00 0.00 ? 33  ARG A NH2  6  
ATOM   7511  H  H    . ARG A 1 33 ? 12.929  -4.162  1.238   1.00 0.00 ? 33  ARG A H    6  
ATOM   7512  H  HA   . ARG A 1 33 ? 14.721  -2.041  0.889   1.00 0.00 ? 33  ARG A HA   6  
ATOM   7513  H  HB2  . ARG A 1 33 ? 15.115  -4.241  2.113   1.00 0.00 ? 33  ARG A HB2  6  
ATOM   7514  H  HB3  . ARG A 1 33 ? 15.291  -5.011  0.544   1.00 0.00 ? 33  ARG A HB3  6  
ATOM   7515  H  HG2  . ARG A 1 33 ? 17.252  -3.463  0.098   1.00 0.00 ? 33  ARG A HG2  6  
ATOM   7516  H  HG3  . ARG A 1 33 ? 17.111  -2.911  1.771   1.00 0.00 ? 33  ARG A HG3  6  
ATOM   7517  H  HD2  . ARG A 1 33 ? 17.557  -5.196  2.577   1.00 0.00 ? 33  ARG A HD2  6  
ATOM   7518  H  HD3  . ARG A 1 33 ? 17.606  -5.789  0.912   1.00 0.00 ? 33  ARG A HD3  6  
ATOM   7519  H  HE   . ARG A 1 33 ? 19.559  -3.843  2.023   1.00 0.00 ? 33  ARG A HE   6  
ATOM   7520  H  HH11 . ARG A 1 33 ? 18.900  -6.637  -0.017  1.00 0.00 ? 33  ARG A HH11 6  
ATOM   7521  H  HH12 . ARG A 1 33 ? 20.561  -6.854  -0.452  1.00 0.00 ? 33  ARG A HH12 6  
ATOM   7522  H  HH21 . ARG A 1 33 ? 21.726  -4.147  1.446   1.00 0.00 ? 33  ARG A HH21 6  
ATOM   7523  H  HH22 . ARG A 1 33 ? 22.169  -5.445  0.379   1.00 0.00 ? 33  ARG A HH22 6  
ATOM   7524  N  N    . MET A 1 34 ? 13.693  -3.256  -1.886  1.00 0.00 ? 34  MET A N    6  
ATOM   7525  C  CA   . MET A 1 34 ? 13.685  -3.183  -3.384  1.00 0.00 ? 34  MET A CA   6  
ATOM   7526  C  C    . MET A 1 34 ? 14.224  -1.839  -3.992  1.00 0.00 ? 34  MET A C    6  
ATOM   7527  O  O    . MET A 1 34 ? 14.540  -1.770  -5.187  1.00 0.00 ? 34  MET A O    6  
ATOM   7528  C  CB   . MET A 1 34 ? 12.237  -3.404  -3.881  1.00 0.00 ? 34  MET A CB   6  
ATOM   7529  C  CG   . MET A 1 34 ? 11.261  -2.259  -3.574  1.00 0.00 ? 34  MET A CG   6  
ATOM   7530  S  SD   . MET A 1 34 ? 9.587   -2.622  -4.124  1.00 0.00 ? 34  MET A SD   6  
ATOM   7531  C  CE   . MET A 1 34 ? 8.774   -1.062  -3.839  1.00 0.00 ? 34  MET A CE   6  
ATOM   7532  H  H    . MET A 1 34 ? 12.911  -3.655  -1.432  1.00 0.00 ? 34  MET A H    6  
ATOM   7533  H  HA   . MET A 1 34 ? 14.298  -3.995  -3.749  1.00 0.00 ? 34  MET A HA   6  
ATOM   7534  H  HB2  . MET A 1 34 ? 12.257  -3.552  -4.950  1.00 0.00 ? 34  MET A HB2  6  
ATOM   7535  H  HB3  . MET A 1 34 ? 11.849  -4.310  -3.422  1.00 0.00 ? 34  MET A HB3  6  
ATOM   7536  H  HG2  . MET A 1 34 ? 11.244  -2.087  -2.499  1.00 0.00 ? 34  MET A HG2  6  
ATOM   7537  H  HG3  . MET A 1 34 ? 11.602  -1.357  -4.072  1.00 0.00 ? 34  MET A HG3  6  
ATOM   7538  H  HE1  . MET A 1 34 ? 7.740   -1.131  -4.142  1.00 0.00 ? 34  MET A HE1  6  
ATOM   7539  H  HE2  . MET A 1 34 ? 9.267   -0.291  -4.413  1.00 0.00 ? 34  MET A HE2  6  
ATOM   7540  H  HE3  . MET A 1 34 ? 8.824   -0.817  -2.788  1.00 0.00 ? 34  MET A HE3  6  
ATOM   7541  N  N    . ILE A 1 35 ? 14.326  -0.811  -3.130  1.00 0.00 ? 35  ILE A N    6  
ATOM   7542  C  CA   . ILE A 1 35 ? 14.865  0.509   -3.452  1.00 0.00 ? 35  ILE A CA   6  
ATOM   7543  C  C    . ILE A 1 35 ? 16.420  0.483   -3.311  1.00 0.00 ? 35  ILE A C    6  
ATOM   7544  O  O    . ILE A 1 35 ? 17.143  0.809   -4.259  1.00 0.00 ? 35  ILE A O    6  
ATOM   7545  C  CB   . ILE A 1 35 ? 14.171  1.629   -2.539  1.00 0.00 ? 35  ILE A CB   6  
ATOM   7546  C  CG1  . ILE A 1 35 ? 15.005  2.951   -2.489  1.00 0.00 ? 35  ILE A CG1  6  
ATOM   7547  C  CG2  . ILE A 1 35 ? 13.840  1.117   -1.115  1.00 0.00 ? 35  ILE A CG2  6  
ATOM   7548  C  CD1  . ILE A 1 35 ? 15.136  3.693   -3.814  1.00 0.00 ? 35  ILE A CD1  6  
ATOM   7549  H  H    . ILE A 1 35 ? 14.107  -1.011  -2.217  1.00 0.00 ? 35  ILE A H    6  
ATOM   7550  H  HA   . ILE A 1 35 ? 14.621  0.729   -4.488  1.00 0.00 ? 35  ILE A HA   6  
ATOM   7551  H  HB   . ILE A 1 35 ? 13.211  1.860   -3.001  1.00 0.00 ? 35  ILE A HB   6  
ATOM   7552  H  HG12 . ILE A 1 35 ? 14.556  3.632   -1.782  1.00 0.00 ? 35  ILE A HG12 6  
ATOM   7553  H  HG13 . ILE A 1 35 ? 15.999  2.706   -2.151  1.00 0.00 ? 35  ILE A HG13 6  
ATOM   7554  H  HG21 . ILE A 1 35 ? 13.167  0.269   -1.178  1.00 0.00 ? 35  ILE A HG21 6  
ATOM   7555  H  HG22 . ILE A 1 35 ? 13.364  1.902   -0.536  1.00 0.00 ? 35  ILE A HG22 6  
ATOM   7556  H  HG23 . ILE A 1 35 ? 14.749  0.809   -0.616  1.00 0.00 ? 35  ILE A HG23 6  
ATOM   7557  H  HD11 . ILE A 1 35 ? 15.668  3.075   -4.526  1.00 0.00 ? 35  ILE A HD11 6  
ATOM   7558  H  HD12 . ILE A 1 35 ? 15.686  4.608   -3.657  1.00 0.00 ? 35  ILE A HD12 6  
ATOM   7559  H  HD13 . ILE A 1 35 ? 14.154  3.930   -4.202  1.00 0.00 ? 35  ILE A HD13 6  
ATOM   7560  N  N    . HIS A 1 36 ? 16.912  0.059   -2.128  1.00 0.00 ? 36  HIS A N    6  
ATOM   7561  C  CA   . HIS A 1 36 ? 18.370  0.070   -1.779  1.00 0.00 ? 36  HIS A CA   6  
ATOM   7562  C  C    . HIS A 1 36 ? 19.022  -1.329  -1.866  1.00 0.00 ? 36  HIS A C    6  
ATOM   7563  O  O    . HIS A 1 36 ? 20.198  -1.468  -1.509  1.00 0.00 ? 36  HIS A O    6  
ATOM   7564  C  CB   . HIS A 1 36 ? 18.621  0.697   -0.353  1.00 0.00 ? 36  HIS A CB   6  
ATOM   7565  C  CG   . HIS A 1 36 ? 17.404  0.919   0.512   1.00 0.00 ? 36  HIS A CG   6  
ATOM   7566  N  ND1  . HIS A 1 36 ? 16.817  2.144   0.655   1.00 0.00 ? 36  HIS A ND1  6  
ATOM   7567  C  CD2  . HIS A 1 36 ? 16.678  0.068   1.303   1.00 0.00 ? 36  HIS A CD2  6  
ATOM   7568  C  CE1  . HIS A 1 36 ? 15.809  2.024   1.505   1.00 0.00 ? 36  HIS A CE1  6  
ATOM   7569  N  NE2  . HIS A 1 36 ? 15.664  0.785   1.940   1.00 0.00 ? 36  HIS A NE2  6  
ATOM   7570  H  H    . HIS A 1 36 ? 16.284  -0.298  -1.465  1.00 0.00 ? 36  HIS A H    6  
ATOM   7571  H  HA   . HIS A 1 36 ? 18.872  0.695   -2.515  1.00 0.00 ? 36  HIS A HA   6  
ATOM   7572  H  HB2  . HIS A 1 36 ? 19.303  0.075   0.218   1.00 0.00 ? 36  HIS A HB2  6  
ATOM   7573  H  HB3  . HIS A 1 36 ? 19.096  1.663   -0.486  1.00 0.00 ? 36  HIS A HB3  6  
ATOM   7574  H  HD1  . HIS A 1 36 ? 17.109  2.973   0.217   1.00 0.00 ? 36  HIS A HD1  6  
ATOM   7575  H  HD2  . HIS A 1 36 ? 16.858  -0.992  1.434   1.00 0.00 ? 36  HIS A HD2  6  
ATOM   7576  H  HE1  . HIS A 1 36 ? 15.172  2.841   1.794   1.00 0.00 ? 36  HIS A HE1  6  
ATOM   7577  N  N    . THR A 1 37 ? 18.278  -2.340  -2.328  1.00 0.00 ? 37  THR A N    6  
ATOM   7578  C  CA   . THR A 1 37 ? 18.706  -3.763  -2.235  1.00 0.00 ? 37  THR A CA   6  
ATOM   7579  C  C    . THR A 1 37 ? 19.997  -4.031  -3.025  1.00 0.00 ? 37  THR A C    6  
ATOM   7580  O  O    . THR A 1 37 ? 20.825  -4.851  -2.603  1.00 0.00 ? 37  THR A O    6  
ATOM   7581  C  CB   . THR A 1 37 ? 17.579  -4.758  -2.676  1.00 0.00 ? 37  THR A CB   6  
ATOM   7582  O  OG1  . THR A 1 37 ? 18.017  -6.123  -2.535  1.00 0.00 ? 37  THR A OG1  6  
ATOM   7583  C  CG2  . THR A 1 37 ? 17.097  -4.516  -4.114  1.00 0.00 ? 37  THR A CG2  6  
ATOM   7584  H  H    . THR A 1 37 ? 17.416  -2.137  -2.755  1.00 0.00 ? 37  THR A H    6  
ATOM   7585  H  HA   . THR A 1 37 ? 18.914  -3.956  -1.187  1.00 0.00 ? 37  THR A HA   6  
ATOM   7586  H  HB   . THR A 1 37 ? 16.730  -4.614  -2.013  1.00 0.00 ? 37  THR A HB   6  
ATOM   7587  H  HG1  . THR A 1 37 ? 17.679  -6.646  -3.267  1.00 0.00 ? 37  THR A HG1  6  
ATOM   7588  H  HG21 . THR A 1 37 ? 16.291  -5.199  -4.346  1.00 0.00 ? 37  THR A HG21 6  
ATOM   7589  H  HG22 . THR A 1 37 ? 17.914  -4.686  -4.805  1.00 0.00 ? 37  THR A HG22 6  
ATOM   7590  H  HG23 . THR A 1 37 ? 16.749  -3.493  -4.216  1.00 0.00 ? 37  THR A HG23 6  
ATOM   7591  N  N    . GLY A 1 38 ? 20.158  -3.351  -4.180  1.00 0.00 ? 38  GLY A N    6  
ATOM   7592  C  CA   . GLY A 1 38 ? 21.319  -3.547  -5.058  1.00 0.00 ? 38  GLY A CA   6  
ATOM   7593  C  C    . GLY A 1 38 ? 21.173  -4.772  -5.968  1.00 0.00 ? 38  GLY A C    6  
ATOM   7594  O  O    . GLY A 1 38 ? 21.798  -4.844  -7.033  1.00 0.00 ? 38  GLY A O    6  
ATOM   7595  H  H    . GLY A 1 38 ? 19.480  -2.696  -4.460  1.00 0.00 ? 38  GLY A H    6  
ATOM   7596  H  HA2  . GLY A 1 38 ? 21.427  -2.662  -5.671  1.00 0.00 ? 38  GLY A HA2  6  
ATOM   7597  H  HA3  . GLY A 1 38 ? 22.214  -3.660  -4.455  1.00 0.00 ? 38  GLY A HA3  6  
ATOM   7598  N  N    . GLU A 1 39 ? 20.357  -5.749  -5.522  1.00 0.00 ? 39  GLU A N    6  
ATOM   7599  C  CA   . GLU A 1 39 ? 20.029  -6.977  -6.241  1.00 0.00 ? 39  GLU A CA   6  
ATOM   7600  C  C    . GLU A 1 39 ? 18.497  -7.086  -6.254  1.00 0.00 ? 39  GLU A C    6  
ATOM   7601  O  O    . GLU A 1 39 ? 17.905  -7.594  -5.295  1.00 0.00 ? 39  GLU A O    6  
ATOM   7602  C  CB   . GLU A 1 39 ? 20.677  -8.203  -5.524  1.00 0.00 ? 39  GLU A CB   6  
ATOM   7603  C  CG   . GLU A 1 39 ? 22.196  -8.065  -5.277  1.00 0.00 ? 39  GLU A CG   6  
ATOM   7604  C  CD   . GLU A 1 39 ? 22.783  -9.199  -4.426  1.00 0.00 ? 39  GLU A CD   6  
ATOM   7605  O  OE1  . GLU A 1 39 ? 22.780  -9.089  -3.183  1.00 0.00 ? 39  GLU A OE1  6  
ATOM   7606  O  OE2  . GLU A 1 39 ? 23.247  -10.211 -4.989  1.00 0.00 ? 39  GLU A OE2  6  
ATOM   7607  H  H    . GLU A 1 39 ? 19.958  -5.648  -4.646  1.00 0.00 ? 39  GLU A H    6  
ATOM   7608  H  HA   . GLU A 1 39 ? 20.400  -6.913  -7.266  1.00 0.00 ? 39  GLU A HA   6  
ATOM   7609  H  HB2  . GLU A 1 39 ? 20.189  -8.352  -4.564  1.00 0.00 ? 39  GLU A HB2  6  
ATOM   7610  H  HB3  . GLU A 1 39 ? 20.513  -9.092  -6.130  1.00 0.00 ? 39  GLU A HB3  6  
ATOM   7611  H  HG2  . GLU A 1 39 ? 22.700  -8.052  -6.238  1.00 0.00 ? 39  GLU A HG2  6  
ATOM   7612  H  HG3  . GLU A 1 39 ? 22.381  -7.117  -4.779  1.00 0.00 ? 39  GLU A HG3  6  
ATOM   7613  N  N    . LYS A 1 40 ? 17.871  -6.496  -7.290  1.00 0.00 ? 40  LYS A N    6  
ATOM   7614  C  CA   . LYS A 1 40 ? 16.392  -6.484  -7.471  1.00 0.00 ? 40  LYS A CA   6  
ATOM   7615  C  C    . LYS A 1 40 ? 15.821  -7.929  -7.415  1.00 0.00 ? 40  LYS A C    6  
ATOM   7616  O  O    . LYS A 1 40 ? 16.158  -8.746  -8.288  1.00 0.00 ? 40  LYS A O    6  
ATOM   7617  C  CB   . LYS A 1 40 ? 16.016  -5.807  -8.816  1.00 0.00 ? 40  LYS A CB   6  
ATOM   7618  C  CG   . LYS A 1 40 ? 16.474  -4.335  -8.943  1.00 0.00 ? 40  LYS A CG   6  
ATOM   7619  C  CD   . LYS A 1 40 ? 16.120  -3.714  -10.318 1.00 0.00 ? 40  LYS A CD   6  
ATOM   7620  C  CE   . LYS A 1 40 ? 16.820  -4.404  -11.505 1.00 0.00 ? 40  LYS A CE   6  
ATOM   7621  N  NZ   . LYS A 1 40 ? 18.297  -4.293  -11.422 1.00 0.00 ? 40  LYS A NZ   6  
ATOM   7622  H  H    . LYS A 1 40 ? 18.444  -6.041  -7.940  1.00 0.00 ? 40  LYS A H    6  
ATOM   7623  H  HA   . LYS A 1 40 ? 15.975  -5.901  -6.651  1.00 0.00 ? 40  LYS A HA   6  
ATOM   7624  H  HB2  . LYS A 1 40 ? 16.468  -6.372  -9.625  1.00 0.00 ? 40  LYS A HB2  6  
ATOM   7625  H  HB3  . LYS A 1 40 ? 14.937  -5.838  -8.934  1.00 0.00 ? 40  LYS A HB3  6  
ATOM   7626  H  HG2  . LYS A 1 40 ? 15.985  -3.754  -8.167  1.00 0.00 ? 40  LYS A HG2  6  
ATOM   7627  H  HG3  . LYS A 1 40 ? 17.551  -4.284  -8.796  1.00 0.00 ? 40  LYS A HG3  6  
ATOM   7628  H  HD2  . LYS A 1 40 ? 15.048  -3.783  -10.466 1.00 0.00 ? 40  LYS A HD2  6  
ATOM   7629  H  HD3  . LYS A 1 40 ? 16.404  -2.666  -10.308 1.00 0.00 ? 40  LYS A HD3  6  
ATOM   7630  H  HE2  . LYS A 1 40 ? 16.548  -5.451  -11.519 1.00 0.00 ? 40  LYS A HE2  6  
ATOM   7631  H  HE3  . LYS A 1 40 ? 16.486  -3.940  -12.427 1.00 0.00 ? 40  LYS A HE3  6  
ATOM   7632  H  HZ1  . LYS A 1 40 ? 18.647  -4.798  -10.584 1.00 0.00 ? 40  LYS A HZ1  6  
ATOM   7633  H  HZ2  . LYS A 1 40 ? 18.574  -3.294  -11.349 1.00 0.00 ? 40  LYS A HZ2  6  
ATOM   7634  H  HZ3  . LYS A 1 40 ? 18.736  -4.699  -12.270 1.00 0.00 ? 40  LYS A HZ3  6  
ATOM   7635  N  N    . PRO A 1 41 ? 15.009  -8.284  -6.351  1.00 0.00 ? 41  PRO A N    6  
ATOM   7636  C  CA   . PRO A 1 41 ? 14.533  -9.675  -6.134  1.00 0.00 ? 41  PRO A CA   6  
ATOM   7637  C  C    . PRO A 1 41 ? 13.628  -10.171 -7.294  1.00 0.00 ? 41  PRO A C    6  
ATOM   7638  O  O    . PRO A 1 41 ? 14.025  -11.053 -8.073  1.00 0.00 ? 41  PRO A O    6  
ATOM   7639  C  CB   . PRO A 1 41 ? 13.787  -9.605  -4.759  1.00 0.00 ? 41  PRO A CB   6  
ATOM   7640  C  CG   . PRO A 1 41 ? 13.416  -8.158  -4.591  1.00 0.00 ? 41  PRO A CG   6  
ATOM   7641  C  CD   . PRO A 1 41 ? 14.508  -7.365  -5.283  1.00 0.00 ? 41  PRO A CD   6  
ATOM   7642  H  HA   . PRO A 1 41 ? 15.378  -10.358 -6.045  1.00 0.00 ? 41  PRO A HA   6  
ATOM   7643  H  HB2  . PRO A 1 41 ? 12.914  -10.248 -4.769  1.00 0.00 ? 41  PRO A HB2  6  
ATOM   7644  H  HB3  . PRO A 1 41 ? 14.453  -9.935  -3.963  1.00 0.00 ? 41  PRO A HB3  6  
ATOM   7645  H  HG2  . PRO A 1 41 ? 12.454  -7.969  -5.058  1.00 0.00 ? 41  PRO A HG2  6  
ATOM   7646  H  HG3  . PRO A 1 41 ? 13.370  -7.902  -3.537  1.00 0.00 ? 41  PRO A HG3  6  
ATOM   7647  H  HD2  . PRO A 1 41 ? 14.103  -6.460  -5.714  1.00 0.00 ? 41  PRO A HD2  6  
ATOM   7648  H  HD3  . PRO A 1 41 ? 15.300  -7.118  -4.582  1.00 0.00 ? 41  PRO A HD3  6  
ATOM   7649  N  N    . LEU A 1 42 ? 12.440  -9.563  -7.418  1.00 0.00 ? 42  LEU A N    6  
ATOM   7650  C  CA   . LEU A 1 42 ? 11.418  -9.932  -8.407  1.00 0.00 ? 42  LEU A CA   6  
ATOM   7651  C  C    . LEU A 1 42 ? 10.687  -8.655  -8.851  1.00 0.00 ? 42  LEU A C    6  
ATOM   7652  O  O    . LEU A 1 42 ? 9.762   -8.199  -8.169  1.00 0.00 ? 42  LEU A O    6  
ATOM   7653  C  CB   . LEU A 1 42 ? 10.418  -10.963 -7.795  1.00 0.00 ? 42  LEU A CB   6  
ATOM   7654  C  CG   . LEU A 1 42 ? 10.979  -12.394 -7.500  1.00 0.00 ? 42  LEU A CG   6  
ATOM   7655  C  CD1  . LEU A 1 42 ? 9.992   -13.229 -6.655  1.00 0.00 ? 42  LEU A CD1  6  
ATOM   7656  C  CD2  . LEU A 1 42 ? 11.362  -13.114 -8.813  1.00 0.00 ? 42  LEU A CD2  6  
ATOM   7657  H  H    . LEU A 1 42 ? 12.237  -8.825  -6.812  1.00 0.00 ? 42  LEU A H    6  
ATOM   7658  H  HA   . LEU A 1 42 ? 11.907  -10.383 -9.271  1.00 0.00 ? 42  LEU A HA   6  
ATOM   7659  H  HB2  . LEU A 1 42 ? 10.041  -10.551 -6.863  1.00 0.00 ? 42  LEU A HB2  6  
ATOM   7660  H  HB3  . LEU A 1 42 ? 9.577   -11.068 -8.475  1.00 0.00 ? 42  LEU A HB3  6  
ATOM   7661  H  HG   . LEU A 1 42 ? 11.885  -12.292 -6.912  1.00 0.00 ? 42  LEU A HG   6  
ATOM   7662  H  HD11 . LEU A 1 42 ? 9.807   -12.728 -5.717  1.00 0.00 ? 42  LEU A HD11 6  
ATOM   7663  H  HD12 . LEU A 1 42 ? 10.419  -14.204 -6.456  1.00 0.00 ? 42  LEU A HD12 6  
ATOM   7664  H  HD13 . LEU A 1 42 ? 9.056   -13.352 -7.188  1.00 0.00 ? 42  LEU A HD13 6  
ATOM   7665  H  HD21 . LEU A 1 42 ? 11.771  -14.093 -8.589  1.00 0.00 ? 42  LEU A HD21 6  
ATOM   7666  H  HD22 . LEU A 1 42 ? 12.110  -12.534 -9.337  1.00 0.00 ? 42  LEU A HD22 6  
ATOM   7667  H  HD23 . LEU A 1 42 ? 10.487  -13.226 -9.445  1.00 0.00 ? 42  LEU A HD23 6  
ATOM   7668  N  N    . GLN A 1 43 ? 11.113  -8.073  -9.987  1.00 0.00 ? 43  GLN A N    6  
ATOM   7669  C  CA   . GLN A 1 43 ? 10.561  -6.806  -10.507 1.00 0.00 ? 43  GLN A CA   6  
ATOM   7670  C  C    . GLN A 1 43 ? 10.240  -6.932  -12.009 1.00 0.00 ? 43  GLN A C    6  
ATOM   7671  O  O    . GLN A 1 43 ? 10.968  -7.593  -12.761 1.00 0.00 ? 43  GLN A O    6  
ATOM   7672  C  CB   . GLN A 1 43 ? 11.558  -5.636  -10.269 1.00 0.00 ? 43  GLN A CB   6  
ATOM   7673  C  CG   . GLN A 1 43 ? 11.057  -4.255  -10.768 1.00 0.00 ? 43  GLN A CG   6  
ATOM   7674  C  CD   . GLN A 1 43 ? 12.102  -3.135  -10.681 1.00 0.00 ? 43  GLN A CD   6  
ATOM   7675  O  OE1  . GLN A 1 43 ? 12.948  -3.129  -9.799  1.00 0.00 ? 43  GLN A OE1  6  
ATOM   7676  N  NE2  . GLN A 1 43 ? 12.054  -2.189  -11.614 1.00 0.00 ? 43  GLN A NE2  6  
ATOM   7677  H  H    . GLN A 1 43 ? 11.806  -8.518  -10.517 1.00 0.00 ? 43  GLN A H    6  
ATOM   7678  H  HA   . GLN A 1 43 ? 9.633   -6.587  -9.972  1.00 0.00 ? 43  GLN A HA   6  
ATOM   7679  H  HB2  . GLN A 1 43 ? 11.752  -5.560  -9.201  1.00 0.00 ? 43  GLN A HB2  6  
ATOM   7680  H  HB3  . GLN A 1 43 ? 12.491  -5.861  -10.769 1.00 0.00 ? 43  GLN A HB3  6  
ATOM   7681  H  HG2  . GLN A 1 43 ? 10.742  -4.349  -11.798 1.00 0.00 ? 43  GLN A HG2  6  
ATOM   7682  H  HG3  . GLN A 1 43 ? 10.199  -3.965  -10.166 1.00 0.00 ? 43  GLN A HG3  6  
ATOM   7683  H  HE21 . GLN A 1 43 ? 11.359  -2.252  -12.303 1.00 0.00 ? 43  GLN A HE21 6  
ATOM   7684  H  HE22 . GLN A 1 43 ? 12.714  -1.466  -11.575 1.00 0.00 ? 43  GLN A HE22 6  
ATOM   7685  N  N    . CYS A 1 44 ? 9.132   -6.286  -12.421 1.00 0.00 ? 44  CYS A N    6  
ATOM   7686  C  CA   . CYS A 1 44 ? 8.708   -6.178  -13.827 1.00 0.00 ? 44  CYS A CA   6  
ATOM   7687  C  C    . CYS A 1 44 ? 9.740   -5.385  -14.634 1.00 0.00 ? 44  CYS A C    6  
ATOM   7688  O  O    . CYS A 1 44 ? 9.894   -4.182  -14.439 1.00 0.00 ? 44  CYS A O    6  
ATOM   7689  C  CB   . CYS A 1 44 ? 7.321   -5.499  -13.900 1.00 0.00 ? 44  CYS A CB   6  
ATOM   7690  S  SG   . CYS A 1 44 ? 6.807   -4.927  -15.560 1.00 0.00 ? 44  CYS A SG   6  
ATOM   7691  H  H    . CYS A 1 44 ? 8.577   -5.860  -11.742 1.00 0.00 ? 44  CYS A H    6  
ATOM   7692  H  HA   . CYS A 1 44 ? 8.625   -7.183  -14.231 1.00 0.00 ? 44  CYS A HA   6  
ATOM   7693  H  HB2  . CYS A 1 44 ? 6.569   -6.201  -13.557 1.00 0.00 ? 44  CYS A HB2  6  
ATOM   7694  H  HB3  . CYS A 1 44 ? 7.308   -4.631  -13.251 1.00 0.00 ? 44  CYS A HB3  6  
ATOM   7695  N  N    . GLU A 1 45 ? 10.452  -6.082  -15.532 1.00 0.00 ? 45  GLU A N    6  
ATOM   7696  C  CA   . GLU A 1 45 ? 11.515  -5.496  -16.372 1.00 0.00 ? 45  GLU A CA   6  
ATOM   7697  C  C    . GLU A 1 45 ? 10.928  -4.840  -17.663 1.00 0.00 ? 45  GLU A C    6  
ATOM   7698  O  O    . GLU A 1 45 ? 11.595  -4.756  -18.706 1.00 0.00 ? 45  GLU A O    6  
ATOM   7699  C  CB   . GLU A 1 45 ? 12.544  -6.625  -16.703 1.00 0.00 ? 45  GLU A CB   6  
ATOM   7700  C  CG   . GLU A 1 45 ? 13.905  -6.144  -17.238 1.00 0.00 ? 45  GLU A CG   6  
ATOM   7701  C  CD   . GLU A 1 45 ? 14.854  -7.298  -17.594 1.00 0.00 ? 45  GLU A CD   6  
ATOM   7702  O  OE1  . GLU A 1 45 ? 14.737  -7.849  -18.708 1.00 0.00 ? 45  GLU A OE1  6  
ATOM   7703  O  OE2  . GLU A 1 45 ? 15.705  -7.679  -16.757 1.00 0.00 ? 45  GLU A OE2  6  
ATOM   7704  H  H    . GLU A 1 45 ? 10.301  -7.046  -15.587 1.00 0.00 ? 45  GLU A H    6  
ATOM   7705  H  HA   . GLU A 1 45 ? 12.019  -4.728  -15.791 1.00 0.00 ? 45  GLU A HA   6  
ATOM   7706  H  HB2  . GLU A 1 45 ? 12.730  -7.198  -15.803 1.00 0.00 ? 45  GLU A HB2  6  
ATOM   7707  H  HB3  . GLU A 1 45 ? 12.104  -7.293  -17.446 1.00 0.00 ? 45  GLU A HB3  6  
ATOM   7708  H  HG2  . GLU A 1 45 ? 13.733  -5.546  -18.128 1.00 0.00 ? 45  GLU A HG2  6  
ATOM   7709  H  HG3  . GLU A 1 45 ? 14.370  -5.517  -16.480 1.00 0.00 ? 45  GLU A HG3  6  
ATOM   7710  N  N    . ILE A 1 46 ? 9.674   -4.339  -17.570 1.00 0.00 ? 46  ILE A N    6  
ATOM   7711  C  CA   . ILE A 1 46 ? 8.960   -3.688  -18.684 1.00 0.00 ? 46  ILE A CA   6  
ATOM   7712  C  C    . ILE A 1 46 ? 8.689   -2.236  -18.279 1.00 0.00 ? 46  ILE A C    6  
ATOM   7713  O  O    . ILE A 1 46 ? 9.096   -1.294  -18.965 1.00 0.00 ? 46  ILE A O    6  
ATOM   7714  C  CB   . ILE A 1 46 ? 7.613   -4.431  -19.021 1.00 0.00 ? 46  ILE A CB   6  
ATOM   7715  C  CG1  . ILE A 1 46 ? 7.881   -5.919  -19.404 1.00 0.00 ? 46  ILE A CG1  6  
ATOM   7716  C  CG2  . ILE A 1 46 ? 6.835   -3.690  -20.136 1.00 0.00 ? 46  ILE A CG2  6  
ATOM   7717  C  CD1  . ILE A 1 46 ? 8.866   -6.116  -20.546 1.00 0.00 ? 46  ILE A CD1  6  
ATOM   7718  H  H    . ILE A 1 46 ? 9.223   -4.353  -16.713 1.00 0.00 ? 46  ILE A H    6  
ATOM   7719  H  HA   . ILE A 1 46 ? 9.595   -3.694  -19.575 1.00 0.00 ? 46  ILE A HA   6  
ATOM   7720  H  HB   . ILE A 1 46 ? 6.991   -4.414  -18.128 1.00 0.00 ? 46  ILE A HB   6  
ATOM   7721  H  HG12 . ILE A 1 46 ? 8.284   -6.441  -18.542 1.00 0.00 ? 46  ILE A HG12 6  
ATOM   7722  H  HG13 . ILE A 1 46 ? 6.948   -6.394  -19.686 1.00 0.00 ? 46  ILE A HG13 6  
ATOM   7723  H  HG21 . ILE A 1 46 ? 7.428   -3.652  -21.041 1.00 0.00 ? 46  ILE A HG21 6  
ATOM   7724  H  HG22 . ILE A 1 46 ? 6.611   -2.680  -19.810 1.00 0.00 ? 46  ILE A HG22 6  
ATOM   7725  H  HG23 . ILE A 1 46 ? 5.907   -4.209  -20.338 1.00 0.00 ? 46  ILE A HG23 6  
ATOM   7726  H  HD11 . ILE A 1 46 ? 8.940   -7.166  -20.772 1.00 0.00 ? 46  ILE A HD11 6  
ATOM   7727  H  HD12 . ILE A 1 46 ? 9.838   -5.744  -20.252 1.00 0.00 ? 46  ILE A HD12 6  
ATOM   7728  H  HD13 . ILE A 1 46 ? 8.523   -5.582  -21.423 1.00 0.00 ? 46  ILE A HD13 6  
ATOM   7729  N  N    . CYS A 1 47 ? 8.005   -2.075  -17.134 1.00 0.00 ? 47  CYS A N    6  
ATOM   7730  C  CA   . CYS A 1 47 ? 7.888   -0.801  -16.444 1.00 0.00 ? 47  CYS A CA   6  
ATOM   7731  C  C    . CYS A 1 47 ? 8.653   -1.055  -15.155 1.00 0.00 ? 47  CYS A C    6  
ATOM   7732  O  O    . CYS A 1 47 ? 9.852   -1.360  -15.215 1.00 0.00 ? 47  CYS A O    6  
ATOM   7733  C  CB   . CYS A 1 47 ? 6.380   -0.381  -16.259 1.00 0.00 ? 47  CYS A CB   6  
ATOM   7734  S  SG   . CYS A 1 47 ? 5.390   -1.357  -15.065 1.00 0.00 ? 47  CYS A SG   6  
ATOM   7735  H  H    . CYS A 1 47 ? 7.614   -2.857  -16.696 1.00 0.00 ? 47  CYS A H    6  
ATOM   7736  H  HA   . CYS A 1 47 ? 8.416   -0.033  -17.013 1.00 0.00 ? 47  CYS A HA   6  
ATOM   7737  H  HB2  . CYS A 1 47 ? 6.349   0.647   -15.925 1.00 0.00 ? 47  CYS A HB2  6  
ATOM   7738  H  HB3  . CYS A 1 47 ? 5.873   -0.448  -17.215 1.00 0.00 ? 47  CYS A HB3  6  
ATOM   7739  N  N    . GLY A 1 48 ? 8.010   -0.982  -14.012 1.00 0.00 ? 48  GLY A N    6  
ATOM   7740  C  CA   . GLY A 1 48 ? 8.460   -1.663  -12.810 1.00 0.00 ? 48  GLY A CA   6  
ATOM   7741  C  C    . GLY A 1 48 ? 7.252   -2.106  -11.999 1.00 0.00 ? 48  GLY A C    6  
ATOM   7742  O  O    . GLY A 1 48 ? 6.153   -1.577  -12.225 1.00 0.00 ? 48  GLY A O    6  
ATOM   7743  H  H    . GLY A 1 48 ? 7.196   -0.465  -13.929 1.00 0.00 ? 48  GLY A H    6  
ATOM   7744  H  HA2  . GLY A 1 48 ? 9.036   -2.542  -13.097 1.00 0.00 ? 48  GLY A HA2  6  
ATOM   7745  H  HA3  . GLY A 1 48 ? 9.072   -0.996  -12.220 1.00 0.00 ? 48  GLY A HA3  6  
ATOM   7746  N  N    . PHE A 1 49 ? 7.430   -3.028  -11.038 1.00 0.00 ? 49  PHE A N    6  
ATOM   7747  C  CA   . PHE A 1 49 ? 6.368   -3.583  -10.204 1.00 0.00 ? 49  PHE A CA   6  
ATOM   7748  C  C    . PHE A 1 49 ? 7.083   -4.687  -9.457  1.00 0.00 ? 49  PHE A C    6  
ATOM   7749  O  O    . PHE A 1 49 ? 7.480   -5.682  -10.081 1.00 0.00 ? 49  PHE A O    6  
ATOM   7750  C  CB   . PHE A 1 49 ? 5.193   -4.176  -11.035 1.00 0.00 ? 49  PHE A CB   6  
ATOM   7751  C  CG   . PHE A 1 49 ? 4.088   -4.856  -10.214 1.00 0.00 ? 49  PHE A CG   6  
ATOM   7752  C  CD1  . PHE A 1 49 ? 4.164   -6.210  -9.894  1.00 0.00 ? 49  PHE A CD1  6  
ATOM   7753  C  CD2  . PHE A 1 49 ? 2.978   -4.142  -9.766  1.00 0.00 ? 49  PHE A CD2  6  
ATOM   7754  C  CE1  . PHE A 1 49 ? 3.176   -6.832  -9.155  1.00 0.00 ? 49  PHE A CE1  6  
ATOM   7755  C  CE2  . PHE A 1 49 ? 1.990   -4.762  -9.028  1.00 0.00 ? 49  PHE A CE2  6  
ATOM   7756  C  CZ   . PHE A 1 49 ? 2.088   -6.105  -8.722  1.00 0.00 ? 49  PHE A CZ   6  
ATOM   7757  H  H    . PHE A 1 49 ? 8.320   -3.332  -10.748 1.00 0.00 ? 49  PHE A H    6  
ATOM   7758  H  HA   . PHE A 1 49 ? 6.014   -2.818  -9.513  1.00 0.00 ? 49  PHE A HA   6  
ATOM   7759  H  HB2  . PHE A 1 49 ? 4.742   -3.374  -11.612 1.00 0.00 ? 49  PHE A HB2  6  
ATOM   7760  H  HB3  . PHE A 1 49 ? 5.593   -4.906  -11.735 1.00 0.00 ? 49  PHE A HB3  6  
ATOM   7761  H  HD1  . PHE A 1 49 ? 5.024   -6.780  -10.228 1.00 0.00 ? 49  PHE A HD1  6  
ATOM   7762  H  HD2  . PHE A 1 49 ? 2.896   -3.090  -10.000 1.00 0.00 ? 49  PHE A HD2  6  
ATOM   7763  H  HE1  . PHE A 1 49 ? 3.254   -7.886  -8.917  1.00 0.00 ? 49  PHE A HE1  6  
ATOM   7764  H  HE2  . PHE A 1 49 ? 1.133   -4.194  -8.690  1.00 0.00 ? 49  PHE A HE2  6  
ATOM   7765  H  HZ   . PHE A 1 49 ? 1.311   -6.589  -8.141  1.00 0.00 ? 49  PHE A HZ   6  
ATOM   7766  N  N    . THR A 1 50 ? 7.247   -4.543  -8.153  1.00 0.00 ? 50  THR A N    6  
ATOM   7767  C  CA   . THR A 1 50 ? 8.046   -5.473  -7.379  1.00 0.00 ? 50  THR A CA   6  
ATOM   7768  C  C    . THR A 1 50 ? 7.129   -6.215  -6.407  1.00 0.00 ? 50  THR A C    6  
ATOM   7769  O  O    . THR A 1 50 ? 6.233   -5.620  -5.800  1.00 0.00 ? 50  THR A O    6  
ATOM   7770  C  CB   . THR A 1 50 ? 9.190   -4.759  -6.587  1.00 0.00 ? 50  THR A CB   6  
ATOM   7771  O  OG1  . THR A 1 50 ? 9.792   -3.736  -7.407  1.00 0.00 ? 50  THR A OG1  6  
ATOM   7772  C  CG2  . THR A 1 50 ? 10.287  -5.748  -6.135  1.00 0.00 ? 50  THR A CG2  6  
ATOM   7773  H  H    . THR A 1 50 ? 6.802   -3.816  -7.685  1.00 0.00 ? 50  THR A H    6  
ATOM   7774  H  HA   . THR A 1 50 ? 8.507   -6.176  -8.076  1.00 0.00 ? 50  THR A HA   6  
ATOM   7775  H  HB   . THR A 1 50 ? 8.761   -4.299  -5.712  1.00 0.00 ? 50  THR A HB   6  
ATOM   7776  H  HG1  . THR A 1 50 ? 10.692  -3.566  -7.101  1.00 0.00 ? 50  THR A HG1  6  
ATOM   7777  H  HG21 . THR A 1 50 ? 11.050  -5.222  -5.575  1.00 0.00 ? 50  THR A HG21 6  
ATOM   7778  H  HG22 . THR A 1 50 ? 10.741  -6.208  -7.004  1.00 0.00 ? 50  THR A HG22 6  
ATOM   7779  H  HG23 . THR A 1 50 ? 9.850   -6.519  -5.513  1.00 0.00 ? 50  THR A HG23 6  
ATOM   7780  N  N    . CYS A 1 51 ? 7.363   -7.503  -6.291  1.00 0.00 ? 51  CYS A N    6  
ATOM   7781  C  CA   . CYS A 1 51 ? 6.591   -8.390  -5.410  1.00 0.00 ? 51  CYS A CA   6  
ATOM   7782  C  C    . CYS A 1 51 ? 7.487   -9.474  -4.813  1.00 0.00 ? 51  CYS A C    6  
ATOM   7783  O  O    . CYS A 1 51 ? 8.593   -9.728  -5.299  1.00 0.00 ? 51  CYS A O    6  
ATOM   7784  C  CB   . CYS A 1 51 ? 5.420   -9.028  -6.192  1.00 0.00 ? 51  CYS A CB   6  
ATOM   7785  S  SG   . CYS A 1 51 ? 4.371   -10.112 -5.203  1.00 0.00 ? 51  CYS A SG   6  
ATOM   7786  H  H    . CYS A 1 51 ? 8.058   -7.873  -6.856  1.00 0.00 ? 51  CYS A H    6  
ATOM   7787  H  HA   . CYS A 1 51 ? 6.185   -7.797  -4.594  1.00 0.00 ? 51  CYS A HA   6  
ATOM   7788  H  HB2  . CYS A 1 51 ? 4.786   -8.246  -6.589  1.00 0.00 ? 51  CYS A HB2  6  
ATOM   7789  H  HB3  . CYS A 1 51 ? 5.809   -9.613  -7.015  1.00 0.00 ? 51  CYS A HB3  6  
ATOM   7790  H  HG   . CYS A 1 51 ? 3.750   -9.361  -4.305  1.00 0.00 ? 51  CYS A HG   6  
ATOM   7791  N  N    . ARG A 1 52 ? 6.988   -10.086 -3.733  1.00 0.00 ? 52  ARG A N    6  
ATOM   7792  C  CA   . ARG A 1 52 ? 7.642   -11.214 -3.057  1.00 0.00 ? 52  ARG A CA   6  
ATOM   7793  C  C    . ARG A 1 52 ? 7.433   -12.519 -3.854  1.00 0.00 ? 52  ARG A C    6  
ATOM   7794  O  O    . ARG A 1 52 ? 8.288   -13.416 -3.849  1.00 0.00 ? 52  ARG A O    6  
ATOM   7795  C  CB   . ARG A 1 52 ? 7.047   -11.357 -1.638  1.00 0.00 ? 52  ARG A CB   6  
ATOM   7796  C  CG   . ARG A 1 52 ? 7.719   -12.429 -0.754  1.00 0.00 ? 52  ARG A CG   6  
ATOM   7797  C  CD   . ARG A 1 52 ? 7.046   -12.573 0.618   1.00 0.00 ? 52  ARG A CD   6  
ATOM   7798  N  NE   . ARG A 1 52 ? 6.975   -11.299 1.346   1.00 0.00 ? 52  ARG A NE   6  
ATOM   7799  C  CZ   . ARG A 1 52 ? 6.321   -11.112 2.490   1.00 0.00 ? 52  ARG A CZ   6  
ATOM   7800  N  NH1  . ARG A 1 52 ? 5.732   -12.117 3.122   1.00 0.00 ? 52  ARG A NH1  6  
ATOM   7801  N  NH2  . ARG A 1 52 ? 6.257   -9.901  3.003   1.00 0.00 ? 52  ARG A NH2  6  
ATOM   7802  H  H    . ARG A 1 52 ? 6.139   -9.757  -3.365  1.00 0.00 ? 52  ARG A H    6  
ATOM   7803  H  HA   . ARG A 1 52 ? 8.703   -11.002 -2.986  1.00 0.00 ? 52  ARG A HA   6  
ATOM   7804  H  HB2  . ARG A 1 52 ? 7.135   -10.401 -1.131  1.00 0.00 ? 52  ARG A HB2  6  
ATOM   7805  H  HB3  . ARG A 1 52 ? 5.989   -11.601 -1.725  1.00 0.00 ? 52  ARG A HB3  6  
ATOM   7806  H  HG2  . ARG A 1 52 ? 7.670   -13.384 -1.266  1.00 0.00 ? 52  ARG A HG2  6  
ATOM   7807  H  HG3  . ARG A 1 52 ? 8.764   -12.162 -0.608  1.00 0.00 ? 52  ARG A HG3  6  
ATOM   7808  H  HD2  . ARG A 1 52 ? 6.038   -12.951 0.479   1.00 0.00 ? 52  ARG A HD2  6  
ATOM   7809  H  HD3  . ARG A 1 52 ? 7.609   -13.283 1.216   1.00 0.00 ? 52  ARG A HD3  6  
ATOM   7810  H  HE   . ARG A 1 52 ? 7.418   -10.530 0.931   1.00 0.00 ? 52  ARG A HE   6  
ATOM   7811  H  HH11 . ARG A 1 52 ? 5.766   -13.043 2.740   1.00 0.00 ? 52  ARG A HH11 6  
ATOM   7812  H  HH12 . ARG A 1 52 ? 5.243   -11.949 3.973   1.00 0.00 ? 52  ARG A HH12 6  
ATOM   7813  H  HH21 . ARG A 1 52 ? 6.689   -9.128  2.528   1.00 0.00 ? 52  ARG A HH21 6  
ATOM   7814  H  HH22 . ARG A 1 52 ? 5.761   -9.742  3.858   1.00 0.00 ? 52  ARG A HH22 6  
ATOM   7815  N  N    . GLN A 1 53 ? 6.280   -12.610 -4.537  1.00 0.00 ? 53  GLN A N    6  
ATOM   7816  C  CA   . GLN A 1 53 ? 5.894   -13.784 -5.333  1.00 0.00 ? 53  GLN A CA   6  
ATOM   7817  C  C    . GLN A 1 53 ? 6.017   -13.458 -6.829  1.00 0.00 ? 53  GLN A C    6  
ATOM   7818  O  O    . GLN A 1 53 ? 5.396   -12.500 -7.313  1.00 0.00 ? 53  GLN A O    6  
ATOM   7819  C  CB   . GLN A 1 53 ? 4.450   -14.220 -4.978  1.00 0.00 ? 53  GLN A CB   6  
ATOM   7820  C  CG   . GLN A 1 53 ? 3.975   -15.510 -5.685  1.00 0.00 ? 53  GLN A CG   6  
ATOM   7821  C  CD   . GLN A 1 53 ? 2.572   -15.961 -5.270  1.00 0.00 ? 53  GLN A CD   6  
ATOM   7822  O  OE1  . GLN A 1 53 ? 2.127   -15.719 -4.144  1.00 0.00 ? 53  GLN A OE1  6  
ATOM   7823  N  NE2  . GLN A 1 53 ? 1.872   -16.647 -6.163  1.00 0.00 ? 53  GLN A NE2  6  
ATOM   7824  H  H    . GLN A 1 53 ? 5.669   -11.847 -4.516  1.00 0.00 ? 53  GLN A H    6  
ATOM   7825  H  HA   . GLN A 1 53 ? 6.573   -14.604 -5.092  1.00 0.00 ? 53  GLN A HA   6  
ATOM   7826  H  HB2  . GLN A 1 53 ? 4.396   -14.384 -3.908  1.00 0.00 ? 53  GLN A HB2  6  
ATOM   7827  H  HB3  . GLN A 1 53 ? 3.768   -13.417 -5.237  1.00 0.00 ? 53  GLN A HB3  6  
ATOM   7828  H  HG2  . GLN A 1 53 ? 3.977   -15.336 -6.756  1.00 0.00 ? 53  GLN A HG2  6  
ATOM   7829  H  HG3  . GLN A 1 53 ? 4.674   -16.308 -5.461  1.00 0.00 ? 53  GLN A HG3  6  
ATOM   7830  H  HE21 . GLN A 1 53 ? 2.282   -16.833 -7.030  1.00 0.00 ? 53  GLN A HE21 6  
ATOM   7831  H  HE22 . GLN A 1 53 ? 0.961   -16.923 -5.928  1.00 0.00 ? 53  GLN A HE22 6  
ATOM   7832  N  N    . LYS A 1 54 ? 6.837   -14.256 -7.531  1.00 0.00 ? 54  LYS A N    6  
ATOM   7833  C  CA   . LYS A 1 54 ? 7.064   -14.154 -8.988  1.00 0.00 ? 54  LYS A CA   6  
ATOM   7834  C  C    . LYS A 1 54 ? 5.743   -14.087 -9.773  1.00 0.00 ? 54  LYS A C    6  
ATOM   7835  O  O    . LYS A 1 54 ? 5.582   -13.224 -10.616 1.00 0.00 ? 54  LYS A O    6  
ATOM   7836  C  CB   . LYS A 1 54 ? 7.912   -15.359 -9.478  1.00 0.00 ? 54  LYS A CB   6  
ATOM   7837  C  CG   . LYS A 1 54 ? 8.172   -15.413 -11.005 1.00 0.00 ? 54  LYS A CG   6  
ATOM   7838  C  CD   . LYS A 1 54 ? 8.976   -16.663 -11.436 1.00 0.00 ? 54  LYS A CD   6  
ATOM   7839  C  CE   . LYS A 1 54 ? 10.391  -16.694 -10.835 1.00 0.00 ? 54  LYS A CE   6  
ATOM   7840  N  NZ   . LYS A 1 54 ? 11.194  -15.507 -11.242 1.00 0.00 ? 54  LYS A NZ   6  
ATOM   7841  H  H    . LYS A 1 54 ? 7.345   -14.923 -7.030  1.00 0.00 ? 54  LYS A H    6  
ATOM   7842  H  HA   . LYS A 1 54 ? 7.623   -13.238 -9.161  1.00 0.00 ? 54  LYS A HA   6  
ATOM   7843  H  HB2  . LYS A 1 54 ? 8.873   -15.334 -8.977  1.00 0.00 ? 54  LYS A HB2  6  
ATOM   7844  H  HB3  . LYS A 1 54 ? 7.403   -16.275 -9.192  1.00 0.00 ? 54  LYS A HB3  6  
ATOM   7845  H  HG2  . LYS A 1 54 ? 7.218   -15.426 -11.523 1.00 0.00 ? 54  LYS A HG2  6  
ATOM   7846  H  HG3  . LYS A 1 54 ? 8.721   -14.523 -11.297 1.00 0.00 ? 54  LYS A HG3  6  
ATOM   7847  H  HD2  . LYS A 1 54 ? 8.442   -17.556 -11.121 1.00 0.00 ? 54  LYS A HD2  6  
ATOM   7848  H  HD3  . LYS A 1 54 ? 9.056   -16.668 -12.518 1.00 0.00 ? 54  LYS A HD3  6  
ATOM   7849  H  HE2  . LYS A 1 54 ? 10.319  -16.712 -9.756  1.00 0.00 ? 54  LYS A HE2  6  
ATOM   7850  H  HE3  . LYS A 1 54 ? 10.901  -17.590 -11.171 1.00 0.00 ? 54  LYS A HE3  6  
ATOM   7851  H  HZ1  . LYS A 1 54 ? 11.273  -15.472 -12.277 1.00 0.00 ? 54  LYS A HZ1  6  
ATOM   7852  H  HZ2  . LYS A 1 54 ? 12.152  -15.566 -10.839 1.00 0.00 ? 54  LYS A HZ2  6  
ATOM   7853  H  HZ3  . LYS A 1 54 ? 10.745  -14.628 -10.913 1.00 0.00 ? 54  LYS A HZ3  6  
ATOM   7854  N  N    . ALA A 1 55 ? 4.812   -14.994 -9.442  1.00 0.00 ? 55  ALA A N    6  
ATOM   7855  C  CA   . ALA A 1 55 ? 3.511   -15.134 -10.147 1.00 0.00 ? 55  ALA A CA   6  
ATOM   7856  C  C    . ALA A 1 55 ? 2.715   -13.800 -10.232 1.00 0.00 ? 55  ALA A C    6  
ATOM   7857  O  O    . ALA A 1 55 ? 1.996   -13.568 -11.208 1.00 0.00 ? 55  ALA A O    6  
ATOM   7858  C  CB   . ALA A 1 55 ? 2.665   -16.234 -9.492  1.00 0.00 ? 55  ALA A CB   6  
ATOM   7859  H  H    . ALA A 1 55 ? 5.047   -15.602 -8.712  1.00 0.00 ? 55  ALA A H    6  
ATOM   7860  H  HA   . ALA A 1 55 ? 3.736   -15.460 -11.159 1.00 0.00 ? 55  ALA A HA   6  
ATOM   7861  H  HB1  . ALA A 1 55 ? 1.757   -16.394 -10.061 1.00 0.00 ? 55  ALA A HB1  6  
ATOM   7862  H  HB2  . ALA A 1 55 ? 2.408   -15.941 -8.482  1.00 0.00 ? 55  ALA A HB2  6  
ATOM   7863  H  HB3  . ALA A 1 55 ? 3.230   -17.159 -9.460  1.00 0.00 ? 55  ALA A HB3  6  
ATOM   7864  N  N    . SER A 1 56 ? 2.869   -12.935 -9.211  1.00 0.00 ? 56  SER A N    6  
ATOM   7865  C  CA   . SER A 1 56 ? 2.170   -11.630 -9.156  1.00 0.00 ? 56  SER A CA   6  
ATOM   7866  C  C    . SER A 1 56 ? 2.607   -10.707 -10.318 1.00 0.00 ? 56  SER A C    6  
ATOM   7867  O  O    . SER A 1 56 ? 1.770   -10.266 -11.122 1.00 0.00 ? 56  SER A O    6  
ATOM   7868  C  CB   . SER A 1 56 ? 2.424   -10.946 -7.797  1.00 0.00 ? 56  SER A CB   6  
ATOM   7869  O  OG   . SER A 1 56 ? 1.690   -9.736  -7.665  1.00 0.00 ? 56  SER A OG   6  
ATOM   7870  H  H    . SER A 1 56 ? 3.461   -13.199 -8.474  1.00 0.00 ? 56  SER A H    6  
ATOM   7871  H  HA   . SER A 1 56 ? 1.105   -11.830 -9.245  1.00 0.00 ? 56  SER A HA   6  
ATOM   7872  H  HB2  . SER A 1 56 ? 2.133   -11.616 -7.001  1.00 0.00 ? 56  SER A HB2  6  
ATOM   7873  H  HB3  . SER A 1 56 ? 3.477   -10.717 -7.699  1.00 0.00 ? 56  SER A HB3  6  
ATOM   7874  H  HG   . SER A 1 56 ? 0.771   -9.886  -7.915  1.00 0.00 ? 56  SER A HG   6  
ATOM   7875  N  N    . LEU A 1 57 ? 3.928   -10.457 -10.427 1.00 0.00 ? 57  LEU A N    6  
ATOM   7876  C  CA   . LEU A 1 57 ? 4.500   -9.606  -11.491 1.00 0.00 ? 57  LEU A CA   6  
ATOM   7877  C  C    . LEU A 1 57 ? 4.525   -10.329 -12.840 1.00 0.00 ? 57  LEU A C    6  
ATOM   7878  O  O    . LEU A 1 57 ? 4.498   -9.682  -13.877 1.00 0.00 ? 57  LEU A O    6  
ATOM   7879  C  CB   . LEU A 1 57 ? 5.930   -9.109  -11.145 1.00 0.00 ? 57  LEU A CB   6  
ATOM   7880  C  CG   . LEU A 1 57 ? 6.998   -10.215 -10.816 1.00 0.00 ? 57  LEU A CG   6  
ATOM   7881  C  CD1  . LEU A 1 57 ? 8.365   -9.900  -11.452 1.00 0.00 ? 57  LEU A CD1  6  
ATOM   7882  C  CD2  . LEU A 1 57 ? 7.131   -10.429 -9.290  1.00 0.00 ? 57  LEU A CD2  6  
ATOM   7883  H  H    . LEU A 1 57 ? 4.537   -10.859 -9.781  1.00 0.00 ? 57  LEU A H    6  
ATOM   7884  H  HA   . LEU A 1 57 ? 3.850   -8.741  -11.590 1.00 0.00 ? 57  LEU A HA   6  
ATOM   7885  H  HB2  . LEU A 1 57 ? 6.283   -8.524  -11.987 1.00 0.00 ? 57  LEU A HB2  6  
ATOM   7886  H  HB3  . LEU A 1 57 ? 5.854   -8.436  -10.296 1.00 0.00 ? 57  LEU A HB3  6  
ATOM   7887  H  HG   . LEU A 1 57 ? 6.670   -11.155 -11.246 1.00 0.00 ? 57  LEU A HG   6  
ATOM   7888  H  HD11 . LEU A 1 57 ? 8.746   -8.962  -11.065 1.00 0.00 ? 57  LEU A HD11 6  
ATOM   7889  H  HD12 . LEU A 1 57 ? 8.250   -9.816  -12.525 1.00 0.00 ? 57  LEU A HD12 6  
ATOM   7890  H  HD13 . LEU A 1 57 ? 9.069   -10.692 -11.232 1.00 0.00 ? 57  LEU A HD13 6  
ATOM   7891  H  HD21 . LEU A 1 57 ? 7.841   -11.225 -9.097  1.00 0.00 ? 57  LEU A HD21 6  
ATOM   7892  H  HD22 . LEU A 1 57 ? 6.171   -10.710 -8.876  1.00 0.00 ? 57  LEU A HD22 6  
ATOM   7893  H  HD23 . LEU A 1 57 ? 7.475   -9.518  -8.815  1.00 0.00 ? 57  LEU A HD23 6  
ATOM   7894  N  N    . ASN A 1 58 ? 4.670   -11.654 -12.803 1.00 0.00 ? 58  ASN A N    6  
ATOM   7895  C  CA   . ASN A 1 58 ? 4.633   -12.537 -13.990 1.00 0.00 ? 58  ASN A CA   6  
ATOM   7896  C  C    . ASN A 1 58 ? 3.386   -12.316 -14.856 1.00 0.00 ? 58  ASN A C    6  
ATOM   7897  O  O    . ASN A 1 58 ? 3.499   -12.121 -16.071 1.00 0.00 ? 58  ASN A O    6  
ATOM   7898  C  CB   . ASN A 1 58 ? 4.735   -14.016 -13.550 1.00 0.00 ? 58  ASN A CB   6  
ATOM   7899  C  CG   . ASN A 1 58 ? 4.711   -15.027 -14.704 1.00 0.00 ? 58  ASN A CG   6  
ATOM   7900  O  OD1  . ASN A 1 58 ? 5.743   -15.365 -15.278 1.00 0.00 ? 58  ASN A OD1  6  
ATOM   7901  N  ND2  . ASN A 1 58 ? 3.537   -15.538 -15.027 1.00 0.00 ? 58  ASN A ND2  6  
ATOM   7902  H  H    . ASN A 1 58 ? 4.936   -12.052 -11.964 1.00 0.00 ? 58  ASN A H    6  
ATOM   7903  H  HA   . ASN A 1 58 ? 5.503   -12.291 -14.583 1.00 0.00 ? 58  ASN A HA   6  
ATOM   7904  H  HB2  . ASN A 1 58 ? 5.659   -14.149 -13.004 1.00 0.00 ? 58  ASN A HB2  6  
ATOM   7905  H  HB3  . ASN A 1 58 ? 3.910   -14.236 -12.880 1.00 0.00 ? 58  ASN A HB3  6  
ATOM   7906  H  HD21 . ASN A 1 58 ? 2.750   -15.250 -14.521 1.00 0.00 ? 58  ASN A HD21 6  
ATOM   7907  H  HD22 . ASN A 1 58 ? 3.498   -16.188 -15.760 1.00 0.00 ? 58  ASN A HD22 6  
ATOM   7908  N  N    . TRP A 1 59 ? 2.209   -12.290 -14.219 1.00 0.00 ? 59  TRP A N    6  
ATOM   7909  C  CA   . TRP A 1 59 ? 0.943   -12.108 -14.947 1.00 0.00 ? 59  TRP A CA   6  
ATOM   7910  C  C    . TRP A 1 59 ? 0.782   -10.629 -15.326 1.00 0.00 ? 59  TRP A C    6  
ATOM   7911  O  O    . TRP A 1 59 ? 0.361   -10.328 -16.437 1.00 0.00 ? 59  TRP A O    6  
ATOM   7912  C  CB   . TRP A 1 59 ? -0.270  -12.621 -14.125 1.00 0.00 ? 59  TRP A CB   6  
ATOM   7913  C  CG   . TRP A 1 59 ? -0.233  -14.113 -13.814 1.00 0.00 ? 59  TRP A CG   6  
ATOM   7914  C  CD1  . TRP A 1 59 ? -0.522  -14.709 -12.613 1.00 0.00 ? 59  TRP A CD1  6  
ATOM   7915  C  CD2  . TRP A 1 59 ? 0.104   -15.195 -14.716 1.00 0.00 ? 59  TRP A CD2  6  
ATOM   7916  N  NE1  . TRP A 1 59 ? -0.368  -16.066 -12.703 1.00 0.00 ? 59  TRP A NE1  6  
ATOM   7917  C  CE2  . TRP A 1 59 ? 0.017   -16.387 -13.976 1.00 0.00 ? 59  TRP A CE2  6  
ATOM   7918  C  CE3  . TRP A 1 59 ? 0.487   -15.276 -16.069 1.00 0.00 ? 59  TRP A CE3  6  
ATOM   7919  C  CZ2  . TRP A 1 59 ? 0.284   -17.634 -14.539 1.00 0.00 ? 59  TRP A CZ2  6  
ATOM   7920  C  CZ3  . TRP A 1 59 ? 0.754   -16.516 -16.622 1.00 0.00 ? 59  TRP A CZ3  6  
ATOM   7921  C  CH2  . TRP A 1 59 ? 0.651   -17.676 -15.855 1.00 0.00 ? 59  TRP A CH2  6  
ATOM   7922  H  H    . TRP A 1 59 ? 2.181   -12.306 -13.248 1.00 0.00 ? 59  TRP A H    6  
ATOM   7923  H  HA   . TRP A 1 59 ? 1.007   -12.697 -15.863 1.00 0.00 ? 59  TRP A HA   6  
ATOM   7924  H  HB2  . TRP A 1 59 ? -0.312  -12.082 -13.187 1.00 0.00 ? 59  TRP A HB2  6  
ATOM   7925  H  HB3  . TRP A 1 59 ? -1.186  -12.428 -14.674 1.00 0.00 ? 59  TRP A HB3  6  
ATOM   7926  H  HD1  . TRP A 1 59 ? -0.815  -14.170 -11.719 1.00 0.00 ? 59  TRP A HD1  6  
ATOM   7927  H  HE1  . TRP A 1 59 ? -0.511  -16.710 -11.970 1.00 0.00 ? 59  TRP A HE1  6  
ATOM   7928  H  HE3  . TRP A 1 59 ? 0.570   -14.386 -16.678 1.00 0.00 ? 59  TRP A HE3  6  
ATOM   7929  H  HZ2  . TRP A 1 59 ? 0.217   -18.545 -13.957 1.00 0.00 ? 59  TRP A HZ2  6  
ATOM   7930  H  HZ3  . TRP A 1 59 ? 1.048   -16.594 -17.666 1.00 0.00 ? 59  TRP A HZ3  6  
ATOM   7931  H  HH2  . TRP A 1 59 ? 0.871   -18.627 -16.325 1.00 0.00 ? 59  TRP A HH2  6  
ATOM   7932  N  N    . HIS A 1 60 ? 1.117   -9.726  -14.372 1.00 0.00 ? 60  HIS A N    6  
ATOM   7933  C  CA   . HIS A 1 60 ? 1.261   -8.267  -14.620 1.00 0.00 ? 60  HIS A CA   6  
ATOM   7934  C  C    . HIS A 1 60 ? 2.098   -7.922  -15.901 1.00 0.00 ? 60  HIS A C    6  
ATOM   7935  O  O    . HIS A 1 60 ? 1.755   -6.979  -16.622 1.00 0.00 ? 60  HIS A O    6  
ATOM   7936  C  CB   . HIS A 1 60 ? 1.874   -7.585  -13.352 1.00 0.00 ? 60  HIS A CB   6  
ATOM   7937  C  CG   . HIS A 1 60 ? 2.384   -6.185  -13.561 1.00 0.00 ? 60  HIS A CG   6  
ATOM   7938  N  ND1  . HIS A 1 60 ? 1.615   -5.054  -13.530 1.00 0.00 ? 60  HIS A ND1  6  
ATOM   7939  C  CD2  . HIS A 1 60 ? 3.615   -5.785  -13.902 1.00 0.00 ? 60  HIS A CD2  6  
ATOM   7940  C  CE1  . HIS A 1 60 ? 2.399   -4.024  -13.875 1.00 0.00 ? 60  HIS A CE1  6  
ATOM   7941  N  NE2  . HIS A 1 60 ? 3.641   -4.414  -14.118 1.00 0.00 ? 60  HIS A NE2  6  
ATOM   7942  H  H    . HIS A 1 60 ? 1.120   -10.022 -13.436 1.00 0.00 ? 60  HIS A H    6  
ATOM   7943  H  HA   . HIS A 1 60 ? 0.261   -7.878  -14.762 1.00 0.00 ? 60  HIS A HA   6  
ATOM   7944  H  HB2  . HIS A 1 60 ? 1.138   -7.535  -12.577 1.00 0.00 ? 60  HIS A HB2  6  
ATOM   7945  H  HB3  . HIS A 1 60 ? 2.704   -8.187  -12.996 1.00 0.00 ? 60  HIS A HB3  6  
ATOM   7946  H  HD1  . HIS A 1 60 ? 0.659   -5.007  -13.302 1.00 0.00 ? 60  HIS A HD1  6  
ATOM   7947  H  HD2  . HIS A 1 60 ? 4.470   -6.433  -13.974 1.00 0.00 ? 60  HIS A HD2  6  
ATOM   7948  H  HE1  . HIS A 1 60 ? 2.063   -3.002  -13.931 1.00 0.00 ? 60  HIS A HE1  6  
ATOM   7949  N  N    . MET A 1 61 ? 3.208   -8.642  -16.149 1.00 0.00 ? 61  MET A N    6  
ATOM   7950  C  CA   . MET A 1 61 ? 4.034   -8.430  -17.365 1.00 0.00 ? 61  MET A CA   6  
ATOM   7951  C  C    . MET A 1 61 ? 3.321   -8.937  -18.627 1.00 0.00 ? 61  MET A C    6  
ATOM   7952  O  O    . MET A 1 61 ? 3.337   -8.274  -19.667 1.00 0.00 ? 61  MET A O    6  
ATOM   7953  C  CB   . MET A 1 61 ? 5.438   -9.067  -17.211 1.00 0.00 ? 61  MET A CB   6  
ATOM   7954  C  CG   . MET A 1 61 ? 6.337   -8.356  -16.195 1.00 0.00 ? 61  MET A CG   6  
ATOM   7955  S  SD   . MET A 1 61 ? 7.983   -9.077  -16.062 1.00 0.00 ? 61  MET A SD   6  
ATOM   7956  C  CE   . MET A 1 61 ? 7.626   -10.703 -15.392 1.00 0.00 ? 61  MET A CE   6  
ATOM   7957  H  H    . MET A 1 61 ? 3.509   -9.297  -15.499 1.00 0.00 ? 61  MET A H    6  
ATOM   7958  H  HA   . MET A 1 61 ? 4.161   -7.362  -17.470 1.00 0.00 ? 61  MET A HA   6  
ATOM   7959  H  HB2  . MET A 1 61 ? 5.324   -10.097 -16.898 1.00 0.00 ? 61  MET A HB2  6  
ATOM   7960  H  HB3  . MET A 1 61 ? 5.943   -9.054  -18.171 1.00 0.00 ? 61  MET A HB3  6  
ATOM   7961  H  HG2  . MET A 1 61 ? 6.453   -7.323  -16.493 1.00 0.00 ? 61  MET A HG2  6  
ATOM   7962  H  HG3  . MET A 1 61 ? 5.866   -8.389  -15.218 1.00 0.00 ? 61  MET A HG3  6  
ATOM   7963  H  HE1  . MET A 1 61 ? 7.000   -11.254 -16.084 1.00 0.00 ? 61  MET A HE1  6  
ATOM   7964  H  HE2  . MET A 1 61 ? 7.113   -10.604 -14.443 1.00 0.00 ? 61  MET A HE2  6  
ATOM   7965  H  HE3  . MET A 1 61 ? 8.552   -11.239 -15.239 1.00 0.00 ? 61  MET A HE3  6  
ATOM   7966  N  N    . LYS A 1 62 ? 2.706   -10.119 -18.519 1.00 0.00 ? 62  LYS A N    6  
ATOM   7967  C  CA   . LYS A 1 62 ? 1.845   -10.680 -19.583 1.00 0.00 ? 62  LYS A CA   6  
ATOM   7968  C  C    . LYS A 1 62 ? 0.628   -9.753  -19.895 1.00 0.00 ? 62  LYS A C    6  
ATOM   7969  O  O    . LYS A 1 62 ? 0.066   -9.807  -20.994 1.00 0.00 ? 62  LYS A O    6  
ATOM   7970  C  CB   . LYS A 1 62 ? 1.383   -12.118 -19.214 1.00 0.00 ? 62  LYS A CB   6  
ATOM   7971  C  CG   . LYS A 1 62 ? 0.953   -12.974 -20.431 1.00 0.00 ? 62  LYS A CG   6  
ATOM   7972  C  CD   . LYS A 1 62 ? 0.460   -14.391 -20.045 1.00 0.00 ? 62  LYS A CD   6  
ATOM   7973  C  CE   . LYS A 1 62 ? -0.867  -14.370 -19.267 1.00 0.00 ? 62  LYS A CE   6  
ATOM   7974  N  NZ   . LYS A 1 62 ? -1.967  -13.775 -20.062 1.00 0.00 ? 62  LYS A NZ   6  
ATOM   7975  H  H    . LYS A 1 62 ? 2.924   -10.664 -17.737 1.00 0.00 ? 62  LYS A H    6  
ATOM   7976  H  HA   . LYS A 1 62 ? 2.461   -10.733 -20.477 1.00 0.00 ? 62  LYS A HA   6  
ATOM   7977  H  HB2  . LYS A 1 62 ? 2.198   -12.631 -18.708 1.00 0.00 ? 62  LYS A HB2  6  
ATOM   7978  H  HB3  . LYS A 1 62 ? 0.544   -12.052 -18.528 1.00 0.00 ? 62  LYS A HB3  6  
ATOM   7979  H  HG2  . LYS A 1 62 ? 0.157   -12.459 -20.957 1.00 0.00 ? 62  LYS A HG2  6  
ATOM   7980  H  HG3  . LYS A 1 62 ? 1.806   -13.072 -21.097 1.00 0.00 ? 62  LYS A HG3  6  
ATOM   7981  H  HD2  . LYS A 1 62 ? 0.319   -14.972 -20.951 1.00 0.00 ? 62  LYS A HD2  6  
ATOM   7982  H  HD3  . LYS A 1 62 ? 1.219   -14.872 -19.433 1.00 0.00 ? 62  LYS A HD3  6  
ATOM   7983  H  HE2  . LYS A 1 62 ? -1.143  -15.383 -19.009 1.00 0.00 ? 62  LYS A HE2  6  
ATOM   7984  H  HE3  . LYS A 1 62 ? -0.739  -13.795 -18.358 1.00 0.00 ? 62  LYS A HE3  6  
ATOM   7985  H  HZ1  . LYS A 1 62 ? -2.139  -14.338 -20.919 1.00 0.00 ? 62  LYS A HZ1  6  
ATOM   7986  H  HZ2  . LYS A 1 62 ? -1.720  -12.803 -20.347 1.00 0.00 ? 62  LYS A HZ2  6  
ATOM   7987  H  HZ3  . LYS A 1 62 ? -2.839  -13.743 -19.500 1.00 0.00 ? 62  LYS A HZ3  6  
ATOM   7988  N  N    . LYS A 1 63 ? 0.226   -8.939  -18.895 1.00 0.00 ? 63  LYS A N    6  
ATOM   7989  C  CA   . LYS A 1 63 ? -0.800  -7.875  -19.080 1.00 0.00 ? 63  LYS A CA   6  
ATOM   7990  C  C    . LYS A 1 63 ? -0.310  -6.817  -20.108 1.00 0.00 ? 63  LYS A C    6  
ATOM   7991  O  O    . LYS A 1 63 ? -1.113  -6.314  -20.911 1.00 0.00 ? 63  LYS A O    6  
ATOM   7992  C  CB   . LYS A 1 63 ? -1.205  -7.180  -17.749 1.00 0.00 ? 63  LYS A CB   6  
ATOM   7993  C  CG   . LYS A 1 63 ? -1.882  -8.088  -16.692 1.00 0.00 ? 63  LYS A CG   6  
ATOM   7994  C  CD   . LYS A 1 63 ? -3.214  -8.719  -17.165 1.00 0.00 ? 63  LYS A CD   6  
ATOM   7995  C  CE   . LYS A 1 63 ? -4.309  -7.679  -17.470 1.00 0.00 ? 63  LYS A CE   6  
ATOM   7996  N  NZ   . LYS A 1 63 ? -5.594  -8.327  -17.801 1.00 0.00 ? 63  LYS A NZ   6  
ATOM   7997  H  H    . LYS A 1 63 ? 0.647   -9.108  -18.029 1.00 0.00 ? 63  LYS A H    6  
ATOM   7998  H  HA   . LYS A 1 63 ? -1.683  -8.359  -19.496 1.00 0.00 ? 63  LYS A HA   6  
ATOM   7999  H  HB2  . LYS A 1 63 ? -0.316  -6.755  -17.298 1.00 0.00 ? 63  LYS A HB2  6  
ATOM   8000  H  HB3  . LYS A 1 63 ? -1.891  -6.369  -17.976 1.00 0.00 ? 63  LYS A HB3  6  
ATOM   8001  H  HG2  . LYS A 1 63 ? -1.197  -8.890  -16.438 1.00 0.00 ? 63  LYS A HG2  6  
ATOM   8002  H  HG3  . LYS A 1 63 ? -2.068  -7.496  -15.797 1.00 0.00 ? 63  LYS A HG3  6  
ATOM   8003  H  HD2  . LYS A 1 63 ? -3.030  -9.295  -18.065 1.00 0.00 ? 63  LYS A HD2  6  
ATOM   8004  H  HD3  . LYS A 1 63 ? -3.576  -9.388  -16.391 1.00 0.00 ? 63  LYS A HD3  6  
ATOM   8005  H  HE2  . LYS A 1 63 ? -4.458  -7.048  -16.604 1.00 0.00 ? 63  LYS A HE2  6  
ATOM   8006  H  HE3  . LYS A 1 63 ? -4.001  -7.068  -18.310 1.00 0.00 ? 63  LYS A HE3  6  
ATOM   8007  H  HZ1  . LYS A 1 63 ? -6.318  -7.607  -17.998 1.00 0.00 ? 63  LYS A HZ1  6  
ATOM   8008  H  HZ2  . LYS A 1 63 ? -5.916  -8.917  -17.006 1.00 0.00 ? 63  LYS A HZ2  6  
ATOM   8009  H  HZ3  . LYS A 1 63 ? -5.484  -8.932  -18.638 1.00 0.00 ? 63  LYS A HZ3  6  
ATOM   8010  N  N    . HIS A 1 64 ? 1.004   -6.473  -20.072 1.00 0.00 ? 64  HIS A N    6  
ATOM   8011  C  CA   . HIS A 1 64 ? 1.648   -5.602  -21.104 1.00 0.00 ? 64  HIS A CA   6  
ATOM   8012  C  C    . HIS A 1 64 ? 1.655   -6.292  -22.489 1.00 0.00 ? 64  HIS A C    6  
ATOM   8013  O  O    . HIS A 1 64 ? 1.662   -5.612  -23.524 1.00 0.00 ? 64  HIS A O    6  
ATOM   8014  C  CB   . HIS A 1 64 ? 3.122   -5.232  -20.737 1.00 0.00 ? 64  HIS A CB   6  
ATOM   8015  C  CG   . HIS A 1 64 ? 3.331   -4.435  -19.473 1.00 0.00 ? 64  HIS A CG   6  
ATOM   8016  N  ND1  . HIS A 1 64 ? 3.121   -3.078  -19.385 1.00 0.00 ? 64  HIS A ND1  6  
ATOM   8017  C  CD2  . HIS A 1 64 ? 3.862   -4.800  -18.275 1.00 0.00 ? 64  HIS A CD2  6  
ATOM   8018  C  CE1  . HIS A 1 64 ? 3.533   -2.671  -18.181 1.00 0.00 ? 64  HIS A CE1  6  
ATOM   8019  N  NE2  . HIS A 1 64 ? 3.993   -3.680  -17.471 1.00 0.00 ? 64  HIS A NE2  6  
ATOM   8020  H  H    . HIS A 1 64 ? 1.548   -6.786  -19.320 1.00 0.00 ? 64  HIS A H    6  
ATOM   8021  H  HA   . HIS A 1 64 ? 1.055   -4.690  -21.183 1.00 0.00 ? 64  HIS A HA   6  
ATOM   8022  H  HB2  . HIS A 1 64 ? 3.699   -6.144  -20.634 1.00 0.00 ? 64  HIS A HB2  6  
ATOM   8023  H  HB3  . HIS A 1 64 ? 3.555   -4.653  -21.553 1.00 0.00 ? 64  HIS A HB3  6  
ATOM   8024  H  HD1  . HIS A 1 64 ? 2.742   -2.506  -20.080 1.00 0.00 ? 64  HIS A HD1  6  
ATOM   8025  H  HD2  . HIS A 1 64 ? 4.160   -5.792  -17.995 1.00 0.00 ? 64  HIS A HD2  6  
ATOM   8026  H  HE1  . HIS A 1 64 ? 3.498   -1.647  -17.841 1.00 0.00 ? 64  HIS A HE1  6  
ATOM   8027  N  N    . ASP A 1 65 ? 1.642   -7.645  -22.490 1.00 0.00 ? 65  ASP A N    6  
ATOM   8028  C  CA   . ASP A 1 65 ? 1.658   -8.457  -23.731 1.00 0.00 ? 65  ASP A CA   6  
ATOM   8029  C  C    . ASP A 1 65 ? 0.223   -8.730  -24.190 1.00 0.00 ? 65  ASP A C    6  
ATOM   8030  O  O    . ASP A 1 65 ? 0.008   -9.236  -25.296 1.00 0.00 ? 65  ASP A O    6  
ATOM   8031  C  CB   . ASP A 1 65 ? 2.386   -9.809  -23.518 1.00 0.00 ? 65  ASP A CB   6  
ATOM   8032  C  CG   . ASP A 1 65 ? 3.839   -9.633  -23.068 1.00 0.00 ? 65  ASP A CG   6  
ATOM   8033  O  OD1  . ASP A 1 65 ? 4.639   -9.009  -23.814 1.00 0.00 ? 65  ASP A OD1  6  
ATOM   8034  O  OD2  . ASP A 1 65 ? 4.206   -10.132 -21.987 1.00 0.00 ? 65  ASP A OD2  6  
ATOM   8035  H  H    . ASP A 1 65 ? 1.517   -8.107  -21.640 1.00 0.00 ? 65  ASP A H    6  
ATOM   8036  H  HA   . ASP A 1 65 ? 2.175   -7.893  -24.511 1.00 0.00 ? 65  ASP A HA   6  
ATOM   8037  H  HB2  . ASP A 1 65 ? 1.848   -10.389 -22.770 1.00 0.00 ? 65  ASP A HB2  6  
ATOM   8038  H  HB3  . ASP A 1 65 ? 2.385   -10.368 -24.451 1.00 0.00 ? 65  ASP A HB3  6  
ATOM   8039  N  N    . ALA A 1 66 ? -0.752  -8.419  -23.314 1.00 0.00 ? 66  ALA A N    6  
ATOM   8040  C  CA   . ALA A 1 66 ? -2.181  -8.526  -23.617 1.00 0.00 ? 66  ALA A CA   6  
ATOM   8041  C  C    . ALA A 1 66 ? -2.579  -7.393  -24.569 1.00 0.00 ? 66  ALA A C    6  
ATOM   8042  O  O    . ALA A 1 66 ? -3.263  -7.635  -25.567 1.00 0.00 ? 66  ALA A O    6  
ATOM   8043  C  CB   . ALA A 1 66 ? -3.027  -8.481  -22.323 1.00 0.00 ? 66  ALA A CB   6  
ATOM   8044  H  H    . ALA A 1 66 ? -0.491  -8.091  -22.433 1.00 0.00 ? 66  ALA A H    6  
ATOM   8045  H  HA   . ALA A 1 66 ? -2.357  -9.489  -24.102 1.00 0.00 ? 66  ALA A HA   6  
ATOM   8046  H  HB1  . ALA A 1 66 ? -2.731  -9.288  -21.660 1.00 0.00 ? 66  ALA A HB1  6  
ATOM   8047  H  HB2  . ALA A 1 66 ? -4.076  -8.591  -22.563 1.00 0.00 ? 66  ALA A HB2  6  
ATOM   8048  H  HB3  . ALA A 1 66 ? -2.874  -7.534  -21.816 1.00 0.00 ? 66  ALA A HB3  6  
ATOM   8049  N  N    . ASP A 1 67 ? -2.167  -6.134  -24.219 1.00 0.00 ? 67  ASP A N    6  
ATOM   8050  C  CA   . ASP A 1 67 ? -2.393  -4.905  -25.042 1.00 0.00 ? 67  ASP A CA   6  
ATOM   8051  C  C    . ASP A 1 67 ? -3.873  -4.407  -25.027 1.00 0.00 ? 67  ASP A C    6  
ATOM   8052  O  O    . ASP A 1 67 ? -4.122  -3.208  -25.184 1.00 0.00 ? 67  ASP A O    6  
ATOM   8053  C  CB   . ASP A 1 67 ? -1.877  -5.063  -26.507 1.00 0.00 ? 67  ASP A CB   6  
ATOM   8054  C  CG   . ASP A 1 67 ? -0.338  -5.173  -26.614 1.00 0.00 ? 67  ASP A CG   6  
ATOM   8055  O  OD1  . ASP A 1 67 ? 0.209   -6.260  -26.343 1.00 0.00 ? 67  ASP A OD1  6  
ATOM   8056  O  OD2  . ASP A 1 67 ? 0.331   -4.168  -26.963 1.00 0.00 ? 67  ASP A OD2  6  
ATOM   8057  H  H    . ASP A 1 67 ? -1.696  -6.006  -23.357 1.00 0.00 ? 67  ASP A H    6  
ATOM   8058  H  HA   . ASP A 1 67 ? -1.798  -4.133  -24.566 1.00 0.00 ? 67  ASP A HA   6  
ATOM   8059  H  HB2  . ASP A 1 67 ? -2.316  -5.955  -26.937 1.00 0.00 ? 67  ASP A HB2  6  
ATOM   8060  H  HB3  . ASP A 1 67 ? -2.203  -4.210  -27.094 1.00 0.00 ? 67  ASP A HB3  6  
ATOM   8061  N  N    . SER A 1 68 ? -4.836  -5.324  -24.793 1.00 0.00 ? 68  SER A N    6  
ATOM   8062  C  CA   . SER A 1 68 ? -6.297  -5.031  -24.760 1.00 0.00 ? 68  SER A CA   6  
ATOM   8063  C  C    . SER A 1 68 ? -6.706  -4.043  -23.631 1.00 0.00 ? 68  SER A C    6  
ATOM   8064  O  O    . SER A 1 68 ? -7.838  -3.541  -23.616 1.00 0.00 ? 68  SER A O    6  
ATOM   8065  C  CB   . SER A 1 68 ? -7.083  -6.364  -24.627 1.00 0.00 ? 68  SER A CB   6  
ATOM   8066  O  OG   . SER A 1 68 ? -8.488  -6.166  -24.710 1.00 0.00 ? 68  SER A OG   6  
ATOM   8067  H  H    . SER A 1 68 ? -4.569  -6.247  -24.671 1.00 0.00 ? 68  SER A H    6  
ATOM   8068  H  HA   . SER A 1 68 ? -6.551  -4.574  -25.712 1.00 0.00 ? 68  SER A HA   6  
ATOM   8069  H  HB2  . SER A 1 68 ? -6.792  -7.035  -25.427 1.00 0.00 ? 68  SER A HB2  6  
ATOM   8070  H  HB3  . SER A 1 68 ? -6.857  -6.833  -23.675 1.00 0.00 ? 68  SER A HB3  6  
ATOM   8071  H  HG   . SER A 1 68 ? -8.674  -5.232  -24.875 1.00 0.00 ? 68  SER A HG   6  
ATOM   8072  N  N    . PHE A 1 69 ? -5.771  -3.743  -22.717 1.00 0.00 ? 69  PHE A N    6  
ATOM   8073  C  CA   . PHE A 1 69 ? -6.013  -2.893  -21.543 1.00 0.00 ? 69  PHE A CA   6  
ATOM   8074  C  C    . PHE A 1 69 ? -5.074  -1.661  -21.593 1.00 0.00 ? 69  PHE A C    6  
ATOM   8075  O  O    . PHE A 1 69 ? -5.355  -0.628  -20.981 1.00 0.00 ? 69  PHE A O    6  
ATOM   8076  C  CB   . PHE A 1 69 ? -5.771  -3.718  -20.243 1.00 0.00 ? 69  PHE A CB   6  
ATOM   8077  C  CG   . PHE A 1 69 ? -6.231  -3.029  -18.956 1.00 0.00 ? 69  PHE A CG   6  
ATOM   8078  C  CD1  . PHE A 1 69 ? -7.579  -3.014  -18.614 1.00 0.00 ? 69  PHE A CD1  6  
ATOM   8079  C  CD2  . PHE A 1 69 ? -5.330  -2.385  -18.103 1.00 0.00 ? 69  PHE A CD2  6  
ATOM   8080  C  CE1  . PHE A 1 69 ? -8.016  -2.384  -17.470 1.00 0.00 ? 69  PHE A CE1  6  
ATOM   8081  C  CE2  . PHE A 1 69 ? -5.771  -1.756  -16.950 1.00 0.00 ? 69  PHE A CE2  6  
ATOM   8082  C  CZ   . PHE A 1 69 ? -7.116  -1.750  -16.637 1.00 0.00 ? 69  PHE A CZ   6  
ATOM   8083  H  H    . PHE A 1 69 ? -4.862  -4.033  -22.885 1.00 0.00 ? 69  PHE A H    6  
ATOM   8084  H  HA   . PHE A 1 69 ? -7.048  -2.549  -21.559 1.00 0.00 ? 69  PHE A HA   6  
ATOM   8085  H  HB2  . PHE A 1 69 ? -6.307  -4.658  -20.319 1.00 0.00 ? 69  PHE A HB2  6  
ATOM   8086  H  HB3  . PHE A 1 69 ? -4.711  -3.938  -20.154 1.00 0.00 ? 69  PHE A HB3  6  
ATOM   8087  H  HD1  . PHE A 1 69 ? -8.299  -3.509  -19.259 1.00 0.00 ? 69  PHE A HD1  6  
ATOM   8088  H  HD2  . PHE A 1 69 ? -4.274  -2.389  -18.345 1.00 0.00 ? 69  PHE A HD2  6  
ATOM   8089  H  HE1  . PHE A 1 69 ? -9.069  -2.383  -17.223 1.00 0.00 ? 69  PHE A HE1  6  
ATOM   8090  H  HE2  . PHE A 1 69 ? -5.061  -1.258  -16.299 1.00 0.00 ? 69  PHE A HE2  6  
ATOM   8091  H  HZ   . PHE A 1 69 ? -7.464  -1.252  -15.741 1.00 0.00 ? 69  PHE A HZ   6  
ATOM   8092  N  N    . TYR A 1 70 ? -3.960  -1.777  -22.347 1.00 0.00 ? 70  TYR A N    6  
ATOM   8093  C  CA   . TYR A 1 70 ? -2.855  -0.793  -22.319 1.00 0.00 ? 70  TYR A CA   6  
ATOM   8094  C  C    . TYR A 1 70 ? -2.758  0.002   -23.630 1.00 0.00 ? 70  TYR A C    6  
ATOM   8095  O  O    . TYR A 1 70 ? -2.029  0.994   -23.697 1.00 0.00 ? 70  TYR A O    6  
ATOM   8096  C  CB   . TYR A 1 70 ? -1.521  -1.524  -22.008 1.00 0.00 ? 70  TYR A CB   6  
ATOM   8097  C  CG   . TYR A 1 70 ? -1.453  -2.104  -20.581 1.00 0.00 ? 70  TYR A CG   6  
ATOM   8098  C  CD1  . TYR A 1 70 ? -2.049  -3.323  -20.267 1.00 0.00 ? 70  TYR A CD1  6  
ATOM   8099  C  CD2  . TYR A 1 70 ? -0.801  -1.422  -19.552 1.00 0.00 ? 70  TYR A CD2  6  
ATOM   8100  C  CE1  . TYR A 1 70 ? -1.999  -3.839  -18.984 1.00 0.00 ? 70  TYR A CE1  6  
ATOM   8101  C  CE2  . TYR A 1 70 ? -0.745  -1.936  -18.270 1.00 0.00 ? 70  TYR A CE2  6  
ATOM   8102  C  CZ   . TYR A 1 70 ? -1.345  -3.142  -17.989 1.00 0.00 ? 70  TYR A CZ   6  
ATOM   8103  O  OH   . TYR A 1 70 ? -1.293  -3.653  -16.710 1.00 0.00 ? 70  TYR A OH   6  
ATOM   8104  H  H    . TYR A 1 70 ? -3.885  -2.532  -22.961 1.00 0.00 ? 70  TYR A H    6  
ATOM   8105  H  HA   . TYR A 1 70 ? -3.048  -0.081  -21.516 1.00 0.00 ? 70  TYR A HA   6  
ATOM   8106  H  HB2  . TYR A 1 70 ? -1.396  -2.341  -22.709 1.00 0.00 ? 70  TYR A HB2  6  
ATOM   8107  H  HB3  . TYR A 1 70 ? -0.689  -0.835  -22.129 1.00 0.00 ? 70  TYR A HB3  6  
ATOM   8108  H  HD1  . TYR A 1 70 ? -2.566  -3.875  -21.050 1.00 0.00 ? 70  TYR A HD1  6  
ATOM   8109  H  HD2  . TYR A 1 70 ? -0.326  -0.472  -19.770 1.00 0.00 ? 70  TYR A HD2  6  
ATOM   8110  H  HE1  . TYR A 1 70 ? -2.466  -4.795  -18.768 1.00 0.00 ? 70  TYR A HE1  6  
ATOM   8111  H  HE2  . TYR A 1 70 ? -0.228  -1.391  -17.493 1.00 0.00 ? 70  TYR A HE2  6  
ATOM   8112  H  HH   . TYR A 1 70 ? -1.541  -2.964  -16.079 1.00 0.00 ? 70  TYR A HH   6  
ATOM   8113  N  N    . GLN A 1 71 ? -3.512  -0.416  -24.660 1.00 0.00 ? 71  GLN A N    6  
ATOM   8114  C  CA   . GLN A 1 71 ? -3.487  0.222   -25.999 1.00 0.00 ? 71  GLN A CA   6  
ATOM   8115  C  C    . GLN A 1 71 ? -4.862  0.791   -26.383 1.00 0.00 ? 71  GLN A C    6  
ATOM   8116  O  O    . GLN A 1 71 ? -5.061  1.237   -27.521 1.00 0.00 ? 71  GLN A O    6  
ATOM   8117  C  CB   . GLN A 1 71 ? -3.029  -0.812  -27.065 1.00 0.00 ? 71  GLN A CB   6  
ATOM   8118  C  CG   . GLN A 1 71 ? -1.611  -1.396  -26.866 1.00 0.00 ? 71  GLN A CG   6  
ATOM   8119  C  CD   . GLN A 1 71 ? -0.461  -0.401  -27.101 1.00 0.00 ? 71  GLN A CD   6  
ATOM   8120  O  OE1  . GLN A 1 71 ? -0.587  0.805   -26.891 1.00 0.00 ? 71  GLN A OE1  6  
ATOM   8121  N  NE2  . GLN A 1 71 ? 0.680   -0.909  -27.530 1.00 0.00 ? 71  GLN A NE2  6  
ATOM   8122  H  H    . GLN A 1 71 ? -4.115  -1.173  -24.524 1.00 0.00 ? 71  GLN A H    6  
ATOM   8123  H  HA   . GLN A 1 71 ? -2.776  1.046   -25.983 1.00 0.00 ? 71  GLN A HA   6  
ATOM   8124  H  HB2  . GLN A 1 71 ? -3.733  -1.637  -27.060 1.00 0.00 ? 71  GLN A HB2  6  
ATOM   8125  H  HB3  . GLN A 1 71 ? -3.064  -0.340  -28.041 1.00 0.00 ? 71  GLN A HB3  6  
ATOM   8126  H  HG2  . GLN A 1 71 ? -1.529  -1.771  -25.852 1.00 0.00 ? 71  GLN A HG2  6  
ATOM   8127  H  HG3  . GLN A 1 71 ? -1.491  -2.231  -27.554 1.00 0.00 ? 71  GLN A HG3  6  
ATOM   8128  H  HE21 . GLN A 1 71 ? 0.730   -1.880  -27.680 1.00 0.00 ? 71  GLN A HE21 6  
ATOM   8129  H  HE22 . GLN A 1 71 ? 1.429   -0.299  -27.677 1.00 0.00 ? 71  GLN A HE22 6  
ATOM   8130  N  N    . PHE A 1 72 ? -5.804  0.802   -25.429 1.00 0.00 ? 72  PHE A N    6  
ATOM   8131  C  CA   . PHE A 1 72 ? -7.188  1.217   -25.661 1.00 0.00 ? 72  PHE A CA   6  
ATOM   8132  C  C    . PHE A 1 72 ? -7.618  2.049   -24.448 1.00 0.00 ? 72  PHE A C    6  
ATOM   8133  O  O    . PHE A 1 72 ? -7.411  1.639   -23.301 1.00 0.00 ? 72  PHE A O    6  
ATOM   8134  C  CB   . PHE A 1 72 ? -8.117  -0.017  -25.820 1.00 0.00 ? 72  PHE A CB   6  
ATOM   8135  C  CG   . PHE A 1 72 ? -7.732  -0.945  -26.984 1.00 0.00 ? 72  PHE A CG   6  
ATOM   8136  C  CD1  . PHE A 1 72 ? -8.202  -0.711  -28.276 1.00 0.00 ? 72  PHE A CD1  6  
ATOM   8137  C  CD2  . PHE A 1 72 ? -6.888  -2.039  -26.785 1.00 0.00 ? 72  PHE A CD2  6  
ATOM   8138  C  CE1  . PHE A 1 72 ? -7.840  -1.540  -29.321 1.00 0.00 ? 72  PHE A CE1  6  
ATOM   8139  C  CE2  . PHE A 1 72 ? -6.526  -2.862  -27.836 1.00 0.00 ? 72  PHE A CE2  6  
ATOM   8140  C  CZ   . PHE A 1 72 ? -7.006  -2.613  -29.101 1.00 0.00 ? 72  PHE A CZ   6  
ATOM   8141  H  H    . PHE A 1 72 ? -5.552  0.623   -24.516 1.00 0.00 ? 72  PHE A H    6  
ATOM   8142  H  HA   . PHE A 1 72 ? -7.235  1.831   -26.566 1.00 0.00 ? 72  PHE A HA   6  
ATOM   8143  H  HB2  . PHE A 1 72 ? -8.102  -0.599  -24.902 1.00 0.00 ? 72  PHE A HB2  6  
ATOM   8144  H  HB3  . PHE A 1 72 ? -9.131  0.326   -25.989 1.00 0.00 ? 72  PHE A HB3  6  
ATOM   8145  H  HD1  . PHE A 1 72 ? -8.859  0.132   -28.461 1.00 0.00 ? 72  PHE A HD1  6  
ATOM   8146  H  HD2  . PHE A 1 72 ? -6.512  -2.244  -25.789 1.00 0.00 ? 72  PHE A HD2  6  
ATOM   8147  H  HE1  . PHE A 1 72 ? -8.218  -1.349  -30.317 1.00 0.00 ? 72  PHE A HE1  6  
ATOM   8148  H  HE2  . PHE A 1 72 ? -5.869  -3.704  -27.662 1.00 0.00 ? 72  PHE A HE2  6  
ATOM   8149  H  HZ   . PHE A 1 72 ? -6.721  -3.258  -29.927 1.00 0.00 ? 72  PHE A HZ   6  
ATOM   8150  N  N    . SER A 1 73 ? -8.238  3.183   -24.722 1.00 0.00 ? 73  SER A N    6  
ATOM   8151  C  CA   . SER A 1 73 ? -8.618  4.177   -23.727 1.00 0.00 ? 73  SER A CA   6  
ATOM   8152  C  C    . SER A 1 73 ? -9.677  5.100   -24.321 1.00 0.00 ? 73  SER A C    6  
ATOM   8153  O  O    . SER A 1 73 ? -9.455  5.726   -25.360 1.00 0.00 ? 73  SER A O    6  
ATOM   8154  C  CB   . SER A 1 73 ? -7.375  4.983   -23.263 1.00 0.00 ? 73  SER A CB   6  
ATOM   8155  O  OG   . SER A 1 73 ? -6.637  5.479   -24.370 1.00 0.00 ? 73  SER A OG   6  
ATOM   8156  H  H    . SER A 1 73 ? -8.460  3.349   -25.648 1.00 0.00 ? 73  SER A H    6  
ATOM   8157  H  HA   . SER A 1 73 ? -9.043  3.653   -22.871 1.00 0.00 ? 73  SER A HA   6  
ATOM   8158  H  HB2  . SER A 1 73 ? -7.681  5.823   -22.646 1.00 0.00 ? 73  SER A HB2  6  
ATOM   8159  H  HB3  . SER A 1 73 ? -6.726  4.338   -22.680 1.00 0.00 ? 73  SER A HB3  6  
ATOM   8160  H  HG   . SER A 1 73 ? -7.049  5.178   -25.189 1.00 0.00 ? 73  SER A HG   6  
ATOM   8161  N  N    . CYS A 1 74 ? -10.837 5.151   -23.676 1.00 0.00 ? 74  CYS A N    6  
ATOM   8162  C  CA   . CYS A 1 74 ? -11.846 6.183   -23.951 1.00 0.00 ? 74  CYS A CA   6  
ATOM   8163  C  C    . CYS A 1 74 ? -11.335 7.526   -23.383 1.00 0.00 ? 74  CYS A C    6  
ATOM   8164  O  O    . CYS A 1 74 ? -10.838 7.563   -22.251 1.00 0.00 ? 74  CYS A O    6  
ATOM   8165  C  CB   . CYS A 1 74 ? -13.217 5.824   -23.333 1.00 0.00 ? 74  CYS A CB   6  
ATOM   8166  S  SG   . CYS A 1 74 ? -14.268 7.286   -23.067 1.00 0.00 ? 74  CYS A SG   6  
ATOM   8167  H  H    . CYS A 1 74 ? -11.003 4.495   -22.977 1.00 0.00 ? 74  CYS A H    6  
ATOM   8168  H  HA   . CYS A 1 74 ? -11.954 6.266   -25.031 1.00 0.00 ? 74  CYS A HA   6  
ATOM   8169  H  HB2  . CYS A 1 74 ? -13.753 5.135   -23.977 1.00 0.00 ? 74  CYS A HB2  6  
ATOM   8170  H  HB3  . CYS A 1 74 ? -13.073 5.354   -22.369 1.00 0.00 ? 74  CYS A HB3  6  
ATOM   8171  N  N    . ASN A 1 75 ? -11.479 8.605   -24.173 1.00 0.00 ? 75  ASN A N    6  
ATOM   8172  C  CA   . ASN A 1 75 ? -10.945 9.955   -23.843 1.00 0.00 ? 75  ASN A CA   6  
ATOM   8173  C  C    . ASN A 1 75 ? -11.505 10.531  -22.522 1.00 0.00 ? 75  ASN A C    6  
ATOM   8174  O  O    . ASN A 1 75 ? -10.838 11.327  -21.852 1.00 0.00 ? 75  ASN A O    6  
ATOM   8175  C  CB   . ASN A 1 75 ? -11.248 10.929  -25.011 1.00 0.00 ? 75  ASN A CB   6  
ATOM   8176  C  CG   . ASN A 1 75 ? -10.627 10.484  -26.336 1.00 0.00 ? 75  ASN A CG   6  
ATOM   8177  O  OD1  . ASN A 1 75 ? -11.241 9.741   -27.107 1.00 0.00 ? 75  ASN A OD1  6  
ATOM   8178  N  ND2  . ASN A 1 75 ? -9.408  10.928  -26.607 1.00 0.00 ? 75  ASN A ND2  6  
ATOM   8179  H  H    . ASN A 1 75 ? -11.934 8.491   -25.031 1.00 0.00 ? 75  ASN A H    6  
ATOM   8180  H  HA   . ASN A 1 75 ? -9.868  9.864   -23.742 1.00 0.00 ? 75  ASN A HA   6  
ATOM   8181  H  HB2  . ASN A 1 75 ? -12.321 10.999  -25.148 1.00 0.00 ? 75  ASN A HB2  6  
ATOM   8182  H  HB3  . ASN A 1 75 ? -10.866 11.915  -24.769 1.00 0.00 ? 75  ASN A HB3  6  
ATOM   8183  H  HD21 . ASN A 1 75 ? -8.971  11.518  -25.949 1.00 0.00 ? 75  ASN A HD21 6  
ATOM   8184  H  HD22 . ASN A 1 75 ? -8.993  10.661  -27.451 1.00 0.00 ? 75  ASN A HD22 6  
ATOM   8185  N  N    . ILE A 1 76 ? -12.718 10.104  -22.144 1.00 0.00 ? 76  ILE A N    6  
ATOM   8186  C  CA   . ILE A 1 76 ? -13.470 10.711  -21.031 1.00 0.00 ? 76  ILE A CA   6  
ATOM   8187  C  C    . ILE A 1 76 ? -13.601 9.715   -19.871 1.00 0.00 ? 76  ILE A C    6  
ATOM   8188  O  O    . ILE A 1 76 ? -13.506 10.092  -18.701 1.00 0.00 ? 76  ILE A O    6  
ATOM   8189  C  CB   . ILE A 1 76 ? -14.905 11.197  -21.494 1.00 0.00 ? 76  ILE A CB   6  
ATOM   8190  C  CG1  . ILE A 1 76 ? -14.817 11.956  -22.874 1.00 0.00 ? 76  ILE A CG1  6  
ATOM   8191  C  CG2  . ILE A 1 76 ? -15.579 12.065  -20.396 1.00 0.00 ? 76  ILE A CG2  6  
ATOM   8192  C  CD1  . ILE A 1 76 ? -15.994 12.855  -23.203 1.00 0.00 ? 76  ILE A CD1  6  
ATOM   8193  H  H    . ILE A 1 76 ? -13.113 9.349   -22.610 1.00 0.00 ? 76  ILE A H    6  
ATOM   8194  H  HA   . ILE A 1 76 ? -12.917 11.586  -20.683 1.00 0.00 ? 76  ILE A HA   6  
ATOM   8195  H  HB   . ILE A 1 76 ? -15.528 10.318  -21.632 1.00 0.00 ? 76  ILE A HB   6  
ATOM   8196  H  HG12 . ILE A 1 76 ? -13.935 12.578  -22.889 1.00 0.00 ? 76  ILE A HG12 6  
ATOM   8197  H  HG13 . ILE A 1 76 ? -14.742 11.215  -23.676 1.00 0.00 ? 76  ILE A HG13 6  
ATOM   8198  H  HG21 . ILE A 1 76 ? -16.583 12.338  -20.704 1.00 0.00 ? 76  ILE A HG21 6  
ATOM   8199  H  HG22 . ILE A 1 76 ? -15.004 12.970  -20.234 1.00 0.00 ? 76  ILE A HG22 6  
ATOM   8200  H  HG23 . ILE A 1 76 ? -15.632 11.508  -19.470 1.00 0.00 ? 76  ILE A HG23 6  
ATOM   8201  H  HD11 . ILE A 1 76 ? -16.045 13.664  -22.492 1.00 0.00 ? 76  ILE A HD11 6  
ATOM   8202  H  HD12 . ILE A 1 76 ? -16.911 12.280  -23.164 1.00 0.00 ? 76  ILE A HD12 6  
ATOM   8203  H  HD13 . ILE A 1 76 ? -15.865 13.256  -24.196 1.00 0.00 ? 76  ILE A HD13 6  
ATOM   8204  N  N    . CYS A 1 77 ? -13.812 8.425   -20.222 1.00 0.00 ? 77  CYS A N    6  
ATOM   8205  C  CA   . CYS A 1 77 ? -14.010 7.356   -19.240 1.00 0.00 ? 77  CYS A CA   6  
ATOM   8206  C  C    . CYS A 1 77 ? -13.494 6.035   -19.828 1.00 0.00 ? 77  CYS A C    6  
ATOM   8207  O  O    . CYS A 1 77 ? -14.276 5.177   -20.250 1.00 0.00 ? 77  CYS A O    6  
ATOM   8208  C  CB   . CYS A 1 77 ? -15.499 7.272   -18.791 1.00 0.00 ? 77  CYS A CB   6  
ATOM   8209  S  SG   . CYS A 1 77 ? -16.730 6.659   -20.018 1.00 0.00 ? 77  CYS A SG   6  
ATOM   8210  H  H    . CYS A 1 77 ? -13.790 8.178   -21.164 1.00 0.00 ? 77  CYS A H    6  
ATOM   8211  H  HA   . CYS A 1 77 ? -13.394 7.596   -18.366 1.00 0.00 ? 77  CYS A HA   6  
ATOM   8212  H  HB2  . CYS A 1 77 ? -15.570 6.617   -17.935 1.00 0.00 ? 77  CYS A HB2  6  
ATOM   8213  H  HB3  . CYS A 1 77 ? -15.821 8.262   -18.482 1.00 0.00 ? 77  CYS A HB3  6  
ATOM   8214  N  N    . GLY A 1 78 ? -12.160 6.011   -20.066 1.00 0.00 ? 78  GLY A N    6  
ATOM   8215  C  CA   . GLY A 1 78 ? -11.373 4.798   -20.383 1.00 0.00 ? 78  GLY A CA   6  
ATOM   8216  C  C    . GLY A 1 78 ? -11.792 3.513   -19.675 1.00 0.00 ? 78  GLY A C    6  
ATOM   8217  O  O    . GLY A 1 78 ? -11.169 3.100   -18.694 1.00 0.00 ? 78  GLY A O    6  
ATOM   8218  H  H    . GLY A 1 78 ? -11.706 6.885   -20.135 1.00 0.00 ? 78  GLY A H    6  
ATOM   8219  H  HA2  . GLY A 1 78 ? -11.436 4.624   -21.450 1.00 0.00 ? 78  GLY A HA2  6  
ATOM   8220  H  HA3  . GLY A 1 78 ? -10.338 5.002   -20.148 1.00 0.00 ? 78  GLY A HA3  6  
ATOM   8221  N  N    . LYS A 1 79 ? -12.875 2.910   -20.179 1.00 0.00 ? 79  LYS A N    6  
ATOM   8222  C  CA   . LYS A 1 79 ? -13.362 1.600   -19.745 1.00 0.00 ? 79  LYS A CA   6  
ATOM   8223  C  C    . LYS A 1 79 ? -12.381 0.476   -20.165 1.00 0.00 ? 79  LYS A C    6  
ATOM   8224  O  O    . LYS A 1 79 ? -12.287 -0.540  -19.470 1.00 0.00 ? 79  LYS A O    6  
ATOM   8225  C  CB   . LYS A 1 79 ? -14.792 1.385   -20.333 1.00 0.00 ? 79  LYS A CB   6  
ATOM   8226  C  CG   . LYS A 1 79 ? -15.643 0.311   -19.625 1.00 0.00 ? 79  LYS A CG   6  
ATOM   8227  C  CD   . LYS A 1 79 ? -15.346 -1.134  -20.098 1.00 0.00 ? 79  LYS A CD   6  
ATOM   8228  C  CE   . LYS A 1 79 ? -16.010 -2.200  -19.219 1.00 0.00 ? 79  LYS A CE   6  
ATOM   8229  N  NZ   . LYS A 1 79 ? -15.568 -3.563  -19.586 1.00 0.00 ? 79  LYS A NZ   6  
ATOM   8230  H  H    . LYS A 1 79 ? -13.432 3.423   -20.799 1.00 0.00 ? 79  LYS A H    6  
ATOM   8231  H  HA   . LYS A 1 79 ? -13.432 1.619   -18.664 1.00 0.00 ? 79  LYS A HA   6  
ATOM   8232  H  HB2  . LYS A 1 79 ? -15.333 2.325   -20.271 1.00 0.00 ? 79  LYS A HB2  6  
ATOM   8233  H  HB3  . LYS A 1 79 ? -14.705 1.121   -21.385 1.00 0.00 ? 79  LYS A HB3  6  
ATOM   8234  H  HG2  . LYS A 1 79 ? -15.453 0.383   -18.561 1.00 0.00 ? 79  LYS A HG2  6  
ATOM   8235  H  HG3  . LYS A 1 79 ? -16.682 0.533   -19.805 1.00 0.00 ? 79  LYS A HG3  6  
ATOM   8236  H  HD2  . LYS A 1 79 ? -15.710 -1.246  -21.113 1.00 0.00 ? 79  LYS A HD2  6  
ATOM   8237  H  HD3  . LYS A 1 79 ? -14.274 -1.295  -20.091 1.00 0.00 ? 79  LYS A HD3  6  
ATOM   8238  H  HE2  . LYS A 1 79 ? -15.748 -2.024  -18.185 1.00 0.00 ? 79  LYS A HE2  6  
ATOM   8239  H  HE3  . LYS A 1 79 ? -17.083 -2.139  -19.333 1.00 0.00 ? 79  LYS A HE3  6  
ATOM   8240  H  HZ1  . LYS A 1 79 ? -14.532 -3.640  -19.507 1.00 0.00 ? 79  LYS A HZ1  6  
ATOM   8241  H  HZ2  . LYS A 1 79 ? -15.842 -3.780  -20.565 1.00 0.00 ? 79  LYS A HZ2  6  
ATOM   8242  H  HZ3  . LYS A 1 79 ? -16.005 -4.263  -18.954 1.00 0.00 ? 79  LYS A HZ3  6  
ATOM   8243  N  N    . LYS A 1 80 ? -11.644 0.707   -21.291 1.00 0.00 ? 80  LYS A N    6  
ATOM   8244  C  CA   . LYS A 1 80 ? -10.733 -0.275  -21.925 1.00 0.00 ? 80  LYS A CA   6  
ATOM   8245  C  C    . LYS A 1 80 ? -11.541 -1.356  -22.665 1.00 0.00 ? 80  LYS A C    6  
ATOM   8246  O  O    . LYS A 1 80 ? -12.240 -2.175  -22.056 1.00 0.00 ? 80  LYS A O    6  
ATOM   8247  C  CB   . LYS A 1 80 ? -9.698  -0.908  -20.932 1.00 0.00 ? 80  LYS A CB   6  
ATOM   8248  C  CG   . LYS A 1 80 ? -8.442  -0.050  -20.640 1.00 0.00 ? 80  LYS A CG   6  
ATOM   8249  C  CD   . LYS A 1 80 ? -8.741  1.388   -20.174 1.00 0.00 ? 80  LYS A CD   6  
ATOM   8250  C  CE   . LYS A 1 80 ? -7.476  2.138   -19.725 1.00 0.00 ? 80  LYS A CE   6  
ATOM   8251  N  NZ   . LYS A 1 80 ? -6.405  2.138   -20.760 1.00 0.00 ? 80  LYS A NZ   6  
ATOM   8252  H  H    . LYS A 1 80 ? -11.714 1.583   -21.716 1.00 0.00 ? 80  LYS A H    6  
ATOM   8253  H  HA   . LYS A 1 80 ? -10.172 0.290   -22.669 1.00 0.00 ? 80  LYS A HA   6  
ATOM   8254  H  HB2  . LYS A 1 80 ? -10.196 -1.104  -19.989 1.00 0.00 ? 80  LYS A HB2  6  
ATOM   8255  H  HB3  . LYS A 1 80 ? -9.359  -1.859  -21.334 1.00 0.00 ? 80  LYS A HB3  6  
ATOM   8256  H  HG2  . LYS A 1 80 ? -7.858  -0.546  -19.869 1.00 0.00 ? 80  LYS A HG2  6  
ATOM   8257  H  HG3  . LYS A 1 80 ? -7.843  -0.002  -21.547 1.00 0.00 ? 80  LYS A HG3  6  
ATOM   8258  H  HD2  . LYS A 1 80 ? -9.200  1.940   -20.996 1.00 0.00 ? 80  LYS A HD2  6  
ATOM   8259  H  HD3  . LYS A 1 80 ? -9.439  1.352   -19.343 1.00 0.00 ? 80  LYS A HD3  6  
ATOM   8260  H  HE2  . LYS A 1 80 ? -7.738  3.162   -19.503 1.00 0.00 ? 80  LYS A HE2  6  
ATOM   8261  H  HE3  . LYS A 1 80 ? -7.092  1.669   -18.826 1.00 0.00 ? 80  LYS A HE3  6  
ATOM   8262  H  HZ1  . LYS A 1 80 ? -5.596  2.712   -20.437 1.00 0.00 ? 80  LYS A HZ1  6  
ATOM   8263  H  HZ2  . LYS A 1 80 ? -6.759  2.536   -21.651 1.00 0.00 ? 80  LYS A HZ2  6  
ATOM   8264  H  HZ3  . LYS A 1 80 ? -6.074  1.168   -20.934 1.00 0.00 ? 80  LYS A HZ3  6  
ATOM   8265  N  N    . PHE A 1 81 ? -11.435 -1.317  -23.998 1.00 0.00 ? 81  PHE A N    6  
ATOM   8266  C  CA   . PHE A 1 81 ? -12.184 -2.187  -24.921 1.00 0.00 ? 81  PHE A CA   6  
ATOM   8267  C  C    . PHE A 1 81 ? -11.193 -3.076  -25.694 1.00 0.00 ? 81  PHE A C    6  
ATOM   8268  O  O    . PHE A 1 81 ? -10.018 -2.730  -25.817 1.00 0.00 ? 81  PHE A O    6  
ATOM   8269  C  CB   . PHE A 1 81 ? -13.023 -1.310  -25.891 1.00 0.00 ? 81  PHE A CB   6  
ATOM   8270  C  CG   . PHE A 1 81 ? -13.967 -0.329  -25.185 1.00 0.00 ? 81  PHE A CG   6  
ATOM   8271  C  CD1  . PHE A 1 81 ? -15.266 -0.696  -24.840 1.00 0.00 ? 81  PHE A CD1  6  
ATOM   8272  C  CD2  . PHE A 1 81 ? -13.543 0.963   -24.853 1.00 0.00 ? 81  PHE A CD2  6  
ATOM   8273  C  CE1  . PHE A 1 81 ? -16.107 0.190   -24.194 1.00 0.00 ? 81  PHE A CE1  6  
ATOM   8274  C  CE2  . PHE A 1 81 ? -14.387 1.849   -24.209 1.00 0.00 ? 81  PHE A CE2  6  
ATOM   8275  C  CZ   . PHE A 1 81 ? -15.667 1.461   -23.880 1.00 0.00 ? 81  PHE A CZ   6  
ATOM   8276  H  H    . PHE A 1 81 ? -10.792 -0.689  -24.378 1.00 0.00 ? 81  PHE A H    6  
ATOM   8277  H  HA   . PHE A 1 81 ? -12.849 -2.827  -24.343 1.00 0.00 ? 81  PHE A HA   6  
ATOM   8278  H  HB2  . PHE A 1 81 ? -12.354 -0.736  -26.523 1.00 0.00 ? 81  PHE A HB2  6  
ATOM   8279  H  HB3  . PHE A 1 81 ? -13.624 -1.955  -26.525 1.00 0.00 ? 81  PHE A HB3  6  
ATOM   8280  H  HD1  . PHE A 1 81 ? -15.623 -1.688  -25.084 1.00 0.00 ? 81  PHE A HD1  6  
ATOM   8281  H  HD2  . PHE A 1 81 ? -12.535 1.274   -25.111 1.00 0.00 ? 81  PHE A HD2  6  
ATOM   8282  H  HE1  . PHE A 1 81 ? -17.115 -0.110  -23.934 1.00 0.00 ? 81  PHE A HE1  6  
ATOM   8283  H  HE2  . PHE A 1 81 ? -14.041 2.845   -23.964 1.00 0.00 ? 81  PHE A HE2  6  
ATOM   8284  H  HZ   . PHE A 1 81 ? -16.326 2.148   -23.370 1.00 0.00 ? 81  PHE A HZ   6  
ATOM   8285  N  N    . GLU A 1 82 ? -11.663 -4.233  -26.185 1.00 0.00 ? 82  GLU A N    6  
ATOM   8286  C  CA   . GLU A 1 82 ? -10.817 -5.195  -26.918 1.00 0.00 ? 82  GLU A CA   6  
ATOM   8287  C  C    . GLU A 1 82 ? -10.408 -4.686  -28.322 1.00 0.00 ? 82  GLU A C    6  
ATOM   8288  O  O    . GLU A 1 82 ? -9.333  -5.048  -28.816 1.00 0.00 ? 82  GLU A O    6  
ATOM   8289  C  CB   . GLU A 1 82 ? -11.514 -6.589  -27.014 1.00 0.00 ? 82  GLU A CB   6  
ATOM   8290  C  CG   . GLU A 1 82 ? -12.746 -6.695  -27.955 1.00 0.00 ? 82  GLU A CG   6  
ATOM   8291  C  CD   . GLU A 1 82 ? -13.996 -5.948  -27.459 1.00 0.00 ? 82  GLU A CD   6  
ATOM   8292  O  OE1  . GLU A 1 82 ? -14.092 -4.728  -27.674 1.00 0.00 ? 82  GLU A OE1  6  
ATOM   8293  O  OE2  . GLU A 1 82 ? -14.889 -6.579  -26.852 1.00 0.00 ? 82  GLU A OE2  6  
ATOM   8294  H  H    . GLU A 1 82 ? -12.594 -4.479  -26.007 1.00 0.00 ? 82  GLU A H    6  
ATOM   8295  H  HA   . GLU A 1 82 ? -9.909  -5.313  -26.336 1.00 0.00 ? 82  GLU A HA   6  
ATOM   8296  H  HB2  . GLU A 1 82 ? -10.781 -7.314  -27.352 1.00 0.00 ? 82  GLU A HB2  6  
ATOM   8297  H  HB3  . GLU A 1 82 ? -11.831 -6.878  -26.016 1.00 0.00 ? 82  GLU A HB3  6  
ATOM   8298  H  HG2  . GLU A 1 82 ? -12.470 -6.298  -28.928 1.00 0.00 ? 82  GLU A HG2  6  
ATOM   8299  H  HG3  . GLU A 1 82 ? -12.992 -7.749  -28.080 1.00 0.00 ? 82  GLU A HG3  6  
ATOM   8300  N  N    . LYS A 1 83 ? -11.262 -3.855  -28.961 1.00 0.00 ? 83  LYS A N    6  
ATOM   8301  C  CA   . LYS A 1 83 ? -11.010 -3.341  -30.310 1.00 0.00 ? 83  LYS A CA   6  
ATOM   8302  C  C    . LYS A 1 83 ? -11.324 -1.841  -30.363 1.00 0.00 ? 83  LYS A C    6  
ATOM   8303  O  O    . LYS A 1 83 ? -12.183 -1.341  -29.613 1.00 0.00 ? 83  LYS A O    6  
ATOM   8304  C  CB   . LYS A 1 83 ? -11.839 -4.149  -31.352 1.00 0.00 ? 83  LYS A CB   6  
ATOM   8305  C  CG   . LYS A 1 83 ? -13.364 -4.143  -31.110 1.00 0.00 ? 83  LYS A CG   6  
ATOM   8306  C  CD   . LYS A 1 83 ? -14.140 -5.075  -32.076 1.00 0.00 ? 83  LYS A CD   6  
ATOM   8307  C  CE   . LYS A 1 83 ? -15.662 -5.029  -31.856 1.00 0.00 ? 83  LYS A CE   6  
ATOM   8308  N  NZ   . LYS A 1 83 ? -16.392 -5.888  -32.827 1.00 0.00 ? 83  LYS A NZ   6  
ATOM   8309  H  H    . LYS A 1 83 ? -12.087 -3.584  -28.507 1.00 0.00 ? 83  LYS A H    6  
ATOM   8310  H  HA   . LYS A 1 83 ? -9.952  -3.473  -30.533 1.00 0.00 ? 83  LYS A HA   6  
ATOM   8311  H  HB2  . LYS A 1 83 ? -11.650 -3.745  -32.343 1.00 0.00 ? 83  LYS A HB2  6  
ATOM   8312  H  HB3  . LYS A 1 83 ? -11.497 -5.182  -31.337 1.00 0.00 ? 83  LYS A HB3  6  
ATOM   8313  H  HG2  . LYS A 1 83 ? -13.555 -4.466  -30.092 1.00 0.00 ? 83  LYS A HG2  6  
ATOM   8314  H  HG3  . LYS A 1 83 ? -13.730 -3.126  -31.231 1.00 0.00 ? 83  LYS A HG3  6  
ATOM   8315  H  HD2  . LYS A 1 83 ? -13.929 -4.773  -33.094 1.00 0.00 ? 83  LYS A HD2  6  
ATOM   8316  H  HD3  . LYS A 1 83 ? -13.795 -6.095  -31.933 1.00 0.00 ? 83  LYS A HD3  6  
ATOM   8317  H  HE2  . LYS A 1 83 ? -15.891 -5.368  -30.856 1.00 0.00 ? 83  LYS A HE2  6  
ATOM   8318  H  HE3  . LYS A 1 83 ? -16.007 -4.006  -31.971 1.00 0.00 ? 83  LYS A HE3  6  
ATOM   8319  H  HZ1  . LYS A 1 83 ? -16.216 -5.563  -33.799 1.00 0.00 ? 83  LYS A HZ1  6  
ATOM   8320  H  HZ2  . LYS A 1 83 ? -17.414 -5.845  -32.644 1.00 0.00 ? 83  LYS A HZ2  6  
ATOM   8321  H  HZ3  . LYS A 1 83 ? -16.082 -6.876  -32.741 1.00 0.00 ? 83  LYS A HZ3  6  
ATOM   8322  N  N    . LYS A 1 84 ? -10.612 -1.138  -31.258 1.00 0.00 ? 84  LYS A N    6  
ATOM   8323  C  CA   . LYS A 1 84 ? -10.788 0.307   -31.500 1.00 0.00 ? 84  LYS A CA   6  
ATOM   8324  C  C    . LYS A 1 84 ? -12.208 0.615   -31.980 1.00 0.00 ? 84  LYS A C    6  
ATOM   8325  O  O    . LYS A 1 84 ? -12.728 1.695   -31.705 1.00 0.00 ? 84  LYS A O    6  
ATOM   8326  C  CB   . LYS A 1 84 ? -9.768  0.818   -32.551 1.00 0.00 ? 84  LYS A CB   6  
ATOM   8327  C  CG   . LYS A 1 84 ? -8.287  0.782   -32.119 1.00 0.00 ? 84  LYS A CG   6  
ATOM   8328  C  CD   . LYS A 1 84 ? -7.334  1.330   -33.213 1.00 0.00 ? 84  LYS A CD   6  
ATOM   8329  C  CE   . LYS A 1 84 ? -7.595  2.815   -33.557 1.00 0.00 ? 84  LYS A CE   6  
ATOM   8330  N  NZ   . LYS A 1 84 ? -6.744  3.298   -34.676 1.00 0.00 ? 84  LYS A NZ   6  
ATOM   8331  H  H    . LYS A 1 84 ? -9.942  -1.617  -31.778 1.00 0.00 ? 84  LYS A H    6  
ATOM   8332  H  HA   . LYS A 1 84 ? -10.613 0.823   -30.559 1.00 0.00 ? 84  LYS A HA   6  
ATOM   8333  H  HB2  . LYS A 1 84 ? -9.865  0.214   -33.445 1.00 0.00 ? 84  LYS A HB2  6  
ATOM   8334  H  HB3  . LYS A 1 84 ? -10.019 1.843   -32.803 1.00 0.00 ? 84  LYS A HB3  6  
ATOM   8335  H  HG2  . LYS A 1 84 ? -8.171  1.380   -31.220 1.00 0.00 ? 84  LYS A HG2  6  
ATOM   8336  H  HG3  . LYS A 1 84 ? -8.014  -0.245  -31.895 1.00 0.00 ? 84  LYS A HG3  6  
ATOM   8337  H  HD2  . LYS A 1 84 ? -6.312  1.226   -32.866 1.00 0.00 ? 84  LYS A HD2  6  
ATOM   8338  H  HD3  . LYS A 1 84 ? -7.459  0.735   -34.111 1.00 0.00 ? 84  LYS A HD3  6  
ATOM   8339  H  HE2  . LYS A 1 84 ? -8.630  2.938   -33.842 1.00 0.00 ? 84  LYS A HE2  6  
ATOM   8340  H  HE3  . LYS A 1 84 ? -7.391  3.426   -32.685 1.00 0.00 ? 84  LYS A HE3  6  
ATOM   8341  H  HZ1  . LYS A 1 84 ? -6.981  2.794   -35.556 1.00 0.00 ? 84  LYS A HZ1  6  
ATOM   8342  H  HZ2  . LYS A 1 84 ? -5.737  3.142   -34.458 1.00 0.00 ? 84  LYS A HZ2  6  
ATOM   8343  H  HZ3  . LYS A 1 84 ? -6.898  4.315   -34.823 1.00 0.00 ? 84  LYS A HZ3  6  
ATOM   8344  N  N    . ASP A 1 85 ? -12.820 -0.353  -32.689 1.00 0.00 ? 85  ASP A N    6  
ATOM   8345  C  CA   . ASP A 1 85 ? -14.229 -0.275  -33.122 1.00 0.00 ? 85  ASP A CA   6  
ATOM   8346  C  C    . ASP A 1 85 ? -15.154 0.017   -31.928 1.00 0.00 ? 85  ASP A C    6  
ATOM   8347  O  O    . ASP A 1 85 ? -16.003 0.905   -32.001 1.00 0.00 ? 85  ASP A O    6  
ATOM   8348  C  CB   . ASP A 1 85 ? -14.648 -1.593  -33.823 1.00 0.00 ? 85  ASP A CB   6  
ATOM   8349  C  CG   . ASP A 1 85 ? -16.152 -1.654  -34.182 1.00 0.00 ? 85  ASP A CG   6  
ATOM   8350  O  OD1  . ASP A 1 85 ? -16.585 -0.973  -35.127 1.00 0.00 ? 85  ASP A OD1  6  
ATOM   8351  O  OD2  . ASP A 1 85 ? -16.914 -2.369  -33.489 1.00 0.00 ? 85  ASP A OD2  6  
ATOM   8352  H  H    . ASP A 1 85 ? -12.292 -1.136  -32.962 1.00 0.00 ? 85  ASP A H    6  
ATOM   8353  H  HA   . ASP A 1 85 ? -14.303 0.545   -33.832 1.00 0.00 ? 85  ASP A HA   6  
ATOM   8354  H  HB2  . ASP A 1 85 ? -14.076 -1.701  -34.738 1.00 0.00 ? 85  ASP A HB2  6  
ATOM   8355  H  HB3  . ASP A 1 85 ? -14.404 -2.427  -33.170 1.00 0.00 ? 85  ASP A HB3  6  
ATOM   8356  N  N    . SER A 1 86 ? -14.937 -0.707  -30.808 1.00 0.00 ? 86  SER A N    6  
ATOM   8357  C  CA   . SER A 1 86 ? -15.732 -0.546  -29.590 1.00 0.00 ? 86  SER A CA   6  
ATOM   8358  C  C    . SER A 1 86 ? -15.494 0.822   -28.907 1.00 0.00 ? 86  SER A C    6  
ATOM   8359  O  O    . SER A 1 86 ? -16.402 1.359   -28.275 1.00 0.00 ? 86  SER A O    6  
ATOM   8360  C  CB   . SER A 1 86 ? -15.432 -1.700  -28.634 1.00 0.00 ? 86  SER A CB   6  
ATOM   8361  O  OG   . SER A 1 86 ? -15.779 -2.938  -29.221 1.00 0.00 ? 86  SER A OG   6  
ATOM   8362  H  H    . SER A 1 86 ? -14.211 -1.375  -30.795 1.00 0.00 ? 86  SER A H    6  
ATOM   8363  H  HA   . SER A 1 86 ? -16.774 -0.610  -29.886 1.00 0.00 ? 86  SER A HA   6  
ATOM   8364  H  HB2  . SER A 1 86 ? -14.379 -1.725  -28.404 1.00 0.00 ? 86  SER A HB2  6  
ATOM   8365  H  HB3  . SER A 1 86 ? -15.993 -1.578  -27.713 1.00 0.00 ? 86  SER A HB3  6  
ATOM   8366  H  HG   . SER A 1 86 ? -15.129 -3.605  -28.970 1.00 0.00 ? 86  SER A HG   6  
ATOM   8367  N  N    . VAL A 1 87 ? -14.271 1.380   -29.051 1.00 0.00 ? 87  VAL A N    6  
ATOM   8368  C  CA   . VAL A 1 87 ? -13.873 2.651   -28.390 1.00 0.00 ? 87  VAL A CA   6  
ATOM   8369  C  C    . VAL A 1 87 ? -14.540 3.848   -29.101 1.00 0.00 ? 87  VAL A C    6  
ATOM   8370  O  O    . VAL A 1 87 ? -15.124 4.732   -28.461 1.00 0.00 ? 87  VAL A O    6  
ATOM   8371  C  CB   . VAL A 1 87 ? -12.299 2.856   -28.382 1.00 0.00 ? 87  VAL A CB   6  
ATOM   8372  C  CG1  . VAL A 1 87 ? -11.894 4.115   -27.563 1.00 0.00 ? 87  VAL A CG1  6  
ATOM   8373  C  CG2  . VAL A 1 87 ? -11.555 1.594   -27.869 1.00 0.00 ? 87  VAL A CG2  6  
ATOM   8374  H  H    . VAL A 1 87 ? -13.645 0.963   -29.675 1.00 0.00 ? 87  VAL A H    6  
ATOM   8375  H  HA   . VAL A 1 87 ? -14.230 2.619   -27.363 1.00 0.00 ? 87  VAL A HA   6  
ATOM   8376  H  HB   . VAL A 1 87 ? -11.979 3.022   -29.413 1.00 0.00 ? 87  VAL A HB   6  
ATOM   8377  H  HG11 . VAL A 1 87 ? -12.375 4.995   -27.975 1.00 0.00 ? 87  VAL A HG11 6  
ATOM   8378  H  HG12 . VAL A 1 87 ? -10.820 4.252   -27.597 1.00 0.00 ? 87  VAL A HG12 6  
ATOM   8379  H  HG13 . VAL A 1 87 ? -12.202 3.994   -26.530 1.00 0.00 ? 87  VAL A HG13 6  
ATOM   8380  H  HG21 . VAL A 1 87 ? -11.800 0.741   -28.497 1.00 0.00 ? 87  VAL A HG21 6  
ATOM   8381  H  HG22 . VAL A 1 87 ? -11.857 1.382   -26.855 1.00 0.00 ? 87  VAL A HG22 6  
ATOM   8382  H  HG23 . VAL A 1 87 ? -10.483 1.756   -27.896 1.00 0.00 ? 87  VAL A HG23 6  
ATOM   8383  N  N    . VAL A 1 88 ? -14.453 3.808   -30.437 1.00 0.00 ? 88  VAL A N    6  
ATOM   8384  C  CA   . VAL A 1 88 ? -14.925 4.877   -31.340 1.00 0.00 ? 88  VAL A CA   6  
ATOM   8385  C  C    . VAL A 1 88 ? -16.454 4.870   -31.391 1.00 0.00 ? 88  VAL A C    6  
ATOM   8386  O  O    . VAL A 1 88 ? -17.085 5.933   -31.420 1.00 0.00 ? 88  VAL A O    6  
ATOM   8387  C  CB   . VAL A 1 88 ? -14.325 4.705   -32.792 1.00 0.00 ? 88  VAL A CB   6  
ATOM   8388  C  CG1  . VAL A 1 88 ? -14.862 5.786   -33.769 1.00 0.00 ? 88  VAL A CG1  6  
ATOM   8389  C  CG2  . VAL A 1 88 ? -12.773 4.711   -32.752 1.00 0.00 ? 88  VAL A CG2  6  
ATOM   8390  H  H    . VAL A 1 88 ? -14.110 2.992   -30.839 1.00 0.00 ? 88  VAL A H    6  
ATOM   8391  H  HA   . VAL A 1 88 ? -14.590 5.833   -30.938 1.00 0.00 ? 88  VAL A HA   6  
ATOM   8392  H  HB   . VAL A 1 88 ? -14.643 3.734   -33.167 1.00 0.00 ? 88  VAL A HB   6  
ATOM   8393  H  HG11 . VAL A 1 88 ? -14.443 5.638   -34.756 1.00 0.00 ? 88  VAL A HG11 6  
ATOM   8394  H  HG12 . VAL A 1 88 ? -14.595 6.769   -33.411 1.00 0.00 ? 88  VAL A HG12 6  
ATOM   8395  H  HG13 . VAL A 1 88 ? -15.942 5.714   -33.825 1.00 0.00 ? 88  VAL A HG13 6  
ATOM   8396  H  HG21 . VAL A 1 88 ? -12.415 3.921   -32.103 1.00 0.00 ? 88  VAL A HG21 6  
ATOM   8397  H  HG22 . VAL A 1 88 ? -12.421 5.663   -32.379 1.00 0.00 ? 88  VAL A HG22 6  
ATOM   8398  H  HG23 . VAL A 1 88 ? -12.375 4.555   -33.752 1.00 0.00 ? 88  VAL A HG23 6  
ATOM   8399  N  N    . ALA A 1 89 ? -17.026 3.649   -31.360 1.00 0.00 ? 89  ALA A N    6  
ATOM   8400  C  CA   . ALA A 1 89 ? -18.488 3.453   -31.328 1.00 0.00 ? 89  ALA A CA   6  
ATOM   8401  C  C    . ALA A 1 89 ? -19.046 3.999   -30.005 1.00 0.00 ? 89  ALA A C    6  
ATOM   8402  O  O    . ALA A 1 89 ? -20.069 4.679   -29.988 1.00 0.00 ? 89  ALA A O    6  
ATOM   8403  C  CB   . ALA A 1 89 ? -18.865 1.970   -31.501 1.00 0.00 ? 89  ALA A CB   6  
ATOM   8404  H  H    . ALA A 1 89 ? -16.442 2.855   -31.329 1.00 0.00 ? 89  ALA A H    6  
ATOM   8405  H  HA   . ALA A 1 89 ? -18.907 4.010   -32.160 1.00 0.00 ? 89  ALA A HA   6  
ATOM   8406  H  HB1  . ALA A 1 89 ? -19.946 1.860   -31.509 1.00 0.00 ? 89  ALA A HB1  6  
ATOM   8407  H  HB2  . ALA A 1 89 ? -18.454 1.386   -30.686 1.00 0.00 ? 89  ALA A HB2  6  
ATOM   8408  H  HB3  . ALA A 1 89 ? -18.468 1.596   -32.438 1.00 0.00 ? 89  ALA A HB3  6  
ATOM   8409  N  N    . HIS A 1 90 ? -18.297 3.735   -28.911 1.00 0.00 ? 90  HIS A N    6  
ATOM   8410  C  CA   . HIS A 1 90 ? -18.676 4.161   -27.542 1.00 0.00 ? 90  HIS A CA   6  
ATOM   8411  C  C    . HIS A 1 90 ? -18.585 5.692   -27.386 1.00 0.00 ? 90  HIS A C    6  
ATOM   8412  O  O    . HIS A 1 90 ? -19.395 6.304   -26.691 1.00 0.00 ? 90  HIS A O    6  
ATOM   8413  C  CB   . HIS A 1 90 ? -17.769 3.438   -26.502 1.00 0.00 ? 90  HIS A CB   6  
ATOM   8414  C  CG   . HIS A 1 90 ? -17.711 4.078   -25.146 1.00 0.00 ? 90  HIS A CG   6  
ATOM   8415  N  ND1  . HIS A 1 90 ? -18.648 3.899   -24.164 1.00 0.00 ? 90  HIS A ND1  6  
ATOM   8416  C  CD2  . HIS A 1 90 ? -16.781 4.914   -24.630 1.00 0.00 ? 90  HIS A CD2  6  
ATOM   8417  C  CE1  . HIS A 1 90 ? -18.270 4.616   -23.104 1.00 0.00 ? 90  HIS A CE1  6  
ATOM   8418  N  NE2  . HIS A 1 90 ? -17.133 5.250   -23.334 1.00 0.00 ? 90  HIS A NE2  6  
ATOM   8419  H  H    . HIS A 1 90 ? -17.436 3.241   -29.030 1.00 0.00 ? 90  HIS A H    6  
ATOM   8420  H  HA   . HIS A 1 90 ? -19.707 3.859   -27.372 1.00 0.00 ? 90  HIS A HA   6  
ATOM   8421  H  HB2  . HIS A 1 90 ? -18.129 2.424   -26.362 1.00 0.00 ? 90  HIS A HB2  6  
ATOM   8422  H  HB3  . HIS A 1 90 ? -16.757 3.390   -26.889 1.00 0.00 ? 90  HIS A HB3  6  
ATOM   8423  H  HD1  . HIS A 1 90 ? -19.463 3.349   -24.229 1.00 0.00 ? 90  HIS A HD1  6  
ATOM   8424  H  HD2  . HIS A 1 90 ? -15.930 5.314   -25.167 1.00 0.00 ? 90  HIS A HD2  6  
ATOM   8425  H  HE1  . HIS A 1 90 ? -18.820 4.670   -22.176 1.00 0.00 ? 90  HIS A HE1  6  
ATOM   8426  N  N    . LYS A 1 91 ? -17.568 6.285   -28.017 1.00 0.00 ? 91  LYS A N    6  
ATOM   8427  C  CA   . LYS A 1 91 ? -17.307 7.732   -27.969 1.00 0.00 ? 91  LYS A CA   6  
ATOM   8428  C  C    . LYS A 1 91 ? -18.383 8.484   -28.774 1.00 0.00 ? 91  LYS A C    6  
ATOM   8429  O  O    . LYS A 1 91 ? -18.877 9.516   -28.345 1.00 0.00 ? 91  LYS A O    6  
ATOM   8430  C  CB   . LYS A 1 91 ? -15.887 8.019   -28.520 1.00 0.00 ? 91  LYS A CB   6  
ATOM   8431  C  CG   . LYS A 1 91 ? -15.461 9.501   -28.457 1.00 0.00 ? 91  LYS A CG   6  
ATOM   8432  C  CD   . LYS A 1 91 ? -14.032 9.729   -29.002 1.00 0.00 ? 91  LYS A CD   6  
ATOM   8433  C  CE   . LYS A 1 91 ? -13.608 11.207  -28.968 1.00 0.00 ? 91  LYS A CE   6  
ATOM   8434  N  NZ   . LYS A 1 91 ? -12.236 11.395  -29.509 1.00 0.00 ? 91  LYS A NZ   6  
ATOM   8435  H  H    . LYS A 1 91 ? -16.990 5.729   -28.574 1.00 0.00 ? 91  LYS A H    6  
ATOM   8436  H  HA   . LYS A 1 91 ? -17.354 8.056   -26.923 1.00 0.00 ? 91  LYS A HA   6  
ATOM   8437  H  HB2  . LYS A 1 91 ? -15.171 7.435   -27.949 1.00 0.00 ? 91  LYS A HB2  6  
ATOM   8438  H  HB3  . LYS A 1 91 ? -15.841 7.693   -29.556 1.00 0.00 ? 91  LYS A HB3  6  
ATOM   8439  H  HG2  . LYS A 1 91 ? -16.155 10.092  -29.043 1.00 0.00 ? 91  LYS A HG2  6  
ATOM   8440  H  HG3  . LYS A 1 91 ? -15.500 9.830   -27.422 1.00 0.00 ? 91  LYS A HG3  6  
ATOM   8441  H  HD2  . LYS A 1 91 ? -13.335 9.157   -28.402 1.00 0.00 ? 91  LYS A HD2  6  
ATOM   8442  H  HD3  . LYS A 1 91 ? -13.989 9.376   -30.029 1.00 0.00 ? 91  LYS A HD3  6  
ATOM   8443  H  HE2  . LYS A 1 91 ? -14.298 11.797  -29.561 1.00 0.00 ? 91  LYS A HE2  6  
ATOM   8444  H  HE3  . LYS A 1 91 ? -13.625 11.560  -27.945 1.00 0.00 ? 91  LYS A HE3  6  
ATOM   8445  H  HZ1  . LYS A 1 91 ? -11.544 10.893  -28.914 1.00 0.00 ? 91  LYS A HZ1  6  
ATOM   8446  H  HZ2  . LYS A 1 91 ? -11.992 12.405  -29.528 1.00 0.00 ? 91  LYS A HZ2  6  
ATOM   8447  H  HZ3  . LYS A 1 91 ? -12.179 11.017  -30.476 1.00 0.00 ? 91  LYS A HZ3  6  
ATOM   8448  N  N    . ALA A 1 92 ? -18.748 7.924   -29.939 1.00 0.00 ? 92  ALA A N    6  
ATOM   8449  C  CA   . ALA A 1 92 ? -19.815 8.470   -30.801 1.00 0.00 ? 92  ALA A CA   6  
ATOM   8450  C  C    . ALA A 1 92 ? -21.198 8.353   -30.124 1.00 0.00 ? 92  ALA A C    6  
ATOM   8451  O  O    . ALA A 1 92 ? -22.096 9.167   -30.360 1.00 0.00 ? 92  ALA A O    6  
ATOM   8452  C  CB   . ALA A 1 92 ? -19.821 7.740   -32.154 1.00 0.00 ? 92  ALA A CB   6  
ATOM   8453  H  H    . ALA A 1 92 ? -18.289 7.116   -30.226 1.00 0.00 ? 92  ALA A H    6  
ATOM   8454  H  HA   . ALA A 1 92 ? -19.591 9.513   -30.981 1.00 0.00 ? 92  ALA A HA   6  
ATOM   8455  H  HB1  . ALA A 1 92 ? -20.047 6.691   -32.003 1.00 0.00 ? 92  ALA A HB1  6  
ATOM   8456  H  HB2  . ALA A 1 92 ? -18.848 7.828   -32.621 1.00 0.00 ? 92  ALA A HB2  6  
ATOM   8457  H  HB3  . ALA A 1 92 ? -20.567 8.176   -32.806 1.00 0.00 ? 92  ALA A HB3  6  
ATOM   8458  N  N    . LYS A 1 93 ? -21.331 7.332   -29.267 1.00 0.00 ? 93  LYS A N    6  
ATOM   8459  C  CA   . LYS A 1 93 ? -22.579 6.968   -28.599 1.00 0.00 ? 93  LYS A CA   6  
ATOM   8460  C  C    . LYS A 1 93 ? -22.814 7.843   -27.359 1.00 0.00 ? 93  LYS A C    6  
ATOM   8461  O  O    . LYS A 1 93 ? -23.856 8.498   -27.221 1.00 0.00 ? 93  LYS A O    6  
ATOM   8462  C  CB   . LYS A 1 93 ? -22.465 5.469   -28.210 1.00 0.00 ? 93  LYS A CB   6  
ATOM   8463  C  CG   . LYS A 1 93 ? -23.548 4.921   -27.277 1.00 0.00 ? 93  LYS A CG   6  
ATOM   8464  C  CD   . LYS A 1 93 ? -23.306 3.437   -26.918 1.00 0.00 ? 93  LYS A CD   6  
ATOM   8465  C  CE   . LYS A 1 93 ? -24.347 2.865   -25.946 1.00 0.00 ? 93  LYS A CE   6  
ATOM   8466  N  NZ   . LYS A 1 93 ? -25.712 2.857   -26.525 1.00 0.00 ? 93  LYS A NZ   6  
ATOM   8467  H  H    . LYS A 1 93 ? -20.541 6.786   -29.057 1.00 0.00 ? 93  LYS A H    6  
ATOM   8468  H  HA   . LYS A 1 93 ? -23.404 7.093   -29.295 1.00 0.00 ? 93  LYS A HA   6  
ATOM   8469  H  HB2  . LYS A 1 93 ? -22.484 4.879   -29.121 1.00 0.00 ? 93  LYS A HB2  6  
ATOM   8470  H  HB3  . LYS A 1 93 ? -21.501 5.317   -27.731 1.00 0.00 ? 93  LYS A HB3  6  
ATOM   8471  H  HG2  . LYS A 1 93 ? -23.537 5.511   -26.368 1.00 0.00 ? 93  LYS A HG2  6  
ATOM   8472  H  HG3  . LYS A 1 93 ? -24.510 5.026   -27.764 1.00 0.00 ? 93  LYS A HG3  6  
ATOM   8473  H  HD2  . LYS A 1 93 ? -23.335 2.848   -27.828 1.00 0.00 ? 93  LYS A HD2  6  
ATOM   8474  H  HD3  . LYS A 1 93 ? -22.319 3.342   -26.469 1.00 0.00 ? 93  LYS A HD3  6  
ATOM   8475  H  HE2  . LYS A 1 93 ? -24.074 1.849   -25.696 1.00 0.00 ? 93  LYS A HE2  6  
ATOM   8476  H  HE3  . LYS A 1 93 ? -24.355 3.458   -25.040 1.00 0.00 ? 93  LYS A HE3  6  
ATOM   8477  H  HZ1  . LYS A 1 93 ? -25.728 2.298   -27.395 1.00 0.00 ? 93  LYS A HZ1  6  
ATOM   8478  H  HZ2  . LYS A 1 93 ? -26.019 3.825   -26.740 1.00 0.00 ? 93  LYS A HZ2  6  
ATOM   8479  H  HZ3  . LYS A 1 93 ? -26.386 2.438   -25.848 1.00 0.00 ? 93  LYS A HZ3  6  
ATOM   8480  N  N    . SER A 1 94 ? -21.803 7.871   -26.480 1.00 0.00 ? 94  SER A N    6  
ATOM   8481  C  CA   . SER A 1 94 ? -21.921 8.399   -25.120 1.00 0.00 ? 94  SER A CA   6  
ATOM   8482  C  C    . SER A 1 94 ? -21.312 9.807   -25.015 1.00 0.00 ? 94  SER A C    6  
ATOM   8483  O  O    . SER A 1 94 ? -21.568 10.520  -24.035 1.00 0.00 ? 94  SER A O    6  
ATOM   8484  C  CB   . SER A 1 94 ? -21.222 7.418   -24.133 1.00 0.00 ? 94  SER A CB   6  
ATOM   8485  O  OG   . SER A 1 94 ? -21.405 7.799   -22.776 1.00 0.00 ? 94  SER A OG   6  
ATOM   8486  H  H    . SER A 1 94 ? -20.933 7.557   -26.770 1.00 0.00 ? 94  SER A H    6  
ATOM   8487  H  HA   . SER A 1 94 ? -22.970 8.450   -24.869 1.00 0.00 ? 94  SER A HA   6  
ATOM   8488  H  HB2  . SER A 1 94 ? -21.634 6.427   -24.256 1.00 0.00 ? 94  SER A HB2  6  
ATOM   8489  H  HB3  . SER A 1 94 ? -20.156 7.385   -24.340 1.00 0.00 ? 94  SER A HB3  6  
ATOM   8490  H  HG   . SER A 1 94 ? -21.700 8.717   -22.730 1.00 0.00 ? 94  SER A HG   6  
ATOM   8491  N  N    . HIS A 1 95 ? -20.499 10.211  -26.025 1.00 0.00 ? 95  HIS A N    6  
ATOM   8492  C  CA   . HIS A 1 95 ? -19.732 11.486  -25.975 1.00 0.00 ? 95  HIS A CA   6  
ATOM   8493  C  C    . HIS A 1 95 ? -19.771 12.272  -27.334 1.00 0.00 ? 95  HIS A C    6  
ATOM   8494  O  O    . HIS A 1 95 ? -18.705 12.619  -27.868 1.00 0.00 ? 95  HIS A O    6  
ATOM   8495  C  CB   . HIS A 1 95 ? -18.245 11.205  -25.573 1.00 0.00 ? 95  HIS A CB   6  
ATOM   8496  C  CG   . HIS A 1 95 ? -18.057 10.279  -24.401 1.00 0.00 ? 95  HIS A CG   6  
ATOM   8497  N  ND1  . HIS A 1 95 ? -18.616 10.469  -23.155 1.00 0.00 ? 95  HIS A ND1  6  
ATOM   8498  C  CD2  . HIS A 1 95 ? -17.363 9.127   -24.321 1.00 0.00 ? 95  HIS A CD2  6  
ATOM   8499  C  CE1  . HIS A 1 95 ? -18.241 9.442   -22.376 1.00 0.00 ? 95  HIS A CE1  6  
ATOM   8500  N  NE2  . HIS A 1 95 ? -17.488 8.602   -23.049 1.00 0.00 ? 95  HIS A NE2  6  
ATOM   8501  H  H    . HIS A 1 95 ? -20.451 9.665   -26.841 1.00 0.00 ? 95  HIS A H    6  
ATOM   8502  H  HA   . HIS A 1 95 ? -20.177 12.123  -25.215 1.00 0.00 ? 95  HIS A HA   6  
ATOM   8503  H  HB2  . HIS A 1 95 ? -17.723 10.772  -26.417 1.00 0.00 ? 95  HIS A HB2  6  
ATOM   8504  H  HB3  . HIS A 1 95 ? -17.765 12.148  -25.325 1.00 0.00 ? 95  HIS A HB3  6  
ATOM   8505  H  HD1  . HIS A 1 95 ? -19.187 11.222  -22.883 1.00 0.00 ? 95  HIS A HD1  6  
ATOM   8506  H  HD2  . HIS A 1 95 ? -16.786 8.678   -25.117 1.00 0.00 ? 95  HIS A HD2  6  
ATOM   8507  H  HE1  . HIS A 1 95 ? -18.539 9.314   -21.344 1.00 0.00 ? 95  HIS A HE1  6  
ATOM   8508  N  N    . PRO A 1 96 ? -20.984 12.565  -27.948 1.00 0.00 ? 96  PRO A N    6  
ATOM   8509  C  CA   . PRO A 1 96 ? -21.093 13.562  -29.064 1.00 0.00 ? 96  PRO A CA   6  
ATOM   8510  C  C    . PRO A 1 96 ? -20.649 14.987  -28.630 1.00 0.00 ? 96  PRO A C    6  
ATOM   8511  O  O    . PRO A 1 96 ? -20.293 15.825  -29.464 1.00 0.00 ? 96  PRO A O    6  
ATOM   8512  C  CB   . PRO A 1 96 ? -22.598 13.522  -29.435 1.00 0.00 ? 96  PRO A CB   6  
ATOM   8513  C  CG   . PRO A 1 96 ? -23.064 12.177  -28.966 1.00 0.00 ? 96  PRO A CG   6  
ATOM   8514  C  CD   . PRO A 1 96 ? -22.300 11.916  -27.692 1.00 0.00 ? 96  PRO A CD   6  
ATOM   8515  H  HA   . PRO A 1 96 ? -20.495 13.252  -29.922 1.00 0.00 ? 96  PRO A HA   6  
ATOM   8516  H  HB2  . PRO A 1 96 ? -23.134 14.325  -28.933 1.00 0.00 ? 96  PRO A HB2  6  
ATOM   8517  H  HB3  . PRO A 1 96 ? -22.716 13.630  -30.509 1.00 0.00 ? 96  PRO A HB3  6  
ATOM   8518  H  HG2  . PRO A 1 96 ? -24.131 12.197  -28.776 1.00 0.00 ? 96  PRO A HG2  6  
ATOM   8519  H  HG3  . PRO A 1 96 ? -22.833 11.415  -29.705 1.00 0.00 ? 96  PRO A HG3  6  
ATOM   8520  H  HD2  . PRO A 1 96 ? -22.790 12.367  -26.837 1.00 0.00 ? 96  PRO A HD2  6  
ATOM   8521  H  HD3  . PRO A 1 96 ? -22.178 10.852  -27.534 1.00 0.00 ? 96  PRO A HD3  6  
ATOM   8522  N  N    . GLU A 1 97 ? -20.695 15.235  -27.308 1.00 0.00 ? 97  GLU A N    6  
ATOM   8523  C  CA   . GLU A 1 97 ? -20.158 16.426  -26.668 1.00 0.00 ? 97  GLU A CA   6  
ATOM   8524  C  C    . GLU A 1 97 ? -19.023 15.965  -25.749 1.00 0.00 ? 97  GLU A C    6  
ATOM   8525  O  O    . GLU A 1 97 ? -19.262 15.479  -24.635 1.00 0.00 ? 97  GLU A O    6  
ATOM   8526  C  CB   . GLU A 1 97 ? -21.267 17.178  -25.870 1.00 0.00 ? 97  GLU A CB   6  
ATOM   8527  C  CG   . GLU A 1 97 ? -20.800 18.473  -25.186 1.00 0.00 ? 97  GLU A CG   6  
ATOM   8528  C  CD   . GLU A 1 97 ? -21.922 19.175  -24.404 1.00 0.00 ? 97  GLU A CD   6  
ATOM   8529  O  OE1  . GLU A 1 97 ? -22.700 19.941  -25.018 1.00 0.00 ? 97  GLU A OE1  6  
ATOM   8530  O  OE2  . GLU A 1 97 ? -22.048 18.948  -23.177 1.00 0.00 ? 97  GLU A OE2  6  
ATOM   8531  H  H    . GLU A 1 97 ? -21.088 14.573  -26.738 1.00 0.00 ? 97  GLU A H    6  
ATOM   8532  H  HA   . GLU A 1 97 ? -19.757 17.080  -27.434 1.00 0.00 ? 97  GLU A HA   6  
ATOM   8533  H  HB2  . GLU A 1 97 ? -22.069 17.435  -26.553 1.00 0.00 ? 97  GLU A HB2  6  
ATOM   8534  H  HB3  . GLU A 1 97 ? -21.668 16.512  -25.105 1.00 0.00 ? 97  GLU A HB3  6  
ATOM   8535  H  HG2  . GLU A 1 97 ? -19.986 18.237  -24.507 1.00 0.00 ? 97  GLU A HG2  6  
ATOM   8536  H  HG3  . GLU A 1 97 ? -20.428 19.150  -25.950 1.00 0.00 ? 97  GLU A HG3  6  
ATOM   8537  N  N    . VAL A 1 98 ? -17.800 16.055  -26.273 1.00 0.00 ? 98  VAL A N    6  
ATOM   8538  C  CA   . VAL A 1 98 ? -16.566 15.718  -25.540 1.00 0.00 ? 98  VAL A CA   6  
ATOM   8539  C  C    . VAL A 1 98 ? -16.214 16.856  -24.547 1.00 0.00 ? 98  VAL A C    6  
ATOM   8540  O  O    . VAL A 1 98 ? -15.818 17.957  -25.001 1.00 0.00 ? 98  VAL A O    6  
ATOM   8541  C  CB   . VAL A 1 98 ? -15.363 15.422  -26.525 1.00 0.00 ? 98  VAL A CB   6  
ATOM   8542  C  CG1  . VAL A 1 98 ? -14.050 15.078  -25.753 1.00 0.00 ? 98  VAL A CG1  6  
ATOM   8543  C  CG2  . VAL A 1 98 ? -15.733 14.299  -27.528 1.00 0.00 ? 98  VAL A CG2  6  
ATOM   8544  O  OXT  . VAL A 1 98 ? -16.356 16.659  -23.321 1.00 0.00 ? 98  VAL A OXT  6  
ATOM   8545  H  H    . VAL A 1 98 ? -17.736 16.341  -27.202 1.00 0.00 ? 98  VAL A H    6  
ATOM   8546  H  HA   . VAL A 1 98 ? -16.766 14.802  -24.979 1.00 0.00 ? 98  VAL A HA   6  
ATOM   8547  H  HB   . VAL A 1 98 ? -15.176 16.330  -27.097 1.00 0.00 ? 98  VAL A HB   6  
ATOM   8548  H  HG11 . VAL A 1 98 ? -14.204 14.197  -25.139 1.00 0.00 ? 98  VAL A HG11 6  
ATOM   8549  H  HG12 . VAL A 1 98 ? -13.766 15.907  -25.117 1.00 0.00 ? 98  VAL A HG12 6  
ATOM   8550  H  HG13 . VAL A 1 98 ? -13.247 14.887  -26.457 1.00 0.00 ? 98  VAL A HG13 6  
ATOM   8551  H  HG21 . VAL A 1 98 ? -14.911 14.132  -28.216 1.00 0.00 ? 98  VAL A HG21 6  
ATOM   8552  H  HG22 . VAL A 1 98 ? -16.611 14.582  -28.095 1.00 0.00 ? 98  VAL A HG22 6  
ATOM   8553  H  HG23 . VAL A 1 98 ? -15.939 13.382  -26.991 1.00 0.00 ? 98  VAL A HG23 6  
HETATM 8554  ZN ZN   . ZN  B 2 .  ? 14.911  0.383   3.833   1.00 0.00 ? 101 ZN  A ZN   6  
HETATM 8555  ZN ZN   . ZN  C 2 .  ? 4.872   -3.592  -15.580 1.00 0.00 ? 102 ZN  A ZN   6  
HETATM 8556  ZN ZN   . ZN  D 2 .  ? -16.464 6.946   -22.363 1.00 0.00 ? 103 ZN  A ZN   6  
ATOM   8557  N  N    . HIS A 1 10 ? 14.208  -10.342 19.899  1.00 0.00 ? 10  HIS A N    7  
ATOM   8558  C  CA   . HIS A 1 10 ? 13.349  -11.515 19.615  1.00 0.00 ? 10  HIS A CA   7  
ATOM   8559  C  C    . HIS A 1 10 ? 14.159  -12.648 18.965  1.00 0.00 ? 10  HIS A C    7  
ATOM   8560  O  O    . HIS A 1 10 ? 13.601  -13.728 18.735  1.00 0.00 ? 10  HIS A O    7  
ATOM   8561  C  CB   . HIS A 1 10 ? 12.169  -11.125 18.691  1.00 0.00 ? 10  HIS A CB   7  
ATOM   8562  C  CG   . HIS A 1 10 ? 11.239  -10.099 19.275  1.00 0.00 ? 10  HIS A CG   7  
ATOM   8563  N  ND1  . HIS A 1 10 ? 10.231  -10.412 20.165  1.00 0.00 ? 10  HIS A ND1  7  
ATOM   8564  C  CD2  . HIS A 1 10 ? 11.185  -8.761  19.109  1.00 0.00 ? 10  HIS A CD2  7  
ATOM   8565  C  CE1  . HIS A 1 10 ? 9.602   -9.309  20.519  1.00 0.00 ? 10  HIS A CE1  7  
ATOM   8566  N  NE2  . HIS A 1 10 ? 10.162  -8.294  19.889  1.00 0.00 ? 10  HIS A NE2  7  
ATOM   8567  H  H    . HIS A 1 10 ? 14.585  -9.955  19.011  1.00 0.00 ? 10  HIS A H    7  
ATOM   8568  H  HA   . HIS A 1 10 ? 12.957  -11.870 20.562  1.00 0.00 ? 10  HIS A HA   7  
ATOM   8569  H  HB2  . HIS A 1 10 ? 12.564  -10.724 17.766  1.00 0.00 ? 10  HIS A HB2  7  
ATOM   8570  H  HB3  . HIS A 1 10 ? 11.581  -12.008 18.466  1.00 0.00 ? 10  HIS A HB3  7  
ATOM   8571  H  HD1  . HIS A 1 10 ? 10.011  -11.312 20.490  1.00 0.00 ? 10  HIS A HD1  7  
ATOM   8572  H  HD2  . HIS A 1 10 ? 11.832  -8.169  18.474  1.00 0.00 ? 10  HIS A HD2  7  
ATOM   8573  H  HE1  . HIS A 1 10 ? 8.781   -9.244  21.229  1.00 0.00 ? 10  HIS A HE1  7  
ATOM   8574  H  HE2  . HIS A 1 10 ? 10.035  -7.352  20.132  1.00 0.00 ? 10  HIS A HE2  7  
ATOM   8575  N  N    . MET A 1 11 ? 15.464  -12.385 18.655  1.00 0.00 ? 11  MET A N    7  
ATOM   8576  C  CA   . MET A 1 11 ? 16.370  -13.337 17.942  1.00 0.00 ? 11  MET A CA   7  
ATOM   8577  C  C    . MET A 1 11 ? 15.843  -13.639 16.514  1.00 0.00 ? 11  MET A C    7  
ATOM   8578  O  O    . MET A 1 11 ? 16.111  -14.698 15.934  1.00 0.00 ? 11  MET A O    7  
ATOM   8579  C  CB   . MET A 1 11 ? 16.578  -14.633 18.780  1.00 0.00 ? 11  MET A CB   7  
ATOM   8580  C  CG   . MET A 1 11 ? 17.242  -14.405 20.153  1.00 0.00 ? 11  MET A CG   7  
ATOM   8581  S  SD   . MET A 1 11 ? 17.262  -15.888 21.193  1.00 0.00 ? 11  MET A SD   7  
ATOM   8582  C  CE   . MET A 1 11 ? 15.510  -16.153 21.499  1.00 0.00 ? 11  MET A CE   7  
ATOM   8583  H  H    . MET A 1 11 ? 15.837  -11.516 18.910  1.00 0.00 ? 11  MET A H    7  
ATOM   8584  H  HA   . MET A 1 11 ? 17.329  -12.838 17.836  1.00 0.00 ? 11  MET A HA   7  
ATOM   8585  H  HB2  . MET A 1 11 ? 15.613  -15.100 18.943  1.00 0.00 ? 11  MET A HB2  7  
ATOM   8586  H  HB3  . MET A 1 11 ? 17.201  -15.319 18.216  1.00 0.00 ? 11  MET A HB3  7  
ATOM   8587  H  HG2  . MET A 1 11 ? 18.263  -14.088 19.997  1.00 0.00 ? 11  MET A HG2  7  
ATOM   8588  H  HG3  . MET A 1 11 ? 16.706  -13.623 20.681  1.00 0.00 ? 11  MET A HG3  7  
ATOM   8589  H  HE1  . MET A 1 11 ? 15.094  -15.286 21.991  1.00 0.00 ? 11  MET A HE1  7  
ATOM   8590  H  HE2  . MET A 1 11 ? 15.382  -17.020 22.130  1.00 0.00 ? 11  MET A HE2  7  
ATOM   8591  H  HE3  . MET A 1 11 ? 15.002  -16.313 20.561  1.00 0.00 ? 11  MET A HE3  7  
ATOM   8592  N  N    . ARG A 1 12 ? 15.145  -12.633 15.960  1.00 0.00 ? 12  ARG A N    7  
ATOM   8593  C  CA   . ARG A 1 12 ? 14.431  -12.692 14.673  1.00 0.00 ? 12  ARG A CA   7  
ATOM   8594  C  C    . ARG A 1 12 ? 14.017  -11.251 14.327  1.00 0.00 ? 12  ARG A C    7  
ATOM   8595  O  O    . ARG A 1 12 ? 12.856  -10.851 14.455  1.00 0.00 ? 12  ARG A O    7  
ATOM   8596  C  CB   . ARG A 1 12 ? 13.201  -13.647 14.762  1.00 0.00 ? 12  ARG A CB   7  
ATOM   8597  C  CG   . ARG A 1 12 ? 12.319  -13.714 13.492  1.00 0.00 ? 12  ARG A CG   7  
ATOM   8598  C  CD   . ARG A 1 12 ? 10.924  -14.298 13.778  1.00 0.00 ? 12  ARG A CD   7  
ATOM   8599  N  NE   . ARG A 1 12 ? 10.240  -13.636 14.924  1.00 0.00 ? 12  ARG A NE   7  
ATOM   8600  C  CZ   . ARG A 1 12 ? 9.828   -12.343 14.976  1.00 0.00 ? 12  ARG A CZ   7  
ATOM   8601  N  NH1  . ARG A 1 12 ? 10.026  -11.515 13.961  1.00 0.00 ? 12  ARG A NH1  7  
ATOM   8602  N  NH2  . ARG A 1 12 ? 9.243   -11.880 16.073  1.00 0.00 ? 12  ARG A NH2  7  
ATOM   8603  H  H    . ARG A 1 12 ? 15.121  -11.781 16.450  1.00 0.00 ? 12  ARG A H    7  
ATOM   8604  H  HA   . ARG A 1 12 ? 15.120  -13.053 13.915  1.00 0.00 ? 12  ARG A HA   7  
ATOM   8605  H  HB2  . ARG A 1 12 ? 13.564  -14.650 14.969  1.00 0.00 ? 12  ARG A HB2  7  
ATOM   8606  H  HB3  . ARG A 1 12 ? 12.581  -13.334 15.599  1.00 0.00 ? 12  ARG A HB3  7  
ATOM   8607  H  HG2  . ARG A 1 12 ? 12.197  -12.710 13.092  1.00 0.00 ? 12  ARG A HG2  7  
ATOM   8608  H  HG3  . ARG A 1 12 ? 12.813  -14.330 12.751  1.00 0.00 ? 12  ARG A HG3  7  
ATOM   8609  H  HD2  . ARG A 1 12 ? 10.304  -14.190 12.896  1.00 0.00 ? 12  ARG A HD2  7  
ATOM   8610  H  HD3  . ARG A 1 12 ? 11.030  -15.351 14.007  1.00 0.00 ? 12  ARG A HD3  7  
ATOM   8611  H  HE   . ARG A 1 12 ? 10.073  -14.203 15.711  1.00 0.00 ? 12  ARG A HE   7  
ATOM   8612  H  HH11 . ARG A 1 12 ? 10.488  -11.837 13.135  1.00 0.00 ? 12  ARG A HH11 7  
ATOM   8613  H  HH12 . ARG A 1 12 ? 9.714   -10.561 14.016  1.00 0.00 ? 12  ARG A HH12 7  
ATOM   8614  H  HH21 . ARG A 1 12 ? 9.108   -12.477 16.863  1.00 0.00 ? 12  ARG A HH21 7  
ATOM   8615  H  HH22 . ARG A 1 12 ? 8.922   -10.928 16.114  1.00 0.00 ? 12  ARG A HH22 7  
ATOM   8616  N  N    . ASP A 1 13 ? 15.020  -10.441 13.972  1.00 0.00 ? 13  ASP A N    7  
ATOM   8617  C  CA   . ASP A 1 13 ? 14.877  -8.994  13.813  1.00 0.00 ? 13  ASP A CA   7  
ATOM   8618  C  C    . ASP A 1 13 ? 15.707  -8.560  12.605  1.00 0.00 ? 13  ASP A C    7  
ATOM   8619  O  O    . ASP A 1 13 ? 16.935  -8.419  12.690  1.00 0.00 ? 13  ASP A O    7  
ATOM   8620  C  CB   . ASP A 1 13 ? 15.354  -8.241  15.086  1.00 0.00 ? 13  ASP A CB   7  
ATOM   8621  C  CG   . ASP A 1 13 ? 14.557  -8.578  16.370  1.00 0.00 ? 13  ASP A CG   7  
ATOM   8622  O  OD1  . ASP A 1 13 ? 14.900  -9.566  17.070  1.00 0.00 ? 13  ASP A OD1  7  
ATOM   8623  O  OD2  . ASP A 1 13 ? 13.597  -7.848  16.696  1.00 0.00 ? 13  ASP A OD2  7  
ATOM   8624  H  H    . ASP A 1 13 ? 15.889  -10.832 13.783  1.00 0.00 ? 13  ASP A H    7  
ATOM   8625  H  HA   . ASP A 1 13 ? 13.827  -8.760  13.631  1.00 0.00 ? 13  ASP A HA   7  
ATOM   8626  H  HB2  . ASP A 1 13 ? 16.401  -8.483  15.262  1.00 0.00 ? 13  ASP A HB2  7  
ATOM   8627  H  HB3  . ASP A 1 13 ? 15.281  -7.173  14.899  1.00 0.00 ? 13  ASP A HB3  7  
ATOM   8628  N  N    . TYR A 1 14 ? 15.034  -8.423  11.472  1.00 0.00 ? 14  TYR A N    7  
ATOM   8629  C  CA   . TYR A 1 14 ? 15.653  -8.006  10.203  1.00 0.00 ? 14  TYR A CA   7  
ATOM   8630  C  C    . TYR A 1 14 ? 15.564  -6.482  10.077  1.00 0.00 ? 14  TYR A C    7  
ATOM   8631  O  O    . TYR A 1 14 ? 14.479  -5.929  9.890   1.00 0.00 ? 14  TYR A O    7  
ATOM   8632  C  CB   . TYR A 1 14 ? 14.970  -8.724  9.006   1.00 0.00 ? 14  TYR A CB   7  
ATOM   8633  C  CG   . TYR A 1 14 ? 15.184  -10.247 9.010   1.00 0.00 ? 14  TYR A CG   7  
ATOM   8634  C  CD1  . TYR A 1 14 ? 14.397  -11.090 9.802   1.00 0.00 ? 14  TYR A CD1  7  
ATOM   8635  C  CD2  . TYR A 1 14 ? 16.199  -10.838 8.247   1.00 0.00 ? 14  TYR A CD2  7  
ATOM   8636  C  CE1  . TYR A 1 14 ? 14.608  -12.452 9.828   1.00 0.00 ? 14  TYR A CE1  7  
ATOM   8637  C  CE2  . TYR A 1 14 ? 16.412  -12.204 8.275   1.00 0.00 ? 14  TYR A CE2  7  
ATOM   8638  C  CZ   . TYR A 1 14 ? 15.614  -13.003 9.067   1.00 0.00 ? 14  TYR A CZ   7  
ATOM   8639  O  OH   . TYR A 1 14 ? 15.823  -14.362 9.097   1.00 0.00 ? 14  TYR A OH   7  
ATOM   8640  H  H    . TYR A 1 14 ? 14.077  -8.602  11.488  1.00 0.00 ? 14  TYR A H    7  
ATOM   8641  H  HA   . TYR A 1 14 ? 16.704  -8.295  10.227  1.00 0.00 ? 14  TYR A HA   7  
ATOM   8642  H  HB2  . TYR A 1 14 ? 13.903  -8.531  9.032   1.00 0.00 ? 14  TYR A HB2  7  
ATOM   8643  H  HB3  . TYR A 1 14 ? 15.369  -8.332  8.077   1.00 0.00 ? 14  TYR A HB3  7  
ATOM   8644  H  HD1  . TYR A 1 14 ? 13.602  -10.661 10.405  1.00 0.00 ? 14  TYR A HD1  7  
ATOM   8645  H  HD2  . TYR A 1 14 ? 16.822  -10.212 7.622   1.00 0.00 ? 14  TYR A HD2  7  
ATOM   8646  H  HE1  . TYR A 1 14 ? 13.984  -13.082 10.447  1.00 0.00 ? 14  TYR A HE1  7  
ATOM   8647  H  HE2  . TYR A 1 14 ? 17.207  -12.639 7.678   1.00 0.00 ? 14  TYR A HE2  7  
ATOM   8648  H  HH   . TYR A 1 14 ? 14.972  -14.812 9.070   1.00 0.00 ? 14  TYR A HH   7  
ATOM   8649  N  N    . ILE A 1 15 ? 16.711  -5.802  10.225  1.00 0.00 ? 15  ILE A N    7  
ATOM   8650  C  CA   . ILE A 1 15 ? 16.794  -4.337  10.237  1.00 0.00 ? 15  ILE A CA   7  
ATOM   8651  C  C    . ILE A 1 15 ? 17.474  -3.886  8.928   1.00 0.00 ? 15  ILE A C    7  
ATOM   8652  O  O    . ILE A 1 15 ? 18.295  -4.622  8.370   1.00 0.00 ? 15  ILE A O    7  
ATOM   8653  C  CB   . ILE A 1 15 ? 17.596  -3.812  11.499  1.00 0.00 ? 15  ILE A CB   7  
ATOM   8654  C  CG1  . ILE A 1 15 ? 17.200  -4.580  12.803  1.00 0.00 ? 15  ILE A CG1  7  
ATOM   8655  C  CG2  . ILE A 1 15 ? 17.416  -2.287  11.683  1.00 0.00 ? 15  ILE A CG2  7  
ATOM   8656  C  CD1  . ILE A 1 15 ? 15.749  -4.457  13.192  1.00 0.00 ? 15  ILE A CD1  7  
ATOM   8657  H  H    . ILE A 1 15 ? 17.551  -6.302  10.279  1.00 0.00 ? 15  ILE A H    7  
ATOM   8658  H  HA   . ILE A 1 15 ? 15.785  -3.932  10.275  1.00 0.00 ? 15  ILE A HA   7  
ATOM   8659  H  HB   . ILE A 1 15 ? 18.639  -3.994  11.323  1.00 0.00 ? 15  ILE A HB   7  
ATOM   8660  H  HG12 . ILE A 1 15 ? 17.405  -5.633  12.672  1.00 0.00 ? 15  ILE A HG12 7  
ATOM   8661  H  HG13 . ILE A 1 15 ? 17.795  -4.210  13.632  1.00 0.00 ? 15  ILE A HG13 7  
ATOM   8662  H  HG21 . ILE A 1 15 ? 17.981  -1.947  12.544  1.00 0.00 ? 15  ILE A HG21 7  
ATOM   8663  H  HG22 . ILE A 1 15 ? 16.366  -2.050  11.829  1.00 0.00 ? 15  ILE A HG22 7  
ATOM   8664  H  HG23 . ILE A 1 15 ? 17.768  -1.765  10.799  1.00 0.00 ? 15  ILE A HG23 7  
ATOM   8665  H  HD11 . ILE A 1 15 ? 15.578  -5.011  14.101  1.00 0.00 ? 15  ILE A HD11 7  
ATOM   8666  H  HD12 . ILE A 1 15 ? 15.133  -4.859  12.403  1.00 0.00 ? 15  ILE A HD12 7  
ATOM   8667  H  HD13 . ILE A 1 15 ? 15.505  -3.420  13.349  1.00 0.00 ? 15  ILE A HD13 7  
ATOM   8668  N  N    . CYS A 1 16 ? 17.119  -2.691  8.436   1.00 0.00 ? 16  CYS A N    7  
ATOM   8669  C  CA   . CYS A 1 16 ? 17.625  -2.157  7.149   1.00 0.00 ? 16  CYS A CA   7  
ATOM   8670  C  C    . CYS A 1 16 ? 18.863  -1.265  7.383   1.00 0.00 ? 16  CYS A C    7  
ATOM   8671  O  O    . CYS A 1 16 ? 19.637  -1.039  6.448   1.00 0.00 ? 16  CYS A O    7  
ATOM   8672  C  CB   . CYS A 1 16 ? 16.499  -1.363  6.440   1.00 0.00 ? 16  CYS A CB   7  
ATOM   8673  S  SG   . CYS A 1 16 ? 16.858  -0.899  4.728   1.00 0.00 ? 16  CYS A SG   7  
ATOM   8674  H  H    . CYS A 1 16 ? 16.508  -2.141  8.964   1.00 0.00 ? 16  CYS A H    7  
ATOM   8675  H  HA   . CYS A 1 16 ? 17.911  -2.993  6.508   1.00 0.00 ? 16  CYS A HA   7  
ATOM   8676  H  HB2  . CYS A 1 16 ? 15.602  -1.968  6.414   1.00 0.00 ? 16  CYS A HB2  7  
ATOM   8677  H  HB3  . CYS A 1 16 ? 16.284  -0.454  6.991   1.00 0.00 ? 16  CYS A HB3  7  
ATOM   8678  N  N    . GLU A 1 17 ? 18.951  -0.724  8.636   1.00 0.00 ? 17  GLU A N    7  
ATOM   8679  C  CA   . GLU A 1 17 ? 20.063  0.098   9.225   1.00 0.00 ? 17  GLU A CA   7  
ATOM   8680  C  C    . GLU A 1 17 ? 19.593  1.542   9.512   1.00 0.00 ? 17  GLU A C    7  
ATOM   8681  O  O    . GLU A 1 17 ? 20.131  2.202   10.410  1.00 0.00 ? 17  GLU A O    7  
ATOM   8682  C  CB   . GLU A 1 17 ? 21.416  0.118   8.429   1.00 0.00 ? 17  GLU A CB   7  
ATOM   8683  C  CG   . GLU A 1 17 ? 22.282  -1.155  8.573   1.00 0.00 ? 17  GLU A CG   7  
ATOM   8684  C  CD   . GLU A 1 17 ? 22.830  -1.356  9.999   1.00 0.00 ? 17  GLU A CD   7  
ATOM   8685  O  OE1  . GLU A 1 17 ? 23.918  -0.817  10.318  1.00 0.00 ? 17  GLU A OE1  7  
ATOM   8686  O  OE2  . GLU A 1 17 ? 22.170  -2.040  10.815  1.00 0.00 ? 17  GLU A OE2  7  
ATOM   8687  H  H    . GLU A 1 17 ? 18.152  -0.816  9.188   1.00 0.00 ? 17  GLU A H    7  
ATOM   8688  H  HA   . GLU A 1 17 ? 20.261  -0.365  10.190  1.00 0.00 ? 17  GLU A HA   7  
ATOM   8689  H  HB2  . GLU A 1 17 ? 21.192  0.246   7.379   1.00 0.00 ? 17  GLU A HB2  7  
ATOM   8690  H  HB3  . GLU A 1 17 ? 22.015  0.967   8.756   1.00 0.00 ? 17  GLU A HB3  7  
ATOM   8691  H  HG2  . GLU A 1 17 ? 21.674  -2.015  8.307   1.00 0.00 ? 17  GLU A HG2  7  
ATOM   8692  H  HG3  . GLU A 1 17 ? 23.114  -1.092  7.878   1.00 0.00 ? 17  GLU A HG3  7  
ATOM   8693  N  N    . TYR A 1 18 ? 18.591  2.023   8.750   1.00 0.00 ? 18  TYR A N    7  
ATOM   8694  C  CA   . TYR A 1 18 ? 18.034  3.384   8.913   1.00 0.00 ? 18  TYR A CA   7  
ATOM   8695  C  C    . TYR A 1 18 ? 16.497  3.332   8.856   1.00 0.00 ? 18  TYR A C    7  
ATOM   8696  O  O    . TYR A 1 18 ? 15.799  3.820   9.749   1.00 0.00 ? 18  TYR A O    7  
ATOM   8697  C  CB   . TYR A 1 18 ? 18.593  4.333   7.817   1.00 0.00 ? 18  TYR A CB   7  
ATOM   8698  C  CG   . TYR A 1 18 ? 18.389  5.810   8.160   1.00 0.00 ? 18  TYR A CG   7  
ATOM   8699  C  CD1  . TYR A 1 18 ? 18.734  6.274   9.427   1.00 0.00 ? 18  TYR A CD1  7  
ATOM   8700  C  CD2  . TYR A 1 18 ? 17.841  6.725   7.260   1.00 0.00 ? 18  TYR A CD2  7  
ATOM   8701  C  CE1  . TYR A 1 18 ? 18.548  7.576   9.788   1.00 0.00 ? 18  TYR A CE1  7  
ATOM   8702  C  CE2  . TYR A 1 18 ? 17.646  8.049   7.623   1.00 0.00 ? 18  TYR A CE2  7  
ATOM   8703  C  CZ   . TYR A 1 18 ? 17.997  8.469   8.890   1.00 0.00 ? 18  TYR A CZ   7  
ATOM   8704  O  OH   . TYR A 1 18 ? 17.800  9.786   9.264   1.00 0.00 ? 18  TYR A OH   7  
ATOM   8705  H  H    . TYR A 1 18 ? 18.186  1.431   8.085   1.00 0.00 ? 18  TYR A H    7  
ATOM   8706  H  HA   . TYR A 1 18 ? 18.326  3.774   9.899   1.00 0.00 ? 18  TYR A HA   7  
ATOM   8707  H  HB2  . TYR A 1 18 ? 19.651  4.160   7.707   1.00 0.00 ? 18  TYR A HB2  7  
ATOM   8708  H  HB3  . TYR A 1 18 ? 18.104  4.129   6.869   1.00 0.00 ? 18  TYR A HB3  7  
ATOM   8709  H  HD1  . TYR A 1 18 ? 19.169  5.582   10.142  1.00 0.00 ? 18  TYR A HD1  7  
ATOM   8710  H  HD2  . TYR A 1 18 ? 17.563  6.390   6.268   1.00 0.00 ? 18  TYR A HD2  7  
ATOM   8711  H  HE1  . TYR A 1 18 ? 18.819  7.890   10.786  1.00 0.00 ? 18  TYR A HE1  7  
ATOM   8712  H  HE2  . TYR A 1 18 ? 17.219  8.744   6.914   1.00 0.00 ? 18  TYR A HE2  7  
ATOM   8713  H  HH   . TYR A 1 18 ? 18.586  10.111  9.722   1.00 0.00 ? 18  TYR A HH   7  
ATOM   8714  N  N    . CYS A 1 19 ? 15.987  2.694   7.796   1.00 0.00 ? 19  CYS A N    7  
ATOM   8715  C  CA   . CYS A 1 19 ? 14.542  2.668   7.466   1.00 0.00 ? 19  CYS A CA   7  
ATOM   8716  C  C    . CYS A 1 19 ? 13.946  1.250   7.607   1.00 0.00 ? 19  CYS A C    7  
ATOM   8717  O  O    . CYS A 1 19 ? 13.427  0.675   6.647   1.00 0.00 ? 19  CYS A O    7  
ATOM   8718  C  CB   . CYS A 1 19 ? 14.335  3.259   6.042   1.00 0.00 ? 19  CYS A CB   7  
ATOM   8719  S  SG   . CYS A 1 19 ? 15.628  2.788   4.849   1.00 0.00 ? 19  CYS A SG   7  
ATOM   8720  H  H    . CYS A 1 19 ? 16.611  2.210   7.209   1.00 0.00 ? 19  CYS A H    7  
ATOM   8721  H  HA   . CYS A 1 19 ? 14.016  3.307   8.176   1.00 0.00 ? 19  CYS A HA   7  
ATOM   8722  H  HB2  . CYS A 1 19 ? 13.385  2.929   5.641   1.00 0.00 ? 19  CYS A HB2  7  
ATOM   8723  H  HB3  . CYS A 1 19 ? 14.331  4.340   6.098   1.00 0.00 ? 19  CYS A HB3  7  
ATOM   8724  N  N    . ALA A 1 20 ? 14.083  0.681   8.817   1.00 0.00 ? 20  ALA A N    7  
ATOM   8725  C  CA   . ALA A 1 20 ? 13.335  -0.513  9.256   1.00 0.00 ? 20  ALA A CA   7  
ATOM   8726  C  C    . ALA A 1 20 ? 13.344  -0.590  10.773  1.00 0.00 ? 20  ALA A C    7  
ATOM   8727  O  O    . ALA A 1 20 ? 14.418  -0.733  11.371  1.00 0.00 ? 20  ALA A O    7  
ATOM   8728  C  CB   . ALA A 1 20 ? 13.912  -1.808  8.684   1.00 0.00 ? 20  ALA A CB   7  
ATOM   8729  H  H    . ALA A 1 20 ? 14.737  1.060   9.438   1.00 0.00 ? 20  ALA A H    7  
ATOM   8730  H  HA   . ALA A 1 20 ? 12.316  -0.408  8.912   1.00 0.00 ? 20  ALA A HA   7  
ATOM   8731  H  HB1  . ALA A 1 20 ? 13.912  -1.756  7.602   1.00 0.00 ? 20  ALA A HB1  7  
ATOM   8732  H  HB2  . ALA A 1 20 ? 13.307  -2.655  8.995   1.00 0.00 ? 20  ALA A HB2  7  
ATOM   8733  H  HB3  . ALA A 1 20 ? 14.929  -1.950  9.033   1.00 0.00 ? 20  ALA A HB3  7  
ATOM   8734  N  N    . ARG A 1 21 ? 12.163  -0.485  11.397  1.00 0.00 ? 21  ARG A N    7  
ATOM   8735  C  CA   . ARG A 1 21 ? 12.070  -0.663  12.849  1.00 0.00 ? 21  ARG A CA   7  
ATOM   8736  C  C    . ARG A 1 21 ? 12.361  -2.150  13.182  1.00 0.00 ? 21  ARG A C    7  
ATOM   8737  O  O    . ARG A 1 21 ? 13.189  -2.429  14.053  1.00 0.00 ? 21  ARG A O    7  
ATOM   8738  C  CB   . ARG A 1 21 ? 10.724  -0.136  13.443  1.00 0.00 ? 21  ARG A CB   7  
ATOM   8739  C  CG   . ARG A 1 21 ? 9.440   -0.907  13.060  1.00 0.00 ? 21  ARG A CG   7  
ATOM   8740  C  CD   . ARG A 1 21 ? 8.211   -0.472  13.890  1.00 0.00 ? 21  ARG A CD   7  
ATOM   8741  N  NE   . ARG A 1 21 ? 8.474   -0.577  15.342  1.00 0.00 ? 21  ARG A NE   7  
ATOM   8742  C  CZ   . ARG A 1 21 ? 7.575   -0.859  16.292  1.00 0.00 ? 21  ARG A CZ   7  
ATOM   8743  N  NH1  . ARG A 1 21 ? 6.296   -1.088  16.002  1.00 0.00 ? 21  ARG A NH1  7  
ATOM   8744  N  NH2  . ARG A 1 21 ? 7.976   -0.916  17.560  1.00 0.00 ? 21  ARG A NH2  7  
ATOM   8745  H  H    . ARG A 1 21 ? 11.391  -0.189  10.868  1.00 0.00 ? 21  ARG A H    7  
ATOM   8746  H  HA   . ARG A 1 21 ? 12.879  -0.067  13.282  1.00 0.00 ? 21  ARG A HA   7  
ATOM   8747  H  HB2  . ARG A 1 21 ? 10.805  -0.146  14.525  1.00 0.00 ? 21  ARG A HB2  7  
ATOM   8748  H  HB3  . ARG A 1 21 ? 10.598  0.897   13.128  1.00 0.00 ? 21  ARG A HB3  7  
ATOM   8749  H  HG2  . ARG A 1 21 ? 9.230   -0.742  12.011  1.00 0.00 ? 21  ARG A HG2  7  
ATOM   8750  H  HG3  . ARG A 1 21 ? 9.609   -1.967  13.223  1.00 0.00 ? 21  ARG A HG3  7  
ATOM   8751  H  HD2  . ARG A 1 21 ? 7.963   0.559   13.652  1.00 0.00 ? 21  ARG A HD2  7  
ATOM   8752  H  HD3  . ARG A 1 21 ? 7.370   -1.108  13.630  1.00 0.00 ? 21  ARG A HD3  7  
ATOM   8753  H  HE   . ARG A 1 21 ? 9.397   -0.427  15.629  1.00 0.00 ? 21  ARG A HE   7  
ATOM   8754  H  HH11 . ARG A 1 21 ? 5.982   -1.053  15.053  1.00 0.00 ? 21  ARG A HH11 7  
ATOM   8755  H  HH12 . ARG A 1 21 ? 5.640   -1.301  16.738  1.00 0.00 ? 21  ARG A HH12 7  
ATOM   8756  H  HH21 . ARG A 1 21 ? 8.939   -0.755  17.791  1.00 0.00 ? 21  ARG A HH21 7  
ATOM   8757  H  HH22 . ARG A 1 21 ? 7.319   -1.124  18.291  1.00 0.00 ? 21  ARG A HH22 7  
ATOM   8758  N  N    . ALA A 1 22 ? 11.693  -3.082  12.462  1.00 0.00 ? 22  ALA A N    7  
ATOM   8759  C  CA   . ALA A 1 22 ? 12.111  -4.495  12.333  1.00 0.00 ? 22  ALA A CA   7  
ATOM   8760  C  C    . ALA A 1 22 ? 11.266  -5.186  11.255  1.00 0.00 ? 22  ALA A C    7  
ATOM   8761  O  O    . ALA A 1 22 ? 10.243  -4.651  10.810  1.00 0.00 ? 22  ALA A O    7  
ATOM   8762  C  CB   . ALA A 1 22 ? 11.977  -5.242  13.680  1.00 0.00 ? 22  ALA A CB   7  
ATOM   8763  H  H    . ALA A 1 22 ? 10.827  -2.845  12.078  1.00 0.00 ? 22  ALA A H    7  
ATOM   8764  H  HA   . ALA A 1 22 ? 13.156  -4.519  12.020  1.00 0.00 ? 22  ALA A HA   7  
ATOM   8765  H  HB1  . ALA A 1 22 ? 12.315  -6.268  13.574  1.00 0.00 ? 22  ALA A HB1  7  
ATOM   8766  H  HB2  . ALA A 1 22 ? 10.943  -5.236  13.999  1.00 0.00 ? 22  ALA A HB2  7  
ATOM   8767  H  HB3  . ALA A 1 22 ? 12.581  -4.743  14.426  1.00 0.00 ? 22  ALA A HB3  7  
ATOM   8768  N  N    . PHE A 1 23 ? 11.733  -6.355  10.796  1.00 0.00 ? 23  PHE A N    7  
ATOM   8769  C  CA   . PHE A 1 23 ? 10.941  -7.277  9.966   1.00 0.00 ? 23  PHE A CA   7  
ATOM   8770  C  C    . PHE A 1 23 ? 11.037  -8.692  10.529  1.00 0.00 ? 23  PHE A C    7  
ATOM   8771  O  O    . PHE A 1 23 ? 12.085  -9.104  11.041  1.00 0.00 ? 23  PHE A O    7  
ATOM   8772  C  CB   . PHE A 1 23 ? 11.418  -7.271  8.489   1.00 0.00 ? 23  PHE A CB   7  
ATOM   8773  C  CG   . PHE A 1 23 ? 11.178  -5.953  7.756   1.00 0.00 ? 23  PHE A CG   7  
ATOM   8774  C  CD1  . PHE A 1 23 ? 9.908   -5.613  7.295   1.00 0.00 ? 23  PHE A CD1  7  
ATOM   8775  C  CD2  . PHE A 1 23 ? 12.216  -5.058  7.521   1.00 0.00 ? 23  PHE A CD2  7  
ATOM   8776  C  CE1  . PHE A 1 23 ? 9.687   -4.420  6.635   1.00 0.00 ? 23  PHE A CE1  7  
ATOM   8777  C  CE2  . PHE A 1 23 ? 11.987  -3.869  6.856   1.00 0.00 ? 23  PHE A CE2  7  
ATOM   8778  C  CZ   . PHE A 1 23 ? 10.728  -3.553  6.413   1.00 0.00 ? 23  PHE A CZ   7  
ATOM   8779  H  H    . PHE A 1 23 ? 12.662  -6.589  10.989  1.00 0.00 ? 23  PHE A H    7  
ATOM   8780  H  HA   . PHE A 1 23 ? 9.895   -6.966  10.000  1.00 0.00 ? 23  PHE A HA   7  
ATOM   8781  H  HB2  . PHE A 1 23 ? 12.484  -7.492  8.458   1.00 0.00 ? 23  PHE A HB2  7  
ATOM   8782  H  HB3  . PHE A 1 23 ? 10.896  -8.051  7.947   1.00 0.00 ? 23  PHE A HB3  7  
ATOM   8783  H  HD1  . PHE A 1 23 ? 9.077   -6.295  7.457   1.00 0.00 ? 23  PHE A HD1  7  
ATOM   8784  H  HD2  . PHE A 1 23 ? 13.215  -5.299  7.862   1.00 0.00 ? 23  PHE A HD2  7  
ATOM   8785  H  HE1  . PHE A 1 23 ? 8.698   -4.169  6.285   1.00 0.00 ? 23  PHE A HE1  7  
ATOM   8786  H  HE2  . PHE A 1 23 ? 12.807  -3.182  6.684   1.00 0.00 ? 23  PHE A HE2  7  
ATOM   8787  H  HZ   . PHE A 1 23 ? 10.556  -2.619  5.895   1.00 0.00 ? 23  PHE A HZ   7  
ATOM   8788  N  N    . LYS A 1 24 ? 9.921   -9.416  10.438  1.00 0.00 ? 24  LYS A N    7  
ATOM   8789  C  CA   . LYS A 1 24 ? 9.835   -10.838 10.780  1.00 0.00 ? 24  LYS A CA   7  
ATOM   8790  C  C    . LYS A 1 24 ? 10.494  -11.705 9.687   1.00 0.00 ? 24  LYS A C    7  
ATOM   8791  O  O    . LYS A 1 24 ? 10.981  -12.802 9.978   1.00 0.00 ? 24  LYS A O    7  
ATOM   8792  C  CB   . LYS A 1 24 ? 8.339   -11.227 10.976  1.00 0.00 ? 24  LYS A CB   7  
ATOM   8793  C  CG   . LYS A 1 24 ? 8.083   -12.691 11.411  1.00 0.00 ? 24  LYS A CG   7  
ATOM   8794  C  CD   . LYS A 1 24 ? 6.578   -13.027 11.568  1.00 0.00 ? 24  LYS A CD   7  
ATOM   8795  C  CE   . LYS A 1 24 ? 5.783   -12.870 10.259  1.00 0.00 ? 24  LYS A CE   7  
ATOM   8796  N  NZ   . LYS A 1 24 ? 6.293   -13.770 9.186   1.00 0.00 ? 24  LYS A NZ   7  
ATOM   8797  H  H    . LYS A 1 24 ? 9.099   -8.966  10.156  1.00 0.00 ? 24  LYS A H    7  
ATOM   8798  H  HA   . LYS A 1 24 ? 10.362  -10.992 11.717  1.00 0.00 ? 24  LYS A HA   7  
ATOM   8799  H  HB2  . LYS A 1 24 ? 7.908   -10.578 11.730  1.00 0.00 ? 24  LYS A HB2  7  
ATOM   8800  H  HB3  . LYS A 1 24 ? 7.817   -11.057 10.041  1.00 0.00 ? 24  LYS A HB3  7  
ATOM   8801  H  HG2  . LYS A 1 24 ? 8.510   -13.353 10.668  1.00 0.00 ? 24  LYS A HG2  7  
ATOM   8802  H  HG3  . LYS A 1 24 ? 8.581   -12.863 12.360  1.00 0.00 ? 24  LYS A HG3  7  
ATOM   8803  H  HD2  . LYS A 1 24 ? 6.487   -14.055 11.902  1.00 0.00 ? 24  LYS A HD2  7  
ATOM   8804  H  HD3  . LYS A 1 24 ? 6.148   -12.376 12.324  1.00 0.00 ? 24  LYS A HD3  7  
ATOM   8805  H  HE2  . LYS A 1 24 ? 4.745   -13.109 10.449  1.00 0.00 ? 24  LYS A HE2  7  
ATOM   8806  H  HE3  . LYS A 1 24 ? 5.853   -11.844 9.920   1.00 0.00 ? 24  LYS A HE3  7  
ATOM   8807  H  HZ1  . LYS A 1 24 ? 6.202   -14.763 9.477   1.00 0.00 ? 24  LYS A HZ1  7  
ATOM   8808  H  HZ2  . LYS A 1 24 ? 7.296   -13.570 8.997   1.00 0.00 ? 24  LYS A HZ2  7  
ATOM   8809  H  HZ3  . LYS A 1 24 ? 5.753   -13.623 8.309   1.00 0.00 ? 24  LYS A HZ3  7  
ATOM   8810  N  N    . SER A 1 25 ? 10.556  -11.174 8.445   1.00 0.00 ? 25  SER A N    7  
ATOM   8811  C  CA   . SER A 1 25 ? 10.983  -11.930 7.252   1.00 0.00 ? 25  SER A CA   7  
ATOM   8812  C  C    . SER A 1 25 ? 11.868  -11.050 6.349   1.00 0.00 ? 25  SER A C    7  
ATOM   8813  O  O    . SER A 1 25 ? 11.604  -9.852  6.174   1.00 0.00 ? 25  SER A O    7  
ATOM   8814  C  CB   . SER A 1 25 ? 9.734   -12.413 6.467   1.00 0.00 ? 25  SER A CB   7  
ATOM   8815  O  OG   . SER A 1 25 ? 10.083  -13.076 5.259   1.00 0.00 ? 25  SER A OG   7  
ATOM   8816  H  H    . SER A 1 25 ? 10.330  -10.226 8.321   1.00 0.00 ? 25  SER A H    7  
ATOM   8817  H  HA   . SER A 1 25 ? 11.556  -12.801 7.575   1.00 0.00 ? 25  SER A HA   7  
ATOM   8818  H  HB2  . SER A 1 25 ? 9.167   -13.105 7.080   1.00 0.00 ? 25  SER A HB2  7  
ATOM   8819  H  HB3  . SER A 1 25 ? 9.099   -11.563 6.223   1.00 0.00 ? 25  SER A HB3  7  
ATOM   8820  H  HG   . SER A 1 25 ? 10.138  -14.029 5.417   1.00 0.00 ? 25  SER A HG   7  
ATOM   8821  N  N    . SER A 1 26 ? 12.921  -11.673 5.790   1.00 0.00 ? 26  SER A N    7  
ATOM   8822  C  CA   . SER A 1 26 ? 13.793  -11.049 4.777   1.00 0.00 ? 26  SER A CA   7  
ATOM   8823  C  C    . SER A 1 26 ? 13.033  -10.823 3.444   1.00 0.00 ? 26  SER A C    7  
ATOM   8824  O  O    . SER A 1 26 ? 13.395  -9.940  2.665   1.00 0.00 ? 26  SER A O    7  
ATOM   8825  C  CB   . SER A 1 26 ? 15.048  -11.918 4.543   1.00 0.00 ? 26  SER A CB   7  
ATOM   8826  O  OG   . SER A 1 26 ? 15.934  -11.314 3.616   1.00 0.00 ? 26  SER A OG   7  
ATOM   8827  H  H    . SER A 1 26 ? 13.123  -12.581 6.102   1.00 0.00 ? 26  SER A H    7  
ATOM   8828  H  HA   . SER A 1 26 ? 14.106  -10.078 5.164   1.00 0.00 ? 26  SER A HA   7  
ATOM   8829  H  HB2  . SER A 1 26 ? 15.575  -12.053 5.479   1.00 0.00 ? 26  SER A HB2  7  
ATOM   8830  H  HB3  . SER A 1 26 ? 14.754  -12.888 4.160   1.00 0.00 ? 26  SER A HB3  7  
ATOM   8831  H  HG   . SER A 1 26 ? 16.714  -11.868 3.512   1.00 0.00 ? 26  SER A HG   7  
ATOM   8832  N  N    . HIS A 1 27 ? 11.986  -11.637 3.181   1.00 0.00 ? 27  HIS A N    7  
ATOM   8833  C  CA   . HIS A 1 27 ? 11.104  -11.459 1.996   1.00 0.00 ? 27  HIS A CA   7  
ATOM   8834  C  C    . HIS A 1 27 ? 10.229  -10.203 2.150   1.00 0.00 ? 27  HIS A C    7  
ATOM   8835  O  O    . HIS A 1 27 ? 9.984   -9.488  1.173   1.00 0.00 ? 27  HIS A O    7  
ATOM   8836  C  CB   . HIS A 1 27 ? 10.219  -12.712 1.749   1.00 0.00 ? 27  HIS A CB   7  
ATOM   8837  C  CG   . HIS A 1 27 ? 10.954  -13.870 1.129   1.00 0.00 ? 27  HIS A CG   7  
ATOM   8838  N  ND1  . HIS A 1 27 ? 11.121  -15.093 1.741   1.00 0.00 ? 27  HIS A ND1  7  
ATOM   8839  C  CD2  . HIS A 1 27 ? 11.556  -13.974 -0.074  1.00 0.00 ? 27  HIS A CD2  7  
ATOM   8840  C  CE1  . HIS A 1 27 ? 11.794  -15.896 0.939   1.00 0.00 ? 27  HIS A CE1  7  
ATOM   8841  N  NE2  . HIS A 1 27 ? 12.068  -15.240 -0.170  1.00 0.00 ? 27  HIS A NE2  7  
ATOM   8842  H  H    . HIS A 1 27 ? 11.802  -12.382 3.799   1.00 0.00 ? 27  HIS A H    7  
ATOM   8843  H  HA   . HIS A 1 27 ? 11.748  -11.314 1.134   1.00 0.00 ? 27  HIS A HA   7  
ATOM   8844  H  HB2  . HIS A 1 27 ? 9.806   -13.046 2.690   1.00 0.00 ? 27  HIS A HB2  7  
ATOM   8845  H  HB3  . HIS A 1 27 ? 9.404   -12.457 1.083   1.00 0.00 ? 27  HIS A HB3  7  
ATOM   8846  H  HD1  . HIS A 1 27 ? 10.791  -15.340 2.635   1.00 0.00 ? 27  HIS A HD1  7  
ATOM   8847  H  HD2  . HIS A 1 27 ? 11.608  -13.203 -0.833  1.00 0.00 ? 27  HIS A HD2  7  
ATOM   8848  H  HE1  . HIS A 1 27 ? 12.075  -16.920 1.159   1.00 0.00 ? 27  HIS A HE1  7  
ATOM   8849  H  HE2  . HIS A 1 27 ? 12.391  -15.654 -0.997  1.00 0.00 ? 27  HIS A HE2  7  
ATOM   8850  N  N    . ASN A 1 28 ? 9.765   -9.962  3.383   1.00 0.00 ? 28  ASN A N    7  
ATOM   8851  C  CA   . ASN A 1 28 ? 8.970   -8.765  3.740   1.00 0.00 ? 28  ASN A CA   7  
ATOM   8852  C  C    . ASN A 1 28 ? 9.838   -7.506  3.591   1.00 0.00 ? 28  ASN A C    7  
ATOM   8853  O  O    . ASN A 1 28 ? 9.408   -6.471  3.084   1.00 0.00 ? 28  ASN A O    7  
ATOM   8854  C  CB   . ASN A 1 28 ? 8.491   -8.861  5.206   1.00 0.00 ? 28  ASN A CB   7  
ATOM   8855  C  CG   . ASN A 1 28 ? 7.239   -8.014  5.476   1.00 0.00 ? 28  ASN A CG   7  
ATOM   8856  O  OD1  . ASN A 1 28 ? 6.123   -8.535  5.522   1.00 0.00 ? 28  ASN A OD1  7  
ATOM   8857  N  ND2  . ASN A 1 28 ? 7.401   -6.703  5.595   1.00 0.00 ? 28  ASN A ND2  7  
ATOM   8858  H  H    . ASN A 1 28 ? 9.965   -10.611 4.084   1.00 0.00 ? 28  ASN A H    7  
ATOM   8859  H  HA   . ASN A 1 28 ? 8.112   -8.704  3.073   1.00 0.00 ? 28  ASN A HA   7  
ATOM   8860  H  HB2  . ASN A 1 28 ? 8.261   -9.896  5.439   1.00 0.00 ? 28  ASN A HB2  7  
ATOM   8861  H  HB3  . ASN A 1 28 ? 9.297   -8.531  5.871   1.00 0.00 ? 28  ASN A HB3  7  
ATOM   8862  H  HD21 . ASN A 1 28 ? 8.301   -6.334  5.503   1.00 0.00 ? 28  ASN A HD21 7  
ATOM   8863  H  HD22 . ASN A 1 28 ? 6.606   -6.152  5.764   1.00 0.00 ? 28  ASN A HD22 7  
ATOM   8864  N  N    . LEU A 1 29 ? 11.060  -7.635  4.106   1.00 0.00 ? 29  LEU A N    7  
ATOM   8865  C  CA   . LEU A 1 29 ? 12.123  -6.634  4.004   1.00 0.00 ? 29  LEU A CA   7  
ATOM   8866  C  C    . LEU A 1 29 ? 12.487  -6.363  2.531   1.00 0.00 ? 29  LEU A C    7  
ATOM   8867  O  O    . LEU A 1 29 ? 12.745  -5.224  2.183   1.00 0.00 ? 29  LEU A O    7  
ATOM   8868  C  CB   . LEU A 1 29 ? 13.330  -7.132  4.864   1.00 0.00 ? 29  LEU A CB   7  
ATOM   8869  C  CG   . LEU A 1 29 ? 14.785  -6.753  4.422   1.00 0.00 ? 29  LEU A CG   7  
ATOM   8870  C  CD1  . LEU A 1 29 ? 15.064  -5.235  4.558   1.00 0.00 ? 29  LEU A CD1  7  
ATOM   8871  C  CD2  . LEU A 1 29 ? 15.825  -7.616  5.178   1.00 0.00 ? 29  LEU A CD2  7  
ATOM   8872  H  H    . LEU A 1 29 ? 11.256  -8.455  4.602   1.00 0.00 ? 29  LEU A H    7  
ATOM   8873  H  HA   . LEU A 1 29 ? 11.743  -5.711  4.434   1.00 0.00 ? 29  LEU A HA   7  
ATOM   8874  H  HB2  . LEU A 1 29 ? 13.189  -6.742  5.870   1.00 0.00 ? 29  LEU A HB2  7  
ATOM   8875  H  HB3  . LEU A 1 29 ? 13.258  -8.215  4.927   1.00 0.00 ? 29  LEU A HB3  7  
ATOM   8876  H  HG   . LEU A 1 29 ? 14.890  -6.988  3.370   1.00 0.00 ? 29  LEU A HG   7  
ATOM   8877  H  HD11 . LEU A 1 29 ? 16.066  -5.023  4.212   1.00 0.00 ? 29  LEU A HD11 7  
ATOM   8878  H  HD12 . LEU A 1 29 ? 14.964  -4.924  5.590   1.00 0.00 ? 29  LEU A HD12 7  
ATOM   8879  H  HD13 . LEU A 1 29 ? 14.357  -4.687  3.948   1.00 0.00 ? 29  LEU A HD13 7  
ATOM   8880  H  HD21 . LEU A 1 29 ? 16.824  -7.353  4.858   1.00 0.00 ? 29  LEU A HD21 7  
ATOM   8881  H  HD22 . LEU A 1 29 ? 15.648  -8.662  4.954   1.00 0.00 ? 29  LEU A HD22 7  
ATOM   8882  H  HD23 . LEU A 1 29 ? 15.735  -7.461  6.247   1.00 0.00 ? 29  LEU A HD23 7  
ATOM   8883  N  N    . ALA A 1 30 ? 12.478  -7.414  1.688   1.00 0.00 ? 30  ALA A N    7  
ATOM   8884  C  CA   . ALA A 1 30 ? 12.707  -7.297  0.220   1.00 0.00 ? 30  ALA A CA   7  
ATOM   8885  C  C    . ALA A 1 30 ? 11.636  -6.417  -0.472  1.00 0.00 ? 30  ALA A C    7  
ATOM   8886  O  O    . ALA A 1 30 ? 11.939  -5.710  -1.441  1.00 0.00 ? 30  ALA A O    7  
ATOM   8887  C  CB   . ALA A 1 30 ? 12.759  -8.692  -0.431  1.00 0.00 ? 30  ALA A CB   7  
ATOM   8888  H  H    . ALA A 1 30 ? 12.338  -8.298  2.070   1.00 0.00 ? 30  ALA A H    7  
ATOM   8889  H  HA   . ALA A 1 30 ? 13.679  -6.834  0.084   1.00 0.00 ? 30  ALA A HA   7  
ATOM   8890  H  HB1  . ALA A 1 30 ? 12.977  -8.596  -1.486  1.00 0.00 ? 30  ALA A HB1  7  
ATOM   8891  H  HB2  . ALA A 1 30 ? 11.807  -9.194  -0.306  1.00 0.00 ? 30  ALA A HB2  7  
ATOM   8892  H  HB3  . ALA A 1 30 ? 13.533  -9.284  0.040   1.00 0.00 ? 30  ALA A HB3  7  
ATOM   8893  N  N    . VAL A 1 31 ? 10.394  -6.479  0.053   1.00 0.00 ? 31  VAL A N    7  
ATOM   8894  C  CA   . VAL A 1 31 ? 9.258   -5.655  -0.425  1.00 0.00 ? 31  VAL A CA   7  
ATOM   8895  C  C    . VAL A 1 31 ? 9.549   -4.148  -0.201  1.00 0.00 ? 31  VAL A C    7  
ATOM   8896  O  O    . VAL A 1 31 ? 9.326   -3.322  -1.088  1.00 0.00 ? 31  VAL A O    7  
ATOM   8897  C  CB   . VAL A 1 31 ? 7.915   -6.077  0.288   1.00 0.00 ? 31  VAL A CB   7  
ATOM   8898  C  CG1  . VAL A 1 31 ? 6.721   -5.190  -0.140  1.00 0.00 ? 31  VAL A CG1  7  
ATOM   8899  C  CG2  . VAL A 1 31 ? 7.612   -7.582  0.046   1.00 0.00 ? 31  VAL A CG2  7  
ATOM   8900  H  H    . VAL A 1 31 ? 10.241  -7.111  0.785   1.00 0.00 ? 31  VAL A H    7  
ATOM   8901  H  HA   . VAL A 1 31 ? 9.147   -5.832  -1.494  1.00 0.00 ? 31  VAL A HA   7  
ATOM   8902  H  HB   . VAL A 1 31 ? 8.053   -5.940  1.359   1.00 0.00 ? 31  VAL A HB   7  
ATOM   8903  H  HG11 . VAL A 1 31 ? 5.825   -5.501  0.384   1.00 0.00 ? 31  VAL A HG11 7  
ATOM   8904  H  HG12 . VAL A 1 31 ? 6.559   -5.290  -1.205  1.00 0.00 ? 31  VAL A HG12 7  
ATOM   8905  H  HG13 . VAL A 1 31 ? 6.932   -4.157  0.094   1.00 0.00 ? 31  VAL A HG13 7  
ATOM   8906  H  HG21 . VAL A 1 31 ? 8.425   -8.182  0.427   1.00 0.00 ? 31  VAL A HG21 7  
ATOM   8907  H  HG22 . VAL A 1 31 ? 7.494   -7.766  -1.014  1.00 0.00 ? 31  VAL A HG22 7  
ATOM   8908  H  HG23 . VAL A 1 31 ? 6.694   -7.858  0.558   1.00 0.00 ? 31  VAL A HG23 7  
ATOM   8909  N  N    . HIS A 1 32 ? 10.065  -3.822  0.999   1.00 0.00 ? 32  HIS A N    7  
ATOM   8910  C  CA   . HIS A 1 32 ? 10.530  -2.461  1.355   1.00 0.00 ? 32  HIS A CA   7  
ATOM   8911  C  C    . HIS A 1 32 ? 11.804  -2.100  0.575   1.00 0.00 ? 32  HIS A C    7  
ATOM   8912  O  O    . HIS A 1 32 ? 11.993  -0.952  0.152   1.00 0.00 ? 32  HIS A O    7  
ATOM   8913  C  CB   . HIS A 1 32 ? 10.785  -2.367  2.896   1.00 0.00 ? 32  HIS A CB   7  
ATOM   8914  C  CG   . HIS A 1 32 ? 11.708  -1.239  3.308   1.00 0.00 ? 32  HIS A CG   7  
ATOM   8915  N  ND1  . HIS A 1 32 ? 11.335  0.079   3.343   1.00 0.00 ? 32  HIS A ND1  7  
ATOM   8916  C  CD2  . HIS A 1 32 ? 13.035  -1.263  3.618   1.00 0.00 ? 32  HIS A CD2  7  
ATOM   8917  C  CE1  . HIS A 1 32 ? 12.410  0.803   3.659   1.00 0.00 ? 32  HIS A CE1  7  
ATOM   8918  N  NE2  . HIS A 1 32 ? 13.476  0.045   3.830   1.00 0.00 ? 32  HIS A NE2  7  
ATOM   8919  H  H    . HIS A 1 32 ? 10.127  -4.524  1.677   1.00 0.00 ? 32  HIS A H    7  
ATOM   8920  H  HA   . HIS A 1 32 ? 9.753   -1.759  1.075   1.00 0.00 ? 32  HIS A HA   7  
ATOM   8921  H  HB2  . HIS A 1 32 ? 9.840   -2.215  3.412   1.00 0.00 ? 32  HIS A HB2  7  
ATOM   8922  H  HB3  . HIS A 1 32 ? 11.222  -3.294  3.246   1.00 0.00 ? 32  HIS A HB3  7  
ATOM   8923  H  HD1  . HIS A 1 32 ? 10.435  0.430   3.167   1.00 0.00 ? 32  HIS A HD1  7  
ATOM   8924  H  HD2  . HIS A 1 32 ? 13.653  -2.152  3.671   1.00 0.00 ? 32  HIS A HD2  7  
ATOM   8925  H  HE1  . HIS A 1 32 ? 12.409  1.880   3.755   1.00 0.00 ? 32  HIS A HE1  7  
ATOM   8926  N  N    . ARG A 1 33 ? 12.669  -3.102  0.407   1.00 0.00 ? 33  ARG A N    7  
ATOM   8927  C  CA   . ARG A 1 33 ? 14.017  -2.948  -0.166  1.00 0.00 ? 33  ARG A CA   7  
ATOM   8928  C  C    . ARG A 1 33 ? 13.964  -2.633  -1.670  1.00 0.00 ? 33  ARG A C    7  
ATOM   8929  O  O    . ARG A 1 33 ? 14.992  -2.406  -2.267  1.00 0.00 ? 33  ARG A O    7  
ATOM   8930  C  CB   . ARG A 1 33 ? 14.853  -4.225  0.140   1.00 0.00 ? 33  ARG A CB   7  
ATOM   8931  C  CG   . ARG A 1 33 ? 16.380  -4.117  -0.079  1.00 0.00 ? 33  ARG A CG   7  
ATOM   8932  C  CD   . ARG A 1 33 ? 17.142  -5.358  0.426   1.00 0.00 ? 33  ARG A CD   7  
ATOM   8933  N  NE   . ARG A 1 33 ? 16.673  -6.615  -0.195  1.00 0.00 ? 33  ARG A NE   7  
ATOM   8934  C  CZ   . ARG A 1 33 ? 16.476  -7.773  0.460   1.00 0.00 ? 33  ARG A CZ   7  
ATOM   8935  N  NH1  . ARG A 1 33 ? 16.624  -7.852  1.778   1.00 0.00 ? 33  ARG A NH1  7  
ATOM   8936  N  NH2  . ARG A 1 33 ? 16.092  -8.842  -0.218  1.00 0.00 ? 33  ARG A NH2  7  
ATOM   8937  H  H    . ARG A 1 33 ? 12.399  -3.982  0.720   1.00 0.00 ? 33  ARG A H    7  
ATOM   8938  H  HA   . ARG A 1 33 ? 14.484  -2.107  0.334   1.00 0.00 ? 33  ARG A HA   7  
ATOM   8939  H  HB2  . ARG A 1 33 ? 14.687  -4.494  1.178   1.00 0.00 ? 33  ARG A HB2  7  
ATOM   8940  H  HB3  . ARG A 1 33 ? 14.481  -5.033  -0.479  1.00 0.00 ? 33  ARG A HB3  7  
ATOM   8941  H  HG2  . ARG A 1 33 ? 16.575  -3.993  -1.139  1.00 0.00 ? 33  ARG A HG2  7  
ATOM   8942  H  HG3  . ARG A 1 33 ? 16.744  -3.243  0.449   1.00 0.00 ? 33  ARG A HG3  7  
ATOM   8943  H  HD2  . ARG A 1 33 ? 18.196  -5.237  0.195   1.00 0.00 ? 33  ARG A HD2  7  
ATOM   8944  H  HD3  . ARG A 1 33 ? 17.025  -5.424  1.504   1.00 0.00 ? 33  ARG A HD3  7  
ATOM   8945  H  HE   . ARG A 1 33 ? 16.522  -6.599  -1.168  1.00 0.00 ? 33  ARG A HE   7  
ATOM   8946  H  HH11 . ARG A 1 33 ? 16.887  -7.038  2.306   1.00 0.00 ? 33  ARG A HH11 7  
ATOM   8947  H  HH12 . ARG A 1 33 ? 16.500  -8.730  2.250   1.00 0.00 ? 33  ARG A HH12 7  
ATOM   8948  H  HH21 . ARG A 1 33 ? 15.951  -8.781  -1.219  1.00 0.00 ? 33  ARG A HH21 7  
ATOM   8949  H  HH22 . ARG A 1 33 ? 15.957  -9.717  0.246   1.00 0.00 ? 33  ARG A HH22 7  
ATOM   8950  N  N    . MET A 1 34 ? 12.736  -2.528  -2.238  1.00 0.00 ? 34  MET A N    7  
ATOM   8951  C  CA   . MET A 1 34 ? 12.477  -2.073  -3.642  1.00 0.00 ? 34  MET A CA   7  
ATOM   8952  C  C    . MET A 1 34 ? 13.264  -0.783  -4.058  1.00 0.00 ? 34  MET A C    7  
ATOM   8953  O  O    . MET A 1 34 ? 13.418  -0.497  -5.250  1.00 0.00 ? 34  MET A O    7  
ATOM   8954  C  CB   . MET A 1 34 ? 10.955  -1.827  -3.810  1.00 0.00 ? 34  MET A CB   7  
ATOM   8955  C  CG   . MET A 1 34 ? 10.385  -0.730  -2.898  1.00 0.00 ? 34  MET A CG   7  
ATOM   8956  S  SD   . MET A 1 34 ? 8.619   -0.433  -3.153  1.00 0.00 ? 34  MET A SD   7  
ATOM   8957  C  CE   . MET A 1 34 ? 8.288   0.799   -1.890  1.00 0.00 ? 34  MET A CE   7  
ATOM   8958  H  H    . MET A 1 34 ? 11.974  -2.858  -1.698  1.00 0.00 ? 34  MET A H    7  
ATOM   8959  H  HA   . MET A 1 34 ? 12.771  -2.876  -4.303  1.00 0.00 ? 34  MET A HA   7  
ATOM   8960  H  HB2  . MET A 1 34 ? 10.757  -1.554  -4.835  1.00 0.00 ? 34  MET A HB2  7  
ATOM   8961  H  HB3  . MET A 1 34 ? 10.430  -2.751  -3.596  1.00 0.00 ? 34  MET A HB3  7  
ATOM   8962  H  HG2  . MET A 1 34 ? 10.539  -1.026  -1.866  1.00 0.00 ? 34  MET A HG2  7  
ATOM   8963  H  HG3  . MET A 1 34 ? 10.919  0.194   -3.083  1.00 0.00 ? 34  MET A HG3  7  
ATOM   8964  H  HE1  . MET A 1 34 ? 7.245   1.101   -1.931  1.00 0.00 ? 34  MET A HE1  7  
ATOM   8965  H  HE2  . MET A 1 34 ? 8.915   1.662   -2.057  1.00 0.00 ? 34  MET A HE2  7  
ATOM   8966  H  HE3  . MET A 1 34 ? 8.502   0.378   -0.919  1.00 0.00 ? 34  MET A HE3  7  
ATOM   8967  N  N    . ILE A 1 35 ? 13.765  -0.044  -3.055  1.00 0.00 ? 35  ILE A N    7  
ATOM   8968  C  CA   . ILE A 1 35 ? 14.629  1.118   -3.238  1.00 0.00 ? 35  ILE A CA   7  
ATOM   8969  C  C    . ILE A 1 35 ? 16.121  0.647   -3.350  1.00 0.00 ? 35  ILE A C    7  
ATOM   8970  O  O    . ILE A 1 35 ? 16.784  0.929   -4.350  1.00 0.00 ? 35  ILE A O    7  
ATOM   8971  C  CB   . ILE A 1 35 ? 14.392  2.189   -2.083  1.00 0.00 ? 35  ILE A CB   7  
ATOM   8972  C  CG1  . ILE A 1 35 ? 15.595  3.165   -1.930  1.00 0.00 ? 35  ILE A CG1  7  
ATOM   8973  C  CG2  . ILE A 1 35 ? 14.017  1.532   -0.728  1.00 0.00 ? 35  ILE A CG2  7  
ATOM   8974  C  CD1  . ILE A 1 35 ? 15.862  4.086   -3.114  1.00 0.00 ? 35  ILE A CD1  7  
ATOM   8975  H  H    . ILE A 1 35 ? 13.642  -0.400  -2.166  1.00 0.00 ? 35  ILE A H    7  
ATOM   8976  H  HA   . ILE A 1 35 ? 14.353  1.591   -4.186  1.00 0.00 ? 35  ILE A HA   7  
ATOM   8977  H  HB   . ILE A 1 35 ? 13.525  2.777   -2.375  1.00 0.00 ? 35  ILE A HB   7  
ATOM   8978  H  HG12 . ILE A 1 35 ? 15.434  3.795   -1.071  1.00 0.00 ? 35  ILE A HG12 7  
ATOM   8979  H  HG13 . ILE A 1 35 ? 16.488  2.576   -1.763  1.00 0.00 ? 35  ILE A HG13 7  
ATOM   8980  H  HG21 . ILE A 1 35 ? 13.106  0.951   -0.840  1.00 0.00 ? 35  ILE A HG21 7  
ATOM   8981  H  HG22 . ILE A 1 35 ? 13.859  2.294   0.026   1.00 0.00 ? 35  ILE A HG22 7  
ATOM   8982  H  HG23 . ILE A 1 35 ? 14.817  0.878   -0.408  1.00 0.00 ? 35  ILE A HG23 7  
ATOM   8983  H  HD11 . ILE A 1 35 ? 16.720  4.705   -2.893  1.00 0.00 ? 35  ILE A HD11 7  
ATOM   8984  H  HD12 . ILE A 1 35 ? 15.003  4.718   -3.285  1.00 0.00 ? 35  ILE A HD12 7  
ATOM   8985  H  HD13 . ILE A 1 35 ? 16.064  3.500   -4.000  1.00 0.00 ? 35  ILE A HD13 7  
ATOM   8986  N  N    . HIS A 1 36 ? 16.613  -0.129  -2.357  1.00 0.00 ? 36  HIS A N    7  
ATOM   8987  C  CA   . HIS A 1 36 ? 18.068  -0.485  -2.213  1.00 0.00 ? 36  HIS A CA   7  
ATOM   8988  C  C    . HIS A 1 36 ? 18.383  -1.872  -2.836  1.00 0.00 ? 36  HIS A C    7  
ATOM   8989  O  O    . HIS A 1 36 ? 19.499  -2.381  -2.681  1.00 0.00 ? 36  HIS A O    7  
ATOM   8990  C  CB   . HIS A 1 36 ? 18.511  -0.506  -0.700  1.00 0.00 ? 36  HIS A CB   7  
ATOM   8991  C  CG   . HIS A 1 36 ? 17.667  0.301   0.254   1.00 0.00 ? 36  HIS A CG   7  
ATOM   8992  N  ND1  . HIS A 1 36 ? 17.836  1.640   0.507   1.00 0.00 ? 36  HIS A ND1  7  
ATOM   8993  C  CD2  . HIS A 1 36 ? 16.659  -0.104  1.065   1.00 0.00 ? 36  HIS A CD2  7  
ATOM   8994  C  CE1  . HIS A 1 36 ? 16.951  1.993   1.452   1.00 0.00 ? 36  HIS A CE1  7  
ATOM   8995  N  NE2  . HIS A 1 36 ? 16.204  0.967   1.832   1.00 0.00 ? 36  HIS A NE2  7  
ATOM   8996  H  H    . HIS A 1 36 ? 15.989  -0.514  -1.714  1.00 0.00 ? 36  HIS A H    7  
ATOM   8997  H  HA   . HIS A 1 36 ? 18.656  0.261   -2.741  1.00 0.00 ? 36  HIS A HA   7  
ATOM   8998  H  HB2  . HIS A 1 36 ? 18.505  -1.531  -0.331  1.00 0.00 ? 36  HIS A HB2  7  
ATOM   8999  H  HB3  . HIS A 1 36 ? 19.524  -0.136  -0.626  1.00 0.00 ? 36  HIS A HB3  7  
ATOM   9000  H  HD1  . HIS A 1 36 ? 18.493  2.235   0.080   1.00 0.00 ? 36  HIS A HD1  7  
ATOM   9001  H  HD2  . HIS A 1 36 ? 16.266  -1.106  1.124   1.00 0.00 ? 36  HIS A HD2  7  
ATOM   9002  H  HE1  . HIS A 1 36 ? 16.858  2.993   1.847   1.00 0.00 ? 36  HIS A HE1  7  
ATOM   9003  N  N    . THR A 1 37 ? 17.401  -2.447  -3.529  1.00 0.00 ? 37  THR A N    7  
ATOM   9004  C  CA   . THR A 1 37 ? 17.283  -3.907  -3.773  1.00 0.00 ? 37  THR A CA   7  
ATOM   9005  C  C    . THR A 1 37 ? 18.515  -4.562  -4.459  1.00 0.00 ? 37  THR A C    7  
ATOM   9006  O  O    . THR A 1 37 ? 19.191  -5.390  -3.826  1.00 0.00 ? 37  THR A O    7  
ATOM   9007  C  CB   . THR A 1 37 ? 15.931  -4.196  -4.541  1.00 0.00 ? 37  THR A CB   7  
ATOM   9008  O  OG1  . THR A 1 37 ? 15.816  -5.550  -4.941  1.00 0.00 ? 37  THR A OG1  7  
ATOM   9009  C  CG2  . THR A 1 37 ? 15.712  -3.282  -5.751  1.00 0.00 ? 37  THR A CG2  7  
ATOM   9010  H  H    . THR A 1 37 ? 16.701  -1.864  -3.888  1.00 0.00 ? 37  THR A H    7  
ATOM   9011  H  HA   . THR A 1 37 ? 17.180  -4.370  -2.792  1.00 0.00 ? 37  THR A HA   7  
ATOM   9012  H  HB   . THR A 1 37 ? 15.119  -4.005  -3.843  1.00 0.00 ? 37  THR A HB   7  
ATOM   9013  H  HG1  . THR A 1 37 ? 15.851  -6.116  -4.160  1.00 0.00 ? 37  THR A HG1  7  
ATOM   9014  H  HG21 . THR A 1 37 ? 15.710  -2.245  -5.434  1.00 0.00 ? 37  THR A HG21 7  
ATOM   9015  H  HG22 . THR A 1 37 ? 14.765  -3.513  -6.212  1.00 0.00 ? 37  THR A HG22 7  
ATOM   9016  H  HG23 . THR A 1 37 ? 16.504  -3.437  -6.469  1.00 0.00 ? 37  THR A HG23 7  
ATOM   9017  N  N    . GLY A 1 38 ? 18.813  -4.187  -5.710  1.00 0.00 ? 38  GLY A N    7  
ATOM   9018  C  CA   . GLY A 1 38 ? 19.866  -4.858  -6.493  1.00 0.00 ? 38  GLY A CA   7  
ATOM   9019  C  C    . GLY A 1 38 ? 19.445  -6.279  -6.877  1.00 0.00 ? 38  GLY A C    7  
ATOM   9020  O  O    . GLY A 1 38 ? 20.265  -7.196  -6.943  1.00 0.00 ? 38  GLY A O    7  
ATOM   9021  H  H    . GLY A 1 38 ? 18.277  -3.479  -6.111  1.00 0.00 ? 38  GLY A H    7  
ATOM   9022  H  HA2  . GLY A 1 38 ? 20.033  -4.294  -7.394  1.00 0.00 ? 38  GLY A HA2  7  
ATOM   9023  H  HA3  . GLY A 1 38 ? 20.787  -4.890  -5.911  1.00 0.00 ? 38  GLY A HA3  7  
ATOM   9024  N  N    . GLU A 1 39 ? 18.133  -6.420  -7.151  1.00 0.00 ? 39  GLU A N    7  
ATOM   9025  C  CA   . GLU A 1 39 ? 17.419  -7.717  -7.332  1.00 0.00 ? 39  GLU A CA   7  
ATOM   9026  C  C    . GLU A 1 39 ? 16.319  -7.514  -8.385  1.00 0.00 ? 39  GLU A C    7  
ATOM   9027  O  O    . GLU A 1 39 ? 16.046  -8.405  -9.193  1.00 0.00 ? 39  GLU A O    7  
ATOM   9028  C  CB   . GLU A 1 39 ? 16.750  -8.235  -6.015  1.00 0.00 ? 39  GLU A CB   7  
ATOM   9029  C  CG   . GLU A 1 39 ? 17.676  -8.405  -4.802  1.00 0.00 ? 39  GLU A CG   7  
ATOM   9030  C  CD   . GLU A 1 39 ? 16.901  -8.720  -3.507  1.00 0.00 ? 39  GLU A CD   7  
ATOM   9031  O  OE1  . GLU A 1 39 ? 16.247  -7.797  -2.962  1.00 0.00 ? 39  GLU A OE1  7  
ATOM   9032  O  OE2  . GLU A 1 39 ? 16.933  -9.879  -3.034  1.00 0.00 ? 39  GLU A OE2  7  
ATOM   9033  H  H    . GLU A 1 39 ? 17.647  -5.597  -7.353  1.00 0.00 ? 39  GLU A H    7  
ATOM   9034  H  HA   . GLU A 1 39 ? 18.128  -8.457  -7.696  1.00 0.00 ? 39  GLU A HA   7  
ATOM   9035  H  HB2  . GLU A 1 39 ? 15.962  -7.545  -5.728  1.00 0.00 ? 39  GLU A HB2  7  
ATOM   9036  H  HB3  . GLU A 1 39 ? 16.291  -9.202  -6.216  1.00 0.00 ? 39  GLU A HB3  7  
ATOM   9037  H  HG2  . GLU A 1 39 ? 18.378  -9.207  -5.010  1.00 0.00 ? 39  GLU A HG2  7  
ATOM   9038  H  HG3  . GLU A 1 39 ? 18.234  -7.483  -4.660  1.00 0.00 ? 39  GLU A HG3  7  
ATOM   9039  N  N    . LYS A 1 40 ? 15.685  -6.315  -8.320  1.00 0.00 ? 40  LYS A N    7  
ATOM   9040  C  CA   . LYS A 1 40 ? 14.631  -5.853  -9.242  1.00 0.00 ? 40  LYS A CA   7  
ATOM   9041  C  C    . LYS A 1 40 ? 13.321  -6.625  -8.972  1.00 0.00 ? 40  LYS A C    7  
ATOM   9042  O  O    . LYS A 1 40 ? 13.012  -7.588  -9.677  1.00 0.00 ? 40  LYS A O    7  
ATOM   9043  C  CB   . LYS A 1 40 ? 15.079  -5.908  -10.751 1.00 0.00 ? 40  LYS A CB   7  
ATOM   9044  C  CG   . LYS A 1 40 ? 16.358  -5.093  -11.045 1.00 0.00 ? 40  LYS A CG   7  
ATOM   9045  C  CD   . LYS A 1 40 ? 16.856  -5.204  -12.499 1.00 0.00 ? 40  LYS A CD   7  
ATOM   9046  C  CE   . LYS A 1 40 ? 15.888  -4.579  -13.515 1.00 0.00 ? 40  LYS A CE   7  
ATOM   9047  N  NZ   . LYS A 1 40 ? 16.427  -4.639  -14.895 1.00 0.00 ? 40  LYS A NZ   7  
ATOM   9048  H  H    . LYS A 1 40 ? 15.914  -5.721  -7.573  1.00 0.00 ? 40  LYS A H    7  
ATOM   9049  H  HA   . LYS A 1 40 ? 14.450  -4.814  -8.989  1.00 0.00 ? 40  LYS A HA   7  
ATOM   9050  H  HB2  . LYS A 1 40 ? 15.261  -6.939  -11.027 1.00 0.00 ? 40  LYS A HB2  7  
ATOM   9051  H  HB3  . LYS A 1 40 ? 14.277  -5.517  -11.373 1.00 0.00 ? 40  LYS A HB3  7  
ATOM   9052  H  HG2  . LYS A 1 40 ? 16.157  -4.048  -10.831 1.00 0.00 ? 40  LYS A HG2  7  
ATOM   9053  H  HG3  . LYS A 1 40 ? 17.146  -5.434  -10.378 1.00 0.00 ? 40  LYS A HG3  7  
ATOM   9054  H  HD2  . LYS A 1 40 ? 17.810  -4.690  -12.575 1.00 0.00 ? 40  LYS A HD2  7  
ATOM   9055  H  HD3  . LYS A 1 40 ? 17.002  -6.254  -12.742 1.00 0.00 ? 40  LYS A HD3  7  
ATOM   9056  H  HE2  . LYS A 1 40 ? 14.946  -5.113  -13.488 1.00 0.00 ? 40  LYS A HE2  7  
ATOM   9057  H  HE3  . LYS A 1 40 ? 15.717  -3.538  -13.254 1.00 0.00 ? 40  LYS A HE3  7  
ATOM   9058  H  HZ1  . LYS A 1 40 ? 15.765  -4.190  -15.558 1.00 0.00 ? 40  LYS A HZ1  7  
ATOM   9059  H  HZ2  . LYS A 1 40 ? 16.568  -5.630  -15.182 1.00 0.00 ? 40  LYS A HZ2  7  
ATOM   9060  H  HZ3  . LYS A 1 40 ? 17.340  -4.145  -14.942 1.00 0.00 ? 40  LYS A HZ3  7  
ATOM   9061  N  N    . PRO A 1 41 ? 12.557  -6.243  -7.884  1.00 0.00 ? 41  PRO A N    7  
ATOM   9062  C  CA   . PRO A 1 41 ? 11.259  -6.867  -7.559  1.00 0.00 ? 41  PRO A CA   7  
ATOM   9063  C  C    . PRO A 1 41 ? 10.135  -6.325  -8.459  1.00 0.00 ? 41  PRO A C    7  
ATOM   9064  O  O    . PRO A 1 41 ? 10.324  -5.343  -9.186  1.00 0.00 ? 41  PRO A O    7  
ATOM   9065  C  CB   . PRO A 1 41 ? 11.048  -6.488  -6.074  1.00 0.00 ? 41  PRO A CB   7  
ATOM   9066  C  CG   . PRO A 1 41 ? 11.708  -5.147  -5.938  1.00 0.00 ? 41  PRO A CG   7  
ATOM   9067  C  CD   . PRO A 1 41 ? 12.885  -5.163  -6.906  1.00 0.00 ? 41  PRO A CD   7  
ATOM   9068  H  HA   . PRO A 1 41 ? 11.309  -7.950  -7.661  1.00 0.00 ? 41  PRO A HA   7  
ATOM   9069  H  HB2  . PRO A 1 41 ? 9.986   -6.446  -5.840  1.00 0.00 ? 41  PRO A HB2  7  
ATOM   9070  H  HB3  . PRO A 1 41 ? 11.523  -7.229  -5.439  1.00 0.00 ? 41  PRO A HB3  7  
ATOM   9071  H  HG2  . PRO A 1 41 ? 11.005  -4.360  -6.202  1.00 0.00 ? 41  PRO A HG2  7  
ATOM   9072  H  HG3  . PRO A 1 41 ? 12.053  -5.000  -4.919  1.00 0.00 ? 41  PRO A HG3  7  
ATOM   9073  H  HD2  . PRO A 1 41 ? 12.982  -4.203  -7.407  1.00 0.00 ? 41  PRO A HD2  7  
ATOM   9074  H  HD3  . PRO A 1 41 ? 13.806  -5.396  -6.378  1.00 0.00 ? 41  PRO A HD3  7  
ATOM   9075  N  N    . LEU A 1 42 ? 8.977   -6.964  -8.390  1.00 0.00 ? 42  LEU A N    7  
ATOM   9076  C  CA   . LEU A 1 42 ? 7.836   -6.676  -9.265  1.00 0.00 ? 42  LEU A CA   7  
ATOM   9077  C  C    . LEU A 1 42 ? 6.710   -6.046  -8.453  1.00 0.00 ? 42  LEU A C    7  
ATOM   9078  O  O    . LEU A 1 42 ? 6.438   -6.482  -7.334  1.00 0.00 ? 42  LEU A O    7  
ATOM   9079  C  CB   . LEU A 1 42 ? 7.389   -7.998  -9.910  1.00 0.00 ? 42  LEU A CB   7  
ATOM   9080  C  CG   . LEU A 1 42 ? 8.468   -8.680  -10.804 1.00 0.00 ? 42  LEU A CG   7  
ATOM   9081  C  CD1  . LEU A 1 42 ? 8.068   -10.103 -11.182 1.00 0.00 ? 42  LEU A CD1  7  
ATOM   9082  C  CD2  . LEU A 1 42 ? 8.755   -7.838  -12.062 1.00 0.00 ? 42  LEU A CD2  7  
ATOM   9083  H  H    . LEU A 1 42 ? 8.875   -7.666  -7.717  1.00 0.00 ? 42  LEU A H    7  
ATOM   9084  H  HA   . LEU A 1 42 ? 8.149   -5.981  -10.050 1.00 0.00 ? 42  LEU A HA   7  
ATOM   9085  H  HB2  . LEU A 1 42 ? 7.103   -8.686  -9.108  1.00 0.00 ? 42  LEU A HB2  7  
ATOM   9086  H  HB3  . LEU A 1 42 ? 6.509   -7.809  -10.520 1.00 0.00 ? 42  LEU A HB3  7  
ATOM   9087  H  HG   . LEU A 1 42 ? 9.395   -8.748  -10.241 1.00 0.00 ? 42  LEU A HG   7  
ATOM   9088  H  HD11 . LEU A 1 42 ? 8.835   -10.548 -11.799 1.00 0.00 ? 42  LEU A HD11 7  
ATOM   9089  H  HD12 . LEU A 1 42 ? 7.131   -10.092 -11.726 1.00 0.00 ? 42  LEU A HD12 7  
ATOM   9090  H  HD13 . LEU A 1 42 ? 7.952   -10.695 -10.283 1.00 0.00 ? 42  LEU A HD13 7  
ATOM   9091  H  HD21 . LEU A 1 42 ? 7.853   -7.747  -12.657 1.00 0.00 ? 42  LEU A HD21 7  
ATOM   9092  H  HD22 . LEU A 1 42 ? 9.527   -8.316  -12.650 1.00 0.00 ? 42  LEU A HD22 7  
ATOM   9093  H  HD23 . LEU A 1 42 ? 9.093   -6.855  -11.771 1.00 0.00 ? 42  LEU A HD23 7  
ATOM   9094  N  N    . GLN A 1 43 ? 6.035   -5.055  -9.042  1.00 0.00 ? 43  GLN A N    7  
ATOM   9095  C  CA   . GLN A 1 43 ? 5.013   -4.242  -8.359  1.00 0.00 ? 43  GLN A CA   7  
ATOM   9096  C  C    . GLN A 1 43 ? 3.728   -4.302  -9.196  1.00 0.00 ? 43  GLN A C    7  
ATOM   9097  O  O    . GLN A 1 43 ? 3.799   -4.342  -10.433 1.00 0.00 ? 43  GLN A O    7  
ATOM   9098  C  CB   . GLN A 1 43 ? 5.527   -2.761  -8.178  1.00 0.00 ? 43  GLN A CB   7  
ATOM   9099  C  CG   . GLN A 1 43 ? 5.423   -2.194  -6.745  1.00 0.00 ? 43  GLN A CG   7  
ATOM   9100  C  CD   . GLN A 1 43 ? 4.026   -1.746  -6.314  1.00 0.00 ? 43  GLN A CD   7  
ATOM   9101  O  OE1  . GLN A 1 43 ? 3.008   -2.236  -6.795  1.00 0.00 ? 43  GLN A OE1  7  
ATOM   9102  N  NE2  . GLN A 1 43 ? 3.975   -0.844  -5.355  1.00 0.00 ? 43  GLN A NE2  7  
ATOM   9103  H  H    . GLN A 1 43 ? 6.177   -4.892  -9.998  1.00 0.00 ? 43  GLN A H    7  
ATOM   9104  H  HA   . GLN A 1 43 ? 4.813   -4.681  -7.378  1.00 0.00 ? 43  GLN A HA   7  
ATOM   9105  H  HB2  . GLN A 1 43 ? 6.573   -2.721  -8.468  1.00 0.00 ? 43  GLN A HB2  7  
ATOM   9106  H  HB3  . GLN A 1 43 ? 4.979   -2.100  -8.845  1.00 0.00 ? 43  GLN A HB3  7  
ATOM   9107  H  HG2  . GLN A 1 43 ? 5.755   -2.953  -6.056  1.00 0.00 ? 43  GLN A HG2  7  
ATOM   9108  H  HG3  . GLN A 1 43 ? 6.092   -1.337  -6.664  1.00 0.00 ? 43  GLN A HG3  7  
ATOM   9109  H  HE21 . GLN A 1 43 ? 4.827   -0.513  -4.987  1.00 0.00 ? 43  GLN A HE21 7  
ATOM   9110  H  HE22 . GLN A 1 43 ? 3.103   -0.527  -5.063  1.00 0.00 ? 43  GLN A HE22 7  
ATOM   9111  N  N    . CYS A 1 44 ? 2.563   -4.326  -8.525  1.00 0.00 ? 44  CYS A N    7  
ATOM   9112  C  CA   . CYS A 1 44 ? 1.260   -4.338  -9.205  1.00 0.00 ? 44  CYS A CA   7  
ATOM   9113  C  C    . CYS A 1 44 ? 1.083   -3.038  -10.000 1.00 0.00 ? 44  CYS A C    7  
ATOM   9114  O  O    . CYS A 1 44 ? 0.866   -1.973  -9.414  1.00 0.00 ? 44  CYS A O    7  
ATOM   9115  C  CB   . CYS A 1 44 ? 0.105   -4.508  -8.192  1.00 0.00 ? 44  CYS A CB   7  
ATOM   9116  S  SG   . CYS A 1 44 ? -1.562  -4.155  -8.868  1.00 0.00 ? 44  CYS A SG   7  
ATOM   9117  H  H    . CYS A 1 44 ? 2.592   -4.311  -7.542  1.00 0.00 ? 44  CYS A H    7  
ATOM   9118  H  HA   . CYS A 1 44 ? 1.250   -5.186  -9.890  1.00 0.00 ? 44  CYS A HA   7  
ATOM   9119  H  HB2  . CYS A 1 44 ? 0.102   -5.532  -7.831  1.00 0.00 ? 44  CYS A HB2  7  
ATOM   9120  H  HB3  . CYS A 1 44 ? 0.262   -3.841  -7.354  1.00 0.00 ? 44  CYS A HB3  7  
ATOM   9121  N  N    . GLU A 1 45 ? 1.196   -3.159  -11.339 1.00 0.00 ? 45  GLU A N    7  
ATOM   9122  C  CA   . GLU A 1 45 ? 1.019   -2.054  -12.307 1.00 0.00 ? 45  GLU A CA   7  
ATOM   9123  C  C    . GLU A 1 45 ? -0.328  -1.328  -12.116 1.00 0.00 ? 45  GLU A C    7  
ATOM   9124  O  O    . GLU A 1 45 ? -0.442  -0.132  -12.387 1.00 0.00 ? 45  GLU A O    7  
ATOM   9125  C  CB   . GLU A 1 45 ? 1.122   -2.619  -13.756 1.00 0.00 ? 45  GLU A CB   7  
ATOM   9126  C  CG   . GLU A 1 45 ? 2.461   -3.320  -14.089 1.00 0.00 ? 45  GLU A CG   7  
ATOM   9127  C  CD   . GLU A 1 45 ? 3.681   -2.395  -13.954 1.00 0.00 ? 45  GLU A CD   7  
ATOM   9128  O  OE1  . GLU A 1 45 ? 3.861   -1.507  -14.822 1.00 0.00 ? 45  GLU A OE1  7  
ATOM   9129  O  OE2  . GLU A 1 45 ? 4.459   -2.537  -12.984 1.00 0.00 ? 45  GLU A OE2  7  
ATOM   9130  H  H    . GLU A 1 45 ? 1.470   -4.028  -11.692 1.00 0.00 ? 45  GLU A H    7  
ATOM   9131  H  HA   . GLU A 1 45 ? 1.823   -1.346  -12.152 1.00 0.00 ? 45  GLU A HA   7  
ATOM   9132  H  HB2  . GLU A 1 45 ? 0.326   -3.340  -13.903 1.00 0.00 ? 45  GLU A HB2  7  
ATOM   9133  H  HB3  . GLU A 1 45 ? 0.982   -1.807  -14.466 1.00 0.00 ? 45  GLU A HB3  7  
ATOM   9134  H  HG2  . GLU A 1 45 ? 2.579   -4.171  -13.423 1.00 0.00 ? 45  GLU A HG2  7  
ATOM   9135  H  HG3  . GLU A 1 45 ? 2.418   -3.691  -15.113 1.00 0.00 ? 45  GLU A HG3  7  
ATOM   9136  N  N    . ILE A 1 46 ? -1.337  -2.067  -11.625 1.00 0.00 ? 46  ILE A N    7  
ATOM   9137  C  CA   . ILE A 1 46 ? -2.697  -1.552  -11.452 1.00 0.00 ? 46  ILE A CA   7  
ATOM   9138  C  C    . ILE A 1 46 ? -2.750  -0.603  -10.242 1.00 0.00 ? 46  ILE A C    7  
ATOM   9139  O  O    . ILE A 1 46 ? -3.280  0.514   -10.345 1.00 0.00 ? 46  ILE A O    7  
ATOM   9140  C  CB   . ILE A 1 46 ? -3.730  -2.731  -11.285 1.00 0.00 ? 46  ILE A CB   7  
ATOM   9141  C  CG1  . ILE A 1 46 ? -3.629  -3.751  -12.469 1.00 0.00 ? 46  ILE A CG1  7  
ATOM   9142  C  CG2  . ILE A 1 46 ? -5.173  -2.197  -11.146 1.00 0.00 ? 46  ILE A CG2  7  
ATOM   9143  C  CD1  . ILE A 1 46 ? -3.923  -3.180  -13.850 1.00 0.00 ? 46  ILE A CD1  7  
ATOM   9144  H  H    . ILE A 1 46 ? -1.155  -2.984  -11.351 1.00 0.00 ? 46  ILE A H    7  
ATOM   9145  H  HA   . ILE A 1 46 ? -2.960  -0.992  -12.349 1.00 0.00 ? 46  ILE A HA   7  
ATOM   9146  H  HB   . ILE A 1 46 ? -3.492  -3.257  -10.362 1.00 0.00 ? 46  ILE A HB   7  
ATOM   9147  H  HG12 . ILE A 1 46 ? -2.628  -4.158  -12.502 1.00 0.00 ? 46  ILE A HG12 7  
ATOM   9148  H  HG13 . ILE A 1 46 ? -4.327  -4.564  -12.297 1.00 0.00 ? 46  ILE A HG13 7  
ATOM   9149  H  HG21 . ILE A 1 46 ? -5.240  -1.559  -10.272 1.00 0.00 ? 46  ILE A HG21 7  
ATOM   9150  H  HG22 . ILE A 1 46 ? -5.858  -3.027  -11.027 1.00 0.00 ? 46  ILE A HG22 7  
ATOM   9151  H  HG23 . ILE A 1 46 ? -5.446  -1.632  -12.028 1.00 0.00 ? 46  ILE A HG23 7  
ATOM   9152  H  HD11 . ILE A 1 46 ? -4.928  -2.773  -13.877 1.00 0.00 ? 46  ILE A HD11 7  
ATOM   9153  H  HD12 . ILE A 1 46 ? -3.838  -3.969  -14.579 1.00 0.00 ? 46  ILE A HD12 7  
ATOM   9154  H  HD13 . ILE A 1 46 ? -3.210  -2.400  -14.080 1.00 0.00 ? 46  ILE A HD13 7  
ATOM   9155  N  N    . CYS A 1 47 ? -2.175  -1.041  -9.098  1.00 0.00 ? 47  CYS A N    7  
ATOM   9156  C  CA   . CYS A 1 47 ? -2.143  -0.222  -7.877  1.00 0.00 ? 47  CYS A CA   7  
ATOM   9157  C  C    . CYS A 1 47 ? -0.808  -0.411  -7.113  1.00 0.00 ? 47  CYS A C    7  
ATOM   9158  O  O    . CYS A 1 47 ? 0.170   0.306   -7.366  1.00 0.00 ? 47  CYS A O    7  
ATOM   9159  C  CB   . CYS A 1 47 ? -3.394  -0.520  -6.978  1.00 0.00 ? 47  CYS A CB   7  
ATOM   9160  S  SG   . CYS A 1 47 ? -3.418  -2.125  -6.074  1.00 0.00 ? 47  CYS A SG   7  
ATOM   9161  H  H    . CYS A 1 47 ? -1.782  -1.932  -9.072  1.00 0.00 ? 47  CYS A H    7  
ATOM   9162  H  HA   . CYS A 1 47 ? -2.193  0.828   -8.184  1.00 0.00 ? 47  CYS A HA   7  
ATOM   9163  H  HB2  . CYS A 1 47 ? -3.476  0.255   -6.234  1.00 0.00 ? 47  CYS A HB2  7  
ATOM   9164  H  HB3  . CYS A 1 47 ? -4.282  -0.497  -7.598  1.00 0.00 ? 47  CYS A HB3  7  
ATOM   9165  N  N    . GLY A 1 48 ? -0.781  -1.400  -6.210  1.00 0.00 ? 48  GLY A N    7  
ATOM   9166  C  CA   . GLY A 1 48 ? 0.308   -1.606  -5.265  1.00 0.00 ? 48  GLY A CA   7  
ATOM   9167  C  C    . GLY A 1 48 ? 0.333   -3.058  -4.821  1.00 0.00 ? 48  GLY A C    7  
ATOM   9168  O  O    . GLY A 1 48 ? -0.753  -3.562  -4.490  1.00 0.00 ? 48  GLY A O    7  
ATOM   9169  H  H    . GLY A 1 48 ? -1.407  -2.128  -6.313  1.00 0.00 ? 48  GLY A H    7  
ATOM   9170  H  HA2  . GLY A 1 48 ? 1.243   -1.358  -5.746  1.00 0.00 ? 48  GLY A HA2  7  
ATOM   9171  H  HA3  . GLY A 1 48 ? 0.164   -0.973  -4.402  1.00 0.00 ? 48  GLY A HA3  7  
ATOM   9172  N  N    . PHE A 1 49 ? 1.503   -3.738  -4.810  1.00 0.00 ? 49  PHE A N    7  
ATOM   9173  C  CA   . PHE A 1 49 ? 1.713   -5.070  -4.229  1.00 0.00 ? 49  PHE A CA   7  
ATOM   9174  C  C    . PHE A 1 49 ? 3.082   -5.463  -4.757  1.00 0.00 ? 49  PHE A C    7  
ATOM   9175  O  O    . PHE A 1 49 ? 3.220   -5.673  -5.968  1.00 0.00 ? 49  PHE A O    7  
ATOM   9176  C  CB   . PHE A 1 49 ? 0.657   -6.138  -4.664  1.00 0.00 ? 49  PHE A CB   7  
ATOM   9177  C  CG   . PHE A 1 49 ? 0.825   -7.511  -4.008  1.00 0.00 ? 49  PHE A CG   7  
ATOM   9178  C  CD1  . PHE A 1 49 ? 0.217   -7.805  -2.790  1.00 0.00 ? 49  PHE A CD1  7  
ATOM   9179  C  CD2  . PHE A 1 49 ? 1.583   -8.508  -4.612  1.00 0.00 ? 49  PHE A CD2  7  
ATOM   9180  C  CE1  . PHE A 1 49 ? 0.366   -9.045  -2.198  1.00 0.00 ? 49  PHE A CE1  7  
ATOM   9181  C  CE2  . PHE A 1 49 ? 1.735   -9.746  -4.022  1.00 0.00 ? 49  PHE A CE2  7  
ATOM   9182  C  CZ   . PHE A 1 49 ? 1.122   -10.018 -2.818  1.00 0.00 ? 49  PHE A CZ   7  
ATOM   9183  H  H    . PHE A 1 49 ? 2.336   -3.373  -5.189  1.00 0.00 ? 49  PHE A H    7  
ATOM   9184  H  HA   . PHE A 1 49 ? 1.742   -4.979  -3.150  1.00 0.00 ? 49  PHE A HA   7  
ATOM   9185  H  HB2  . PHE A 1 49 ? -0.330  -5.767  -4.409  1.00 0.00 ? 49  PHE A HB2  7  
ATOM   9186  H  HB3  . PHE A 1 49 ? 0.699   -6.265  -5.745  1.00 0.00 ? 49  PHE A HB3  7  
ATOM   9187  H  HD1  . PHE A 1 49 ? -0.378  -7.048  -2.297  1.00 0.00 ? 49  PHE A HD1  7  
ATOM   9188  H  HD2  . PHE A 1 49 ? 2.072   -8.300  -5.557  1.00 0.00 ? 49  PHE A HD2  7  
ATOM   9189  H  HE1  . PHE A 1 49 ? -0.114  -9.256  -1.249  1.00 0.00 ? 49  PHE A HE1  7  
ATOM   9190  H  HE2  . PHE A 1 49 ? 2.326   -10.509 -4.513  1.00 0.00 ? 49  PHE A HE2  7  
ATOM   9191  H  HZ   . PHE A 1 49 ? 1.241   -10.989 -2.360  1.00 0.00 ? 49  PHE A HZ   7  
ATOM   9192  N  N    . THR A 1 50 ? 4.094   -5.576  -3.893  1.00 0.00 ? 50  THR A N    7  
ATOM   9193  C  CA   . THR A 1 50 ? 5.459   -5.853  -4.347  1.00 0.00 ? 50  THR A CA   7  
ATOM   9194  C  C    . THR A 1 50 ? 5.871   -7.235  -3.851  1.00 0.00 ? 50  THR A C    7  
ATOM   9195  O  O    . THR A 1 50 ? 5.631   -7.583  -2.689  1.00 0.00 ? 50  THR A O    7  
ATOM   9196  C  CB   . THR A 1 50 ? 6.509   -4.806  -3.846  1.00 0.00 ? 50  THR A CB   7  
ATOM   9197  O  OG1  . THR A 1 50 ? 5.953   -3.493  -3.897  1.00 0.00 ? 50  THR A OG1  7  
ATOM   9198  C  CG2  . THR A 1 50 ? 7.819   -4.838  -4.671  1.00 0.00 ? 50  THR A CG2  7  
ATOM   9199  H  H    . THR A 1 50 ? 3.935   -5.499  -2.938  1.00 0.00 ? 50  THR A H    7  
ATOM   9200  H  HA   . THR A 1 50 ? 5.444   -5.824  -5.438  1.00 0.00 ? 50  THR A HA   7  
ATOM   9201  H  HB   . THR A 1 50 ? 6.755   -5.034  -2.823  1.00 0.00 ? 50  THR A HB   7  
ATOM   9202  H  HG1  . THR A 1 50 ? 5.013   -3.548  -4.111  1.00 0.00 ? 50  THR A HG1  7  
ATOM   9203  H  HG21 . THR A 1 50 ? 8.261   -5.829  -4.614  1.00 0.00 ? 50  THR A HG21 7  
ATOM   9204  H  HG22 . THR A 1 50 ? 8.524   -4.116  -4.275  1.00 0.00 ? 50  THR A HG22 7  
ATOM   9205  H  HG23 . THR A 1 50 ? 7.609   -4.603  -5.704  1.00 0.00 ? 50  THR A HG23 7  
ATOM   9206  N  N    . CYS A 1 51 ? 6.470   -7.999  -4.742  1.00 0.00 ? 51  CYS A N    7  
ATOM   9207  C  CA   . CYS A 1 51 ? 7.007   -9.331  -4.446  1.00 0.00 ? 51  CYS A CA   7  
ATOM   9208  C  C    . CYS A 1 51 ? 8.050   -9.743  -5.488  1.00 0.00 ? 51  CYS A C    7  
ATOM   9209  O  O    . CYS A 1 51 ? 8.090   -9.209  -6.601  1.00 0.00 ? 51  CYS A O    7  
ATOM   9210  C  CB   . CYS A 1 51 ? 5.851   -10.360 -4.391  1.00 0.00 ? 51  CYS A CB   7  
ATOM   9211  S  SG   . CYS A 1 51 ? 4.695   -10.226 -5.763  1.00 0.00 ? 51  CYS A SG   7  
ATOM   9212  H  H    . CYS A 1 51 ? 6.515   -7.657  -5.651  1.00 0.00 ? 51  CYS A H    7  
ATOM   9213  H  HA   . CYS A 1 51 ? 7.490   -9.288  -3.472  1.00 0.00 ? 51  CYS A HA   7  
ATOM   9214  H  HB2  . CYS A 1 51 ? 6.251   -11.369 -4.401  1.00 0.00 ? 51  CYS A HB2  7  
ATOM   9215  H  HB3  . CYS A 1 51 ? 5.280   -10.220 -3.478  1.00 0.00 ? 51  CYS A HB3  7  
ATOM   9216  H  HG   . CYS A 1 51 ? 4.663   -8.960  -6.148  1.00 0.00 ? 51  CYS A HG   7  
ATOM   9217  N  N    . ARG A 1 52 ? 8.898   -10.705 -5.092  1.00 0.00 ? 52  ARG A N    7  
ATOM   9218  C  CA   . ARG A 1 52 ? 9.929   -11.313 -5.956  1.00 0.00 ? 52  ARG A CA   7  
ATOM   9219  C  C    . ARG A 1 52 ? 9.323   -12.416 -6.864  1.00 0.00 ? 52  ARG A C    7  
ATOM   9220  O  O    . ARG A 1 52 ? 9.980   -12.901 -7.791  1.00 0.00 ? 52  ARG A O    7  
ATOM   9221  C  CB   . ARG A 1 52 ? 11.056  -11.893 -5.051  1.00 0.00 ? 52  ARG A CB   7  
ATOM   9222  C  CG   . ARG A 1 52 ? 11.868  -10.815 -4.285  1.00 0.00 ? 52  ARG A CG   7  
ATOM   9223  C  CD   . ARG A 1 52 ? 12.736  -9.972  -5.237  1.00 0.00 ? 52  ARG A CD   7  
ATOM   9224  N  NE   . ARG A 1 52 ? 13.797  -10.794 -5.859  1.00 0.00 ? 52  ARG A NE   7  
ATOM   9225  C  CZ   . ARG A 1 52 ? 14.300  -10.636 -7.093  1.00 0.00 ? 52  ARG A CZ   7  
ATOM   9226  N  NH1  . ARG A 1 52 ? 13.817  -9.735  -7.934  1.00 0.00 ? 52  ARG A NH1  7  
ATOM   9227  N  NH2  . ARG A 1 52 ? 15.302  -11.409 -7.490  1.00 0.00 ? 52  ARG A NH2  7  
ATOM   9228  H  H    . ARG A 1 52 ? 8.823   -11.035 -4.171  1.00 0.00 ? 52  ARG A H    7  
ATOM   9229  H  HA   . ARG A 1 52 ? 10.351  -10.534 -6.589  1.00 0.00 ? 52  ARG A HA   7  
ATOM   9230  H  HB2  . ARG A 1 52 ? 10.611  -12.565 -4.323  1.00 0.00 ? 52  ARG A HB2  7  
ATOM   9231  H  HB3  . ARG A 1 52 ? 11.747  -12.463 -5.668  1.00 0.00 ? 52  ARG A HB3  7  
ATOM   9232  H  HG2  . ARG A 1 52 ? 11.179  -10.158 -3.758  1.00 0.00 ? 52  ARG A HG2  7  
ATOM   9233  H  HG3  . ARG A 1 52 ? 12.512  -11.306 -3.556  1.00 0.00 ? 52  ARG A HG3  7  
ATOM   9234  H  HD2  . ARG A 1 52 ? 12.102  -9.553  -6.014  1.00 0.00 ? 52  ARG A HD2  7  
ATOM   9235  H  HD3  . ARG A 1 52 ? 13.200  -9.165  -4.682  1.00 0.00 ? 52  ARG A HD3  7  
ATOM   9236  H  HE   . ARG A 1 52 ? 14.175  -11.511 -5.296  1.00 0.00 ? 52  ARG A HE   7  
ATOM   9237  H  HH11 . ARG A 1 52 ? 13.054  -9.150  -7.665  1.00 0.00 ? 52  ARG A HH11 7  
ATOM   9238  H  HH12 . ARG A 1 52 ? 14.215  -9.636  -8.852  1.00 0.00 ? 52  ARG A HH12 7  
ATOM   9239  H  HH21 . ARG A 1 52 ? 15.679  -12.110 -6.873  1.00 0.00 ? 52  ARG A HH21 7  
ATOM   9240  H  HH22 . ARG A 1 52 ? 15.686  -11.301 -8.410  1.00 0.00 ? 52  ARG A HH22 7  
ATOM   9241  N  N    . GLN A 1 53 ? 8.062   -12.795 -6.578  1.00 0.00 ? 53  GLN A N    7  
ATOM   9242  C  CA   . GLN A 1 53 ? 7.311   -13.820 -7.325  1.00 0.00 ? 53  GLN A CA   7  
ATOM   9243  C  C    . GLN A 1 53 ? 6.301   -13.124 -8.252  1.00 0.00 ? 53  GLN A C    7  
ATOM   9244  O  O    . GLN A 1 53 ? 5.347   -12.517 -7.760  1.00 0.00 ? 53  GLN A O    7  
ATOM   9245  C  CB   . GLN A 1 53 ? 6.563   -14.755 -6.329  1.00 0.00 ? 53  GLN A CB   7  
ATOM   9246  C  CG   . GLN A 1 53 ? 7.469   -15.459 -5.296  1.00 0.00 ? 53  GLN A CG   7  
ATOM   9247  C  CD   . GLN A 1 53 ? 6.677   -16.292 -4.290  1.00 0.00 ? 53  GLN A CD   7  
ATOM   9248  O  OE1  . GLN A 1 53 ? 6.418   -17.475 -4.511  1.00 0.00 ? 53  GLN A OE1  7  
ATOM   9249  N  NE2  . GLN A 1 53 ? 6.262   -15.665 -3.200  1.00 0.00 ? 53  GLN A NE2  7  
ATOM   9250  H  H    . GLN A 1 53 ? 7.601   -12.343 -5.845  1.00 0.00 ? 53  GLN A H    7  
ATOM   9251  H  HA   . GLN A 1 53 ? 8.004   -14.412 -7.920  1.00 0.00 ? 53  GLN A HA   7  
ATOM   9252  H  HB2  . GLN A 1 53 ? 5.827   -14.166 -5.784  1.00 0.00 ? 53  GLN A HB2  7  
ATOM   9253  H  HB3  . GLN A 1 53 ? 6.037   -15.519 -6.898  1.00 0.00 ? 53  GLN A HB3  7  
ATOM   9254  H  HG2  . GLN A 1 53 ? 8.161   -16.110 -5.819  1.00 0.00 ? 53  GLN A HG2  7  
ATOM   9255  H  HG3  . GLN A 1 53 ? 8.035   -14.706 -4.752  1.00 0.00 ? 53  GLN A HG3  7  
ATOM   9256  H  HE21 . GLN A 1 53 ? 6.485   -14.714 -3.095  1.00 0.00 ? 53  GLN A HE21 7  
ATOM   9257  H  HE22 . GLN A 1 53 ? 5.749   -16.175 -2.544  1.00 0.00 ? 53  GLN A HE22 7  
ATOM   9258  N  N    . LYS A 1 54 ? 6.551   -13.169 -9.577  1.00 0.00 ? 54  LYS A N    7  
ATOM   9259  C  CA   . LYS A 1 54 ? 5.618   -12.633 -10.608 1.00 0.00 ? 54  LYS A CA   7  
ATOM   9260  C  C    . LYS A 1 54 ? 4.195   -13.188 -10.431 1.00 0.00 ? 54  LYS A C    7  
ATOM   9261  O  O    . LYS A 1 54 ? 3.217   -12.451 -10.537 1.00 0.00 ? 54  LYS A O    7  
ATOM   9262  C  CB   . LYS A 1 54 ? 6.133   -12.946 -12.035 1.00 0.00 ? 54  LYS A CB   7  
ATOM   9263  C  CG   . LYS A 1 54 ? 5.320   -12.284 -13.172 1.00 0.00 ? 54  LYS A CG   7  
ATOM   9264  C  CD   . LYS A 1 54 ? 5.945   -12.531 -14.560 1.00 0.00 ? 54  LYS A CD   7  
ATOM   9265  C  CE   . LYS A 1 54 ? 5.156   -11.859 -15.691 1.00 0.00 ? 54  LYS A CE   7  
ATOM   9266  N  NZ   . LYS A 1 54 ? 5.065   -10.386 -15.517 1.00 0.00 ? 54  LYS A NZ   7  
ATOM   9267  H  H    . LYS A 1 54 ? 7.418   -13.520 -9.868  1.00 0.00 ? 54  LYS A H    7  
ATOM   9268  H  HA   . LYS A 1 54 ? 5.587   -11.557 -10.478 1.00 0.00 ? 54  LYS A HA   7  
ATOM   9269  H  HB2  . LYS A 1 54 ? 7.162   -12.606 -12.115 1.00 0.00 ? 54  LYS A HB2  7  
ATOM   9270  H  HB3  . LYS A 1 54 ? 6.115   -14.020 -12.185 1.00 0.00 ? 54  LYS A HB3  7  
ATOM   9271  H  HG2  . LYS A 1 54 ? 4.312   -12.689 -13.165 1.00 0.00 ? 54  LYS A HG2  7  
ATOM   9272  H  HG3  . LYS A 1 54 ? 5.272   -11.213 -12.991 1.00 0.00 ? 54  LYS A HG3  7  
ATOM   9273  H  HD2  . LYS A 1 54 ? 6.957   -12.138 -14.565 1.00 0.00 ? 54  LYS A HD2  7  
ATOM   9274  H  HD3  . LYS A 1 54 ? 5.980   -13.602 -14.741 1.00 0.00 ? 54  LYS A HD3  7  
ATOM   9275  H  HE2  . LYS A 1 54 ? 5.645   -12.064 -16.633 1.00 0.00 ? 54  LYS A HE2  7  
ATOM   9276  H  HE3  . LYS A 1 54 ? 4.154   -12.266 -15.716 1.00 0.00 ? 54  LYS A HE3  7  
ATOM   9277  H  HZ1  . LYS A 1 54 ? 4.566   -10.157 -14.634 1.00 0.00 ? 54  LYS A HZ1  7  
ATOM   9278  H  HZ2  . LYS A 1 54 ? 4.545   -9.962  -16.315 1.00 0.00 ? 54  LYS A HZ2  7  
ATOM   9279  H  HZ3  . LYS A 1 54 ? 6.017   -9.971  -15.480 1.00 0.00 ? 54  LYS A HZ3  7  
ATOM   9280  N  N    . ALA A 1 55 ? 4.137   -14.493 -10.152 1.00 0.00 ? 55  ALA A N    7  
ATOM   9281  C  CA   . ALA A 1 55 ? 2.884   -15.219 -9.882  1.00 0.00 ? 55  ALA A CA   7  
ATOM   9282  C  C    . ALA A 1 55 ? 2.043   -14.535 -8.766  1.00 0.00 ? 55  ALA A C    7  
ATOM   9283  O  O    . ALA A 1 55 ? 0.831   -14.368 -8.913  1.00 0.00 ? 55  ALA A O    7  
ATOM   9284  C  CB   . ALA A 1 55 ? 3.202   -16.675 -9.522  1.00 0.00 ? 55  ALA A CB   7  
ATOM   9285  H  H    . ALA A 1 55 ? 4.996   -14.969 -10.173 1.00 0.00 ? 55  ALA A H    7  
ATOM   9286  H  HA   . ALA A 1 55 ? 2.305   -15.224 -10.805 1.00 0.00 ? 55  ALA A HA   7  
ATOM   9287  H  HB1  . ALA A 1 55 ? 3.779   -17.132 -10.319 1.00 0.00 ? 55  ALA A HB1  7  
ATOM   9288  H  HB2  . ALA A 1 55 ? 2.284   -17.235 -9.387  1.00 0.00 ? 55  ALA A HB2  7  
ATOM   9289  H  HB3  . ALA A 1 55 ? 3.780   -16.707 -8.608  1.00 0.00 ? 55  ALA A HB3  7  
ATOM   9290  N  N    . SER A 1 56 ? 2.726   -14.076 -7.699  1.00 0.00 ? 56  SER A N    7  
ATOM   9291  C  CA   . SER A 1 56 ? 2.080   -13.526 -6.487  1.00 0.00 ? 56  SER A CA   7  
ATOM   9292  C  C    . SER A 1 56 ? 1.228   -12.270 -6.812  1.00 0.00 ? 56  SER A C    7  
ATOM   9293  O  O    . SER A 1 56 ? 0.033   -12.223 -6.469  1.00 0.00 ? 56  SER A O    7  
ATOM   9294  C  CB   . SER A 1 56 ? 3.148   -13.223 -5.412  1.00 0.00 ? 56  SER A CB   7  
ATOM   9295  O  OG   . SER A 1 56 ? 2.561   -12.881 -4.166  1.00 0.00 ? 56  SER A OG   7  
ATOM   9296  H  H    . SER A 1 56 ? 3.701   -14.107 -7.744  1.00 0.00 ? 56  SER A H    7  
ATOM   9297  H  HA   . SER A 1 56 ? 1.415   -14.296 -6.100  1.00 0.00 ? 56  SER A HA   7  
ATOM   9298  H  HB2  . SER A 1 56 ? 3.773   -14.093 -5.267  1.00 0.00 ? 56  SER A HB2  7  
ATOM   9299  H  HB3  . SER A 1 56 ? 3.765   -12.398 -5.742  1.00 0.00 ? 56  SER A HB3  7  
ATOM   9300  H  HG   . SER A 1 56 ? 3.015   -12.116 -3.802  1.00 0.00 ? 56  SER A HG   7  
ATOM   9301  N  N    . LEU A 1 57 ? 1.832   -11.261 -7.496  1.00 0.00 ? 57  LEU A N    7  
ATOM   9302  C  CA   . LEU A 1 57 ? 1.108   -10.031 -7.899  1.00 0.00 ? 57  LEU A CA   7  
ATOM   9303  C  C    . LEU A 1 57 ? 0.159   -10.302 -9.078  1.00 0.00 ? 57  LEU A C    7  
ATOM   9304  O  O    . LEU A 1 57 ? -0.869  -9.638  -9.190  1.00 0.00 ? 57  LEU A O    7  
ATOM   9305  C  CB   . LEU A 1 57 ? 2.059   -8.847  -8.250  1.00 0.00 ? 57  LEU A CB   7  
ATOM   9306  C  CG   . LEU A 1 57 ? 3.076   -9.056  -9.434  1.00 0.00 ? 57  LEU A CG   7  
ATOM   9307  C  CD1  . LEU A 1 57 ? 3.360   -7.734  -10.178 1.00 0.00 ? 57  LEU A CD1  7  
ATOM   9308  C  CD2  . LEU A 1 57 ? 4.397   -9.673  -8.947  1.00 0.00 ? 57  LEU A CD2  7  
ATOM   9309  H  H    . LEU A 1 57 ? 2.774   -11.349 -7.726  1.00 0.00 ? 57  LEU A H    7  
ATOM   9310  H  HA   . LEU A 1 57 ? 0.502   -9.732  -7.043  1.00 0.00 ? 57  LEU A HA   7  
ATOM   9311  H  HB2  . LEU A 1 57 ? 1.430   -7.999  -8.483  1.00 0.00 ? 57  LEU A HB2  7  
ATOM   9312  H  HB3  . LEU A 1 57 ? 2.620   -8.590  -7.353  1.00 0.00 ? 57  LEU A HB3  7  
ATOM   9313  H  HG   . LEU A 1 57 ? 2.646   -9.745  -10.158 1.00 0.00 ? 57  LEU A HG   7  
ATOM   9314  H  HD11 . LEU A 1 57 ? 3.820   -7.017  -9.505  1.00 0.00 ? 57  LEU A HD11 7  
ATOM   9315  H  HD12 . LEU A 1 57 ? 2.431   -7.321  -10.552 1.00 0.00 ? 57  LEU A HD12 7  
ATOM   9316  H  HD13 . LEU A 1 57 ? 4.023   -7.918  -11.014 1.00 0.00 ? 57  LEU A HD13 7  
ATOM   9317  H  HD21 . LEU A 1 57 ? 5.076   -9.799  -9.781  1.00 0.00 ? 57  LEU A HD21 7  
ATOM   9318  H  HD22 . LEU A 1 57 ? 4.206   -10.639 -8.501  1.00 0.00 ? 57  LEU A HD22 7  
ATOM   9319  H  HD23 . LEU A 1 57 ? 4.858   -9.025  -8.206  1.00 0.00 ? 57  LEU A HD23 7  
ATOM   9320  N  N    . ASN A 1 58 ? 0.555   -11.227 -9.979  1.00 0.00 ? 58  ASN A N    7  
ATOM   9321  C  CA   . ASN A 1 58 ? -0.296  -11.709 -11.099 1.00 0.00 ? 58  ASN A CA   7  
ATOM   9322  C  C    . ASN A 1 58 ? -1.677  -12.189 -10.628 1.00 0.00 ? 58  ASN A C    7  
ATOM   9323  O  O    . ASN A 1 58 ? -2.695  -11.863 -11.251 1.00 0.00 ? 58  ASN A O    7  
ATOM   9324  C  CB   . ASN A 1 58 ? 0.425   -12.843 -11.890 1.00 0.00 ? 58  ASN A CB   7  
ATOM   9325  C  CG   . ASN A 1 58 ? -0.446  -13.523 -12.961 1.00 0.00 ? 58  ASN A CG   7  
ATOM   9326  O  OD1  . ASN A 1 58 ? -0.526  -13.059 -14.098 1.00 0.00 ? 58  ASN A OD1  7  
ATOM   9327  N  ND2  . ASN A 1 58 ? -1.087  -14.639 -12.611 1.00 0.00 ? 58  ASN A ND2  7  
ATOM   9328  H  H    . ASN A 1 58 ? 1.489   -11.521 -9.952  1.00 0.00 ? 58  ASN A H    7  
ATOM   9329  H  HA   . ASN A 1 58 ? -0.440  -10.869 -11.761 1.00 0.00 ? 58  ASN A HA   7  
ATOM   9330  H  HB2  . ASN A 1 58 ? 1.297   -12.426 -12.381 1.00 0.00 ? 58  ASN A HB2  7  
ATOM   9331  H  HB3  . ASN A 1 58 ? 0.765   -13.602 -11.192 1.00 0.00 ? 58  ASN A HB3  7  
ATOM   9332  H  HD21 . ASN A 1 58 ? -0.976  -14.975 -11.695 1.00 0.00 ? 58  ASN A HD21 7  
ATOM   9333  H  HD22 . ASN A 1 58 ? -1.634  -15.093 -13.290 1.00 0.00 ? 58  ASN A HD22 7  
ATOM   9334  N  N    . TRP A 1 59 ? -1.720  -12.924 -9.514  1.00 0.00 ? 59  TRP A N    7  
ATOM   9335  C  CA   . TRP A 1 59 ? -2.979  -13.479 -8.988  1.00 0.00 ? 59  TRP A CA   7  
ATOM   9336  C  C    . TRP A 1 59 ? -3.749  -12.394 -8.218  1.00 0.00 ? 59  TRP A C    7  
ATOM   9337  O  O    . TRP A 1 59 ? -4.976  -12.368 -8.255  1.00 0.00 ? 59  TRP A O    7  
ATOM   9338  C  CB   . TRP A 1 59 ? -2.717  -14.723 -8.115  1.00 0.00 ? 59  TRP A CB   7  
ATOM   9339  C  CG   . TRP A 1 59 ? -2.167  -15.914 -8.884  1.00 0.00 ? 59  TRP A CG   7  
ATOM   9340  C  CD1  . TRP A 1 59 ? -1.044  -16.641 -8.587  1.00 0.00 ? 59  TRP A CD1  7  
ATOM   9341  C  CD2  . TRP A 1 59 ? -2.723  -16.514 -10.074 1.00 0.00 ? 59  TRP A CD2  7  
ATOM   9342  N  NE1  . TRP A 1 59 ? -0.861  -17.628 -9.513  1.00 0.00 ? 59  TRP A NE1  7  
ATOM   9343  C  CE2  . TRP A 1 59 ? -1.877  -17.579 -10.425 1.00 0.00 ? 59  TRP A CE2  7  
ATOM   9344  C  CE3  . TRP A 1 59 ? -3.856  -16.269 -10.871 1.00 0.00 ? 59  TRP A CE3  7  
ATOM   9345  C  CZ2  . TRP A 1 59 ? -2.116  -18.388 -11.533 1.00 0.00 ? 59  TRP A CZ2  7  
ATOM   9346  C  CZ3  . TRP A 1 59 ? -4.086  -17.068 -11.975 1.00 0.00 ? 59  TRP A CZ3  7  
ATOM   9347  C  CH2  . TRP A 1 59 ? -3.221  -18.121 -12.294 1.00 0.00 ? 59  TRP A CH2  7  
ATOM   9348  H  H    . TRP A 1 59 ? -0.918  -13.021 -8.963  1.00 0.00 ? 59  TRP A H    7  
ATOM   9349  H  HA   . TRP A 1 59 ? -3.587  -13.783 -9.848  1.00 0.00 ? 59  TRP A HA   7  
ATOM   9350  H  HB2  . TRP A 1 59 ? -2.008  -14.462 -7.336  1.00 0.00 ? 59  TRP A HB2  7  
ATOM   9351  H  HB3  . TRP A 1 59 ? -3.644  -15.037 -7.645  1.00 0.00 ? 59  TRP A HB3  7  
ATOM   9352  H  HD1  . TRP A 1 59 ? -0.388  -16.439 -7.749  1.00 0.00 ? 59  TRP A HD1  7  
ATOM   9353  H  HE1  . TRP A 1 59 ? -0.122  -18.277 -9.517  1.00 0.00 ? 59  TRP A HE1  7  
ATOM   9354  H  HE3  . TRP A 1 59 ? -4.533  -15.459 -10.638 1.00 0.00 ? 59  TRP A HE3  7  
ATOM   9355  H  HZ2  . TRP A 1 59 ? -1.454  -19.204 -11.797 1.00 0.00 ? 59  TRP A HZ2  7  
ATOM   9356  H  HZ3  . TRP A 1 59 ? -4.955  -16.893 -12.599 1.00 0.00 ? 59  TRP A HZ3  7  
ATOM   9357  H  HH2  . TRP A 1 59 ? -3.442  -18.729 -13.164 1.00 0.00 ? 59  TRP A HH2  7  
ATOM   9358  N  N    . HIS A 1 60 ? -3.016  -11.546 -7.470  1.00 0.00 ? 60  HIS A N    7  
ATOM   9359  C  CA   . HIS A 1 60 ? -3.542  -10.245 -6.973  1.00 0.00 ? 60  HIS A CA   7  
ATOM   9360  C  C    . HIS A 1 60 ? -4.252  -9.388  -8.080  1.00 0.00 ? 60  HIS A C    7  
ATOM   9361  O  O    . HIS A 1 60 ? -5.181  -8.629  -7.775  1.00 0.00 ? 60  HIS A O    7  
ATOM   9362  C  CB   . HIS A 1 60 ? -2.402  -9.439  -6.274  1.00 0.00 ? 60  HIS A CB   7  
ATOM   9363  C  CG   . HIS A 1 60 ? -2.741  -8.000  -5.975  1.00 0.00 ? 60  HIS A CG   7  
ATOM   9364  N  ND1  . HIS A 1 60 ? -3.715  -7.586  -5.095  1.00 0.00 ? 60  HIS A ND1  7  
ATOM   9365  C  CD2  . HIS A 1 60 ? -2.268  -6.883  -6.547  1.00 0.00 ? 60  HIS A CD2  7  
ATOM   9366  C  CE1  . HIS A 1 60 ? -3.803  -6.253  -5.187  1.00 0.00 ? 60  HIS A CE1  7  
ATOM   9367  N  NE2  . HIS A 1 60 ? -2.946  -5.766  -6.074  1.00 0.00 ? 60  HIS A NE2  7  
ATOM   9368  H  H    . HIS A 1 60 ? -2.177  -11.879 -7.085  1.00 0.00 ? 60  HIS A H    7  
ATOM   9369  H  HA   . HIS A 1 60 ? -4.285  -10.493 -6.222  1.00 0.00 ? 60  HIS A HA   7  
ATOM   9370  H  HB2  . HIS A 1 60 ? -2.147  -9.907  -5.341  1.00 0.00 ? 60  HIS A HB2  7  
ATOM   9371  H  HB3  . HIS A 1 60 ? -1.527  -9.447  -6.917  1.00 0.00 ? 60  HIS A HB3  7  
ATOM   9372  H  HD1  . HIS A 1 60 ? -4.239  -8.160  -4.494  1.00 0.00 ? 60  HIS A HD1  7  
ATOM   9373  H  HD2  . HIS A 1 60 ? -1.474  -6.853  -7.271  1.00 0.00 ? 60  HIS A HD2  7  
ATOM   9374  H  HE1  . HIS A 1 60 ? -4.497  -5.648  -4.614  1.00 0.00 ? 60  HIS A HE1  7  
ATOM   9375  N  N    . MET A 1 61 ? -3.772  -9.453  -9.337  1.00 0.00 ? 61  MET A N    7  
ATOM   9376  C  CA   . MET A 1 61 ? -4.455  -8.809  -10.495 1.00 0.00 ? 61  MET A CA   7  
ATOM   9377  C  C    . MET A 1 61 ? -5.769  -9.534  -10.895 1.00 0.00 ? 61  MET A C    7  
ATOM   9378  O  O    . MET A 1 61 ? -6.723  -8.898  -11.347 1.00 0.00 ? 61  MET A O    7  
ATOM   9379  C  CB   . MET A 1 61 ? -3.472  -8.695  -11.687 1.00 0.00 ? 61  MET A CB   7  
ATOM   9380  C  CG   . MET A 1 61 ? -2.245  -7.810  -11.419 1.00 0.00 ? 61  MET A CG   7  
ATOM   9381  S  SD   . MET A 1 61 ? -1.066  -7.834  -12.783 1.00 0.00 ? 61  MET A SD   7  
ATOM   9382  C  CE   . MET A 1 61 ? 0.210   -6.737  -12.175 1.00 0.00 ? 61  MET A CE   7  
ATOM   9383  H  H    . MET A 1 61 ? -2.897  -9.872  -9.487  1.00 0.00 ? 61  MET A H    7  
ATOM   9384  H  HA   . MET A 1 61 ? -4.723  -7.802  -10.184 1.00 0.00 ? 61  MET A HA   7  
ATOM   9385  H  HB2  . MET A 1 61 ? -3.120  -9.684  -11.950 1.00 0.00 ? 61  MET A HB2  7  
ATOM   9386  H  HB3  . MET A 1 61 ? -3.999  -8.278  -12.538 1.00 0.00 ? 61  MET A HB3  7  
ATOM   9387  H  HG2  . MET A 1 61 ? -2.574  -6.788  -11.266 1.00 0.00 ? 61  MET A HG2  7  
ATOM   9388  H  HG3  . MET A 1 61 ? -1.743  -8.160  -10.524 1.00 0.00 ? 61  MET A HG3  7  
ATOM   9389  H  HE1  . MET A 1 61 ? 0.594   -7.112  -11.235 1.00 0.00 ? 61  MET A HE1  7  
ATOM   9390  H  HE2  . MET A 1 61 ? -0.200  -5.746  -12.032 1.00 0.00 ? 61  MET A HE2  7  
ATOM   9391  H  HE3  . MET A 1 61 ? 1.016   -6.691  -12.894 1.00 0.00 ? 61  MET A HE3  7  
ATOM   9392  N  N    . LYS A 1 62 ? -5.788  -10.868 -10.765 1.00 0.00 ? 62  LYS A N    7  
ATOM   9393  C  CA   . LYS A 1 62 ? -7.043  -11.665 -10.849 1.00 0.00 ? 62  LYS A CA   7  
ATOM   9394  C  C    . LYS A 1 62 ? -8.052  -11.250 -9.729  1.00 0.00 ? 62  LYS A C    7  
ATOM   9395  O  O    . LYS A 1 62 ? -9.266  -11.394 -9.880  1.00 0.00 ? 62  LYS A O    7  
ATOM   9396  C  CB   . LYS A 1 62 ? -6.734  -13.183 -10.777 1.00 0.00 ? 62  LYS A CB   7  
ATOM   9397  C  CG   . LYS A 1 62 ? -7.964  -14.089 -11.021 1.00 0.00 ? 62  LYS A CG   7  
ATOM   9398  C  CD   . LYS A 1 62 ? -7.702  -15.583 -10.738 1.00 0.00 ? 62  LYS A CD   7  
ATOM   9399  C  CE   . LYS A 1 62 ? -7.310  -15.844 -9.275  1.00 0.00 ? 62  LYS A CE   7  
ATOM   9400  N  NZ   . LYS A 1 62 ? -7.155  -17.288 -8.986  1.00 0.00 ? 62  LYS A NZ   7  
ATOM   9401  H  H    . LYS A 1 62 ? -4.919  -11.321 -10.706 1.00 0.00 ? 62  LYS A H    7  
ATOM   9402  H  HA   . LYS A 1 62 ? -7.499  -11.449 -11.810 1.00 0.00 ? 62  LYS A HA   7  
ATOM   9403  H  HB2  . LYS A 1 62 ? -5.979  -13.423 -11.521 1.00 0.00 ? 62  LYS A HB2  7  
ATOM   9404  H  HB3  . LYS A 1 62 ? -6.331  -13.407 -9.796  1.00 0.00 ? 62  LYS A HB3  7  
ATOM   9405  H  HG2  . LYS A 1 62 ? -8.772  -13.756 -10.378 1.00 0.00 ? 62  LYS A HG2  7  
ATOM   9406  H  HG3  . LYS A 1 62 ? -8.274  -13.976 -12.056 1.00 0.00 ? 62  LYS A HG3  7  
ATOM   9407  H  HD2  . LYS A 1 62 ? -8.605  -16.139 -10.959 1.00 0.00 ? 62  LYS A HD2  7  
ATOM   9408  H  HD3  . LYS A 1 62 ? -6.903  -15.935 -11.387 1.00 0.00 ? 62  LYS A HD3  7  
ATOM   9409  H  HE2  . LYS A 1 62 ? -6.371  -15.351 -9.061  1.00 0.00 ? 62  LYS A HE2  7  
ATOM   9410  H  HE3  . LYS A 1 62 ? -8.078  -15.440 -8.622  1.00 0.00 ? 62  LYS A HE3  7  
ATOM   9411  H  HZ1  . LYS A 1 62 ? -6.407  -17.696 -9.578  1.00 0.00 ? 62  LYS A HZ1  7  
ATOM   9412  H  HZ2  . LYS A 1 62 ? -8.044  -17.794 -9.178  1.00 0.00 ? 62  LYS A HZ2  7  
ATOM   9413  H  HZ3  . LYS A 1 62 ? -6.902  -17.426 -7.987  1.00 0.00 ? 62  LYS A HZ3  7  
ATOM   9414  N  N    . LYS A 1 63 ? -7.517  -10.749 -8.603  1.00 0.00 ? 63  LYS A N    7  
ATOM   9415  C  CA   . LYS A 1 63 ? -8.338  -10.185 -7.504  1.00 0.00 ? 63  LYS A CA   7  
ATOM   9416  C  C    . LYS A 1 63 ? -9.002  -8.854  -7.957  1.00 0.00 ? 63  LYS A C    7  
ATOM   9417  O  O    . LYS A 1 63 ? -10.125 -8.537  -7.546  1.00 0.00 ? 63  LYS A O    7  
ATOM   9418  C  CB   . LYS A 1 63 ? -7.507  -10.027 -6.202  1.00 0.00 ? 63  LYS A CB   7  
ATOM   9419  C  CG   . LYS A 1 63 ? -6.879  -11.354 -5.706  1.00 0.00 ? 63  LYS A CG   7  
ATOM   9420  C  CD   . LYS A 1 63 ? -6.130  -11.222 -4.358  1.00 0.00 ? 63  LYS A CD   7  
ATOM   9421  C  CE   . LYS A 1 63 ? -7.071  -10.952 -3.174  1.00 0.00 ? 63  LYS A CE   7  
ATOM   9422  N  NZ   . LYS A 1 63 ? -6.344  -10.879 -1.880  1.00 0.00 ? 63  LYS A NZ   7  
ATOM   9423  H  H    . LYS A 1 63 ? -6.540  -10.767 -8.540  1.00 0.00 ? 63  LYS A H    7  
ATOM   9424  H  HA   . LYS A 1 63 ? -9.139  -10.898 -7.309  1.00 0.00 ? 63  LYS A HA   7  
ATOM   9425  H  HB2  . LYS A 1 63 ? -6.708  -9.317  -6.381  1.00 0.00 ? 63  LYS A HB2  7  
ATOM   9426  H  HB3  . LYS A 1 63 ? -8.149  -9.639  -5.417  1.00 0.00 ? 63  LYS A HB3  7  
ATOM   9427  H  HG2  . LYS A 1 63 ? -7.663  -12.096 -5.592  1.00 0.00 ? 63  LYS A HG2  7  
ATOM   9428  H  HG3  . LYS A 1 63 ? -6.176  -11.704 -6.460  1.00 0.00 ? 63  LYS A HG3  7  
ATOM   9429  H  HD2  . LYS A 1 63 ? -5.592  -12.142 -4.170  1.00 0.00 ? 63  LYS A HD2  7  
ATOM   9430  H  HD3  . LYS A 1 63 ? -5.417  -10.407 -4.434  1.00 0.00 ? 63  LYS A HD3  7  
ATOM   9431  H  HE2  . LYS A 1 63 ? -7.580  -10.010 -3.333  1.00 0.00 ? 63  LYS A HE2  7  
ATOM   9432  H  HE3  . LYS A 1 63 ? -7.808  -11.744 -3.112  1.00 0.00 ? 63  LYS A HE3  7  
ATOM   9433  H  HZ1  . LYS A 1 63 ? -5.632  -10.123 -1.914  1.00 0.00 ? 63  LYS A HZ1  7  
ATOM   9434  H  HZ2  . LYS A 1 63 ? -5.867  -11.780 -1.688  1.00 0.00 ? 63  LYS A HZ2  7  
ATOM   9435  H  HZ3  . LYS A 1 63 ? -7.010  -10.682 -1.104  1.00 0.00 ? 63  LYS A HZ3  7  
ATOM   9436  N  N    . HIS A 1 64 ? -8.314  -8.114  -8.853  1.00 0.00 ? 64  HIS A N    7  
ATOM   9437  C  CA   . HIS A 1 64 ? -8.863  -6.892  -9.500  1.00 0.00 ? 64  HIS A CA   7  
ATOM   9438  C  C    . HIS A 1 64 ? -9.976  -7.245  -10.509 1.00 0.00 ? 64  HIS A C    7  
ATOM   9439  O  O    . HIS A 1 64 ? -10.777 -6.379  -10.865 1.00 0.00 ? 64  HIS A O    7  
ATOM   9440  C  CB   . HIS A 1 64 ? -7.755  -6.086  -10.235 1.00 0.00 ? 64  HIS A CB   7  
ATOM   9441  C  CG   . HIS A 1 64 ? -6.849  -5.296  -9.347  1.00 0.00 ? 64  HIS A CG   7  
ATOM   9442  N  ND1  . HIS A 1 64 ? -7.280  -4.211  -8.624  1.00 0.00 ? 64  HIS A ND1  7  
ATOM   9443  C  CD2  . HIS A 1 64 ? -5.509  -5.380  -9.138  1.00 0.00 ? 64  HIS A CD2  7  
ATOM   9444  C  CE1  . HIS A 1 64 ? -6.230  -3.675  -8.018  1.00 0.00 ? 64  HIS A CE1  7  
ATOM   9445  N  NE2  . HIS A 1 64 ? -5.126  -4.342  -8.299  1.00 0.00 ? 64  HIS A NE2  7  
ATOM   9446  H  H    . HIS A 1 64 ? -7.433  -8.430  -9.125  1.00 0.00 ? 64  HIS A H    7  
ATOM   9447  H  HA   . HIS A 1 64 ? -9.293  -6.267  -8.719  1.00 0.00 ? 64  HIS A HA   7  
ATOM   9448  H  HB2  . HIS A 1 64 ? -7.140  -6.766  -10.808 1.00 0.00 ? 64  HIS A HB2  7  
ATOM   9449  H  HB3  . HIS A 1 64 ? -8.211  -5.377  -10.923 1.00 0.00 ? 64  HIS A HB3  7  
ATOM   9450  H  HD1  . HIS A 1 64 ? -8.207  -3.885  -8.571  1.00 0.00 ? 64  HIS A HD1  7  
ATOM   9451  H  HD2  . HIS A 1 64 ? -4.840  -6.118  -9.563  1.00 0.00 ? 64  HIS A HD2  7  
ATOM   9452  H  HE1  . HIS A 1 64 ? -6.270  -2.792  -7.390  1.00 0.00 ? 64  HIS A HE1  7  
ATOM   9453  N  N    . ASP A 1 65 ? -10.003 -8.511  -10.974 1.00 0.00 ? 65  ASP A N    7  
ATOM   9454  C  CA   . ASP A 1 65 ? -10.977 -8.975  -11.980 1.00 0.00 ? 65  ASP A CA   7  
ATOM   9455  C  C    . ASP A 1 65 ? -12.397 -9.032  -11.374 1.00 0.00 ? 65  ASP A C    7  
ATOM   9456  O  O    . ASP A 1 65 ? -13.378 -8.677  -12.038 1.00 0.00 ? 65  ASP A O    7  
ATOM   9457  C  CB   . ASP A 1 65 ? -10.541 -10.345 -12.555 1.00 0.00 ? 65  ASP A CB   7  
ATOM   9458  C  CG   . ASP A 1 65 ? -11.510 -10.913 -13.604 1.00 0.00 ? 65  ASP A CG   7  
ATOM   9459  O  OD1  . ASP A 1 65 ? -11.478 -10.454 -14.760 1.00 0.00 ? 65  ASP A OD1  7  
ATOM   9460  O  OD2  . ASP A 1 65 ? -12.301 -11.823 -13.267 1.00 0.00 ? 65  ASP A OD2  7  
ATOM   9461  H  H    . ASP A 1 65 ? -9.366  -9.159  -10.607 1.00 0.00 ? 65  ASP A H    7  
ATOM   9462  H  HA   . ASP A 1 65 ? -10.985 -8.253  -12.786 1.00 0.00 ? 65  ASP A HA   7  
ATOM   9463  H  HB2  . ASP A 1 65 ? -9.564  -10.234 -13.015 1.00 0.00 ? 65  ASP A HB2  7  
ATOM   9464  H  HB3  . ASP A 1 65 ? -10.445 -11.057 -11.739 1.00 0.00 ? 65  ASP A HB3  7  
ATOM   9465  N  N    . ALA A 1 66 ? -12.493 -9.472  -10.107 1.00 0.00 ? 66  ALA A N    7  
ATOM   9466  C  CA   . ALA A 1 66 ? -13.744 -9.409  -9.323  1.00 0.00 ? 66  ALA A CA   7  
ATOM   9467  C  C    . ALA A 1 66 ? -14.029 -7.952  -8.911  1.00 0.00 ? 66  ALA A C    7  
ATOM   9468  O  O    . ALA A 1 66 ? -15.184 -7.509  -8.887  1.00 0.00 ? 66  ALA A O    7  
ATOM   9469  C  CB   . ALA A 1 66 ? -13.627 -10.308 -8.086  1.00 0.00 ? 66  ALA A CB   7  
ATOM   9470  H  H    . ALA A 1 66 ? -11.715 -9.860  -9.672  1.00 0.00 ? 66  ALA A H    7  
ATOM   9471  H  HA   . ALA A 1 66 ? -14.564 -9.776  -9.938  1.00 0.00 ? 66  ALA A HA   7  
ATOM   9472  H  HB1  . ALA A 1 66 ? -13.418 -11.327 -8.393  1.00 0.00 ? 66  ALA A HB1  7  
ATOM   9473  H  HB2  . ALA A 1 66 ? -14.553 -10.295 -7.523  1.00 0.00 ? 66  ALA A HB2  7  
ATOM   9474  H  HB3  . ALA A 1 66 ? -12.822 -9.959  -7.450  1.00 0.00 ? 66  ALA A HB3  7  
ATOM   9475  N  N    . ASP A 1 67 ? -12.939 -7.281  -8.490  1.00 0.00 ? 67  ASP A N    7  
ATOM   9476  C  CA   . ASP A 1 67 ? -12.845 -5.817  -8.336  1.00 0.00 ? 67  ASP A CA   7  
ATOM   9477  C  C    . ASP A 1 67 ? -13.363 -5.365  -6.959  1.00 0.00 ? 67  ASP A C    7  
ATOM   9478  O  O    . ASP A 1 67 ? -12.568 -4.990  -6.086  1.00 0.00 ? 67  ASP A O    7  
ATOM   9479  C  CB   . ASP A 1 67 ? -13.531 -5.038  -9.519  1.00 0.00 ? 67  ASP A CB   7  
ATOM   9480  C  CG   . ASP A 1 67 ? -13.587 -3.514  -9.311  1.00 0.00 ? 67  ASP A CG   7  
ATOM   9481  O  OD1  . ASP A 1 67 ? -12.541 -2.844  -9.460  1.00 0.00 ? 67  ASP A OD1  7  
ATOM   9482  O  OD2  . ASP A 1 67 ? -14.676 -2.981  -8.982  1.00 0.00 ? 67  ASP A OD2  7  
ATOM   9483  H  H    . ASP A 1 67 ? -12.177 -7.820  -8.201  1.00 0.00 ? 67  ASP A H    7  
ATOM   9484  H  HA   . ASP A 1 67 ? -11.784 -5.594  -8.372  1.00 0.00 ? 67  ASP A HA   7  
ATOM   9485  H  HB2  . ASP A 1 67 ? -12.987 -5.237  -10.440 1.00 0.00 ? 67  ASP A HB2  7  
ATOM   9486  H  HB3  . ASP A 1 67 ? -14.544 -5.415  -9.643  1.00 0.00 ? 67  ASP A HB3  7  
ATOM   9487  N  N    . SER A 1 68 ? -14.689 -5.473  -6.769  1.00 0.00 ? 68  SER A N    7  
ATOM   9488  C  CA   . SER A 1 68 ? -15.429 -4.863  -5.639  1.00 0.00 ? 68  SER A CA   7  
ATOM   9489  C  C    . SER A 1 68 ? -14.978 -5.385  -4.254  1.00 0.00 ? 68  SER A C    7  
ATOM   9490  O  O    . SER A 1 68 ? -14.973 -4.636  -3.266  1.00 0.00 ? 68  SER A O    7  
ATOM   9491  C  CB   . SER A 1 68 ? -16.951 -5.118  -5.835  1.00 0.00 ? 68  SER A CB   7  
ATOM   9492  O  OG   . SER A 1 68 ? -17.730 -4.495  -4.826  1.00 0.00 ? 68  SER A OG   7  
ATOM   9493  H  H    . SER A 1 68 ? -15.217 -5.973  -7.427  1.00 0.00 ? 68  SER A H    7  
ATOM   9494  H  HA   . SER A 1 68 ? -15.260 -3.790  -5.678  1.00 0.00 ? 68  SER A HA   7  
ATOM   9495  H  HB2  . SER A 1 68 ? -17.267 -4.723  -6.794  1.00 0.00 ? 68  SER A HB2  7  
ATOM   9496  H  HB3  . SER A 1 68 ? -17.146 -6.183  -5.813  1.00 0.00 ? 68  SER A HB3  7  
ATOM   9497  H  HG   . SER A 1 68 ? -17.200 -3.817  -4.389  1.00 0.00 ? 68  SER A HG   7  
ATOM   9498  N  N    . PHE A 1 69 ? -14.596 -6.672  -4.195  1.00 0.00 ? 69  PHE A N    7  
ATOM   9499  C  CA   . PHE A 1 69 ? -14.303 -7.382  -2.919  1.00 0.00 ? 69  PHE A CA   7  
ATOM   9500  C  C    . PHE A 1 69 ? -13.054 -8.279  -3.042  1.00 0.00 ? 69  PHE A C    7  
ATOM   9501  O  O    . PHE A 1 69 ? -12.751 -9.049  -2.128  1.00 0.00 ? 69  PHE A O    7  
ATOM   9502  C  CB   . PHE A 1 69 ? -15.547 -8.188  -2.433  1.00 0.00 ? 69  PHE A CB   7  
ATOM   9503  C  CG   . PHE A 1 69 ? -16.625 -7.308  -1.787  1.00 0.00 ? 69  PHE A CG   7  
ATOM   9504  C  CD1  . PHE A 1 69 ? -16.535 -6.947  -0.441  1.00 0.00 ? 69  PHE A CD1  7  
ATOM   9505  C  CD2  . PHE A 1 69 ? -17.713 -6.830  -2.519  1.00 0.00 ? 69  PHE A CD2  7  
ATOM   9506  C  CE1  . PHE A 1 69 ? -17.492 -6.134  0.146   1.00 0.00 ? 69  PHE A CE1  7  
ATOM   9507  C  CE2  . PHE A 1 69 ? -18.666 -6.015  -1.935  1.00 0.00 ? 69  PHE A CE2  7  
ATOM   9508  C  CZ   . PHE A 1 69 ? -18.560 -5.674  -0.600  1.00 0.00 ? 69  PHE A CZ   7  
ATOM   9509  H  H    . PHE A 1 69 ? -14.419 -7.145  -5.034  1.00 0.00 ? 69  PHE A H    7  
ATOM   9510  H  HA   . PHE A 1 69 ? -14.068 -6.627  -2.171  1.00 0.00 ? 69  PHE A HA   7  
ATOM   9511  H  HB2  . PHE A 1 69 ? -15.989 -8.715  -3.278  1.00 0.00 ? 69  PHE A HB2  7  
ATOM   9512  H  HB3  . PHE A 1 69 ? -15.238 -8.924  -1.699  1.00 0.00 ? 69  PHE A HB3  7  
ATOM   9513  H  HD1  . PHE A 1 69 ? -15.700 -7.304  0.151   1.00 0.00 ? 69  PHE A HD1  7  
ATOM   9514  H  HD2  . PHE A 1 69 ? -17.807 -7.094  -3.567  1.00 0.00 ? 69  PHE A HD2  7  
ATOM   9515  H  HE1  . PHE A 1 69 ? -17.407 -5.870  1.193   1.00 0.00 ? 69  PHE A HE1  7  
ATOM   9516  H  HE2  . PHE A 1 69 ? -19.501 -5.656  -2.521  1.00 0.00 ? 69  PHE A HE2  7  
ATOM   9517  H  HZ   . PHE A 1 69 ? -19.308 -5.041  -0.143  1.00 0.00 ? 69  PHE A HZ   7  
ATOM   9518  N  N    . TYR A 1 70 ? -12.354 -8.166  -4.189  1.00 0.00 ? 70  TYR A N    7  
ATOM   9519  C  CA   . TYR A 1 70 ? -11.081 -8.878  -4.491  1.00 0.00 ? 70  TYR A CA   7  
ATOM   9520  C  C    . TYR A 1 70 ? -11.159 -10.428 -4.473  1.00 0.00 ? 70  TYR A C    7  
ATOM   9521  O  O    . TYR A 1 70 ? -10.143 -11.091 -4.682  1.00 0.00 ? 70  TYR A O    7  
ATOM   9522  C  CB   . TYR A 1 70 ? -9.926  -8.364  -3.576  1.00 0.00 ? 70  TYR A CB   7  
ATOM   9523  C  CG   . TYR A 1 70 ? -9.556  -6.894  -3.822  1.00 0.00 ? 70  TYR A CG   7  
ATOM   9524  C  CD1  . TYR A 1 70 ? -9.057  -6.486  -5.062  1.00 0.00 ? 70  TYR A CD1  7  
ATOM   9525  C  CD2  . TYR A 1 70 ? -9.713  -5.925  -2.833  1.00 0.00 ? 70  TYR A CD2  7  
ATOM   9526  C  CE1  . TYR A 1 70 ? -8.726  -5.170  -5.301  1.00 0.00 ? 70  TYR A CE1  7  
ATOM   9527  C  CE2  . TYR A 1 70 ? -9.385  -4.604  -3.066  1.00 0.00 ? 70  TYR A CE2  7  
ATOM   9528  C  CZ   . TYR A 1 70 ? -8.896  -4.228  -4.304  1.00 0.00 ? 70  TYR A CZ   7  
ATOM   9529  O  OH   . TYR A 1 70 ? -8.564  -2.909  -4.542  1.00 0.00 ? 70  TYR A OH   7  
ATOM   9530  H  H    . TYR A 1 70 ? -12.670 -7.512  -4.844  1.00 0.00 ? 70  TYR A H    7  
ATOM   9531  H  HA   . TYR A 1 70 ? -10.833 -8.599  -5.511  1.00 0.00 ? 70  TYR A HA   7  
ATOM   9532  H  HB2  . TYR A 1 70 ? -10.218 -8.474  -2.536  1.00 0.00 ? 70  TYR A HB2  7  
ATOM   9533  H  HB3  . TYR A 1 70 ? -9.032  -8.961  -3.749  1.00 0.00 ? 70  TYR A HB3  7  
ATOM   9534  H  HD1  . TYR A 1 70 ? -8.924  -7.222  -5.846  1.00 0.00 ? 70  TYR A HD1  7  
ATOM   9535  H  HD2  . TYR A 1 70 ? -10.098 -6.222  -1.865  1.00 0.00 ? 70  TYR A HD2  7  
ATOM   9536  H  HE1  . TYR A 1 70 ? -8.342  -4.880  -6.272  1.00 0.00 ? 70  TYR A HE1  7  
ATOM   9537  H  HE2  . TYR A 1 70 ? -9.512  -3.870  -2.281  1.00 0.00 ? 70  TYR A HE2  7  
ATOM   9538  H  HH   . TYR A 1 70 ? -9.071  -2.576  -5.296  1.00 0.00 ? 70  TYR A HH   7  
ATOM   9539  N  N    . GLN A 1 71 ? -12.343 -11.010 -4.241  1.00 0.00 ? 71  GLN A N    7  
ATOM   9540  C  CA   . GLN A 1 71 ? -12.529 -12.470 -4.274  1.00 0.00 ? 71  GLN A CA   7  
ATOM   9541  C  C    . GLN A 1 71 ? -12.994 -12.884 -5.680  1.00 0.00 ? 71  GLN A C    7  
ATOM   9542  O  O    . GLN A 1 71 ? -12.221 -12.766 -6.635  1.00 0.00 ? 71  GLN A O    7  
ATOM   9543  C  CB   . GLN A 1 71 ? -13.511 -12.900 -3.151  1.00 0.00 ? 71  GLN A CB   7  
ATOM   9544  C  CG   . GLN A 1 71 ? -13.009 -12.616 -1.722  1.00 0.00 ? 71  GLN A CG   7  
ATOM   9545  C  CD   . GLN A 1 71 ? -14.042 -12.915 -0.624  1.00 0.00 ? 71  GLN A CD   7  
ATOM   9546  O  OE1  . GLN A 1 71 ? -14.084 -12.229 0.398   1.00 0.00 ? 71  GLN A OE1  7  
ATOM   9547  N  NE2  . GLN A 1 71 ? -14.844 -13.960 -0.798  1.00 0.00 ? 71  GLN A NE2  7  
ATOM   9548  H  H    . GLN A 1 71 ? -13.110 -10.450 -4.041  1.00 0.00 ? 71  GLN A H    7  
ATOM   9549  H  HA   . GLN A 1 71 ? -11.566 -12.946 -4.093  1.00 0.00 ? 71  GLN A HA   7  
ATOM   9550  H  HB2  . GLN A 1 71 ? -14.446 -12.366 -3.292  1.00 0.00 ? 71  GLN A HB2  7  
ATOM   9551  H  HB3  . GLN A 1 71 ? -13.705 -13.965 -3.242  1.00 0.00 ? 71  GLN A HB3  7  
ATOM   9552  H  HG2  . GLN A 1 71 ? -12.132 -13.227 -1.540  1.00 0.00 ? 71  GLN A HG2  7  
ATOM   9553  H  HG3  . GLN A 1 71 ? -12.727 -11.570 -1.659  1.00 0.00 ? 71  GLN A HG3  7  
ATOM   9554  H  HE21 . GLN A 1 71 ? -14.747 -14.502 -1.611  1.00 0.00 ? 71  GLN A HE21 7  
ATOM   9555  H  HE22 . GLN A 1 71 ? -15.512 -14.147 -0.109  1.00 0.00 ? 71  GLN A HE22 7  
ATOM   9556  N  N    . PHE A 1 72 ? -14.254 -13.333 -5.830  1.00 0.00 ? 72  PHE A N    7  
ATOM   9557  C  CA   . PHE A 1 72 ? -14.833 -13.747 -7.106  1.00 0.00 ? 72  PHE A CA   7  
ATOM   9558  C  C    . PHE A 1 72 ? -16.286 -13.313 -7.055  1.00 0.00 ? 72  PHE A C    7  
ATOM   9559  O  O    . PHE A 1 72 ? -16.942 -13.477 -6.026  1.00 0.00 ? 72  PHE A O    7  
ATOM   9560  C  CB   . PHE A 1 72 ? -14.701 -15.286 -7.319  1.00 0.00 ? 72  PHE A CB   7  
ATOM   9561  C  CG   . PHE A 1 72 ? -13.244 -15.752 -7.395  1.00 0.00 ? 72  PHE A CG   7  
ATOM   9562  C  CD1  . PHE A 1 72 ? -12.544 -15.726 -8.597  1.00 0.00 ? 72  PHE A CD1  7  
ATOM   9563  C  CD2  . PHE A 1 72 ? -12.553 -16.144 -6.246  1.00 0.00 ? 72  PHE A CD2  7  
ATOM   9564  C  CE1  . PHE A 1 72 ? -11.216 -16.098 -8.651  1.00 0.00 ? 72  PHE A CE1  7  
ATOM   9565  C  CE2  . PHE A 1 72 ? -11.224 -16.503 -6.304  1.00 0.00 ? 72  PHE A CE2  7  
ATOM   9566  C  CZ   . PHE A 1 72 ? -10.557 -16.479 -7.506  1.00 0.00 ? 72  PHE A CZ   7  
ATOM   9567  H  H    . PHE A 1 72 ? -14.846 -13.355 -5.065  1.00 0.00 ? 72  PHE A H    7  
ATOM   9568  H  HA   . PHE A 1 72 ? -14.328 -13.214 -7.913  1.00 0.00 ? 72  PHE A HA   7  
ATOM   9569  H  HB2  . PHE A 1 72 ? -15.184 -15.804 -6.494  1.00 0.00 ? 72  PHE A HB2  7  
ATOM   9570  H  HB3  . PHE A 1 72 ? -15.200 -15.570 -8.235  1.00 0.00 ? 72  PHE A HB3  7  
ATOM   9571  H  HD1  . PHE A 1 72 ? -13.053 -15.426 -9.506  1.00 0.00 ? 72  PHE A HD1  7  
ATOM   9572  H  HD2  . PHE A 1 72 ? -13.074 -16.174 -5.297  1.00 0.00 ? 72  PHE A HD2  7  
ATOM   9573  H  HE1  . PHE A 1 72 ? -10.689 -16.082 -9.597  1.00 0.00 ? 72  PHE A HE1  7  
ATOM   9574  H  HE2  . PHE A 1 72 ? -10.705 -16.796 -5.398  1.00 0.00 ? 72  PHE A HE2  7  
ATOM   9575  H  HZ   . PHE A 1 72 ? -9.512  -16.762 -7.553  1.00 0.00 ? 72  PHE A HZ   7  
ATOM   9576  N  N    . SER A 1 73 ? -16.780 -12.766 -8.153  1.00 0.00 ? 73  SER A N    7  
ATOM   9577  C  CA   . SER A 1 73 ? -18.073 -12.091 -8.200  1.00 0.00 ? 73  SER A CA   7  
ATOM   9578  C  C    . SER A 1 73 ? -18.790 -12.422 -9.506  1.00 0.00 ? 73  SER A C    7  
ATOM   9579  O  O    . SER A 1 73 ? -18.206 -12.368 -10.587 1.00 0.00 ? 73  SER A O    7  
ATOM   9580  C  CB   . SER A 1 73 ? -17.865 -10.564 -8.048  1.00 0.00 ? 73  SER A CB   7  
ATOM   9581  O  OG   . SER A 1 73 ? -16.982 -10.056 -9.034  1.00 0.00 ? 73  SER A OG   7  
ATOM   9582  H  H    . SER A 1 73 ? -16.253 -12.808 -8.962  1.00 0.00 ? 73  SER A H    7  
ATOM   9583  H  HA   . SER A 1 73 ? -18.682 -12.445 -7.364  1.00 0.00 ? 73  SER A HA   7  
ATOM   9584  H  HB2  . SER A 1 73 ? -18.816 -10.052 -8.140  1.00 0.00 ? 73  SER A HB2  7  
ATOM   9585  H  HB3  . SER A 1 73 ? -17.446 -10.352 -7.071  1.00 0.00 ? 73  SER A HB3  7  
ATOM   9586  H  HG   . SER A 1 73 ? -16.979 -9.094  -9.001  1.00 0.00 ? 73  SER A HG   7  
ATOM   9587  N  N    . CYS A 1 74 ? -20.063 -12.779 -9.364  1.00 0.00 ? 74  CYS A N    7  
ATOM   9588  C  CA   . CYS A 1 74 ? -20.983 -12.984 -10.489 1.00 0.00 ? 74  CYS A CA   7  
ATOM   9589  C  C    . CYS A 1 74 ? -21.405 -11.606 -11.015 1.00 0.00 ? 74  CYS A C    7  
ATOM   9590  O  O    . CYS A 1 74 ? -21.839 -10.774 -10.229 1.00 0.00 ? 74  CYS A O    7  
ATOM   9591  C  CB   . CYS A 1 74 ? -22.203 -13.822 -10.015 1.00 0.00 ? 74  CYS A CB   7  
ATOM   9592  S  SG   . CYS A 1 74 ? -23.549 -14.030 -11.233 1.00 0.00 ? 74  CYS A SG   7  
ATOM   9593  H  H    . CYS A 1 74 ? -20.396 -12.871 -8.455  1.00 0.00 ? 74  CYS A H    7  
ATOM   9594  H  HA   . CYS A 1 74 ? -20.457 -13.529 -11.272 1.00 0.00 ? 74  CYS A HA   7  
ATOM   9595  H  HB2  . CYS A 1 74 ? -21.864 -14.817 -9.748  1.00 0.00 ? 74  CYS A HB2  7  
ATOM   9596  H  HB3  . CYS A 1 74 ? -22.634 -13.360 -9.136  1.00 0.00 ? 74  CYS A HB3  7  
ATOM   9597  N  N    . ASN A 1 75 ? -21.247 -11.343 -12.320 1.00 0.00 ? 75  ASN A N    7  
ATOM   9598  C  CA   . ASN A 1 75 ? -21.620 -10.034 -12.911 1.00 0.00 ? 75  ASN A CA   7  
ATOM   9599  C  C    . ASN A 1 75 ? -23.130 -9.761  -12.769 1.00 0.00 ? 75  ASN A C    7  
ATOM   9600  O  O    . ASN A 1 75 ? -23.554 -8.606  -12.686 1.00 0.00 ? 75  ASN A O    7  
ATOM   9601  C  CB   . ASN A 1 75 ? -21.205 -9.964  -14.396 1.00 0.00 ? 75  ASN A CB   7  
ATOM   9602  C  CG   . ASN A 1 75 ? -21.495 -8.607  -15.053 1.00 0.00 ? 75  ASN A CG   7  
ATOM   9603  O  OD1  . ASN A 1 75 ? -20.679 -7.698  -14.989 1.00 0.00 ? 75  ASN A OD1  7  
ATOM   9604  N  ND2  . ASN A 1 75 ? -22.664 -8.457  -15.666 1.00 0.00 ? 75  ASN A ND2  7  
ATOM   9605  H  H    . ASN A 1 75 ? -20.856 -12.027 -12.901 1.00 0.00 ? 75  ASN A H    7  
ATOM   9606  H  HA   . ASN A 1 75 ? -21.077 -9.265  -12.362 1.00 0.00 ? 75  ASN A HA   7  
ATOM   9607  H  HB2  . ASN A 1 75 ? -20.140 -10.151 -14.470 1.00 0.00 ? 75  ASN A HB2  7  
ATOM   9608  H  HB3  . ASN A 1 75 ? -21.726 -10.735 -14.948 1.00 0.00 ? 75  ASN A HB3  7  
ATOM   9609  H  HD21 . ASN A 1 75 ? -23.289 -9.214  -15.677 1.00 0.00 ? 75  ASN A HD21 7  
ATOM   9610  H  HD22 . ASN A 1 75 ? -22.852 -7.595  -16.095 1.00 0.00 ? 75  ASN A HD22 7  
ATOM   9611  N  N    . ILE A 1 76 ? -23.918 -10.844 -12.716 1.00 0.00 ? 76  ILE A N    7  
ATOM   9612  C  CA   . ILE A 1 76 ? -25.379 -10.776 -12.779 1.00 0.00 ? 76  ILE A CA   7  
ATOM   9613  C  C    . ILE A 1 76 ? -26.012 -10.594 -11.376 1.00 0.00 ? 76  ILE A C    7  
ATOM   9614  O  O    . ILE A 1 76 ? -26.915 -9.768  -11.225 1.00 0.00 ? 76  ILE A O    7  
ATOM   9615  C  CB   . ILE A 1 76 ? -25.975 -12.042 -13.521 1.00 0.00 ? 76  ILE A CB   7  
ATOM   9616  C  CG1  . ILE A 1 76 ? -25.119 -12.371 -14.807 1.00 0.00 ? 76  ILE A CG1  7  
ATOM   9617  C  CG2  . ILE A 1 76 ? -27.475 -11.825 -13.860 1.00 0.00 ? 76  ILE A CG2  7  
ATOM   9618  C  CD1  . ILE A 1 76 ? -25.763 -13.278 -15.842 1.00 0.00 ? 76  ILE A CD1  7  
ATOM   9619  H  H    . ILE A 1 76 ? -23.499 -11.719 -12.649 1.00 0.00 ? 76  ILE A H    7  
ATOM   9620  H  HA   . ILE A 1 76 ? -25.632 -9.898  -13.382 1.00 0.00 ? 76  ILE A HA   7  
ATOM   9621  H  HB   . ILE A 1 76 ? -25.916 -12.888 -12.839 1.00 0.00 ? 76  ILE A HB   7  
ATOM   9622  H  HG12 . ILE A 1 76 ? -24.865 -11.452 -15.314 1.00 0.00 ? 76  ILE A HG12 7  
ATOM   9623  H  HG13 . ILE A 1 76 ? -24.199 -12.860 -14.489 1.00 0.00 ? 76  ILE A HG13 7  
ATOM   9624  H  HG21 . ILE A 1 76 ? -27.581 -10.986 -14.539 1.00 0.00 ? 76  ILE A HG21 7  
ATOM   9625  H  HG22 . ILE A 1 76 ? -28.030 -11.620 -12.953 1.00 0.00 ? 76  ILE A HG22 7  
ATOM   9626  H  HG23 . ILE A 1 76 ? -27.880 -12.715 -14.328 1.00 0.00 ? 76  ILE A HG23 7  
ATOM   9627  H  HD11 . ILE A 1 76 ? -26.660 -12.815 -16.218 1.00 0.00 ? 76  ILE A HD11 7  
ATOM   9628  H  HD12 . ILE A 1 76 ? -26.010 -14.229 -15.391 1.00 0.00 ? 76  ILE A HD12 7  
ATOM   9629  H  HD13 . ILE A 1 76 ? -25.073 -13.440 -16.658 1.00 0.00 ? 76  ILE A HD13 7  
ATOM   9630  N  N    . CYS A 1 77 ? -25.547 -11.340 -10.334 1.00 0.00 ? 77  CYS A N    7  
ATOM   9631  C  CA   . CYS A 1 77 ? -26.163 -11.244 -8.983  1.00 0.00 ? 77  CYS A CA   7  
ATOM   9632  C  C    . CYS A 1 77 ? -25.114 -11.071 -7.874  1.00 0.00 ? 77  CYS A C    7  
ATOM   9633  O  O    . CYS A 1 77 ? -25.482 -10.911 -6.707  1.00 0.00 ? 77  CYS A O    7  
ATOM   9634  C  CB   . CYS A 1 77 ? -27.094 -12.457 -8.705  1.00 0.00 ? 77  CYS A CB   7  
ATOM   9635  S  SG   . CYS A 1 77 ? -26.257 -14.059 -8.503  1.00 0.00 ? 77  CYS A SG   7  
ATOM   9636  H  H    . CYS A 1 77 ? -24.790 -11.942 -10.461 1.00 0.00 ? 77  CYS A H    7  
ATOM   9637  H  HA   . CYS A 1 77 ? -26.769 -10.345 -8.965  1.00 0.00 ? 77  CYS A HA   7  
ATOM   9638  H  HB2  . CYS A 1 77 ? -27.661 -12.277 -7.798  1.00 0.00 ? 77  CYS A HB2  7  
ATOM   9639  H  HB3  . CYS A 1 77 ? -27.790 -12.559 -9.529  1.00 0.00 ? 77  CYS A HB3  7  
ATOM   9640  N  N    . GLY A 1 78 ? -23.805 -11.087 -8.250  1.00 0.00 ? 78  GLY A N    7  
ATOM   9641  C  CA   . GLY A 1 78 ? -22.701 -10.817 -7.320  1.00 0.00 ? 78  GLY A CA   7  
ATOM   9642  C  C    . GLY A 1 78 ? -22.677 -11.688 -6.089  1.00 0.00 ? 78  GLY A C    7  
ATOM   9643  O  O    . GLY A 1 78 ? -22.226 -11.243 -5.042  1.00 0.00 ? 78  GLY A O    7  
ATOM   9644  H  H    . GLY A 1 78 ? -23.585 -11.247 -9.185  1.00 0.00 ? 78  GLY A H    7  
ATOM   9645  H  HA2  . GLY A 1 78 ? -21.774 -10.963 -7.845  1.00 0.00 ? 78  GLY A HA2  7  
ATOM   9646  H  HA3  . GLY A 1 78 ? -22.760 -9.779  -7.020  1.00 0.00 ? 78  GLY A HA3  7  
ATOM   9647  N  N    . LYS A 1 79 ? -23.150 -12.941 -6.232  1.00 0.00 ? 79  LYS A N    7  
ATOM   9648  C  CA   . LYS A 1 79 ? -23.360 -13.846 -5.099  1.00 0.00 ? 79  LYS A CA   7  
ATOM   9649  C  C    . LYS A 1 79 ? -22.048 -14.194 -4.337  1.00 0.00 ? 79  LYS A C    7  
ATOM   9650  O  O    . LYS A 1 79 ? -22.119 -14.570 -3.166  1.00 0.00 ? 79  LYS A O    7  
ATOM   9651  C  CB   . LYS A 1 79 ? -24.048 -15.145 -5.606  1.00 0.00 ? 79  LYS A CB   7  
ATOM   9652  C  CG   . LYS A 1 79 ? -24.807 -15.921 -4.498  1.00 0.00 ? 79  LYS A CG   7  
ATOM   9653  C  CD   . LYS A 1 79 ? -24.628 -17.452 -4.545  1.00 0.00 ? 79  LYS A CD   7  
ATOM   9654  C  CE   . LYS A 1 79 ? -23.185 -17.889 -4.252  1.00 0.00 ? 79  LYS A CE   7  
ATOM   9655  N  NZ   . LYS A 1 79 ? -22.692 -17.413 -2.937  1.00 0.00 ? 79  LYS A NZ   7  
ATOM   9656  H  H    . LYS A 1 79 ? -23.478 -13.226 -7.106  1.00 0.00 ? 79  LYS A H    7  
ATOM   9657  H  HA   . LYS A 1 79 ? -24.039 -13.348 -4.410  1.00 0.00 ? 79  LYS A HA   7  
ATOM   9658  H  HB2  . LYS A 1 79 ? -24.765 -14.886 -6.388  1.00 0.00 ? 79  LYS A HB2  7  
ATOM   9659  H  HB3  . LYS A 1 79 ? -23.299 -15.790 -6.041  1.00 0.00 ? 79  LYS A HB3  7  
ATOM   9660  H  HG2  . LYS A 1 79 ? -24.470 -15.570 -3.529  1.00 0.00 ? 79  LYS A HG2  7  
ATOM   9661  H  HG3  . LYS A 1 79 ? -25.863 -15.689 -4.593  1.00 0.00 ? 79  LYS A HG3  7  
ATOM   9662  H  HD2  . LYS A 1 79 ? -25.278 -17.900 -3.804  1.00 0.00 ? 79  LYS A HD2  7  
ATOM   9663  H  HD3  . LYS A 1 79 ? -24.915 -17.813 -5.530  1.00 0.00 ? 79  LYS A HD3  7  
ATOM   9664  H  HE2  . LYS A 1 79 ? -23.140 -18.969 -4.267  1.00 0.00 ? 79  LYS A HE2  7  
ATOM   9665  H  HE3  . LYS A 1 79 ? -22.531 -17.501 -5.028  1.00 0.00 ? 79  LYS A HE3  7  
ATOM   9666  H  HZ1  . LYS A 1 79 ? -21.686 -17.658 -2.820  1.00 0.00 ? 79  LYS A HZ1  7  
ATOM   9667  H  HZ2  . LYS A 1 79 ? -23.228 -17.860 -2.168  1.00 0.00 ? 79  LYS A HZ2  7  
ATOM   9668  H  HZ3  . LYS A 1 79 ? -22.794 -16.382 -2.864  1.00 0.00 ? 79  LYS A HZ3  7  
ATOM   9669  N  N    . LYS A 1 80 ? -20.877 -14.072 -5.020  1.00 0.00 ? 80  LYS A N    7  
ATOM   9670  C  CA   . LYS A 1 80 ? -19.526 -14.273 -4.432  1.00 0.00 ? 80  LYS A CA   7  
ATOM   9671  C  C    . LYS A 1 80 ? -19.202 -15.766 -4.281  1.00 0.00 ? 80  LYS A C    7  
ATOM   9672  O  O    . LYS A 1 80 ? -19.915 -16.506 -3.591  1.00 0.00 ? 80  LYS A O    7  
ATOM   9673  C  CB   . LYS A 1 80 ? -19.291 -13.520 -3.081  1.00 0.00 ? 80  LYS A CB   7  
ATOM   9674  C  CG   . LYS A 1 80 ? -19.522 -11.995 -3.144  1.00 0.00 ? 80  LYS A CG   7  
ATOM   9675  C  CD   . LYS A 1 80 ? -18.721 -11.300 -4.270  1.00 0.00 ? 80  LYS A CD   7  
ATOM   9676  C  CE   . LYS A 1 80 ? -18.887 -9.771  -4.249  1.00 0.00 ? 80  LYS A CE   7  
ATOM   9677  N  NZ   . LYS A 1 80 ? -20.315 -9.356  -4.275  1.00 0.00 ? 80  LYS A NZ   7  
ATOM   9678  H  H    . LYS A 1 80 ? -20.922 -13.864 -5.968  1.00 0.00 ? 80  LYS A H    7  
ATOM   9679  H  HA   . LYS A 1 80 ? -18.837 -13.858 -5.165  1.00 0.00 ? 80  LYS A HA   7  
ATOM   9680  H  HB2  . LYS A 1 80 ? -19.964 -13.927 -2.332  1.00 0.00 ? 80  LYS A HB2  7  
ATOM   9681  H  HB3  . LYS A 1 80 ? -18.267 -13.693 -2.755  1.00 0.00 ? 80  LYS A HB3  7  
ATOM   9682  H  HG2  . LYS A 1 80 ? -20.582 -11.814 -3.312  1.00 0.00 ? 80  LYS A HG2  7  
ATOM   9683  H  HG3  . LYS A 1 80 ? -19.241 -11.562 -2.189  1.00 0.00 ? 80  LYS A HG3  7  
ATOM   9684  H  HD2  . LYS A 1 80 ? -17.670 -11.541 -4.154  1.00 0.00 ? 80  LYS A HD2  7  
ATOM   9685  H  HD3  . LYS A 1 80 ? -19.069 -11.678 -5.234  1.00 0.00 ? 80  LYS A HD3  7  
ATOM   9686  H  HE2  . LYS A 1 80 ? -18.429 -9.377  -3.350  1.00 0.00 ? 80  LYS A HE2  7  
ATOM   9687  H  HE3  . LYS A 1 80 ? -18.383 -9.354  -5.114  1.00 0.00 ? 80  LYS A HE3  7  
ATOM   9688  H  HZ1  . LYS A 1 80 ? -20.816 -9.725  -3.441  1.00 0.00 ? 80  LYS A HZ1  7  
ATOM   9689  H  HZ2  . LYS A 1 80 ? -20.782 -9.715  -5.133  1.00 0.00 ? 80  LYS A HZ2  7  
ATOM   9690  H  HZ3  . LYS A 1 80 ? -20.380 -8.320  -4.270  1.00 0.00 ? 80  LYS A HZ3  7  
ATOM   9691  N  N    . PHE A 1 81 ? -18.133 -16.203 -4.979  1.00 0.00 ? 81  PHE A N    7  
ATOM   9692  C  CA   . PHE A 1 81 ? -17.700 -17.622 -5.019  1.00 0.00 ? 81  PHE A CA   7  
ATOM   9693  C  C    . PHE A 1 81 ? -16.230 -17.781 -4.615  1.00 0.00 ? 81  PHE A C    7  
ATOM   9694  O  O    . PHE A 1 81 ? -15.470 -16.806 -4.585  1.00 0.00 ? 81  PHE A O    7  
ATOM   9695  C  CB   . PHE A 1 81 ? -17.923 -18.192 -6.437  1.00 0.00 ? 81  PHE A CB   7  
ATOM   9696  C  CG   . PHE A 1 81 ? -19.391 -18.218 -6.845  1.00 0.00 ? 81  PHE A CG   7  
ATOM   9697  C  CD1  . PHE A 1 81 ? -20.004 -17.097 -7.409  1.00 0.00 ? 81  PHE A CD1  7  
ATOM   9698  C  CD2  . PHE A 1 81 ? -20.164 -19.353 -6.633  1.00 0.00 ? 81  PHE A CD2  7  
ATOM   9699  C  CE1  . PHE A 1 81 ? -21.333 -17.119 -7.748  1.00 0.00 ? 81  PHE A CE1  7  
ATOM   9700  C  CE2  . PHE A 1 81 ? -21.491 -19.370 -6.970  1.00 0.00 ? 81  PHE A CE2  7  
ATOM   9701  C  CZ   . PHE A 1 81 ? -22.073 -18.254 -7.525  1.00 0.00 ? 81  PHE A CZ   7  
ATOM   9702  H  H    . PHE A 1 81 ? -17.632 -15.547 -5.511  1.00 0.00 ? 81  PHE A H    7  
ATOM   9703  H  HA   . PHE A 1 81 ? -18.307 -18.189 -4.317  1.00 0.00 ? 81  PHE A HA   7  
ATOM   9704  H  HB2  . PHE A 1 81 ? -17.379 -17.587 -7.159  1.00 0.00 ? 81  PHE A HB2  7  
ATOM   9705  H  HB3  . PHE A 1 81 ? -17.544 -19.206 -6.484  1.00 0.00 ? 81  PHE A HB3  7  
ATOM   9706  H  HD1  . PHE A 1 81 ? -19.420 -16.203 -7.587  1.00 0.00 ? 81  PHE A HD1  7  
ATOM   9707  H  HD2  . PHE A 1 81 ? -19.710 -20.235 -6.192  1.00 0.00 ? 81  PHE A HD2  7  
ATOM   9708  H  HE1  . PHE A 1 81 ? -21.797 -16.243 -8.184  1.00 0.00 ? 81  PHE A HE1  7  
ATOM   9709  H  HE2  . PHE A 1 81 ? -22.080 -20.262 -6.802  1.00 0.00 ? 81  PHE A HE2  7  
ATOM   9710  H  HZ   . PHE A 1 81 ? -23.120 -18.271 -7.786  1.00 0.00 ? 81  PHE A HZ   7  
ATOM   9711  N  N    . GLU A 1 82 ? -15.856 -19.027 -4.271  1.00 0.00 ? 82  GLU A N    7  
ATOM   9712  C  CA   . GLU A 1 82 ? -14.479 -19.384 -3.908  1.00 0.00 ? 82  GLU A CA   7  
ATOM   9713  C  C    . GLU A 1 82 ? -13.523 -19.397 -5.121  1.00 0.00 ? 82  GLU A C    7  
ATOM   9714  O  O    . GLU A 1 82 ? -12.340 -19.095 -4.964  1.00 0.00 ? 82  GLU A O    7  
ATOM   9715  C  CB   . GLU A 1 82 ? -14.461 -20.753 -3.188  1.00 0.00 ? 82  GLU A CB   7  
ATOM   9716  C  CG   . GLU A 1 82 ? -13.140 -21.085 -2.467  1.00 0.00 ? 82  GLU A CG   7  
ATOM   9717  C  CD   . GLU A 1 82 ? -12.843 -20.127 -1.295  1.00 0.00 ? 82  GLU A CD   7  
ATOM   9718  O  OE1  . GLU A 1 82 ? -13.297 -20.402 -0.165  1.00 0.00 ? 82  GLU A OE1  7  
ATOM   9719  O  OE2  . GLU A 1 82 ? -12.172 -19.089 -1.504  1.00 0.00 ? 82  GLU A OE2  7  
ATOM   9720  H  H    . GLU A 1 82 ? -16.545 -19.712 -4.156  1.00 0.00 ? 82  GLU A H    7  
ATOM   9721  H  HA   . GLU A 1 82 ? -14.130 -18.628 -3.209  1.00 0.00 ? 82  GLU A HA   7  
ATOM   9722  H  HB2  . GLU A 1 82 ? -15.259 -20.767 -2.449  1.00 0.00 ? 82  GLU A HB2  7  
ATOM   9723  H  HB3  . GLU A 1 82 ? -14.660 -21.533 -3.914  1.00 0.00 ? 82  GLU A HB3  7  
ATOM   9724  H  HG2  . GLU A 1 82 ? -13.196 -22.101 -2.088  1.00 0.00 ? 82  GLU A HG2  7  
ATOM   9725  H  HG3  . GLU A 1 82 ? -12.329 -21.029 -3.188  1.00 0.00 ? 82  GLU A HG3  7  
ATOM   9726  N  N    . LYS A 1 83 ? -14.033 -19.761 -6.322  1.00 0.00 ? 83  LYS A N    7  
ATOM   9727  C  CA   . LYS A 1 83 ? -13.231 -19.738 -7.557  1.00 0.00 ? 83  LYS A CA   7  
ATOM   9728  C  C    . LYS A 1 83 ? -14.104 -19.464 -8.785  1.00 0.00 ? 83  LYS A C    7  
ATOM   9729  O  O    . LYS A 1 83 ? -15.335 -19.569 -8.728  1.00 0.00 ? 83  LYS A O    7  
ATOM   9730  C  CB   . LYS A 1 83 ? -12.406 -21.050 -7.735  1.00 0.00 ? 83  LYS A CB   7  
ATOM   9731  C  CG   . LYS A 1 83 ? -13.228 -22.353 -7.856  1.00 0.00 ? 83  LYS A CG   7  
ATOM   9732  C  CD   . LYS A 1 83 ? -12.322 -23.573 -8.168  1.00 0.00 ? 83  LYS A CD   7  
ATOM   9733  C  CE   . LYS A 1 83 ? -13.082 -24.910 -8.197  1.00 0.00 ? 83  LYS A CE   7  
ATOM   9734  N  NZ   . LYS A 1 83 ? -13.652 -25.266 -6.869  1.00 0.00 ? 83  LYS A NZ   7  
ATOM   9735  H  H    . LYS A 1 83 ? -14.967 -20.043 -6.364  1.00 0.00 ? 83  LYS A H    7  
ATOM   9736  H  HA   . LYS A 1 83 ? -12.529 -18.909 -7.469  1.00 0.00 ? 83  LYS A HA   7  
ATOM   9737  H  HB2  . LYS A 1 83 ? -11.790 -20.955 -8.622  1.00 0.00 ? 83  LYS A HB2  7  
ATOM   9738  H  HB3  . LYS A 1 83 ? -11.746 -21.151 -6.877  1.00 0.00 ? 83  LYS A HB3  7  
ATOM   9739  H  HG2  . LYS A 1 83 ? -13.746 -22.530 -6.920  1.00 0.00 ? 83  LYS A HG2  7  
ATOM   9740  H  HG3  . LYS A 1 83 ? -13.959 -22.241 -8.655  1.00 0.00 ? 83  LYS A HG3  7  
ATOM   9741  H  HD2  . LYS A 1 83 ? -11.850 -23.419 -9.134  1.00 0.00 ? 83  LYS A HD2  7  
ATOM   9742  H  HD3  . LYS A 1 83 ? -11.549 -23.629 -7.409  1.00 0.00 ? 83  LYS A HD3  7  
ATOM   9743  H  HE2  . LYS A 1 83 ? -13.888 -24.848 -8.916  1.00 0.00 ? 83  LYS A HE2  7  
ATOM   9744  H  HE3  . LYS A 1 83 ? -12.397 -25.692 -8.499  1.00 0.00 ? 83  LYS A HE3  7  
ATOM   9745  H  HZ1  . LYS A 1 83 ? -12.906 -25.236 -6.144  1.00 0.00 ? 83  LYS A HZ1  7  
ATOM   9746  H  HZ2  . LYS A 1 83 ? -14.044 -26.227 -6.895  1.00 0.00 ? 83  LYS A HZ2  7  
ATOM   9747  H  HZ3  . LYS A 1 83 ? -14.406 -24.602 -6.604  1.00 0.00 ? 83  LYS A HZ3  7  
ATOM   9748  N  N    . LYS A 1 84 ? -13.420 -19.123 -9.892  1.00 0.00 ? 84  LYS A N    7  
ATOM   9749  C  CA   . LYS A 1 84 ? -14.031 -18.794 -11.196 1.00 0.00 ? 84  LYS A CA   7  
ATOM   9750  C  C    . LYS A 1 84 ? -14.928 -19.931 -11.700 1.00 0.00 ? 84  LYS A C    7  
ATOM   9751  O  O    . LYS A 1 84 ? -16.014 -19.680 -12.222 1.00 0.00 ? 84  LYS A O    7  
ATOM   9752  C  CB   . LYS A 1 84 ? -12.920 -18.512 -12.241 1.00 0.00 ? 84  LYS A CB   7  
ATOM   9753  C  CG   . LYS A 1 84 ? -12.019 -17.303 -11.913 1.00 0.00 ? 84  LYS A CG   7  
ATOM   9754  C  CD   . LYS A 1 84 ? -10.903 -17.071 -12.952 1.00 0.00 ? 84  LYS A CD   7  
ATOM   9755  C  CE   . LYS A 1 84 ? -11.440 -16.830 -14.375 1.00 0.00 ? 84  LYS A CE   7  
ATOM   9756  N  NZ   . LYS A 1 84 ? -10.355 -16.486 -15.333 1.00 0.00 ? 84  LYS A NZ   7  
ATOM   9757  H  H    . LYS A 1 84 ? -12.449 -19.090 -9.823  1.00 0.00 ? 84  LYS A H    7  
ATOM   9758  H  HA   . LYS A 1 84 ? -14.631 -17.895 -11.066 1.00 0.00 ? 84  LYS A HA   7  
ATOM   9759  H  HB2  . LYS A 1 84 ? -12.288 -19.389 -12.313 1.00 0.00 ? 84  LYS A HB2  7  
ATOM   9760  H  HB3  . LYS A 1 84 ? -13.378 -18.340 -13.207 1.00 0.00 ? 84  LYS A HB3  7  
ATOM   9761  H  HG2  . LYS A 1 84 ? -12.634 -16.411 -11.863 1.00 0.00 ? 84  LYS A HG2  7  
ATOM   9762  H  HG3  . LYS A 1 84 ? -11.561 -17.466 -10.942 1.00 0.00 ? 84  LYS A HG3  7  
ATOM   9763  H  HD2  . LYS A 1 84 ? -10.323 -16.207 -12.652 1.00 0.00 ? 84  LYS A HD2  7  
ATOM   9764  H  HD3  . LYS A 1 84 ? -10.250 -17.941 -12.969 1.00 0.00 ? 84  LYS A HD3  7  
ATOM   9765  H  HE2  . LYS A 1 84 ? -11.931 -17.729 -14.724 1.00 0.00 ? 84  LYS A HE2  7  
ATOM   9766  H  HE3  . LYS A 1 84 ? -12.157 -16.018 -14.352 1.00 0.00 ? 84  LYS A HE3  7  
ATOM   9767  H  HZ1  . LYS A 1 84 ? -9.687  -17.277 -15.411 1.00 0.00 ? 84  LYS A HZ1  7  
ATOM   9768  H  HZ2  . LYS A 1 84 ? -9.838  -15.649 -15.003 1.00 0.00 ? 84  LYS A HZ2  7  
ATOM   9769  H  HZ3  . LYS A 1 84 ? -10.755 -16.284 -16.271 1.00 0.00 ? 84  LYS A HZ3  7  
ATOM   9770  N  N    . ASP A 1 85 ? -14.454 -21.175 -11.509 1.00 0.00 ? 85  ASP A N    7  
ATOM   9771  C  CA   . ASP A 1 85 ? -15.179 -22.402 -11.913 1.00 0.00 ? 85  ASP A CA   7  
ATOM   9772  C  C    . ASP A 1 85 ? -16.601 -22.434 -11.330 1.00 0.00 ? 85  ASP A C    7  
ATOM   9773  O  O    . ASP A 1 85 ? -17.557 -22.789 -12.029 1.00 0.00 ? 85  ASP A O    7  
ATOM   9774  C  CB   . ASP A 1 85 ? -14.392 -23.647 -11.451 1.00 0.00 ? 85  ASP A CB   7  
ATOM   9775  C  CG   . ASP A 1 85 ? -15.046 -24.988 -11.852 1.00 0.00 ? 85  ASP A CG   7  
ATOM   9776  O  OD1  . ASP A 1 85 ? -14.790 -25.474 -12.976 1.00 0.00 ? 85  ASP A OD1  7  
ATOM   9777  O  OD2  . ASP A 1 85 ? -15.812 -25.560 -11.042 1.00 0.00 ? 85  ASP A OD2  7  
ATOM   9778  H  H    . ASP A 1 85 ? -13.564 -21.270 -11.106 1.00 0.00 ? 85  ASP A H    7  
ATOM   9779  H  HA   . ASP A 1 85 ? -15.240 -22.405 -12.995 1.00 0.00 ? 85  ASP A HA   7  
ATOM   9780  H  HB2  . ASP A 1 85 ? -13.391 -23.609 -11.874 1.00 0.00 ? 85  ASP A HB2  7  
ATOM   9781  H  HB3  . ASP A 1 85 ? -14.301 -23.616 -10.372 1.00 0.00 ? 85  ASP A HB3  7  
ATOM   9782  N  N    . SER A 1 86 ? -16.727 -22.034 -10.050 1.00 0.00 ? 86  SER A N    7  
ATOM   9783  C  CA   . SER A 1 86 ? -18.011 -22.016 -9.347  1.00 0.00 ? 86  SER A CA   7  
ATOM   9784  C  C    . SER A 1 86 ? -18.980 -20.977 -9.956  1.00 0.00 ? 86  SER A C    7  
ATOM   9785  O  O    . SER A 1 86 ? -20.183 -21.194 -9.970  1.00 0.00 ? 86  SER A O    7  
ATOM   9786  C  CB   . SER A 1 86 ? -17.755 -21.702 -7.864  1.00 0.00 ? 86  SER A CB   7  
ATOM   9787  O  OG   . SER A 1 86 ? -16.746 -22.546 -7.333  1.00 0.00 ? 86  SER A OG   7  
ATOM   9788  H  H    . SER A 1 86 ? -15.926 -21.746 -9.548  1.00 0.00 ? 86  SER A H    7  
ATOM   9789  H  HA   . SER A 1 86 ? -18.440 -23.009 -9.421  1.00 0.00 ? 86  SER A HA   7  
ATOM   9790  H  HB2  . SER A 1 86 ? -17.426 -20.678 -7.759  1.00 0.00 ? 86  SER A HB2  7  
ATOM   9791  H  HB3  . SER A 1 86 ? -18.668 -21.842 -7.294  1.00 0.00 ? 86  SER A HB3  7  
ATOM   9792  H  HG   . SER A 1 86 ? -16.662 -23.332 -7.886  1.00 0.00 ? 86  SER A HG   7  
ATOM   9793  N  N    . VAL A 1 87 ? -18.414 -19.863 -10.472 1.00 0.00 ? 87  VAL A N    7  
ATOM   9794  C  CA   . VAL A 1 87 ? -19.190 -18.707 -10.987 1.00 0.00 ? 87  VAL A CA   7  
ATOM   9795  C  C    . VAL A 1 87 ? -19.779 -19.039 -12.374 1.00 0.00 ? 87  VAL A C    7  
ATOM   9796  O  O    . VAL A 1 87 ? -20.943 -18.747 -12.665 1.00 0.00 ? 87  VAL A O    7  
ATOM   9797  C  CB   . VAL A 1 87 ? -18.326 -17.381 -11.109 1.00 0.00 ? 87  VAL A CB   7  
ATOM   9798  C  CG1  . VAL A 1 87 ? -19.240 -16.145 -11.287 1.00 0.00 ? 87  VAL A CG1  7  
ATOM   9799  C  CG2  . VAL A 1 87 ? -17.361 -17.191 -9.912  1.00 0.00 ? 87  VAL A CG2  7  
ATOM   9800  H  H    . VAL A 1 87 ? -17.449 -19.849 -10.573 1.00 0.00 ? 87  VAL A H    7  
ATOM   9801  H  HA   . VAL A 1 87 ? -20.010 -18.523 -10.294 1.00 0.00 ? 87  VAL A HA   7  
ATOM   9802  H  HB   . VAL A 1 87 ? -17.706 -17.462 -12.010 1.00 0.00 ? 87  VAL A HB   7  
ATOM   9803  H  HG11 . VAL A 1 87 ? -19.881 -16.039 -10.420 1.00 0.00 ? 87  VAL A HG11 7  
ATOM   9804  H  HG12 . VAL A 1 87 ? -19.858 -16.261 -12.171 1.00 0.00 ? 87  VAL A HG12 7  
ATOM   9805  H  HG13 . VAL A 1 87 ? -18.640 -15.249 -11.394 1.00 0.00 ? 87  VAL A HG13 7  
ATOM   9806  H  HG21 . VAL A 1 87 ? -17.931 -17.105 -8.995  1.00 0.00 ? 87  VAL A HG21 7  
ATOM   9807  H  HG22 . VAL A 1 87 ? -16.773 -16.293 -10.047 1.00 0.00 ? 87  VAL A HG22 7  
ATOM   9808  H  HG23 . VAL A 1 87 ? -16.693 -18.043 -9.834  1.00 0.00 ? 87  VAL A HG23 7  
ATOM   9809  N  N    . VAL A 1 88 ? -18.930 -19.671 -13.195 1.00 0.00 ? 88  VAL A N    7  
ATOM   9810  C  CA   . VAL A 1 88 ? -19.210 -19.992 -14.609 1.00 0.00 ? 88  VAL A CA   7  
ATOM   9811  C  C    . VAL A 1 88 ? -20.262 -21.096 -14.677 1.00 0.00 ? 88  VAL A C    7  
ATOM   9812  O  O    . VAL A 1 88 ? -21.214 -21.032 -15.465 1.00 0.00 ? 88  VAL A O    7  
ATOM   9813  C  CB   . VAL A 1 88 ? -17.890 -20.441 -15.358 1.00 0.00 ? 88  VAL A CB   7  
ATOM   9814  C  CG1  . VAL A 1 88 ? -18.174 -20.871 -16.822 1.00 0.00 ? 88  VAL A CG1  7  
ATOM   9815  C  CG2  . VAL A 1 88 ? -16.821 -19.315 -15.300 1.00 0.00 ? 88  VAL A CG2  7  
ATOM   9816  H  H    . VAL A 1 88 ? -18.085 -19.972 -12.817 1.00 0.00 ? 88  VAL A H    7  
ATOM   9817  H  HA   . VAL A 1 88 ? -19.596 -19.097 -15.090 1.00 0.00 ? 88  VAL A HA   7  
ATOM   9818  H  HB   . VAL A 1 88 ? -17.484 -21.304 -14.832 1.00 0.00 ? 88  VAL A HB   7  
ATOM   9819  H  HG11 . VAL A 1 88 ? -17.258 -21.202 -17.296 1.00 0.00 ? 88  VAL A HG11 7  
ATOM   9820  H  HG12 . VAL A 1 88 ? -18.578 -20.033 -17.380 1.00 0.00 ? 88  VAL A HG12 7  
ATOM   9821  H  HG13 . VAL A 1 88 ? -18.897 -21.681 -16.835 1.00 0.00 ? 88  VAL A HG13 7  
ATOM   9822  H  HG21 . VAL A 1 88 ? -16.601 -19.068 -14.265 1.00 0.00 ? 88  VAL A HG21 7  
ATOM   9823  H  HG22 . VAL A 1 88 ? -17.187 -18.426 -15.804 1.00 0.00 ? 88  VAL A HG22 7  
ATOM   9824  H  HG23 . VAL A 1 88 ? -15.909 -19.646 -15.783 1.00 0.00 ? 88  VAL A HG23 7  
ATOM   9825  N  N    . ALA A 1 89 ? -20.087 -22.078 -13.765 1.00 0.00 ? 89  ALA A N    7  
ATOM   9826  C  CA   . ALA A 1 89 ? -20.993 -23.219 -13.639 1.00 0.00 ? 89  ALA A CA   7  
ATOM   9827  C  C    . ALA A 1 89 ? -22.357 -22.743 -13.126 1.00 0.00 ? 89  ALA A C    7  
ATOM   9828  O  O    . ALA A 1 89 ? -23.405 -23.224 -13.555 1.00 0.00 ? 89  ALA A O    7  
ATOM   9829  C  CB   . ALA A 1 89 ? -20.400 -24.270 -12.694 1.00 0.00 ? 89  ALA A CB   7  
ATOM   9830  H  H    . ALA A 1 89 ? -19.331 -22.000 -13.132 1.00 0.00 ? 89  ALA A H    7  
ATOM   9831  H  HA   . ALA A 1 89 ? -21.106 -23.664 -14.620 1.00 0.00 ? 89  ALA A HA   7  
ATOM   9832  H  HB1  . ALA A 1 89 ? -20.272 -23.842 -11.708 1.00 0.00 ? 89  ALA A HB1  7  
ATOM   9833  H  HB2  . ALA A 1 89 ? -19.437 -24.598 -13.063 1.00 0.00 ? 89  ALA A HB2  7  
ATOM   9834  H  HB3  . ALA A 1 89 ? -21.062 -25.126 -12.627 1.00 0.00 ? 89  ALA A HB3  7  
ATOM   9835  N  N    . HIS A 1 90 ? -22.304 -21.746 -12.223 1.00 0.00 ? 90  HIS A N    7  
ATOM   9836  C  CA   . HIS A 1 90 ? -23.494 -21.134 -11.613 1.00 0.00 ? 90  HIS A CA   7  
ATOM   9837  C  C    . HIS A 1 90 ? -24.308 -20.330 -12.643 1.00 0.00 ? 90  HIS A C    7  
ATOM   9838  O  O    . HIS A 1 90 ? -25.512 -20.466 -12.700 1.00 0.00 ? 90  HIS A O    7  
ATOM   9839  C  CB   . HIS A 1 90 ? -23.056 -20.235 -10.422 1.00 0.00 ? 90  HIS A CB   7  
ATOM   9840  C  CG   . HIS A 1 90 ? -23.952 -19.067 -10.094 1.00 0.00 ? 90  HIS A CG   7  
ATOM   9841  N  ND1  . HIS A 1 90 ? -25.015 -19.121 -9.227  1.00 0.00 ? 90  HIS A ND1  7  
ATOM   9842  C  CD2  . HIS A 1 90 ? -23.868 -17.772 -10.502 1.00 0.00 ? 90  HIS A CD2  7  
ATOM   9843  C  CE1  . HIS A 1 90 ? -25.523 -17.888 -9.129  1.00 0.00 ? 90  HIS A CE1  7  
ATOM   9844  N  NE2  . HIS A 1 90 ? -24.858 -17.037 -9.886  1.00 0.00 ? 90  HIS A NE2  7  
ATOM   9845  H  H    . HIS A 1 90 ? -21.413 -21.396 -11.955 1.00 0.00 ? 90  HIS A H    7  
ATOM   9846  H  HA   . HIS A 1 90 ? -24.117 -21.941 -11.229 1.00 0.00 ? 90  HIS A HA   7  
ATOM   9847  H  HB2  . HIS A 1 90 ? -22.992 -20.840 -9.527  1.00 0.00 ? 90  HIS A HB2  7  
ATOM   9848  H  HB3  . HIS A 1 90 ? -22.070 -19.835 -10.628 1.00 0.00 ? 90  HIS A HB3  7  
ATOM   9849  H  HD1  . HIS A 1 90 ? -25.346 -19.922 -8.761  1.00 0.00 ? 90  HIS A HD1  7  
ATOM   9850  H  HD2  . HIS A 1 90 ? -23.150 -17.373 -11.203 1.00 0.00 ? 90  HIS A HD2  7  
ATOM   9851  H  HE1  . HIS A 1 90 ? -26.368 -17.627 -8.511  1.00 0.00 ? 90  HIS A HE1  7  
ATOM   9852  N  N    . LYS A 1 91 ? -23.610 -19.524 -13.461 1.00 0.00 ? 91  LYS A N    7  
ATOM   9853  C  CA   . LYS A 1 91 ? -24.232 -18.494 -14.329 1.00 0.00 ? 91  LYS A CA   7  
ATOM   9854  C  C    . LYS A 1 91 ? -25.008 -19.173 -15.462 1.00 0.00 ? 91  LYS A C    7  
ATOM   9855  O  O    . LYS A 1 91 ? -26.104 -18.743 -15.834 1.00 0.00 ? 91  LYS A O    7  
ATOM   9856  C  CB   . LYS A 1 91 ? -23.150 -17.562 -14.938 1.00 0.00 ? 91  LYS A CB   7  
ATOM   9857  C  CG   . LYS A 1 91 ? -23.720 -16.363 -15.737 1.00 0.00 ? 91  LYS A CG   7  
ATOM   9858  C  CD   . LYS A 1 91 ? -22.693 -15.718 -16.693 1.00 0.00 ? 91  LYS A CD   7  
ATOM   9859  C  CE   . LYS A 1 91 ? -22.250 -16.676 -17.815 1.00 0.00 ? 91  LYS A CE   7  
ATOM   9860  N  NZ   . LYS A 1 91 ? -21.257 -16.056 -18.718 1.00 0.00 ? 91  LYS A NZ   7  
ATOM   9861  H  H    . LYS A 1 91 ? -22.654 -19.668 -13.524 1.00 0.00 ? 91  LYS A H    7  
ATOM   9862  H  HA   . LYS A 1 91 ? -24.919 -17.899 -13.722 1.00 0.00 ? 91  LYS A HA   7  
ATOM   9863  H  HB2  . LYS A 1 91 ? -22.524 -17.169 -14.138 1.00 0.00 ? 91  LYS A HB2  7  
ATOM   9864  H  HB3  . LYS A 1 91 ? -22.521 -18.149 -15.600 1.00 0.00 ? 91  LYS A HB3  7  
ATOM   9865  H  HG2  . LYS A 1 91 ? -24.566 -16.701 -16.321 1.00 0.00 ? 91  LYS A HG2  7  
ATOM   9866  H  HG3  . LYS A 1 91 ? -24.062 -15.609 -15.034 1.00 0.00 ? 91  LYS A HG3  7  
ATOM   9867  H  HD2  . LYS A 1 91 ? -23.138 -14.839 -17.141 1.00 0.00 ? 91  LYS A HD2  7  
ATOM   9868  H  HD3  . LYS A 1 91 ? -21.819 -15.418 -16.120 1.00 0.00 ? 91  LYS A HD3  7  
ATOM   9869  H  HE2  . LYS A 1 91 ? -21.806 -17.558 -17.377 1.00 0.00 ? 91  LYS A HE2  7  
ATOM   9870  H  HE3  . LYS A 1 91 ? -23.117 -16.967 -18.398 1.00 0.00 ? 91  LYS A HE3  7  
ATOM   9871  H  HZ1  . LYS A 1 91 ? -20.418 -15.772 -18.181 1.00 0.00 ? 91  LYS A HZ1  7  
ATOM   9872  H  HZ2  . LYS A 1 91 ? -21.663 -15.217 -19.176 1.00 0.00 ? 91  LYS A HZ2  7  
ATOM   9873  H  HZ3  . LYS A 1 91 ? -20.970 -16.732 -19.453 1.00 0.00 ? 91  LYS A HZ3  7  
ATOM   9874  N  N    . ALA A 1 92 ? -24.391 -20.244 -15.989 1.00 0.00 ? 92  ALA A N    7  
ATOM   9875  C  CA   . ALA A 1 92 ? -24.963 -21.080 -17.048 1.00 0.00 ? 92  ALA A CA   7  
ATOM   9876  C  C    . ALA A 1 92 ? -26.325 -21.691 -16.635 1.00 0.00 ? 92  ALA A C    7  
ATOM   9877  O  O    . ALA A 1 92 ? -27.206 -21.902 -17.474 1.00 0.00 ? 92  ALA A O    7  
ATOM   9878  C  CB   . ALA A 1 92 ? -23.962 -22.183 -17.419 1.00 0.00 ? 92  ALA A CB   7  
ATOM   9879  H  H    . ALA A 1 92 ? -23.499 -20.468 -15.646 1.00 0.00 ? 92  ALA A H    7  
ATOM   9880  H  HA   . ALA A 1 92 ? -25.101 -20.451 -17.916 1.00 0.00 ? 92  ALA A HA   7  
ATOM   9881  H  HB1  . ALA A 1 92 ? -24.341 -22.762 -18.249 1.00 0.00 ? 92  ALA A HB1  7  
ATOM   9882  H  HB2  . ALA A 1 92 ? -23.809 -22.835 -16.567 1.00 0.00 ? 92  ALA A HB2  7  
ATOM   9883  H  HB3  . ALA A 1 92 ? -23.012 -21.738 -17.697 1.00 0.00 ? 92  ALA A HB3  7  
ATOM   9884  N  N    . LYS A 1 93 ? -26.493 -21.939 -15.318 1.00 0.00 ? 93  LYS A N    7  
ATOM   9885  C  CA   . LYS A 1 93 ? -27.661 -22.680 -14.764 1.00 0.00 ? 93  LYS A CA   7  
ATOM   9886  C  C    . LYS A 1 93 ? -28.690 -21.727 -14.122 1.00 0.00 ? 93  LYS A C    7  
ATOM   9887  O  O    . LYS A 1 93 ? -29.903 -21.899 -14.291 1.00 0.00 ? 93  LYS A O    7  
ATOM   9888  C  CB   . LYS A 1 93 ? -27.161 -23.708 -13.706 1.00 0.00 ? 93  LYS A CB   7  
ATOM   9889  C  CG   . LYS A 1 93 ? -26.153 -24.728 -14.274 1.00 0.00 ? 93  LYS A CG   7  
ATOM   9890  C  CD   . LYS A 1 93 ? -25.641 -25.736 -13.220 1.00 0.00 ? 93  LYS A CD   7  
ATOM   9891  C  CE   . LYS A 1 93 ? -24.606 -26.713 -13.805 1.00 0.00 ? 93  LYS A CE   7  
ATOM   9892  N  NZ   . LYS A 1 93 ? -24.146 -27.691 -12.791 1.00 0.00 ? 93  LYS A NZ   7  
ATOM   9893  H  H    . LYS A 1 93 ? -25.805 -21.603 -14.692 1.00 0.00 ? 93  LYS A H    7  
ATOM   9894  H  HA   . LYS A 1 93 ? -28.147 -23.224 -15.572 1.00 0.00 ? 93  LYS A HA   7  
ATOM   9895  H  HB2  . LYS A 1 93 ? -26.682 -23.172 -12.891 1.00 0.00 ? 93  LYS A HB2  7  
ATOM   9896  H  HB3  . LYS A 1 93 ? -28.014 -24.253 -13.310 1.00 0.00 ? 93  LYS A HB3  7  
ATOM   9897  H  HG2  . LYS A 1 93 ? -26.629 -25.279 -15.078 1.00 0.00 ? 93  LYS A HG2  7  
ATOM   9898  H  HG3  . LYS A 1 93 ? -25.302 -24.181 -14.674 1.00 0.00 ? 93  LYS A HG3  7  
ATOM   9899  H  HD2  . LYS A 1 93 ? -25.178 -25.191 -12.404 1.00 0.00 ? 93  LYS A HD2  7  
ATOM   9900  H  HD3  . LYS A 1 93 ? -26.483 -26.304 -12.834 1.00 0.00 ? 93  LYS A HD3  7  
ATOM   9901  H  HE2  . LYS A 1 93 ? -25.050 -27.254 -14.634 1.00 0.00 ? 93  LYS A HE2  7  
ATOM   9902  H  HE3  . LYS A 1 93 ? -23.750 -26.153 -14.163 1.00 0.00 ? 93  LYS A HE3  7  
ATOM   9903  H  HZ1  . LYS A 1 93 ? -23.493 -28.376 -13.218 1.00 0.00 ? 93  LYS A HZ1  7  
ATOM   9904  H  HZ2  . LYS A 1 93 ? -24.959 -28.204 -12.397 1.00 0.00 ? 93  LYS A HZ2  7  
ATOM   9905  H  HZ3  . LYS A 1 93 ? -23.660 -27.196 -12.015 1.00 0.00 ? 93  LYS A HZ3  7  
ATOM   9906  N  N    . SER A 1 94 ? -28.176 -20.721 -13.406 1.00 0.00 ? 94  SER A N    7  
ATOM   9907  C  CA   . SER A 1 94 ? -28.962 -19.813 -12.557 1.00 0.00 ? 94  SER A CA   7  
ATOM   9908  C  C    . SER A 1 94 ? -29.522 -18.640 -13.371 1.00 0.00 ? 94  SER A C    7  
ATOM   9909  O  O    . SER A 1 94 ? -30.462 -17.965 -12.933 1.00 0.00 ? 94  SER A O    7  
ATOM   9910  C  CB   . SER A 1 94 ? -28.076 -19.281 -11.407 1.00 0.00 ? 94  SER A CB   7  
ATOM   9911  O  OG   . SER A 1 94 ? -28.793 -18.466 -10.504 1.00 0.00 ? 94  SER A OG   7  
ATOM   9912  H  H    . SER A 1 94 ? -27.232 -20.576 -13.454 1.00 0.00 ? 94  SER A H    7  
ATOM   9913  H  HA   . SER A 1 94 ? -29.780 -20.375 -12.134 1.00 0.00 ? 94  SER A HA   7  
ATOM   9914  H  HB2  . SER A 1 94 ? -27.667 -20.116 -10.850 1.00 0.00 ? 94  SER A HB2  7  
ATOM   9915  H  HB3  . SER A 1 94 ? -27.255 -18.701 -11.814 1.00 0.00 ? 94  SER A HB3  7  
ATOM   9916  H  HG   . SER A 1 94 ? -29.481 -18.996 -10.082 1.00 0.00 ? 94  SER A HG   7  
ATOM   9917  N  N    . HIS A 1 95 ? -28.943 -18.403 -14.566 1.00 0.00 ? 95  HIS A N    7  
ATOM   9918  C  CA   . HIS A 1 95 ? -29.319 -17.266 -15.431 1.00 0.00 ? 95  HIS A CA   7  
ATOM   9919  C  C    . HIS A 1 95 ? -29.479 -17.722 -16.922 1.00 0.00 ? 95  HIS A C    7  
ATOM   9920  O  O    . HIS A 1 95 ? -28.788 -17.192 -17.804 1.00 0.00 ? 95  HIS A O    7  
ATOM   9921  C  CB   . HIS A 1 95 ? -28.253 -16.120 -15.306 1.00 0.00 ? 95  HIS A CB   7  
ATOM   9922  C  CG   . HIS A 1 95 ? -27.916 -15.693 -13.889 1.00 0.00 ? 95  HIS A CG   7  
ATOM   9923  N  ND1  . HIS A 1 95 ? -28.836 -15.222 -12.981 1.00 0.00 ? 95  HIS A ND1  7  
ATOM   9924  C  CD2  . HIS A 1 95 ? -26.717 -15.661 -13.242 1.00 0.00 ? 95  HIS A CD2  7  
ATOM   9925  C  CE1  . HIS A 1 95 ? -28.190 -14.924 -11.843 1.00 0.00 ? 95  HIS A CE1  7  
ATOM   9926  N  NE2  . HIS A 1 95 ? -26.899 -15.173 -11.956 1.00 0.00 ? 95  HIS A NE2  7  
ATOM   9927  H  H    . HIS A 1 95 ? -28.257 -19.029 -14.886 1.00 0.00 ? 95  HIS A H    7  
ATOM   9928  H  HA   . HIS A 1 95 ? -30.280 -16.882 -15.099 1.00 0.00 ? 95  HIS A HA   7  
ATOM   9929  H  HB2  . HIS A 1 95 ? -27.332 -16.435 -15.782 1.00 0.00 ? 95  HIS A HB2  7  
ATOM   9930  H  HB3  . HIS A 1 95 ? -28.623 -15.242 -15.826 1.00 0.00 ? 95  HIS A HB3  7  
ATOM   9931  H  HD1  . HIS A 1 95 ? -29.804 -15.132 -13.131 1.00 0.00 ? 95  HIS A HD1  7  
ATOM   9932  H  HD2  . HIS A 1 95 ? -25.761 -15.939 -13.664 1.00 0.00 ? 95  HIS A HD2  7  
ATOM   9933  H  HE1  . HIS A 1 95 ? -28.661 -14.527 -10.954 1.00 0.00 ? 95  HIS A HE1  7  
ATOM   9934  N  N    . PRO A 1 96 ? -30.389 -18.719 -17.249 1.00 0.00 ? 96  PRO A N    7  
ATOM   9935  C  CA   . PRO A 1 96 ? -30.652 -19.122 -18.656 1.00 0.00 ? 96  PRO A CA   7  
ATOM   9936  C  C    . PRO A 1 96 ? -31.352 -17.982 -19.451 1.00 0.00 ? 96  PRO A C    7  
ATOM   9937  O  O    . PRO A 1 96 ? -31.026 -17.744 -20.618 1.00 0.00 ? 96  PRO A O    7  
ATOM   9938  C  CB   . PRO A 1 96 ? -31.542 -20.393 -18.516 1.00 0.00 ? 96  PRO A CB   7  
ATOM   9939  C  CG   . PRO A 1 96 ? -32.204 -20.247 -17.183 1.00 0.00 ? 96  PRO A CG   7  
ATOM   9940  C  CD   . PRO A 1 96 ? -31.195 -19.539 -16.301 1.00 0.00 ? 96  PRO A CD   7  
ATOM   9941  H  HA   . PRO A 1 96 ? -29.722 -19.384 -19.158 1.00 0.00 ? 96  PRO A HA   7  
ATOM   9942  H  HB2  . PRO A 1 96 ? -32.273 -20.442 -19.324 1.00 0.00 ? 96  PRO A HB2  7  
ATOM   9943  H  HB3  . PRO A 1 96 ? -30.919 -21.284 -18.551 1.00 0.00 ? 96  PRO A HB3  7  
ATOM   9944  H  HG2  . PRO A 1 96 ? -33.109 -19.654 -17.282 1.00 0.00 ? 96  PRO A HG2  7  
ATOM   9945  H  HG3  . PRO A 1 96 ? -32.444 -21.223 -16.773 1.00 0.00 ? 96  PRO A HG3  7  
ATOM   9946  H  HD2  . PRO A 1 96 ? -31.693 -18.908 -15.577 1.00 0.00 ? 96  PRO A HD2  7  
ATOM   9947  H  HD3  . PRO A 1 96 ? -30.557 -20.251 -15.788 1.00 0.00 ? 96  PRO A HD3  7  
ATOM   9948  N  N    . GLU A 1 97 ? -32.306 -17.283 -18.793 1.00 0.00 ? 97  GLU A N    7  
ATOM   9949  C  CA   . GLU A 1 97 ? -32.973 -16.095 -19.329 1.00 0.00 ? 97  GLU A CA   7  
ATOM   9950  C  C    . GLU A 1 97 ? -32.502 -14.892 -18.501 1.00 0.00 ? 97  GLU A C    7  
ATOM   9951  O  O    . GLU A 1 97 ? -33.036 -14.603 -17.421 1.00 0.00 ? 97  GLU A O    7  
ATOM   9952  C  CB   . GLU A 1 97 ? -34.532 -16.232 -19.269 1.00 0.00 ? 97  GLU A CB   7  
ATOM   9953  C  CG   . GLU A 1 97 ? -35.181 -17.226 -20.265 1.00 0.00 ? 97  GLU A CG   7  
ATOM   9954  C  CD   . GLU A 1 97 ? -34.870 -18.709 -19.986 1.00 0.00 ? 97  GLU A CD   7  
ATOM   9955  O  OE1  . GLU A 1 97 ? -35.418 -19.270 -19.001 1.00 0.00 ? 97  GLU A OE1  7  
ATOM   9956  O  OE2  . GLU A 1 97 ? -34.106 -19.326 -20.755 1.00 0.00 ? 97  GLU A OE2  7  
ATOM   9957  H  H    . GLU A 1 97 ? -32.551 -17.563 -17.915 1.00 0.00 ? 97  GLU A H    7  
ATOM   9958  H  HA   . GLU A 1 97 ? -32.667 -15.953 -20.360 1.00 0.00 ? 97  GLU A HA   7  
ATOM   9959  H  HB2  . GLU A 1 97 ? -34.810 -16.535 -18.268 1.00 0.00 ? 97  GLU A HB2  7  
ATOM   9960  H  HB3  . GLU A 1 97 ? -34.970 -15.253 -19.453 1.00 0.00 ? 97  GLU A HB3  7  
ATOM   9961  H  HG2  . GLU A 1 97 ? -36.262 -17.098 -20.223 1.00 0.00 ? 97  GLU A HG2  7  
ATOM   9962  H  HG3  . GLU A 1 97 ? -34.848 -16.976 -21.271 1.00 0.00 ? 97  GLU A HG3  7  
ATOM   9963  N  N    . VAL A 1 98 ? -31.476 -14.225 -19.007 1.00 0.00 ? 98  VAL A N    7  
ATOM   9964  C  CA   . VAL A 1 98 ? -30.939 -12.977 -18.440 1.00 0.00 ? 98  VAL A CA   7  
ATOM   9965  C  C    . VAL A 1 98 ? -30.958 -11.864 -19.516 1.00 0.00 ? 98  VAL A C    7  
ATOM   9966  O  O    . VAL A 1 98 ? -31.632 -10.834 -19.309 1.00 0.00 ? 98  VAL A O    7  
ATOM   9967  C  CB   . VAL A 1 98 ? -29.497 -13.169 -17.798 1.00 0.00 ? 98  VAL A CB   7  
ATOM   9968  C  CG1  . VAL A 1 98 ? -28.489 -13.870 -18.744 1.00 0.00 ? 98  VAL A CG1  7  
ATOM   9969  C  CG2  . VAL A 1 98 ? -28.941 -11.816 -17.274 1.00 0.00 ? 98  VAL A CG2  7  
ATOM   9970  O  OXT  . VAL A 1 98 ? -30.341 -12.042 -20.588 1.00 0.00 ? 98  VAL A OXT  7  
ATOM   9971  H  H    . VAL A 1 98 ? -31.039 -14.609 -19.789 1.00 0.00 ? 98  VAL A H    7  
ATOM   9972  H  HA   . VAL A 1 98 ? -31.607 -12.676 -17.626 1.00 0.00 ? 98  VAL A HA   7  
ATOM   9973  H  HB   . VAL A 1 98 ? -29.619 -13.817 -16.930 1.00 0.00 ? 98  VAL A HB   7  
ATOM   9974  H  HG11 . VAL A 1 98 ? -28.352 -13.275 -19.641 1.00 0.00 ? 98  VAL A HG11 7  
ATOM   9975  H  HG12 . VAL A 1 98 ? -28.867 -14.847 -19.023 1.00 0.00 ? 98  VAL A HG12 7  
ATOM   9976  H  HG13 . VAL A 1 98 ? -27.533 -13.992 -18.245 1.00 0.00 ? 98  VAL A HG13 7  
ATOM   9977  H  HG21 . VAL A 1 98 ? -28.806 -11.129 -18.102 1.00 0.00 ? 98  VAL A HG21 7  
ATOM   9978  H  HG22 . VAL A 1 98 ? -27.986 -11.973 -16.784 1.00 0.00 ? 98  VAL A HG22 7  
ATOM   9979  H  HG23 . VAL A 1 98 ? -29.634 -11.382 -16.563 1.00 0.00 ? 98  VAL A HG23 7  
HETATM 9980  ZN ZN   . ZN  B 2 .  ? 15.465  0.718   3.756   1.00 0.00 ? 101 ZN  A ZN   7  
HETATM 9981  ZN ZN   . ZN  C 2 .  ? -3.314  -4.143  -7.308  1.00 0.00 ? 102 ZN  A ZN   7  
HETATM 9982  ZN ZN   . ZN  D 2 .  ? -25.454 -15.139 -10.434 1.00 0.00 ? 103 ZN  A ZN   7  
ATOM   9983  N  N    . HIS A 1 10 ? 14.275  -10.053 20.630  1.00 0.00 ? 10  HIS A N    8  
ATOM   9984  C  CA   . HIS A 1 10 ? 14.804  -9.483  19.372  1.00 0.00 ? 10  HIS A CA   8  
ATOM   9985  C  C    . HIS A 1 10 ? 15.913  -10.394 18.779  1.00 0.00 ? 10  HIS A C    8  
ATOM   9986  O  O    . HIS A 1 10 ? 17.072  -10.332 19.192  1.00 0.00 ? 10  HIS A O    8  
ATOM   9987  C  CB   . HIS A 1 10 ? 15.292  -8.013  19.587  1.00 0.00 ? 10  HIS A CB   8  
ATOM   9988  C  CG   . HIS A 1 10 ? 16.277  -7.806  20.725  1.00 0.00 ? 10  HIS A CG   8  
ATOM   9989  N  ND1  . HIS A 1 10 ? 15.894  -7.695  22.046  1.00 0.00 ? 10  HIS A ND1  8  
ATOM   9990  C  CD2  . HIS A 1 10 ? 17.636  -7.715  20.729  1.00 0.00 ? 10  HIS A CD2  8  
ATOM   9991  C  CE1  . HIS A 1 10 ? 16.964  -7.551  22.807  1.00 0.00 ? 10  HIS A CE1  8  
ATOM   9992  N  NE2  . HIS A 1 10 ? 18.032  -7.560  22.032  1.00 0.00 ? 10  HIS A NE2  8  
ATOM   9993  H  H    . HIS A 1 10 ? 15.024  -10.103 21.341  1.00 0.00 ? 10  HIS A H    8  
ATOM   9994  H  HA   . HIS A 1 10 ? 13.974  -9.469  18.671  1.00 0.00 ? 10  HIS A HA   8  
ATOM   9995  H  HB2  . HIS A 1 10 ? 15.757  -7.663  18.678  1.00 0.00 ? 10  HIS A HB2  8  
ATOM   9996  H  HB3  . HIS A 1 10 ? 14.427  -7.389  19.787  1.00 0.00 ? 10  HIS A HB3  8  
ATOM   9997  H  HD1  . HIS A 1 10 ? 14.969  -7.707  22.374  1.00 0.00 ? 10  HIS A HD1  8  
ATOM   9998  H  HD2  . HIS A 1 10 ? 18.284  -7.754  19.864  1.00 0.00 ? 10  HIS A HD2  8  
ATOM   9999  H  HE1  . HIS A 1 10 ? 16.963  -7.459  23.884  1.00 0.00 ? 10  HIS A HE1  8  
ATOM   10000 H  HE2  . HIS A 1 10 ? 18.954  -7.657  22.361  1.00 0.00 ? 10  HIS A HE2  8  
ATOM   10001 N  N    . MET A 1 11 ? 15.528  -11.268 17.819  1.00 0.00 ? 11  MET A N    8  
ATOM   10002 C  CA   . MET A 1 11 ? 16.454  -12.213 17.145  1.00 0.00 ? 11  MET A CA   8  
ATOM   10003 C  C    . MET A 1 11 ? 15.898  -12.650 15.770  1.00 0.00 ? 11  MET A C    8  
ATOM   10004 O  O    . MET A 1 11 ? 16.657  -12.740 14.799  1.00 0.00 ? 11  MET A O    8  
ATOM   10005 C  CB   . MET A 1 11 ? 16.786  -13.435 18.062  1.00 0.00 ? 11  MET A CB   8  
ATOM   10006 C  CG   . MET A 1 11 ? 15.578  -14.109 18.731  1.00 0.00 ? 11  MET A CG   8  
ATOM   10007 S  SD   . MET A 1 11 ? 16.058  -15.499 19.776  1.00 0.00 ? 11  MET A SD   8  
ATOM   10008 C  CE   . MET A 1 11 ? 14.492  -15.938 20.540  1.00 0.00 ? 11  MET A CE   8  
ATOM   10009 H  H    . MET A 1 11 ? 14.588  -11.259 17.532  1.00 0.00 ? 11  MET A H    8  
ATOM   10010 H  HA   . MET A 1 11 ? 17.376  -11.674 16.961  1.00 0.00 ? 11  MET A HA   8  
ATOM   10011 H  HB2  . MET A 1 11 ? 17.313  -14.185 17.481  1.00 0.00 ? 11  MET A HB2  8  
ATOM   10012 H  HB3  . MET A 1 11 ? 17.449  -13.101 18.852  1.00 0.00 ? 11  MET A HB3  8  
ATOM   10013 H  HG2  . MET A 1 11 ? 15.055  -13.378 19.342  1.00 0.00 ? 11  MET A HG2  8  
ATOM   10014 H  HG3  . MET A 1 11 ? 14.905  -14.472 17.963  1.00 0.00 ? 11  MET A HG3  8  
ATOM   10015 H  HE1  . MET A 1 11 ? 14.129  -15.113 21.139  1.00 0.00 ? 11  MET A HE1  8  
ATOM   10016 H  HE2  . MET A 1 11 ? 14.642  -16.797 21.173  1.00 0.00 ? 11  MET A HE2  8  
ATOM   10017 H  HE3  . MET A 1 11 ? 13.766  -16.176 19.775  1.00 0.00 ? 11  MET A HE3  8  
ATOM   10018 N  N    . ARG A 1 12 ? 14.570  -12.899 15.683  1.00 0.00 ? 12  ARG A N    8  
ATOM   10019 C  CA   . ARG A 1 12 ? 13.871  -13.169 14.388  1.00 0.00 ? 12  ARG A CA   8  
ATOM   10020 C  C    . ARG A 1 12 ? 13.461  -11.834 13.732  1.00 0.00 ? 12  ARG A C    8  
ATOM   10021 O  O    . ARG A 1 12 ? 12.346  -11.684 13.219  1.00 0.00 ? 12  ARG A O    8  
ATOM   10022 C  CB   . ARG A 1 12 ? 12.623  -14.112 14.587  1.00 0.00 ? 12  ARG A CB   8  
ATOM   10023 C  CG   . ARG A 1 12 ? 12.934  -15.620 14.802  1.00 0.00 ? 12  ARG A CG   8  
ATOM   10024 C  CD   . ARG A 1 12 ? 13.542  -15.927 16.174  1.00 0.00 ? 12  ARG A CD   8  
ATOM   10025 N  NE   . ARG A 1 12 ? 13.932  -17.348 16.316  1.00 0.00 ? 12  ARG A NE   8  
ATOM   10026 C  CZ   . ARG A 1 12 ? 13.624  -18.149 17.352  1.00 0.00 ? 12  ARG A CZ   8  
ATOM   10027 N  NH1  . ARG A 1 12 ? 12.813  -17.735 18.323  1.00 0.00 ? 12  ARG A NH1  8  
ATOM   10028 N  NH2  . ARG A 1 12 ? 14.100  -19.387 17.384  1.00 0.00 ? 12  ARG A NH2  8  
ATOM   10029 H  H    . ARG A 1 12 ? 14.044  -12.893 16.506  1.00 0.00 ? 12  ARG A H    8  
ATOM   10030 H  HA   . ARG A 1 12 ? 14.577  -13.660 13.722  1.00 0.00 ? 12  ARG A HA   8  
ATOM   10031 H  HB2  . ARG A 1 12 ? 12.057  -13.763 15.443  1.00 0.00 ? 12  ARG A HB2  8  
ATOM   10032 H  HB3  . ARG A 1 12 ? 11.987  -14.029 13.710  1.00 0.00 ? 12  ARG A HB3  8  
ATOM   10033 H  HG2  . ARG A 1 12 ? 12.013  -16.183 14.702  1.00 0.00 ? 12  ARG A HG2  8  
ATOM   10034 H  HG3  . ARG A 1 12 ? 13.625  -15.947 14.028  1.00 0.00 ? 12  ARG A HG3  8  
ATOM   10035 H  HD2  . ARG A 1 12 ? 14.425  -15.313 16.309  1.00 0.00 ? 12  ARG A HD2  8  
ATOM   10036 H  HD3  . ARG A 1 12 ? 12.818  -15.675 16.937  1.00 0.00 ? 12  ARG A HD3  8  
ATOM   10037 H  HE   . ARG A 1 12 ? 14.488  -17.719 15.595  1.00 0.00 ? 12  ARG A HE   8  
ATOM   10038 H  HH11 . ARG A 1 12 ? 12.420  -16.812 18.295  1.00 0.00 ? 12  ARG A HH11 8  
ATOM   10039 H  HH12 . ARG A 1 12 ? 12.601  -18.340 19.097  1.00 0.00 ? 12  ARG A HH12 8  
ATOM   10040 H  HH21 . ARG A 1 12 ? 14.691  -19.719 16.642  1.00 0.00 ? 12  ARG A HH21 8  
ATOM   10041 H  HH22 . ARG A 1 12 ? 13.879  -19.995 18.150  1.00 0.00 ? 12  ARG A HH22 8  
ATOM   10042 N  N    . ASP A 1 13 ? 14.410  -10.885 13.700  1.00 0.00 ? 13  ASP A N    8  
ATOM   10043 C  CA   . ASP A 1 13 ? 14.158  -9.479  13.373  1.00 0.00 ? 13  ASP A CA   8  
ATOM   10044 C  C    . ASP A 1 13 ? 15.128  -9.047  12.271  1.00 0.00 ? 13  ASP A C    8  
ATOM   10045 O  O    . ASP A 1 13 ? 16.291  -8.726  12.525  1.00 0.00 ? 13  ASP A O    8  
ATOM   10046 C  CB   . ASP A 1 13 ? 14.304  -8.592  14.633  1.00 0.00 ? 13  ASP A CB   8  
ATOM   10047 C  CG   . ASP A 1 13 ? 13.230  -8.884  15.702  1.00 0.00 ? 13  ASP A CG   8  
ATOM   10048 O  OD1  . ASP A 1 13 ? 13.341  -9.897  16.422  1.00 0.00 ? 13  ASP A OD1  8  
ATOM   10049 O  OD2  . ASP A 1 13 ? 12.261  -8.112  15.829  1.00 0.00 ? 13  ASP A OD2  8  
ATOM   10050 H  H    . ASP A 1 13 ? 15.333  -11.149 13.834  1.00 0.00 ? 13  ASP A H    8  
ATOM   10051 H  HA   . ASP A 1 13 ? 13.135  -9.387  13.002  1.00 0.00 ? 13  ASP A HA   8  
ATOM   10052 H  HB2  . ASP A 1 13 ? 15.286  -8.747  15.070  1.00 0.00 ? 13  ASP A HB2  8  
ATOM   10053 H  HB3  . ASP A 1 13 ? 14.221  -7.545  14.327  1.00 0.00 ? 13  ASP A HB3  8  
ATOM   10054 N  N    . TYR A 1 14 ? 14.630  -9.153  11.054  1.00 0.00 ? 14  TYR A N    8  
ATOM   10055 C  CA   . TYR A 1 14 ? 15.291  -8.748  9.814   1.00 0.00 ? 14  TYR A CA   8  
ATOM   10056 C  C    . TYR A 1 14 ? 15.205  -7.222  9.675   1.00 0.00 ? 14  TYR A C    8  
ATOM   10057 O  O    . TYR A 1 14 ? 14.105  -6.663  9.616   1.00 0.00 ? 14  TYR A O    8  
ATOM   10058 C  CB   . TYR A 1 14 ? 14.576  -9.431  8.620   1.00 0.00 ? 14  TYR A CB   8  
ATOM   10059 C  CG   . TYR A 1 14 ? 14.459  -10.967 8.754   1.00 0.00 ? 14  TYR A CG   8  
ATOM   10060 C  CD1  . TYR A 1 14 ? 13.377  -11.554 9.412   1.00 0.00 ? 14  TYR A CD1  8  
ATOM   10061 C  CD2  . TYR A 1 14 ? 15.438  -11.823 8.243   1.00 0.00 ? 14  TYR A CD2  8  
ATOM   10062 C  CE1  . TYR A 1 14 ? 13.270  -12.921 9.549   1.00 0.00 ? 14  TYR A CE1  8  
ATOM   10063 C  CE2  . TYR A 1 14 ? 15.334  -13.196 8.381   1.00 0.00 ? 14  TYR A CE2  8  
ATOM   10064 C  CZ   . TYR A 1 14 ? 14.252  -13.739 9.035   1.00 0.00 ? 14  TYR A CZ   8  
ATOM   10065 O  OH   . TYR A 1 14 ? 14.144  -15.106 9.176   1.00 0.00 ? 14  TYR A OH   8  
ATOM   10066 H  H    . TYR A 1 14 ? 13.746  -9.529  10.978  1.00 0.00 ? 14  TYR A H    8  
ATOM   10067 H  HA   . TYR A 1 14 ? 16.330  -9.064  9.845   1.00 0.00 ? 14  TYR A HA   8  
ATOM   10068 H  HB2  . TYR A 1 14 ? 13.570  -9.022  8.537   1.00 0.00 ? 14  TYR A HB2  8  
ATOM   10069 H  HB3  . TYR A 1 14 ? 15.117  -9.206  7.707   1.00 0.00 ? 14  TYR A HB3  8  
ATOM   10070 H  HD1  . TYR A 1 14 ? 12.600  -10.916 9.815   1.00 0.00 ? 14  TYR A HD1  8  
ATOM   10071 H  HD2  . TYR A 1 14 ? 16.287  -11.403 7.727   1.00 0.00 ? 14  TYR A HD2  8  
ATOM   10072 H  HE1  . TYR A 1 14 ? 12.413  -13.346 10.063  1.00 0.00 ? 14  TYR A HE1  8  
ATOM   10073 H  HE2  . TYR A 1 14 ? 16.104  -13.841 7.974   1.00 0.00 ? 14  TYR A HE2  8  
ATOM   10074 H  HH   . TYR A 1 14 ? 14.962  -15.455 9.558   1.00 0.00 ? 14  TYR A HH   8  
ATOM   10075 N  N    . ILE A 1 15 ? 16.359  -6.546  9.637   1.00 0.00 ? 15  ILE A N    8  
ATOM   10076 C  CA   . ILE A 1 15 ? 16.428  -5.068  9.653   1.00 0.00 ? 15  ILE A CA   8  
ATOM   10077 C  C    . ILE A 1 15 ? 17.005  -4.567  8.310   1.00 0.00 ? 15  ILE A C    8  
ATOM   10078 O  O    . ILE A 1 15 ? 17.777  -5.273  7.661   1.00 0.00 ? 15  ILE A O    8  
ATOM   10079 C  CB   . ILE A 1 15 ? 17.315  -4.532  10.858  1.00 0.00 ? 15  ILE A CB   8  
ATOM   10080 C  CG1  . ILE A 1 15 ? 17.085  -5.349  12.167  1.00 0.00 ? 15  ILE A CG1  8  
ATOM   10081 C  CG2  . ILE A 1 15 ? 17.067  -3.021  11.116  1.00 0.00 ? 15  ILE A CG2  8  
ATOM   10082 C  CD1  . ILE A 1 15 ? 15.695  -5.249  12.745  1.00 0.00 ? 15  ILE A CD1  8  
ATOM   10083 H  H    . ILE A 1 15 ? 17.195  -7.052  9.564   1.00 0.00 ? 15  ILE A H    8  
ATOM   10084 H  HA   . ILE A 1 15 ? 15.418  -4.674  9.769   1.00 0.00 ? 15  ILE A HA   8  
ATOM   10085 H  HB   . ILE A 1 15 ? 18.349  -4.643  10.586  1.00 0.00 ? 15  ILE A HB   8  
ATOM   10086 H  HG12 . ILE A 1 15 ? 17.274  -6.396  11.972  1.00 0.00 ? 15  ILE A HG12 8  
ATOM   10087 H  HG13 . ILE A 1 15 ? 17.780  -5.008  12.926  1.00 0.00 ? 15  ILE A HG13 8  
ATOM   10088 H  HG21 . ILE A 1 15 ? 17.698  -2.677  11.928  1.00 0.00 ? 15  ILE A HG21 8  
ATOM   10089 H  HG22 . ILE A 1 15 ? 16.029  -2.851  11.380  1.00 0.00 ? 15  ILE A HG22 8  
ATOM   10090 H  HG23 . ILE A 1 15 ? 17.299  -2.451  10.223  1.00 0.00 ? 15  ILE A HG23 8  
ATOM   10091 H  HD11 . ILE A 1 15 ? 14.977  -5.584  12.014  1.00 0.00 ? 15  ILE A HD11 8  
ATOM   10092 H  HD12 . ILE A 1 15 ? 15.489  -4.223  13.010  1.00 0.00 ? 15  ILE A HD12 8  
ATOM   10093 H  HD13 . ILE A 1 15 ? 15.631  -5.867  13.623  1.00 0.00 ? 15  ILE A HD13 8  
ATOM   10094 N  N    . CYS A 1 16 ? 16.606  -3.355  7.907   1.00 0.00 ? 16  CYS A N    8  
ATOM   10095 C  CA   . CYS A 1 16 ? 17.140  -2.670  6.704   1.00 0.00 ? 16  CYS A CA   8  
ATOM   10096 C  C    . CYS A 1 16 ? 18.484  -1.977  7.005   1.00 0.00 ? 16  CYS A C    8  
ATOM   10097 O  O    . CYS A 1 16 ? 19.228  -1.649  6.075   1.00 0.00 ? 16  CYS A O    8  
ATOM   10098 C  CB   . CYS A 1 16 ? 16.114  -1.634  6.176   1.00 0.00 ? 16  CYS A CB   8  
ATOM   10099 S  SG   . CYS A 1 16 ? 16.806  -0.379  5.067   1.00 0.00 ? 16  CYS A SG   8  
ATOM   10100 H  H    . CYS A 1 16 ? 15.928  -2.898  8.441   1.00 0.00 ? 16  CYS A H    8  
ATOM   10101 H  HA   . CYS A 1 16 ? 17.306  -3.421  5.930   1.00 0.00 ? 16  CYS A HA   8  
ATOM   10102 H  HB2  . CYS A 1 16 ? 15.336  -2.146  5.629   1.00 0.00 ? 16  CYS A HB2  8  
ATOM   10103 H  HB3  . CYS A 1 16 ? 15.672  -1.106  7.009   1.00 0.00 ? 16  CYS A HB3  8  
ATOM   10104 N  N    . GLU A 1 17 ? 18.704  -1.666  8.306   1.00 0.00 ? 17  GLU A N    8  
ATOM   10105 C  CA   . GLU A 1 17 ? 19.972  -1.107  8.861   1.00 0.00 ? 17  GLU A CA   8  
ATOM   10106 C  C    . GLU A 1 17 ? 19.983  0.440   8.726   1.00 0.00 ? 17  GLU A C    8  
ATOM   10107 O  O    . GLU A 1 17 ? 20.868  1.116   9.257   1.00 0.00 ? 17  GLU A O    8  
ATOM   10108 C  CB   . GLU A 1 17 ? 21.244  -1.771  8.221   1.00 0.00 ? 17  GLU A CB   8  
ATOM   10109 C  CG   . GLU A 1 17 ? 22.595  -1.429  8.886   1.00 0.00 ? 17  GLU A CG   8  
ATOM   10110 C  CD   . GLU A 1 17 ? 23.804  -2.049  8.161   1.00 0.00 ? 17  GLU A CD   8  
ATOM   10111 O  OE1  . GLU A 1 17 ? 24.337  -1.424  7.219   1.00 0.00 ? 17  GLU A OE1  8  
ATOM   10112 O  OE2  . GLU A 1 17 ? 24.221  -3.170  8.516   1.00 0.00 ? 17  GLU A OE2  8  
ATOM   10113 H  H    . GLU A 1 17 ? 17.935  -1.714  8.907   1.00 0.00 ? 17  GLU A H    8  
ATOM   10114 H  HA   . GLU A 1 17 ? 19.961  -1.338  9.920   1.00 0.00 ? 17  GLU A HA   8  
ATOM   10115 H  HB2  . GLU A 1 17 ? 21.118  -2.847  8.254   1.00 0.00 ? 17  GLU A HB2  8  
ATOM   10116 H  HB3  . GLU A 1 17 ? 21.296  -1.472  7.178   1.00 0.00 ? 17  GLU A HB3  8  
ATOM   10117 H  HG2  . GLU A 1 17 ? 22.711  -0.348  8.901   1.00 0.00 ? 17  GLU A HG2  8  
ATOM   10118 H  HG3  . GLU A 1 17 ? 22.575  -1.787  9.911   1.00 0.00 ? 17  GLU A HG3  8  
ATOM   10119 N  N    . TYR A 1 18 ? 18.952  1.000   8.055   1.00 0.00 ? 18  TYR A N    8  
ATOM   10120 C  CA   . TYR A 1 18 ? 18.853  2.443   7.776   1.00 0.00 ? 18  TYR A CA   8  
ATOM   10121 C  C    . TYR A 1 18 ? 17.431  2.923   8.087   1.00 0.00 ? 18  TYR A C    8  
ATOM   10122 O  O    . TYR A 1 18 ? 17.227  3.914   8.793   1.00 0.00 ? 18  TYR A O    8  
ATOM   10123 C  CB   . TYR A 1 18 ? 19.209  2.733   6.293   1.00 0.00 ? 18  TYR A CB   8  
ATOM   10124 C  CG   . TYR A 1 18 ? 19.397  4.228   5.998   1.00 0.00 ? 18  TYR A CG   8  
ATOM   10125 C  CD1  . TYR A 1 18 ? 20.106  5.030   6.895   1.00 0.00 ? 18  TYR A CD1  8  
ATOM   10126 C  CD2  . TYR A 1 18 ? 18.875  4.838   4.857   1.00 0.00 ? 18  TYR A CD2  8  
ATOM   10127 C  CE1  . TYR A 1 18 ? 20.286  6.368   6.674   1.00 0.00 ? 18  TYR A CE1  8  
ATOM   10128 C  CE2  . TYR A 1 18 ? 19.054  6.191   4.631   1.00 0.00 ? 18  TYR A CE2  8  
ATOM   10129 C  CZ   . TYR A 1 18 ? 19.759  6.951   5.540   1.00 0.00 ? 18  TYR A CZ   8  
ATOM   10130 O  OH   . TYR A 1 18 ? 19.936  8.299   5.317   1.00 0.00 ? 18  TYR A OH   8  
ATOM   10131 H  H    . TYR A 1 18 ? 18.205  0.433   7.777   1.00 0.00 ? 18  TYR A H    8  
ATOM   10132 H  HA   . TYR A 1 18 ? 19.559  2.983   8.421   1.00 0.00 ? 18  TYR A HA   8  
ATOM   10133 H  HB2  . TYR A 1 18 ? 20.131  2.228   6.046   1.00 0.00 ? 18  TYR A HB2  8  
ATOM   10134 H  HB3  . TYR A 1 18 ? 18.421  2.350   5.646   1.00 0.00 ? 18  TYR A HB3  8  
ATOM   10135 H  HD1  . TYR A 1 18 ? 20.524  4.579   7.787   1.00 0.00 ? 18  TYR A HD1  8  
ATOM   10136 H  HD2  . TYR A 1 18 ? 18.316  4.240   4.142   1.00 0.00 ? 18  TYR A HD2  8  
ATOM   10137 H  HE1  . TYR A 1 18 ? 20.838  6.951   7.394   1.00 0.00 ? 18  TYR A HE1  8  
ATOM   10138 H  HE2  . TYR A 1 18 ? 18.643  6.648   3.740   1.00 0.00 ? 18  TYR A HE2  8  
ATOM   10139 H  HH   . TYR A 1 18 ? 19.104  8.687   5.022   1.00 0.00 ? 18  TYR A HH   8  
ATOM   10140 N  N    . CYS A 1 19 ? 16.458  2.194   7.516   1.00 0.00 ? 19  CYS A N    8  
ATOM   10141 C  CA   . CYS A 1 19 ? 15.022  2.474   7.677   1.00 0.00 ? 19  CYS A CA   8  
ATOM   10142 C  C    . CYS A 1 19 ? 14.208  1.169   7.729   1.00 0.00 ? 19  CYS A C    8  
ATOM   10143 O  O    . CYS A 1 19 ? 13.688  0.706   6.718   1.00 0.00 ? 19  CYS A O    8  
ATOM   10144 C  CB   . CYS A 1 19 ? 14.527  3.426   6.558   1.00 0.00 ? 19  CYS A CB   8  
ATOM   10145 S  SG   . CYS A 1 19 ? 15.321  3.191   4.934   1.00 0.00 ? 19  CYS A SG   8  
ATOM   10146 H  H    . CYS A 1 19 ? 16.726  1.446   6.947   1.00 0.00 ? 19  CYS A H    8  
ATOM   10147 H  HA   . CYS A 1 19 ? 14.887  2.977   8.634   1.00 0.00 ? 19  CYS A HA   8  
ATOM   10148 H  HB2  . CYS A 1 19 ? 13.461  3.314   6.415   1.00 0.00 ? 19  CYS A HB2  8  
ATOM   10149 H  HB3  . CYS A 1 19 ? 14.723  4.452   6.859   1.00 0.00 ? 19  CYS A HB3  8  
ATOM   10150 N  N    . ALA A 1 20 ? 14.222  0.537   8.908   1.00 0.00 ? 20  ALA A N    8  
ATOM   10151 C  CA   . ALA A 1 20 ? 13.287  -0.528  9.299   1.00 0.00 ? 20  ALA A CA   8  
ATOM   10152 C  C    . ALA A 1 20 ? 13.333  -0.708  10.810  1.00 0.00 ? 20  ALA A C    8  
ATOM   10153 O  O    . ALA A 1 20 ? 14.426  -0.845  11.374  1.00 0.00 ? 20  ALA A O    8  
ATOM   10154 C  CB   . ALA A 1 20 ? 13.599  -1.867  8.612   1.00 0.00 ? 20  ALA A CB   8  
ATOM   10155 H  H    . ALA A 1 20 ? 14.914  0.793   9.546   1.00 0.00 ? 20  ALA A H    8  
ATOM   10156 H  HA   . ALA A 1 20 ? 12.293  -0.214  9.004   1.00 0.00 ? 20  ALA A HA   8  
ATOM   10157 H  HB1  . ALA A 1 20 ? 12.865  -2.615  8.900   1.00 0.00 ? 20  ALA A HB1  8  
ATOM   10158 H  HB2  . ALA A 1 20 ? 14.589  -2.209  8.896   1.00 0.00 ? 20  ALA A HB2  8  
ATOM   10159 H  HB3  . ALA A 1 20 ? 13.567  -1.738  7.538   1.00 0.00 ? 20  ALA A HB3  8  
ATOM   10160 N  N    . ARG A 1 21 ? 12.151  -0.701  11.447  1.00 0.00 ? 21  ARG A N    8  
ATOM   10161 C  CA   . ARG A 1 21 ? 12.040  -0.956  12.887  1.00 0.00 ? 21  ARG A CA   8  
ATOM   10162 C  C    . ARG A 1 21 ? 12.442  -2.431  13.165  1.00 0.00 ? 21  ARG A C    8  
ATOM   10163 O  O    . ARG A 1 21 ? 13.423  -2.675  13.881  1.00 0.00 ? 21  ARG A O    8  
ATOM   10164 C  CB   . ARG A 1 21 ? 10.609  -0.581  13.424  1.00 0.00 ? 21  ARG A CB   8  
ATOM   10165 C  CG   . ARG A 1 21 ? 9.414   -1.265  12.700  1.00 0.00 ? 21  ARG A CG   8  
ATOM   10166 C  CD   . ARG A 1 21 ? 8.033   -0.928  13.287  1.00 0.00 ? 21  ARG A CD   8  
ATOM   10167 N  NE   . ARG A 1 21 ? 6.957   -1.678  12.596  1.00 0.00 ? 21  ARG A NE   8  
ATOM   10168 C  CZ   . ARG A 1 21 ? 5.643   -1.477  12.742  1.00 0.00 ? 21  ARG A CZ   8  
ATOM   10169 N  NH1  . ARG A 1 21 ? 5.174   -0.545  13.562  1.00 0.00 ? 21  ARG A NH1  8  
ATOM   10170 N  NH2  . ARG A 1 21 ? 4.804   -2.215  12.043  1.00 0.00 ? 21  ARG A NH2  8  
ATOM   10171 H  H    . ARG A 1 21 ? 11.365  -0.432  10.926  1.00 0.00 ? 21  ARG A H    8  
ATOM   10172 H  HA   . ARG A 1 21 ? 12.770  -0.310  13.381  1.00 0.00 ? 21  ARG A HA   8  
ATOM   10173 H  HB2  . ARG A 1 21 ? 10.557  -0.834  14.476  1.00 0.00 ? 21  ARG A HB2  8  
ATOM   10174 H  HB3  . ARG A 1 21 ? 10.485  0.497   13.329  1.00 0.00 ? 21  ARG A HB3  8  
ATOM   10175 H  HG2  . ARG A 1 21 ? 9.427   -0.969  11.662  1.00 0.00 ? 21  ARG A HG2  8  
ATOM   10176 H  HG3  . ARG A 1 21 ? 9.549   -2.340  12.754  1.00 0.00 ? 21  ARG A HG3  8  
ATOM   10177 H  HD2  . ARG A 1 21 ? 8.022   -1.179  14.339  1.00 0.00 ? 21  ARG A HD2  8  
ATOM   10178 H  HD3  . ARG A 1 21 ? 7.851   0.134   13.169  1.00 0.00 ? 21  ARG A HD3  8  
ATOM   10179 H  HE   . ARG A 1 21 ? 7.242   -2.392  11.983  1.00 0.00 ? 21  ARG A HE   8  
ATOM   10180 H  HH11 . ARG A 1 21 ? 5.810   0.017   14.097  1.00 0.00 ? 21  ARG A HH11 8  
ATOM   10181 H  HH12 . ARG A 1 21 ? 4.188   -0.401  13.649  1.00 0.00 ? 21  ARG A HH12 8  
ATOM   10182 H  HH21 . ARG A 1 21 ? 5.155   -2.921  11.423  1.00 0.00 ? 21  ARG A HH21 8  
ATOM   10183 H  HH22 . ARG A 1 21 ? 3.814   -2.085  12.132  1.00 0.00 ? 21  ARG A HH22 8  
ATOM   10184 N  N    . ALA A 1 22 ? 11.711  -3.391  12.551  1.00 0.00 ? 22  ALA A N    8  
ATOM   10185 C  CA   . ALA A 1 22 ? 12.060  -4.816  12.510  1.00 0.00 ? 22  ALA A CA   8  
ATOM   10186 C  C    . ALA A 1 22 ? 11.033  -5.542  11.645  1.00 0.00 ? 22  ALA A C    8  
ATOM   10187 O  O    . ALA A 1 22 ? 9.862   -5.155  11.616  1.00 0.00 ? 22  ALA A O    8  
ATOM   10188 C  CB   . ALA A 1 22 ? 12.065  -5.420  13.926  1.00 0.00 ? 22  ALA A CB   8  
ATOM   10189 H  H    . ALA A 1 22 ? 10.849  -3.156  12.186  1.00 0.00 ? 22  ALA A H    8  
ATOM   10190 H  HA   . ALA A 1 22 ? 13.052  -4.929  12.066  1.00 0.00 ? 22  ALA A HA   8  
ATOM   10191 H  HB1  . ALA A 1 22 ? 12.806  -4.912  14.529  1.00 0.00 ? 22  ALA A HB1  8  
ATOM   10192 H  HB2  . ALA A 1 22 ? 12.303  -6.476  13.881  1.00 0.00 ? 22  ALA A HB2  8  
ATOM   10193 H  HB3  . ALA A 1 22 ? 11.088  -5.285  14.379  1.00 0.00 ? 22  ALA A HB3  8  
ATOM   10194 N  N    . PHE A 1 23 ? 11.480  -6.576  10.936  1.00 0.00 ? 23  PHE A N    8  
ATOM   10195 C  CA   . PHE A 1 23 ? 10.601  -7.466  10.160  1.00 0.00 ? 23  PHE A CA   8  
ATOM   10196 C  C    . PHE A 1 23 ? 10.738  -8.883  10.699  1.00 0.00 ? 23  PHE A C    8  
ATOM   10197 O  O    . PHE A 1 23 ? 11.828  -9.307  11.036  1.00 0.00 ? 23  PHE A O    8  
ATOM   10198 C  CB   . PHE A 1 23 ? 10.965  -7.422  8.657   1.00 0.00 ? 23  PHE A CB   8  
ATOM   10199 C  CG   . PHE A 1 23 ? 10.653  -6.083  7.981   1.00 0.00 ? 23  PHE A CG   8  
ATOM   10200 C  CD1  . PHE A 1 23 ? 9.335   -5.727  7.697   1.00 0.00 ? 23  PHE A CD1  8  
ATOM   10201 C  CD2  . PHE A 1 23 ? 11.660  -5.191  7.615   1.00 0.00 ? 23  PHE A CD2  8  
ATOM   10202 C  CE1  . PHE A 1 23 ? 9.039   -4.531  7.076   1.00 0.00 ? 23  PHE A CE1  8  
ATOM   10203 C  CE2  . PHE A 1 23 ? 11.357  -3.996  6.993   1.00 0.00 ? 23  PHE A CE2  8  
ATOM   10204 C  CZ   . PHE A 1 23 ? 10.049  -3.670  6.722   1.00 0.00 ? 23  PHE A CZ   8  
ATOM   10205 H  H    . PHE A 1 23 ? 12.447  -6.748  10.923  1.00 0.00 ? 23  PHE A H    8  
ATOM   10206 H  HA   . PHE A 1 23 ? 9.570   -7.142  10.292  1.00 0.00 ? 23  PHE A HA   8  
ATOM   10207 H  HB2  . PHE A 1 23 ? 12.024  -7.629  8.541   1.00 0.00 ? 23  PHE A HB2  8  
ATOM   10208 H  HB3  . PHE A 1 23 ? 10.405  -8.192  8.134   1.00 0.00 ? 23  PHE A HB3  8  
ATOM   10209 H  HD1  . PHE A 1 23 ? 8.533   -6.400  7.968   1.00 0.00 ? 23  PHE A HD1  8  
ATOM   10210 H  HD2  . PHE A 1 23 ? 12.695  -5.440  7.825   1.00 0.00 ? 23  PHE A HD2  8  
ATOM   10211 H  HE1  . PHE A 1 23 ? 8.010   -4.273  6.862   1.00 0.00 ? 23  PHE A HE1  8  
ATOM   10212 H  HE2  . PHE A 1 23 ? 12.150  -3.314  6.709   1.00 0.00 ? 23  PHE A HE2  8  
ATOM   10213 H  HZ   . PHE A 1 23 ? 9.812   -2.733  6.231   1.00 0.00 ? 23  PHE A HZ   8  
ATOM   10214 N  N    . LYS A 1 24 ? 9.624   -9.605  10.808  1.00 0.00 ? 24  LYS A N    8  
ATOM   10215 C  CA   . LYS A 1 24 ? 9.641   -11.022 11.200  1.00 0.00 ? 24  LYS A CA   8  
ATOM   10216 C  C    . LYS A 1 24 ? 9.774   -11.933 9.962   1.00 0.00 ? 24  LYS A C    8  
ATOM   10217 O  O    . LYS A 1 24 ? 9.822   -13.159 10.096  1.00 0.00 ? 24  LYS A O    8  
ATOM   10218 C  CB   . LYS A 1 24 ? 8.387   -11.372 12.036  1.00 0.00 ? 24  LYS A CB   8  
ATOM   10219 C  CG   . LYS A 1 24 ? 7.032   -11.180 11.317  1.00 0.00 ? 24  LYS A CG   8  
ATOM   10220 C  CD   . LYS A 1 24 ? 5.834   -11.543 12.220  1.00 0.00 ? 24  LYS A CD   8  
ATOM   10221 C  CE   . LYS A 1 24 ? 4.485   -11.383 11.501  1.00 0.00 ? 24  LYS A CE   8  
ATOM   10222 N  NZ   . LYS A 1 24 ? 4.361   -12.290 10.327  1.00 0.00 ? 24  LYS A NZ   8  
ATOM   10223 H  H    . LYS A 1 24 ? 8.765   -9.171  10.635  1.00 0.00 ? 24  LYS A H    8  
ATOM   10224 H  HA   . LYS A 1 24 ? 10.521  -11.186 11.825  1.00 0.00 ? 24  LYS A HA   8  
ATOM   10225 H  HB2  . LYS A 1 24 ? 8.460   -12.408 12.349  1.00 0.00 ? 24  LYS A HB2  8  
ATOM   10226 H  HB3  . LYS A 1 24 ? 8.390   -10.746 12.924  1.00 0.00 ? 24  LYS A HB3  8  
ATOM   10227 H  HG2  . LYS A 1 24 ? 6.938   -10.139 11.020  1.00 0.00 ? 24  LYS A HG2  8  
ATOM   10228 H  HG3  . LYS A 1 24 ? 7.009   -11.806 10.427  1.00 0.00 ? 24  LYS A HG3  8  
ATOM   10229 H  HD2  . LYS A 1 24 ? 5.933   -12.576 12.544  1.00 0.00 ? 24  LYS A HD2  8  
ATOM   10230 H  HD3  . LYS A 1 24 ? 5.846   -10.897 13.095  1.00 0.00 ? 24  LYS A HD3  8  
ATOM   10231 H  HE2  . LYS A 1 24 ? 3.684   -11.603 12.197  1.00 0.00 ? 24  LYS A HE2  8  
ATOM   10232 H  HE3  . LYS A 1 24 ? 4.383   -10.359 11.161  1.00 0.00 ? 24  LYS A HE3  8  
ATOM   10233 H  HZ1  . LYS A 1 24 ? 3.410   -12.213 9.913   1.00 0.00 ? 24  LYS A HZ1  8  
ATOM   10234 H  HZ2  . LYS A 1 24 ? 4.516   -13.275 10.612  1.00 0.00 ? 24  LYS A HZ2  8  
ATOM   10235 H  HZ3  . LYS A 1 24 ? 5.063   -12.040 9.604   1.00 0.00 ? 24  LYS A HZ3  8  
ATOM   10236 N  N    . SER A 1 25 ? 9.860   -11.332 8.755   1.00 0.00 ? 25  SER A N    8  
ATOM   10237 C  CA   . SER A 1 25 ? 10.031  -12.072 7.495   1.00 0.00 ? 25  SER A CA   8  
ATOM   10238 C  C    . SER A 1 25 ? 11.064  -11.353 6.593   1.00 0.00 ? 25  SER A C    8  
ATOM   10239 O  O    . SER A 1 25 ? 11.002  -10.126 6.419   1.00 0.00 ? 25  SER A O    8  
ATOM   10240 C  CB   . SER A 1 25 ? 8.663   -12.186 6.777   1.00 0.00 ? 25  SER A CB   8  
ATOM   10241 O  OG   . SER A 1 25 ? 7.690   -12.808 7.612   1.00 0.00 ? 25  SER A OG   8  
ATOM   10242 H  H    . SER A 1 25 ? 9.811   -10.356 8.690   1.00 0.00 ? 25  SER A H    8  
ATOM   10243 H  HA   . SER A 1 25 ? 10.396  -13.069 7.724   1.00 0.00 ? 25  SER A HA   8  
ATOM   10244 H  HB2  . SER A 1 25 ? 8.306   -11.196 6.513   1.00 0.00 ? 25  SER A HB2  8  
ATOM   10245 H  HB3  . SER A 1 25 ? 8.768   -12.779 5.879   1.00 0.00 ? 25  SER A HB3  8  
ATOM   10246 H  HG   . SER A 1 25 ? 8.130   -13.249 8.349   1.00 0.00 ? 25  SER A HG   8  
ATOM   10247 N  N    . SER A 1 26 ? 12.009  -12.144 6.041   1.00 0.00 ? 26  SER A N    8  
ATOM   10248 C  CA   . SER A 1 26 ? 13.041  -11.674 5.088   1.00 0.00 ? 26  SER A CA   8  
ATOM   10249 C  C    . SER A 1 26 ? 12.407  -11.119 3.795   1.00 0.00 ? 26  SER A C    8  
ATOM   10250 O  O    . SER A 1 26 ? 12.875  -10.115 3.246   1.00 0.00 ? 26  SER A O    8  
ATOM   10251 C  CB   . SER A 1 26 ? 14.022  -12.833 4.772   1.00 0.00 ? 26  SER A CB   8  
ATOM   10252 O  OG   . SER A 1 26 ? 13.323  -13.985 4.323   1.00 0.00 ? 26  SER A OG   8  
ATOM   10253 H  H    . SER A 1 26 ? 12.040  -13.079 6.338   1.00 0.00 ? 26  SER A H    8  
ATOM   10254 H  HA   . SER A 1 26 ? 13.593  -10.875 5.574   1.00 0.00 ? 26  SER A HA   8  
ATOM   10255 H  HB2  . SER A 1 26 ? 14.721  -12.531 4.003   1.00 0.00 ? 26  SER A HB2  8  
ATOM   10256 H  HB3  . SER A 1 26 ? 14.573  -13.097 5.667   1.00 0.00 ? 26  SER A HB3  8  
ATOM   10257 H  HG   . SER A 1 26 ? 13.344  -14.019 3.360   1.00 0.00 ? 26  SER A HG   8  
ATOM   10258 N  N    . HIS A 1 27 ? 11.327  -11.782 3.331   1.00 0.00 ? 27  HIS A N    8  
ATOM   10259 C  CA   . HIS A 1 27 ? 10.569  -11.351 2.134   1.00 0.00 ? 27  HIS A CA   8  
ATOM   10260 C  C    . HIS A 1 27 ? 9.940   -9.963  2.336   1.00 0.00 ? 27  HIS A C    8  
ATOM   10261 O  O    . HIS A 1 27 ? 9.959   -9.139  1.426   1.00 0.00 ? 27  HIS A O    8  
ATOM   10262 C  CB   . HIS A 1 27 ? 9.476   -12.390 1.768   1.00 0.00 ? 27  HIS A CB   8  
ATOM   10263 C  CG   . HIS A 1 27 ? 10.001  -13.617 1.074   1.00 0.00 ? 27  HIS A CG   8  
ATOM   10264 N  ND1  . HIS A 1 27 ? 9.972   -13.772 -0.297  1.00 0.00 ? 27  HIS A ND1  8  
ATOM   10265 C  CD2  . HIS A 1 27 ? 10.566  -14.741 1.562   1.00 0.00 ? 27  HIS A CD2  8  
ATOM   10266 C  CE1  . HIS A 1 27 ? 10.501  -14.936 -0.614  1.00 0.00 ? 27  HIS A CE1  8  
ATOM   10267 N  NE2  . HIS A 1 27 ? 10.870  -15.545 0.495   1.00 0.00 ? 27  HIS A NE2  8  
ATOM   10268 H  H    . HIS A 1 27 ? 11.033  -12.590 3.811   1.00 0.00 ? 27  HIS A H    8  
ATOM   10269 H  HA   . HIS A 1 27 ? 11.278  -11.284 1.313   1.00 0.00 ? 27  HIS A HA   8  
ATOM   10270 H  HB2  . HIS A 1 27 ? 8.979   -12.713 2.671   1.00 0.00 ? 27  HIS A HB2  8  
ATOM   10271 H  HB3  . HIS A 1 27 ? 8.742   -11.932 1.113   1.00 0.00 ? 27  HIS A HB3  8  
ATOM   10272 H  HD1  . HIS A 1 27 ? 9.611   -13.125 -0.942  1.00 0.00 ? 27  HIS A HD1  8  
ATOM   10273 H  HD2  . HIS A 1 27 ? 10.736  -14.971 2.604   1.00 0.00 ? 27  HIS A HD2  8  
ATOM   10274 H  HE1  . HIS A 1 27 ? 10.602  -15.332 -1.616  1.00 0.00 ? 27  HIS A HE1  8  
ATOM   10275 H  HE2  . HIS A 1 27 ? 11.446  -16.340 0.534   1.00 0.00 ? 27  HIS A HE2  8  
ATOM   10276 N  N    . ASN A 1 28 ? 9.413   -9.720  3.550   1.00 0.00 ? 28  ASN A N    8  
ATOM   10277 C  CA   . ASN A 1 28 ? 8.740   -8.448  3.917   1.00 0.00 ? 28  ASN A CA   8  
ATOM   10278 C  C    . ASN A 1 28 ? 9.724   -7.268  3.784   1.00 0.00 ? 28  ASN A C    8  
ATOM   10279 O  O    . ASN A 1 28 ? 9.388   -6.206  3.250   1.00 0.00 ? 28  ASN A O    8  
ATOM   10280 C  CB   . ASN A 1 28 ? 8.221   -8.543  5.379   1.00 0.00 ? 28  ASN A CB   8  
ATOM   10281 C  CG   . ASN A 1 28 ? 7.084   -7.563  5.752   1.00 0.00 ? 28  ASN A CG   8  
ATOM   10282 O  OD1  . ASN A 1 28 ? 6.197   -7.910  6.534   1.00 0.00 ? 28  ASN A OD1  8  
ATOM   10283 N  ND2  . ASN A 1 28 ? 7.091   -6.338  5.237   1.00 0.00 ? 28  ASN A ND2  8  
ATOM   10284 H  H    . ASN A 1 28 ? 9.487   -10.420 4.228   1.00 0.00 ? 28  ASN A H    8  
ATOM   10285 H  HA   . ASN A 1 28 ? 7.901   -8.300  3.245   1.00 0.00 ? 28  ASN A HA   8  
ATOM   10286 H  HB2  . ASN A 1 28 ? 7.862   -9.547  5.551   1.00 0.00 ? 28  ASN A HB2  8  
ATOM   10287 H  HB3  . ASN A 1 28 ? 9.063   -8.362  6.054   1.00 0.00 ? 28  ASN A HB3  8  
ATOM   10288 H  HD21 . ASN A 1 28 ? 7.809   -6.081  4.628   1.00 0.00 ? 28  ASN A HD21 8  
ATOM   10289 H  HD22 . ASN A 1 28 ? 6.377   -5.723  5.510   1.00 0.00 ? 28  ASN A HD22 8  
ATOM   10290 N  N    . LEU A 1 29 ? 10.933  -7.494  4.302   1.00 0.00 ? 29  LEU A N    8  
ATOM   10291 C  CA   . LEU A 1 29 ? 12.058  -6.552  4.228   1.00 0.00 ? 29  LEU A CA   8  
ATOM   10292 C  C    . LEU A 1 29 ? 12.470  -6.299  2.764   1.00 0.00 ? 29  LEU A C    8  
ATOM   10293 O  O    . LEU A 1 29 ? 12.764  -5.164  2.405   1.00 0.00 ? 29  LEU A O    8  
ATOM   10294 C  CB   . LEU A 1 29 ? 13.237  -7.101  5.118   1.00 0.00 ? 29  LEU A CB   8  
ATOM   10295 C  CG   . LEU A 1 29 ? 14.692  -7.113  4.522   1.00 0.00 ? 29  LEU A CG   8  
ATOM   10296 C  CD1  . LEU A 1 29 ? 15.327  -5.701  4.444   1.00 0.00 ? 29  LEU A CD1  8  
ATOM   10297 C  CD2  . LEU A 1 29 ? 15.603  -8.090  5.297   1.00 0.00 ? 29  LEU A CD2  8  
ATOM   10298 H  H    . LEU A 1 29 ? 11.075  -8.342  4.776   1.00 0.00 ? 29  LEU A H    8  
ATOM   10299 H  HA   . LEU A 1 29 ? 11.713  -5.611  4.644   1.00 0.00 ? 29  LEU A HA   8  
ATOM   10300 H  HB2  . LEU A 1 29 ? 13.266  -6.499  6.025   1.00 0.00 ? 29  LEU A HB2  8  
ATOM   10301 H  HB3  . LEU A 1 29 ? 12.974  -8.117  5.414   1.00 0.00 ? 29  LEU A HB3  8  
ATOM   10302 H  HG   . LEU A 1 29 ? 14.637  -7.481  3.504   1.00 0.00 ? 29  LEU A HG   8  
ATOM   10303 H  HD11 . LEU A 1 29 ? 14.671  -5.039  3.894   1.00 0.00 ? 29  LEU A HD11 8  
ATOM   10304 H  HD12 . LEU A 1 29 ? 16.273  -5.766  3.918   1.00 0.00 ? 29  LEU A HD12 8  
ATOM   10305 H  HD13 . LEU A 1 29 ? 15.491  -5.307  5.440   1.00 0.00 ? 29  LEU A HD13 8  
ATOM   10306 H  HD21 . LEU A 1 29 ? 15.669  -7.791  6.338   1.00 0.00 ? 29  LEU A HD21 8  
ATOM   10307 H  HD22 . LEU A 1 29 ? 16.595  -8.086  4.861   1.00 0.00 ? 29  LEU A HD22 8  
ATOM   10308 H  HD23 . LEU A 1 29 ? 15.195  -9.089  5.235   1.00 0.00 ? 29  LEU A HD23 8  
ATOM   10309 N  N    . ALA A 1 30 ? 12.489  -7.360  1.945   1.00 0.00 ? 30  ALA A N    8  
ATOM   10310 C  CA   . ALA A 1 30 ? 12.854  -7.273  0.514   1.00 0.00 ? 30  ALA A CA   8  
ATOM   10311 C  C    . ALA A 1 30 ? 11.830  -6.424  -0.296  1.00 0.00 ? 30  ALA A C    8  
ATOM   10312 O  O    . ALA A 1 30 ? 12.197  -5.773  -1.281  1.00 0.00 ? 30  ALA A O    8  
ATOM   10313 C  CB   . ALA A 1 30 ? 13.007  -8.682  -0.074  1.00 0.00 ? 30  ALA A CB   8  
ATOM   10314 H  H    . ALA A 1 30 ? 12.262  -8.234  2.324   1.00 0.00 ? 30  ALA A H    8  
ATOM   10315 H  HA   . ALA A 1 30 ? 13.826  -6.784  0.457   1.00 0.00 ? 30  ALA A HA   8  
ATOM   10316 H  HB1  . ALA A 1 30 ? 13.329  -8.619  -1.106  1.00 0.00 ? 30  ALA A HB1  8  
ATOM   10317 H  HB2  . ALA A 1 30 ? 12.055  -9.199  -0.027  1.00 0.00 ? 30  ALA A HB2  8  
ATOM   10318 H  HB3  . ALA A 1 30 ? 13.741  -9.239  0.498   1.00 0.00 ? 30  ALA A HB3  8  
ATOM   10319 N  N    . VAL A 1 31 ? 10.554  -6.439  0.151   1.00 0.00 ? 31  VAL A N    8  
ATOM   10320 C  CA   . VAL A 1 31 ? 9.474   -5.596  -0.425  1.00 0.00 ? 31  VAL A CA   8  
ATOM   10321 C  C    . VAL A 1 31 ? 9.756   -4.097  -0.157  1.00 0.00 ? 31  VAL A C    8  
ATOM   10322 O  O    . VAL A 1 31 ? 9.563   -3.249  -1.034  1.00 0.00 ? 31  VAL A O    8  
ATOM   10323 C  CB   . VAL A 1 31 ? 8.058   -5.996  0.138   1.00 0.00 ? 31  VAL A CB   8  
ATOM   10324 C  CG1  . VAL A 1 31 ? 6.928   -5.106  -0.441  1.00 0.00 ? 31  VAL A CG1  8  
ATOM   10325 C  CG2  . VAL A 1 31 ? 7.757   -7.490  -0.130  1.00 0.00 ? 31  VAL A CG2  8  
ATOM   10326 H  H    . VAL A 1 31 ? 10.343  -7.040  0.893   1.00 0.00 ? 31  VAL A H    8  
ATOM   10327 H  HA   . VAL A 1 31 ? 9.469   -5.758  -1.499  1.00 0.00 ? 31  VAL A HA   8  
ATOM   10328 H  HB   . VAL A 1 31 ? 8.079   -5.849  1.219   1.00 0.00 ? 31  VAL A HB   8  
ATOM   10329 H  HG11 . VAL A 1 31 ? 6.894   -5.214  -1.518  1.00 0.00 ? 31  VAL A HG11 8  
ATOM   10330 H  HG12 . VAL A 1 31 ? 7.115   -4.068  -0.195  1.00 0.00 ? 31  VAL A HG12 8  
ATOM   10331 H  HG13 . VAL A 1 31 ? 5.974   -5.401  -0.020  1.00 0.00 ? 31  VAL A HG13 8  
ATOM   10332 H  HG21 . VAL A 1 31 ? 8.525   -8.106  0.321   1.00 0.00 ? 31  VAL A HG21 8  
ATOM   10333 H  HG22 . VAL A 1 31 ? 7.738   -7.675  -1.196  1.00 0.00 ? 31  VAL A HG22 8  
ATOM   10334 H  HG23 . VAL A 1 31 ? 6.797   -7.756  0.295   1.00 0.00 ? 31  VAL A HG23 8  
ATOM   10335 N  N    . HIS A 1 32 ? 10.222  -3.794  1.069   1.00 0.00 ? 32  HIS A N    8  
ATOM   10336 C  CA   . HIS A 1 32 ? 10.665  -2.435  1.465   1.00 0.00 ? 32  HIS A CA   8  
ATOM   10337 C  C    . HIS A 1 32 ? 11.958  -2.043  0.725   1.00 0.00 ? 32  HIS A C    8  
ATOM   10338 O  O    . HIS A 1 32 ? 12.122  -0.896  0.291   1.00 0.00 ? 32  HIS A O    8  
ATOM   10339 C  CB   . HIS A 1 32 ? 10.877  -2.355  3.015   1.00 0.00 ? 32  HIS A CB   8  
ATOM   10340 C  CG   . HIS A 1 32 ? 11.724  -1.181  3.469   1.00 0.00 ? 32  HIS A CG   8  
ATOM   10341 N  ND1  . HIS A 1 32 ? 11.247  0.098   3.597   1.00 0.00 ? 32  HIS A ND1  8  
ATOM   10342 C  CD2  . HIS A 1 32 ? 13.062  -1.110  3.727   1.00 0.00 ? 32  HIS A CD2  8  
ATOM   10343 C  CE1  . HIS A 1 32 ? 12.271  0.896   3.907   1.00 0.00 ? 32  HIS A CE1  8  
ATOM   10344 N  NE2  . HIS A 1 32 ? 13.403  0.220   3.997   1.00 0.00 ? 32  HIS A NE2  8  
ATOM   10345 H  H    . HIS A 1 32 ? 10.266  -4.504  1.738   1.00 0.00 ? 32  HIS A H    8  
ATOM   10346 H  HA   . HIS A 1 32 ? 9.885   -1.740  1.174   1.00 0.00 ? 32  HIS A HA   8  
ATOM   10347 H  HB2  . HIS A 1 32 ? 9.914   -2.276  3.507   1.00 0.00 ? 32  HIS A HB2  8  
ATOM   10348 H  HB3  . HIS A 1 32 ? 11.359  -3.265  3.354   1.00 0.00 ? 32  HIS A HB3  8  
ATOM   10349 H  HD1  . HIS A 1 32 ? 10.316  0.381   3.482   1.00 0.00 ? 32  HIS A HD1  8  
ATOM   10350 H  HD2  . HIS A 1 32 ? 13.749  -1.950  3.717   1.00 0.00 ? 32  HIS A HD2  8  
ATOM   10351 H  HE1  . HIS A 1 32 ? 12.186  1.959   4.064   1.00 0.00 ? 32  HIS A HE1  8  
ATOM   10352 N  N    . ARG A 1 33 ? 12.863  -3.022  0.601   1.00 0.00 ? 33  ARG A N    8  
ATOM   10353 C  CA   . ARG A 1 33 ? 14.211  -2.858  0.025   1.00 0.00 ? 33  ARG A CA   8  
ATOM   10354 C  C    . ARG A 1 33 ? 14.162  -2.491  -1.483  1.00 0.00 ? 33  ARG A C    8  
ATOM   10355 O  O    . ARG A 1 33 ? 15.191  -2.194  -2.066  1.00 0.00 ? 33  ARG A O    8  
ATOM   10356 C  CB   . ARG A 1 33 ? 15.031  -4.162  0.268   1.00 0.00 ? 33  ARG A CB   8  
ATOM   10357 C  CG   . ARG A 1 33 ? 16.533  -4.076  -0.077  1.00 0.00 ? 33  ARG A CG   8  
ATOM   10358 C  CD   . ARG A 1 33 ? 17.225  -5.450  -0.069  1.00 0.00 ? 33  ARG A CD   8  
ATOM   10359 N  NE   . ARG A 1 33 ? 17.281  -6.073  1.263   1.00 0.00 ? 33  ARG A NE   8  
ATOM   10360 C  CZ   . ARG A 1 33 ? 17.314  -7.390  1.489   1.00 0.00 ? 33  ARG A CZ   8  
ATOM   10361 N  NH1  . ARG A 1 33 ? 17.105  -8.255  0.514   1.00 0.00 ? 33  ARG A NH1  8  
ATOM   10362 N  NH2  . ARG A 1 33 ? 17.516  -7.829  2.707   1.00 0.00 ? 33  ARG A NH2  8  
ATOM   10363 H  H    . ARG A 1 33 ? 12.624  -3.896  0.946   1.00 0.00 ? 33  ARG A H    8  
ATOM   10364 H  HA   . ARG A 1 33 ? 14.691  -2.039  0.553   1.00 0.00 ? 33  ARG A HA   8  
ATOM   10365 H  HB2  . ARG A 1 33 ? 14.943  -4.434  1.316   1.00 0.00 ? 33  ARG A HB2  8  
ATOM   10366 H  HB3  . ARG A 1 33 ? 14.591  -4.951  -0.329  1.00 0.00 ? 33  ARG A HB3  8  
ATOM   10367 H  HG2  . ARG A 1 33 ? 16.638  -3.647  -1.067  1.00 0.00 ? 33  ARG A HG2  8  
ATOM   10368 H  HG3  . ARG A 1 33 ? 17.027  -3.429  0.641   1.00 0.00 ? 33  ARG A HG3  8  
ATOM   10369 H  HD2  . ARG A 1 33 ? 16.687  -6.111  -0.738  1.00 0.00 ? 33  ARG A HD2  8  
ATOM   10370 H  HD3  . ARG A 1 33 ? 18.236  -5.328  -0.432  1.00 0.00 ? 33  ARG A HD3  8  
ATOM   10371 H  HE   . ARG A 1 33 ? 17.360  -5.465  2.033   1.00 0.00 ? 33  ARG A HE   8  
ATOM   10372 H  HH11 . ARG A 1 33 ? 16.912  -7.934  -0.415  1.00 0.00 ? 33  ARG A HH11 8  
ATOM   10373 H  HH12 . ARG A 1 33 ? 17.151  -9.239  0.697   1.00 0.00 ? 33  ARG A HH12 8  
ATOM   10374 H  HH21 . ARG A 1 33 ? 17.643  -7.180  3.462   1.00 0.00 ? 33  ARG A HH21 8  
ATOM   10375 H  HH22 . ARG A 1 33 ? 17.546  -8.812  2.888   1.00 0.00 ? 33  ARG A HH22 8  
ATOM   10376 N  N    . MET A 1 34 ? 12.936  -2.444  -2.061  1.00 0.00 ? 34  MET A N    8  
ATOM   10377 C  CA   . MET A 1 34 ? 12.660  -1.999  -3.462  1.00 0.00 ? 34  MET A CA   8  
ATOM   10378 C  C    . MET A 1 34 ? 13.407  -0.690  -3.875  1.00 0.00 ? 34  MET A C    8  
ATOM   10379 O  O    . MET A 1 34 ? 13.680  -0.472  -5.059  1.00 0.00 ? 34  MET A O    8  
ATOM   10380 C  CB   . MET A 1 34 ? 11.131  -1.778  -3.606  1.00 0.00 ? 34  MET A CB   8  
ATOM   10381 C  CG   . MET A 1 34 ? 10.572  -0.642  -2.728  1.00 0.00 ? 34  MET A CG   8  
ATOM   10382 S  SD   . MET A 1 34 ? 8.777   -0.483  -2.809  1.00 0.00 ? 34  MET A SD   8  
ATOM   10383 C  CE   . MET A 1 34 ? 8.487   0.903   -1.709  1.00 0.00 ? 34  MET A CE   8  
ATOM   10384 H  H    . MET A 1 34 ? 12.192  -2.801  -1.526  1.00 0.00 ? 34  MET A H    8  
ATOM   10385 H  HA   . MET A 1 34 ? 12.962  -2.798  -4.128  1.00 0.00 ? 34  MET A HA   8  
ATOM   10386 H  HB2  . MET A 1 34 ? 10.905  -1.552  -4.641  1.00 0.00 ? 34  MET A HB2  8  
ATOM   10387 H  HB3  . MET A 1 34 ? 10.619  -2.695  -3.340  1.00 0.00 ? 34  MET A HB3  8  
ATOM   10388 H  HG2  . MET A 1 34 ? 10.849  -0.834  -1.697  1.00 0.00 ? 34  MET A HG2  8  
ATOM   10389 H  HG3  . MET A 1 34 ? 11.014  0.297   -3.042  1.00 0.00 ? 34  MET A HG3  8  
ATOM   10390 H  HE1  . MET A 1 34 ? 9.026   1.769   -2.070  1.00 0.00 ? 34  MET A HE1  8  
ATOM   10391 H  HE2  . MET A 1 34 ? 8.831   0.649   -0.716  1.00 0.00 ? 34  MET A HE2  8  
ATOM   10392 H  HE3  . MET A 1 34 ? 7.429   1.127   -1.678  1.00 0.00 ? 34  MET A HE3  8  
ATOM   10393 N  N    . ILE A 1 35 ? 13.759  0.126   -2.873  1.00 0.00 ? 35  ILE A N    8  
ATOM   10394 C  CA   . ILE A 1 35 ? 14.435  1.410   -3.054  1.00 0.00 ? 35  ILE A CA   8  
ATOM   10395 C  C    . ILE A 1 35 ? 15.988  1.213   -3.103  1.00 0.00 ? 35  ILE A C    8  
ATOM   10396 O  O    . ILE A 1 35 ? 16.668  1.821   -3.935  1.00 0.00 ? 35  ILE A O    8  
ATOM   10397 C  CB   . ILE A 1 35 ? 13.971  2.430   -1.933  1.00 0.00 ? 35  ILE A CB   8  
ATOM   10398 C  CG1  . ILE A 1 35 ? 14.878  3.696   -1.876  1.00 0.00 ? 35  ILE A CG1  8  
ATOM   10399 C  CG2  . ILE A 1 35 ? 13.864  1.760   -0.543  1.00 0.00 ? 35  ILE A CG2  8  
ATOM   10400 C  CD1  . ILE A 1 35 ? 14.826  4.594   -3.105  1.00 0.00 ? 35  ILE A CD1  8  
ATOM   10401 H  H    . ILE A 1 35 ? 13.660  -0.228  -1.980  1.00 0.00 ? 35  ILE A H    8  
ATOM   10402 H  HA   . ILE A 1 35 ? 14.120  1.817   -4.018  1.00 0.00 ? 35  ILE A HA   8  
ATOM   10403 H  HB   . ILE A 1 35 ? 12.963  2.748   -2.197  1.00 0.00 ? 35  ILE A HB   8  
ATOM   10404 H  HG12 . ILE A 1 35 ? 14.596  4.297   -1.027  1.00 0.00 ? 35  ILE A HG12 8  
ATOM   10405 H  HG13 . ILE A 1 35 ? 15.898  3.366   -1.751  1.00 0.00 ? 35  ILE A HG13 8  
ATOM   10406 H  HG21 . ILE A 1 35 ? 14.839  1.397   -0.245  1.00 0.00 ? 35  ILE A HG21 8  
ATOM   10407 H  HG22 . ILE A 1 35 ? 13.174  0.929   -0.590  1.00 0.00 ? 35  ILE A HG22 8  
ATOM   10408 H  HG23 . ILE A 1 35 ? 13.510  2.478   0.190   1.00 0.00 ? 35  ILE A HG23 8  
ATOM   10409 H  HD11 . ILE A 1 35 ? 15.158  4.043   -3.973  1.00 0.00 ? 35  ILE A HD11 8  
ATOM   10410 H  HD12 . ILE A 1 35 ? 15.473  5.444   -2.948  1.00 0.00 ? 35  ILE A HD12 8  
ATOM   10411 H  HD13 . ILE A 1 35 ? 13.813  4.939   -3.259  1.00 0.00 ? 35  ILE A HD13 8  
ATOM   10412 N  N    . HIS A 1 36 ? 16.535  0.322   -2.237  1.00 0.00 ? 36  HIS A N    8  
ATOM   10413 C  CA   . HIS A 1 36 ? 18.012  0.154   -2.061  1.00 0.00 ? 36  HIS A CA   8  
ATOM   10414 C  C    . HIS A 1 36 ? 18.575  -1.047  -2.862  1.00 0.00 ? 36  HIS A C    8  
ATOM   10415 O  O    . HIS A 1 36 ? 19.785  -1.120  -3.097  1.00 0.00 ? 36  HIS A O    8  
ATOM   10416 C  CB   . HIS A 1 36 ? 18.384  -0.077  -0.566  1.00 0.00 ? 36  HIS A CB   8  
ATOM   10417 C  CG   . HIS A 1 36 ? 17.561  0.684   0.437   1.00 0.00 ? 36  HIS A CG   8  
ATOM   10418 N  ND1  . HIS A 1 36 ? 17.691  2.028   0.687   1.00 0.00 ? 36  HIS A ND1  8  
ATOM   10419 C  CD2  . HIS A 1 36 ? 16.592  0.237   1.280   1.00 0.00 ? 36  HIS A CD2  8  
ATOM   10420 C  CE1  . HIS A 1 36 ? 16.823  2.345   1.654   1.00 0.00 ? 36  HIS A CE1  8  
ATOM   10421 N  NE2  . HIS A 1 36 ? 16.126  1.289   2.050   1.00 0.00 ? 36  HIS A NE2  8  
ATOM   10422 H  H    . HIS A 1 36 ? 15.945  -0.238  -1.703  1.00 0.00 ? 36  HIS A H    8  
ATOM   10423 H  HA   . HIS A 1 36 ? 18.504  1.059   -2.407  1.00 0.00 ? 36  HIS A HA   8  
ATOM   10424 H  HB2  . HIS A 1 36 ? 18.289  -1.133  -0.323  1.00 0.00 ? 36  HIS A HB2  8  
ATOM   10425 H  HB3  . HIS A 1 36 ? 19.420  0.212   -0.417  1.00 0.00 ? 36  HIS A HB3  8  
ATOM   10426 H  HD1  . HIS A 1 36 ? 18.306  2.647   0.238   1.00 0.00 ? 36  HIS A HD1  8  
ATOM   10427 H  HD2  . HIS A 1 36 ? 16.238  -0.780  1.357   1.00 0.00 ? 36  HIS A HD2  8  
ATOM   10428 H  HE1  . HIS A 1 36 ? 16.708  3.341   2.067   1.00 0.00 ? 36  HIS A HE1  8  
ATOM   10429 N  N    . THR A 1 37 ? 17.689  -1.970  -3.251  1.00 0.00 ? 37  THR A N    8  
ATOM   10430 C  CA   . THR A 1 37 ? 18.054  -3.358  -3.606  1.00 0.00 ? 37  THR A CA   8  
ATOM   10431 C  C    . THR A 1 37 ? 19.000  -3.479  -4.810  1.00 0.00 ? 37  THR A C    8  
ATOM   10432 O  O    . THR A 1 37 ? 20.008  -4.189  -4.734  1.00 0.00 ? 37  THR A O    8  
ATOM   10433 C  CB   . THR A 1 37 ? 16.777  -4.239  -3.850  1.00 0.00 ? 37  THR A CB   8  
ATOM   10434 O  OG1  . THR A 1 37 ? 17.143  -5.558  -4.285  1.00 0.00 ? 37  THR A OG1  8  
ATOM   10435 C  CG2  . THR A 1 37 ? 15.803  -3.604  -4.859  1.00 0.00 ? 37  THR A CG2  8  
ATOM   10436 H  H    . THR A 1 37 ? 16.748  -1.706  -3.321  1.00 0.00 ? 37  THR A H    8  
ATOM   10437 H  HA   . THR A 1 37 ? 18.560  -3.777  -2.740  1.00 0.00 ? 37  THR A HA   8  
ATOM   10438 H  HB   . THR A 1 37 ? 16.259  -4.336  -2.898  1.00 0.00 ? 37  THR A HB   8  
ATOM   10439 H  HG1  . THR A 1 37 ? 17.071  -6.169  -3.548  1.00 0.00 ? 37  THR A HG1  8  
ATOM   10440 H  HG21 . THR A 1 37 ? 14.925  -4.233  -4.959  1.00 0.00 ? 37  THR A HG21 8  
ATOM   10441 H  HG22 . THR A 1 37 ? 16.285  -3.513  -5.823  1.00 0.00 ? 37  THR A HG22 8  
ATOM   10442 H  HG23 . THR A 1 37 ? 15.503  -2.625  -4.513  1.00 0.00 ? 37  THR A HG23 8  
ATOM   10443 N  N    . GLY A 1 38 ? 18.685  -2.800  -5.919  1.00 0.00 ? 38  GLY A N    8  
ATOM   10444 C  CA   . GLY A 1 38 ? 19.314  -3.094  -7.207  1.00 0.00 ? 38  GLY A CA   8  
ATOM   10445 C  C    . GLY A 1 38 ? 18.623  -4.230  -7.953  1.00 0.00 ? 38  GLY A C    8  
ATOM   10446 O  O    . GLY A 1 38 ? 18.616  -4.245  -9.184  1.00 0.00 ? 38  GLY A O    8  
ATOM   10447 H  H    . GLY A 1 38 ? 18.054  -2.047  -5.879  1.00 0.00 ? 38  GLY A H    8  
ATOM   10448 H  HA2  . GLY A 1 38 ? 19.277  -2.202  -7.815  1.00 0.00 ? 38  GLY A HA2  8  
ATOM   10449 H  HA3  . GLY A 1 38 ? 20.356  -3.362  -7.055  1.00 0.00 ? 38  GLY A HA3  8  
ATOM   10450 N  N    . GLU A 1 39 ? 18.044  -5.196  -7.212  1.00 0.00 ? 39  GLU A N    8  
ATOM   10451 C  CA   . GLU A 1 39 ? 17.212  -6.265  -7.775  1.00 0.00 ? 39  GLU A CA   8  
ATOM   10452 C  C    . GLU A 1 39 ? 15.763  -6.041  -7.329  1.00 0.00 ? 39  GLU A C    8  
ATOM   10453 O  O    . GLU A 1 39 ? 15.285  -6.644  -6.351  1.00 0.00 ? 39  GLU A O    8  
ATOM   10454 C  CB   . GLU A 1 39 ? 17.737  -7.650  -7.326  1.00 0.00 ? 39  GLU A CB   8  
ATOM   10455 C  CG   . GLU A 1 39 ? 19.195  -7.958  -7.726  1.00 0.00 ? 39  GLU A CG   8  
ATOM   10456 C  CD   . GLU A 1 39 ? 19.449  -7.955  -9.248  1.00 0.00 ? 39  GLU A CD   8  
ATOM   10457 O  OE1  . GLU A 1 39 ? 19.082  -8.944  -9.921  1.00 0.00 ? 39  GLU A OE1  8  
ATOM   10458 O  OE2  . GLU A 1 39 ? 20.021  -6.977  -9.780  1.00 0.00 ? 39  GLU A OE2  8  
ATOM   10459 H  H    . GLU A 1 39 ? 18.194  -5.216  -6.254  1.00 0.00 ? 39  GLU A H    8  
ATOM   10460 H  HA   . GLU A 1 39 ? 17.252  -6.204  -8.864  1.00 0.00 ? 39  GLU A HA   8  
ATOM   10461 H  HB2  . GLU A 1 39 ? 17.674  -7.710  -6.242  1.00 0.00 ? 39  GLU A HB2  8  
ATOM   10462 H  HB3  . GLU A 1 39 ? 17.098  -8.414  -7.750  1.00 0.00 ? 39  GLU A HB3  8  
ATOM   10463 H  HG2  . GLU A 1 39 ? 19.845  -7.224  -7.258  1.00 0.00 ? 39  GLU A HG2  8  
ATOM   10464 H  HG3  . GLU A 1 39 ? 19.451  -8.938  -7.340  1.00 0.00 ? 39  GLU A HG3  8  
ATOM   10465 N  N    . LYS A 1 40 ? 15.108  -5.102  -8.022  1.00 0.00 ? 40  LYS A N    8  
ATOM   10466 C  CA   . LYS A 1 40 ? 13.743  -4.640  -7.693  1.00 0.00 ? 40  LYS A CA   8  
ATOM   10467 C  C    . LYS A 1 40 ? 12.760  -5.830  -7.717  1.00 0.00 ? 40  LYS A C    8  
ATOM   10468 O  O    . LYS A 1 40 ? 12.667  -6.503  -8.752  1.00 0.00 ? 40  LYS A O    8  
ATOM   10469 C  CB   . LYS A 1 40 ? 13.295  -3.546  -8.691  1.00 0.00 ? 40  LYS A CB   8  
ATOM   10470 C  CG   . LYS A 1 40 ? 14.262  -2.347  -8.804  1.00 0.00 ? 40  LYS A CG   8  
ATOM   10471 C  CD   . LYS A 1 40 ? 13.749  -1.269  -9.783  1.00 0.00 ? 40  LYS A CD   8  
ATOM   10472 C  CE   . LYS A 1 40 ? 14.736  -0.108  -9.947  1.00 0.00 ? 40  LYS A CE   8  
ATOM   10473 N  NZ   . LYS A 1 40 ? 15.969  -0.523  -10.659 1.00 0.00 ? 40  LYS A NZ   8  
ATOM   10474 H  H    . LYS A 1 40 ? 15.573  -4.726  -8.791  1.00 0.00 ? 40  LYS A H    8  
ATOM   10475 H  HA   . LYS A 1 40 ? 13.779  -4.212  -6.695  1.00 0.00 ? 40  LYS A HA   8  
ATOM   10476 H  HB2  . LYS A 1 40 ? 13.199  -3.994  -9.674  1.00 0.00 ? 40  LYS A HB2  8  
ATOM   10477 H  HB3  . LYS A 1 40 ? 12.322  -3.173  -8.381  1.00 0.00 ? 40  LYS A HB3  8  
ATOM   10478 H  HG2  . LYS A 1 40 ? 14.381  -1.900  -7.824  1.00 0.00 ? 40  LYS A HG2  8  
ATOM   10479 H  HG3  . LYS A 1 40 ? 15.229  -2.707  -9.152  1.00 0.00 ? 40  LYS A HG3  8  
ATOM   10480 H  HD2  . LYS A 1 40 ? 13.585  -1.725  -10.755 1.00 0.00 ? 40  LYS A HD2  8  
ATOM   10481 H  HD3  . LYS A 1 40 ? 12.801  -0.879  -9.415  1.00 0.00 ? 40  LYS A HD3  8  
ATOM   10482 H  HE2  . LYS A 1 40 ? 14.263  0.687   -10.507 1.00 0.00 ? 40  LYS A HE2  8  
ATOM   10483 H  HE3  . LYS A 1 40 ? 15.011  0.267   -8.967  1.00 0.00 ? 40  LYS A HE3  8  
ATOM   10484 H  HZ1  . LYS A 1 40 ? 16.476  -1.243  -10.110 1.00 0.00 ? 40  LYS A HZ1  8  
ATOM   10485 H  HZ2  . LYS A 1 40 ? 16.595  0.293   -10.796 1.00 0.00 ? 40  LYS A HZ2  8  
ATOM   10486 H  HZ3  . LYS A 1 40 ? 15.726  -0.919  -11.589 1.00 0.00 ? 40  LYS A HZ3  8  
ATOM   10487 N  N    . PRO A 1 41 ? 12.036  -6.126  -6.579  1.00 0.00 ? 41  PRO A N    8  
ATOM   10488 C  CA   . PRO A 1 41 ? 11.194  -7.342  -6.457  1.00 0.00 ? 41  PRO A CA   8  
ATOM   10489 C  C    . PRO A 1 41 ? 10.021  -7.343  -7.479  1.00 0.00 ? 41  PRO A C    8  
ATOM   10490 O  O    . PRO A 1 41 ? 10.167  -7.872  -8.590  1.00 0.00 ? 41  PRO A O    8  
ATOM   10491 C  CB   . PRO A 1 41 ? 10.727  -7.317  -4.965  1.00 0.00 ? 41  PRO A CB   8  
ATOM   10492 C  CG   . PRO A 1 41 ? 10.806  -5.869  -4.565  1.00 0.00 ? 41  PRO A CG   8  
ATOM   10493 C  CD   . PRO A 1 41 ? 11.974  -5.290  -5.341  1.00 0.00 ? 41  PRO A CD   8  
ATOM   10494 H  HA   . PRO A 1 41 ? 11.792  -8.235  -6.629  1.00 0.00 ? 41  PRO A HA   8  
ATOM   10495 H  HB2  . PRO A 1 41 ? 9.716   -7.705  -4.878  1.00 0.00 ? 41  PRO A HB2  8  
ATOM   10496 H  HB3  . PRO A 1 41 ? 11.391  -7.928  -4.360  1.00 0.00 ? 41  PRO A HB3  8  
ATOM   10497 H  HG2  . PRO A 1 41 ? 9.881   -5.359  -4.831  1.00 0.00 ? 41  PRO A HG2  8  
ATOM   10498 H  HG3  . PRO A 1 41 ? 10.978  -5.782  -3.497  1.00 0.00 ? 41  PRO A HG3  8  
ATOM   10499 H  HD2  . PRO A 1 41 ? 11.789  -4.250  -5.588  1.00 0.00 ? 41  PRO A HD2  8  
ATOM   10500 H  HD3  . PRO A 1 41 ? 12.898  -5.376  -4.774  1.00 0.00 ? 41  PRO A HD3  8  
ATOM   10501 N  N    . LEU A 1 42 ? 8.890   -6.718  -7.120  1.00 0.00 ? 42  LEU A N    8  
ATOM   10502 C  CA   . LEU A 1 42 ? 7.700   -6.614  -7.971  1.00 0.00 ? 42  LEU A CA   8  
ATOM   10503 C  C    . LEU A 1 42 ? 7.053   -5.260  -7.693  1.00 0.00 ? 42  LEU A C    8  
ATOM   10504 O  O    . LEU A 1 42 ? 6.389   -5.092  -6.676  1.00 0.00 ? 42  LEU A O    8  
ATOM   10505 C  CB   . LEU A 1 42 ? 6.715   -7.780  -7.661  1.00 0.00 ? 42  LEU A CB   8  
ATOM   10506 C  CG   . LEU A 1 42 ? 7.190   -9.218  -8.060  1.00 0.00 ? 42  LEU A CG   8  
ATOM   10507 C  CD1  . LEU A 1 42 ? 6.256   -10.310 -7.506  1.00 0.00 ? 42  LEU A CD1  8  
ATOM   10508 C  CD2  . LEU A 1 42 ? 7.347   -9.340  -9.592  1.00 0.00 ? 42  LEU A CD2  8  
ATOM   10509 H  H    . LEU A 1 42 ? 8.844   -6.312  -6.232  1.00 0.00 ? 42  LEU A H    8  
ATOM   10510 H  HA   . LEU A 1 42 ? 8.002   -6.658  -9.016  1.00 0.00 ? 42  LEU A HA   8  
ATOM   10511 H  HB2  . LEU A 1 42 ? 6.513   -7.765  -6.594  1.00 0.00 ? 42  LEU A HB2  8  
ATOM   10512 H  HB3  . LEU A 1 42 ? 5.784   -7.578  -8.176  1.00 0.00 ? 42  LEU A HB3  8  
ATOM   10513 H  HG   . LEU A 1 42 ? 8.167   -9.393  -7.624  1.00 0.00 ? 42  LEU A HG   8  
ATOM   10514 H  HD11 . LEU A 1 42 ? 6.622   -11.285 -7.798  1.00 0.00 ? 42  LEU A HD11 8  
ATOM   10515 H  HD12 . LEU A 1 42 ? 5.253   -10.174 -7.893  1.00 0.00 ? 42  LEU A HD12 8  
ATOM   10516 H  HD13 . LEU A 1 42 ? 6.230   -10.252 -6.426  1.00 0.00 ? 42  LEU A HD13 8  
ATOM   10517 H  HD21 . LEU A 1 42 ? 7.707   -10.328 -9.844  1.00 0.00 ? 42  LEU A HD21 8  
ATOM   10518 H  HD22 . LEU A 1 42 ? 8.061   -8.606  -9.942  1.00 0.00 ? 42  LEU A HD22 8  
ATOM   10519 H  HD23 . LEU A 1 42 ? 6.392   -9.170  -10.077 1.00 0.00 ? 42  LEU A HD23 8  
ATOM   10520 N  N    . GLN A 1 43 ? 7.287   -4.289  -8.575  1.00 0.00 ? 43  GLN A N    8  
ATOM   10521 C  CA   . GLN A 1 43 ? 6.799   -2.918  -8.412  1.00 0.00 ? 43  GLN A CA   8  
ATOM   10522 C  C    . GLN A 1 43 ? 6.375   -2.356  -9.769  1.00 0.00 ? 43  GLN A C    8  
ATOM   10523 O  O    . GLN A 1 43 ? 7.137   -2.411  -10.744 1.00 0.00 ? 43  GLN A O    8  
ATOM   10524 C  CB   . GLN A 1 43 ? 7.895   -2.044  -7.755  1.00 0.00 ? 43  GLN A CB   8  
ATOM   10525 C  CG   . GLN A 1 43 ? 7.534   -0.547  -7.604  1.00 0.00 ? 43  GLN A CG   8  
ATOM   10526 C  CD   . GLN A 1 43 ? 8.603   0.268   -6.873  1.00 0.00 ? 43  GLN A CD   8  
ATOM   10527 O  OE1  . GLN A 1 43 ? 9.254   -0.222  -5.955  1.00 0.00 ? 43  GLN A OE1  8  
ATOM   10528 N  NE2  . GLN A 1 43 ? 8.825   1.506   -7.306  1.00 0.00 ? 43  GLN A NE2  8  
ATOM   10529 H  H    . GLN A 1 43 ? 7.805   -4.497  -9.377  1.00 0.00 ? 43  GLN A H    8  
ATOM   10530 H  HA   . GLN A 1 43 ? 5.926   -2.939  -7.751  1.00 0.00 ? 43  GLN A HA   8  
ATOM   10531 H  HB2  . GLN A 1 43 ? 8.096   -2.447  -6.768  1.00 0.00 ? 43  GLN A HB2  8  
ATOM   10532 H  HB3  . GLN A 1 43 ? 8.799   -2.123  -8.349  1.00 0.00 ? 43  GLN A HB3  8  
ATOM   10533 H  HG2  . GLN A 1 43 ? 7.379   -0.120  -8.589  1.00 0.00 ? 43  GLN A HG2  8  
ATOM   10534 H  HG3  . GLN A 1 43 ? 6.611   -0.472  -7.042  1.00 0.00 ? 43  GLN A HG3  8  
ATOM   10535 H  HE21 . GLN A 1 43 ? 8.301   1.834   -8.071  1.00 0.00 ? 43  GLN A HE21 8  
ATOM   10536 H  HE22 . GLN A 1 43 ? 9.504   2.044   -6.845  1.00 0.00 ? 43  GLN A HE22 8  
ATOM   10537 N  N    . CYS A 1 44 ? 5.137   -1.857  -9.809  1.00 0.00 ? 44  CYS A N    8  
ATOM   10538 C  CA   . CYS A 1 44 ? 4.505   -1.280  -10.997 1.00 0.00 ? 44  CYS A CA   8  
ATOM   10539 C  C    . CYS A 1 44 ? 5.233   -0.003  -11.452 1.00 0.00 ? 44  CYS A C    8  
ATOM   10540 O  O    . CYS A 1 44 ? 5.145   1.041   -10.791 1.00 0.00 ? 44  CYS A O    8  
ATOM   10541 C  CB   . CYS A 1 44 ? 3.030   -0.978  -10.679 1.00 0.00 ? 44  CYS A CB   8  
ATOM   10542 S  SG   . CYS A 1 44 ? 2.115   -0.053  -11.952 1.00 0.00 ? 44  CYS A SG   8  
ATOM   10543 H  H    . CYS A 1 44 ? 4.615   -1.885  -8.986  1.00 0.00 ? 44  CYS A H    8  
ATOM   10544 H  HA   . CYS A 1 44 ? 4.544   -2.030  -11.788 1.00 0.00 ? 44  CYS A HA   8  
ATOM   10545 H  HB2  . CYS A 1 44 ? 2.502   -1.910  -10.518 1.00 0.00 ? 44  CYS A HB2  8  
ATOM   10546 H  HB3  . CYS A 1 44 ? 2.981   -0.386  -9.772  1.00 0.00 ? 44  CYS A HB3  8  
ATOM   10547 N  N    . GLU A 1 45 ? 5.931   -0.108  -12.597 1.00 0.00 ? 45  GLU A N    8  
ATOM   10548 C  CA   . GLU A 1 45 ? 6.742   0.979   -13.195 1.00 0.00 ? 45  GLU A CA   8  
ATOM   10549 C  C    . GLU A 1 45 ? 5.857   1.860   -14.113 1.00 0.00 ? 45  GLU A C    8  
ATOM   10550 O  O    . GLU A 1 45 ? 6.193   2.176   -15.260 1.00 0.00 ? 45  GLU A O    8  
ATOM   10551 C  CB   . GLU A 1 45 ? 7.952   0.338   -13.950 1.00 0.00 ? 45  GLU A CB   8  
ATOM   10552 C  CG   . GLU A 1 45 ? 8.989   1.331   -14.534 1.00 0.00 ? 45  GLU A CG   8  
ATOM   10553 C  CD   . GLU A 1 45 ? 9.560   2.311   -13.496 1.00 0.00 ? 45  GLU A CD   8  
ATOM   10554 O  OE1  . GLU A 1 45 ? 10.486  1.923   -12.756 1.00 0.00 ? 45  GLU A OE1  8  
ATOM   10555 O  OE2  . GLU A 1 45 ? 9.083   3.469   -13.408 1.00 0.00 ? 45  GLU A OE2  8  
ATOM   10556 H  H    . GLU A 1 45 ? 5.891   -0.957  -13.077 1.00 0.00 ? 45  GLU A H    8  
ATOM   10557 H  HA   . GLU A 1 45 ? 7.122   1.600   -12.383 1.00 0.00 ? 45  GLU A HA   8  
ATOM   10558 H  HB2  . GLU A 1 45 ? 8.474   -0.322  -13.266 1.00 0.00 ? 45  GLU A HB2  8  
ATOM   10559 H  HB3  . GLU A 1 45 ? 7.565   -0.261  -14.767 1.00 0.00 ? 45  GLU A HB3  8  
ATOM   10560 H  HG2  . GLU A 1 45 ? 9.806   0.763   -14.967 1.00 0.00 ? 45  GLU A HG2  8  
ATOM   10561 H  HG3  . GLU A 1 45 ? 8.510   1.899   -15.327 1.00 0.00 ? 45  GLU A HG3  8  
ATOM   10562 N  N    . ILE A 1 46 ? 4.705   2.271   -13.564 1.00 0.00 ? 46  ILE A N    8  
ATOM   10563 C  CA   . ILE A 1 46 ? 3.677   3.094   -14.238 1.00 0.00 ? 46  ILE A CA   8  
ATOM   10564 C  C    . ILE A 1 46 ? 3.247   4.234   -13.253 1.00 0.00 ? 46  ILE A C    8  
ATOM   10565 O  O    . ILE A 1 46 ? 2.490   5.142   -13.592 1.00 0.00 ? 46  ILE A O    8  
ATOM   10566 C  CB   . ILE A 1 46 ? 2.410   2.235   -14.617 1.00 0.00 ? 46  ILE A CB   8  
ATOM   10567 C  CG1  . ILE A 1 46 ? 2.777   0.937   -15.405 1.00 0.00 ? 46  ILE A CG1  8  
ATOM   10568 C  CG2  . ILE A 1 46 ? 1.392   3.082   -15.419 1.00 0.00 ? 46  ILE A CG2  8  
ATOM   10569 C  CD1  . ILE A 1 46 ? 3.459   1.178   -16.745 1.00 0.00 ? 46  ILE A CD1  8  
ATOM   10570 H  H    . ILE A 1 46 ? 4.533   2.051   -12.635 1.00 0.00 ? 46  ILE A H    8  
ATOM   10571 H  HA   . ILE A 1 46 ? 4.106   3.534   -15.139 1.00 0.00 ? 46  ILE A HA   8  
ATOM   10572 H  HB   . ILE A 1 46 ? 1.938   1.947   -13.682 1.00 0.00 ? 46  ILE A HB   8  
ATOM   10573 H  HG12 . ILE A 1 46 ? 3.452   0.343   -14.807 1.00 0.00 ? 46  ILE A HG12 8  
ATOM   10574 H  HG13 . ILE A 1 46 ? 1.878   0.357   -15.592 1.00 0.00 ? 46  ILE A HG13 8  
ATOM   10575 H  HG21 . ILE A 1 46 ? 0.544   2.466   -15.709 1.00 0.00 ? 46  ILE A HG21 8  
ATOM   10576 H  HG22 . ILE A 1 46 ? 1.860   3.486   -16.306 1.00 0.00 ? 46  ILE A HG22 8  
ATOM   10577 H  HG23 . ILE A 1 46 ? 1.039   3.895   -14.797 1.00 0.00 ? 46  ILE A HG23 8  
ATOM   10578 H  HD11 . ILE A 1 46 ? 4.388   1.702   -16.578 1.00 0.00 ? 46  ILE A HD11 8  
ATOM   10579 H  HD12 . ILE A 1 46 ? 2.817   1.770   -17.382 1.00 0.00 ? 46  ILE A HD12 8  
ATOM   10580 H  HD13 . ILE A 1 46 ? 3.660   0.231   -17.220 1.00 0.00 ? 46  ILE A HD13 8  
ATOM   10581 N  N    . CYS A 1 47 ? 3.814   4.186   -12.037 1.00 0.00 ? 47  CYS A N    8  
ATOM   10582 C  CA   . CYS A 1 47 ? 3.363   4.930   -10.883 1.00 0.00 ? 47  CYS A CA   8  
ATOM   10583 C  C    . CYS A 1 47 ? 4.349   4.494   -9.793  1.00 0.00 ? 47  CYS A C    8  
ATOM   10584 O  O    . CYS A 1 47 ? 5.565   4.476   -10.039 1.00 0.00 ? 47  CYS A O    8  
ATOM   10585 C  CB   . CYS A 1 47 ? 1.852   4.630   -10.569 1.00 0.00 ? 47  CYS A CB   8  
ATOM   10586 S  SG   . CYS A 1 47 ? 1.507   3.018   -9.781  1.00 0.00 ? 47  CYS A SG   8  
ATOM   10587 H  H    . CYS A 1 47 ? 4.698   3.799   -11.965 1.00 0.00 ? 47  CYS A H    8  
ATOM   10588 H  HA   . CYS A 1 47 ? 3.501   5.994   -11.073 1.00 0.00 ? 47  CYS A HA   8  
ATOM   10589 H  HB2  . CYS A 1 47 ? 1.470   5.391   -9.905  1.00 0.00 ? 47  CYS A HB2  8  
ATOM   10590 H  HB3  . CYS A 1 47 ? 1.289   4.655   -11.491 1.00 0.00 ? 47  CYS A HB3  8  
ATOM   10591 N  N    . GLY A 1 48 ? 3.864   4.158   -8.628  1.00 0.00 ? 48  GLY A N    8  
ATOM   10592 C  CA   . GLY A 1 48 ? 4.611   3.365   -7.663  1.00 0.00 ? 48  GLY A CA   8  
ATOM   10593 C  C    . GLY A 1 48 ? 3.604   2.519   -6.889  1.00 0.00 ? 48  GLY A C    8  
ATOM   10594 O  O    . GLY A 1 48 ? 2.640   3.101   -6.381  1.00 0.00 ? 48  GLY A O    8  
ATOM   10595 H  H    . GLY A 1 48 ? 2.942   4.344   -8.428  1.00 0.00 ? 48  GLY A H    8  
ATOM   10596 H  HA2  . GLY A 1 48 ? 5.315   2.725   -8.199  1.00 0.00 ? 48  GLY A HA2  8  
ATOM   10597 H  HA3  . GLY A 1 48 ? 5.148   4.014   -6.983  1.00 0.00 ? 48  GLY A HA3  8  
ATOM   10598 N  N    . PHE A 1 49 ? 3.781   1.184   -6.744  1.00 0.00 ? 49  PHE A N    8  
ATOM   10599 C  CA   . PHE A 1 49 ? 2.756   0.288   -6.195  1.00 0.00 ? 49  PHE A CA   8  
ATOM   10600 C  C    . PHE A 1 49 ? 3.466   -1.065  -6.167  1.00 0.00 ? 49  PHE A C    8  
ATOM   10601 O  O    . PHE A 1 49 ? 3.779   -1.607  -7.231  1.00 0.00 ? 49  PHE A O    8  
ATOM   10602 C  CB   . PHE A 1 49 ? 1.483   0.250   -7.091  1.00 0.00 ? 49  PHE A CB   8  
ATOM   10603 C  CG   . PHE A 1 49 ? 0.327   -0.612  -6.561  1.00 0.00 ? 49  PHE A CG   8  
ATOM   10604 C  CD1  . PHE A 1 49 ? 0.335   -1.999  -6.713  1.00 0.00 ? 49  PHE A CD1  8  
ATOM   10605 C  CD2  . PHE A 1 49 ? -0.773  -0.031  -5.928  1.00 0.00 ? 49  PHE A CD2  8  
ATOM   10606 C  CE1  . PHE A 1 49 ? -0.709  -2.775  -6.253  1.00 0.00 ? 49  PHE A CE1  8  
ATOM   10607 C  CE2  . PHE A 1 49 ? -1.818  -0.807  -5.470  1.00 0.00 ? 49  PHE A CE2  8  
ATOM   10608 C  CZ   . PHE A 1 49 ? -1.788  -2.179  -5.629  1.00 0.00 ? 49  PHE A CZ   8  
ATOM   10609 H  H    . PHE A 1 49 ? 4.647   0.729   -6.820  1.00 0.00 ? 49  PHE A H    8  
ATOM   10610 H  HA   . PHE A 1 49 ? 2.510   0.605   -5.181  1.00 0.00 ? 49  PHE A HA   8  
ATOM   10611 H  HB2  . PHE A 1 49 ? 1.114   1.262   -7.211  1.00 0.00 ? 49  PHE A HB2  8  
ATOM   10612 H  HB3  . PHE A 1 49 ? 1.756   -0.127  -8.073  1.00 0.00 ? 49  PHE A HB3  8  
ATOM   10613 H  HD1  . PHE A 1 49 ? 1.183   -2.469  -7.203  1.00 0.00 ? 49  PHE A HD1  8  
ATOM   10614 H  HD2  . PHE A 1 49 ? -0.807  1.045   -5.799  1.00 0.00 ? 49  PHE A HD2  8  
ATOM   10615 H  HE1  . PHE A 1 49 ? -0.682  -3.850  -6.381  1.00 0.00 ? 49  PHE A HE1  8  
ATOM   10616 H  HE2  . PHE A 1 49 ? -2.665  -0.339  -4.983  1.00 0.00 ? 49  PHE A HE2  8  
ATOM   10617 H  HZ   . PHE A 1 49 ? -2.609  -2.784  -5.268  1.00 0.00 ? 49  PHE A HZ   8  
ATOM   10618 N  N    . THR A 1 50 ? 3.727   -1.606  -4.979  1.00 0.00 ? 50  THR A N    8  
ATOM   10619 C  CA   . THR A 1 50 ? 4.616   -2.753  -4.822  1.00 0.00 ? 50  THR A CA   8  
ATOM   10620 C  C    . THR A 1 50 ? 3.818   -3.949  -4.296  1.00 0.00 ? 50  THR A C    8  
ATOM   10621 O  O    . THR A 1 50 ? 2.938   -3.802  -3.441  1.00 0.00 ? 50  THR A O    8  
ATOM   10622 C  CB   . THR A 1 50 ? 5.790   -2.421  -3.855  1.00 0.00 ? 50  THR A CB   8  
ATOM   10623 O  OG1  . THR A 1 50 ? 6.317   -1.130  -4.203  1.00 0.00 ? 50  THR A OG1  8  
ATOM   10624 C  CG2  . THR A 1 50 ? 6.927   -3.467  -3.910  1.00 0.00 ? 50  THR A CG2  8  
ATOM   10625 H  H    . THR A 1 50 ? 3.299   -1.253  -4.185  1.00 0.00 ? 50  THR A H    8  
ATOM   10626 H  HA   . THR A 1 50 ? 5.041   -2.986  -5.803  1.00 0.00 ? 50  THR A HA   8  
ATOM   10627 H  HB   . THR A 1 50 ? 5.406   -2.383  -2.849  1.00 0.00 ? 50  THR A HB   8  
ATOM   10628 H  HG1  . THR A 1 50 ? 7.274   -1.185  -4.292  1.00 0.00 ? 50  THR A HG1  8  
ATOM   10629 H  HG21 . THR A 1 50 ? 7.722   -3.183  -3.230  1.00 0.00 ? 50  THR A HG21 8  
ATOM   10630 H  HG22 . THR A 1 50 ? 7.323   -3.515  -4.916  1.00 0.00 ? 50  THR A HG22 8  
ATOM   10631 H  HG23 . THR A 1 50 ? 6.544   -4.441  -3.634  1.00 0.00 ? 50  THR A HG23 8  
ATOM   10632 N  N    . CYS A 1 51 ? 4.145   -5.109  -4.821  1.00 0.00 ? 51  CYS A N    8  
ATOM   10633 C  CA   . CYS A 1 51 ? 3.444   -6.370  -4.555  1.00 0.00 ? 51  CYS A CA   8  
ATOM   10634 C  C    . CYS A 1 51 ? 4.442   -7.496  -4.243  1.00 0.00 ? 51  CYS A C    8  
ATOM   10635 O  O    . CYS A 1 51 ? 5.639   -7.386  -4.535  1.00 0.00 ? 51  CYS A O    8  
ATOM   10636 C  CB   . CYS A 1 51 ? 2.593   -6.727  -5.794  1.00 0.00 ? 51  CYS A CB   8  
ATOM   10637 S  SG   . CYS A 1 51 ? 1.408   -5.436  -6.263  1.00 0.00 ? 51  CYS A SG   8  
ATOM   10638 H  H    . CYS A 1 51 ? 4.875   -5.102  -5.449  1.00 0.00 ? 51  CYS A H    8  
ATOM   10639 H  HA   . CYS A 1 51 ? 2.786   -6.238  -3.700  1.00 0.00 ? 51  CYS A HA   8  
ATOM   10640 H  HB2  . CYS A 1 51 ? 3.243   -6.897  -6.643  1.00 0.00 ? 51  CYS A HB2  8  
ATOM   10641 H  HB3  . CYS A 1 51 ? 2.031   -7.635  -5.599  1.00 0.00 ? 51  CYS A HB3  8  
ATOM   10642 H  HG   . CYS A 1 51 ? 0.233   -5.759  -5.743  1.00 0.00 ? 51  CYS A HG   8  
ATOM   10643 N  N    . ARG A 1 52 ? 3.921   -8.561  -3.621  1.00 0.00 ? 52  ARG A N    8  
ATOM   10644 C  CA   . ARG A 1 52 ? 4.654   -9.821  -3.379  1.00 0.00 ? 52  ARG A CA   8  
ATOM   10645 C  C    . ARG A 1 52 ? 4.299   -10.838 -4.474  1.00 0.00 ? 52  ARG A C    8  
ATOM   10646 O  O    . ARG A 1 52 ? 5.114   -11.698 -4.830  1.00 0.00 ? 52  ARG A O    8  
ATOM   10647 C  CB   . ARG A 1 52 ? 4.290   -10.394 -1.983  1.00 0.00 ? 52  ARG A CB   8  
ATOM   10648 C  CG   . ARG A 1 52 ? 4.623   -9.450  -0.808  1.00 0.00 ? 52  ARG A CG   8  
ATOM   10649 C  CD   . ARG A 1 52 ? 4.235   -10.032 0.564   1.00 0.00 ? 52  ARG A CD   8  
ATOM   10650 N  NE   . ARG A 1 52 ? 4.598   -9.126  1.669   1.00 0.00 ? 52  ARG A NE   8  
ATOM   10651 C  CZ   . ARG A 1 52 ? 4.348   -9.351  2.962   1.00 0.00 ? 52  ARG A CZ   8  
ATOM   10652 N  NH1  . ARG A 1 52 ? 3.713   -10.441 3.355   1.00 0.00 ? 52  ARG A NH1  8  
ATOM   10653 N  NH2  . ARG A 1 52 ? 4.725   -8.463  3.850   1.00 0.00 ? 52  ARG A NH2  8  
ATOM   10654 H  H    . ARG A 1 52 ? 2.999   -8.503  -3.308  1.00 0.00 ? 52  ARG A H    8  
ATOM   10655 H  HA   . ARG A 1 52 ? 5.721   -9.620  -3.418  1.00 0.00 ? 52  ARG A HA   8  
ATOM   10656 H  HB2  . ARG A 1 52 ? 3.222   -10.604 -1.960  1.00 0.00 ? 52  ARG A HB2  8  
ATOM   10657 H  HB3  . ARG A 1 52 ? 4.826   -11.326 -1.834  1.00 0.00 ? 52  ARG A HB3  8  
ATOM   10658 H  HG2  . ARG A 1 52 ? 5.689   -9.257  -0.808  1.00 0.00 ? 52  ARG A HG2  8  
ATOM   10659 H  HG3  . ARG A 1 52 ? 4.096   -8.511  -0.952  1.00 0.00 ? 52  ARG A HG3  8  
ATOM   10660 H  HD2  . ARG A 1 52 ? 3.161   -10.191 0.588   1.00 0.00 ? 52  ARG A HD2  8  
ATOM   10661 H  HD3  . ARG A 1 52 ? 4.742   -10.978 0.708   1.00 0.00 ? 52  ARG A HD3  8  
ATOM   10662 H  HE   . ARG A 1 52 ? 5.057   -8.287  1.423   1.00 0.00 ? 52  ARG A HE   8  
ATOM   10663 H  HH11 . ARG A 1 52 ? 3.411   -11.120 2.681   1.00 0.00 ? 52  ARG A HH11 8  
ATOM   10664 H  HH12 . ARG A 1 52 ? 3.521   -10.593 4.329   1.00 0.00 ? 52  ARG A HH12 8  
ATOM   10665 H  HH21 . ARG A 1 52 ? 5.193   -7.627  3.556   1.00 0.00 ? 52  ARG A HH21 8  
ATOM   10666 H  HH22 . ARG A 1 52 ? 4.559   -8.620  4.824   1.00 0.00 ? 52  ARG A HH22 8  
ATOM   10667 N  N    . GLN A 1 53 ? 3.050   -10.745 -4.969  1.00 0.00 ? 53  GLN A N    8  
ATOM   10668 C  CA   . GLN A 1 53 ? 2.531   -11.580 -6.064  1.00 0.00 ? 53  GLN A CA   8  
ATOM   10669 C  C    . GLN A 1 53 ? 2.632   -10.826 -7.402  1.00 0.00 ? 53  GLN A C    8  
ATOM   10670 O  O    . GLN A 1 53 ? 2.240   -9.658  -7.495  1.00 0.00 ? 53  GLN A O    8  
ATOM   10671 C  CB   . GLN A 1 53 ? 1.059   -11.985 -5.771  1.00 0.00 ? 53  GLN A CB   8  
ATOM   10672 C  CG   . GLN A 1 53 ? 0.863   -12.761 -4.450  1.00 0.00 ? 53  GLN A CG   8  
ATOM   10673 C  CD   . GLN A 1 53 ? -0.593  -13.170 -4.204  1.00 0.00 ? 53  GLN A CD   8  
ATOM   10674 O  OE1  . GLN A 1 53 ? -1.367  -12.424 -3.603  1.00 0.00 ? 53  GLN A OE1  8  
ATOM   10675 N  NE2  . GLN A 1 53 ? -0.973  -14.349 -4.675  1.00 0.00 ? 53  GLN A NE2  8  
ATOM   10676 H  H    . GLN A 1 53 ? 2.445   -10.092 -4.566  1.00 0.00 ? 53  GLN A H    8  
ATOM   10677 H  HA   . GLN A 1 53 ? 3.136   -12.485 -6.123  1.00 0.00 ? 53  GLN A HA   8  
ATOM   10678 H  HB2  . GLN A 1 53 ? 0.449   -11.085 -5.725  1.00 0.00 ? 53  GLN A HB2  8  
ATOM   10679 H  HB3  . GLN A 1 53 ? 0.697   -12.607 -6.588  1.00 0.00 ? 53  GLN A HB3  8  
ATOM   10680 H  HG2  . GLN A 1 53 ? 1.478   -13.655 -4.470  1.00 0.00 ? 53  GLN A HG2  8  
ATOM   10681 H  HG3  . GLN A 1 53 ? 1.189   -12.132 -3.626  1.00 0.00 ? 53  GLN A HG3  8  
ATOM   10682 H  HE21 . GLN A 1 53 ? -0.309  -14.892 -5.149  1.00 0.00 ? 53  GLN A HE21 8  
ATOM   10683 H  HE22 . GLN A 1 53 ? -1.903  -14.628 -4.534  1.00 0.00 ? 53  GLN A HE22 8  
ATOM   10684 N  N    . LYS A 1 54 ? 3.193   -11.506 -8.416  1.00 0.00 ? 54  LYS A N    8  
ATOM   10685 C  CA   . LYS A 1 54 ? 3.328   -10.994 -9.796  1.00 0.00 ? 54  LYS A CA   8  
ATOM   10686 C  C    . LYS A 1 54 ? 1.954   -10.617 -10.395 1.00 0.00 ? 54  LYS A C    8  
ATOM   10687 O  O    . LYS A 1 54 ? 1.808   -9.567  -11.017 1.00 0.00 ? 54  LYS A O    8  
ATOM   10688 C  CB   . LYS A 1 54 ? 4.049   -12.061 -10.655 1.00 0.00 ? 54  LYS A CB   8  
ATOM   10689 C  CG   . LYS A 1 54 ? 4.197   -11.734 -12.157 1.00 0.00 ? 54  LYS A CG   8  
ATOM   10690 C  CD   . LYS A 1 54 ? 4.921   -12.868 -12.917 1.00 0.00 ? 54  LYS A CD   8  
ATOM   10691 C  CE   . LYS A 1 54 ? 4.946   -12.654 -14.435 1.00 0.00 ? 54  LYS A CE   8  
ATOM   10692 N  NZ   . LYS A 1 54 ? 3.590   -12.729 -15.031 1.00 0.00 ? 54  LYS A NZ   8  
ATOM   10693 H  H    . LYS A 1 54 ? 3.554   -12.394 -8.219  1.00 0.00 ? 54  LYS A H    8  
ATOM   10694 H  HA   . LYS A 1 54 ? 3.946   -10.101 -9.757  1.00 0.00 ? 54  LYS A HA   8  
ATOM   10695 H  HB2  . LYS A 1 54 ? 5.044   -12.213 -10.247 1.00 0.00 ? 54  LYS A HB2  8  
ATOM   10696 H  HB3  . LYS A 1 54 ? 3.501   -12.995 -10.570 1.00 0.00 ? 54  LYS A HB3  8  
ATOM   10697 H  HG2  . LYS A 1 54 ? 3.208   -11.596 -12.586 1.00 0.00 ? 54  LYS A HG2  8  
ATOM   10698 H  HG3  . LYS A 1 54 ? 4.765   -10.813 -12.266 1.00 0.00 ? 54  LYS A HG3  8  
ATOM   10699 H  HD2  . LYS A 1 54 ? 5.943   -12.935 -12.557 1.00 0.00 ? 54  LYS A HD2  8  
ATOM   10700 H  HD3  . LYS A 1 54 ? 4.412   -13.808 -12.705 1.00 0.00 ? 54  LYS A HD3  8  
ATOM   10701 H  HE2  . LYS A 1 54 ? 5.366   -11.678 -14.653 1.00 0.00 ? 54  LYS A HE2  8  
ATOM   10702 H  HE3  . LYS A 1 54 ? 5.566   -13.417 -14.887 1.00 0.00 ? 54  LYS A HE3  8  
ATOM   10703 H  HZ1  . LYS A 1 54 ? 3.132   -13.626 -14.770 1.00 0.00 ? 54  LYS A HZ1  8  
ATOM   10704 H  HZ2  . LYS A 1 54 ? 3.646   -12.673 -16.065 1.00 0.00 ? 54  LYS A HZ2  8  
ATOM   10705 H  HZ3  . LYS A 1 54 ? 3.000   -11.942 -14.687 1.00 0.00 ? 54  LYS A HZ3  8  
ATOM   10706 N  N    . ALA A 1 55 ? 0.973   -11.497 -10.176 1.00 0.00 ? 55  ALA A N    8  
ATOM   10707 C  CA   . ALA A 1 55 ? -0.430  -11.285 -10.595 1.00 0.00 ? 55  ALA A CA   8  
ATOM   10708 C  C    . ALA A 1 55 ? -1.019  -9.952  -10.056 1.00 0.00 ? 55  ALA A C    8  
ATOM   10709 O  O    . ALA A 1 55 ? -1.717  -9.239  -10.779 1.00 0.00 ? 55  ALA A O    8  
ATOM   10710 C  CB   . ALA A 1 55 ? -1.283  -12.474 -10.144 1.00 0.00 ? 55  ALA A CB   8  
ATOM   10711 H  H    . ALA A 1 55 ? 1.224   -12.345 -9.753  1.00 0.00 ? 55  ALA A H    8  
ATOM   10712 H  HA   . ALA A 1 55 ? -0.442  -11.256 -11.682 1.00 0.00 ? 55  ALA A HA   8  
ATOM   10713 H  HB1  . ALA A 1 55 ? -0.870  -13.391 -10.546 1.00 0.00 ? 55  ALA A HB1  8  
ATOM   10714 H  HB2  . ALA A 1 55 ? -2.300  -12.356 -10.503 1.00 0.00 ? 55  ALA A HB2  8  
ATOM   10715 H  HB3  . ALA A 1 55 ? -1.289  -12.528 -9.064  1.00 0.00 ? 55  ALA A HB3  8  
ATOM   10716 N  N    . SER A 1 56 ? -0.693  -9.634  -8.793  1.00 0.00 ? 56  SER A N    8  
ATOM   10717 C  CA   . SER A 1 56 ? -1.236  -8.460  -8.075  1.00 0.00 ? 56  SER A CA   8  
ATOM   10718 C  C    . SER A 1 56 ? -0.959  -7.129  -8.827  1.00 0.00 ? 56  SER A C    8  
ATOM   10719 O  O    . SER A 1 56 ? -1.903  -6.399  -9.148  1.00 0.00 ? 56  SER A O    8  
ATOM   10720 C  CB   . SER A 1 56 ? -0.650  -8.429  -6.650  1.00 0.00 ? 56  SER A CB   8  
ATOM   10721 O  OG   . SER A 1 56 ? -1.176  -7.367  -5.863  1.00 0.00 ? 56  SER A OG   8  
ATOM   10722 H  H    . SER A 1 56 ? -0.092  -10.246 -8.323  1.00 0.00 ? 56  SER A H    8  
ATOM   10723 H  HA   . SER A 1 56 ? -2.309  -8.595  -8.000  1.00 0.00 ? 56  SER A HA   8  
ATOM   10724 H  HB2  . SER A 1 56 ? -0.875  -9.362  -6.153  1.00 0.00 ? 56  SER A HB2  8  
ATOM   10725 H  HB3  . SER A 1 56 ? 0.426   -8.314  -6.711  1.00 0.00 ? 56  SER A HB3  8  
ATOM   10726 H  HG   . SER A 1 56 ? -2.127  -7.294  -6.011  1.00 0.00 ? 56  SER A HG   8  
ATOM   10727 N  N    . LEU A 1 57 ? 0.326   -6.835  -9.138  1.00 0.00 ? 57  LEU A N    8  
ATOM   10728 C  CA   . LEU A 1 57 ? 0.690   -5.618  -9.896  1.00 0.00 ? 57  LEU A CA   8  
ATOM   10729 C  C    . LEU A 1 57 ? 0.364   -5.763  -11.398 1.00 0.00 ? 57  LEU A C    8  
ATOM   10730 O  O    . LEU A 1 57 ? 0.173   -4.752  -12.074 1.00 0.00 ? 57  LEU A O    8  
ATOM   10731 C  CB   . LEU A 1 57 ? 2.176   -5.191  -9.713  1.00 0.00 ? 57  LEU A CB   8  
ATOM   10732 C  CG   . LEU A 1 57 ? 3.279   -6.104  -10.361 1.00 0.00 ? 57  LEU A CG   8  
ATOM   10733 C  CD1  . LEU A 1 57 ? 4.587   -5.325  -10.592 1.00 0.00 ? 57  LEU A CD1  8  
ATOM   10734 C  CD2  . LEU A 1 57 ? 3.550   -7.356  -9.506  1.00 0.00 ? 57  LEU A CD2  8  
ATOM   10735 H  H    . LEU A 1 57 ? 1.027   -7.440  -8.853  1.00 0.00 ? 57  LEU A H    8  
ATOM   10736 H  HA   . LEU A 1 57 ? 0.065   -4.813  -9.503  1.00 0.00 ? 57  LEU A HA   8  
ATOM   10737 H  HB2  . LEU A 1 57 ? 2.276   -4.195  -10.127 1.00 0.00 ? 57  LEU A HB2  8  
ATOM   10738 H  HB3  . LEU A 1 57 ? 2.378   -5.118  -8.648  1.00 0.00 ? 57  LEU A HB3  8  
ATOM   10739 H  HG   . LEU A 1 57 ? 2.933   -6.438  -11.333 1.00 0.00 ? 57  LEU A HG   8  
ATOM   10740 H  HD11 . LEU A 1 57 ? 4.390   -4.462  -11.218 1.00 0.00 ? 57  LEU A HD11 8  
ATOM   10741 H  HD12 . LEU A 1 57 ? 5.305   -5.960  -11.089 1.00 0.00 ? 57  LEU A HD12 8  
ATOM   10742 H  HD13 . LEU A 1 57 ? 4.994   -4.991  -9.644  1.00 0.00 ? 57  LEU A HD13 8  
ATOM   10743 H  HD21 . LEU A 1 57 ? 4.309   -7.967  -9.979  1.00 0.00 ? 57  LEU A HD21 8  
ATOM   10744 H  HD22 . LEU A 1 57 ? 2.640   -7.938  -9.416  1.00 0.00 ? 57  LEU A HD22 8  
ATOM   10745 H  HD23 . LEU A 1 57 ? 3.886   -7.067  -8.518  1.00 0.00 ? 57  LEU A HD23 8  
ATOM   10746 N  N    . ASN A 1 58 ? 0.377   -7.014  -11.919 1.00 0.00 ? 58  ASN A N    8  
ATOM   10747 C  CA   . ASN A 1 58 ? -0.014  -7.332  -13.323 1.00 0.00 ? 58  ASN A CA   8  
ATOM   10748 C  C    . ASN A 1 58 ? -1.455  -6.911  -13.648 1.00 0.00 ? 58  ASN A C    8  
ATOM   10749 O  O    . ASN A 1 58 ? -1.736  -6.424  -14.748 1.00 0.00 ? 58  ASN A O    8  
ATOM   10750 C  CB   . ASN A 1 58 ? 0.163   -8.850  -13.604 1.00 0.00 ? 58  ASN A CB   8  
ATOM   10751 C  CG   . ASN A 1 58 ? -0.378  -9.311  -14.969 1.00 0.00 ? 58  ASN A CG   8  
ATOM   10752 O  OD1  . ASN A 1 58 ? 0.332   -9.286  -15.967 1.00 0.00 ? 58  ASN A OD1  8  
ATOM   10753 N  ND2  . ASN A 1 58 ? -1.644  -9.726  -15.020 1.00 0.00 ? 58  ASN A ND2  8  
ATOM   10754 H  H    . ASN A 1 58 ? 0.728   -7.748  -11.374 1.00 0.00 ? 58  ASN A H    8  
ATOM   10755 H  HA   . ASN A 1 58 ? 0.654   -6.780  -13.966 1.00 0.00 ? 58  ASN A HA   8  
ATOM   10756 H  HB2  . ASN A 1 58 ? 1.219   -9.092  -13.561 1.00 0.00 ? 58  ASN A HB2  8  
ATOM   10757 H  HB3  . ASN A 1 58 ? -0.343  -9.415  -12.829 1.00 0.00 ? 58  ASN A HB3  8  
ATOM   10758 H  HD21 . ASN A 1 58 ? -2.169  -9.725  -14.193 1.00 0.00 ? 58  ASN A HD21 8  
ATOM   10759 H  HD22 . ASN A 1 58 ? -2.002  -10.013 -15.891 1.00 0.00 ? 58  ASN A HD22 8  
ATOM   10760 N  N    . TRP A 1 59 ? -2.367  -7.114  -12.699 1.00 0.00 ? 59  TRP A N    8  
ATOM   10761 C  CA   . TRP A 1 59 ? -3.784  -6.768  -12.887 1.00 0.00 ? 59  TRP A CA   8  
ATOM   10762 C  C    . TRP A 1 59 ? -3.950  -5.267  -12.670 1.00 0.00 ? 59  TRP A C    8  
ATOM   10763 O  O    . TRP A 1 59 ? -4.633  -4.591  -13.441 1.00 0.00 ? 59  TRP A O    8  
ATOM   10764 C  CB   . TRP A 1 59 ? -4.696  -7.604  -11.951 1.00 0.00 ? 59  TRP A CB   8  
ATOM   10765 C  CG   . TRP A 1 59 ? -4.927  -9.010  -12.463 1.00 0.00 ? 59  TRP A CG   8  
ATOM   10766 C  CD1  . TRP A 1 59 ? -4.366  -10.173 -12.014 1.00 0.00 ? 59  TRP A CD1  8  
ATOM   10767 C  CD2  . TRP A 1 59 ? -5.777  -9.376  -13.562 1.00 0.00 ? 59  TRP A CD2  8  
ATOM   10768 N  NE1  . TRP A 1 59 ? -4.829  -11.232 -12.751 1.00 0.00 ? 59  TRP A NE1  8  
ATOM   10769 C  CE2  . TRP A 1 59 ? -5.701  -10.770 -13.702 1.00 0.00 ? 59  TRP A CE2  8  
ATOM   10770 C  CE3  . TRP A 1 59 ? -6.614  -8.659  -14.425 1.00 0.00 ? 59  TRP A CE3  8  
ATOM   10771 C  CZ2  . TRP A 1 59 ? -6.413  -11.462 -14.679 1.00 0.00 ? 59  TRP A CZ2  8  
ATOM   10772 C  CZ3  . TRP A 1 59 ? -7.323  -9.347  -15.394 1.00 0.00 ? 59  TRP A CZ3  8  
ATOM   10773 C  CH2  . TRP A 1 59 ? -7.220  -10.737 -15.510 1.00 0.00 ? 59  TRP A CH2  8  
ATOM   10774 H  H    . TRP A 1 59 ? -2.070  -7.395  -11.812 1.00 0.00 ? 59  TRP A H    8  
ATOM   10775 H  HA   . TRP A 1 59 ? -4.046  -6.989  -13.923 1.00 0.00 ? 59  TRP A HA   8  
ATOM   10776 H  HB2  . TRP A 1 59 ? -4.242  -7.664  -10.968 1.00 0.00 ? 59  TRP A HB2  8  
ATOM   10777 H  HB3  . TRP A 1 59 ? -5.663  -7.124  -11.860 1.00 0.00 ? 59  TRP A HB3  8  
ATOM   10778 H  HD1  . TRP A 1 59 ? -3.662  -10.238 -11.196 1.00 0.00 ? 59  TRP A HD1  8  
ATOM   10779 H  HE1  . TRP A 1 59 ? -4.575  -12.172 -12.613 1.00 0.00 ? 59  TRP A HE1  8  
ATOM   10780 H  HE3  . TRP A 1 59 ? -6.704  -7.582  -14.350 1.00 0.00 ? 59  TRP A HE3  8  
ATOM   10781 H  HZ2  . TRP A 1 59 ? -6.345  -12.542 -14.776 1.00 0.00 ? 59  TRP A HZ2  8  
ATOM   10782 H  HZ3  . TRP A 1 59 ? -7.976  -8.804  -16.075 1.00 0.00 ? 59  TRP A HZ3  8  
ATOM   10783 H  HH2  . TRP A 1 59 ? -7.795  -11.238 -16.280 1.00 0.00 ? 59  TRP A HH2  8  
ATOM   10784 N  N    . HIS A 1 60 ? -3.334  -4.773  -11.589 1.00 0.00 ? 60  HIS A N    8  
ATOM   10785 C  CA   . HIS A 1 60 ? -3.152  -3.340  -11.332 1.00 0.00 ? 60  HIS A CA   8  
ATOM   10786 C  C    . HIS A 1 60 ? -2.591  -2.510  -12.539 1.00 0.00 ? 60  HIS A C    8  
ATOM   10787 O  O    . HIS A 1 60 ? -2.985  -1.350  -12.704 1.00 0.00 ? 60  HIS A O    8  
ATOM   10788 C  CB   . HIS A 1 60 ? -2.265  -3.183  -10.070 1.00 0.00 ? 60  HIS A CB   8  
ATOM   10789 C  CG   . HIS A 1 60 ? -1.805  -1.790  -9.813  1.00 0.00 ? 60  HIS A CG   8  
ATOM   10790 N  ND1  . HIS A 1 60 ? -2.625  -0.762  -9.458  1.00 0.00 ? 60  HIS A ND1  8  
ATOM   10791 C  CD2  . HIS A 1 60 ? -0.600  -1.261  -10.015 1.00 0.00 ? 60  HIS A CD2  8  
ATOM   10792 C  CE1  . HIS A 1 60 ? -1.896  0.350   -9.476  1.00 0.00 ? 60  HIS A CE1  8  
ATOM   10793 N  NE2  . HIS A 1 60 ? -0.637  0.106   -9.828  1.00 0.00 ? 60  HIS A NE2  8  
ATOM   10794 H  H    . HIS A 1 60 ? -3.138  -5.377  -10.838 1.00 0.00 ? 60  HIS A H    8  
ATOM   10795 H  HA   . HIS A 1 60 ? -4.135  -2.946  -11.095 1.00 0.00 ? 60  HIS A HA   8  
ATOM   10796 H  HB2  . HIS A 1 60 ? -2.810  -3.508  -9.203  1.00 0.00 ? 60  HIS A HB2  8  
ATOM   10797 H  HB3  . HIS A 1 60 ? -1.387  -3.811  -10.180 1.00 0.00 ? 60  HIS A HB3  8  
ATOM   10798 H  HD1  . HIS A 1 60 ? -3.577  -0.830  -9.216  1.00 0.00 ? 60  HIS A HD1  8  
ATOM   10799 H  HD2  . HIS A 1 60 ? 0.280   -1.821  -10.275 1.00 0.00 ? 60  HIS A HD2  8  
ATOM   10800 H  HE1  . HIS A 1 60 ? -2.282  1.327   -9.245  1.00 0.00 ? 60  HIS A HE1  8  
ATOM   10801 N  N    . MET A 1 61 ? -1.654  -3.052  -13.343 1.00 0.00 ? 61  MET A N    8  
ATOM   10802 C  CA   . MET A 1 61 ? -1.128  -2.308  -14.525 1.00 0.00 ? 61  MET A CA   8  
ATOM   10803 C  C    . MET A 1 61 ? -2.191  -2.239  -15.647 1.00 0.00 ? 61  MET A C    8  
ATOM   10804 O  O    . MET A 1 61 ? -2.292  -1.236  -16.358 1.00 0.00 ? 61  MET A O    8  
ATOM   10805 C  CB   . MET A 1 61 ? 0.253   -2.859  -15.018 1.00 0.00 ? 61  MET A CB   8  
ATOM   10806 C  CG   . MET A 1 61 ? 0.251   -4.201  -15.766 1.00 0.00 ? 61  MET A CG   8  
ATOM   10807 S  SD   . MET A 1 61 ? -0.454  -4.086  -17.430 1.00 0.00 ? 61  MET A SD   8  
ATOM   10808 C  CE   . MET A 1 61 ? -0.335  -5.774  -18.012 1.00 0.00 ? 61  MET A CE   8  
ATOM   10809 H  H    . MET A 1 61 ? -1.296  -3.937  -13.133 1.00 0.00 ? 61  MET A H    8  
ATOM   10810 H  HA   . MET A 1 61 ? -0.968  -1.286  -14.186 1.00 0.00 ? 61  MET A HA   8  
ATOM   10811 H  HB2  . MET A 1 61 ? 0.698   -2.126  -15.678 1.00 0.00 ? 61  MET A HB2  8  
ATOM   10812 H  HB3  . MET A 1 61 ? 0.898   -2.962  -14.150 1.00 0.00 ? 61  MET A HB3  8  
ATOM   10813 H  HG2  . MET A 1 61 ? 1.271   -4.556  -15.849 1.00 0.00 ? 61  MET A HG2  8  
ATOM   10814 H  HG3  . MET A 1 61 ? -0.328  -4.913  -15.195 1.00 0.00 ? 61  MET A HG3  8  
ATOM   10815 H  HE1  . MET A 1 61 ? -0.738  -5.837  -19.015 1.00 0.00 ? 61  MET A HE1  8  
ATOM   10816 H  HE2  . MET A 1 61 ? -0.900  -6.422  -17.356 1.00 0.00 ? 61  MET A HE2  8  
ATOM   10817 H  HE3  . MET A 1 61 ? 0.700   -6.083  -18.020 1.00 0.00 ? 61  MET A HE3  8  
ATOM   10818 N  N    . LYS A 1 62 ? -2.987  -3.318  -15.782 1.00 0.00 ? 62  LYS A N    8  
ATOM   10819 C  CA   . LYS A 1 62 ? -4.180  -3.339  -16.666 1.00 0.00 ? 62  LYS A CA   8  
ATOM   10820 C  C    . LYS A 1 62 ? -5.236  -2.301  -16.210 1.00 0.00 ? 62  LYS A C    8  
ATOM   10821 O  O    . LYS A 1 62 ? -5.996  -1.774  -17.030 1.00 0.00 ? 62  LYS A O    8  
ATOM   10822 C  CB   . LYS A 1 62 ? -4.809  -4.759  -16.691 1.00 0.00 ? 62  LYS A CB   8  
ATOM   10823 C  CG   . LYS A 1 62 ? -3.878  -5.868  -17.229 1.00 0.00 ? 62  LYS A CG   8  
ATOM   10824 C  CD   . LYS A 1 62 ? -4.542  -7.263  -17.238 1.00 0.00 ? 62  LYS A CD   8  
ATOM   10825 C  CE   . LYS A 1 62 ? -5.799  -7.320  -18.133 1.00 0.00 ? 62  LYS A CE   8  
ATOM   10826 N  NZ   . LYS A 1 62 ? -5.498  -7.038  -19.558 1.00 0.00 ? 62  LYS A NZ   8  
ATOM   10827 H  H    . LYS A 1 62 ? -2.724  -4.140  -15.318 1.00 0.00 ? 62  LYS A H    8  
ATOM   10828 H  HA   . LYS A 1 62 ? -3.851  -3.080  -17.668 1.00 0.00 ? 62  LYS A HA   8  
ATOM   10829 H  HB2  . LYS A 1 62 ? -5.098  -5.025  -15.680 1.00 0.00 ? 62  LYS A HB2  8  
ATOM   10830 H  HB3  . LYS A 1 62 ? -5.701  -4.734  -17.309 1.00 0.00 ? 62  LYS A HB3  8  
ATOM   10831 H  HG2  . LYS A 1 62 ? -3.581  -5.617  -18.242 1.00 0.00 ? 62  LYS A HG2  8  
ATOM   10832 H  HG3  . LYS A 1 62 ? -2.989  -5.908  -16.604 1.00 0.00 ? 62  LYS A HG3  8  
ATOM   10833 H  HD2  . LYS A 1 62 ? -3.823  -7.987  -17.606 1.00 0.00 ? 62  LYS A HD2  8  
ATOM   10834 H  HD3  . LYS A 1 62 ? -4.821  -7.528  -16.220 1.00 0.00 ? 62  LYS A HD3  8  
ATOM   10835 H  HE2  . LYS A 1 62 ? -6.231  -8.310  -18.068 1.00 0.00 ? 62  LYS A HE2  8  
ATOM   10836 H  HE3  . LYS A 1 62 ? -6.523  -6.597  -17.781 1.00 0.00 ? 62  LYS A HE3  8  
ATOM   10837 H  HZ1  . LYS A 1 62 ? -5.044  -6.109  -19.655 1.00 0.00 ? 62  LYS A HZ1  8  
ATOM   10838 H  HZ2  . LYS A 1 62 ? -6.373  -7.040  -20.119 1.00 0.00 ? 62  LYS A HZ2  8  
ATOM   10839 H  HZ3  . LYS A 1 62 ? -4.860  -7.764  -19.940 1.00 0.00 ? 62  LYS A HZ3  8  
ATOM   10840 N  N    . LYS A 1 63 ? -5.288  -2.056  -14.888 1.00 0.00 ? 63  LYS A N    8  
ATOM   10841 C  CA   . LYS A 1 63 ? -6.141  -0.994  -14.308 1.00 0.00 ? 63  LYS A CA   8  
ATOM   10842 C  C    . LYS A 1 63 ? -5.796  0.398   -14.878 1.00 0.00 ? 63  LYS A C    8  
ATOM   10843 O  O    . LYS A 1 63 ? -6.678  1.240   -14.987 1.00 0.00 ? 63  LYS A O    8  
ATOM   10844 C  CB   . LYS A 1 63 ? -6.108  -0.979  -12.759 1.00 0.00 ? 63  LYS A CB   8  
ATOM   10845 C  CG   . LYS A 1 63 ? -6.601  -2.287  -12.091 1.00 0.00 ? 63  LYS A CG   8  
ATOM   10846 C  CD   . LYS A 1 63 ? -8.028  -2.739  -12.512 1.00 0.00 ? 63  LYS A CD   8  
ATOM   10847 C  CE   . LYS A 1 63 ? -9.172  -1.881  -11.924 1.00 0.00 ? 63  LYS A CE   8  
ATOM   10848 N  NZ   . LYS A 1 63 ? -9.176  -0.480  -12.408 1.00 0.00 ? 63  LYS A NZ   8  
ATOM   10849 H  H    . LYS A 1 63 ? -4.784  -2.675  -14.316 1.00 0.00 ? 63  LYS A H    8  
ATOM   10850 H  HA   . LYS A 1 63 ? -7.160  -1.221  -14.619 1.00 0.00 ? 63  LYS A HA   8  
ATOM   10851 H  HB2  . LYS A 1 63 ? -5.088  -0.800  -12.439 1.00 0.00 ? 63  LYS A HB2  8  
ATOM   10852 H  HB3  . LYS A 1 63 ? -6.730  -0.163  -12.401 1.00 0.00 ? 63  LYS A HB3  8  
ATOM   10853 H  HG2  . LYS A 1 63 ? -5.909  -3.082  -12.352 1.00 0.00 ? 63  LYS A HG2  8  
ATOM   10854 H  HG3  . LYS A 1 63 ? -6.579  -2.152  -11.013 1.00 0.00 ? 63  LYS A HG3  8  
ATOM   10855 H  HD2  . LYS A 1 63 ? -8.103  -2.712  -13.594 1.00 0.00 ? 63  LYS A HD2  8  
ATOM   10856 H  HD3  . LYS A 1 63 ? -8.168  -3.764  -12.183 1.00 0.00 ? 63  LYS A HD3  8  
ATOM   10857 H  HE2  . LYS A 1 63 ? -10.118 -2.331  -12.191 1.00 0.00 ? 63  LYS A HE2  8  
ATOM   10858 H  HE3  . LYS A 1 63 ? -9.081  -1.872  -10.846 1.00 0.00 ? 63  LYS A HE3  8  
ATOM   10859 H  HZ1  . LYS A 1 63 ? -10.061 -0.015  -12.138 1.00 0.00 ? 63  LYS A HZ1  8  
ATOM   10860 H  HZ2  . LYS A 1 63 ? -9.090  -0.456  -13.444 1.00 0.00 ? 63  LYS A HZ2  8  
ATOM   10861 H  HZ3  . LYS A 1 63 ? -8.381  0.046   -11.994 1.00 0.00 ? 63  LYS A HZ3  8  
ATOM   10862 N  N    . HIS A 1 64 ? -4.515  0.623   -15.258 1.00 0.00 ? 64  HIS A N    8  
ATOM   10863 C  CA   . HIS A 1 64 ? -4.071  1.886   -15.912 1.00 0.00 ? 64  HIS A CA   8  
ATOM   10864 C  C    . HIS A 1 64 ? -4.472  1.931   -17.409 1.00 0.00 ? 64  HIS A C    8  
ATOM   10865 O  O    . HIS A 1 64 ? -4.365  2.982   -18.046 1.00 0.00 ? 64  HIS A O    8  
ATOM   10866 C  CB   . HIS A 1 64 ? -2.527  2.067   -15.818 1.00 0.00 ? 64  HIS A CB   8  
ATOM   10867 C  CG   . HIS A 1 64 ? -1.946  2.266   -14.445 1.00 0.00 ? 64  HIS A CG   8  
ATOM   10868 N  ND1  . HIS A 1 64 ? -1.935  3.476   -13.787 1.00 0.00 ? 64  HIS A ND1  8  
ATOM   10869 C  CD2  . HIS A 1 64 ? -1.216  1.422   -13.675 1.00 0.00 ? 64  HIS A CD2  8  
ATOM   10870 C  CE1  . HIS A 1 64 ? -1.200  3.334   -12.677 1.00 0.00 ? 64  HIS A CE1  8  
ATOM   10871 N  NE2  . HIS A 1 64 ? -0.736  2.108   -12.568 1.00 0.00 ? 64  HIS A NE2  8  
ATOM   10872 H  H    . HIS A 1 64 ? -3.845  -0.083  -15.124 1.00 0.00 ? 64  HIS A H    8  
ATOM   10873 H  HA   . HIS A 1 64 ? -4.559  2.722   -15.409 1.00 0.00 ? 64  HIS A HA   8  
ATOM   10874 H  HB2  . HIS A 1 64 ? -2.048  1.187   -16.234 1.00 0.00 ? 64  HIS A HB2  8  
ATOM   10875 H  HB3  . HIS A 1 64 ? -2.230  2.925   -16.419 1.00 0.00 ? 64  HIS A HB3  8  
ATOM   10876 H  HD1  . HIS A 1 64 ? -2.392  4.297   -14.079 1.00 0.00 ? 64  HIS A HD1  8  
ATOM   10877 H  HD2  . HIS A 1 64 ? -1.024  0.391   -13.884 1.00 0.00 ? 64  HIS A HD2  8  
ATOM   10878 H  HE1  . HIS A 1 64 ? -1.015  4.126   -11.962 1.00 0.00 ? 64  HIS A HE1  8  
ATOM   10879 N  N    . ASP A 1 65 ? -4.937  0.802   -17.966 1.00 0.00 ? 65  ASP A N    8  
ATOM   10880 C  CA   . ASP A 1 65 ? -5.184  0.672   -19.426 1.00 0.00 ? 65  ASP A CA   8  
ATOM   10881 C  C    . ASP A 1 65 ? -6.628  1.048   -19.769 1.00 0.00 ? 65  ASP A C    8  
ATOM   10882 O  O    . ASP A 1 65 ? -6.900  1.587   -20.847 1.00 0.00 ? 65  ASP A O    8  
ATOM   10883 C  CB   . ASP A 1 65 ? -4.884  -0.767  -19.907 1.00 0.00 ? 65  ASP A CB   8  
ATOM   10884 C  CG   . ASP A 1 65 ? -4.939  -0.930  -21.444 1.00 0.00 ? 65  ASP A CG   8  
ATOM   10885 O  OD1  . ASP A 1 65 ? -3.903  -0.741  -22.113 1.00 0.00 ? 65  ASP A OD1  8  
ATOM   10886 O  OD2  . ASP A 1 65 ? -6.019  -1.243  -21.992 1.00 0.00 ? 65  ASP A OD2  8  
ATOM   10887 H  H    . ASP A 1 65 ? -5.179  0.060   -17.380 1.00 0.00 ? 65  ASP A H    8  
ATOM   10888 H  HA   . ASP A 1 65 ? -4.518  1.357   -19.946 1.00 0.00 ? 65  ASP A HA   8  
ATOM   10889 H  HB2  . ASP A 1 65 ? -3.894  -1.047  -19.563 1.00 0.00 ? 65  ASP A HB2  8  
ATOM   10890 H  HB3  . ASP A 1 65 ? -5.600  -1.452  -19.459 1.00 0.00 ? 65  ASP A HB3  8  
ATOM   10891 N  N    . ALA A 1 66 ? -7.554  0.748   -18.854 1.00 0.00 ? 66  ALA A N    8  
ATOM   10892 C  CA   . ALA A 1 66 ? -8.985  1.065   -19.020 1.00 0.00 ? 66  ALA A CA   8  
ATOM   10893 C  C    . ALA A 1 66 ? -9.412  2.171   -18.030 1.00 0.00 ? 66  ALA A C    8  
ATOM   10894 O  O    . ALA A 1 66 ? -10.594 2.513   -17.980 1.00 0.00 ? 66  ALA A O    8  
ATOM   10895 C  CB   . ALA A 1 66 ? -9.835  -0.212  -18.842 1.00 0.00 ? 66  ALA A CB   8  
ATOM   10896 H  H    . ALA A 1 66 ? -7.267  0.391   -17.991 1.00 0.00 ? 66  ALA A H    8  
ATOM   10897 H  HA   . ALA A 1 66 ? -9.149  1.435   -20.033 1.00 0.00 ? 66  ALA A HA   8  
ATOM   10898 H  HB1  . ALA A 1 66 ? -10.881 0.025   -18.982 1.00 0.00 ? 66  ALA A HB1  8  
ATOM   10899 H  HB2  . ALA A 1 66 ? -9.693  -0.614  -17.843 1.00 0.00 ? 66  ALA A HB2  8  
ATOM   10900 H  HB3  . ALA A 1 66 ? -9.537  -0.957  -19.567 1.00 0.00 ? 66  ALA A HB3  8  
ATOM   10901 N  N    . ASP A 1 67 ? -8.412  2.703   -17.263 1.00 0.00 ? 67  ASP A N    8  
ATOM   10902 C  CA   . ASP A 1 67 ? -8.566  3.646   -16.122 1.00 0.00 ? 67  ASP A CA   8  
ATOM   10903 C  C    . ASP A 1 67 ? -9.559  4.793   -16.381 1.00 0.00 ? 67  ASP A C    8  
ATOM   10904 O  O    . ASP A 1 67 ? -9.188  5.900   -16.771 1.00 0.00 ? 67  ASP A O    8  
ATOM   10905 C  CB   . ASP A 1 67 ? -7.170  4.210   -15.717 1.00 0.00 ? 67  ASP A CB   8  
ATOM   10906 C  CG   . ASP A 1 67 ? -7.150  5.042   -14.418 1.00 0.00 ? 67  ASP A CG   8  
ATOM   10907 O  OD1  . ASP A 1 67 ? -8.018  4.842   -13.540 1.00 0.00 ? 67  ASP A OD1  8  
ATOM   10908 O  OD2  . ASP A 1 67 ? -6.256  5.894   -14.265 1.00 0.00 ? 67  ASP A OD2  8  
ATOM   10909 H  H    . ASP A 1 67 ? -7.513  2.413   -17.453 1.00 0.00 ? 67  ASP A H    8  
ATOM   10910 H  HA   . ASP A 1 67 ? -8.940  3.063   -15.285 1.00 0.00 ? 67  ASP A HA   8  
ATOM   10911 H  HB2  . ASP A 1 67 ? -6.486  3.382   -15.582 1.00 0.00 ? 67  ASP A HB2  8  
ATOM   10912 H  HB3  . ASP A 1 67 ? -6.801  4.828   -16.531 1.00 0.00 ? 67  ASP A HB3  8  
ATOM   10913 N  N    . SER A 1 68 ? -10.832 4.462   -16.204 1.00 0.00 ? 68  SER A N    8  
ATOM   10914 C  CA   . SER A 1 68 ? -11.944 5.430   -16.219 1.00 0.00 ? 68  SER A CA   8  
ATOM   10915 C  C    . SER A 1 68 ? -12.054 6.185   -14.879 1.00 0.00 ? 68  SER A C    8  
ATOM   10916 O  O    . SER A 1 68 ? -12.773 7.183   -14.787 1.00 0.00 ? 68  SER A O    8  
ATOM   10917 C  CB   . SER A 1 68 ? -13.264 4.697   -16.544 1.00 0.00 ? 68  SER A CB   8  
ATOM   10918 O  OG   . SER A 1 68 ? -13.166 3.979   -17.764 1.00 0.00 ? 68  SER A OG   8  
ATOM   10919 H  H    . SER A 1 68 ? -11.040 3.509   -16.114 1.00 0.00 ? 68  SER A H    8  
ATOM   10920 H  HA   . SER A 1 68 ? -11.750 6.157   -17.002 1.00 0.00 ? 68  SER A HA   8  
ATOM   10921 H  HB2  . SER A 1 68 ? -13.496 3.994   -15.756 1.00 0.00 ? 68  SER A HB2  8  
ATOM   10922 H  HB3  . SER A 1 68 ? -14.073 5.416   -16.631 1.00 0.00 ? 68  SER A HB3  8  
ATOM   10923 H  HG   . SER A 1 68 ? -12.236 3.896   -18.016 1.00 0.00 ? 68  SER A HG   8  
ATOM   10924 N  N    . PHE A 1 69 ? -11.351 5.691   -13.840 1.00 0.00 ? 69  PHE A N    8  
ATOM   10925 C  CA   . PHE A 1 69 ? -11.222 6.404   -12.554 1.00 0.00 ? 69  PHE A CA   8  
ATOM   10926 C  C    . PHE A 1 69 ? -10.338 7.646   -12.728 1.00 0.00 ? 69  PHE A C    8  
ATOM   10927 O  O    . PHE A 1 69 ? -10.585 8.682   -12.089 1.00 0.00 ? 69  PHE A O    8  
ATOM   10928 C  CB   . PHE A 1 69 ? -10.641 5.475   -11.454 1.00 0.00 ? 69  PHE A CB   8  
ATOM   10929 C  CG   . PHE A 1 69 ? -11.617 4.393   -10.979 1.00 0.00 ? 69  PHE A CG   8  
ATOM   10930 C  CD1  . PHE A 1 69 ? -12.563 4.671   -9.984  1.00 0.00 ? 69  PHE A CD1  8  
ATOM   10931 C  CD2  . PHE A 1 69 ? -11.601 3.106   -11.523 1.00 0.00 ? 69  PHE A CD2  8  
ATOM   10932 C  CE1  . PHE A 1 69 ? -13.452 3.703   -9.554  1.00 0.00 ? 69  PHE A CE1  8  
ATOM   10933 C  CE2  . PHE A 1 69 ? -12.495 2.143   -11.087 1.00 0.00 ? 69  PHE A CE2  8  
ATOM   10934 C  CZ   . PHE A 1 69 ? -13.417 2.441   -10.104 1.00 0.00 ? 69  PHE A CZ   8  
ATOM   10935 H  H    . PHE A 1 69 ? -10.904 4.826   -13.944 1.00 0.00 ? 69  PHE A H    8  
ATOM   10936 H  HA   . PHE A 1 69 ? -12.215 6.729   -12.254 1.00 0.00 ? 69  PHE A HA   8  
ATOM   10937 H  HB2  . PHE A 1 69 ? -9.746  4.987   -11.838 1.00 0.00 ? 69  PHE A HB2  8  
ATOM   10938 H  HB3  . PHE A 1 69 ? -10.359 6.075   -10.595 1.00 0.00 ? 69  PHE A HB3  8  
ATOM   10939 H  HD1  . PHE A 1 69 ? -12.599 5.661   -9.547  1.00 0.00 ? 69  PHE A HD1  8  
ATOM   10940 H  HD2  . PHE A 1 69 ? -10.879 2.860   -12.292 1.00 0.00 ? 69  PHE A HD2  8  
ATOM   10941 H  HE1  . PHE A 1 69 ? -14.176 3.936   -8.783  1.00 0.00 ? 69  PHE A HE1  8  
ATOM   10942 H  HE2  . PHE A 1 69 ? -12.473 1.151   -11.519 1.00 0.00 ? 69  PHE A HE2  8  
ATOM   10943 H  HZ   . PHE A 1 69 ? -14.114 1.683   -9.767  1.00 0.00 ? 69  PHE A HZ   8  
ATOM   10944 N  N    . TYR A 1 70 ? -9.319  7.511   -13.609 1.00 0.00 ? 70  TYR A N    8  
ATOM   10945 C  CA   . TYR A 1 70 ? -8.332  8.556   -13.916 1.00 0.00 ? 70  TYR A CA   8  
ATOM   10946 C  C    . TYR A 1 70 ? -7.587  8.986   -12.650 1.00 0.00 ? 70  TYR A C    8  
ATOM   10947 O  O    . TYR A 1 70 ? -7.935  9.985   -12.010 1.00 0.00 ? 70  TYR A O    8  
ATOM   10948 C  CB   . TYR A 1 70 ? -8.964  9.750   -14.670 1.00 0.00 ? 70  TYR A CB   8  
ATOM   10949 C  CG   . TYR A 1 70 ? -9.441  9.394   -16.086 1.00 0.00 ? 70  TYR A CG   8  
ATOM   10950 C  CD1  . TYR A 1 70 ? -8.520  9.068   -17.090 1.00 0.00 ? 70  TYR A CD1  8  
ATOM   10951 C  CD2  . TYR A 1 70 ? -10.796 9.379   -16.419 1.00 0.00 ? 70  TYR A CD2  8  
ATOM   10952 C  CE1  . TYR A 1 70 ? -8.942  8.738   -18.363 1.00 0.00 ? 70  TYR A CE1  8  
ATOM   10953 C  CE2  . TYR A 1 70 ? -11.216 9.052   -17.692 1.00 0.00 ? 70  TYR A CE2  8  
ATOM   10954 C  CZ   . TYR A 1 70 ? -10.289 8.732   -18.657 1.00 0.00 ? 70  TYR A CZ   8  
ATOM   10955 O  OH   . TYR A 1 70 ? -10.711 8.398   -19.922 1.00 0.00 ? 70  TYR A OH   8  
ATOM   10956 H  H    . TYR A 1 70 ? -9.211  6.647   -14.065 1.00 0.00 ? 70  TYR A H    8  
ATOM   10957 H  HA   . TYR A 1 70 ? -7.606  8.090   -14.578 1.00 0.00 ? 70  TYR A HA   8  
ATOM   10958 H  HB2  . TYR A 1 70 ? -9.810  10.119  -14.101 1.00 0.00 ? 70  TYR A HB2  8  
ATOM   10959 H  HB3  . TYR A 1 70 ? -8.233  10.549  -14.759 1.00 0.00 ? 70  TYR A HB3  8  
ATOM   10960 H  HD1  . TYR A 1 70 ? -7.460  9.074   -16.861 1.00 0.00 ? 70  TYR A HD1  8  
ATOM   10961 H  HD2  . TYR A 1 70 ? -11.532 9.631   -15.660 1.00 0.00 ? 70  TYR A HD2  8  
ATOM   10962 H  HE1  . TYR A 1 70 ? -8.212  8.489   -19.125 1.00 0.00 ? 70  TYR A HE1  8  
ATOM   10963 H  HE2  . TYR A 1 70 ? -12.274 9.049   -17.927 1.00 0.00 ? 70  TYR A HE2  8  
ATOM   10964 H  HH   . TYR A 1 70 ? -10.242 7.607   -20.220 1.00 0.00 ? 70  TYR A HH   8  
ATOM   10965 N  N    . GLN A 1 71 ? -6.585  8.177   -12.289 1.00 0.00 ? 71  GLN A N    8  
ATOM   10966 C  CA   . GLN A 1 71 ? -5.790  8.329   -11.063 1.00 0.00 ? 71  GLN A CA   8  
ATOM   10967 C  C    . GLN A 1 71 ? -4.958  9.622   -11.099 1.00 0.00 ? 71  GLN A C    8  
ATOM   10968 O  O    . GLN A 1 71 ? -4.887  10.361  -10.111 1.00 0.00 ? 71  GLN A O    8  
ATOM   10969 C  CB   . GLN A 1 71 ? -4.855  7.103   -10.901 1.00 0.00 ? 71  GLN A CB   8  
ATOM   10970 C  CG   . GLN A 1 71 ? -3.922  7.155   -9.672  1.00 0.00 ? 71  GLN A CG   8  
ATOM   10971 C  CD   . GLN A 1 71 ? -2.858  6.060   -9.668  1.00 0.00 ? 71  GLN A CD   8  
ATOM   10972 O  OE1  . GLN A 1 71 ? -3.069  4.964   -10.197 1.00 0.00 ? 71  GLN A OE1  8  
ATOM   10973 N  NE2  . GLN A 1 71 ? -1.700  6.344   -9.083  1.00 0.00 ? 71  GLN A NE2  8  
ATOM   10974 H  H    . GLN A 1 71 ? -6.353  7.445   -12.894 1.00 0.00 ? 71  GLN A H    8  
ATOM   10975 H  HA   . GLN A 1 71 ? -6.472  8.365   -10.223 1.00 0.00 ? 71  GLN A HA   8  
ATOM   10976 H  HB2  . GLN A 1 71 ? -5.465  6.207   -10.820 1.00 0.00 ? 71  GLN A HB2  8  
ATOM   10977 H  HB3  . GLN A 1 71 ? -4.241  7.015   -11.794 1.00 0.00 ? 71  GLN A HB3  8  
ATOM   10978 H  HG2  . GLN A 1 71 ? -3.424  8.120   -9.653  1.00 0.00 ? 71  GLN A HG2  8  
ATOM   10979 H  HG3  . GLN A 1 71 ? -4.523  7.052   -8.778  1.00 0.00 ? 71  GLN A HG3  8  
ATOM   10980 H  HE21 . GLN A 1 71 ? -1.589  7.240   -8.690  1.00 0.00 ? 71  GLN A HE21 8  
ATOM   10981 H  HE22 . GLN A 1 71 ? -1.008  5.657   -9.063  1.00 0.00 ? 71  GLN A HE22 8  
ATOM   10982 N  N    . PHE A 1 72 ? -4.353  9.880   -12.262 1.00 0.00 ? 72  PHE A N    8  
ATOM   10983 C  CA   . PHE A 1 72 ? -3.432  10.998  -12.478 1.00 0.00 ? 72  PHE A CA   8  
ATOM   10984 C  C    . PHE A 1 72 ? -4.222  12.180  -13.046 1.00 0.00 ? 72  PHE A C    8  
ATOM   10985 O  O    . PHE A 1 72 ? -5.106  11.987  -13.889 1.00 0.00 ? 72  PHE A O    8  
ATOM   10986 C  CB   . PHE A 1 72 ? -2.312  10.574  -13.464 1.00 0.00 ? 72  PHE A CB   8  
ATOM   10987 C  CG   . PHE A 1 72 ? -1.643  9.248   -13.096 1.00 0.00 ? 72  PHE A CG   8  
ATOM   10988 C  CD1  . PHE A 1 72 ? -2.170  8.037   -13.543 1.00 0.00 ? 72  PHE A CD1  8  
ATOM   10989 C  CD2  . PHE A 1 72 ? -0.506  9.209   -12.299 1.00 0.00 ? 72  PHE A CD2  8  
ATOM   10990 C  CE1  . PHE A 1 72 ? -1.582  6.840   -13.212 1.00 0.00 ? 72  PHE A CE1  8  
ATOM   10991 C  CE2  . PHE A 1 72 ? 0.085   8.005   -11.969 1.00 0.00 ? 72  PHE A CE2  8  
ATOM   10992 C  CZ   . PHE A 1 72 ? -0.455  6.823   -12.425 1.00 0.00 ? 72  PHE A CZ   8  
ATOM   10993 H  H    . PHE A 1 72 ? -4.541  9.309   -13.024 1.00 0.00 ? 72  PHE A H    8  
ATOM   10994 H  HA   . PHE A 1 72 ? -2.986  11.280  -11.525 1.00 0.00 ? 72  PHE A HA   8  
ATOM   10995 H  HB2  . PHE A 1 72 ? -2.732  10.470  -14.461 1.00 0.00 ? 72  PHE A HB2  8  
ATOM   10996 H  HB3  . PHE A 1 72 ? -1.548  11.343  -13.496 1.00 0.00 ? 72  PHE A HB3  8  
ATOM   10997 H  HD1  . PHE A 1 72 ? -3.061  8.044   -14.163 1.00 0.00 ? 72  PHE A HD1  8  
ATOM   10998 H  HD2  . PHE A 1 72 ? -0.078  10.135  -11.937 1.00 0.00 ? 72  PHE A HD2  8  
ATOM   10999 H  HE1  . PHE A 1 72 ? -2.010  5.908   -13.569 1.00 0.00 ? 72  PHE A HE1  8  
ATOM   11000 H  HE2  . PHE A 1 72 ? 0.973   7.992   -11.350 1.00 0.00 ? 72  PHE A HE2  8  
ATOM   11001 H  HZ   . PHE A 1 72 ? 0.009   5.881   -12.164 1.00 0.00 ? 72  PHE A HZ   8  
ATOM   11002 N  N    . SER A 1 73 ? -3.894  13.384  -12.580 1.00 0.00 ? 73  SER A N    8  
ATOM   11003 C  CA   . SER A 1 73 ? -4.567  14.621  -12.971 1.00 0.00 ? 73  SER A CA   8  
ATOM   11004 C  C    . SER A 1 73 ? -3.608  15.806  -12.872 1.00 0.00 ? 73  SER A C    8  
ATOM   11005 O  O    . SER A 1 73 ? -2.556  15.732  -12.236 1.00 0.00 ? 73  SER A O    8  
ATOM   11006 C  CB   . SER A 1 73 ? -5.788  14.861  -12.057 1.00 0.00 ? 73  SER A CB   8  
ATOM   11007 O  OG   . SER A 1 73 ? -5.415  14.940  -10.691 1.00 0.00 ? 73  SER A OG   8  
ATOM   11008 H  H    . SER A 1 73 ? -3.192  13.437  -11.908 1.00 0.00 ? 73  SER A H    8  
ATOM   11009 H  HA   . SER A 1 73 ? -4.902  14.528  -13.999 1.00 0.00 ? 73  SER A HA   8  
ATOM   11010 H  HB2  . SER A 1 73 ? -6.283  15.783  -12.335 1.00 0.00 ? 73  SER A HB2  8  
ATOM   11011 H  HB3  . SER A 1 73 ? -6.483  14.038  -12.173 1.00 0.00 ? 73  SER A HB3  8  
ATOM   11012 H  HG   . SER A 1 73 ? -6.125  14.573  -10.152 1.00 0.00 ? 73  SER A HG   8  
ATOM   11013 N  N    . CYS A 1 74 ? -4.019  16.901  -13.498 1.00 0.00 ? 74  CYS A N    8  
ATOM   11014 C  CA   . CYS A 1 74 ? -3.379  18.212  -13.376 1.00 0.00 ? 74  CYS A CA   8  
ATOM   11015 C  C    . CYS A 1 74 ? -4.217  19.028  -12.391 1.00 0.00 ? 74  CYS A C    8  
ATOM   11016 O  O    . CYS A 1 74 ? -5.417  19.189  -12.601 1.00 0.00 ? 74  CYS A O    8  
ATOM   11017 C  CB   . CYS A 1 74 ? -3.315  18.911  -14.757 1.00 0.00 ? 74  CYS A CB   8  
ATOM   11018 S  SG   . CYS A 1 74 ? -2.955  20.708  -14.714 1.00 0.00 ? 74  CYS A SG   8  
ATOM   11019 H  H    . CYS A 1 74 ? -4.830  16.833  -14.039 1.00 0.00 ? 74  CYS A H    8  
ATOM   11020 H  HA   . CYS A 1 74 ? -2.371  18.088  -12.984 1.00 0.00 ? 74  CYS A HA   8  
ATOM   11021 H  HB2  . CYS A 1 74 ? -2.555  18.448  -15.360 1.00 0.00 ? 74  CYS A HB2  8  
ATOM   11022 H  HB3  . CYS A 1 74 ? -4.268  18.780  -15.260 1.00 0.00 ? 74  CYS A HB3  8  
ATOM   11023 N  N    . ASN A 1 75 ? -3.607  19.545  -11.316 1.00 0.00 ? 75  ASN A N    8  
ATOM   11024 C  CA   . ASN A 1 75 ? -4.336  20.347  -10.300 1.00 0.00 ? 75  ASN A CA   8  
ATOM   11025 C  C    . ASN A 1 75 ? -4.754  21.739  -10.856 1.00 0.00 ? 75  ASN A C    8  
ATOM   11026 O  O    . ASN A 1 75 ? -5.487  22.486  -10.207 1.00 0.00 ? 75  ASN A O    8  
ATOM   11027 C  CB   . ASN A 1 75 ? -3.463  20.486  -9.025  1.00 0.00 ? 75  ASN A CB   8  
ATOM   11028 C  CG   . ASN A 1 75 ? -4.204  21.077  -7.823  1.00 0.00 ? 75  ASN A CG   8  
ATOM   11029 O  OD1  . ASN A 1 75 ? -4.852  20.360  -7.067  1.00 0.00 ? 75  ASN A OD1  8  
ATOM   11030 N  ND2  . ASN A 1 75 ? -4.120  22.391  -7.642  1.00 0.00 ? 75  ASN A ND2  8  
ATOM   11031 H  H    . ASN A 1 75 ? -2.648  19.372  -11.185 1.00 0.00 ? 75  ASN A H    8  
ATOM   11032 H  HA   . ASN A 1 75 ? -5.241  19.801  -10.043 1.00 0.00 ? 75  ASN A HA   8  
ATOM   11033 H  HB2  . ASN A 1 75 ? -3.096  19.506  -8.743  1.00 0.00 ? 75  ASN A HB2  8  
ATOM   11034 H  HB3  . ASN A 1 75 ? -2.611  21.117  -9.247  1.00 0.00 ? 75  ASN A HB3  8  
ATOM   11035 H  HD21 . ASN A 1 75 ? -3.593  22.915  -8.284  1.00 0.00 ? 75  ASN A HD21 8  
ATOM   11036 H  HD22 . ASN A 1 75 ? -4.577  22.785  -6.869  1.00 0.00 ? 75  ASN A HD22 8  
ATOM   11037 N  N    . ILE A 1 76 ? -4.313  22.053  -12.089 1.00 0.00 ? 76  ILE A N    8  
ATOM   11038 C  CA   . ILE A 1 76 ? -4.510  23.368  -12.716 1.00 0.00 ? 76  ILE A CA   8  
ATOM   11039 C  C    . ILE A 1 76 ? -5.552  23.238  -13.850 1.00 0.00 ? 76  ILE A C    8  
ATOM   11040 O  O    . ILE A 1 76 ? -6.323  24.166  -14.101 1.00 0.00 ? 76  ILE A O    8  
ATOM   11041 C  CB   . ILE A 1 76 ? -3.135  23.944  -13.267 1.00 0.00 ? 76  ILE A CB   8  
ATOM   11042 C  CG1  . ILE A 1 76 ? -1.956  23.634  -12.252 1.00 0.00 ? 76  ILE A CG1  8  
ATOM   11043 C  CG2  . ILE A 1 76 ? -3.255  25.460  -13.576 1.00 0.00 ? 76  ILE A CG2  8  
ATOM   11044 C  CD1  . ILE A 1 76 ? -0.706  24.484  -12.379 1.00 0.00 ? 76  ILE A CD1  8  
ATOM   11045 H  H    . ILE A 1 76 ? -3.871  21.365  -12.611 1.00 0.00 ? 76  ILE A H    8  
ATOM   11046 H  HA   . ILE A 1 76 ? -4.897  24.058  -11.961 1.00 0.00 ? 76  ILE A HA   8  
ATOM   11047 H  HB   . ILE A 1 76 ? -2.918  23.440  -14.206 1.00 0.00 ? 76  ILE A HB   8  
ATOM   11048 H  HG12 . ILE A 1 76 ? -2.310  23.757  -11.242 1.00 0.00 ? 76  ILE A HG12 8  
ATOM   11049 H  HG13 . ILE A 1 76 ? -1.646  22.596  -12.392 1.00 0.00 ? 76  ILE A HG13 8  
ATOM   11050 H  HG21 . ILE A 1 76 ? -3.461  26.009  -12.666 1.00 0.00 ? 76  ILE A HG21 8  
ATOM   11051 H  HG22 . ILE A 1 76 ? -4.060  25.629  -14.283 1.00 0.00 ? 76  ILE A HG22 8  
ATOM   11052 H  HG23 . ILE A 1 76 ? -2.329  25.820  -14.010 1.00 0.00 ? 76  ILE A HG23 8  
ATOM   11053 H  HD11 . ILE A 1 76 ? -0.956  25.519  -12.209 1.00 0.00 ? 76  ILE A HD11 8  
ATOM   11054 H  HD12 . ILE A 1 76 ? -0.284  24.370  -13.367 1.00 0.00 ? 76  ILE A HD12 8  
ATOM   11055 H  HD13 . ILE A 1 76 ? 0.020   24.166  -11.644 1.00 0.00 ? 76  ILE A HD13 8  
ATOM   11056 N  N    . CYS A 1 77 ? -5.570  22.048  -14.503 1.00 0.00 ? 77  CYS A N    8  
ATOM   11057 C  CA   . CYS A 1 77 ? -6.522  21.713  -15.572 1.00 0.00 ? 77  CYS A CA   8  
ATOM   11058 C  C    . CYS A 1 77 ? -6.388  20.209  -15.889 1.00 0.00 ? 77  CYS A C    8  
ATOM   11059 O  O    . CYS A 1 77 ? -5.714  19.819  -16.842 1.00 0.00 ? 77  CYS A O    8  
ATOM   11060 C  CB   . CYS A 1 77 ? -6.328  22.596  -16.841 1.00 0.00 ? 77  CYS A CB   8  
ATOM   11061 S  SG   . CYS A 1 77 ? -4.821  22.298  -17.836 1.00 0.00 ? 77  CYS A SG   8  
ATOM   11062 H  H    . CYS A 1 77 ? -4.942  21.358  -14.228 1.00 0.00 ? 77  CYS A H    8  
ATOM   11063 H  HA   . CYS A 1 77 ? -7.524  21.888  -15.174 1.00 0.00 ? 77  CYS A HA   8  
ATOM   11064 H  HB2  . CYS A 1 77 ? -7.169  22.444  -17.504 1.00 0.00 ? 77  CYS A HB2  8  
ATOM   11065 H  HB3  . CYS A 1 77 ? -6.315  23.637  -16.540 1.00 0.00 ? 77  CYS A HB3  8  
ATOM   11066 N  N    . GLY A 1 78 ? -6.861  19.398  -14.916 1.00 0.00 ? 78  GLY A N    8  
ATOM   11067 C  CA   . GLY A 1 78 ? -6.952  17.923  -14.987 1.00 0.00 ? 78  GLY A CA   8  
ATOM   11068 C  C    . GLY A 1 78 ? -7.381  17.304  -16.310 1.00 0.00 ? 78  GLY A C    8  
ATOM   11069 O  O    . GLY A 1 78 ? -8.510  16.834  -16.450 1.00 0.00 ? 78  GLY A O    8  
ATOM   11070 H  H    . GLY A 1 78 ? -7.067  19.824  -14.053 1.00 0.00 ? 78  GLY A H    8  
ATOM   11071 H  HA2  . GLY A 1 78 ? -5.978  17.523  -14.742 1.00 0.00 ? 78  GLY A HA2  8  
ATOM   11072 H  HA3  . GLY A 1 78 ? -7.638  17.599  -14.218 1.00 0.00 ? 78  GLY A HA3  8  
ATOM   11073 N  N    . LYS A 1 79 ? -6.437  17.275  -17.266 1.00 0.00 ? 79  LYS A N    8  
ATOM   11074 C  CA   . LYS A 1 79 ? -6.577  16.563  -18.542 1.00 0.00 ? 79  LYS A CA   8  
ATOM   11075 C  C    . LYS A 1 79 ? -6.630  15.030  -18.327 1.00 0.00 ? 79  LYS A C    8  
ATOM   11076 O  O    . LYS A 1 79 ? -7.135  14.303  -19.189 1.00 0.00 ? 79  LYS A O    8  
ATOM   11077 C  CB   . LYS A 1 79 ? -5.391  16.985  -19.454 1.00 0.00 ? 79  LYS A CB   8  
ATOM   11078 C  CG   . LYS A 1 79 ? -5.588  16.801  -20.974 1.00 0.00 ? 79  LYS A CG   8  
ATOM   11079 C  CD   . LYS A 1 79 ? -5.187  15.394  -21.482 1.00 0.00 ? 79  LYS A CD   8  
ATOM   11080 C  CE   . LYS A 1 79 ? -5.367  15.238  -22.997 1.00 0.00 ? 79  LYS A CE   8  
ATOM   11081 N  NZ   . LYS A 1 79 ? -5.026  13.868  -23.467 1.00 0.00 ? 79  LYS A NZ   8  
ATOM   11082 H  H    . LYS A 1 79 ? -5.641  17.831  -17.149 1.00 0.00 ? 79  LYS A H    8  
ATOM   11083 H  HA   . LYS A 1 79 ? -7.505  16.887  -19.000 1.00 0.00 ? 79  LYS A HA   8  
ATOM   11084 H  HB2  . LYS A 1 79 ? -5.189  18.037  -19.279 1.00 0.00 ? 79  LYS A HB2  8  
ATOM   11085 H  HB3  . LYS A 1 79 ? -4.507  16.428  -19.153 1.00 0.00 ? 79  LYS A HB3  8  
ATOM   11086 H  HG2  . LYS A 1 79 ? -6.630  16.984  -21.207 1.00 0.00 ? 79  LYS A HG2  8  
ATOM   11087 H  HG3  . LYS A 1 79 ? -4.986  17.542  -21.480 1.00 0.00 ? 79  LYS A HG3  8  
ATOM   11088 H  HD2  . LYS A 1 79 ? -4.146  15.218  -21.236 1.00 0.00 ? 79  LYS A HD2  8  
ATOM   11089 H  HD3  . LYS A 1 79 ? -5.797  14.648  -20.976 1.00 0.00 ? 79  LYS A HD3  8  
ATOM   11090 H  HE2  . LYS A 1 79 ? -6.397  15.434  -23.252 1.00 0.00 ? 79  LYS A HE2  8  
ATOM   11091 H  HE3  . LYS A 1 79 ? -4.727  15.946  -23.505 1.00 0.00 ? 79  LYS A HE3  8  
ATOM   11092 H  HZ1  . LYS A 1 79 ? -5.149  13.809  -24.497 1.00 0.00 ? 79  LYS A HZ1  8  
ATOM   11093 H  HZ2  . LYS A 1 79 ? -5.652  13.170  -23.018 1.00 0.00 ? 79  LYS A HZ2  8  
ATOM   11094 H  HZ3  . LYS A 1 79 ? -4.043  13.639  -23.225 1.00 0.00 ? 79  LYS A HZ3  8  
ATOM   11095 N  N    . LYS A 1 80 ? -6.095  14.575  -17.161 1.00 0.00 ? 80  LYS A N    8  
ATOM   11096 C  CA   . LYS A 1 80 ? -6.111  13.163  -16.713 1.00 0.00 ? 80  LYS A CA   8  
ATOM   11097 C  C    . LYS A 1 80 ? -5.157  12.337  -17.581 1.00 0.00 ? 80  LYS A C    8  
ATOM   11098 O  O    . LYS A 1 80 ? -5.480  12.010  -18.727 1.00 0.00 ? 80  LYS A O    8  
ATOM   11099 C  CB   . LYS A 1 80 ? -7.531  12.529  -16.716 1.00 0.00 ? 80  LYS A CB   8  
ATOM   11100 C  CG   . LYS A 1 80 ? -8.614  13.307  -15.948 1.00 0.00 ? 80  LYS A CG   8  
ATOM   11101 C  CD   . LYS A 1 80 ? -8.260  13.554  -14.461 1.00 0.00 ? 80  LYS A CD   8  
ATOM   11102 C  CE   . LYS A 1 80 ? -9.463  14.081  -13.663 1.00 0.00 ? 80  LYS A CE   8  
ATOM   11103 N  NZ   . LYS A 1 80 ? -10.067 15.304  -14.282 1.00 0.00 ? 80  LYS A NZ   8  
ATOM   11104 H  H    . LYS A 1 80 ? -5.631  15.218  -16.596 1.00 0.00 ? 80  LYS A H    8  
ATOM   11105 H  HA   . LYS A 1 80 ? -5.738  13.162  -15.690 1.00 0.00 ? 80  LYS A HA   8  
ATOM   11106 H  HB2  . LYS A 1 80 ? -7.865  12.428  -17.744 1.00 0.00 ? 80  LYS A HB2  8  
ATOM   11107 H  HB3  . LYS A 1 80 ? -7.462  11.528  -16.284 1.00 0.00 ? 80  LYS A HB3  8  
ATOM   11108 H  HG2  . LYS A 1 80 ? -8.758  14.267  -16.434 1.00 0.00 ? 80  LYS A HG2  8  
ATOM   11109 H  HG3  . LYS A 1 80 ? -9.543  12.743  -16.002 1.00 0.00 ? 80  LYS A HG3  8  
ATOM   11110 H  HD2  . LYS A 1 80 ? -7.923  12.624  -14.017 1.00 0.00 ? 80  LYS A HD2  8  
ATOM   11111 H  HD3  . LYS A 1 80 ? -7.453  14.287  -14.407 1.00 0.00 ? 80  LYS A HD3  8  
ATOM   11112 H  HE2  . LYS A 1 80 ? -10.222 13.308  -13.620 1.00 0.00 ? 80  LYS A HE2  8  
ATOM   11113 H  HE3  . LYS A 1 80 ? -9.143  14.321  -12.656 1.00 0.00 ? 80  LYS A HE3  8  
ATOM   11114 H  HZ1  . LYS A 1 80 ? -9.360  16.060  -14.369 1.00 0.00 ? 80  LYS A HZ1  8  
ATOM   11115 H  HZ2  . LYS A 1 80 ? -10.852 15.651  -13.699 1.00 0.00 ? 80  LYS A HZ2  8  
ATOM   11116 H  HZ3  . LYS A 1 80 ? -10.440 15.077  -15.230 1.00 0.00 ? 80  LYS A HZ3  8  
ATOM   11117 N  N    . PHE A 1 81 ? -3.985  12.021  -17.031 1.00 0.00 ? 81  PHE A N    8  
ATOM   11118 C  CA   . PHE A 1 81 ? -2.852  11.473  -17.799 1.00 0.00 ? 81  PHE A CA   8  
ATOM   11119 C  C    . PHE A 1 81 ? -2.637  9.989   -17.501 1.00 0.00 ? 81  PHE A C    8  
ATOM   11120 O  O    . PHE A 1 81 ? -3.109  9.478   -16.481 1.00 0.00 ? 81  PHE A O    8  
ATOM   11121 C  CB   . PHE A 1 81 ? -1.580  12.290  -17.475 1.00 0.00 ? 81  PHE A CB   8  
ATOM   11122 C  CG   . PHE A 1 81 ? -1.765  13.790  -17.722 1.00 0.00 ? 81  PHE A CG   8  
ATOM   11123 C  CD1  . PHE A 1 81 ? -1.542  14.347  -18.981 1.00 0.00 ? 81  PHE A CD1  8  
ATOM   11124 C  CD2  . PHE A 1 81 ? -2.198  14.636  -16.697 1.00 0.00 ? 81  PHE A CD2  8  
ATOM   11125 C  CE1  . PHE A 1 81 ? -1.743  15.689  -19.197 1.00 0.00 ? 81  PHE A CE1  8  
ATOM   11126 C  CE2  . PHE A 1 81 ? -2.392  15.976  -16.922 1.00 0.00 ? 81  PHE A CE2  8  
ATOM   11127 C  CZ   . PHE A 1 81 ? -2.166  16.500  -18.167 1.00 0.00 ? 81  PHE A CZ   8  
ATOM   11128 H  H    . PHE A 1 81 ? -3.878  12.148  -16.065 1.00 0.00 ? 81  PHE A H    8  
ATOM   11129 H  HA   . PHE A 1 81 ? -3.069  11.579  -18.863 1.00 0.00 ? 81  PHE A HA   8  
ATOM   11130 H  HB2  . PHE A 1 81 ? -1.311  12.143  -16.432 1.00 0.00 ? 81  PHE A HB2  8  
ATOM   11131 H  HB3  . PHE A 1 81 ? -0.759  11.943  -18.098 1.00 0.00 ? 81  PHE A HB3  8  
ATOM   11132 H  HD1  . PHE A 1 81 ? -1.205  13.717  -19.793 1.00 0.00 ? 81  PHE A HD1  8  
ATOM   11133 H  HD2  . PHE A 1 81 ? -2.379  14.225  -15.709 1.00 0.00 ? 81  PHE A HD2  8  
ATOM   11134 H  HE1  . PHE A 1 81 ? -1.568  16.112  -20.178 1.00 0.00 ? 81  PHE A HE1  8  
ATOM   11135 H  HE2  . PHE A 1 81 ? -2.724  16.616  -16.115 1.00 0.00 ? 81  PHE A HE2  8  
ATOM   11136 H  HZ   . PHE A 1 81 ? -2.321  17.554  -18.344 1.00 0.00 ? 81  PHE A HZ   8  
ATOM   11137 N  N    . GLU A 1 82 ? -1.924  9.319   -18.424 1.00 0.00 ? 82  GLU A N    8  
ATOM   11138 C  CA   . GLU A 1 82 ? -1.532  7.898   -18.306 1.00 0.00 ? 82  GLU A CA   8  
ATOM   11139 C  C    . GLU A 1 82 ? -0.668  7.622   -17.057 1.00 0.00 ? 82  GLU A C    8  
ATOM   11140 O  O    . GLU A 1 82 ? -0.839  6.581   -16.405 1.00 0.00 ? 82  GLU A O    8  
ATOM   11141 C  CB   . GLU A 1 82 ? -0.762  7.477   -19.590 1.00 0.00 ? 82  GLU A CB   8  
ATOM   11142 C  CG   . GLU A 1 82 ? 0.442   8.387   -19.921 1.00 0.00 ? 82  GLU A CG   8  
ATOM   11143 C  CD   . GLU A 1 82 ? 1.266   7.920   -21.128 1.00 0.00 ? 82  GLU A CD   8  
ATOM   11144 O  OE1  . GLU A 1 82 ? 0.827   8.133   -22.277 1.00 0.00 ? 82  GLU A OE1  8  
ATOM   11145 O  OE2  . GLU A 1 82 ? 2.369   7.368   -20.934 1.00 0.00 ? 82  GLU A OE2  8  
ATOM   11146 H  H    . GLU A 1 82 ? -1.749  9.762   -19.282 1.00 0.00 ? 82  GLU A H    8  
ATOM   11147 H  HA   . GLU A 1 82 ? -2.442  7.312   -18.236 1.00 0.00 ? 82  GLU A HA   8  
ATOM   11148 H  HB2  . GLU A 1 82 ? -0.404  6.454   -19.481 1.00 0.00 ? 82  GLU A HB2  8  
ATOM   11149 H  HB3  . GLU A 1 82 ? -1.450  7.509   -20.431 1.00 0.00 ? 82  GLU A HB3  8  
ATOM   11150 H  HG2  . GLU A 1 82 ? 0.068   9.383   -20.129 1.00 0.00 ? 82  GLU A HG2  8  
ATOM   11151 H  HG3  . GLU A 1 82 ? 1.088   8.439   -19.050 1.00 0.00 ? 82  GLU A HG3  8  
ATOM   11152 N  N    . LYS A 1 83 ? 0.241   8.568   -16.738 1.00 0.00 ? 83  LYS A N    8  
ATOM   11153 C  CA   . LYS A 1 83 ? 1.138   8.463   -15.592 1.00 0.00 ? 83  LYS A CA   8  
ATOM   11154 C  C    . LYS A 1 83 ? 1.815   9.803   -15.289 1.00 0.00 ? 83  LYS A C    8  
ATOM   11155 O  O    . LYS A 1 83 ? 1.705   10.765  -16.064 1.00 0.00 ? 83  LYS A O    8  
ATOM   11156 C  CB   . LYS A 1 83 ? 2.171   7.310   -15.779 1.00 0.00 ? 83  LYS A CB   8  
ATOM   11157 C  CG   . LYS A 1 83 ? 3.017   7.358   -17.067 1.00 0.00 ? 83  LYS A CG   8  
ATOM   11158 C  CD   . LYS A 1 83 ? 3.954   6.132   -17.190 1.00 0.00 ? 83  LYS A CD   8  
ATOM   11159 C  CE   . LYS A 1 83 ? 4.704   6.103   -18.532 1.00 0.00 ? 83  LYS A CE   8  
ATOM   11160 N  NZ   . LYS A 1 83 ? 5.536   7.317   -18.745 1.00 0.00 ? 83  LYS A NZ   8  
ATOM   11161 H  H    . LYS A 1 83 ? 0.282   9.372   -17.298 1.00 0.00 ? 83  LYS A H    8  
ATOM   11162 H  HA   . LYS A 1 83 ? 0.517   8.219   -14.737 1.00 0.00 ? 83  LYS A HA   8  
ATOM   11163 H  HB2  . LYS A 1 83 ? 2.846   7.309   -14.931 1.00 0.00 ? 83  LYS A HB2  8  
ATOM   11164 H  HB3  . LYS A 1 83 ? 1.622   6.370   -15.774 1.00 0.00 ? 83  LYS A HB3  8  
ATOM   11165 H  HG2  . LYS A 1 83 ? 2.348   7.372   -17.922 1.00 0.00 ? 83  LYS A HG2  8  
ATOM   11166 H  HG3  . LYS A 1 83 ? 3.617   8.265   -17.066 1.00 0.00 ? 83  LYS A HG3  8  
ATOM   11167 H  HD2  . LYS A 1 83 ? 4.682   6.161   -16.384 1.00 0.00 ? 83  LYS A HD2  8  
ATOM   11168 H  HD3  . LYS A 1 83 ? 3.362   5.224   -17.099 1.00 0.00 ? 83  LYS A HD3  8  
ATOM   11169 H  HE2  . LYS A 1 83 ? 5.349   5.233   -18.558 1.00 0.00 ? 83  LYS A HE2  8  
ATOM   11170 H  HE3  . LYS A 1 83 ? 3.983   6.032   -19.337 1.00 0.00 ? 83  LYS A HE3  8  
ATOM   11171 H  HZ1  . LYS A 1 83 ? 6.281   7.374   -18.016 1.00 0.00 ? 83  LYS A HZ1  8  
ATOM   11172 H  HZ2  . LYS A 1 83 ? 4.946   8.167   -18.680 1.00 0.00 ? 83  LYS A HZ2  8  
ATOM   11173 H  HZ3  . LYS A 1 83 ? 5.985   7.291   -19.681 1.00 0.00 ? 83  LYS A HZ3  8  
ATOM   11174 N  N    . LYS A 1 84 ? 2.534   9.816   -14.156 1.00 0.00 ? 84  LYS A N    8  
ATOM   11175 C  CA   . LYS A 1 84 ? 3.157   11.012  -13.555 1.00 0.00 ? 84  LYS A CA   8  
ATOM   11176 C  C    . LYS A 1 84 ? 4.091   11.739  -14.526 1.00 0.00 ? 84  LYS A C    8  
ATOM   11177 O  O    . LYS A 1 84 ? 4.161   12.965  -14.500 1.00 0.00 ? 84  LYS A O    8  
ATOM   11178 C  CB   . LYS A 1 84 ? 3.925   10.608  -12.267 1.00 0.00 ? 84  LYS A CB   8  
ATOM   11179 C  CG   . LYS A 1 84 ? 3.020   10.090  -11.132 1.00 0.00 ? 84  LYS A CG   8  
ATOM   11180 C  CD   . LYS A 1 84 ? 2.086   11.190  -10.567 1.00 0.00 ? 84  LYS A CD   8  
ATOM   11181 C  CE   . LYS A 1 84 ? 2.832   12.274  -9.770  1.00 0.00 ? 84  LYS A CE   8  
ATOM   11182 N  NZ   . LYS A 1 84 ? 3.462   11.715  -8.547  1.00 0.00 ? 84  LYS A NZ   8  
ATOM   11183 H  H    . LYS A 1 84 ? 2.652   8.963   -13.697 1.00 0.00 ? 84  LYS A H    8  
ATOM   11184 H  HA   . LYS A 1 84 ? 2.352   11.690  -13.277 1.00 0.00 ? 84  LYS A HA   8  
ATOM   11185 H  HB2  . LYS A 1 84 ? 4.633   9.826   -12.515 1.00 0.00 ? 84  LYS A HB2  8  
ATOM   11186 H  HB3  . LYS A 1 84 ? 4.474   11.464  -11.897 1.00 0.00 ? 84  LYS A HB3  8  
ATOM   11187 H  HG2  . LYS A 1 84 ? 2.406   9.283   -11.518 1.00 0.00 ? 84  LYS A HG2  8  
ATOM   11188 H  HG3  . LYS A 1 84 ? 3.644   9.703   -10.327 1.00 0.00 ? 84  LYS A HG3  8  
ATOM   11189 H  HD2  . LYS A 1 84 ? 1.568   11.667  -11.391 1.00 0.00 ? 84  LYS A HD2  8  
ATOM   11190 H  HD3  . LYS A 1 84 ? 1.354   10.722  -9.917  1.00 0.00 ? 84  LYS A HD3  8  
ATOM   11191 H  HE2  . LYS A 1 84 ? 3.603   12.715  -10.392 1.00 0.00 ? 84  LYS A HE2  8  
ATOM   11192 H  HE3  . LYS A 1 84 ? 2.126   13.042  -9.479  1.00 0.00 ? 84  LYS A HE3  8  
ATOM   11193 H  HZ1  . LYS A 1 84 ? 3.974   12.453  -8.030  1.00 0.00 ? 84  LYS A HZ1  8  
ATOM   11194 H  HZ2  . LYS A 1 84 ? 4.130   10.956  -8.802  1.00 0.00 ? 84  LYS A HZ2  8  
ATOM   11195 H  HZ3  . LYS A 1 84 ? 2.734   11.318  -7.919  1.00 0.00 ? 84  LYS A HZ3  8  
ATOM   11196 N  N    . ASP A 1 85 ? 4.779   10.968  -15.388 1.00 0.00 ? 85  ASP A N    8  
ATOM   11197 C  CA   . ASP A 1 85 ? 5.714   11.511  -16.399 1.00 0.00 ? 85  ASP A CA   8  
ATOM   11198 C  C    . ASP A 1 85 ? 5.024   12.558  -17.288 1.00 0.00 ? 85  ASP A C    8  
ATOM   11199 O  O    . ASP A 1 85 ? 5.563   13.647  -17.492 1.00 0.00 ? 85  ASP A O    8  
ATOM   11200 C  CB   . ASP A 1 85 ? 6.282   10.377  -17.276 1.00 0.00 ? 85  ASP A CB   8  
ATOM   11201 C  CG   . ASP A 1 85 ? 6.972   9.286   -16.453 1.00 0.00 ? 85  ASP A CG   8  
ATOM   11202 O  OD1  . ASP A 1 85 ? 8.184   9.397   -16.181 1.00 0.00 ? 85  ASP A OD1  8  
ATOM   11203 O  OD2  . ASP A 1 85 ? 6.292   8.318   -16.053 1.00 0.00 ? 85  ASP A OD2  8  
ATOM   11204 H  H    . ASP A 1 85 ? 4.664   9.992   -15.334 1.00 0.00 ? 85  ASP A H    8  
ATOM   11205 H  HA   . ASP A 1 85 ? 6.536   11.986  -15.863 1.00 0.00 ? 85  ASP A HA   8  
ATOM   11206 H  HB2  . ASP A 1 85 ? 5.475   9.925   -17.844 1.00 0.00 ? 85  ASP A HB2  8  
ATOM   11207 H  HB3  . ASP A 1 85 ? 7.004   10.795  -17.975 1.00 0.00 ? 85  ASP A HB3  8  
ATOM   11208 N  N    . SER A 1 86 ? 3.799   12.227  -17.756 1.00 0.00 ? 86  SER A N    8  
ATOM   11209 C  CA   . SER A 1 86 ? 3.009   13.105  -18.631 1.00 0.00 ? 86  SER A CA   8  
ATOM   11210 C  C    . SER A 1 86 ? 2.504   14.348  -17.863 1.00 0.00 ? 86  SER A C    8  
ATOM   11211 O  O    . SER A 1 86 ? 2.366   15.414  -18.444 1.00 0.00 ? 86  SER A O    8  
ATOM   11212 C  CB   . SER A 1 86 ? 1.826   12.329  -19.257 1.00 0.00 ? 86  SER A CB   8  
ATOM   11213 O  OG   . SER A 1 86 ? 1.126   13.119  -20.205 1.00 0.00 ? 86  SER A OG   8  
ATOM   11214 H  H    . SER A 1 86 ? 3.404   11.363  -17.504 1.00 0.00 ? 86  SER A H    8  
ATOM   11215 H  HA   . SER A 1 86 ? 3.669   13.433  -19.428 1.00 0.00 ? 86  SER A HA   8  
ATOM   11216 H  HB2  . SER A 1 86 ? 2.200   11.442  -19.760 1.00 0.00 ? 86  SER A HB2  8  
ATOM   11217 H  HB3  . SER A 1 86 ? 1.131   12.032  -18.481 1.00 0.00 ? 86  SER A HB3  8  
ATOM   11218 H  HG   . SER A 1 86 ? 0.619   12.541  -20.786 1.00 0.00 ? 86  SER A HG   8  
ATOM   11219 N  N    . VAL A 1 87 ? 2.258   14.189  -16.545 1.00 0.00 ? 87  VAL A N    8  
ATOM   11220 C  CA   . VAL A 1 87 ? 1.667   15.248  -15.684 1.00 0.00 ? 87  VAL A CA   8  
ATOM   11221 C  C    . VAL A 1 87 ? 2.713   16.352  -15.412 1.00 0.00 ? 87  VAL A C    8  
ATOM   11222 O  O    . VAL A 1 87 ? 2.430   17.557  -15.500 1.00 0.00 ? 87  VAL A O    8  
ATOM   11223 C  CB   . VAL A 1 87 ? 1.166   14.660  -14.303 1.00 0.00 ? 87  VAL A CB   8  
ATOM   11224 C  CG1  . VAL A 1 87 ? 0.365   15.715  -13.509 1.00 0.00 ? 87  VAL A CG1  8  
ATOM   11225 C  CG2  . VAL A 1 87 ? 0.336   13.367  -14.491 1.00 0.00 ? 87  VAL A CG2  8  
ATOM   11226 H  H    . VAL A 1 87 ? 2.523   13.346  -16.134 1.00 0.00 ? 87  VAL A H    8  
ATOM   11227 H  HA   . VAL A 1 87 ? 0.815   15.683  -16.208 1.00 0.00 ? 87  VAL A HA   8  
ATOM   11228 H  HB   . VAL A 1 87 ? 2.050   14.398  -13.713 1.00 0.00 ? 87  VAL A HB   8  
ATOM   11229 H  HG11 . VAL A 1 87 ? -0.508  16.017  -14.075 1.00 0.00 ? 87  VAL A HG11 8  
ATOM   11230 H  HG12 . VAL A 1 87 ? 0.984   16.586  -13.326 1.00 0.00 ? 87  VAL A HG12 8  
ATOM   11231 H  HG13 . VAL A 1 87 ? 0.048   15.305  -12.556 1.00 0.00 ? 87  VAL A HG13 8  
ATOM   11232 H  HG21 . VAL A 1 87 ? 0.926   12.629  -15.020 1.00 0.00 ? 87  VAL A HG21 8  
ATOM   11233 H  HG22 . VAL A 1 87 ? -0.552  13.583  -15.063 1.00 0.00 ? 87  VAL A HG22 8  
ATOM   11234 H  HG23 . VAL A 1 87 ? 0.049   12.965  -13.527 1.00 0.00 ? 87  VAL A HG23 8  
ATOM   11235 N  N    . VAL A 1 88 ? 3.922   15.881  -15.098 1.00 0.00 ? 88  VAL A N    8  
ATOM   11236 C  CA   . VAL A 1 88 ? 5.090   16.708  -14.746 1.00 0.00 ? 88  VAL A CA   8  
ATOM   11237 C  C    . VAL A 1 88 ? 5.598   17.421  -16.002 1.00 0.00 ? 88  VAL A C    8  
ATOM   11238 O  O    . VAL A 1 88 ? 5.971   18.605  -15.