data_2MF0
# 
_entry.id   2MF0 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2MF0         
RCSB  RCSB103548   
BMRB  19534        
WWPDB D_1000103548 
# 
loop_
_pdbx_database_related.db_id 
_pdbx_database_related.db_name 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
19534 BMRB unspecified . 
2MF1  PDB  unspecified . 
# 
_pdbx_database_status.deposit_site                    BMRB 
_pdbx_database_status.entry_id                        2MF0 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2013-10-02 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  REL 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Duss, O.'        1 
'Michel, E.'      2 
'Yulikov, M.'     3 
'Schubert, M.'    4 
'Jeschke, G.'     5 
'Allain, F.H.-T.' 6 
# 
_citation.id                        primary 
_citation.title                     'Structural basis of the non-coding RNA RsmZ acting as a protein sponge.' 
_citation.journal_abbrev            Nature 
_citation.journal_volume            509 
_citation.page_first                588 
_citation.page_last                 592 
_citation.year                      2014 
_citation.journal_id_ASTM           NATUAS 
_citation.country                   UK 
_citation.journal_id_ISSN           0028-0836 
_citation.journal_id_CSD            0006 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   24828038 
_citation.pdbx_database_id_DOI      10.1038/nature13271 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Duss, O.'     1 
primary 'Michel, E.'   2 
primary 'Yulikov, M.'  3 
primary 'Schubert, M.' 4 
primary 'Jeschke, G.'  5 
primary 'Allain, F.H.' 6 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Carbon storage regulator homolog' 7847.951  6 ? ? ? ? 
2 polymer syn 'RNA_(72-MER)'                     23372.031 1 ? ? ? ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'   no no MLILTRKVGESINIGDDITITILGVSGQQVRIGINAPKDVAVHREEIYQRIQAGLTAPDKRETPHHHHHH   
MLILTRKVGESINIGDDITITILGVSGQQVRIGINAPKDVAVHREEIYQRIQAGLTAPDKRETPHHHHHH   A,B,C,D,E,F ? 
2 polyribonucleotide no no UGUCGACGGAUAGACACAGCCAUCAAGGACGAUGGUCAGGACAUCGCAGGAAGCGAUUCAUCAGGACGAUGA 
UGUCGACGGAUAGACACAGCCAUCAAGGACGAUGGUCAGGACAUCGCAGGAAGCGAUUCAUCAGGACGAUGA G           ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  MET n 
1 2  LEU n 
1 3  ILE n 
1 4  LEU n 
1 5  THR n 
1 6  ARG n 
1 7  LYS n 
1 8  VAL n 
1 9  GLY n 
1 10 GLU n 
1 11 SER n 
1 12 ILE n 
1 13 ASN n 
1 14 ILE n 
1 15 GLY n 
1 16 ASP n 
1 17 ASP n 
1 18 ILE n 
1 19 THR n 
1 20 ILE n 
1 21 THR n 
1 22 ILE n 
1 23 LEU n 
1 24 GLY n 
1 25 VAL n 
1 26 SER n 
1 27 GLY n 
1 28 GLN n 
1 29 GLN n 
1 30 VAL n 
1 31 ARG n 
1 32 ILE n 
1 33 GLY n 
1 34 ILE n 
1 35 ASN n 
1 36 ALA n 
1 37 PRO n 
1 38 LYS n 
1 39 ASP n 
1 40 VAL n 
1 41 ALA n 
1 42 VAL n 
1 43 HIS n 
1 44 ARG n 
1 45 GLU n 
1 46 GLU n 
1 47 ILE n 
1 48 TYR n 
1 49 GLN n 
1 50 ARG n 
1 51 ILE n 
1 52 GLN n 
1 53 ALA n 
1 54 GLY n 
1 55 LEU n 
1 56 THR n 
1 57 ALA n 
1 58 PRO n 
1 59 ASP n 
1 60 LYS n 
1 61 ARG n 
1 62 GLU n 
1 63 THR n 
1 64 PRO n 
1 65 HIS n 
1 66 HIS n 
1 67 HIS n 
1 68 HIS n 
1 69 HIS n 
1 70 HIS n 
2 1  U   n 
2 2  G   n 
2 3  U   n 
2 4  C   n 
2 5  G   n 
2 6  A   n 
2 7  C   n 
2 8  G   n 
2 9  G   n 
2 10 A   n 
2 11 U   n 
2 12 A   n 
2 13 G   n 
2 14 A   n 
2 15 C   n 
2 16 A   n 
2 17 C   n 
2 18 A   n 
2 19 G   n 
2 20 C   n 
2 21 C   n 
2 22 A   n 
2 23 U   n 
2 24 C   n 
2 25 A   n 
2 26 A   n 
2 27 G   n 
2 28 G   n 
2 29 A   n 
2 30 C   n 
2 31 G   n 
2 32 A   n 
2 33 U   n 
2 34 G   n 
2 35 G   n 
2 36 U   n 
2 37 C   n 
2 38 A   n 
2 39 G   n 
2 40 G   n 
2 41 A   n 
2 42 C   n 
2 43 A   n 
2 44 U   n 
2 45 C   n 
2 46 G   n 
2 47 C   n 
2 48 A   n 
2 49 G   n 
2 50 G   n 
2 51 A   n 
2 52 A   n 
2 53 G   n 
2 54 C   n 
2 55 G   n 
2 56 A   n 
2 57 U   n 
2 58 U   n 
2 59 C   n 
2 60 A   n 
2 61 U   n 
2 62 C   n 
2 63 A   n 
2 64 G   n 
2 65 G   n 
2 66 A   n 
2 67 C   n 
2 68 G   n 
2 69 A   n 
2 70 U   n 
2 71 G   n 
2 72 A   n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'rsmE, csrA, PFL_2095' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    CHA0 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Pseudomonas protegens Pf-5' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     220664 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               pET28a 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP Q4KEY0_PSEF5 Q4KEY0 1 MLILTRKVGESINIGDDITITILGVSGQQVRIGINAPKDVAVHREEIYQRIQAGLTAPD              1 ? 
2 PDB 2MF0         2MF0   2 UGUCGACGGAUAGACACAGCCAUCAAGGACGAUGGUCAGGACAUCGCAGGAAGCGAUUCAUCAGGACGAUGA ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2MF0 A 1 ? 59 ? Q4KEY0 1 ? 59 ? 1 59 
2 1 2MF0 B 1 ? 59 ? Q4KEY0 1 ? 59 ? 1 59 
3 1 2MF0 C 1 ? 59 ? Q4KEY0 1 ? 59 ? 1 59 
4 1 2MF0 D 1 ? 59 ? Q4KEY0 1 ? 59 ? 1 59 
5 1 2MF0 E 1 ? 59 ? Q4KEY0 1 ? 59 ? 1 59 
6 1 2MF0 F 1 ? 59 ? Q4KEY0 1 ? 59 ? 1 59 
7 2 2MF0 G 1 ? 72 ? 2MF0   1 ? 72 ? 1 72 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2MF0 LYS A 60 ? UNP Q4KEY0 ? ? 'EXPRESSION TAG' 60 1  
1 2MF0 ARG A 61 ? UNP Q4KEY0 ? ? 'EXPRESSION TAG' 61 2  
1 2MF0 GLU A 62 ? UNP Q4KEY0 ? ? 'EXPRESSION TAG' 62 3  
1 2MF0 THR A 63 ? UNP Q4KEY0 ? ? 'EXPRESSION TAG' 63 4  
1 2MF0 PRO A 64 ? UNP Q4KEY0 ? ? 'EXPRESSION TAG' 64 5  
1 2MF0 HIS A 65 ? UNP Q4KEY0 ? ? 'EXPRESSION TAG' 65 6  
1 2MF0 HIS A 66 ? UNP Q4KEY0 ? ? 'EXPRESSION TAG' 66 7  
1 2MF0 HIS A 67 ? UNP Q4KEY0 ? ? 'EXPRESSION TAG' 67 8  
1 2MF0 HIS A 68 ? UNP Q4KEY0 ? ? 'EXPRESSION TAG' 68 9  
1 2MF0 HIS A 69 ? UNP Q4KEY0 ? ? 'EXPRESSION TAG' 69 10 
1 2MF0 HIS A 70 ? UNP Q4KEY0 ? ? 'EXPRESSION TAG' 70 11 
2 2MF0 LYS B 60 ? UNP Q4KEY0 ? ? 'EXPRESSION TAG' 60 12 
2 2MF0 ARG B 61 ? UNP Q4KEY0 ? ? 'EXPRESSION TAG' 61 13 
2 2MF0 GLU B 62 ? UNP Q4KEY0 ? ? 'EXPRESSION TAG' 62 14 
2 2MF0 THR B 63 ? UNP Q4KEY0 ? ? 'EXPRESSION TAG' 63 15 
2 2MF0 PRO B 64 ? UNP Q4KEY0 ? ? 'EXPRESSION TAG' 64 16 
2 2MF0 HIS B 65 ? UNP Q4KEY0 ? ? 'EXPRESSION TAG' 65 17 
2 2MF0 HIS B 66 ? UNP Q4KEY0 ? ? 'EXPRESSION TAG' 66 18 
2 2MF0 HIS B 67 ? UNP Q4KEY0 ? ? 'EXPRESSION TAG' 67 19 
2 2MF0 HIS B 68 ? UNP Q4KEY0 ? ? 'EXPRESSION TAG' 68 20 
2 2MF0 HIS B 69 ? UNP Q4KEY0 ? ? 'EXPRESSION TAG' 69 21 
2 2MF0 HIS B 70 ? UNP Q4KEY0 ? ? 'EXPRESSION TAG' 70 22 
3 2MF0 LYS C 60 ? UNP Q4KEY0 ? ? 'EXPRESSION TAG' 60 23 
3 2MF0 ARG C 61 ? UNP Q4KEY0 ? ? 'EXPRESSION TAG' 61 24 
3 2MF0 GLU C 62 ? UNP Q4KEY0 ? ? 'EXPRESSION TAG' 62 25 
3 2MF0 THR C 63 ? UNP Q4KEY0 ? ? 'EXPRESSION TAG' 63 26 
3 2MF0 PRO C 64 ? UNP Q4KEY0 ? ? 'EXPRESSION TAG' 64 27 
3 2MF0 HIS C 65 ? UNP Q4KEY0 ? ? 'EXPRESSION TAG' 65 28 
3 2MF0 HIS C 66 ? UNP Q4KEY0 ? ? 'EXPRESSION TAG' 66 29 
3 2MF0 HIS C 67 ? UNP Q4KEY0 ? ? 'EXPRESSION TAG' 67 30 
3 2MF0 HIS C 68 ? UNP Q4KEY0 ? ? 'EXPRESSION TAG' 68 31 
3 2MF0 HIS C 69 ? UNP Q4KEY0 ? ? 'EXPRESSION TAG' 69 32 
3 2MF0 HIS C 70 ? UNP Q4KEY0 ? ? 'EXPRESSION TAG' 70 33 
4 2MF0 LYS D 60 ? UNP Q4KEY0 ? ? 'EXPRESSION TAG' 60 34 
4 2MF0 ARG D 61 ? UNP Q4KEY0 ? ? 'EXPRESSION TAG' 61 35 
4 2MF0 GLU D 62 ? UNP Q4KEY0 ? ? 'EXPRESSION TAG' 62 36 
4 2MF0 THR D 63 ? UNP Q4KEY0 ? ? 'EXPRESSION TAG' 63 37 
4 2MF0 PRO D 64 ? UNP Q4KEY0 ? ? 'EXPRESSION TAG' 64 38 
4 2MF0 HIS D 65 ? UNP Q4KEY0 ? ? 'EXPRESSION TAG' 65 39 
4 2MF0 HIS D 66 ? UNP Q4KEY0 ? ? 'EXPRESSION TAG' 66 40 
4 2MF0 HIS D 67 ? UNP Q4KEY0 ? ? 'EXPRESSION TAG' 67 41 
4 2MF0 HIS D 68 ? UNP Q4KEY0 ? ? 'EXPRESSION TAG' 68 42 
4 2MF0 HIS D 69 ? UNP Q4KEY0 ? ? 'EXPRESSION TAG' 69 43 
4 2MF0 HIS D 70 ? UNP Q4KEY0 ? ? 'EXPRESSION TAG' 70 44 
5 2MF0 LYS E 60 ? UNP Q4KEY0 ? ? 'EXPRESSION TAG' 60 45 
5 2MF0 ARG E 61 ? UNP Q4KEY0 ? ? 'EXPRESSION TAG' 61 46 
5 2MF0 GLU E 62 ? UNP Q4KEY0 ? ? 'EXPRESSION TAG' 62 47 
5 2MF0 THR E 63 ? UNP Q4KEY0 ? ? 'EXPRESSION TAG' 63 48 
5 2MF0 PRO E 64 ? UNP Q4KEY0 ? ? 'EXPRESSION TAG' 64 49 
5 2MF0 HIS E 65 ? UNP Q4KEY0 ? ? 'EXPRESSION TAG' 65 50 
5 2MF0 HIS E 66 ? UNP Q4KEY0 ? ? 'EXPRESSION TAG' 66 51 
5 2MF0 HIS E 67 ? UNP Q4KEY0 ? ? 'EXPRESSION TAG' 67 52 
5 2MF0 HIS E 68 ? UNP Q4KEY0 ? ? 'EXPRESSION TAG' 68 53 
5 2MF0 HIS E 69 ? UNP Q4KEY0 ? ? 'EXPRESSION TAG' 69 54 
5 2MF0 HIS E 70 ? UNP Q4KEY0 ? ? 'EXPRESSION TAG' 70 55 
6 2MF0 LYS F 60 ? UNP Q4KEY0 ? ? 'EXPRESSION TAG' 60 56 
6 2MF0 ARG F 61 ? UNP Q4KEY0 ? ? 'EXPRESSION TAG' 61 57 
6 2MF0 GLU F 62 ? UNP Q4KEY0 ? ? 'EXPRESSION TAG' 62 58 
6 2MF0 THR F 63 ? UNP Q4KEY0 ? ? 'EXPRESSION TAG' 63 59 
6 2MF0 PRO F 64 ? UNP Q4KEY0 ? ? 'EXPRESSION TAG' 64 60 
6 2MF0 HIS F 65 ? UNP Q4KEY0 ? ? 'EXPRESSION TAG' 65 61 
6 2MF0 HIS F 66 ? UNP Q4KEY0 ? ? 'EXPRESSION TAG' 66 62 
6 2MF0 HIS F 67 ? UNP Q4KEY0 ? ? 'EXPRESSION TAG' 67 63 
6 2MF0 HIS F 68 ? UNP Q4KEY0 ? ? 'EXPRESSION TAG' 68 64 
6 2MF0 HIS F 69 ? UNP Q4KEY0 ? ? 'EXPRESSION TAG' 69 65 
6 2MF0 HIS F 70 ? UNP Q4KEY0 ? ? 'EXPRESSION TAG' 70 66 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
A   'RNA linking'       y "ADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
ALA 'L-peptide linking' y ALANINE                      ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                     ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                   ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'              ? 'C4 H7 N O4'      133.103 
C   'RNA linking'       y "CYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O8 P'  323.197 
G   'RNA linking'       y "GUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O8 P' 363.221 
GLN 'L-peptide linking' y GLUTAMINE                    ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'              ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                      ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                    ? 'C6 H10 N3 O2 1'  156.162 
ILE 'L-peptide linking' y ISOLEUCINE                   ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                      ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                       ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                   ? 'C5 H11 N O2 S'   149.211 
PRO 'L-peptide linking' y PROLINE                      ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                       ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                    ? 'C4 H9 N O3'      119.119 
TYR 'L-peptide linking' y TYROSINE                     ? 'C9 H11 N O3'     181.189 
U   'RNA linking'       y "URIDINE-5'-MONOPHOSPHATE"   ? 'C9 H13 N2 O9 P'  324.181 
VAL 'L-peptide linking' y VALINE                       ? 'C5 H11 N O2'     117.146 
# 
loop_
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.type 
1 1  1 '2D 1H-15N HSQC'  
1 2  2 '2D 1H-15N HSQC'  
1 3  3 '2D 1H-15N HSQC'  
1 4  4 '2D 1H-15N HSQC'  
1 5  5 '2D 1H-15N HSQC'  
1 6  1 '2D 1H-13C TROSY' 
1 7  2 '2D 1H-13C TROSY' 
1 8  3 '2D 1H-13C TROSY' 
1 9  4 '2D 1H-13C TROSY' 
1 10 5 '2D 1H-13C TROSY' 
1 11 6 '2D 1H-15N HSQC'  
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      0.18 
_pdbx_nmr_exptl_sample_conditions.pH                  7.2 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature         313 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
loop_
_pdbx_nmr_sample_details.contents 
_pdbx_nmr_sample_details.solution_id 
_pdbx_nmr_sample_details.solvent_system 
;0.2 mM [U-13C; U-15N], segmentally labeled RNA (1-16 LABELED), 1.2 mM [U-100% 15N; U-80% 2H] RsmE, 0.03 mM sodium chloride, 0.05 mM potassium phosphate, 95% H2O/5% D2O
;
1 '95% H2O/5% D2O' 
;0.2 mM [U-13C; U-15N], segmentally labeled RNA (17-40 LABELED), 1.2 mM [U-100% 15N; U-80% 2H] RsmE, 0.03 mM sodium chloride, 0.05 mM potassium phosphate, 95% H2O/5% D2O
;
2 '95% H2O/5% D2O' 
;0.2 mM [U-13C; U-15N], segmentally labeled RNA (41-58 LABELED), 1.2 mM [U-100% 15N; U-80% 2H] RsmE, 0.03 mM sodium chloride, 0.05 mM potassium phosphate, 95% H2O/5% D2O
;
3 '95% H2O/5% D2O' 
;0.2 mM [U-13C; U-15N], segmentally labeled RNA (59-72 LABELED), 1.2 mM [U-100% 15N; U-80% 2H] RsmE, 0.03 mM sodium chloride, 0.05 mM potassium phosphate, 95% H2O/5% D2O
;
4 '95% H2O/5% D2O' 
;0.2 mM [U-13C; U-15N], segmentally labeled RNA (36-44 LABELED), 1.2 mM [U-100% 15N; U-80% 2H] RsmE, 0.03 mM sodium chloride, 0.05 mM potassium phosphate, 95% H2O/5% D2O
;
5 '95% H2O/5% D2O' 
'0.2 mM RNA (72-MER), 1.2 mM [U-100% 15N; U-80% 2H] RsmE, 0.03 mM sodium chloride, 0.05 mM potassium phosphate, 95% H2O/5% D2O' 6 
'95% H2O/5% D2O' 
# 
loop_
_pdbx_nmr_spectrometer.field_strength 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.type 
500 Bruker Avance 1 'Bruker Avance' 
600 Bruker Avance 2 'Bruker Avance' 
700 Bruker Avance 3 'Bruker Avance' 
900 Bruker Avance 4 'Bruker Avance' 
# 
_pdbx_nmr_refine.entry_id           2MF0 
_pdbx_nmr_refine.method             'simulated annealing' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy' 
_pdbx_nmr_ensemble.conformers_calculated_total_number            2500 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.entry_id                                      2MF0 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    0.61 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   0.25 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.entry_id             2MF0 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.authors 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.ordinal 
'Guntert, Mumenthaler and Wuthrich'                                    'structure solution' CYANA   ? 1 
'Case, Darden, Cheatham, III, Simmerling, Wang, Duke, Luo and Kollman' refinement           AMBER   ? 2 
'Bruker Biospin'                                                       processing           TOPSPIN ? 3 
Goddard                                                                'data analysis'      SPARKY  ? 4 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.entry_id                   2MF0 
_exptl.method                     'SOLUTION NMR' 
_exptl.method_details             ? 
# 
_struct.entry_id                  2MF0 
_struct.title                     
'Structural basis of the non-coding RNA RsmZ acting as protein sponge: Conformer L of RsmZ(1-72)/RsmE(dimer) 1to3 complex' 
_struct.pdbx_descriptor           'Carbon storage regulator homolog' 
_struct.pdbx_model_details        'lowest energy, model1' 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2MF0 
_struct_keywords.pdbx_keywords   'RNA BINDING PROTEIN/RNA' 
_struct_keywords.text            
;Protein/RNA, non-coding RNA, translation repressor protein, Pseudomonas aeruginosa, messenger RNA, protein sequestration, two conformations, RNAse E cleave sites, homo-dimeric proteins, cooperativity, multiple protein binding sites, translation activation, ribosome binding site, large solution structure, electron paramagnetic resonance, protein sponge, RNP assembly, RNA BINDING PROTEIN-RNA complex
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 1 ? 
F N N 1 ? 
G N N 2 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 GLU A 45 ? GLN A 52 ? GLU A 45 GLN A 52 1 ? 8 
HELX_P HELX_P2 2 GLU B 45 ? GLN B 52 ? GLU B 45 GLN B 52 1 ? 8 
HELX_P HELX_P3 3 GLU C 45 ? GLN C 52 ? GLU C 45 GLN C 52 1 ? 8 
HELX_P HELX_P4 4 GLU D 45 ? GLN D 52 ? GLU D 45 GLN D 52 1 ? 8 
HELX_P HELX_P5 5 GLU E 45 ? GLN E 52 ? GLU E 45 GLN E 52 1 ? 8 
HELX_P HELX_P6 6 GLU F 45 ? GLN F 49 ? GLU F 45 GLN F 49 1 ? 5 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
hydrog1  hydrog ? ? G U 1  N3 ? ? ? 1_555 G A 16 N1 ? ? G U 1  G A 16 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog2  hydrog ? ? G U 1  O4 ? ? ? 1_555 G A 16 N6 ? ? G U 1  G A 16 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog3  hydrog ? ? G G 2  N1 ? ? ? 1_555 G C 15 N3 ? ? G G 2  G C 15 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog4  hydrog ? ? G G 2  N2 ? ? ? 1_555 G C 15 O2 ? ? G G 2  G C 15 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog5  hydrog ? ? G G 2  O6 ? ? ? 1_555 G C 15 N4 ? ? G G 2  G C 15 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog6  hydrog ? ? G U 3  N3 ? ? ? 1_555 G A 14 N1 ? ? G U 3  G A 14 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog7  hydrog ? ? G U 3  O4 ? ? ? 1_555 G A 14 N6 ? ? G U 3  G A 14 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog8  hydrog ? ? G C 4  N3 ? ? ? 1_555 G G 13 N1 ? ? G C 4  G G 13 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog9  hydrog ? ? G C 4  N4 ? ? ? 1_555 G G 13 O6 ? ? G C 4  G G 13 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog10 hydrog ? ? G C 4  O2 ? ? ? 1_555 G G 13 N2 ? ? G C 4  G G 13 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog11 hydrog ? ? G G 8  N2 ? ? ? 1_555 G G 9  N7 ? ? G G 8  G G 9  1_555 ? ? ? ? ? ? 'G-G MISPAIR' ? ? 
hydrog12 hydrog ? ? G G 19 N1 ? ? ? 1_555 G U 36 O2 ? ? G G 19 G U 36 1_555 ? ? ? ? ? ? TYPE_28_PAIR  ? ? 
hydrog13 hydrog ? ? G G 19 O6 ? ? ? 1_555 G U 36 N3 ? ? G G 19 G U 36 1_555 ? ? ? ? ? ? TYPE_28_PAIR  ? ? 
hydrog14 hydrog ? ? G C 20 N3 ? ? ? 1_555 G G 35 N1 ? ? G C 20 G G 35 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog15 hydrog ? ? G C 20 N4 ? ? ? 1_555 G G 35 O6 ? ? G C 20 G G 35 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog16 hydrog ? ? G C 20 O2 ? ? ? 1_555 G G 35 N2 ? ? G C 20 G G 35 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog17 hydrog ? ? G C 21 N3 ? ? ? 1_555 G G 34 N1 ? ? G C 21 G G 34 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog18 hydrog ? ? G C 21 N4 ? ? ? 1_555 G G 34 O6 ? ? G C 21 G G 34 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog19 hydrog ? ? G C 21 O2 ? ? ? 1_555 G G 34 N2 ? ? G C 21 G G 34 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog20 hydrog ? ? G A 22 N1 ? ? ? 1_555 G U 33 N3 ? ? G A 22 G U 33 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog21 hydrog ? ? G A 22 N6 ? ? ? 1_555 G U 33 O4 ? ? G A 22 G U 33 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog22 hydrog ? ? G U 23 N3 ? ? ? 1_555 G A 32 N1 ? ? G U 23 G A 32 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog23 hydrog ? ? G U 23 O4 ? ? ? 1_555 G A 32 N6 ? ? G U 23 G A 32 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog24 hydrog ? ? G C 24 N3 ? ? ? 1_555 G G 31 N1 ? ? G C 24 G G 31 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog25 hydrog ? ? G C 24 N4 ? ? ? 1_555 G G 31 O6 ? ? G C 24 G G 31 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog26 hydrog ? ? G C 24 O2 ? ? ? 1_555 G G 31 N2 ? ? G C 24 G G 31 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog27 hydrog ? ? G U 44 N3 ? ? ? 1_555 G A 56 N1 ? ? G U 44 G A 56 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog28 hydrog ? ? G U 44 O4 ? ? ? 1_555 G A 56 N6 ? ? G U 44 G A 56 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog29 hydrog ? ? G C 45 N3 ? ? ? 1_555 G G 55 N1 ? ? G C 45 G G 55 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog30 hydrog ? ? G C 45 N4 ? ? ? 1_555 G G 55 O6 ? ? G C 45 G G 55 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog31 hydrog ? ? G C 45 O2 ? ? ? 1_555 G G 55 N2 ? ? G C 45 G G 55 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog32 hydrog ? ? G G 46 N1 ? ? ? 1_555 G C 54 N3 ? ? G G 46 G C 54 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog33 hydrog ? ? G G 46 N2 ? ? ? 1_555 G C 54 O2 ? ? G G 46 G C 54 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog34 hydrog ? ? G G 46 O6 ? ? ? 1_555 G C 54 N4 ? ? G G 46 G C 54 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog35 hydrog ? ? G C 47 N3 ? ? ? 1_555 G G 53 N1 ? ? G C 47 G G 53 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog36 hydrog ? ? G C 47 N4 ? ? ? 1_555 G G 53 O6 ? ? G C 47 G G 53 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog37 hydrog ? ? G C 47 O2 ? ? ? 1_555 G G 53 N2 ? ? G C 47 G G 53 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog38 hydrog ? ? G G 49 N2 ? ? ? 1_555 G G 50 N7 ? ? G G 49 G G 50 1_555 ? ? ? ? ? ? 'G-G MISPAIR' ? ? 
hydrog39 hydrog ? ? G C 59 N3 ? ? ? 1_555 G G 71 N1 ? ? G C 59 G G 71 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog40 hydrog ? ? G C 59 N4 ? ? ? 1_555 G G 71 O6 ? ? G C 59 G G 71 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog41 hydrog ? ? G C 59 O2 ? ? ? 1_555 G G 71 N2 ? ? G C 59 G G 71 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog42 hydrog ? ? G A 60 N1 ? ? ? 1_555 G U 70 N3 ? ? G A 60 G U 70 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog43 hydrog ? ? G A 60 N6 ? ? ? 1_555 G U 70 O4 ? ? G A 60 G U 70 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog44 hydrog ? ? G U 61 N3 ? ? ? 1_555 G A 69 N1 ? ? G U 61 G A 69 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog45 hydrog ? ? G U 61 O4 ? ? ? 1_555 G A 69 N6 ? ? G U 61 G A 69 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog46 hydrog ? ? G C 62 N3 ? ? ? 1_555 G G 68 N1 ? ? G C 62 G G 68 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog47 hydrog ? ? G C 62 N4 ? ? ? 1_555 G G 68 O6 ? ? G C 62 G G 68 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog48 hydrog ? ? G C 62 O2 ? ? ? 1_555 G G 68 N2 ? ? G C 62 G G 68 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog49 hydrog ? ? G G 64 N2 ? ? ? 1_555 G G 65 N7 ? ? G G 64 G G 65 1_555 ? ? ? ? ? ? 'G-G MISPAIR' ? ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 5 ? 
C ? 5 ? 
D ? 5 ? 
E ? 5 ? 
F ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
C 4 5 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
D 4 5 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
E 4 5 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
F 4 5 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LEU A 2  ? LYS A 7  ? LEU A 2  LYS A 7  
A 2 GLN B 29 ? ASN B 35 ? GLN B 29 ASN B 35 
A 3 ILE B 18 ? SER B 26 ? ILE B 18 SER B 26 
A 4 SER B 11 ? ILE B 14 ? SER B 11 ILE B 14 
A 5 VAL A 42 ? ARG A 44 ? VAL A 42 ARG A 44 
B 1 LEU B 2  ? LYS B 7  ? LEU B 2  LYS B 7  
B 2 GLN A 29 ? ASN A 35 ? GLN A 29 ASN A 35 
B 3 ILE A 18 ? SER A 26 ? ILE A 18 SER A 26 
B 4 SER A 11 ? ILE A 14 ? SER A 11 ILE A 14 
B 5 VAL B 42 ? ARG B 44 ? VAL B 42 ARG B 44 
C 1 LEU C 2  ? LYS C 7  ? LEU C 2  LYS C 7  
C 2 GLN D 29 ? ASN D 35 ? GLN D 29 ASN D 35 
C 3 ILE D 18 ? SER D 26 ? ILE D 18 SER D 26 
C 4 SER D 11 ? ILE D 14 ? SER D 11 ILE D 14 
C 5 VAL C 42 ? ARG C 44 ? VAL C 42 ARG C 44 
D 1 LEU D 2  ? LYS D 7  ? LEU D 2  LYS D 7  
D 2 GLN C 29 ? ASN C 35 ? GLN C 29 ASN C 35 
D 3 ILE C 18 ? SER C 26 ? ILE C 18 SER C 26 
D 4 SER C 11 ? ILE C 14 ? SER C 11 ILE C 14 
D 5 VAL D 42 ? ARG D 44 ? VAL D 42 ARG D 44 
E 1 LEU E 2  ? LYS E 7  ? LEU E 2  LYS E 7  
E 2 GLN F 29 ? ASN F 35 ? GLN F 29 ASN F 35 
E 3 ILE F 18 ? SER F 26 ? ILE F 18 SER F 26 
E 4 SER F 11 ? ILE F 14 ? SER F 11 ILE F 14 
E 5 VAL E 42 ? ARG E 44 ? VAL E 42 ARG E 44 
F 1 LEU F 2  ? LYS F 7  ? LEU F 2  LYS F 7  
F 2 GLN E 29 ? ASN E 35 ? GLN E 29 ASN E 35 
F 3 ILE E 18 ? SER E 26 ? ILE E 18 SER E 26 
F 4 SER E 11 ? ILE E 14 ? SER E 11 ILE E 14 
F 5 VAL F 42 ? ARG F 44 ? VAL F 42 ARG F 44 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N LEU A 4  ? N LEU A 4  O ILE B 32 ? O ILE B 32 
A 2 3 O GLY B 33 ? O GLY B 33 N THR B 21 ? N THR B 21 
A 3 4 O ILE B 20 ? O ILE B 20 N ILE B 12 ? N ILE B 12 
A 4 5 O ASN B 13 ? O ASN B 13 N HIS A 43 ? N HIS A 43 
B 1 2 O ARG B 6  ? O ARG B 6  N VAL A 30 ? N VAL A 30 
B 2 3 O GLY A 33 ? O GLY A 33 N THR A 21 ? N THR A 21 
B 3 4 O ILE A 20 ? O ILE A 20 N ILE A 12 ? N ILE A 12 
B 4 5 N ASN A 13 ? N ASN A 13 O HIS B 43 ? O HIS B 43 
C 1 2 N LEU C 2  ? N LEU C 2  O ILE D 34 ? O ILE D 34 
C 2 3 O GLY D 33 ? O GLY D 33 N THR D 21 ? N THR D 21 
C 3 4 O ILE D 20 ? O ILE D 20 N ILE D 12 ? N ILE D 12 
C 4 5 O ASN D 13 ? O ASN D 13 N HIS C 43 ? N HIS C 43 
D 1 2 O LEU D 2  ? O LEU D 2  N ILE C 34 ? N ILE C 34 
D 2 3 O ASN C 35 ? O ASN C 35 N THR C 19 ? N THR C 19 
D 3 4 O ILE C 20 ? O ILE C 20 N ILE C 12 ? N ILE C 12 
D 4 5 N ASN C 13 ? N ASN C 13 O HIS D 43 ? O HIS D 43 
E 1 2 N LEU E 2  ? N LEU E 2  O ILE F 34 ? O ILE F 34 
E 2 3 O GLN F 29 ? O GLN F 29 N SER F 26 ? N SER F 26 
E 3 4 O ILE F 20 ? O ILE F 20 N ILE F 12 ? N ILE F 12 
E 4 5 O ASN F 13 ? O ASN F 13 N HIS E 43 ? N HIS E 43 
F 1 2 O LEU F 2  ? O LEU F 2  N ILE E 34 ? N ILE E 34 
F 2 3 O GLY E 33 ? O GLY E 33 N THR E 21 ? N THR E 21 
F 3 4 O ILE E 20 ? O ILE E 20 N ILE E 12 ? N ILE E 12 
F 4 5 N ASN E 13 ? N ASN E 13 O HIS F 43 ? O HIS F 43 
# 
_atom_sites.entry_id                    2MF0 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1      N N      . MET A 1 1  ? 1.972   35.595  11.210  1.00 0.00 ? 1  MET A N      1  
ATOM 2      C CA     . MET A 1 1  ? 1.803   34.229  10.682  1.00 0.00 ? 1  MET A CA     1  
ATOM 3      C C      . MET A 1 1  ? 1.893   33.223  11.823  1.00 0.00 ? 1  MET A C      1  
ATOM 4      O O      . MET A 1 1  ? 2.809   33.323  12.635  1.00 0.00 ? 1  MET A O      1  
ATOM 5      C CB     . MET A 1 1  ? 2.861   33.942  9.613   1.00 0.00 ? 1  MET A CB     1  
ATOM 6      C CG     . MET A 1 1  ? 2.445   32.790  8.702   1.00 0.00 ? 1  MET A CG     1  
ATOM 7      S SD     . MET A 1 1  ? 3.511   32.526  7.261   1.00 0.00 ? 1  MET A SD     1  
ATOM 8      C CE     . MET A 1 1  ? 5.031   31.979  8.079   1.00 0.00 ? 1  MET A CE     1  
ATOM 9      H H1     . MET A 1 1  ? 2.926   35.723  11.519  1.00 0.00 ? 1  MET A H1     1  
ATOM 10     H H2     . MET A 1 1  ? 1.351   35.752  11.991  1.00 0.00 ? 1  MET A H2     1  
ATOM 11     H H3     . MET A 1 1  ? 1.776   36.275  10.490  1.00 0.00 ? 1  MET A H3     1  
ATOM 12     H HA     . MET A 1 1  ? 0.814   34.150  10.228  1.00 0.00 ? 1  MET A HA     1  
ATOM 13     H HB2    . MET A 1 1  ? 2.999   34.833  9.001   1.00 0.00 ? 1  MET A HB2    1  
ATOM 14     H HB3    . MET A 1 1  ? 3.809   33.699  10.093  1.00 0.00 ? 1  MET A HB3    1  
ATOM 15     H HG2    . MET A 1 1  ? 2.408   31.870  9.284   1.00 0.00 ? 1  MET A HG2    1  
ATOM 16     H HG3    . MET A 1 1  ? 1.444   33.003  8.329   1.00 0.00 ? 1  MET A HG3    1  
ATOM 17     H HE1    . MET A 1 1  ? 5.425   32.781  8.707   1.00 0.00 ? 1  MET A HE1    1  
ATOM 18     H HE2    . MET A 1 1  ? 4.824   31.104  8.693   1.00 0.00 ? 1  MET A HE2    1  
ATOM 19     H HE3    . MET A 1 1  ? 5.774   31.720  7.326   1.00 0.00 ? 1  MET A HE3    1  
ATOM 20     N N      . LEU A 1 2  ? 0.952   32.278  11.919  1.00 0.00 ? 2  LEU A N      1  
ATOM 21     C CA     . LEU A 1 2  ? 0.906   31.308  13.000  1.00 0.00 ? 2  LEU A CA     1  
ATOM 22     C C      . LEU A 1 2  ? 1.588   30.016  12.556  1.00 0.00 ? 2  LEU A C      1  
ATOM 23     O O      . LEU A 1 2  ? 1.090   29.327  11.669  1.00 0.00 ? 2  LEU A O      1  
ATOM 24     C CB     . LEU A 1 2  ? -0.563  31.095  13.378  1.00 0.00 ? 2  LEU A CB     1  
ATOM 25     C CG     . LEU A 1 2  ? -0.838  30.514  14.769  1.00 0.00 ? 2  LEU A CG     1  
ATOM 26     C CD1    . LEU A 1 2  ? -2.067  29.614  14.691  1.00 0.00 ? 2  LEU A CD1    1  
ATOM 27     C CD2    . LEU A 1 2  ? 0.308   29.730  15.402  1.00 0.00 ? 2  LEU A CD2    1  
ATOM 28     H H      . LEU A 1 2  ? 0.237   32.192  11.207  1.00 0.00 ? 2  LEU A H      1  
ATOM 29     H HA     . LEU A 1 2  ? 1.436   31.710  13.863  1.00 0.00 ? 2  LEU A HA     1  
ATOM 30     H HB2    . LEU A 1 2  ? -1.074  32.057  13.324  1.00 0.00 ? 2  LEU A HB2    1  
ATOM 31     H HB3    . LEU A 1 2  ? -1.031  30.470  12.620  1.00 0.00 ? 2  LEU A HB3    1  
ATOM 32     H HG     . LEU A 1 2  ? -1.079  31.331  15.447  1.00 0.00 ? 2  LEU A HG     1  
ATOM 33     H HD11   . LEU A 1 2  ? -2.923  30.203  14.361  1.00 0.00 ? 2  LEU A HD11   1  
ATOM 34     H HD12   . LEU A 1 2  ? -1.889  28.797  13.992  1.00 0.00 ? 2  LEU A HD12   1  
ATOM 35     H HD13   . LEU A 1 2  ? -2.281  29.208  15.678  1.00 0.00 ? 2  LEU A HD13   1  
ATOM 36     H HD21   . LEU A 1 2  ? 1.152   30.398  15.580  1.00 0.00 ? 2  LEU A HD21   1  
ATOM 37     H HD22   . LEU A 1 2  ? -0.017  29.334  16.364  1.00 0.00 ? 2  LEU A HD22   1  
ATOM 38     H HD23   . LEU A 1 2  ? 0.602   28.904  14.757  1.00 0.00 ? 2  LEU A HD23   1  
ATOM 39     N N      . ILE A 1 3  ? 2.743   29.692  13.145  1.00 0.00 ? 3  ILE A N      1  
ATOM 40     C CA     . ILE A 1 3  ? 3.502   28.496  12.814  1.00 0.00 ? 3  ILE A CA     1  
ATOM 41     C C      . ILE A 1 3  ? 3.146   27.388  13.797  1.00 0.00 ? 3  ILE A C      1  
ATOM 42     O O      . ILE A 1 3  ? 3.106   27.610  15.005  1.00 0.00 ? 3  ILE A O      1  
ATOM 43     C CB     . ILE A 1 3  ? 5.010   28.769  12.787  1.00 0.00 ? 3  ILE A CB     1  
ATOM 44     C CG1    . ILE A 1 3  ? 5.430   29.577  11.555  1.00 0.00 ? 3  ILE A CG1    1  
ATOM 45     C CG2    . ILE A 1 3  ? 5.804   27.464  12.722  1.00 0.00 ? 3  ILE A CG2    1  
ATOM 46     C CD1    . ILE A 1 3  ? 5.042   31.050  11.638  1.00 0.00 ? 3  ILE A CD1    1  
ATOM 47     H H      . ILE A 1 3  ? 3.090   30.273  13.895  1.00 0.00 ? 3  ILE A H      1  
ATOM 48     H HA     . ILE A 1 3  ? 3.207   28.166  11.820  1.00 0.00 ? 3  ILE A HA     1  
ATOM 49     H HB     . ILE A 1 3  ? 5.305   29.300  13.692  1.00 0.00 ? 3  ILE A HB     1  
ATOM 50     H HG12   . ILE A 1 3  ? 6.515   29.531  11.453  1.00 0.00 ? 3  ILE A HG12   1  
ATOM 51     H HG13   . ILE A 1 3  ? 4.986   29.136  10.664  1.00 0.00 ? 3  ILE A HG13   1  
ATOM 52     H HG21   . ILE A 1 3  ? 5.517   26.896  11.836  1.00 0.00 ? 3  ILE A HG21   1  
ATOM 53     H HG22   . ILE A 1 3  ? 6.870   27.688  12.674  1.00 0.00 ? 3  ILE A HG22   1  
ATOM 54     H HG23   . ILE A 1 3  ? 5.624   26.862  13.611  1.00 0.00 ? 3  ILE A HG23   1  
ATOM 55     H HD11   . ILE A 1 3  ? 5.452   31.467  12.558  1.00 0.00 ? 3  ILE A HD11   1  
ATOM 56     H HD12   . ILE A 1 3  ? 5.459   31.586  10.788  1.00 0.00 ? 3  ILE A HD12   1  
ATOM 57     H HD13   . ILE A 1 3  ? 3.960   31.167  11.611  1.00 0.00 ? 3  ILE A HD13   1  
ATOM 58     N N      . LEU A 1 4  ? 2.909   26.185  13.268  1.00 0.00 ? 4  LEU A N      1  
ATOM 59     C CA     . LEU A 1 4  ? 2.597   24.995  14.040  1.00 0.00 ? 4  LEU A CA     1  
ATOM 60     C C      . LEU A 1 4  ? 3.432   23.824  13.532  1.00 0.00 ? 4  LEU A C      1  
ATOM 61     O O      . LEU A 1 4  ? 3.818   23.787  12.365  1.00 0.00 ? 4  LEU A O      1  
ATOM 62     C CB     . LEU A 1 4  ? 1.099   24.695  13.941  1.00 0.00 ? 4  LEU A CB     1  
ATOM 63     C CG     . LEU A 1 4  ? 0.220   25.829  14.471  1.00 0.00 ? 4  LEU A CG     1  
ATOM 64     C CD1    . LEU A 1 4  ? -1.252  25.597  14.146  1.00 0.00 ? 4  LEU A CD1    1  
ATOM 65     C CD2    . LEU A 1 4  ? 0.281   25.928  15.992  1.00 0.00 ? 4  LEU A CD2    1  
ATOM 66     H H      . LEU A 1 4  ? 2.999   26.075  12.267  1.00 0.00 ? 4  LEU A H      1  
ATOM 67     H HA     . LEU A 1 4  ? 2.858   25.165  15.084  1.00 0.00 ? 4  LEU A HA     1  
ATOM 68     H HB2    . LEU A 1 4  ? 0.855   24.519  12.894  1.00 0.00 ? 4  LEU A HB2    1  
ATOM 69     H HB3    . LEU A 1 4  ? 0.880   23.785  14.499  1.00 0.00 ? 4  LEU A HB3    1  
ATOM 70     H HG     . LEU A 1 4  ? 0.520   26.778  14.027  1.00 0.00 ? 4  LEU A HG     1  
ATOM 71     H HD11   . LEU A 1 4  ? -1.829  26.452  14.497  1.00 0.00 ? 4  LEU A HD11   1  
ATOM 72     H HD12   . LEU A 1 4  ? -1.374  25.494  13.068  1.00 0.00 ? 4  LEU A HD12   1  
ATOM 73     H HD13   . LEU A 1 4  ? -1.601  24.698  14.651  1.00 0.00 ? 4  LEU A HD13   1  
ATOM 74     H HD21   . LEU A 1 4  ? 1.303   26.118  16.320  1.00 0.00 ? 4  LEU A HD21   1  
ATOM 75     H HD22   . LEU A 1 4  ? -0.356  26.753  16.309  1.00 0.00 ? 4  LEU A HD22   1  
ATOM 76     H HD23   . LEU A 1 4  ? -0.089  25.002  16.430  1.00 0.00 ? 4  LEU A HD23   1  
ATOM 77     N N      . THR A 1 5  ? 3.694   22.848  14.403  1.00 0.00 ? 5  THR A N      1  
ATOM 78     C CA     . THR A 1 5  ? 4.532   21.700  14.101  1.00 0.00 ? 5  THR A CA     1  
ATOM 79     C C      . THR A 1 5  ? 3.698   20.436  14.251  1.00 0.00 ? 5  THR A C      1  
ATOM 80     O O      . THR A 1 5  ? 3.452   19.975  15.364  1.00 0.00 ? 5  THR A O      1  
ATOM 81     C CB     . THR A 1 5  ? 5.743   21.688  15.033  1.00 0.00 ? 5  THR A CB     1  
ATOM 82     O OG1    . THR A 1 5  ? 6.466   22.888  14.879  1.00 0.00 ? 5  THR A OG1    1  
ATOM 83     C CG2    . THR A 1 5  ? 6.698   20.534  14.737  1.00 0.00 ? 5  THR A CG2    1  
ATOM 84     H H      . THR A 1 5  ? 3.332   22.921  15.344  1.00 0.00 ? 5  THR A H      1  
ATOM 85     H HA     . THR A 1 5  ? 4.893   21.763  13.075  1.00 0.00 ? 5  THR A HA     1  
ATOM 86     H HB     . THR A 1 5  ? 5.402   21.610  16.065  1.00 0.00 ? 5  THR A HB     1  
ATOM 87     H HG1    . THR A 1 5  ? 6.690   23.194  15.765  1.00 0.00 ? 5  THR A HG1    1  
ATOM 88     H HG21   . THR A 1 5  ? 6.199   19.583  14.915  1.00 0.00 ? 5  THR A HG21   1  
ATOM 89     H HG22   . THR A 1 5  ? 7.030   20.586  13.700  1.00 0.00 ? 5  THR A HG22   1  
ATOM 90     H HG23   . THR A 1 5  ? 7.561   20.610  15.399  1.00 0.00 ? 5  THR A HG23   1  
ATOM 91     N N      . ARG A 1 6  ? 3.237   19.881  13.129  1.00 0.00 ? 6  ARG A N      1  
ATOM 92     C CA     . ARG A 1 6  ? 2.409   18.686  13.117  1.00 0.00 ? 6  ARG A CA     1  
ATOM 93     C C      . ARG A 1 6  ? 3.265   17.451  12.884  1.00 0.00 ? 6  ARG A C      1  
ATOM 94     O O      . ARG A 1 6  ? 4.424   17.559  12.495  1.00 0.00 ? 6  ARG A O      1  
ATOM 95     C CB     . ARG A 1 6  ? 1.324   18.811  12.044  1.00 0.00 ? 6  ARG A CB     1  
ATOM 96     C CG     . ARG A 1 6  ? 0.263   19.860  12.380  1.00 0.00 ? 6  ARG A CG     1  
ATOM 97     C CD     . ARG A 1 6  ? -0.848  19.307  13.275  1.00 0.00 ? 6  ARG A CD     1  
ATOM 98     N NE     . ARG A 1 6  ? -0.369  18.912  14.602  1.00 0.00 ? 6  ARG A NE     1  
ATOM 99     C CZ     . ARG A 1 6  ? 0.059   19.712  15.583  1.00 0.00 ? 6  ARG A CZ     1  
ATOM 100    N NH1    . ARG A 1 6  ? 0.006   21.041  15.497  1.00 0.00 ? 6  ARG A NH1    1  
ATOM 101    N NH2    . ARG A 1 6  ? 0.582   19.150  16.670  1.00 0.00 ? 6  ARG A NH2    1  
ATOM 102    H H      . ARG A 1 6  ? 3.553   20.248  12.241  1.00 0.00 ? 6  ARG A H      1  
ATOM 103    H HA     . ARG A 1 6  ? 1.945   18.560  14.094  1.00 0.00 ? 6  ARG A HA     1  
ATOM 104    H HB2    . ARG A 1 6  ? 1.800   19.084  11.101  1.00 0.00 ? 6  ARG A HB2    1  
ATOM 105    H HB3    . ARG A 1 6  ? 0.834   17.848  11.905  1.00 0.00 ? 6  ARG A HB3    1  
ATOM 106    H HG2    . ARG A 1 6  ? 0.731   20.724  12.853  1.00 0.00 ? 6  ARG A HG2    1  
ATOM 107    H HG3    . ARG A 1 6  ? -0.192  20.193  11.447  1.00 0.00 ? 6  ARG A HG3    1  
ATOM 108    H HD2    . ARG A 1 6  ? -1.635  20.050  13.391  1.00 0.00 ? 6  ARG A HD2    1  
ATOM 109    H HD3    . ARG A 1 6  ? -1.288  18.440  12.784  1.00 0.00 ? 6  ARG A HD3    1  
ATOM 110    H HE     . ARG A 1 6  ? -0.243  17.923  14.768  1.00 0.00 ? 6  ARG A HE     1  
ATOM 111    H HH11   . ARG A 1 6  ? -0.398  21.473  14.679  1.00 0.00 ? 6  ARG A HH11   1  
ATOM 112    H HH12   . ARG A 1 6  ? 0.448   21.609  16.205  1.00 0.00 ? 6  ARG A HH12   1  
ATOM 113    H HH21   . ARG A 1 6  ? 0.720   18.148  16.662  1.00 0.00 ? 6  ARG A HH21   1  
ATOM 114    H HH22   . ARG A 1 6  ? 0.984   19.717  17.401  1.00 0.00 ? 6  ARG A HH22   1  
ATOM 115    N N      . LYS A 1 7  ? 2.692   16.272  13.130  1.00 0.00 ? 7  LYS A N      1  
ATOM 116    C CA     . LYS A 1 7  ? 3.289   15.002  12.746  1.00 0.00 ? 7  LYS A CA     1  
ATOM 117    C C      . LYS A 1 7  ? 2.281   14.189  11.946  1.00 0.00 ? 7  LYS A C      1  
ATOM 118    O O      . LYS A 1 7  ? 1.085   14.468  12.007  1.00 0.00 ? 7  LYS A O      1  
ATOM 119    C CB     . LYS A 1 7  ? 3.799   14.243  13.972  1.00 0.00 ? 7  LYS A CB     1  
ATOM 120    C CG     . LYS A 1 7  ? 4.803   15.053  14.790  1.00 0.00 ? 7  LYS A CG     1  
ATOM 121    C CD     . LYS A 1 7  ? 4.206   15.945  15.880  1.00 0.00 ? 7  LYS A CD     1  
ATOM 122    C CE     . LYS A 1 7  ? 4.387   15.345  17.273  1.00 0.00 ? 7  LYS A CE     1  
ATOM 123    N NZ     . LYS A 1 7  ? 3.553   14.147  17.470  1.00 0.00 ? 7  LYS A NZ     1  
ATOM 124    H H      . LYS A 1 7  ? 1.763   16.257  13.529  1.00 0.00 ? 7  LYS A H      1  
ATOM 125    H HA     . LYS A 1 7  ? 4.132   15.186  12.080  1.00 0.00 ? 7  LYS A HA     1  
ATOM 126    H HB2    . LYS A 1 7  ? 2.964   13.929  14.598  1.00 0.00 ? 7  LYS A HB2    1  
ATOM 127    H HB3    . LYS A 1 7  ? 4.333   13.363  13.613  1.00 0.00 ? 7  LYS A HB3    1  
ATOM 128    H HG2    . LYS A 1 7  ? 5.505   14.356  15.247  1.00 0.00 ? 7  LYS A HG2    1  
ATOM 129    H HG3    . LYS A 1 7  ? 5.354   15.690  14.101  1.00 0.00 ? 7  LYS A HG3    1  
ATOM 130    H HD2    . LYS A 1 7  ? 4.713   16.909  15.855  1.00 0.00 ? 7  LYS A HD2    1  
ATOM 131    H HD3    . LYS A 1 7  ? 3.149   16.122  15.693  1.00 0.00 ? 7  LYS A HD3    1  
ATOM 132    H HE2    . LYS A 1 7  ? 5.439   15.092  17.414  1.00 0.00 ? 7  LYS A HE2    1  
ATOM 133    H HE3    . LYS A 1 7  ? 4.113   16.101  18.010  1.00 0.00 ? 7  LYS A HE3    1  
ATOM 134    H HZ1    . LYS A 1 7  ? 3.866   13.396  16.873  1.00 0.00 ? 7  LYS A HZ1    1  
ATOM 135    H HZ2    . LYS A 1 7  ? 3.611   13.836  18.429  1.00 0.00 ? 7  LYS A HZ2    1  
ATOM 136    H HZ3    . LYS A 1 7  ? 2.585   14.354  17.251  1.00 0.00 ? 7  LYS A HZ3    1  
ATOM 137    N N      . VAL A 1 8  ? 2.769   13.223  11.164  1.00 0.00 ? 8  VAL A N      1  
ATOM 138    C CA     . VAL A 1 8  ? 1.944   12.416  10.278  1.00 0.00 ? 8  VAL A CA     1  
ATOM 139    C C      . VAL A 1 8  ? 0.692   11.920  10.996  1.00 0.00 ? 8  VAL A C      1  
ATOM 140    O O      . VAL A 1 8  ? 0.780   11.225  12.007  1.00 0.00 ? 8  VAL A O      1  
ATOM 141    C CB     . VAL A 1 8  ? 2.766   11.243  9.741   1.00 0.00 ? 8  VAL A CB     1  
ATOM 142    C CG1    . VAL A 1 8  ? 1.886   10.303  8.920   1.00 0.00 ? 8  VAL A CG1    1  
ATOM 143    C CG2    . VAL A 1 8  ? 3.903   11.758  8.858   1.00 0.00 ? 8  VAL A CG2    1  
ATOM 144    H H      . VAL A 1 8  ? 3.767   13.065  11.161  1.00 0.00 ? 8  VAL A H      1  
ATOM 145    H HA     . VAL A 1 8  ? 1.626   13.024  9.428   1.00 0.00 ? 8  VAL A HA     1  
ATOM 146    H HB     . VAL A 1 8  ? 3.194   10.685  10.574  1.00 0.00 ? 8  VAL A HB     1  
ATOM 147    H HG11   . VAL A 1 8  ? 1.268   10.881  8.234   1.00 0.00 ? 8  VAL A HG11   1  
ATOM 148    H HG12   . VAL A 1 8  ? 2.509   9.608   8.357   1.00 0.00 ? 8  VAL A HG12   1  
ATOM 149    H HG13   . VAL A 1 8  ? 1.241   9.731   9.588   1.00 0.00 ? 8  VAL A HG13   1  
ATOM 150    H HG21   . VAL A 1 8  ? 3.508   12.420  8.088   1.00 0.00 ? 8  VAL A HG21   1  
ATOM 151    H HG22   . VAL A 1 8  ? 4.624   12.307  9.465   1.00 0.00 ? 8  VAL A HG22   1  
ATOM 152    H HG23   . VAL A 1 8  ? 4.412   10.917  8.387   1.00 0.00 ? 8  VAL A HG23   1  
ATOM 153    N N      . GLY A 1 9  ? -0.476  12.298  10.469  1.00 0.00 ? 9  GLY A N      1  
ATOM 154    C CA     . GLY A 1 9  ? -1.779  11.917  10.986  1.00 0.00 ? 9  GLY A CA     1  
ATOM 155    C C      . GLY A 1 9  ? -2.473  13.008  11.799  1.00 0.00 ? 9  GLY A C      1  
ATOM 156    O O      . GLY A 1 9  ? -3.673  12.894  12.045  1.00 0.00 ? 9  GLY A O      1  
ATOM 157    H H      . GLY A 1 9  ? -0.466  12.868  9.634   1.00 0.00 ? 9  GLY A H      1  
ATOM 158    H HA2    . GLY A 1 9  ? -2.421  11.659  10.145  1.00 0.00 ? 9  GLY A HA2    1  
ATOM 159    H HA3    . GLY A 1 9  ? -1.674  11.034  11.617  1.00 0.00 ? 9  GLY A HA3    1  
ATOM 160    N N      . GLU A 1 10 ? -1.766  14.060  12.220  1.00 0.00 ? 10 GLU A N      1  
ATOM 161    C CA     . GLU A 1 10 ? -2.356  15.133  13.009  1.00 0.00 ? 10 GLU A CA     1  
ATOM 162    C C      . GLU A 1 10 ? -3.053  16.181  12.139  1.00 0.00 ? 10 GLU A C      1  
ATOM 163    O O      . GLU A 1 10 ? -2.834  16.241  10.930  1.00 0.00 ? 10 GLU A O      1  
ATOM 164    C CB     . GLU A 1 10 ? -1.285  15.767  13.896  1.00 0.00 ? 10 GLU A CB     1  
ATOM 165    C CG     . GLU A 1 10 ? -0.702  14.763  14.891  1.00 0.00 ? 10 GLU A CG     1  
ATOM 166    C CD     . GLU A 1 10 ? 0.400   15.373  15.750  1.00 0.00 ? 10 GLU A CD     1  
ATOM 167    O OE1    . GLU A 1 10 ? 0.707   16.570  15.559  1.00 0.00 ? 10 GLU A OE1    1  
ATOM 168    O OE2    . GLU A 1 10 ? 0.962   14.637  16.592  1.00 0.00 ? 10 GLU A OE2    1  
ATOM 169    H H      . GLU A 1 10 ? -0.766  14.089  12.065  1.00 0.00 ? 10 GLU A H      1  
ATOM 170    H HA     . GLU A 1 10 ? -3.112  14.704  13.665  1.00 0.00 ? 10 GLU A HA     1  
ATOM 171    H HB2    . GLU A 1 10 ? -0.489  16.166  13.266  1.00 0.00 ? 10 GLU A HB2    1  
ATOM 172    H HB3    . GLU A 1 10 ? -1.737  16.586  14.455  1.00 0.00 ? 10 GLU A HB3    1  
ATOM 173    H HG2    . GLU A 1 10 ? -1.503  14.404  15.538  1.00 0.00 ? 10 GLU A HG2    1  
ATOM 174    H HG3    . GLU A 1 10 ? -0.289  13.911  14.349  1.00 0.00 ? 10 GLU A HG3    1  
ATOM 175    N N      . SER A 1 11 ? -3.875  17.037  12.760  1.00 0.00 ? 11 SER A N      1  
ATOM 176    C CA     . SER A 1 11 ? -4.787  17.922  12.047  1.00 0.00 ? 11 SER A CA     1  
ATOM 177    C C      . SER A 1 11 ? -4.812  19.354  12.579  1.00 0.00 ? 11 SER A C      1  
ATOM 178    O O      . SER A 1 11 ? -4.617  19.587  13.771  1.00 0.00 ? 11 SER A O      1  
ATOM 179    C CB     . SER A 1 11 ? -6.203  17.351  12.112  1.00 0.00 ? 11 SER A CB     1  
ATOM 180    O OG     . SER A 1 11 ? -6.267  16.065  11.534  1.00 0.00 ? 11 SER A OG     1  
ATOM 181    H H      . SER A 1 11 ? -3.976  16.978  13.763  1.00 0.00 ? 11 SER A H      1  
ATOM 182    H HA     . SER A 1 11 ? -4.480  17.963  11.003  1.00 0.00 ? 11 SER A HA     1  
ATOM 183    H HB2    . SER A 1 11 ? -6.511  17.285  13.156  1.00 0.00 ? 11 SER A HB2    1  
ATOM 184    H HB3    . SER A 1 11 ? -6.891  18.016  11.588  1.00 0.00 ? 11 SER A HB3    1  
ATOM 185    H HG     . SER A 1 11 ? -6.413  16.163  10.587  1.00 0.00 ? 11 SER A HG     1  
ATOM 186    N N      . ILE A 1 12 ? -5.144  20.301  11.696  1.00 0.00 ? 12 ILE A N      1  
ATOM 187    C CA     . ILE A 1 12 ? -5.445  21.691  12.012  1.00 0.00 ? 12 ILE A CA     1  
ATOM 188    C C      . ILE A 1 12 ? -6.908  21.986  11.685  1.00 0.00 ? 12 ILE A C      1  
ATOM 189    O O      . ILE A 1 12 ? -7.495  21.338  10.821  1.00 0.00 ? 12 ILE A O      1  
ATOM 190    C CB     . ILE A 1 12 ? -4.519  22.659  11.265  1.00 0.00 ? 12 ILE A CB     1  
ATOM 191    C CG1    . ILE A 1 12 ? -3.041  22.257  11.285  1.00 0.00 ? 12 ILE A CG1    1  
ATOM 192    C CG2    . ILE A 1 12 ? -4.642  24.076  11.832  1.00 0.00 ? 12 ILE A CG2    1  
ATOM 193    C CD1    . ILE A 1 12 ? -2.399  22.392  12.665  1.00 0.00 ? 12 ILE A CD1    1  
ATOM 194    H H      . ILE A 1 12 ? -5.353  19.999  10.754  1.00 0.00 ? 12 ILE A H      1  
ATOM 195    H HA     . ILE A 1 12 ? -5.306  21.848  13.079  1.00 0.00 ? 12 ILE A HA     1  
ATOM 196    H HB     . ILE A 1 12 ? -4.832  22.687  10.221  1.00 0.00 ? 12 ILE A HB     1  
ATOM 197    H HG12   . ILE A 1 12 ? -2.928  21.230  10.936  1.00 0.00 ? 12 ILE A HG12   1  
ATOM 198    H HG13   . ILE A 1 12 ? -2.499  22.898  10.591  1.00 0.00 ? 12 ILE A HG13   1  
ATOM 199    H HG21   . ILE A 1 12 ? -4.576  24.062  12.921  1.00 0.00 ? 12 ILE A HG21   1  
ATOM 200    H HG22   . ILE A 1 12 ? -3.831  24.696  11.452  1.00 0.00 ? 12 ILE A HG22   1  
ATOM 201    H HG23   . ILE A 1 12 ? -5.586  24.527  11.528  1.00 0.00 ? 12 ILE A HG23   1  
ATOM 202    H HD11   . ILE A 1 12 ? -1.353  22.093  12.603  1.00 0.00 ? 12 ILE A HD11   1  
ATOM 203    H HD12   . ILE A 1 12 ? -2.433  23.430  12.993  1.00 0.00 ? 12 ILE A HD12   1  
ATOM 204    H HD13   . ILE A 1 12 ? -2.925  21.768  13.386  1.00 0.00 ? 12 ILE A HD13   1  
ATOM 205    N N      . ASN A 1 13 ? -7.495  22.988  12.342  1.00 0.00 ? 13 ASN A N      1  
ATOM 206    C CA     . ASN A 1 13 ? -8.838  23.475  12.079  1.00 0.00 ? 13 ASN A CA     1  
ATOM 207    C C      . ASN A 1 13 ? -8.808  24.982  11.838  1.00 0.00 ? 13 ASN A C      1  
ATOM 208    O O      . ASN A 1 13 ? -8.093  25.707  12.529  1.00 0.00 ? 13 ASN A O      1  
ATOM 209    C CB     . ASN A 1 13 ? -9.740  23.107  13.257  1.00 0.00 ? 13 ASN A CB     1  
ATOM 210    C CG     . ASN A 1 13 ? -11.204 23.079  12.846  1.00 0.00 ? 13 ASN A CG     1  
ATOM 211    O OD1    . ASN A 1 13 ? -11.797 24.108  12.533  1.00 0.00 ? 13 ASN A OD1    1  
ATOM 212    N ND2    . ASN A 1 13 ? -11.799 21.891  12.805  1.00 0.00 ? 13 ASN A ND2    1  
ATOM 213    H H      . ASN A 1 13 ? -6.955  23.495  13.030  1.00 0.00 ? 13 ASN A H      1  
ATOM 214    H HA     . ASN A 1 13 ? -9.226  22.991  11.182  1.00 0.00 ? 13 ASN A HA     1  
ATOM 215    H HB2    . ASN A 1 13 ? -9.460  22.122  13.630  1.00 0.00 ? 13 ASN A HB2    1  
ATOM 216    H HB3    . ASN A 1 13 ? -9.607  23.829  14.062  1.00 0.00 ? 13 ASN A HB3    1  
ATOM 217    H HD21   . ASN A 1 13 ? -11.314 21.074  13.158  1.00 0.00 ? 13 ASN A HD21   1  
ATOM 218    H HD22   . ASN A 1 13 ? -12.745 21.817  12.463  1.00 0.00 ? 13 ASN A HD22   1  
ATOM 219    N N      . ILE A 1 14 ? -9.565  25.451  10.842  1.00 0.00 ? 14 ILE A N      1  
ATOM 220    C CA     . ILE A 1 14 ? -9.585  26.842  10.418  1.00 0.00 ? 14 ILE A CA     1  
ATOM 221    C C      . ILE A 1 14 ? -11.032 27.319  10.317  1.00 0.00 ? 14 ILE A C      1  
ATOM 222    O O      . ILE A 1 14 ? -11.852 26.715  9.627   1.00 0.00 ? 14 ILE A O      1  
ATOM 223    C CB     . ILE A 1 14 ? -8.838  27.019  9.092   1.00 0.00 ? 14 ILE A CB     1  
ATOM 224    C CG1    . ILE A 1 14 ? -7.422  26.440  9.181   1.00 0.00 ? 14 ILE A CG1    1  
ATOM 225    C CG2    . ILE A 1 14 ? -8.792  28.502  8.720   1.00 0.00 ? 14 ILE A CG2    1  
ATOM 226    C CD1    . ILE A 1 14 ? -6.609  26.622  7.900   1.00 0.00 ? 14 ILE A CD1    1  
ATOM 227    H H      . ILE A 1 14 ? -10.180 24.810  10.359  1.00 0.00 ? 14 ILE A H      1  
ATOM 228    H HA     . ILE A 1 14 ? -9.082  27.448  11.171  1.00 0.00 ? 14 ILE A HA     1  
ATOM 229    H HB     . ILE A 1 14 ? -9.379  26.488  8.309   1.00 0.00 ? 14 ILE A HB     1  
ATOM 230    H HG12   . ILE A 1 14 ? -6.889  26.911  10.007  1.00 0.00 ? 14 ILE A HG12   1  
ATOM 231    H HG13   . ILE A 1 14 ? -7.485  25.370  9.378   1.00 0.00 ? 14 ILE A HG13   1  
ATOM 232    H HG21   . ILE A 1 14 ? -9.799  28.917  8.688   1.00 0.00 ? 14 ILE A HG21   1  
ATOM 233    H HG22   . ILE A 1 14 ? -8.199  29.052  9.451   1.00 0.00 ? 14 ILE A HG22   1  
ATOM 234    H HG23   . ILE A 1 14 ? -8.350  28.626  7.731   1.00 0.00 ? 14 ILE A HG23   1  
ATOM 235    H HD11   . ILE A 1 14 ? -7.199  26.309  7.038   1.00 0.00 ? 14 ILE A HD11   1  
ATOM 236    H HD12   . ILE A 1 14 ? -6.316  27.665  7.789   1.00 0.00 ? 14 ILE A HD12   1  
ATOM 237    H HD13   . ILE A 1 14 ? -5.708  26.011  7.956   1.00 0.00 ? 14 ILE A HD13   1  
ATOM 238    N N      . GLY A 1 15 ? -11.341 28.422  11.003  1.00 0.00 ? 15 GLY A N      1  
ATOM 239    C CA     . GLY A 1 15 ? -12.701 28.918  11.128  1.00 0.00 ? 15 GLY A CA     1  
ATOM 240    C C      . GLY A 1 15 ? -13.568 27.930  11.899  1.00 0.00 ? 15 GLY A C      1  
ATOM 241    O O      . GLY A 1 15 ? -13.200 27.497  12.990  1.00 0.00 ? 15 GLY A O      1  
ATOM 242    H H      . GLY A 1 15 ? -10.633 28.841  11.590  1.00 0.00 ? 15 GLY A H      1  
ATOM 243    H HA2    . GLY A 1 15 ? -12.694 29.871  11.657  1.00 0.00 ? 15 GLY A HA2    1  
ATOM 244    H HA3    . GLY A 1 15 ? -13.121 29.072  10.133  1.00 0.00 ? 15 GLY A HA3    1  
ATOM 245    N N      . ASP A 1 16 ? -14.723 27.580  11.331  1.00 0.00 ? 16 ASP A N      1  
ATOM 246    C CA     . ASP A 1 16 ? -15.613 26.562  11.866  1.00 0.00 ? 16 ASP A CA     1  
ATOM 247    C C      . ASP A 1 16 ? -16.029 25.524  10.822  1.00 0.00 ? 16 ASP A C      1  
ATOM 248    O O      . ASP A 1 16 ? -16.844 24.652  11.118  1.00 0.00 ? 16 ASP A O      1  
ATOM 249    C CB     . ASP A 1 16 ? -16.818 27.229  12.532  1.00 0.00 ? 16 ASP A CB     1  
ATOM 250    C CG     . ASP A 1 16 ? -17.779 27.866  11.531  1.00 0.00 ? 16 ASP A CG     1  
ATOM 251    O OD1    . ASP A 1 16 ? -17.380 28.855  10.878  1.00 0.00 ? 16 ASP A OD1    1  
ATOM 252    O OD2    . ASP A 1 16 ? -18.942 27.409  11.466  1.00 0.00 ? 16 ASP A OD2    1  
ATOM 253    H H      . ASP A 1 16 ? -15.024 28.067  10.498  1.00 0.00 ? 16 ASP A H      1  
ATOM 254    H HA     . ASP A 1 16 ? -15.077 26.015  12.642  1.00 0.00 ? 16 ASP A HA     1  
ATOM 255    H HB2    . ASP A 1 16 ? -17.351 26.480  13.118  1.00 0.00 ? 16 ASP A HB2    1  
ATOM 256    H HB3    . ASP A 1 16 ? -16.461 27.995  13.221  1.00 0.00 ? 16 ASP A HB3    1  
ATOM 257    N N      . ASP A 1 17 ? -15.473 25.595  9.608   1.00 0.00 ? 17 ASP A N      1  
ATOM 258    C CA     . ASP A 1 17 ? -15.847 24.730  8.500   1.00 0.00 ? 17 ASP A CA     1  
ATOM 259    C C      . ASP A 1 17 ? -14.679 23.922  7.937   1.00 0.00 ? 17 ASP A C      1  
ATOM 260    O O      . ASP A 1 17 ? -14.906 22.844  7.391   1.00 0.00 ? 17 ASP A O      1  
ATOM 261    C CB     . ASP A 1 17 ? -16.475 25.563  7.382   1.00 0.00 ? 17 ASP A CB     1  
ATOM 262    C CG     . ASP A 1 17 ? -17.926 25.933  7.676   1.00 0.00 ? 17 ASP A CG     1  
ATOM 263    O OD1    . ASP A 1 17 ? -18.748 25.003  7.833   1.00 0.00 ? 17 ASP A OD1    1  
ATOM 264    O OD2    . ASP A 1 17 ? -18.234 27.145  7.667   1.00 0.00 ? 17 ASP A OD2    1  
ATOM 265    H H      . ASP A 1 17 ? -14.785 26.314  9.436   1.00 0.00 ? 17 ASP A H      1  
ATOM 266    H HA     . ASP A 1 17 ? -16.591 24.009  8.840   1.00 0.00 ? 17 ASP A HA     1  
ATOM 267    H HB2    . ASP A 1 17 ? -15.881 26.464  7.225   1.00 0.00 ? 17 ASP A HB2    1  
ATOM 268    H HB3    . ASP A 1 17 ? -16.451 24.983  6.460   1.00 0.00 ? 17 ASP A HB3    1  
ATOM 269    N N      . ILE A 1 18 ? -13.445 24.429  8.021   1.00 0.00 ? 18 ILE A N      1  
ATOM 270    C CA     . ILE A 1 18 ? -12.306 23.841  7.333   1.00 0.00 ? 18 ILE A CA     1  
ATOM 271    C C      . ILE A 1 18 ? -11.450 23.037  8.307   1.00 0.00 ? 18 ILE A C      1  
ATOM 272    O O      . ILE A 1 18 ? -11.079 23.526  9.373   1.00 0.00 ? 18 ILE A O      1  
ATOM 273    C CB     . ILE A 1 18 ? -11.477 24.915  6.623   1.00 0.00 ? 18 ILE A CB     1  
ATOM 274    C CG1    . ILE A 1 18 ? -12.305 25.683  5.591   1.00 0.00 ? 18 ILE A CG1    1  
ATOM 275    C CG2    . ILE A 1 18 ? -10.273 24.281  5.923   1.00 0.00 ? 18 ILE A CG2    1  
ATOM 276    C CD1    . ILE A 1 18 ? -12.828 26.994  6.176   1.00 0.00 ? 18 ILE A CD1    1  
ATOM 277    H H      . ILE A 1 18 ? -13.288 25.283  8.538   1.00 0.00 ? 18 ILE A H      1  
ATOM 278    H HA     . ILE A 1 18 ? -12.673 23.156  6.570   1.00 0.00 ? 18 ILE A HA     1  
ATOM 279    H HB     . ILE A 1 18 ? -11.100 25.615  7.368   1.00 0.00 ? 18 ILE A HB     1  
ATOM 280    H HG12   . ILE A 1 18 ? -11.691 25.923  4.723   1.00 0.00 ? 18 ILE A HG12   1  
ATOM 281    H HG13   . ILE A 1 18 ? -13.146 25.074  5.259   1.00 0.00 ? 18 ILE A HG13   1  
ATOM 282    H HG21   . ILE A 1 18 ? -9.589  23.862  6.662   1.00 0.00 ? 18 ILE A HG21   1  
ATOM 283    H HG22   . ILE A 1 18 ? -10.605 23.493  5.247   1.00 0.00 ? 18 ILE A HG22   1  
ATOM 284    H HG23   . ILE A 1 18 ? -9.735  25.041  5.356   1.00 0.00 ? 18 ILE A HG23   1  
ATOM 285    H HD11   . ILE A 1 18 ? -13.483 26.790  7.021   1.00 0.00 ? 18 ILE A HD11   1  
ATOM 286    H HD12   . ILE A 1 18 ? -11.985 27.600  6.512   1.00 0.00 ? 18 ILE A HD12   1  
ATOM 287    H HD13   . ILE A 1 18 ? -13.384 27.535  5.411   1.00 0.00 ? 18 ILE A HD13   1  
ATOM 288    N N      . THR A 1 19 ? -11.056 21.835  7.883   1.00 0.00 ? 19 THR A N      1  
ATOM 289    C CA     . THR A 1 19 ? -10.129 20.984  8.613   1.00 0.00 ? 19 THR A CA     1  
ATOM 290    C C      . THR A 1 19 ? -9.015  20.516  7.686   1.00 0.00 ? 19 THR A C      1  
ATOM 291    O O      . THR A 1 19 ? -9.260  20.233  6.516   1.00 0.00 ? 19 THR A O      1  
ATOM 292    C CB     . THR A 1 19 ? -10.857 19.787  9.228   1.00 0.00 ? 19 THR A CB     1  
ATOM 293    O OG1    . THR A 1 19 ? -12.092 20.179  9.789   1.00 0.00 ? 19 THR A OG1    1  
ATOM 294    C CG2    . THR A 1 19 ? -10.030 19.152  10.344  1.00 0.00 ? 19 THR A CG2    1  
ATOM 295    H H      . THR A 1 19 ? -11.411 21.504  6.996   1.00 0.00 ? 19 THR A H      1  
ATOM 296    H HA     . THR A 1 19 ? -9.676  21.561  9.418   1.00 0.00 ? 19 THR A HA     1  
ATOM 297    H HB     . THR A 1 19 ? -11.044 19.043  8.453   1.00 0.00 ? 19 THR A HB     1  
ATOM 298    H HG1    . THR A 1 19 ? -12.546 19.389  10.098  1.00 0.00 ? 19 THR A HG1    1  
ATOM 299    H HG21   . THR A 1 19 ? -10.577 18.312  10.771  1.00 0.00 ? 19 THR A HG21   1  
ATOM 300    H HG22   . THR A 1 19 ? -9.082  18.790  9.947   1.00 0.00 ? 19 THR A HG22   1  
ATOM 301    H HG23   . THR A 1 19 ? -9.841  19.889  11.124  1.00 0.00 ? 19 THR A HG23   1  
ATOM 302    N N      . ILE A 1 20 ? -7.784  20.446  8.196   1.00 0.00 ? 20 ILE A N      1  
ATOM 303    C CA     . ILE A 1 20 ? -6.592  20.074  7.449   1.00 0.00 ? 20 ILE A CA     1  
ATOM 304    C C      . ILE A 1 20 ? -5.944  18.884  8.145   1.00 0.00 ? 20 ILE A C      1  
ATOM 305    O O      . ILE A 1 20 ? -5.880  18.871  9.372   1.00 0.00 ? 20 ILE A O      1  
ATOM 306    C CB     . ILE A 1 20 ? -5.606  21.245  7.403   1.00 0.00 ? 20 ILE A CB     1  
ATOM 307    C CG1    . ILE A 1 20 ? -6.253  22.601  7.099   1.00 0.00 ? 20 ILE A CG1    1  
ATOM 308    C CG2    . ILE A 1 20 ? -4.485  20.957  6.403   1.00 0.00 ? 20 ILE A CG2    1  
ATOM 309    C CD1    . ILE A 1 20 ? -6.885  22.699  5.712   1.00 0.00 ? 20 ILE A CD1    1  
ATOM 310    H H      . ILE A 1 20 ? -7.659  20.657  9.177   1.00 0.00 ? 20 ILE A H      1  
ATOM 311    H HA     . ILE A 1 20 ? -6.865  19.790  6.433   1.00 0.00 ? 20 ILE A HA     1  
ATOM 312    H HB     . ILE A 1 20 ? -5.148  21.330  8.389   1.00 0.00 ? 20 ILE A HB     1  
ATOM 313    H HG12   . ILE A 1 20 ? -7.012  22.822  7.849   1.00 0.00 ? 20 ILE A HG12   1  
ATOM 314    H HG13   . ILE A 1 20 ? -5.488  23.371  7.180   1.00 0.00 ? 20 ILE A HG13   1  
ATOM 315    H HG21   . ILE A 1 20 ? -3.878  20.123  6.756   1.00 0.00 ? 20 ILE A HG21   1  
ATOM 316    H HG22   . ILE A 1 20 ? -4.904  20.705  5.429   1.00 0.00 ? 20 ILE A HG22   1  
ATOM 317    H HG23   . ILE A 1 20 ? -3.846  21.834  6.304   1.00 0.00 ? 20 ILE A HG23   1  
ATOM 318    H HD11   . ILE A 1 20 ? -6.114  22.629  4.944   1.00 0.00 ? 20 ILE A HD11   1  
ATOM 319    H HD12   . ILE A 1 20 ? -7.613  21.901  5.575   1.00 0.00 ? 20 ILE A HD12   1  
ATOM 320    H HD13   . ILE A 1 20 ? -7.388  23.660  5.618   1.00 0.00 ? 20 ILE A HD13   1  
ATOM 321    N N      . THR A 1 21 ? -5.408  17.922  7.391   1.00 0.00 ? 21 THR A N      1  
ATOM 322    C CA     . THR A 1 21 ? -4.709  16.772  7.948   1.00 0.00 ? 21 THR A CA     1  
ATOM 323    C C      . THR A 1 21 ? -3.450  16.489  7.138   1.00 0.00 ? 21 THR A C      1  
ATOM 324    O O      . THR A 1 21 ? -3.487  16.514  5.909   1.00 0.00 ? 21 THR A O      1  
ATOM 325    C CB     . THR A 1 21 ? -5.629  15.550  7.971   1.00 0.00 ? 21 THR A CB     1  
ATOM 326    O OG1    . THR A 1 21 ? -6.814  15.855  8.673   1.00 0.00 ? 21 THR A OG1    1  
ATOM 327    C CG2    . THR A 1 21 ? -4.980  14.359  8.675   1.00 0.00 ? 21 THR A CG2    1  
ATOM 328    H H      . THR A 1 21 ? -5.477  17.991  6.384   1.00 0.00 ? 21 THR A H      1  
ATOM 329    H HA     . THR A 1 21 ? -4.410  16.991  8.972   1.00 0.00 ? 21 THR A HA     1  
ATOM 330    H HB     . THR A 1 21 ? -5.882  15.270  6.948   1.00 0.00 ? 21 THR A HB     1  
ATOM 331    H HG1    . THR A 1 21 ? -7.422  15.117  8.571   1.00 0.00 ? 21 THR A HG1    1  
ATOM 332    H HG21   . THR A 1 21 ? -5.678  13.522  8.686   1.00 0.00 ? 21 THR A HG21   1  
ATOM 333    H HG22   . THR A 1 21 ? -4.074  14.055  8.151   1.00 0.00 ? 21 THR A HG22   1  
ATOM 334    H HG23   . THR A 1 21 ? -4.727  14.629  9.700   1.00 0.00 ? 21 THR A HG23   1  
ATOM 335    N N      . ILE A 1 22 ? -2.332  16.202  7.808   1.00 0.00 ? 22 ILE A N      1  
ATOM 336    C CA     . ILE A 1 22 ? -1.100  15.823  7.137   1.00 0.00 ? 22 ILE A CA     1  
ATOM 337    C C      . ILE A 1 22 ? -1.092  14.301  7.014   1.00 0.00 ? 22 ILE A C      1  
ATOM 338    O O      . ILE A 1 22 ? -0.886  13.586  7.993   1.00 0.00 ? 22 ILE A O      1  
ATOM 339    C CB     . ILE A 1 22 ? 0.080   16.477  7.867   1.00 0.00 ? 22 ILE A CB     1  
ATOM 340    C CG1    . ILE A 1 22 ? 1.370   16.508  7.047   1.00 0.00 ? 22 ILE A CG1    1  
ATOM 341    C CG2    . ILE A 1 22 ? 0.356   15.921  9.265   1.00 0.00 ? 22 ILE A CG2    1  
ATOM 342    C CD1    . ILE A 1 22 ? 1.788   15.155  6.475   1.00 0.00 ? 22 ILE A CD1    1  
ATOM 343    H H      . ILE A 1 22 ? -2.353  16.113  8.815   1.00 0.00 ? 22 ILE A H      1  
ATOM 344    H HA     . ILE A 1 22 ? -1.114  16.236  6.129   1.00 0.00 ? 22 ILE A HA     1  
ATOM 345    H HB     . ILE A 1 22 ? -0.198  17.522  8.013   1.00 0.00 ? 22 ILE A HB     1  
ATOM 346    H HG12   . ILE A 1 22 ? 1.243   17.205  6.219   1.00 0.00 ? 22 ILE A HG12   1  
ATOM 347    H HG13   . ILE A 1 22 ? 2.176   16.885  7.677   1.00 0.00 ? 22 ILE A HG13   1  
ATOM 348    H HG21   . ILE A 1 22 ? -0.572  15.847  9.832   1.00 0.00 ? 22 ILE A HG21   1  
ATOM 349    H HG22   . ILE A 1 22 ? 0.815   14.937  9.198   1.00 0.00 ? 22 ILE A HG22   1  
ATOM 350    H HG23   . ILE A 1 22 ? 1.038   16.588  9.792   1.00 0.00 ? 22 ILE A HG23   1  
ATOM 351    H HD11   . ILE A 1 22 ? 2.825   15.205  6.146   1.00 0.00 ? 22 ILE A HD11   1  
ATOM 352    H HD12   . ILE A 1 22 ? 1.700   14.375  7.229   1.00 0.00 ? 22 ILE A HD12   1  
ATOM 353    H HD13   . ILE A 1 22 ? 1.155   14.923  5.619   1.00 0.00 ? 22 ILE A HD13   1  
ATOM 354    N N      . LEU A 1 23 ? -1.430  13.789  5.827   1.00 0.00 ? 23 LEU A N      1  
ATOM 355    C CA     . LEU A 1 23 ? -1.693  12.371  5.630   1.00 0.00 ? 23 LEU A CA     1  
ATOM 356    C C      . LEU A 1 23 ? -0.395  11.564  5.613   1.00 0.00 ? 23 LEU A C      1  
ATOM 357    O O      . LEU A 1 23 ? -0.406  10.388  5.971   1.00 0.00 ? 23 LEU A O      1  
ATOM 358    C CB     . LEU A 1 23 ? -2.542  12.095  4.385   1.00 0.00 ? 23 LEU A CB     1  
ATOM 359    C CG     . LEU A 1 23 ? -3.464  13.229  3.934   1.00 0.00 ? 23 LEU A CG     1  
ATOM 360    C CD1    . LEU A 1 23 ? -4.133  12.839  2.620   1.00 0.00 ? 23 LEU A CD1    1  
ATOM 361    C CD2    . LEU A 1 23 ? -4.562  13.513  4.956   1.00 0.00 ? 23 LEU A CD2    1  
ATOM 362    H H      . LEU A 1 23 ? -1.505  14.402  5.027   1.00 0.00 ? 23 LEU A H      1  
ATOM 363    H HA     . LEU A 1 23 ? -2.268  12.026  6.490   1.00 0.00 ? 23 LEU A HA     1  
ATOM 364    H HB2    . LEU A 1 23 ? -1.893  11.838  3.550   1.00 0.00 ? 23 LEU A HB2    1  
ATOM 365    H HB3    . LEU A 1 23 ? -3.154  11.215  4.586   1.00 0.00 ? 23 LEU A HB3    1  
ATOM 366    H HG     . LEU A 1 23 ? -2.883  14.135  3.768   1.00 0.00 ? 23 LEU A HG     1  
ATOM 367    H HD11   . LEU A 1 23 ? -4.651  11.886  2.724   1.00 0.00 ? 23 LEU A HD11   1  
ATOM 368    H HD12   . LEU A 1 23 ? -4.853  13.612  2.358   1.00 0.00 ? 23 LEU A HD12   1  
ATOM 369    H HD13   . LEU A 1 23 ? -3.393  12.752  1.824   1.00 0.00 ? 23 LEU A HD13   1  
ATOM 370    H HD21   . LEU A 1 23 ? -5.258  12.677  4.991   1.00 0.00 ? 23 LEU A HD21   1  
ATOM 371    H HD22   . LEU A 1 23 ? -4.123  13.661  5.942   1.00 0.00 ? 23 LEU A HD22   1  
ATOM 372    H HD23   . LEU A 1 23 ? -5.103  14.414  4.671   1.00 0.00 ? 23 LEU A HD23   1  
ATOM 373    N N      . GLY A 1 24 ? 0.728   12.185  5.237   1.00 0.00 ? 24 GLY A N      1  
ATOM 374    C CA     . GLY A 1 24 ? 2.045   11.591  5.403   1.00 0.00 ? 24 GLY A CA     1  
ATOM 375    C C      . GLY A 1 24 ? 3.155   12.358  4.695   1.00 0.00 ? 24 GLY A C      1  
ATOM 376    O O      . GLY A 1 24 ? 2.918   13.422  4.126   1.00 0.00 ? 24 GLY A O      1  
ATOM 377    H H      . GLY A 1 24 ? 0.673   13.128  4.878   1.00 0.00 ? 24 GLY A H      1  
ATOM 378    H HA2    . GLY A 1 24 ? 2.283   11.561  6.465   1.00 0.00 ? 24 GLY A HA2    1  
ATOM 379    H HA3    . GLY A 1 24 ? 2.032   10.564  5.038   1.00 0.00 ? 24 GLY A HA3    1  
ATOM 380    N N      . VAL A 1 25 ? 4.382   11.831  4.747   1.00 0.00 ? 25 VAL A N      1  
ATOM 381    C CA     . VAL A 1 25 ? 5.551   12.437  4.125   1.00 0.00 ? 25 VAL A CA     1  
ATOM 382    C C      . VAL A 1 25 ? 6.326   11.422  3.292   1.00 0.00 ? 25 VAL A C      1  
ATOM 383    O O      . VAL A 1 25 ? 6.336   10.232  3.602   1.00 0.00 ? 25 VAL A O      1  
ATOM 384    C CB     . VAL A 1 25 ? 6.466   13.096  5.161   1.00 0.00 ? 25 VAL A CB     1  
ATOM 385    C CG1    . VAL A 1 25 ? 5.760   14.257  5.856   1.00 0.00 ? 25 VAL A CG1    1  
ATOM 386    C CG2    . VAL A 1 25 ? 6.959   12.123  6.231   1.00 0.00 ? 25 VAL A CG2    1  
ATOM 387    H H      . VAL A 1 25 ? 4.510   10.938  5.201   1.00 0.00 ? 25 VAL A H      1  
ATOM 388    H HA     . VAL A 1 25 ? 5.216   13.219  3.442   1.00 0.00 ? 25 VAL A HA     1  
ATOM 389    H HB     . VAL A 1 25 ? 7.336   13.497  4.640   1.00 0.00 ? 25 VAL A HB     1  
ATOM 390    H HG11   . VAL A 1 25 ? 5.358   14.938  5.105   1.00 0.00 ? 25 VAL A HG11   1  
ATOM 391    H HG12   . VAL A 1 25 ? 4.949   13.885  6.481   1.00 0.00 ? 25 VAL A HG12   1  
ATOM 392    H HG13   . VAL A 1 25 ? 6.474   14.796  6.478   1.00 0.00 ? 25 VAL A HG13   1  
ATOM 393    H HG21   . VAL A 1 25 ? 7.614   12.654  6.921   1.00 0.00 ? 25 VAL A HG21   1  
ATOM 394    H HG22   . VAL A 1 25 ? 6.114   11.712  6.783   1.00 0.00 ? 25 VAL A HG22   1  
ATOM 395    H HG23   . VAL A 1 25 ? 7.519   11.313  5.765   1.00 0.00 ? 25 VAL A HG23   1  
ATOM 396    N N      . SER A 1 26 ? 7.002   11.912  2.249   1.00 0.00 ? 26 SER A N      1  
ATOM 397    C CA     . SER A 1 26 ? 7.736   11.099  1.291   1.00 0.00 ? 26 SER A CA     1  
ATOM 398    C C      . SER A 1 26 ? 9.055   11.775  0.932   1.00 0.00 ? 26 SER A C      1  
ATOM 399    O O      . SER A 1 26 ? 9.266   12.187  -0.207  1.00 0.00 ? 26 SER A O      1  
ATOM 400    C CB     . SER A 1 26 ? 6.878   10.863  0.048   1.00 0.00 ? 26 SER A CB     1  
ATOM 401    O OG     . SER A 1 26 ? 5.793   10.012  0.354   1.00 0.00 ? 26 SER A OG     1  
ATOM 402    H H      . SER A 1 26 ? 6.953   12.905  2.067   1.00 0.00 ? 26 SER A H      1  
ATOM 403    H HA     . SER A 1 26 ? 7.968   10.132  1.736   1.00 0.00 ? 26 SER A HA     1  
ATOM 404    H HB2    . SER A 1 26 ? 6.494   11.818  -0.313  1.00 0.00 ? 26 SER A HB2    1  
ATOM 405    H HB3    . SER A 1 26 ? 7.485   10.410  -0.735  1.00 0.00 ? 26 SER A HB3    1  
ATOM 406    H HG     . SER A 1 26 ? 5.315   9.816   -0.459  1.00 0.00 ? 26 SER A HG     1  
ATOM 407    N N      . GLY A 1 27 ? 9.935   11.939  1.923   1.00 0.00 ? 27 GLY A N      1  
ATOM 408    C CA     . GLY A 1 27 ? 11.170  12.689  1.764   1.00 0.00 ? 27 GLY A CA     1  
ATOM 409    C C      . GLY A 1 27 ? 10.906  14.190  1.817   1.00 0.00 ? 27 GLY A C      1  
ATOM 410    O O      . GLY A 1 27 ? 10.396  14.694  2.815   1.00 0.00 ? 27 GLY A O      1  
ATOM 411    H H      . GLY A 1 27 ? 9.698   11.610  2.848   1.00 0.00 ? 27 GLY A H      1  
ATOM 412    H HA2    . GLY A 1 27 ? 11.860  12.426  2.566   1.00 0.00 ? 27 GLY A HA2    1  
ATOM 413    H HA3    . GLY A 1 27 ? 11.632  12.436  0.811   1.00 0.00 ? 27 GLY A HA3    1  
ATOM 414    N N      . GLN A 1 28 ? 11.256  14.908  0.746   1.00 0.00 ? 28 GLN A N      1  
ATOM 415    C CA     . GLN A 1 28 ? 11.158  16.358  0.693   1.00 0.00 ? 28 GLN A CA     1  
ATOM 416    C C      . GLN A 1 28 ? 9.744   16.832  0.355   1.00 0.00 ? 28 GLN A C      1  
ATOM 417    O O      . GLN A 1 28 ? 9.452   18.016  0.503   1.00 0.00 ? 28 GLN A O      1  
ATOM 418    C CB     . GLN A 1 28 ? 12.201  16.870  -0.302  1.00 0.00 ? 28 GLN A CB     1  
ATOM 419    C CG     . GLN A 1 28 ? 12.449  18.374  -0.211  1.00 0.00 ? 28 GLN A CG     1  
ATOM 420    C CD     . GLN A 1 28 ? 13.565  18.805  -1.154  1.00 0.00 ? 28 GLN A CD     1  
ATOM 421    O OE1    . GLN A 1 28 ? 13.321  19.154  -2.307  1.00 0.00 ? 28 GLN A OE1    1  
ATOM 422    N NE2    . GLN A 1 28 ? 14.814  18.778  -0.695  1.00 0.00 ? 28 GLN A NE2    1  
ATOM 423    H H      . GLN A 1 28 ? 11.640  14.439  -0.064  1.00 0.00 ? 28 GLN A H      1  
ATOM 424    H HA     . GLN A 1 28 ? 11.411  16.753  1.677   1.00 0.00 ? 28 GLN A HA     1  
ATOM 425    H HB2    . GLN A 1 28 ? 13.144  16.356  -0.114  1.00 0.00 ? 28 GLN A HB2    1  
ATOM 426    H HB3    . GLN A 1 28 ? 11.873  16.633  -1.312  1.00 0.00 ? 28 GLN A HB3    1  
ATOM 427    H HG2    . GLN A 1 28 ? 11.540  18.909  -0.489  1.00 0.00 ? 28 GLN A HG2    1  
ATOM 428    H HG3    . GLN A 1 28 ? 12.719  18.634  0.812   1.00 0.00 ? 28 GLN A HG3    1  
ATOM 429    H HE21   . GLN A 1 28 ? 15.002  18.475  0.250   1.00 0.00 ? 28 GLN A HE21   1  
ATOM 430    H HE22   . GLN A 1 28 ? 15.571  19.040  -1.309  1.00 0.00 ? 28 GLN A HE22   1  
ATOM 431    N N      . GLN A 1 29 ? 8.850   15.934  -0.071  1.00 0.00 ? 29 GLN A N      1  
ATOM 432    C CA     . GLN A 1 29 ? 7.440   16.241  -0.263  1.00 0.00 ? 29 GLN A CA     1  
ATOM 433    C C      . GLN A 1 29 ? 6.556   15.749  0.879   1.00 0.00 ? 29 GLN A C      1  
ATOM 434    O O      . GLN A 1 29 ? 6.816   14.723  1.507   1.00 0.00 ? 29 GLN A O      1  
ATOM 435    C CB     . GLN A 1 29 ? 6.948   15.758  -1.628  1.00 0.00 ? 29 GLN A CB     1  
ATOM 436    C CG     . GLN A 1 29 ? 6.960   14.238  -1.771  1.00 0.00 ? 29 GLN A CG     1  
ATOM 437    C CD     . GLN A 1 29 ? 6.565   13.807  -3.178  1.00 0.00 ? 29 GLN A CD     1  
ATOM 438    O OE1    . GLN A 1 29 ? 7.185   14.204  -4.160  1.00 0.00 ? 29 GLN A OE1    1  
ATOM 439    N NE2    . GLN A 1 29 ? 5.527   12.982  -3.305  1.00 0.00 ? 29 GLN A NE2    1  
ATOM 440    H H      . GLN A 1 29 ? 9.154   14.986  -0.235  1.00 0.00 ? 29 GLN A H      1  
ATOM 441    H HA     . GLN A 1 29 ? 7.336   17.324  -0.270  1.00 0.00 ? 29 GLN A HA     1  
ATOM 442    H HB2    . GLN A 1 29 ? 5.928   16.113  -1.778  1.00 0.00 ? 29 GLN A HB2    1  
ATOM 443    H HB3    . GLN A 1 29 ? 7.574   16.195  -2.404  1.00 0.00 ? 29 GLN A HB3    1  
ATOM 444    H HG2    . GLN A 1 29 ? 7.962   13.860  -1.566  1.00 0.00 ? 29 GLN A HG2    1  
ATOM 445    H HG3    . GLN A 1 29 ? 6.262   13.809  -1.053  1.00 0.00 ? 29 GLN A HG3    1  
ATOM 446    H HE21   . GLN A 1 29 ? 5.016   12.669  -2.494  1.00 0.00 ? 29 GLN A HE21   1  
ATOM 447    H HE22   . GLN A 1 29 ? 5.252   12.688  -4.232  1.00 0.00 ? 29 GLN A HE22   1  
ATOM 448    N N      . VAL A 1 30 ? 5.474   16.496  1.105   1.00 0.00 ? 30 VAL A N      1  
ATOM 449    C CA     . VAL A 1 30 ? 4.506   16.319  2.175   1.00 0.00 ? 30 VAL A CA     1  
ATOM 450    C C      . VAL A 1 30 ? 3.128   16.128  1.551   1.00 0.00 ? 30 VAL A C      1  
ATOM 451    O O      . VAL A 1 30 ? 2.708   16.938  0.728   1.00 0.00 ? 30 VAL A O      1  
ATOM 452    C CB     . VAL A 1 30 ? 4.524   17.556  3.077   1.00 0.00 ? 30 VAL A CB     1  
ATOM 453    C CG1    . VAL A 1 30 ? 3.550   17.419  4.244   1.00 0.00 ? 30 VAL A CG1    1  
ATOM 454    C CG2    . VAL A 1 30 ? 5.917   17.801  3.654   1.00 0.00 ? 30 VAL A CG2    1  
ATOM 455    H H      . VAL A 1 30 ? 5.361   17.332  0.547   1.00 0.00 ? 30 VAL A H      1  
ATOM 456    H HA     . VAL A 1 30 ? 4.760   15.439  2.767   1.00 0.00 ? 30 VAL A HA     1  
ATOM 457    H HB     . VAL A 1 30 ? 4.234   18.428  2.490   1.00 0.00 ? 30 VAL A HB     1  
ATOM 458    H HG11   . VAL A 1 30 ? 3.914   16.661  4.937   1.00 0.00 ? 30 VAL A HG11   1  
ATOM 459    H HG12   . VAL A 1 30 ? 3.478   18.373  4.766   1.00 0.00 ? 30 VAL A HG12   1  
ATOM 460    H HG13   . VAL A 1 30 ? 2.560   17.138  3.883   1.00 0.00 ? 30 VAL A HG13   1  
ATOM 461    H HG21   . VAL A 1 30 ? 6.602   18.099  2.860   1.00 0.00 ? 30 VAL A HG21   1  
ATOM 462    H HG22   . VAL A 1 30 ? 5.873   18.599  4.394   1.00 0.00 ? 30 VAL A HG22   1  
ATOM 463    H HG23   . VAL A 1 30 ? 6.289   16.892  4.128   1.00 0.00 ? 30 VAL A HG23   1  
ATOM 464    N N      . ARG A 1 31 ? 2.421   15.065  1.940   1.00 0.00 ? 31 ARG A N      1  
ATOM 465    C CA     . ARG A 1 31 ? 1.088   14.747  1.451   1.00 0.00 ? 31 ARG A CA     1  
ATOM 466    C C      . ARG A 1 31 ? 0.047   15.311  2.413   1.00 0.00 ? 31 ARG A C      1  
ATOM 467    O O      . ARG A 1 31 ? -0.201  14.733  3.469   1.00 0.00 ? 31 ARG A O      1  
ATOM 468    C CB     . ARG A 1 31 ? 0.977   13.229  1.304   1.00 0.00 ? 31 ARG A CB     1  
ATOM 469    C CG     . ARG A 1 31 ? -0.308  12.802  0.594   1.00 0.00 ? 31 ARG A CG     1  
ATOM 470    C CD     . ARG A 1 31 ? -0.427  11.279  0.637   1.00 0.00 ? 31 ARG A CD     1  
ATOM 471    N NE     . ARG A 1 31 ? -1.534  10.800  -0.197  1.00 0.00 ? 31 ARG A NE     1  
ATOM 472    C CZ     . ARG A 1 31 ? -2.313  9.746   0.071   1.00 0.00 ? 31 ARG A CZ     1  
ATOM 473    N NH1    . ARG A 1 31 ? -2.266  9.111   1.242   1.00 0.00 ? 31 ARG A NH1    1  
ATOM 474    N NH2    . ARG A 1 31 ? -3.159  9.295   -0.853  1.00 0.00 ? 31 ARG A NH2    1  
ATOM 475    H H      . ARG A 1 31 ? 2.802   14.468  2.661   1.00 0.00 ? 31 ARG A H      1  
ATOM 476    H HA     . ARG A 1 31 ? 0.941   15.204  0.473   1.00 0.00 ? 31 ARG A HA     1  
ATOM 477    H HB2    . ARG A 1 31 ? 1.829   12.867  0.727   1.00 0.00 ? 31 ARG A HB2    1  
ATOM 478    H HB3    . ARG A 1 31 ? 1.012   12.767  2.291   1.00 0.00 ? 31 ARG A HB3    1  
ATOM 479    H HG2    . ARG A 1 31 ? -1.172  13.243  1.092   1.00 0.00 ? 31 ARG A HG2    1  
ATOM 480    H HG3    . ARG A 1 31 ? -0.278  13.140  -0.441  1.00 0.00 ? 31 ARG A HG3    1  
ATOM 481    H HD2    . ARG A 1 31 ? 0.502   10.841  0.270   1.00 0.00 ? 31 ARG A HD2    1  
ATOM 482    H HD3    . ARG A 1 31 ? -0.571  10.970  1.672   1.00 0.00 ? 31 ARG A HD3    1  
ATOM 483    H HE     . ARG A 1 31 ? -1.665  11.258  -1.088  1.00 0.00 ? 31 ARG A HE     1  
ATOM 484    H HH11   . ARG A 1 31 ? -1.607  9.400   1.949   1.00 0.00 ? 31 ARG A HH11   1  
ATOM 485    H HH12   . ARG A 1 31 ? -2.874  8.322   1.406   1.00 0.00 ? 31 ARG A HH12   1  
ATOM 486    H HH21   . ARG A 1 31 ? -3.117  9.661   -1.791  1.00 0.00 ? 31 ARG A HH21   1  
ATOM 487    H HH22   . ARG A 1 31 ? -3.756  8.505   -0.643  1.00 0.00 ? 31 ARG A HH22   1  
ATOM 488    N N      . ILE A 1 32 ? -0.556  16.441  2.041   1.00 0.00 ? 32 ILE A N      1  
ATOM 489    C CA     . ILE A 1 32 ? -1.517  17.162  2.863   1.00 0.00 ? 32 ILE A CA     1  
ATOM 490    C C      . ILE A 1 32 ? -2.916  16.994  2.276   1.00 0.00 ? 32 ILE A C      1  
ATOM 491    O O      . ILE A 1 32 ? -3.098  17.118  1.066   1.00 0.00 ? 32 ILE A O      1  
ATOM 492    C CB     . ILE A 1 32 ? -1.142  18.646  2.957   1.00 0.00 ? 32 ILE A CB     1  
ATOM 493    C CG1    . ILE A 1 32 ? 0.315   18.819  3.399   1.00 0.00 ? 32 ILE A CG1    1  
ATOM 494    C CG2    . ILE A 1 32 ? -2.081  19.354  3.936   1.00 0.00 ? 32 ILE A CG2    1  
ATOM 495    C CD1    . ILE A 1 32 ? 0.756   20.280  3.483   1.00 0.00 ? 32 ILE A CD1    1  
ATOM 496    H H      . ILE A 1 32 ? -0.306  16.847  1.149   1.00 0.00 ? 32 ILE A H      1  
ATOM 497    H HA     . ILE A 1 32 ? -1.503  16.741  3.869   1.00 0.00 ? 32 ILE A HA     1  
ATOM 498    H HB     . ILE A 1 32 ? -1.260  19.099  1.973   1.00 0.00 ? 32 ILE A HB     1  
ATOM 499    H HG12   . ILE A 1 32 ? 0.453   18.351  4.372   1.00 0.00 ? 32 ILE A HG12   1  
ATOM 500    H HG13   . ILE A 1 32 ? 0.966   18.325  2.679   1.00 0.00 ? 32 ILE A HG13   1  
ATOM 501    H HG21   . ILE A 1 32 ? -3.116  19.252  3.610   1.00 0.00 ? 32 ILE A HG21   1  
ATOM 502    H HG22   . ILE A 1 32 ? -1.974  18.927  4.933   1.00 0.00 ? 32 ILE A HG22   1  
ATOM 503    H HG23   . ILE A 1 32 ? -1.853  20.419  3.973   1.00 0.00 ? 32 ILE A HG23   1  
ATOM 504    H HD11   . ILE A 1 32 ? 0.473   20.806  2.570   1.00 0.00 ? 32 ILE A HD11   1  
ATOM 505    H HD12   . ILE A 1 32 ? 0.297   20.763  4.344   1.00 0.00 ? 32 ILE A HD12   1  
ATOM 506    H HD13   . ILE A 1 32 ? 1.839   20.322  3.595   1.00 0.00 ? 32 ILE A HD13   1  
ATOM 507    N N      . GLY A 1 33 ? -3.910  16.749  3.134   1.00 0.00 ? 33 GLY A N      1  
ATOM 508    C CA     . GLY A 1 33 ? -5.316  16.759  2.773   1.00 0.00 ? 33 GLY A CA     1  
ATOM 509    C C      . GLY A 1 33 ? -6.043  17.956  3.374   1.00 0.00 ? 33 GLY A C      1  
ATOM 510    O O      . GLY A 1 33 ? -5.841  18.295  4.539   1.00 0.00 ? 33 GLY A O      1  
ATOM 511    H H      . GLY A 1 33 ? -3.692  16.683  4.119   1.00 0.00 ? 33 GLY A H      1  
ATOM 512    H HA2    . GLY A 1 33 ? -5.421  16.790  1.689   1.00 0.00 ? 33 GLY A HA2    1  
ATOM 513    H HA3    . GLY A 1 33 ? -5.792  15.847  3.134   1.00 0.00 ? 33 GLY A HA3    1  
ATOM 514    N N      . ILE A 1 34 ? -6.912  18.578  2.574   1.00 0.00 ? 34 ILE A N      1  
ATOM 515    C CA     . ILE A 1 34 ? -7.740  19.707  2.960   1.00 0.00 ? 34 ILE A CA     1  
ATOM 516    C C      . ILE A 1 34 ? -9.202  19.272  2.927   1.00 0.00 ? 34 ILE A C      1  
ATOM 517    O O      . ILE A 1 34 ? -9.641  18.639  1.969   1.00 0.00 ? 34 ILE A O      1  
ATOM 518    C CB     . ILE A 1 34 ? -7.486  20.885  2.014   1.00 0.00 ? 34 ILE A CB     1  
ATOM 519    C CG1    . ILE A 1 34 ? -6.042  21.389  2.108   1.00 0.00 ? 34 ILE A CG1    1  
ATOM 520    C CG2    . ILE A 1 34 ? -8.432  22.043  2.341   1.00 0.00 ? 34 ILE A CG2    1  
ATOM 521    C CD1    . ILE A 1 34 ? -5.132  20.774  1.047   1.00 0.00 ? 34 ILE A CD1    1  
ATOM 522    H H      . ILE A 1 34 ? -6.997  18.255  1.620   1.00 0.00 ? 34 ILE A H      1  
ATOM 523    H HA     . ILE A 1 34 ? -7.489  20.022  3.976   1.00 0.00 ? 34 ILE A HA     1  
ATOM 524    H HB     . ILE A 1 34 ? -7.687  20.568  0.990   1.00 0.00 ? 34 ILE A HB     1  
ATOM 525    H HG12   . ILE A 1 34 ? -6.029  22.470  1.973   1.00 0.00 ? 34 ILE A HG12   1  
ATOM 526    H HG13   . ILE A 1 34 ? -5.639  21.168  3.097   1.00 0.00 ? 34 ILE A HG13   1  
ATOM 527    H HG21   . ILE A 1 34 ? -8.366  22.297  3.398   1.00 0.00 ? 34 ILE A HG21   1  
ATOM 528    H HG22   . ILE A 1 34 ? -8.162  22.916  1.748   1.00 0.00 ? 34 ILE A HG22   1  
ATOM 529    H HG23   . ILE A 1 34 ? -9.459  21.767  2.098   1.00 0.00 ? 34 ILE A HG23   1  
ATOM 530    H HD11   . ILE A 1 34 ? -5.547  20.953  0.054   1.00 0.00 ? 34 ILE A HD11   1  
ATOM 531    H HD12   . ILE A 1 34 ? -4.146  21.237  1.106   1.00 0.00 ? 34 ILE A HD12   1  
ATOM 532    H HD13   . ILE A 1 34 ? -5.025  19.702  1.209   1.00 0.00 ? 34 ILE A HD13   1  
ATOM 533    N N      . ASN A 1 35 ? -9.972  19.632  3.954   1.00 0.00 ? 35 ASN A N      1  
ATOM 534    C CA     . ASN A 1 35 ? -11.389 19.325  4.057   1.00 0.00 ? 35 ASN A CA     1  
ATOM 535    C C      . ASN A 1 35 ? -12.175 20.607  4.311   1.00 0.00 ? 35 ASN A C      1  
ATOM 536    O O      . ASN A 1 35 ? -12.600 20.903  5.425   1.00 0.00 ? 35 ASN A O      1  
ATOM 537    C CB     . ASN A 1 35 ? -11.597 18.291  5.160   1.00 0.00 ? 35 ASN A CB     1  
ATOM 538    C CG     . ASN A 1 35 ? -13.000 17.702  5.154   1.00 0.00 ? 35 ASN A CG     1  
ATOM 539    O OD1    . ASN A 1 35 ? -13.709 17.745  4.153   1.00 0.00 ? 35 ASN A OD1    1  
ATOM 540    N ND2    . ASN A 1 35 ? -13.406 17.093  6.266   1.00 0.00 ? 35 ASN A ND2    1  
ATOM 541    H H      . ASN A 1 35 ? -9.543  20.092  4.745   1.00 0.00 ? 35 ASN A H      1  
ATOM 542    H HA     . ASN A 1 35 ? -11.733 18.900  3.114   1.00 0.00 ? 35 ASN A HA     1  
ATOM 543    H HB2    . ASN A 1 35 ? -10.876 17.486  5.027   1.00 0.00 ? 35 ASN A HB2    1  
ATOM 544    H HB3    . ASN A 1 35 ? -11.414 18.779  6.116   1.00 0.00 ? 35 ASN A HB3    1  
ATOM 545    H HD21   . ASN A 1 35 ? -12.801 17.051  7.072   1.00 0.00 ? 35 ASN A HD21   1  
ATOM 546    H HD22   . ASN A 1 35 ? -14.329 16.684  6.294   1.00 0.00 ? 35 ASN A HD22   1  
ATOM 547    N N      . ALA A 1 36 ? -12.307 21.387  3.239   1.00 0.00 ? 36 ALA A N      1  
ATOM 548    C CA     . ALA A 1 36 ? -13.130 22.582  3.175   1.00 0.00 ? 36 ALA A CA     1  
ATOM 549    C C      . ALA A 1 36 ? -14.414 22.314  2.392   1.00 0.00 ? 36 ALA A C      1  
ATOM 550    O O      . ALA A 1 36 ? -14.416 21.455  1.509   1.00 0.00 ? 36 ALA A O      1  
ATOM 551    C CB     . ALA A 1 36 ? -12.310 23.695  2.526   1.00 0.00 ? 36 ALA A CB     1  
ATOM 552    H H      . ALA A 1 36 ? -11.865 21.062  2.393   1.00 0.00 ? 36 ALA A H      1  
ATOM 553    H HA     . ALA A 1 36 ? -13.395 22.895  4.185   1.00 0.00 ? 36 ALA A HA     1  
ATOM 554    H HB1    . ALA A 1 36 ? -12.856 24.634  2.594   1.00 0.00 ? 36 ALA A HB1    1  
ATOM 555    H HB2    . ALA A 1 36 ? -11.354 23.801  3.039   1.00 0.00 ? 36 ALA A HB2    1  
ATOM 556    H HB3    . ALA A 1 36 ? -12.136 23.455  1.477   1.00 0.00 ? 36 ALA A HB3    1  
ATOM 557    N N      . PRO A 1 37 ? -15.495 23.060  2.648   1.00 0.00 ? 37 PRO A N      1  
ATOM 558    C CA     . PRO A 1 37 ? -16.724 22.945  1.886   1.00 0.00 ? 37 PRO A CA     1  
ATOM 559    C C      . PRO A 1 37 ? -16.551 23.558  0.501   1.00 0.00 ? 37 PRO A C      1  
ATOM 560    O O      . PRO A 1 37 ? -15.761 24.484  0.326   1.00 0.00 ? 37 PRO A O      1  
ATOM 561    C CB     . PRO A 1 37 ? -17.779 23.696  2.694   1.00 0.00 ? 37 PRO A CB     1  
ATOM 562    C CG     . PRO A 1 37 ? -16.972 24.751  3.448   1.00 0.00 ? 37 PRO A CG     1  
ATOM 563    C CD     . PRO A 1 37 ? -15.602 24.107  3.647   1.00 0.00 ? 37 PRO A CD     1  
ATOM 564    H HA     . PRO A 1 37 ? -17.002 21.895  1.790   1.00 0.00 ? 37 PRO A HA     1  
ATOM 565    H HB2    . PRO A 1 37 ? -18.527 24.159  2.050   1.00 0.00 ? 37 PRO A HB2    1  
ATOM 566    H HB3    . PRO A 1 37 ? -18.253 23.018  3.403   1.00 0.00 ? 37 PRO A HB3    1  
ATOM 567    H HG2    . PRO A 1 37 ? -16.868 25.647  2.836   1.00 0.00 ? 37 PRO A HG2    1  
ATOM 568    H HG3    . PRO A 1 37 ? -17.440 24.991  4.402   1.00 0.00 ? 37 PRO A HG3    1  
ATOM 569    H HD2    . PRO A 1 37 ? -14.820 24.854  3.517   1.00 0.00 ? 37 PRO A HD2    1  
ATOM 570    H HD3    . PRO A 1 37 ? -15.544 23.671  4.644   1.00 0.00 ? 37 PRO A HD3    1  
ATOM 571    N N      . LYS A 1 38 ? -17.346 23.108  -0.474  1.00 0.00 ? 38 LYS A N      1  
ATOM 572    C CA     . LYS A 1 38 ? -17.264 23.592  -1.845  1.00 0.00 ? 38 LYS A CA     1  
ATOM 573    C C      . LYS A 1 38 ? -17.725 25.039  -1.993  1.00 0.00 ? 38 LYS A C      1  
ATOM 574    O O      . LYS A 1 38 ? -17.614 25.616  -3.072  1.00 0.00 ? 38 LYS A O      1  
ATOM 575    C CB     . LYS A 1 38 ? -18.048 22.667  -2.776  1.00 0.00 ? 38 LYS A CB     1  
ATOM 576    C CG     . LYS A 1 38 ? -17.546 21.228  -2.656  1.00 0.00 ? 38 LYS A CG     1  
ATOM 577    C CD     . LYS A 1 38 ? -17.985 20.371  -3.841  1.00 0.00 ? 38 LYS A CD     1  
ATOM 578    C CE     . LYS A 1 38 ? -17.132 20.667  -5.075  1.00 0.00 ? 38 LYS A CE     1  
ATOM 579    N NZ     . LYS A 1 38 ? -17.383 19.681  -6.142  1.00 0.00 ? 38 LYS A NZ     1  
ATOM 580    H H      . LYS A 1 38 ? -18.002 22.368  -0.269  1.00 0.00 ? 38 LYS A H      1  
ATOM 581    H HA     . LYS A 1 38 ? -16.217 23.566  -2.152  1.00 0.00 ? 38 LYS A HA     1  
ATOM 582    H HB2    . LYS A 1 38 ? -19.108 22.703  -2.524  1.00 0.00 ? 38 LYS A HB2    1  
ATOM 583    H HB3    . LYS A 1 38 ? -17.920 23.012  -3.802  1.00 0.00 ? 38 LYS A HB3    1  
ATOM 584    H HG2    . LYS A 1 38 ? -16.458 21.232  -2.592  1.00 0.00 ? 38 LYS A HG2    1  
ATOM 585    H HG3    . LYS A 1 38 ? -17.944 20.789  -1.741  1.00 0.00 ? 38 LYS A HG3    1  
ATOM 586    H HD2    . LYS A 1 38 ? -17.870 19.321  -3.572  1.00 0.00 ? 38 LYS A HD2    1  
ATOM 587    H HD3    . LYS A 1 38 ? -19.036 20.560  -4.063  1.00 0.00 ? 38 LYS A HD3    1  
ATOM 588    H HE2    . LYS A 1 38 ? -17.358 21.671  -5.437  1.00 0.00 ? 38 LYS A HE2    1  
ATOM 589    H HE3    . LYS A 1 38 ? -16.078 20.628  -4.795  1.00 0.00 ? 38 LYS A HE3    1  
ATOM 590    H HZ1    . LYS A 1 38 ? -17.124 18.759  -5.823  1.00 0.00 ? 38 LYS A HZ1    1  
ATOM 591    H HZ2    . LYS A 1 38 ? -18.361 19.678  -6.396  1.00 0.00 ? 38 LYS A HZ2    1  
ATOM 592    H HZ3    . LYS A 1 38 ? -16.837 19.905  -6.962  1.00 0.00 ? 38 LYS A HZ3    1  
ATOM 593    N N      . ASP A 1 39 ? -18.209 25.640  -0.903  1.00 0.00 ? 39 ASP A N      1  
ATOM 594    C CA     . ASP A 1 39 ? -18.489 27.063  -0.820  1.00 0.00 ? 39 ASP A CA     1  
ATOM 595    C C      . ASP A 1 39 ? -17.212 27.899  -0.856  1.00 0.00 ? 39 ASP A C      1  
ATOM 596    O O      . ASP A 1 39 ? -17.252 29.049  -1.289  1.00 0.00 ? 39 ASP A O      1  
ATOM 597    C CB     . ASP A 1 39 ? -19.281 27.351  0.454   1.00 0.00 ? 39 ASP A CB     1  
ATOM 598    C CG     . ASP A 1 39 ? -20.672 26.727  0.403   1.00 0.00 ? 39 ASP A CG     1  
ATOM 599    O OD1    . ASP A 1 39 ? -21.563 27.336  -0.228  1.00 0.00 ? 39 ASP A OD1    1  
ATOM 600    O OD2    . ASP A 1 39 ? -20.851 25.641  0.997   1.00 0.00 ? 39 ASP A OD2    1  
ATOM 601    H H      . ASP A 1 39 ? -18.278 25.098  -0.054  1.00 0.00 ? 39 ASP A H      1  
ATOM 602    H HA     . ASP A 1 39 ? -19.096 27.350  -1.679  1.00 0.00 ? 39 ASP A HA     1  
ATOM 603    H HB2    . ASP A 1 39 ? -18.733 26.961  1.314   1.00 0.00 ? 39 ASP A HB2    1  
ATOM 604    H HB3    . ASP A 1 39 ? -19.380 28.430  0.575   1.00 0.00 ? 39 ASP A HB3    1  
ATOM 605    N N      . VAL A 1 40 ? -16.077 27.326  -0.440  1.00 0.00 ? 40 VAL A N      1  
ATOM 606    C CA     . VAL A 1 40 ? -14.774 27.966  -0.534  1.00 0.00 ? 40 VAL A CA     1  
ATOM 607    C C      . VAL A 1 40 ? -13.838 27.199  -1.461  1.00 0.00 ? 40 VAL A C      1  
ATOM 608    O O      . VAL A 1 40 ? -13.858 25.971  -1.532  1.00 0.00 ? 40 VAL A O      1  
ATOM 609    C CB     . VAL A 1 40 ? -14.156 28.190  0.848   1.00 0.00 ? 40 VAL A CB     1  
ATOM 610    C CG1    . VAL A 1 40 ? -15.131 28.919  1.773   1.00 0.00 ? 40 VAL A CG1    1  
ATOM 611    C CG2    . VAL A 1 40 ? -13.713 26.896  1.525   1.00 0.00 ? 40 VAL A CG2    1  
ATOM 612    H H      . VAL A 1 40 ? -16.106 26.397  -0.045  1.00 0.00 ? 40 VAL A H      1  
ATOM 613    H HA     . VAL A 1 40 ? -14.912 28.953  -0.974  1.00 0.00 ? 40 VAL A HA     1  
ATOM 614    H HB     . VAL A 1 40 ? -13.274 28.814  0.719   1.00 0.00 ? 40 VAL A HB     1  
ATOM 615    H HG11   . VAL A 1 40 ? -15.984 28.278  1.998   1.00 0.00 ? 40 VAL A HG11   1  
ATOM 616    H HG12   . VAL A 1 40 ? -14.625 29.182  2.702   1.00 0.00 ? 40 VAL A HG12   1  
ATOM 617    H HG13   . VAL A 1 40 ? -15.482 29.830  1.289   1.00 0.00 ? 40 VAL A HG13   1  
ATOM 618    H HG21   . VAL A 1 40 ? -14.568 26.235  1.657   1.00 0.00 ? 40 VAL A HG21   1  
ATOM 619    H HG22   . VAL A 1 40 ? -12.956 26.404  0.915   1.00 0.00 ? 40 VAL A HG22   1  
ATOM 620    H HG23   . VAL A 1 40 ? -13.283 27.127  2.500   1.00 0.00 ? 40 VAL A HG23   1  
ATOM 621    N N      . ALA A 1 41 ? -13.010 27.946  -2.192  1.00 0.00 ? 41 ALA A N      1  
ATOM 622    C CA     . ALA A 1 41 ? -12.034 27.403  -3.119  1.00 0.00 ? 41 ALA A CA     1  
ATOM 623    C C      . ALA A 1 41 ? -10.790 26.926  -2.376  1.00 0.00 ? 41 ALA A C      1  
ATOM 624    O O      . ALA A 1 41 ? -10.363 27.568  -1.418  1.00 0.00 ? 41 ALA A O      1  
ATOM 625    C CB     . ALA A 1 41 ? -11.696 28.483  -4.144  1.00 0.00 ? 41 ALA A CB     1  
ATOM 626    H H      . ALA A 1 41 ? -13.018 28.946  -2.057  1.00 0.00 ? 41 ALA A H      1  
ATOM 627    H HA     . ALA A 1 41 ? -12.477 26.556  -3.643  1.00 0.00 ? 41 ALA A HA     1  
ATOM 628    H HB1    . ALA A 1 41 ? -12.603 28.794  -4.663  1.00 0.00 ? 41 ALA A HB1    1  
ATOM 629    H HB2    . ALA A 1 41 ? -11.253 29.344  -3.644  1.00 0.00 ? 41 ALA A HB2    1  
ATOM 630    H HB3    . ALA A 1 41 ? -10.988 28.089  -4.872  1.00 0.00 ? 41 ALA A HB3    1  
ATOM 631    N N      . VAL A 1 42 ? -10.184 25.820  -2.819  1.00 0.00 ? 42 VAL A N      1  
ATOM 632    C CA     . VAL A 1 42 ? -8.882  25.390  -2.330  1.00 0.00 ? 42 VAL A CA     1  
ATOM 633    C C      . VAL A 1 42 ? -7.965  25.067  -3.504  1.00 0.00 ? 42 VAL A C      1  
ATOM 634    O O      . VAL A 1 42 ? -8.339  24.302  -4.390  1.00 0.00 ? 42 VAL A O      1  
ATOM 635    C CB     . VAL A 1 42 ? -8.987  24.216  -1.352  1.00 0.00 ? 42 VAL A CB     1  
ATOM 636    C CG1    . VAL A 1 42 ? -9.917  24.557  -0.190  1.00 0.00 ? 42 VAL A CG1    1  
ATOM 637    C CG2    . VAL A 1 42 ? -9.501  22.924  -1.984  1.00 0.00 ? 42 VAL A CG2    1  
ATOM 638    H H      . VAL A 1 42 ? -10.576 25.328  -3.610  1.00 0.00 ? 42 VAL A H      1  
ATOM 639    H HA     . VAL A 1 42 ? -8.426  26.219  -1.788  1.00 0.00 ? 42 VAL A HA     1  
ATOM 640    H HB     . VAL A 1 42 ? -7.994  24.023  -0.946  1.00 0.00 ? 42 VAL A HB     1  
ATOM 641    H HG11   . VAL A 1 42 ? -9.598  25.492  0.268   1.00 0.00 ? 42 VAL A HG11   1  
ATOM 642    H HG12   . VAL A 1 42 ? -10.942 24.657  -0.546  1.00 0.00 ? 42 VAL A HG12   1  
ATOM 643    H HG13   . VAL A 1 42 ? -9.877  23.759  0.550   1.00 0.00 ? 42 VAL A HG13   1  
ATOM 644    H HG21   . VAL A 1 42 ? -8.784  22.555  -2.716  1.00 0.00 ? 42 VAL A HG21   1  
ATOM 645    H HG22   . VAL A 1 42 ? -9.634  22.166  -1.212  1.00 0.00 ? 42 VAL A HG22   1  
ATOM 646    H HG23   . VAL A 1 42 ? -10.454 23.109  -2.475  1.00 0.00 ? 42 VAL A HG23   1  
ATOM 647    N N      . HIS A 1 43 ? -6.779  25.679  -3.540  1.00 0.00 ? 43 HIS A N      1  
ATOM 648    C CA     . HIS A 1 43 ? -5.837  25.536  -4.639  1.00 0.00 ? 43 HIS A CA     1  
ATOM 649    C C      . HIS A 1 43 ? -4.407  25.707  -4.147  1.00 0.00 ? 43 HIS A C      1  
ATOM 650    O O      . HIS A 1 43 ? -4.166  26.367  -3.139  1.00 0.00 ? 43 HIS A O      1  
ATOM 651    C CB     . HIS A 1 43 ? -6.130  26.568  -5.729  1.00 0.00 ? 43 HIS A CB     1  
ATOM 652    C CG     . HIS A 1 43 ? -7.503  26.437  -6.331  1.00 0.00 ? 43 HIS A CG     1  
ATOM 653    N ND1    . HIS A 1 43 ? -7.899  25.444  -7.227  1.00 0.00 ? 43 HIS A ND1    1  
ATOM 654    C CD2    . HIS A 1 43 ? -8.593  27.189  -5.986  1.00 0.00 ? 43 HIS A CD2    1  
ATOM 655    C CE1    . HIS A 1 43 ? -9.215  25.618  -7.403  1.00 0.00 ? 43 HIS A CE1    1  
ATOM 656    N NE2    . HIS A 1 43 ? -9.660  26.657  -6.678  1.00 0.00 ? 43 HIS A NE2    1  
ATOM 657    H H      . HIS A 1 43 ? -6.512  26.280  -2.771  1.00 0.00 ? 43 HIS A H      1  
ATOM 658    H HA     . HIS A 1 43 ? -5.931  24.537  -5.065  1.00 0.00 ? 43 HIS A HA     1  
ATOM 659    H HB2    . HIS A 1 43 ? -6.023  27.569  -5.311  1.00 0.00 ? 43 HIS A HB2    1  
ATOM 660    H HB3    . HIS A 1 43 ? -5.395  26.457  -6.527  1.00 0.00 ? 43 HIS A HB3    1  
ATOM 661    H HD2    . HIS A 1 43 ? -8.616  27.997  -5.269  1.00 0.00 ? 43 HIS A HD2    1  
ATOM 662    H HE1    . HIS A 1 43 ? -9.853  24.960  -7.976  1.00 0.00 ? 43 HIS A HE1    1  
ATOM 663    H HE2    . HIS A 1 43 ? -10.626 26.947  -6.605  1.00 0.00 ? 43 HIS A HE2    1  
ATOM 664    N N      . ARG A 1 44 ? -3.440  25.160  -4.888  1.00 0.00 ? 44 ARG A N      1  
ATOM 665    C CA     . ARG A 1 44 ? -2.030  25.429  -4.658  1.00 0.00 ? 44 ARG A CA     1  
ATOM 666    C C      . ARG A 1 44 ? -1.642  26.823  -5.135  1.00 0.00 ? 44 ARG A C      1  
ATOM 667    O O      . ARG A 1 44 ? -2.281  27.377  -6.027  1.00 0.00 ? 44 ARG A O      1  
ATOM 668    C CB     . ARG A 1 44 ? -1.188  24.356  -5.348  1.00 0.00 ? 44 ARG A CB     1  
ATOM 669    C CG     . ARG A 1 44 ? -1.341  24.489  -6.862  1.00 0.00 ? 44 ARG A CG     1  
ATOM 670    C CD     . ARG A 1 44 ? -0.623  23.372  -7.604  1.00 0.00 ? 44 ARG A CD     1  
ATOM 671    N NE     . ARG A 1 44 ? -1.414  22.146  -7.551  1.00 0.00 ? 44 ARG A NE     1  
ATOM 672    C CZ     . ARG A 1 44 ? -1.171  21.084  -8.323  1.00 0.00 ? 44 ARG A CZ     1  
ATOM 673    N NH1    . ARG A 1 44 ? -0.036  20.981  -9.014  1.00 0.00 ? 44 ARG A NH1    1  
ATOM 674    N NH2    . ARG A 1 44 ? -2.072  20.108  -8.410  1.00 0.00 ? 44 ARG A NH2    1  
ATOM 675    H H      . ARG A 1 44 ? -3.699  24.614  -5.698  1.00 0.00 ? 44 ARG A H      1  
ATOM 676    H HA     . ARG A 1 44 ? -1.842  25.383  -3.586  1.00 0.00 ? 44 ARG A HA     1  
ATOM 677    H HB2    . ARG A 1 44 ? -0.140  24.481  -5.076  1.00 0.00 ? 44 ARG A HB2    1  
ATOM 678    H HB3    . ARG A 1 44 ? -1.525  23.370  -5.027  1.00 0.00 ? 44 ARG A HB3    1  
ATOM 679    H HG2    . ARG A 1 44 ? -2.399  24.449  -7.121  1.00 0.00 ? 44 ARG A HG2    1  
ATOM 680    H HG3    . ARG A 1 44 ? -0.921  25.439  -7.186  1.00 0.00 ? 44 ARG A HG3    1  
ATOM 681    H HD2    . ARG A 1 44 ? -0.490  23.667  -8.645  1.00 0.00 ? 44 ARG A HD2    1  
ATOM 682    H HD3    . ARG A 1 44 ? 0.356   23.211  -7.156  1.00 0.00 ? 44 ARG A HD3    1  
ATOM 683    H HE     . ARG A 1 44 ? -2.261  22.170  -7.001  1.00 0.00 ? 44 ARG A HE     1  
ATOM 684    H HH11   . ARG A 1 44 ? 0.635   21.739  -9.011  1.00 0.00 ? 44 ARG A HH11   1  
ATOM 685    H HH12   . ARG A 1 44 ? 0.202   20.111  -9.468  1.00 0.00 ? 44 ARG A HH12   1  
ATOM 686    H HH21   . ARG A 1 44 ? -2.967  20.193  -7.947  1.00 0.00 ? 44 ARG A HH21   1  
ATOM 687    H HH22   . ARG A 1 44 ? -1.907  19.341  -9.041  1.00 0.00 ? 44 ARG A HH22   1  
ATOM 688    N N      . GLU A 1 45 ? -0.497  27.325  -4.669  1.00 0.00 ? 45 GLU A N      1  
ATOM 689    C CA     . GLU A 1 45 ? 0.004   28.632  -5.066  1.00 0.00 ? 45 GLU A CA     1  
ATOM 690    C C      . GLU A 1 45 ? 0.546   28.629  -6.494  1.00 0.00 ? 45 GLU A C      1  
ATOM 691    O O      . GLU A 1 45 ? 0.493   29.642  -7.189  1.00 0.00 ? 45 GLU A O      1  
ATOM 692    C CB     . GLU A 1 45 ? 1.054   29.101  -4.059  1.00 0.00 ? 45 GLU A CB     1  
ATOM 693    C CG     . GLU A 1 45 ? 1.507   30.528  -4.366  1.00 0.00 ? 45 GLU A CG     1  
ATOM 694    C CD     . GLU A 1 45 ? 2.259   31.145  -3.191  1.00 0.00 ? 45 GLU A CD     1  
ATOM 695    O OE1    . GLU A 1 45 ? 1.588   31.669  -2.275  1.00 0.00 ? 45 GLU A OE1    1  
ATOM 696    O OE2    . GLU A 1 45 ? 3.510   31.113  -3.213  1.00 0.00 ? 45 GLU A OE2    1  
ATOM 697    H H      . GLU A 1 45 ? 0.034   26.774  -4.008  1.00 0.00 ? 45 GLU A H      1  
ATOM 698    H HA     . GLU A 1 45 ? -0.824  29.340  -5.034  1.00 0.00 ? 45 GLU A HA     1  
ATOM 699    H HB2    . GLU A 1 45 ? 0.618   29.074  -3.060  1.00 0.00 ? 45 GLU A HB2    1  
ATOM 700    H HB3    . GLU A 1 45 ? 1.916   28.433  -4.087  1.00 0.00 ? 45 GLU A HB3    1  
ATOM 701    H HG2    . GLU A 1 45 ? 2.156   30.512  -5.242  1.00 0.00 ? 45 GLU A HG2    1  
ATOM 702    H HG3    . GLU A 1 45 ? 0.633   31.138  -4.597  1.00 0.00 ? 45 GLU A HG3    1  
ATOM 703    N N      . GLU A 1 46 ? 0.981   27.462  -6.974  1.00 0.00 ? 46 GLU A N      1  
ATOM 704    C CA     . GLU A 1 46 ? 1.382   27.228  -8.353  1.00 0.00 ? 46 GLU A CA     1  
ATOM 705    C C      . GLU A 1 46 ? 0.234   27.427  -9.345  1.00 0.00 ? 46 GLU A C      1  
ATOM 706    O O      . GLU A 1 46 ? 0.483   27.672  -10.525 1.00 0.00 ? 46 GLU A O      1  
ATOM 707    C CB     . GLU A 1 46 ? 1.973   25.817  -8.404  1.00 0.00 ? 46 GLU A CB     1  
ATOM 708    C CG     . GLU A 1 46 ? 2.155   25.224  -9.801  1.00 0.00 ? 46 GLU A CG     1  
ATOM 709    C CD     . GLU A 1 46 ? 2.734   23.815  -9.710  1.00 0.00 ? 46 GLU A CD     1  
ATOM 710    O OE1    . GLU A 1 46 ? 1.991   22.907  -9.276  1.00 0.00 ? 46 GLU A OE1    1  
ATOM 711    O OE2    . GLU A 1 46 ? 3.918   23.641  -10.074 1.00 0.00 ? 46 GLU A OE2    1  
ATOM 712    H H      . GLU A 1 46 ? 1.062   26.689  -6.330  1.00 0.00 ? 46 GLU A H      1  
ATOM 713    H HA     . GLU A 1 46 ? 2.168   27.937  -8.614  1.00 0.00 ? 46 GLU A HA     1  
ATOM 714    H HB2    . GLU A 1 46 ? 2.945   25.837  -7.909  1.00 0.00 ? 46 GLU A HB2    1  
ATOM 715    H HB3    . GLU A 1 46 ? 1.329   25.151  -7.833  1.00 0.00 ? 46 GLU A HB3    1  
ATOM 716    H HG2    . GLU A 1 46 ? 1.189   25.171  -10.304 1.00 0.00 ? 46 GLU A HG2    1  
ATOM 717    H HG3    . GLU A 1 46 ? 2.819   25.867  -10.381 1.00 0.00 ? 46 GLU A HG3    1  
ATOM 718    N N      . ILE A 1 47 ? -1.020  27.375  -8.883  1.00 0.00 ? 47 ILE A N      1  
ATOM 719    C CA     . ILE A 1 47 ? -2.208  27.460  -9.719  1.00 0.00 ? 47 ILE A CA     1  
ATOM 720    C C      . ILE A 1 47 ? -3.075  28.648  -9.316  1.00 0.00 ? 47 ILE A C      1  
ATOM 721    O O      . ILE A 1 47 ? -3.756  29.217  -10.164 1.00 0.00 ? 47 ILE A O      1  
ATOM 722    C CB     . ILE A 1 47 ? -2.967  26.128  -9.657  1.00 0.00 ? 47 ILE A CB     1  
ATOM 723    C CG1    . ILE A 1 47 ? -2.297  25.122  -10.599 1.00 0.00 ? 47 ILE A CG1    1  
ATOM 724    C CG2    . ILE A 1 47 ? -4.458  26.260  -9.970  1.00 0.00 ? 47 ILE A CG2    1  
ATOM 725    C CD1    . ILE A 1 47 ? -3.049  23.796  -10.728 1.00 0.00 ? 47 ILE A CD1    1  
ATOM 726    H H      . ILE A 1 47 ? -1.162  27.295  -7.885  1.00 0.00 ? 47 ILE A H      1  
ATOM 727    H HA     . ILE A 1 47 ? -1.911  27.633  -10.753 1.00 0.00 ? 47 ILE A HA     1  
ATOM 728    H HB     . ILE A 1 47 ? -2.902  25.752  -8.639  1.00 0.00 ? 47 ILE A HB     1  
ATOM 729    H HG12   . ILE A 1 47 ? -2.211  25.563  -11.591 1.00 0.00 ? 47 ILE A HG12   1  
ATOM 730    H HG13   . ILE A 1 47 ? -1.291  24.918  -10.234 1.00 0.00 ? 47 ILE A HG13   1  
ATOM 731    H HG21   . ILE A 1 47 ? -4.599  26.612  -10.991 1.00 0.00 ? 47 ILE A HG21   1  
ATOM 732    H HG22   . ILE A 1 47 ? -4.943  25.293  -9.842  1.00 0.00 ? 47 ILE A HG22   1  
ATOM 733    H HG23   . ILE A 1 47 ? -4.929  26.950  -9.269  1.00 0.00 ? 47 ILE A HG23   1  
ATOM 734    H HD11   . ILE A 1 47 ? -2.417  23.058  -11.222 1.00 0.00 ? 47 ILE A HD11   1  
ATOM 735    H HD12   . ILE A 1 47 ? -3.327  23.416  -9.745  1.00 0.00 ? 47 ILE A HD12   1  
ATOM 736    H HD13   . ILE A 1 47 ? -3.944  23.949  -11.332 1.00 0.00 ? 47 ILE A HD13   1  
ATOM 737    N N      . TYR A 1 48 ? -3.013  29.099  -8.060  1.00 0.00 ? 48 TYR A N      1  
ATOM 738    C CA     . TYR A 1 48 ? -3.858  30.174  -7.573  1.00 0.00 ? 48 TYR A CA     1  
ATOM 739    C C      . TYR A 1 48 ? -3.601  31.460  -8.352  1.00 0.00 ? 48 TYR A C      1  
ATOM 740    O O      . TYR A 1 48 ? -4.513  32.235  -8.629  1.00 0.00 ? 48 TYR A O      1  
ATOM 741    C CB     . TYR A 1 48 ? -3.586  30.367  -6.082  1.00 0.00 ? 48 TYR A CB     1  
ATOM 742    C CG     . TYR A 1 48 ? -4.434  31.459  -5.477  1.00 0.00 ? 48 TYR A CG     1  
ATOM 743    C CD1    . TYR A 1 48 ? -5.711  31.154  -4.988  1.00 0.00 ? 48 TYR A CD1    1  
ATOM 744    C CD2    . TYR A 1 48 ? -3.993  32.788  -5.530  1.00 0.00 ? 48 TYR A CD2    1  
ATOM 745    C CE1    . TYR A 1 48 ? -6.555  32.183  -4.548  1.00 0.00 ? 48 TYR A CE1    1  
ATOM 746    C CE2    . TYR A 1 48 ? -4.841  33.823  -5.121  1.00 0.00 ? 48 TYR A CE2    1  
ATOM 747    C CZ     . TYR A 1 48 ? -6.121  33.523  -4.610  1.00 0.00 ? 48 TYR A CZ     1  
ATOM 748    O OH     . TYR A 1 48 ? -6.953  34.531  -4.222  1.00 0.00 ? 48 TYR A OH     1  
ATOM 749    H H      . TYR A 1 48 ? -2.376  28.675  -7.402  1.00 0.00 ? 48 TYR A H      1  
ATOM 750    H HA     . TYR A 1 48 ? -4.901  29.894  -7.707  1.00 0.00 ? 48 TYR A HA     1  
ATOM 751    H HB2    . TYR A 1 48 ? -3.796  29.434  -5.561  1.00 0.00 ? 48 TYR A HB2    1  
ATOM 752    H HB3    . TYR A 1 48 ? -2.535  30.614  -5.939  1.00 0.00 ? 48 TYR A HB3    1  
ATOM 753    H HD1    . TYR A 1 48 ? -6.051  30.129  -4.979  1.00 0.00 ? 48 TYR A HD1    1  
ATOM 754    H HD2    . TYR A 1 48 ? -3.021  33.016  -5.947  1.00 0.00 ? 48 TYR A HD2    1  
ATOM 755    H HE1    . TYR A 1 48 ? -7.549  31.947  -4.197  1.00 0.00 ? 48 TYR A HE1    1  
ATOM 756    H HE2    . TYR A 1 48 ? -4.536  34.850  -5.259  1.00 0.00 ? 48 TYR A HE2    1  
ATOM 757    H HH     . TYR A 1 48 ? -7.801  34.209  -3.900  1.00 0.00 ? 48 TYR A HH     1  
ATOM 758    N N      . GLN A 1 49 ? -2.355  31.638  -8.794  1.00 0.00 ? 49 GLN A N      1  
ATOM 759    C CA     . GLN A 1 49 ? -1.928  32.797  -9.555  1.00 0.00 ? 49 GLN A CA     1  
ATOM 760    C C      . GLN A 1 49 ? -2.402  32.729  -11.005 1.00 0.00 ? 49 GLN A C      1  
ATOM 761    O O      . GLN A 1 49 ? -2.469  33.759  -11.671 1.00 0.00 ? 49 GLN A O      1  
ATOM 762    C CB     . GLN A 1 49 ? -0.406  32.896  -9.459  1.00 0.00 ? 49 GLN A CB     1  
ATOM 763    C CG     . GLN A 1 49 ? 0.025   32.914  -7.992  1.00 0.00 ? 49 GLN A CG     1  
ATOM 764    C CD     . GLN A 1 49 ? 1.531   33.090  -7.850  1.00 0.00 ? 49 GLN A CD     1  
ATOM 765    O OE1    . GLN A 1 49 ? 2.054   34.200  -7.903  1.00 0.00 ? 49 GLN A OE1    1  
ATOM 766    N NE2    . GLN A 1 49 ? 2.258   31.987  -7.684  1.00 0.00 ? 49 GLN A NE2    1  
ATOM 767    H H      . GLN A 1 49 ? -1.652  30.958  -8.541  1.00 0.00 ? 49 GLN A H      1  
ATOM 768    H HA     . GLN A 1 49 ? -2.362  33.687  -9.098  1.00 0.00 ? 49 GLN A HA     1  
ATOM 769    H HB2    . GLN A 1 49 ? 0.050   32.042  -9.960  1.00 0.00 ? 49 GLN A HB2    1  
ATOM 770    H HB3    . GLN A 1 49 ? -0.074  33.814  -9.944  1.00 0.00 ? 49 GLN A HB3    1  
ATOM 771    H HG2    . GLN A 1 49 ? -0.503  33.712  -7.473  1.00 0.00 ? 49 GLN A HG2    1  
ATOM 772    H HG3    . GLN A 1 49 ? -0.261  31.980  -7.507  1.00 0.00 ? 49 GLN A HG3    1  
ATOM 773    H HE21   . GLN A 1 49 ? 1.794   31.092  -7.602  1.00 0.00 ? 49 GLN A HE21   1  
ATOM 774    H HE22   . GLN A 1 49 ? 3.259   32.062  -7.586  1.00 0.00 ? 49 GLN A HE22   1  
ATOM 775    N N      . ARG A 1 50 ? -2.794  31.540  -11.478 1.00 0.00 ? 50 ARG A N      1  
ATOM 776    C CA     . ARG A 1 50 ? -3.459  31.348  -12.759 1.00 0.00 ? 50 ARG A CA     1  
ATOM 777    C C      . ARG A 1 50 ? -4.952  31.648  -12.656 1.00 0.00 ? 50 ARG A C      1  
ATOM 778    O O      . ARG A 1 50 ? -5.518  32.234  -13.576 1.00 0.00 ? 50 ARG A O      1  
ATOM 779    C CB     . ARG A 1 50 ? -3.150  29.950  -13.303 1.00 0.00 ? 50 ARG A CB     1  
ATOM 780    C CG     . ARG A 1 50 ? -4.311  28.954  -13.279 1.00 0.00 ? 50 ARG A CG     1  
ATOM 781    C CD     . ARG A 1 50 ? -3.831  27.548  -13.631 1.00 0.00 ? 50 ARG A CD     1  
ATOM 782    N NE     . ARG A 1 50 ? -3.441  27.444  -15.041 1.00 0.00 ? 50 ARG A NE     1  
ATOM 783    C CZ     . ARG A 1 50 ? -2.971  26.341  -15.631 1.00 0.00 ? 50 ARG A CZ     1  
ATOM 784    N NH1    . ARG A 1 50 ? -2.827  25.200  -14.955 1.00 0.00 ? 50 ARG A NH1    1  
ATOM 785    N NH2    . ARG A 1 50 ? -2.638  26.366  -16.921 1.00 0.00 ? 50 ARG A NH2    1  
ATOM 786    H H      . ARG A 1 50 ? -2.717  30.734  -10.874 1.00 0.00 ? 50 ARG A H      1  
ATOM 787    H HA     . ARG A 1 50 ? -3.043  32.068  -13.464 1.00 0.00 ? 50 ARG A HA     1  
ATOM 788    H HB2    . ARG A 1 50 ? -2.815  30.056  -14.336 1.00 0.00 ? 50 ARG A HB2    1  
ATOM 789    H HB3    . ARG A 1 50 ? -2.318  29.528  -12.739 1.00 0.00 ? 50 ARG A HB3    1  
ATOM 790    H HG2    . ARG A 1 50 ? -4.762  28.921  -12.289 1.00 0.00 ? 50 ARG A HG2    1  
ATOM 791    H HG3    . ARG A 1 50 ? -5.080  29.241  -13.996 1.00 0.00 ? 50 ARG A HG3    1  
ATOM 792    H HD2    . ARG A 1 50 ? -2.983  27.305  -12.992 1.00 0.00 ? 50 ARG A HD2    1  
ATOM 793    H HD3    . ARG A 1 50 ? -4.639  26.848  -13.422 1.00 0.00 ? 50 ARG A HD3    1  
ATOM 794    H HE     . ARG A 1 50 ? -3.545  28.270  -15.612 1.00 0.00 ? 50 ARG A HE     1  
ATOM 795    H HH11   . ARG A 1 50 ? -3.093  25.157  -13.983 1.00 0.00 ? 50 ARG A HH11   1  
ATOM 796    H HH12   . ARG A 1 50 ? -2.471  24.379  -15.420 1.00 0.00 ? 50 ARG A HH12   1  
ATOM 797    H HH21   . ARG A 1 50 ? -2.738  27.217  -17.453 1.00 0.00 ? 50 ARG A HH21   1  
ATOM 798    H HH22   . ARG A 1 50 ? -2.284  25.533  -17.368 1.00 0.00 ? 50 ARG A HH22   1  
ATOM 799    N N      . ILE A 1 51 ? -5.572  31.331  -11.516 1.00 0.00 ? 51 ILE A N      1  
ATOM 800    C CA     . ILE A 1 51 ? -6.959  31.667  -11.230 1.00 0.00 ? 51 ILE A CA     1  
ATOM 801    C C      . ILE A 1 51 ? -7.119  33.182  -11.193 1.00 0.00 ? 51 ILE A C      1  
ATOM 802    O O      . ILE A 1 51 ? -7.936  33.752  -11.914 1.00 0.00 ? 51 ILE A O      1  
ATOM 803    C CB     . ILE A 1 51 ? -7.398  31.034  -9.906  1.00 0.00 ? 51 ILE A CB     1  
ATOM 804    C CG1    . ILE A 1 51 ? -7.251  29.513  -9.968  1.00 0.00 ? 51 ILE A CG1    1  
ATOM 805    C CG2    . ILE A 1 51 ? -8.846  31.386  -9.559  1.00 0.00 ? 51 ILE A CG2    1  
ATOM 806    C CD1    . ILE A 1 51 ? -7.489  28.894  -8.593  1.00 0.00 ? 51 ILE A CD1    1  
ATOM 807    H H      . ILE A 1 51 ? -5.051  30.826  -10.813 1.00 0.00 ? 51 ILE A H      1  
ATOM 808    H HA     . ILE A 1 51 ? -7.596  31.268  -12.016 1.00 0.00 ? 51 ILE A HA     1  
ATOM 809    H HB     . ILE A 1 51 ? -6.760  31.416  -9.110  1.00 0.00 ? 51 ILE A HB     1  
ATOM 810    H HG12   . ILE A 1 51 ? -7.961  29.098  -10.683 1.00 0.00 ? 51 ILE A HG12   1  
ATOM 811    H HG13   . ILE A 1 51 ? -6.244  29.247  -10.286 1.00 0.00 ? 51 ILE A HG13   1  
ATOM 812    H HG21   . ILE A 1 51 ? -9.026  31.177  -8.503  1.00 0.00 ? 51 ILE A HG21   1  
ATOM 813    H HG22   . ILE A 1 51 ? -9.040  32.442  -9.737  1.00 0.00 ? 51 ILE A HG22   1  
ATOM 814    H HG23   . ILE A 1 51 ? -9.531  30.796  -10.169 1.00 0.00 ? 51 ILE A HG23   1  
ATOM 815    H HD11   . ILE A 1 51 ? -7.100  27.877  -8.591  1.00 0.00 ? 51 ILE A HD11   1  
ATOM 816    H HD12   . ILE A 1 51 ? -6.976  29.486  -7.835  1.00 0.00 ? 51 ILE A HD12   1  
ATOM 817    H HD13   . ILE A 1 51 ? -8.558  28.876  -8.378  1.00 0.00 ? 51 ILE A HD13   1  
ATOM 818    N N      . GLN A 1 52 ? -6.269  33.844  -10.405 1.00 0.00 ? 52 GLN A N      1  
ATOM 819    C CA     . GLN A 1 52 ? -6.324  35.280  -10.191 1.00 0.00 ? 52 GLN A CA     1  
ATOM 820    C C      . GLN A 1 52 ? -5.659  36.059  -11.323 1.00 0.00 ? 52 GLN A C      1  
ATOM 821    O O      . GLN A 1 52 ? -5.569  37.283  -11.256 1.00 0.00 ? 52 GLN A O      1  
ATOM 822    C CB     . GLN A 1 52 ? -5.746  35.613  -8.814  1.00 0.00 ? 52 GLN A CB     1  
ATOM 823    C CG     . GLN A 1 52 ? -6.577  35.003  -7.685  1.00 0.00 ? 52 GLN A CG     1  
ATOM 824    C CD     . GLN A 1 52 ? -8.069  35.277  -7.835  1.00 0.00 ? 52 GLN A CD     1  
ATOM 825    O OE1    . GLN A 1 52 ? -8.503  36.419  -7.955  1.00 0.00 ? 52 GLN A OE1    1  
ATOM 826    N NE2    . GLN A 1 52 ? -8.880  34.223  -7.891  1.00 0.00 ? 52 GLN A NE2    1  
ATOM 827    H H      . GLN A 1 52 ? -5.573  33.318  -9.894  1.00 0.00 ? 52 GLN A H      1  
ATOM 828    H HA     . GLN A 1 52 ? -7.372  35.578  -10.203 1.00 0.00 ? 52 GLN A HA     1  
ATOM 829    H HB2    . GLN A 1 52 ? -4.724  35.236  -8.749  1.00 0.00 ? 52 GLN A HB2    1  
ATOM 830    H HB3    . GLN A 1 52 ? -5.721  36.693  -8.670  1.00 0.00 ? 52 GLN A HB3    1  
ATOM 831    H HG2    . GLN A 1 52 ? -6.409  33.926  -7.657  1.00 0.00 ? 52 GLN A HG2    1  
ATOM 832    H HG3    . GLN A 1 52 ? -6.246  35.427  -6.739  1.00 0.00 ? 52 GLN A HG3    1  
ATOM 833    H HE21   . GLN A 1 52 ? -8.507  33.295  -7.756  1.00 0.00 ? 52 GLN A HE21   1  
ATOM 834    H HE22   . GLN A 1 52 ? -9.835  34.347  -8.192  1.00 0.00 ? 52 GLN A HE22   1  
ATOM 835    N N      . ALA A 1 53 ? -5.222  35.370  -12.382 1.00 0.00 ? 53 ALA A N      1  
ATOM 836    C CA     . ALA A 1 53 ? -4.687  36.018  -13.565 1.00 0.00 ? 53 ALA A CA     1  
ATOM 837    C C      . ALA A 1 53 ? -5.745  36.842  -14.297 1.00 0.00 ? 53 ALA A C      1  
ATOM 838    O O      . ALA A 1 53 ? -5.414  37.840  -14.934 1.00 0.00 ? 53 ALA A O      1  
ATOM 839    C CB     . ALA A 1 53 ? -4.088  34.970  -14.504 1.00 0.00 ? 53 ALA A CB     1  
ATOM 840    H H      . ALA A 1 53 ? -5.303  34.363  -12.389 1.00 0.00 ? 53 ALA A H      1  
ATOM 841    H HA     . ALA A 1 53 ? -3.889  36.677  -13.231 1.00 0.00 ? 53 ALA A HA     1  
ATOM 842    H HB1    . ALA A 1 53 ? -3.353  34.369  -13.971 1.00 0.00 ? 53 ALA A HB1    1  
ATOM 843    H HB2    . ALA A 1 53 ? -4.878  34.326  -14.893 1.00 0.00 ? 53 ALA A HB2    1  
ATOM 844    H HB3    . ALA A 1 53 ? -3.598  35.471  -15.338 1.00 0.00 ? 53 ALA A HB3    1  
ATOM 845    N N      . GLY A 1 54 ? -7.014  36.428  -14.212 1.00 0.00 ? 54 GLY A N      1  
ATOM 846    C CA     . GLY A 1 54 ? -8.133  37.143  -14.805 1.00 0.00 ? 54 GLY A CA     1  
ATOM 847    C C      . GLY A 1 54 ? -9.187  36.225  -15.417 1.00 0.00 ? 54 GLY A C      1  
ATOM 848    O O      . GLY A 1 54 ? -9.887  36.638  -16.341 1.00 0.00 ? 54 GLY A O      1  
ATOM 849    H H      . GLY A 1 54 ? -7.215  35.608  -13.657 1.00 0.00 ? 54 GLY A H      1  
ATOM 850    H HA2    . GLY A 1 54 ? -8.611  37.742  -14.029 1.00 0.00 ? 54 GLY A HA2    1  
ATOM 851    H HA3    . GLY A 1 54 ? -7.772  37.815  -15.583 1.00 0.00 ? 54 GLY A HA3    1  
ATOM 852    N N      . LEU A 1 55 ? -9.290  34.982  -14.940 1.00 0.00 ? 55 LEU A N      1  
ATOM 853    C CA     . LEU A 1 55 ? -10.262 33.999  -15.382 1.00 0.00 ? 55 LEU A CA     1  
ATOM 854    C C      . LEU A 1 55 ? -11.085 33.517  -14.188 1.00 0.00 ? 55 LEU A C      1  
ATOM 855    O O      . LEU A 1 55 ? -10.905 34.001  -13.072 1.00 0.00 ? 55 LEU A O      1  
ATOM 856    C CB     . LEU A 1 55 ? -9.544  32.899  -16.171 1.00 0.00 ? 55 LEU A CB     1  
ATOM 857    C CG     . LEU A 1 55 ? -8.256  32.359  -15.542 1.00 0.00 ? 55 LEU A CG     1  
ATOM 858    C CD1    . LEU A 1 55 ? -8.541  31.372  -14.415 1.00 0.00 ? 55 LEU A CD1    1  
ATOM 859    C CD2    . LEU A 1 55 ? -7.437  31.645  -16.612 1.00 0.00 ? 55 LEU A CD2    1  
ATOM 860    H H      . LEU A 1 55 ? -8.725  34.692  -14.155 1.00 0.00 ? 55 LEU A H      1  
ATOM 861    H HA     . LEU A 1 55 ? -10.962 34.479  -16.064 1.00 0.00 ? 55 LEU A HA     1  
ATOM 862    H HB2    . LEU A 1 55 ? -10.230 32.071  -16.352 1.00 0.00 ? 55 LEU A HB2    1  
ATOM 863    H HB3    . LEU A 1 55 ? -9.288  33.322  -17.142 1.00 0.00 ? 55 LEU A HB3    1  
ATOM 864    H HG     . LEU A 1 55 ? -7.649  33.175  -15.151 1.00 0.00 ? 55 LEU A HG     1  
ATOM 865    H HD11   . LEU A 1 55 ? -9.280  30.637  -14.736 1.00 0.00 ? 55 LEU A HD11   1  
ATOM 866    H HD12   . LEU A 1 55 ? -7.623  30.853  -14.142 1.00 0.00 ? 55 LEU A HD12   1  
ATOM 867    H HD13   . LEU A 1 55 ? -8.911  31.925  -13.552 1.00 0.00 ? 55 LEU A HD13   1  
ATOM 868    H HD21   . LEU A 1 55 ? -6.513  31.273  -16.170 1.00 0.00 ? 55 LEU A HD21   1  
ATOM 869    H HD22   . LEU A 1 55 ? -8.011  30.815  -17.025 1.00 0.00 ? 55 LEU A HD22   1  
ATOM 870    H HD23   . LEU A 1 55 ? -7.191  32.354  -17.402 1.00 0.00 ? 55 LEU A HD23   1  
ATOM 871    N N      . THR A 1 56 ? -12.001 32.577  -14.432 1.00 0.00 ? 56 THR A N      1  
ATOM 872    C CA     . THR A 1 56 ? -13.066 32.163  -13.528 1.00 0.00 ? 56 THR A CA     1  
ATOM 873    C C      . THR A 1 56 ? -14.070 33.278  -13.244 1.00 0.00 ? 56 THR A C      1  
ATOM 874    O O      . THR A 1 56 ? -13.861 34.432  -13.614 1.00 0.00 ? 56 THR A O      1  
ATOM 875    C CB     . THR A 1 56 ? -12.584 31.488  -12.240 1.00 0.00 ? 56 THR A CB     1  
ATOM 876    O OG1    . THR A 1 56 ? -12.065 32.418  -11.316 1.00 0.00 ? 56 THR A OG1    1  
ATOM 877    C CG2    . THR A 1 56 ? -11.538 30.406  -12.493 1.00 0.00 ? 56 THR A CG2    1  
ATOM 878    H H      . THR A 1 56 ? -12.048 32.212  -15.373 1.00 0.00 ? 56 THR A H      1  
ATOM 879    H HA     . THR A 1 56 ? -13.609 31.399  -14.078 1.00 0.00 ? 56 THR A HA     1  
ATOM 880    H HB     . THR A 1 56 ? -13.445 31.007  -11.775 1.00 0.00 ? 56 THR A HB     1  
ATOM 881    H HG1    . THR A 1 56 ? -11.525 33.042  -11.815 1.00 0.00 ? 56 THR A HG1    1  
ATOM 882    H HG21   . THR A 1 56 ? -10.573 30.868  -12.698 1.00 0.00 ? 56 THR A HG21   1  
ATOM 883    H HG22   . THR A 1 56 ? -11.448 29.778  -11.607 1.00 0.00 ? 56 THR A HG22   1  
ATOM 884    H HG23   . THR A 1 56 ? -11.838 29.790  -13.340 1.00 0.00 ? 56 THR A HG23   1  
ATOM 885    N N      . ALA A 1 57 ? -15.207 32.919  -12.639 1.00 0.00 ? 57 ALA A N      1  
ATOM 886    C CA     . ALA A 1 57 ? -16.313 33.826  -12.380 1.00 0.00 ? 57 ALA A CA     1  
ATOM 887    C C      . ALA A 1 57 ? -16.546 34.005  -10.880 1.00 0.00 ? 57 ALA A C      1  
ATOM 888    O O      . ALA A 1 57 ? -16.257 33.095  -10.104 1.00 0.00 ? 57 ALA A O      1  
ATOM 889    C CB     . ALA A 1 57 ? -17.560 33.287  -13.078 1.00 0.00 ? 57 ALA A CB     1  
ATOM 890    H H      . ALA A 1 57 ? -15.317 31.961  -12.338 1.00 0.00 ? 57 ALA A H      1  
ATOM 891    H HA     . ALA A 1 57 ? -16.078 34.799  -12.814 1.00 0.00 ? 57 ALA A HA     1  
ATOM 892    H HB1    . ALA A 1 57 ? -17.817 32.308  -12.672 1.00 0.00 ? 57 ALA A HB1    1  
ATOM 893    H HB2    . ALA A 1 57 ? -18.395 33.970  -12.920 1.00 0.00 ? 57 ALA A HB2    1  
ATOM 894    H HB3    . ALA A 1 57 ? -17.371 33.196  -14.149 1.00 0.00 ? 57 ALA A HB3    1  
ATOM 895    N N      . PRO A 1 58 ? -17.092 35.150  -10.455 1.00 0.00 ? 58 PRO A N      1  
ATOM 896    C CA     . PRO A 1 58 ? -17.373 35.433  -9.059  1.00 0.00 ? 58 PRO A CA     1  
ATOM 897    C C      . PRO A 1 58 ? -18.597 34.680  -8.553  1.00 0.00 ? 58 PRO A C      1  
ATOM 898    O O      . PRO A 1 58 ? -19.408 34.162  -9.319  1.00 0.00 ? 58 PRO A O      1  
ATOM 899    C CB     . PRO A 1 58 ? -17.581 36.944  -8.976  1.00 0.00 ? 58 PRO A CB     1  
ATOM 900    C CG     . PRO A 1 58 ? -18.071 37.324  -10.371 1.00 0.00 ? 58 PRO A CG     1  
ATOM 901    C CD     . PRO A 1 58 ? -17.433 36.286  -11.291 1.00 0.00 ? 58 PRO A CD     1  
ATOM 902    H HA     . PRO A 1 58 ? -16.524 35.158  -8.433  1.00 0.00 ? 58 PRO A HA     1  
ATOM 903    H HB2    . PRO A 1 58 ? -18.311 37.197  -8.207  1.00 0.00 ? 58 PRO A HB2    1  
ATOM 904    H HB3    . PRO A 1 58 ? -16.629 37.432  -8.769  1.00 0.00 ? 58 PRO A HB3    1  
ATOM 905    H HG2    . PRO A 1 58 ? -19.157 37.237  -10.419 1.00 0.00 ? 58 PRO A HG2    1  
ATOM 906    H HG3    . PRO A 1 58 ? -17.756 38.331  -10.641 1.00 0.00 ? 58 PRO A HG3    1  
ATOM 907    H HD2    . PRO A 1 58 ? -18.142 35.999  -12.068 1.00 0.00 ? 58 PRO A HD2    1  
ATOM 908    H HD3    . PRO A 1 58 ? -16.530 36.697  -11.742 1.00 0.00 ? 58 PRO A HD3    1  
ATOM 909    N N      . ASP A 1 59 ? -18.724 34.636  -7.226  1.00 0.00 ? 59 ASP A N      1  
ATOM 910    C CA     . ASP A 1 59 ? -19.760 33.903  -6.524  1.00 0.00 ? 59 ASP A CA     1  
ATOM 911    C C      . ASP A 1 59 ? -21.108 34.614  -6.613  1.00 0.00 ? 59 ASP A C      1  
ATOM 912    O O      . ASP A 1 59 ? -21.241 35.741  -6.137  1.00 0.00 ? 59 ASP A O      1  
ATOM 913    C CB     . ASP A 1 59 ? -19.306 33.756  -5.074  1.00 0.00 ? 59 ASP A CB     1  
ATOM 914    C CG     . ASP A 1 59 ? -20.368 33.088  -4.205  1.00 0.00 ? 59 ASP A CG     1  
ATOM 915    O OD1    . ASP A 1 59 ? -20.866 32.015  -4.612  1.00 0.00 ? 59 ASP A OD1    1  
ATOM 916    O OD2    . ASP A 1 59 ? -20.673 33.636  -3.124  1.00 0.00 ? 59 ASP A OD2    1  
ATOM 917    H H      . ASP A 1 59 ? -18.034 35.113  -6.662  1.00 0.00 ? 59 ASP A H      1  
ATOM 918    H HA     . ASP A 1 59 ? -19.854 32.909  -6.964  1.00 0.00 ? 59 ASP A HA     1  
ATOM 919    H HB2    . ASP A 1 59 ? -18.392 33.162  -5.054  1.00 0.00 ? 59 ASP A HB2    1  
ATOM 920    H HB3    . ASP A 1 59 ? -19.067 34.748  -4.689  1.00 0.00 ? 59 ASP A HB3    1  
ATOM 921    N N      . MET B 1 1  ? -12.442 15.415  1.078   1.00 0.00 ? 1  MET B N      1  
ATOM 922    C CA     . MET B 1 1  ? -11.010 15.758  1.160   1.00 0.00 ? 1  MET B CA     1  
ATOM 923    C C      . MET B 1 1  ? -10.460 16.109  -0.216  1.00 0.00 ? 1  MET B C      1  
ATOM 924    O O      . MET B 1 1  ? -10.869 15.519  -1.213  1.00 0.00 ? 1  MET B O      1  
ATOM 925    C CB     . MET B 1 1  ? -10.214 14.590  1.743   1.00 0.00 ? 1  MET B CB     1  
ATOM 926    C CG     . MET B 1 1  ? -8.843  14.990  2.285   1.00 0.00 ? 1  MET B CG     1  
ATOM 927    S SD     . MET B 1 1  ? -8.889  15.698  3.947   1.00 0.00 ? 1  MET B SD     1  
ATOM 928    C CE     . MET B 1 1  ? -9.027  14.110  4.800   1.00 0.00 ? 1  MET B CE     1  
ATOM 929    H H1     . MET B 1 1  ? -12.547 14.494  0.675   1.00 0.00 ? 1  MET B H1     1  
ATOM 930    H H2     . MET B 1 1  ? -12.933 16.088  0.508   1.00 0.00 ? 1  MET B H2     1  
ATOM 931    H H3     . MET B 1 1  ? -12.849 15.404  2.003   1.00 0.00 ? 1  MET B H3     1  
ATOM 932    H HA     . MET B 1 1  ? -10.894 16.624  1.810   1.00 0.00 ? 1  MET B HA     1  
ATOM 933    H HB2    . MET B 1 1  ? -10.787 14.136  2.550   1.00 0.00 ? 1  MET B HB2    1  
ATOM 934    H HB3    . MET B 1 1  ? -10.070 13.843  0.963   1.00 0.00 ? 1  MET B HB3    1  
ATOM 935    H HG2    . MET B 1 1  ? -8.238  14.085  2.344   1.00 0.00 ? 1  MET B HG2    1  
ATOM 936    H HG3    . MET B 1 1  ? -8.356  15.688  1.605   1.00 0.00 ? 1  MET B HG3    1  
ATOM 937    H HE1    . MET B 1 1  ? -9.243  14.268  5.857   1.00 0.00 ? 1  MET B HE1    1  
ATOM 938    H HE2    . MET B 1 1  ? -9.819  13.519  4.339   1.00 0.00 ? 1  MET B HE2    1  
ATOM 939    H HE3    . MET B 1 1  ? -8.089  13.564  4.689   1.00 0.00 ? 1  MET B HE3    1  
ATOM 940    N N      . LEU B 1 2  ? -9.473  17.007  -0.255  1.00 0.00 ? 2  LEU B N      1  
ATOM 941    C CA     . LEU B 1 2  ? -8.711  17.371  -1.437  1.00 0.00 ? 2  LEU B CA     1  
ATOM 942    C C      . LEU B 1 2  ? -7.226  17.274  -1.096  1.00 0.00 ? 2  LEU B C      1  
ATOM 943    O O      . LEU B 1 2  ? -6.756  17.973  -0.201  1.00 0.00 ? 2  LEU B O      1  
ATOM 944    C CB     . LEU B 1 2  ? -9.164  18.775  -1.845  1.00 0.00 ? 2  LEU B CB     1  
ATOM 945    C CG     . LEU B 1 2  ? -8.579  19.336  -3.143  1.00 0.00 ? 2  LEU B CG     1  
ATOM 946    C CD1    . LEU B 1 2  ? -7.278  20.094  -2.899  1.00 0.00 ? 2  LEU B CD1    1  
ATOM 947    C CD2    . LEU B 1 2  ? -8.328  18.265  -4.200  1.00 0.00 ? 2  LEU B CD2    1  
ATOM 948    H H      . LEU B 1 2  ? -9.250  17.510  0.594   1.00 0.00 ? 2  LEU B H      1  
ATOM 949    H HA     . LEU B 1 2  ? -8.938  16.674  -2.242  1.00 0.00 ? 2  LEU B HA     1  
ATOM 950    H HB2    . LEU B 1 2  ? -10.246 18.750  -1.964  1.00 0.00 ? 2  LEU B HB2    1  
ATOM 951    H HB3    . LEU B 1 2  ? -8.947  19.468  -1.031  1.00 0.00 ? 2  LEU B HB3    1  
ATOM 952    H HG     . LEU B 1 2  ? -9.302  20.046  -3.548  1.00 0.00 ? 2  LEU B HG     1  
ATOM 953    H HD11   . LEU B 1 2  ? -7.425  20.832  -2.110  1.00 0.00 ? 2  LEU B HD11   1  
ATOM 954    H HD12   . LEU B 1 2  ? -6.489  19.402  -2.607  1.00 0.00 ? 2  LEU B HD12   1  
ATOM 955    H HD13   . LEU B 1 2  ? -6.992  20.606  -3.818  1.00 0.00 ? 2  LEU B HD13   1  
ATOM 956    H HD21   . LEU B 1 2  ? -8.079  18.762  -5.135  1.00 0.00 ? 2  LEU B HD21   1  
ATOM 957    H HD22   . LEU B 1 2  ? -7.498  17.622  -3.909  1.00 0.00 ? 2  LEU B HD22   1  
ATOM 958    H HD23   . LEU B 1 2  ? -9.228  17.668  -4.343  1.00 0.00 ? 2  LEU B HD23   1  
ATOM 959    N N      . ILE B 1 3  ? -6.503  16.353  -1.741  1.00 0.00 ? 3  ILE B N      1  
ATOM 960    C CA     . ILE B 1 3  ? -5.149  15.976  -1.365  1.00 0.00 ? 3  ILE B CA     1  
ATOM 961    C C      . ILE B 1 3  ? -4.132  16.458  -2.393  1.00 0.00 ? 3  ILE B C      1  
ATOM 962    O O      . ILE B 1 3  ? -4.352  16.325  -3.596  1.00 0.00 ? 3  ILE B O      1  
ATOM 963    C CB     . ILE B 1 3  ? -5.042  14.461  -1.171  1.00 0.00 ? 3  ILE B CB     1  
ATOM 964    C CG1    . ILE B 1 3  ? -5.923  13.959  -0.026  1.00 0.00 ? 3  ILE B CG1    1  
ATOM 965    C CG2    . ILE B 1 3  ? -3.612  14.058  -0.807  1.00 0.00 ? 3  ILE B CG2    1  
ATOM 966    C CD1    . ILE B 1 3  ? -7.356  13.635  -0.429  1.00 0.00 ? 3  ILE B CD1    1  
ATOM 967    H H      . ILE B 1 3  ? -6.945  15.820  -2.478  1.00 0.00 ? 3  ILE B H      1  
ATOM 968    H HA     . ILE B 1 3  ? -4.903  16.452  -0.417  1.00 0.00 ? 3  ILE B HA     1  
ATOM 969    H HB     . ILE B 1 3  ? -5.326  13.958  -2.096  1.00 0.00 ? 3  ILE B HB     1  
ATOM 970    H HG12   . ILE B 1 3  ? -5.503  13.032  0.361   1.00 0.00 ? 3  ILE B HG12   1  
ATOM 971    H HG13   . ILE B 1 3  ? -5.938  14.701  0.772   1.00 0.00 ? 3  ILE B HG13   1  
ATOM 972    H HG21   . ILE B 1 3  ? -3.296  14.583  0.095   1.00 0.00 ? 3  ILE B HG21   1  
ATOM 973    H HG22   . ILE B 1 3  ? -3.572  12.984  -0.627  1.00 0.00 ? 3  ILE B HG22   1  
ATOM 974    H HG23   . ILE B 1 3  ? -2.929  14.294  -1.623  1.00 0.00 ? 3  ILE B HG23   1  
ATOM 975    H HD11   . ILE B 1 3  ? -7.361  12.901  -1.234  1.00 0.00 ? 3  ILE B HD11   1  
ATOM 976    H HD12   . ILE B 1 3  ? -7.844  13.213  0.447   1.00 0.00 ? 3  ILE B HD12   1  
ATOM 977    H HD13   . ILE B 1 3  ? -7.889  14.537  -0.724  1.00 0.00 ? 3  ILE B HD13   1  
ATOM 978    N N      . LEU B 1 4  ? -2.998  16.964  -1.898  1.00 0.00 ? 4  LEU B N      1  
ATOM 979    C CA     . LEU B 1 4  ? -1.918  17.518  -2.697  1.00 0.00 ? 4  LEU B CA     1  
ATOM 980    C C      . LEU B 1 4  ? -0.558  17.149  -2.112  1.00 0.00 ? 4  LEU B C      1  
ATOM 981    O O      . LEU B 1 4  ? -0.403  17.103  -0.892  1.00 0.00 ? 4  LEU B O      1  
ATOM 982    C CB     . LEU B 1 4  ? -2.035  19.045  -2.717  1.00 0.00 ? 4  LEU B CB     1  
ATOM 983    C CG     . LEU B 1 4  ? -3.368  19.584  -3.238  1.00 0.00 ? 4  LEU B CG     1  
ATOM 984    C CD1    . LEU B 1 4  ? -3.423  21.093  -3.023  1.00 0.00 ? 4  LEU B CD1    1  
ATOM 985    C CD2    . LEU B 1 4  ? -3.538  19.335  -4.734  1.00 0.00 ? 4  LEU B CD2    1  
ATOM 986    H H      . LEU B 1 4  ? -2.889  17.001  -0.894  1.00 0.00 ? 4  LEU B H      1  
ATOM 987    H HA     . LEU B 1 4  ? -1.979  17.133  -3.713  1.00 0.00 ? 4  LEU B HA     1  
ATOM 988    H HB2    . LEU B 1 4  ? -1.892  19.411  -1.700  1.00 0.00 ? 4  LEU B HB2    1  
ATOM 989    H HB3    . LEU B 1 4  ? -1.229  19.447  -3.333  1.00 0.00 ? 4  LEU B HB3    1  
ATOM 990    H HG     . LEU B 1 4  ? -4.195  19.129  -2.695  1.00 0.00 ? 4  LEU B HG     1  
ATOM 991    H HD11   . LEU B 1 4  ? -2.613  21.570  -3.575  1.00 0.00 ? 4  LEU B HD11   1  
ATOM 992    H HD12   . LEU B 1 4  ? -4.379  21.477  -3.380  1.00 0.00 ? 4  LEU B HD12   1  
ATOM 993    H HD13   . LEU B 1 4  ? -3.325  21.312  -1.960  1.00 0.00 ? 4  LEU B HD13   1  
ATOM 994    H HD21   . LEU B 1 4  ? -4.479  19.779  -5.056  1.00 0.00 ? 4  LEU B HD21   1  
ATOM 995    H HD22   . LEU B 1 4  ? -2.713  19.785  -5.286  1.00 0.00 ? 4  LEU B HD22   1  
ATOM 996    H HD23   . LEU B 1 4  ? -3.571  18.266  -4.935  1.00 0.00 ? 4  LEU B HD23   1  
ATOM 997    N N      . THR B 1 5  ? 0.447   16.945  -2.968  1.00 0.00 ? 5  THR B N      1  
ATOM 998    C CA     . THR B 1 5  ? 1.829   16.882  -2.518  1.00 0.00 ? 5  THR B CA     1  
ATOM 999    C C      . THR B 1 5  ? 2.421   18.282  -2.597  1.00 0.00 ? 5  THR B C      1  
ATOM 1000   O O      . THR B 1 5  ? 2.348   18.927  -3.643  1.00 0.00 ? 5  THR B O      1  
ATOM 1001   C CB     . THR B 1 5  ? 2.699   15.916  -3.322  1.00 0.00 ? 5  THR B CB     1  
ATOM 1002   O OG1    . THR B 1 5  ? 2.618   16.181  -4.705  1.00 0.00 ? 5  THR B OG1    1  
ATOM 1003   C CG2    . THR B 1 5  ? 2.318   14.463  -3.059  1.00 0.00 ? 5  THR B CG2    1  
ATOM 1004   H H      . THR B 1 5  ? 0.268   16.963  -3.965  1.00 0.00 ? 5  THR B H      1  
ATOM 1005   H HA     . THR B 1 5  ? 1.851   16.555  -1.479  1.00 0.00 ? 5  THR B HA     1  
ATOM 1006   H HB     . THR B 1 5  ? 3.735   16.049  -3.012  1.00 0.00 ? 5  THR B HB     1  
ATOM 1007   H HG1    . THR B 1 5  ? 3.096   16.997  -4.880  1.00 0.00 ? 5  THR B HG1    1  
ATOM 1008   H HG21   . THR B 1 5  ? 1.257   14.313  -3.257  1.00 0.00 ? 5  THR B HG21   1  
ATOM 1009   H HG22   . THR B 1 5  ? 2.906   13.816  -3.709  1.00 0.00 ? 5  THR B HG22   1  
ATOM 1010   H HG23   . THR B 1 5  ? 2.537   14.217  -2.019  1.00 0.00 ? 5  THR B HG23   1  
ATOM 1011   N N      . ARG B 1 6  ? 3.037   18.738  -1.504  1.00 0.00 ? 6  ARG B N      1  
ATOM 1012   C CA     . ARG B 1 6  ? 3.827   19.958  -1.481  1.00 0.00 ? 6  ARG B CA     1  
ATOM 1013   C C      . ARG B 1 6  ? 5.237   19.655  -1.012  1.00 0.00 ? 6  ARG B C      1  
ATOM 1014   O O      . ARG B 1 6  ? 5.436   19.059  0.044   1.00 0.00 ? 6  ARG B O      1  
ATOM 1015   C CB     . ARG B 1 6  ? 3.166   21.004  -0.582  1.00 0.00 ? 6  ARG B CB     1  
ATOM 1016   C CG     . ARG B 1 6  ? 1.928   21.637  -1.219  1.00 0.00 ? 6  ARG B CG     1  
ATOM 1017   C CD     . ARG B 1 6  ? 2.288   22.809  -2.132  1.00 0.00 ? 6  ARG B CD     1  
ATOM 1018   N NE     . ARG B 1 6  ? 2.994   22.380  -3.341  1.00 0.00 ? 6  ARG B NE     1  
ATOM 1019   C CZ     . ARG B 1 6  ? 2.460   21.953  -4.489  1.00 0.00 ? 6  ARG B CZ     1  
ATOM 1020   N NH1    . ARG B 1 6  ? 1.144   21.830  -4.658  1.00 0.00 ? 6  ARG B NH1    1  
ATOM 1021   N NH2    . ARG B 1 6  ? 3.278   21.639  -5.492  1.00 0.00 ? 6  ARG B NH2    1  
ATOM 1022   H H      . ARG B 1 6  ? 3.005   18.181  -0.660  1.00 0.00 ? 6  ARG B H      1  
ATOM 1023   H HA     . ARG B 1 6  ? 3.932   20.347  -2.494  1.00 0.00 ? 6  ARG B HA     1  
ATOM 1024   H HB2    . ARG B 1 6  ? 2.876   20.528  0.355   1.00 0.00 ? 6  ARG B HB2    1  
ATOM 1025   H HB3    . ARG B 1 6  ? 3.886   21.788  -0.353  1.00 0.00 ? 6  ARG B HB3    1  
ATOM 1026   H HG2    . ARG B 1 6  ? 1.368   20.887  -1.777  1.00 0.00 ? 6  ARG B HG2    1  
ATOM 1027   H HG3    . ARG B 1 6  ? 1.294   22.010  -0.415  1.00 0.00 ? 6  ARG B HG3    1  
ATOM 1028   H HD2    . ARG B 1 6  ? 1.390   23.350  -2.426  1.00 0.00 ? 6  ARG B HD2    1  
ATOM 1029   H HD3    . ARG B 1 6  ? 2.917   23.504  -1.576  1.00 0.00 ? 6  ARG B HD3    1  
ATOM 1030   H HE     . ARG B 1 6  ? 4.003   22.375  -3.294  1.00 0.00 ? 6  ARG B HE     1  
ATOM 1031   H HH11   . ARG B 1 6  ? 0.528   21.996  -3.876  1.00 0.00 ? 6  ARG B HH11   1  
ATOM 1032   H HH12   . ARG B 1 6  ? 0.788   21.400  -5.498  1.00 0.00 ? 6  ARG B HH12   1  
ATOM 1033   H HH21   . ARG B 1 6  ? 4.276   21.665  -5.324  1.00 0.00 ? 6  ARG B HH21   1  
ATOM 1034   H HH22   . ARG B 1 6  ? 2.915   21.358  -6.390  1.00 0.00 ? 6  ARG B HH22   1  
ATOM 1035   N N      . LYS B 1 7  ? 6.215   20.094  -1.804  1.00 0.00 ? 7  LYS B N      1  
ATOM 1036   C CA     . LYS B 1 7  ? 7.606   20.054  -1.387  1.00 0.00 ? 7  LYS B CA     1  
ATOM 1037   C C      . LYS B 1 7  ? 7.890   21.190  -0.414  1.00 0.00 ? 7  LYS B C      1  
ATOM 1038   O O      . LYS B 1 7  ? 7.204   22.209  -0.433  1.00 0.00 ? 7  LYS B O      1  
ATOM 1039   C CB     . LYS B 1 7  ? 8.539   20.091  -2.596  1.00 0.00 ? 7  LYS B CB     1  
ATOM 1040   C CG     . LYS B 1 7  ? 8.919   18.687  -3.067  1.00 0.00 ? 7  LYS B CG     1  
ATOM 1041   C CD     . LYS B 1 7  ? 10.166  18.741  -3.950  1.00 0.00 ? 7  LYS B CD     1  
ATOM 1042   C CE     . LYS B 1 7  ? 10.895  17.399  -3.913  1.00 0.00 ? 7  LYS B CE     1  
ATOM 1043   N NZ     . LYS B 1 7  ? 12.282  17.533  -4.390  1.00 0.00 ? 7  LYS B NZ     1  
ATOM 1044   H H      . LYS B 1 7  ? 5.951   20.682  -2.586  1.00 0.00 ? 7  LYS B H      1  
ATOM 1045   H HA     . LYS B 1 7  ? 7.785   19.128  -0.844  1.00 0.00 ? 7  LYS B HA     1  
ATOM 1046   H HB2    . LYS B 1 7  ? 8.090   20.654  -3.414  1.00 0.00 ? 7  LYS B HB2    1  
ATOM 1047   H HB3    . LYS B 1 7  ? 9.450   20.592  -2.279  1.00 0.00 ? 7  LYS B HB3    1  
ATOM 1048   H HG2    . LYS B 1 7  ? 9.135   18.068  -2.197  1.00 0.00 ? 7  LYS B HG2    1  
ATOM 1049   H HG3    . LYS B 1 7  ? 8.091   18.246  -3.622  1.00 0.00 ? 7  LYS B HG3    1  
ATOM 1050   H HD2    . LYS B 1 7  ? 9.882   18.981  -4.974  1.00 0.00 ? 7  LYS B HD2    1  
ATOM 1051   H HD3    . LYS B 1 7  ? 10.840  19.514  -3.578  1.00 0.00 ? 7  LYS B HD3    1  
ATOM 1052   H HE2    . LYS B 1 7  ? 10.902  17.033  -2.887  1.00 0.00 ? 7  LYS B HE2    1  
ATOM 1053   H HE3    . LYS B 1 7  ? 10.358  16.672  -4.524  1.00 0.00 ? 7  LYS B HE3    1  
ATOM 1054   H HZ1    . LYS B 1 7  ? 12.744  18.284  -3.894  1.00 0.00 ? 7  LYS B HZ1    1  
ATOM 1055   H HZ2    . LYS B 1 7  ? 12.802  16.686  -4.199  1.00 0.00 ? 7  LYS B HZ2    1  
ATOM 1056   H HZ3    . LYS B 1 7  ? 12.300  17.726  -5.381  1.00 0.00 ? 7  LYS B HZ3    1  
ATOM 1057   N N      . VAL B 1 8  ? 8.884   21.009  0.460   1.00 0.00 ? 8  VAL B N      1  
ATOM 1058   C CA     . VAL B 1 8  ? 9.190   22.009  1.470   1.00 0.00 ? 8  VAL B CA     1  
ATOM 1059   C C      . VAL B 1 8  ? 9.493   23.353  0.816   1.00 0.00 ? 8  VAL B C      1  
ATOM 1060   O O      . VAL B 1 8  ? 10.258  23.433  -0.144  1.00 0.00 ? 8  VAL B O      1  
ATOM 1061   C CB     . VAL B 1 8  ? 10.309  21.568  2.416   1.00 0.00 ? 8  VAL B CB     1  
ATOM 1062   C CG1    . VAL B 1 8  ? 9.901   20.268  3.106   1.00 0.00 ? 8  VAL B CG1    1  
ATOM 1063   C CG2    . VAL B 1 8  ? 11.665  21.363  1.746   1.00 0.00 ? 8  VAL B CG2    1  
ATOM 1064   H H      . VAL B 1 8  ? 9.371   20.124  0.484   1.00 0.00 ? 8  VAL B H      1  
ATOM 1065   H HA     . VAL B 1 8  ? 8.299   22.120  2.088   1.00 0.00 ? 8  VAL B HA     1  
ATOM 1066   H HB     . VAL B 1 8  ? 10.426  22.339  3.178   1.00 0.00 ? 8  VAL B HB     1  
ATOM 1067   H HG11   . VAL B 1 8  ? 10.622  20.031  3.888   1.00 0.00 ? 8  VAL B HG11   1  
ATOM 1068   H HG12   . VAL B 1 8  ? 8.909   20.386  3.541   1.00 0.00 ? 8  VAL B HG12   1  
ATOM 1069   H HG13   . VAL B 1 8  ? 9.885   19.450  2.389   1.00 0.00 ? 8  VAL B HG13   1  
ATOM 1070   H HG21   . VAL B 1 8  ? 12.347  20.899  2.458   1.00 0.00 ? 8  VAL B HG21   1  
ATOM 1071   H HG22   . VAL B 1 8  ? 11.553  20.722  0.873   1.00 0.00 ? 8  VAL B HG22   1  
ATOM 1072   H HG23   . VAL B 1 8  ? 12.074  22.326  1.442   1.00 0.00 ? 8  VAL B HG23   1  
ATOM 1073   N N      . GLY B 1 9  ? 8.833   24.404  1.306   1.00 0.00 ? 9  GLY B N      1  
ATOM 1074   C CA     . GLY B 1 9  ? 8.916   25.746  0.752   1.00 0.00 ? 9  GLY B CA     1  
ATOM 1075   C C      . GLY B 1 9  ? 7.779   26.121  -0.195  1.00 0.00 ? 9  GLY B C      1  
ATOM 1076   O O      . GLY B 1 9  ? 7.675   27.287  -0.571  1.00 0.00 ? 9  GLY B O      1  
ATOM 1077   H H      . GLY B 1 9  ? 8.249   24.266  2.120   1.00 0.00 ? 9  GLY B H      1  
ATOM 1078   H HA2    . GLY B 1 9  ? 8.914   26.457  1.579   1.00 0.00 ? 9  GLY B HA2    1  
ATOM 1079   H HA3    . GLY B 1 9  ? 9.859   25.859  0.216   1.00 0.00 ? 9  GLY B HA3    1  
ATOM 1080   N N      . GLU B 1 10 ? 6.919   25.175  -0.586  1.00 0.00 ? 10 GLU B N      1  
ATOM 1081   C CA     . GLU B 1 10 ? 5.777   25.449  -1.446  1.00 0.00 ? 10 GLU B CA     1  
ATOM 1082   C C      . GLU B 1 10 ? 4.541   25.847  -0.638  1.00 0.00 ? 10 GLU B C      1  
ATOM 1083   O O      . GLU B 1 10 ? 4.485   25.642  0.574   1.00 0.00 ? 10 GLU B O      1  
ATOM 1084   C CB     . GLU B 1 10 ? 5.503   24.255  -2.358  1.00 0.00 ? 10 GLU B CB     1  
ATOM 1085   C CG     . GLU B 1 10 ? 6.693   23.949  -3.268  1.00 0.00 ? 10 GLU B CG     1  
ATOM 1086   C CD     . GLU B 1 10 ? 6.343   22.887  -4.305  1.00 0.00 ? 10 GLU B CD     1  
ATOM 1087   O OE1    . GLU B 1 10 ? 5.644   21.916  -3.938  1.00 0.00 ? 10 GLU B OE1    1  
ATOM 1088   O OE2    . GLU B 1 10 ? 6.743   23.053  -5.478  1.00 0.00 ? 10 GLU B OE2    1  
ATOM 1089   H H      . GLU B 1 10 ? 7.056   24.223  -0.275  1.00 0.00 ? 10 GLU B H      1  
ATOM 1090   H HA     . GLU B 1 10 ? 6.024   26.296  -2.088  1.00 0.00 ? 10 GLU B HA     1  
ATOM 1091   H HB2    . GLU B 1 10 ? 5.271   23.381  -1.749  1.00 0.00 ? 10 GLU B HB2    1  
ATOM 1092   H HB3    . GLU B 1 10 ? 4.642   24.489  -2.984  1.00 0.00 ? 10 GLU B HB3    1  
ATOM 1093   H HG2    . GLU B 1 10 ? 6.990   24.868  -3.776  1.00 0.00 ? 10 GLU B HG2    1  
ATOM 1094   H HG3    . GLU B 1 10 ? 7.535   23.600  -2.669  1.00 0.00 ? 10 GLU B HG3    1  
ATOM 1095   N N      . SER B 1 11 ? 3.533   26.411  -1.312  1.00 0.00 ? 11 SER B N      1  
ATOM 1096   C CA     . SER B 1 11 ? 2.396   27.051  -0.666  1.00 0.00 ? 11 SER B CA     1  
ATOM 1097   C C      . SER B 1 11 ? 1.050   26.619  -1.240  1.00 0.00 ? 11 SER B C      1  
ATOM 1098   O O      . SER B 1 11 ? 0.953   26.188  -2.389  1.00 0.00 ? 11 SER B O      1  
ATOM 1099   C CB     . SER B 1 11 ? 2.539   28.569  -0.769  1.00 0.00 ? 11 SER B CB     1  
ATOM 1100   O OG     . SER B 1 11 ? 3.564   29.024  0.088   1.00 0.00 ? 11 SER B OG     1  
ATOM 1101   H H      . SER B 1 11 ? 3.608   26.506  -2.315  1.00 0.00 ? 11 SER B H      1  
ATOM 1102   H HA     . SER B 1 11 ? 2.396   26.789  0.392   1.00 0.00 ? 11 SER B HA     1  
ATOM 1103   H HB2    . SER B 1 11 ? 2.782   28.835  -1.798  1.00 0.00 ? 11 SER B HB2    1  
ATOM 1104   H HB3    . SER B 1 11 ? 1.600   29.047  -0.492  1.00 0.00 ? 11 SER B HB3    1  
ATOM 1105   H HG     . SER B 1 11 ? 3.745   29.946  -0.121  1.00 0.00 ? 11 SER B HG     1  
ATOM 1106   N N      . ILE B 1 12 ? 0.003   26.772  -0.424  1.00 0.00 ? 12 ILE B N      1  
ATOM 1107   C CA     . ILE B 1 12 ? -1.378  26.398  -0.687  1.00 0.00 ? 12 ILE B CA     1  
ATOM 1108   C C      . ILE B 1 12 ? -2.286  27.540  -0.229  1.00 0.00 ? 12 ILE B C      1  
ATOM 1109   O O      . ILE B 1 12 ? -1.929  28.286  0.679   1.00 0.00 ? 12 ILE B O      1  
ATOM 1110   C CB     . ILE B 1 12 ? -1.694  25.091  0.052   1.00 0.00 ? 12 ILE B CB     1  
ATOM 1111   C CG1    . ILE B 1 12 ? -0.804  23.918  -0.378  1.00 0.00 ? 12 ILE B CG1    1  
ATOM 1112   C CG2    . ILE B 1 12 ? -3.170  24.705  -0.062  1.00 0.00 ? 12 ILE B CG2    1  
ATOM 1113   C CD1    . ILE B 1 12 ? -1.014  23.439  -1.814  1.00 0.00 ? 12 ILE B CD1    1  
ATOM 1114   H H      . ILE B 1 12 ? 0.183   27.185  0.482   1.00 0.00 ? 12 ILE B H      1  
ATOM 1115   H HA     . ILE B 1 12 ? -1.520  26.253  -1.757  1.00 0.00 ? 12 ILE B HA     1  
ATOM 1116   H HB     . ILE B 1 12 ? -1.492  25.259  1.108   1.00 0.00 ? 12 ILE B HB     1  
ATOM 1117   H HG12   . ILE B 1 12 ? 0.242   24.195  -0.250  1.00 0.00 ? 12 ILE B HG12   1  
ATOM 1118   H HG13   . ILE B 1 12 ? -0.985  23.072  0.285   1.00 0.00 ? 12 ILE B HG13   1  
ATOM 1119   H HG21   . ILE B 1 12 ? -3.315  23.690  0.310   1.00 0.00 ? 12 ILE B HG21   1  
ATOM 1120   H HG22   . ILE B 1 12 ? -3.778  25.379  0.541   1.00 0.00 ? 12 ILE B HG22   1  
ATOM 1121   H HG23   . ILE B 1 12 ? -3.499  24.757  -1.100  1.00 0.00 ? 12 ILE B HG23   1  
ATOM 1122   H HD11   . ILE B 1 12 ? -2.074  23.349  -2.041  1.00 0.00 ? 12 ILE B HD11   1  
ATOM 1123   H HD12   . ILE B 1 12 ? -0.545  24.138  -2.503  1.00 0.00 ? 12 ILE B HD12   1  
ATOM 1124   H HD13   . ILE B 1 12 ? -0.543  22.464  -1.937  1.00 0.00 ? 12 ILE B HD13   1  
ATOM 1125   N N      . ASN B 1 13 ? -3.464  27.698  -0.840  1.00 0.00 ? 13 ASN B N      1  
ATOM 1126   C CA     . ASN B 1 13 ? -4.380  28.800  -0.592  1.00 0.00 ? 13 ASN B CA     1  
ATOM 1127   C C      . ASN B 1 13 ? -5.799  28.280  -0.363  1.00 0.00 ? 13 ASN B C      1  
ATOM 1128   O O      . ASN B 1 13 ? -6.234  27.341  -1.027  1.00 0.00 ? 13 ASN B O      1  
ATOM 1129   C CB     . ASN B 1 13 ? -4.338  29.777  -1.768  1.00 0.00 ? 13 ASN B CB     1  
ATOM 1130   C CG     . ASN B 1 13 ? -2.921  30.214  -2.113  1.00 0.00 ? 13 ASN B CG     1  
ATOM 1131   O OD1    . ASN B 1 13 ? -2.319  29.709  -3.056  1.00 0.00 ? 13 ASN B OD1    1  
ATOM 1132   N ND2    . ASN B 1 13 ? -2.351  31.150  -1.358  1.00 0.00 ? 13 ASN B ND2    1  
ATOM 1133   H H      . ASN B 1 13 ? -3.731  27.034  -1.553  1.00 0.00 ? 13 ASN B H      1  
ATOM 1134   H HA     . ASN B 1 13 ? -4.071  29.339  0.302   1.00 0.00 ? 13 ASN B HA     1  
ATOM 1135   H HB2    . ASN B 1 13 ? -4.777  29.301  -2.645  1.00 0.00 ? 13 ASN B HB2    1  
ATOM 1136   H HB3    . ASN B 1 13 ? -4.931  30.658  -1.523  1.00 0.00 ? 13 ASN B HB3    1  
ATOM 1137   H HD21   . ASN B 1 13 ? -2.825  31.534  -0.553  1.00 0.00 ? 13 ASN B HD21   1  
ATOM 1138   H HD22   . ASN B 1 13 ? -1.404  31.433  -1.564  1.00 0.00 ? 13 ASN B HD22   1  
ATOM 1139   N N      . ILE B 1 14 ? -6.527  28.906  0.567   1.00 0.00 ? 14 ILE B N      1  
ATOM 1140   C CA     . ILE B 1 14 ? -7.894  28.545  0.914   1.00 0.00 ? 14 ILE B CA     1  
ATOM 1141   C C      . ILE B 1 14 ? -8.756  29.803  0.953   1.00 0.00 ? 14 ILE B C      1  
ATOM 1142   O O      . ILE B 1 14 ? -8.415  30.782  1.614   1.00 0.00 ? 14 ILE B O      1  
ATOM 1143   C CB     . ILE B 1 14 ? -7.933  27.791  2.248   1.00 0.00 ? 14 ILE B CB     1  
ATOM 1144   C CG1    . ILE B 1 14 ? -7.146  26.479  2.137   1.00 0.00 ? 14 ILE B CG1    1  
ATOM 1145   C CG2    . ILE B 1 14 ? -9.381  27.529  2.673   1.00 0.00 ? 14 ILE B CG2    1  
ATOM 1146   C CD1    . ILE B 1 14 ? -7.101  25.687  3.443   1.00 0.00 ? 14 ILE B CD1    1  
ATOM 1147   H H      . ILE B 1 14 ? -6.127  29.703  1.043   1.00 0.00 ? 14 ILE B H      1  
ATOM 1148   H HA     . ILE B 1 14 ? -8.296  27.888  0.143   1.00 0.00 ? 14 ILE B HA     1  
ATOM 1149   H HB     . ILE B 1 14 ? -7.461  28.406  3.013   1.00 0.00 ? 14 ILE B HB     1  
ATOM 1150   H HG12   . ILE B 1 14 ? -7.585  25.854  1.360   1.00 0.00 ? 14 ILE B HG12   1  
ATOM 1151   H HG13   . ILE B 1 14 ? -6.118  26.704  1.857   1.00 0.00 ? 14 ILE B HG13   1  
ATOM 1152   H HG21   . ILE B 1 14 ? -9.898  26.943  1.915   1.00 0.00 ? 14 ILE B HG21   1  
ATOM 1153   H HG22   . ILE B 1 14 ? -9.405  26.996  3.623   1.00 0.00 ? 14 ILE B HG22   1  
ATOM 1154   H HG23   . ILE B 1 14 ? -9.909  28.473  2.812   1.00 0.00 ? 14 ILE B HG23   1  
ATOM 1155   H HD11   . ILE B 1 14 ? -8.071  25.228  3.635   1.00 0.00 ? 14 ILE B HD11   1  
ATOM 1156   H HD12   . ILE B 1 14 ? -6.353  24.899  3.359   1.00 0.00 ? 14 ILE B HD12   1  
ATOM 1157   H HD13   . ILE B 1 14 ? -6.834  26.346  4.269   1.00 0.00 ? 14 ILE B HD13   1  
ATOM 1158   N N      . GLY B 1 15 ? -9.889  29.774  0.246   1.00 0.00 ? 15 GLY B N      1  
ATOM 1159   C CA     . GLY B 1 15 ? -10.751 30.930  0.078   1.00 0.00 ? 15 GLY B CA     1  
ATOM 1160   C C      . GLY B 1 15 ? -9.994  32.091  -0.558  1.00 0.00 ? 15 GLY B C      1  
ATOM 1161   O O      . GLY B 1 15 ? -9.257  31.904  -1.524  1.00 0.00 ? 15 GLY B O      1  
ATOM 1162   H H      . GLY B 1 15 ? -10.106 28.941  -0.286  1.00 0.00 ? 15 GLY B H      1  
ATOM 1163   H HA2    . GLY B 1 15 ? -11.594 30.666  -0.560  1.00 0.00 ? 15 GLY B HA2    1  
ATOM 1164   H HA3    . GLY B 1 15 ? -11.132 31.237  1.052   1.00 0.00 ? 15 GLY B HA3    1  
ATOM 1165   N N      . ASP B 1 16 ? -10.163 33.290  0.006   1.00 0.00 ? 16 ASP B N      1  
ATOM 1166   C CA     . ASP B 1 16 ? -9.424  34.480  -0.388  1.00 0.00 ? 16 ASP B CA     1  
ATOM 1167   C C      . ASP B 1 16 ? -8.739  35.168  0.793   1.00 0.00 ? 16 ASP B C      1  
ATOM 1168   O O      . ASP B 1 16 ? -8.122  36.217  0.614   1.00 0.00 ? 16 ASP B O      1  
ATOM 1169   C CB     . ASP B 1 16 ? -10.346 35.427  -1.155  1.00 0.00 ? 16 ASP B CB     1  
ATOM 1170   C CG     . ASP B 1 16 ? -11.418 36.063  -0.274  1.00 0.00 ? 16 ASP B CG     1  
ATOM 1171   O OD1    . ASP B 1 16 ? -12.353 35.337  0.132   1.00 0.00 ? 16 ASP B OD1    1  
ATOM 1172   O OD2    . ASP B 1 16 ? -11.341 37.291  -0.052  1.00 0.00 ? 16 ASP B OD2    1  
ATOM 1173   H H      . ASP B 1 16 ? -10.873 33.398  0.715   1.00 0.00 ? 16 ASP B H      1  
ATOM 1174   H HA     . ASP B 1 16 ? -8.630  34.180  -1.071  1.00 0.00 ? 16 ASP B HA     1  
ATOM 1175   H HB2    . ASP B 1 16 ? -9.741  36.212  -1.610  1.00 0.00 ? 16 ASP B HB2    1  
ATOM 1176   H HB3    . ASP B 1 16 ? -10.830 34.874  -1.962  1.00 0.00 ? 16 ASP B HB3    1  
ATOM 1177   N N      . ASP B 1 17 ? -8.799  34.575  1.990   1.00 0.00 ? 17 ASP B N      1  
ATOM 1178   C CA     . ASP B 1 17 ? -8.207  35.134  3.197   1.00 0.00 ? 17 ASP B CA     1  
ATOM 1179   C C      . ASP B 1 17 ? -7.063  34.291  3.757   1.00 0.00 ? 17 ASP B C      1  
ATOM 1180   O O      . ASP B 1 17 ? -6.251  34.817  4.516   1.00 0.00 ? 17 ASP B O      1  
ATOM 1181   C CB     . ASP B 1 17 ? -9.281  35.322  4.268   1.00 0.00 ? 17 ASP B CB     1  
ATOM 1182   C CG     . ASP B 1 17 ? -10.280 36.416  3.903   1.00 0.00 ? 17 ASP B CG     1  
ATOM 1183   O OD1    . ASP B 1 17 ? -9.864  37.594  3.847   1.00 0.00 ? 17 ASP B OD1    1  
ATOM 1184   O OD2    . ASP B 1 17 ? -11.476 36.087  3.745   1.00 0.00 ? 17 ASP B OD2    1  
ATOM 1185   H H      . ASP B 1 17 ? -9.305  33.704  2.073   1.00 0.00 ? 17 ASP B H      1  
ATOM 1186   H HA     . ASP B 1 17 ? -7.794  36.117  2.969   1.00 0.00 ? 17 ASP B HA     1  
ATOM 1187   H HB2    . ASP B 1 17 ? -9.803  34.379  4.435   1.00 0.00 ? 17 ASP B HB2    1  
ATOM 1188   H HB3    . ASP B 1 17 ? -8.796  35.599  5.204   1.00 0.00 ? 17 ASP B HB3    1  
ATOM 1189   N N      . ILE B 1 18 ? -6.986  32.999  3.420   1.00 0.00 ? 18 ILE B N      1  
ATOM 1190   C CA     . ILE B 1 18 ? -6.075  32.066  4.065   1.00 0.00 ? 18 ILE B CA     1  
ATOM 1191   C C      . ILE B 1 18 ? -5.022  31.560  3.086   1.00 0.00 ? 18 ILE B C      1  
ATOM 1192   O O      . ILE B 1 18 ? -5.329  31.147  1.969   1.00 0.00 ? 18 ILE B O      1  
ATOM 1193   C CB     . ILE B 1 18 ? -6.842  30.901  4.697   1.00 0.00 ? 18 ILE B CB     1  
ATOM 1194   C CG1    . ILE B 1 18 ? -7.876  31.396  5.712   1.00 0.00 ? 18 ILE B CG1    1  
ATOM 1195   C CG2    . ILE B 1 18 ? -5.887  29.925  5.386   1.00 0.00 ? 18 ILE B CG2    1  
ATOM 1196   C CD1    . ILE B 1 18 ? -9.274  31.384  5.097   1.00 0.00 ? 18 ILE B CD1    1  
ATOM 1197   H H      . ILE B 1 18 ? -7.627  32.625  2.734   1.00 0.00 ? 18 ILE B H      1  
ATOM 1198   H HA     . ILE B 1 18 ? -5.553  32.584  4.870   1.00 0.00 ? 18 ILE B HA     1  
ATOM 1199   H HB     . ILE B 1 18 ? -7.358  30.358  3.907   1.00 0.00 ? 18 ILE B HB     1  
ATOM 1200   H HG12   . ILE B 1 18 ? -7.883  30.749  6.589   1.00 0.00 ? 18 ILE B HG12   1  
ATOM 1201   H HG13   . ILE B 1 18 ? -7.633  32.408  6.035   1.00 0.00 ? 18 ILE B HG13   1  
ATOM 1202   H HG21   . ILE B 1 18 ? -5.273  30.453  6.118   1.00 0.00 ? 18 ILE B HG21   1  
ATOM 1203   H HG22   . ILE B 1 18 ? -6.459  29.147  5.892   1.00 0.00 ? 18 ILE B HG22   1  
ATOM 1204   H HG23   . ILE B 1 18 ? -5.242  29.447  4.650   1.00 0.00 ? 18 ILE B HG23   1  
ATOM 1205   H HD11   . ILE B 1 18 ? -9.994  31.755  5.824   1.00 0.00 ? 18 ILE B HD11   1  
ATOM 1206   H HD12   . ILE B 1 18 ? -9.292  32.019  4.211   1.00 0.00 ? 18 ILE B HD12   1  
ATOM 1207   H HD13   . ILE B 1 18 ? -9.534  30.364  4.813   1.00 0.00 ? 18 ILE B HD13   1  
ATOM 1208   N N      . THR B 1 19 ? -3.775  31.517  3.559   1.00 0.00 ? 19 THR B N      1  
ATOM 1209   C CA     . THR B 1 19 ? -2.655  30.885  2.881   1.00 0.00 ? 19 THR B CA     1  
ATOM 1210   C C      . THR B 1 19 ? -1.904  29.977  3.849   1.00 0.00 ? 19 THR B C      1  
ATOM 1211   O O      . THR B 1 19 ? -1.869  30.227  5.052   1.00 0.00 ? 19 THR B O      1  
ATOM 1212   C CB     . THR B 1 19 ? -1.755  31.957  2.263   1.00 0.00 ? 19 THR B CB     1  
ATOM 1213   O OG1    . THR B 1 19 ? -2.463  32.602  1.227   1.00 0.00 ? 19 THR B OG1    1  
ATOM 1214   C CG2    . THR B 1 19 ? -0.470  31.398  1.659   1.00 0.00 ? 19 THR B CG2    1  
ATOM 1215   H H      . THR B 1 19 ? -3.606  31.902  4.479   1.00 0.00 ? 19 THR B H      1  
ATOM 1216   H HA     . THR B 1 19 ? -3.035  30.262  2.071   1.00 0.00 ? 19 THR B HA     1  
ATOM 1217   H HB     . THR B 1 19 ? -1.494  32.694  3.022   1.00 0.00 ? 19 THR B HB     1  
ATOM 1218   H HG1    . THR B 1 19 ? -3.147  33.147  1.628   1.00 0.00 ? 19 THR B HG1    1  
ATOM 1219   H HG21   . THR B 1 19 ? -0.703  30.586  0.971   1.00 0.00 ? 19 THR B HG21   1  
ATOM 1220   H HG22   . THR B 1 19 ? 0.048   32.189  1.115   1.00 0.00 ? 19 THR B HG22   1  
ATOM 1221   H HG23   . THR B 1 19 ? 0.186   31.031  2.449   1.00 0.00 ? 19 THR B HG23   1  
ATOM 1222   N N      . ILE B 1 20 ? -1.339  28.890  3.319   1.00 0.00 ? 20 ILE B N      1  
ATOM 1223   C CA     . ILE B 1 20 ? -0.623  27.858  4.051   1.00 0.00 ? 20 ILE B CA     1  
ATOM 1224   C C      . ILE B 1 20 ? 0.721   27.640  3.366   1.00 0.00 ? 20 ILE B C      1  
ATOM 1225   O O      . ILE B 1 20 ? 0.792   27.623  2.139   1.00 0.00 ? 20 ILE B O      1  
ATOM 1226   C CB     . ILE B 1 20 ? -1.430  26.555  4.050   1.00 0.00 ? 20 ILE B CB     1  
ATOM 1227   C CG1    . ILE B 1 20 ? -2.854  26.724  4.586   1.00 0.00 ? 20 ILE B CG1    1  
ATOM 1228   C CG2    . ILE B 1 20 ? -0.700  25.453  4.819   1.00 0.00 ? 20 ILE B CG2    1  
ATOM 1229   C CD1    . ILE B 1 20 ? -2.923  26.944  6.096   1.00 0.00 ? 20 ILE B CD1    1  
ATOM 1230   H H      . ILE B 1 20 ? -1.404  28.764  2.318   1.00 0.00 ? 20 ILE B H      1  
ATOM 1231   H HA     . ILE B 1 20 ? -0.453  28.181  5.077   1.00 0.00 ? 20 ILE B HA     1  
ATOM 1232   H HB     . ILE B 1 20 ? -1.520  26.228  3.015   1.00 0.00 ? 20 ILE B HB     1  
ATOM 1233   H HG12   . ILE B 1 20 ? -3.323  27.573  4.090   1.00 0.00 ? 20 ILE B HG12   1  
ATOM 1234   H HG13   . ILE B 1 20 ? -3.432  25.835  4.333   1.00 0.00 ? 20 ILE B HG13   1  
ATOM 1235   H HG21   . ILE B 1 20 ? 0.193   25.146  4.274   1.00 0.00 ? 20 ILE B HG21   1  
ATOM 1236   H HG22   . ILE B 1 20 ? -0.410  25.810  5.808   1.00 0.00 ? 20 ILE B HG22   1  
ATOM 1237   H HG23   . ILE B 1 20 ? -1.352  24.586  4.927   1.00 0.00 ? 20 ILE B HG23   1  
ATOM 1238   H HD11   . ILE B 1 20 ? -2.679  26.019  6.619   1.00 0.00 ? 20 ILE B HD11   1  
ATOM 1239   H HD12   . ILE B 1 20 ? -2.220  27.723  6.386   1.00 0.00 ? 20 ILE B HD12   1  
ATOM 1240   H HD13   . ILE B 1 20 ? -3.933  27.249  6.370   1.00 0.00 ? 20 ILE B HD13   1  
ATOM 1241   N N      . THR B 1 21 ? 1.779   27.417  4.148   1.00 0.00 ? 21 THR B N      1  
ATOM 1242   C CA     . THR B 1 21 ? 3.111   27.161  3.620   1.00 0.00 ? 21 THR B CA     1  
ATOM 1243   C C      . THR B 1 21 ? 3.787   26.051  4.412   1.00 0.00 ? 21 THR B C      1  
ATOM 1244   O O      . THR B 1 21 ? 3.876   26.131  5.636   1.00 0.00 ? 21 THR B O      1  
ATOM 1245   C CB     . THR B 1 21 ? 3.961   28.432  3.668   1.00 0.00 ? 21 THR B CB     1  
ATOM 1246   O OG1    . THR B 1 21 ? 3.306   29.494  3.010   1.00 0.00 ? 21 THR B OG1    1  
ATOM 1247   C CG2    . THR B 1 21 ? 5.313   28.230  2.987   1.00 0.00 ? 21 THR B CG2    1  
ATOM 1248   H H      . THR B 1 21 ? 1.652   27.445  5.150   1.00 0.00 ? 21 THR B H      1  
ATOM 1249   H HA     . THR B 1 21 ? 3.034   26.840  2.581   1.00 0.00 ? 21 THR B HA     1  
ATOM 1250   H HB     . THR B 1 21 ? 4.126   28.712  4.709   1.00 0.00 ? 21 THR B HB     1  
ATOM 1251   H HG1    . THR B 1 21 ? 3.299   29.296  2.068   1.00 0.00 ? 21 THR B HG1    1  
ATOM 1252   H HG21   . THR B 1 21 ? 5.886   27.464  3.509   1.00 0.00 ? 21 THR B HG21   1  
ATOM 1253   H HG22   . THR B 1 21 ? 5.166   27.921  1.952   1.00 0.00 ? 21 THR B HG22   1  
ATOM 1254   H HG23   . THR B 1 21 ? 5.873   29.165  3.007   1.00 0.00 ? 21 THR B HG23   1  
ATOM 1255   N N      . ILE B 1 22 ? 4.311   25.033  3.724   1.00 0.00 ? 22 ILE B N      1  
ATOM 1256   C CA     . ILE B 1 22 ? 5.168   24.044  4.358   1.00 0.00 ? 22 ILE B CA     1  
ATOM 1257   C C      . ILE B 1 22 ? 6.560   24.648  4.521   1.00 0.00 ? 22 ILE B C      1  
ATOM 1258   O O      . ILE B 1 22 ? 7.239   24.930  3.536   1.00 0.00 ? 22 ILE B O      1  
ATOM 1259   C CB     . ILE B 1 22 ? 5.153   22.724  3.576   1.00 0.00 ? 22 ILE B CB     1  
ATOM 1260   C CG1    . ILE B 1 22 ? 6.259   21.762  4.015   1.00 0.00 ? 22 ILE B CG1    1  
ATOM 1261   C CG2    . ILE B 1 22 ? 5.278   22.911  2.066   1.00 0.00 ? 22 ILE B CG2    1  
ATOM 1262   C CD1    . ILE B 1 22 ? 6.106   21.357  5.476   1.00 0.00 ? 22 ILE B CD1    1  
ATOM 1263   H H      . ILE B 1 22 ? 4.279   25.049  2.714   1.00 0.00 ? 22 ILE B H      1  
ATOM 1264   H HA     . ILE B 1 22 ? 4.774   23.835  5.352   1.00 0.00 ? 22 ILE B HA     1  
ATOM 1265   H HB     . ILE B 1 22 ? 4.195   22.239  3.764   1.00 0.00 ? 22 ILE B HB     1  
ATOM 1266   H HG12   . ILE B 1 22 ? 6.214   20.861  3.402   1.00 0.00 ? 22 ILE B HG12   1  
ATOM 1267   H HG13   . ILE B 1 22 ? 7.236   22.225  3.880   1.00 0.00 ? 22 ILE B HG13   1  
ATOM 1268   H HG21   . ILE B 1 22 ? 6.147   23.527  1.834   1.00 0.00 ? 22 ILE B HG21   1  
ATOM 1269   H HG22   . ILE B 1 22 ? 5.393   21.940  1.586   1.00 0.00 ? 22 ILE B HG22   1  
ATOM 1270   H HG23   . ILE B 1 22 ? 4.376   23.382  1.677   1.00 0.00 ? 22 ILE B HG23   1  
ATOM 1271   H HD11   . ILE B 1 22 ? 6.297   22.220  6.112   1.00 0.00 ? 22 ILE B HD11   1  
ATOM 1272   H HD12   . ILE B 1 22 ? 5.095   20.989  5.647   1.00 0.00 ? 22 ILE B HD12   1  
ATOM 1273   H HD13   . ILE B 1 22 ? 6.831   20.577  5.708   1.00 0.00 ? 22 ILE B HD13   1  
ATOM 1274   N N      . LEU B 1 23 ? 6.990   24.876  5.764   1.00 0.00 ? 23 LEU B N      1  
ATOM 1275   C CA     . LEU B 1 23 ? 8.303   25.435  6.039   1.00 0.00 ? 23 LEU B CA     1  
ATOM 1276   C C      . LEU B 1 23 ? 9.380   24.356  5.986   1.00 0.00 ? 23 LEU B C      1  
ATOM 1277   O O      . LEU B 1 23 ? 10.503  24.628  5.566   1.00 0.00 ? 23 LEU B O      1  
ATOM 1278   C CB     . LEU B 1 23 ? 8.316   26.136  7.399   1.00 0.00 ? 23 LEU B CB     1  
ATOM 1279   C CG     . LEU B 1 23 ? 7.233   27.200  7.588   1.00 0.00 ? 23 LEU B CG     1  
ATOM 1280   C CD1    . LEU B 1 23 ? 7.480   27.926  8.909   1.00 0.00 ? 23 LEU B CD1    1  
ATOM 1281   C CD2    . LEU B 1 23 ? 7.215   28.213  6.447   1.00 0.00 ? 23 LEU B CD2    1  
ATOM 1282   H H      . LEU B 1 23 ? 6.419   24.595  6.551   1.00 0.00 ? 23 LEU B H      1  
ATOM 1283   H HA     . LEU B 1 23 ? 8.540   26.173  5.272   1.00 0.00 ? 23 LEU B HA     1  
ATOM 1284   H HB2    . LEU B 1 23 ? 8.203   25.386  8.181   1.00 0.00 ? 23 LEU B HB2    1  
ATOM 1285   H HB3    . LEU B 1 23 ? 9.292   26.606  7.526   1.00 0.00 ? 23 LEU B HB3    1  
ATOM 1286   H HG     . LEU B 1 23 ? 6.256   26.723  7.644   1.00 0.00 ? 23 LEU B HG     1  
ATOM 1287   H HD11   . LEU B 1 23 ? 6.769   28.745  9.016   1.00 0.00 ? 23 LEU B HD11   1  
ATOM 1288   H HD12   . LEU B 1 23 ? 7.348   27.229  9.736   1.00 0.00 ? 23 LEU B HD12   1  
ATOM 1289   H HD13   . LEU B 1 23 ? 8.497   28.317  8.927   1.00 0.00 ? 23 LEU B HD13   1  
ATOM 1290   H HD21   . LEU B 1 23 ? 8.223   28.586  6.270   1.00 0.00 ? 23 LEU B HD21   1  
ATOM 1291   H HD22   . LEU B 1 23 ? 6.846   27.732  5.543   1.00 0.00 ? 23 LEU B HD22   1  
ATOM 1292   H HD23   . LEU B 1 23 ? 6.554   29.043  6.698   1.00 0.00 ? 23 LEU B HD23   1  
ATOM 1293   N N      . GLY B 1 24 ? 9.032   23.123  6.366   1.00 0.00 ? 24 GLY B N      1  
ATOM 1294   C CA     . GLY B 1 24 ? 9.899   21.974  6.167   1.00 0.00 ? 24 GLY B CA     1  
ATOM 1295   C C      . GLY B 1 24 ? 9.539   20.786  7.050   1.00 0.00 ? 24 GLY B C      1  
ATOM 1296   O O      . GLY B 1 24 ? 8.575   20.841  7.810   1.00 0.00 ? 24 GLY B O      1  
ATOM 1297   H H      . GLY B 1 24 ? 8.089   22.960  6.694   1.00 0.00 ? 24 GLY B H      1  
ATOM 1298   H HA2    . GLY B 1 24 ? 9.811   21.665  5.129   1.00 0.00 ? 24 GLY B HA2    1  
ATOM 1299   H HA3    . GLY B 1 24 ? 10.939  22.252  6.347   1.00 0.00 ? 24 GLY B HA3    1  
ATOM 1300   N N      . VAL B 1 25 ? 10.310  19.700  6.942   1.00 0.00 ? 25 VAL B N      1  
ATOM 1301   C CA     . VAL B 1 25 ? 10.112  18.498  7.740   1.00 0.00 ? 25 VAL B CA     1  
ATOM 1302   C C      . VAL B 1 25 ? 11.279  18.278  8.695   1.00 0.00 ? 25 VAL B C      1  
ATOM 1303   O O      . VAL B 1 25 ? 12.399  18.718  8.437   1.00 0.00 ? 25 VAL B O      1  
ATOM 1304   C CB     . VAL B 1 25 ? 9.838   17.262  6.875   1.00 0.00 ? 25 VAL B CB     1  
ATOM 1305   C CG1    . VAL B 1 25 ? 8.948   17.596  5.679   1.00 0.00 ? 25 VAL B CG1    1  
ATOM 1306   C CG2    . VAL B 1 25 ? 11.096  16.568  6.353   1.00 0.00 ? 25 VAL B CG2    1  
ATOM 1307   H H      . VAL B 1 25 ? 11.097  19.717  6.311   1.00 0.00 ? 25 VAL B H      1  
ATOM 1308   H HA     . VAL B 1 25 ? 9.226   18.645  8.356   1.00 0.00 ? 25 VAL B HA     1  
ATOM 1309   H HB     . VAL B 1 25 ? 9.303   16.541  7.492   1.00 0.00 ? 25 VAL B HB     1  
ATOM 1310   H HG11   . VAL B 1 25 ? 8.060   18.128  6.019   1.00 0.00 ? 25 VAL B HG11   1  
ATOM 1311   H HG12   . VAL B 1 25 ? 9.490   18.216  4.963   1.00 0.00 ? 25 VAL B HG12   1  
ATOM 1312   H HG13   . VAL B 1 25 ? 8.650   16.668  5.192   1.00 0.00 ? 25 VAL B HG13   1  
ATOM 1313   H HG21   . VAL B 1 25 ? 10.808  15.727  5.721   1.00 0.00 ? 25 VAL B HG21   1  
ATOM 1314   H HG22   . VAL B 1 25 ? 11.699  17.267  5.775   1.00 0.00 ? 25 VAL B HG22   1  
ATOM 1315   H HG23   . VAL B 1 25 ? 11.678  16.173  7.185   1.00 0.00 ? 25 VAL B HG23   1  
ATOM 1316   N N      . SER B 1 26 ? 11.017  17.564  9.791   1.00 0.00 ? 26 SER B N      1  
ATOM 1317   C CA     . SER B 1 26 ? 12.036  17.087  10.712  1.00 0.00 ? 26 SER B CA     1  
ATOM 1318   C C      . SER B 1 26 ? 11.688  15.666  11.141  1.00 0.00 ? 26 SER B C      1  
ATOM 1319   O O      . SER B 1 26 ? 11.032  15.445  12.156  1.00 0.00 ? 26 SER B O      1  
ATOM 1320   C CB     . SER B 1 26 ? 12.156  18.042  11.898  1.00 0.00 ? 26 SER B CB     1  
ATOM 1321   O OG     . SER B 1 26 ? 13.329  17.762  12.630  1.00 0.00 ? 26 SER B OG     1  
ATOM 1322   H H      . SER B 1 26 ? 10.069  17.250  9.942   1.00 0.00 ? 26 SER B H      1  
ATOM 1323   H HA     . SER B 1 26 ? 12.998  17.062  10.199  1.00 0.00 ? 26 SER B HA     1  
ATOM 1324   H HB2    . SER B 1 26 ? 12.208  19.066  11.525  1.00 0.00 ? 26 SER B HB2    1  
ATOM 1325   H HB3    . SER B 1 26 ? 11.283  17.947  12.544  1.00 0.00 ? 26 SER B HB3    1  
ATOM 1326   H HG     . SER B 1 26 ? 13.435  18.452  13.295  1.00 0.00 ? 26 SER B HG     1  
ATOM 1327   N N      . GLY B 1 27 ? 12.024  14.697  10.287  1.00 0.00 ? 27 GLY B N      1  
ATOM 1328   C CA     . GLY B 1 27 ? 11.670  13.307  10.514  1.00 0.00 ? 27 GLY B CA     1  
ATOM 1329   C C      . GLY B 1 27 ? 10.241  13.050  10.061  1.00 0.00 ? 27 GLY B C      1  
ATOM 1330   O O      . GLY B 1 27 ? 9.913   13.235  8.890   1.00 0.00 ? 27 GLY B O      1  
ATOM 1331   H H      . GLY B 1 27 ? 12.349  14.957  9.365   1.00 0.00 ? 27 GLY B H      1  
ATOM 1332   H HA2    . GLY B 1 27 ? 12.345  12.661  9.953   1.00 0.00 ? 27 GLY B HA2    1  
ATOM 1333   H HA3    . GLY B 1 27 ? 11.746  13.064  11.574  1.00 0.00 ? 27 GLY B HA3    1  
ATOM 1334   N N      . GLN B 1 28 ? 9.380   12.689  11.016  1.00 0.00 ? 28 GLN B N      1  
ATOM 1335   C CA     . GLN B 1 28 ? 7.954   12.531  10.794  1.00 0.00 ? 28 GLN B CA     1  
ATOM 1336   C C      . GLN B 1 28 ? 7.187   13.729  11.343  1.00 0.00 ? 28 GLN B C      1  
ATOM 1337   O O      . GLN B 1 28 ? 5.957   13.722  11.380  1.00 0.00 ? 28 GLN B O      1  
ATOM 1338   C CB     . GLN B 1 28 ? 7.498   11.199  11.392  1.00 0.00 ? 28 GLN B CB     1  
ATOM 1339   C CG     . GLN B 1 28 ? 7.383   10.125  10.309  1.00 0.00 ? 28 GLN B CG     1  
ATOM 1340   C CD     . GLN B 1 28 ? 8.711   9.895   9.599   1.00 0.00 ? 28 GLN B CD     1  
ATOM 1341   O OE1    . GLN B 1 28 ? 9.613   9.260   10.138  1.00 0.00 ? 28 GLN B OE1    1  
ATOM 1342   N NE2    . GLN B 1 28 ? 8.877   10.445  8.397   1.00 0.00 ? 28 GLN B NE2    1  
ATOM 1343   H H      . GLN B 1 28 ? 9.692   12.712  11.978  1.00 0.00 ? 28 GLN B H      1  
ATOM 1344   H HA     . GLN B 1 28 ? 7.760   12.511  9.722   1.00 0.00 ? 28 GLN B HA     1  
ATOM 1345   H HB2    . GLN B 1 28 ? 8.206   10.870  12.153  1.00 0.00 ? 28 GLN B HB2    1  
ATOM 1346   H HB3    . GLN B 1 28 ? 6.528   11.325  11.869  1.00 0.00 ? 28 GLN B HB3    1  
ATOM 1347   H HG2    . GLN B 1 28 ? 7.061   9.191   10.769  1.00 0.00 ? 28 GLN B HG2    1  
ATOM 1348   H HG3    . GLN B 1 28 ? 6.626   10.429  9.585   1.00 0.00 ? 28 GLN B HG3    1  
ATOM 1349   H HE21   . GLN B 1 28 ? 8.124   10.969  7.976   1.00 0.00 ? 28 GLN B HE21   1  
ATOM 1350   H HE22   . GLN B 1 28 ? 9.808   10.517  8.012   1.00 0.00 ? 28 GLN B HE22   1  
ATOM 1351   N N      . GLN B 1 29 ? 7.920   14.796  11.674  1.00 0.00 ? 29 GLN B N      1  
ATOM 1352   C CA     . GLN B 1 29 ? 7.358   16.086  12.021  1.00 0.00 ? 29 GLN B CA     1  
ATOM 1353   C C      . GLN B 1 29 ? 7.405   17.032  10.827  1.00 0.00 ? 29 GLN B C      1  
ATOM 1354   O O      . GLN B 1 29 ? 8.243   16.893  9.938   1.00 0.00 ? 29 GLN B O      1  
ATOM 1355   C CB     . GLN B 1 29 ? 8.134   16.716  13.174  1.00 0.00 ? 29 GLN B CB     1  
ATOM 1356   C CG     . GLN B 1 29 ? 8.419   15.815  14.374  1.00 0.00 ? 29 GLN B CG     1  
ATOM 1357   C CD     . GLN B 1 29 ? 8.865   16.686  15.539  1.00 0.00 ? 29 GLN B CD     1  
ATOM 1358   O OE1    . GLN B 1 29 ? 10.045  16.989  15.697  1.00 0.00 ? 29 GLN B OE1    1  
ATOM 1359   N NE2    . GLN B 1 29 ? 7.912   17.209  16.308  1.00 0.00 ? 29 GLN B NE2    1  
ATOM 1360   H H      . GLN B 1 29 ? 8.926   14.733  11.612  1.00 0.00 ? 29 GLN B H      1  
ATOM 1361   H HA     . GLN B 1 29 ? 6.318   15.957  12.318  1.00 0.00 ? 29 GLN B HA     1  
ATOM 1362   H HB2    . GLN B 1 29 ? 9.087   17.071  12.788  1.00 0.00 ? 29 GLN B HB2    1  
ATOM 1363   H HB3    . GLN B 1 29 ? 7.569   17.579  13.519  1.00 0.00 ? 29 GLN B HB3    1  
ATOM 1364   H HG2    . GLN B 1 29 ? 7.522   15.263  14.651  1.00 0.00 ? 29 GLN B HG2    1  
ATOM 1365   H HG3    . GLN B 1 29 ? 9.208   15.105  14.126  1.00 0.00 ? 29 GLN B HG3    1  
ATOM 1366   H HE21   . GLN B 1 29 ? 6.942   16.999  16.132  1.00 0.00 ? 29 GLN B HE21   1  
ATOM 1367   H HE22   . GLN B 1 29 ? 8.180   17.875  17.019  1.00 0.00 ? 29 GLN B HE22   1  
ATOM 1368   N N      . VAL B 1 30 ? 6.512   18.022  10.839  1.00 0.00 ? 30 VAL B N      1  
ATOM 1369   C CA     . VAL B 1 30 ? 6.235   18.897  9.712   1.00 0.00 ? 30 VAL B CA     1  
ATOM 1370   C C      . VAL B 1 30 ? 5.941   20.299  10.238  1.00 0.00 ? 30 VAL B C      1  
ATOM 1371   O O      . VAL B 1 30 ? 4.938   20.513  10.914  1.00 0.00 ? 30 VAL B O      1  
ATOM 1372   C CB     . VAL B 1 30 ? 5.053   18.334  8.914   1.00 0.00 ? 30 VAL B CB     1  
ATOM 1373   C CG1    . VAL B 1 30 ? 4.833   19.130  7.632   1.00 0.00 ? 30 VAL B CG1    1  
ATOM 1374   C CG2    . VAL B 1 30 ? 5.289   16.885  8.490   1.00 0.00 ? 30 VAL B CG2    1  
ATOM 1375   H H      . VAL B 1 30 ? 5.874   18.069  11.622  1.00 0.00 ? 30 VAL B H      1  
ATOM 1376   H HA     . VAL B 1 30 ? 7.107   18.941  9.060   1.00 0.00 ? 30 VAL B HA     1  
ATOM 1377   H HB     . VAL B 1 30 ? 4.149   18.380  9.520   1.00 0.00 ? 30 VAL B HB     1  
ATOM 1378   H HG11   . VAL B 1 30 ? 5.671   18.968  6.954   1.00 0.00 ? 30 VAL B HG11   1  
ATOM 1379   H HG12   . VAL B 1 30 ? 3.913   18.795  7.153   1.00 0.00 ? 30 VAL B HG12   1  
ATOM 1380   H HG13   . VAL B 1 30 ? 4.750   20.192  7.860   1.00 0.00 ? 30 VAL B HG13   1  
ATOM 1381   H HG21   . VAL B 1 30 ? 5.244   16.228  9.360   1.00 0.00 ? 30 VAL B HG21   1  
ATOM 1382   H HG22   . VAL B 1 30 ? 4.519   16.575  7.784   1.00 0.00 ? 30 VAL B HG22   1  
ATOM 1383   H HG23   . VAL B 1 30 ? 6.266   16.795  8.013   1.00 0.00 ? 30 VAL B HG23   1  
ATOM 1384   N N      . ARG B 1 31 ? 6.836   21.250  9.956   1.00 0.00 ? 31 ARG B N      1  
ATOM 1385   C CA     . ARG B 1 31 ? 6.726   22.642  10.366  1.00 0.00 ? 31 ARG B CA     1  
ATOM 1386   C C      . ARG B 1 31 ? 5.943   23.421  9.316   1.00 0.00 ? 31 ARG B C      1  
ATOM 1387   O O      . ARG B 1 31 ? 6.368   23.503  8.165   1.00 0.00 ? 31 ARG B O      1  
ATOM 1388   C CB     . ARG B 1 31 ? 8.130   23.224  10.556  1.00 0.00 ? 31 ARG B CB     1  
ATOM 1389   C CG     . ARG B 1 31 ? 8.462   23.540  12.014  1.00 0.00 ? 31 ARG B CG     1  
ATOM 1390   C CD     . ARG B 1 31 ? 7.733   24.793  12.499  1.00 0.00 ? 31 ARG B CD     1  
ATOM 1391   N NE     . ARG B 1 31 ? 8.298   25.285  13.759  1.00 0.00 ? 31 ARG B NE     1  
ATOM 1392   C CZ     . ARG B 1 31 ? 9.335   26.123  13.867  1.00 0.00 ? 31 ARG B CZ     1  
ATOM 1393   N NH1    . ARG B 1 31 ? 9.902   26.656  12.786  1.00 0.00 ? 31 ARG B NH1    1  
ATOM 1394   N NH2    . ARG B 1 31 ? 9.821   26.441  15.066  1.00 0.00 ? 31 ARG B NH2    1  
ATOM 1395   H H      . ARG B 1 31 ? 7.603   21.013  9.342   1.00 0.00 ? 31 ARG B H      1  
ATOM 1396   H HA     . ARG B 1 31 ? 6.183   22.696  11.309  1.00 0.00 ? 31 ARG B HA     1  
ATOM 1397   H HB2    . ARG B 1 31 ? 8.869   22.517  10.181  1.00 0.00 ? 31 ARG B HB2    1  
ATOM 1398   H HB3    . ARG B 1 31 ? 8.231   24.140  9.975   1.00 0.00 ? 31 ARG B HB3    1  
ATOM 1399   H HG2    . ARG B 1 31 ? 8.194   22.691  12.645  1.00 0.00 ? 31 ARG B HG2    1  
ATOM 1400   H HG3    . ARG B 1 31 ? 9.536   23.705  12.093  1.00 0.00 ? 31 ARG B HG3    1  
ATOM 1401   H HD2    . ARG B 1 31 ? 7.800   25.575  11.741  1.00 0.00 ? 31 ARG B HD2    1  
ATOM 1402   H HD3    . ARG B 1 31 ? 6.679   24.554  12.651  1.00 0.00 ? 31 ARG B HD3    1  
ATOM 1403   H HE     . ARG B 1 31 ? 7.802   25.042  14.605  1.00 0.00 ? 31 ARG B HE     1  
ATOM 1404   H HH11   . ARG B 1 31 ? 9.548   26.426  11.871  1.00 0.00 ? 31 ARG B HH11   1  
ATOM 1405   H HH12   . ARG B 1 31 ? 10.535  27.439  12.885  1.00 0.00 ? 31 ARG B HH12   1  
ATOM 1406   H HH21   . ARG B 1 31 ? 9.486   25.957  15.886  1.00 0.00 ? 31 ARG B HH21   1  
ATOM 1407   H HH22   . ARG B 1 31 ? 10.609  27.071  15.142  1.00 0.00 ? 31 ARG B HH22   1  
ATOM 1408   N N      . ILE B 1 32 ? 4.807   23.999  9.716   1.00 0.00 ? 32 ILE B N      1  
ATOM 1409   C CA     . ILE B 1 32 ? 3.831   24.594  8.816   1.00 0.00 ? 32 ILE B CA     1  
ATOM 1410   C C      . ILE B 1 32 ? 3.524   26.021  9.253   1.00 0.00 ? 32 ILE B C      1  
ATOM 1411   O O      . ILE B 1 32 ? 3.249   26.262  10.427  1.00 0.00 ? 32 ILE B O      1  
ATOM 1412   C CB     . ILE B 1 32 ? 2.533   23.779  8.777   1.00 0.00 ? 32 ILE B CB     1  
ATOM 1413   C CG1    . ILE B 1 32 ? 2.770   22.284  9.020   1.00 0.00 ? 32 ILE B CG1    1  
ATOM 1414   C CG2    . ILE B 1 32 ? 1.849   24.028  7.431   1.00 0.00 ? 32 ILE B CG2    1  
ATOM 1415   C CD1    . ILE B 1 32 ? 1.537   21.416  8.775   1.00 0.00 ? 32 ILE B CD1    1  
ATOM 1416   H H      . ILE B 1 32 ? 4.540   23.914  10.687  1.00 0.00 ? 32 ILE B H      1  
ATOM 1417   H HA     . ILE B 1 32 ? 4.251   24.624  7.810   1.00 0.00 ? 32 ILE B HA     1  
ATOM 1418   H HB     . ILE B 1 32 ? 1.871   24.138  9.565   1.00 0.00 ? 32 ILE B HB     1  
ATOM 1419   H HG12   . ILE B 1 32 ? 3.571   21.942  8.366   1.00 0.00 ? 32 ILE B HG12   1  
ATOM 1420   H HG13   . ILE B 1 32 ? 3.072   22.146  10.059  1.00 0.00 ? 32 ILE B HG13   1  
ATOM 1421   H HG21   . ILE B 1 32 ? 0.842   23.612  7.440   1.00 0.00 ? 32 ILE B HG21   1  
ATOM 1422   H HG22   . ILE B 1 32 ? 1.771   25.099  7.245   1.00 0.00 ? 32 ILE B HG22   1  
ATOM 1423   H HG23   . ILE B 1 32 ? 2.426   23.566  6.629   1.00 0.00 ? 32 ILE B HG23   1  
ATOM 1424   H HD11   . ILE B 1 32 ? 0.688   21.811  9.335   1.00 0.00 ? 32 ILE B HD11   1  
ATOM 1425   H HD12   . ILE B 1 32 ? 1.301   21.394  7.712   1.00 0.00 ? 32 ILE B HD12   1  
ATOM 1426   H HD13   . ILE B 1 32 ? 1.745   20.398  9.108   1.00 0.00 ? 32 ILE B HD13   1  
ATOM 1427   N N      . GLY B 1 33 ? 3.522   26.961  8.307   1.00 0.00 ? 33 GLY B N      1  
ATOM 1428   C CA     . GLY B 1 33 ? 3.043   28.315  8.525   1.00 0.00 ? 33 GLY B CA     1  
ATOM 1429   C C      . GLY B 1 33 ? 1.597   28.473  8.075   1.00 0.00 ? 33 GLY B C      1  
ATOM 1430   O O      . GLY B 1 33 ? 1.225   27.997  7.004   1.00 0.00 ? 33 GLY B O      1  
ATOM 1431   H H      . GLY B 1 33 ? 3.724   26.690  7.354   1.00 0.00 ? 33 GLY B H      1  
ATOM 1432   H HA2    . GLY B 1 33 ? 3.120   28.575  9.580   1.00 0.00 ? 33 GLY B HA2    1  
ATOM 1433   H HA3    . GLY B 1 33 ? 3.648   29.011  7.947   1.00 0.00 ? 33 GLY B HA3    1  
ATOM 1434   N N      . ILE B 1 34 ? 0.802   29.187  8.875   1.00 0.00 ? 34 ILE B N      1  
ATOM 1435   C CA     . ILE B 1 34 ? -0.565  29.548  8.541   1.00 0.00 ? 34 ILE B CA     1  
ATOM 1436   C C      . ILE B 1 34 ? -0.699  31.062  8.534   1.00 0.00 ? 34 ILE B C      1  
ATOM 1437   O O      . ILE B 1 34 ? -0.279  31.754  9.459   1.00 0.00 ? 34 ILE B O      1  
ATOM 1438   C CB     . ILE B 1 34 ? -1.576  28.916  9.498   1.00 0.00 ? 34 ILE B CB     1  
ATOM 1439   C CG1    . ILE B 1 34 ? -1.322  27.411  9.586   1.00 0.00 ? 34 ILE B CG1    1  
ATOM 1440   C CG2    . ILE B 1 34 ? -2.986  29.236  8.994   1.00 0.00 ? 34 ILE B CG2    1  
ATOM 1441   C CD1    . ILE B 1 34 ? -2.203  26.747  10.642  1.00 0.00 ? 34 ILE B CD1    1  
ATOM 1442   H H      . ILE B 1 34 ? 1.145   29.466  9.784   1.00 0.00 ? 34 ILE B H      1  
ATOM 1443   H HA     . ILE B 1 34 ? -0.782  29.192  7.534   1.00 0.00 ? 34 ILE B HA     1  
ATOM 1444   H HB     . ILE B 1 34 ? -1.448  29.351  10.489  1.00 0.00 ? 34 ILE B HB     1  
ATOM 1445   H HG12   . ILE B 1 34 ? -1.472  26.949  8.611   1.00 0.00 ? 34 ILE B HG12   1  
ATOM 1446   H HG13   . ILE B 1 34 ? -0.287  27.246  9.875   1.00 0.00 ? 34 ILE B HG13   1  
ATOM 1447   H HG21   . ILE B 1 34 ? -3.728  28.604  9.482   1.00 0.00 ? 34 ILE B HG21   1  
ATOM 1448   H HG22   . ILE B 1 34 ? -3.227  30.277  9.213   1.00 0.00 ? 34 ILE B HG22   1  
ATOM 1449   H HG23   . ILE B 1 34 ? -3.052  29.076  7.919   1.00 0.00 ? 34 ILE B HG23   1  
ATOM 1450   H HD11   . ILE B 1 34 ? -1.845  25.732  10.815  1.00 0.00 ? 34 ILE B HD11   1  
ATOM 1451   H HD12   . ILE B 1 34 ? -2.143  27.318  11.569  1.00 0.00 ? 34 ILE B HD12   1  
ATOM 1452   H HD13   . ILE B 1 34 ? -3.239  26.705  10.305  1.00 0.00 ? 34 ILE B HD13   1  
ATOM 1453   N N      . ASN B 1 35 ? -1.342  31.557  7.480   1.00 0.00 ? 35 ASN B N      1  
ATOM 1454   C CA     . ASN B 1 35 ? -1.372  32.966  7.139   1.00 0.00 ? 35 ASN B CA     1  
ATOM 1455   C C      . ASN B 1 35 ? -2.803  33.380  6.823   1.00 0.00 ? 35 ASN B C      1  
ATOM 1456   O O      . ASN B 1 35 ? -3.217  33.473  5.669   1.00 0.00 ? 35 ASN B O      1  
ATOM 1457   C CB     . ASN B 1 35 ? -0.386  33.204  5.996   1.00 0.00 ? 35 ASN B CB     1  
ATOM 1458   C CG     . ASN B 1 35 ? 0.028   34.663  5.870   1.00 0.00 ? 35 ASN B CG     1  
ATOM 1459   O OD1    . ASN B 1 35 ? -0.615  35.566  6.398   1.00 0.00 ? 35 ASN B OD1    1  
ATOM 1460   N ND2    . ASN B 1 35 ? 1.151   34.911  5.199   1.00 0.00 ? 35 ASN B ND2    1  
ATOM 1461   H H      . ASN B 1 35 ? -1.800  30.896  6.867   1.00 0.00 ? 35 ASN B H      1  
ATOM 1462   H HA     . ASN B 1 35 ? -1.040  33.545  8.001   1.00 0.00 ? 35 ASN B HA     1  
ATOM 1463   H HB2    . ASN B 1 35 ? 0.506   32.613  6.194   1.00 0.00 ? 35 ASN B HB2    1  
ATOM 1464   H HB3    . ASN B 1 35 ? -0.816  32.864  5.055   1.00 0.00 ? 35 ASN B HB3    1  
ATOM 1465   H HD21   . ASN B 1 35 ? 1.678   34.150  4.797   1.00 0.00 ? 35 ASN B HD21   1  
ATOM 1466   H HD22   . ASN B 1 35 ? 1.506   35.855  5.157   1.00 0.00 ? 35 ASN B HD22   1  
ATOM 1467   N N      . ALA B 1 36 ? -3.570  33.541  7.902   1.00 0.00 ? 36 ALA B N      1  
ATOM 1468   C CA     . ALA B 1 36 ? -4.945  34.004  7.883   1.00 0.00 ? 36 ALA B CA     1  
ATOM 1469   C C      . ALA B 1 36 ? -5.089  35.228  8.779   1.00 0.00 ? 36 ALA B C      1  
ATOM 1470   O O      . ALA B 1 36 ? -4.306  35.394  9.715   1.00 0.00 ? 36 ALA B O      1  
ATOM 1471   C CB     . ALA B 1 36 ? -5.851  32.875  8.371   1.00 0.00 ? 36 ALA B CB     1  
ATOM 1472   H H      . ALA B 1 36 ? -3.136  33.416  8.804   1.00 0.00 ? 36 ALA B H      1  
ATOM 1473   H HA     . ALA B 1 36 ? -5.232  34.281  6.868   1.00 0.00 ? 36 ALA B HA     1  
ATOM 1474   H HB1    . ALA B 1 36 ? -6.892  33.163  8.224   1.00 0.00 ? 36 ALA B HB1    1  
ATOM 1475   H HB2    . ALA B 1 36 ? -5.647  31.964  7.810   1.00 0.00 ? 36 ALA B HB2    1  
ATOM 1476   H HB3    . ALA B 1 36 ? -5.679  32.696  9.432   1.00 0.00 ? 36 ALA B HB3    1  
ATOM 1477   N N      . PRO B 1 37 ? -6.111  36.060  8.553   1.00 0.00 ? 37 PRO B N      1  
ATOM 1478   C CA     . PRO B 1 37 ? -6.460  37.120  9.476   1.00 0.00 ? 37 PRO B CA     1  
ATOM 1479   C C      . PRO B 1 37 ? -6.823  36.560  10.847  1.00 0.00 ? 37 PRO B C      1  
ATOM 1480   O O      . PRO B 1 37 ? -7.335  35.449  10.964  1.00 0.00 ? 37 PRO B O      1  
ATOM 1481   C CB     . PRO B 1 37 ? -7.653  37.835  8.847   1.00 0.00 ? 37 PRO B CB     1  
ATOM 1482   C CG     . PRO B 1 37 ? -8.246  36.842  7.852   1.00 0.00 ? 37 PRO B CG     1  
ATOM 1483   C CD     . PRO B 1 37 ? -7.035  36.017  7.435   1.00 0.00 ? 37 PRO B CD     1  
ATOM 1484   H HA     . PRO B 1 37 ? -5.622  37.811  9.574   1.00 0.00 ? 37 PRO B HA     1  
ATOM 1485   H HB2    . PRO B 1 37 ? -8.391  38.081  9.606   1.00 0.00 ? 37 PRO B HB2    1  
ATOM 1486   H HB3    . PRO B 1 37 ? -7.318  38.732  8.325   1.00 0.00 ? 37 PRO B HB3    1  
ATOM 1487   H HG2    . PRO B 1 37 ? -8.981  36.201  8.338   1.00 0.00 ? 37 PRO B HG2    1  
ATOM 1488   H HG3    . PRO B 1 37 ? -8.685  37.357  6.997   1.00 0.00 ? 37 PRO B HG3    1  
ATOM 1489   H HD2    . PRO B 1 37 ? -7.339  35.000  7.191   1.00 0.00 ? 37 PRO B HD2    1  
ATOM 1490   H HD3    . PRO B 1 37 ? -6.583  36.506  6.574   1.00 0.00 ? 37 PRO B HD3    1  
ATOM 1491   N N      . LYS B 1 38 ? -6.697  37.393  11.882  1.00 0.00 ? 38 LYS B N      1  
ATOM 1492   C CA     . LYS B 1 38 ? -7.204  37.109  13.218  1.00 0.00 ? 38 LYS B CA     1  
ATOM 1493   C C      . LYS B 1 38 ? -8.730  37.109  13.269  1.00 0.00 ? 38 LYS B C      1  
ATOM 1494   O O      . LYS B 1 38 ? -9.329  36.866  14.314  1.00 0.00 ? 38 LYS B O      1  
ATOM 1495   C CB     . LYS B 1 38 ? -6.554  38.045  14.238  1.00 0.00 ? 38 LYS B CB     1  
ATOM 1496   C CG     . LYS B 1 38 ? -5.039  37.835  14.263  1.00 0.00 ? 38 LYS B CG     1  
ATOM 1497   C CD     . LYS B 1 38 ? -4.661  36.517  14.937  1.00 0.00 ? 38 LYS B CD     1  
ATOM 1498   C CE     . LYS B 1 38 ? -4.611  36.613  16.461  1.00 0.00 ? 38 LYS B CE     1  
ATOM 1499   N NZ     . LYS B 1 38 ? -3.587  37.566  16.928  1.00 0.00 ? 38 LYS B NZ     1  
ATOM 1500   H H      . LYS B 1 38 ? -6.272  38.296  11.725  1.00 0.00 ? 38 LYS B H      1  
ATOM 1501   H HA     . LYS B 1 38 ? -6.920  36.085  13.459  1.00 0.00 ? 38 LYS B HA     1  
ATOM 1502   H HB2    . LYS B 1 38 ? -6.774  39.079  13.974  1.00 0.00 ? 38 LYS B HB2    1  
ATOM 1503   H HB3    . LYS B 1 38 ? -6.963  37.833  15.226  1.00 0.00 ? 38 LYS B HB3    1  
ATOM 1504   H HG2    . LYS B 1 38 ? -4.650  37.831  13.246  1.00 0.00 ? 38 LYS B HG2    1  
ATOM 1505   H HG3    . LYS B 1 38 ? -4.541  38.648  14.789  1.00 0.00 ? 38 LYS B HG3    1  
ATOM 1506   H HD2    . LYS B 1 38 ? -5.370  35.737  14.667  1.00 0.00 ? 38 LYS B HD2    1  
ATOM 1507   H HD3    . LYS B 1 38 ? -3.692  36.225  14.538  1.00 0.00 ? 38 LYS B HD3    1  
ATOM 1508   H HE2    . LYS B 1 38 ? -5.592  36.920  16.830  1.00 0.00 ? 38 LYS B HE2    1  
ATOM 1509   H HE3    . LYS B 1 38 ? -4.391  35.623  16.863  1.00 0.00 ? 38 LYS B HE3    1  
ATOM 1510   H HZ1    . LYS B 1 38 ? -2.684  37.320  16.543  1.00 0.00 ? 38 LYS B HZ1    1  
ATOM 1511   H HZ2    . LYS B 1 38 ? -3.813  38.504  16.629  1.00 0.00 ? 38 LYS B HZ2    1  
ATOM 1512   H HZ3    . LYS B 1 38 ? -3.525  37.557  17.936  1.00 0.00 ? 38 LYS B HZ3    1  
ATOM 1513   N N      . ASP B 1 39 ? -9.347  37.379  12.117  1.00 0.00 ? 39 ASP B N      1  
ATOM 1514   C CA     . ASP B 1 39 ? -10.777 37.261  11.886  1.00 0.00 ? 39 ASP B CA     1  
ATOM 1515   C C      . ASP B 1 39 ? -11.234 35.808  11.973  1.00 0.00 ? 39 ASP B C      1  
ATOM 1516   O O      . ASP B 1 39 ? -12.386 35.541  12.311  1.00 0.00 ? 39 ASP B O      1  
ATOM 1517   C CB     . ASP B 1 39 ? -11.097 37.786  10.486  1.00 0.00 ? 39 ASP B CB     1  
ATOM 1518   C CG     . ASP B 1 39 ? -12.494 38.395  10.422  1.00 0.00 ? 39 ASP B CG     1  
ATOM 1519   O OD1    . ASP B 1 39 ? -12.697 39.459  11.048  1.00 0.00 ? 39 ASP B OD1    1  
ATOM 1520   O OD2    . ASP B 1 39 ? -13.360 37.815  9.730   1.00 0.00 ? 39 ASP B OD2    1  
ATOM 1521   H H      . ASP B 1 39 ? -8.746  37.516  11.319  1.00 0.00 ? 39 ASP B H      1  
ATOM 1522   H HA     . ASP B 1 39 ? -11.310 37.851  12.633  1.00 0.00 ? 39 ASP B HA     1  
ATOM 1523   H HB2    . ASP B 1 39 ? -10.360 38.527  10.176  1.00 0.00 ? 39 ASP B HB2    1  
ATOM 1524   H HB3    . ASP B 1 39 ? -11.029 36.962  9.774   1.00 0.00 ? 39 ASP B HB3    1  
ATOM 1525   N N      . VAL B 1 40 ? -10.326 34.869  11.687  1.00 0.00 ? 40 VAL B N      1  
ATOM 1526   C CA     . VAL B 1 40 ? -10.568 33.438  11.771  1.00 0.00 ? 40 VAL B CA     1  
ATOM 1527   C C      . VAL B 1 40 ? -9.760  32.835  12.912  1.00 0.00 ? 40 VAL B C      1  
ATOM 1528   O O      . VAL B 1 40 ? -8.628  33.247  13.168  1.00 0.00 ? 40 VAL B O      1  
ATOM 1529   C CB     . VAL B 1 40 ? -10.276 32.727  10.447  1.00 0.00 ? 40 VAL B CB     1  
ATOM 1530   C CG1    . VAL B 1 40 ? -11.026 33.413  9.306   1.00 0.00 ? 40 VAL B CG1    1  
ATOM 1531   C CG2    . VAL B 1 40 ? -8.794  32.692  10.089  1.00 0.00 ? 40 VAL B CG2    1  
ATOM 1532   H H      . VAL B 1 40 ? -9.388  35.162  11.451  1.00 0.00 ? 40 VAL B H      1  
ATOM 1533   H HA     . VAL B 1 40 ? -11.623 33.277  11.996  1.00 0.00 ? 40 VAL B HA     1  
ATOM 1534   H HB     . VAL B 1 40 ? -10.600 31.689  10.532  1.00 0.00 ? 40 VAL B HB     1  
ATOM 1535   H HG11   . VAL B 1 40 ? -10.654 34.430  9.173   1.00 0.00 ? 40 VAL B HG11   1  
ATOM 1536   H HG12   . VAL B 1 40 ? -10.879 32.855  8.382   1.00 0.00 ? 40 VAL B HG12   1  
ATOM 1537   H HG13   . VAL B 1 40 ? -12.091 33.450  9.537   1.00 0.00 ? 40 VAL B HG13   1  
ATOM 1538   H HG21   . VAL B 1 40 ? -8.459  33.691  9.815   1.00 0.00 ? 40 VAL B HG21   1  
ATOM 1539   H HG22   . VAL B 1 40 ? -8.216  32.325  10.937  1.00 0.00 ? 40 VAL B HG22   1  
ATOM 1540   H HG23   . VAL B 1 40 ? -8.646  32.018  9.246   1.00 0.00 ? 40 VAL B HG23   1  
ATOM 1541   N N      . ALA B 1 41 ? -10.335 31.843  13.591  1.00 0.00 ? 41 ALA B N      1  
ATOM 1542   C CA     . ALA B 1 41 ? -9.592  31.056  14.557  1.00 0.00 ? 41 ALA B CA     1  
ATOM 1543   C C      . ALA B 1 41 ? -8.889  29.883  13.887  1.00 0.00 ? 41 ALA B C      1  
ATOM 1544   O O      . ALA B 1 41 ? -9.394  29.288  12.937  1.00 0.00 ? 41 ALA B O      1  
ATOM 1545   C CB     . ALA B 1 41 ? -10.521 30.639  15.696  1.00 0.00 ? 41 ALA B CB     1  
ATOM 1546   H H      . ALA B 1 41 ? -11.273 31.552  13.358  1.00 0.00 ? 41 ALA B H      1  
ATOM 1547   H HA     . ALA B 1 41 ? -8.788  31.681  14.941  1.00 0.00 ? 41 ALA B HA     1  
ATOM 1548   H HB1    . ALA B 1 41 ? -11.269 29.938  15.328  1.00 0.00 ? 41 ALA B HB1    1  
ATOM 1549   H HB2    . ALA B 1 41 ? -9.940  30.169  16.487  1.00 0.00 ? 41 ALA B HB2    1  
ATOM 1550   H HB3    . ALA B 1 41 ? -11.018 31.520  16.104  1.00 0.00 ? 41 ALA B HB3    1  
ATOM 1551   N N      . VAL B 1 42 ? -7.676  29.608  14.372  1.00 0.00 ? 42 VAL B N      1  
ATOM 1552   C CA     . VAL B 1 42 ? -6.717  28.736  13.717  1.00 0.00 ? 42 VAL B CA     1  
ATOM 1553   C C      . VAL B 1 42 ? -5.972  27.934  14.779  1.00 0.00 ? 42 VAL B C      1  
ATOM 1554   O O      . VAL B 1 42 ? -5.062  28.453  15.420  1.00 0.00 ? 42 VAL B O      1  
ATOM 1555   C CB     . VAL B 1 42 ? -5.762  29.617  12.907  1.00 0.00 ? 42 VAL B CB     1  
ATOM 1556   C CG1    . VAL B 1 42 ? -4.869  28.792  11.993  1.00 0.00 ? 42 VAL B CG1    1  
ATOM 1557   C CG2    . VAL B 1 42 ? -6.478  30.565  11.947  1.00 0.00 ? 42 VAL B CG2    1  
ATOM 1558   H H      . VAL B 1 42 ? -7.342  30.148  15.160  1.00 0.00 ? 42 VAL B H      1  
ATOM 1559   H HA     . VAL B 1 42 ? -7.226  28.050  13.041  1.00 0.00 ? 42 VAL B HA     1  
ATOM 1560   H HB     . VAL B 1 42 ? -5.139  30.205  13.581  1.00 0.00 ? 42 VAL B HB     1  
ATOM 1561   H HG11   . VAL B 1 42 ? -5.498  28.311  11.244  1.00 0.00 ? 42 VAL B HG11   1  
ATOM 1562   H HG12   . VAL B 1 42 ? -4.174  29.471  11.500  1.00 0.00 ? 42 VAL B HG12   1  
ATOM 1563   H HG13   . VAL B 1 42 ? -4.325  28.052  12.578  1.00 0.00 ? 42 VAL B HG13   1  
ATOM 1564   H HG21   . VAL B 1 42 ? -5.736  31.125  11.374  1.00 0.00 ? 42 VAL B HG21   1  
ATOM 1565   H HG22   . VAL B 1 42 ? -7.108  29.993  11.266  1.00 0.00 ? 42 VAL B HG22   1  
ATOM 1566   H HG23   . VAL B 1 42 ? -7.096  31.266  12.503  1.00 0.00 ? 42 VAL B HG23   1  
ATOM 1567   N N      . HIS B 1 43 ? -6.389  26.688  15.024  1.00 0.00 ? 43 HIS B N      1  
ATOM 1568   C CA     . HIS B 1 43 ? -5.735  25.821  15.995  1.00 0.00 ? 43 HIS B CA     1  
ATOM 1569   C C      . HIS B 1 43 ? -5.782  24.357  15.578  1.00 0.00 ? 43 HIS B C      1  
ATOM 1570   O O      . HIS B 1 43 ? -6.653  23.948  14.813  1.00 0.00 ? 43 HIS B O      1  
ATOM 1571   C CB     . HIS B 1 43 ? -6.310  25.967  17.408  1.00 0.00 ? 43 HIS B CB     1  
ATOM 1572   C CG     . HIS B 1 43 ? -6.910  27.305  17.748  1.00 0.00 ? 43 HIS B CG     1  
ATOM 1573   N ND1    . HIS B 1 43 ? -6.395  28.181  18.703  1.00 0.00 ? 43 HIS B ND1    1  
ATOM 1574   C CD2    . HIS B 1 43 ? -8.095  27.806  17.282  1.00 0.00 ? 43 HIS B CD2    1  
ATOM 1575   C CE1    . HIS B 1 43 ? -7.256  29.201  18.772  1.00 0.00 ? 43 HIS B CE1    1  
ATOM 1576   N NE2    . HIS B 1 43 ? -8.279  29.013  17.923  1.00 0.00 ? 43 HIS B NE2    1  
ATOM 1577   H H      . HIS B 1 43 ? -7.124  26.301  14.449  1.00 0.00 ? 43 HIS B H      1  
ATOM 1578   H HA     . HIS B 1 43 ? -4.682  26.102  16.033  1.00 0.00 ? 43 HIS B HA     1  
ATOM 1579   H HB2    . HIS B 1 43 ? -7.028  25.179  17.641  1.00 0.00 ? 43 HIS B HB2    1  
ATOM 1580   H HB3    . HIS B 1 43 ? -5.489  25.800  18.103  1.00 0.00 ? 43 HIS B HB3    1  
ATOM 1581   H HD2    . HIS B 1 43 ? -8.768  27.327  16.585  1.00 0.00 ? 43 HIS B HD2    1  
ATOM 1582   H HE1    . HIS B 1 43 ? -7.178  30.030  19.461  1.00 0.00 ? 43 HIS B HE1    1  
ATOM 1583   H HE2    . HIS B 1 43 ? -9.113  29.583  17.888  1.00 0.00 ? 43 HIS B HE2    1  
ATOM 1584   N N      . ARG B 1 44 ? -4.868  23.553  16.127  1.00 0.00 ? 44 ARG B N      1  
ATOM 1585   C CA     . ARG B 1 44 ? -4.909  22.104  16.006  1.00 0.00 ? 44 ARG B CA     1  
ATOM 1586   C C      . ARG B 1 44 ? -6.141  21.527  16.697  1.00 0.00 ? 44 ARG B C      1  
ATOM 1587   O O      . ARG B 1 44 ? -6.699  22.160  17.591  1.00 0.00 ? 44 ARG B O      1  
ATOM 1588   C CB     . ARG B 1 44 ? -3.594  21.505  16.505  1.00 0.00 ? 44 ARG B CB     1  
ATOM 1589   C CG     . ARG B 1 44 ? -3.328  21.791  17.983  1.00 0.00 ? 44 ARG B CG     1  
ATOM 1590   C CD     . ARG B 1 44 ? -1.899  21.386  18.337  1.00 0.00 ? 44 ARG B CD     1  
ATOM 1591   N NE     . ARG B 1 44 ? -1.708  21.283  19.786  1.00 0.00 ? 44 ARG B NE     1  
ATOM 1592   C CZ     . ARG B 1 44 ? -1.460  22.282  20.638  1.00 0.00 ? 44 ARG B CZ     1  
ATOM 1593   N NH1    . ARG B 1 44 ? -1.311  23.547  20.253  1.00 0.00 ? 44 ARG B NH1    1  
ATOM 1594   N NH2    . ARG B 1 44 ? -1.378  22.014  21.939  1.00 0.00 ? 44 ARG B NH2    1  
ATOM 1595   H H      . ARG B 1 44 ? -4.184  23.958  16.752  1.00 0.00 ? 44 ARG B H      1  
ATOM 1596   H HA     . ARG B 1 44 ? -4.996  21.852  14.951  1.00 0.00 ? 44 ARG B HA     1  
ATOM 1597   H HB2    . ARG B 1 44 ? -3.610  20.426  16.348  1.00 0.00 ? 44 ARG B HB2    1  
ATOM 1598   H HB3    . ARG B 1 44 ? -2.779  21.923  15.913  1.00 0.00 ? 44 ARG B HB3    1  
ATOM 1599   H HG2    . ARG B 1 44 ? -3.456  22.852  18.190  1.00 0.00 ? 44 ARG B HG2    1  
ATOM 1600   H HG3    . ARG B 1 44 ? -4.035  21.224  18.587  1.00 0.00 ? 44 ARG B HG3    1  
ATOM 1601   H HD2    . ARG B 1 44 ? -1.689  20.413  17.894  1.00 0.00 ? 44 ARG B HD2    1  
ATOM 1602   H HD3    . ARG B 1 44 ? -1.202  22.115  17.923  1.00 0.00 ? 44 ARG B HD3    1  
ATOM 1603   H HE     . ARG B 1 44 ? -1.801  20.366  20.203  1.00 0.00 ? 44 ARG B HE     1  
ATOM 1604   H HH11   . ARG B 1 44 ? -1.412  23.818  19.286  1.00 0.00 ? 44 ARG B HH11   1  
ATOM 1605   H HH12   . ARG B 1 44 ? -1.160  24.247  20.968  1.00 0.00 ? 44 ARG B HH12   1  
ATOM 1606   H HH21   . ARG B 1 44 ? -1.571  21.075  22.260  1.00 0.00 ? 44 ARG B HH21   1  
ATOM 1607   H HH22   . ARG B 1 44 ? -1.246  22.784  22.582  1.00 0.00 ? 44 ARG B HH22   1  
ATOM 1608   N N      . GLU B 1 45 ? -6.584  20.336  16.287  1.00 0.00 ? 45 GLU B N      1  
ATOM 1609   C CA     . GLU B 1 45 ? -7.839  19.750  16.738  1.00 0.00 ? 45 GLU B CA     1  
ATOM 1610   C C      . GLU B 1 45 ? -7.932  19.656  18.260  1.00 0.00 ? 45 GLU B C      1  
ATOM 1611   O O      . GLU B 1 45 ? -8.969  19.990  18.826  1.00 0.00 ? 45 GLU B O      1  
ATOM 1612   C CB     . GLU B 1 45 ? -7.997  18.358  16.128  1.00 0.00 ? 45 GLU B CB     1  
ATOM 1613   C CG     . GLU B 1 45 ? -8.682  18.420  14.763  1.00 0.00 ? 45 GLU B CG     1  
ATOM 1614   C CD     . GLU B 1 45 ? -10.141 18.860  14.869  1.00 0.00 ? 45 GLU B CD     1  
ATOM 1615   O OE1    . GLU B 1 45 ? -10.859 18.330  15.747  1.00 0.00 ? 45 GLU B OE1    1  
ATOM 1616   O OE2    . GLU B 1 45 ? -10.545 19.730  14.066  1.00 0.00 ? 45 GLU B OE2    1  
ATOM 1617   H H      . GLU B 1 45 ? -6.076  19.861  15.553  1.00 0.00 ? 45 GLU B H      1  
ATOM 1618   H HA     . GLU B 1 45 ? -8.672  20.374  16.405  1.00 0.00 ? 45 GLU B HA     1  
ATOM 1619   H HB2    . GLU B 1 45 ? -7.015  17.899  16.014  1.00 0.00 ? 45 GLU B HB2    1  
ATOM 1620   H HB3    . GLU B 1 45 ? -8.586  17.729  16.794  1.00 0.00 ? 45 GLU B HB3    1  
ATOM 1621   H HG2    . GLU B 1 45 ? -8.130  19.116  14.130  1.00 0.00 ? 45 GLU B HG2    1  
ATOM 1622   H HG3    . GLU B 1 45 ? -8.642  17.432  14.305  1.00 0.00 ? 45 GLU B HG3    1  
ATOM 1623   N N      . GLU B 1 46 ? -6.849  19.268  18.941  1.00 0.00 ? 46 GLU B N      1  
ATOM 1624   C CA     . GLU B 1 46 ? -6.859  19.169  20.394  1.00 0.00 ? 46 GLU B CA     1  
ATOM 1625   C C      . GLU B 1 46 ? -7.082  20.513  21.076  1.00 0.00 ? 46 GLU B C      1  
ATOM 1626   O O      . GLU B 1 46 ? -7.560  20.542  22.207  1.00 0.00 ? 46 GLU B O      1  
ATOM 1627   C CB     . GLU B 1 46 ? -5.581  18.522  20.931  1.00 0.00 ? 46 GLU B CB     1  
ATOM 1628   C CG     . GLU B 1 46 ? -4.289  19.204  20.488  1.00 0.00 ? 46 GLU B CG     1  
ATOM 1629   C CD     . GLU B 1 46 ? -3.076  18.572  21.163  1.00 0.00 ? 46 GLU B CD     1  
ATOM 1630   O OE1    . GLU B 1 46 ? -2.905  17.338  21.045  1.00 0.00 ? 46 GLU B OE1    1  
ATOM 1631   O OE2    . GLU B 1 46 ? -2.280  19.334  21.756  1.00 0.00 ? 46 GLU B OE2    1  
ATOM 1632   H H      . GLU B 1 46 ? -6.023  18.978  18.437  1.00 0.00 ? 46 GLU B H      1  
ATOM 1633   H HA     . GLU B 1 46 ? -7.694  18.528  20.678  1.00 0.00 ? 46 GLU B HA     1  
ATOM 1634   H HB2    . GLU B 1 46 ? -5.622  18.525  22.021  1.00 0.00 ? 46 GLU B HB2    1  
ATOM 1635   H HB3    . GLU B 1 46 ? -5.554  17.487  20.603  1.00 0.00 ? 46 GLU B HB3    1  
ATOM 1636   H HG2    . GLU B 1 46 ? -4.186  19.108  19.407  1.00 0.00 ? 46 GLU B HG2    1  
ATOM 1637   H HG3    . GLU B 1 46 ? -4.337  20.263  20.744  1.00 0.00 ? 46 GLU B HG3    1  
ATOM 1638   N N      . ILE B 1 47 ? -6.776  21.620  20.397  1.00 0.00 ? 47 ILE B N      1  
ATOM 1639   C CA     . ILE B 1 47 ? -7.086  22.956  20.876  1.00 0.00 ? 47 ILE B CA     1  
ATOM 1640   C C      . ILE B 1 47 ? -8.498  23.354  20.475  1.00 0.00 ? 47 ILE B C      1  
ATOM 1641   O O      . ILE B 1 47 ? -9.286  23.765  21.325  1.00 0.00 ? 47 ILE B O      1  
ATOM 1642   C CB     . ILE B 1 47 ? -6.063  23.952  20.325  1.00 0.00 ? 47 ILE B CB     1  
ATOM 1643   C CG1    . ILE B 1 47 ? -4.667  23.710  20.896  1.00 0.00 ? 47 ILE B CG1    1  
ATOM 1644   C CG2    . ILE B 1 47 ? -6.506  25.382  20.627  1.00 0.00 ? 47 ILE B CG2    1  
ATOM 1645   C CD1    . ILE B 1 47 ? -4.723  23.523  22.409  1.00 0.00 ? 47 ILE B CD1    1  
ATOM 1646   H H      . ILE B 1 47 ? -6.440  21.530  19.448  1.00 0.00 ? 47 ILE B H      1  
ATOM 1647   H HA     . ILE B 1 47 ? -7.059  22.964  21.965  1.00 0.00 ? 47 ILE B HA     1  
ATOM 1648   H HB     . ILE B 1 47 ? -6.002  23.839  19.244  1.00 0.00 ? 47 ILE B HB     1  
ATOM 1649   H HG12   . ILE B 1 47 ? -4.243  22.810  20.449  1.00 0.00 ? 47 ILE B HG12   1  
ATOM 1650   H HG13   . ILE B 1 47 ? -4.021  24.556  20.657  1.00 0.00 ? 47 ILE B HG13   1  
ATOM 1651   H HG21   . ILE B 1 47 ? -5.694  26.069  20.394  1.00 0.00 ? 47 ILE B HG21   1  
ATOM 1652   H HG22   . ILE B 1 47 ? -7.362  25.641  20.005  1.00 0.00 ? 47 ILE B HG22   1  
ATOM 1653   H HG23   . ILE B 1 47 ? -6.785  25.479  21.676  1.00 0.00 ? 47 ILE B HG23   1  
ATOM 1654   H HD11   . ILE B 1 47 ? -5.469  24.202  22.824  1.00 0.00 ? 47 ILE B HD11   1  
ATOM 1655   H HD12   . ILE B 1 47 ? -5.001  22.488  22.613  1.00 0.00 ? 47 ILE B HD12   1  
ATOM 1656   H HD13   . ILE B 1 47 ? -3.744  23.744  22.833  1.00 0.00 ? 47 ILE B HD13   1  
ATOM 1657   N N      . TYR B 1 48 ? -8.811  23.197  19.187  1.00 0.00 ? 48 TYR B N      1  
ATOM 1658   C CA     . TYR B 1 48 ? -10.099 23.556  18.626  1.00 0.00 ? 48 TYR B CA     1  
ATOM 1659   C C      . TYR B 1 48 ? -11.235 23.028  19.491  1.00 0.00 ? 48 TYR B C      1  
ATOM 1660   O O      . TYR B 1 48 ? -12.156 23.783  19.786  1.00 0.00 ? 48 TYR B O      1  
ATOM 1661   C CB     . TYR B 1 48 ? -10.220 22.977  17.219  1.00 0.00 ? 48 TYR B CB     1  
ATOM 1662   C CG     . TYR B 1 48 ? -11.567 23.220  16.585  1.00 0.00 ? 48 TYR B CG     1  
ATOM 1663   C CD1    . TYR B 1 48 ? -11.987 24.519  16.271  1.00 0.00 ? 48 TYR B CD1    1  
ATOM 1664   C CD2    . TYR B 1 48 ? -12.419 22.129  16.367  1.00 0.00 ? 48 TYR B CD2    1  
ATOM 1665   C CE1    . TYR B 1 48 ? -13.250 24.726  15.702  1.00 0.00 ? 48 TYR B CE1    1  
ATOM 1666   C CE2    . TYR B 1 48 ? -13.666 22.324  15.761  1.00 0.00 ? 48 TYR B CE2    1  
ATOM 1667   C CZ     . TYR B 1 48 ? -14.085 23.626  15.417  1.00 0.00 ? 48 TYR B CZ     1  
ATOM 1668   O OH     . TYR B 1 48 ? -15.310 23.818  14.850  1.00 0.00 ? 48 TYR B OH     1  
ATOM 1669   H H      . TYR B 1 48 ? -8.112  22.825  18.559  1.00 0.00 ? 48 TYR B H      1  
ATOM 1670   H HA     . TYR B 1 48 ? -10.179 24.641  18.570  1.00 0.00 ? 48 TYR B HA     1  
ATOM 1671   H HB2    . TYR B 1 48 ? -9.437  23.388  16.582  1.00 0.00 ? 48 TYR B HB2    1  
ATOM 1672   H HB3    . TYR B 1 48 ? -10.099 21.898  17.285  1.00 0.00 ? 48 TYR B HB3    1  
ATOM 1673   H HD1    . TYR B 1 48 ? -11.343 25.362  16.479  1.00 0.00 ? 48 TYR B HD1    1  
ATOM 1674   H HD2    . TYR B 1 48 ? -12.118 21.135  16.662  1.00 0.00 ? 48 TYR B HD2    1  
ATOM 1675   H HE1    . TYR B 1 48 ? -13.578 25.731  15.479  1.00 0.00 ? 48 TYR B HE1    1  
ATOM 1676   H HE2    . TYR B 1 48 ? -14.292 21.469  15.564  1.00 0.00 ? 48 TYR B HE2    1  
ATOM 1677   H HH     . TYR B 1 48 ? -15.503 24.748  14.690  1.00 0.00 ? 48 TYR B HH     1  
ATOM 1678   N N      . GLN B 1 49 ? -11.120 21.786  19.972  1.00 0.00 ? 49 GLN B N      1  
ATOM 1679   C CA     . GLN B 1 49 ? -12.189 21.051  20.627  1.00 0.00 ? 49 GLN B CA     1  
ATOM 1680   C C      . GLN B 1 49 ? -12.591 21.612  21.992  1.00 0.00 ? 49 GLN B C      1  
ATOM 1681   O O      . GLN B 1 49 ? -13.668 21.272  22.478  1.00 0.00 ? 49 GLN B O      1  
ATOM 1682   C CB     . GLN B 1 49 ? -11.783 19.581  20.737  1.00 0.00 ? 49 GLN B CB     1  
ATOM 1683   C CG     . GLN B 1 49 ? -11.912 18.882  19.383  1.00 0.00 ? 49 GLN B CG     1  
ATOM 1684   C CD     . GLN B 1 49 ? -11.309 17.482  19.388  1.00 0.00 ? 49 GLN B CD     1  
ATOM 1685   O OE1    . GLN B 1 49 ? -11.171 16.841  20.429  1.00 0.00 ? 49 GLN B OE1    1  
ATOM 1686   N NE2    . GLN B 1 49 ? -10.965 16.956  18.215  1.00 0.00 ? 49 GLN B NE2    1  
ATOM 1687   H H      . GLN B 1 49 ? -10.285 21.265  19.744  1.00 0.00 ? 49 GLN B H      1  
ATOM 1688   H HA     . GLN B 1 49 ? -13.070 21.101  19.987  1.00 0.00 ? 49 GLN B HA     1  
ATOM 1689   H HB2    . GLN B 1 49 ? -10.752 19.515  21.091  1.00 0.00 ? 49 GLN B HB2    1  
ATOM 1690   H HB3    . GLN B 1 49 ? -12.432 19.077  21.454  1.00 0.00 ? 49 GLN B HB3    1  
ATOM 1691   H HG2    . GLN B 1 49 ? -12.966 18.807  19.120  1.00 0.00 ? 49 GLN B HG2    1  
ATOM 1692   H HG3    . GLN B 1 49 ? -11.416 19.475  18.616  1.00 0.00 ? 49 GLN B HG3    1  
ATOM 1693   H HE21   . GLN B 1 49 ? -11.039 17.508  17.368  1.00 0.00 ? 49 GLN B HE21   1  
ATOM 1694   H HE22   . GLN B 1 49 ? -10.578 16.025  18.184  1.00 0.00 ? 49 GLN B HE22   1  
ATOM 1695   N N      . ARG B 1 50 ? -11.817 22.530  22.581  1.00 0.00 ? 50 ARG B N      1  
ATOM 1696   C CA     . ARG B 1 50 ? -12.239 23.263  23.767  1.00 0.00 ? 50 ARG B CA     1  
ATOM 1697   C C      . ARG B 1 50 ? -12.994 24.538  23.415  1.00 0.00 ? 50 ARG B C      1  
ATOM 1698   O O      . ARG B 1 50 ? -13.926 24.926  24.113  1.00 0.00 ? 50 ARG B O      1  
ATOM 1699   C CB     . ARG B 1 50 ? -11.046 23.672  24.633  1.00 0.00 ? 50 ARG B CB     1  
ATOM 1700   C CG     . ARG B 1 50 ? -10.269 22.508  25.244  1.00 0.00 ? 50 ARG B CG     1  
ATOM 1701   C CD     . ARG B 1 50 ? -9.126  22.117  24.313  1.00 0.00 ? 50 ARG B CD     1  
ATOM 1702   N NE     . ARG B 1 50 ? -8.372  20.980  24.847  1.00 0.00 ? 50 ARG B NE     1  
ATOM 1703   C CZ     . ARG B 1 50 ? -7.304  21.046  25.646  1.00 0.00 ? 50 ARG B CZ     1  
ATOM 1704   N NH1    . ARG B 1 50 ? -6.929  22.188  26.222  1.00 0.00 ? 50 ARG B NH1    1  
ATOM 1705   N NH2    . ARG B 1 50 ? -6.589  19.948  25.891  1.00 0.00 ? 50 ARG B NH2    1  
ATOM 1706   H H      . ARG B 1 50 ? -10.941 22.786  22.141  1.00 0.00 ? 50 ARG B H      1  
ATOM 1707   H HA     . ARG B 1 50 ? -12.901 22.634  24.361  1.00 0.00 ? 50 ARG B HA     1  
ATOM 1708   H HB2    . ARG B 1 50 ? -10.371 24.285  24.036  1.00 0.00 ? 50 ARG B HB2    1  
ATOM 1709   H HB3    . ARG B 1 50 ? -11.419 24.284  25.455  1.00 0.00 ? 50 ARG B HB3    1  
ATOM 1710   H HG2    . ARG B 1 50 ? -9.856  22.819  26.204  1.00 0.00 ? 50 ARG B HG2    1  
ATOM 1711   H HG3    . ARG B 1 50 ? -10.932 21.658  25.400  1.00 0.00 ? 50 ARG B HG3    1  
ATOM 1712   H HD2    . ARG B 1 50 ? -9.573  21.825  23.362  1.00 0.00 ? 50 ARG B HD2    1  
ATOM 1713   H HD3    . ARG B 1 50 ? -8.469  22.973  24.136  1.00 0.00 ? 50 ARG B HD3    1  
ATOM 1714   H HE     . ARG B 1 50 ? -8.570  20.082  24.428  1.00 0.00 ? 50 ARG B HE     1  
ATOM 1715   H HH11   . ARG B 1 50 ? -7.505  23.010  26.124  1.00 0.00 ? 50 ARG B HH11   1  
ATOM 1716   H HH12   . ARG B 1 50 ? -6.108  22.212  26.808  1.00 0.00 ? 50 ARG B HH12   1  
ATOM 1717   H HH21   . ARG B 1 50 ? -6.849  19.071  25.461  1.00 0.00 ? 50 ARG B HH21   1  
ATOM 1718   H HH22   . ARG B 1 50 ? -5.784  19.991  26.498  1.00 0.00 ? 50 ARG B HH22   1  
ATOM 1719   N N      . ILE B 1 51 ? -12.579 25.207  22.339  1.00 0.00 ? 51 ILE B N      1  
ATOM 1720   C CA     . ILE B 1 51 ? -12.997 26.558  22.006  1.00 0.00 ? 51 ILE B CA     1  
ATOM 1721   C C      . ILE B 1 51 ? -14.490 26.655  21.711  1.00 0.00 ? 51 ILE B C      1  
ATOM 1722   O O      . ILE B 1 51 ? -15.243 27.241  22.485  1.00 0.00 ? 51 ILE B O      1  
ATOM 1723   C CB     . ILE B 1 51 ? -12.104 27.020  20.853  1.00 0.00 ? 51 ILE B CB     1  
ATOM 1724   C CG1    . ILE B 1 51 ? -10.739 27.397  21.435  1.00 0.00 ? 51 ILE B CG1    1  
ATOM 1725   C CG2    . ILE B 1 51 ? -12.733 28.160  20.056  1.00 0.00 ? 51 ILE B CG2    1  
ATOM 1726   C CD1    . ILE B 1 51 ? -9.605  27.147  20.447  1.00 0.00 ? 51 ILE B CD1    1  
ATOM 1727   H H      . ILE B 1 51 ? -11.845 24.796  21.779  1.00 0.00 ? 51 ILE B H      1  
ATOM 1728   H HA     . ILE B 1 51 ? -12.802 27.205  22.860  1.00 0.00 ? 51 ILE B HA     1  
ATOM 1729   H HB     . ILE B 1 51 ? -11.981 26.179  20.172  1.00 0.00 ? 51 ILE B HB     1  
ATOM 1730   H HG12   . ILE B 1 51 ? -10.719 28.439  21.755  1.00 0.00 ? 51 ILE B HG12   1  
ATOM 1731   H HG13   . ILE B 1 51 ? -10.543 26.767  22.302  1.00 0.00 ? 51 ILE B HG13   1  
ATOM 1732   H HG21   . ILE B 1 51 ? -13.582 27.763  19.498  1.00 0.00 ? 51 ILE B HG21   1  
ATOM 1733   H HG22   . ILE B 1 51 ? -13.072 28.944  20.734  1.00 0.00 ? 51 ILE B HG22   1  
ATOM 1734   H HG23   . ILE B 1 51 ? -12.007 28.564  19.352  1.00 0.00 ? 51 ILE B HG23   1  
ATOM 1735   H HD11   . ILE B 1 51 ? -9.598  26.092  20.176  1.00 0.00 ? 51 ILE B HD11   1  
ATOM 1736   H HD12   . ILE B 1 51 ? -9.765  27.750  19.555  1.00 0.00 ? 51 ILE B HD12   1  
ATOM 1737   H HD13   . ILE B 1 51 ? -8.653  27.405  20.915  1.00 0.00 ? 51 ILE B HD13   1  
ATOM 1738   N N      . GLN B 1 52 ? -14.955 25.956  20.674  1.00 0.00 ? 52 GLN B N      1  
ATOM 1739   C CA     . GLN B 1 52 ? -16.365 25.885  20.332  1.00 0.00 ? 52 GLN B CA     1  
ATOM 1740   C C      . GLN B 1 52 ? -17.176 25.083  21.350  1.00 0.00 ? 52 GLN B C      1  
ATOM 1741   O O      . GLN B 1 52 ? -18.389 24.951  21.201  1.00 0.00 ? 52 GLN B O      1  
ATOM 1742   C CB     . GLN B 1 52 ? -16.540 25.387  18.890  1.00 0.00 ? 52 GLN B CB     1  
ATOM 1743   C CG     . GLN B 1 52 ? -15.629 24.218  18.502  1.00 0.00 ? 52 GLN B CG     1  
ATOM 1744   C CD     . GLN B 1 52 ? -15.660 23.121  19.554  1.00 0.00 ? 52 GLN B CD     1  
ATOM 1745   O OE1    . GLN B 1 52 ? -16.630 22.385  19.711  1.00 0.00 ? 52 GLN B OE1    1  
ATOM 1746   N NE2    . GLN B 1 52 ? -14.622 23.119  20.383  1.00 0.00 ? 52 GLN B NE2    1  
ATOM 1747   H H      . GLN B 1 52 ? -14.299 25.457  20.090  1.00 0.00 ? 52 GLN B H      1  
ATOM 1748   H HA     . GLN B 1 52 ? -16.745 26.906  20.379  1.00 0.00 ? 52 GLN B HA     1  
ATOM 1749   H HB2    . GLN B 1 52 ? -17.578 25.090  18.738  1.00 0.00 ? 52 GLN B HB2    1  
ATOM 1750   H HB3    . GLN B 1 52 ? -16.331 26.216  18.214  1.00 0.00 ? 52 GLN B HB3    1  
ATOM 1751   H HG2    . GLN B 1 52 ? -15.905 23.796  17.537  1.00 0.00 ? 52 GLN B HG2    1  
ATOM 1752   H HG3    . GLN B 1 52 ? -14.609 24.588  18.403  1.00 0.00 ? 52 GLN B HG3    1  
ATOM 1753   H HE21   . GLN B 1 52 ? -13.783 23.615  20.119  1.00 0.00 ? 52 GLN B HE21   1  
ATOM 1754   H HE22   . GLN B 1 52 ? -14.651 22.651  21.274  1.00 0.00 ? 52 GLN B HE22   1  
ATOM 1755   N N      . ALA B 1 53 ? -16.540 24.600  22.424  1.00 0.00 ? 53 ALA B N      1  
ATOM 1756   C CA     . ALA B 1 53 ? -17.225 23.991  23.549  1.00 0.00 ? 53 ALA B CA     1  
ATOM 1757   C C      . ALA B 1 53 ? -17.925 25.031  24.425  1.00 0.00 ? 53 ALA B C      1  
ATOM 1758   O O      . ALA B 1 53 ? -18.846 24.682  25.161  1.00 0.00 ? 53 ALA B O      1  
ATOM 1759   C CB     . ALA B 1 53 ? -16.250 23.127  24.352  1.00 0.00 ? 53 ALA B CB     1  
ATOM 1760   H H      . ALA B 1 53 ? -15.548 24.762  22.519  1.00 0.00 ? 53 ALA B H      1  
ATOM 1761   H HA     . ALA B 1 53 ? -17.988 23.329  23.144  1.00 0.00 ? 53 ALA B HA     1  
ATOM 1762   H HB1    . ALA B 1 53 ? -15.754 23.727  25.114  1.00 0.00 ? 53 ALA B HB1    1  
ATOM 1763   H HB2    . ALA B 1 53 ? -16.798 22.325  24.847  1.00 0.00 ? 53 ALA B HB2    1  
ATOM 1764   H HB3    . ALA B 1 53 ? -15.496 22.688  23.696  1.00 0.00 ? 53 ALA B HB3    1  
ATOM 1765   N N      . GLY B 1 54 ? -17.527 26.304  24.328  1.00 0.00 ? 54 GLY B N      1  
ATOM 1766   C CA     . GLY B 1 54 ? -18.252 27.414  24.928  1.00 0.00 ? 54 GLY B CA     1  
ATOM 1767   C C      . GLY B 1 54 ? -17.361 28.518  25.487  1.00 0.00 ? 54 GLY B C      1  
ATOM 1768   O O      . GLY B 1 54 ? -17.699 29.102  26.515  1.00 0.00 ? 54 GLY B O      1  
ATOM 1769   H H      . GLY B 1 54 ? -16.744 26.520  23.727  1.00 0.00 ? 54 GLY B H      1  
ATOM 1770   H HA2    . GLY B 1 54 ? -18.886 27.859  24.166  1.00 0.00 ? 54 GLY B HA2    1  
ATOM 1771   H HA3    . GLY B 1 54 ? -18.887 27.047  25.734  1.00 0.00 ? 54 GLY B HA3    1  
ATOM 1772   N N      . LEU B 1 55 ? -16.222 28.794  24.846  1.00 0.00 ? 55 LEU B N      1  
ATOM 1773   C CA     . LEU B 1 55 ? -15.179 29.632  25.417  1.00 0.00 ? 55 LEU B CA     1  
ATOM 1774   C C      . LEU B 1 55 ? -14.142 30.071  24.384  1.00 0.00 ? 55 LEU B C      1  
ATOM 1775   O O      . LEU B 1 55 ? -14.258 29.780  23.196  1.00 0.00 ? 55 LEU B O      1  
ATOM 1776   C CB     . LEU B 1 55 ? -14.536 28.864  26.577  1.00 0.00 ? 55 LEU B CB     1  
ATOM 1777   C CG     . LEU B 1 55 ? -14.107 27.437  26.223  1.00 0.00 ? 55 LEU B CG     1  
ATOM 1778   C CD1    . LEU B 1 55 ? -12.673 27.390  25.705  1.00 0.00 ? 55 LEU B CD1    1  
ATOM 1779   C CD2    . LEU B 1 55 ? -14.238 26.560  27.464  1.00 0.00 ? 55 LEU B CD2    1  
ATOM 1780   H H      . LEU B 1 55 ? -16.015 28.327  23.974  1.00 0.00 ? 55 LEU B H      1  
ATOM 1781   H HA     . LEU B 1 55 ? -15.638 30.535  25.821  1.00 0.00 ? 55 LEU B HA     1  
ATOM 1782   H HB2    . LEU B 1 55 ? -13.679 29.415  26.963  1.00 0.00 ? 55 LEU B HB2    1  
ATOM 1783   H HB3    . LEU B 1 55 ? -15.266 28.816  27.385  1.00 0.00 ? 55 LEU B HB3    1  
ATOM 1784   H HG     . LEU B 1 55 ? -14.756 27.012  25.459  1.00 0.00 ? 55 LEU B HG     1  
ATOM 1785   H HD11   . LEU B 1 55 ? -12.605 27.961  24.780  1.00 0.00 ? 55 LEU B HD11   1  
ATOM 1786   H HD12   . LEU B 1 55 ? -11.991 27.801  26.448  1.00 0.00 ? 55 LEU B HD12   1  
ATOM 1787   H HD13   . LEU B 1 55 ? -12.405 26.355  25.496  1.00 0.00 ? 55 LEU B HD13   1  
ATOM 1788   H HD21   . LEU B 1 55 ? -13.902 25.550  27.231  1.00 0.00 ? 55 LEU B HD21   1  
ATOM 1789   H HD22   . LEU B 1 55 ? -13.638 26.975  28.273  1.00 0.00 ? 55 LEU B HD22   1  
ATOM 1790   H HD23   . LEU B 1 55 ? -15.290 26.527  27.750  1.00 0.00 ? 55 LEU B HD23   1  
ATOM 1791   N N      . THR B 1 56 ? -13.107 30.774  24.853  1.00 0.00 ? 56 THR B N      1  
ATOM 1792   C CA     . THR B 1 56 ? -11.916 31.105  24.084  1.00 0.00 ? 56 THR B CA     1  
ATOM 1793   C C      . THR B 1 56 ? -10.680 30.814  24.927  1.00 0.00 ? 56 THR B C      1  
ATOM 1794   O O      . THR B 1 56 ? -10.800 30.260  26.018  1.00 0.00 ? 56 THR B O      1  
ATOM 1795   C CB     . THR B 1 56 ? -11.975 32.567  23.625  1.00 0.00 ? 56 THR B CB     1  
ATOM 1796   O OG1    . THR B 1 56 ? -13.282 32.920  23.225  1.00 0.00 ? 56 THR B OG1    1  
ATOM 1797   C CG2    . THR B 1 56 ? -11.067 32.859  22.432  1.00 0.00 ? 56 THR B CG2    1  
ATOM 1798   H H      . THR B 1 56 ? -13.075 30.968  25.844  1.00 0.00 ? 56 THR B H      1  
ATOM 1799   H HA     . THR B 1 56 ? -11.844 30.446  23.219  1.00 0.00 ? 56 THR B HA     1  
ATOM 1800   H HB     . THR B 1 56 ? -11.687 33.213  24.455  1.00 0.00 ? 56 THR B HB     1  
ATOM 1801   H HG1    . THR B 1 56 ? -13.858 32.844  23.991  1.00 0.00 ? 56 THR B HG1    1  
ATOM 1802   H HG21   . THR B 1 56 ? -10.042 33.017  22.768  1.00 0.00 ? 56 THR B HG21   1  
ATOM 1803   H HG22   . THR B 1 56 ? -11.102 32.032  21.722  1.00 0.00 ? 56 THR B HG22   1  
ATOM 1804   H HG23   . THR B 1 56 ? -11.402 33.769  21.933  1.00 0.00 ? 56 THR B HG23   1  
ATOM 1805   N N      . ALA B 1 57 ? -9.491  31.122  24.401  1.00 0.00 ? 57 ALA B N      1  
ATOM 1806   C CA     . ALA B 1 57 ? -8.220  30.921  25.076  1.00 0.00 ? 57 ALA B CA     1  
ATOM 1807   C C      . ALA B 1 57 ? -8.326  31.267  26.563  1.00 0.00 ? 57 ALA B C      1  
ATOM 1808   O O      . ALA B 1 57 ? -8.725  32.382  26.898  1.00 0.00 ? 57 ALA B O      1  
ATOM 1809   C CB     . ALA B 1 57 ? -7.159  31.775  24.387  1.00 0.00 ? 57 ALA B CB     1  
ATOM 1810   H H      . ALA B 1 57 ? -9.458  31.518  23.473  1.00 0.00 ? 57 ALA B H      1  
ATOM 1811   H HA     . ALA B 1 57 ? -7.932  29.879  24.936  1.00 0.00 ? 57 ALA B HA     1  
ATOM 1812   H HB1    . ALA B 1 57 ? -7.104  31.502  23.333  1.00 0.00 ? 57 ALA B HB1    1  
ATOM 1813   H HB2    . ALA B 1 57 ? -7.424  32.829  24.479  1.00 0.00 ? 57 ALA B HB2    1  
ATOM 1814   H HB3    . ALA B 1 57 ? -6.189  31.598  24.852  1.00 0.00 ? 57 ALA B HB3    1  
ATOM 1815   N N      . PRO B 1 58 ? -7.985  30.325  27.451  1.00 0.00 ? 58 PRO B N      1  
ATOM 1816   C CA     . PRO B 1 58 ? -8.240  30.366  28.880  1.00 0.00 ? 58 PRO B CA     1  
ATOM 1817   C C      . PRO B 1 58 ? -8.032  31.692  29.603  1.00 0.00 ? 58 PRO B C      1  
ATOM 1818   O O      . PRO B 1 58 ? -8.856  32.046  30.444  1.00 0.00 ? 58 PRO B O      1  
ATOM 1819   C CB     . PRO B 1 58 ? -7.314  29.297  29.453  1.00 0.00 ? 58 PRO B CB     1  
ATOM 1820   C CG     . PRO B 1 58 ? -7.388  28.208  28.386  1.00 0.00 ? 58 PRO B CG     1  
ATOM 1821   C CD     . PRO B 1 58 ? -7.555  28.989  27.084  1.00 0.00 ? 58 PRO B CD     1  
ATOM 1822   H HA     . PRO B 1 58 ? -9.269  30.050  29.053  1.00 0.00 ? 58 PRO B HA     1  
ATOM 1823   H HB2    . PRO B 1 58 ? -6.294  29.678  29.519  1.00 0.00 ? 58 PRO B HB2    1  
ATOM 1824   H HB3    . PRO B 1 58 ? -7.653  28.954  30.429  1.00 0.00 ? 58 PRO B HB3    1  
ATOM 1825   H HG2    . PRO B 1 58 ? -6.476  27.610  28.373  1.00 0.00 ? 58 PRO B HG2    1  
ATOM 1826   H HG3    . PRO B 1 58 ? -8.262  27.580  28.558  1.00 0.00 ? 58 PRO B HG3    1  
ATOM 1827   H HD2    . PRO B 1 58 ? -6.599  29.038  26.562  1.00 0.00 ? 58 PRO B HD2    1  
ATOM 1828   H HD3    . PRO B 1 58 ? -8.313  28.528  26.448  1.00 0.00 ? 58 PRO B HD3    1  
ATOM 1829   N N      . ASP B 1 59 ? -6.939  32.408  29.326  1.00 0.00 ? 59 ASP B N      1  
ATOM 1830   C CA     . ASP B 1 59 ? -6.554  33.524  30.172  1.00 0.00 ? 59 ASP B CA     1  
ATOM 1831   C C      . ASP B 1 59 ? -5.864  34.673  29.439  1.00 0.00 ? 59 ASP B C      1  
ATOM 1832   O O      . ASP B 1 59 ? -6.068  35.828  29.808  1.00 0.00 ? 59 ASP B O      1  
ATOM 1833   C CB     . ASP B 1 59 ? -5.674  32.946  31.281  1.00 0.00 ? 59 ASP B CB     1  
ATOM 1834   C CG     . ASP B 1 59 ? -5.284  33.996  32.317  1.00 0.00 ? 59 ASP B CG     1  
ATOM 1835   O OD1    . ASP B 1 59 ? -6.185  34.452  33.056  1.00 0.00 ? 59 ASP B OD1    1  
ATOM 1836   O OD2    . ASP B 1 59 ? -4.079  34.321  32.402  1.00 0.00 ? 59 ASP B OD2    1  
ATOM 1837   H H      . ASP B 1 59 ? -6.294  32.074  28.626  1.00 0.00 ? 59 ASP B H      1  
ATOM 1838   H HA     . ASP B 1 59 ? -7.446  33.942  30.639  1.00 0.00 ? 59 ASP B HA     1  
ATOM 1839   H HB2    . ASP B 1 59 ? -6.229  32.146  31.772  1.00 0.00 ? 59 ASP B HB2    1  
ATOM 1840   H HB3    . ASP B 1 59 ? -4.787  32.493  30.836  1.00 0.00 ? 59 ASP B HB3    1  
ATOM 1841   N N      . MET C 1 1  ? -10.363 -8.469  -3.717  1.00 0.00 ? 1  MET C N      1  
ATOM 1842   C CA     . MET C 1 1  ? -9.047  -9.131  -3.637  1.00 0.00 ? 1  MET C CA     1  
ATOM 1843   C C      . MET C 1 1  ? -8.642  -9.432  -2.201  1.00 0.00 ? 1  MET C C      1  
ATOM 1844   O O      . MET C 1 1  ? -8.718  -8.545  -1.356  1.00 0.00 ? 1  MET C O      1  
ATOM 1845   C CB     . MET C 1 1  ? -7.979  -8.224  -4.248  1.00 0.00 ? 1  MET C CB     1  
ATOM 1846   C CG     . MET C 1 1  ? -6.636  -8.921  -4.461  1.00 0.00 ? 1  MET C CG     1  
ATOM 1847   S SD     . MET C 1 1  ? -6.396  -9.534  -6.146  1.00 0.00 ? 1  MET C SD     1  
ATOM 1848   C CE     . MET C 1 1  ? -6.056  -7.944  -6.940  1.00 0.00 ? 1  MET C CE     1  
ATOM 1849   H H1     . MET C 1 1  ? -11.067 -9.031  -3.259  1.00 0.00 ? 1  MET C H1     1  
ATOM 1850   H H2     . MET C 1 1  ? -10.627 -8.336  -4.683  1.00 0.00 ? 1  MET C H2     1  
ATOM 1851   H H3     . MET C 1 1  ? -10.323 -7.568  -3.264  1.00 0.00 ? 1  MET C H3     1  
ATOM 1852   H HA     . MET C 1 1  ? -9.084  -10.065 -4.197  1.00 0.00 ? 1  MET C HA     1  
ATOM 1853   H HB2    . MET C 1 1  ? -8.335  -7.839  -5.204  1.00 0.00 ? 1  MET C HB2    1  
ATOM 1854   H HB3    . MET C 1 1  ? -7.816  -7.380  -3.578  1.00 0.00 ? 1  MET C HB3    1  
ATOM 1855   H HG2    . MET C 1 1  ? -5.842  -8.205  -4.241  1.00 0.00 ? 1  MET C HG2    1  
ATOM 1856   H HG3    . MET C 1 1  ? -6.529  -9.751  -3.764  1.00 0.00 ? 1  MET C HG3    1  
ATOM 1857   H HE1    . MET C 1 1  ? -5.269  -7.428  -6.389  1.00 0.00 ? 1  MET C HE1    1  
ATOM 1858   H HE2    . MET C 1 1  ? -5.738  -8.107  -7.970  1.00 0.00 ? 1  MET C HE2    1  
ATOM 1859   H HE3    . MET C 1 1  ? -6.956  -7.330  -6.928  1.00 0.00 ? 1  MET C HE3    1  
ATOM 1860   N N      . LEU C 1 2  ? -8.104  -10.629 -1.955  1.00 0.00 ? 2  LEU C N      1  
ATOM 1861   C CA     . LEU C 1 2  ? -7.413  -10.996 -0.732  1.00 0.00 ? 2  LEU C CA     1  
ATOM 1862   C C      . LEU C 1 2  ? -5.940  -11.190 -1.085  1.00 0.00 ? 2  LEU C C      1  
ATOM 1863   O O      . LEU C 1 2  ? -5.597  -12.106 -1.829  1.00 0.00 ? 2  LEU C O      1  
ATOM 1864   C CB     . LEU C 1 2  ? -8.033  -12.277 -0.166  1.00 0.00 ? 2  LEU C CB     1  
ATOM 1865   C CG     . LEU C 1 2  ? -7.640  -12.639 1.272   1.00 0.00 ? 2  LEU C CG     1  
ATOM 1866   C CD1    . LEU C 1 2  ? -6.760  -13.881 1.264   1.00 0.00 ? 2  LEU C CD1    1  
ATOM 1867   C CD2    . LEU C 1 2  ? -6.880  -11.571 2.056   1.00 0.00 ? 2  LEU C CD2    1  
ATOM 1868   H H      . LEU C 1 2  ? -8.096  -11.313 -2.698  1.00 0.00 ? 2  LEU C H      1  
ATOM 1869   H HA     . LEU C 1 2  ? -7.523  -10.193 -0.000  1.00 0.00 ? 2  LEU C HA     1  
ATOM 1870   H HB2    . LEU C 1 2  ? -9.117  -12.182 -0.213  1.00 0.00 ? 2  LEU C HB2    1  
ATOM 1871   H HB3    . LEU C 1 2  ? -7.786  -13.113 -0.819  1.00 0.00 ? 2  LEU C HB3    1  
ATOM 1872   H HG     . LEU C 1 2  ? -8.547  -12.883 1.825   1.00 0.00 ? 2  LEU C HG     1  
ATOM 1873   H HD11   . LEU C 1 2  ? -6.455  -14.113 2.284   1.00 0.00 ? 2  LEU C HD11   1  
ATOM 1874   H HD12   . LEU C 1 2  ? -7.334  -14.714 0.858   1.00 0.00 ? 2  LEU C HD12   1  
ATOM 1875   H HD13   . LEU C 1 2  ? -5.881  -13.695 0.648   1.00 0.00 ? 2  LEU C HD13   1  
ATOM 1876   H HD21   . LEU C 1 2  ? -5.902  -11.392 1.610   1.00 0.00 ? 2  LEU C HD21   1  
ATOM 1877   H HD22   . LEU C 1 2  ? -7.455  -10.648 2.082   1.00 0.00 ? 2  LEU C HD22   1  
ATOM 1878   H HD23   . LEU C 1 2  ? -6.733  -11.920 3.077   1.00 0.00 ? 2  LEU C HD23   1  
ATOM 1879   N N      . ILE C 1 3  ? -5.074  -10.283 -0.628  1.00 0.00 ? 3  ILE C N      1  
ATOM 1880   C CA     . ILE C 1 3  ? -3.642  -10.346 -0.865  1.00 0.00 ? 3  ILE C CA     1  
ATOM 1881   C C      . ILE C 1 3  ? -2.978  -11.192 0.212   1.00 0.00 ? 3  ILE C C      1  
ATOM 1882   O O      . ILE C 1 3  ? -3.213  -10.983 1.402   1.00 0.00 ? 3  ILE C O      1  
ATOM 1883   C CB     . ILE C 1 3  ? -3.012  -8.951  -0.896  1.00 0.00 ? 3  ILE C CB     1  
ATOM 1884   C CG1    . ILE C 1 3  ? -3.498  -8.148  -2.102  1.00 0.00 ? 3  ILE C CG1    1  
ATOM 1885   C CG2    . ILE C 1 3  ? -1.493  -9.101  -1.016  1.00 0.00 ? 3  ILE C CG2    1  
ATOM 1886   C CD1    . ILE C 1 3  ? -4.773  -7.358  -1.835  1.00 0.00 ? 3  ILE C CD1    1  
ATOM 1887   H H      . ILE C 1 3  ? -5.402  -9.585  0.023   1.00 0.00 ? 3  ILE C H      1  
ATOM 1888   H HA     . ILE C 1 3  ? -3.466  -10.815 -1.834  1.00 0.00 ? 3  ILE C HA     1  
ATOM 1889   H HB     . ILE C 1 3  ? -3.253  -8.409  0.021   1.00 0.00 ? 3  ILE C HB     1  
ATOM 1890   H HG12   . ILE C 1 3  ? -2.737  -7.425  -2.394  1.00 0.00 ? 3  ILE C HG12   1  
ATOM 1891   H HG13   . ILE C 1 3  ? -3.679  -8.830  -2.931  1.00 0.00 ? 3  ILE C HG13   1  
ATOM 1892   H HG21   . ILE C 1 3  ? -1.250  -9.828  -1.792  1.00 0.00 ? 3  ILE C HG21   1  
ATOM 1893   H HG22   . ILE C 1 3  ? -1.036  -8.150  -1.285  1.00 0.00 ? 3  ILE C HG22   1  
ATOM 1894   H HG23   . ILE C 1 3  ? -1.072  -9.426  -0.065  1.00 0.00 ? 3  ILE C HG23   1  
ATOM 1895   H HD11   . ILE C 1 3  ? -5.610  -8.038  -1.687  1.00 0.00 ? 3  ILE C HD11   1  
ATOM 1896   H HD12   . ILE C 1 3  ? -4.637  -6.705  -0.972  1.00 0.00 ? 3  ILE C HD12   1  
ATOM 1897   H HD13   . ILE C 1 3  ? -4.976  -6.753  -2.714  1.00 0.00 ? 3  ILE C HD13   1  
ATOM 1898   N N      . LEU C 1 4  ? -2.079  -12.078 -0.218  1.00 0.00 ? 4  LEU C N      1  
ATOM 1899   C CA     . LEU C 1 4  ? -1.181  -12.813 0.653   1.00 0.00 ? 4  LEU C CA     1  
ATOM 1900   C C      . LEU C 1 4  ? 0.254   -12.618 0.176   1.00 0.00 ? 4  LEU C C      1  
ATOM 1901   O O      . LEU C 1 4  ? 0.534   -12.725 -1.017  1.00 0.00 ? 4  LEU C O      1  
ATOM 1902   C CB     . LEU C 1 4  ? -1.574  -14.292 0.656   1.00 0.00 ? 4  LEU C CB     1  
ATOM 1903   C CG     . LEU C 1 4  ? -2.989  -14.529 1.190   1.00 0.00 ? 4  LEU C CG     1  
ATOM 1904   C CD1    . LEU C 1 4  ? -3.382  -15.992 1.000   1.00 0.00 ? 4  LEU C CD1    1  
ATOM 1905   C CD2    . LEU C 1 4  ? -3.097  -14.173 2.671   1.00 0.00 ? 4  LEU C CD2    1  
ATOM 1906   H H      . LEU C 1 4  ? -1.948  -12.191 -1.215  1.00 0.00 ? 4  LEU C H      1  
ATOM 1907   H HA     . LEU C 1 4  ? -1.262  -12.423 1.667   1.00 0.00 ? 4  LEU C HA     1  
ATOM 1908   H HB2    . LEU C 1 4  ? -1.515  -14.669 -0.365  1.00 0.00 ? 4  LEU C HB2    1  
ATOM 1909   H HB3    . LEU C 1 4  ? -0.863  -14.846 1.269   1.00 0.00 ? 4  LEU C HB3    1  
ATOM 1910   H HG     . LEU C 1 4  ? -3.694  -13.918 0.628   1.00 0.00 ? 4  LEU C HG     1  
ATOM 1911   H HD11   . LEU C 1 4  ? -3.452  -16.211 -0.065  1.00 0.00 ? 4  LEU C HD11   1  
ATOM 1912   H HD12   . LEU C 1 4  ? -2.635  -16.644 1.451   1.00 0.00 ? 4  LEU C HD12   1  
ATOM 1913   H HD13   . LEU C 1 4  ? -4.354  -16.171 1.460   1.00 0.00 ? 4  LEU C HD13   1  
ATOM 1914   H HD21   . LEU C 1 4  ? -3.103  -13.090 2.791   1.00 0.00 ? 4  LEU C HD21   1  
ATOM 1915   H HD22   . LEU C 1 4  ? -4.026  -14.570 3.079   1.00 0.00 ? 4  LEU C HD22   1  
ATOM 1916   H HD23   . LEU C 1 4  ? -2.250  -14.584 3.217   1.00 0.00 ? 4  LEU C HD23   1  
ATOM 1917   N N      . THR C 1 5  ? 1.175   -12.351 1.105   1.00 0.00 ? 5  THR C N      1  
ATOM 1918   C CA     . THR C 1 5  ? 2.601   -12.373 0.820   1.00 0.00 ? 5  THR C CA     1  
ATOM 1919   C C      . THR C 1 5  ? 3.145   -13.774 1.054   1.00 0.00 ? 5  THR C C      1  
ATOM 1920   O O      . THR C 1 5  ? 2.697   -14.480 1.957   1.00 0.00 ? 5  THR C O      1  
ATOM 1921   C CB     . THR C 1 5  ? 3.391   -11.374 1.664   1.00 0.00 ? 5  THR C CB     1  
ATOM 1922   O OG1    . THR C 1 5  ? 3.083   -11.496 3.032   1.00 0.00 ? 5  THR C OG1    1  
ATOM 1923   C CG2    . THR C 1 5  ? 3.093   -9.943  1.234   1.00 0.00 ? 5  THR C CG2    1  
ATOM 1924   H H      . THR C 1 5  ? 0.891   -12.261 2.070   1.00 0.00 ? 5  THR C H      1  
ATOM 1925   H HA     . THR C 1 5  ? 2.756   -12.118 -0.227  1.00 0.00 ? 5  THR C HA     1  
ATOM 1926   H HB     . THR C 1 5  ? 4.455   -11.560 1.516   1.00 0.00 ? 5  THR C HB     1  
ATOM 1927   H HG1    . THR C 1 5  ? 3.784   -11.071 3.537   1.00 0.00 ? 5  THR C HG1    1  
ATOM 1928   H HG21   . THR C 1 5  ? 3.525   -9.771  0.249   1.00 0.00 ? 5  THR C HG21   1  
ATOM 1929   H HG22   . THR C 1 5  ? 2.014   -9.792  1.201   1.00 0.00 ? 5  THR C HG22   1  
ATOM 1930   H HG23   . THR C 1 5  ? 3.540   -9.249  1.945   1.00 0.00 ? 5  THR C HG23   1  
ATOM 1931   N N      . ARG C 1 6  ? 4.102   -14.186 0.220   1.00 0.00 ? 6  ARG C N      1  
ATOM 1932   C CA     . ARG C 1 6  ? 4.634   -15.535 0.260   1.00 0.00 ? 6  ARG C CA     1  
ATOM 1933   C C      . ARG C 1 6  ? 6.116   -15.518 -0.099  1.00 0.00 ? 6  ARG C C      1  
ATOM 1934   O O      . ARG C 1 6  ? 6.472   -15.032 -1.170  1.00 0.00 ? 6  ARG C O      1  
ATOM 1935   C CB     . ARG C 1 6  ? 3.795   -16.368 -0.712  1.00 0.00 ? 6  ARG C CB     1  
ATOM 1936   C CG     . ARG C 1 6  ? 3.724   -17.854 -0.367  1.00 0.00 ? 6  ARG C CG     1  
ATOM 1937   C CD     . ARG C 1 6  ? 2.860   -18.190 0.849   1.00 0.00 ? 6  ARG C CD     1  
ATOM 1938   N NE     . ARG C 1 6  ? 3.554   -18.028 2.130   1.00 0.00 ? 6  ARG C NE     1  
ATOM 1939   C CZ     . ARG C 1 6  ? 3.038   -18.353 3.319   1.00 0.00 ? 6  ARG C CZ     1  
ATOM 1940   N NH1    . ARG C 1 6  ? 1.940   -19.098 3.422   1.00 0.00 ? 6  ARG C NH1    1  
ATOM 1941   N NH2    . ARG C 1 6  ? 3.638   -17.968 4.444   1.00 0.00 ? 6  ARG C NH2    1  
ATOM 1942   H H      . ARG C 1 6  ? 4.343   -13.603 -0.571  1.00 0.00 ? 6  ARG C H      1  
ATOM 1943   H HA     . ARG C 1 6  ? 4.531   -15.925 1.272   1.00 0.00 ? 6  ARG C HA     1  
ATOM 1944   H HB2    . ARG C 1 6  ? 2.777   -15.980 -0.741  1.00 0.00 ? 6  ARG C HB2    1  
ATOM 1945   H HB3    . ARG C 1 6  ? 4.207   -16.261 -1.715  1.00 0.00 ? 6  ARG C HB3    1  
ATOM 1946   H HG2    . ARG C 1 6  ? 3.286   -18.365 -1.224  1.00 0.00 ? 6  ARG C HG2    1  
ATOM 1947   H HG3    . ARG C 1 6  ? 4.737   -18.226 -0.235  1.00 0.00 ? 6  ARG C HG3    1  
ATOM 1948   H HD2    . ARG C 1 6  ? 1.969   -17.560 0.842   1.00 0.00 ? 6  ARG C HD2    1  
ATOM 1949   H HD3    . ARG C 1 6  ? 2.547   -19.230 0.758   1.00 0.00 ? 6  ARG C HD3    1  
ATOM 1950   H HE     . ARG C 1 6  ? 4.503   -17.680 2.126   1.00 0.00 ? 6  ARG C HE     1  
ATOM 1951   H HH11   . ARG C 1 6  ? 1.583   -19.573 2.606   1.00 0.00 ? 6  ARG C HH11   1  
ATOM 1952   H HH12   . ARG C 1 6  ? 1.692   -19.453 4.338   1.00 0.00 ? 6  ARG C HH12   1  
ATOM 1953   H HH21   . ARG C 1 6  ? 4.542   -17.520 4.399   1.00 0.00 ? 6  ARG C HH21   1  
ATOM 1954   H HH22   . ARG C 1 6  ? 3.169   -18.113 5.328   1.00 0.00 ? 6  ARG C HH22   1  
ATOM 1955   N N      . LYS C 1 7  ? 6.980   -16.045 0.771   1.00 0.00 ? 7  LYS C N      1  
ATOM 1956   C CA     . LYS C 1 7  ? 8.382   -16.281 0.455   1.00 0.00 ? 7  LYS C CA     1  
ATOM 1957   C C      . LYS C 1 7  ? 8.466   -17.482 -0.482  1.00 0.00 ? 7  LYS C C      1  
ATOM 1958   O O      . LYS C 1 7  ? 7.619   -18.371 -0.404  1.00 0.00 ? 7  LYS C O      1  
ATOM 1959   C CB     . LYS C 1 7  ? 9.165   -16.540 1.745   1.00 0.00 ? 7  LYS C CB     1  
ATOM 1960   C CG     . LYS C 1 7  ? 10.560  -15.916 1.791   1.00 0.00 ? 7  LYS C CG     1  
ATOM 1961   C CD     . LYS C 1 7  ? 10.515  -14.399 1.994   1.00 0.00 ? 7  LYS C CD     1  
ATOM 1962   C CE     . LYS C 1 7  ? 11.878  -13.805 2.351   1.00 0.00 ? 7  LYS C CE     1  
ATOM 1963   N NZ     . LYS C 1 7  ? 12.385  -14.307 3.640   1.00 0.00 ? 7  LYS C NZ     1  
ATOM 1964   H H      . LYS C 1 7  ? 6.617   -16.484 1.609   1.00 0.00 ? 7  LYS C H      1  
ATOM 1965   H HA     . LYS C 1 7  ? 8.791   -15.407 -0.053  1.00 0.00 ? 7  LYS C HA     1  
ATOM 1966   H HB2    . LYS C 1 7  ? 8.595   -16.186 2.604   1.00 0.00 ? 7  LYS C HB2    1  
ATOM 1967   H HB3    . LYS C 1 7  ? 9.300   -17.615 1.845   1.00 0.00 ? 7  LYS C HB3    1  
ATOM 1968   H HG2    . LYS C 1 7  ? 11.100  -16.369 2.621   1.00 0.00 ? 7  LYS C HG2    1  
ATOM 1969   H HG3    . LYS C 1 7  ? 11.088  -16.157 0.869   1.00 0.00 ? 7  LYS C HG3    1  
ATOM 1970   H HD2    . LYS C 1 7  ? 10.163  -13.936 1.073   1.00 0.00 ? 7  LYS C HD2    1  
ATOM 1971   H HD3    . LYS C 1 7  ? 9.813   -14.154 2.791   1.00 0.00 ? 7  LYS C HD3    1  
ATOM 1972   H HE2    . LYS C 1 7  ? 12.596  -14.044 1.567   1.00 0.00 ? 7  LYS C HE2    1  
ATOM 1973   H HE3    . LYS C 1 7  ? 11.778  -12.720 2.411   1.00 0.00 ? 7  LYS C HE3    1  
ATOM 1974   H HZ1    . LYS C 1 7  ? 13.298  -13.918 3.825   1.00 0.00 ? 7  LYS C HZ1    1  
ATOM 1975   H HZ2    . LYS C 1 7  ? 11.756  -14.025 4.380   1.00 0.00 ? 7  LYS C HZ2    1  
ATOM 1976   H HZ3    . LYS C 1 7  ? 12.455  -15.314 3.628   1.00 0.00 ? 7  LYS C HZ3    1  
ATOM 1977   N N      . VAL C 1 8  ? 9.466   -17.541 -1.366  1.00 0.00 ? 8  VAL C N      1  
ATOM 1978   C CA     . VAL C 1 8  ? 9.576   -18.641 -2.315  1.00 0.00 ? 8  VAL C CA     1  
ATOM 1979   C C      . VAL C 1 8  ? 9.617   -19.992 -1.602  1.00 0.00 ? 8  VAL C C      1  
ATOM 1980   O O      . VAL C 1 8  ? 10.288  -20.147 -0.583  1.00 0.00 ? 8  VAL C O      1  
ATOM 1981   C CB     . VAL C 1 8  ? 10.769  -18.486 -3.261  1.00 0.00 ? 8  VAL C CB     1  
ATOM 1982   C CG1    . VAL C 1 8  ? 10.654  -17.206 -4.086  1.00 0.00 ? 8  VAL C CG1    1  
ATOM 1983   C CG2    . VAL C 1 8  ? 12.122  -18.484 -2.553  1.00 0.00 ? 8  VAL C CG2    1  
ATOM 1984   H H      . VAL C 1 8  ? 10.094  -16.755 -1.455  1.00 0.00 ? 8  VAL C H      1  
ATOM 1985   H HA     . VAL C 1 8  ? 8.683   -18.619 -2.940  1.00 0.00 ? 8  VAL C HA     1  
ATOM 1986   H HB     . VAL C 1 8  ? 10.757  -19.330 -3.952  1.00 0.00 ? 8  VAL C HB     1  
ATOM 1987   H HG11   . VAL C 1 8  ? 11.404  -17.213 -4.878  1.00 0.00 ? 8  VAL C HG11   1  
ATOM 1988   H HG12   . VAL C 1 8  ? 9.662   -17.134 -4.529  1.00 0.00 ? 8  VAL C HG12   1  
ATOM 1989   H HG13   . VAL C 1 8  ? 10.833  -16.338 -3.454  1.00 0.00 ? 8  VAL C HG13   1  
ATOM 1990   H HG21   . VAL C 1 8  ? 12.310  -19.463 -2.112  1.00 0.00 ? 8  VAL C HG21   1  
ATOM 1991   H HG22   . VAL C 1 8  ? 12.906  -18.276 -3.283  1.00 0.00 ? 8  VAL C HG22   1  
ATOM 1992   H HG23   . VAL C 1 8  ? 12.137  -17.723 -1.773  1.00 0.00 ? 8  VAL C HG23   1  
ATOM 1993   N N      . GLY C 1 9  ? 8.879   -20.971 -2.130  1.00 0.00 ? 9  GLY C N      1  
ATOM 1994   C CA     . GLY C 1 9  ? 8.797   -22.320 -1.596  1.00 0.00 ? 9  GLY C CA     1  
ATOM 1995   C C      . GLY C 1 9  ? 7.687   -22.525 -0.565  1.00 0.00 ? 9  GLY C C      1  
ATOM 1996   O O      . GLY C 1 9  ? 7.458   -23.661 -0.155  1.00 0.00 ? 9  GLY C O      1  
ATOM 1997   H H      . GLY C 1 9  ? 8.329   -20.781 -2.957  1.00 0.00 ? 9  GLY C H      1  
ATOM 1998   H HA2    . GLY C 1 9  ? 8.623   -23.010 -2.423  1.00 0.00 ? 9  GLY C HA2    1  
ATOM 1999   H HA3    . GLY C 1 9  ? 9.749   -22.581 -1.133  1.00 0.00 ? 9  GLY C HA3    1  
ATOM 2000   N N      . GLU C 1 10 ? 6.990   -21.468 -0.138  1.00 0.00 ? 10 GLU C N      1  
ATOM 2001   C CA     . GLU C 1 10 ? 5.863   -21.575 0.781   1.00 0.00 ? 10 GLU C CA     1  
ATOM 2002   C C      . GLU C 1 10 ? 4.545   -21.820 0.042   1.00 0.00 ? 10 GLU C C      1  
ATOM 2003   O O      . GLU C 1 10 ? 4.483   -21.743 -1.186  1.00 0.00 ? 10 GLU C O      1  
ATOM 2004   C CB     . GLU C 1 10 ? 5.777   -20.326 1.659   1.00 0.00 ? 10 GLU C CB     1  
ATOM 2005   C CG     . GLU C 1 10 ? 7.015   -20.064 2.516   1.00 0.00 ? 10 GLU C CG     1  
ATOM 2006   C CD     . GLU C 1 10 ? 6.830   -18.820 3.382   1.00 0.00 ? 10 GLU C CD     1  
ATOM 2007   O OE1    . GLU C 1 10 ? 6.232   -17.833 2.896   1.00 0.00 ? 10 GLU C OE1    1  
ATOM 2008   O OE2    . GLU C 1 10 ? 7.280   -18.853 4.549   1.00 0.00 ? 10 GLU C OE2    1  
ATOM 2009   H H      . GLU C 1 10 ? 7.225   -20.549 -0.487  1.00 0.00 ? 10 GLU C H      1  
ATOM 2010   H HA     . GLU C 1 10 ? 6.030   -22.427 1.440   1.00 0.00 ? 10 GLU C HA     1  
ATOM 2011   H HB2    . GLU C 1 10 ? 5.630   -19.466 1.012   1.00 0.00 ? 10 GLU C HB2    1  
ATOM 2012   H HB3    . GLU C 1 10 ? 4.916   -20.421 2.321   1.00 0.00 ? 10 GLU C HB3    1  
ATOM 2013   H HG2    . GLU C 1 10 ? 7.191   -20.933 3.151   1.00 0.00 ? 10 GLU C HG2    1  
ATOM 2014   H HG3    . GLU C 1 10 ? 7.883   -19.924 1.871   1.00 0.00 ? 10 GLU C HG3    1  
ATOM 2015   N N      . SER C 1 11 ? 3.467   -22.090 0.787   1.00 0.00 ? 11 SER C N      1  
ATOM 2016   C CA     . SER C 1 11 ? 2.210   -22.581 0.236   1.00 0.00 ? 11 SER C CA     1  
ATOM 2017   C C      . SER C 1 11 ? 0.981   -21.788 0.681   1.00 0.00 ? 11 SER C C      1  
ATOM 2018   O O      . SER C 1 11 ? 0.992   -21.103 1.703   1.00 0.00 ? 11 SER C O      1  
ATOM 2019   C CB     . SER C 1 11 ? 2.033   -24.052 0.610   1.00 0.00 ? 11 SER C CB     1  
ATOM 2020   O OG     . SER C 1 11 ? 3.109   -24.823 0.119   1.00 0.00 ? 11 SER C OG     1  
ATOM 2021   H H      . SER C 1 11 ? 3.560   -22.093 1.792   1.00 0.00 ? 11 SER C H      1  
ATOM 2022   H HA     . SER C 1 11 ? 2.254   -22.524 -0.851  1.00 0.00 ? 11 SER C HA     1  
ATOM 2023   H HB2    . SER C 1 11 ? 1.993   -24.145 1.696   1.00 0.00 ? 11 SER C HB2    1  
ATOM 2024   H HB3    . SER C 1 11 ? 1.101   -24.425 0.185   1.00 0.00 ? 11 SER C HB3    1  
ATOM 2025   H HG     . SER C 1 11 ? 2.969   -25.742 0.372   1.00 0.00 ? 11 SER C HG     1  
ATOM 2026   N N      . ILE C 1 12 ? -0.100  -21.912 -0.095  1.00 0.00 ? 12 ILE C N      1  
ATOM 2027   C CA     . ILE C 1 12 ? -1.398  -21.276 0.085   1.00 0.00 ? 12 ILE C CA     1  
ATOM 2028   C C      . ILE C 1 12 ? -2.483  -22.294 -0.268  1.00 0.00 ? 12 ILE C C      1  
ATOM 2029   O O      . ILE C 1 12 ? -2.213  -23.271 -0.963  1.00 0.00 ? 12 ILE C O      1  
ATOM 2030   C CB     . ILE C 1 12 ? -1.463  -20.015 -0.788  1.00 0.00 ? 12 ILE C CB     1  
ATOM 2031   C CG1    . ILE C 1 12 ? -0.470  -18.966 -0.276  1.00 0.00 ? 12 ILE C CG1    1  
ATOM 2032   C CG2    . ILE C 1 12 ? -2.866  -19.409 -0.870  1.00 0.00 ? 12 ILE C CG2    1  
ATOM 2033   C CD1    . ILE C 1 12 ? -0.458  -17.684 -1.107  1.00 0.00 ? 12 ILE C CD1    1  
ATOM 2034   H H      . ILE C 1 12 ? -0.016  -22.503 -0.911  1.00 0.00 ? 12 ILE C H      1  
ATOM 2035   H HA     . ILE C 1 12 ? -1.523  -20.993 1.130   1.00 0.00 ? 12 ILE C HA     1  
ATOM 2036   H HB     . ILE C 1 12 ? -1.158  -20.288 -1.797  1.00 0.00 ? 12 ILE C HB     1  
ATOM 2037   H HG12   . ILE C 1 12 ? -0.703  -18.716 0.759   1.00 0.00 ? 12 ILE C HG12   1  
ATOM 2038   H HG13   . ILE C 1 12 ? 0.534   -19.386 -0.316  1.00 0.00 ? 12 ILE C HG13   1  
ATOM 2039   H HG21   . ILE C 1 12 ? -2.864  -18.529 -1.512  1.00 0.00 ? 12 ILE C HG21   1  
ATOM 2040   H HG22   . ILE C 1 12 ? -3.563  -20.117 -1.317  1.00 0.00 ? 12 ILE C HG22   1  
ATOM 2041   H HG23   . ILE C 1 12 ? -3.211  -19.125 0.124   1.00 0.00 ? 12 ILE C HG23   1  
ATOM 2042   H HD11   . ILE C 1 12 ? -0.417  -17.933 -2.168  1.00 0.00 ? 12 ILE C HD11   1  
ATOM 2043   H HD12   . ILE C 1 12 ? -1.355  -17.101 -0.901  1.00 0.00 ? 12 ILE C HD12   1  
ATOM 2044   H HD13   . ILE C 1 12 ? 0.416   -17.089 -0.843  1.00 0.00 ? 12 ILE C HD13   1  
ATOM 2045   N N      . ASN C 1 13 ? -3.718  -22.095 0.201   1.00 0.00 ? 13 ASN C N      1  
ATOM 2046   C CA     . ASN C 1 13 ? -4.845  -22.974 -0.073  1.00 0.00 ? 13 ASN C CA     1  
ATOM 2047   C C      . ASN C 1 13 ? -6.088  -22.200 -0.501  1.00 0.00 ? 13 ASN C C      1  
ATOM 2048   O O      . ASN C 1 13 ? -6.324  -21.080 -0.049  1.00 0.00 ? 13 ASN C O      1  
ATOM 2049   C CB     . ASN C 1 13 ? -5.137  -23.828 1.162   1.00 0.00 ? 13 ASN C CB     1  
ATOM 2050   C CG     . ASN C 1 13 ? -4.263  -25.073 1.186   1.00 0.00 ? 13 ASN C CG     1  
ATOM 2051   O OD1    . ASN C 1 13 ? -3.309  -25.165 1.952   1.00 0.00 ? 13 ASN C OD1    1  
ATOM 2052   N ND2    . ASN C 1 13 ? -4.562  -26.035 0.317   1.00 0.00 ? 13 ASN C ND2    1  
ATOM 2053   H H      . ASN C 1 13 ? -3.903  -21.257 0.734   1.00 0.00 ? 13 ASN C H      1  
ATOM 2054   H HA     . ASN C 1 13 ? -4.585  -23.638 -0.897  1.00 0.00 ? 13 ASN C HA     1  
ATOM 2055   H HB2    . ASN C 1 13 ? -4.962  -23.243 2.064   1.00 0.00 ? 13 ASN C HB2    1  
ATOM 2056   H HB3    . ASN C 1 13 ? -6.182  -24.141 1.152   1.00 0.00 ? 13 ASN C HB3    1  
ATOM 2057   H HD21   . ASN C 1 13 ? -5.303  -25.900 -0.356  1.00 0.00 ? 13 ASN C HD21   1  
ATOM 2058   H HD22   . ASN C 1 13 ? -3.937  -26.821 0.210   1.00 0.00 ? 13 ASN C HD22   1  
ATOM 2059   N N      . ILE C 1 14 ? -6.910  -22.830 -1.346  1.00 0.00 ? 14 ILE C N      1  
ATOM 2060   C CA     . ILE C 1 14 ? -8.190  -22.309 -1.799  1.00 0.00 ? 14 ILE C CA     1  
ATOM 2061   C C      . ILE C 1 14 ? -9.240  -23.413 -1.695  1.00 0.00 ? 14 ILE C C      1  
ATOM 2062   O O      . ILE C 1 14 ? -8.982  -24.566 -2.037  1.00 0.00 ? 14 ILE C O      1  
ATOM 2063   C CB     . ILE C 1 14 ? -8.071  -21.748 -3.222  1.00 0.00 ? 14 ILE C CB     1  
ATOM 2064   C CG1    . ILE C 1 14 ? -7.025  -20.630 -3.279  1.00 0.00 ? 14 ILE C CG1    1  
ATOM 2065   C CG2    . ILE C 1 14 ? -9.426  -21.232 -3.711  1.00 0.00 ? 14 ILE C CG2    1  
ATOM 2066   C CD1    . ILE C 1 14 ? -6.848  -20.032 -4.675  1.00 0.00 ? 14 ILE C CD1    1  
ATOM 2067   H H      . ILE C 1 14 ? -6.673  -23.768 -1.639  1.00 0.00 ? 14 ILE C H      1  
ATOM 2068   H HA     . ILE C 1 14 ? -8.491  -21.496 -1.138  1.00 0.00 ? 14 ILE C HA     1  
ATOM 2069   H HB     . ILE C 1 14 ? -7.747  -22.547 -3.887  1.00 0.00 ? 14 ILE C HB     1  
ATOM 2070   H HG12   . ILE C 1 14 ? -7.305  -19.834 -2.588  1.00 0.00 ? 14 ILE C HG12   1  
ATOM 2071   H HG13   . ILE C 1 14 ? -6.058  -21.027 -2.970  1.00 0.00 ? 14 ILE C HG13   1  
ATOM 2072   H HG21   . ILE C 1 14 ? -10.172 -22.026 -3.671  1.00 0.00 ? 14 ILE C HG21   1  
ATOM 2073   H HG22   . ILE C 1 14 ? -9.752  -20.396 -3.093  1.00 0.00 ? 14 ILE C HG22   1  
ATOM 2074   H HG23   . ILE C 1 14 ? -9.351  -20.906 -4.748  1.00 0.00 ? 14 ILE C HG23   1  
ATOM 2075   H HD11   . ILE C 1 14 ? -7.716  -19.429 -4.939  1.00 0.00 ? 14 ILE C HD11   1  
ATOM 2076   H HD12   . ILE C 1 14 ? -5.965  -19.393 -4.683  1.00 0.00 ? 14 ILE C HD12   1  
ATOM 2077   H HD13   . ILE C 1 14 ? -6.717  -20.831 -5.405  1.00 0.00 ? 14 ILE C HD13   1  
ATOM 2078   N N      . GLY C 1 15 ? -10.431 -23.071 -1.197  1.00 0.00 ? 15 GLY C N      1  
ATOM 2079   C CA     . GLY C 1 15 ? -11.493 -24.024 -0.923  1.00 0.00 ? 15 GLY C CA     1  
ATOM 2080   C C      . GLY C 1 15 ? -11.030 -25.122 0.029   1.00 0.00 ? 15 GLY C C      1  
ATOM 2081   O O      . GLY C 1 15 ? -10.286 -24.864 0.973   1.00 0.00 ? 15 GLY C O      1  
ATOM 2082   H H      . GLY C 1 15 ? -10.592 -22.104 -0.952  1.00 0.00 ? 15 GLY C H      1  
ATOM 2083   H HA2    . GLY C 1 15 ? -12.341 -23.507 -0.475  1.00 0.00 ? 15 GLY C HA2    1  
ATOM 2084   H HA3    . GLY C 1 15 ? -11.817 -24.475 -1.861  1.00 0.00 ? 15 GLY C HA3    1  
ATOM 2085   N N      . ASP C 1 16 ? -11.454 -26.357 -0.247  1.00 0.00 ? 16 ASP C N      1  
ATOM 2086   C CA     . ASP C 1 16 ? -10.956 -27.555 0.409   1.00 0.00 ? 16 ASP C CA     1  
ATOM 2087   C C      . ASP C 1 16 ? -10.358 -28.550 -0.587  1.00 0.00 ? 16 ASP C C      1  
ATOM 2088   O O      . ASP C 1 16 ? -10.037 -29.678 -0.219  1.00 0.00 ? 16 ASP C O      1  
ATOM 2089   C CB     . ASP C 1 16 ? -12.058 -28.175 1.270   1.00 0.00 ? 16 ASP C CB     1  
ATOM 2090   C CG     . ASP C 1 16 ? -13.190 -28.787 0.449   1.00 0.00 ? 16 ASP C CG     1  
ATOM 2091   O OD1    . ASP C 1 16 ? -13.941 -28.013 -0.186  1.00 0.00 ? 16 ASP C OD1    1  
ATOM 2092   O OD2    . ASP C 1 16 ? -13.353 -30.025 0.506   1.00 0.00 ? 16 ASP C OD2    1  
ATOM 2093   H H      . ASP C 1 16 ? -12.165 -26.480 -0.955  1.00 0.00 ? 16 ASP C H      1  
ATOM 2094   H HA     . ASP C 1 16 ? -10.147 -27.265 1.080   1.00 0.00 ? 16 ASP C HA     1  
ATOM 2095   H HB2    . ASP C 1 16 ? -11.615 -28.944 1.903   1.00 0.00 ? 16 ASP C HB2    1  
ATOM 2096   H HB3    . ASP C 1 16 ? -12.469 -27.405 1.924   1.00 0.00 ? 16 ASP C HB3    1  
ATOM 2097   N N      . ASP C 1 17 ? -10.179 -28.131 -1.845  1.00 0.00 ? 17 ASP C N      1  
ATOM 2098   C CA     . ASP C 1 17 ? -9.710  -28.979 -2.930  1.00 0.00 ? 17 ASP C CA     1  
ATOM 2099   C C      . ASP C 1 17 ? -8.440  -28.457 -3.602  1.00 0.00 ? 17 ASP C C      1  
ATOM 2100   O O      . ASP C 1 17 ? -7.810  -29.204 -4.350  1.00 0.00 ? 17 ASP C O      1  
ATOM 2101   C CB     . ASP C 1 17 ? -10.822 -29.134 -3.967  1.00 0.00 ? 17 ASP C CB     1  
ATOM 2102   C CG     . ASP C 1 17 ? -11.893 -30.125 -3.524  1.00 0.00 ? 17 ASP C CG     1  
ATOM 2103   O OD1    . ASP C 1 17 ? -11.553 -31.318 -3.355  1.00 0.00 ? 17 ASP C OD1    1  
ATOM 2104   O OD2    . ASP C 1 17 ? -13.069 -29.712 -3.422  1.00 0.00 ? 17 ASP C OD2    1  
ATOM 2105   H H      . ASP C 1 17 ? -10.444 -27.183 -2.073  1.00 0.00 ? 17 ASP C H      1  
ATOM 2106   H HA     . ASP C 1 17 ? -9.476  -29.970 -2.541  1.00 0.00 ? 17 ASP C HA     1  
ATOM 2107   H HB2    . ASP C 1 17 ? -11.274 -28.160 -4.160  1.00 0.00 ? 17 ASP C HB2    1  
ATOM 2108   H HB3    . ASP C 1 17 ? -10.390 -29.492 -4.902  1.00 0.00 ? 17 ASP C HB3    1  
ATOM 2109   N N      . ILE C 1 18 ? -8.055  -27.197 -3.371  1.00 0.00 ? 18 ILE C N      1  
ATOM 2110   C CA     . ILE C 1 18 ? -6.997  -26.542 -4.124  1.00 0.00 ? 18 ILE C CA     1  
ATOM 2111   C C      . ILE C 1 18 ? -5.852  -26.105 -3.214  1.00 0.00 ? 18 ILE C C      1  
ATOM 2112   O O      . ILE C 1 18 ? -6.068  -25.524 -2.152  1.00 0.00 ? 18 ILE C O      1  
ATOM 2113   C CB     . ILE C 1 18 ? -7.559  -25.373 -4.941  1.00 0.00 ? 18 ILE C CB     1  
ATOM 2114   C CG1    . ILE C 1 18 ? -8.649  -25.831 -5.915  1.00 0.00 ? 18 ILE C CG1    1  
ATOM 2115   C CG2    . ILE C 1 18 ? -6.448  -24.672 -5.724  1.00 0.00 ? 18 ILE C CG2    1  
ATOM 2116   C CD1    . ILE C 1 18 ? -10.050 -25.549 -5.373  1.00 0.00 ? 18 ILE C CD1    1  
ATOM 2117   H H      . ILE C 1 18 ? -8.563  -26.637 -2.701  1.00 0.00 ? 18 ILE C H      1  
ATOM 2118   H HA     . ILE C 1 18 ? -6.590  -27.259 -4.835  1.00 0.00 ? 18 ILE C HA     1  
ATOM 2119   H HB     . ILE C 1 18 ? -7.989  -24.643 -4.256  1.00 0.00 ? 18 ILE C HB     1  
ATOM 2120   H HG12   . ILE C 1 18 ? -8.545  -25.302 -6.862  1.00 0.00 ? 18 ILE C HG12   1  
ATOM 2121   H HG13   . ILE C 1 18 ? -8.546  -26.898 -6.111  1.00 0.00 ? 18 ILE C HG13   1  
ATOM 2122   H HG21   . ILE C 1 18 ? -5.750  -24.192 -5.037  1.00 0.00 ? 18 ILE C HG21   1  
ATOM 2123   H HG22   . ILE C 1 18 ? -5.910  -25.395 -6.338  1.00 0.00 ? 18 ILE C HG22   1  
ATOM 2124   H HG23   . ILE C 1 18 ? -6.876  -23.902 -6.365  1.00 0.00 ? 18 ILE C HG23   1  
ATOM 2125   H HD11   . ILE C 1 18 ? -10.792 -25.931 -6.076  1.00 0.00 ? 18 ILE C HD11   1  
ATOM 2126   H HD12   . ILE C 1 18 ? -10.188 -26.036 -4.408  1.00 0.00 ? 18 ILE C HD12   1  
ATOM 2127   H HD13   . ILE C 1 18 ? -10.188 -24.475 -5.257  1.00 0.00 ? 18 ILE C HD13   1  
ATOM 2128   N N      . THR C 1 19 ? -4.621  -26.325 -3.682  1.00 0.00 ? 19 THR C N      1  
ATOM 2129   C CA     . THR C 1 19 ? -3.400  -25.811 -3.079  1.00 0.00 ? 19 THR C CA     1  
ATOM 2130   C C      . THR C 1 19 ? -2.634  -24.990 -4.111  1.00 0.00 ? 19 THR C C      1  
ATOM 2131   O O      . THR C 1 19 ? -2.549  -25.378 -5.275  1.00 0.00 ? 19 THR C O      1  
ATOM 2132   C CB     . THR C 1 19 ? -2.538  -26.961 -2.553  1.00 0.00 ? 19 THR C CB     1  
ATOM 2133   O OG1    . THR C 1 19 ? -3.298  -27.796 -1.707  1.00 0.00 ? 19 THR C OG1    1  
ATOM 2134   C CG2    . THR C 1 19 ? -1.344  -26.459 -1.745  1.00 0.00 ? 19 THR C CG2    1  
ATOM 2135   H H      . THR C 1 19 ? -4.527  -26.821 -4.558  1.00 0.00 ? 19 THR C H      1  
ATOM 2136   H HA     . THR C 1 19 ? -3.653  -25.164 -2.241  1.00 0.00 ? 19 THR C HA     1  
ATOM 2137   H HB     . THR C 1 19 ? -2.175  -27.550 -3.395  1.00 0.00 ? 19 THR C HB     1  
ATOM 2138   H HG1    . THR C 1 19 ? -2.799  -28.606 -1.557  1.00 0.00 ? 19 THR C HG1    1  
ATOM 2139   H HG21   . THR C 1 19 ? -0.686  -25.866 -2.380  1.00 0.00 ? 19 THR C HG21   1  
ATOM 2140   H HG22   . THR C 1 19 ? -1.692  -25.852 -0.911  1.00 0.00 ? 19 THR C HG22   1  
ATOM 2141   H HG23   . THR C 1 19 ? -0.783  -27.310 -1.359  1.00 0.00 ? 19 THR C HG23   1  
ATOM 2142   N N      . ILE C 1 20 ? -2.071  -23.856 -3.691  1.00 0.00 ? 20 ILE C N      1  
ATOM 2143   C CA     . ILE C 1 20 ? -1.244  -22.985 -4.513  1.00 0.00 ? 20 ILE C CA     1  
ATOM 2144   C C      . ILE C 1 20 ? 0.149   -22.924 -3.897  1.00 0.00 ? 20 ILE C C      1  
ATOM 2145   O O      . ILE C 1 20 ? 0.278   -22.839 -2.677  1.00 0.00 ? 20 ILE C O      1  
ATOM 2146   C CB     . ILE C 1 20 ? -1.866  -21.587 -4.593  1.00 0.00 ? 20 ILE C CB     1  
ATOM 2147   C CG1    . ILE C 1 20 ? -3.343  -21.583 -4.997  1.00 0.00 ? 20 ILE C CG1    1  
ATOM 2148   C CG2    . ILE C 1 20 ? -1.057  -20.692 -5.532  1.00 0.00 ? 20 ILE C CG2    1  
ATOM 2149   C CD1    . ILE C 1 20 ? -3.606  -22.118 -6.403  1.00 0.00 ? 20 ILE C CD1    1  
ATOM 2150   H H      . ILE C 1 20 ? -2.128  -23.630 -2.707  1.00 0.00 ? 20 ILE C H      1  
ATOM 2151   H HA     . ILE C 1 20 ? -1.164  -23.396 -5.519  1.00 0.00 ? 20 ILE C HA     1  
ATOM 2152   H HB     . ILE C 1 20 ? -1.817  -21.147 -3.597  1.00 0.00 ? 20 ILE C HB     1  
ATOM 2153   H HG12   . ILE C 1 20 ? -3.918  -22.174 -4.283  1.00 0.00 ? 20 ILE C HG12   1  
ATOM 2154   H HG13   . ILE C 1 20 ? -3.714  -20.559 -4.946  1.00 0.00 ? 20 ILE C HG13   1  
ATOM 2155   H HG21   . ILE C 1 20 ? -0.922  -21.182 -6.497  1.00 0.00 ? 20 ILE C HG21   1  
ATOM 2156   H HG22   . ILE C 1 20 ? -1.577  -19.745 -5.679  1.00 0.00 ? 20 ILE C HG22   1  
ATOM 2157   H HG23   . ILE C 1 20 ? -0.078  -20.485 -5.098  1.00 0.00 ? 20 ILE C HG23   1  
ATOM 2158   H HD11   . ILE C 1 20 ? -3.139  -21.470 -7.143  1.00 0.00 ? 20 ILE C HD11   1  
ATOM 2159   H HD12   . ILE C 1 20 ? -3.210  -23.129 -6.498  1.00 0.00 ? 20 ILE C HD12   1  
ATOM 2160   H HD13   . ILE C 1 20 ? -4.680  -22.140 -6.584  1.00 0.00 ? 20 ILE C HD13   1  
ATOM 2161   N N      . THR C 1 21 ? 1.201   -22.946 -4.718  1.00 0.00 ? 21 THR C N      1  
ATOM 2162   C CA     . THR C 1 21 ? 2.572   -22.936 -4.233  1.00 0.00 ? 21 THR C CA     1  
ATOM 2163   C C      . THR C 1 21 ? 3.404   -21.931 -5.016  1.00 0.00 ? 21 THR C C      1  
ATOM 2164   O O      . THR C 1 21 ? 3.418   -21.971 -6.245  1.00 0.00 ? 21 THR C O      1  
ATOM 2165   C CB     . THR C 1 21 ? 3.194   -24.330 -4.330  1.00 0.00 ? 21 THR C CB     1  
ATOM 2166   O OG1    . THR C 1 21 ? 2.297   -25.324 -3.885  1.00 0.00 ? 21 THR C OG1    1  
ATOM 2167   C CG2    . THR C 1 21 ? 4.445   -24.421 -3.461  1.00 0.00 ? 21 THR C CG2    1  
ATOM 2168   H H      . THR C 1 21 ? 1.048   -23.001 -5.717  1.00 0.00 ? 21 THR C H      1  
ATOM 2169   H HA     . THR C 1 21 ? 2.582   -22.636 -3.184  1.00 0.00 ? 21 THR C HA     1  
ATOM 2170   H HB     . THR C 1 21 ? 3.458   -24.536 -5.367  1.00 0.00 ? 21 THR C HB     1  
ATOM 2171   H HG1    . THR C 1 21 ? 1.586   -25.394 -4.531  1.00 0.00 ? 21 THR C HG1    1  
ATOM 2172   H HG21   . THR C 1 21 ? 4.175   -24.299 -2.412  1.00 0.00 ? 21 THR C HG21   1  
ATOM 2173   H HG22   . THR C 1 21 ? 4.910   -25.395 -3.603  1.00 0.00 ? 21 THR C HG22   1  
ATOM 2174   H HG23   . THR C 1 21 ? 5.158   -23.644 -3.738  1.00 0.00 ? 21 THR C HG23   1  
ATOM 2175   N N      . ILE C 1 22 ? 4.122   -21.043 -4.324  1.00 0.00 ? 22 ILE C N      1  
ATOM 2176   C CA     . ILE C 1 22 ? 5.120   -20.217 -4.984  1.00 0.00 ? 22 ILE C CA     1  
ATOM 2177   C C      . ILE C 1 22 ? 6.407   -21.027 -5.092  1.00 0.00 ? 22 ILE C C      1  
ATOM 2178   O O      . ILE C 1 22 ? 6.932   -21.505 -4.090  1.00 0.00 ? 22 ILE C O      1  
ATOM 2179   C CB     . ILE C 1 22 ? 5.311   -18.871 -4.278  1.00 0.00 ? 22 ILE C CB     1  
ATOM 2180   C CG1    . ILE C 1 22 ? 6.435   -18.036 -4.892  1.00 0.00 ? 22 ILE C CG1    1  
ATOM 2181   C CG2    . ILE C 1 22 ? 5.646   -19.026 -2.797  1.00 0.00 ? 22 ILE C CG2    1  
ATOM 2182   C CD1    . ILE C 1 22 ? 6.183   -17.679 -6.354  1.00 0.00 ? 22 ILE C CD1    1  
ATOM 2183   H H      . ILE C 1 22 ? 4.137   -21.092 -3.315  1.00 0.00 ? 22 ILE C H      1  
ATOM 2184   H HA     . ILE C 1 22 ? 4.770   -20.006 -5.995  1.00 0.00 ? 22 ILE C HA     1  
ATOM 2185   H HB     . ILE C 1 22 ? 4.380   -18.309 -4.358  1.00 0.00 ? 22 ILE C HB     1  
ATOM 2186   H HG12   . ILE C 1 22 ? 6.530   -17.109 -4.325  1.00 0.00 ? 22 ILE C HG12   1  
ATOM 2187   H HG13   . ILE C 1 22 ? 7.378   -18.578 -4.821  1.00 0.00 ? 22 ILE C HG13   1  
ATOM 2188   H HG21   . ILE C 1 22 ? 4.849   -19.568 -2.291  1.00 0.00 ? 22 ILE C HG21   1  
ATOM 2189   H HG22   . ILE C 1 22 ? 6.585   -19.565 -2.678  1.00 0.00 ? 22 ILE C HG22   1  
ATOM 2190   H HG23   . ILE C 1 22 ? 5.752   -18.040 -2.346  1.00 0.00 ? 22 ILE C HG23   1  
ATOM 2191   H HD11   . ILE C 1 22 ? 5.299   -17.047 -6.431  1.00 0.00 ? 22 ILE C HD11   1  
ATOM 2192   H HD12   . ILE C 1 22 ? 7.053   -17.145 -6.736  1.00 0.00 ? 22 ILE C HD12   1  
ATOM 2193   H HD13   . ILE C 1 22 ? 6.041   -18.580 -6.950  1.00 0.00 ? 22 ILE C HD13   1  
ATOM 2194   N N      . LEU C 1 23 ? 6.892   -21.239 -6.316  1.00 0.00 ? 23 LEU C N      1  
ATOM 2195   C CA     . LEU C 1 23 ? 8.023   -22.119 -6.553  1.00 0.00 ? 23 LEU C CA     1  
ATOM 2196   C C      . LEU C 1 23 ? 9.308   -21.302 -6.605  1.00 0.00 ? 23 LEU C C      1  
ATOM 2197   O O      . LEU C 1 23 ? 10.319  -21.707 -6.034  1.00 0.00 ? 23 LEU C O      1  
ATOM 2198   C CB     . LEU C 1 23 ? 7.808   -22.939 -7.825  1.00 0.00 ? 23 LEU C CB     1  
ATOM 2199   C CG     . LEU C 1 23 ? 6.375   -23.447 -8.001  1.00 0.00 ? 23 LEU C CG     1  
ATOM 2200   C CD1    . LEU C 1 23 ? 6.322   -24.333 -9.239  1.00 0.00 ? 23 LEU C CD1    1  
ATOM 2201   C CD2    . LEU C 1 23 ? 5.881   -24.279 -6.820  1.00 0.00 ? 23 LEU C CD2    1  
ATOM 2202   H H      . LEU C 1 23 ? 6.435   -20.825 -7.117  1.00 0.00 ? 23 LEU C H      1  
ATOM 2203   H HA     . LEU C 1 23 ? 8.108   -22.820 -5.721  1.00 0.00 ? 23 LEU C HA     1  
ATOM 2204   H HB2    . LEU C 1 23 ? 8.062   -22.324 -8.686  1.00 0.00 ? 23 LEU C HB2    1  
ATOM 2205   H HB3    . LEU C 1 23 ? 8.488   -23.792 -7.806  1.00 0.00 ? 23 LEU C HB3    1  
ATOM 2206   H HG     . LEU C 1 23 ? 5.703   -22.604 -8.153  1.00 0.00 ? 23 LEU C HG     1  
ATOM 2207   H HD11   . LEU C 1 23 ? 5.288   -24.426 -9.567  1.00 0.00 ? 23 LEU C HD11   1  
ATOM 2208   H HD12   . LEU C 1 23 ? 6.928   -23.890 -10.031 1.00 0.00 ? 23 LEU C HD12   1  
ATOM 2209   H HD13   . LEU C 1 23 ? 6.707   -25.322 -8.992  1.00 0.00 ? 23 LEU C HD13   1  
ATOM 2210   H HD21   . LEU C 1 23 ? 4.925   -24.735 -7.076  1.00 0.00 ? 23 LEU C HD21   1  
ATOM 2211   H HD22   . LEU C 1 23 ? 6.606   -25.061 -6.595  1.00 0.00 ? 23 LEU C HD22   1  
ATOM 2212   H HD23   . LEU C 1 23 ? 5.754   -23.642 -5.948  1.00 0.00 ? 23 LEU C HD23   1  
ATOM 2213   N N      . GLY C 1 24 ? 9.253   -20.118 -7.222  1.00 0.00 ? 24 GLY C N      1  
ATOM 2214   C CA     . GLY C 1 24 ? 10.340  -19.158 -7.116  1.00 0.00 ? 24 GLY C CA     1  
ATOM 2215   C C      . GLY C 1 24 ? 10.181  -17.948 -8.028  1.00 0.00 ? 24 GLY C C      1  
ATOM 2216   O O      . GLY C 1 24 ? 9.211   -17.854 -8.778  1.00 0.00 ? 24 GLY C O      1  
ATOM 2217   H H      . GLY C 1 24 ? 8.424   -19.863 -7.742  1.00 0.00 ? 24 GLY C H      1  
ATOM 2218   H HA2    . GLY C 1 24 ? 10.380  -18.803 -6.088  1.00 0.00 ? 24 GLY C HA2    1  
ATOM 2219   H HA3    . GLY C 1 24 ? 11.291  -19.647 -7.333  1.00 0.00 ? 24 GLY C HA3    1  
ATOM 2220   N N      . VAL C 1 25 ? 11.147  -17.027 -7.970  1.00 0.00 ? 25 VAL C N      1  
ATOM 2221   C CA     . VAL C 1 25 ? 11.251  -15.918 -8.907  1.00 0.00 ? 25 VAL C CA     1  
ATOM 2222   C C      . VAL C 1 25 ? 12.489  -16.082 -9.782  1.00 0.00 ? 25 VAL C C      1  
ATOM 2223   O O      . VAL C 1 25 ? 13.481  -16.683 -9.374  1.00 0.00 ? 25 VAL C O      1  
ATOM 2224   C CB     . VAL C 1 25 ? 11.218  -14.551 -8.212  1.00 0.00 ? 25 VAL C CB     1  
ATOM 2225   C CG1    . VAL C 1 25 ? 10.188  -14.521 -7.081  1.00 0.00 ? 25 VAL C CG1    1  
ATOM 2226   C CG2    . VAL C 1 25 ? 12.581  -14.134 -7.658  1.00 0.00 ? 25 VAL C CG2    1  
ATOM 2227   H H      . VAL C 1 25 ? 11.923  -17.174 -7.340  1.00 0.00 ? 25 VAL C H      1  
ATOM 2228   H HA     . VAL C 1 25 ? 10.386  -15.951 -9.568  1.00 0.00 ? 25 VAL C HA     1  
ATOM 2229   H HB     . VAL C 1 25 ? 10.930  -13.799 -8.947  1.00 0.00 ? 25 VAL C HB     1  
ATOM 2230   H HG11   . VAL C 1 25 ? 10.510  -15.158 -6.257  1.00 0.00 ? 25 VAL C HG11   1  
ATOM 2231   H HG12   . VAL C 1 25 ? 10.079  -13.500 -6.715  1.00 0.00 ? 25 VAL C HG12   1  
ATOM 2232   H HG13   . VAL C 1 25 ? 9.225   -14.871 -7.453  1.00 0.00 ? 25 VAL C HG13   1  
ATOM 2233   H HG21   . VAL C 1 25 ? 12.987  -14.923 -7.026  1.00 0.00 ? 25 VAL C HG21   1  
ATOM 2234   H HG22   . VAL C 1 25 ? 13.263  -13.930 -8.485  1.00 0.00 ? 25 VAL C HG22   1  
ATOM 2235   H HG23   . VAL C 1 25 ? 12.471  -13.220 -7.074  1.00 0.00 ? 25 VAL C HG23   1  
ATOM 2236   N N      . SER C 1 26 ? 12.423  -15.536 -10.997 1.00 0.00 ? 26 SER C N      1  
ATOM 2237   C CA     . SER C 1 26 ? 13.520  -15.502 -11.949 1.00 0.00 ? 26 SER C CA     1  
ATOM 2238   C C      . SER C 1 26 ? 13.365  -14.242 -12.791 1.00 0.00 ? 26 SER C C      1  
ATOM 2239   O O      . SER C 1 26 ? 12.561  -14.214 -13.719 1.00 0.00 ? 26 SER C O      1  
ATOM 2240   C CB     . SER C 1 26 ? 13.471  -16.758 -12.819 1.00 0.00 ? 26 SER C CB     1  
ATOM 2241   O OG     . SER C 1 26 ? 14.458  -16.697 -13.825 1.00 0.00 ? 26 SER C OG     1  
ATOM 2242   H H      . SER C 1 26 ? 11.564  -15.074 -11.267 1.00 0.00 ? 26 SER C H      1  
ATOM 2243   H HA     . SER C 1 26 ? 14.474  -15.469 -11.421 1.00 0.00 ? 26 SER C HA     1  
ATOM 2244   H HB2    . SER C 1 26 ? 13.646  -17.635 -12.196 1.00 0.00 ? 26 SER C HB2    1  
ATOM 2245   H HB3    . SER C 1 26 ? 12.487  -16.845 -13.281 1.00 0.00 ? 26 SER C HB3    1  
ATOM 2246   H HG     . SER C 1 26 ? 14.143  -16.110 -14.521 1.00 0.00 ? 26 SER C HG     1  
ATOM 2247   N N      . GLY C 1 27 ? 14.073  -13.168 -12.434 1.00 0.00 ? 27 GLY C N      1  
ATOM 2248   C CA     . GLY C 1 27 ? 13.802  -11.870 -13.027 1.00 0.00 ? 27 GLY C CA     1  
ATOM 2249   C C      . GLY C 1 27 ? 12.549  -11.256 -12.416 1.00 0.00 ? 27 GLY C C      1  
ATOM 2250   O O      . GLY C 1 27 ? 12.278  -11.419 -11.227 1.00 0.00 ? 27 GLY C O      1  
ATOM 2251   H H      . GLY C 1 27 ? 14.696  -13.215 -11.640 1.00 0.00 ? 27 GLY C H      1  
ATOM 2252   H HA2    . GLY C 1 27 ? 14.653  -11.203 -12.897 1.00 0.00 ? 27 GLY C HA2    1  
ATOM 2253   H HA3    . GLY C 1 27 ? 13.605  -12.016 -14.089 1.00 0.00 ? 27 GLY C HA3    1  
ATOM 2254   N N      . GLN C 1 28 ? 11.741  -10.625 -13.268 1.00 0.00 ? 28 GLN C N      1  
ATOM 2255   C CA     . GLN C 1 28 ? 10.392  -10.210 -12.918 1.00 0.00 ? 28 GLN C CA     1  
ATOM 2256   C C      . GLN C 1 28 ? 9.398   -11.355 -13.087 1.00 0.00 ? 28 GLN C C      1  
ATOM 2257   O O      . GLN C 1 28 ? 8.201   -11.168 -12.881 1.00 0.00 ? 28 GLN C O      1  
ATOM 2258   C CB     . GLN C 1 28 ? 10.007  -8.996  -13.767 1.00 0.00 ? 28 GLN C CB     1  
ATOM 2259   C CG     . GLN C 1 28 ? 10.408  -7.642  -13.176 1.00 0.00 ? 28 GLN C CG     1  
ATOM 2260   C CD     . GLN C 1 28 ? 10.760  -7.675  -11.692 1.00 0.00 ? 28 GLN C CD     1  
ATOM 2261   O OE1    . GLN C 1 28 ? 9.889   -7.553  -10.834 1.00 0.00 ? 28 GLN C OE1    1  
ATOM 2262   N NE2    . GLN C 1 28 ? 12.020  -7.934  -11.344 1.00 0.00 ? 28 GLN C NE2    1  
ATOM 2263   H H      . GLN C 1 28 ? 12.035  -10.511 -14.230 1.00 0.00 ? 28 GLN C H      1  
ATOM 2264   H HA     . GLN C 1 28 ? 10.360  -9.959  -11.860 1.00 0.00 ? 28 GLN C HA     1  
ATOM 2265   H HB2    . GLN C 1 28 ? 10.470  -9.091  -14.750 1.00 0.00 ? 28 GLN C HB2    1  
ATOM 2266   H HB3    . GLN C 1 28 ? 8.930   -9.002  -13.938 1.00 0.00 ? 28 GLN C HB3    1  
ATOM 2267   H HG2    . GLN C 1 28 ? 11.263  -7.253  -13.730 1.00 0.00 ? 28 GLN C HG2    1  
ATOM 2268   H HG3    . GLN C 1 28 ? 9.567   -6.962  -13.315 1.00 0.00 ? 28 GLN C HG3    1  
ATOM 2269   H HE21   . GLN C 1 28 ? 12.755  -7.949  -12.039 1.00 0.00 ? 28 GLN C HE21   1  
ATOM 2270   H HE22   . GLN C 1 28 ? 12.214  -8.211  -10.393 1.00 0.00 ? 28 GLN C HE22   1  
ATOM 2271   N N      . GLN C 1 29 ? 9.882   -12.538 -13.472 1.00 0.00 ? 29 GLN C N      1  
ATOM 2272   C CA     . GLN C 1 29 ? 9.072   -13.727 -13.667 1.00 0.00 ? 29 GLN C CA     1  
ATOM 2273   C C      . GLN C 1 29 ? 8.932   -14.502 -12.363 1.00 0.00 ? 29 GLN C C      1  
ATOM 2274   O O      . GLN C 1 29 ? 9.841   -14.518 -11.535 1.00 0.00 ? 29 GLN C O      1  
ATOM 2275   C CB     . GLN C 1 29 ? 9.723   -14.585 -14.749 1.00 0.00 ? 29 GLN C CB     1  
ATOM 2276   C CG     . GLN C 1 29 ? 8.832   -14.753 -15.974 1.00 0.00 ? 29 GLN C CG     1  
ATOM 2277   C CD     . GLN C 1 29 ? 9.271   -15.905 -16.869 1.00 0.00 ? 29 GLN C CD     1  
ATOM 2278   O OE1    . GLN C 1 29 ? 8.455   -16.500 -17.565 1.00 0.00 ? 29 GLN C OE1    1  
ATOM 2279   N NE2    . GLN C 1 29 ? 10.561  -16.230 -16.903 1.00 0.00 ? 29 GLN C NE2    1  
ATOM 2280   H H      . GLN C 1 29 ? 10.880  -12.639 -13.595 1.00 0.00 ? 29 GLN C H      1  
ATOM 2281   H HA     . GLN C 1 29 ? 8.077   -13.428 -13.996 1.00 0.00 ? 29 GLN C HA     1  
ATOM 2282   H HB2    . GLN C 1 29 ? 10.619  -14.074 -15.101 1.00 0.00 ? 29 GLN C HB2    1  
ATOM 2283   H HB3    . GLN C 1 29 ? 9.986   -15.562 -14.341 1.00 0.00 ? 29 GLN C HB3    1  
ATOM 2284   H HG2    . GLN C 1 29 ? 7.798   -14.912 -15.666 1.00 0.00 ? 29 GLN C HG2    1  
ATOM 2285   H HG3    . GLN C 1 29 ? 8.912   -13.832 -16.547 1.00 0.00 ? 29 GLN C HG3    1  
ATOM 2286   H HE21   . GLN C 1 29 ? 11.244  -15.709 -16.373 1.00 0.00 ? 29 GLN C HE21   1  
ATOM 2287   H HE22   . GLN C 1 29 ? 10.838  -17.031 -17.451 1.00 0.00 ? 29 GLN C HE22   1  
ATOM 2288   N N      . VAL C 1 30 ? 7.792   -15.176 -12.200 1.00 0.00 ? 30 VAL C N      1  
ATOM 2289   C CA     . VAL C 1 30 ? 7.413   -15.852 -10.974 1.00 0.00 ? 30 VAL C CA     1  
ATOM 2290   C C      . VAL C 1 30 ? 6.841   -17.215 -11.342 1.00 0.00 ? 30 VAL C C      1  
ATOM 2291   O O      . VAL C 1 30 ? 5.806   -17.280 -12.004 1.00 0.00 ? 30 VAL C O      1  
ATOM 2292   C CB     . VAL C 1 30 ? 6.380   -14.992 -10.238 1.00 0.00 ? 30 VAL C CB     1  
ATOM 2293   C CG1    . VAL C 1 30 ? 5.994   -15.626 -8.907  1.00 0.00 ? 30 VAL C CG1    1  
ATOM 2294   C CG2    . VAL C 1 30 ? 6.923   -13.594 -9.942  1.00 0.00 ? 30 VAL C CG2    1  
ATOM 2295   H H      . VAL C 1 30 ? 7.053   -15.040 -12.877 1.00 0.00 ? 30 VAL C H      1  
ATOM 2296   H HA     . VAL C 1 30 ? 8.283   -15.989 -10.333 1.00 0.00 ? 30 VAL C HA     1  
ATOM 2297   H HB     . VAL C 1 30 ? 5.483   -14.897 -10.851 1.00 0.00 ? 30 VAL C HB     1  
ATOM 2298   H HG11   . VAL C 1 30 ? 5.690   -16.661 -9.062  1.00 0.00 ? 30 VAL C HG11   1  
ATOM 2299   H HG12   . VAL C 1 30 ? 6.849   -15.591 -8.233  1.00 0.00 ? 30 VAL C HG12   1  
ATOM 2300   H HG13   . VAL C 1 30 ? 5.165   -15.066 -8.472  1.00 0.00 ? 30 VAL C HG13   1  
ATOM 2301   H HG21   . VAL C 1 30 ? 7.016   -13.026 -10.868 1.00 0.00 ? 30 VAL C HG21   1  
ATOM 2302   H HG22   . VAL C 1 30 ? 6.239   -13.065 -9.279  1.00 0.00 ? 30 VAL C HG22   1  
ATOM 2303   H HG23   . VAL C 1 30 ? 7.900   -13.668 -9.461  1.00 0.00 ? 30 VAL C HG23   1  
ATOM 2304   N N      . ARG C 1 31 ? 7.518   -18.301 -10.958 1.00 0.00 ? 31 ARG C N      1  
ATOM 2305   C CA     . ARG C 1 31 ? 7.016   -19.651 -11.165 1.00 0.00 ? 31 ARG C CA     1  
ATOM 2306   C C      . ARG C 1 31 ? 6.042   -20.008 -10.052 1.00 0.00 ? 31 ARG C C      1  
ATOM 2307   O O      . ARG C 1 31 ? 6.445   -20.145 -8.897  1.00 0.00 ? 31 ARG C O      1  
ATOM 2308   C CB     . ARG C 1 31 ? 8.160   -20.665 -11.256 1.00 0.00 ? 31 ARG C CB     1  
ATOM 2309   C CG     . ARG C 1 31 ? 7.658   -21.928 -11.955 1.00 0.00 ? 31 ARG C CG     1  
ATOM 2310   C CD     . ARG C 1 31 ? 8.702   -23.041 -12.072 1.00 0.00 ? 31 ARG C CD     1  
ATOM 2311   N NE     . ARG C 1 31 ? 9.777   -22.703 -13.009 1.00 0.00 ? 31 ARG C NE     1  
ATOM 2312   C CZ     . ARG C 1 31 ? 10.436  -23.590 -13.763 1.00 0.00 ? 31 ARG C CZ     1  
ATOM 2313   N NH1    . ARG C 1 31 ? 10.316  -24.904 -13.572 1.00 0.00 ? 31 ARG C NH1    1  
ATOM 2314   N NH2    . ARG C 1 31 ? 11.252  -23.163 -14.726 1.00 0.00 ? 31 ARG C NH2    1  
ATOM 2315   H H      . ARG C 1 31 ? 8.329   -18.184 -10.367 1.00 0.00 ? 31 ARG C H      1  
ATOM 2316   H HA     . ARG C 1 31 ? 6.471   -19.672 -12.109 1.00 0.00 ? 31 ARG C HA     1  
ATOM 2317   H HB2    . ARG C 1 31 ? 8.980   -20.258 -11.842 1.00 0.00 ? 31 ARG C HB2    1  
ATOM 2318   H HB3    . ARG C 1 31 ? 8.534   -20.904 -10.261 1.00 0.00 ? 31 ARG C HB3    1  
ATOM 2319   H HG2    . ARG C 1 31 ? 6.796   -22.305 -11.408 1.00 0.00 ? 31 ARG C HG2    1  
ATOM 2320   H HG3    . ARG C 1 31 ? 7.323   -21.652 -12.953 1.00 0.00 ? 31 ARG C HG3    1  
ATOM 2321   H HD2    . ARG C 1 31 ? 9.120   -23.263 -11.090 1.00 0.00 ? 31 ARG C HD2    1  
ATOM 2322   H HD3    . ARG C 1 31 ? 8.202   -23.940 -12.431 1.00 0.00 ? 31 ARG C HD3    1  
ATOM 2323   H HE     . ARG C 1 31 ? 9.957   -21.724 -13.174 1.00 0.00 ? 31 ARG C HE     1  
ATOM 2324   H HH11   . ARG C 1 31 ? 9.848   -25.255 -12.750 1.00 0.00 ? 31 ARG C HH11   1  
ATOM 2325   H HH12   . ARG C 1 31 ? 10.857  -25.548 -14.131 1.00 0.00 ? 31 ARG C HH12   1  
ATOM 2326   H HH21   . ARG C 1 31 ? 11.472  -22.182 -14.806 1.00 0.00 ? 31 ARG C HH21   1  
ATOM 2327   H HH22   . ARG C 1 31 ? 11.628  -23.823 -15.392 1.00 0.00 ? 31 ARG C HH22   1  
ATOM 2328   N N      . ILE C 1 32 ? 4.768   -20.161 -10.418 1.00 0.00 ? 32 ILE C N      1  
ATOM 2329   C CA     . ILE C 1 32 ? 3.679   -20.516 -9.522  1.00 0.00 ? 32 ILE C CA     1  
ATOM 2330   C C      . ILE C 1 32 ? 3.135   -21.891 -9.897  1.00 0.00 ? 32 ILE C C      1  
ATOM 2331   O O      . ILE C 1 32 ? 2.939   -22.184 -11.076 1.00 0.00 ? 32 ILE C O      1  
ATOM 2332   C CB     . ILE C 1 32 ? 2.563   -19.464 -9.564  1.00 0.00 ? 32 ILE C CB     1  
ATOM 2333   C CG1    . ILE C 1 32 ? 3.107   -18.042 -9.750  1.00 0.00 ? 32 ILE C CG1    1  
ATOM 2334   C CG2    . ILE C 1 32 ? 1.741   -19.574 -8.278  1.00 0.00 ? 32 ILE C CG2    1  
ATOM 2335   C CD1    . ILE C 1 32 ? 2.034   -16.957 -9.660  1.00 0.00 ? 32 ILE C CD1    1  
ATOM 2336   H H      . ILE C 1 32 ? 4.527   -19.974 -11.382 1.00 0.00 ? 32 ILE C H      1  
ATOM 2337   H HA     . ILE C 1 32 ? 4.065   -20.564 -8.503  1.00 0.00 ? 32 ILE C HA     1  
ATOM 2338   H HB     . ILE C 1 32 ? 1.910   -19.684 -10.408 1.00 0.00 ? 32 ILE C HB     1  
ATOM 2339   H HG12   . ILE C 1 32 ? 3.875   -17.842 -9.003  1.00 0.00 ? 32 ILE C HG12   1  
ATOM 2340   H HG13   . ILE C 1 32 ? 3.560   -17.967 -10.738 1.00 0.00 ? 32 ILE C HG13   1  
ATOM 2341   H HG21   . ILE C 1 32 ? 1.417   -20.603 -8.125  1.00 0.00 ? 32 ILE C HG21   1  
ATOM 2342   H HG22   . ILE C 1 32 ? 2.341   -19.256 -7.424  1.00 0.00 ? 32 ILE C HG22   1  
ATOM 2343   H HG23   . ILE C 1 32 ? 0.852   -18.948 -8.347  1.00 0.00 ? 32 ILE C HG23   1  
ATOM 2344   H HD11   . ILE C 1 32 ? 1.192   -17.216 -10.302 1.00 0.00 ? 32 ILE C HD11   1  
ATOM 2345   H HD12   . ILE C 1 32 ? 1.693   -16.850 -8.630  1.00 0.00 ? 32 ILE C HD12   1  
ATOM 2346   H HD13   . ILE C 1 32 ? 2.455   -16.008 -9.990  1.00 0.00 ? 32 ILE C HD13   1  
ATOM 2347   N N      . GLY C 1 33 ? 2.879   -22.734 -8.895  1.00 0.00 ? 33 GLY C N      1  
ATOM 2348   C CA     . GLY C 1 33 ? 2.232   -24.025 -9.055  1.00 0.00 ? 33 GLY C CA     1  
ATOM 2349   C C      . GLY C 1 33 ? 0.801   -24.002 -8.536  1.00 0.00 ? 33 GLY C C      1  
ATOM 2350   O O      . GLY C 1 33 ? 0.527   -23.429 -7.481  1.00 0.00 ? 33 GLY C O      1  
ATOM 2351   H H      . GLY C 1 33 ? 3.059   -22.425 -7.948  1.00 0.00 ? 33 GLY C H      1  
ATOM 2352   H HA2    . GLY C 1 33 ? 2.223   -24.308 -10.108 1.00 0.00 ? 33 GLY C HA2    1  
ATOM 2353   H HA3    . GLY C 1 33 ? 2.789   -24.778 -8.499  1.00 0.00 ? 33 GLY C HA3    1  
ATOM 2354   N N      . ILE C 1 34 ? -0.111  -24.638 -9.275  1.00 0.00 ? 34 ILE C N      1  
ATOM 2355   C CA     . ILE C 1 34 ? -1.531  -24.676 -8.971  1.00 0.00 ? 34 ILE C CA     1  
ATOM 2356   C C      . ILE C 1 34 ? -1.983  -26.130 -8.932  1.00 0.00 ? 34 ILE C C      1  
ATOM 2357   O O      . ILE C 1 34 ? -1.882  -26.842 -9.927  1.00 0.00 ? 34 ILE C O      1  
ATOM 2358   C CB     . ILE C 1 34 ? -2.317  -23.897 -10.030 1.00 0.00 ? 34 ILE C CB     1  
ATOM 2359   C CG1    . ILE C 1 34 ? -1.800  -22.463 -10.180 1.00 0.00 ? 34 ILE C CG1    1  
ATOM 2360   C CG2    . ILE C 1 34 ? -3.802  -23.886 -9.664  1.00 0.00 ? 34 ILE C CG2    1  
ATOM 2361   C CD1    . ILE C 1 34 ? -2.348  -21.797 -11.442 1.00 0.00 ? 34 ILE C CD1    1  
ATOM 2362   H H      . ILE C 1 34 ? 0.175   -25.018 -10.168 1.00 0.00 ? 34 ILE C H      1  
ATOM 2363   H HA     . ILE C 1 34 ? -1.712  -24.235 -7.991  1.00 0.00 ? 34 ILE C HA     1  
ATOM 2364   H HB     . ILE C 1 34 ? -2.201  -24.406 -10.987 1.00 0.00 ? 34 ILE C HB     1  
ATOM 2365   H HG12   . ILE C 1 34 ? -2.072  -21.877 -9.303  1.00 0.00 ? 34 ILE C HG12   1  
ATOM 2366   H HG13   . ILE C 1 34 ? -0.714  -22.469 -10.262 1.00 0.00 ? 34 ILE C HG13   1  
ATOM 2367   H HG21   . ILE C 1 34 ? -3.947  -23.410 -8.695  1.00 0.00 ? 34 ILE C HG21   1  
ATOM 2368   H HG22   . ILE C 1 34 ? -4.369  -23.335 -10.414 1.00 0.00 ? 34 ILE C HG22   1  
ATOM 2369   H HG23   . ILE C 1 34 ? -4.187  -24.905 -9.622  1.00 0.00 ? 34 ILE C HG23   1  
ATOM 2370   H HD11   . ILE C 1 34 ? -3.413  -21.596 -11.330 1.00 0.00 ? 34 ILE C HD11   1  
ATOM 2371   H HD12   . ILE C 1 34 ? -1.826  -20.854 -11.606 1.00 0.00 ? 34 ILE C HD12   1  
ATOM 2372   H HD13   . ILE C 1 34 ? -2.185  -22.451 -12.297 1.00 0.00 ? 34 ILE C HD13   1  
ATOM 2373   N N      . ASN C 1 35 ? -2.480  -26.588 -7.782  1.00 0.00 ? 35 ASN C N      1  
ATOM 2374   C CA     . ASN C 1 35 ? -2.815  -27.984 -7.566  1.00 0.00 ? 35 ASN C CA     1  
ATOM 2375   C C      . ASN C 1 35 ? -4.301  -28.126 -7.254  1.00 0.00 ? 35 ASN C C      1  
ATOM 2376   O O      . ASN C 1 35 ? -4.725  -27.907 -6.121  1.00 0.00 ? 35 ASN C O      1  
ATOM 2377   C CB     . ASN C 1 35 ? -1.920  -28.530 -6.453  1.00 0.00 ? 35 ASN C CB     1  
ATOM 2378   C CG     . ASN C 1 35 ? -1.931  -30.051 -6.407  1.00 0.00 ? 35 ASN C CG     1  
ATOM 2379   O OD1    . ASN C 1 35 ? -1.967  -30.713 -7.441  1.00 0.00 ? 35 ASN C OD1    1  
ATOM 2380   N ND2    . ASN C 1 35 ? -1.834  -30.631 -5.214  1.00 0.00 ? 35 ASN C ND2    1  
ATOM 2381   H H      . ASN C 1 35 ? -2.535  -25.963 -6.989  1.00 0.00 ? 35 ASN C H      1  
ATOM 2382   H HA     . ASN C 1 35 ? -2.611  -28.548 -8.477  1.00 0.00 ? 35 ASN C HA     1  
ATOM 2383   H HB2    . ASN C 1 35 ? -0.894  -28.205 -6.622  1.00 0.00 ? 35 ASN C HB2    1  
ATOM 2384   H HB3    . ASN C 1 35 ? -2.250  -28.123 -5.498  1.00 0.00 ? 35 ASN C HB3    1  
ATOM 2385   H HD21   . ASN C 1 35 ? -1.782  -30.069 -4.377  1.00 0.00 ? 35 ASN C HD21   1  
ATOM 2386   H HD22   . ASN C 1 35 ? -1.795  -31.638 -5.158  1.00 0.00 ? 35 ASN C HD22   1  
ATOM 2387   N N      . ALA C 1 36 ? -5.090  -28.465 -8.276  1.00 0.00 ? 36 ALA C N      1  
ATOM 2388   C CA     . ALA C 1 36 ? -6.539  -28.555 -8.202  1.00 0.00 ? 36 ALA C CA     1  
ATOM 2389   C C      . ALA C 1 36 ? -7.029  -29.785 -8.965  1.00 0.00 ? 36 ALA C C      1  
ATOM 2390   O O      . ALA C 1 36 ? -6.342  -30.239 -9.880  1.00 0.00 ? 36 ALA C O      1  
ATOM 2391   C CB     . ALA C 1 36 ? -7.127  -27.273 -8.793  1.00 0.00 ? 36 ALA C CB     1  
ATOM 2392   H H      . ALA C 1 36 ? -4.668  -28.645 -9.176  1.00 0.00 ? 36 ALA C H      1  
ATOM 2393   H HA     . ALA C 1 36 ? -6.842  -28.639 -7.159  1.00 0.00 ? 36 ALA C HA     1  
ATOM 2394   H HB1    . ALA C 1 36 ? -6.862  -27.194 -9.848  1.00 0.00 ? 36 ALA C HB1    1  
ATOM 2395   H HB2    . ALA C 1 36 ? -8.213  -27.282 -8.700  1.00 0.00 ? 36 ALA C HB2    1  
ATOM 2396   H HB3    . ALA C 1 36 ? -6.732  -26.407 -8.262  1.00 0.00 ? 36 ALA C HB3    1  
ATOM 2397   N N      . PRO C 1 37 ? -8.221  -30.310 -8.656  1.00 0.00 ? 37 PRO C N      1  
ATOM 2398   C CA     . PRO C 1 37 ? -8.846  -31.355 -9.447  1.00 0.00 ? 37 PRO C CA     1  
ATOM 2399   C C      . PRO C 1 37 ? -9.134  -30.872 -10.865 1.00 0.00 ? 37 PRO C C      1  
ATOM 2400   O O      . PRO C 1 37 ? -9.459  -29.705 -11.071 1.00 0.00 ? 37 PRO C O      1  
ATOM 2401   C CB     . PRO C 1 37 ? -10.140 -31.722 -8.719  1.00 0.00 ? 37 PRO C CB     1  
ATOM 2402   C CG     . PRO C 1 37 ? -10.438 -30.528 -7.815  1.00 0.00 ? 37 PRO C CG     1  
ATOM 2403   C CD     . PRO C 1 37 ? -9.070  -29.908 -7.551  1.00 0.00 ? 37 PRO C CD     1  
ATOM 2404   H HA     . PRO C 1 37 ? -8.192  -32.226 -9.487  1.00 0.00 ? 37 PRO C HA     1  
ATOM 2405   H HB2    . PRO C 1 37 ? -10.961 -31.883 -9.419  1.00 0.00 ? 37 PRO C HB2    1  
ATOM 2406   H HB3    . PRO C 1 37 ? -9.979  -32.612 -8.112  1.00 0.00 ? 37 PRO C HB3    1  
ATOM 2407   H HG2    . PRO C 1 37 ? -11.072 -29.811 -8.337  1.00 0.00 ? 37 PRO C HG2    1  
ATOM 2408   H HG3    . PRO C 1 37 ? -10.909 -30.850 -6.886  1.00 0.00 ? 37 PRO C HG3    1  
ATOM 2409   H HD2    . PRO C 1 37 ? -9.160  -28.824 -7.487  1.00 0.00 ? 37 PRO C HD2    1  
ATOM 2410   H HD3    . PRO C 1 37 ? -8.672  -30.313 -6.621  1.00 0.00 ? 37 PRO C HD3    1  
ATOM 2411   N N      . LYS C 1 38 ? -9.135  -31.793 -11.835 1.00 0.00 ? 38 LYS C N      1  
ATOM 2412   C CA     . LYS C 1 38 ? -9.537  -31.513 -13.206 1.00 0.00 ? 38 LYS C CA     1  
ATOM 2413   C C      . LYS C 1 38 ? -11.021 -31.166 -13.325 1.00 0.00 ? 38 LYS C C      1  
ATOM 2414   O O      . LYS C 1 38 ? -11.494 -30.838 -14.411 1.00 0.00 ? 38 LYS C O      1  
ATOM 2415   C CB     . LYS C 1 38 ? -9.163  -32.687 -14.114 1.00 0.00 ? 38 LYS C CB     1  
ATOM 2416   C CG     . LYS C 1 38 ? -7.650  -32.845 -14.283 1.00 0.00 ? 38 LYS C CG     1  
ATOM 2417   C CD     . LYS C 1 38 ? -7.006  -31.769 -15.161 1.00 0.00 ? 38 LYS C CD     1  
ATOM 2418   C CE     . LYS C 1 38 ? -6.836  -32.208 -16.615 1.00 0.00 ? 38 LYS C CE     1  
ATOM 2419   N NZ     . LYS C 1 38 ? -8.110  -32.197 -17.358 1.00 0.00 ? 38 LYS C NZ     1  
ATOM 2420   H H      . LYS C 1 38 ? -8.865  -32.740 -11.605 1.00 0.00 ? 38 LYS C H      1  
ATOM 2421   H HA     . LYS C 1 38 ? -8.994  -30.629 -13.540 1.00 0.00 ? 38 LYS C HA     1  
ATOM 2422   H HB2    . LYS C 1 38 ? -9.567  -33.604 -13.686 1.00 0.00 ? 38 LYS C HB2    1  
ATOM 2423   H HB3    . LYS C 1 38 ? -9.617  -32.545 -15.095 1.00 0.00 ? 38 LYS C HB3    1  
ATOM 2424   H HG2    . LYS C 1 38 ? -7.181  -32.817 -13.300 1.00 0.00 ? 38 LYS C HG2    1  
ATOM 2425   H HG3    . LYS C 1 38 ? -7.445  -33.824 -14.717 1.00 0.00 ? 38 LYS C HG3    1  
ATOM 2426   H HD2    . LYS C 1 38 ? -7.574  -30.840 -15.124 1.00 0.00 ? 38 LYS C HD2    1  
ATOM 2427   H HD3    . LYS C 1 38 ? -6.016  -31.559 -14.760 1.00 0.00 ? 38 LYS C HD3    1  
ATOM 2428   H HE2    . LYS C 1 38 ? -6.133  -31.526 -17.098 1.00 0.00 ? 38 LYS C HE2    1  
ATOM 2429   H HE3    . LYS C 1 38 ? -6.403  -33.208 -16.636 1.00 0.00 ? 38 LYS C HE3    1  
ATOM 2430   H HZ1    . LYS C 1 38 ? -8.532  -31.280 -17.325 1.00 0.00 ? 38 LYS C HZ1    1  
ATOM 2431   H HZ2    . LYS C 1 38 ? -7.949  -32.437 -18.326 1.00 0.00 ? 38 LYS C HZ2    1  
ATOM 2432   H HZ3    . LYS C 1 38 ? -8.756  -32.870 -16.968 1.00 0.00 ? 38 LYS C HZ3    1  
ATOM 2433   N N      . ASP C 1 39 ? -11.744 -31.181 -12.203 1.00 0.00 ? 39 ASP C N      1  
ATOM 2434   C CA     . ASP C 1 39 ? -13.100 -30.668 -12.094 1.00 0.00 ? 39 ASP C CA     1  
ATOM 2435   C C      . ASP C 1 39 ? -13.142 -29.154 -12.297 1.00 0.00 ? 39 ASP C C      1  
ATOM 2436   O O      . ASP C 1 39 ? -14.177 -28.615 -12.686 1.00 0.00 ? 39 ASP C O      1  
ATOM 2437   C CB     . ASP C 1 39 ? -13.630 -31.008 -10.702 1.00 0.00 ? 39 ASP C CB     1  
ATOM 2438   C CG     . ASP C 1 39 ? -15.153 -30.923 -10.641 1.00 0.00 ? 39 ASP C CG     1  
ATOM 2439   O OD1    . ASP C 1 39 ? -15.813 -31.731 -11.332 1.00 0.00 ? 39 ASP C OD1    1  
ATOM 2440   O OD2    . ASP C 1 39 ? -15.664 -30.075 -9.877  1.00 0.00 ? 39 ASP C OD2    1  
ATOM 2441   H H      . ASP C 1 39 ? -11.305 -31.511 -11.357 1.00 0.00 ? 39 ASP C H      1  
ATOM 2442   H HA     . ASP C 1 39 ? -13.725 -31.146 -12.848 1.00 0.00 ? 39 ASP C HA     1  
ATOM 2443   H HB2    . ASP C 1 39 ? -13.313 -32.014 -10.424 1.00 0.00 ? 39 ASP C HB2    1  
ATOM 2444   H HB3    . ASP C 1 39 ? -13.195 -30.317 -9.979  1.00 0.00 ? 39 ASP C HB3    1  
ATOM 2445   N N      . VAL C 1 40 ? -12.013 -28.472 -12.072 1.00 0.00 ? 40 VAL C N      1  
ATOM 2446   C CA     . VAL C 1 40 ? -11.855 -27.047 -12.318 1.00 0.00 ? 40 VAL C CA     1  
ATOM 2447   C C      . VAL C 1 40 ? -10.705 -26.797 -13.288 1.00 0.00 ? 40 VAL C C      1  
ATOM 2448   O O      . VAL C 1 40 ? -9.713  -27.524 -13.296 1.00 0.00 ? 40 VAL C O      1  
ATOM 2449   C CB     . VAL C 1 40 ? -11.667 -26.272 -11.010 1.00 0.00 ? 40 VAL C CB     1  
ATOM 2450   C CG1    . VAL C 1 40 ? -12.750 -26.636 -9.995  1.00 0.00 ? 40 VAL C CG1    1  
ATOM 2451   C CG2    . VAL C 1 40 ? -10.302 -26.499 -10.363 1.00 0.00 ? 40 VAL C CG2    1  
ATOM 2452   H H      . VAL C 1 40 ? -11.194 -28.979 -11.764 1.00 0.00 ? 40 VAL C H      1  
ATOM 2453   H HA     . VAL C 1 40 ? -12.765 -26.673 -12.788 1.00 0.00 ? 40 VAL C HA     1  
ATOM 2454   H HB     . VAL C 1 40 ? -11.752 -25.208 -11.232 1.00 0.00 ? 40 VAL C HB     1  
ATOM 2455   H HG11   . VAL C 1 40 ? -12.625 -27.668 -9.665  1.00 0.00 ? 40 VAL C HG11   1  
ATOM 2456   H HG12   . VAL C 1 40 ? -12.679 -25.975 -9.131  1.00 0.00 ? 40 VAL C HG12   1  
ATOM 2457   H HG13   . VAL C 1 40 ? -13.734 -26.521 -10.451 1.00 0.00 ? 40 VAL C HG13   1  
ATOM 2458   H HG21   . VAL C 1 40 ? -9.508  -26.203 -11.049 1.00 0.00 ? 40 VAL C HG21   1  
ATOM 2459   H HG22   . VAL C 1 40 ? -10.226 -25.895 -9.459  1.00 0.00 ? 40 VAL C HG22   1  
ATOM 2460   H HG23   . VAL C 1 40 ? -10.188 -27.550 -10.100 1.00 0.00 ? 40 VAL C HG23   1  
ATOM 2461   N N      . ALA C 1 41 ? -10.826 -25.746 -14.103 1.00 0.00 ? 41 ALA C N      1  
ATOM 2462   C CA     . ALA C 1 41 ? -9.772  -25.335 -15.012 1.00 0.00 ? 41 ALA C CA     1  
ATOM 2463   C C      . ALA C 1 41 ? -8.781  -24.399 -14.327 1.00 0.00 ? 41 ALA C C      1  
ATOM 2464   O O      . ALA C 1 41 ? -9.127  -23.736 -13.351 1.00 0.00 ? 41 ALA C O      1  
ATOM 2465   C CB     . ALA C 1 41 ? -10.401 -24.685 -16.243 1.00 0.00 ? 41 ALA C CB     1  
ATOM 2466   H H      . ALA C 1 41 ? -11.666 -25.187 -14.070 1.00 0.00 ? 41 ALA C H      1  
ATOM 2467   H HA     . ALA C 1 41 ? -9.232  -26.225 -15.332 1.00 0.00 ? 41 ALA C HA     1  
ATOM 2468   H HB1    . ALA C 1 41 ? -9.619  -24.450 -16.965 1.00 0.00 ? 41 ALA C HB1    1  
ATOM 2469   H HB2    . ALA C 1 41 ? -11.111 -25.374 -16.700 1.00 0.00 ? 41 ALA C HB2    1  
ATOM 2470   H HB3    . ALA C 1 41 ? -10.916 -23.768 -15.957 1.00 0.00 ? 41 ALA C HB3    1  
ATOM 2471   N N      . VAL C 1 42 ? -7.551  -24.318 -14.844 1.00 0.00 ? 42 VAL C N      1  
ATOM 2472   C CA     . VAL C 1 42 ? -6.566  -23.337 -14.413 1.00 0.00 ? 42 VAL C CA     1  
ATOM 2473   C C      . VAL C 1 42 ? -5.833  -22.777 -15.628 1.00 0.00 ? 42 VAL C C      1  
ATOM 2474   O O      . VAL C 1 42 ? -5.413  -23.545 -16.491 1.00 0.00 ? 42 VAL C O      1  
ATOM 2475   C CB     . VAL C 1 42 ? -5.589  -23.926 -13.388 1.00 0.00 ? 42 VAL C CB     1  
ATOM 2476   C CG1    . VAL C 1 42 ? -6.317  -24.580 -12.214 1.00 0.00 ? 42 VAL C CG1    1  
ATOM 2477   C CG2    . VAL C 1 42 ? -4.652  -24.980 -13.977 1.00 0.00 ? 42 VAL C CG2    1  
ATOM 2478   H H      . VAL C 1 42 ? -7.311  -24.913 -15.625 1.00 0.00 ? 42 VAL C H      1  
ATOM 2479   H HA     . VAL C 1 42 ? -7.086  -22.509 -13.932 1.00 0.00 ? 42 VAL C HA     1  
ATOM 2480   H HB     . VAL C 1 42 ? -4.978  -23.114 -12.997 1.00 0.00 ? 42 VAL C HB     1  
ATOM 2481   H HG11   . VAL C 1 42 ? -5.589  -24.952 -11.494 1.00 0.00 ? 42 VAL C HG11   1  
ATOM 2482   H HG12   . VAL C 1 42 ? -6.959  -23.846 -11.727 1.00 0.00 ? 42 VAL C HG12   1  
ATOM 2483   H HG13   . VAL C 1 42 ? -6.916  -25.421 -12.559 1.00 0.00 ? 42 VAL C HG13   1  
ATOM 2484   H HG21   . VAL C 1 42 ? -4.064  -25.432 -13.179 1.00 0.00 ? 42 VAL C HG21   1  
ATOM 2485   H HG22   . VAL C 1 42 ? -5.230  -25.753 -14.479 1.00 0.00 ? 42 VAL C HG22   1  
ATOM 2486   H HG23   . VAL C 1 42 ? -3.974  -24.515 -14.692 1.00 0.00 ? 42 VAL C HG23   1  
ATOM 2487   N N      . HIS C 1 43 ? -5.711  -21.452 -15.737 1.00 0.00 ? 43 HIS C N      1  
ATOM 2488   C CA     . HIS C 1 43 ? -5.160  -20.800 -16.917 1.00 0.00 ? 43 HIS C CA     1  
ATOM 2489   C C      . HIS C 1 43 ? -4.616  -19.411 -16.603 1.00 0.00 ? 43 HIS C C      1  
ATOM 2490   O O      . HIS C 1 43 ? -5.022  -18.789 -15.625 1.00 0.00 ? 43 HIS C O      1  
ATOM 2491   C CB     . HIS C 1 43 ? -6.253  -20.621 -17.974 1.00 0.00 ? 43 HIS C CB     1  
ATOM 2492   C CG     . HIS C 1 43 ? -6.839  -21.895 -18.516 1.00 0.00 ? 43 HIS C CG     1  
ATOM 2493   N ND1    . HIS C 1 43 ? -6.172  -22.814 -19.326 1.00 0.00 ? 43 HIS C ND1    1  
ATOM 2494   C CD2    . HIS C 1 43 ? -8.138  -22.294 -18.358 1.00 0.00 ? 43 HIS C CD2    1  
ATOM 2495   C CE1    . HIS C 1 43 ? -7.071  -23.763 -19.611 1.00 0.00 ? 43 HIS C CE1    1  
ATOM 2496   N NE2    . HIS C 1 43 ? -8.258  -23.483 -19.047 1.00 0.00 ? 43 HIS C NE2    1  
ATOM 2497   H H      . HIS C 1 43 ? -6.069  -20.861 -14.998 1.00 0.00 ? 43 HIS C H      1  
ATOM 2498   H HA     . HIS C 1 43 ? -4.346  -21.401 -17.323 1.00 0.00 ? 43 HIS C HA     1  
ATOM 2499   H HB2    . HIS C 1 43 ? -7.056  -20.020 -17.548 1.00 0.00 ? 43 HIS C HB2    1  
ATOM 2500   H HB3    . HIS C 1 43 ? -5.838  -20.065 -18.814 1.00 0.00 ? 43 HIS C HB3    1  
ATOM 2501   H HD2    . HIS C 1 43 ? -8.918  -21.754 -17.843 1.00 0.00 ? 43 HIS C HD2    1  
ATOM 2502   H HE1    . HIS C 1 43 ? -6.875  -24.634 -20.219 1.00 0.00 ? 43 HIS C HE1    1  
ATOM 2503   H HE2    . HIS C 1 43 ? -9.100  -24.029 -19.155 1.00 0.00 ? 43 HIS C HE2    1  
ATOM 2504   N N      . ARG C 1 44 ? -3.750  -18.886 -17.475 1.00 0.00 ? 44 ARG C N      1  
ATOM 2505   C CA     . ARG C 1 44 ? -3.395  -17.474 -17.462 1.00 0.00 ? 44 ARG C CA     1  
ATOM 2506   C C      . ARG C 1 44 ? -4.608  -16.683 -17.938 1.00 0.00 ? 44 ARG C C      1  
ATOM 2507   O O      . ARG C 1 44 ? -5.398  -17.202 -18.724 1.00 0.00 ? 44 ARG C O      1  
ATOM 2508   C CB     . ARG C 1 44 ? -2.197  -17.224 -18.379 1.00 0.00 ? 44 ARG C CB     1  
ATOM 2509   C CG     . ARG C 1 44 ? -0.917  -17.819 -17.791 1.00 0.00 ? 44 ARG C CG     1  
ATOM 2510   C CD     . ARG C 1 44 ? 0.257   -17.684 -18.762 1.00 0.00 ? 44 ARG C CD     1  
ATOM 2511   N NE     . ARG C 1 44 ? 0.075   -18.517 -19.956 1.00 0.00 ? 44 ARG C NE     1  
ATOM 2512   C CZ     . ARG C 1 44 ? 0.204   -19.847 -19.996 1.00 0.00 ? 44 ARG C CZ     1  
ATOM 2513   N NH1    . ARG C 1 44 ? 0.681   -20.529 -18.956 1.00 0.00 ? 44 ARG C NH1    1  
ATOM 2514   N NH2    . ARG C 1 44 ? -0.148  -20.530 -21.084 1.00 0.00 ? 44 ARG C NH2    1  
ATOM 2515   H H      . ARG C 1 44 ? -3.435  -19.452 -18.251 1.00 0.00 ? 44 ARG C H      1  
ATOM 2516   H HA     . ARG C 1 44 ? -3.145  -17.165 -16.448 1.00 0.00 ? 44 ARG C HA     1  
ATOM 2517   H HB2    . ARG C 1 44 ? -2.395  -17.669 -19.353 1.00 0.00 ? 44 ARG C HB2    1  
ATOM 2518   H HB3    . ARG C 1 44 ? -2.061  -16.151 -18.505 1.00 0.00 ? 44 ARG C HB3    1  
ATOM 2519   H HG2    . ARG C 1 44 ? -0.674  -17.299 -16.865 1.00 0.00 ? 44 ARG C HG2    1  
ATOM 2520   H HG3    . ARG C 1 44 ? -1.079  -18.872 -17.568 1.00 0.00 ? 44 ARG C HG3    1  
ATOM 2521   H HD2    . ARG C 1 44 ? 0.352   -16.641 -19.063 1.00 0.00 ? 44 ARG C HD2    1  
ATOM 2522   H HD3    . ARG C 1 44 ? 1.176   -17.973 -18.251 1.00 0.00 ? 44 ARG C HD3    1  
ATOM 2523   H HE     . ARG C 1 44 ? -0.202  -18.048 -20.806 1.00 0.00 ? 44 ARG C HE     1  
ATOM 2524   H HH11   . ARG C 1 44 ? 1.005   -20.038 -18.138 1.00 0.00 ? 44 ARG C HH11   1  
ATOM 2525   H HH12   . ARG C 1 44 ? 0.678   -21.540 -18.987 1.00 0.00 ? 44 ARG C HH12   1  
ATOM 2526   H HH21   . ARG C 1 44 ? -0.496  -20.047 -21.898 1.00 0.00 ? 44 ARG C HH21   1  
ATOM 2527   H HH22   . ARG C 1 44 ? -0.130  -21.539 -21.057 1.00 0.00 ? 44 ARG C HH22   1  
ATOM 2528   N N      . GLU C 1 45 ? -4.759  -15.422 -17.529 1.00 0.00 ? 45 GLU C N      1  
ATOM 2529   C CA     . GLU C 1 45 ? -5.941  -14.645 -17.876 1.00 0.00 ? 45 GLU C CA     1  
ATOM 2530   C C      . GLU C 1 45 ? -6.063  -14.444 -19.386 1.00 0.00 ? 45 GLU C C      1  
ATOM 2531   O O      . GLU C 1 45 ? -7.166  -14.453 -19.928 1.00 0.00 ? 45 GLU C O      1  
ATOM 2532   C CB     . GLU C 1 45 ? -5.911  -13.309 -17.132 1.00 0.00 ? 45 GLU C CB     1  
ATOM 2533   C CG     . GLU C 1 45 ? -7.208  -12.523 -17.316 1.00 0.00 ? 45 GLU C CG     1  
ATOM 2534   C CD     . GLU C 1 45 ? -7.153  -11.158 -16.638 1.00 0.00 ? 45 GLU C CD     1  
ATOM 2535   O OE1    . GLU C 1 45 ? -6.573  -10.228 -17.243 1.00 0.00 ? 45 GLU C OE1    1  
ATOM 2536   O OE2    . GLU C 1 45 ? -7.719  -11.024 -15.530 1.00 0.00 ? 45 GLU C OE2    1  
ATOM 2537   H H      . GLU C 1 45 ? -4.074  -15.012 -16.908 1.00 0.00 ? 45 GLU C H      1  
ATOM 2538   H HA     . GLU C 1 45 ? -6.824  -15.192 -17.544 1.00 0.00 ? 45 GLU C HA     1  
ATOM 2539   H HB2    . GLU C 1 45 ? -5.777  -13.504 -16.068 1.00 0.00 ? 45 GLU C HB2    1  
ATOM 2540   H HB3    . GLU C 1 45 ? -5.071  -12.717 -17.496 1.00 0.00 ? 45 GLU C HB3    1  
ATOM 2541   H HG2    . GLU C 1 45 ? -7.378  -12.376 -18.380 1.00 0.00 ? 45 GLU C HG2    1  
ATOM 2542   H HG3    . GLU C 1 45 ? -8.044  -13.098 -16.918 1.00 0.00 ? 45 GLU C HG3    1  
ATOM 2543   N N      . GLU C 1 46 ? -4.935  -14.359 -20.098 1.00 0.00 ? 46 GLU C N      1  
ATOM 2544   C CA     . GLU C 1 46 ? -4.922  -14.236 -21.546 1.00 0.00 ? 46 GLU C CA     1  
ATOM 2545   C C      . GLU C 1 46 ? -5.367  -15.513 -22.260 1.00 0.00 ? 46 GLU C C      1  
ATOM 2546   O O      . GLU C 1 46 ? -5.832  -15.447 -23.396 1.00 0.00 ? 46 GLU C O      1  
ATOM 2547   C CB     . GLU C 1 46 ? -3.535  -13.791 -22.011 1.00 0.00 ? 46 GLU C CB     1  
ATOM 2548   C CG     . GLU C 1 46 ? -2.457  -14.849 -21.770 1.00 0.00 ? 46 GLU C CG     1  
ATOM 2549   C CD     . GLU C 1 46 ? -1.069  -14.257 -21.989 1.00 0.00 ? 46 GLU C CD     1  
ATOM 2550   O OE1    . GLU C 1 46 ? -0.521  -13.696 -21.015 1.00 0.00 ? 46 GLU C OE1    1  
ATOM 2551   O OE2    . GLU C 1 46 ? -0.550  -14.366 -23.123 1.00 0.00 ? 46 GLU C OE2    1  
ATOM 2552   H H      . GLU C 1 46 ? -4.051  -14.339 -19.610 1.00 0.00 ? 46 GLU C H      1  
ATOM 2553   H HA     . GLU C 1 46 ? -5.626  -13.452 -21.824 1.00 0.00 ? 46 GLU C HA     1  
ATOM 2554   H HB2    . GLU C 1 46 ? -3.573  -13.562 -23.076 1.00 0.00 ? 46 GLU C HB2    1  
ATOM 2555   H HB3    . GLU C 1 46 ? -3.264  -12.882 -21.475 1.00 0.00 ? 46 GLU C HB3    1  
ATOM 2556   H HG2    . GLU C 1 46 ? -2.530  -15.217 -20.746 1.00 0.00 ? 46 GLU C HG2    1  
ATOM 2557   H HG3    . GLU C 1 46 ? -2.614  -15.687 -22.449 1.00 0.00 ? 46 GLU C HG3    1  
ATOM 2558   N N      . ILE C 1 47 ? -5.270  -16.668 -21.594 1.00 0.00 ? 47 ILE C N      1  
ATOM 2559   C CA     . ILE C 1 47 ? -5.797  -17.930 -22.091 1.00 0.00 ? 47 ILE C CA     1  
ATOM 2560   C C      . ILE C 1 47 ? -7.237  -18.126 -21.627 1.00 0.00 ? 47 ILE C C      1  
ATOM 2561   O O      . ILE C 1 47 ? -8.064  -18.623 -22.387 1.00 0.00 ? 47 ILE C O      1  
ATOM 2562   C CB     . ILE C 1 47 ? -4.912  -19.095 -21.637 1.00 0.00 ? 47 ILE C CB     1  
ATOM 2563   C CG1    . ILE C 1 47 ? -3.449  -18.942 -22.061 1.00 0.00 ? 47 ILE C CG1    1  
ATOM 2564   C CG2    . ILE C 1 47 ? -5.472  -20.423 -22.152 1.00 0.00 ? 47 ILE C CG2    1  
ATOM 2565   C CD1    . ILE C 1 47 ? -3.231  -18.858 -23.572 1.00 0.00 ? 47 ILE C CD1    1  
ATOM 2566   H H      . ILE C 1 47 ? -4.916  -16.650 -20.648 1.00 0.00 ? 47 ILE C H      1  
ATOM 2567   H HA     . ILE C 1 47 ? -5.802  -17.909 -23.180 1.00 0.00 ? 47 ILE C HA     1  
ATOM 2568   H HB     . ILE C 1 47 ? -4.928  -19.126 -20.549 1.00 0.00 ? 47 ILE C HB     1  
ATOM 2569   H HG12   . ILE C 1 47 ? -3.033  -18.046 -21.601 1.00 0.00 ? 47 ILE C HG12   1  
ATOM 2570   H HG13   . ILE C 1 47 ? -2.892  -19.798 -21.678 1.00 0.00 ? 47 ILE C HG13   1  
ATOM 2571   H HG21   . ILE C 1 47 ? -6.392  -20.668 -21.620 1.00 0.00 ? 47 ILE C HG21   1  
ATOM 2572   H HG22   . ILE C 1 47 ? -5.686  -20.357 -23.219 1.00 0.00 ? 47 ILE C HG22   1  
ATOM 2573   H HG23   . ILE C 1 47 ? -4.752  -21.222 -21.975 1.00 0.00 ? 47 ILE C HG23   1  
ATOM 2574   H HD11   . ILE C 1 47 ? -3.685  -17.947 -23.962 1.00 0.00 ? 47 ILE C HD11   1  
ATOM 2575   H HD12   . ILE C 1 47 ? -2.161  -18.838 -23.779 1.00 0.00 ? 47 ILE C HD12   1  
ATOM 2576   H HD13   . ILE C 1 47 ? -3.671  -19.724 -24.067 1.00 0.00 ? 47 ILE C HD13   1  
ATOM 2577   N N      . TYR C 1 48 ? -7.573  -17.683 -20.413 1.00 0.00 ? 48 TYR C N      1  
ATOM 2578   C CA     . TYR C 1 48 ? -8.907  -17.800 -19.845 1.00 0.00 ? 48 TYR C CA     1  
ATOM 2579   C C      . TYR C 1 48 ? -9.977  -17.194 -20.748 1.00 0.00 ? 48 TYR C C      1  
ATOM 2580   O O      . TYR C 1 48 ? -11.090 -17.710 -20.820 1.00 0.00 ? 48 TYR C O      1  
ATOM 2581   C CB     . TYR C 1 48 ? -8.920  -17.094 -18.492 1.00 0.00 ? 48 TYR C CB     1  
ATOM 2582   C CG     . TYR C 1 48 ? -10.277 -17.084 -17.825 1.00 0.00 ? 48 TYR C CG     1  
ATOM 2583   C CD1    . TYR C 1 48 ? -10.771 -18.243 -17.211 1.00 0.00 ? 48 TYR C CD1    1  
ATOM 2584   C CD2    . TYR C 1 48 ? -11.048 -15.914 -17.848 1.00 0.00 ? 48 TYR C CD2    1  
ATOM 2585   C CE1    . TYR C 1 48 ? -12.022 -18.221 -16.578 1.00 0.00 ? 48 TYR C CE1    1  
ATOM 2586   C CE2    . TYR C 1 48 ? -12.305 -15.887 -17.230 1.00 0.00 ? 48 TYR C CE2    1  
ATOM 2587   C CZ     . TYR C 1 48 ? -12.788 -17.037 -16.572 1.00 0.00 ? 48 TYR C CZ     1  
ATOM 2588   O OH     . TYR C 1 48 ? -13.992 -17.009 -15.933 1.00 0.00 ? 48 TYR C OH     1  
ATOM 2589   H H      . TYR C 1 48 ? -6.849  -17.295 -19.824 1.00 0.00 ? 48 TYR C H      1  
ATOM 2590   H HA     . TYR C 1 48 ? -9.136  -18.855 -19.689 1.00 0.00 ? 48 TYR C HA     1  
ATOM 2591   H HB2    . TYR C 1 48 ? -8.199  -17.578 -17.835 1.00 0.00 ? 48 TYR C HB2    1  
ATOM 2592   H HB3    . TYR C 1 48 ? -8.602  -16.062 -18.632 1.00 0.00 ? 48 TYR C HB3    1  
ATOM 2593   H HD1    . TYR C 1 48 ? -10.183 -19.149 -17.211 1.00 0.00 ? 48 TYR C HD1    1  
ATOM 2594   H HD2    . TYR C 1 48 ? -10.671 -15.027 -18.335 1.00 0.00 ? 48 TYR C HD2    1  
ATOM 2595   H HE1    . TYR C 1 48 ? -12.402 -19.108 -16.094 1.00 0.00 ? 48 TYR C HE1    1  
ATOM 2596   H HE2    . TYR C 1 48 ? -12.898 -14.985 -17.260 1.00 0.00 ? 48 TYR C HE2    1  
ATOM 2597   H HH     . TYR C 1 48 ? -14.422 -16.150 -15.985 1.00 0.00 ? 48 TYR C HH     1  
ATOM 2598   N N      . GLN C 1 49 ? -9.639  -16.134 -21.485 1.00 0.00 ? 49 GLN C N      1  
ATOM 2599   C CA     . GLN C 1 49 ? -10.565 -15.473 -22.390 1.00 0.00 ? 49 GLN C CA     1  
ATOM 2600   C C      . GLN C 1 49 ? -11.013 -16.382 -23.532 1.00 0.00 ? 49 GLN C C      1  
ATOM 2601   O O      . GLN C 1 49 ? -12.129 -16.229 -24.024 1.00 0.00 ? 49 GLN C O      1  
ATOM 2602   C CB     . GLN C 1 49 ? -9.916  -14.194 -22.916 1.00 0.00 ? 49 GLN C CB     1  
ATOM 2603   C CG     . GLN C 1 49 ? -9.820  -13.149 -21.802 1.00 0.00 ? 49 GLN C CG     1  
ATOM 2604   C CD     . GLN C 1 49 ? -9.015  -11.921 -22.212 1.00 0.00 ? 49 GLN C CD     1  
ATOM 2605   O OE1    . GLN C 1 49 ? -8.631  -11.749 -23.366 1.00 0.00 ? 49 GLN C OE1    1  
ATOM 2606   N NE2    . GLN C 1 49 ? -8.754  -11.021 -21.265 1.00 0.00 ? 49 GLN C NE2    1  
ATOM 2607   H H      . GLN C 1 49 ? -8.721  -15.729 -21.362 1.00 0.00 ? 49 GLN C H      1  
ATOM 2608   H HA     . GLN C 1 49 ? -11.456 -15.197 -21.824 1.00 0.00 ? 49 GLN C HA     1  
ATOM 2609   H HB2    . GLN C 1 49 ? -8.919  -14.424 -23.294 1.00 0.00 ? 49 GLN C HB2    1  
ATOM 2610   H HB3    . GLN C 1 49 ? -10.519 -13.791 -23.729 1.00 0.00 ? 49 GLN C HB3    1  
ATOM 2611   H HG2    . GLN C 1 49 ? -10.825 -12.832 -21.528 1.00 0.00 ? 49 GLN C HG2    1  
ATOM 2612   H HG3    . GLN C 1 49 ? -9.355  -13.596 -20.922 1.00 0.00 ? 49 GLN C HG3    1  
ATOM 2613   H HE21   . GLN C 1 49 ? -9.069  -11.175 -20.319 1.00 0.00 ? 49 GLN C HE21   1  
ATOM 2614   H HE22   . GLN C 1 49 ? -8.230  -10.191 -21.504 1.00 0.00 ? 49 GLN C HE22   1  
ATOM 2615   N N      . ARG C 1 50 ? -10.209 -17.387 -23.900 1.00 0.00 ? 50 ARG C N      1  
ATOM 2616   C CA     . ARG C 1 50 ? -10.619 -18.443 -24.816 1.00 0.00 ? 50 ARG C CA     1  
ATOM 2617   C C      . ARG C 1 50 ? -11.658 -19.357 -24.178 1.00 0.00 ? 50 ARG C C      1  
ATOM 2618   O O      . ARG C 1 50 ? -12.596 -19.783 -24.848 1.00 0.00 ? 50 ARG C O      1  
ATOM 2619   C CB     . ARG C 1 50 ? -9.398  -19.252 -25.251 1.00 0.00 ? 50 ARG C CB     1  
ATOM 2620   C CG     . ARG C 1 50 ? -9.793  -20.477 -26.074 1.00 0.00 ? 50 ARG C CG     1  
ATOM 2621   C CD     . ARG C 1 50 ? -8.535  -21.272 -26.408 1.00 0.00 ? 50 ARG C CD     1  
ATOM 2622   N NE     . ARG C 1 50 ? -8.851  -22.503 -27.139 1.00 0.00 ? 50 ARG C NE     1  
ATOM 2623   C CZ     . ARG C 1 50 ? -7.952  -23.412 -27.528 1.00 0.00 ? 50 ARG C CZ     1  
ATOM 2624   N NH1    . ARG C 1 50 ? -6.652  -23.254 -27.277 1.00 0.00 ? 50 ARG C NH1    1  
ATOM 2625   N NH2    . ARG C 1 50 ? -8.347  -24.504 -28.182 1.00 0.00 ? 50 ARG C NH2    1  
ATOM 2626   H H      . ARG C 1 50 ? -9.312  -17.482 -23.446 1.00 0.00 ? 50 ARG C H      1  
ATOM 2627   H HA     . ARG C 1 50 ? -11.069 -17.993 -25.700 1.00 0.00 ? 50 ARG C HA     1  
ATOM 2628   H HB2    . ARG C 1 50 ? -8.738  -18.616 -25.842 1.00 0.00 ? 50 ARG C HB2    1  
ATOM 2629   H HB3    . ARG C 1 50 ? -8.858  -19.601 -24.373 1.00 0.00 ? 50 ARG C HB3    1  
ATOM 2630   H HG2    . ARG C 1 50 ? -10.458 -21.118 -25.494 1.00 0.00 ? 50 ARG C HG2    1  
ATOM 2631   H HG3    . ARG C 1 50 ? -10.301 -20.158 -26.983 1.00 0.00 ? 50 ARG C HG3    1  
ATOM 2632   H HD2    . ARG C 1 50 ? -7.875  -20.647 -27.008 1.00 0.00 ? 50 ARG C HD2    1  
ATOM 2633   H HD3    . ARG C 1 50 ? -8.027  -21.518 -25.476 1.00 0.00 ? 50 ARG C HD3    1  
ATOM 2634   H HE     . ARG C 1 50 ? -9.820  -22.673 -27.364 1.00 0.00 ? 50 ARG C HE     1  
ATOM 2635   H HH11   . ARG C 1 50 ? -6.333  -22.431 -26.788 1.00 0.00 ? 50 ARG C HH11   1  
ATOM 2636   H HH12   . ARG C 1 50 ? -5.988  -23.950 -27.580 1.00 0.00 ? 50 ARG C HH12   1  
ATOM 2637   H HH21   . ARG C 1 50 ? -9.326  -24.647 -28.385 1.00 0.00 ? 50 ARG C HH21   1  
ATOM 2638   H HH22   . ARG C 1 50 ? -7.668  -25.190 -28.476 1.00 0.00 ? 50 ARG C HH22   1  
ATOM 2639   N N      . ILE C 1 51 ? -11.523 -19.646 -22.882 1.00 0.00 ? 51 ILE C N      1  
ATOM 2640   C CA     . ILE C 1 51 ? -12.480 -20.484 -22.178 1.00 0.00 ? 51 ILE C CA     1  
ATOM 2641   C C      . ILE C 1 51 ? -13.820 -19.758 -22.053 1.00 0.00 ? 51 ILE C C      1  
ATOM 2642   O O      . ILE C 1 51 ? -14.865 -20.398 -21.950 1.00 0.00 ? 51 ILE C O      1  
ATOM 2643   C CB     . ILE C 1 51 ? -11.896 -20.975 -20.848 1.00 0.00 ? 51 ILE C CB     1  
ATOM 2644   C CG1    . ILE C 1 51 ? -10.823 -22.046 -21.063 1.00 0.00 ? 51 ILE C CG1    1  
ATOM 2645   C CG2    . ILE C 1 51 ? -12.962 -21.620 -19.961 1.00 0.00 ? 51 ILE C CG2    1  
ATOM 2646   C CD1    . ILE C 1 51 ? -9.509  -21.529 -21.648 1.00 0.00 ? 51 ILE C CD1    1  
ATOM 2647   H H      . ILE C 1 51 ? -10.754 -19.247 -22.362 1.00 0.00 ? 51 ILE C H      1  
ATOM 2648   H HA     . ILE C 1 51 ? -12.651 -21.361 -22.798 1.00 0.00 ? 51 ILE C HA     1  
ATOM 2649   H HB     . ILE C 1 51 ? -11.463 -20.135 -20.303 1.00 0.00 ? 51 ILE C HB     1  
ATOM 2650   H HG12   . ILE C 1 51 ? -10.594 -22.504 -20.100 1.00 0.00 ? 51 ILE C HG12   1  
ATOM 2651   H HG13   . ILE C 1 51 ? -11.216 -22.825 -21.717 1.00 0.00 ? 51 ILE C HG13   1  
ATOM 2652   H HG21   . ILE C 1 51 ? -13.721 -20.890 -19.685 1.00 0.00 ? 51 ILE C HG21   1  
ATOM 2653   H HG22   . ILE C 1 51 ? -13.433 -22.449 -20.488 1.00 0.00 ? 51 ILE C HG22   1  
ATOM 2654   H HG23   . ILE C 1 51 ? -12.504 -21.993 -19.044 1.00 0.00 ? 51 ILE C HG23   1  
ATOM 2655   H HD11   . ILE C 1 51 ? -8.747  -22.303 -21.559 1.00 0.00 ? 51 ILE C HD11   1  
ATOM 2656   H HD12   . ILE C 1 51 ? -9.632  -21.291 -22.704 1.00 0.00 ? 51 ILE C HD12   1  
ATOM 2657   H HD13   . ILE C 1 51 ? -9.183  -20.645 -21.099 1.00 0.00 ? 51 ILE C HD13   1  
ATOM 2658   N N      . GLN C 1 52 ? -13.813 -18.431 -22.212 1.00 0.00 ? 52 GLN C N      1  
ATOM 2659   C CA     . GLN C 1 52 ? -15.015 -17.615 -22.273 1.00 0.00 ? 52 GLN C CA     1  
ATOM 2660   C C      . GLN C 1 52 ? -15.492 -17.363 -23.703 1.00 0.00 ? 52 GLN C C      1  
ATOM 2661   O O      . GLN C 1 52 ? -16.514 -16.707 -23.900 1.00 0.00 ? 52 GLN C O      1  
ATOM 2662   C CB     . GLN C 1 52 ? -14.784 -16.294 -21.536 1.00 0.00 ? 52 GLN C CB     1  
ATOM 2663   C CG     . GLN C 1 52 ? -14.358 -16.481 -20.079 1.00 0.00 ? 52 GLN C CG     1  
ATOM 2664   C CD     . GLN C 1 52 ? -15.242 -17.475 -19.337 1.00 0.00 ? 52 GLN C CD     1  
ATOM 2665   O OE1    . GLN C 1 52 ? -16.443 -17.266 -19.182 1.00 0.00 ? 52 GLN C OE1    1  
ATOM 2666   N NE2    . GLN C 1 52 ? -14.669 -18.595 -18.900 1.00 0.00 ? 52 GLN C NE2    1  
ATOM 2667   H H      . GLN C 1 52 ? -12.924 -17.977 -22.365 1.00 0.00 ? 52 GLN C H      1  
ATOM 2668   H HA     . GLN C 1 52 ? -15.817 -18.144 -21.757 1.00 0.00 ? 52 GLN C HA     1  
ATOM 2669   H HB2    . GLN C 1 52 ? -14.018 -15.719 -22.056 1.00 0.00 ? 52 GLN C HB2    1  
ATOM 2670   H HB3    . GLN C 1 52 ? -15.710 -15.718 -21.550 1.00 0.00 ? 52 GLN C HB3    1  
ATOM 2671   H HG2    . GLN C 1 52 ? -13.324 -16.826 -20.049 1.00 0.00 ? 52 GLN C HG2    1  
ATOM 2672   H HG3    . GLN C 1 52 ? -14.404 -15.519 -19.570 1.00 0.00 ? 52 GLN C HG3    1  
ATOM 2673   H HE21   . GLN C 1 52 ? -13.670 -18.710 -18.978 1.00 0.00 ? 52 GLN C HE21   1  
ATOM 2674   H HE22   . GLN C 1 52 ? -15.225 -19.275 -18.397 1.00 0.00 ? 52 GLN C HE22   1  
ATOM 2675   N N      . ALA C 1 53 ? -14.787 -17.884 -24.712 1.00 0.00 ? 53 ALA C N      1  
ATOM 2676   C CA     . ALA C 1 53 ? -15.066 -17.615 -26.115 1.00 0.00 ? 53 ALA C CA     1  
ATOM 2677   C C      . ALA C 1 53 ? -16.106 -18.563 -26.711 1.00 0.00 ? 53 ALA C C      1  
ATOM 2678   O O      . ALA C 1 53 ? -16.497 -18.402 -27.866 1.00 0.00 ? 53 ALA C O      1  
ATOM 2679   C CB     . ALA C 1 53 ? -13.757 -17.663 -26.904 1.00 0.00 ? 53 ALA C CB     1  
ATOM 2680   H H      . ALA C 1 53 ? -13.973 -18.446 -24.504 1.00 0.00 ? 53 ALA C H      1  
ATOM 2681   H HA     . ALA C 1 53 ? -15.464 -16.604 -26.192 1.00 0.00 ? 53 ALA C HA     1  
ATOM 2682   H HB1    . ALA C 1 53 ? -13.370 -18.681 -26.931 1.00 0.00 ? 53 ALA C HB1    1  
ATOM 2683   H HB2    . ALA C 1 53 ? -13.934 -17.325 -27.924 1.00 0.00 ? 53 ALA C HB2    1  
ATOM 2684   H HB3    . ALA C 1 53 ? -13.021 -17.008 -26.438 1.00 0.00 ? 53 ALA C HB3    1  
ATOM 2685   N N      . GLY C 1 54 ? -16.554 -19.560 -25.942 1.00 0.00 ? 54 GLY C N      1  
ATOM 2686   C CA     . GLY C 1 54 ? -17.477 -20.582 -26.403 1.00 0.00 ? 54 GLY C CA     1  
ATOM 2687   C C      . GLY C 1 54 ? -17.652 -21.664 -25.346 1.00 0.00 ? 54 GLY C C      1  
ATOM 2688   O O      . GLY C 1 54 ? -17.878 -21.358 -24.177 1.00 0.00 ? 54 GLY C O      1  
ATOM 2689   H H      . GLY C 1 54 ? -16.216 -19.629 -24.993 1.00 0.00 ? 54 GLY C H      1  
ATOM 2690   H HA2    . GLY C 1 54 ? -18.449 -20.135 -26.616 1.00 0.00 ? 54 GLY C HA2    1  
ATOM 2691   H HA3    . GLY C 1 54 ? -17.089 -21.030 -27.318 1.00 0.00 ? 54 GLY C HA3    1  
ATOM 2692   N N      . LEU C 1 55 ? -17.496 -22.926 -25.757 1.00 0.00 ? 55 LEU C N      1  
ATOM 2693   C CA     . LEU C 1 55 ? -17.408 -24.081 -24.875 1.00 0.00 ? 55 LEU C CA     1  
ATOM 2694   C C      . LEU C 1 55 ? -18.676 -24.312 -24.052 1.00 0.00 ? 55 LEU C C      1  
ATOM 2695   O O      . LEU C 1 55 ? -18.641 -25.007 -23.038 1.00 0.00 ? 55 LEU C O      1  
ATOM 2696   C CB     . LEU C 1 55 ? -16.157 -23.989 -23.996 1.00 0.00 ? 55 LEU C CB     1  
ATOM 2697   C CG     . LEU C 1 55 ? -14.888 -23.558 -24.738 1.00 0.00 ? 55 LEU C CG     1  
ATOM 2698   C CD1    . LEU C 1 55 ? -13.732 -23.454 -23.746 1.00 0.00 ? 55 LEU C CD1    1  
ATOM 2699   C CD2    . LEU C 1 55 ? -14.509 -24.545 -25.839 1.00 0.00 ? 55 LEU C CD2    1  
ATOM 2700   H H      . LEU C 1 55 ? -17.335 -23.088 -26.741 1.00 0.00 ? 55 LEU C H      1  
ATOM 2701   H HA     . LEU C 1 55 ? -17.294 -24.960 -25.511 1.00 0.00 ? 55 LEU C HA     1  
ATOM 2702   H HB2    . LEU C 1 55 ? -16.346 -23.272 -23.196 1.00 0.00 ? 55 LEU C HB2    1  
ATOM 2703   H HB3    . LEU C 1 55 ? -15.980 -24.962 -23.538 1.00 0.00 ? 55 LEU C HB3    1  
ATOM 2704   H HG     . LEU C 1 55 ? -15.036 -22.574 -25.180 1.00 0.00 ? 55 LEU C HG     1  
ATOM 2705   H HD11   . LEU C 1 55 ? -13.448 -24.445 -23.395 1.00 0.00 ? 55 LEU C HD11   1  
ATOM 2706   H HD12   . LEU C 1 55 ? -12.879 -22.981 -24.234 1.00 0.00 ? 55 LEU C HD12   1  
ATOM 2707   H HD13   . LEU C 1 55 ? -14.049 -22.850 -22.895 1.00 0.00 ? 55 LEU C HD13   1  
ATOM 2708   H HD21   . LEU C 1 55 ? -13.558 -24.248 -26.282 1.00 0.00 ? 55 LEU C HD21   1  
ATOM 2709   H HD22   . LEU C 1 55 ? -14.419 -25.548 -25.423 1.00 0.00 ? 55 LEU C HD22   1  
ATOM 2710   H HD23   . LEU C 1 55 ? -15.274 -24.541 -26.617 1.00 0.00 ? 55 LEU C HD23   1  
ATOM 2711   N N      . THR C 1 56 ? -19.811 -23.768 -24.500 1.00 0.00 ? 56 THR C N      1  
ATOM 2712   C CA     . THR C 1 56 ? -21.102 -23.926 -23.845 1.00 0.00 ? 56 THR C CA     1  
ATOM 2713   C C      . THR C 1 56 ? -21.725 -25.291 -24.117 1.00 0.00 ? 56 THR C C      1  
ATOM 2714   O O      . THR C 1 56 ? -22.616 -25.715 -23.383 1.00 0.00 ? 56 THR C O      1  
ATOM 2715   C CB     . THR C 1 56 ? -22.059 -22.820 -24.293 1.00 0.00 ? 56 THR C CB     1  
ATOM 2716   O OG1    . THR C 1 56 ? -22.077 -22.738 -25.701 1.00 0.00 ? 56 THR C OG1    1  
ATOM 2717   C CG2    . THR C 1 56 ? -21.630 -21.465 -23.736 1.00 0.00 ? 56 THR C CG2    1  
ATOM 2718   H H      . THR C 1 56 ? -19.785 -23.204 -25.337 1.00 0.00 ? 56 THR C H      1  
ATOM 2719   H HA     . THR C 1 56 ? -20.962 -23.842 -22.768 1.00 0.00 ? 56 THR C HA     1  
ATOM 2720   H HB     . THR C 1 56 ? -23.062 -23.047 -23.931 1.00 0.00 ? 56 THR C HB     1  
ATOM 2721   H HG1    . THR C 1 56 ? -22.754 -22.101 -25.954 1.00 0.00 ? 56 THR C HG1    1  
ATOM 2722   H HG21   . THR C 1 56 ? -22.366 -20.710 -24.011 1.00 0.00 ? 56 THR C HG21   1  
ATOM 2723   H HG22   . THR C 1 56 ? -21.566 -21.520 -22.649 1.00 0.00 ? 56 THR C HG22   1  
ATOM 2724   H HG23   . THR C 1 56 ? -20.657 -21.185 -24.141 1.00 0.00 ? 56 THR C HG23   1  
ATOM 2725   N N      . ALA C 1 57 ? -21.232 -26.001 -25.136 1.00 0.00 ? 57 ALA C N      1  
ATOM 2726   C CA     . ALA C 1 57 ? -21.560 -27.390 -25.399 1.00 0.00 ? 57 ALA C CA     1  
ATOM 2727   C C      . ALA C 1 57 ? -20.279 -28.212 -25.546 1.00 0.00 ? 57 ALA C C      1  
ATOM 2728   O O      . ALA C 1 57 ? -19.338 -27.752 -26.193 1.00 0.00 ? 57 ALA C O      1  
ATOM 2729   C CB     . ALA C 1 57 ? -22.419 -27.472 -26.660 1.00 0.00 ? 57 ALA C CB     1  
ATOM 2730   H H      . ALA C 1 57 ? -20.517 -25.581 -25.711 1.00 0.00 ? 57 ALA C H      1  
ATOM 2731   H HA     . ALA C 1 57 ? -22.151 -27.778 -24.568 1.00 0.00 ? 57 ALA C HA     1  
ATOM 2732   H HB1    . ALA C 1 57 ? -22.686 -28.511 -26.853 1.00 0.00 ? 57 ALA C HB1    1  
ATOM 2733   H HB2    . ALA C 1 57 ? -23.330 -26.889 -26.520 1.00 0.00 ? 57 ALA C HB2    1  
ATOM 2734   H HB3    . ALA C 1 57 ? -21.865 -27.077 -27.512 1.00 0.00 ? 57 ALA C HB3    1  
ATOM 2735   N N      . PRO C 1 58 ? -20.230 -29.429 -24.990 1.00 0.00 ? 58 PRO C N      1  
ATOM 2736   C CA     . PRO C 1 58 ? -19.143 -30.365 -25.220 1.00 0.00 ? 58 PRO C CA     1  
ATOM 2737   C C      . PRO C 1 58 ? -19.049 -30.825 -26.673 1.00 0.00 ? 58 PRO C C      1  
ATOM 2738   O O      . PRO C 1 58 ? -19.912 -30.529 -27.498 1.00 0.00 ? 58 PRO C O      1  
ATOM 2739   C CB     . PRO C 1 58 ? -19.394 -31.550 -24.288 1.00 0.00 ? 58 PRO C CB     1  
ATOM 2740   C CG     . PRO C 1 58 ? -20.332 -31.009 -23.211 1.00 0.00 ? 58 PRO C CG     1  
ATOM 2741   C CD     . PRO C 1 58 ? -21.085 -29.879 -23.908 1.00 0.00 ? 58 PRO C CD     1  
ATOM 2742   H HA     . PRO C 1 58 ? -18.203 -29.889 -24.939 1.00 0.00 ? 58 PRO C HA     1  
ATOM 2743   H HB2    . PRO C 1 58 ? -19.892 -32.354 -24.829 1.00 0.00 ? 58 PRO C HB2    1  
ATOM 2744   H HB3    . PRO C 1 58 ? -18.460 -31.906 -23.855 1.00 0.00 ? 58 PRO C HB3    1  
ATOM 2745   H HG2    . PRO C 1 58 ? -21.018 -31.782 -22.864 1.00 0.00 ? 58 PRO C HG2    1  
ATOM 2746   H HG3    . PRO C 1 58 ? -19.750 -30.608 -22.381 1.00 0.00 ? 58 PRO C HG3    1  
ATOM 2747   H HD2    . PRO C 1 58 ? -22.026 -30.254 -24.313 1.00 0.00 ? 58 PRO C HD2    1  
ATOM 2748   H HD3    . PRO C 1 58 ? -21.270 -29.072 -23.199 1.00 0.00 ? 58 PRO C HD3    1  
ATOM 2749   N N      . ASP C 1 59 ? -18.016 -31.617 -26.971 1.00 0.00 ? 59 ASP C N      1  
ATOM 2750   C CA     . ASP C 1 59 ? -17.786 -32.189 -28.289 1.00 0.00 ? 59 ASP C CA     1  
ATOM 2751   C C      . ASP C 1 59 ? -18.907 -33.133 -28.720 1.00 0.00 ? 59 ASP C C      1  
ATOM 2752   O O      . ASP C 1 59 ? -19.106 -33.352 -29.914 1.00 0.00 ? 59 ASP C O      1  
ATOM 2753   C CB     . ASP C 1 59 ? -16.458 -32.946 -28.265 1.00 0.00 ? 59 ASP C CB     1  
ATOM 2754   C CG     . ASP C 1 59 ? -15.974 -33.294 -29.669 1.00 0.00 ? 59 ASP C CG     1  
ATOM 2755   O OD1    . ASP C 1 59 ? -15.689 -32.351 -30.440 1.00 0.00 ? 59 ASP C OD1    1  
ATOM 2756   O OD2    . ASP C 1 59 ? -15.843 -34.503 -29.963 1.00 0.00 ? 59 ASP C OD2    1  
ATOM 2757   H H      . ASP C 1 59 ? -17.334 -31.815 -26.252 1.00 0.00 ? 59 ASP C H      1  
ATOM 2758   H HA     . ASP C 1 59 ? -17.718 -31.377 -29.015 1.00 0.00 ? 59 ASP C HA     1  
ATOM 2759   H HB2    . ASP C 1 59 ? -15.701 -32.344 -27.764 1.00 0.00 ? 59 ASP C HB2    1  
ATOM 2760   H HB3    . ASP C 1 59 ? -16.578 -33.858 -27.679 1.00 0.00 ? 59 ASP C HB3    1  
ATOM 2761   N N      . MET D 1 1  ? -0.544  -30.976 -9.947  1.00 0.00 ? 1  MET D N      1  
ATOM 2762   C CA     . MET D 1 1  ? -0.023  -29.604 -10.090 1.00 0.00 ? 1  MET D CA     1  
ATOM 2763   C C      . MET D 1 1  ? 0.109   -29.194 -11.550 1.00 0.00 ? 1  MET D C      1  
ATOM 2764   O O      . MET D 1 1  ? 0.641   -29.947 -12.362 1.00 0.00 ? 1  MET D O      1  
ATOM 2765   C CB     . MET D 1 1  ? 1.336   -29.453 -9.408  1.00 0.00 ? 1  MET D CB     1  
ATOM 2766   C CG     . MET D 1 1  ? 1.761   -27.997 -9.242  1.00 0.00 ? 1  MET D CG     1  
ATOM 2767   S SD     . MET D 1 1  ? 1.570   -27.328 -7.576  1.00 0.00 ? 1  MET D SD     1  
ATOM 2768   C CE     . MET D 1 1  ? 3.174   -27.941 -7.015  1.00 0.00 ? 1  MET D CE     1  
ATOM 2769   H H1     . MET D 1 1  ? 0.149   -31.639 -10.263 1.00 0.00 ? 1  MET D H1     1  
ATOM 2770   H H2     . MET D 1 1  ? -1.385  -31.089 -10.494 1.00 0.00 ? 1  MET D H2     1  
ATOM 2771   H H3     . MET D 1 1  ? -0.758  -31.163 -8.977  1.00 0.00 ? 1  MET D H3     1  
ATOM 2772   H HA     . MET D 1 1  ? -0.723  -28.921 -9.608  1.00 0.00 ? 1  MET D HA     1  
ATOM 2773   H HB2    . MET D 1 1  ? 1.318   -29.937 -8.431  1.00 0.00 ? 1  MET D HB2    1  
ATOM 2774   H HB3    . MET D 1 1  ? 2.089   -29.936 -10.031 1.00 0.00 ? 1  MET D HB3    1  
ATOM 2775   H HG2    . MET D 1 1  ? 2.827   -27.958 -9.463  1.00 0.00 ? 1  MET D HG2    1  
ATOM 2776   H HG3    . MET D 1 1  ? 1.237   -27.356 -9.950  1.00 0.00 ? 1  MET D HG3    1  
ATOM 2777   H HE1    . MET D 1 1  ? 3.349   -27.634 -5.985  1.00 0.00 ? 1  MET D HE1    1  
ATOM 2778   H HE2    . MET D 1 1  ? 3.188   -29.028 -7.098  1.00 0.00 ? 1  MET D HE2    1  
ATOM 2779   H HE3    . MET D 1 1  ? 3.952   -27.543 -7.668  1.00 0.00 ? 1  MET D HE3    1  
ATOM 2780   N N      . LEU D 1 2  ? -0.287  -27.954 -11.843 1.00 0.00 ? 2  LEU D N      1  
ATOM 2781   C CA     . LEU D 1 2  ? -0.053  -27.261 -13.095 1.00 0.00 ? 2  LEU D CA     1  
ATOM 2782   C C      . LEU D 1 2  ? 0.805   -26.035 -12.798 1.00 0.00 ? 2  LEU D C      1  
ATOM 2783   O O      . LEU D 1 2  ? 0.381   -25.135 -12.076 1.00 0.00 ? 2  LEU D O      1  
ATOM 2784   C CB     . LEU D 1 2  ? -1.420  -26.909 -13.683 1.00 0.00 ? 2  LEU D CB     1  
ATOM 2785   C CG     . LEU D 1 2  ? -1.416  -26.277 -15.075 1.00 0.00 ? 2  LEU D CG     1  
ATOM 2786   C CD1    . LEU D 1 2  ? -1.145  -24.776 -15.033 1.00 0.00 ? 2  LEU D CD1    1  
ATOM 2787   C CD2    . LEU D 1 2  ? -0.398  -26.918 -16.012 1.00 0.00 ? 2  LEU D CD2    1  
ATOM 2788   H H      . LEU D 1 2  ? -0.767  -27.417 -11.133 1.00 0.00 ? 2  LEU D H      1  
ATOM 2789   H HA     . LEU D 1 2  ? 0.477   -27.920 -13.782 1.00 0.00 ? 2  LEU D HA     1  
ATOM 2790   H HB2    . LEU D 1 2  ? -2.000  -27.829 -13.747 1.00 0.00 ? 2  LEU D HB2    1  
ATOM 2791   H HB3    . LEU D 1 2  ? -1.940  -26.245 -12.992 1.00 0.00 ? 2  LEU D HB3    1  
ATOM 2792   H HG     . LEU D 1 2  ? -2.408  -26.420 -15.504 1.00 0.00 ? 2  LEU D HG     1  
ATOM 2793   H HD11   . LEU D 1 2  ? -1.435  -24.346 -15.991 1.00 0.00 ? 2  LEU D HD11   1  
ATOM 2794   H HD12   . LEU D 1 2  ? -1.734  -24.315 -14.241 1.00 0.00 ? 2  LEU D HD12   1  
ATOM 2795   H HD13   . LEU D 1 2  ? -0.086  -24.587 -14.858 1.00 0.00 ? 2  LEU D HD13   1  
ATOM 2796   H HD21   . LEU D 1 2  ? -0.547  -27.997 -16.045 1.00 0.00 ? 2  LEU D HD21   1  
ATOM 2797   H HD22   . LEU D 1 2  ? -0.551  -26.508 -17.008 1.00 0.00 ? 2  LEU D HD22   1  
ATOM 2798   H HD23   . LEU D 1 2  ? 0.619   -26.695 -15.689 1.00 0.00 ? 2  LEU D HD23   1  
ATOM 2799   N N      . ILE D 1 3  ? 2.049   -26.045 -13.280 1.00 0.00 ? 3  ILE D N      1  
ATOM 2800   C CA     . ILE D 1 3  ? 3.029   -24.995 -13.058 1.00 0.00 ? 3  ILE D CA     1  
ATOM 2801   C C      . ILE D 1 3  ? 3.100   -24.089 -14.283 1.00 0.00 ? 3  ILE D C      1  
ATOM 2802   O O      . ILE D 1 3  ? 3.060   -24.565 -15.416 1.00 0.00 ? 3  ILE D O      1  
ATOM 2803   C CB     . ILE D 1 3  ? 4.398   -25.606 -12.742 1.00 0.00 ? 3  ILE D CB     1  
ATOM 2804   C CG1    . ILE D 1 3  ? 4.410   -26.388 -11.426 1.00 0.00 ? 3  ILE D CG1    1  
ATOM 2805   C CG2    . ILE D 1 3  ? 5.447   -24.501 -12.629 1.00 0.00 ? 3  ILE D CG2    1  
ATOM 2806   C CD1    . ILE D 1 3  ? 4.054   -27.859 -11.619 1.00 0.00 ? 3  ILE D CD1    1  
ATOM 2807   H H      . ILE D 1 3  ? 2.340   -26.830 -13.845 1.00 0.00 ? 3  ILE D H      1  
ATOM 2808   H HA     . ILE D 1 3  ? 2.721   -24.392 -12.205 1.00 0.00 ? 3  ILE D HA     1  
ATOM 2809   H HB     . ILE D 1 3  ? 4.691   -26.266 -13.559 1.00 0.00 ? 3  ILE D HB     1  
ATOM 2810   H HG12   . ILE D 1 3  ? 5.410   -26.361 -10.995 1.00 0.00 ? 3  ILE D HG12   1  
ATOM 2811   H HG13   . ILE D 1 3  ? 3.731   -25.937 -10.704 1.00 0.00 ? 3  ILE D HG13   1  
ATOM 2812   H HG21   . ILE D 1 3  ? 5.120   -23.759 -11.901 1.00 0.00 ? 3  ILE D HG21   1  
ATOM 2813   H HG22   . ILE D 1 3  ? 6.390   -24.941 -12.303 1.00 0.00 ? 3  ILE D HG22   1  
ATOM 2814   H HG23   . ILE D 1 3  ? 5.600   -24.023 -13.598 1.00 0.00 ? 3  ILE D HG23   1  
ATOM 2815   H HD11   . ILE D 1 3  ? 4.599   -28.254 -12.475 1.00 0.00 ? 3  ILE D HD11   1  
ATOM 2816   H HD12   . ILE D 1 3  ? 4.343   -28.418 -10.728 1.00 0.00 ? 3  ILE D HD12   1  
ATOM 2817   H HD13   . ILE D 1 3  ? 2.982   -27.963 -11.777 1.00 0.00 ? 3  ILE D HD13   1  
ATOM 2818   N N      . LEU D 1 4  ? 3.240   -22.781 -14.052 1.00 0.00 ? 4  LEU D N      1  
ATOM 2819   C CA     . LEU D 1 4  ? 3.472   -21.795 -15.094 1.00 0.00 ? 4  LEU D CA     1  
ATOM 2820   C C      . LEU D 1 4  ? 4.167   -20.560 -14.532 1.00 0.00 ? 4  LEU D C      1  
ATOM 2821   O O      . LEU D 1 4  ? 4.108   -20.292 -13.333 1.00 0.00 ? 4  LEU D O      1  
ATOM 2822   C CB     . LEU D 1 4  ? 2.163   -21.466 -15.819 1.00 0.00 ? 4  LEU D CB     1  
ATOM 2823   C CG     . LEU D 1 4  ? 0.902   -21.362 -14.956 1.00 0.00 ? 4  LEU D CG     1  
ATOM 2824   C CD1    . LEU D 1 4  ? 0.794   -20.013 -14.249 1.00 0.00 ? 4  LEU D CD1    1  
ATOM 2825   C CD2    . LEU D 1 4  ? -0.322  -21.516 -15.855 1.00 0.00 ? 4  LEU D CD2    1  
ATOM 2826   H H      . LEU D 1 4  ? 3.244   -22.453 -13.095 1.00 0.00 ? 4  LEU D H      1  
ATOM 2827   H HA     . LEU D 1 4  ? 4.156   -22.234 -15.820 1.00 0.00 ? 4  LEU D HA     1  
ATOM 2828   H HB2    . LEU D 1 4  ? 2.288   -20.532 -16.368 1.00 0.00 ? 4  LEU D HB2    1  
ATOM 2829   H HB3    . LEU D 1 4  ? 2.002   -22.254 -16.554 1.00 0.00 ? 4  LEU D HB3    1  
ATOM 2830   H HG     . LEU D 1 4  ? 0.872   -22.159 -14.215 1.00 0.00 ? 4  LEU D HG     1  
ATOM 2831   H HD11   . LEU D 1 4  ? 1.577   -19.927 -13.497 1.00 0.00 ? 4  LEU D HD11   1  
ATOM 2832   H HD12   . LEU D 1 4  ? 0.892   -19.204 -14.975 1.00 0.00 ? 4  LEU D HD12   1  
ATOM 2833   H HD13   . LEU D 1 4  ? -0.177  -19.939 -13.760 1.00 0.00 ? 4  LEU D HD13   1  
ATOM 2834   H HD21   . LEU D 1 4  ? -0.215  -22.410 -16.468 1.00 0.00 ? 4  LEU D HD21   1  
ATOM 2835   H HD22   . LEU D 1 4  ? -1.217  -21.607 -15.239 1.00 0.00 ? 4  LEU D HD22   1  
ATOM 2836   H HD23   . LEU D 1 4  ? -0.417  -20.647 -16.502 1.00 0.00 ? 4  LEU D HD23   1  
ATOM 2837   N N      . THR D 1 5  ? 4.857   -19.816 -15.400 1.00 0.00 ? 5  THR D N      1  
ATOM 2838   C CA     . THR D 1 5  ? 5.436   -18.535 -15.033 1.00 0.00 ? 5  THR D CA     1  
ATOM 2839   C C      . THR D 1 5  ? 4.489   -17.390 -15.361 1.00 0.00 ? 5  THR D C      1  
ATOM 2840   O O      . THR D 1 5  ? 3.810   -17.408 -16.386 1.00 0.00 ? 5  THR D O      1  
ATOM 2841   C CB     . THR D 1 5  ? 6.759   -18.270 -15.749 1.00 0.00 ? 5  THR D CB     1  
ATOM 2842   O OG1    . THR D 1 5  ? 6.633   -18.485 -17.136 1.00 0.00 ? 5  THR D OG1    1  
ATOM 2843   C CG2    . THR D 1 5  ? 7.908   -19.120 -15.214 1.00 0.00 ? 5  THR D CG2    1  
ATOM 2844   H H      . THR D 1 5  ? 4.871   -20.073 -16.378 1.00 0.00 ? 5  THR D H      1  
ATOM 2845   H HA     . THR D 1 5  ? 5.627   -18.529 -13.962 1.00 0.00 ? 5  THR D HA     1  
ATOM 2846   H HB     . THR D 1 5  ? 7.019   -17.224 -15.585 1.00 0.00 ? 5  THR D HB     1  
ATOM 2847   H HG1    . THR D 1 5  ? 7.298   -17.931 -17.558 1.00 0.00 ? 5  THR D HG1    1  
ATOM 2848   H HG21   . THR D 1 5  ? 7.704   -20.175 -15.394 1.00 0.00 ? 5  THR D HG21   1  
ATOM 2849   H HG22   . THR D 1 5  ? 8.825   -18.827 -15.727 1.00 0.00 ? 5  THR D HG22   1  
ATOM 2850   H HG23   . THR D 1 5  ? 8.027   -18.940 -14.146 1.00 0.00 ? 5  THR D HG23   1  
ATOM 2851   N N      . ARG D 1 6  ? 4.507   -16.352 -14.521 1.00 0.00 ? 6  ARG D N      1  
ATOM 2852   C CA     . ARG D 1 6  ? 3.874   -15.075 -14.804 1.00 0.00 ? 6  ARG D CA     1  
ATOM 2853   C C      . ARG D 1 6  ? 4.817   -13.950 -14.400 1.00 0.00 ? 6  ARG D C      1  
ATOM 2854   O O      . ARG D 1 6  ? 5.548   -14.076 -13.420 1.00 0.00 ? 6  ARG D O      1  
ATOM 2855   C CB     . ARG D 1 6  ? 2.537   -14.966 -14.071 1.00 0.00 ? 6  ARG D CB     1  
ATOM 2856   C CG     . ARG D 1 6  ? 1.402   -15.619 -14.859 1.00 0.00 ? 6  ARG D CG     1  
ATOM 2857   C CD     . ARG D 1 6  ? 0.608   -14.610 -15.688 1.00 0.00 ? 6  ARG D CD     1  
ATOM 2858   N NE     . ARG D 1 6  ? 1.343   -14.156 -16.874 1.00 0.00 ? 6  ARG D NE     1  
ATOM 2859   C CZ     . ARG D 1 6  ? 0.776   -13.905 -18.059 1.00 0.00 ? 6  ARG D CZ     1  
ATOM 2860   N NH1    . ARG D 1 6  ? -0.546  -13.886 -18.216 1.00 0.00 ? 6  ARG D NH1    1  
ATOM 2861   N NH2    . ARG D 1 6  ? 1.523   -13.677 -19.136 1.00 0.00 ? 6  ARG D NH2    1  
ATOM 2862   H H      . ARG D 1 6  ? 5.021   -16.440 -13.654 1.00 0.00 ? 6  ARG D H      1  
ATOM 2863   H HA     . ARG D 1 6  ? 3.706   -14.996 -15.879 1.00 0.00 ? 6  ARG D HA     1  
ATOM 2864   H HB2    . ARG D 1 6  ? 2.623   -15.447 -13.096 1.00 0.00 ? 6  ARG D HB2    1  
ATOM 2865   H HB3    . ARG D 1 6  ? 2.296   -13.915 -13.905 1.00 0.00 ? 6  ARG D HB3    1  
ATOM 2866   H HG2    . ARG D 1 6  ? 1.784   -16.403 -15.513 1.00 0.00 ? 6  ARG D HG2    1  
ATOM 2867   H HG3    . ARG D 1 6  ? 0.718   -16.090 -14.154 1.00 0.00 ? 6  ARG D HG3    1  
ATOM 2868   H HD2    . ARG D 1 6  ? -0.317  -15.094 -15.997 1.00 0.00 ? 6  ARG D HD2    1  
ATOM 2869   H HD3    . ARG D 1 6  ? 0.348   -13.756 -15.062 1.00 0.00 ? 6  ARG D HD3    1  
ATOM 2870   H HE     . ARG D 1 6  ? 2.342   -14.022 -16.802 1.00 0.00 ? 6  ARG D HE     1  
ATOM 2871   H HH11   . ARG D 1 6  ? -1.160  -13.961 -17.417 1.00 0.00 ? 6  ARG D HH11   1  
ATOM 2872   H HH12   . ARG D 1 6  ? -0.908  -13.699 -19.142 1.00 0.00 ? 6  ARG D HH12   1  
ATOM 2873   H HH21   . ARG D 1 6  ? 2.530   -13.705 -19.092 1.00 0.00 ? 6  ARG D HH21   1  
ATOM 2874   H HH22   . ARG D 1 6  ? 1.049   -13.548 -20.021 1.00 0.00 ? 6  ARG D HH22   1  
ATOM 2875   N N      . LYS D 1 7  ? 4.816   -12.857 -15.165 1.00 0.00 ? 7  LYS D N      1  
ATOM 2876   C CA     . LYS D 1 7  ? 5.539   -11.650 -14.803 1.00 0.00 ? 7  LYS D CA     1  
ATOM 2877   C C      . LYS D 1 7  ? 4.730   -10.840 -13.800 1.00 0.00 ? 7  LYS D C      1  
ATOM 2878   O O      . LYS D 1 7  ? 3.511   -10.982 -13.726 1.00 0.00 ? 7  LYS D O      1  
ATOM 2879   C CB     . LYS D 1 7  ? 5.825   -10.824 -16.055 1.00 0.00 ? 7  LYS D CB     1  
ATOM 2880   C CG     . LYS D 1 7  ? 6.915   -11.425 -16.941 1.00 0.00 ? 7  LYS D CG     1  
ATOM 2881   C CD     . LYS D 1 7  ? 8.288   -11.042 -16.386 1.00 0.00 ? 7  LYS D CD     1  
ATOM 2882   C CE     . LYS D 1 7  ? 9.471   -11.205 -17.339 1.00 0.00 ? 7  LYS D CE     1  
ATOM 2883   N NZ     . LYS D 1 7  ? 9.273   -10.527 -18.633 1.00 0.00 ? 7  LYS D NZ     1  
ATOM 2884   H H      . LYS D 1 7  ? 4.159   -12.802 -15.930 1.00 0.00 ? 7  LYS D H      1  
ATOM 2885   H HA     . LYS D 1 7  ? 6.483   -11.922 -14.332 1.00 0.00 ? 7  LYS D HA     1  
ATOM 2886   H HB2    . LYS D 1 7  ? 4.907   -10.722 -16.634 1.00 0.00 ? 7  LYS D HB2    1  
ATOM 2887   H HB3    . LYS D 1 7  ? 6.154   -9.832  -15.746 1.00 0.00 ? 7  LYS D HB3    1  
ATOM 2888   H HG2    . LYS D 1 7  ? 6.816   -12.508 -16.989 1.00 0.00 ? 7  LYS D HG2    1  
ATOM 2889   H HG3    . LYS D 1 7  ? 6.782   -11.010 -17.937 1.00 0.00 ? 7  LYS D HG3    1  
ATOM 2890   H HD2    . LYS D 1 7  ? 8.269   -10.004 -16.055 1.00 0.00 ? 7  LYS D HD2    1  
ATOM 2891   H HD3    . LYS D 1 7  ? 8.483   -11.678 -15.523 1.00 0.00 ? 7  LYS D HD3    1  
ATOM 2892   H HE2    . LYS D 1 7  ? 10.336  -10.770 -16.836 1.00 0.00 ? 7  LYS D HE2    1  
ATOM 2893   H HE3    . LYS D 1 7  ? 9.664   -12.264 -17.507 1.00 0.00 ? 7  LYS D HE3    1  
ATOM 2894   H HZ1    . LYS D 1 7  ? 8.736   -9.680  -18.519 1.00 0.00 ? 7  LYS D HZ1    1  
ATOM 2895   H HZ2    . LYS D 1 7  ? 10.171  -10.287 -19.029 1.00 0.00 ? 7  LYS D HZ2    1  
ATOM 2896   H HZ3    . LYS D 1 7  ? 8.804   -11.147 -19.281 1.00 0.00 ? 7  LYS D HZ3    1  
ATOM 2897   N N      . VAL D 1 8  ? 5.395   -9.962  -13.045 1.00 0.00 ? 8  VAL D N      1  
ATOM 2898   C CA     . VAL D 1 8  ? 4.722   -9.144  -12.047 1.00 0.00 ? 8  VAL D CA     1  
ATOM 2899   C C      . VAL D 1 8  ? 3.671   -8.245  -12.687 1.00 0.00 ? 8  VAL D C      1  
ATOM 2900   O O      . VAL D 1 8  ? 3.915   -7.606  -13.709 1.00 0.00 ? 8  VAL D O      1  
ATOM 2901   C CB     . VAL D 1 8  ? 5.731   -8.325  -11.240 1.00 0.00 ? 8  VAL D CB     1  
ATOM 2902   C CG1    . VAL D 1 8  ? 6.534   -9.240  -10.318 1.00 0.00 ? 8  VAL D CG1    1  
ATOM 2903   C CG2    . VAL D 1 8  ? 6.718   -7.550  -12.113 1.00 0.00 ? 8  VAL D CG2    1  
ATOM 2904   H H      . VAL D 1 8  ? 6.393   -9.853  -13.170 1.00 0.00 ? 8  VAL D H      1  
ATOM 2905   H HA     . VAL D 1 8  ? 4.193   -9.809  -11.362 1.00 0.00 ? 8  VAL D HA     1  
ATOM 2906   H HB     . VAL D 1 8  ? 5.182   -7.613  -10.624 1.00 0.00 ? 8  VAL D HB     1  
ATOM 2907   H HG11   . VAL D 1 8  ? 7.149   -9.920  -10.906 1.00 0.00 ? 8  VAL D HG11   1  
ATOM 2908   H HG12   . VAL D 1 8  ? 7.181   -8.632  -9.685  1.00 0.00 ? 8  VAL D HG12   1  
ATOM 2909   H HG13   . VAL D 1 8  ? 5.860   -9.823  -9.691  1.00 0.00 ? 8  VAL D HG13   1  
ATOM 2910   H HG21   . VAL D 1 8  ? 7.371   -6.961  -11.469 1.00 0.00 ? 8  VAL D HG21   1  
ATOM 2911   H HG22   . VAL D 1 8  ? 7.325   -8.238  -12.703 1.00 0.00 ? 8  VAL D HG22   1  
ATOM 2912   H HG23   . VAL D 1 8  ? 6.182   -6.877  -12.781 1.00 0.00 ? 8  VAL D HG23   1  
ATOM 2913   N N      . GLY D 1 9  ? 2.481   -8.218  -12.082 1.00 0.00 ? 9  GLY D N      1  
ATOM 2914   C CA     . GLY D 1 9  ? 1.353   -7.426  -12.543 1.00 0.00 ? 9  GLY D CA     1  
ATOM 2915   C C      . GLY D 1 9  ? 0.459   -8.154  -13.544 1.00 0.00 ? 9  GLY D C      1  
ATOM 2916   O O      . GLY D 1 9  ? -0.540  -7.587  -13.981 1.00 0.00 ? 9  GLY D O      1  
ATOM 2917   H H      . GLY D 1 9  ? 2.325   -8.821  -11.285 1.00 0.00 ? 9  GLY D H      1  
ATOM 2918   H HA2    . GLY D 1 9  ? 0.747   -7.153  -11.680 1.00 0.00 ? 9  GLY D HA2    1  
ATOM 2919   H HA3    . GLY D 1 9  ? 1.719   -6.511  -13.006 1.00 0.00 ? 9  GLY D HA3    1  
ATOM 2920   N N      . GLU D 1 10 ? 0.788   -9.396  -13.910 1.00 0.00 ? 10 GLU D N      1  
ATOM 2921   C CA     . GLU D 1 10 ? -0.013  -10.190 -14.830 1.00 0.00 ? 10 GLU D CA     1  
ATOM 2922   C C      . GLU D 1 10 ? -1.075  -11.015 -14.103 1.00 0.00 ? 10 GLU D C      1  
ATOM 2923   O O      . GLU D 1 10 ? -1.036  -11.173 -12.883 1.00 0.00 ? 10 GLU D O      1  
ATOM 2924   C CB     . GLU D 1 10 ? 0.891   -11.083 -15.680 1.00 0.00 ? 10 GLU D CB     1  
ATOM 2925   C CG     . GLU D 1 10 ? 1.857   -10.291 -16.563 1.00 0.00 ? 10 GLU D CG     1  
ATOM 2926   C CD     . GLU D 1 10 ? 1.133   -9.358  -17.530 1.00 0.00 ? 10 GLU D CD     1  
ATOM 2927   O OE1    . GLU D 1 10 ? 0.160   -9.811  -18.173 1.00 0.00 ? 10 GLU D OE1    1  
ATOM 2928   O OE2    . GLU D 1 10 ? 1.561   -8.189  -17.650 1.00 0.00 ? 10 GLU D OE2    1  
ATOM 2929   H H      . GLU D 1 10 ? 1.623   -9.819  -13.529 1.00 0.00 ? 10 GLU D H      1  
ATOM 2930   H HA     . GLU D 1 10 ? -0.542  -9.515  -15.503 1.00 0.00 ? 10 GLU D HA     1  
ATOM 2931   H HB2    . GLU D 1 10 ? 1.462   -11.741 -15.026 1.00 0.00 ? 10 GLU D HB2    1  
ATOM 2932   H HB3    . GLU D 1 10 ? 0.265   -11.701 -16.322 1.00 0.00 ? 10 GLU D HB3    1  
ATOM 2933   H HG2    . GLU D 1 10 ? 2.532   -9.714  -15.930 1.00 0.00 ? 10 GLU D HG2    1  
ATOM 2934   H HG3    . GLU D 1 10 ? 2.458   -10.998 -17.135 1.00 0.00 ? 10 GLU D HG3    1  
ATOM 2935   N N      . SER D 1 11 ? -2.017  -11.572 -14.870 1.00 0.00 ? 11 SER D N      1  
ATOM 2936   C CA     . SER D 1 11 ? -3.226  -12.180 -14.336 1.00 0.00 ? 11 SER D CA     1  
ATOM 2937   C C      . SER D 1 11 ? -3.393  -13.644 -14.733 1.00 0.00 ? 11 SER D C      1  
ATOM 2938   O O      . SER D 1 11 ? -2.783  -14.131 -15.686 1.00 0.00 ? 11 SER D O      1  
ATOM 2939   C CB     . SER D 1 11 ? -4.436  -11.350 -14.756 1.00 0.00 ? 11 SER D CB     1  
ATOM 2940   O OG     . SER D 1 11 ? -4.333  -10.039 -14.244 1.00 0.00 ? 11 SER D OG     1  
ATOM 2941   H H      . SER D 1 11 ? -1.965  -11.444 -15.871 1.00 0.00 ? 11 SER D H      1  
ATOM 2942   H HA     . SER D 1 11 ? -3.181  -12.150 -13.247 1.00 0.00 ? 11 SER D HA     1  
ATOM 2943   H HB2    . SER D 1 11 ? -4.480  -11.307 -15.845 1.00 0.00 ? 11 SER D HB2    1  
ATOM 2944   H HB3    . SER D 1 11 ? -5.344  -11.815 -14.372 1.00 0.00 ? 11 SER D HB3    1  
ATOM 2945   H HG     . SER D 1 11 ? -5.096  -9.534  -14.546 1.00 0.00 ? 11 SER D HG     1  
ATOM 2946   N N      . ILE D 1 12 ? -4.252  -14.336 -13.981 1.00 0.00 ? 12 ILE D N      1  
ATOM 2947   C CA     . ILE D 1 12 ? -4.454  -15.777 -13.943 1.00 0.00 ? 12 ILE D CA     1  
ATOM 2948   C C      . ILE D 1 12 ? -5.914  -16.042 -13.570 1.00 0.00 ? 12 ILE D C      1  
ATOM 2949   O O      . ILE D 1 12 ? -6.586  -15.168 -13.026 1.00 0.00 ? 12 ILE D O      1  
ATOM 2950   C CB     . ILE D 1 12 ? -3.495  -16.392 -12.913 1.00 0.00 ? 12 ILE D CB     1  
ATOM 2951   C CG1    . ILE D 1 12 ? -2.026  -16.148 -13.271 1.00 0.00 ? 12 ILE D CG1    1  
ATOM 2952   C CG2    . ILE D 1 12 ? -3.720  -17.892 -12.700 1.00 0.00 ? 12 ILE D CG2    1  
ATOM 2953   C CD1    . ILE D 1 12 ? -1.092  -16.720 -12.206 1.00 0.00 ? 12 ILE D CD1    1  
ATOM 2954   H H      . ILE D 1 12 ? -4.841  -13.803 -13.356 1.00 0.00 ? 12 ILE D H      1  
ATOM 2955   H HA     . ILE D 1 12 ? -4.258  -16.207 -14.924 1.00 0.00 ? 12 ILE D HA     1  
ATOM 2956   H HB     . ILE D 1 12 ? -3.667  -15.885 -11.966 1.00 0.00 ? 12 ILE D HB     1  
ATOM 2957   H HG12   . ILE D 1 12 ? -1.798  -16.599 -14.237 1.00 0.00 ? 12 ILE D HG12   1  
ATOM 2958   H HG13   . ILE D 1 12 ? -1.836  -15.076 -13.324 1.00 0.00 ? 12 ILE D HG13   1  
ATOM 2959   H HG21   . ILE D 1 12 ? -4.717  -18.084 -12.308 1.00 0.00 ? 12 ILE D HG21   1  
ATOM 2960   H HG22   . ILE D 1 12 ? -3.573  -18.431 -13.635 1.00 0.00 ? 12 ILE D HG22   1  
ATOM 2961   H HG23   . ILE D 1 12 ? -3.025  -18.287 -11.958 1.00 0.00 ? 12 ILE D HG23   1  
ATOM 2962   H HD11   . ILE D 1 12 ? -1.545  -16.603 -11.222 1.00 0.00 ? 12 ILE D HD11   1  
ATOM 2963   H HD12   . ILE D 1 12 ? -0.923  -17.777 -12.407 1.00 0.00 ? 12 ILE D HD12   1  
ATOM 2964   H HD13   . ILE D 1 12 ? -0.141  -16.186 -12.220 1.00 0.00 ? 12 ILE D HD13   1  
ATOM 2965   N N      . ASN D 1 13 ? -6.418  -17.251 -13.828 1.00 0.00 ? 13 ASN D N      1  
ATOM 2966   C CA     . ASN D 1 13 ? -7.778  -17.651 -13.500 1.00 0.00 ? 13 ASN D CA     1  
ATOM 2967   C C      . ASN D 1 13 ? -7.867  -19.104 -13.044 1.00 0.00 ? 13 ASN D C      1  
ATOM 2968   O O      . ASN D 1 13 ? -7.070  -19.947 -13.453 1.00 0.00 ? 13 ASN D O      1  
ATOM 2969   C CB     . ASN D 1 13 ? -8.685  -17.425 -14.709 1.00 0.00 ? 13 ASN D CB     1  
ATOM 2970   C CG     . ASN D 1 13 ? -9.085  -15.963 -14.840 1.00 0.00 ? 13 ASN D CG     1  
ATOM 2971   O OD1    . ASN D 1 13 ? -8.534  -15.227 -15.652 1.00 0.00 ? 13 ASN D OD1    1  
ATOM 2972   N ND2    . ASN D 1 13 ? -10.032 -15.519 -14.018 1.00 0.00 ? 13 ASN D ND2    1  
ATOM 2973   H H      . ASN D 1 13 ? -5.790  -17.956 -14.190 1.00 0.00 ? 13 ASN D H      1  
ATOM 2974   H HA     . ASN D 1 13 ? -8.138  -17.033 -12.677 1.00 0.00 ? 13 ASN D HA     1  
ATOM 2975   H HB2    . ASN D 1 13 ? -8.168  -17.744 -15.613 1.00 0.00 ? 13 ASN D HB2    1  
ATOM 2976   H HB3    . ASN D 1 13 ? -9.591  -18.021 -14.600 1.00 0.00 ? 13 ASN D HB3    1  
ATOM 2977   H HD21   . ASN D 1 13 ? -10.426 -16.133 -13.319 1.00 0.00 ? 13 ASN D HD21   1  
ATOM 2978   H HD22   . ASN D 1 13 ? -10.251 -14.534 -14.004 1.00 0.00 ? 13 ASN D HD22   1  
ATOM 2979   N N      . ILE D 1 14 ? -8.883  -19.391 -12.224 1.00 0.00 ? 14 ILE D N      1  
ATOM 2980   C CA     . ILE D 1 14 ? -9.210  -20.724 -11.743 1.00 0.00 ? 14 ILE D CA     1  
ATOM 2981   C C      . ILE D 1 14 ? -10.718 -20.943 -11.856 1.00 0.00 ? 14 ILE D C      1  
ATOM 2982   O O      . ILE D 1 14 ? -11.508 -20.037 -11.597 1.00 0.00 ? 14 ILE D O      1  
ATOM 2983   C CB     . ILE D 1 14 ? -8.705  -20.911 -10.307 1.00 0.00 ? 14 ILE D CB     1  
ATOM 2984   C CG1    . ILE D 1 14 ? -7.187  -20.709 -10.252 1.00 0.00 ? 14 ILE D CG1    1  
ATOM 2985   C CG2    . ILE D 1 14 ? -9.098  -22.290 -9.774  1.00 0.00 ? 14 ILE D CG2    1  
ATOM 2986   C CD1    . ILE D 1 14 ? -6.582  -20.945 -8.869  1.00 0.00 ? 14 ILE D CD1    1  
ATOM 2987   H H      . ILE D 1 14 ? -9.524  -18.650 -11.975 1.00 0.00 ? 14 ILE D H      1  
ATOM 2988   H HA     . ILE D 1 14 ? -8.715  -21.459 -12.376 1.00 0.00 ? 14 ILE D HA     1  
ATOM 2989   H HB     . ILE D 1 14 ? -9.168  -20.157 -9.671  1.00 0.00 ? 14 ILE D HB     1  
ATOM 2990   H HG12   . ILE D 1 14 ? -6.706  -21.379 -10.965 1.00 0.00 ? 14 ILE D HG12   1  
ATOM 2991   H HG13   . ILE D 1 14 ? -6.962  -19.680 -10.537 1.00 0.00 ? 14 ILE D HG13   1  
ATOM 2992   H HG21   . ILE D 1 14 ? -8.753  -22.413 -8.748  1.00 0.00 ? 14 ILE D HG21   1  
ATOM 2993   H HG22   . ILE D 1 14 ? -10.183 -22.396 -9.766  1.00 0.00 ? 14 ILE D HG22   1  
ATOM 2994   H HG23   . ILE D 1 14 ? -8.663  -23.071 -10.397 1.00 0.00 ? 14 ILE D HG23   1  
ATOM 2995   H HD11   . ILE D 1 14 ? -6.597  -22.008 -8.629  1.00 0.00 ? 14 ILE D HD11   1  
ATOM 2996   H HD12   . ILE D 1 14 ? -5.546  -20.605 -8.866  1.00 0.00 ? 14 ILE D HD12   1  
ATOM 2997   H HD13   . ILE D 1 14 ? -7.144  -20.389 -8.119  1.00 0.00 ? 14 ILE D HD13   1  
ATOM 2998   N N      . GLY D 1 15 ? -11.128 -22.149 -12.253 1.00 0.00 ? 15 GLY D N      1  
ATOM 2999   C CA     . GLY D 1 15 ? -12.526 -22.495 -12.443 1.00 0.00 ? 15 GLY D CA     1  
ATOM 3000   C C      . GLY D 1 15 ? -13.182 -21.611 -13.499 1.00 0.00 ? 15 GLY D C      1  
ATOM 3001   O O      . GLY D 1 15 ? -12.601 -21.356 -14.553 1.00 0.00 ? 15 GLY D O      1  
ATOM 3002   H H      . GLY D 1 15 ? -10.433 -22.841 -12.495 1.00 0.00 ? 15 GLY D H      1  
ATOM 3003   H HA2    . GLY D 1 15 ? -12.605 -23.535 -12.760 1.00 0.00 ? 15 GLY D HA2    1  
ATOM 3004   H HA3    . GLY D 1 15 ? -13.054 -22.378 -11.497 1.00 0.00 ? 15 GLY D HA3    1  
ATOM 3005   N N      . ASP D 1 16 ? -14.392 -21.134 -13.201 1.00 0.00 ? 16 ASP D N      1  
ATOM 3006   C CA     . ASP D 1 16 ? -15.118 -20.179 -14.024 1.00 0.00 ? 16 ASP D CA     1  
ATOM 3007   C C      . ASP D 1 16 ? -15.550 -18.955 -13.216 1.00 0.00 ? 16 ASP D C      1  
ATOM 3008   O O      . ASP D 1 16 ? -16.332 -18.137 -13.695 1.00 0.00 ? 16 ASP D O      1  
ATOM 3009   C CB     . ASP D 1 16 ? -16.304 -20.899 -14.668 1.00 0.00 ? 16 ASP D CB     1  
ATOM 3010   C CG     . ASP D 1 16 ? -16.816 -20.186 -15.917 1.00 0.00 ? 16 ASP D CG     1  
ATOM 3011   O OD1    . ASP D 1 16 ? -16.059 -20.135 -16.913 1.00 0.00 ? 16 ASP D OD1    1  
ATOM 3012   O OD2    . ASP D 1 16 ? -17.998 -19.776 -15.917 1.00 0.00 ? 16 ASP D OD2    1  
ATOM 3013   H H      . ASP D 1 16 ? -14.844 -21.453 -12.355 1.00 0.00 ? 16 ASP D H      1  
ATOM 3014   H HA     . ASP D 1 16 ? -14.460 -19.828 -14.819 1.00 0.00 ? 16 ASP D HA     1  
ATOM 3015   H HB2    . ASP D 1 16 ? -15.995 -21.905 -14.954 1.00 0.00 ? 16 ASP D HB2    1  
ATOM 3016   H HB3    . ASP D 1 16 ? -17.107 -20.990 -13.936 1.00 0.00 ? 16 ASP D HB3    1  
ATOM 3017   N N      . ASP D 1 17 ? -15.051 -18.822 -11.981 1.00 0.00 ? 17 ASP D N      1  
ATOM 3018   C CA     . ASP D 1 17 ? -15.496 -17.813 -11.030 1.00 0.00 ? 17 ASP D CA     1  
ATOM 3019   C C      . ASP D 1 17 ? -14.346 -17.112 -10.308 1.00 0.00 ? 17 ASP D C      1  
ATOM 3020   O O      . ASP D 1 17 ? -14.577 -16.093 -9.659  1.00 0.00 ? 17 ASP D O      1  
ATOM 3021   C CB     . ASP D 1 17 ? -16.431 -18.448 -10.000 1.00 0.00 ? 17 ASP D CB     1  
ATOM 3022   C CG     . ASP D 1 17 ? -17.693 -19.020 -10.638 1.00 0.00 ? 17 ASP D CG     1  
ATOM 3023   O OD1    . ASP D 1 17 ? -18.637 -18.234 -10.874 1.00 0.00 ? 17 ASP D OD1    1  
ATOM 3024   O OD2    . ASP D 1 17 ? -17.739 -20.253 -10.846 1.00 0.00 ? 17 ASP D OD2    1  
ATOM 3025   H H      . ASP D 1 17 ? -14.397 -19.518 -11.654 1.00 0.00 ? 17 ASP D H      1  
ATOM 3026   H HA     . ASP D 1 17 ? -16.056 -17.044 -11.563 1.00 0.00 ? 17 ASP D HA     1  
ATOM 3027   H HB2    . ASP D 1 17 ? -15.901 -19.231 -9.457  1.00 0.00 ? 17 ASP D HB2    1  
ATOM 3028   H HB3    . ASP D 1 17 ? -16.722 -17.687 -9.276  1.00 0.00 ? 17 ASP D HB3    1  
ATOM 3029   N N      . ILE D 1 18 ? -13.120 -17.639 -10.388 1.00 0.00 ? 18 ILE D N      1  
ATOM 3030   C CA     . ILE D 1 18 ? -11.993 -17.160 -9.601  1.00 0.00 ? 18 ILE D CA     1  
ATOM 3031   C C      . ILE D 1 18 ? -10.944 -16.522 -10.507 1.00 0.00 ? 18 ILE D C      1  
ATOM 3032   O O      . ILE D 1 18 ? -10.592 -17.062 -11.554 1.00 0.00 ? 18 ILE D O      1  
ATOM 3033   C CB     . ILE D 1 18 ? -11.401 -18.291 -8.754  1.00 0.00 ? 18 ILE D CB     1  
ATOM 3034   C CG1    . ILE D 1 18 ? -12.443 -18.892 -7.804  1.00 0.00 ? 18 ILE D CG1    1  
ATOM 3035   C CG2    . ILE D 1 18 ? -10.209 -17.788 -7.938  1.00 0.00 ? 18 ILE D CG2    1  
ATOM 3036   C CD1    . ILE D 1 18 ? -13.042 -20.184 -8.357  1.00 0.00 ? 18 ILE D CD1    1  
ATOM 3037   H H      . ILE D 1 18 ? -12.957 -18.429 -10.995 1.00 0.00 ? 18 ILE D H      1  
ATOM 3038   H HA     . ILE D 1 18 ? -12.345 -16.390 -8.915  1.00 0.00 ? 18 ILE D HA     1  
ATOM 3039   H HB     . ILE D 1 18 ? -11.039 -19.076 -9.415  1.00 0.00 ? 18 ILE D HB     1  
ATOM 3040   H HG12   . ILE D 1 18 ? -11.979 -19.122 -6.844  1.00 0.00 ? 18 ILE D HG12   1  
ATOM 3041   H HG13   . ILE D 1 18 ? -13.241 -18.170 -7.629  1.00 0.00 ? 18 ILE D HG13   1  
ATOM 3042   H HG21   . ILE D 1 18 ? -9.392  -17.506 -8.603  1.00 0.00 ? 18 ILE D HG21   1  
ATOM 3043   H HG22   . ILE D 1 18 ? -10.502 -16.925 -7.341  1.00 0.00 ? 18 ILE D HG22   1  
ATOM 3044   H HG23   . ILE D 1 18 ? -9.851  -18.578 -7.278  1.00 0.00 ? 18 ILE D HG23   1  
ATOM 3045   H HD11   . ILE D 1 18 ? -13.780 -20.570 -7.654  1.00 0.00 ? 18 ILE D HD11   1  
ATOM 3046   H HD12   . ILE D 1 18 ? -13.527 -19.997 -9.315  1.00 0.00 ? 18 ILE D HD12   1  
ATOM 3047   H HD13   . ILE D 1 18 ? -12.255 -20.926 -8.491  1.00 0.00 ? 18 ILE D HD13   1  
ATOM 3048   N N      . THR D 1 19 ? -10.407 -15.383 -10.066 1.00 0.00 ? 19 THR D N      1  
ATOM 3049   C CA     . THR D 1 19 ? -9.271  -14.721 -10.687 1.00 0.00 ? 19 THR D CA     1  
ATOM 3050   C C      . THR D 1 19 ? -8.111  -14.672 -9.699  1.00 0.00 ? 19 THR D C      1  
ATOM 3051   O O      . THR D 1 19 ? -8.317  -14.556 -8.493  1.00 0.00 ? 19 THR D O      1  
ATOM 3052   C CB     . THR D 1 19 ? -9.673  -13.322 -11.159 1.00 0.00 ? 19 THR D CB     1  
ATOM 3053   O OG1    . THR D 1 19 ? -10.793 -13.404 -12.012 1.00 0.00 ? 19 THR D OG1    1  
ATOM 3054   C CG2    . THR D 1 19 ? -8.563  -12.619 -11.936 1.00 0.00 ? 19 THR D CG2    1  
ATOM 3055   H H      . THR D 1 19 ? -10.729 -15.008 -9.183  1.00 0.00 ? 19 THR D H      1  
ATOM 3056   H HA     . THR D 1 19 ? -8.945  -15.299 -11.551 1.00 0.00 ? 19 THR D HA     1  
ATOM 3057   H HB     . THR D 1 19 ? -9.937  -12.712 -10.294 1.00 0.00 ? 19 THR D HB     1  
ATOM 3058   H HG1    . THR D 1 19 ? -11.551 -13.674 -11.485 1.00 0.00 ? 19 THR D HG1    1  
ATOM 3059   H HG21   . THR D 1 19 ? -7.703  -12.445 -11.290 1.00 0.00 ? 19 THR D HG21   1  
ATOM 3060   H HG22   . THR D 1 19 ? -8.265  -13.230 -12.789 1.00 0.00 ? 19 THR D HG22   1  
ATOM 3061   H HG23   . THR D 1 19 ? -8.930  -11.658 -12.298 1.00 0.00 ? 19 THR D HG23   1  
ATOM 3062   N N      . ILE D 1 20 ? -6.887  -14.793 -10.214 1.00 0.00 ? 20 ILE D N      1  
ATOM 3063   C CA     . ILE D 1 20 ? -5.654  -14.746 -9.446  1.00 0.00 ? 20 ILE D CA     1  
ATOM 3064   C C      . ILE D 1 20 ? -4.730  -13.729 -10.111 1.00 0.00 ? 20 ILE D C      1  
ATOM 3065   O O      . ILE D 1 20 ? -4.730  -13.598 -11.333 1.00 0.00 ? 20 ILE D O      1  
ATOM 3066   C CB     . ILE D 1 20 ? -5.028  -16.144 -9.391  1.00 0.00 ? 20 ILE D CB     1  
ATOM 3067   C CG1    . ILE D 1 20 ? -5.945  -17.217 -8.798  1.00 0.00 ? 20 ILE D CG1    1  
ATOM 3068   C CG2    . ILE D 1 20 ? -3.689  -16.126 -8.653  1.00 0.00 ? 20 ILE D CG2    1  
ATOM 3069   C CD1    . ILE D 1 20 ? -6.238  -17.046 -7.310  1.00 0.00 ? 20 ILE D CD1    1  
ATOM 3070   H H      . ILE D 1 20 ? -6.792  -14.838 -11.220 1.00 0.00 ? 20 ILE D H      1  
ATOM 3071   H HA     . ILE D 1 20 ? -5.863  -14.408 -8.431  1.00 0.00 ? 20 ILE D HA     1  
ATOM 3072   H HB     . ILE D 1 20 ? -4.837  -16.458 -10.416 1.00 0.00 ? 20 ILE D HB     1  
ATOM 3073   H HG12   . ILE D 1 20 ? -6.889  -17.231 -9.343  1.00 0.00 ? 20 ILE D HG12   1  
ATOM 3074   H HG13   . ILE D 1 20 ? -5.472  -18.189 -8.942  1.00 0.00 ? 20 ILE D HG13   1  
ATOM 3075   H HG21   . ILE D 1 20 ? -3.328  -17.145 -8.520  1.00 0.00 ? 20 ILE D HG21   1  
ATOM 3076   H HG22   . ILE D 1 20 ? -2.951  -15.571 -9.233  1.00 0.00 ? 20 ILE D HG22   1  
ATOM 3077   H HG23   . ILE D 1 20 ? -3.804  -15.655 -7.676  1.00 0.00 ? 20 ILE D HG23   1  
ATOM 3078   H HD11   . ILE D 1 20 ? -6.969  -17.792 -7.000  1.00 0.00 ? 20 ILE D HD11   1  
ATOM 3079   H HD12   . ILE D 1 20 ? -5.325  -17.187 -6.731  1.00 0.00 ? 20 ILE D HD12   1  
ATOM 3080   H HD13   . ILE D 1 20 ? -6.642  -16.052 -7.126  1.00 0.00 ? 20 ILE D HD13   1  
ATOM 3081   N N      . THR D 1 21 ? -3.949  -12.985 -9.324  1.00 0.00 ? 21 THR D N      1  
ATOM 3082   C CA     . THR D 1 21 ? -3.058  -11.956 -9.838  1.00 0.00 ? 21 THR D CA     1  
ATOM 3083   C C      . THR D 1 21 ? -1.724  -12.035 -9.109  1.00 0.00 ? 21 THR D C      1  
ATOM 3084   O O      . THR D 1 21 ? -1.704  -12.202 -7.892  1.00 0.00 ? 21 THR D O      1  
ATOM 3085   C CB     . THR D 1 21 ? -3.673  -10.566 -9.656  1.00 0.00 ? 21 THR D CB     1  
ATOM 3086   O OG1    . THR D 1 21 ? -5.050  -10.565 -9.958  1.00 0.00 ? 21 THR D OG1    1  
ATOM 3087   C CG2    . THR D 1 21 ? -3.007  -9.543  -10.574 1.00 0.00 ? 21 THR D CG2    1  
ATOM 3088   H H      . THR D 1 21 ? -3.985  -13.122 -8.323  1.00 0.00 ? 21 THR D H      1  
ATOM 3089   H HA     . THR D 1 21 ? -2.880  -12.122 -10.901 1.00 0.00 ? 21 THR D HA     1  
ATOM 3090   H HB     . THR D 1 21 ? -3.545  -10.254 -8.619  1.00 0.00 ? 21 THR D HB     1  
ATOM 3091   H HG1    . THR D 1 21 ? -5.505  -11.072 -9.279  1.00 0.00 ? 21 THR D HG1    1  
ATOM 3092   H HG21   . THR D 1 21 ? -3.160  -9.830  -11.614 1.00 0.00 ? 21 THR D HG21   1  
ATOM 3093   H HG22   . THR D 1 21 ? -3.451  -8.562  -10.403 1.00 0.00 ? 21 THR D HG22   1  
ATOM 3094   H HG23   . THR D 1 21 ? -1.938  -9.493  -10.367 1.00 0.00 ? 21 THR D HG23   1  
ATOM 3095   N N      . ILE D 1 22 ? -0.601  -11.881 -9.815  1.00 0.00 ? 22 ILE D N      1  
ATOM 3096   C CA     . ILE D 1 22 ? 0.688   -11.726 -9.166  1.00 0.00 ? 22 ILE D CA     1  
ATOM 3097   C C      . ILE D 1 22 ? 0.947   -10.225 -9.071  1.00 0.00 ? 22 ILE D C      1  
ATOM 3098   O O      . ILE D 1 22 ? 1.141   -9.554  -10.081 1.00 0.00 ? 22 ILE D O      1  
ATOM 3099   C CB     . ILE D 1 22 ? 1.727   -12.569 -9.914  1.00 0.00 ? 22 ILE D CB     1  
ATOM 3100   C CG1    . ILE D 1 22 ? 3.022   -12.776 -9.126  1.00 0.00 ? 22 ILE D CG1    1  
ATOM 3101   C CG2    . ILE D 1 22 ? 2.042   -12.088 -11.329 1.00 0.00 ? 22 ILE D CG2    1  
ATOM 3102   C CD1    . ILE D 1 22 ? 3.635   -11.504 -8.546  1.00 0.00 ? 22 ILE D CD1    1  
ATOM 3103   H H      . ILE D 1 22 ? -0.638  -11.660 -10.802 1.00 0.00 ? 22 ILE D H      1  
ATOM 3104   H HA     . ILE D 1 22 ? 0.630   -12.124 -8.152  1.00 0.00 ? 22 ILE D HA     1  
ATOM 3105   H HB     . ILE D 1 22 ? 1.290   -13.562 -10.026 1.00 0.00 ? 22 ILE D HB     1  
ATOM 3106   H HG12   . ILE D 1 22 ? 2.808   -13.449 -8.299  1.00 0.00 ? 22 ILE D HG12   1  
ATOM 3107   H HG13   . ILE D 1 22 ? 3.756   -13.258 -9.772  1.00 0.00 ? 22 ILE D HG13   1  
ATOM 3108   H HG21   . ILE D 1 22 ? 2.701   -12.805 -11.816 1.00 0.00 ? 22 ILE D HG21   1  
ATOM 3109   H HG22   . ILE D 1 22 ? 1.124   -12.007 -11.910 1.00 0.00 ? 22 ILE D HG22   1  
ATOM 3110   H HG23   . ILE D 1 22 ? 2.538   -11.120 -11.300 1.00 0.00 ? 22 ILE D HG23   1  
ATOM 3111   H HD11   . ILE D 1 22 ? 3.084   -11.224 -7.648  1.00 0.00 ? 22 ILE D HD11   1  
ATOM 3112   H HD12   . ILE D 1 22 ? 4.674   -11.699 -8.284  1.00 0.00 ? 22 ILE D HD12   1  
ATOM 3113   H HD13   . ILE D 1 22 ? 3.603   -10.697 -9.278  1.00 0.00 ? 22 ILE D HD13   1  
ATOM 3114   N N      . LEU D 1 23 ? 0.814   -9.655  -7.870  1.00 0.00 ? 23 LEU D N      1  
ATOM 3115   C CA     . LEU D 1 23 ? 0.812   -8.213  -7.684  1.00 0.00 ? 23 LEU D CA     1  
ATOM 3116   C C      . LEU D 1 23 ? 2.230   -7.650  -7.719  1.00 0.00 ? 23 LEU D C      1  
ATOM 3117   O O      . LEU D 1 23 ? 2.436   -6.545  -8.219  1.00 0.00 ? 23 LEU D O      1  
ATOM 3118   C CB     . LEU D 1 23 ? 0.107   -7.834  -6.382  1.00 0.00 ? 23 LEU D CB     1  
ATOM 3119   C CG     . LEU D 1 23 ? -1.278  -8.460  -6.226  1.00 0.00 ? 23 LEU D CG     1  
ATOM 3120   C CD1    . LEU D 1 23 ? -1.879  -8.002  -4.902  1.00 0.00 ? 23 LEU D CD1    1  
ATOM 3121   C CD2    . LEU D 1 23 ? -2.248  -8.044  -7.328  1.00 0.00 ? 23 LEU D CD2    1  
ATOM 3122   H H      . LEU D 1 23 ? 0.730   -10.240 -7.050  1.00 0.00 ? 23 LEU D H      1  
ATOM 3123   H HA     . LEU D 1 23 ? 0.263   -7.759  -8.510  1.00 0.00 ? 23 LEU D HA     1  
ATOM 3124   H HB2    . LEU D 1 23 ? 0.730   -8.153  -5.549  1.00 0.00 ? 23 LEU D HB2    1  
ATOM 3125   H HB3    . LEU D 1 23 ? 0.012   -6.749  -6.341  1.00 0.00 ? 23 LEU D HB3    1  
ATOM 3126   H HG     . LEU D 1 23 ? -1.193  -9.546  -6.216  1.00 0.00 ? 23 LEU D HG     1  
ATOM 3127   H HD11   . LEU D 1 23 ? -1.875  -6.913  -4.847  1.00 0.00 ? 23 LEU D HD11   1  
ATOM 3128   H HD12   . LEU D 1 23 ? -2.906  -8.359  -4.840  1.00 0.00 ? 23 LEU D HD12   1  
ATOM 3129   H HD13   . LEU D 1 23 ? -1.296  -8.413  -4.077  1.00 0.00 ? 23 LEU D HD13   1  
ATOM 3130   H HD21   . LEU D 1 23 ? -1.870  -8.372  -8.296  1.00 0.00 ? 23 LEU D HD21   1  
ATOM 3131   H HD22   . LEU D 1 23 ? -3.215  -8.511  -7.144  1.00 0.00 ? 23 LEU D HD22   1  
ATOM 3132   H HD23   . LEU D 1 23 ? -2.363  -6.960  -7.327  1.00 0.00 ? 23 LEU D HD23   1  
ATOM 3133   N N      . GLY D 1 24 ? 3.219   -8.406  -7.232  1.00 0.00 ? 24 GLY D N      1  
ATOM 3134   C CA     . GLY D 1 24 ? 4.621   -8.061  -7.414  1.00 0.00 ? 24 GLY D CA     1  
ATOM 3135   C C      . GLY D 1 24 ? 5.562   -8.927  -6.583  1.00 0.00 ? 24 GLY D C      1  
ATOM 3136   O O      . GLY D 1 24 ? 5.116   -9.854  -5.911  1.00 0.00 ? 24 GLY D O      1  
ATOM 3137   H H      . GLY D 1 24 ? 2.997   -9.285  -6.785  1.00 0.00 ? 24 GLY D H      1  
ATOM 3138   H HA2    . GLY D 1 24 ? 4.878   -8.178  -8.466  1.00 0.00 ? 24 GLY D HA2    1  
ATOM 3139   H HA3    . GLY D 1 24 ? 4.779   -7.016  -7.144  1.00 0.00 ? 24 GLY D HA3    1  
ATOM 3140   N N      . VAL D 1 25 ? 6.861   -8.617  -6.608  1.00 0.00 ? 25 VAL D N      1  
ATOM 3141   C CA     . VAL D 1 25 ? 7.839   -9.208  -5.704  1.00 0.00 ? 25 VAL D CA     1  
ATOM 3142   C C      . VAL D 1 25 ? 8.338   -8.188  -4.687  1.00 0.00 ? 25 VAL D C      1  
ATOM 3143   O O      . VAL D 1 25 ? 8.318   -6.986  -4.943  1.00 0.00 ? 25 VAL D O      1  
ATOM 3144   C CB     . VAL D 1 25 ? 9.024   -9.833  -6.445  1.00 0.00 ? 25 VAL D CB     1  
ATOM 3145   C CG1    . VAL D 1 25 ? 8.566   -10.814 -7.524  1.00 0.00 ? 25 VAL D CG1    1  
ATOM 3146   C CG2    . VAL D 1 25 ? 9.947   -8.777  -7.052  1.00 0.00 ? 25 VAL D CG2    1  
ATOM 3147   H H      . VAL D 1 25 ? 7.170   -7.857  -7.197  1.00 0.00 ? 25 VAL D H      1  
ATOM 3148   H HA     . VAL D 1 25 ? 7.356   -10.009 -5.146  1.00 0.00 ? 25 VAL D HA     1  
ATOM 3149   H HB     . VAL D 1 25 ? 9.613   -10.399 -5.723  1.00 0.00 ? 25 VAL D HB     1  
ATOM 3150   H HG11   . VAL D 1 25 ? 7.878   -11.540 -7.091  1.00 0.00 ? 25 VAL D HG11   1  
ATOM 3151   H HG12   . VAL D 1 25 ? 8.068   -10.278 -8.332  1.00 0.00 ? 25 VAL D HG12   1  
ATOM 3152   H HG13   . VAL D 1 25 ? 9.433   -11.339 -7.926  1.00 0.00 ? 25 VAL D HG13   1  
ATOM 3153   H HG21   . VAL D 1 25 ? 9.381   -8.118  -7.711  1.00 0.00 ? 25 VAL D HG21   1  
ATOM 3154   H HG22   . VAL D 1 25 ? 10.403  -8.193  -6.252  1.00 0.00 ? 25 VAL D HG22   1  
ATOM 3155   H HG23   . VAL D 1 25 ? 10.737  -9.267  -7.619  1.00 0.00 ? 25 VAL D HG23   1  
ATOM 3156   N N      . SER D 1 26 ? 8.862   -8.690  -3.565  1.00 0.00 ? 26 SER D N      1  
ATOM 3157   C CA     . SER D 1 26 ? 9.578   -7.901  -2.576  1.00 0.00 ? 26 SER D CA     1  
ATOM 3158   C C      . SER D 1 26 ? 10.716  -8.731  -1.990  1.00 0.00 ? 26 SER D C      1  
ATOM 3159   O O      . SER D 1 26 ? 10.575  -9.338  -0.930  1.00 0.00 ? 26 SER D O      1  
ATOM 3160   C CB     . SER D 1 26 ? 8.626   -7.439  -1.475  1.00 0.00 ? 26 SER D CB     1  
ATOM 3161   O OG     . SER D 1 26 ? 7.639   -6.566  -1.983  1.00 0.00 ? 26 SER D OG     1  
ATOM 3162   H H      . SER D 1 26 ? 8.838   -9.692  -3.433  1.00 0.00 ? 26 SER D H      1  
ATOM 3163   H HA     . SER D 1 26 ? 10.008  -7.020  -3.053  1.00 0.00 ? 26 SER D HA     1  
ATOM 3164   H HB2    . SER D 1 26 ? 8.141   -8.308  -1.030  1.00 0.00 ? 26 SER D HB2    1  
ATOM 3165   H HB3    . SER D 1 26 ? 9.205   -6.918  -0.712  1.00 0.00 ? 26 SER D HB3    1  
ATOM 3166   H HG     . SER D 1 26 ? 7.092   -6.263  -1.250  1.00 0.00 ? 26 SER D HG     1  
ATOM 3167   N N      . GLY D 1 27 ? 11.832  -8.824  -2.716  1.00 0.00 ? 27 GLY D N      1  
ATOM 3168   C CA     . GLY D 1 27 ? 12.951  -9.666  -2.326  1.00 0.00 ? 27 GLY D CA     1  
ATOM 3169   C C      . GLY D 1 27 ? 12.704  -11.120 -2.707  1.00 0.00 ? 27 GLY D C      1  
ATOM 3170   O O      . GLY D 1 27 ? 12.568  -11.445 -3.885  1.00 0.00 ? 27 GLY D O      1  
ATOM 3171   H H      . GLY D 1 27 ? 11.907  -8.307  -3.580  1.00 0.00 ? 27 GLY D H      1  
ATOM 3172   H HA2    . GLY D 1 27 ? 13.854  -9.332  -2.834  1.00 0.00 ? 27 GLY D HA2    1  
ATOM 3173   H HA3    . GLY D 1 27 ? 13.110  -9.583  -1.252  1.00 0.00 ? 27 GLY D HA3    1  
ATOM 3174   N N      . GLN D 1 28 ? 12.630  -11.992 -1.699  1.00 0.00 ? 28 GLN D N      1  
ATOM 3175   C CA     . GLN D 1 28 ? 12.248  -13.384 -1.866  1.00 0.00 ? 28 GLN D CA     1  
ATOM 3176   C C      . GLN D 1 28 ? 10.741  -13.549 -1.710  1.00 0.00 ? 28 GLN D C      1  
ATOM 3177   O O      . GLN D 1 28 ? 10.210  -14.638 -1.918  1.00 0.00 ? 28 GLN D O      1  
ATOM 3178   C CB     . GLN D 1 28 ? 12.987  -14.241 -0.838  1.00 0.00 ? 28 GLN D CB     1  
ATOM 3179   C CG     . GLN D 1 28 ? 13.972  -15.207 -1.492  1.00 0.00 ? 28 GLN D CG     1  
ATOM 3180   C CD     . GLN D 1 28 ? 14.704  -16.065 -0.466  1.00 0.00 ? 28 GLN D CD     1  
ATOM 3181   O OE1    . GLN D 1 28 ? 14.308  -16.170 0.692   1.00 0.00 ? 28 GLN D OE1    1  
ATOM 3182   N NE2    . GLN D 1 28 ? 15.783  -16.726 -0.880  1.00 0.00 ? 28 GLN D NE2    1  
ATOM 3183   H H      . GLN D 1 28 ? 12.638  -11.626 -0.757  1.00 0.00 ? 28 GLN D H      1  
ATOM 3184   H HA     . GLN D 1 28 ? 12.520  -13.716 -2.869  1.00 0.00 ? 28 GLN D HA     1  
ATOM 3185   H HB2    . GLN D 1 28 ? 13.519  -13.601 -0.135  1.00 0.00 ? 28 GLN D HB2    1  
ATOM 3186   H HB3    . GLN D 1 28 ? 12.259  -14.828 -0.283  1.00 0.00 ? 28 GLN D HB3    1  
ATOM 3187   H HG2    . GLN D 1 28 ? 13.421  -15.866 -2.163  1.00 0.00 ? 28 GLN D HG2    1  
ATOM 3188   H HG3    . GLN D 1 28 ? 14.701  -14.640 -2.071  1.00 0.00 ? 28 GLN D HG3    1  
ATOM 3189   H HE21   . GLN D 1 28 ? 16.097  -16.638 -1.836  1.00 0.00 ? 28 GLN D HE21   1  
ATOM 3190   H HE22   . GLN D 1 28 ? 16.286  -17.308 -0.226  1.00 0.00 ? 28 GLN D HE22   1  
ATOM 3191   N N      . GLN D 1 29 ? 10.044  -12.491 -1.287  1.00 0.00 ? 29 GLN D N      1  
ATOM 3192   C CA     . GLN D 1 29 ? 8.597   -12.494 -1.220  1.00 0.00 ? 29 GLN D CA     1  
ATOM 3193   C C      . GLN D 1 29 ? 7.954   -12.250 -2.578  1.00 0.00 ? 29 GLN D C      1  
ATOM 3194   O O      . GLN D 1 29 ? 8.516   -11.588 -3.449  1.00 0.00 ? 29 GLN D O      1  
ATOM 3195   C CB     . GLN D 1 29 ? 8.103   -11.412 -0.269  1.00 0.00 ? 29 GLN D CB     1  
ATOM 3196   C CG     . GLN D 1 29 ? 8.423   -11.707 1.192   1.00 0.00 ? 29 GLN D CG     1  
ATOM 3197   C CD     . GLN D 1 29 ? 7.634   -10.726 2.042   1.00 0.00 ? 29 GLN D CD     1  
ATOM 3198   O OE1    . GLN D 1 29 ? 6.623   -11.080 2.643   1.00 0.00 ? 29 GLN D OE1    1  
ATOM 3199   N NE2    . GLN D 1 29 ? 8.019   -9.453  2.006   1.00 0.00 ? 29 GLN D NE2    1  
ATOM 3200   H H      . GLN D 1 29 ? 10.532  -11.641 -1.042  1.00 0.00 ? 29 GLN D H      1  
ATOM 3201   H HA     . GLN D 1 29 ? 8.262   -13.461 -0.847  1.00 0.00 ? 29 GLN D HA     1  
ATOM 3202   H HB2    . GLN D 1 29 ? 8.522   -10.450 -0.555  1.00 0.00 ? 29 GLN D HB2    1  
ATOM 3203   H HB3    . GLN D 1 29 ? 7.021   -11.339 -0.369  1.00 0.00 ? 29 GLN D HB3    1  
ATOM 3204   H HG2    . GLN D 1 29 ? 8.119   -12.723 1.440   1.00 0.00 ? 29 GLN D HG2    1  
ATOM 3205   H HG3    . GLN D 1 29 ? 9.490   -11.580 1.375   1.00 0.00 ? 29 GLN D HG3    1  
ATOM 3206   H HE21   . GLN D 1 29 ? 8.800   -9.191  1.421   1.00 0.00 ? 29 GLN D HE21   1  
ATOM 3207   H HE22   . GLN D 1 29 ? 7.516   -8.751  2.530   1.00 0.00 ? 29 GLN D HE22   1  
ATOM 3208   N N      . VAL D 1 30 ? 6.690   -12.663 -2.662  1.00 0.00 ? 30 VAL D N      1  
ATOM 3209   C CA     . VAL D 1 30 ? 5.783   -12.369 -3.755  1.00 0.00 ? 30 VAL D CA     1  
ATOM 3210   C C      . VAL D 1 30 ? 4.445   -11.934 -3.169  1.00 0.00 ? 30 VAL D C      1  
ATOM 3211   O O      . VAL D 1 30 ? 3.885   -12.641 -2.334  1.00 0.00 ? 30 VAL D O      1  
ATOM 3212   C CB     . VAL D 1 30 ? 5.619   -13.612 -4.633  1.00 0.00 ? 30 VAL D CB     1  
ATOM 3213   C CG1    . VAL D 1 30 ? 4.872   -13.259 -5.915  1.00 0.00 ? 30 VAL D CG1    1  
ATOM 3214   C CG2    . VAL D 1 30 ? 6.970   -14.201 -5.042  1.00 0.00 ? 30 VAL D CG2    1  
ATOM 3215   H H      . VAL D 1 30 ? 6.335   -13.245 -1.915  1.00 0.00 ? 30 VAL D H      1  
ATOM 3216   H HA     . VAL D 1 30 ? 6.188   -11.560 -4.361  1.00 0.00 ? 30 VAL D HA     1  
ATOM 3217   H HB     . VAL D 1 30 ? 5.055   -14.371 -4.089  1.00 0.00 ? 30 VAL D HB     1  
ATOM 3218   H HG11   . VAL D 1 30 ? 3.950   -12.727 -5.683  1.00 0.00 ? 30 VAL D HG11   1  
ATOM 3219   H HG12   . VAL D 1 30 ? 5.509   -12.629 -6.535  1.00 0.00 ? 30 VAL D HG12   1  
ATOM 3220   H HG13   . VAL D 1 30 ? 4.629   -14.175 -6.454  1.00 0.00 ? 30 VAL D HG13   1  
ATOM 3221   H HG21   . VAL D 1 30 ? 7.609   -13.417 -5.447  1.00 0.00 ? 30 VAL D HG21   1  
ATOM 3222   H HG22   . VAL D 1 30 ? 7.456   -14.656 -4.177  1.00 0.00 ? 30 VAL D HG22   1  
ATOM 3223   H HG23   . VAL D 1 30 ? 6.821   -14.967 -5.801  1.00 0.00 ? 30 VAL D HG23   1  
ATOM 3224   N N      . ARG D 1 31 ? 3.949   -10.757 -3.562  1.00 0.00 ? 31 ARG D N      1  
ATOM 3225   C CA     . ARG D 1 31 ? 2.580   -10.354 -3.279  1.00 0.00 ? 31 ARG D CA     1  
ATOM 3226   C C      . ARG D 1 31 ? 1.677   -11.043 -4.293  1.00 0.00 ? 31 ARG D C      1  
ATOM 3227   O O      . ARG D 1 31 ? 1.751   -10.737 -5.482  1.00 0.00 ? 31 ARG D O      1  
ATOM 3228   C CB     . ARG D 1 31 ? 2.390   -8.842  -3.401  1.00 0.00 ? 31 ARG D CB     1  
ATOM 3229   C CG     . ARG D 1 31 ? 2.743   -8.067  -2.133  1.00 0.00 ? 31 ARG D CG     1  
ATOM 3230   C CD     . ARG D 1 31 ? 1.942   -6.766  -2.068  1.00 0.00 ? 31 ARG D CD     1  
ATOM 3231   N NE     . ARG D 1 31 ? 2.244   -5.846  -3.170  1.00 0.00 ? 31 ARG D NE     1  
ATOM 3232   C CZ     . ARG D 1 31 ? 1.577   -4.708  -3.387  1.00 0.00 ? 31 ARG D CZ     1  
ATOM 3233   N NH1    . ARG D 1 31 ? 0.596   -4.317  -2.575  1.00 0.00 ? 31 ARG D NH1    1  
ATOM 3234   N NH2    . ARG D 1 31 ? 1.878   -3.932  -4.427  1.00 0.00 ? 31 ARG D NH2    1  
ATOM 3235   H H      . ARG D 1 31 ? 4.453   -10.234 -4.265  1.00 0.00 ? 31 ARG D H      1  
ATOM 3236   H HA     . ARG D 1 31 ? 2.292   -10.679 -2.279  1.00 0.00 ? 31 ARG D HA     1  
ATOM 3237   H HB2    . ARG D 1 31 ? 2.969   -8.459  -4.241  1.00 0.00 ? 31 ARG D HB2    1  
ATOM 3238   H HB3    . ARG D 1 31 ? 1.333   -8.664  -3.600  1.00 0.00 ? 31 ARG D HB3    1  
ATOM 3239   H HG2    . ARG D 1 31 ? 2.471   -8.667  -1.266  1.00 0.00 ? 31 ARG D HG2    1  
ATOM 3240   H HG3    . ARG D 1 31 ? 3.813   -7.861  -2.104  1.00 0.00 ? 31 ARG D HG3    1  
ATOM 3241   H HD2    . ARG D 1 31 ? 0.880   -7.010  -2.100  1.00 0.00 ? 31 ARG D HD2    1  
ATOM 3242   H HD3    . ARG D 1 31 ? 2.158   -6.266  -1.125  1.00 0.00 ? 31 ARG D HD3    1  
ATOM 3243   H HE     . ARG D 1 31 ? 3.012   -6.076  -3.783  1.00 0.00 ? 31 ARG D HE     1  
ATOM 3244   H HH11   . ARG D 1 31 ? 0.356   -4.875  -1.767  1.00 0.00 ? 31 ARG D HH11   1  
ATOM 3245   H HH12   . ARG D 1 31 ? 0.118   -3.441  -2.751  1.00 0.00 ? 31 ARG D HH12   1  
ATOM 3246   H HH21   . ARG D 1 31 ? 2.617   -4.194  -5.064  1.00 0.00 ? 31 ARG D HH21   1  
ATOM 3247   H HH22   . ARG D 1 31 ? 1.364   -3.076  -4.572  1.00 0.00 ? 31 ARG D HH22   1  
ATOM 3248   N N      . ILE D 1 32 ? 0.817   -11.944 -3.816  1.00 0.00 ? 32 ILE D N      1  
ATOM 3249   C CA     . ILE D 1 32 ? -0.121  -12.673 -4.651  1.00 0.00 ? 32 ILE D CA     1  
ATOM 3250   C C      . ILE D 1 32 ? -1.538  -12.274 -4.253  1.00 0.00 ? 32 ILE D C      1  
ATOM 3251   O O      . ILE D 1 32 ? -1.904  -12.352 -3.082  1.00 0.00 ? 32 ILE D O      1  
ATOM 3252   C CB     . ILE D 1 32 ? 0.084   -14.186 -4.519  1.00 0.00 ? 32 ILE D CB     1  
ATOM 3253   C CG1    . ILE D 1 32 ? 1.576   -14.534 -4.498  1.00 0.00 ? 32 ILE D CG1    1  
ATOM 3254   C CG2    . ILE D 1 32 ? -0.644  -14.876 -5.674  1.00 0.00 ? 32 ILE D CG2    1  
ATOM 3255   C CD1    . ILE D 1 32 ? 1.865   -16.028 -4.642  1.00 0.00 ? 32 ILE D CD1    1  
ATOM 3256   H H      . ILE D 1 32 ? 0.816   -12.148 -2.826  1.00 0.00 ? 32 ILE D H      1  
ATOM 3257   H HA     . ILE D 1 32 ? 0.053   -12.396 -5.693  1.00 0.00 ? 32 ILE D HA     1  
ATOM 3258   H HB     . ILE D 1 32 ? -0.357  -14.523 -3.580  1.00 0.00 ? 32 ILE D HB     1  
ATOM 3259   H HG12   . ILE D 1 32 ? 2.076   -14.008 -5.309  1.00 0.00 ? 32 ILE D HG12   1  
ATOM 3260   H HG13   . ILE D 1 32 ? 1.995   -14.201 -3.547  1.00 0.00 ? 32 ILE D HG13   1  
ATOM 3261   H HG21   . ILE D 1 32 ? -0.641  -15.956 -5.525  1.00 0.00 ? 32 ILE D HG21   1  
ATOM 3262   H HG22   . ILE D 1 32 ? -1.681  -14.544 -5.716  1.00 0.00 ? 32 ILE D HG22   1  
ATOM 3263   H HG23   . ILE D 1 32 ? -0.154  -14.638 -6.618  1.00 0.00 ? 32 ILE D HG23   1  
ATOM 3264   H HD11   . ILE D 1 32 ? 1.268   -16.592 -3.925  1.00 0.00 ? 32 ILE D HD11   1  
ATOM 3265   H HD12   . ILE D 1 32 ? 1.633   -16.351 -5.656  1.00 0.00 ? 32 ILE D HD12   1  
ATOM 3266   H HD13   . ILE D 1 32 ? 2.923   -16.206 -4.449  1.00 0.00 ? 32 ILE D HD13   1  
ATOM 3267   N N      . GLY D 1 33 ? -2.328  -11.816 -5.225  1.00 0.00 ? 33 GLY D N      1  
ATOM 3268   C CA     . GLY D 1 33 ? -3.719  -11.453 -5.030  1.00 0.00 ? 33 GLY D CA     1  
ATOM 3269   C C      . GLY D 1 33 ? -4.642  -12.592 -5.443  1.00 0.00 ? 33 GLY D C      1  
ATOM 3270   O O      . GLY D 1 33 ? -4.476  -13.173 -6.514  1.00 0.00 ? 33 GLY D O      1  
ATOM 3271   H H      . GLY D 1 33 ? -1.986  -11.836 -6.176  1.00 0.00 ? 33 GLY D H      1  
ATOM 3272   H HA2    . GLY D 1 33 ? -3.899  -11.201 -3.985  1.00 0.00 ? 33 GLY D HA2    1  
ATOM 3273   H HA3    . GLY D 1 33 ? -3.943  -10.580 -5.642  1.00 0.00 ? 33 GLY D HA3    1  
ATOM 3274   N N      . ILE D 1 34 ? -5.634  -12.892 -4.603  1.00 0.00 ? 34 ILE D N      1  
ATOM 3275   C CA     . ILE D 1 34 ? -6.681  -13.854 -4.899  1.00 0.00 ? 34 ILE D CA     1  
ATOM 3276   C C      . ILE D 1 34 ? -8.017  -13.124 -4.971  1.00 0.00 ? 34 ILE D C      1  
ATOM 3277   O O      . ILE D 1 34 ? -8.276  -12.210 -4.192  1.00 0.00 ? 34 ILE D O      1  
ATOM 3278   C CB     . ILE D 1 34 ? -6.696  -14.988 -3.868  1.00 0.00 ? 34 ILE D CB     1  
ATOM 3279   C CG1    . ILE D 1 34 ? -5.383  -15.779 -3.885  1.00 0.00 ? 34 ILE D CG1    1  
ATOM 3280   C CG2    . ILE D 1 34 ? -7.860  -15.937 -4.162  1.00 0.00 ? 34 ILE D CG2    1  
ATOM 3281   C CD1    . ILE D 1 34 ? -4.375  -15.269 -2.854  1.00 0.00 ? 34 ILE D CD1    1  
ATOM 3282   H H      . ILE D 1 34 ? -5.699  -12.387 -3.729  1.00 0.00 ? 34 ILE D H      1  
ATOM 3283   H HA     . ILE D 1 34 ? -6.492  -14.292 -5.879  1.00 0.00 ? 34 ILE D HA     1  
ATOM 3284   H HB     . ILE D 1 34 ? -6.846  -14.564 -2.874  1.00 0.00 ? 34 ILE D HB     1  
ATOM 3285   H HG12   . ILE D 1 34 ? -5.583  -16.826 -3.660  1.00 0.00 ? 34 ILE D HG12   1  
ATOM 3286   H HG13   . ILE D 1 34 ? -4.934  -15.727 -4.877  1.00 0.00 ? 34 ILE D HG13   1  
ATOM 3287   H HG21   . ILE D 1 34 ? -7.782  -16.836 -3.551  1.00 0.00 ? 34 ILE D HG21   1  
ATOM 3288   H HG22   . ILE D 1 34 ? -8.806  -15.450 -3.929  1.00 0.00 ? 34 ILE D HG22   1  
ATOM 3289   H HG23   . ILE D 1 34 ? -7.854  -16.230 -5.211  1.00 0.00 ? 34 ILE D HG23   1  
ATOM 3290   H HD11   . ILE D 1 34 ? -4.831  -15.261 -1.864  1.00 0.00 ? 34 ILE D HD11   1  
ATOM 3291   H HD12   . ILE D 1 34 ? -3.507  -15.929 -2.842  1.00 0.00 ? 34 ILE D HD12   1  
ATOM 3292   H HD13   . ILE D 1 34 ? -4.046  -14.262 -3.108  1.00 0.00 ? 34 ILE D HD13   1  
ATOM 3293   N N      . ASN D 1 35 ? -8.867  -13.510 -5.923  1.00 0.00 ? 35 ASN D N      1  
ATOM 3294   C CA     . ASN D 1 35 ? -10.175 -12.912 -6.115  1.00 0.00 ? 35 ASN D CA     1  
ATOM 3295   C C      . ASN D 1 35 ? -11.193 -14.011 -6.400  1.00 0.00 ? 35 ASN D C      1  
ATOM 3296   O O      . ASN D 1 35 ? -11.416 -14.391 -7.548  1.00 0.00 ? 35 ASN D O      1  
ATOM 3297   C CB     . ASN D 1 35 ? -10.084 -11.878 -7.237  1.00 0.00 ? 35 ASN D CB     1  
ATOM 3298   C CG     . ASN D 1 35 ? -11.355 -11.053 -7.376  1.00 0.00 ? 35 ASN D CG     1  
ATOM 3299   O OD1    . ASN D 1 35 ? -12.233 -11.074 -6.518  1.00 0.00 ? 35 ASN D OD1    1  
ATOM 3300   N ND2    . ASN D 1 35 ? -11.449 -10.264 -8.444  1.00 0.00 ? 35 ASN D ND2    1  
ATOM 3301   H H      . ASN D 1 35 ? -8.620  -14.299 -6.505  1.00 0.00 ? 35 ASN D H      1  
ATOM 3302   H HA     . ASN D 1 35 ? -10.474 -12.403 -5.198  1.00 0.00 ? 35 ASN D HA     1  
ATOM 3303   H HB2    . ASN D 1 35 ? -9.254  -11.202 -7.036  1.00 0.00 ? 35 ASN D HB2    1  
ATOM 3304   H HB3    . ASN D 1 35 ? -9.885  -12.387 -8.180  1.00 0.00 ? 35 ASN D HB3    1  
ATOM 3305   H HD21   . ASN D 1 35 ? -10.708 -10.245 -9.129  1.00 0.00 ? 35 ASN D HD21   1  
ATOM 3306   H HD22   . ASN D 1 35 ? -12.266 -9.681  -8.557  1.00 0.00 ? 35 ASN D HD22   1  
ATOM 3307   N N      . ALA D 1 36 ? -11.797 -14.530 -5.330  1.00 0.00 ? 36 ALA D N      1  
ATOM 3308   C CA     . ALA D 1 36 ? -12.794 -15.584 -5.380  1.00 0.00 ? 36 ALA D CA     1  
ATOM 3309   C C      . ALA D 1 36 ? -14.065 -15.113 -4.679  1.00 0.00 ? 36 ALA D C      1  
ATOM 3310   O O      . ALA D 1 36 ? -13.986 -14.256 -3.799  1.00 0.00 ? 36 ALA D O      1  
ATOM 3311   C CB     . ALA D 1 36 ? -12.213 -16.826 -4.704  1.00 0.00 ? 36 ALA D CB     1  
ATOM 3312   H H      . ALA D 1 36 ? -11.581 -14.149 -4.421  1.00 0.00 ? 36 ALA D H      1  
ATOM 3313   H HA     . ALA D 1 36 ? -13.027 -15.820 -6.419  1.00 0.00 ? 36 ALA D HA     1  
ATOM 3314   H HB1    . ALA D 1 36 ? -11.267 -17.097 -5.171  1.00 0.00 ? 36 ALA D HB1    1  
ATOM 3315   H HB2    . ALA D 1 36 ? -12.042 -16.629 -3.646  1.00 0.00 ? 36 ALA D HB2    1  
ATOM 3316   H HB3    . ALA D 1 36 ? -12.909 -17.658 -4.804  1.00 0.00 ? 36 ALA D HB3    1  
ATOM 3317   N N      . PRO D 1 37 ? -15.233 -15.680 -5.003  1.00 0.00 ? 37 PRO D N      1  
ATOM 3318   C CA     . PRO D 1 37 ? -16.437 -15.444 -4.231  1.00 0.00 ? 37 PRO D CA     1  
ATOM 3319   C C      . PRO D 1 37 ? -16.241 -15.907 -2.792  1.00 0.00 ? 37 PRO D C      1  
ATOM 3320   O O      . PRO D 1 37 ? -15.560 -16.902 -2.547  1.00 0.00 ? 37 PRO D O      1  
ATOM 3321   C CB     . PRO D 1 37 ? -17.541 -16.240 -4.925  1.00 0.00 ? 37 PRO D CB     1  
ATOM 3322   C CG     . PRO D 1 37 ? -16.814 -17.303 -5.745  1.00 0.00 ? 37 PRO D CG     1  
ATOM 3323   C CD     . PRO D 1 37 ? -15.460 -16.668 -6.042  1.00 0.00 ? 37 PRO D CD     1  
ATOM 3324   H HA     . PRO D 1 37 ? -16.685 -14.383 -4.244  1.00 0.00 ? 37 PRO D HA     1  
ATOM 3325   H HB2    . PRO D 1 37 ? -18.207 -16.706 -4.201  1.00 0.00 ? 37 PRO D HB2    1  
ATOM 3326   H HB3    . PRO D 1 37 ? -18.104 -15.584 -5.591  1.00 0.00 ? 37 PRO D HB3    1  
ATOM 3327   H HG2    . PRO D 1 37 ? -16.675 -18.211 -5.158  1.00 0.00 ? 37 PRO D HG2    1  
ATOM 3328   H HG3    . PRO D 1 37 ? -17.353 -17.524 -6.667  1.00 0.00 ? 37 PRO D HG3    1  
ATOM 3329   H HD2    . PRO D 1 37 ? -14.683 -17.431 -6.047  1.00 0.00 ? 37 PRO D HD2    1  
ATOM 3330   H HD3    . PRO D 1 37 ? -15.521 -16.171 -7.009  1.00 0.00 ? 37 PRO D HD3    1  
ATOM 3331   N N      . LYS D 1 38 ? -16.929 -15.268 -1.842  1.00 0.00 ? 38 LYS D N      1  
ATOM 3332   C CA     . LYS D 1 38 ? -17.012 -15.730 -0.463  1.00 0.00 ? 38 LYS D CA     1  
ATOM 3333   C C      . LYS D 1 38 ? -17.729 -17.073 -0.342  1.00 0.00 ? 38 LYS D C      1  
ATOM 3334   O O      . LYS D 1 38 ? -17.839 -17.627 0.751   1.00 0.00 ? 38 LYS D O      1  
ATOM 3335   C CB     . LYS D 1 38 ? -17.654 -14.652 0.413   1.00 0.00 ? 38 LYS D CB     1  
ATOM 3336   C CG     . LYS D 1 38 ? -16.744 -13.434 0.591   1.00 0.00 ? 38 LYS D CG     1  
ATOM 3337   C CD     . LYS D 1 38 ? -15.546 -13.702 1.504   1.00 0.00 ? 38 LYS D CD     1  
ATOM 3338   C CE     . LYS D 1 38 ? -15.734 -13.116 2.904   1.00 0.00 ? 38 LYS D CE     1  
ATOM 3339   N NZ     . LYS D 1 38 ? -16.761 -13.838 3.678   1.00 0.00 ? 38 LYS D NZ     1  
ATOM 3340   H H      . LYS D 1 38 ? -17.467 -14.451 -2.099  1.00 0.00 ? 38 LYS D H      1  
ATOM 3341   H HA     . LYS D 1 38 ? -15.994 -15.902 -0.109  1.00 0.00 ? 38 LYS D HA     1  
ATOM 3342   H HB2    . LYS D 1 38 ? -18.589 -14.333 -0.047  1.00 0.00 ? 38 LYS D HB2    1  
ATOM 3343   H HB3    . LYS D 1 38 ? -17.884 -15.071 1.394   1.00 0.00 ? 38 LYS D HB3    1  
ATOM 3344   H HG2    . LYS D 1 38 ? -16.377 -13.121 -0.386  1.00 0.00 ? 38 LYS D HG2    1  
ATOM 3345   H HG3    . LYS D 1 38 ? -17.332 -12.612 1.000   1.00 0.00 ? 38 LYS D HG3    1  
ATOM 3346   H HD2    . LYS D 1 38 ? -15.349 -14.771 1.582   1.00 0.00 ? 38 LYS D HD2    1  
ATOM 3347   H HD3    . LYS D 1 38 ? -14.666 -13.233 1.061   1.00 0.00 ? 38 LYS D HD3    1  
ATOM 3348   H HE2    . LYS D 1 38 ? -14.782 -13.170 3.433   1.00 0.00 ? 38 LYS D HE2    1  
ATOM 3349   H HE3    . LYS D 1 38 ? -16.012 -12.064 2.813   1.00 0.00 ? 38 LYS D HE3    1  
ATOM 3350   H HZ1    . LYS D 1 38 ? -17.667 -13.745 3.241   1.00 0.00 ? 38 LYS D HZ1    1  
ATOM 3351   H HZ2    . LYS D 1 38 ? -16.528 -14.819 3.748   1.00 0.00 ? 38 LYS D HZ2    1  
ATOM 3352   H HZ3    . LYS D 1 38 ? -16.822 -13.459 4.612   1.00 0.00 ? 38 LYS D HZ3    1  
ATOM 3353   N N      . ASP D 1 39 ? -18.186 -17.614 -1.474  1.00 0.00 ? 39 ASP D N      1  
ATOM 3354   C CA     . ASP D 1 39 ? -18.698 -18.967 -1.606  1.00 0.00 ? 39 ASP D CA     1  
ATOM 3355   C C      . ASP D 1 39 ? -17.598 -20.001 -1.369  1.00 0.00 ? 39 ASP D C      1  
ATOM 3356   O O      . ASP D 1 39 ? -17.889 -21.129 -0.975  1.00 0.00 ? 39 ASP D O      1  
ATOM 3357   C CB     . ASP D 1 39 ? -19.244 -19.135 -3.024  1.00 0.00 ? 39 ASP D CB     1  
ATOM 3358   C CG     . ASP D 1 39 ? -20.294 -20.240 -3.094  1.00 0.00 ? 39 ASP D CG     1  
ATOM 3359   O OD1    . ASP D 1 39 ? -21.371 -20.065 -2.481  1.00 0.00 ? 39 ASP D OD1    1  
ATOM 3360   O OD2    . ASP D 1 39 ? -20.039 -21.252 -3.784  1.00 0.00 ? 39 ASP D OD2    1  
ATOM 3361   H H      . ASP D 1 39 ? -18.048 -17.088 -2.324  1.00 0.00 ? 39 ASP D H      1  
ATOM 3362   H HA     . ASP D 1 39 ? -19.498 -19.120 -0.882  1.00 0.00 ? 39 ASP D HA     1  
ATOM 3363   H HB2    . ASP D 1 39 ? -19.676 -18.196 -3.374  1.00 0.00 ? 39 ASP D HB2    1  
ATOM 3364   H HB3    . ASP D 1 39 ? -18.419 -19.375 -3.694  1.00 0.00 ? 39 ASP D HB3    1  
ATOM 3365   N N      . VAL D 1 40 ? -16.337 -19.612 -1.586  1.00 0.00 ? 40 VAL D N      1  
ATOM 3366   C CA     . VAL D 1 40 ? -15.168 -20.444 -1.353  1.00 0.00 ? 40 VAL D CA     1  
ATOM 3367   C C      . VAL D 1 40 ? -14.179 -19.737 -0.433  1.00 0.00 ? 40 VAL D C      1  
ATOM 3368   O O      . VAL D 1 40 ? -14.181 -18.513 -0.310  1.00 0.00 ? 40 VAL D O      1  
ATOM 3369   C CB     . VAL D 1 40 ? -14.497 -20.849 -2.669  1.00 0.00 ? 40 VAL D CB     1  
ATOM 3370   C CG1    . VAL D 1 40 ? -15.512 -21.417 -3.660  1.00 0.00 ? 40 VAL D CG1    1  
ATOM 3371   C CG2    . VAL D 1 40 ? -13.762 -19.687 -3.333  1.00 0.00 ? 40 VAL D CG2    1  
ATOM 3372   H H      . VAL D 1 40 ? -16.169 -18.662 -1.887  1.00 0.00 ? 40 VAL D H      1  
ATOM 3373   H HA     . VAL D 1 40 ? -15.484 -21.358 -0.852  1.00 0.00 ? 40 VAL D HA     1  
ATOM 3374   H HB     . VAL D 1 40 ? -13.760 -21.622 -2.454  1.00 0.00 ? 40 VAL D HB     1  
ATOM 3375   H HG11   . VAL D 1 40 ? -16.195 -20.631 -3.987  1.00 0.00 ? 40 VAL D HG11   1  
ATOM 3376   H HG12   . VAL D 1 40 ? -14.988 -21.817 -4.529  1.00 0.00 ? 40 VAL D HG12   1  
ATOM 3377   H HG13   . VAL D 1 40 ? -16.080 -22.216 -3.186  1.00 0.00 ? 40 VAL D HG13   1  
ATOM 3378   H HG21   . VAL D 1 40 ? -13.279 -20.038 -4.244  1.00 0.00 ? 40 VAL D HG21   1  
ATOM 3379   H HG22   . VAL D 1 40 ? -14.470 -18.898 -3.584  1.00 0.00 ? 40 VAL D HG22   1  
ATOM 3380   H HG23   . VAL D 1 40 ? -12.998 -19.295 -2.661  1.00 0.00 ? 40 VAL D HG23   1  
ATOM 3381   N N      . ALA D 1 41 ? -13.298 -20.518 0.196   1.00 0.00 ? 41 ALA D N      1  
ATOM 3382   C CA     . ALA D 1 41 ? -12.305 -20.009 1.121   1.00 0.00 ? 41 ALA D CA     1  
ATOM 3383   C C      . ALA D 1 41 ? -10.953 -19.781 0.450   1.00 0.00 ? 41 ALA D C      1  
ATOM 3384   O O      . ALA D 1 41 ? -10.660 -20.381 -0.583  1.00 0.00 ? 41 ALA D O      1  
ATOM 3385   C CB     . ALA D 1 41 ? -12.188 -20.983 2.293   1.00 0.00 ? 41 ALA D CB     1  
ATOM 3386   H H      . ALA D 1 41 ? -13.334 -21.516 0.048   1.00 0.00 ? 41 ALA D H      1  
ATOM 3387   H HA     . ALA D 1 41 ? -12.656 -19.053 1.503   1.00 0.00 ? 41 ALA D HA     1  
ATOM 3388   H HB1    . ALA D 1 41 ? -13.160 -21.099 2.772   1.00 0.00 ? 41 ALA D HB1    1  
ATOM 3389   H HB2    . ALA D 1 41 ? -11.842 -21.954 1.935   1.00 0.00 ? 41 ALA D HB2    1  
ATOM 3390   H HB3    . ALA D 1 41 ? -11.475 -20.594 3.019   1.00 0.00 ? 41 ALA D HB3    1  
ATOM 3391   N N      . VAL D 1 42 ? -10.122 -18.909 1.025   1.00 0.00 ? 42 VAL D N      1  
ATOM 3392   C CA     . VAL D 1 42 ? -8.721  -18.780 0.648   1.00 0.00 ? 42 VAL D CA     1  
ATOM 3393   C C      . VAL D 1 42 ? -7.903  -18.374 1.868   1.00 0.00 ? 42 VAL D C      1  
ATOM 3394   O O      . VAL D 1 42 ? -8.208  -17.369 2.506   1.00 0.00 ? 42 VAL D O      1  
ATOM 3395   C CB     . VAL D 1 42 ? -8.519  -17.839 -0.546  1.00 0.00 ? 42 VAL D CB     1  
ATOM 3396   C CG1    . VAL D 1 42 ? -9.422  -16.606 -0.561  1.00 0.00 ? 42 VAL D CG1    1  
ATOM 3397   C CG2    . VAL D 1 42 ? -7.069  -17.365 -0.644  1.00 0.00 ? 42 VAL D CG2    1  
ATOM 3398   H H      . VAL D 1 42 ? -10.444 -18.385 1.827   1.00 0.00 ? 42 VAL D H      1  
ATOM 3399   H HA     . VAL D 1 42 ? -8.367  -19.764 0.341   1.00 0.00 ? 42 VAL D HA     1  
ATOM 3400   H HB     . VAL D 1 42 ? -8.741  -18.407 -1.450  1.00 0.00 ? 42 VAL D HB     1  
ATOM 3401   H HG11   . VAL D 1 42 ? -9.158  -15.970 -1.408  1.00 0.00 ? 42 VAL D HG11   1  
ATOM 3402   H HG12   . VAL D 1 42 ? -10.459 -16.917 -0.683  1.00 0.00 ? 42 VAL D HG12   1  
ATOM 3403   H HG13   . VAL D 1 42 ? -9.309  -16.045 0.366   1.00 0.00 ? 42 VAL D HG13   1  
ATOM 3404   H HG21   . VAL D 1 42 ? -6.945  -16.751 -1.536  1.00 0.00 ? 42 VAL D HG21   1  
ATOM 3405   H HG22   . VAL D 1 42 ? -6.813  -16.753 0.221   1.00 0.00 ? 42 VAL D HG22   1  
ATOM 3406   H HG23   . VAL D 1 42 ? -6.401  -18.223 -0.700  1.00 0.00 ? 42 VAL D HG23   1  
ATOM 3407   N N      . HIS D 1 43 ? -6.863  -19.147 2.197   1.00 0.00 ? 43 HIS D N      1  
ATOM 3408   C CA     . HIS D 1 43 ? -5.924  -18.811 3.256   1.00 0.00 ? 43 HIS D CA     1  
ATOM 3409   C C      . HIS D 1 43 ? -4.530  -19.345 2.955   1.00 0.00 ? 43 HIS D C      1  
ATOM 3410   O O      . HIS D 1 43 ? -4.362  -20.234 2.123   1.00 0.00 ? 43 HIS D O      1  
ATOM 3411   C CB     . HIS D 1 43 ? -6.364  -19.360 4.615   1.00 0.00 ? 43 HIS D CB     1  
ATOM 3412   C CG     . HIS D 1 43 ? -7.844  -19.334 4.884   1.00 0.00 ? 43 HIS D CG     1  
ATOM 3413   N ND1    . HIS D 1 43 ? -8.502  -18.340 5.607   1.00 0.00 ? 43 HIS D ND1    1  
ATOM 3414   C CD2    . HIS D 1 43 ? -8.740  -20.314 4.550   1.00 0.00 ? 43 HIS D CD2    1  
ATOM 3415   C CE1    . HIS D 1 43 ? -9.781  -18.724 5.673   1.00 0.00 ? 43 HIS D CE1    1  
ATOM 3416   N NE2    . HIS D 1 43 ? -9.957  -19.902 5.050   1.00 0.00 ? 43 HIS D NE2    1  
ATOM 3417   H H      . HIS D 1 43 ? -6.632  -19.933 1.604   1.00 0.00 ? 43 HIS D H      1  
ATOM 3418   H HA     . HIS D 1 43 ? -5.853  -17.725 3.323   1.00 0.00 ? 43 HIS D HA     1  
ATOM 3419   H HB2    . HIS D 1 43 ? -5.994  -20.376 4.754   1.00 0.00 ? 43 HIS D HB2    1  
ATOM 3420   H HB3    . HIS D 1 43 ? -5.882  -18.754 5.379   1.00 0.00 ? 43 HIS D HB3    1  
ATOM 3421   H HD2    . HIS D 1 43 ? -8.526  -21.234 4.024   1.00 0.00 ? 43 HIS D HD2    1  
ATOM 3422   H HE1    . HIS D 1 43 ? -10.559 -18.179 6.188   1.00 0.00 ? 43 HIS D HE1    1  
ATOM 3423   H HE2    . HIS D 1 43 ? -10.824 -20.419 5.010   1.00 0.00 ? 43 HIS D HE2    1  
ATOM 3424   N N      . ARG D 1 44 ? -3.531  -18.859 3.695   1.00 0.00 ? 44 ARG D N      1  
ATOM 3425   C CA     . ARG D 1 44 ? -2.193  -19.431 3.698   1.00 0.00 ? 44 ARG D CA     1  
ATOM 3426   C C      . ARG D 1 44 ? -2.229  -20.850 4.258   1.00 0.00 ? 44 ARG D C      1  
ATOM 3427   O O      . ARG D 1 44 ? -3.123  -21.175 5.033   1.00 0.00 ? 44 ARG D O      1  
ATOM 3428   C CB     . ARG D 1 44 ? -1.287  -18.532 4.537   1.00 0.00 ? 44 ARG D CB     1  
ATOM 3429   C CG     . ARG D 1 44 ? -1.073  -17.192 3.838   1.00 0.00 ? 44 ARG D CG     1  
ATOM 3430   C CD     . ARG D 1 44 ? -0.361  -16.191 4.744   1.00 0.00 ? 44 ARG D CD     1  
ATOM 3431   N NE     . ARG D 1 44 ? -1.275  -15.633 5.746   1.00 0.00 ? 44 ARG D NE     1  
ATOM 3432   C CZ     . ARG D 1 44 ? -1.096  -15.633 7.072   1.00 0.00 ? 44 ARG D CZ     1  
ATOM 3433   N NH1    . ARG D 1 44 ? -0.079  -16.270 7.653   1.00 0.00 ? 44 ARG D NH1    1  
ATOM 3434   N NH2    . ARG D 1 44 ? -1.978  -14.997 7.840   1.00 0.00 ? 44 ARG D NH2    1  
ATOM 3435   H H      . ARG D 1 44 ? -3.736  -18.132 4.366   1.00 0.00 ? 44 ARG D H      1  
ATOM 3436   H HA     . ARG D 1 44 ? -1.813  -19.472 2.677   1.00 0.00 ? 44 ARG D HA     1  
ATOM 3437   H HB2    . ARG D 1 44 ? -1.743  -18.370 5.513   1.00 0.00 ? 44 ARG D HB2    1  
ATOM 3438   H HB3    . ARG D 1 44 ? -0.324  -19.019 4.672   1.00 0.00 ? 44 ARG D HB3    1  
ATOM 3439   H HG2    . ARG D 1 44 ? -0.474  -17.349 2.940   1.00 0.00 ? 44 ARG D HG2    1  
ATOM 3440   H HG3    . ARG D 1 44 ? -2.037  -16.774 3.552   1.00 0.00 ? 44 ARG D HG3    1  
ATOM 3441   H HD2    . ARG D 1 44 ? 0.497   -16.668 5.216   1.00 0.00 ? 44 ARG D HD2    1  
ATOM 3442   H HD3    . ARG D 1 44 ? -0.000  -15.378 4.115   1.00 0.00 ? 44 ARG D HD3    1  
ATOM 3443   H HE     . ARG D 1 44 ? -2.109  -15.180 5.402   1.00 0.00 ? 44 ARG D HE     1  
ATOM 3444   H HH11   . ARG D 1 44 ? 0.576   -16.807 7.098   1.00 0.00 ? 44 ARG D HH11   1  
ATOM 3445   H HH12   . ARG D 1 44 ? 0.025   -16.231 8.655   1.00 0.00 ? 44 ARG D HH12   1  
ATOM 3446   H HH21   . ARG D 1 44 ? -2.788  -14.568 7.412   1.00 0.00 ? 44 ARG D HH21   1  
ATOM 3447   H HH22   . ARG D 1 44 ? -1.919  -15.055 8.848   1.00 0.00 ? 44 ARG D HH22   1  
ATOM 3448   N N      . GLU D 1 45 ? -1.252  -21.693 3.919   1.00 0.00 ? 45 GLU D N      1  
ATOM 3449   C CA     . GLU D 1 45 ? -1.219  -23.076 4.375   1.00 0.00 ? 45 GLU D CA     1  
ATOM 3450   C C      . GLU D 1 45 ? -1.154  -23.164 5.898   1.00 0.00 ? 45 GLU D C      1  
ATOM 3451   O O      . GLU D 1 45 ? -1.857  -23.972 6.502   1.00 0.00 ? 45 GLU D O      1  
ATOM 3452   C CB     . GLU D 1 45 ? -0.021  -23.769 3.723   1.00 0.00 ? 45 GLU D CB     1  
ATOM 3453   C CG     . GLU D 1 45 ? -0.120  -25.294 3.730   1.00 0.00 ? 45 GLU D CG     1  
ATOM 3454   C CD     . GLU D 1 45 ? 0.136   -25.925 5.095   1.00 0.00 ? 45 GLU D CD     1  
ATOM 3455   O OE1    . GLU D 1 45 ? 1.179   -25.606 5.707   1.00 0.00 ? 45 GLU D OE1    1  
ATOM 3456   O OE2    . GLU D 1 45 ? -0.669  -26.795 5.492   1.00 0.00 ? 45 GLU D OE2    1  
ATOM 3457   H H      . GLU D 1 45 ? -0.508  -21.375 3.313   1.00 0.00 ? 45 GLU D H      1  
ATOM 3458   H HA     . GLU D 1 45 ? -2.130  -23.582 4.049   1.00 0.00 ? 45 GLU D HA     1  
ATOM 3459   H HB2    . GLU D 1 45 ? 0.020   -23.455 2.681   1.00 0.00 ? 45 GLU D HB2    1  
ATOM 3460   H HB3    . GLU D 1 45 ? 0.901   -23.451 4.210   1.00 0.00 ? 45 GLU D HB3    1  
ATOM 3461   H HG2    . GLU D 1 45 ? -1.109  -25.581 3.375   1.00 0.00 ? 45 GLU D HG2    1  
ATOM 3462   H HG3    . GLU D 1 45 ? 0.619   -25.692 3.035   1.00 0.00 ? 45 GLU D HG3    1  
ATOM 3463   N N      . GLU D 1 46 ? -0.397  -22.272 6.544   1.00 0.00 ? 46 GLU D N      1  
ATOM 3464   C CA     . GLU D 1 46 ? -0.307  -22.215 7.995   1.00 0.00 ? 46 GLU D CA     1  
ATOM 3465   C C      . GLU D 1 46 ? -1.602  -21.742 8.652   1.00 0.00 ? 46 GLU D C      1  
ATOM 3466   O O      . GLU D 1 46 ? -1.823  -22.004 9.832   1.00 0.00 ? 46 GLU D O      1  
ATOM 3467   C CB     . GLU D 1 46 ? 0.888   -21.361 8.429   1.00 0.00 ? 46 GLU D CB     1  
ATOM 3468   C CG     . GLU D 1 46 ? 0.780   -19.868 8.110   1.00 0.00 ? 46 GLU D CG     1  
ATOM 3469   C CD     . GLU D 1 46 ? 1.382   -19.469 6.765   1.00 0.00 ? 46 GLU D CD     1  
ATOM 3470   O OE1    . GLU D 1 46 ? 1.437   -20.317 5.847   1.00 0.00 ? 46 GLU D OE1    1  
ATOM 3471   O OE2    . GLU D 1 46 ? 1.735   -18.279 6.616   1.00 0.00 ? 46 GLU D OE2    1  
ATOM 3472   H H      . GLU D 1 46 ? 0.209   -21.663 6.008   1.00 0.00 ? 46 GLU D H      1  
ATOM 3473   H HA     . GLU D 1 46 ? -0.123  -23.229 8.352   1.00 0.00 ? 46 GLU D HA     1  
ATOM 3474   H HB2    . GLU D 1 46 ? 0.989   -21.464 9.509   1.00 0.00 ? 46 GLU D HB2    1  
ATOM 3475   H HB3    . GLU D 1 46 ? 1.798   -21.761 7.981   1.00 0.00 ? 46 GLU D HB3    1  
ATOM 3476   H HG2    . GLU D 1 46 ? -0.264  -19.556 8.141   1.00 0.00 ? 46 GLU D HG2    1  
ATOM 3477   H HG3    . GLU D 1 46 ? 1.306   -19.321 8.893   1.00 0.00 ? 46 GLU D HG3    1  
ATOM 3478   N N      . ILE D 1 47 ? -2.477  -21.073 7.894   1.00 0.00 ? 47 ILE D N      1  
ATOM 3479   C CA     . ILE D 1 47 ? -3.767  -20.598 8.370   1.00 0.00 ? 47 ILE D CA     1  
ATOM 3480   C C      . ILE D 1 47 ? -4.862  -21.617 8.093   1.00 0.00 ? 47 ILE D C      1  
ATOM 3481   O O      . ILE D 1 47 ? -5.701  -21.867 8.955   1.00 0.00 ? 47 ILE D O      1  
ATOM 3482   C CB     . ILE D 1 47 ? -4.095  -19.252 7.718   1.00 0.00 ? 47 ILE D CB     1  
ATOM 3483   C CG1    . ILE D 1 47 ? -3.125  -18.156 8.163   1.00 0.00 ? 47 ILE D CG1    1  
ATOM 3484   C CG2    . ILE D 1 47 ? -5.530  -18.829 8.030   1.00 0.00 ? 47 ILE D CG2    1  
ATOM 3485   C CD1    . ILE D 1 47 ? -2.977  -18.061 9.679   1.00 0.00 ? 47 ILE D CD1    1  
ATOM 3486   H H      . ILE D 1 47 ? -2.261  -20.940 6.916   1.00 0.00 ? 47 ILE D H      1  
ATOM 3487   H HA     . ILE D 1 47 ? -3.726  -20.468 9.451   1.00 0.00 ? 47 ILE D HA     1  
ATOM 3488   H HB     . ILE D 1 47 ? -4.007  -19.357 6.637   1.00 0.00 ? 47 ILE D HB     1  
ATOM 3489   H HG12   . ILE D 1 47 ? -2.145  -18.348 7.729   1.00 0.00 ? 47 ILE D HG12   1  
ATOM 3490   H HG13   . ILE D 1 47 ? -3.483  -17.199 7.784   1.00 0.00 ? 47 ILE D HG13   1  
ATOM 3491   H HG21   . ILE D 1 47 ? -6.232  -19.487 7.520   1.00 0.00 ? 47 ILE D HG21   1  
ATOM 3492   H HG22   . ILE D 1 47 ? -5.711  -18.882 9.103   1.00 0.00 ? 47 ILE D HG22   1  
ATOM 3493   H HG23   . ILE D 1 47 ? -5.694  -17.813 7.677   1.00 0.00 ? 47 ILE D HG23   1  
ATOM 3494   H HD11   . ILE D 1 47 ? -2.378  -17.184 9.921   1.00 0.00 ? 47 ILE D HD11   1  
ATOM 3495   H HD12   . ILE D 1 47 ? -3.959  -17.973 10.145  1.00 0.00 ? 47 ILE D HD12   1  
ATOM 3496   H HD13   . ILE D 1 47 ? -2.462  -18.944 10.057  1.00 0.00 ? 47 ILE D HD13   1  
ATOM 3497   N N      . TYR D 1 48 ? -4.822  -22.242 6.915   1.00 0.00 ? 48 TYR D N      1  
ATOM 3498   C CA     . TYR D 1 48 ? -5.739  -23.280 6.485   1.00 0.00 ? 48 TYR D CA     1  
ATOM 3499   C C      . TYR D 1 48 ? -5.953  -24.334 7.567   1.00 0.00 ? 48 TYR D C      1  
ATOM 3500   O O      . TYR D 1 48 ? -7.085  -24.746 7.811   1.00 0.00 ? 48 TYR D O      1  
ATOM 3501   C CB     . TYR D 1 48 ? -5.138  -23.896 5.223   1.00 0.00 ? 48 TYR D CB     1  
ATOM 3502   C CG     . TYR D 1 48 ? -5.905  -25.071 4.670   1.00 0.00 ? 48 TYR D CG     1  
ATOM 3503   C CD1    . TYR D 1 48 ? -7.144  -24.869 4.044   1.00 0.00 ? 48 TYR D CD1    1  
ATOM 3504   C CD2    . TYR D 1 48 ? -5.363  -26.359 4.768   1.00 0.00 ? 48 TYR D CD2    1  
ATOM 3505   C CE1    . TYR D 1 48 ? -7.832  -25.957 3.491   1.00 0.00 ? 48 TYR D CE1    1  
ATOM 3506   C CE2    . TYR D 1 48 ? -6.028  -27.444 4.184   1.00 0.00 ? 48 TYR D CE2    1  
ATOM 3507   C CZ     . TYR D 1 48 ? -7.265  -27.248 3.536   1.00 0.00 ? 48 TYR D CZ     1  
ATOM 3508   O OH     . TYR D 1 48 ? -7.930  -28.314 3.006   1.00 0.00 ? 48 TYR D OH     1  
ATOM 3509   H H      . TYR D 1 48 ? -4.101  -21.971 6.261   1.00 0.00 ? 48 TYR D H      1  
ATOM 3510   H HA     . TYR D 1 48 ? -6.702  -22.833 6.238   1.00 0.00 ? 48 TYR D HA     1  
ATOM 3511   H HB2    . TYR D 1 48 ? -5.077  -23.127 4.454   1.00 0.00 ? 48 TYR D HB2    1  
ATOM 3512   H HB3    . TYR D 1 48 ? -4.123  -24.223 5.441   1.00 0.00 ? 48 TYR D HB3    1  
ATOM 3513   H HD1    . TYR D 1 48 ? -7.573  -23.879 3.997   1.00 0.00 ? 48 TYR D HD1    1  
ATOM 3514   H HD2    . TYR D 1 48 ? -4.435  -26.522 5.295   1.00 0.00 ? 48 TYR D HD2    1  
ATOM 3515   H HE1    . TYR D 1 48 ? -8.804  -25.799 3.049   1.00 0.00 ? 48 TYR D HE1    1  
ATOM 3516   H HE2    . TYR D 1 48 ? -5.596  -28.430 4.253   1.00 0.00 ? 48 TYR D HE2    1  
ATOM 3517   H HH     . TYR D 1 48 ? -8.779  -28.070 2.625   1.00 0.00 ? 48 TYR D HH     1  
ATOM 3518   N N      . GLN D 1 49 ? -4.885  -24.674 8.294   1.00 0.00 ? 49 GLN D N      1  
ATOM 3519   C CA     . GLN D 1 49 ? -4.896  -25.653 9.369   1.00 0.00 ? 49 GLN D CA     1  
ATOM 3520   C C      . GLN D 1 49 ? -5.799  -25.267 10.539  1.00 0.00 ? 49 GLN D C      1  
ATOM 3521   O O      . GLN D 1 49 ? -6.284  -26.155 11.235  1.00 0.00 ? 49 GLN D O      1  
ATOM 3522   C CB     . GLN D 1 49 ? -3.461  -25.848 9.861   1.00 0.00 ? 49 GLN D CB     1  
ATOM 3523   C CG     . GLN D 1 49 ? -2.594  -26.543 8.810   1.00 0.00 ? 49 GLN D CG     1  
ATOM 3524   C CD     . GLN D 1 49 ? -1.117  -26.529 9.191   1.00 0.00 ? 49 GLN D CD     1  
ATOM 3525   O OE1    . GLN D 1 49 ? -0.748  -26.359 10.351  1.00 0.00 ? 49 GLN D OE1    1  
ATOM 3526   N NE2    . GLN D 1 49 ? -0.234  -26.718 8.214   1.00 0.00 ? 49 GLN D NE2    1  
ATOM 3527   H H      . GLN D 1 49 ? -3.992  -24.281 8.035   1.00 0.00 ? 49 GLN D H      1  
ATOM 3528   H HA     . GLN D 1 49 ? -5.256  -26.601 8.971   1.00 0.00 ? 49 GLN D HA     1  
ATOM 3529   H HB2    . GLN D 1 49 ? -3.032  -24.874 10.098  1.00 0.00 ? 49 GLN D HB2    1  
ATOM 3530   H HB3    . GLN D 1 49 ? -3.471  -26.455 10.766  1.00 0.00 ? 49 GLN D HB3    1  
ATOM 3531   H HG2    . GLN D 1 49 ? -2.919  -27.578 8.705   1.00 0.00 ? 49 GLN D HG2    1  
ATOM 3532   H HG3    . GLN D 1 49 ? -2.717  -26.050 7.846   1.00 0.00 ? 49 GLN D HG3    1  
ATOM 3533   H HE21   . GLN D 1 49 ? -0.550  -26.781 7.254   1.00 0.00 ? 49 GLN D HE21   1  
ATOM 3534   H HE22   . GLN D 1 49 ? 0.753   -26.617 8.397   1.00 0.00 ? 49 GLN D HE22   1  
ATOM 3535   N N      . ARG D 1 50 ? -6.063  -23.974 10.759  1.00 0.00 ? 50 ARG D N      1  
ATOM 3536   C CA     . ARG D 1 50 ? -7.035  -23.532 11.750  1.00 0.00 ? 50 ARG D CA     1  
ATOM 3537   C C      . ARG D 1 50 ? -8.444  -23.808 11.249  1.00 0.00 ? 50 ARG D C      1  
ATOM 3538   O O      . ARG D 1 50 ? -9.246  -24.406 11.961  1.00 0.00 ? 50 ARG D O      1  
ATOM 3539   C CB     . ARG D 1 50 ? -6.901  -22.041 12.069  1.00 0.00 ? 50 ARG D CB     1  
ATOM 3540   C CG     . ARG D 1 50 ? -5.651  -21.718 12.889  1.00 0.00 ? 50 ARG D CG     1  
ATOM 3541   C CD     . ARG D 1 50 ? -4.522  -21.267 11.966  1.00 0.00 ? 50 ARG D CD     1  
ATOM 3542   N NE     . ARG D 1 50 ? -3.262  -21.086 12.693  1.00 0.00 ? 50 ARG D NE     1  
ATOM 3543   C CZ     . ARG D 1 50 ? -2.392  -22.054 12.997  1.00 0.00 ? 50 ARG D CZ     1  
ATOM 3544   N NH1    . ARG D 1 50 ? -2.659  -23.336 12.745  1.00 0.00 ? 50 ARG D NH1    1  
ATOM 3545   N NH2    . ARG D 1 50 ? -1.236  -21.750 13.586  1.00 0.00 ? 50 ARG D NH2    1  
ATOM 3546   H H      . ARG D 1 50 ? -5.737  -23.293 10.085  1.00 0.00 ? 50 ARG D H      1  
ATOM 3547   H HA     . ARG D 1 50 ? -6.899  -24.102 12.669  1.00 0.00 ? 50 ARG D HA     1  
ATOM 3548   H HB2    . ARG D 1 50 ? -6.919  -21.457 11.149  1.00 0.00 ? 50 ARG D HB2    1  
ATOM 3549   H HB3    . ARG D 1 50 ? -7.765  -21.739 12.658  1.00 0.00 ? 50 ARG D HB3    1  
ATOM 3550   H HG2    . ARG D 1 50 ? -5.878  -20.912 13.587  1.00 0.00 ? 50 ARG D HG2    1  
ATOM 3551   H HG3    . ARG D 1 50 ? -5.344  -22.595 13.457  1.00 0.00 ? 50 ARG D HG3    1  
ATOM 3552   H HD2    . ARG D 1 50 ? -4.402  -22.011 11.180  1.00 0.00 ? 50 ARG D HD2    1  
ATOM 3553   H HD3    . ARG D 1 50 ? -4.804  -20.323 11.502  1.00 0.00 ? 50 ARG D HD3    1  
ATOM 3554   H HE     . ARG D 1 50 ? -3.007  -20.139 12.938  1.00 0.00 ? 50 ARG D HE     1  
ATOM 3555   H HH11   . ARG D 1 50 ? -3.531  -23.586 12.305  1.00 0.00 ? 50 ARG D HH11   1  
ATOM 3556   H HH12   . ARG D 1 50 ? -1.977  -24.048 12.962  1.00 0.00 ? 50 ARG D HH12   1  
ATOM 3557   H HH21   . ARG D 1 50 ? -1.008  -20.787 13.786  1.00 0.00 ? 50 ARG D HH21   1  
ATOM 3558   H HH22   . ARG D 1 50 ? -0.578  -22.479 13.817  1.00 0.00 ? 50 ARG D HH22   1  
ATOM 3559   N N      . ILE D 1 51 ? -8.735  -23.420 10.006  1.00 0.00 ? 51 ILE D N      1  
ATOM 3560   C CA     . ILE D 1 51 ? -10.042 -23.616 9.404   1.00 0.00 ? 51 ILE D CA     1  
ATOM 3561   C C      . ILE D 1 51 ? -10.363 -25.105 9.312   1.00 0.00 ? 51 ILE D C      1  
ATOM 3562   O O      . ILE D 1 51 ? -11.482 -25.522 9.604   1.00 0.00 ? 51 ILE D O      1  
ATOM 3563   C CB     . ILE D 1 51 ? -10.109 -22.862 8.072   1.00 0.00 ? 51 ILE D CB     1  
ATOM 3564   C CG1    . ILE D 1 51 ? -9.963  -21.353 8.293   1.00 0.00 ? 51 ILE D CG1    1  
ATOM 3565   C CG2    . ILE D 1 51 ? -11.436 -23.083 7.345   1.00 0.00 ? 51 ILE D CG2    1  
ATOM 3566   C CD1    . ILE D 1 51 ? -8.516  -20.873 8.222   1.00 0.00 ? 51 ILE D CD1    1  
ATOM 3567   H H      . ILE D 1 51 ? -8.021  -22.955 9.463   1.00 0.00 ? 51 ILE D H      1  
ATOM 3568   H HA     . ILE D 1 51 ? -10.799 -23.192 10.058  1.00 0.00 ? 51 ILE D HA     1  
ATOM 3569   H HB     . ILE D 1 51 ? -9.303  -23.206 7.423   1.00 0.00 ? 51 ILE D HB     1  
ATOM 3570   H HG12   . ILE D 1 51 ? -10.515 -20.823 7.520   1.00 0.00 ? 51 ILE D HG12   1  
ATOM 3571   H HG13   . ILE D 1 51 ? -10.389 -21.065 9.255   1.00 0.00 ? 51 ILE D HG13   1  
ATOM 3572   H HG21   . ILE D 1 51 ? -12.215 -22.475 7.803   1.00 0.00 ? 51 ILE D HG21   1  
ATOM 3573   H HG22   . ILE D 1 51 ? -11.327 -22.788 6.302   1.00 0.00 ? 51 ILE D HG22   1  
ATOM 3574   H HG23   . ILE D 1 51 ? -11.735 -24.131 7.387   1.00 0.00 ? 51 ILE D HG23   1  
ATOM 3575   H HD11   . ILE D 1 51 ? -8.505  -19.798 8.049   1.00 0.00 ? 51 ILE D HD11   1  
ATOM 3576   H HD12   . ILE D 1 51 ? -8.015  -21.078 9.166   1.00 0.00 ? 51 ILE D HD12   1  
ATOM 3577   H HD13   . ILE D 1 51 ? -7.997  -21.369 7.400   1.00 0.00 ? 51 ILE D HD13   1  
ATOM 3578   N N      . GLN D 1 52 ? -9.340  -25.929 9.073   1.00 0.00 ? 52 GLN D N      1  
ATOM 3579   C CA     . GLN D 1 52 ? -9.494  -27.370 8.974   1.00 0.00 ? 52 GLN D CA     1  
ATOM 3580   C C      . GLN D 1 52 ? -9.506  -28.033 10.352  1.00 0.00 ? 52 GLN D C      1  
ATOM 3581   O O      . GLN D 1 52 ? -9.688  -29.245 10.449  1.00 0.00 ? 52 GLN D O      1  
ATOM 3582   C CB     . GLN D 1 52 ? -8.405  -27.940 8.059   1.00 0.00 ? 52 GLN D CB     1  
ATOM 3583   C CG     . GLN D 1 52 ? -8.430  -27.435 6.615   1.00 0.00 ? 52 GLN D CG     1  
ATOM 3584   C CD     . GLN D 1 52 ? -9.720  -26.748 6.186   1.00 0.00 ? 52 GLN D CD     1  
ATOM 3585   O OE1    . GLN D 1 52 ? -10.684 -27.391 5.780   1.00 0.00 ? 52 GLN D OE1    1  
ATOM 3586   N NE2    . GLN D 1 52 ? -9.768  -25.421 6.283   1.00 0.00 ? 52 GLN D NE2    1  
ATOM 3587   H H      . GLN D 1 52 ? -8.435  -25.532 8.859   1.00 0.00 ? 52 GLN D H      1  
ATOM 3588   H HA     . GLN D 1 52 ? -10.464 -27.576 8.522   1.00 0.00 ? 52 GLN D HA     1  
ATOM 3589   H HB2    . GLN D 1 52 ? -7.431  -27.711 8.491   1.00 0.00 ? 52 GLN D HB2    1  
ATOM 3590   H HB3    . GLN D 1 52 ? -8.497  -29.025 8.021   1.00 0.00 ? 52 GLN D HB3    1  
ATOM 3591   H HG2    . GLN D 1 52 ? -7.600  -26.743 6.472   1.00 0.00 ? 52 GLN D HG2    1  
ATOM 3592   H HG3    . GLN D 1 52 ? -8.265  -28.283 5.951   1.00 0.00 ? 52 GLN D HG3    1  
ATOM 3593   H HE21   . GLN D 1 52 ? -9.013  -24.933 6.748   1.00 0.00 ? 52 GLN D HE21   1  
ATOM 3594   H HE22   . GLN D 1 52 ? -10.652 -24.951 6.158   1.00 0.00 ? 52 GLN D HE22   1  
ATOM 3595   N N      . ALA D 1 53 ? -9.388  -27.241 11.421  1.00 0.00 ? 53 ALA D N      1  
ATOM 3596   C CA     . ALA D 1 53 ? -9.597  -27.680 12.790  1.00 0.00 ? 53 ALA D CA     1  
ATOM 3597   C C      . ALA D 1 53 ? -11.074 -27.647 13.189  1.00 0.00 ? 53 ALA D C      1  
ATOM 3598   O O      . ALA D 1 53 ? -11.422 -28.150 14.256  1.00 0.00 ? 53 ALA D O      1  
ATOM 3599   C CB     . ALA D 1 53 ? -8.737  -26.830 13.725  1.00 0.00 ? 53 ALA D CB     1  
ATOM 3600   H H      . ALA D 1 53 ? -9.209  -26.256 11.282  1.00 0.00 ? 53 ALA D H      1  
ATOM 3601   H HA     . ALA D 1 53 ? -9.256  -28.713 12.872  1.00 0.00 ? 53 ALA D HA     1  
ATOM 3602   H HB1    . ALA D 1 53 ? -9.216  -25.869 13.910  1.00 0.00 ? 53 ALA D HB1    1  
ATOM 3603   H HB2    . ALA D 1 53 ? -8.611  -27.348 14.676  1.00 0.00 ? 53 ALA D HB2    1  
ATOM 3604   H HB3    . ALA D 1 53 ? -7.755  -26.654 13.284  1.00 0.00 ? 53 ALA D HB3    1  
ATOM 3605   N N      . GLY D 1 54 ? -11.950 -27.090 12.344  1.00 0.00 ? 54 GLY D N      1  
ATOM 3606   C CA     . GLY D 1 54 ? -13.393 -27.192 12.501  1.00 0.00 ? 54 GLY D CA     1  
ATOM 3607   C C      . GLY D 1 54 ? -14.100 -25.852 12.676  1.00 0.00 ? 54 GLY D C      1  
ATOM 3608   O O      . GLY D 1 54 ? -14.922 -25.715 13.580  1.00 0.00 ? 54 GLY D O      1  
ATOM 3609   H H      . GLY D 1 54 ? -11.601 -26.667 11.495  1.00 0.00 ? 54 GLY D H      1  
ATOM 3610   H HA2    . GLY D 1 54 ? -13.807 -27.688 11.623  1.00 0.00 ? 54 GLY D HA2    1  
ATOM 3611   H HA3    . GLY D 1 54 ? -13.618 -27.799 13.378  1.00 0.00 ? 54 GLY D HA3    1  
ATOM 3612   N N      . LEU D 1 55 ? -13.767 -24.853 11.855  1.00 0.00 ? 55 LEU D N      1  
ATOM 3613   C CA     . LEU D 1 55 ? -14.203 -23.478 12.053  1.00 0.00 ? 55 LEU D CA     1  
ATOM 3614   C C      . LEU D 1 55 ? -14.051 -22.639 10.787  1.00 0.00 ? 55 LEU D C      1  
ATOM 3615   O O      . LEU D 1 55 ? -13.478 -23.101 9.802   1.00 0.00 ? 55 LEU D O      1  
ATOM 3616   C CB     . LEU D 1 55 ? -13.396 -22.863 13.200  1.00 0.00 ? 55 LEU D CB     1  
ATOM 3617   C CG     . LEU D 1 55 ? -11.876 -22.955 13.028  1.00 0.00 ? 55 LEU D CG     1  
ATOM 3618   C CD1    . LEU D 1 55 ? -11.297 -21.866 12.124  1.00 0.00 ? 55 LEU D CD1    1  
ATOM 3619   C CD2    . LEU D 1 55 ? -11.233 -22.826 14.405  1.00 0.00 ? 55 LEU D CD2    1  
ATOM 3620   H H      . LEU D 1 55 ? -13.130 -25.033 11.091  1.00 0.00 ? 55 LEU D H      1  
ATOM 3621   H HA     . LEU D 1 55 ? -15.258 -23.476 12.330  1.00 0.00 ? 55 LEU D HA     1  
ATOM 3622   H HB2    . LEU D 1 55 ? -13.678 -21.817 13.327  1.00 0.00 ? 55 LEU D HB2    1  
ATOM 3623   H HB3    . LEU D 1 55 ? -13.671 -23.384 14.116  1.00 0.00 ? 55 LEU D HB3    1  
ATOM 3624   H HG     . LEU D 1 55 ? -11.609 -23.929 12.621  1.00 0.00 ? 55 LEU D HG     1  
ATOM 3625   H HD11   . LEU D 1 55 ? -10.227 -22.025 11.998  1.00 0.00 ? 55 LEU D HD11   1  
ATOM 3626   H HD12   . LEU D 1 55 ? -11.743 -21.900 11.132  1.00 0.00 ? 55 LEU D HD12   1  
ATOM 3627   H HD13   . LEU D 1 55 ? -11.467 -20.883 12.558  1.00 0.00 ? 55 LEU D HD13   1  
ATOM 3628   H HD21   . LEU D 1 55 ? -10.147 -22.843 14.306  1.00 0.00 ? 55 LEU D HD21   1  
ATOM 3629   H HD22   . LEU D 1 55 ? -11.546 -21.893 14.874  1.00 0.00 ? 55 LEU D HD22   1  
ATOM 3630   H HD23   . LEU D 1 55 ? -11.545 -23.668 15.022  1.00 0.00 ? 55 LEU D HD23   1  
ATOM 3631   N N      . THR D 1 56 ? -14.497 -21.380 10.854  1.00 0.00 ? 56 THR D N      1  
ATOM 3632   C CA     . THR D 1 56 ? -14.209 -20.349 9.868   1.00 0.00 ? 56 THR D CA     1  
ATOM 3633   C C      . THR D 1 56 ? -14.142 -18.999 10.577  1.00 0.00 ? 56 THR D C      1  
ATOM 3634   O O      . THR D 1 56 ? -15.180 -18.387 10.822  1.00 0.00 ? 56 THR D O      1  
ATOM 3635   C CB     . THR D 1 56 ? -15.261 -20.312 8.755   1.00 0.00 ? 56 THR D CB     1  
ATOM 3636   O OG1    . THR D 1 56 ? -15.484 -21.591 8.206   1.00 0.00 ? 56 THR D OG1    1  
ATOM 3637   C CG2    . THR D 1 56 ? -14.789 -19.403 7.622   1.00 0.00 ? 56 THR D CG2    1  
ATOM 3638   H H      . THR D 1 56 ? -15.010 -21.099 11.677  1.00 0.00 ? 56 THR D H      1  
ATOM 3639   H HA     . THR D 1 56 ? -13.238 -20.552 9.415   1.00 0.00 ? 56 THR D HA     1  
ATOM 3640   H HB     . THR D 1 56 ? -16.203 -19.935 9.153   1.00 0.00 ? 56 THR D HB     1  
ATOM 3641   H HG1    . THR D 1 56 ? -16.220 -21.527 7.588   1.00 0.00 ? 56 THR D HG1    1  
ATOM 3642   H HG21   . THR D 1 56 ? -15.518 -19.419 6.812   1.00 0.00 ? 56 THR D HG21   1  
ATOM 3643   H HG22   . THR D 1 56 ? -14.688 -18.380 7.984   1.00 0.00 ? 56 THR D HG22   1  
ATOM 3644   H HG23   . THR D 1 56 ? -13.826 -19.750 7.248   1.00 0.00 ? 56 THR D HG23   1  
ATOM 3645   N N      . ALA D 1 57 ? -12.934 -18.568 10.953  1.00 0.00 ? 57 ALA D N      1  
ATOM 3646   C CA     . ALA D 1 57 ? -12.644 -17.327 11.658  1.00 0.00 ? 57 ALA D CA     1  
ATOM 3647   C C      . ALA D 1 57 ? -13.629 -17.006 12.785  1.00 0.00 ? 57 ALA D C      1  
ATOM 3648   O O      . ALA D 1 57 ? -14.561 -16.225 12.585  1.00 0.00 ? 57 ALA D O      1  
ATOM 3649   C CB     . ALA D 1 57 ? -12.512 -16.190 10.644  1.00 0.00 ? 57 ALA D CB     1  
ATOM 3650   H H      . ALA D 1 57 ? -12.131 -19.121 10.689  1.00 0.00 ? 57 ALA D H      1  
ATOM 3651   H HA     . ALA D 1 57 ? -11.661 -17.439 12.116  1.00 0.00 ? 57 ALA D HA     1  
ATOM 3652   H HB1    . ALA D 1 57 ? -13.492 -15.926 10.245  1.00 0.00 ? 57 ALA D HB1    1  
ATOM 3653   H HB2    . ALA D 1 57 ? -12.064 -15.322 11.130  1.00 0.00 ? 57 ALA D HB2    1  
ATOM 3654   H HB3    . ALA D 1 57 ? -11.867 -16.503 9.824   1.00 0.00 ? 57 ALA D HB3    1  
ATOM 3655   N N      . PRO D 1 58 ? -13.439 -17.580 13.980  1.00 0.00 ? 58 PRO D N      1  
ATOM 3656   C CA     . PRO D 1 58 ? -14.389 -17.488 15.075  1.00 0.00 ? 58 PRO D CA     1  
ATOM 3657   C C      . PRO D 1 58 ? -14.620 -16.069 15.584  1.00 0.00 ? 58 PRO D C      1  
ATOM 3658   O O      . PRO D 1 58 ? -13.863 -15.144 15.291  1.00 0.00 ? 58 PRO D O      1  
ATOM 3659   C CB     . PRO D 1 58 ? -13.845 -18.367 16.198  1.00 0.00 ? 58 PRO D CB     1  
ATOM 3660   C CG     . PRO D 1 58 ? -12.910 -19.345 15.492  1.00 0.00 ? 58 PRO D CG     1  
ATOM 3661   C CD     . PRO D 1 58 ? -12.410 -18.558 14.284  1.00 0.00 ? 58 PRO D CD     1  
ATOM 3662   H HA     . PRO D 1 58 ? -15.336 -17.910 14.739  1.00 0.00 ? 58 PRO D HA     1  
ATOM 3663   H HB2    . PRO D 1 58 ? -13.270 -17.764 16.902  1.00 0.00 ? 58 PRO D HB2    1  
ATOM 3664   H HB3    . PRO D 1 58 ? -14.657 -18.879 16.713  1.00 0.00 ? 58 PRO D HB3    1  
ATOM 3665   H HG2    . PRO D 1 58 ? -12.084 -19.638 16.141  1.00 0.00 ? 58 PRO D HG2    1  
ATOM 3666   H HG3    . PRO D 1 58 ? -13.471 -20.219 15.161  1.00 0.00 ? 58 PRO D HG3    1  
ATOM 3667   H HD2    . PRO D 1 58 ? -11.480 -18.047 14.532  1.00 0.00 ? 58 PRO D HD2    1  
ATOM 3668   H HD3    . PRO D 1 58 ? -12.260 -19.232 13.443  1.00 0.00 ? 58 PRO D HD3    1  
ATOM 3669   N N      . ASP D 1 59 ? -15.638 -15.927 16.436  1.00 0.00 ? 59 ASP D N      1  
ATOM 3670   C CA     . ASP D 1 59 ? -16.017 -14.669 17.060  1.00 0.00 ? 59 ASP D CA     1  
ATOM 3671   C C      . ASP D 1 59 ? -14.910 -14.089 17.936  1.00 0.00 ? 59 ASP D C      1  
ATOM 3672   O O      . ASP D 1 59 ? -14.815 -12.873 18.091  1.00 0.00 ? 59 ASP D O      1  
ATOM 3673   C CB     . ASP D 1 59 ? -17.262 -14.925 17.908  1.00 0.00 ? 59 ASP D CB     1  
ATOM 3674   C CG     . ASP D 1 59 ? -17.965 -13.626 18.293  1.00 0.00 ? 59 ASP D CG     1  
ATOM 3675   O OD1    . ASP D 1 59 ? -18.438 -12.921 17.374  1.00 0.00 ? 59 ASP D OD1    1  
ATOM 3676   O OD2    . ASP D 1 59 ? -18.068 -13.350 19.509  1.00 0.00 ? 59 ASP D OD2    1  
ATOM 3677   H H      . ASP D 1 59 ? -16.214 -16.733 16.634  1.00 0.00 ? 59 ASP D H      1  
ATOM 3678   H HA     . ASP D 1 59 ? -16.260 -13.949 16.279  1.00 0.00 ? 59 ASP D HA     1  
ATOM 3679   H HB2    . ASP D 1 59 ? -17.954 -15.557 17.350  1.00 0.00 ? 59 ASP D HB2    1  
ATOM 3680   H HB3    . ASP D 1 59 ? -16.972 -15.470 18.807  1.00 0.00 ? 59 ASP D HB3    1  
ATOM 3681   N N      . MET E 1 1  ? 48.603  5.966   -14.290 1.00 0.00 ? 1  MET E N      1  
ATOM 3682   C CA     . MET E 1 1  ? 47.433  5.375   -13.610 1.00 0.00 ? 1  MET E CA     1  
ATOM 3683   C C      . MET E 1 1  ? 46.347  5.199   -14.671 1.00 0.00 ? 1  MET E C      1  
ATOM 3684   O O      . MET E 1 1  ? 46.594  5.578   -15.814 1.00 0.00 ? 1  MET E O      1  
ATOM 3685   C CB     . MET E 1 1  ? 47.049  6.368   -12.508 1.00 0.00 ? 1  MET E CB     1  
ATOM 3686   C CG     . MET E 1 1  ? 45.845  6.024   -11.636 1.00 0.00 ? 1  MET E CG     1  
ATOM 3687   S SD     . MET E 1 1  ? 45.823  7.018   -10.122 1.00 0.00 ? 1  MET E SD     1  
ATOM 3688   C CE     . MET E 1 1  ? 44.037  7.182   -9.884  1.00 0.00 ? 1  MET E CE     1  
ATOM 3689   H H1     . MET E 1 1  ? 49.350  6.117   -13.626 1.00 0.00 ? 1  MET E H1     1  
ATOM 3690   H H2     . MET E 1 1  ? 48.351  6.847   -14.714 1.00 0.00 ? 1  MET E H2     1  
ATOM 3691   H H3     . MET E 1 1  ? 48.930  5.340   -15.012 1.00 0.00 ? 1  MET E H3     1  
ATOM 3692   H HA     . MET E 1 1  ? 47.687  4.408   -13.174 1.00 0.00 ? 1  MET E HA     1  
ATOM 3693   H HB2    . MET E 1 1  ? 47.909  6.479   -11.847 1.00 0.00 ? 1  MET E HB2    1  
ATOM 3694   H HB3    . MET E 1 1  ? 46.861  7.340   -12.964 1.00 0.00 ? 1  MET E HB3    1  
ATOM 3695   H HG2    . MET E 1 1  ? 44.936  6.223   -12.203 1.00 0.00 ? 1  MET E HG2    1  
ATOM 3696   H HG3    . MET E 1 1  ? 45.882  4.970   -11.363 1.00 0.00 ? 1  MET E HG3    1  
ATOM 3697   H HE1    . MET E 1 1  ? 43.589  7.526   -10.816 1.00 0.00 ? 1  MET E HE1    1  
ATOM 3698   H HE2    . MET E 1 1  ? 43.613  6.217   -9.607  1.00 0.00 ? 1  MET E HE2    1  
ATOM 3699   H HE3    . MET E 1 1  ? 43.838  7.906   -9.094  1.00 0.00 ? 1  MET E HE3    1  
ATOM 3700   N N      . LEU E 1 2  ? 45.154  4.666   -14.374 1.00 0.00 ? 2  LEU E N      1  
ATOM 3701   C CA     . LEU E 1 2  ? 44.075  4.694   -15.350 1.00 0.00 ? 2  LEU E CA     1  
ATOM 3702   C C      . LEU E 1 2  ? 43.091  5.812   -15.027 1.00 0.00 ? 2  LEU E C      1  
ATOM 3703   O O      . LEU E 1 2  ? 42.575  5.897   -13.916 1.00 0.00 ? 2  LEU E O      1  
ATOM 3704   C CB     . LEU E 1 2  ? 43.404  3.325   -15.480 1.00 0.00 ? 2  LEU E CB     1  
ATOM 3705   C CG     . LEU E 1 2  ? 42.595  3.253   -16.779 1.00 0.00 ? 2  LEU E CG     1  
ATOM 3706   C CD1    . LEU E 1 2  ? 42.678  1.863   -17.401 1.00 0.00 ? 2  LEU E CD1    1  
ATOM 3707   C CD2    . LEU E 1 2  ? 41.120  3.570   -16.549 1.00 0.00 ? 2  LEU E CD2    1  
ATOM 3708   H H      . LEU E 1 2  ? 44.918  4.382   -13.433 1.00 0.00 ? 2  LEU E H      1  
ATOM 3709   H HA     . LEU E 1 2  ? 44.501  4.918   -16.328 1.00 0.00 ? 2  LEU E HA     1  
ATOM 3710   H HB2    . LEU E 1 2  ? 44.181  2.561   -15.500 1.00 0.00 ? 2  LEU E HB2    1  
ATOM 3711   H HB3    . LEU E 1 2  ? 42.758  3.140   -14.621 1.00 0.00 ? 2  LEU E HB3    1  
ATOM 3712   H HG     . LEU E 1 2  ? 42.996  3.966   -17.500 1.00 0.00 ? 2  LEU E HG     1  
ATOM 3713   H HD11   . LEU E 1 2  ? 42.224  1.137   -16.728 1.00 0.00 ? 2  LEU E HD11   1  
ATOM 3714   H HD12   . LEU E 1 2  ? 42.140  1.854   -18.349 1.00 0.00 ? 2  LEU E HD12   1  
ATOM 3715   H HD13   . LEU E 1 2  ? 43.720  1.597   -17.579 1.00 0.00 ? 2  LEU E HD13   1  
ATOM 3716   H HD21   . LEU E 1 2  ? 40.600  3.590   -17.506 1.00 0.00 ? 2  LEU E HD21   1  
ATOM 3717   H HD22   . LEU E 1 2  ? 40.672  2.805   -15.915 1.00 0.00 ? 2  LEU E HD22   1  
ATOM 3718   H HD23   . LEU E 1 2  ? 41.015  4.542   -16.068 1.00 0.00 ? 2  LEU E HD23   1  
ATOM 3719   N N      . ILE E 1 3  ? 42.859  6.683   -16.012 1.00 0.00 ? 3  ILE E N      1  
ATOM 3720   C CA     . ILE E 1 3  ? 42.127  7.931   -15.864 1.00 0.00 ? 3  ILE E CA     1  
ATOM 3721   C C      . ILE E 1 3  ? 41.050  7.999   -16.944 1.00 0.00 ? 3  ILE E C      1  
ATOM 3722   O O      . ILE E 1 3  ? 41.317  7.695   -18.106 1.00 0.00 ? 3  ILE E O      1  
ATOM 3723   C CB     . ILE E 1 3  ? 43.100  9.109   -15.973 1.00 0.00 ? 3  ILE E CB     1  
ATOM 3724   C CG1    . ILE E 1 3  ? 44.298  9.002   -15.021 1.00 0.00 ? 3  ILE E CG1    1  
ATOM 3725   C CG2    . ILE E 1 3  ? 42.356  10.425  -15.747 1.00 0.00 ? 3  ILE E CG2    1  
ATOM 3726   C CD1    . ILE E 1 3  ? 43.945  9.076   -13.535 1.00 0.00 ? 3  ILE E CD1    1  
ATOM 3727   H H      . ILE E 1 3  ? 43.300  6.521   -16.905 1.00 0.00 ? 3  ILE E H      1  
ATOM 3728   H HA     . ILE E 1 3  ? 41.648  7.964   -14.884 1.00 0.00 ? 3  ILE E HA     1  
ATOM 3729   H HB     . ILE E 1 3  ? 43.498  9.123   -16.987 1.00 0.00 ? 3  ILE E HB     1  
ATOM 3730   H HG12   . ILE E 1 3  ? 44.828  8.068   -15.207 1.00 0.00 ? 3  ILE E HG12   1  
ATOM 3731   H HG13   . ILE E 1 3  ? 44.993  9.812   -15.242 1.00 0.00 ? 3  ILE E HG13   1  
ATOM 3732   H HG21   . ILE E 1 3  ? 43.069  11.245  -15.661 1.00 0.00 ? 3  ILE E HG21   1  
ATOM 3733   H HG22   . ILE E 1 3  ? 41.693  10.625  -16.590 1.00 0.00 ? 3  ILE E HG22   1  
ATOM 3734   H HG23   . ILE E 1 3  ? 41.762  10.363  -14.835 1.00 0.00 ? 3  ILE E HG23   1  
ATOM 3735   H HD11   . ILE E 1 3  ? 43.196  8.326   -13.286 1.00 0.00 ? 3  ILE E HD11   1  
ATOM 3736   H HD12   . ILE E 1 3  ? 44.841  8.889   -12.943 1.00 0.00 ? 3  ILE E HD12   1  
ATOM 3737   H HD13   . ILE E 1 3  ? 43.568  10.068  -13.293 1.00 0.00 ? 3  ILE E HD13   1  
ATOM 3738   N N      . LEU E 1 4  ? 39.829  8.381   -16.562 1.00 0.00 ? 4  LEU E N      1  
ATOM 3739   C CA     . LEU E 1 4  ? 38.653  8.369   -17.419 1.00 0.00 ? 4  LEU E CA     1  
ATOM 3740   C C      . LEU E 1 4  ? 37.810  9.623   -17.214 1.00 0.00 ? 4  LEU E C      1  
ATOM 3741   O O      . LEU E 1 4  ? 37.922  10.290  -16.187 1.00 0.00 ? 4  LEU E O      1  
ATOM 3742   C CB     . LEU E 1 4  ? 37.798  7.146   -17.081 1.00 0.00 ? 4  LEU E CB     1  
ATOM 3743   C CG     . LEU E 1 4  ? 38.333  5.826   -17.635 1.00 0.00 ? 4  LEU E CG     1  
ATOM 3744   C CD1    . LEU E 1 4  ? 37.488  4.696   -17.054 1.00 0.00 ? 4  LEU E CD1    1  
ATOM 3745   C CD2    . LEU E 1 4  ? 38.230  5.767   -19.158 1.00 0.00 ? 4  LEU E CD2    1  
ATOM 3746   H H      . LEU E 1 4  ? 39.688  8.638   -15.594 1.00 0.00 ? 4  LEU E H      1  
ATOM 3747   H HA     . LEU E 1 4  ? 38.955  8.333   -18.465 1.00 0.00 ? 4  LEU E HA     1  
ATOM 3748   H HB2    . LEU E 1 4  ? 37.722  7.067   -15.995 1.00 0.00 ? 4  LEU E HB2    1  
ATOM 3749   H HB3    . LEU E 1 4  ? 36.790  7.294   -17.471 1.00 0.00 ? 4  LEU E HB3    1  
ATOM 3750   H HG     . LEU E 1 4  ? 39.371  5.690   -17.335 1.00 0.00 ? 4  LEU E HG     1  
ATOM 3751   H HD11   . LEU E 1 4  ? 37.638  4.656   -15.975 1.00 0.00 ? 4  LEU E HD11   1  
ATOM 3752   H HD12   . LEU E 1 4  ? 36.434  4.882   -17.264 1.00 0.00 ? 4  LEU E HD12   1  
ATOM 3753   H HD13   . LEU E 1 4  ? 37.788  3.743   -17.490 1.00 0.00 ? 4  LEU E HD13   1  
ATOM 3754   H HD21   . LEU E 1 4  ? 38.903  6.499   -19.604 1.00 0.00 ? 4  LEU E HD21   1  
ATOM 3755   H HD22   . LEU E 1 4  ? 38.518  4.774   -19.503 1.00 0.00 ? 4  LEU E HD22   1  
ATOM 3756   H HD23   . LEU E 1 4  ? 37.205  5.974   -19.470 1.00 0.00 ? 4  LEU E HD23   1  
ATOM 3757   N N      . THR E 1 5  ? 36.892  9.881   -18.150 1.00 0.00 ? 5  THR E N      1  
ATOM 3758   C CA     . THR E 1 5  ? 35.852  10.885  -17.995 1.00 0.00 ? 5  THR E CA     1  
ATOM 3759   C C      . THR E 1 5  ? 34.513  10.274  -18.392 1.00 0.00 ? 5  THR E C      1  
ATOM 3760   O O      . THR E 1 5  ? 34.199  10.144  -19.575 1.00 0.00 ? 5  THR E O      1  
ATOM 3761   C CB     . THR E 1 5  ? 36.159  12.166  -18.777 1.00 0.00 ? 5  THR E CB     1  
ATOM 3762   O OG1    . THR E 1 5  ? 37.548  12.357  -18.939 1.00 0.00 ? 5  THR E OG1    1  
ATOM 3763   C CG2    . THR E 1 5  ? 35.627  13.378  -18.014 1.00 0.00 ? 5  THR E CG2    1  
ATOM 3764   H H      . THR E 1 5  ? 36.882  9.320   -18.990 1.00 0.00 ? 5  THR E H      1  
ATOM 3765   H HA     . THR E 1 5  ? 35.794  11.152  -16.940 1.00 0.00 ? 5  THR E HA     1  
ATOM 3766   H HB     . THR E 1 5  ? 35.693  12.120  -19.762 1.00 0.00 ? 5  THR E HB     1  
ATOM 3767   H HG1    . THR E 1 5  ? 37.679  13.064  -19.578 1.00 0.00 ? 5  THR E HG1    1  
ATOM 3768   H HG21   . THR E 1 5  ? 35.762  14.277  -18.616 1.00 0.00 ? 5  THR E HG21   1  
ATOM 3769   H HG22   . THR E 1 5  ? 34.567  13.256  -17.797 1.00 0.00 ? 5  THR E HG22   1  
ATOM 3770   H HG23   . THR E 1 5  ? 36.172  13.486  -17.076 1.00 0.00 ? 5  THR E HG23   1  
ATOM 3771   N N      . ARG E 1 6  ? 33.746  9.836   -17.389 1.00 0.00 ? 6  ARG E N      1  
ATOM 3772   C CA     . ARG E 1 6  ? 32.547  9.024   -17.534 1.00 0.00 ? 6  ARG E CA     1  
ATOM 3773   C C      . ARG E 1 6  ? 31.282  9.841   -17.310 1.00 0.00 ? 6  ARG E C      1  
ATOM 3774   O O      . ARG E 1 6  ? 31.183  10.576  -16.332 1.00 0.00 ? 6  ARG E O      1  
ATOM 3775   C CB     . ARG E 1 6  ? 32.657  7.877   -16.525 1.00 0.00 ? 6  ARG E CB     1  
ATOM 3776   C CG     . ARG E 1 6  ? 31.718  6.699   -16.788 1.00 0.00 ? 6  ARG E CG     1  
ATOM 3777   C CD     . ARG E 1 6  ? 32.187  5.814   -17.943 1.00 0.00 ? 6  ARG E CD     1  
ATOM 3778   N NE     . ARG E 1 6  ? 31.878  6.411   -19.244 1.00 0.00 ? 6  ARG E NE     1  
ATOM 3779   C CZ     . ARG E 1 6  ? 32.727  6.636   -20.250 1.00 0.00 ? 6  ARG E CZ     1  
ATOM 3780   N NH1    . ARG E 1 6  ? 34.027  6.353   -20.161 1.00 0.00 ? 6  ARG E NH1    1  
ATOM 3781   N NH2    . ARG E 1 6  ? 32.257  7.199   -21.361 1.00 0.00 ? 6  ARG E NH2    1  
ATOM 3782   H H      . ARG E 1 6  ? 34.082  9.982   -16.447 1.00 0.00 ? 6  ARG E H      1  
ATOM 3783   H HA     . ARG E 1 6  ? 32.479  8.644   -18.551 1.00 0.00 ? 6  ARG E HA     1  
ATOM 3784   H HB2    . ARG E 1 6  ? 33.681  7.506   -16.510 1.00 0.00 ? 6  ARG E HB2    1  
ATOM 3785   H HB3    . ARG E 1 6  ? 32.441  8.270   -15.532 1.00 0.00 ? 6  ARG E HB3    1  
ATOM 3786   H HG2    . ARG E 1 6  ? 31.683  6.088   -15.886 1.00 0.00 ? 6  ARG E HG2    1  
ATOM 3787   H HG3    . ARG E 1 6  ? 30.715  7.076   -16.983 1.00 0.00 ? 6  ARG E HG3    1  
ATOM 3788   H HD2    . ARG E 1 6  ? 33.257  5.632   -17.843 1.00 0.00 ? 6  ARG E HD2    1  
ATOM 3789   H HD3    . ARG E 1 6  ? 31.673  4.854   -17.872 1.00 0.00 ? 6  ARG E HD3    1  
ATOM 3790   H HE     . ARG E 1 6  ? 30.930  6.731   -19.396 1.00 0.00 ? 6  ARG E HE     1  
ATOM 3791   H HH11   . ARG E 1 6  ? 34.393  5.954   -19.311 1.00 0.00 ? 6  ARG E HH11   1  
ATOM 3792   H HH12   . ARG E 1 6  ? 34.650  6.623   -20.907 1.00 0.00 ? 6  ARG E HH12   1  
ATOM 3793   H HH21   . ARG E 1 6  ? 31.270  7.418   -21.408 1.00 0.00 ? 6  ARG E HH21   1  
ATOM 3794   H HH22   . ARG E 1 6  ? 32.868  7.399   -22.140 1.00 0.00 ? 6  ARG E HH22   1  
ATOM 3795   N N      . LYS E 1 7  ? 30.306  9.706   -18.212 1.00 0.00 ? 7  LYS E N      1  
ATOM 3796   C CA     . LYS E 1 7  ? 29.019  10.363  -18.064 1.00 0.00 ? 7  LYS E CA     1  
ATOM 3797   C C      . LYS E 1 7  ? 28.107  9.600   -17.113 1.00 0.00 ? 7  LYS E C      1  
ATOM 3798   O O      . LYS E 1 7  ? 28.257  8.393   -16.930 1.00 0.00 ? 7  LYS E O      1  
ATOM 3799   C CB     . LYS E 1 7  ? 28.339  10.537  -19.420 1.00 0.00 ? 7  LYS E CB     1  
ATOM 3800   C CG     . LYS E 1 7  ? 28.690  11.869  -20.081 1.00 0.00 ? 7  LYS E CG     1  
ATOM 3801   C CD     . LYS E 1 7  ? 27.505  12.448  -20.855 1.00 0.00 ? 7  LYS E CD     1  
ATOM 3802   C CE     . LYS E 1 7  ? 26.992  11.529  -21.964 1.00 0.00 ? 7  LYS E CE     1  
ATOM 3803   N NZ     . LYS E 1 7  ? 27.958  11.385  -23.068 1.00 0.00 ? 7  LYS E NZ     1  
ATOM 3804   H H      . LYS E 1 7  ? 30.409  9.028   -18.955 1.00 0.00 ? 7  LYS E H      1  
ATOM 3805   H HA     . LYS E 1 7  ? 29.179  11.345  -17.621 1.00 0.00 ? 7  LYS E HA     1  
ATOM 3806   H HB2    . LYS E 1 7  ? 28.602  9.717   -20.087 1.00 0.00 ? 7  LYS E HB2    1  
ATOM 3807   H HB3    . LYS E 1 7  ? 27.266  10.504  -19.253 1.00 0.00 ? 7  LYS E HB3    1  
ATOM 3808   H HG2    . LYS E 1 7  ? 28.975  12.594  -19.321 1.00 0.00 ? 7  LYS E HG2    1  
ATOM 3809   H HG3    . LYS E 1 7  ? 29.535  11.714  -20.751 1.00 0.00 ? 7  LYS E HG3    1  
ATOM 3810   H HD2    . LYS E 1 7  ? 26.689  12.629  -20.155 1.00 0.00 ? 7  LYS E HD2    1  
ATOM 3811   H HD3    . LYS E 1 7  ? 27.796  13.408  -21.280 1.00 0.00 ? 7  LYS E HD3    1  
ATOM 3812   H HE2    . LYS E 1 7  ? 26.767  10.549  -21.540 1.00 0.00 ? 7  LYS E HE2    1  
ATOM 3813   H HE3    . LYS E 1 7  ? 26.064  11.950  -22.352 1.00 0.00 ? 7  LYS E HE3    1  
ATOM 3814   H HZ1    . LYS E 1 7  ? 27.559  10.828  -23.809 1.00 0.00 ? 7  LYS E HZ1    1  
ATOM 3815   H HZ2    . LYS E 1 7  ? 28.199  12.290  -23.447 1.00 0.00 ? 7  LYS E HZ2    1  
ATOM 3816   H HZ3    . LYS E 1 7  ? 28.801  10.927  -22.748 1.00 0.00 ? 7  LYS E HZ3    1  
ATOM 3817   N N      . VAL E 1 8  ? 27.129  10.303  -16.538 1.00 0.00 ? 8  VAL E N      1  
ATOM 3818   C CA     . VAL E 1 8  ? 26.213  9.703   -15.581 1.00 0.00 ? 8  VAL E CA     1  
ATOM 3819   C C      . VAL E 1 8  ? 25.417  8.566   -16.214 1.00 0.00 ? 8  VAL E C      1  
ATOM 3820   O O      . VAL E 1 8  ? 24.949  8.675   -17.347 1.00 0.00 ? 8  VAL E O      1  
ATOM 3821   C CB     . VAL E 1 8  ? 25.304  10.734  -14.909 1.00 0.00 ? 8  VAL E CB     1  
ATOM 3822   C CG1    . VAL E 1 8  ? 26.135  11.828  -14.240 1.00 0.00 ? 8  VAL E CG1    1  
ATOM 3823   C CG2    . VAL E 1 8  ? 24.314  11.419  -15.847 1.00 0.00 ? 8  VAL E CG2    1  
ATOM 3824   H H      . VAL E 1 8  ? 27.062  11.294  -16.726 1.00 0.00 ? 8  VAL E H      1  
ATOM 3825   H HA     . VAL E 1 8  ? 26.824  9.268   -14.791 1.00 0.00 ? 8  VAL E HA     1  
ATOM 3826   H HB     . VAL E 1 8  ? 24.732  10.221  -14.138 1.00 0.00 ? 8  VAL E HB     1  
ATOM 3827   H HG11   . VAL E 1 8  ? 26.920  11.380  -13.630 1.00 0.00 ? 8  VAL E HG11   1  
ATOM 3828   H HG12   . VAL E 1 8  ? 26.588  12.469  -14.994 1.00 0.00 ? 8  VAL E HG12   1  
ATOM 3829   H HG13   . VAL E 1 8  ? 25.488  12.438  -13.610 1.00 0.00 ? 8  VAL E HG13   1  
ATOM 3830   H HG21   . VAL E 1 8  ? 24.845  11.924  -16.654 1.00 0.00 ? 8  VAL E HG21   1  
ATOM 3831   H HG22   . VAL E 1 8  ? 23.626  10.682  -16.264 1.00 0.00 ? 8  VAL E HG22   1  
ATOM 3832   H HG23   . VAL E 1 8  ? 23.739  12.148  -15.276 1.00 0.00 ? 8  VAL E HG23   1  
ATOM 3833   N N      . GLY E 1 9  ? 25.292  7.455   -15.484 1.00 0.00 ? 9  GLY E N      1  
ATOM 3834   C CA     . GLY E 1 9  ? 24.584  6.265   -15.927 1.00 0.00 ? 9  GLY E CA     1  
ATOM 3835   C C      . GLY E 1 9  ? 25.452  5.266   -16.689 1.00 0.00 ? 9  GLY E C      1  
ATOM 3836   O O      . GLY E 1 9  ? 24.959  4.200   -17.052 1.00 0.00 ? 9  GLY E O      1  
ATOM 3837   H H      . GLY E 1 9  ? 25.718  7.424   -14.566 1.00 0.00 ? 9  GLY E H      1  
ATOM 3838   H HA2    . GLY E 1 9  ? 24.176  5.762   -15.051 1.00 0.00 ? 9  GLY E HA2    1  
ATOM 3839   H HA3    . GLY E 1 9  ? 23.753  6.559   -16.568 1.00 0.00 ? 9  GLY E HA3    1  
ATOM 3840   N N      . GLU E 1 10 ? 26.729  5.575   -16.931 1.00 0.00 ? 10 GLU E N      1  
ATOM 3841   C CA     . GLU E 1 10 ? 27.665  4.663   -17.574 1.00 0.00 ? 10 GLU E CA     1  
ATOM 3842   C C      . GLU E 1 10 ? 28.498  3.898   -16.545 1.00 0.00 ? 10 GLU E C      1  
ATOM 3843   O O      . GLU E 1 10 ? 28.504  4.234   -15.362 1.00 0.00 ? 10 GLU E O      1  
ATOM 3844   C CB     . GLU E 1 10 ? 28.551  5.429   -18.557 1.00 0.00 ? 10 GLU E CB     1  
ATOM 3845   C CG     . GLU E 1 10 ? 27.740  6.147   -19.637 1.00 0.00 ? 10 GLU E CG     1  
ATOM 3846   C CD     . GLU E 1 10 ? 28.644  6.755   -20.706 1.00 0.00 ? 10 GLU E CD     1  
ATOM 3847   O OE1    . GLU E 1 10 ? 29.614  7.452   -20.335 1.00 0.00 ? 10 GLU E OE1    1  
ATOM 3848   O OE2    . GLU E 1 10 ? 28.377  6.522   -21.906 1.00 0.00 ? 10 GLU E OE2    1  
ATOM 3849   H H      . GLU E 1 10 ? 27.085  6.470   -16.624 1.00 0.00 ? 10 GLU E H      1  
ATOM 3850   H HA     . GLU E 1 10 ? 27.102  3.926   -18.147 1.00 0.00 ? 10 GLU E HA     1  
ATOM 3851   H HB2    . GLU E 1 10 ? 29.135  6.164   -18.008 1.00 0.00 ? 10 GLU E HB2    1  
ATOM 3852   H HB3    . GLU E 1 10 ? 29.233  4.729   -19.039 1.00 0.00 ? 10 GLU E HB3    1  
ATOM 3853   H HG2    . GLU E 1 10 ? 27.058  5.432   -20.099 1.00 0.00 ? 10 GLU E HG2    1  
ATOM 3854   H HG3    . GLU E 1 10 ? 27.150  6.942   -19.181 1.00 0.00 ? 10 GLU E HG3    1  
ATOM 3855   N N      . SER E 1 11 ? 29.215  2.863   -16.995 1.00 0.00 ? 11 SER E N      1  
ATOM 3856   C CA     . SER E 1 11 ? 29.873  1.908   -16.116 1.00 0.00 ? 11 SER E CA     1  
ATOM 3857   C C      . SER E 1 11 ? 31.344  1.688   -16.457 1.00 0.00 ? 11 SER E C      1  
ATOM 3858   O O      . SER E 1 11 ? 31.797  1.958   -17.568 1.00 0.00 ? 11 SER E O      1  
ATOM 3859   C CB     . SER E 1 11 ? 29.123  0.576   -16.141 1.00 0.00 ? 11 SER E CB     1  
ATOM 3860   O OG     . SER E 1 11 ? 27.815  0.728   -15.629 1.00 0.00 ? 11 SER E OG     1  
ATOM 3861   H H      . SER E 1 11 ? 29.217  2.661   -17.985 1.00 0.00 ? 11 SER E H      1  
ATOM 3862   H HA     . SER E 1 11 ? 29.837  2.286   -15.094 1.00 0.00 ? 11 SER E HA     1  
ATOM 3863   H HB2    . SER E 1 11 ? 29.063  0.219   -17.169 1.00 0.00 ? 11 SER E HB2    1  
ATOM 3864   H HB3    . SER E 1 11 ? 29.660  -0.158  -15.541 1.00 0.00 ? 11 SER E HB3    1  
ATOM 3865   H HG     . SER E 1 11 ? 27.861  0.717   -14.667 1.00 0.00 ? 11 SER E HG     1  
ATOM 3866   N N      . ILE E 1 12 ? 32.087  1.176   -15.473 1.00 0.00 ? 12 ILE E N      1  
ATOM 3867   C CA     . ILE E 1 12 ? 33.509  0.868   -15.521 1.00 0.00 ? 12 ILE E CA     1  
ATOM 3868   C C      . ILE E 1 12 ? 33.720  -0.480  -14.832 1.00 0.00 ? 12 ILE E C      1  
ATOM 3869   O O      . ILE E 1 12 ? 32.877  -0.912  -14.049 1.00 0.00 ? 12 ILE E O      1  
ATOM 3870   C CB     . ILE E 1 12 ? 34.306  1.998   -14.854 1.00 0.00 ? 12 ILE E CB     1  
ATOM 3871   C CG1    . ILE E 1 12 ? 34.037  3.342   -15.537 1.00 0.00 ? 12 ILE E CG1    1  
ATOM 3872   C CG2    . ILE E 1 12 ? 35.811  1.722   -14.858 1.00 0.00 ? 12 ILE E CG2    1  
ATOM 3873   C CD1    . ILE E 1 12 ? 34.616  4.519   -14.754 1.00 0.00 ? 12 ILE E CD1    1  
ATOM 3874   H H      . ILE E 1 12 ? 31.618  0.953   -14.605 1.00 0.00 ? 12 ILE E H      1  
ATOM 3875   H HA     . ILE E 1 12 ? 33.820  0.773   -16.560 1.00 0.00 ? 12 ILE E HA     1  
ATOM 3876   H HB     . ILE E 1 12 ? 33.979  2.075   -13.817 1.00 0.00 ? 12 ILE E HB     1  
ATOM 3877   H HG12   . ILE E 1 12 ? 34.457  3.336   -16.543 1.00 0.00 ? 12 ILE E HG12   1  
ATOM 3878   H HG13   . ILE E 1 12 ? 32.965  3.514   -15.612 1.00 0.00 ? 12 ILE E HG13   1  
ATOM 3879   H HG21   . ILE E 1 12 ? 36.041  0.812   -14.305 1.00 0.00 ? 12 ILE E HG21   1  
ATOM 3880   H HG22   . ILE E 1 12 ? 36.177  1.637   -15.882 1.00 0.00 ? 12 ILE E HG22   1  
ATOM 3881   H HG23   . ILE E 1 12 ? 36.343  2.532   -14.362 1.00 0.00 ? 12 ILE E HG23   1  
ATOM 3882   H HD11   . ILE E 1 12 ? 34.268  5.452   -15.198 1.00 0.00 ? 12 ILE E HD11   1  
ATOM 3883   H HD12   . ILE E 1 12 ? 34.282  4.466   -13.717 1.00 0.00 ? 12 ILE E HD12   1  
ATOM 3884   H HD13   . ILE E 1 12 ? 35.704  4.494   -14.787 1.00 0.00 ? 12 ILE E HD13   1  
ATOM 3885   N N      . ASN E 1 13 ? 34.821  -1.178  -15.125 1.00 0.00 ? 13 ASN E N      1  
ATOM 3886   C CA     . ASN E 1 13 ? 35.063  -2.520  -14.620 1.00 0.00 ? 13 ASN E CA     1  
ATOM 3887   C C      . ASN E 1 13 ? 36.495  -2.720  -14.136 1.00 0.00 ? 13 ASN E C      1  
ATOM 3888   O O      . ASN E 1 13 ? 37.435  -2.137  -14.675 1.00 0.00 ? 13 ASN E O      1  
ATOM 3889   C CB     . ASN E 1 13 ? 34.709  -3.541  -15.700 1.00 0.00 ? 13 ASN E CB     1  
ATOM 3890   C CG     . ASN E 1 13 ? 33.212  -3.800  -15.742 1.00 0.00 ? 13 ASN E CG     1  
ATOM 3891   O OD1    . ASN E 1 13 ? 32.498  -3.279  -16.594 1.00 0.00 ? 13 ASN E OD1    1  
ATOM 3892   N ND2    . ASN E 1 13 ? 32.715  -4.582  -14.787 1.00 0.00 ? 13 ASN E ND2    1  
ATOM 3893   H H      . ASN E 1 13 ? 35.527  -0.753  -15.711 1.00 0.00 ? 13 ASN E H      1  
ATOM 3894   H HA     . ASN E 1 13 ? 34.416  -2.697  -13.761 1.00 0.00 ? 13 ASN E HA     1  
ATOM 3895   H HB2    . ASN E 1 13 ? 35.049  -3.184  -16.671 1.00 0.00 ? 13 ASN E HB2    1  
ATOM 3896   H HB3    . ASN E 1 13 ? 35.216  -4.483  -15.482 1.00 0.00 ? 13 ASN E HB3    1  
ATOM 3897   H HD21   . ASN E 1 13 ? 33.314  -4.933  -14.053 1.00 0.00 ? 13 ASN E HD21   1  
ATOM 3898   H HD22   . ASN E 1 13 ? 31.717  -4.718  -14.718 1.00 0.00 ? 13 ASN E HD22   1  
ATOM 3899   N N      . ILE E 1 14 ? 36.651  -3.583  -13.128 1.00 0.00 ? 14 ILE E N      1  
ATOM 3900   C CA     . ILE E 1 14 ? 37.921  -3.889  -12.491 1.00 0.00 ? 14 ILE E CA     1  
ATOM 3901   C C      . ILE E 1 14 ? 38.010  -5.395  -12.254 1.00 0.00 ? 14 ILE E C      1  
ATOM 3902   O O      . ILE E 1 14 ? 37.039  -6.026  -11.840 1.00 0.00 ? 14 ILE E O      1  
ATOM 3903   C CB     . ILE E 1 14 ? 38.067  -3.103  -11.183 1.00 0.00 ? 14 ILE E CB     1  
ATOM 3904   C CG1    . ILE E 1 14 ? 37.864  -1.602  -11.417 1.00 0.00 ? 14 ILE E CG1    1  
ATOM 3905   C CG2    . ILE E 1 14 ? 39.443  -3.367  -10.569 1.00 0.00 ? 14 ILE E CG2    1  
ATOM 3906   C CD1    . ILE E 1 14 ? 37.993  -0.763  -10.146 1.00 0.00 ? 14 ILE E CD1    1  
ATOM 3907   H H      . ILE E 1 14 ? 35.836  -4.068  -12.777 1.00 0.00 ? 14 ILE E H      1  
ATOM 3908   H HA     . ILE E 1 14 ? 38.732  -3.599  -13.158 1.00 0.00 ? 14 ILE E HA     1  
ATOM 3909   H HB     . ILE E 1 14 ? 37.303  -3.442  -10.483 1.00 0.00 ? 14 ILE E HB     1  
ATOM 3910   H HG12   . ILE E 1 14 ? 38.591  -1.248  -12.148 1.00 0.00 ? 14 ILE E HG12   1  
ATOM 3911   H HG13   . ILE E 1 14 ? 36.862  -1.432  -11.812 1.00 0.00 ? 14 ILE E HG13   1  
ATOM 3912   H HG21   . ILE E 1 14 ? 39.533  -2.852  -9.612  1.00 0.00 ? 14 ILE E HG21   1  
ATOM 3913   H HG22   . ILE E 1 14 ? 39.579  -4.431  -10.385 1.00 0.00 ? 14 ILE E HG22   1  
ATOM 3914   H HG23   . ILE E 1 14 ? 40.225  -3.014  -11.243 1.00 0.00 ? 14 ILE E HG23   1  
ATOM 3915   H HD11   . ILE E 1 14 ? 37.414  -1.217  -9.341  1.00 0.00 ? 14 ILE E HD11   1  
ATOM 3916   H HD12   . ILE E 1 14 ? 39.040  -0.688  -9.853  1.00 0.00 ? 14 ILE E HD12   1  
ATOM 3917   H HD13   . ILE E 1 14 ? 37.611  0.239   -10.340 1.00 0.00 ? 14 ILE E HD13   1  
ATOM 3918   N N      . GLY E 1 15 ? 39.176  -5.985  -12.530 1.00 0.00 ? 15 GLY E N      1  
ATOM 3919   C CA     . GLY E 1 15 ? 39.380  -7.421  -12.455 1.00 0.00 ? 15 GLY E CA     1  
ATOM 3920   C C      . GLY E 1 15 ? 38.414  -8.167  -13.368 1.00 0.00 ? 15 GLY E C      1  
ATOM 3921   O O      . GLY E 1 15 ? 38.162  -7.746  -14.496 1.00 0.00 ? 15 GLY E O      1  
ATOM 3922   H H      . GLY E 1 15 ? 39.935  -5.417  -12.882 1.00 0.00 ? 15 GLY E H      1  
ATOM 3923   H HA2    . GLY E 1 15 ? 40.400  -7.662  -12.753 1.00 0.00 ? 15 GLY E HA2    1  
ATOM 3924   H HA3    . GLY E 1 15 ? 39.230  -7.749  -11.426 1.00 0.00 ? 15 GLY E HA3    1  
ATOM 3925   N N      . ASP E 1 16 ? 37.858  -9.271  -12.863 1.00 0.00 ? 16 ASP E N      1  
ATOM 3926   C CA     . ASP E 1 16 ? 36.806  -10.025 -13.526 1.00 0.00 ? 16 ASP E CA     1  
ATOM 3927   C C      . ASP E 1 16 ? 35.585  -10.236 -12.630 1.00 0.00 ? 16 ASP E C      1  
ATOM 3928   O O      . ASP E 1 16 ? 34.678  -10.982 -12.994 1.00 0.00 ? 16 ASP E O      1  
ATOM 3929   C CB     . ASP E 1 16 ? 37.372  -11.338 -14.070 1.00 0.00 ? 16 ASP E CB     1  
ATOM 3930   C CG     . ASP E 1 16 ? 37.730  -12.339 -12.975 1.00 0.00 ? 16 ASP E CG     1  
ATOM 3931   O OD1    . ASP E 1 16 ? 38.669  -12.053 -12.200 1.00 0.00 ? 16 ASP E OD1    1  
ATOM 3932   O OD2    . ASP E 1 16 ? 37.116  -13.430 -12.956 1.00 0.00 ? 16 ASP E OD2    1  
ATOM 3933   H H      . ASP E 1 16 ? 38.202  -9.631  -11.985 1.00 0.00 ? 16 ASP E H      1  
ATOM 3934   H HA     . ASP E 1 16 ? 36.462  -9.446  -14.383 1.00 0.00 ? 16 ASP E HA     1  
ATOM 3935   H HB2    . ASP E 1 16 ? 36.636  -11.783 -14.740 1.00 0.00 ? 16 ASP E HB2    1  
ATOM 3936   H HB3    . ASP E 1 16 ? 38.263  -11.120 -14.659 1.00 0.00 ? 16 ASP E HB3    1  
ATOM 3937   N N      . ASP E 1 17 ? 35.532  -9.559  -11.478 1.00 0.00 ? 17 ASP E N      1  
ATOM 3938   C CA     . ASP E 1 17 ? 34.450  -9.687  -10.512 1.00 0.00 ? 17 ASP E CA     1  
ATOM 3939   C C      . ASP E 1 17 ? 33.817  -8.353  -10.118 1.00 0.00 ? 17 ASP E C      1  
ATOM 3940   O O      . ASP E 1 17 ? 32.763  -8.360  -9.485  1.00 0.00 ? 17 ASP E O      1  
ATOM 3941   C CB     . ASP E 1 17 ? 34.959  -10.403 -9.260  1.00 0.00 ? 17 ASP E CB     1  
ATOM 3942   C CG     . ASP E 1 17 ? 35.161  -11.898 -9.487  1.00 0.00 ? 17 ASP E CG     1  
ATOM 3943   O OD1    . ASP E 1 17 ? 34.153  -12.594 -9.739  1.00 0.00 ? 17 ASP E OD1    1  
ATOM 3944   O OD2    . ASP E 1 17 ? 36.311  -12.363 -9.331  1.00 0.00 ? 17 ASP E OD2    1  
ATOM 3945   H H      . ASP E 1 17 ? 36.304  -8.954  -11.240 1.00 0.00 ? 17 ASP E H      1  
ATOM 3946   H HA     . ASP E 1 17 ? 33.655  -10.294 -10.944 1.00 0.00 ? 17 ASP E HA     1  
ATOM 3947   H HB2    . ASP E 1 17 ? 35.893  -9.945  -8.932  1.00 0.00 ? 17 ASP E HB2    1  
ATOM 3948   H HB3    . ASP E 1 17 ? 34.231  -10.278 -8.458  1.00 0.00 ? 17 ASP E HB3    1  
ATOM 3949   N N      . ILE E 1 18 ? 34.433  -7.214  -10.456 1.00 0.00 ? 18 ILE E N      1  
ATOM 3950   C CA     . ILE E 1 18 ? 34.021  -5.917  -9.941  1.00 0.00 ? 18 ILE E CA     1  
ATOM 3951   C C      . ILE E 1 18 ? 33.483  -5.024  -11.056 1.00 0.00 ? 18 ILE E C      1  
ATOM 3952   O O      . ILE E 1 18 ? 34.089  -4.891  -12.118 1.00 0.00 ? 18 ILE E O      1  
ATOM 3953   C CB     . ILE E 1 18 ? 35.157  -5.240  -9.165  1.00 0.00 ? 18 ILE E CB     1  
ATOM 3954   C CG1    . ILE E 1 18 ? 35.652  -6.114  -8.009  1.00 0.00 ? 18 ILE E CG1    1  
ATOM 3955   C CG2    . ILE E 1 18 ? 34.695  -3.894  -8.603  1.00 0.00 ? 18 ILE E CG2    1  
ATOM 3956   C CD1    . ILE E 1 18 ? 36.899  -6.908  -8.398  1.00 0.00 ? 18 ILE E CD1    1  
ATOM 3957   H H      . ILE E 1 18 ? 35.257  -7.245  -11.040 1.00 0.00 ? 18 ILE E H      1  
ATOM 3958   H HA     . ILE E 1 18 ? 33.208  -6.073  -9.234  1.00 0.00 ? 18 ILE E HA     1  
ATOM 3959   H HB     . ILE E 1 18 ? 35.985  -5.050  -9.845  1.00 0.00 ? 18 ILE E HB     1  
ATOM 3960   H HG12   . ILE E 1 18 ? 35.908  -5.488  -7.154  1.00 0.00 ? 18 ILE E HG12   1  
ATOM 3961   H HG13   . ILE E 1 18 ? 34.866  -6.803  -7.700  1.00 0.00 ? 18 ILE E HG13   1  
ATOM 3962   H HG21   . ILE E 1 18 ? 34.474  -3.203  -9.416  1.00 0.00 ? 18 ILE E HG21   1  
ATOM 3963   H HG22   . ILE E 1 18 ? 33.805  -4.030  -7.991  1.00 0.00 ? 18 ILE E HG22   1  
ATOM 3964   H HG23   . ILE E 1 18 ? 35.488  -3.458  -7.995  1.00 0.00 ? 18 ILE E HG23   1  
ATOM 3965   H HD11   . ILE E 1 18 ? 37.698  -6.221  -8.674  1.00 0.00 ? 18 ILE E HD11   1  
ATOM 3966   H HD12   . ILE E 1 18 ? 37.221  -7.511  -7.549  1.00 0.00 ? 18 ILE E HD12   1  
ATOM 3967   H HD13   . ILE E 1 18 ? 36.680  -7.564  -9.239  1.00 0.00 ? 18 ILE E HD13   1  
ATOM 3968   N N      . THR E 1 19 ? 32.368  -4.351  -10.763 1.00 0.00 ? 19 THR E N      1  
ATOM 3969   C CA     . THR E 1 19 ? 31.762  -3.342  -11.616 1.00 0.00 ? 19 THR E CA     1  
ATOM 3970   C C      . THR E 1 19 ? 31.560  -2.053  -10.828 1.00 0.00 ? 19 THR E C      1  
ATOM 3971   O O      . THR E 1 19 ? 31.188  -2.082  -9.657  1.00 0.00 ? 19 THR E O      1  
ATOM 3972   C CB     . THR E 1 19 ? 30.431  -3.840  -12.183 1.00 0.00 ? 19 THR E CB     1  
ATOM 3973   O OG1    . THR E 1 19 ? 30.602  -5.084  -12.827 1.00 0.00 ? 19 THR E OG1    1  
ATOM 3974   C CG2    . THR E 1 19 ? 29.850  -2.868  -13.208 1.00 0.00 ? 19 THR E CG2    1  
ATOM 3975   H H      . THR E 1 19 ? 31.945  -4.512  -9.858  1.00 0.00 ? 19 THR E H      1  
ATOM 3976   H HA     . THR E 1 19 ? 32.431  -3.128  -12.450 1.00 0.00 ? 19 THR E HA     1  
ATOM 3977   H HB     . THR E 1 19 ? 29.718  -3.964  -11.368 1.00 0.00 ? 19 THR E HB     1  
ATOM 3978   H HG1    . THR E 1 19 ? 29.736  -5.488  -12.934 1.00 0.00 ? 19 THR E HG1    1  
ATOM 3979   H HG21   . THR E 1 19 ? 29.540  -1.947  -12.713 1.00 0.00 ? 19 THR E HG21   1  
ATOM 3980   H HG22   . THR E 1 19 ? 30.599  -2.637  -13.967 1.00 0.00 ? 19 THR E HG22   1  
ATOM 3981   H HG23   . THR E 1 19 ? 28.980  -3.318  -13.686 1.00 0.00 ? 19 THR E HG23   1  
ATOM 3982   N N      . ILE E 1 20 ? 31.794  -0.916  -11.486 1.00 0.00 ? 20 ILE E N      1  
ATOM 3983   C CA     . ILE E 1 20 ? 31.565  0.420   -10.960 1.00 0.00 ? 20 ILE E CA     1  
ATOM 3984   C C      . ILE E 1 20 ? 30.566  1.122   -11.872 1.00 0.00 ? 20 ILE E C      1  
ATOM 3985   O O      . ILE E 1 20 ? 30.642  0.989   -13.092 1.00 0.00 ? 20 ILE E O      1  
ATOM 3986   C CB     . ILE E 1 20 ? 32.881  1.201   -10.905 1.00 0.00 ? 20 ILE E CB     1  
ATOM 3987   C CG1    . ILE E 1 20 ? 33.978  0.467   -10.129 1.00 0.00 ? 20 ILE E CG1    1  
ATOM 3988   C CG2    . ILE E 1 20 ? 32.671  2.602   -10.330 1.00 0.00 ? 20 ILE E CG2    1  
ATOM 3989   C CD1    . ILE E 1 20 ? 33.712  0.350   -8.629  1.00 0.00 ? 20 ILE E CD1    1  
ATOM 3990   H H      . ILE E 1 20 ? 32.074  -0.974  -12.456 1.00 0.00 ? 20 ILE E H      1  
ATOM 3991   H HA     . ILE E 1 20 ? 31.141  0.354   -9.958  1.00 0.00 ? 20 ILE E HA     1  
ATOM 3992   H HB     . ILE E 1 20 ? 33.240  1.314   -11.927 1.00 0.00 ? 20 ILE E HB     1  
ATOM 3993   H HG12   . ILE E 1 20 ? 34.087  -0.535  -10.539 1.00 0.00 ? 20 ILE E HG12   1  
ATOM 3994   H HG13   . ILE E 1 20 ? 34.923  0.992   -10.272 1.00 0.00 ? 20 ILE E HG13   1  
ATOM 3995   H HG21   . ILE E 1 20 ? 32.136  2.543   -9.381  1.00 0.00 ? 20 ILE E HG21   1  
ATOM 3996   H HG22   . ILE E 1 20 ? 33.637  3.082   -10.169 1.00 0.00 ? 20 ILE E HG22   1  
ATOM 3997   H HG23   . ILE E 1 20 ? 32.096  3.209   -11.029 1.00 0.00 ? 20 ILE E HG23   1  
ATOM 3998   H HD11   . ILE E 1 20 ? 33.764  1.334   -8.163  1.00 0.00 ? 20 ILE E HD11   1  
ATOM 3999   H HD12   . ILE E 1 20 ? 32.729  -0.087  -8.459  1.00 0.00 ? 20 ILE E HD12   1  
ATOM 4000   H HD13   . ILE E 1 20 ? 34.470  -0.294  -8.182  1.00 0.00 ? 20 ILE E HD13   1  
ATOM 4001   N N      . THR E 1 21 ? 29.661  1.912   -11.293 1.00 0.00 ? 21 THR E N      1  
ATOM 4002   C CA     . THR E 1 21 ? 28.695  2.691   -12.054 1.00 0.00 ? 21 THR E CA     1  
ATOM 4003   C C      . THR E 1 21 ? 28.563  4.084   -11.454 1.00 0.00 ? 21 THR E C      1  
ATOM 4004   O O      . THR E 1 21 ? 28.296  4.226   -10.263 1.00 0.00 ? 21 THR E O      1  
ATOM 4005   C CB     . THR E 1 21 ? 27.339  1.984   -12.092 1.00 0.00 ? 21 THR E CB     1  
ATOM 4006   O OG1    . THR E 1 21 ? 27.488  0.685   -12.620 1.00 0.00 ? 21 THR E OG1    1  
ATOM 4007   C CG2    . THR E 1 21 ? 26.342  2.722   -12.984 1.00 0.00 ? 21 THR E CG2    1  
ATOM 4008   H H      . THR E 1 21 ? 29.665  1.988   -10.285 1.00 0.00 ? 21 THR E H      1  
ATOM 4009   H HA     . THR E 1 21 ? 29.048  2.799   -13.080 1.00 0.00 ? 21 THR E HA     1  
ATOM 4010   H HB     . THR E 1 21 ? 26.937  1.918   -11.080 1.00 0.00 ? 21 THR E HB     1  
ATOM 4011   H HG1    . THR E 1 21 ? 26.648  0.226   -12.529 1.00 0.00 ? 21 THR E HG1    1  
ATOM 4012   H HG21   . THR E 1 21 ? 26.720  2.766   -14.004 1.00 0.00 ? 21 THR E HG21   1  
ATOM 4013   H HG22   . THR E 1 21 ? 25.389  2.193   -12.978 1.00 0.00 ? 21 THR E HG22   1  
ATOM 4014   H HG23   . THR E 1 21 ? 26.183  3.736   -12.618 1.00 0.00 ? 21 THR E HG23   1  
ATOM 4015   N N      . ILE E 1 22 ? 28.706  5.121   -12.282 1.00 0.00 ? 22 ILE E N      1  
ATOM 4016   C CA     . ILE E 1 22 ? 28.403  6.483   -11.875 1.00 0.00 ? 22 ILE E CA     1  
ATOM 4017   C C      . ILE E 1 22 ? 26.890  6.673   -11.911 1.00 0.00 ? 22 ILE E C      1  
ATOM 4018   O O      . ILE E 1 22 ? 26.287  6.723   -12.981 1.00 0.00 ? 22 ILE E O      1  
ATOM 4019   C CB     . ILE E 1 22 ? 29.188  7.484   -12.731 1.00 0.00 ? 22 ILE E CB     1  
ATOM 4020   C CG1    . ILE E 1 22 ? 28.690  8.924   -12.612 1.00 0.00 ? 22 ILE E CG1    1  
ATOM 4021   C CG2    . ILE E 1 22 ? 29.179  7.134   -14.218 1.00 0.00 ? 22 ILE E CG2    1  
ATOM 4022   C CD1    . ILE E 1 22 ? 28.753  9.438   -11.178 1.00 0.00 ? 22 ILE E CD1    1  
ATOM 4023   H H      . ILE E 1 22 ? 28.850  4.948   -13.267 1.00 0.00 ? 22 ILE E H      1  
ATOM 4024   H HA     . ILE E 1 22 ? 28.730  6.615   -10.843 1.00 0.00 ? 22 ILE E HA     1  
ATOM 4025   H HB     . ILE E 1 22 ? 30.226  7.462   -12.397 1.00 0.00 ? 22 ILE E HB     1  
ATOM 4026   H HG12   . ILE E 1 22 ? 29.312  9.564   -13.239 1.00 0.00 ? 22 ILE E HG12   1  
ATOM 4027   H HG13   . ILE E 1 22 ? 27.657  8.992   -12.955 1.00 0.00 ? 22 ILE E HG13   1  
ATOM 4028   H HG21   . ILE E 1 22 ? 29.730  6.209   -14.386 1.00 0.00 ? 22 ILE E HG21   1  
ATOM 4029   H HG22   . ILE E 1 22 ? 28.152  7.027   -14.565 1.00 0.00 ? 22 ILE E HG22   1  
ATOM 4030   H HG23   . ILE E 1 22 ? 29.665  7.931   -14.779 1.00 0.00 ? 22 ILE E HG23   1  
ATOM 4031   H HD11   . ILE E 1 22 ? 28.061  8.874   -10.555 1.00 0.00 ? 22 ILE E HD11   1  
ATOM 4032   H HD12   . ILE E 1 22 ? 29.769  9.325   -10.801 1.00 0.00 ? 22 ILE E HD12   1  
ATOM 4033   H HD13   . ILE E 1 22 ? 28.463  10.488  -11.168 1.00 0.00 ? 22 ILE E HD13   1  
ATOM 4034   N N      . LEU E 1 23 ? 26.253  6.728   -10.739 1.00 0.00 ? 23 LEU E N      1  
ATOM 4035   C CA     . LEU E 1 23 ? 24.806  6.830   -10.646 1.00 0.00 ? 23 LEU E CA     1  
ATOM 4036   C C      . LEU E 1 23 ? 24.345  8.248   -10.975 1.00 0.00 ? 23 LEU E C      1  
ATOM 4037   O O      . LEU E 1 23 ? 23.271  8.430   -11.545 1.00 0.00 ? 23 LEU E O      1  
ATOM 4038   C CB     . LEU E 1 23 ? 24.313  6.417   -9.258  1.00 0.00 ? 23 LEU E CB     1  
ATOM 4039   C CG     . LEU E 1 23 ? 24.919  5.128   -8.698  1.00 0.00 ? 23 LEU E CG     1  
ATOM 4040   C CD1    . LEU E 1 23 ? 24.190  4.761   -7.409  1.00 0.00 ? 23 LEU E CD1    1  
ATOM 4041   C CD2    . LEU E 1 23 ? 24.799  3.936   -9.643  1.00 0.00 ? 23 LEU E CD2    1  
ATOM 4042   H H      . LEU E 1 23 ? 26.789  6.748   -9.881  1.00 0.00 ? 23 LEU E H      1  
ATOM 4043   H HA     . LEU E 1 23 ? 24.363  6.155   -11.379 1.00 0.00 ? 23 LEU E HA     1  
ATOM 4044   H HB2    . LEU E 1 23 ? 24.530  7.224   -8.558  1.00 0.00 ? 23 LEU E HB2    1  
ATOM 4045   H HB3    . LEU E 1 23 ? 23.230  6.300   -9.305  1.00 0.00 ? 23 LEU E HB3    1  
ATOM 4046   H HG     . LEU E 1 23 ? 25.970  5.297   -8.469  1.00 0.00 ? 23 LEU E HG     1  
ATOM 4047   H HD11   . LEU E 1 23 ? 24.670  3.893   -6.957  1.00 0.00 ? 23 LEU E HD11   1  
ATOM 4048   H HD12   . LEU E 1 23 ? 24.229  5.599   -6.714  1.00 0.00 ? 23 LEU E HD12   1  
ATOM 4049   H HD13   . LEU E 1 23 ? 23.149  4.524   -7.627  1.00 0.00 ? 23 LEU E HD13   1  
ATOM 4050   H HD21   . LEU E 1 23 ? 25.497  4.056   -10.471 1.00 0.00 ? 23 LEU E HD21   1  
ATOM 4051   H HD22   . LEU E 1 23 ? 25.035  3.017   -9.106  1.00 0.00 ? 23 LEU E HD22   1  
ATOM 4052   H HD23   . LEU E 1 23 ? 23.783  3.877   -10.031 1.00 0.00 ? 23 LEU E HD23   1  
ATOM 4053   N N      . GLY E 1 24 ? 25.169  9.250   -10.652 1.00 0.00 ? 24 GLY E N      1  
ATOM 4054   C CA     . GLY E 1 24 ? 24.961  10.618  -11.094 1.00 0.00 ? 24 GLY E CA     1  
ATOM 4055   C C      . GLY E 1 24 ? 25.646  11.655  -10.210 1.00 0.00 ? 24 GLY E C      1  
ATOM 4056   O O      . GLY E 1 24 ? 26.353  11.307  -9.267  1.00 0.00 ? 24 GLY E O      1  
ATOM 4057   H H      . GLY E 1 24 ? 26.039  9.026   -10.185 1.00 0.00 ? 24 GLY E H      1  
ATOM 4058   H HA2    . GLY E 1 24 ? 25.369  10.713  -12.098 1.00 0.00 ? 24 GLY E HA2    1  
ATOM 4059   H HA3    . GLY E 1 24 ? 23.895  10.841  -11.144 1.00 0.00 ? 24 GLY E HA3    1  
ATOM 4060   N N      . VAL E 1 25 ? 25.453  12.937  -10.532 1.00 0.00 ? 25 VAL E N      1  
ATOM 4061   C CA     . VAL E 1 25 ? 26.090  14.050  -9.840  1.00 0.00 ? 25 VAL E CA     1  
ATOM 4062   C C      . VAL E 1 25 ? 25.080  14.889  -9.065  1.00 0.00 ? 25 VAL E C      1  
ATOM 4063   O O      . VAL E 1 25 ? 23.903  14.952  -9.419  1.00 0.00 ? 25 VAL E O      1  
ATOM 4064   C CB     . VAL E 1 25 ? 26.892  14.932  -10.801 1.00 0.00 ? 25 VAL E CB     1  
ATOM 4065   C CG1    . VAL E 1 25 ? 27.793  14.097  -11.710 1.00 0.00 ? 25 VAL E CG1    1  
ATOM 4066   C CG2    . VAL E 1 25 ? 26.008  15.843  -11.653 1.00 0.00 ? 25 VAL E CG2    1  
ATOM 4067   H H      . VAL E 1 25 ? 24.846  13.158  -11.309 1.00 0.00 ? 25 VAL E H      1  
ATOM 4068   H HA     . VAL E 1 25 ? 26.797  13.646  -9.115  1.00 0.00 ? 25 VAL E HA     1  
ATOM 4069   H HB     . VAL E 1 25 ? 27.535  15.582  -10.208 1.00 0.00 ? 25 VAL E HB     1  
ATOM 4070   H HG11   . VAL E 1 25 ? 28.394  13.419  -11.105 1.00 0.00 ? 25 VAL E HG11   1  
ATOM 4071   H HG12   . VAL E 1 25 ? 27.194  13.518  -12.414 1.00 0.00 ? 25 VAL E HG12   1  
ATOM 4072   H HG13   . VAL E 1 25 ? 28.455  14.758  -12.271 1.00 0.00 ? 25 VAL E HG13   1  
ATOM 4073   H HG21   . VAL E 1 25 ? 25.234  15.259  -12.151 1.00 0.00 ? 25 VAL E HG21   1  
ATOM 4074   H HG22   . VAL E 1 25 ? 25.550  16.602  -11.018 1.00 0.00 ? 25 VAL E HG22   1  
ATOM 4075   H HG23   . VAL E 1 25 ? 26.619  16.349  -12.401 1.00 0.00 ? 25 VAL E HG23   1  
ATOM 4076   N N      . SER E 1 26 ? 25.565  15.587  -8.036  1.00 0.00 ? 26 SER E N      1  
ATOM 4077   C CA     . SER E 1 26 ? 24.829  16.612  -7.318  1.00 0.00 ? 26 SER E CA     1  
ATOM 4078   C C      . SER E 1 26 ? 25.802  17.676  -6.818  1.00 0.00 ? 26 SER E C      1  
ATOM 4079   O O      . SER E 1 26 ? 26.349  17.588  -5.721  1.00 0.00 ? 26 SER E O      1  
ATOM 4080   C CB     . SER E 1 26 ? 24.018  15.988  -6.179  1.00 0.00 ? 26 SER E CB     1  
ATOM 4081   O OG     . SER E 1 26 ? 24.765  15.033  -5.454  1.00 0.00 ? 26 SER E OG     1  
ATOM 4082   H H      . SER E 1 26 ? 26.514  15.408  -7.736  1.00 0.00 ? 26 SER E H      1  
ATOM 4083   H HA     . SER E 1 26 ? 24.128  17.092  -8.002  1.00 0.00 ? 26 SER E HA     1  
ATOM 4084   H HB2    . SER E 1 26 ? 23.680  16.776  -5.504  1.00 0.00 ? 26 SER E HB2    1  
ATOM 4085   H HB3    . SER E 1 26 ? 23.141  15.498  -6.602  1.00 0.00 ? 26 SER E HB3    1  
ATOM 4086   H HG     . SER E 1 26 ? 24.202  14.669  -4.763  1.00 0.00 ? 26 SER E HG     1  
ATOM 4087   N N      . GLY E 1 27 ? 26.037  18.700  -7.643  1.00 0.00 ? 27 GLY E N      1  
ATOM 4088   C CA     . GLY E 1 27 ? 27.021  19.729  -7.349  1.00 0.00 ? 27 GLY E CA     1  
ATOM 4089   C C      . GLY E 1 27 ? 28.441  19.172  -7.361  1.00 0.00 ? 27 GLY E C      1  
ATOM 4090   O O      . GLY E 1 27 ? 28.932  18.773  -8.415  1.00 0.00 ? 27 GLY E O      1  
ATOM 4091   H H      . GLY E 1 27 ? 25.572  18.731  -8.538  1.00 0.00 ? 27 GLY E H      1  
ATOM 4092   H HA2    . GLY E 1 27 ? 26.949  20.523  -8.093  1.00 0.00 ? 27 GLY E HA2    1  
ATOM 4093   H HA3    . GLY E 1 27 ? 26.803  20.152  -6.370  1.00 0.00 ? 27 GLY E HA3    1  
ATOM 4094   N N      . GLN E 1 28 ? 29.095  19.123  -6.196  1.00 0.00 ? 28 GLN E N      1  
ATOM 4095   C CA     . GLN E 1 28 ? 30.407  18.507  -6.067  1.00 0.00 ? 28 GLN E CA     1  
ATOM 4096   C C      . GLN E 1 28 ? 30.301  17.035  -5.695  1.00 0.00 ? 28 GLN E C      1  
ATOM 4097   O O      . GLN E 1 28 ? 31.263  16.292  -5.880  1.00 0.00 ? 28 GLN E O      1  
ATOM 4098   C CB     . GLN E 1 28 ? 31.245  19.194  -4.988  1.00 0.00 ? 28 GLN E CB     1  
ATOM 4099   C CG     . GLN E 1 28 ? 31.477  20.687  -5.201  1.00 0.00 ? 28 GLN E CG     1  
ATOM 4100   C CD     . GLN E 1 28 ? 31.641  21.068  -6.668  1.00 0.00 ? 28 GLN E CD     1  
ATOM 4101   O OE1    . GLN E 1 28 ? 30.822  21.790  -7.231  1.00 0.00 ? 28 GLN E OE1    1  
ATOM 4102   N NE2    . GLN E 1 28 ? 32.676  20.560  -7.336  1.00 0.00 ? 28 GLN E NE2    1  
ATOM 4103   H H      . GLN E 1 28 ? 28.591  19.340  -5.348  1.00 0.00 ? 28 GLN E H      1  
ATOM 4104   H HA     . GLN E 1 28 ? 30.933  18.569  -7.018  1.00 0.00 ? 28 GLN E HA     1  
ATOM 4105   H HB2    . GLN E 1 28 ? 30.767  19.052  -4.019  1.00 0.00 ? 28 GLN E HB2    1  
ATOM 4106   H HB3    . GLN E 1 28 ? 32.219  18.705  -4.954  1.00 0.00 ? 28 GLN E HB3    1  
ATOM 4107   H HG2    . GLN E 1 28 ? 30.630  21.227  -4.778  1.00 0.00 ? 28 GLN E HG2    1  
ATOM 4108   H HG3    . GLN E 1 28 ? 32.374  20.958  -4.644  1.00 0.00 ? 28 GLN E HG3    1  
ATOM 4109   H HE21   . GLN E 1 28 ? 33.363  19.997  -6.856  1.00 0.00 ? 28 GLN E HE21   1  
ATOM 4110   H HE22   . GLN E 1 28 ? 32.732  20.700  -8.335  1.00 0.00 ? 28 GLN E HE22   1  
ATOM 4111   N N      . GLN E 1 29 ? 29.174  16.643  -5.096  1.00 0.00 ? 29 GLN E N      1  
ATOM 4112   C CA     . GLN E 1 29 ? 28.928  15.270  -4.702  1.00 0.00 ? 29 GLN E CA     1  
ATOM 4113   C C      . GLN E 1 29 ? 28.635  14.417  -5.930  1.00 0.00 ? 29 GLN E C      1  
ATOM 4114   O O      . GLN E 1 29 ? 28.061  14.884  -6.912  1.00 0.00 ? 29 GLN E O      1  
ATOM 4115   C CB     . GLN E 1 29 ? 27.780  15.211  -3.694  1.00 0.00 ? 29 GLN E CB     1  
ATOM 4116   C CG     . GLN E 1 29 ? 28.251  15.504  -2.269  1.00 0.00 ? 29 GLN E CG     1  
ATOM 4117   C CD     . GLN E 1 29 ? 29.109  14.385  -1.693  1.00 0.00 ? 29 GLN E CD     1  
ATOM 4118   O OE1    . GLN E 1 29 ? 29.342  13.360  -2.326  1.00 0.00 ? 29 GLN E OE1    1  
ATOM 4119   N NE2    . GLN E 1 29 ? 29.611  14.562  -0.474  1.00 0.00 ? 29 GLN E NE2    1  
ATOM 4120   H H      . GLN E 1 29 ? 28.396  17.284  -5.044  1.00 0.00 ? 29 GLN E H      1  
ATOM 4121   H HA     . GLN E 1 29 ? 29.829  14.875  -4.233  1.00 0.00 ? 29 GLN E HA     1  
ATOM 4122   H HB2    . GLN E 1 29 ? 27.006  15.928  -3.966  1.00 0.00 ? 29 GLN E HB2    1  
ATOM 4123   H HB3    . GLN E 1 29 ? 27.325  14.223  -3.726  1.00 0.00 ? 29 GLN E HB3    1  
ATOM 4124   H HG2    . GLN E 1 29 ? 28.820  16.434  -2.261  1.00 0.00 ? 29 GLN E HG2    1  
ATOM 4125   H HG3    . GLN E 1 29 ? 27.376  15.632  -1.632  1.00 0.00 ? 29 GLN E HG3    1  
ATOM 4126   H HE21   . GLN E 1 29 ? 29.409  15.408  0.038   1.00 0.00 ? 29 GLN E HE21   1  
ATOM 4127   H HE22   . GLN E 1 29 ? 30.164  13.825  -0.061  1.00 0.00 ? 29 GLN E HE22   1  
ATOM 4128   N N      . VAL E 1 30 ? 29.061  13.156  -5.867  1.00 0.00 ? 30 VAL E N      1  
ATOM 4129   C CA     . VAL E 1 30 ? 28.957  12.209  -6.962  1.00 0.00 ? 30 VAL E CA     1  
ATOM 4130   C C      . VAL E 1 30 ? 28.505  10.881  -6.371  1.00 0.00 ? 30 VAL E C      1  
ATOM 4131   O O      . VAL E 1 30 ? 29.190  10.322  -5.516  1.00 0.00 ? 30 VAL E O      1  
ATOM 4132   C CB     . VAL E 1 30 ? 30.308  12.077  -7.670  1.00 0.00 ? 30 VAL E CB     1  
ATOM 4133   C CG1    . VAL E 1 30 ? 30.172  11.195  -8.906  1.00 0.00 ? 30 VAL E CG1    1  
ATOM 4134   C CG2    . VAL E 1 30 ? 30.846  13.428  -8.140  1.00 0.00 ? 30 VAL E CG2    1  
ATOM 4135   H H      . VAL E 1 30 ? 29.587  12.859  -5.056  1.00 0.00 ? 30 VAL E H      1  
ATOM 4136   H HA     . VAL E 1 30 ? 28.212  12.550  -7.680  1.00 0.00 ? 30 VAL E HA     1  
ATOM 4137   H HB     . VAL E 1 30 ? 31.033  11.618  -6.999  1.00 0.00 ? 30 VAL E HB     1  
ATOM 4138   H HG11   . VAL E 1 30 ? 29.669  10.265  -8.647  1.00 0.00 ? 30 VAL E HG11   1  
ATOM 4139   H HG12   . VAL E 1 30 ? 29.599  11.721  -9.669  1.00 0.00 ? 30 VAL E HG12   1  
ATOM 4140   H HG13   . VAL E 1 30 ? 31.166  10.964  -9.291  1.00 0.00 ? 30 VAL E HG13   1  
ATOM 4141   H HG21   . VAL E 1 30 ? 31.725  13.276  -8.766  1.00 0.00 ? 30 VAL E HG21   1  
ATOM 4142   H HG22   . VAL E 1 30 ? 30.083  13.953  -8.713  1.00 0.00 ? 30 VAL E HG22   1  
ATOM 4143   H HG23   . VAL E 1 30 ? 31.134  14.030  -7.278  1.00 0.00 ? 30 VAL E HG23   1  
ATOM 4144   N N      . ARG E 1 31 ? 27.326  10.403  -6.773  1.00 0.00 ? 31 ARG E N      1  
ATOM 4145   C CA     . ARG E 1 31 ? 26.793  9.142   -6.285  1.00 0.00 ? 31 ARG E CA     1  
ATOM 4146   C C      . ARG E 1 31 ? 27.294  8.005   -7.164  1.00 0.00 ? 31 ARG E C      1  
ATOM 4147   O O      . ARG E 1 31 ? 27.114  8.031   -8.381  1.00 0.00 ? 31 ARG E O      1  
ATOM 4148   C CB     . ARG E 1 31 ? 25.268  9.200   -6.205  1.00 0.00 ? 31 ARG E CB     1  
ATOM 4149   C CG     . ARG E 1 31 ? 24.780  8.169   -5.188  1.00 0.00 ? 31 ARG E CG     1  
ATOM 4150   C CD     . ARG E 1 31 ? 23.254  8.115   -5.161  1.00 0.00 ? 31 ARG E CD     1  
ATOM 4151   N NE     . ARG E 1 31 ? 22.778  7.398   -3.974  1.00 0.00 ? 31 ARG E NE     1  
ATOM 4152   C CZ     . ARG E 1 31 ? 21.852  6.431   -3.953  1.00 0.00 ? 31 ARG E CZ     1  
ATOM 4153   N NH1    . ARG E 1 31 ? 21.090  6.160   -5.012  1.00 0.00 ? 31 ARG E NH1    1  
ATOM 4154   N NH2    . ARG E 1 31 ? 21.693  5.687   -2.860  1.00 0.00 ? 31 ARG E NH2    1  
ATOM 4155   H H      . ARG E 1 31 ? 26.834  10.869  -7.523  1.00 0.00 ? 31 ARG E H      1  
ATOM 4156   H HA     . ARG E 1 31 ? 27.175  8.981   -5.276  1.00 0.00 ? 31 ARG E HA     1  
ATOM 4157   H HB2    . ARG E 1 31 ? 24.958  10.192  -5.876  1.00 0.00 ? 31 ARG E HB2    1  
ATOM 4158   H HB3    . ARG E 1 31 ? 24.834  9.002   -7.185  1.00 0.00 ? 31 ARG E HB3    1  
ATOM 4159   H HG2    . ARG E 1 31 ? 25.172  7.186   -5.446  1.00 0.00 ? 31 ARG E HG2    1  
ATOM 4160   H HG3    . ARG E 1 31 ? 25.146  8.445   -4.200  1.00 0.00 ? 31 ARG E HG3    1  
ATOM 4161   H HD2    . ARG E 1 31 ? 22.881  9.139   -5.142  1.00 0.00 ? 31 ARG E HD2    1  
ATOM 4162   H HD3    . ARG E 1 31 ? 22.900  7.631   -6.072  1.00 0.00 ? 31 ARG E HD3    1  
ATOM 4163   H HE     . ARG E 1 31 ? 23.247  7.604   -3.104  1.00 0.00 ? 31 ARG E HE     1  
ATOM 4164   H HH11   . ARG E 1 31 ? 21.152  6.736   -5.837  1.00 0.00 ? 31 ARG E HH11   1  
ATOM 4165   H HH12   . ARG E 1 31 ? 20.356  5.471   -4.928  1.00 0.00 ? 31 ARG E HH12   1  
ATOM 4166   H HH21   . ARG E 1 31 ? 22.263  5.844   -2.042  1.00 0.00 ? 31 ARG E HH21   1  
ATOM 4167   H HH22   . ARG E 1 31 ? 21.138  4.843   -2.910  1.00 0.00 ? 31 ARG E HH22   1  
ATOM 4168   N N      . ILE E 1 32 ? 27.934  7.018   -6.535  1.00 0.00 ? 32 ILE E N      1  
ATOM 4169   C CA     . ILE E 1 32 ? 28.683  5.974   -7.219  1.00 0.00 ? 32 ILE E CA     1  
ATOM 4170   C C      . ILE E 1 32 ? 28.310  4.605   -6.664  1.00 0.00 ? 32 ILE E C      1  
ATOM 4171   O O      . ILE E 1 32 ? 28.378  4.383   -5.457  1.00 0.00 ? 32 ILE E O      1  
ATOM 4172   C CB     . ILE E 1 32 ? 30.196  6.197   -7.105  1.00 0.00 ? 32 ILE E CB     1  
ATOM 4173   C CG1    . ILE E 1 32 ? 30.580  7.680   -7.111  1.00 0.00 ? 32 ILE E CG1    1  
ATOM 4174   C CG2    . ILE E 1 32 ? 30.880  5.444   -8.248  1.00 0.00 ? 32 ILE E CG2    1  
ATOM 4175   C CD1    . ILE E 1 32 ? 32.088  7.927   -7.158  1.00 0.00 ? 32 ILE E CD1    1  
ATOM 4176   H H      . ILE E 1 32 ? 27.956  7.043   -5.525  1.00 0.00 ? 32 ILE E H      1  
ATOM 4177   H HA     . ILE E 1 32 ? 28.418  5.995   -8.277  1.00 0.00 ? 32 ILE E HA     1  
ATOM 4178   H HB     . ILE E 1 32 ? 30.539  5.771   -6.162  1.00 0.00 ? 32 ILE E HB     1  
ATOM 4179   H HG12   . ILE E 1 32 ? 30.114  8.180   -7.961  1.00 0.00 ? 32 ILE E HG12   1  
ATOM 4180   H HG13   . ILE E 1 32 ? 30.206  8.134   -6.194  1.00 0.00 ? 32 ILE E HG13   1  
ATOM 4181   H HG21   . ILE E 1 32 ? 30.531  4.412   -8.280  1.00 0.00 ? 32 ILE E HG21   1  
ATOM 4182   H HG22   . ILE E 1 32 ? 30.654  5.927   -9.199  1.00 0.00 ? 32 ILE E HG22   1  
ATOM 4183   H HG23   . ILE E 1 32 ? 31.959  5.431   -8.096  1.00 0.00 ? 32 ILE E HG23   1  
ATOM 4184   H HD11   . ILE E 1 32 ? 32.584  7.341   -6.384  1.00 0.00 ? 32 ILE E HD11   1  
ATOM 4185   H HD12   . ILE E 1 32 ? 32.483  7.655   -8.137  1.00 0.00 ? 32 ILE E HD12   1  
ATOM 4186   H HD13   . ILE E 1 32 ? 32.283  8.986   -6.985  1.00 0.00 ? 32 ILE E HD13   1  
ATOM 4187   N N      . GLY E 1 33 ? 27.941  3.681   -7.553  1.00 0.00 ? 33 GLY E N      1  
ATOM 4188   C CA     . GLY E 1 33 ? 27.685  2.290   -7.224  1.00 0.00 ? 33 GLY E CA     1  
ATOM 4189   C C      . GLY E 1 33 ? 28.940  1.439   -7.380  1.00 0.00 ? 33 GLY E C      1  
ATOM 4190   O O      . GLY E 1 33 ? 29.700  1.614   -8.332  1.00 0.00 ? 33 GLY E O      1  
ATOM 4191   H H      . GLY E 1 33 ? 27.953  3.925   -8.533  1.00 0.00 ? 33 GLY E H      1  
ATOM 4192   H HA2    . GLY E 1 33 ? 27.325  2.220   -6.199  1.00 0.00 ? 33 GLY E HA2    1  
ATOM 4193   H HA3    . GLY E 1 33 ? 26.914  1.902   -7.889  1.00 0.00 ? 33 GLY E HA3    1  
ATOM 4194   N N      . ILE E 1 34 ? 29.140  0.503   -6.449  1.00 0.00 ? 34 ILE E N      1  
ATOM 4195   C CA     . ILE E 1 34 ? 30.270  -0.409  -6.413  1.00 0.00 ? 34 ILE E CA     1  
ATOM 4196   C C      . ILE E 1 34 ? 29.750  -1.823  -6.191  1.00 0.00 ? 34 ILE E C      1  
ATOM 4197   O O      . ILE E 1 34 ? 29.134  -2.118  -5.169  1.00 0.00 ? 34 ILE E O      1  
ATOM 4198   C CB     . ILE E 1 34 ? 31.249  -0.030  -5.296  1.00 0.00 ? 34 ILE E CB     1  
ATOM 4199   C CG1    . ILE E 1 34 ? 31.720  1.425   -5.395  1.00 0.00 ? 34 ILE E CG1    1  
ATOM 4200   C CG2    . ILE E 1 34 ? 32.444  -0.984  -5.339  1.00 0.00 ? 34 ILE E CG2    1  
ATOM 4201   C CD1    . ILE E 1 34 ? 32.376  1.892   -4.096  1.00 0.00 ? 34 ILE E CD1    1  
ATOM 4202   H H      . ILE E 1 34 ? 28.462  0.421   -5.704  1.00 0.00 ? 34 ILE E H      1  
ATOM 4203   H HA     . ILE E 1 34 ? 30.786  -0.388  -7.373  1.00 0.00 ? 34 ILE E HA     1  
ATOM 4204   H HB     . ILE E 1 34 ? 30.739  -0.159  -4.340  1.00 0.00 ? 34 ILE E HB     1  
ATOM 4205   H HG12   . ILE E 1 34 ? 32.426  1.530   -6.218  1.00 0.00 ? 34 ILE E HG12   1  
ATOM 4206   H HG13   . ILE E 1 34 ? 30.869  2.080   -5.581  1.00 0.00 ? 34 ILE E HG13   1  
ATOM 4207   H HG21   . ILE E 1 34 ? 32.857  -1.023  -6.346  1.00 0.00 ? 34 ILE E HG21   1  
ATOM 4208   H HG22   . ILE E 1 34 ? 33.224  -0.654  -4.654  1.00 0.00 ? 34 ILE E HG22   1  
ATOM 4209   H HG23   . ILE E 1 34 ? 32.132  -1.986  -5.043  1.00 0.00 ? 34 ILE E HG23   1  
ATOM 4210   H HD11   . ILE E 1 34 ? 33.349  1.416   -3.972  1.00 0.00 ? 34 ILE E HD11   1  
ATOM 4211   H HD12   . ILE E 1 34 ? 32.513  2.972   -4.131  1.00 0.00 ? 34 ILE E HD12   1  
ATOM 4212   H HD13   . ILE E 1 34 ? 31.734  1.640   -3.251  1.00 0.00 ? 34 ILE E HD13   1  
ATOM 4213   N N      . ASN E 1 35 ? 30.018  -2.708  -7.150  1.00 0.00 ? 35 ASN E N      1  
ATOM 4214   C CA     . ASN E 1 35 ? 29.452  -4.042  -7.176  1.00 0.00 ? 35 ASN E CA     1  
ATOM 4215   C C      . ASN E 1 35 ? 30.574  -5.073  -7.190  1.00 0.00 ? 35 ASN E C      1  
ATOM 4216   O O      . ASN E 1 35 ? 31.178  -5.333  -8.230  1.00 0.00 ? 35 ASN E O      1  
ATOM 4217   C CB     . ASN E 1 35 ? 28.535  -4.134  -8.395  1.00 0.00 ? 35 ASN E CB     1  
ATOM 4218   C CG     . ASN E 1 35 ? 27.705  -5.409  -8.419  1.00 0.00 ? 35 ASN E CG     1  
ATOM 4219   O OD1    . ASN E 1 35 ? 27.786  -6.250  -7.527  1.00 0.00 ? 35 ASN E OD1    1  
ATOM 4220   N ND2    . ASN E 1 35 ? 26.844  -5.545  -9.425  1.00 0.00 ? 35 ASN E ND2    1  
ATOM 4221   H H      . ASN E 1 35 ? 30.542  -2.408  -7.962  1.00 0.00 ? 35 ASN E H      1  
ATOM 4222   H HA     . ASN E 1 35 ? 28.849  -4.203  -6.282  1.00 0.00 ? 35 ASN E HA     1  
ATOM 4223   H HB2    . ASN E 1 35 ? 27.853  -3.284  -8.379  1.00 0.00 ? 35 ASN E HB2    1  
ATOM 4224   H HB3    . ASN E 1 35 ? 29.137  -4.065  -9.299  1.00 0.00 ? 35 ASN E HB3    1  
ATOM 4225   H HD21   . ASN E 1 35 ? 26.776  -4.831  -10.134 1.00 0.00 ? 35 ASN E HD21   1  
ATOM 4226   H HD22   . ASN E 1 35 ? 26.227  -6.343  -9.440  1.00 0.00 ? 35 ASN E HD22   1  
ATOM 4227   N N      . ALA E 1 36 ? 30.869  -5.625  -6.011  1.00 0.00 ? 36 ALA E N      1  
ATOM 4228   C CA     . ALA E 1 36 ? 31.855  -6.674  -5.819  1.00 0.00 ? 36 ALA E CA     1  
ATOM 4229   C C      . ALA E 1 36 ? 31.336  -7.720  -4.837  1.00 0.00 ? 36 ALA E C      1  
ATOM 4230   O O      . ALA E 1 36 ? 30.515  -7.398  -3.978  1.00 0.00 ? 36 ALA E O      1  
ATOM 4231   C CB     . ALA E 1 36 ? 33.153  -6.062  -5.295  1.00 0.00 ? 36 ALA E CB     1  
ATOM 4232   H H      . ALA E 1 36 ? 30.336  -5.339  -5.202  1.00 0.00 ? 36 ALA E H      1  
ATOM 4233   H HA     . ALA E 1 36 ? 32.052  -7.158  -6.776  1.00 0.00 ? 36 ALA E HA     1  
ATOM 4234   H HB1    . ALA E 1 36 ? 33.496  -5.278  -5.969  1.00 0.00 ? 36 ALA E HB1    1  
ATOM 4235   H HB2    . ALA E 1 36 ? 32.989  -5.644  -4.301  1.00 0.00 ? 36 ALA E HB2    1  
ATOM 4236   H HB3    . ALA E 1 36 ? 33.915  -6.837  -5.225  1.00 0.00 ? 36 ALA E HB3    1  
ATOM 4237   N N      . PRO E 1 37 ? 31.846  -8.954  -4.908  1.00 0.00 ? 37 PRO E N      1  
ATOM 4238   C CA     . PRO E 1 37 ? 31.542  -9.988  -3.938  1.00 0.00 ? 37 PRO E CA     1  
ATOM 4239   C C      . PRO E 1 37 ? 32.002  -9.614  -2.533  1.00 0.00 ? 37 PRO E C      1  
ATOM 4240   O O      . PRO E 1 37 ? 32.954  -8.856  -2.361  1.00 0.00 ? 37 PRO E O      1  
ATOM 4241   C CB     . PRO E 1 37 ? 32.262  -11.244 -4.429  1.00 0.00 ? 37 PRO E CB     1  
ATOM 4242   C CG     . PRO E 1 37 ? 33.307  -10.761 -5.431  1.00 0.00 ? 37 PRO E CG     1  
ATOM 4243   C CD     . PRO E 1 37 ? 32.736  -9.445  -5.944  1.00 0.00 ? 37 PRO E CD     1  
ATOM 4244   H HA     . PRO E 1 37 ? 30.466  -10.164 -3.928  1.00 0.00 ? 37 PRO E HA     1  
ATOM 4245   H HB2    . PRO E 1 37 ? 32.759  -11.749 -3.603  1.00 0.00 ? 37 PRO E HB2    1  
ATOM 4246   H HB3    . PRO E 1 37 ? 31.555  -11.911 -4.921  1.00 0.00 ? 37 PRO E HB3    1  
ATOM 4247   H HG2    . PRO E 1 37 ? 34.257  -10.579 -4.928  1.00 0.00 ? 37 PRO E HG2    1  
ATOM 4248   H HG3    . PRO E 1 37 ? 33.433  -11.478 -6.244  1.00 0.00 ? 37 PRO E HG3    1  
ATOM 4249   H HD2    . PRO E 1 37 ? 33.547  -8.745  -6.147  1.00 0.00 ? 37 PRO E HD2    1  
ATOM 4250   H HD3    . PRO E 1 37 ? 32.166  -9.641  -6.851  1.00 0.00 ? 37 PRO E HD3    1  
ATOM 4251   N N      . LYS E 1 38 ? 31.422  -10.260 -1.517  1.00 0.00 ? 38 LYS E N      1  
ATOM 4252   C CA     . LYS E 1 38 ? 31.895  -10.183 -0.140  1.00 0.00 ? 38 LYS E CA     1  
ATOM 4253   C C      . LYS E 1 38 ? 33.245  -10.865 0.057   1.00 0.00 ? 38 LYS E C      1  
ATOM 4254   O O      . LYS E 1 38 ? 33.809  -10.847 1.149   1.00 0.00 ? 38 LYS E O      1  
ATOM 4255   C CB     . LYS E 1 38 ? 30.835  -10.734 0.814   1.00 0.00 ? 38 LYS E CB     1  
ATOM 4256   C CG     . LYS E 1 38 ? 29.558  -9.893  0.798   1.00 0.00 ? 38 LYS E CG     1  
ATOM 4257   C CD     . LYS E 1 38 ? 29.759  -8.513  1.426   1.00 0.00 ? 38 LYS E CD     1  
ATOM 4258   C CE     . LYS E 1 38 ? 29.377  -8.482  2.905   1.00 0.00 ? 38 LYS E CE     1  
ATOM 4259   N NZ     . LYS E 1 38 ? 27.920  -8.580  3.099   1.00 0.00 ? 38 LYS E NZ     1  
ATOM 4260   H H      . LYS E 1 38 ? 30.645  -10.875 -1.713  1.00 0.00 ? 38 LYS E H      1  
ATOM 4261   H HA     . LYS E 1 38 ? 32.069  -9.131  0.089   1.00 0.00 ? 38 LYS E HA     1  
ATOM 4262   H HB2    . LYS E 1 38 ? 30.591  -11.756 0.523   1.00 0.00 ? 38 LYS E HB2    1  
ATOM 4263   H HB3    . LYS E 1 38 ? 31.231  -10.752 1.830   1.00 0.00 ? 38 LYS E HB3    1  
ATOM 4264   H HG2    . LYS E 1 38 ? 29.224  -9.759  -0.231  1.00 0.00 ? 38 LYS E HG2    1  
ATOM 4265   H HG3    . LYS E 1 38 ? 28.776  -10.430 1.335   1.00 0.00 ? 38 LYS E HG3    1  
ATOM 4266   H HD2    . LYS E 1 38 ? 30.798  -8.197  1.337   1.00 0.00 ? 38 LYS E HD2    1  
ATOM 4267   H HD3    . LYS E 1 38 ? 29.162  -7.798  0.864   1.00 0.00 ? 38 LYS E HD3    1  
ATOM 4268   H HE2    . LYS E 1 38 ? 29.876  -9.303  3.422   1.00 0.00 ? 38 LYS E HE2    1  
ATOM 4269   H HE3    . LYS E 1 38 ? 29.732  -7.543  3.335   1.00 0.00 ? 38 LYS E HE3    1  
ATOM 4270   H HZ1    . LYS E 1 38 ? 27.573  -9.463  2.754   1.00 0.00 ? 38 LYS E HZ1    1  
ATOM 4271   H HZ2    . LYS E 1 38 ? 27.688  -8.501  4.079   1.00 0.00 ? 38 LYS E HZ2    1  
ATOM 4272   H HZ3    . LYS E 1 38 ? 27.456  -7.834  2.597   1.00 0.00 ? 38 LYS E HZ3    1  
ATOM 4273   N N      . ASP E 1 39 ? 33.776  -11.437 -1.025  1.00 0.00 ? 39 ASP E N      1  
ATOM 4274   C CA     . ASP E 1 39 ? 35.133  -11.949 -1.113  1.00 0.00 ? 39 ASP E CA     1  
ATOM 4275   C C      . ASP E 1 39 ? 36.164  -10.831 -0.983  1.00 0.00 ? 39 ASP E C      1  
ATOM 4276   O O      . ASP E 1 39 ? 37.296  -11.082 -0.576  1.00 0.00 ? 39 ASP E O      1  
ATOM 4277   C CB     . ASP E 1 39 ? 35.300  -12.633 -2.470  1.00 0.00 ? 39 ASP E CB     1  
ATOM 4278   C CG     . ASP E 1 39 ? 36.372  -13.718 -2.424  1.00 0.00 ? 39 ASP E CG     1  
ATOM 4279   O OD1    . ASP E 1 39 ? 36.152  -14.730 -1.723  1.00 0.00 ? 39 ASP E OD1    1  
ATOM 4280   O OD2    . ASP E 1 39 ? 37.405  -13.554 -3.111  1.00 0.00 ? 39 ASP E OD2    1  
ATOM 4281   H H      . ASP E 1 39 ? 33.229  -11.399 -1.871  1.00 0.00 ? 39 ASP E H      1  
ATOM 4282   H HA     . ASP E 1 39 ? 35.292  -12.675 -0.315  1.00 0.00 ? 39 ASP E HA     1  
ATOM 4283   H HB2    . ASP E 1 39 ? 34.350  -13.069 -2.780  1.00 0.00 ? 39 ASP E HB2    1  
ATOM 4284   H HB3    . ASP E 1 39 ? 35.569  -11.884 -3.214  1.00 0.00 ? 39 ASP E HB3    1  
ATOM 4285   N N      . VAL E 1 40 ? 35.769  -9.597  -1.313  1.00 0.00 ? 40 VAL E N      1  
ATOM 4286   C CA     . VAL E 1 40 ? 36.611  -8.416  -1.224  1.00 0.00 ? 40 VAL E CA     1  
ATOM 4287   C C      . VAL E 1 40 ? 35.994  -7.390  -0.280  1.00 0.00 ? 40 VAL E C      1  
ATOM 4288   O O      . VAL E 1 40 ? 34.773  -7.320  -0.129  1.00 0.00 ? 40 VAL E O      1  
ATOM 4289   C CB     . VAL E 1 40 ? 36.872  -7.810  -2.605  1.00 0.00 ? 40 VAL E CB     1  
ATOM 4290   C CG1    . VAL E 1 40 ? 37.302  -8.879  -3.609  1.00 0.00 ? 40 VAL E CG1    1  
ATOM 4291   C CG2    . VAL E 1 40 ? 35.660  -7.073  -3.170  1.00 0.00 ? 40 VAL E CG2    1  
ATOM 4292   H H      . VAL E 1 40 ? 34.814  -9.458  -1.616  1.00 0.00 ? 40 VAL E H      1  
ATOM 4293   H HA     . VAL E 1 40 ? 37.576  -8.705  -0.807  1.00 0.00 ? 40 VAL E HA     1  
ATOM 4294   H HB     . VAL E 1 40 ? 37.676  -7.080  -2.518  1.00 0.00 ? 40 VAL E HB     1  
ATOM 4295   H HG11   . VAL E 1 40 ? 36.472  -9.557  -3.815  1.00 0.00 ? 40 VAL E HG11   1  
ATOM 4296   H HG12   . VAL E 1 40 ? 37.611  -8.403  -4.540  1.00 0.00 ? 40 VAL E HG12   1  
ATOM 4297   H HG13   . VAL E 1 40 ? 38.139  -9.447  -3.204  1.00 0.00 ? 40 VAL E HG13   1  
ATOM 4298   H HG21   . VAL E 1 40 ? 34.855  -7.783  -3.349  1.00 0.00 ? 40 VAL E HG21   1  
ATOM 4299   H HG22   . VAL E 1 40 ? 35.328  -6.303  -2.474  1.00 0.00 ? 40 VAL E HG22   1  
ATOM 4300   H HG23   . VAL E 1 40 ? 35.938  -6.597  -4.111  1.00 0.00 ? 40 VAL E HG23   1  
ATOM 4301   N N      . ALA E 1 41 ? 36.838  -6.549  0.320   1.00 0.00 ? 41 ALA E N      1  
ATOM 4302   C CA     . ALA E 1 41 ? 36.380  -5.422  1.111   1.00 0.00 ? 41 ALA E CA     1  
ATOM 4303   C C      . ALA E 1 41 ? 36.164  -4.183  0.247   1.00 0.00 ? 41 ALA E C      1  
ATOM 4304   O O      . ALA E 1 41 ? 36.745  -4.061  -0.830  1.00 0.00 ? 41 ALA E O      1  
ATOM 4305   C CB     . ALA E 1 41 ? 37.385  -5.157  2.231   1.00 0.00 ? 41 ALA E CB     1  
ATOM 4306   H H      . ALA E 1 41 ? 37.832  -6.650  0.168   1.00 0.00 ? 41 ALA E H      1  
ATOM 4307   H HA     . ALA E 1 41 ? 35.424  -5.690  1.556   1.00 0.00 ? 41 ALA E HA     1  
ATOM 4308   H HB1    . ALA E 1 41 ? 37.015  -4.357  2.871   1.00 0.00 ? 41 ALA E HB1    1  
ATOM 4309   H HB2    . ALA E 1 41 ? 37.515  -6.060  2.829   1.00 0.00 ? 41 ALA E HB2    1  
ATOM 4310   H HB3    . ALA E 1 41 ? 38.346  -4.863  1.806   1.00 0.00 ? 41 ALA E HB3    1  
ATOM 4311   N N      . VAL E 1 42 ? 35.335  -3.250  0.719   1.00 0.00 ? 42 VAL E N      1  
ATOM 4312   C CA     . VAL E 1 42 ? 35.207  -1.932  0.115   1.00 0.00 ? 42 VAL E CA     1  
ATOM 4313   C C      . VAL E 1 42 ? 34.720  -0.922  1.148   1.00 0.00 ? 42 VAL E C      1  
ATOM 4314   O O      . VAL E 1 42 ? 33.716  -1.143  1.822   1.00 0.00 ? 42 VAL E O      1  
ATOM 4315   C CB     . VAL E 1 42 ? 34.325  -1.963  -1.139  1.00 0.00 ? 42 VAL E CB     1  
ATOM 4316   C CG1    . VAL E 1 42 ? 33.174  -2.962  -1.043  1.00 0.00 ? 42 VAL E CG1    1  
ATOM 4317   C CG2    . VAL E 1 42 ? 33.751  -0.589  -1.482  1.00 0.00 ? 42 VAL E CG2    1  
ATOM 4318   H H      . VAL E 1 42 ? 34.811  -3.440  1.563   1.00 0.00 ? 42 VAL E H      1  
ATOM 4319   H HA     . VAL E 1 42 ? 36.200  -1.615  -0.200  1.00 0.00 ? 42 VAL E HA     1  
ATOM 4320   H HB     . VAL E 1 42 ? 34.952  -2.271  -1.976  1.00 0.00 ? 42 VAL E HB     1  
ATOM 4321   H HG11   . VAL E 1 42 ? 32.471  -2.799  -1.859  1.00 0.00 ? 42 VAL E HG11   1  
ATOM 4322   H HG12   . VAL E 1 42 ? 33.568  -3.974  -1.123  1.00 0.00 ? 42 VAL E HG12   1  
ATOM 4323   H HG13   . VAL E 1 42 ? 32.661  -2.843  -0.088  1.00 0.00 ? 42 VAL E HG13   1  
ATOM 4324   H HG21   . VAL E 1 42 ? 34.557  0.141   -1.560  1.00 0.00 ? 42 VAL E HG21   1  
ATOM 4325   H HG22   . VAL E 1 42 ? 33.228  -0.645  -2.437  1.00 0.00 ? 42 VAL E HG22   1  
ATOM 4326   H HG23   . VAL E 1 42 ? 33.040  -0.275  -0.719  1.00 0.00 ? 42 VAL E HG23   1  
ATOM 4327   N N      . HIS E 1 43 ? 35.437  0.200   1.253   1.00 0.00 ? 43 HIS E N      1  
ATOM 4328   C CA     . HIS E 1 43 ? 35.077  1.340   2.082   1.00 0.00 ? 43 HIS E CA     1  
ATOM 4329   C C      . HIS E 1 43 ? 35.577  2.616   1.417   1.00 0.00 ? 43 HIS E C      1  
ATOM 4330   O O      . HIS E 1 43 ? 36.414  2.543   0.517   1.00 0.00 ? 43 HIS E O      1  
ATOM 4331   C CB     . HIS E 1 43 ? 35.692  1.221   3.479   1.00 0.00 ? 43 HIS E CB     1  
ATOM 4332   C CG     . HIS E 1 43 ? 35.786  -0.178  4.024   1.00 0.00 ? 43 HIS E CG     1  
ATOM 4333   N ND1    . HIS E 1 43 ? 34.819  -0.804  4.813   1.00 0.00 ? 43 HIS E ND1    1  
ATOM 4334   C CD2    . HIS E 1 43 ? 36.857  -1.016  3.875   1.00 0.00 ? 43 HIS E CD2    1  
ATOM 4335   C CE1    . HIS E 1 43 ? 35.324  -2.007  5.113   1.00 0.00 ? 43 HIS E CE1    1  
ATOM 4336   N NE2    . HIS E 1 43 ? 36.541  -2.167  4.564   1.00 0.00 ? 43 HIS E NE2    1  
ATOM 4337   H H      . HIS E 1 43 ? 36.218  0.328   0.624   1.00 0.00 ? 43 HIS E H      1  
ATOM 4338   H HA     . HIS E 1 43 ? 33.992  1.394   2.165   1.00 0.00 ? 43 HIS E HA     1  
ATOM 4339   H HB2    . HIS E 1 43 ? 36.693  1.654   3.472   1.00 0.00 ? 43 HIS E HB2    1  
ATOM 4340   H HB3    . HIS E 1 43 ? 35.088  1.809   4.168   1.00 0.00 ? 43 HIS E HB3    1  
ATOM 4341   H HD2    . HIS E 1 43 ? 37.769  -0.804  3.335   1.00 0.00 ? 43 HIS E HD2    1  
ATOM 4342   H HE1    . HIS E 1 43 ? 34.830  -2.742  5.732   1.00 0.00 ? 43 HIS E HE1    1  
ATOM 4343   H HE2    . HIS E 1 43 ? 37.140  -2.970  4.692   1.00 0.00 ? 43 HIS E HE2    1  
ATOM 4344   N N      . ARG E 1 44 ? 35.147  3.797   1.876   1.00 0.00 ? 44 ARG E N      1  
ATOM 4345   C CA     . ARG E 1 44 ? 35.792  5.014   1.413   1.00 0.00 ? 44 ARG E CA     1  
ATOM 4346   C C      . ARG E 1 44 ? 37.177  5.121   2.044   1.00 0.00 ? 44 ARG E C      1  
ATOM 4347   O O      . ARG E 1 44 ? 37.450  4.498   3.068   1.00 0.00 ? 44 ARG E O      1  
ATOM 4348   C CB     . ARG E 1 44 ? 34.914  6.247   1.622   1.00 0.00 ? 44 ARG E CB     1  
ATOM 4349   C CG     . ARG E 1 44 ? 34.665  6.551   3.097   1.00 0.00 ? 44 ARG E CG     1  
ATOM 4350   C CD     . ARG E 1 44 ? 33.886  7.858   3.234   1.00 0.00 ? 44 ARG E CD     1  
ATOM 4351   N NE     . ARG E 1 44 ? 33.724  8.238   4.639   1.00 0.00 ? 44 ARG E NE     1  
ATOM 4352   C CZ     . ARG E 1 44 ? 32.892  7.660   5.510   1.00 0.00 ? 44 ARG E CZ     1  
ATOM 4353   N NH1    . ARG E 1 44 ? 32.151  6.606   5.170   1.00 0.00 ? 44 ARG E NH1    1  
ATOM 4354   N NH2    . ARG E 1 44 ? 32.834  8.133   6.752   1.00 0.00 ? 44 ARG E NH2    1  
ATOM 4355   H H      . ARG E 1 44 ? 34.574  3.843   2.708   1.00 0.00 ? 44 ARG E H      1  
ATOM 4356   H HA     . ARG E 1 44 ? 35.934  4.919   0.338   1.00 0.00 ? 44 ARG E HA     1  
ATOM 4357   H HB2    . ARG E 1 44 ? 35.402  7.107   1.160   1.00 0.00 ? 44 ARG E HB2    1  
ATOM 4358   H HB3    . ARG E 1 44 ? 33.957  6.089   1.124   1.00 0.00 ? 44 ARG E HB3    1  
ATOM 4359   H HG2    . ARG E 1 44 ? 34.092  5.734   3.536   1.00 0.00 ? 44 ARG E HG2    1  
ATOM 4360   H HG3    . ARG E 1 44 ? 35.619  6.647   3.613   1.00 0.00 ? 44 ARG E HG3    1  
ATOM 4361   H HD2    . ARG E 1 44 ? 34.426  8.650   2.715   1.00 0.00 ? 44 ARG E HD2    1  
ATOM 4362   H HD3    . ARG E 1 44 ? 32.906  7.744   2.772   1.00 0.00 ? 44 ARG E HD3    1  
ATOM 4363   H HE     . ARG E 1 44 ? 34.302  8.987   4.997   1.00 0.00 ? 44 ARG E HE     1  
ATOM 4364   H HH11   . ARG E 1 44 ? 32.203  6.232   4.234   1.00 0.00 ? 44 ARG E HH11   1  
ATOM 4365   H HH12   . ARG E 1 44 ? 31.609  6.113   5.867   1.00 0.00 ? 44 ARG E HH12   1  
ATOM 4366   H HH21   . ARG E 1 44 ? 33.503  8.847   7.015   1.00 0.00 ? 44 ARG E HH21   1  
ATOM 4367   H HH22   . ARG E 1 44 ? 32.274  7.674   7.454   1.00 0.00 ? 44 ARG E HH22   1  
ATOM 4368   N N      . GLU E 1 45 ? 38.057  5.912   1.428   1.00 0.00 ? 45 GLU E N      1  
ATOM 4369   C CA     . GLU E 1 45 ? 39.469  5.946   1.772   1.00 0.00 ? 45 GLU E CA     1  
ATOM 4370   C C      . GLU E 1 45 ? 39.699  6.467   3.190   1.00 0.00 ? 45 GLU E C      1  
ATOM 4371   O O      . GLU E 1 45 ? 40.710  6.147   3.810   1.00 0.00 ? 45 GLU E O      1  
ATOM 4372   C CB     . GLU E 1 45 ? 40.180  6.767   0.695   1.00 0.00 ? 45 GLU E CB     1  
ATOM 4373   C CG     . GLU E 1 45 ? 41.692  6.923   0.851   1.00 0.00 ? 45 GLU E CG     1  
ATOM 4374   C CD     . GLU E 1 45 ? 42.428  5.607   1.073   1.00 0.00 ? 45 GLU E CD     1  
ATOM 4375   O OE1    . GLU E 1 45 ? 42.030  4.600   0.449   1.00 0.00 ? 45 GLU E OE1    1  
ATOM 4376   O OE2    . GLU E 1 45 ? 43.436  5.630   1.815   1.00 0.00 ? 45 GLU E OE2    1  
ATOM 4377   H H      . GLU E 1 45 ? 37.752  6.466   0.640   1.00 0.00 ? 45 GLU E H      1  
ATOM 4378   H HA     . GLU E 1 45 ? 39.853  4.926   1.732   1.00 0.00 ? 45 GLU E HA     1  
ATOM 4379   H HB2    . GLU E 1 45 ? 39.996  6.289   -0.266  1.00 0.00 ? 45 GLU E HB2    1  
ATOM 4380   H HB3    . GLU E 1 45 ? 39.739  7.764   0.671   1.00 0.00 ? 45 GLU E HB3    1  
ATOM 4381   H HG2    . GLU E 1 45 ? 42.085  7.382   -0.057  1.00 0.00 ? 45 GLU E HG2    1  
ATOM 4382   H HG3    . GLU E 1 45 ? 41.877  7.608   1.677   1.00 0.00 ? 45 GLU E HG3    1  
ATOM 4383   N N      . GLU E 1 46 ? 38.714  7.162   3.764   1.00 0.00 ? 46 GLU E N      1  
ATOM 4384   C CA     . GLU E 1 46 ? 38.697  7.538   5.169   1.00 0.00 ? 46 GLU E CA     1  
ATOM 4385   C C      . GLU E 1 46 ? 38.669  6.321   6.089   1.00 0.00 ? 46 GLU E C      1  
ATOM 4386   O O      . GLU E 1 46 ? 39.467  6.222   7.018   1.00 0.00 ? 46 GLU E O      1  
ATOM 4387   C CB     . GLU E 1 46 ? 37.451  8.390   5.411   1.00 0.00 ? 46 GLU E CB     1  
ATOM 4388   C CG     . GLU E 1 46 ? 37.435  9.001   6.812   1.00 0.00 ? 46 GLU E CG     1  
ATOM 4389   C CD     . GLU E 1 46 ? 36.320  10.033  6.955   1.00 0.00 ? 46 GLU E CD     1  
ATOM 4390   O OE1    . GLU E 1 46 ? 35.151  9.678   6.688   1.00 0.00 ? 46 GLU E OE1    1  
ATOM 4391   O OE2    . GLU E 1 46 ? 36.631  11.184  7.334   1.00 0.00 ? 46 GLU E OE2    1  
ATOM 4392   H H      . GLU E 1 46 ? 37.908  7.404   3.205   1.00 0.00 ? 46 GLU E H      1  
ATOM 4393   H HA     . GLU E 1 46 ? 39.600  8.110   5.389   1.00 0.00 ? 46 GLU E HA     1  
ATOM 4394   H HB2    . GLU E 1 46 ? 37.419  9.195   4.680   1.00 0.00 ? 46 GLU E HB2    1  
ATOM 4395   H HB3    . GLU E 1 46 ? 36.566  7.766   5.270   1.00 0.00 ? 46 GLU E HB3    1  
ATOM 4396   H HG2    . GLU E 1 46 ? 37.294  8.212   7.551   1.00 0.00 ? 46 GLU E HG2    1  
ATOM 4397   H HG3    . GLU E 1 46 ? 38.398  9.478   6.996   1.00 0.00 ? 46 GLU E HG3    1  
ATOM 4398   N N      . ILE E 1 47 ? 37.733  5.401   5.843   1.00 0.00 ? 47 ILE E N      1  
ATOM 4399   C CA     . ILE E 1 47 ? 37.484  4.258   6.706   1.00 0.00 ? 47 ILE E CA     1  
ATOM 4400   C C      . ILE E 1 47 ? 38.582  3.218   6.515   1.00 0.00 ? 47 ILE E C      1  
ATOM 4401   O O      . ILE E 1 47 ? 39.040  2.604   7.476   1.00 0.00 ? 47 ILE E O      1  
ATOM 4402   C CB     . ILE E 1 47 ? 36.112  3.657   6.387   1.00 0.00 ? 47 ILE E CB     1  
ATOM 4403   C CG1    . ILE E 1 47 ? 34.973  4.680   6.382   1.00 0.00 ? 47 ILE E CG1    1  
ATOM 4404   C CG2    . ILE E 1 47 ? 35.781  2.523   7.358   1.00 0.00 ? 47 ILE E CG2    1  
ATOM 4405   C CD1    . ILE E 1 47 ? 34.957  5.622   7.585   1.00 0.00 ? 47 ILE E CD1    1  
ATOM 4406   H H      . ILE E 1 47 ? 37.178  5.486   5.003   1.00 0.00 ? 47 ILE E H      1  
ATOM 4407   H HA     . ILE E 1 47 ? 37.497  4.584   7.746   1.00 0.00 ? 47 ILE E HA     1  
ATOM 4408   H HB     . ILE E 1 47 ? 36.168  3.237   5.383   1.00 0.00 ? 47 ILE E HB     1  
ATOM 4409   H HG12   . ILE E 1 47 ? 35.052  5.285   5.481   1.00 0.00 ? 47 ILE E HG12   1  
ATOM 4410   H HG13   . ILE E 1 47 ? 34.021  4.149   6.341   1.00 0.00 ? 47 ILE E HG13   1  
ATOM 4411   H HG21   . ILE E 1 47 ? 35.825  2.881   8.386   1.00 0.00 ? 47 ILE E HG21   1  
ATOM 4412   H HG22   . ILE E 1 47 ? 34.780  2.142   7.153   1.00 0.00 ? 47 ILE E HG22   1  
ATOM 4413   H HG23   . ILE E 1 47 ? 36.491  1.707   7.232   1.00 0.00 ? 47 ILE E HG23   1  
ATOM 4414   H HD11   . ILE E 1 47 ? 35.670  6.431   7.418   1.00 0.00 ? 47 ILE E HD11   1  
ATOM 4415   H HD12   . ILE E 1 47 ? 33.957  6.042   7.693   1.00 0.00 ? 47 ILE E HD12   1  
ATOM 4416   H HD13   . ILE E 1 47 ? 35.214  5.080   8.494   1.00 0.00 ? 47 ILE E HD13   1  
ATOM 4417   N N      . TYR E 1 48 ? 39.066  3.077   5.279   1.00 0.00 ? 48 TYR E N      1  
ATOM 4418   C CA     . TYR E 1 48 ? 40.158  2.185   4.936   1.00 0.00 ? 48 TYR E CA     1  
ATOM 4419   C C      . TYR E 1 48 ? 41.404  2.452   5.775   1.00 0.00 ? 48 TYR E C      1  
ATOM 4420   O O      . TYR E 1 48 ? 42.075  1.514   6.201   1.00 0.00 ? 48 TYR E O      1  
ATOM 4421   C CB     . TYR E 1 48 ? 40.456  2.366   3.449   1.00 0.00 ? 48 TYR E CB     1  
ATOM 4422   C CG     . TYR E 1 48 ? 41.556  1.474   2.924   1.00 0.00 ? 48 TYR E CG     1  
ATOM 4423   C CD1    . TYR E 1 48 ? 41.319  0.106   2.720   1.00 0.00 ? 48 TYR E CD1    1  
ATOM 4424   C CD2    . TYR E 1 48 ? 42.800  2.029   2.600   1.00 0.00 ? 48 TYR E CD2    1  
ATOM 4425   C CE1    . TYR E 1 48 ? 42.302  -0.694  2.124   1.00 0.00 ? 48 TYR E CE1    1  
ATOM 4426   C CE2    . TYR E 1 48 ? 43.785  1.237   1.998   1.00 0.00 ? 48 TYR E CE2    1  
ATOM 4427   C CZ     . TYR E 1 48 ? 43.536  -0.127  1.742   1.00 0.00 ? 48 TYR E CZ     1  
ATOM 4428   O OH     . TYR E 1 48 ? 44.510  -0.896  1.180   1.00 0.00 ? 48 TYR E OH     1  
ATOM 4429   H H      . TYR E 1 48 ? 38.643  3.612   4.532   1.00 0.00 ? 48 TYR E H      1  
ATOM 4430   H HA     . TYR E 1 48 ? 39.842  1.156   5.109   1.00 0.00 ? 48 TYR E HA     1  
ATOM 4431   H HB2    . TYR E 1 48 ? 39.547  2.166   2.881   1.00 0.00 ? 48 TYR E HB2    1  
ATOM 4432   H HB3    . TYR E 1 48 ? 40.736  3.404   3.273   1.00 0.00 ? 48 TYR E HB3    1  
ATOM 4433   H HD1    . TYR E 1 48 ? 40.375  -0.331  3.009   1.00 0.00 ? 48 TYR E HD1    1  
ATOM 4434   H HD2    . TYR E 1 48 ? 43.000  3.073   2.795   1.00 0.00 ? 48 TYR E HD2    1  
ATOM 4435   H HE1    . TYR E 1 48 ? 42.106  -1.741  1.946   1.00 0.00 ? 48 TYR E HE1    1  
ATOM 4436   H HE2    . TYR E 1 48 ? 44.736  1.675   1.736   1.00 0.00 ? 48 TYR E HE2    1  
ATOM 4437   H HH     . TYR E 1 48 ? 44.242  -1.813  1.063   1.00 0.00 ? 48 TYR E HH     1  
ATOM 4438   N N      . GLN E 1 49 ? 41.680  3.718   6.098   1.00 0.00 ? 49 GLN E N      1  
ATOM 4439   C CA     . GLN E 1 49 ? 42.870  4.105   6.838   1.00 0.00 ? 49 GLN E CA     1  
ATOM 4440   C C      . GLN E 1 49 ? 42.810  3.705   8.311   1.00 0.00 ? 49 GLN E C      1  
ATOM 4441   O O      . GLN E 1 49 ? 43.854  3.541   8.939   1.00 0.00 ? 49 GLN E O      1  
ATOM 4442   C CB     . GLN E 1 49 ? 43.076  5.613   6.690   1.00 0.00 ? 49 GLN E CB     1  
ATOM 4443   C CG     . GLN E 1 49 ? 43.531  5.938   5.268   1.00 0.00 ? 49 GLN E CG     1  
ATOM 4444   C CD     . GLN E 1 49 ? 43.518  7.430   4.954   1.00 0.00 ? 49 GLN E CD     1  
ATOM 4445   O OE1    . GLN E 1 49 ? 43.388  8.281   5.831   1.00 0.00 ? 49 GLN E OE1    1  
ATOM 4446   N NE2    . GLN E 1 49 ? 43.701  7.775   3.683   1.00 0.00 ? 49 GLN E NE2    1  
ATOM 4447   H H      . GLN E 1 49 ? 41.093  4.455   5.731   1.00 0.00 ? 49 GLN E H      1  
ATOM 4448   H HA     . GLN E 1 49 ? 43.727  3.594   6.398   1.00 0.00 ? 49 GLN E HA     1  
ATOM 4449   H HB2    . GLN E 1 49 ? 42.142  6.131   6.908   1.00 0.00 ? 49 GLN E HB2    1  
ATOM 4450   H HB3    . GLN E 1 49 ? 43.840  5.947   7.392   1.00 0.00 ? 49 GLN E HB3    1  
ATOM 4451   H HG2    . GLN E 1 49 ? 44.546  5.572   5.131   1.00 0.00 ? 49 GLN E HG2    1  
ATOM 4452   H HG3    . GLN E 1 49 ? 42.895  5.419   4.551   1.00 0.00 ? 49 GLN E HG3    1  
ATOM 4453   H HE21   . GLN E 1 49 ? 43.721  7.050   2.975   1.00 0.00 ? 49 GLN E HE21   1  
ATOM 4454   H HE22   . GLN E 1 49 ? 43.704  8.751   3.426   1.00 0.00 ? 49 GLN E HE22   1  
ATOM 4455   N N      . ARG E 1 50 ? 41.609  3.489   8.861   1.00 0.00 ? 50 ARG E N      1  
ATOM 4456   C CA     . ARG E 1 50 ? 41.434  2.951   10.203  1.00 0.00 ? 50 ARG E CA     1  
ATOM 4457   C C      . ARG E 1 50 ? 41.739  1.458   10.232  1.00 0.00 ? 50 ARG E C      1  
ATOM 4458   O O      . ARG E 1 50 ? 42.158  0.927   11.257  1.00 0.00 ? 50 ARG E O      1  
ATOM 4459   C CB     . ARG E 1 50 ? 40.004  3.204   10.687  1.00 0.00 ? 50 ARG E CB     1  
ATOM 4460   C CG     . ARG E 1 50 ? 39.812  4.601   11.281  1.00 0.00 ? 50 ARG E CG     1  
ATOM 4461   C CD     . ARG E 1 50 ? 39.794  5.687   10.205  1.00 0.00 ? 50 ARG E CD     1  
ATOM 4462   N NE     . ARG E 1 50 ? 39.560  7.009   10.795  1.00 0.00 ? 50 ARG E NE     1  
ATOM 4463   C CZ     . ARG E 1 50 ? 39.813  8.171   10.184  1.00 0.00 ? 50 ARG E CZ     1  
ATOM 4464   N NH1    . ARG E 1 50 ? 40.170  8.216   8.901   1.00 0.00 ? 50 ARG E NH1    1  
ATOM 4465   N NH2    . ARG E 1 50 ? 39.710  9.315   10.859  1.00 0.00 ? 50 ARG E NH2    1  
ATOM 4466   H H      . ARG E 1 50 ? 40.788  3.574   8.279   1.00 0.00 ? 50 ARG E H      1  
ATOM 4467   H HA     . ARG E 1 50 ? 42.131  3.439   10.884  1.00 0.00 ? 50 ARG E HA     1  
ATOM 4468   H HB2    . ARG E 1 50 ? 39.299  3.060   9.870   1.00 0.00 ? 50 ARG E HB2    1  
ATOM 4469   H HB3    . ARG E 1 50 ? 39.760  2.469   11.455  1.00 0.00 ? 50 ARG E HB3    1  
ATOM 4470   H HG2    . ARG E 1 50 ? 38.862  4.623   11.814  1.00 0.00 ? 50 ARG E HG2    1  
ATOM 4471   H HG3    . ARG E 1 50 ? 40.614  4.806   11.990  1.00 0.00 ? 50 ARG E HG3    1  
ATOM 4472   H HD2    . ARG E 1 50 ? 40.754  5.696   9.689   1.00 0.00 ? 50 ARG E HD2    1  
ATOM 4473   H HD3    . ARG E 1 50 ? 39.004  5.464   9.487   1.00 0.00 ? 50 ARG E HD3    1  
ATOM 4474   H HE     . ARG E 1 50 ? 39.252  7.040   11.755  1.00 0.00 ? 50 ARG E HE     1  
ATOM 4475   H HH11   . ARG E 1 50 ? 40.119  7.376   8.340   1.00 0.00 ? 50 ARG E HH11   1  
ATOM 4476   H HH12   . ARG E 1 50 ? 40.392  9.100   8.468   1.00 0.00 ? 50 ARG E HH12   1  
ATOM 4477   H HH21   . ARG E 1 50 ? 39.447  9.306   11.834  1.00 0.00 ? 50 ARG E HH21   1  
ATOM 4478   H HH22   . ARG E 1 50 ? 39.898  10.194  10.399  1.00 0.00 ? 50 ARG E HH22   1  
ATOM 4479   N N      . ILE E 1 51 ? 41.543  0.790   9.093   1.00 0.00 ? 51 ILE E N      1  
ATOM 4480   C CA     . ILE E 1 51 ? 41.630  -0.653  8.949   1.00 0.00 ? 51 ILE E CA     1  
ATOM 4481   C C      . ILE E 1 51 ? 43.051  -1.059  8.567   1.00 0.00 ? 51 ILE E C      1  
ATOM 4482   O O      . ILE E 1 51 ? 43.580  -2.045  9.078   1.00 0.00 ? 51 ILE E O      1  
ATOM 4483   C CB     . ILE E 1 51 ? 40.576  -1.083  7.923   1.00 0.00 ? 51 ILE E CB     1  
ATOM 4484   C CG1    . ILE E 1 51 ? 39.179  -0.795  8.482   1.00 0.00 ? 51 ILE E CG1    1  
ATOM 4485   C CG2    . ILE E 1 51 ? 40.680  -2.566  7.569   1.00 0.00 ? 51 ILE E CG2    1  
ATOM 4486   C CD1    . ILE E 1 51 ? 38.112  -0.823  7.390   1.00 0.00 ? 51 ILE E CD1    1  
ATOM 4487   H H      . ILE E 1 51 ? 41.201  1.310   8.298   1.00 0.00 ? 51 ILE E H      1  
ATOM 4488   H HA     . ILE E 1 51 ? 41.387  -1.124  9.901   1.00 0.00 ? 51 ILE E HA     1  
ATOM 4489   H HB     . ILE E 1 51 ? 40.720  -0.503  7.011   1.00 0.00 ? 51 ILE E HB     1  
ATOM 4490   H HG12   . ILE E 1 51 ? 38.930  -1.530  9.247   1.00 0.00 ? 51 ILE E HG12   1  
ATOM 4491   H HG13   . ILE E 1 51 ? 39.151  0.194   8.940   1.00 0.00 ? 51 ILE E HG13   1  
ATOM 4492   H HG21   . ILE E 1 51 ? 40.014  -2.795  6.737   1.00 0.00 ? 51 ILE E HG21   1  
ATOM 4493   H HG22   . ILE E 1 51 ? 41.697  -2.809  7.263   1.00 0.00 ? 51 ILE E HG22   1  
ATOM 4494   H HG23   . ILE E 1 51 ? 40.400  -3.170  8.432   1.00 0.00 ? 51 ILE E HG23   1  
ATOM 4495   H HD11   . ILE E 1 51 ? 38.381  -0.120  6.603   1.00 0.00 ? 51 ILE E HD11   1  
ATOM 4496   H HD12   . ILE E 1 51 ? 38.027  -1.828  6.978   1.00 0.00 ? 51 ILE E HD12   1  
ATOM 4497   H HD13   . ILE E 1 51 ? 37.156  -0.528  7.823   1.00 0.00 ? 51 ILE E HD13   1  
ATOM 4498   N N      . GLN E 1 52 ? 43.710  -0.244  7.741   1.00 0.00 ? 52 GLN E N      1  
ATOM 4499   C CA     . GLN E 1 52 ? 45.099  -0.414  7.341   1.00 0.00 ? 52 GLN E CA     1  
ATOM 4500   C C      . GLN E 1 52 ? 46.097  0.081   8.386   1.00 0.00 ? 52 GLN E C      1  
ATOM 4501   O O      . GLN E 1 52 ? 47.305  0.022   8.158   1.00 0.00 ? 52 GLN E O      1  
ATOM 4502   C CB     . GLN E 1 52 ? 45.328  0.234   5.976   1.00 0.00 ? 52 GLN E CB     1  
ATOM 4503   C CG     . GLN E 1 52 ? 44.559  -0.462  4.855   1.00 0.00 ? 52 GLN E CG     1  
ATOM 4504   C CD     . GLN E 1 52 ? 44.633  -1.982  4.932   1.00 0.00 ? 52 GLN E CD     1  
ATOM 4505   O OE1    . GLN E 1 52 ? 45.661  -2.587  4.640   1.00 0.00 ? 52 GLN E OE1    1  
ATOM 4506   N NE2    . GLN E 1 52 ? 43.560  -2.622  5.393   1.00 0.00 ? 52 GLN E NE2    1  
ATOM 4507   H H      . GLN E 1 52 ? 43.199  0.519   7.319   1.00 0.00 ? 52 GLN E H      1  
ATOM 4508   H HA     . GLN E 1 52 ? 45.287  -1.484  7.246   1.00 0.00 ? 52 GLN E HA     1  
ATOM 4509   H HB2    . GLN E 1 52 ? 45.030  1.282   6.017   1.00 0.00 ? 52 GLN E HB2    1  
ATOM 4510   H HB3    . GLN E 1 52 ? 46.389  0.196   5.729   1.00 0.00 ? 52 GLN E HB3    1  
ATOM 4511   H HG2    . GLN E 1 52 ? 43.515  -0.150  4.884   1.00 0.00 ? 52 GLN E HG2    1  
ATOM 4512   H HG3    . GLN E 1 52 ? 44.989  -0.145  3.906   1.00 0.00 ? 52 GLN E HG3    1  
ATOM 4513   H HE21   . GLN E 1 52 ? 42.725  -2.104  5.620   1.00 0.00 ? 52 GLN E HE21   1  
ATOM 4514   H HE22   . GLN E 1 52 ? 43.621  -3.609  5.597   1.00 0.00 ? 52 GLN E HE22   1  
ATOM 4515   N N      . ALA E 1 53 ? 45.615  0.542   9.543   1.00 0.00 ? 53 ALA E N      1  
ATOM 4516   C CA     . ALA E 1 53 ? 46.424  0.925   10.689  1.00 0.00 ? 53 ALA E CA     1  
ATOM 4517   C C      . ALA E 1 53 ? 47.247  -0.214  11.294  1.00 0.00 ? 53 ALA E C      1  
ATOM 4518   O O      . ALA E 1 53 ? 47.863  -0.033  12.344  1.00 0.00 ? 53 ALA E O      1  
ATOM 4519   C CB     . ALA E 1 53 ? 45.499  1.526   11.743  1.00 0.00 ? 53 ALA E CB     1  
ATOM 4520   H H      . ALA E 1 53 ? 44.612  0.604   9.651   1.00 0.00 ? 53 ALA E H      1  
ATOM 4521   H HA     . ALA E 1 53 ? 47.122  1.700   10.366  1.00 0.00 ? 53 ALA E HA     1  
ATOM 4522   H HB1    . ALA E 1 53 ? 44.838  0.749   12.124  1.00 0.00 ? 53 ALA E HB1    1  
ATOM 4523   H HB2    . ALA E 1 53 ? 46.096  1.921   12.564  1.00 0.00 ? 53 ALA E HB2    1  
ATOM 4524   H HB3    . ALA E 1 53 ? 44.910  2.330   11.301  1.00 0.00 ? 53 ALA E HB3    1  
ATOM 4525   N N      . GLY E 1 54 ? 47.222  -1.407  10.691  1.00 0.00 ? 54 GLY E N      1  
ATOM 4526   C CA     . GLY E 1 54 ? 48.062  -2.520  11.096  1.00 0.00 ? 54 GLY E CA     1  
ATOM 4527   C C      . GLY E 1 54 ? 47.260  -3.649  11.732  1.00 0.00 ? 54 GLY E C      1  
ATOM 4528   O O      . GLY E 1 54 ? 47.662  -4.176  12.767  1.00 0.00 ? 54 GLY E O      1  
ATOM 4529   H H      . GLY E 1 54 ? 46.716  -1.494  9.822   1.00 0.00 ? 54 GLY E H      1  
ATOM 4530   H HA2    . GLY E 1 54 ? 48.586  -2.909  10.223  1.00 0.00 ? 54 GLY E HA2    1  
ATOM 4531   H HA3    . GLY E 1 54 ? 48.798  -2.163  11.817  1.00 0.00 ? 54 GLY E HA3    1  
ATOM 4532   N N      . LEU E 1 55 ? 46.084  -3.952  11.176  1.00 0.00 ? 55 LEU E N      1  
ATOM 4533   C CA     . LEU E 1 55 ? 45.129  -4.856  11.793  1.00 0.00 ? 55 LEU E CA     1  
ATOM 4534   C C      . LEU E 1 55 ? 44.284  -5.612  10.771  1.00 0.00 ? 55 LEU E C      1  
ATOM 4535   O O      . LEU E 1 55 ? 44.235  -6.840  10.808  1.00 0.00 ? 55 LEU E O      1  
ATOM 4536   C CB     . LEU E 1 55 ? 44.267  -4.112  12.819  1.00 0.00 ? 55 LEU E CB     1  
ATOM 4537   C CG     . LEU E 1 55 ? 43.764  -2.709  12.455  1.00 0.00 ? 55 LEU E CG     1  
ATOM 4538   C CD1    . LEU E 1 55 ? 42.306  -2.704  11.998  1.00 0.00 ? 55 LEU E CD1    1  
ATOM 4539   C CD2    . LEU E 1 55 ? 43.847  -1.812  13.688  1.00 0.00 ? 55 LEU E CD2    1  
ATOM 4540   H H      . LEU E 1 55 ? 45.825  -3.506  10.307  1.00 0.00 ? 55 LEU E H      1  
ATOM 4541   H HA     . LEU E 1 55 ? 45.690  -5.615  12.339  1.00 0.00 ? 55 LEU E HA     1  
ATOM 4542   H HB2    . LEU E 1 55 ? 43.411  -4.739  13.067  1.00 0.00 ? 55 LEU E HB2    1  
ATOM 4543   H HB3    . LEU E 1 55 ? 44.867  -4.027  13.726  1.00 0.00 ? 55 LEU E HB3    1  
ATOM 4544   H HG     . LEU E 1 55 ? 44.378  -2.263  11.674  1.00 0.00 ? 55 LEU E HG     1  
ATOM 4545   H HD11   . LEU E 1 55 ? 41.960  -1.673  11.916  1.00 0.00 ? 55 LEU E HD11   1  
ATOM 4546   H HD12   . LEU E 1 55 ? 42.208  -3.173  11.020  1.00 0.00 ? 55 LEU E HD12   1  
ATOM 4547   H HD13   . LEU E 1 55 ? 41.684  -3.223  12.726  1.00 0.00 ? 55 LEU E HD13   1  
ATOM 4548   H HD21   . LEU E 1 55 ? 43.462  -0.820  13.449  1.00 0.00 ? 55 LEU E HD21   1  
ATOM 4549   H HD22   . LEU E 1 55 ? 43.255  -2.242  14.497  1.00 0.00 ? 55 LEU E HD22   1  
ATOM 4550   H HD23   . LEU E 1 55 ? 44.885  -1.720  14.006  1.00 0.00 ? 55 LEU E HD23   1  
ATOM 4551   N N      . THR E 1 56 ? 43.599  -4.888  9.882   1.00 0.00 ? 56 THR E N      1  
ATOM 4552   C CA     . THR E 1 56 ? 42.579  -5.414  8.985   1.00 0.00 ? 56 THR E CA     1  
ATOM 4553   C C      . THR E 1 56 ? 41.536  -6.271  9.703   1.00 0.00 ? 56 THR E C      1  
ATOM 4554   O O      . THR E 1 56 ? 40.886  -7.120  9.096   1.00 0.00 ? 56 THR E O      1  
ATOM 4555   C CB     . THR E 1 56 ? 43.206  -6.102  7.768   1.00 0.00 ? 56 THR E CB     1  
ATOM 4556   O OG1    . THR E 1 56 ? 44.368  -5.413  7.361   1.00 0.00 ? 56 THR E OG1    1  
ATOM 4557   C CG2    . THR E 1 56 ? 42.264  -6.096  6.564   1.00 0.00 ? 56 THR E CG2    1  
ATOM 4558   H H      . THR E 1 56 ? 43.765  -3.892  9.839   1.00 0.00 ? 56 THR E H      1  
ATOM 4559   H HA     . THR E 1 56 ? 42.038  -4.547  8.613   1.00 0.00 ? 56 THR E HA     1  
ATOM 4560   H HB     . THR E 1 56 ? 43.470  -7.128  8.023   1.00 0.00 ? 56 THR E HB     1  
ATOM 4561   H HG1    . THR E 1 56 ? 44.861  -5.985  6.765   1.00 0.00 ? 56 THR E HG1    1  
ATOM 4562   H HG21   . THR E 1 56 ? 41.416  -6.755  6.741   1.00 0.00 ? 56 THR E HG21   1  
ATOM 4563   H HG22   . THR E 1 56 ? 41.900  -5.085  6.380   1.00 0.00 ? 56 THR E HG22   1  
ATOM 4564   H HG23   . THR E 1 56 ? 42.798  -6.448  5.682   1.00 0.00 ? 56 THR E HG23   1  
ATOM 4565   N N      . ALA E 1 57 ? 41.337  -6.027  11.001  1.00 0.00 ? 57 ALA E N      1  
ATOM 4566   C CA     . ALA E 1 57 ? 40.308  -6.651  11.814  1.00 0.00 ? 57 ALA E CA     1  
ATOM 4567   C C      . ALA E 1 57 ? 40.050  -5.797  13.054  1.00 0.00 ? 57 ALA E C      1  
ATOM 4568   O O      . ALA E 1 57 ? 40.998  -5.488  13.775  1.00 0.00 ? 57 ALA E O      1  
ATOM 4569   C CB     . ALA E 1 57 ? 40.767  -8.050  12.220  1.00 0.00 ? 57 ALA E CB     1  
ATOM 4570   H H      . ALA E 1 57 ? 41.920  -5.338  11.455  1.00 0.00 ? 57 ALA E H      1  
ATOM 4571   H HA     . ALA E 1 57 ? 39.397  -6.743  11.222  1.00 0.00 ? 57 ALA E HA     1  
ATOM 4572   H HB1    . ALA E 1 57 ? 41.713  -7.989  12.758  1.00 0.00 ? 57 ALA E HB1    1  
ATOM 4573   H HB2    . ALA E 1 57 ? 40.015  -8.509  12.864  1.00 0.00 ? 57 ALA E HB2    1  
ATOM 4574   H HB3    . ALA E 1 57 ? 40.897  -8.666  11.330  1.00 0.00 ? 57 ALA E HB3    1  
ATOM 4575   N N      . PRO E 1 58 ? 38.797  -5.423  13.341  1.00 0.00 ? 58 PRO E N      1  
ATOM 4576   C CA     . PRO E 1 58 ? 38.446  -4.679  14.536  1.00 0.00 ? 58 PRO E CA     1  
ATOM 4577   C C      . PRO E 1 58 ? 38.970  -5.313  15.818  1.00 0.00 ? 58 PRO E C      1  
ATOM 4578   O O      . PRO E 1 58 ? 38.921  -6.532  15.975  1.00 0.00 ? 58 PRO E O      1  
ATOM 4579   C CB     . PRO E 1 58 ? 36.921  -4.629  14.554  1.00 0.00 ? 58 PRO E CB     1  
ATOM 4580   C CG     . PRO E 1 58 ? 36.551  -4.676  13.073  1.00 0.00 ? 58 PRO E CG     1  
ATOM 4581   C CD     . PRO E 1 58 ? 37.656  -5.528  12.451  1.00 0.00 ? 58 PRO E CD     1  
ATOM 4582   H HA     . PRO E 1 58 ? 38.836  -3.664  14.447  1.00 0.00 ? 58 PRO E HA     1  
ATOM 4583   H HB2    . PRO E 1 58 ? 36.522  -5.512  15.055  1.00 0.00 ? 58 PRO E HB2    1  
ATOM 4584   H HB3    . PRO E 1 58 ? 36.564  -3.725  15.048  1.00 0.00 ? 58 PRO E HB3    1  
ATOM 4585   H HG2    . PRO E 1 58 ? 35.571  -5.132  12.926  1.00 0.00 ? 58 PRO E HG2    1  
ATOM 4586   H HG3    . PRO E 1 58 ? 36.576  -3.670  12.652  1.00 0.00 ? 58 PRO E HG3    1  
ATOM 4587   H HD2    . PRO E 1 58 ? 37.331  -6.566  12.390  1.00 0.00 ? 58 PRO E HD2    1  
ATOM 4588   H HD3    . PRO E 1 58 ? 37.905  -5.148  11.460  1.00 0.00 ? 58 PRO E HD3    1  
ATOM 4589   N N      . ASP E 1 59 ? 39.407  -4.468  16.756  1.00 0.00 ? 59 ASP E N      1  
ATOM 4590   C CA     . ASP E 1 59 ? 39.741  -4.839  18.123  1.00 0.00 ? 59 ASP E CA     1  
ATOM 4591   C C      . ASP E 1 59 ? 40.904  -5.826  18.243  1.00 0.00 ? 59 ASP E C      1  
ATOM 4592   O O      . ASP E 1 59 ? 41.203  -6.296  19.341  1.00 0.00 ? 59 ASP E O      1  
ATOM 4593   C CB     . ASP E 1 59 ? 38.468  -5.354  18.800  1.00 0.00 ? 59 ASP E CB     1  
ATOM 4594   C CG     . ASP E 1 59 ? 38.583  -5.406  20.321  1.00 0.00 ? 59 ASP E CG     1  
ATOM 4595   O OD1    . ASP E 1 59 ? 38.905  -4.358  20.923  1.00 0.00 ? 59 ASP E OD1    1  
ATOM 4596   O OD2    . ASP E 1 59 ? 38.282  -6.476  20.896  1.00 0.00 ? 59 ASP E OD2    1  
ATOM 4597   H H      . ASP E 1 59 ? 39.420  -3.482  16.537  1.00 0.00 ? 59 ASP E H      1  
ATOM 4598   H HA     . ASP E 1 59 ? 40.046  -3.928  18.639  1.00 0.00 ? 59 ASP E HA     1  
ATOM 4599   H HB2    . ASP E 1 59 ? 37.637  -4.702  18.532  1.00 0.00 ? 59 ASP E HB2    1  
ATOM 4600   H HB3    . ASP E 1 59 ? 38.227  -6.341  18.407  1.00 0.00 ? 59 ASP E HB3    1  
ATOM 4601   N N      . MET F 1 1  ? 26.359  -5.007  -3.264  1.00 0.00 ? 1  MET F N      1  
ATOM 4602   C CA     . MET F 1 1  ? 26.211  -3.742  -4.008  1.00 0.00 ? 1  MET F CA     1  
ATOM 4603   C C      . MET F 1 1  ? 26.234  -2.550  -3.060  1.00 0.00 ? 1  MET F C      1  
ATOM 4604   O O      . MET F 1 1  ? 25.253  -2.303  -2.364  1.00 0.00 ? 1  MET F O      1  
ATOM 4605   C CB     . MET F 1 1  ? 24.919  -3.757  -4.828  1.00 0.00 ? 1  MET F CB     1  
ATOM 4606   C CG     . MET F 1 1  ? 24.641  -2.410  -5.493  1.00 0.00 ? 1  MET F CG     1  
ATOM 4607   S SD     . MET F 1 1  ? 26.010  -1.756  -6.478  1.00 0.00 ? 1  MET F SD     1  
ATOM 4608   C CE     . MET F 1 1  ? 25.056  -0.519  -7.389  1.00 0.00 ? 1  MET F CE     1  
ATOM 4609   H H1     . MET F 1 1  ? 25.556  -5.156  -2.668  1.00 0.00 ? 1  MET F H1     1  
ATOM 4610   H H2     . MET F 1 1  ? 27.192  -4.983  -2.694  1.00 0.00 ? 1  MET F H2     1  
ATOM 4611   H H3     . MET F 1 1  ? 26.425  -5.781  -3.909  1.00 0.00 ? 1  MET F H3     1  
ATOM 4612   H HA     . MET F 1 1  ? 27.050  -3.638  -4.697  1.00 0.00 ? 1  MET F HA     1  
ATOM 4613   H HB2    . MET F 1 1  ? 24.996  -4.522  -5.602  1.00 0.00 ? 1  MET F HB2    1  
ATOM 4614   H HB3    . MET F 1 1  ? 24.078  -4.001  -4.178  1.00 0.00 ? 1  MET F HB3    1  
ATOM 4615   H HG2    . MET F 1 1  ? 23.775  -2.518  -6.146  1.00 0.00 ? 1  MET F HG2    1  
ATOM 4616   H HG3    . MET F 1 1  ? 24.382  -1.680  -4.725  1.00 0.00 ? 1  MET F HG3    1  
ATOM 4617   H HE1    . MET F 1 1  ? 24.337  -1.033  -8.026  1.00 0.00 ? 1  MET F HE1    1  
ATOM 4618   H HE2    . MET F 1 1  ? 24.521  0.118   -6.683  1.00 0.00 ? 1  MET F HE2    1  
ATOM 4619   H HE3    . MET F 1 1  ? 25.723  0.083   -8.005  1.00 0.00 ? 1  MET F HE3    1  
ATOM 4620   N N      . LEU F 1 2  ? 27.327  -1.785  -3.040  1.00 0.00 ? 2  LEU F N      1  
ATOM 4621   C CA     . LEU F 1 2  ? 27.407  -0.561  -2.260  1.00 0.00 ? 2  LEU F CA     1  
ATOM 4622   C C      . LEU F 1 2  ? 27.111  0.665   -3.112  1.00 0.00 ? 2  LEU F C      1  
ATOM 4623   O O      . LEU F 1 2  ? 27.405  0.686   -4.304  1.00 0.00 ? 2  LEU F O      1  
ATOM 4624   C CB     . LEU F 1 2  ? 28.803  -0.423  -1.651  1.00 0.00 ? 2  LEU F CB     1  
ATOM 4625   C CG     . LEU F 1 2  ? 28.840  -0.933  -0.213  1.00 0.00 ? 2  LEU F CG     1  
ATOM 4626   C CD1    . LEU F 1 2  ? 30.269  -0.991  0.313   1.00 0.00 ? 2  LEU F CD1    1  
ATOM 4627   C CD2    . LEU F 1 2  ? 28.030  -0.039  0.722   1.00 0.00 ? 2  LEU F CD2    1  
ATOM 4628   H H      . LEU F 1 2  ? 28.076  -1.959  -3.697  1.00 0.00 ? 2  LEU F H      1  
ATOM 4629   H HA     . LEU F 1 2  ? 26.647  -0.603  -1.479  1.00 0.00 ? 2  LEU F HA     1  
ATOM 4630   H HB2    . LEU F 1 2  ? 29.512  -0.994  -2.250  1.00 0.00 ? 2  LEU F HB2    1  
ATOM 4631   H HB3    . LEU F 1 2  ? 29.110  0.623   -1.659  1.00 0.00 ? 2  LEU F HB3    1  
ATOM 4632   H HG     . LEU F 1 2  ? 28.445  -1.946  -0.216  1.00 0.00 ? 2  LEU F HG     1  
ATOM 4633   H HD11   . LEU F 1 2  ? 30.259  -1.479  1.288   1.00 0.00 ? 2  LEU F HD11   1  
ATOM 4634   H HD12   . LEU F 1 2  ? 30.875  -1.579  -0.375  1.00 0.00 ? 2  LEU F HD12   1  
ATOM 4635   H HD13   . LEU F 1 2  ? 30.681  0.015   0.397   1.00 0.00 ? 2  LEU F HD13   1  
ATOM 4636   H HD21   . LEU F 1 2  ? 28.314  1.004   0.582   1.00 0.00 ? 2  LEU F HD21   1  
ATOM 4637   H HD22   . LEU F 1 2  ? 26.964  -0.158  0.531   1.00 0.00 ? 2  LEU F HD22   1  
ATOM 4638   H HD23   . LEU F 1 2  ? 28.232  -0.334  1.752   1.00 0.00 ? 2  LEU F HD23   1  
ATOM 4639   N N      . ILE F 1 3  ? 26.576  1.707   -2.473  1.00 0.00 ? 3  ILE F N      1  
ATOM 4640   C CA     . ILE F 1 3  ? 26.447  3.025   -3.064  1.00 0.00 ? 3  ILE F CA     1  
ATOM 4641   C C      . ILE F 1 3  ? 27.036  4.050   -2.104  1.00 0.00 ? 3  ILE F C      1  
ATOM 4642   O O      . ILE F 1 3  ? 26.659  4.119   -0.935  1.00 0.00 ? 3  ILE F O      1  
ATOM 4643   C CB     . ILE F 1 3  ? 24.996  3.341   -3.437  1.00 0.00 ? 3  ILE F CB     1  
ATOM 4644   C CG1    . ILE F 1 3  ? 24.464  2.418   -4.536  1.00 0.00 ? 3  ILE F CG1    1  
ATOM 4645   C CG2    . ILE F 1 3  ? 24.939  4.761   -3.997  1.00 0.00 ? 3  ILE F CG2    1  
ATOM 4646   C CD1    . ILE F 1 3  ? 23.875  1.112   -4.015  1.00 0.00 ? 3  ILE F CD1    1  
ATOM 4647   H H      . ILE F 1 3  ? 26.253  1.585   -1.524  1.00 0.00 ? 3  ILE F H      1  
ATOM 4648   H HA     . ILE F 1 3  ? 27.031  3.049   -3.983  1.00 0.00 ? 3  ILE F HA     1  
ATOM 4649   H HB     . ILE F 1 3  ? 24.357  3.277   -2.556  1.00 0.00 ? 3  ILE F HB     1  
ATOM 4650   H HG12   . ILE F 1 3  ? 23.660  2.923   -5.069  1.00 0.00 ? 3  ILE F HG12   1  
ATOM 4651   H HG13   . ILE F 1 3  ? 25.257  2.197   -5.250  1.00 0.00 ? 3  ILE F HG13   1  
ATOM 4652   H HG21   . ILE F 1 3  ? 25.687  4.875   -4.782  1.00 0.00 ? 3  ILE F HG21   1  
ATOM 4653   H HG22   . ILE F 1 3  ? 23.953  4.941   -4.426  1.00 0.00 ? 3  ILE F HG22   1  
ATOM 4654   H HG23   . ILE F 1 3  ? 25.120  5.488   -3.206  1.00 0.00 ? 3  ILE F HG23   1  
ATOM 4655   H HD11   . ILE F 1 3  ? 23.066  1.330   -3.318  1.00 0.00 ? 3  ILE F HD11   1  
ATOM 4656   H HD12   . ILE F 1 3  ? 23.480  0.566   -4.869  1.00 0.00 ? 3  ILE F HD12   1  
ATOM 4657   H HD13   . ILE F 1 3  ? 24.632  0.495   -3.538  1.00 0.00 ? 3  ILE F HD13   1  
ATOM 4658   N N      . LEU F 1 4  ? 27.991  4.828   -2.615  1.00 0.00 ? 4  LEU F N      1  
ATOM 4659   C CA     . LEU F 1 4  ? 28.716  5.869   -1.910  1.00 0.00 ? 4  LEU F CA     1  
ATOM 4660   C C      . LEU F 1 4  ? 28.342  7.223   -2.503  1.00 0.00 ? 4  LEU F C      1  
ATOM 4661   O O      . LEU F 1 4  ? 28.014  7.303   -3.686  1.00 0.00 ? 4  LEU F O      1  
ATOM 4662   C CB     . LEU F 1 4  ? 30.218  5.621   -2.081  1.00 0.00 ? 4  LEU F CB     1  
ATOM 4663   C CG     . LEU F 1 4  ? 30.877  4.762   -1.000  1.00 0.00 ? 4  LEU F CG     1  
ATOM 4664   C CD1    . LEU F 1 4  ? 30.940  5.519   0.323   1.00 0.00 ? 4  LEU F CD1    1  
ATOM 4665   C CD2    . LEU F 1 4  ? 30.186  3.417   -0.789  1.00 0.00 ? 4  LEU F CD2    1  
ATOM 4666   H H      . LEU F 1 4  ? 28.206  4.724   -3.597  1.00 0.00 ? 4  LEU F H      1  
ATOM 4667   H HA     . LEU F 1 4  ? 28.453  5.862   -0.852  1.00 0.00 ? 4  LEU F HA     1  
ATOM 4668   H HB2    . LEU F 1 4  ? 30.389  5.148   -3.048  1.00 0.00 ? 4  LEU F HB2    1  
ATOM 4669   H HB3    . LEU F 1 4  ? 30.732  6.582   -2.103  1.00 0.00 ? 4  LEU F HB3    1  
ATOM 4670   H HG     . LEU F 1 4  ? 31.901  4.564   -1.313  1.00 0.00 ? 4  LEU F HG     1  
ATOM 4671   H HD11   . LEU F 1 4  ? 31.273  6.542   0.143   1.00 0.00 ? 4  LEU F HD11   1  
ATOM 4672   H HD12   . LEU F 1 4  ? 29.957  5.530   0.789   1.00 0.00 ? 4  LEU F HD12   1  
ATOM 4673   H HD13   . LEU F 1 4  ? 31.642  5.019   0.991   1.00 0.00 ? 4  LEU F HD13   1  
ATOM 4674   H HD21   . LEU F 1 4  ? 30.798  2.796   -0.134  1.00 0.00 ? 4  LEU F HD21   1  
ATOM 4675   H HD22   . LEU F 1 4  ? 29.210  3.563   -0.328  1.00 0.00 ? 4  LEU F HD22   1  
ATOM 4676   H HD23   . LEU F 1 4  ? 30.067  2.913   -1.748  1.00 0.00 ? 4  LEU F HD23   1  
ATOM 4677   N N      . THR F 1 5  ? 28.457  8.298   -1.717  1.00 0.00 ? 5  THR F N      1  
ATOM 4678   C CA     . THR F 1 5  ? 28.363  9.647   -2.253  1.00 0.00 ? 5  THR F CA     1  
ATOM 4679   C C      . THR F 1 5  ? 29.651  10.396  -1.938  1.00 0.00 ? 5  THR F C      1  
ATOM 4680   O O      . THR F 1 5  ? 29.929  10.717  -0.783  1.00 0.00 ? 5  THR F O      1  
ATOM 4681   C CB     . THR F 1 5  ? 27.125  10.402  -1.765  1.00 0.00 ? 5  THR F CB     1  
ATOM 4682   O OG1    . THR F 1 5  ? 26.075  9.522   -1.428  1.00 0.00 ? 5  THR F OG1    1  
ATOM 4683   C CG2    . THR F 1 5  ? 26.615  11.304  -2.887  1.00 0.00 ? 5  THR F CG2    1  
ATOM 4684   H H      . THR F 1 5  ? 28.691  8.186   -0.740  1.00 0.00 ? 5  THR F H      1  
ATOM 4685   H HA     . THR F 1 5  ? 28.289  9.583   -3.338  1.00 0.00 ? 5  THR F HA     1  
ATOM 4686   H HB     . THR F 1 5  ? 27.377  11.017  -0.899  1.00 0.00 ? 5  THR F HB     1  
ATOM 4687   H HG1    . THR F 1 5  ? 26.318  9.068   -0.614  1.00 0.00 ? 5  THR F HG1    1  
ATOM 4688   H HG21   . THR F 1 5  ? 26.275  10.690  -3.722  1.00 0.00 ? 5  THR F HG21   1  
ATOM 4689   H HG22   . THR F 1 5  ? 25.787  11.911  -2.522  1.00 0.00 ? 5  THR F HG22   1  
ATOM 4690   H HG23   . THR F 1 5  ? 27.415  11.958  -3.230  1.00 0.00 ? 5  THR F HG23   1  
ATOM 4691   N N      . ARG F 1 6  ? 30.480  10.581  -2.967  1.00 0.00 ? 6  ARG F N      1  
ATOM 4692   C CA     . ARG F 1 6  ? 31.845  11.072  -2.862  1.00 0.00 ? 6  ARG F CA     1  
ATOM 4693   C C      . ARG F 1 6  ? 31.968  12.422  -3.559  1.00 0.00 ? 6  ARG F C      1  
ATOM 4694   O O      . ARG F 1 6  ? 31.584  12.522  -4.722  1.00 0.00 ? 6  ARG F O      1  
ATOM 4695   C CB     . ARG F 1 6  ? 32.749  10.016  -3.504  1.00 0.00 ? 6  ARG F CB     1  
ATOM 4696   C CG     . ARG F 1 6  ? 34.225  10.110  -3.121  1.00 0.00 ? 6  ARG F CG     1  
ATOM 4697   C CD     . ARG F 1 6  ? 34.508  9.582   -1.715  1.00 0.00 ? 6  ARG F CD     1  
ATOM 4698   N NE     . ARG F 1 6  ? 34.115  10.553  -0.690  1.00 0.00 ? 6  ARG F NE     1  
ATOM 4699   C CZ     . ARG F 1 6  ? 33.237  10.368  0.300   1.00 0.00 ? 6  ARG F CZ     1  
ATOM 4700   N NH1    . ARG F 1 6  ? 32.602  9.210   0.480   1.00 0.00 ? 6  ARG F NH1    1  
ATOM 4701   N NH2    . ARG F 1 6  ? 32.950  11.398  1.093   1.00 0.00 ? 6  ARG F NH2    1  
ATOM 4702   H H      . ARG F 1 6  ? 30.172  10.273  -3.879  1.00 0.00 ? 6  ARG F H      1  
ATOM 4703   H HA     . ARG F 1 6  ? 32.093  11.206  -1.811  1.00 0.00 ? 6  ARG F HA     1  
ATOM 4704   H HB2    . ARG F 1 6  ? 32.386  9.024   -3.236  1.00 0.00 ? 6  ARG F HB2    1  
ATOM 4705   H HB3    . ARG F 1 6  ? 32.670  10.105  -4.587  1.00 0.00 ? 6  ARG F HB3    1  
ATOM 4706   H HG2    . ARG F 1 6  ? 34.797  9.509   -3.827  1.00 0.00 ? 6  ARG F HG2    1  
ATOM 4707   H HG3    . ARG F 1 6  ? 34.552  11.145  -3.207  1.00 0.00 ? 6  ARG F HG3    1  
ATOM 4708   H HD2    . ARG F 1 6  ? 33.989  8.635   -1.571  1.00 0.00 ? 6  ARG F HD2    1  
ATOM 4709   H HD3    . ARG F 1 6  ? 35.579  9.399   -1.623  1.00 0.00 ? 6  ARG F HD3    1  
ATOM 4710   H HE     . ARG F 1 6  ? 34.443  11.503  -0.811  1.00 0.00 ? 6  ARG F HE     1  
ATOM 4711   H HH11   . ARG F 1 6  ? 32.779  8.446   -0.155  1.00 0.00 ? 6  ARG F HH11   1  
ATOM 4712   H HH12   . ARG F 1 6  ? 31.819  9.170   1.115   1.00 0.00 ? 6  ARG F HH12   1  
ATOM 4713   H HH21   . ARG F 1 6  ? 33.374  12.292  0.886   1.00 0.00 ? 6  ARG F HH21   1  
ATOM 4714   H HH22   . ARG F 1 6  ? 32.299  11.297  1.858   1.00 0.00 ? 6  ARG F HH22   1  
ATOM 4715   N N      . LYS F 1 7  ? 32.511  13.451  -2.898  1.00 0.00 ? 7  LYS F N      1  
ATOM 4716   C CA     . LYS F 1 7  ? 32.740  14.723  -3.573  1.00 0.00 ? 7  LYS F CA     1  
ATOM 4717   C C      . LYS F 1 7  ? 34.143  14.835  -4.150  1.00 0.00 ? 7  LYS F C      1  
ATOM 4718   O O      . LYS F 1 7  ? 35.031  14.050  -3.821  1.00 0.00 ? 7  LYS F O      1  
ATOM 4719   C CB     . LYS F 1 7  ? 32.371  15.958  -2.746  1.00 0.00 ? 7  LYS F CB     1  
ATOM 4720   C CG     . LYS F 1 7  ? 33.245  16.173  -1.514  1.00 0.00 ? 7  LYS F CG     1  
ATOM 4721   C CD     . LYS F 1 7  ? 33.015  17.591  -0.993  1.00 0.00 ? 7  LYS F CD     1  
ATOM 4722   C CE     . LYS F 1 7  ? 34.022  17.989  0.085   1.00 0.00 ? 7  LYS F CE     1  
ATOM 4723   N NZ     . LYS F 1 7  ? 33.951  17.115  1.271   1.00 0.00 ? 7  LYS F NZ     1  
ATOM 4724   H H      . LYS F 1 7  ? 32.934  13.294  -1.993  1.00 0.00 ? 7  LYS F H      1  
ATOM 4725   H HA     . LYS F 1 7  ? 32.076  14.734  -4.435  1.00 0.00 ? 7  LYS F HA     1  
ATOM 4726   H HB2    . LYS F 1 7  ? 32.486  16.826  -3.395  1.00 0.00 ? 7  LYS F HB2    1  
ATOM 4727   H HB3    . LYS F 1 7  ? 31.319  15.932  -2.459  1.00 0.00 ? 7  LYS F HB3    1  
ATOM 4728   H HG2    . LYS F 1 7  ? 32.975  15.449  -0.746  1.00 0.00 ? 7  LYS F HG2    1  
ATOM 4729   H HG3    . LYS F 1 7  ? 34.296  16.056  -1.780  1.00 0.00 ? 7  LYS F HG3    1  
ATOM 4730   H HD2    . LYS F 1 7  ? 33.114  18.296  -1.819  1.00 0.00 ? 7  LYS F HD2    1  
ATOM 4731   H HD3    . LYS F 1 7  ? 32.001  17.668  -0.602  1.00 0.00 ? 7  LYS F HD3    1  
ATOM 4732   H HE2    . LYS F 1 7  ? 35.026  17.949  -0.339  1.00 0.00 ? 7  LYS F HE2    1  
ATOM 4733   H HE3    . LYS F 1 7  ? 33.819  19.019  0.379   1.00 0.00 ? 7  LYS F HE3    1  
ATOM 4734   H HZ1    . LYS F 1 7  ? 34.306  16.192  1.052   1.00 0.00 ? 7  LYS F HZ1    1  
ATOM 4735   H HZ2    . LYS F 1 7  ? 34.519  17.492  2.016   1.00 0.00 ? 7  LYS F HZ2    1  
ATOM 4736   H HZ3    . LYS F 1 7  ? 33.000  17.034  1.599   1.00 0.00 ? 7  LYS F HZ3    1  
ATOM 4737   N N      . VAL F 1 8  ? 34.324  15.814  -5.038  1.00 0.00 ? 8  VAL F N      1  
ATOM 4738   C CA     . VAL F 1 8  ? 35.531  15.908  -5.843  1.00 0.00 ? 8  VAL F CA     1  
ATOM 4739   C C      . VAL F 1 8  ? 36.795  16.000  -4.994  1.00 0.00 ? 8  VAL F C      1  
ATOM 4740   O O      . VAL F 1 8  ? 36.845  16.729  -4.004  1.00 0.00 ? 8  VAL F O      1  
ATOM 4741   C CB     . VAL F 1 8  ? 35.452  17.034  -6.877  1.00 0.00 ? 8  VAL F CB     1  
ATOM 4742   C CG1    . VAL F 1 8  ? 34.159  16.931  -7.685  1.00 0.00 ? 8  VAL F CG1    1  
ATOM 4743   C CG2    . VAL F 1 8  ? 35.521  18.446  -6.303  1.00 0.00 ? 8  VAL F CG2    1  
ATOM 4744   H H      . VAL F 1 8  ? 33.534  16.401  -5.270  1.00 0.00 ? 8  VAL F H      1  
ATOM 4745   H HA     . VAL F 1 8  ? 35.597  14.979  -6.405  1.00 0.00 ? 8  VAL F HA     1  
ATOM 4746   H HB     . VAL F 1 8  ? 36.297  16.916  -7.556  1.00 0.00 ? 8  VAL F HB     1  
ATOM 4747   H HG11   . VAL F 1 8  ? 34.027  15.911  -8.046  1.00 0.00 ? 8  VAL F HG11   1  
ATOM 4748   H HG12   . VAL F 1 8  ? 33.306  17.209  -7.067  1.00 0.00 ? 8  VAL F HG12   1  
ATOM 4749   H HG13   . VAL F 1 8  ? 34.207  17.613  -8.535  1.00 0.00 ? 8  VAL F HG13   1  
ATOM 4750   H HG21   . VAL F 1 8  ? 36.483  18.601  -5.818  1.00 0.00 ? 8  VAL F HG21   1  
ATOM 4751   H HG22   . VAL F 1 8  ? 35.430  19.156  -7.127  1.00 0.00 ? 8  VAL F HG22   1  
ATOM 4752   H HG23   . VAL F 1 8  ? 34.716  18.601  -5.586  1.00 0.00 ? 8  VAL F HG23   1  
ATOM 4753   N N      . GLY F 1 9  ? 37.816  15.235  -5.385  1.00 0.00 ? 9  GLY F N      1  
ATOM 4754   C CA     . GLY F 1 9  ? 39.110  15.196  -4.723  1.00 0.00 ? 9  GLY F CA     1  
ATOM 4755   C C      . GLY F 1 9  ? 39.223  14.132  -3.635  1.00 0.00 ? 9  GLY F C      1  
ATOM 4756   O O      . GLY F 1 9  ? 40.300  13.961  -3.069  1.00 0.00 ? 9  GLY F O      1  
ATOM 4757   H H      . GLY F 1 9  ? 37.690  14.626  -6.184  1.00 0.00 ? 9  GLY F H      1  
ATOM 4758   H HA2    . GLY F 1 9  ? 39.876  14.997  -5.474  1.00 0.00 ? 9  GLY F HA2    1  
ATOM 4759   H HA3    . GLY F 1 9  ? 39.316  16.169  -4.278  1.00 0.00 ? 9  GLY F HA3    1  
ATOM 4760   N N      . GLU F 1 10 ? 38.140  13.410  -3.333  1.00 0.00 ? 10 GLU F N      1  
ATOM 4761   C CA     . GLU F 1 10 ? 38.125  12.367  -2.318  1.00 0.00 ? 10 GLU F CA     1  
ATOM 4762   C C      . GLU F 1 10 ? 38.315  10.980  -2.934  1.00 0.00 ? 10 GLU F C      1  
ATOM 4763   O O      . GLU F 1 10 ? 38.265  10.821  -4.153  1.00 0.00 ? 10 GLU F O      1  
ATOM 4764   C CB     . GLU F 1 10 ? 36.826  12.457  -1.515  1.00 0.00 ? 10 GLU F CB     1  
ATOM 4765   C CG     . GLU F 1 10 ? 36.666  13.811  -0.822  1.00 0.00 ? 10 GLU F CG     1  
ATOM 4766   C CD     . GLU F 1 10 ? 35.348  13.927  -0.061  1.00 0.00 ? 10 GLU F CD     1  
ATOM 4767   O OE1    . GLU F 1 10 ? 34.368  13.252  -0.448  1.00 0.00 ? 10 GLU F OE1    1  
ATOM 4768   O OE2    . GLU F 1 10 ? 35.299  14.723  0.903   1.00 0.00 ? 10 GLU F OE2    1  
ATOM 4769   H H      . GLU F 1 10 ? 37.271  13.606  -3.812  1.00 0.00 ? 10 GLU F H      1  
ATOM 4770   H HA     . GLU F 1 10 ? 38.952  12.532  -1.627  1.00 0.00 ? 10 GLU F HA     1  
ATOM 4771   H HB2    . GLU F 1 10 ? 35.989  12.299  -2.192  1.00 0.00 ? 10 GLU F HB2    1  
ATOM 4772   H HB3    . GLU F 1 10 ? 36.819  11.673  -0.757  1.00 0.00 ? 10 GLU F HB3    1  
ATOM 4773   H HG2    . GLU F 1 10 ? 37.497  13.949  -0.129  1.00 0.00 ? 10 GLU F HG2    1  
ATOM 4774   H HG3    . GLU F 1 10 ? 36.704  14.609  -1.566  1.00 0.00 ? 10 GLU F HG3    1  
ATOM 4775   N N      . SER F 1 11 ? 38.529  9.962   -2.094  1.00 0.00 ? 11 SER F N      1  
ATOM 4776   C CA     . SER F 1 11 ? 38.949  8.641   -2.535  1.00 0.00 ? 11 SER F CA     1  
ATOM 4777   C C      . SER F 1 11 ? 38.192  7.506   -1.849  1.00 0.00 ? 11 SER F C      1  
ATOM 4778   O O      . SER F 1 11 ? 37.507  7.706   -0.847  1.00 0.00 ? 11 SER F O      1  
ATOM 4779   C CB     . SER F 1 11 ? 40.454  8.485   -2.314  1.00 0.00 ? 11 SER F CB     1  
ATOM 4780   O OG     . SER F 1 11 ? 41.172  9.317   -3.198  1.00 0.00 ? 11 SER F OG     1  
ATOM 4781   H H      . SER F 1 11 ? 38.503  10.134  -1.098  1.00 0.00 ? 11 SER F H      1  
ATOM 4782   H HA     . SER F 1 11 ? 38.760  8.550   -3.604  1.00 0.00 ? 11 SER F HA     1  
ATOM 4783   H HB2    . SER F 1 11 ? 40.696  8.756   -1.286  1.00 0.00 ? 11 SER F HB2    1  
ATOM 4784   H HB3    . SER F 1 11 ? 40.746  7.448   -2.487  1.00 0.00 ? 11 SER F HB3    1  
ATOM 4785   H HG     . SER F 1 11 ? 42.101  9.304   -2.943  1.00 0.00 ? 11 SER F HG     1  
ATOM 4786   N N      . ILE F 1 12 ? 38.331  6.297   -2.401  1.00 0.00 ? 12 ILE F N      1  
ATOM 4787   C CA     . ILE F 1 12 ? 37.653  5.070   -2.004  1.00 0.00 ? 12 ILE F CA     1  
ATOM 4788   C C      . ILE F 1 12 ? 38.613  3.899   -2.216  1.00 0.00 ? 12 ILE F C      1  
ATOM 4789   O O      . ILE F 1 12 ? 39.471  3.968   -3.093  1.00 0.00 ? 12 ILE F O      1  
ATOM 4790   C CB     . ILE F 1 12 ? 36.347  4.903   -2.794  1.00 0.00 ? 12 ILE F CB     1  
ATOM 4791   C CG1    . ILE F 1 12 ? 35.430  6.111   -2.575  1.00 0.00 ? 12 ILE F CG1    1  
ATOM 4792   C CG2    . ILE F 1 12 ? 35.599  3.614   -2.438  1.00 0.00 ? 12 ILE F CG2    1  
ATOM 4793   C CD1    . ILE F 1 12 ? 34.069  5.992   -3.259  1.00 0.00 ? 12 ILE F CD1    1  
ATOM 4794   H H      . ILE F 1 12 ? 39.018  6.208   -3.138  1.00 0.00 ? 12 ILE F H      1  
ATOM 4795   H HA     . ILE F 1 12 ? 37.421  5.123   -0.942  1.00 0.00 ? 12 ILE F HA     1  
ATOM 4796   H HB     . ILE F 1 12 ? 36.595  4.860   -3.854  1.00 0.00 ? 12 ILE F HB     1  
ATOM 4797   H HG12   . ILE F 1 12 ? 35.271  6.257   -1.506  1.00 0.00 ? 12 ILE F HG12   1  
ATOM 4798   H HG13   . ILE F 1 12 ? 35.911  7.002   -2.979  1.00 0.00 ? 12 ILE F HG13   1  
ATOM 4799   H HG21   . ILE F 1 12 ? 35.214  3.663   -1.420  1.00 0.00 ? 12 ILE F HG21   1  
ATOM 4800   H HG22   . ILE F 1 12 ? 34.762  3.468   -3.120  1.00 0.00 ? 12 ILE F HG22   1  
ATOM 4801   H HG23   . ILE F 1 12 ? 36.247  2.744   -2.543  1.00 0.00 ? 12 ILE F HG23   1  
ATOM 4802   H HD11   . ILE F 1 12 ? 33.552  6.950   -3.200  1.00 0.00 ? 12 ILE F HD11   1  
ATOM 4803   H HD12   . ILE F 1 12 ? 34.206  5.718   -4.304  1.00 0.00 ? 12 ILE F HD12   1  
ATOM 4804   H HD13   . ILE F 1 12 ? 33.469  5.236   -2.754  1.00 0.00 ? 12 ILE F HD13   1  
ATOM 4805   N N      . ASN F 1 13 ? 38.496  2.830   -1.423  1.00 0.00 ? 13 ASN F N      1  
ATOM 4806   C CA     . ASN F 1 13 ? 39.341  1.653   -1.554  1.00 0.00 ? 13 ASN F CA     1  
ATOM 4807   C C      . ASN F 1 13 ? 38.530  0.380   -1.783  1.00 0.00 ? 13 ASN F C      1  
ATOM 4808   O O      . ASN F 1 13 ? 37.430  0.228   -1.254  1.00 0.00 ? 13 ASN F O      1  
ATOM 4809   C CB     . ASN F 1 13 ? 40.266  1.504   -0.345  1.00 0.00 ? 13 ASN F CB     1  
ATOM 4810   C CG     . ASN F 1 13 ? 41.685  1.212   -0.811  1.00 0.00 ? 13 ASN F CG     1  
ATOM 4811   O OD1    . ASN F 1 13 ? 42.038  0.069   -1.087  1.00 0.00 ? 13 ASN F OD1    1  
ATOM 4812   N ND2    . ASN F 1 13 ? 42.487  2.260   -0.986  1.00 0.00 ? 13 ASN F ND2    1  
ATOM 4813   H H      . ASN F 1 13 ? 37.704  2.774   -0.796  1.00 0.00 ? 13 ASN F H      1  
ATOM 4814   H HA     . ASN F 1 13 ? 39.971  1.783   -2.434  1.00 0.00 ? 13 ASN F HA     1  
ATOM 4815   H HB2    . ASN F 1 13 ? 40.276  2.412   0.258   1.00 0.00 ? 13 ASN F HB2    1  
ATOM 4816   H HB3    . ASN F 1 13 ? 39.921  0.684   0.285   1.00 0.00 ? 13 ASN F HB3    1  
ATOM 4817   H HD21   . ASN F 1 13 ? 42.229  3.158   -0.598  1.00 0.00 ? 13 ASN F HD21   1  
ATOM 4818   H HD22   . ASN F 1 13 ? 43.356  2.151   -1.487  1.00 0.00 ? 13 ASN F HD22   1  
ATOM 4819   N N      . ILE F 1 14 ? 39.100  -0.550  -2.556  1.00 0.00 ? 14 ILE F N      1  
ATOM 4820   C CA     . ILE F 1 14 ? 38.504  -1.828  -2.912  1.00 0.00 ? 14 ILE F CA     1  
ATOM 4821   C C      . ILE F 1 14 ? 39.556  -2.925  -2.769  1.00 0.00 ? 14 ILE F C      1  
ATOM 4822   O O      . ILE F 1 14 ? 40.706  -2.757  -3.174  1.00 0.00 ? 14 ILE F O      1  
ATOM 4823   C CB     . ILE F 1 14 ? 37.938  -1.781  -4.337  1.00 0.00 ? 14 ILE F CB     1  
ATOM 4824   C CG1    . ILE F 1 14 ? 36.906  -0.657  -4.478  1.00 0.00 ? 14 ILE F CG1    1  
ATOM 4825   C CG2    . ILE F 1 14 ? 37.303  -3.127  -4.691  1.00 0.00 ? 14 ILE F CG2    1  
ATOM 4826   C CD1    . ILE F 1 14 ? 36.328  -0.537  -5.887  1.00 0.00 ? 14 ILE F CD1    1  
ATOM 4827   H H      . ILE F 1 14 ? 40.026  -0.366  -2.918  1.00 0.00 ? 14 ILE F H      1  
ATOM 4828   H HA     . ILE F 1 14 ? 37.688  -2.044  -2.223  1.00 0.00 ? 14 ILE F HA     1  
ATOM 4829   H HB     . ILE F 1 14 ? 38.757  -1.590  -5.031  1.00 0.00 ? 14 ILE F HB     1  
ATOM 4830   H HG12   . ILE F 1 14 ? 36.091  -0.822  -3.774  1.00 0.00 ? 14 ILE F HG12   1  
ATOM 4831   H HG13   . ILE F 1 14 ? 37.378  0.297   -4.241  1.00 0.00 ? 14 ILE F HG13   1  
ATOM 4832   H HG21   . ILE F 1 14 ? 36.479  -3.342  -4.010  1.00 0.00 ? 14 ILE F HG21   1  
ATOM 4833   H HG22   . ILE F 1 14 ? 36.930  -3.111  -5.715  1.00 0.00 ? 14 ILE F HG22   1  
ATOM 4834   H HG23   . ILE F 1 14 ? 38.043  -3.925  -4.627  1.00 0.00 ? 14 ILE F HG23   1  
ATOM 4835   H HD11   . ILE F 1 14 ? 37.135  -0.533  -6.621  1.00 0.00 ? 14 ILE F HD11   1  
ATOM 4836   H HD12   . ILE F 1 14 ? 35.651  -1.367  -6.088  1.00 0.00 ? 14 ILE F HD12   1  
ATOM 4837   H HD13   . ILE F 1 14 ? 35.768  0.396   -5.968  1.00 0.00 ? 14 ILE F HD13   1  
ATOM 4838   N N      . GLY F 1 15 ? 39.163  -4.065  -2.196  1.00 0.00 ? 15 GLY F N      1  
ATOM 4839   C CA     . GLY F 1 15 ? 40.080  -5.140  -1.861  1.00 0.00 ? 15 GLY F CA     1  
ATOM 4840   C C      . GLY F 1 15 ? 41.120  -4.671  -0.851  1.00 0.00 ? 15 GLY F C      1  
ATOM 4841   O O      . GLY F 1 15 ? 40.784  -4.022  0.138   1.00 0.00 ? 15 GLY F O      1  
ATOM 4842   H H      . GLY F 1 15 ? 38.214  -4.136  -1.859  1.00 0.00 ? 15 GLY F H      1  
ATOM 4843   H HA2    . GLY F 1 15 ? 39.525  -5.974  -1.432  1.00 0.00 ? 15 GLY F HA2    1  
ATOM 4844   H HA3    . GLY F 1 15 ? 40.581  -5.481  -2.767  1.00 0.00 ? 15 GLY F HA3    1  
ATOM 4845   N N      . ASP F 1 16 ? 42.391  -4.982  -1.120  1.00 0.00 ? 16 ASP F N      1  
ATOM 4846   C CA     . ASP F 1 16 ? 43.520  -4.529  -0.324  1.00 0.00 ? 16 ASP F CA     1  
ATOM 4847   C C      . ASP F 1 16 ? 44.539  -3.759  -1.162  1.00 0.00 ? 16 ASP F C      1  
ATOM 4848   O O      . ASP F 1 16 ? 45.599  -3.396  -0.654  1.00 0.00 ? 16 ASP F O      1  
ATOM 4849   C CB     . ASP F 1 16 ? 44.168  -5.735  0.359   1.00 0.00 ? 16 ASP F CB     1  
ATOM 4850   C CG     . ASP F 1 16 ? 43.226  -6.391  1.365   1.00 0.00 ? 16 ASP F CG     1  
ATOM 4851   O OD1    . ASP F 1 16 ? 43.134  -5.875  2.500   1.00 0.00 ? 16 ASP F OD1    1  
ATOM 4852   O OD2    . ASP F 1 16 ? 42.623  -7.430  1.016   1.00 0.00 ? 16 ASP F OD2    1  
ATOM 4853   H H      . ASP F 1 16 ? 42.587  -5.583  -1.908  1.00 0.00 ? 16 ASP F H      1  
ATOM 4854   H HA     . ASP F 1 16 ? 43.163  -3.854  0.454   1.00 0.00 ? 16 ASP F HA     1  
ATOM 4855   H HB2    . ASP F 1 16 ? 44.460  -6.462  -0.399  1.00 0.00 ? 16 ASP F HB2    1  
ATOM 4856   H HB3    . ASP F 1 16 ? 45.067  -5.411  0.883   1.00 0.00 ? 16 ASP F HB3    1  
ATOM 4857   N N      . ASP F 1 17 ? 44.242  -3.503  -2.440  1.00 0.00 ? 17 ASP F N      1  
ATOM 4858   C CA     . ASP F 1 17 ? 45.214  -2.983  -3.390  1.00 0.00 ? 17 ASP F CA     1  
ATOM 4859   C C      . ASP F 1 17 ? 44.652  -1.946  -4.361  1.00 0.00 ? 17 ASP F C      1  
ATOM 4860   O O      . ASP F 1 17 ? 45.435  -1.223  -4.975  1.00 0.00 ? 17 ASP F O      1  
ATOM 4861   C CB     . ASP F 1 17 ? 45.814  -4.146  -4.180  1.00 0.00 ? 17 ASP F CB     1  
ATOM 4862   C CG     . ASP F 1 17 ? 46.676  -5.056  -3.312  1.00 0.00 ? 17 ASP F CG     1  
ATOM 4863   O OD1    . ASP F 1 17 ? 47.842  -4.685  -3.054  1.00 0.00 ? 17 ASP F OD1    1  
ATOM 4864   O OD2    . ASP F 1 17 ? 46.194  -6.152  -2.949  1.00 0.00 ? 17 ASP F OD2    1  
ATOM 4865   H H      . ASP F 1 17 ? 43.336  -3.779  -2.788  1.00 0.00 ? 17 ASP F H      1  
ATOM 4866   H HA     . ASP F 1 17 ? 46.022  -2.497  -2.842  1.00 0.00 ? 17 ASP F HA     1  
ATOM 4867   H HB2    . ASP F 1 17 ? 45.009  -4.723  -4.637  1.00 0.00 ? 17 ASP F HB2    1  
ATOM 4868   H HB3    . ASP F 1 17 ? 46.436  -3.743  -4.979  1.00 0.00 ? 17 ASP F HB3    1  
ATOM 4869   N N      . ILE F 1 18 ? 43.329  -1.866  -4.541  1.00 0.00 ? 18 ILE F N      1  
ATOM 4870   C CA     . ILE F 1 18 ? 42.726  -1.002  -5.544  1.00 0.00 ? 18 ILE F CA     1  
ATOM 4871   C C      . ILE F 1 18 ? 42.218  0.283   -4.898  1.00 0.00 ? 18 ILE F C      1  
ATOM 4872   O O      . ILE F 1 18 ? 41.396  0.247   -3.984  1.00 0.00 ? 18 ILE F O      1  
ATOM 4873   C CB     . ILE F 1 18 ? 41.599  -1.707  -6.304  1.00 0.00 ? 18 ILE F CB     1  
ATOM 4874   C CG1    . ILE F 1 18 ? 42.064  -3.013  -6.953  1.00 0.00 ? 18 ILE F CG1    1  
ATOM 4875   C CG2    . ILE F 1 18 ? 41.050  -0.785  -7.393  1.00 0.00 ? 18 ILE F CG2    1  
ATOM 4876   C CD1    . ILE F 1 18 ? 41.777  -4.205  -6.042  1.00 0.00 ? 18 ILE F CD1    1  
ATOM 4877   H H      . ILE F 1 18 ? 42.707  -2.410  -3.959  1.00 0.00 ? 18 ILE F H      1  
ATOM 4878   H HA     . ILE F 1 18 ? 43.489  -0.735  -6.273  1.00 0.00 ? 18 ILE F HA     1  
ATOM 4879   H HB     . ILE F 1 18 ? 40.789  -1.926  -5.610  1.00 0.00 ? 18 ILE F HB     1  
ATOM 4880   H HG12   . ILE F 1 18 ? 41.532  -3.169  -7.891  1.00 0.00 ? 18 ILE F HG12   1  
ATOM 4881   H HG13   . ILE F 1 18 ? 43.132  -2.963  -7.165  1.00 0.00 ? 18 ILE F HG13   1  
ATOM 4882   H HG21   . ILE F 1 18 ? 40.267  -1.302  -7.947  1.00 0.00 ? 18 ILE F HG21   1  
ATOM 4883   H HG22   . ILE F 1 18 ? 40.616  0.110   -6.948  1.00 0.00 ? 18 ILE F HG22   1  
ATOM 4884   H HG23   . ILE F 1 18 ? 41.848  -0.499  -8.079  1.00 0.00 ? 18 ILE F HG23   1  
ATOM 4885   H HD11   . ILE F 1 18 ? 40.721  -4.203  -5.770  1.00 0.00 ? 18 ILE F HD11   1  
ATOM 4886   H HD12   . ILE F 1 18 ? 42.017  -5.128  -6.568  1.00 0.00 ? 18 ILE F HD12   1  
ATOM 4887   H HD13   . ILE F 1 18 ? 42.382  -4.137  -5.138  1.00 0.00 ? 18 ILE F HD13   1  
ATOM 4888   N N      . THR F 1 19 ? 42.634  1.422   -5.449  1.00 0.00 ? 19 THR F N      1  
ATOM 4889   C CA     . THR F 1 19 ? 42.216  2.738   -4.990  1.00 0.00 ? 19 THR F CA     1  
ATOM 4890   C C      . THR F 1 19 ? 41.476  3.470   -6.104  1.00 0.00 ? 19 THR F C      1  
ATOM 4891   O O      . THR F 1 19 ? 41.890  3.438   -7.261  1.00 0.00 ? 19 THR F O      1  
ATOM 4892   C CB     . THR F 1 19 ? 43.416  3.548   -4.499  1.00 0.00 ? 19 THR F CB     1  
ATOM 4893   O OG1    . THR F 1 19 ? 44.140  2.812   -3.537  1.00 0.00 ? 19 THR F OG1    1  
ATOM 4894   C CG2    . THR F 1 19 ? 42.977  4.858   -3.846  1.00 0.00 ? 19 THR F CG2    1  
ATOM 4895   H H      . THR F 1 19 ? 43.245  1.364   -6.253  1.00 0.00 ? 19 THR F H      1  
ATOM 4896   H HA     . THR F 1 19 ? 41.530  2.623   -4.152  1.00 0.00 ? 19 THR F HA     1  
ATOM 4897   H HB     . THR F 1 19 ? 44.068  3.772   -5.342  1.00 0.00 ? 19 THR F HB     1  
ATOM 4898   H HG1    . THR F 1 19 ? 44.986  3.252   -3.400  1.00 0.00 ? 19 THR F HG1    1  
ATOM 4899   H HG21   . THR F 1 19 ? 43.844  5.361   -3.419  1.00 0.00 ? 19 THR F HG21   1  
ATOM 4900   H HG22   . THR F 1 19 ? 42.525  5.512   -4.592  1.00 0.00 ? 19 THR F HG22   1  
ATOM 4901   H HG23   . THR F 1 19 ? 42.254  4.654   -3.056  1.00 0.00 ? 19 THR F HG23   1  
ATOM 4902   N N      . ILE F 1 20 ? 40.378  4.137   -5.742  1.00 0.00 ? 20 ILE F N      1  
ATOM 4903   C CA     . ILE F 1 20 ? 39.564  4.950   -6.631  1.00 0.00 ? 20 ILE F CA     1  
ATOM 4904   C C      . ILE F 1 20 ? 39.611  6.392   -6.142  1.00 0.00 ? 20 ILE F C      1  
ATOM 4905   O O      . ILE F 1 20 ? 39.585  6.640   -4.937  1.00 0.00 ? 20 ILE F O      1  
ATOM 4906   C CB     . ILE F 1 20 ? 38.119  4.442   -6.651  1.00 0.00 ? 20 ILE F CB     1  
ATOM 4907   C CG1    . ILE F 1 20 ? 38.016  2.941   -6.933  1.00 0.00 ? 20 ILE F CG1    1  
ATOM 4908   C CG2    . ILE F 1 20 ? 37.272  5.228   -7.653  1.00 0.00 ? 20 ILE F CG2    1  
ATOM 4909   C CD1    . ILE F 1 20 ? 38.417  2.554   -8.355  1.00 0.00 ? 20 ILE F CD1    1  
ATOM 4910   H H      . ILE F 1 20 ? 40.120  4.134   -4.765  1.00 0.00 ? 20 ILE F H      1  
ATOM 4911   H HA     . ILE F 1 20 ? 39.971  4.911   -7.641  1.00 0.00 ? 20 ILE F HA     1  
ATOM 4912   H HB     . ILE F 1 20 ? 37.699  4.608   -5.660  1.00 0.00 ? 20 ILE F HB     1  
ATOM 4913   H HG12   . ILE F 1 20 ? 38.655  2.404   -6.234  1.00 0.00 ? 20 ILE F HG12   1  
ATOM 4914   H HG13   . ILE F 1 20 ? 36.989  2.619   -6.760  1.00 0.00 ? 20 ILE F HG13   1  
ATOM 4915   H HG21   . ILE F 1 20 ? 37.763  5.251   -8.625  1.00 0.00 ? 20 ILE F HG21   1  
ATOM 4916   H HG22   . ILE F 1 20 ? 36.293  4.757   -7.754  1.00 0.00 ? 20 ILE F HG22   1  
ATOM 4917   H HG23   . ILE F 1 20 ? 37.128  6.248   -7.298  1.00 0.00 ? 20 ILE F HG23   1  
ATOM 4918   H HD11   . ILE F 1 20 ? 38.512  1.470   -8.417  1.00 0.00 ? 20 ILE F HD11   1  
ATOM 4919   H HD12   . ILE F 1 20 ? 37.655  2.885   -9.061  1.00 0.00 ? 20 ILE F HD12   1  
ATOM 4920   H HD13   . ILE F 1 20 ? 39.373  3.011   -8.609  1.00 0.00 ? 20 ILE F HD13   1  
ATOM 4921   N N      . THR F 1 21 ? 39.630  7.344   -7.077  1.00 0.00 ? 21 THR F N      1  
ATOM 4922   C CA     . THR F 1 21 ? 39.608  8.766   -6.774  1.00 0.00 ? 21 THR F CA     1  
ATOM 4923   C C      . THR F 1 21 ? 38.669  9.485   -7.734  1.00 0.00 ? 21 THR F C      1  
ATOM 4924   O O      . THR F 1 21 ? 38.768  9.315   -8.947  1.00 0.00 ? 21 THR F O      1  
ATOM 4925   C CB     . THR F 1 21 ? 41.014  9.359   -6.865  1.00 0.00 ? 21 THR F CB     1  
ATOM 4926   O OG1    . THR F 1 21 ? 41.915  8.625   -6.065  1.00 0.00 ? 21 THR F OG1    1  
ATOM 4927   C CG2    . THR F 1 21 ? 41.046  10.808  -6.384  1.00 0.00 ? 21 THR F CG2    1  
ATOM 4928   H H      . THR F 1 21 ? 39.656  7.057   -8.046  1.00 0.00 ? 21 THR F H      1  
ATOM 4929   H HA     . THR F 1 21 ? 39.239  8.913   -5.759  1.00 0.00 ? 21 THR F HA     1  
ATOM 4930   H HB     . THR F 1 21 ? 41.352  9.320   -7.901  1.00 0.00 ? 21 THR F HB     1  
ATOM 4931   H HG1    . THR F 1 21 ? 41.645  8.735   -5.147  1.00 0.00 ? 21 THR F HG1    1  
ATOM 4932   H HG21   . THR F 1 21 ? 40.718  10.862  -5.345  1.00 0.00 ? 21 THR F HG21   1  
ATOM 4933   H HG22   . THR F 1 21 ? 42.063  11.193  -6.460  1.00 0.00 ? 21 THR F HG22   1  
ATOM 4934   H HG23   . THR F 1 21 ? 40.388  11.423  -6.997  1.00 0.00 ? 21 THR F HG23   1  
ATOM 4935   N N      . ILE F 1 22 ? 37.779  10.325  -7.197  1.00 0.00 ? 22 ILE F N      1  
ATOM 4936   C CA     . ILE F 1 22 ? 36.981  11.234  -8.002  1.00 0.00 ? 22 ILE F CA     1  
ATOM 4937   C C      . ILE F 1 22 ? 37.798  12.495  -8.261  1.00 0.00 ? 22 ILE F C      1  
ATOM 4938   O O      . ILE F 1 22 ? 38.097  13.256  -7.343  1.00 0.00 ? 22 ILE F O      1  
ATOM 4939   C CB     . ILE F 1 22 ? 35.620  11.486  -7.344  1.00 0.00 ? 22 ILE F CB     1  
ATOM 4940   C CG1    . ILE F 1 22 ? 34.852  12.658  -7.958  1.00 0.00 ? 22 ILE F CG1    1  
ATOM 4941   C CG2    . ILE F 1 22 ? 35.721  11.753  -5.843  1.00 0.00 ? 22 ILE F CG2    1  
ATOM 4942   C CD1    . ILE F 1 22 ? 34.603  12.468  -9.449  1.00 0.00 ? 22 ILE F CD1    1  
ATOM 4943   H H      . ILE F 1 22 ? 37.782  10.471  -6.197  1.00 0.00 ? 22 ILE F H      1  
ATOM 4944   H HA     . ILE F 1 22 ? 36.786  10.759  -8.965  1.00 0.00 ? 22 ILE F HA     1  
ATOM 4945   H HB     . ILE F 1 22 ? 35.017  10.587  -7.474  1.00 0.00 ? 22 ILE F HB     1  
ATOM 4946   H HG12   . ILE F 1 22 ? 33.891  12.753  -7.452  1.00 0.00 ? 22 ILE F HG12   1  
ATOM 4947   H HG13   . ILE F 1 22 ? 35.416  13.579  -7.824  1.00 0.00 ? 22 ILE F HG13   1  
ATOM 4948   H HG21   . ILE F 1 22 ? 36.065  10.856  -5.331  1.00 0.00 ? 22 ILE F HG21   1  
ATOM 4949   H HG22   . ILE F 1 22 ? 36.411  12.576  -5.657  1.00 0.00 ? 22 ILE F HG22   1  
ATOM 4950   H HG23   . ILE F 1 22 ? 34.736  12.016  -5.456  1.00 0.00 ? 22 ILE F HG23   1  
ATOM 4951   H HD11   . ILE F 1 22 ? 34.063  11.535  -9.616  1.00 0.00 ? 22 ILE F HD11   1  
ATOM 4952   H HD12   . ILE F 1 22 ? 34.018  13.311  -9.815  1.00 0.00 ? 22 ILE F HD12   1  
ATOM 4953   H HD13   . ILE F 1 22 ? 35.555  12.445  -9.977  1.00 0.00 ? 22 ILE F HD13   1  
ATOM 4954   N N      . LEU F 1 23 ? 38.214  12.695  -9.514  1.00 0.00 ? 23 LEU F N      1  
ATOM 4955   C CA     . LEU F 1 23 ? 39.134  13.755  -9.892  1.00 0.00 ? 23 LEU F CA     1  
ATOM 4956   C C      . LEU F 1 23 ? 38.395  15.077  -10.078 1.00 0.00 ? 23 LEU F C      1  
ATOM 4957   O O      . LEU F 1 23 ? 38.968  16.141  -9.852  1.00 0.00 ? 23 LEU F O      1  
ATOM 4958   C CB     . LEU F 1 23 ? 39.891  13.361  -11.162 1.00 0.00 ? 23 LEU F CB     1  
ATOM 4959   C CG     . LEU F 1 23 ? 40.459  11.940  -11.137 1.00 0.00 ? 23 LEU F CG     1  
ATOM 4960   C CD1    . LEU F 1 23 ? 41.102  11.611  -12.482 1.00 0.00 ? 23 LEU F CD1    1  
ATOM 4961   C CD2    . LEU F 1 23 ? 41.520  11.761  -10.056 1.00 0.00 ? 23 LEU F CD2    1  
ATOM 4962   H H      . LEU F 1 23 ? 37.881  12.082  -10.245 1.00 0.00 ? 23 LEU F H      1  
ATOM 4963   H HA     . LEU F 1 23 ? 39.860  13.890  -9.089  1.00 0.00 ? 23 LEU F HA     1  
ATOM 4964   H HB2    . LEU F 1 23 ? 39.216  13.446  -12.013 1.00 0.00 ? 23 LEU F HB2    1  
ATOM 4965   H HB3    . LEU F 1 23 ? 40.709  14.066  -11.314 1.00 0.00 ? 23 LEU F HB3    1  
ATOM 4966   H HG     . LEU F 1 23 ? 39.656  11.225  -10.964 1.00 0.00 ? 23 LEU F HG     1  
ATOM 4967   H HD11   . LEU F 1 23 ? 40.336  11.601  -13.257 1.00 0.00 ? 23 LEU F HD11   1  
ATOM 4968   H HD12   . LEU F 1 23 ? 41.863  12.353  -12.725 1.00 0.00 ? 23 LEU F HD12   1  
ATOM 4969   H HD13   . LEU F 1 23 ? 41.558  10.624  -12.431 1.00 0.00 ? 23 LEU F HD13   1  
ATOM 4970   H HD21   . LEU F 1 23 ? 41.904  10.741  -10.096 1.00 0.00 ? 23 LEU F HD21   1  
ATOM 4971   H HD22   . LEU F 1 23 ? 42.338  12.462  -10.222 1.00 0.00 ? 23 LEU F HD22   1  
ATOM 4972   H HD23   . LEU F 1 23 ? 41.077  11.939  -9.078  1.00 0.00 ? 23 LEU F HD23   1  
ATOM 4973   N N      . GLY F 1 24 ? 37.115  15.014  -10.453 1.00 0.00 ? 24 GLY F N      1  
ATOM 4974   C CA     . GLY F 1 24 ? 36.220  16.159  -10.464 1.00 0.00 ? 24 GLY F CA     1  
ATOM 4975   C C      . GLY F 1 24 ? 35.054  15.991  -11.430 1.00 0.00 ? 24 GLY F C      1  
ATOM 4976   O O      . GLY F 1 24 ? 34.896  14.936  -12.042 1.00 0.00 ? 24 GLY F O      1  
ATOM 4977   H H      . GLY F 1 24 ? 36.716  14.103  -10.645 1.00 0.00 ? 24 GLY F H      1  
ATOM 4978   H HA2    . GLY F 1 24 ? 35.809  16.273  -9.464  1.00 0.00 ? 24 GLY F HA2    1  
ATOM 4979   H HA3    . GLY F 1 24 ? 36.765  17.072  -10.705 1.00 0.00 ? 24 GLY F HA3    1  
ATOM 4980   N N      . VAL F 1 25 ? 34.215  17.024  -11.552 1.00 0.00 ? 25 VAL F N      1  
ATOM 4981   C CA     . VAL F 1 25 ? 33.048  17.008  -12.423 1.00 0.00 ? 25 VAL F CA     1  
ATOM 4982   C C      . VAL F 1 25 ? 33.197  18.002  -13.570 1.00 0.00 ? 25 VAL F C      1  
ATOM 4983   O O      . VAL F 1 25 ? 33.781  19.072  -13.404 1.00 0.00 ? 25 VAL F O      1  
ATOM 4984   C CB     . VAL F 1 25 ? 31.753  17.258  -11.642 1.00 0.00 ? 25 VAL F CB     1  
ATOM 4985   C CG1    . VAL F 1 25 ? 31.649  16.342  -10.423 1.00 0.00 ? 25 VAL F CG1    1  
ATOM 4986   C CG2    . VAL F 1 25 ? 31.593  18.712  -11.199 1.00 0.00 ? 25 VAL F CG2    1  
ATOM 4987   H H      . VAL F 1 25 ? 34.394  17.865  -11.023 1.00 0.00 ? 25 VAL F H      1  
ATOM 4988   H HA     . VAL F 1 25 ? 32.960  16.017  -12.866 1.00 0.00 ? 25 VAL F HA     1  
ATOM 4989   H HB     . VAL F 1 25 ? 30.915  17.029  -12.299 1.00 0.00 ? 25 VAL F HB     1  
ATOM 4990   H HG11   . VAL F 1 25 ? 30.653  16.426  -9.989  1.00 0.00 ? 25 VAL F HG11   1  
ATOM 4991   H HG12   . VAL F 1 25 ? 31.821  15.308  -10.722 1.00 0.00 ? 25 VAL F HG12   1  
ATOM 4992   H HG13   . VAL F 1 25 ? 32.385  16.628  -9.672  1.00 0.00 ? 25 VAL F HG13   1  
ATOM 4993   H HG21   . VAL F 1 25 ? 31.442  19.345  -12.075 1.00 0.00 ? 25 VAL F HG21   1  
ATOM 4994   H HG22   . VAL F 1 25 ? 30.716  18.802  -10.558 1.00 0.00 ? 25 VAL F HG22   1  
ATOM 4995   H HG23   . VAL F 1 25 ? 32.477  19.041  -10.653 1.00 0.00 ? 25 VAL F HG23   1  
ATOM 4996   N N      . SER F 1 26 ? 32.618  17.658  -14.722 1.00 0.00 ? 26 SER F N      1  
ATOM 4997   C CA     . SER F 1 26 ? 32.447  18.551  -15.857 1.00 0.00 ? 26 SER F CA     1  
ATOM 4998   C C      . SER F 1 26 ? 31.049  18.343  -16.425 1.00 0.00 ? 26 SER F C      1  
ATOM 4999   O O      . SER F 1 26 ? 30.844  17.524  -17.321 1.00 0.00 ? 26 SER F O      1  
ATOM 5000   C CB     . SER F 1 26 ? 33.500  18.246  -16.922 1.00 0.00 ? 26 SER F CB     1  
ATOM 5001   O OG     . SER F 1 26 ? 34.803  18.497  -16.439 1.00 0.00 ? 26 SER F OG     1  
ATOM 5002   H H      . SER F 1 26 ? 32.193  16.744  -14.795 1.00 0.00 ? 26 SER F H      1  
ATOM 5003   H HA     . SER F 1 26 ? 32.553  19.588  -15.539 1.00 0.00 ? 26 SER F HA     1  
ATOM 5004   H HB2    . SER F 1 26 ? 33.424  17.198  -17.216 1.00 0.00 ? 26 SER F HB2    1  
ATOM 5005   H HB3    . SER F 1 26 ? 33.315  18.871  -17.796 1.00 0.00 ? 26 SER F HB3    1  
ATOM 5006   H HG     . SER F 1 26 ? 35.430  18.226  -17.116 1.00 0.00 ? 26 SER F HG     1  
ATOM 5007   N N      . GLY F 1 27 ? 30.075  19.104  -15.918 1.00 0.00 ? 27 GLY F N      1  
ATOM 5008   C CA     . GLY F 1 27 ? 28.672  18.895  -16.230 1.00 0.00 ? 27 GLY F CA     1  
ATOM 5009   C C      . GLY F 1 27 ? 28.229  17.465  -15.934 1.00 0.00 ? 27 GLY F C      1  
ATOM 5010   O O      . GLY F 1 27 ? 28.306  17.014  -14.792 1.00 0.00 ? 27 GLY F O      1  
ATOM 5011   H H      . GLY F 1 27 ? 30.305  19.777  -15.200 1.00 0.00 ? 27 GLY F H      1  
ATOM 5012   H HA2    . GLY F 1 27 ? 28.064  19.579  -15.637 1.00 0.00 ? 27 GLY F HA2    1  
ATOM 5013   H HA3    . GLY F 1 27 ? 28.510  19.116  -17.283 1.00 0.00 ? 27 GLY F HA3    1  
ATOM 5014   N N      . GLN F 1 28 ? 27.774  16.748  -16.966 1.00 0.00 ? 28 GLN F N      1  
ATOM 5015   C CA     . GLN F 1 28 ? 27.330  15.367  -16.855 1.00 0.00 ? 28 GLN F CA     1  
ATOM 5016   C C      . GLN F 1 28 ? 28.484  14.374  -16.937 1.00 0.00 ? 28 GLN F C      1  
ATOM 5017   O O      . GLN F 1 28 ? 28.317  13.220  -16.546 1.00 0.00 ? 28 GLN F O      1  
ATOM 5018   C CB     . GLN F 1 28 ? 26.304  15.063  -17.949 1.00 0.00 ? 28 GLN F CB     1  
ATOM 5019   C CG     . GLN F 1 28 ? 24.865  15.385  -17.540 1.00 0.00 ? 28 GLN F CG     1  
ATOM 5020   C CD     . GLN F 1 28 ? 24.734  16.654  -16.703 1.00 0.00 ? 28 GLN F CD     1  
ATOM 5021   O OE1    . GLN F 1 28 ? 24.765  17.767  -17.222 1.00 0.00 ? 28 GLN F OE1    1  
ATOM 5022   N NE2    . GLN F 1 28 ? 24.617  16.510  -15.384 1.00 0.00 ? 28 GLN F NE2    1  
ATOM 5023   H H      . GLN F 1 28 ? 27.748  17.178  -17.879 1.00 0.00 ? 28 GLN F H      1  
ATOM 5024   H HA     . GLN F 1 28 ? 26.860  15.220  -15.883 1.00 0.00 ? 28 GLN F HA     1  
ATOM 5025   H HB2    . GLN F 1 28 ? 26.568  15.605  -18.857 1.00 0.00 ? 28 GLN F HB2    1  
ATOM 5026   H HB3    . GLN F 1 28 ? 26.345  14.000  -18.185 1.00 0.00 ? 28 GLN F HB3    1  
ATOM 5027   H HG2    . GLN F 1 28 ? 24.259  15.484  -18.441 1.00 0.00 ? 28 GLN F HG2    1  
ATOM 5028   H HG3    . GLN F 1 28 ? 24.476  14.543  -16.968 1.00 0.00 ? 28 GLN F HG3    1  
ATOM 5029   H HE21   . GLN F 1 28 ? 24.566  15.587  -14.979 1.00 0.00 ? 28 GLN F HE21   1  
ATOM 5030   H HE22   . GLN F 1 28 ? 24.622  17.324  -14.787 1.00 0.00 ? 28 GLN F HE22   1  
ATOM 5031   N N      . GLN F 1 29 ? 29.646  14.791  -17.447 1.00 0.00 ? 29 GLN F N      1  
ATOM 5032   C CA     . GLN F 1 29 ? 30.847  13.976  -17.398 1.00 0.00 ? 29 GLN F CA     1  
ATOM 5033   C C      . GLN F 1 29 ? 31.532  14.130  -16.045 1.00 0.00 ? 29 GLN F C      1  
ATOM 5034   O O      . GLN F 1 29 ? 31.508  15.195  -15.432 1.00 0.00 ? 29 GLN F O      1  
ATOM 5035   C CB     . GLN F 1 29 ? 31.777  14.331  -18.560 1.00 0.00 ? 29 GLN F CB     1  
ATOM 5036   C CG     . GLN F 1 29 ? 32.176  13.076  -19.337 1.00 0.00 ? 29 GLN F CG     1  
ATOM 5037   C CD     . GLN F 1 29 ? 32.880  13.421  -20.642 1.00 0.00 ? 29 GLN F CD     1  
ATOM 5038   O OE1    . GLN F 1 29 ? 33.877  14.137  -20.665 1.00 0.00 ? 29 GLN F OE1    1  
ATOM 5039   N NE2    . GLN F 1 29 ? 32.359  12.933  -21.767 1.00 0.00 ? 29 GLN F NE2    1  
ATOM 5040   H H      . GLN F 1 29 ? 29.748  15.759  -17.716 1.00 0.00 ? 29 GLN F H      1  
ATOM 5041   H HA     . GLN F 1 29 ? 30.555  12.932  -17.500 1.00 0.00 ? 29 GLN F HA     1  
ATOM 5042   H HB2    . GLN F 1 29 ? 31.269  15.007  -19.245 1.00 0.00 ? 29 GLN F HB2    1  
ATOM 5043   H HB3    . GLN F 1 29 ? 32.669  14.830  -18.181 1.00 0.00 ? 29 GLN F HB3    1  
ATOM 5044   H HG2    . GLN F 1 29 ? 32.825  12.452  -18.724 1.00 0.00 ? 29 GLN F HG2    1  
ATOM 5045   H HG3    . GLN F 1 29 ? 31.281  12.498  -19.563 1.00 0.00 ? 29 GLN F HG3    1  
ATOM 5046   H HE21   . GLN F 1 29 ? 31.542  12.342  -21.731 1.00 0.00 ? 29 GLN F HE21   1  
ATOM 5047   H HE22   . GLN F 1 29 ? 32.788  13.160  -22.651 1.00 0.00 ? 29 GLN F HE22   1  
ATOM 5048   N N      . VAL F 1 30 ? 32.150  13.045  -15.576 1.00 0.00 ? 30 VAL F N      1  
ATOM 5049   C CA     . VAL F 1 30 ? 32.797  12.968  -14.280 1.00 0.00 ? 30 VAL F CA     1  
ATOM 5050   C C      . VAL F 1 30 ? 34.176  12.362  -14.493 1.00 0.00 ? 30 VAL F C      1  
ATOM 5051   O O      . VAL F 1 30 ? 34.295  11.286  -15.076 1.00 0.00 ? 30 VAL F O      1  
ATOM 5052   C CB     . VAL F 1 30 ? 31.955  12.114  -13.330 1.00 0.00 ? 30 VAL F CB     1  
ATOM 5053   C CG1    . VAL F 1 30 ? 32.590  12.080  -11.944 1.00 0.00 ? 30 VAL F CG1    1  
ATOM 5054   C CG2    . VAL F 1 30 ? 30.546  12.684  -13.174 1.00 0.00 ? 30 VAL F CG2    1  
ATOM 5055   H H      . VAL F 1 30 ? 32.062  12.176  -16.083 1.00 0.00 ? 30 VAL F H      1  
ATOM 5056   H HA     . VAL F 1 30 ? 32.909  13.966  -13.855 1.00 0.00 ? 30 VAL F HA     1  
ATOM 5057   H HB     . VAL F 1 30 ? 31.888  11.096  -13.714 1.00 0.00 ? 30 VAL F HB     1  
ATOM 5058   H HG11   . VAL F 1 30 ? 33.617  11.723  -12.011 1.00 0.00 ? 30 VAL F HG11   1  
ATOM 5059   H HG12   . VAL F 1 30 ? 32.579  13.082  -11.515 1.00 0.00 ? 30 VAL F HG12   1  
ATOM 5060   H HG13   . VAL F 1 30 ? 32.024  11.405  -11.304 1.00 0.00 ? 30 VAL F HG13   1  
ATOM 5061   H HG21   . VAL F 1 30 ? 30.008  12.122  -12.411 1.00 0.00 ? 30 VAL F HG21   1  
ATOM 5062   H HG22   . VAL F 1 30 ? 30.606  13.732  -12.878 1.00 0.00 ? 30 VAL F HG22   1  
ATOM 5063   H HG23   . VAL F 1 30 ? 30.003  12.602  -14.115 1.00 0.00 ? 30 VAL F HG23   1  
ATOM 5064   N N      . ARG F 1 31 ? 35.226  13.074  -14.079 1.00 0.00 ? 31 ARG F N      1  
ATOM 5065   C CA     . ARG F 1 31 ? 36.599  12.645  -14.278 1.00 0.00 ? 31 ARG F CA     1  
ATOM 5066   C C      . ARG F 1 31 ? 37.022  11.766  -13.108 1.00 0.00 ? 31 ARG F C      1  
ATOM 5067   O O      . ARG F 1 31 ? 36.955  12.195  -11.957 1.00 0.00 ? 31 ARG F O      1  
ATOM 5068   C CB     . ARG F 1 31 ? 37.482  13.876  -14.478 1.00 0.00 ? 31 ARG F CB     1  
ATOM 5069   C CG     . ARG F 1 31 ? 38.739  13.514  -15.271 1.00 0.00 ? 31 ARG F CG     1  
ATOM 5070   C CD     . ARG F 1 31 ? 39.611  14.745  -15.511 1.00 0.00 ? 31 ARG F CD     1  
ATOM 5071   N NE     . ARG F 1 31 ? 39.035  15.625  -16.533 1.00 0.00 ? 31 ARG F NE     1  
ATOM 5072   C CZ     . ARG F 1 31 ? 38.509  16.838  -16.328 1.00 0.00 ? 31 ARG F CZ     1  
ATOM 5073   N NH1    . ARG F 1 31 ? 38.383  17.351  -15.105 1.00 0.00 ? 31 ARG F NH1    1  
ATOM 5074   N NH2    . ARG F 1 31 ? 38.096  17.565  -17.364 1.00 0.00 ? 31 ARG F NH2    1  
ATOM 5075   H H      . ARG F 1 31 ? 35.066  13.912  -13.535 1.00 0.00 ? 31 ARG F H      1  
ATOM 5076   H HA     . ARG F 1 31 ? 36.643  12.044  -15.185 1.00 0.00 ? 31 ARG F HA     1  
ATOM 5077   H HB2    . ARG F 1 31 ? 36.923  14.626  -15.038 1.00 0.00 ? 31 ARG F HB2    1  
ATOM 5078   H HB3    . ARG F 1 31 ? 37.756  14.299  -13.512 1.00 0.00 ? 31 ARG F HB3    1  
ATOM 5079   H HG2    . ARG F 1 31 ? 39.314  12.776  -14.714 1.00 0.00 ? 31 ARG F HG2    1  
ATOM 5080   H HG3    . ARG F 1 31 ? 38.455  13.083  -16.231 1.00 0.00 ? 31 ARG F HG3    1  
ATOM 5081   H HD2    . ARG F 1 31 ? 39.743  15.276  -14.569 1.00 0.00 ? 31 ARG F HD2    1  
ATOM 5082   H HD3    . ARG F 1 31 ? 40.591  14.412  -15.853 1.00 0.00 ? 31 ARG F HD3    1  
ATOM 5083   H HE     . ARG F 1 31 ? 39.080  15.298  -17.487 1.00 0.00 ? 31 ARG F HE     1  
ATOM 5084   H HH11   . ARG F 1 31 ? 38.707  16.830  -14.304 1.00 0.00 ? 31 ARG F HH11   1  
ATOM 5085   H HH12   . ARG F 1 31 ? 37.952  18.255  -14.978 1.00 0.00 ? 31 ARG F HH12   1  
ATOM 5086   H HH21   . ARG F 1 31 ? 38.192  17.208  -18.304 1.00 0.00 ? 31 ARG F HH21   1  
ATOM 5087   H HH22   . ARG F 1 31 ? 37.761  18.506  -17.219 1.00 0.00 ? 31 ARG F HH22   1  
ATOM 5088   N N      . ILE F 1 32 ? 37.412  10.523  -13.396 1.00 0.00 ? 32 ILE F N      1  
ATOM 5089   C CA     . ILE F 1 32 ? 37.626  9.482   -12.400 1.00 0.00 ? 32 ILE F CA     1  
ATOM 5090   C C      . ILE F 1 32 ? 38.984  8.822   -12.613 1.00 0.00 ? 32 ILE F C      1  
ATOM 5091   O O      . ILE F 1 32 ? 39.409  8.625   -13.749 1.00 0.00 ? 32 ILE F O      1  
ATOM 5092   C CB     . ILE F 1 32 ? 36.504  8.436   -12.437 1.00 0.00 ? 32 ILE F CB     1  
ATOM 5093   C CG1    . ILE F 1 32 ? 35.132  9.075   -12.674 1.00 0.00 ? 32 ILE F CG1    1  
ATOM 5094   C CG2    . ILE F 1 32 ? 36.511  7.640   -11.130 1.00 0.00 ? 32 ILE F CG2    1  
ATOM 5095   C CD1    . ILE F 1 32 ? 33.955  8.111   -12.534 1.00 0.00 ? 32 ILE F CD1    1  
ATOM 5096   H H      . ILE F 1 32 ? 37.530  10.280  -14.370 1.00 0.00 ? 32 ILE F H      1  
ATOM 5097   H HA     . ILE F 1 32 ? 37.625  9.940   -11.411 1.00 0.00 ? 32 ILE F HA     1  
ATOM 5098   H HB     . ILE F 1 32 ? 36.700  7.747   -13.259 1.00 0.00 ? 32 ILE F HB     1  
ATOM 5099   H HG12   . ILE F 1 32 ? 34.989  9.906   -11.983 1.00 0.00 ? 32 ILE F HG12   1  
ATOM 5100   H HG13   . ILE F 1 32 ? 35.111  9.464   -13.691 1.00 0.00 ? 32 ILE F HG13   1  
ATOM 5101   H HG21   . ILE F 1 32 ? 37.492  7.201   -10.955 1.00 0.00 ? 32 ILE F HG21   1  
ATOM 5102   H HG22   . ILE F 1 32 ? 36.255  8.292   -10.295 1.00 0.00 ? 32 ILE F HG22   1  
ATOM 5103   H HG23   . ILE F 1 32 ? 35.792  6.823   -11.184 1.00 0.00 ? 32 ILE F HG23   1  
ATOM 5104   H HD11   . ILE F 1 32 ? 34.143  7.210   -13.117 1.00 0.00 ? 32 ILE F HD11   1  
ATOM 5105   H HD12   . ILE F 1 32 ? 33.806  7.851   -11.487 1.00 0.00 ? 32 ILE F HD12   1  
ATOM 5106   H HD13   . ILE F 1 32 ? 33.050  8.595   -12.905 1.00 0.00 ? 32 ILE F HD13   1  
ATOM 5107   N N      . GLY F 1 33 ? 39.662  8.466   -11.518 1.00 0.00 ? 33 GLY F N      1  
ATOM 5108   C CA     . GLY F 1 33 ? 40.944  7.785   -11.538 1.00 0.00 ? 33 GLY F CA     1  
ATOM 5109   C C      . GLY F 1 33 ? 40.894  6.458   -10.788 1.00 0.00 ? 33 GLY F C      1  
ATOM 5110   O O      . GLY F 1 33 ? 40.250  6.352   -9.745  1.00 0.00 ? 33 GLY F O      1  
ATOM 5111   H H      . GLY F 1 33 ? 39.254  8.656   -10.612 1.00 0.00 ? 33 GLY F H      1  
ATOM 5112   H HA2    . GLY F 1 33 ? 41.246  7.593   -12.567 1.00 0.00 ? 33 GLY F HA2    1  
ATOM 5113   H HA3    . GLY F 1 33 ? 41.689  8.427   -11.071 1.00 0.00 ? 33 GLY F HA3    1  
ATOM 5114   N N      . ILE F 1 34 ? 41.588  5.450   -11.323 1.00 0.00 ? 34 ILE F N      1  
ATOM 5115   C CA     . ILE F 1 34 ? 41.639  4.099   -10.787 1.00 0.00 ? 34 ILE F CA     1  
ATOM 5116   C C      . ILE F 1 34 ? 43.089  3.637   -10.731 1.00 0.00 ? 34 ILE F C      1  
ATOM 5117   O O      . ILE F 1 34 ? 43.817  3.730   -11.718 1.00 0.00 ? 34 ILE F O      1  
ATOM 5118   C CB     . ILE F 1 34 ? 40.840  3.135   -11.669 1.00 0.00 ? 34 ILE F CB     1  
ATOM 5119   C CG1    . ILE F 1 34 ? 39.402  3.594   -11.927 1.00 0.00 ? 34 ILE F CG1    1  
ATOM 5120   C CG2    . ILE F 1 34 ? 40.829  1.735   -11.054 1.00 0.00 ? 34 ILE F CG2    1  
ATOM 5121   C CD1    . ILE F 1 34 ? 39.047  3.353   -13.392 1.00 0.00 ? 34 ILE F CD1    1  
ATOM 5122   H H      . ILE F 1 34 ? 42.078  5.615   -12.192 1.00 0.00 ? 34 ILE F H      1  
ATOM 5123   H HA     . ILE F 1 34 ? 41.234  4.088   -9.775  1.00 0.00 ? 34 ILE F HA     1  
ATOM 5124   H HB     . ILE F 1 34 ? 41.362  3.065   -12.624 1.00 0.00 ? 34 ILE F HB     1  
ATOM 5125   H HG12   . ILE F 1 34 ? 38.708  3.048   -11.288 1.00 0.00 ? 34 ILE F HG12   1  
ATOM 5126   H HG13   . ILE F 1 34 ? 39.282  4.657   -11.724 1.00 0.00 ? 34 ILE F HG13   1  
ATOM 5127   H HG21   . ILE F 1 34 ? 40.079  1.118   -11.549 1.00 0.00 ? 34 ILE F HG21   1  
ATOM 5128   H HG22   . ILE F 1 34 ? 41.805  1.266   -11.180 1.00 0.00 ? 34 ILE F HG22   1  
ATOM 5129   H HG23   . ILE F 1 34 ? 40.594  1.789   -9.991  1.00 0.00 ? 34 ILE F HG23   1  
ATOM 5130   H HD11   . ILE F 1 34 ? 39.001  2.283   -13.589 1.00 0.00 ? 34 ILE F HD11   1  
ATOM 5131   H HD12   . ILE F 1 34 ? 38.081  3.808   -13.609 1.00 0.00 ? 34 ILE F HD12   1  
ATOM 5132   H HD13   . ILE F 1 34 ? 39.810  3.811   -14.023 1.00 0.00 ? 34 ILE F HD13   1  
ATOM 5133   N N      . ASN F 1 35 ? 43.487  3.090   -9.582  1.00 0.00 ? 35 ASN F N      1  
ATOM 5134   C CA     . ASN F 1 35 ? 44.842  2.642   -9.321  1.00 0.00 ? 35 ASN F CA     1  
ATOM 5135   C C      . ASN F 1 35 ? 44.807  1.199   -8.830  1.00 0.00 ? 35 ASN F C      1  
ATOM 5136   O O      . ASN F 1 35 ? 44.380  0.938   -7.707  1.00 0.00 ? 35 ASN F O      1  
ATOM 5137   C CB     . ASN F 1 35 ? 45.451  3.590   -8.290  1.00 0.00 ? 35 ASN F CB     1  
ATOM 5138   C CG     . ASN F 1 35 ? 46.939  3.358   -8.063  1.00 0.00 ? 35 ASN F CG     1  
ATOM 5139   O OD1    . ASN F 1 35 ? 47.543  2.445   -8.619  1.00 0.00 ? 35 ASN F OD1    1  
ATOM 5140   N ND2    . ASN F 1 35 ? 47.563  4.210   -7.255  1.00 0.00 ? 35 ASN F ND2    1  
ATOM 5141   H H      . ASN F 1 35 ? 42.830  3.045   -8.814  1.00 0.00 ? 35 ASN F H      1  
ATOM 5142   H HA     . ASN F 1 35 ? 45.431  2.690   -10.237 1.00 0.00 ? 35 ASN F HA     1  
ATOM 5143   H HB2    . ASN F 1 35 ? 45.311  4.615   -8.632  1.00 0.00 ? 35 ASN F HB2    1  
ATOM 5144   H HB3    . ASN F 1 35 ? 44.919  3.480   -7.346  1.00 0.00 ? 35 ASN F HB3    1  
ATOM 5145   H HD21   . ASN F 1 35 ? 47.054  4.970   -6.826  1.00 0.00 ? 35 ASN F HD21   1  
ATOM 5146   H HD22   . ASN F 1 35 ? 48.556  4.108   -7.100  1.00 0.00 ? 35 ASN F HD22   1  
ATOM 5147   N N      . ALA F 1 36 ? 45.215  0.264   -9.690  1.00 0.00 ? 36 ALA F N      1  
ATOM 5148   C CA     . ALA F 1 36 ? 45.182  -1.161  -9.410  1.00 0.00 ? 36 ALA F CA     1  
ATOM 5149   C C      . ALA F 1 36 ? 46.524  -1.826  -9.706  1.00 0.00 ? 36 ALA F C      1  
ATOM 5150   O O      . ALA F 1 36 ? 47.293  -1.326  -10.526 1.00 0.00 ? 36 ALA F O      1  
ATOM 5151   C CB     . ALA F 1 36 ? 44.069  -1.804  -10.236 1.00 0.00 ? 36 ALA F CB     1  
ATOM 5152   H H      . ALA F 1 36 ? 45.544  0.556   -10.600 1.00 0.00 ? 36 ALA F H      1  
ATOM 5153   H HA     . ALA F 1 36 ? 44.956  -1.315  -8.354  1.00 0.00 ? 36 ALA F HA     1  
ATOM 5154   H HB1    . ALA F 1 36 ? 44.250  -1.634  -11.298 1.00 0.00 ? 36 ALA F HB1    1  
ATOM 5155   H HB2    . ALA F 1 36 ? 44.057  -2.877  -10.050 1.00 0.00 ? 36 ALA F HB2    1  
ATOM 5156   H HB3    . ALA F 1 36 ? 43.105  -1.379  -9.954  1.00 0.00 ? 36 ALA F HB3    1  
ATOM 5157   N N      . PRO F 1 37 ? 46.798  -2.978  -9.082  1.00 0.00 ? 37 PRO F N      1  
ATOM 5158   C CA     . PRO F 1 37 ? 47.958  -3.790  -9.393  1.00 0.00 ? 37 PRO F CA     1  
ATOM 5159   C C      . PRO F 1 37 ? 47.895  -4.363  -10.806 1.00 0.00 ? 37 PRO F C      1  
ATOM 5160   O O      . PRO F 1 37 ? 46.817  -4.538  -11.371 1.00 0.00 ? 37 PRO F O      1  
ATOM 5161   C CB     . PRO F 1 37 ? 47.965  -4.915  -8.359  1.00 0.00 ? 37 PRO F CB     1  
ATOM 5162   C CG     . PRO F 1 37 ? 46.527  -5.001  -7.855  1.00 0.00 ? 37 PRO F CG     1  
ATOM 5163   C CD     . PRO F 1 37 ? 45.999  -3.581  -8.030  1.00 0.00 ? 37 PRO F CD     1  
ATOM 5164   H HA     . PRO F 1 37 ? 48.864  -3.193  -9.286  1.00 0.00 ? 37 PRO F HA     1  
ATOM 5165   H HB2    . PRO F 1 37 ? 48.247  -5.857  -8.823  1.00 0.00 ? 37 PRO F HB2    1  
ATOM 5166   H HB3    . PRO F 1 37 ? 48.636  -4.665  -7.538  1.00 0.00 ? 37 PRO F HB3    1  
ATOM 5167   H HG2    . PRO F 1 37 ? 45.957  -5.685  -8.482  1.00 0.00 ? 37 PRO F HG2    1  
ATOM 5168   H HG3    . PRO F 1 37 ? 46.493  -5.321  -6.814  1.00 0.00 ? 37 PRO F HG3    1  
ATOM 5169   H HD2    . PRO F 1 37 ? 44.944  -3.619  -8.302  1.00 0.00 ? 37 PRO F HD2    1  
ATOM 5170   H HD3    . PRO F 1 37 ? 46.129  -3.019  -7.106  1.00 0.00 ? 37 PRO F HD3    1  
ATOM 5171   N N      . LYS F 1 38 ? 49.050  -4.785  -11.330 1.00 0.00 ? 38 LYS F N      1  
ATOM 5172   C CA     . LYS F 1 38 ? 49.140  -5.491  -12.601 1.00 0.00 ? 38 LYS F CA     1  
ATOM 5173   C C      . LYS F 1 38 ? 48.589  -6.912  -12.524 1.00 0.00 ? 38 LYS F C      1  
ATOM 5174   O O      . LYS F 1 38 ? 48.494  -7.596  -13.540 1.00 0.00 ? 38 LYS F O      1  
ATOM 5175   C CB     . LYS F 1 38 ? 50.591  -5.496  -13.091 1.00 0.00 ? 38 LYS F CB     1  
ATOM 5176   C CG     . LYS F 1 38 ? 51.214  -4.103  -13.198 1.00 0.00 ? 38 LYS F CG     1  
ATOM 5177   C CD     . LYS F 1 38 ? 50.427  -3.181  -14.131 1.00 0.00 ? 38 LYS F CD     1  
ATOM 5178   C CE     . LYS F 1 38 ? 51.177  -1.873  -14.380 1.00 0.00 ? 38 LYS F CE     1  
ATOM 5179   N NZ     . LYS F 1 38 ? 51.238  -1.031  -13.170 1.00 0.00 ? 38 LYS F NZ     1  
ATOM 5180   H H      . LYS F 1 38 ? 49.902  -4.642  -10.807 1.00 0.00 ? 38 LYS F H      1  
ATOM 5181   H HA     . LYS F 1 38 ? 48.527  -4.964  -13.332 1.00 0.00 ? 38 LYS F HA     1  
ATOM 5182   H HB2    . LYS F 1 38 ? 51.193  -6.093  -12.405 1.00 0.00 ? 38 LYS F HB2    1  
ATOM 5183   H HB3    . LYS F 1 38 ? 50.629  -5.968  -14.073 1.00 0.00 ? 38 LYS F HB3    1  
ATOM 5184   H HG2    . LYS F 1 38 ? 51.272  -3.655  -12.206 1.00 0.00 ? 38 LYS F HG2    1  
ATOM 5185   H HG3    . LYS F 1 38 ? 52.228  -4.209  -13.584 1.00 0.00 ? 38 LYS F HG3    1  
ATOM 5186   H HD2    . LYS F 1 38 ? 50.279  -3.685  -15.086 1.00 0.00 ? 38 LYS F HD2    1  
ATOM 5187   H HD3    . LYS F 1 38 ? 49.451  -2.958  -13.698 1.00 0.00 ? 38 LYS F HD3    1  
ATOM 5188   H HE2    . LYS F 1 38 ? 52.187  -2.102  -14.720 1.00 0.00 ? 38 LYS F HE2    1  
ATOM 5189   H HE3    . LYS F 1 38 ? 50.667  -1.325  -15.173 1.00 0.00 ? 38 LYS F HE3    1  
ATOM 5190   H HZ1    . LYS F 1 38 ? 50.307  -0.828  -12.835 1.00 0.00 ? 38 LYS F HZ1    1  
ATOM 5191   H HZ2    . LYS F 1 38 ? 51.753  -1.498  -12.437 1.00 0.00 ? 38 LYS F HZ2    1  
ATOM 5192   H HZ3    . LYS F 1 38 ? 51.702  -0.158  -13.376 1.00 0.00 ? 38 LYS F HZ3    1  
ATOM 5193   N N      . ASP F 1 39 ? 48.191  -7.350  -11.326 1.00 0.00 ? 39 ASP F N      1  
ATOM 5194   C CA     . ASP F 1 39 ? 47.505  -8.608  -11.091 1.00 0.00 ? 39 ASP F CA     1  
ATOM 5195   C C      . ASP F 1 39 ? 46.082  -8.610  -11.644 1.00 0.00 ? 39 ASP F C      1  
ATOM 5196   O O      . ASP F 1 39 ? 45.517  -9.681  -11.863 1.00 0.00 ? 39 ASP F O      1  
ATOM 5197   C CB     . ASP F 1 39 ? 47.478  -8.866  -9.585  1.00 0.00 ? 39 ASP F CB     1  
ATOM 5198   C CG     . ASP F 1 39 ? 48.846  -9.304  -9.072  1.00 0.00 ? 39 ASP F CG     1  
ATOM 5199   O OD1    . ASP F 1 39 ? 49.158  -10.510 -9.192  1.00 0.00 ? 39 ASP F OD1    1  
ATOM 5200   O OD2    . ASP F 1 39 ? 49.585  -8.437  -8.556  1.00 0.00 ? 39 ASP F OD2    1  
ATOM 5201   H H      . ASP F 1 39 ? 48.331  -6.748  -10.529 1.00 0.00 ? 39 ASP F H      1  
ATOM 5202   H HA     . ASP F 1 39 ? 48.057  -9.414  -11.575 1.00 0.00 ? 39 ASP F HA     1  
ATOM 5203   H HB2    . ASP F 1 39 ? 47.167  -7.954  -9.075  1.00 0.00 ? 39 ASP F HB2    1  
ATOM 5204   H HB3    . ASP F 1 39 ? 46.745  -9.639  -9.360  1.00 0.00 ? 39 ASP F HB3    1  
ATOM 5205   N N      . VAL F 1 40 ? 45.494  -7.431  -11.870 1.00 0.00 ? 40 VAL F N      1  
ATOM 5206   C CA     . VAL F 1 40 ? 44.117  -7.289  -12.322 1.00 0.00 ? 40 VAL F CA     1  
ATOM 5207   C C      . VAL F 1 40 ? 44.031  -6.439  -13.585 1.00 0.00 ? 40 VAL F C      1  
ATOM 5208   O O      . VAL F 1 40 ? 44.965  -5.715  -13.926 1.00 0.00 ? 40 VAL F O      1  
ATOM 5209   C CB     . VAL F 1 40 ? 43.229  -6.715  -11.215 1.00 0.00 ? 40 VAL F CB     1  
ATOM 5210   C CG1    . VAL F 1 40 ? 43.320  -7.545  -9.936  1.00 0.00 ? 40 VAL F CG1    1  
ATOM 5211   C CG2    . VAL F 1 40 ? 43.575  -5.266  -10.882 1.00 0.00 ? 40 VAL F CG2    1  
ATOM 5212   H H      . VAL F 1 40 ? 46.022  -6.583  -11.717 1.00 0.00 ? 40 VAL F H      1  
ATOM 5213   H HA     . VAL F 1 40 ? 43.726  -8.275  -12.573 1.00 0.00 ? 40 VAL F HA     1  
ATOM 5214   H HB     . VAL F 1 40 ? 42.195  -6.729  -11.559 1.00 0.00 ? 40 VAL F HB     1  
ATOM 5215   H HG11   . VAL F 1 40 ? 42.593  -7.178  -9.212  1.00 0.00 ? 40 VAL F HG11   1  
ATOM 5216   H HG12   . VAL F 1 40 ? 43.105  -8.590  -10.161 1.00 0.00 ? 40 VAL F HG12   1  
ATOM 5217   H HG13   . VAL F 1 40 ? 44.319  -7.463  -9.508  1.00 0.00 ? 40 VAL F HG13   1  
ATOM 5218   H HG21   . VAL F 1 40 ? 44.581  -5.213  -10.469 1.00 0.00 ? 40 VAL F HG21   1  
ATOM 5219   H HG22   . VAL F 1 40 ? 43.513  -4.652  -11.781 1.00 0.00 ? 40 VAL F HG22   1  
ATOM 5220   H HG23   . VAL F 1 40 ? 42.865  -4.888  -10.146 1.00 0.00 ? 40 VAL F HG23   1  
ATOM 5221   N N      . ALA F 1 41 ? 42.885  -6.506  -14.266 1.00 0.00 ? 41 ALA F N      1  
ATOM 5222   C CA     . ALA F 1 41 ? 42.559  -5.621  -15.371 1.00 0.00 ? 41 ALA F CA     1  
ATOM 5223   C C      . ALA F 1 41 ? 41.723  -4.433  -14.906 1.00 0.00 ? 41 ALA F C      1  
ATOM 5224   O O      . ALA F 1 41 ? 41.124  -4.466  -13.833 1.00 0.00 ? 41 ALA F O      1  
ATOM 5225   C CB     . ALA F 1 41 ? 41.832  -6.429  -16.445 1.00 0.00 ? 41 ALA F CB     1  
ATOM 5226   H H      . ALA F 1 41 ? 42.164  -7.137  -13.948 1.00 0.00 ? 41 ALA F H      1  
ATOM 5227   H HA     . ALA F 1 41 ? 43.486  -5.233  -15.793 1.00 0.00 ? 41 ALA F HA     1  
ATOM 5228   H HB1    . ALA F 1 41 ? 42.438  -7.287  -16.733 1.00 0.00 ? 41 ALA F HB1    1  
ATOM 5229   H HB2    . ALA F 1 41 ? 40.870  -6.774  -16.063 1.00 0.00 ? 41 ALA F HB2    1  
ATOM 5230   H HB3    . ALA F 1 41 ? 41.665  -5.802  -17.320 1.00 0.00 ? 41 ALA F HB3    1  
ATOM 5231   N N      . VAL F 1 42 ? 41.660  -3.379  -15.725 1.00 0.00 ? 42 VAL F N      1  
ATOM 5232   C CA     . VAL F 1 42 ? 40.744  -2.266  -15.527 1.00 0.00 ? 42 VAL F CA     1  
ATOM 5233   C C      . VAL F 1 42 ? 40.461  -1.576  -16.858 1.00 0.00 ? 42 VAL F C      1  
ATOM 5234   O O      . VAL F 1 42 ? 41.388  -1.198  -17.571 1.00 0.00 ? 42 VAL F O      1  
ATOM 5235   C CB     . VAL F 1 42 ? 41.278  -1.303  -14.462 1.00 0.00 ? 42 VAL F CB     1  
ATOM 5236   C CG1    . VAL F 1 42 ? 42.758  -0.959  -14.630 1.00 0.00 ? 42 VAL F CG1    1  
ATOM 5237   C CG2    . VAL F 1 42 ? 40.460  -0.013  -14.420 1.00 0.00 ? 42 VAL F CG2    1  
ATOM 5238   H H      . VAL F 1 42 ? 42.201  -3.390  -16.578 1.00 0.00 ? 42 VAL F H      1  
ATOM 5239   H HA     . VAL F 1 42 ? 39.801  -2.668  -15.159 1.00 0.00 ? 42 VAL F HA     1  
ATOM 5240   H HB     . VAL F 1 42 ? 41.166  -1.785  -13.492 1.00 0.00 ? 42 VAL F HB     1  
ATOM 5241   H HG11   . VAL F 1 42 ? 43.037  -0.179  -13.922 1.00 0.00 ? 42 VAL F HG11   1  
ATOM 5242   H HG12   . VAL F 1 42 ? 43.365  -1.842  -14.428 1.00 0.00 ? 42 VAL F HG12   1  
ATOM 5243   H HG13   . VAL F 1 42 ? 42.958  -0.613  -15.642 1.00 0.00 ? 42 VAL F HG13   1  
ATOM 5244   H HG21   . VAL F 1 42 ? 40.541  0.524   -15.365 1.00 0.00 ? 42 VAL F HG21   1  
ATOM 5245   H HG22   . VAL F 1 42 ? 39.413  -0.248  -14.228 1.00 0.00 ? 42 VAL F HG22   1  
ATOM 5246   H HG23   . VAL F 1 42 ? 40.835  0.627   -13.623 1.00 0.00 ? 42 VAL F HG23   1  
ATOM 5247   N N      . HIS F 1 43 ? 39.178  -1.419  -17.198 1.00 0.00 ? 43 HIS F N      1  
ATOM 5248   C CA     . HIS F 1 43 ? 38.725  -0.699  -18.380 1.00 0.00 ? 43 HIS F CA     1  
ATOM 5249   C C      . HIS F 1 43 ? 37.322  -0.145  -18.152 1.00 0.00 ? 43 HIS F C      1  
ATOM 5250   O O      . HIS F 1 43 ? 36.667  -0.508  -17.176 1.00 0.00 ? 43 HIS F O      1  
ATOM 5251   C CB     . HIS F 1 43 ? 38.710  -1.601  -19.618 1.00 0.00 ? 43 HIS F CB     1  
ATOM 5252   C CG     . HIS F 1 43 ? 39.783  -2.655  -19.694 1.00 0.00 ? 43 HIS F CG     1  
ATOM 5253   N ND1    . HIS F 1 43 ? 40.906  -2.606  -20.522 1.00 0.00 ? 43 HIS F ND1    1  
ATOM 5254   C CD2    . HIS F 1 43 ? 39.724  -3.885  -19.095 1.00 0.00 ? 43 HIS F CD2    1  
ATOM 5255   C CE1    . HIS F 1 43 ? 41.515  -3.789  -20.378 1.00 0.00 ? 43 HIS F CE1    1  
ATOM 5256   N NE2    . HIS F 1 43 ? 40.836  -4.576  -19.528 1.00 0.00 ? 43 HIS F NE2    1  
ATOM 5257   H H      . HIS F 1 43 ? 38.467  -1.712  -16.541 1.00 0.00 ? 43 HIS F H      1  
ATOM 5258   H HA     . HIS F 1 43 ? 39.401  0.136   -18.565 1.00 0.00 ? 43 HIS F HA     1  
ATOM 5259   H HB2    . HIS F 1 43 ? 37.741  -2.099  -19.690 1.00 0.00 ? 43 HIS F HB2    1  
ATOM 5260   H HB3    . HIS F 1 43 ? 38.818  -0.957  -20.490 1.00 0.00 ? 43 HIS F HB3    1  
ATOM 5261   H HD2    . HIS F 1 43 ? 38.937  -4.253  -18.454 1.00 0.00 ? 43 HIS F HD2    1  
ATOM 5262   H HE1    . HIS F 1 43 ? 42.410  -4.091  -20.904 1.00 0.00 ? 43 HIS F HE1    1  
ATOM 5263   H HE2    . HIS F 1 43 ? 41.058  -5.539  -19.319 1.00 0.00 ? 43 HIS F HE2    1  
ATOM 5264   N N      . ARG F 1 44 ? 36.813  0.680   -19.073 1.00 0.00 ? 44 ARG F N      1  
ATOM 5265   C CA     . ARG F 1 44 ? 35.409  1.065   -19.060 1.00 0.00 ? 44 ARG F CA     1  
ATOM 5266   C C      . ARG F 1 44 ? 34.556  -0.072  -19.614 1.00 0.00 ? 44 ARG F C      1  
ATOM 5267   O O      . ARG F 1 44 ? 35.075  -0.960  -20.287 1.00 0.00 ? 44 ARG F O      1  
ATOM 5268   C CB     . ARG F 1 44 ? 35.203  2.390   -19.796 1.00 0.00 ? 44 ARG F CB     1  
ATOM 5269   C CG     . ARG F 1 44 ? 35.576  2.311   -21.277 1.00 0.00 ? 44 ARG F CG     1  
ATOM 5270   C CD     . ARG F 1 44 ? 35.269  3.637   -21.971 1.00 0.00 ? 44 ARG F CD     1  
ATOM 5271   N NE     . ARG F 1 44 ? 35.542  3.559   -23.409 1.00 0.00 ? 44 ARG F NE     1  
ATOM 5272   C CZ     . ARG F 1 44 ? 36.690  3.872   -24.018 1.00 0.00 ? 44 ARG F CZ     1  
ATOM 5273   N NH1    . ARG F 1 44 ? 37.767  4.269   -23.339 1.00 0.00 ? 44 ARG F NH1    1  
ATOM 5274   N NH2    . ARG F 1 44 ? 36.756  3.777   -25.344 1.00 0.00 ? 44 ARG F NH2    1  
ATOM 5275   H H      . ARG F 1 44 ? 37.340  0.871   -19.913 1.00 0.00 ? 44 ARG F H      1  
ATOM 5276   H HA     . ARG F 1 44 ? 35.111  1.224   -18.024 1.00 0.00 ? 44 ARG F HA     1  
ATOM 5277   H HB2    . ARG F 1 44 ? 34.156  2.681   -19.709 1.00 0.00 ? 44 ARG F HB2    1  
ATOM 5278   H HB3    . ARG F 1 44 ? 35.812  3.157   -19.318 1.00 0.00 ? 44 ARG F HB3    1  
ATOM 5279   H HG2    . ARG F 1 44 ? 36.639  2.093   -21.375 1.00 0.00 ? 44 ARG F HG2    1  
ATOM 5280   H HG3    . ARG F 1 44 ? 34.999  1.519   -21.752 1.00 0.00 ? 44 ARG F HG3    1  
ATOM 5281   H HD2    . ARG F 1 44 ? 34.215  3.876   -21.827 1.00 0.00 ? 44 ARG F HD2    1  
ATOM 5282   H HD3    . ARG F 1 44 ? 35.866  4.429   -21.520 1.00 0.00 ? 44 ARG F HD3    1  
ATOM 5283   H HE     . ARG F 1 44 ? 34.786  3.266   -24.014 1.00 0.00 ? 44 ARG F HE     1  
ATOM 5284   H HH11   . ARG F 1 44 ? 37.729  4.346   -22.334 1.00 0.00 ? 44 ARG F HH11   1  
ATOM 5285   H HH12   . ARG F 1 44 ? 38.616  4.501   -23.832 1.00 0.00 ? 44 ARG F HH12   1  
ATOM 5286   H HH21   . ARG F 1 44 ? 35.935  3.452   -25.840 1.00 0.00 ? 44 ARG F HH21   1  
ATOM 5287   H HH22   . ARG F 1 44 ? 37.603  4.010   -25.840 1.00 0.00 ? 44 ARG F HH22   1  
ATOM 5288   N N      . GLU F 1 45 ? 33.245  -0.048  -19.357 1.00 0.00 ? 45 GLU F N      1  
ATOM 5289   C CA     . GLU F 1 45 ? 32.361  -1.160  -19.678 1.00 0.00 ? 45 GLU F CA     1  
ATOM 5290   C C      . GLU F 1 45 ? 32.342  -1.467  -21.174 1.00 0.00 ? 45 GLU F C      1  
ATOM 5291   O O      . GLU F 1 45 ? 32.232  -2.628  -21.563 1.00 0.00 ? 45 GLU F O      1  
ATOM 5292   C CB     . GLU F 1 45 ? 30.964  -0.841  -19.145 1.00 0.00 ? 45 GLU F CB     1  
ATOM 5293   C CG     . GLU F 1 45 ? 30.041  -2.056  -19.036 1.00 0.00 ? 45 GLU F CG     1  
ATOM 5294   C CD     . GLU F 1 45 ? 29.445  -2.515  -20.361 1.00 0.00 ? 45 GLU F CD     1  
ATOM 5295   O OE1    . GLU F 1 45 ? 29.000  -1.647  -21.144 1.00 0.00 ? 45 GLU F OE1    1  
ATOM 5296   O OE2    . GLU F 1 45 ? 29.337  -3.748  -20.547 1.00 0.00 ? 45 GLU F OE2    1  
ATOM 5297   H H      . GLU F 1 45 ? 32.862  0.720   -18.824 1.00 0.00 ? 45 GLU F H      1  
ATOM 5298   H HA     . GLU F 1 45 ? 32.729  -2.045  -19.159 1.00 0.00 ? 45 GLU F HA     1  
ATOM 5299   H HB2    . GLU F 1 45 ? 31.078  -0.444  -18.137 1.00 0.00 ? 45 GLU F HB2    1  
ATOM 5300   H HB3    . GLU F 1 45 ? 30.500  -0.069  -19.760 1.00 0.00 ? 45 GLU F HB3    1  
ATOM 5301   H HG2    . GLU F 1 45 ? 30.585  -2.877  -18.567 1.00 0.00 ? 45 GLU F HG2    1  
ATOM 5302   H HG3    . GLU F 1 45 ? 29.203  -1.791  -18.392 1.00 0.00 ? 45 GLU F HG3    1  
ATOM 5303   N N      . GLU F 1 46 ? 32.558  -0.453  -22.017 1.00 0.00 ? 46 GLU F N      1  
ATOM 5304   C CA     . GLU F 1 46 ? 32.694  -0.603  -23.457 1.00 0.00 ? 46 GLU F CA     1  
ATOM 5305   C C      . GLU F 1 46 ? 33.796  -1.591  -23.825 1.00 0.00 ? 46 GLU F C      1  
ATOM 5306   O O      . GLU F 1 46 ? 33.634  -2.412  -24.726 1.00 0.00 ? 46 GLU F O      1  
ATOM 5307   C CB     . GLU F 1 46 ? 33.029  0.767   -24.049 1.00 0.00 ? 46 GLU F CB     1  
ATOM 5308   C CG     . GLU F 1 46 ? 32.937  0.770   -25.574 1.00 0.00 ? 46 GLU F CG     1  
ATOM 5309   C CD     . GLU F 1 46 ? 33.157  2.173   -26.135 1.00 0.00 ? 46 GLU F CD     1  
ATOM 5310   O OE1    . GLU F 1 46 ? 34.216  2.766   -25.833 1.00 0.00 ? 46 GLU F OE1    1  
ATOM 5311   O OE2    . GLU F 1 46 ? 32.269  2.659   -26.872 1.00 0.00 ? 46 GLU F OE2    1  
ATOM 5312   H H      . GLU F 1 46 ? 32.654  0.476   -21.632 1.00 0.00 ? 46 GLU F H      1  
ATOM 5313   H HA     . GLU F 1 46 ? 31.750  -0.959  -23.871 1.00 0.00 ? 46 GLU F HA     1  
ATOM 5314   H HB2    . GLU F 1 46 ? 32.332  1.508   -23.659 1.00 0.00 ? 46 GLU F HB2    1  
ATOM 5315   H HB3    . GLU F 1 46 ? 34.036  1.048   -23.739 1.00 0.00 ? 46 GLU F HB3    1  
ATOM 5316   H HG2    . GLU F 1 46 ? 33.691  0.098   -25.986 1.00 0.00 ? 46 GLU F HG2    1  
ATOM 5317   H HG3    . GLU F 1 46 ? 31.953  0.405   -25.870 1.00 0.00 ? 46 GLU F HG3    1  
ATOM 5318   N N      . ILE F 1 47 ? 34.934  -1.494  -23.133 1.00 0.00 ? 47 ILE F N      1  
ATOM 5319   C CA     . ILE F 1 47 ? 36.142  -2.236  -23.442 1.00 0.00 ? 47 ILE F CA     1  
ATOM 5320   C C      . ILE F 1 47 ? 36.162  -3.556  -22.677 1.00 0.00 ? 47 ILE F C      1  
ATOM 5321   O O      . ILE F 1 47 ? 36.633  -4.562  -23.199 1.00 0.00 ? 47 ILE F O      1  
ATOM 5322   C CB     . ILE F 1 47 ? 37.361  -1.374  -23.108 1.00 0.00 ? 47 ILE F CB     1  
ATOM 5323   C CG1    . ILE F 1 47 ? 37.317  0.010   -23.767 1.00 0.00 ? 47 ILE F CG1    1  
ATOM 5324   C CG2    . ILE F 1 47 ? 38.656  -2.091  -23.491 1.00 0.00 ? 47 ILE F CG2    1  
ATOM 5325   C CD1    . ILE F 1 47 ? 36.948  -0.013  -25.249 1.00 0.00 ? 47 ILE F CD1    1  
ATOM 5326   H H      . ILE F 1 47 ? 34.960  -0.871  -22.336 1.00 0.00 ? 47 ILE F H      1  
ATOM 5327   H HA     . ILE F 1 47 ? 36.158  -2.467  -24.507 1.00 0.00 ? 47 ILE F HA     1  
ATOM 5328   H HB     . ILE F 1 47 ? 37.361  -1.214  -22.030 1.00 0.00 ? 47 ILE F HB     1  
ATOM 5329   H HG12   . ILE F 1 47 ? 36.583  0.624   -23.246 1.00 0.00 ? 47 ILE F HG12   1  
ATOM 5330   H HG13   . ILE F 1 47 ? 38.288  0.489   -23.653 1.00 0.00 ? 47 ILE F HG13   1  
ATOM 5331   H HG21   . ILE F 1 47 ? 38.635  -2.372  -24.543 1.00 0.00 ? 47 ILE F HG21   1  
ATOM 5332   H HG22   . ILE F 1 47 ? 39.509  -1.433  -23.312 1.00 0.00 ? 47 ILE F HG22   1  
ATOM 5333   H HG23   . ILE F 1 47 ? 38.781  -2.986  -22.883 1.00 0.00 ? 47 ILE F HG23   1  
ATOM 5334   H HD11   . ILE F 1 47 ? 37.567  -0.738  -25.778 1.00 0.00 ? 47 ILE F HD11   1  
ATOM 5335   H HD12   . ILE F 1 47 ? 35.895  -0.271  -25.361 1.00 0.00 ? 47 ILE F HD12   1  
ATOM 5336   H HD13   . ILE F 1 47 ? 37.110  0.977   -25.674 1.00 0.00 ? 47 ILE F HD13   1  
ATOM 5337   N N      . TYR F 1 48 ? 35.572  -3.578  -21.478 1.00 0.00 ? 48 TYR F N      1  
ATOM 5338   C CA     . TYR F 1 48 ? 35.455  -4.761  -20.643 1.00 0.00 ? 48 TYR F CA     1  
ATOM 5339   C C      . TYR F 1 48 ? 34.887  -5.961  -21.394 1.00 0.00 ? 48 TYR F C      1  
ATOM 5340   O O      . TYR F 1 48 ? 35.288  -7.096  -21.143 1.00 0.00 ? 48 TYR F O      1  
ATOM 5341   C CB     . TYR F 1 48 ? 34.533  -4.427  -19.473 1.00 0.00 ? 48 TYR F CB     1  
ATOM 5342   C CG     . TYR F 1 48 ? 34.340  -5.566  -18.500 1.00 0.00 ? 48 TYR F CG     1  
ATOM 5343   C CD1    . TYR F 1 48 ? 35.421  -6.044  -17.746 1.00 0.00 ? 48 TYR F CD1    1  
ATOM 5344   C CD2    . TYR F 1 48 ? 33.075  -6.154  -18.371 1.00 0.00 ? 48 TYR F CD2    1  
ATOM 5345   C CE1    . TYR F 1 48 ? 35.229  -7.080  -16.821 1.00 0.00 ? 48 TYR F CE1    1  
ATOM 5346   C CE2    . TYR F 1 48 ? 32.878  -7.199  -17.459 1.00 0.00 ? 48 TYR F CE2    1  
ATOM 5347   C CZ     . TYR F 1 48 ? 33.949  -7.650  -16.662 1.00 0.00 ? 48 TYR F CZ     1  
ATOM 5348   O OH     . TYR F 1 48 ? 33.749  -8.661  -15.769 1.00 0.00 ? 48 TYR F OH     1  
ATOM 5349   H H      . TYR F 1 48 ? 35.210  -2.710  -21.107 1.00 0.00 ? 48 TYR F H      1  
ATOM 5350   H HA     . TYR F 1 48 ? 36.440  -5.026  -20.258 1.00 0.00 ? 48 TYR F HA     1  
ATOM 5351   H HB2    . TYR F 1 48 ? 34.928  -3.562  -18.943 1.00 0.00 ? 48 TYR F HB2    1  
ATOM 5352   H HB3    . TYR F 1 48 ? 33.555  -4.155  -19.871 1.00 0.00 ? 48 TYR F HB3    1  
ATOM 5353   H HD1    . TYR F 1 48 ? 36.402  -5.607  -17.865 1.00 0.00 ? 48 TYR F HD1    1  
ATOM 5354   H HD2    . TYR F 1 48 ? 32.247  -5.799  -18.968 1.00 0.00 ? 48 TYR F HD2    1  
ATOM 5355   H HE1    . TYR F 1 48 ? 36.063  -7.436  -16.234 1.00 0.00 ? 48 TYR F HE1    1  
ATOM 5356   H HE2    . TYR F 1 48 ? 31.905  -7.661  -17.379 1.00 0.00 ? 48 TYR F HE2    1  
ATOM 5357   H HH     . TYR F 1 48 ? 34.547  -8.894  -15.286 1.00 0.00 ? 48 TYR F HH     1  
ATOM 5358   N N      . GLN F 1 49 ? 33.990  -5.715  -22.350 1.00 0.00 ? 49 GLN F N      1  
ATOM 5359   C CA     . GLN F 1 49 ? 33.309  -6.738  -23.129 1.00 0.00 ? 49 GLN F CA     1  
ATOM 5360   C C      . GLN F 1 49 ? 34.274  -7.629  -23.910 1.00 0.00 ? 49 GLN F C      1  
ATOM 5361   O O      . GLN F 1 49 ? 33.940  -8.767  -24.233 1.00 0.00 ? 49 GLN F O      1  
ATOM 5362   C CB     . GLN F 1 49 ? 32.316  -6.040  -24.058 1.00 0.00 ? 49 GLN F CB     1  
ATOM 5363   C CG     . GLN F 1 49 ? 31.168  -5.444  -23.240 1.00 0.00 ? 49 GLN F CG     1  
ATOM 5364   C CD     . GLN F 1 49 ? 30.377  -4.384  -23.999 1.00 0.00 ? 49 GLN F CD     1  
ATOM 5365   O OE1    . GLN F 1 49 ? 30.503  -4.211  -25.209 1.00 0.00 ? 49 GLN F OE1    1  
ATOM 5366   N NE2    . GLN F 1 49 ? 29.516  -3.663  -23.286 1.00 0.00 ? 49 GLN F NE2    1  
ATOM 5367   H H      . GLN F 1 49 ? 33.705  -4.756  -22.497 1.00 0.00 ? 49 GLN F H      1  
ATOM 5368   H HA     . GLN F 1 49 ? 32.743  -7.368  -22.442 1.00 0.00 ? 49 GLN F HA     1  
ATOM 5369   H HB2    . GLN F 1 49 ? 32.832  -5.250  -24.604 1.00 0.00 ? 49 GLN F HB2    1  
ATOM 5370   H HB3    . GLN F 1 49 ? 31.910  -6.759  -24.770 1.00 0.00 ? 49 GLN F HB3    1  
ATOM 5371   H HG2    . GLN F 1 49 ? 30.487  -6.244  -22.951 1.00 0.00 ? 49 GLN F HG2    1  
ATOM 5372   H HG3    . GLN F 1 49 ? 31.561  -4.998  -22.325 1.00 0.00 ? 49 GLN F HG3    1  
ATOM 5373   H HE21   . GLN F 1 49 ? 29.476  -3.796  -22.283 1.00 0.00 ? 49 GLN F HE21   1  
ATOM 5374   H HE22   . GLN F 1 49 ? 29.089  -2.836  -23.674 1.00 0.00 ? 49 GLN F HE22   1  
ATOM 5375   N N      . ARG F 1 50 ? 35.493  -7.143  -24.166 1.00 0.00 ? 50 ARG F N      1  
ATOM 5376   C CA     . ARG F 1 50 ? 36.560  -7.833  -24.878 1.00 0.00 ? 50 ARG F CA     1  
ATOM 5377   C C      . ARG F 1 50 ? 37.272  -8.867  -24.011 1.00 0.00 ? 50 ARG F C      1  
ATOM 5378   O O      . ARG F 1 50 ? 38.034  -9.678  -24.532 1.00 0.00 ? 50 ARG F O      1  
ATOM 5379   C CB     . ARG F 1 50 ? 37.562  -6.821  -25.437 1.00 0.00 ? 50 ARG F CB     1  
ATOM 5380   C CG     . ARG F 1 50 ? 37.069  -6.099  -26.693 1.00 0.00 ? 50 ARG F CG     1  
ATOM 5381   C CD     . ARG F 1 50 ? 35.761  -5.333  -26.497 1.00 0.00 ? 50 ARG F CD     1  
ATOM 5382   N NE     . ARG F 1 50 ? 35.431  -4.523  -27.673 1.00 0.00 ? 50 ARG F NE     1  
ATOM 5383   C CZ     . ARG F 1 50 ? 34.541  -4.847  -28.619 1.00 0.00 ? 50 ARG F CZ     1  
ATOM 5384   N NH1    . ARG F 1 50 ? 33.910  -6.021  -28.613 1.00 0.00 ? 50 ARG F NH1    1  
ATOM 5385   N NH2    . ARG F 1 50 ? 34.273  -3.987  -29.600 1.00 0.00 ? 50 ARG F NH2    1  
ATOM 5386   H H      . ARG F 1 50 ? 35.708  -6.216  -23.822 1.00 0.00 ? 50 ARG F H      1  
ATOM 5387   H HA     . ARG F 1 50 ? 36.123  -8.379  -25.714 1.00 0.00 ? 50 ARG F HA     1  
ATOM 5388   H HB2    . ARG F 1 50 ? 37.826  -6.100  -24.662 1.00 0.00 ? 50 ARG F HB2    1  
ATOM 5389   H HB3    . ARG F 1 50 ? 38.475  -7.351  -25.707 1.00 0.00 ? 50 ARG F HB3    1  
ATOM 5390   H HG2    . ARG F 1 50 ? 37.840  -5.396  -27.009 1.00 0.00 ? 50 ARG F HG2    1  
ATOM 5391   H HG3    . ARG F 1 50 ? 36.930  -6.831  -27.489 1.00 0.00 ? 50 ARG F HG3    1  
ATOM 5392   H HD2    . ARG F 1 50 ? 34.956  -6.040  -26.300 1.00 0.00 ? 50 ARG F HD2    1  
ATOM 5393   H HD3    . ARG F 1 50 ? 35.863  -4.672  -25.636 1.00 0.00 ? 50 ARG F HD3    1  
ATOM 5394   H HE     . ARG F 1 50 ? 35.883  -3.624  -27.751 1.00 0.00 ? 50 ARG F HE     1  
ATOM 5395   H HH11   . ARG F 1 50 ? 34.116  -6.698  -27.893 1.00 0.00 ? 50 ARG F HH11   1  
ATOM 5396   H HH12   . ARG F 1 50 ? 33.240  -6.240  -29.335 1.00 0.00 ? 50 ARG F HH12   1  
ATOM 5397   H HH21   . ARG F 1 50 ? 34.733  -3.090  -29.628 1.00 0.00 ? 50 ARG F HH21   1  
ATOM 5398   H HH22   . ARG F 1 50 ? 33.600  -4.228  -30.313 1.00 0.00 ? 50 ARG F HH22   1  
ATOM 5399   N N      . ILE F 1 51 ? 37.203  -8.715  -22.687 1.00 0.00 ? 51 ILE F N      1  
ATOM 5400   C CA     . ILE F 1 51 ? 38.026  -9.446  -21.735 1.00 0.00 ? 51 ILE F CA     1  
ATOM 5401   C C      . ILE F 1 51 ? 37.391  -10.761 -21.288 1.00 0.00 ? 51 ILE F C      1  
ATOM 5402   O O      . ILE F 1 51 ? 37.946  -11.834 -21.510 1.00 0.00 ? 51 ILE F O      1  
ATOM 5403   C CB     . ILE F 1 51 ? 38.306  -8.502  -20.561 1.00 0.00 ? 51 ILE F CB     1  
ATOM 5404   C CG1    . ILE F 1 51 ? 39.450  -7.530  -20.858 1.00 0.00 ? 51 ILE F CG1    1  
ATOM 5405   C CG2    . ILE F 1 51 ? 38.641  -9.232  -19.260 1.00 0.00 ? 51 ILE F CG2    1  
ATOM 5406   C CD1    . ILE F 1 51 ? 39.219  -6.612  -22.056 1.00 0.00 ? 51 ILE F CD1    1  
ATOM 5407   H H      . ILE F 1 51 ? 36.619  -7.975  -22.325 1.00 0.00 ? 51 ILE F H      1  
ATOM 5408   H HA     . ILE F 1 51 ? 38.971  -9.700  -22.217 1.00 0.00 ? 51 ILE F HA     1  
ATOM 5409   H HB     . ILE F 1 51 ? 37.396  -7.930  -20.376 1.00 0.00 ? 51 ILE F HB     1  
ATOM 5410   H HG12   . ILE F 1 51 ? 39.581  -6.887  -19.989 1.00 0.00 ? 51 ILE F HG12   1  
ATOM 5411   H HG13   . ILE F 1 51 ? 40.372  -8.091  -21.014 1.00 0.00 ? 51 ILE F HG13   1  
ATOM 5412   H HG21   . ILE F 1 51 ? 37.748  -9.722  -18.871 1.00 0.00 ? 51 ILE F HG21   1  
ATOM 5413   H HG22   . ILE F 1 51 ? 39.423  -9.970  -19.435 1.00 0.00 ? 51 ILE F HG22   1  
ATOM 5414   H HG23   . ILE F 1 51 ? 38.984  -8.514  -18.515 1.00 0.00 ? 51 ILE F HG23   1  
ATOM 5415   H HD11   . ILE F 1 51 ? 38.226  -6.166  -21.989 1.00 0.00 ? 51 ILE F HD11   1  
ATOM 5416   H HD12   . ILE F 1 51 ? 39.965  -5.819  -22.054 1.00 0.00 ? 51 ILE F HD12   1  
ATOM 5417   H HD13   . ILE F 1 51 ? 39.315  -7.178  -22.982 1.00 0.00 ? 51 ILE F HD13   1  
ATOM 5418   N N      . GLN F 1 52 ? 36.226  -10.679 -20.642 1.00 0.00 ? 52 GLN F N      1  
ATOM 5419   C CA     . GLN F 1 52 ? 35.592  -11.781 -19.936 1.00 0.00 ? 52 GLN F CA     1  
ATOM 5420   C C      . GLN F 1 52 ? 34.739  -12.698 -20.810 1.00 0.00 ? 52 GLN F C      1  
ATOM 5421   O O      . GLN F 1 52 ? 34.148  -13.650 -20.301 1.00 0.00 ? 52 GLN F O      1  
ATOM 5422   C CB     . GLN F 1 52 ? 34.811  -11.242 -18.733 1.00 0.00 ? 52 GLN F CB     1  
ATOM 5423   C CG     . GLN F 1 52 ? 33.923  -10.026 -19.016 1.00 0.00 ? 52 GLN F CG     1  
ATOM 5424   C CD     . GLN F 1 52 ? 33.229  -10.090 -20.369 1.00 0.00 ? 52 GLN F CD     1  
ATOM 5425   O OE1    . GLN F 1 52 ? 32.269  -10.829 -20.571 1.00 0.00 ? 52 GLN F OE1    1  
ATOM 5426   N NE2    . GLN F 1 52 ? 33.787  -9.384  -21.351 1.00 0.00 ? 52 GLN F NE2    1  
ATOM 5427   H H      . GLN F 1 52 ? 35.830  -9.760  -20.506 1.00 0.00 ? 52 GLN F H      1  
ATOM 5428   H HA     . GLN F 1 52 ? 36.394  -12.415 -19.555 1.00 0.00 ? 52 GLN F HA     1  
ATOM 5429   H HB2    . GLN F 1 52 ? 34.189  -12.040 -18.325 1.00 0.00 ? 52 GLN F HB2    1  
ATOM 5430   H HB3    . GLN F 1 52 ? 35.525  -10.957 -17.960 1.00 0.00 ? 52 GLN F HB3    1  
ATOM 5431   H HG2    . GLN F 1 52 ? 33.168  -9.940  -18.237 1.00 0.00 ? 52 GLN F HG2    1  
ATOM 5432   H HG3    . GLN F 1 52 ? 34.543  -9.129  -18.984 1.00 0.00 ? 52 GLN F HG3    1  
ATOM 5433   H HE21   . GLN F 1 52 ? 34.472  -8.672  -21.141 1.00 0.00 ? 52 GLN F HE21   1  
ATOM 5434   H HE22   . GLN F 1 52 ? 33.582  -9.596  -22.315 1.00 0.00 ? 52 GLN F HE22   1  
ATOM 5435   N N      . ALA F 1 53 ? 34.692  -12.462 -22.123 1.00 0.00 ? 53 ALA F N      1  
ATOM 5436   C CA     . ALA F 1 53 ? 33.876  -13.232 -23.048 1.00 0.00 ? 53 ALA F CA     1  
ATOM 5437   C C      . ALA F 1 53 ? 34.412  -14.644 -23.295 1.00 0.00 ? 53 ALA F C      1  
ATOM 5438   O O      . ALA F 1 53 ? 33.894  -15.358 -24.151 1.00 0.00 ? 53 ALA F O      1  
ATOM 5439   C CB     . ALA F 1 53 ? 33.732  -12.444 -24.348 1.00 0.00 ? 53 ALA F CB     1  
ATOM 5440   H H      . ALA F 1 53 ? 35.209  -11.678 -22.494 1.00 0.00 ? 53 ALA F H      1  
ATOM 5441   H HA     . ALA F 1 53 ? 32.883  -13.335 -22.610 1.00 0.00 ? 53 ALA F HA     1  
ATOM 5442   H HB1    . ALA F 1 53 ? 33.393  -11.429 -24.135 1.00 0.00 ? 53 ALA F HB1    1  
ATOM 5443   H HB2    . ALA F 1 53 ? 34.691  -12.405 -24.862 1.00 0.00 ? 53 ALA F HB2    1  
ATOM 5444   H HB3    . ALA F 1 53 ? 33.003  -12.933 -24.994 1.00 0.00 ? 53 ALA F HB3    1  
ATOM 5445   N N      . GLY F 1 54 ? 35.482  -15.034 -22.595 1.00 0.00 ? 54 GLY F N      1  
ATOM 5446   C CA     . GLY F 1 54 ? 36.246  -16.243 -22.851 1.00 0.00 ? 54 GLY F CA     1  
ATOM 5447   C C      . GLY F 1 54 ? 37.601  -15.925 -23.475 1.00 0.00 ? 54 GLY F C      1  
ATOM 5448   O O      . GLY F 1 54 ? 38.126  -16.724 -24.249 1.00 0.00 ? 54 GLY F O      1  
ATOM 5449   H H      . GLY F 1 54 ? 35.796  -14.439 -21.842 1.00 0.00 ? 54 GLY F H      1  
ATOM 5450   H HA2    . GLY F 1 54 ? 36.408  -16.769 -21.910 1.00 0.00 ? 54 GLY F HA2    1  
ATOM 5451   H HA3    . GLY F 1 54 ? 35.691  -16.894 -23.526 1.00 0.00 ? 54 GLY F HA3    1  
ATOM 5452   N N      . LEU F 1 55 ? 38.139  -14.740 -23.175 1.00 0.00 ? 55 LEU F N      1  
ATOM 5453   C CA     . LEU F 1 55 ? 39.290  -14.152 -23.837 1.00 0.00 ? 55 LEU F CA     1  
ATOM 5454   C C      . LEU F 1 55 ? 40.350  -13.801 -22.795 1.00 0.00 ? 55 LEU F C      1  
ATOM 5455   O O      . LEU F 1 55 ? 40.317  -14.316 -21.679 1.00 0.00 ? 55 LEU F O      1  
ATOM 5456   C CB     . LEU F 1 55 ? 38.824  -12.931 -24.638 1.00 0.00 ? 55 LEU F CB     1  
ATOM 5457   C CG     . LEU F 1 55 ? 37.628  -13.226 -25.546 1.00 0.00 ? 55 LEU F CG     1  
ATOM 5458   C CD1    . LEU F 1 55 ? 37.070  -11.949 -26.170 1.00 0.00 ? 55 LEU F CD1    1  
ATOM 5459   C CD2    . LEU F 1 55 ? 38.018  -14.175 -26.678 1.00 0.00 ? 55 LEU F CD2    1  
ATOM 5460   H H      . LEU F 1 55 ? 37.714  -14.181 -22.448 1.00 0.00 ? 55 LEU F H      1  
ATOM 5461   H HA     . LEU F 1 55 ? 39.730  -14.874 -24.525 1.00 0.00 ? 55 LEU F HA     1  
ATOM 5462   H HB2    . LEU F 1 55 ? 38.541  -12.144 -23.940 1.00 0.00 ? 55 LEU F HB2    1  
ATOM 5463   H HB3    . LEU F 1 55 ? 39.648  -12.564 -25.250 1.00 0.00 ? 55 LEU F HB3    1  
ATOM 5464   H HG     . LEU F 1 55 ? 36.828  -13.661 -24.948 1.00 0.00 ? 55 LEU F HG     1  
ATOM 5465   H HD11   . LEU F 1 55 ? 37.876  -11.370 -26.622 1.00 0.00 ? 55 LEU F HD11   1  
ATOM 5466   H HD12   . LEU F 1 55 ? 36.331  -12.200 -26.931 1.00 0.00 ? 55 LEU F HD12   1  
ATOM 5467   H HD13   . LEU F 1 55 ? 36.580  -11.358 -25.395 1.00 0.00 ? 55 LEU F HD13   1  
ATOM 5468   H HD21   . LEU F 1 55 ? 37.147  -14.380 -27.300 1.00 0.00 ? 55 LEU F HD21   1  
ATOM 5469   H HD22   . LEU F 1 55 ? 38.798  -13.720 -27.289 1.00 0.00 ? 55 LEU F HD22   1  
ATOM 5470   H HD23   . LEU F 1 55 ? 38.388  -15.116 -26.273 1.00 0.00 ? 55 LEU F HD23   1  
ATOM 5471   N N      . THR F 1 56 ? 41.326  -12.970 -23.169 1.00 0.00 ? 56 THR F N      1  
ATOM 5472   C CA     . THR F 1 56 ? 42.473  -12.590 -22.351 1.00 0.00 ? 56 THR F CA     1  
ATOM 5473   C C      . THR F 1 56 ? 43.446  -13.740 -22.088 1.00 0.00 ? 56 THR F C      1  
ATOM 5474   O O      . THR F 1 56 ? 44.598  -13.498 -21.732 1.00 0.00 ? 56 THR F O      1  
ATOM 5475   C CB     . THR F 1 56 ? 42.029  -11.910 -21.053 1.00 0.00 ? 56 THR F CB     1  
ATOM 5476   O OG1    . THR F 1 56 ? 40.957  -11.029 -21.305 1.00 0.00 ? 56 THR F OG1    1  
ATOM 5477   C CG2    . THR F 1 56 ? 43.142  -11.074 -20.425 1.00 0.00 ? 56 THR F CG2    1  
ATOM 5478   H H      . THR F 1 56 ? 41.275  -12.566 -24.094 1.00 0.00 ? 56 THR F H      1  
ATOM 5479   H HA     . THR F 1 56 ? 43.020  -11.845 -22.925 1.00 0.00 ? 56 THR F HA     1  
ATOM 5480   H HB     . THR F 1 56 ? 41.706  -12.664 -20.336 1.00 0.00 ? 56 THR F HB     1  
ATOM 5481   H HG1    . THR F 1 56 ? 40.169  -11.561 -21.452 1.00 0.00 ? 56 THR F HG1    1  
ATOM 5482   H HG21   . THR F 1 56 ? 43.567  -10.402 -21.169 1.00 0.00 ? 56 THR F HG21   1  
ATOM 5483   H HG22   . THR F 1 56 ? 42.732  -10.485 -19.603 1.00 0.00 ? 56 THR F HG22   1  
ATOM 5484   H HG23   . THR F 1 56 ? 43.921  -11.726 -20.031 1.00 0.00 ? 56 THR F HG23   1  
ATOM 5485   N N      . ALA F 1 57 ? 43.033  -14.984 -22.344 1.00 0.00 ? 57 ALA F N      1  
ATOM 5486   C CA     . ALA F 1 57 ? 43.871  -16.169 -22.286 1.00 0.00 ? 57 ALA F CA     1  
ATOM 5487   C C      . ALA F 1 57 ? 43.692  -16.985 -23.566 1.00 0.00 ? 57 ALA F C      1  
ATOM 5488   O O      . ALA F 1 57 ? 42.725  -17.737 -23.680 1.00 0.00 ? 57 ALA F O      1  
ATOM 5489   C CB     . ALA F 1 57 ? 43.496  -16.967 -21.038 1.00 0.00 ? 57 ALA F CB     1  
ATOM 5490   H H      . ALA F 1 57 ? 42.059  -15.125 -22.572 1.00 0.00 ? 57 ALA F H      1  
ATOM 5491   H HA     . ALA F 1 57 ? 44.918  -15.879 -22.194 1.00 0.00 ? 57 ALA F HA     1  
ATOM 5492   H HB1    . ALA F 1 57 ? 42.438  -17.231 -21.069 1.00 0.00 ? 57 ALA F HB1    1  
ATOM 5493   H HB2    . ALA F 1 57 ? 44.094  -17.878 -20.993 1.00 0.00 ? 57 ALA F HB2    1  
ATOM 5494   H HB3    . ALA F 1 57 ? 43.689  -16.368 -20.149 1.00 0.00 ? 57 ALA F HB3    1  
ATOM 5495   N N      . PRO F 1 58 ? 44.584  -16.822 -24.553 1.00 0.00 ? 58 PRO F N      1  
ATOM 5496   C CA     . PRO F 1 58 ? 44.509  -17.534 -25.817 1.00 0.00 ? 58 PRO F CA     1  
ATOM 5497   C C      . PRO F 1 58 ? 44.757  -19.035 -25.689 1.00 0.00 ? 58 PRO F C      1  
ATOM 5498   O O      . PRO F 1 58 ? 45.055  -19.550 -24.613 1.00 0.00 ? 58 PRO F O      1  
ATOM 5499   C CB     . PRO F 1 58 ? 45.558  -16.898 -26.728 1.00 0.00 ? 58 PRO F CB     1  
ATOM 5500   C CG     . PRO F 1 58 ? 45.813  -15.521 -26.121 1.00 0.00 ? 58 PRO F CG     1  
ATOM 5501   C CD     . PRO F 1 58 ? 45.534  -15.728 -24.635 1.00 0.00 ? 58 PRO F CD     1  
ATOM 5502   H HA     . PRO F 1 58 ? 43.521  -17.373 -26.252 1.00 0.00 ? 58 PRO F HA     1  
ATOM 5503   H HB2    . PRO F 1 58 ? 46.481  -17.477 -26.699 1.00 0.00 ? 58 PRO F HB2    1  
ATOM 5504   H HB3    . PRO F 1 58 ? 45.191  -16.827 -27.753 1.00 0.00 ? 58 PRO F HB3    1  
ATOM 5505   H HG2    . PRO F 1 58 ? 46.840  -15.199 -26.288 1.00 0.00 ? 58 PRO F HG2    1  
ATOM 5506   H HG3    . PRO F 1 58 ? 45.108  -14.797 -26.534 1.00 0.00 ? 58 PRO F HG3    1  
ATOM 5507   H HD2    . PRO F 1 58 ? 46.455  -16.003 -24.121 1.00 0.00 ? 58 PRO F HD2    1  
ATOM 5508   H HD3    . PRO F 1 58 ? 45.120  -14.813 -24.211 1.00 0.00 ? 58 PRO F HD3    1  
ATOM 5509   N N      . ASP F 1 59 ? 44.701  -19.727 -26.829 1.00 0.00 ? 59 ASP F N      1  
ATOM 5510   C CA     . ASP F 1 59 ? 44.969  -21.152 -26.940 1.00 0.00 ? 59 ASP F CA     1  
ATOM 5511   C C      . ASP F 1 59 ? 46.391  -21.517 -26.517 1.00 0.00 ? 59 ASP F C      1  
ATOM 5512   O O      . ASP F 1 59 ? 46.632  -22.631 -26.054 1.00 0.00 ? 59 ASP F O      1  
ATOM 5513   C CB     . ASP F 1 59 ? 44.743  -21.559 -28.396 1.00 0.00 ? 59 ASP F CB     1  
ATOM 5514   C CG     . ASP F 1 59 ? 44.671  -23.075 -28.558 1.00 0.00 ? 59 ASP F CG     1  
ATOM 5515   O OD1    . ASP F 1 59 ? 43.733  -23.681 -27.994 1.00 0.00 ? 59 ASP F OD1    1  
ATOM 5516   O OD2    . ASP F 1 59 ? 45.527  -23.631 -29.281 1.00 0.00 ? 59 ASP F OD2    1  
ATOM 5517   H H      . ASP F 1 59 ? 44.437  -19.239 -27.674 1.00 0.00 ? 59 ASP F H      1  
ATOM 5518   H HA     . ASP F 1 59 ? 44.266  -21.692 -26.305 1.00 0.00 ? 59 ASP F HA     1  
ATOM 5519   H HB2    . ASP F 1 59 ? 43.813  -21.115 -28.752 1.00 0.00 ? 59 ASP F HB2    1  
ATOM 5520   H HB3    . ASP F 1 59 ? 45.554  -21.158 -29.004 1.00 0.00 ? 59 ASP F HB3    1  
ATOM 5521   O "O5'"  . U   G 2 1  ? 14.207  -2.184  -4.851  1.00 0.00 ? 1  U   G "O5'"  1  
ATOM 5522   C "C5'"  . U   G 2 1  ? 15.570  -2.561  -4.836  1.00 0.00 ? 1  U   G "C5'"  1  
ATOM 5523   C "C4'"  . U   G 2 1  ? 16.051  -2.908  -3.427  1.00 0.00 ? 1  U   G "C4'"  1  
ATOM 5524   O "O4'"  . U   G 2 1  ? 15.909  -1.816  -2.539  1.00 0.00 ? 1  U   G "O4'"  1  
ATOM 5525   C "C3'"  . U   G 2 1  ? 15.294  -4.070  -2.792  1.00 0.00 ? 1  U   G "C3'"  1  
ATOM 5526   O "O3'"  . U   G 2 1  ? 15.696  -5.335  -3.277  1.00 0.00 ? 1  U   G "O3'"  1  
ATOM 5527   C "C2'"  . U   G 2 1  ? 15.658  -3.849  -1.327  1.00 0.00 ? 1  U   G "C2'"  1  
ATOM 5528   O "O2'"  . U   G 2 1  ? 16.934  -4.355  -0.996  1.00 0.00 ? 1  U   G "O2'"  1  
ATOM 5529   C "C1'"  . U   G 2 1  ? 15.691  -2.324  -1.237  1.00 0.00 ? 1  U   G "C1'"  1  
ATOM 5530   N N1     . U   G 2 1  ? 14.411  -1.841  -0.676  1.00 0.00 ? 1  U   G N1     1  
ATOM 5531   C C2     . U   G 2 1  ? 14.328  -1.722  0.704   1.00 0.00 ? 1  U   G C2     1  
ATOM 5532   O O2     . U   G 2 1  ? 15.265  -1.977  1.458   1.00 0.00 ? 1  U   G O2     1  
ATOM 5533   N N3     . U   G 2 1  ? 13.108  -1.314  1.216   1.00 0.00 ? 1  U   G N3     1  
ATOM 5534   C C4     . U   G 2 1  ? 11.976  -1.014  0.478   1.00 0.00 ? 1  U   G C4     1  
ATOM 5535   O O4     . U   G 2 1  ? 10.962  -0.605  1.040   1.00 0.00 ? 1  U   G O4     1  
ATOM 5536   C C5     . U   G 2 1  ? 12.134  -1.226  -0.942  1.00 0.00 ? 1  U   G C5     1  
ATOM 5537   C C6     . U   G 2 1  ? 13.311  -1.638  -1.465  1.00 0.00 ? 1  U   G C6     1  
ATOM 5538   H "H5'"  . U   G 2 1  ? 16.177  -1.744  -5.225  1.00 0.00 ? 1  U   G "H5'"  1  
ATOM 5539   H "H5''" . U   G 2 1  ? 15.709  -3.433  -5.476  1.00 0.00 ? 1  U   G "H5''" 1  
ATOM 5540   H "H4'"  . U   G 2 1  ? 17.105  -3.182  -3.472  1.00 0.00 ? 1  U   G "H4'"  1  
ATOM 5541   H "H3'"  . U   G 2 1  ? 14.223  -3.926  -2.934  1.00 0.00 ? 1  U   G "H3'"  1  
ATOM 5542   H "H2'"  . U   G 2 1  ? 14.894  -4.262  -0.669  1.00 0.00 ? 1  U   G "H2'"  1  
ATOM 5543   H "HO2'" . U   G 2 1  ? 16.836  -5.277  -0.736  1.00 0.00 ? 1  U   G "HO2'" 1  
ATOM 5544   H "H1'"  . U   G 2 1  ? 16.512  -2.023  -0.586  1.00 0.00 ? 1  U   G "H1'"  1  
ATOM 5545   H H3     . U   G 2 1  ? 13.020  -1.284  2.221   1.00 0.00 ? 1  U   G H3     1  
ATOM 5546   H H5     . U   G 2 1  ? 11.286  -1.062  -1.591  1.00 0.00 ? 1  U   G H5     1  
ATOM 5547   H H6     . U   G 2 1  ? 13.389  -1.811  -2.528  1.00 0.00 ? 1  U   G H6     1  
ATOM 5548   H "HO5'" . U   G 2 1  ? 13.895  -2.180  -5.762  1.00 0.00 ? 1  U   G "HO5'" 1  
ATOM 5549   P P      . G   G 2 2  ? 14.739  -6.619  -3.117  1.00 0.00 ? 2  G   G P      1  
ATOM 5550   O OP1    . G   G 2 2  ? 15.305  -7.699  -3.957  1.00 0.00 ? 2  G   G OP1    1  
ATOM 5551   O OP2    . G   G 2 2  ? 13.341  -6.189  -3.340  1.00 0.00 ? 2  G   G OP2    1  
ATOM 5552   O "O5'"  . G   G 2 2  ? 14.883  -7.048  -1.570  1.00 0.00 ? 2  G   G "O5'"  1  
ATOM 5553   C "C5'"  . G   G 2 2  ? 15.982  -7.816  -1.125  1.00 0.00 ? 2  G   G "C5'"  1  
ATOM 5554   C "C4'"  . G   G 2 2  ? 16.125  -7.757  0.396   1.00 0.00 ? 2  G   G "C4'"  1  
ATOM 5555   O "O4'"  . G   G 2 2  ? 16.028  -6.420  0.850   1.00 0.00 ? 2  G   G "O4'"  1  
ATOM 5556   C "C3'"  . G   G 2 2  ? 15.082  -8.566  1.166   1.00 0.00 ? 2  G   G "C3'"  1  
ATOM 5557   O "O3'"  . G   G 2 2  ? 15.401  -9.940  1.262   1.00 0.00 ? 2  G   G "O3'"  1  
ATOM 5558   C "C2'"  . G   G 2 2  ? 15.142  -7.852  2.514   1.00 0.00 ? 2  G   G "C2'"  1  
ATOM 5559   O "O2'"  . G   G 2 2  ? 16.241  -8.262  3.304   1.00 0.00 ? 2  G   G "O2'"  1  
ATOM 5560   C "C1'"  . G   G 2 2  ? 15.367  -6.400  2.100   1.00 0.00 ? 2  G   G "C1'"  1  
ATOM 5561   N N9     . G   G 2 2  ? 14.068  -5.705  2.013   1.00 0.00 ? 2  G   G N9     1  
ATOM 5562   C C8     . G   G 2 2  ? 13.275  -5.451  0.923   1.00 0.00 ? 2  G   G C8     1  
ATOM 5563   N N7     . G   G 2 2  ? 12.197  -4.770  1.199   1.00 0.00 ? 2  G   G N7     1  
ATOM 5564   C C5     . G   G 2 2  ? 12.249  -4.607  2.582   1.00 0.00 ? 2  G   G C5     1  
ATOM 5565   C C6     . G   G 2 2  ? 11.340  -3.973  3.476   1.00 0.00 ? 2  G   G C6     1  
ATOM 5566   O O6     . G   G 2 2  ? 10.301  -3.369  3.216   1.00 0.00 ? 2  G   G O6     1  
ATOM 5567   N N1     . G   G 2 2  ? 11.728  -4.097  4.801   1.00 0.00 ? 2  G   G N1     1  
ATOM 5568   C C2     . G   G 2 2  ? 12.870  -4.737  5.220   1.00 0.00 ? 2  G   G C2     1  
ATOM 5569   N N2     . G   G 2 2  ? 13.076  -4.816  6.534   1.00 0.00 ? 2  G   G N2     1  
ATOM 5570   N N3     . G   G 2 2  ? 13.753  -5.302  4.389   1.00 0.00 ? 2  G   G N3     1  
ATOM 5571   C C4     . G   G 2 2  ? 13.376  -5.203  3.089   1.00 0.00 ? 2  G   G C4     1  
ATOM 5572   H "H5'"  . G   G 2 2  ? 16.896  -7.426  -1.573  1.00 0.00 ? 2  G   G "H5'"  1  
ATOM 5573   H "H5''" . G   G 2 2  ? 15.856  -8.852  -1.436  1.00 0.00 ? 2  G   G "H5''" 1  
ATOM 5574   H "H4'"  . G   G 2 2  ? 17.109  -8.141  0.665   1.00 0.00 ? 2  G   G "H4'"  1  
ATOM 5575   H "H3'"  . G   G 2 2  ? 14.100  -8.429  0.711   1.00 0.00 ? 2  G   G "H3'"  1  
ATOM 5576   H "H2'"  . G   G 2 2  ? 14.204  -7.965  3.057   1.00 0.00 ? 2  G   G "H2'"  1  
ATOM 5577   H "HO2'" . G   G 2 2  ? 16.068  -8.025  4.221   1.00 0.00 ? 2  G   G "HO2'" 1  
ATOM 5578   H "H1'"  . G   G 2 2  ? 15.979  -5.888  2.844   1.00 0.00 ? 2  G   G "H1'"  1  
ATOM 5579   H H8     . G   G 2 2  ? 13.536  -5.764  -0.078  1.00 0.00 ? 2  G   G H8     1  
ATOM 5580   H H1     . G   G 2 2  ? 11.169  -3.618  5.492   1.00 0.00 ? 2  G   G H1     1  
ATOM 5581   H H21    . G   G 2 2  ? 12.398  -4.423  7.173   1.00 0.00 ? 2  G   G H21    1  
ATOM 5582   H H22    . G   G 2 2  ? 13.927  -5.236  6.875   1.00 0.00 ? 2  G   G H22    1  
ATOM 5583   P P      . U   G 2 3  ? 14.295  -11.035 1.679   1.00 0.00 ? 3  U   G P      1  
ATOM 5584   O OP1    . U   G 2 3  ? 14.964  -12.353 1.757   1.00 0.00 ? 3  U   G OP1    1  
ATOM 5585   O OP2    . U   G 2 3  ? 13.123  -10.876 0.791   1.00 0.00 ? 3  U   G OP2    1  
ATOM 5586   O "O5'"  . U   G 2 3  ? 13.805  -10.646 3.162   1.00 0.00 ? 3  U   G "O5'"  1  
ATOM 5587   C "C5'"  . U   G 2 3  ? 14.589  -10.929 4.302   1.00 0.00 ? 3  U   G "C5'"  1  
ATOM 5588   C "C4'"  . U   G 2 3  ? 13.985  -10.271 5.542   1.00 0.00 ? 3  U   G "C4'"  1  
ATOM 5589   O "O4'"  . U   G 2 3  ? 13.785  -8.882  5.346   1.00 0.00 ? 3  U   G "O4'"  1  
ATOM 5590   C "C3'"  . U   G 2 3  ? 12.623  -10.840 5.931   1.00 0.00 ? 3  U   G "C3'"  1  
ATOM 5591   O "O3'"  . U   G 2 3  ? 12.687  -12.074 6.617   1.00 0.00 ? 3  U   G "O3'"  1  
ATOM 5592   C "C2'"  . U   G 2 3  ? 12.115  -9.696  6.803   1.00 0.00 ? 3  U   G "C2'"  1  
ATOM 5593   O "O2'"  . U   G 2 3  ? 12.714  -9.675  8.084   1.00 0.00 ? 3  U   G "O2'"  1  
ATOM 5594   C "C1'"  . U   G 2 3  ? 12.620  -8.473  6.040   1.00 0.00 ? 3  U   G "C1'"  1  
ATOM 5595   N N1     . U   G 2 3  ? 11.565  -7.965  5.135   1.00 0.00 ? 3  U   G N1     1  
ATOM 5596   C C2     . U   G 2 3  ? 10.574  -7.171  5.694   1.00 0.00 ? 3  U   G C2     1  
ATOM 5597   O O2     . U   G 2 3  ? 10.523  -6.903  6.893   1.00 0.00 ? 3  U   G O2     1  
ATOM 5598   N N3     . U   G 2 3  ? 9.613   -6.679  4.827   1.00 0.00 ? 3  U   G N3     1  
ATOM 5599   C C4     . U   G 2 3  ? 9.541   -6.926  3.468   1.00 0.00 ? 3  U   G C4     1  
ATOM 5600   O O4     . U   G 2 3  ? 8.633   -6.443  2.795   1.00 0.00 ? 3  U   G O4     1  
ATOM 5601   C C5     . U   G 2 3  ? 10.590  -7.788  2.977   1.00 0.00 ? 3  U   G C5     1  
ATOM 5602   C C6     . U   G 2 3  ? 11.542  -8.277  3.803   1.00 0.00 ? 3  U   G C6     1  
ATOM 5603   H "H5'"  . U   G 2 3  ? 15.601  -10.551 4.154   1.00 0.00 ? 3  U   G "H5'"  1  
ATOM 5604   H "H5''" . U   G 2 3  ? 14.639  -12.007 4.455   1.00 0.00 ? 3  U   G "H5''" 1  
ATOM 5605   H "H4'"  . U   G 2 3  ? 14.668  -10.412 6.380   1.00 0.00 ? 3  U   G "H4'"  1  
ATOM 5606   H "H3'"  . U   G 2 3  ? 11.999  -10.932 5.042   1.00 0.00 ? 3  U   G "H3'"  1  
ATOM 5607   H "H2'"  . U   G 2 3  ? 11.028  -9.715  6.871   1.00 0.00 ? 3  U   G "H2'"  1  
ATOM 5608   H "HO2'" . U   G 2 3  ? 12.156  -9.161  8.676   1.00 0.00 ? 3  U   G "HO2'" 1  
ATOM 5609   H "H1'"  . U   G 2 3  ? 12.877  -7.690  6.754   1.00 0.00 ? 3  U   G "H1'"  1  
ATOM 5610   H H3     . U   G 2 3  ? 8.904   -6.075  5.218   1.00 0.00 ? 3  U   G H3     1  
ATOM 5611   H H5     . U   G 2 3  ? 10.607  -8.051  1.930   1.00 0.00 ? 3  U   G H5     1  
ATOM 5612   H H6     . U   G 2 3  ? 12.304  -8.926  3.400   1.00 0.00 ? 3  U   G H6     1  
ATOM 5613   P P      . C   G 2 4  ? 11.368  -12.979 6.812   1.00 0.00 ? 4  C   G P      1  
ATOM 5614   O OP1    . C   G 2 4  ? 11.758  -14.191 7.565   1.00 0.00 ? 4  C   G OP1    1  
ATOM 5615   O OP2    . C   G 2 4  ? 10.732  -13.131 5.484   1.00 0.00 ? 4  C   G OP2    1  
ATOM 5616   O "O5'"  . C   G 2 4  ? 10.387  -12.094 7.735   1.00 0.00 ? 4  C   G "O5'"  1  
ATOM 5617   C "C5'"  . C   G 2 4  ? 10.682  -11.840 9.094   1.00 0.00 ? 4  C   G "C5'"  1  
ATOM 5618   C "C4'"  . C   G 2 4  ? 9.837   -10.706 9.681   1.00 0.00 ? 4  C   G "C4'"  1  
ATOM 5619   O "O4'"  . C   G 2 4  ? 9.718   -9.578  8.833   1.00 0.00 ? 4  C   G "O4'"  1  
ATOM 5620   C "C3'"  . C   G 2 4  ? 8.415   -11.158 9.999   1.00 0.00 ? 4  C   G "C3'"  1  
ATOM 5621   O "O3'"  . C   G 2 4  ? 8.356   -11.837 11.238  1.00 0.00 ? 4  C   G "O3'"  1  
ATOM 5622   C "C2'"  . C   G 2 4  ? 7.679   -9.821  9.999   1.00 0.00 ? 4  C   G "C2'"  1  
ATOM 5623   O "O2'"  . C   G 2 4  ? 7.800   -9.137  11.230  1.00 0.00 ? 4  C   G "O2'"  1  
ATOM 5624   C "C1'"  . C   G 2 4  ? 8.419   -9.021  8.932   1.00 0.00 ? 4  C   G "C1'"  1  
ATOM 5625   N N1     . C   G 2 4  ? 7.694   -9.076  7.641   1.00 0.00 ? 4  C   G N1     1  
ATOM 5626   C C2     . C   G 2 4  ? 6.545   -8.310  7.477   1.00 0.00 ? 4  C   G C2     1  
ATOM 5627   O O2     . C   G 2 4  ? 6.004   -7.727  8.414   1.00 0.00 ? 4  C   G O2     1  
ATOM 5628   N N3     . C   G 2 4  ? 5.966   -8.220  6.252   1.00 0.00 ? 4  C   G N3     1  
ATOM 5629   C C4     . C   G 2 4  ? 6.454   -8.931  5.236   1.00 0.00 ? 4  C   G C4     1  
ATOM 5630   N N4     . C   G 2 4  ? 5.825   -8.851  4.064   1.00 0.00 ? 4  C   G N4     1  
ATOM 5631   C C5     . C   G 2 4  ? 7.580   -9.798  5.393   1.00 0.00 ? 4  C   G C5     1  
ATOM 5632   C C6     . C   G 2 4  ? 8.164   -9.837  6.608   1.00 0.00 ? 4  C   G C6     1  
ATOM 5633   H "H5'"  . C   G 2 4  ? 11.735  -11.583 9.196   1.00 0.00 ? 4  C   G "H5'"  1  
ATOM 5634   H "H5''" . C   G 2 4  ? 10.504  -12.748 9.671   1.00 0.00 ? 4  C   G "H5''" 1  
ATOM 5635   H "H4'"  . C   G 2 4  ? 10.299  -10.384 10.614  1.00 0.00 ? 4  C   G "H4'"  1  
ATOM 5636   H "H3'"  . C   G 2 4  ? 8.053   -11.782 9.181   1.00 0.00 ? 4  C   G "H3'"  1  
ATOM 5637   H "H2'"  . C   G 2 4  ? 6.633   -9.964  9.729   1.00 0.00 ? 4  C   G "H2'"  1  
ATOM 5638   H "HO2'" . C   G 2 4  ? 7.311   -9.639  11.890  1.00 0.00 ? 4  C   G "HO2'" 1  
ATOM 5639   H "H1'"  . C   G 2 4  ? 8.491   -7.981  9.253   1.00 0.00 ? 4  C   G "H1'"  1  
ATOM 5640   H H41    . C   G 2 4  ? 5.134   -8.130  3.906   1.00 0.00 ? 4  C   G H41    1  
ATOM 5641   H H42    . C   G 2 4  ? 6.003   -9.565  3.371   1.00 0.00 ? 4  C   G H42    1  
ATOM 5642   H H5     . C   G 2 4  ? 7.985   -10.399 4.594   1.00 0.00 ? 4  C   G H5     1  
ATOM 5643   H H6     . C   G 2 4  ? 9.023   -10.476 6.751   1.00 0.00 ? 4  C   G H6     1  
ATOM 5644   P P      . G   G 2 5  ? 6.972   -12.441 11.793  1.00 0.00 ? 5  G   G P      1  
ATOM 5645   O OP1    . G   G 2 5  ? 7.277   -13.248 12.997  1.00 0.00 ? 5  G   G OP1    1  
ATOM 5646   O OP2    . G   G 2 5  ? 6.254   -13.067 10.660  1.00 0.00 ? 5  G   G OP2    1  
ATOM 5647   O "O5'"  . G   G 2 5  ? 6.167   -11.128 12.266  1.00 0.00 ? 5  G   G "O5'"  1  
ATOM 5648   C "C5'"  . G   G 2 5  ? 4.777   -11.169 12.506  1.00 0.00 ? 5  G   G "C5'"  1  
ATOM 5649   C "C4'"  . G   G 2 5  ? 4.085   -9.926  11.943  1.00 0.00 ? 5  G   G "C4'"  1  
ATOM 5650   O "O4'"  . G   G 2 5  ? 4.430   -9.677  10.595  1.00 0.00 ? 5  G   G "O4'"  1  
ATOM 5651   C "C3'"  . G   G 2 5  ? 2.567   -10.080 12.036  1.00 0.00 ? 5  G   G "C3'"  1  
ATOM 5652   O "O3'"  . G   G 2 5  ? 2.048   -9.195  13.008  1.00 0.00 ? 5  G   G "O3'"  1  
ATOM 5653   C "C2'"  . G   G 2 5  ? 2.061   -9.818  10.617  1.00 0.00 ? 5  G   G "C2'"  1  
ATOM 5654   O "O2'"  . G   G 2 5  ? 1.482   -8.537  10.470  1.00 0.00 ? 5  G   G "O2'"  1  
ATOM 5655   C "C1'"  . G   G 2 5  ? 3.314   -9.872  9.751   1.00 0.00 ? 5  G   G "C1'"  1  
ATOM 5656   N N9     . G   G 2 5  ? 3.515   -11.111 8.970   1.00 0.00 ? 5  G   G N9     1  
ATOM 5657   C C8     . G   G 2 5  ? 4.116   -11.203 7.740   1.00 0.00 ? 5  G   G C8     1  
ATOM 5658   N N7     . G   G 2 5  ? 4.352   -12.422 7.345   1.00 0.00 ? 5  G   G N7     1  
ATOM 5659   C C5     . G   G 2 5  ? 3.827   -13.205 8.371   1.00 0.00 ? 5  G   G C5     1  
ATOM 5660   C C6     . G   G 2 5  ? 3.750   -14.623 8.488   1.00 0.00 ? 5  G   G C6     1  
ATOM 5661   O O6     . G   G 2 5  ? 4.169   -15.483 7.715   1.00 0.00 ? 5  G   G O6     1  
ATOM 5662   N N1     . G   G 2 5  ? 3.099   -15.030 9.642   1.00 0.00 ? 5  G   G N1     1  
ATOM 5663   C C2     . G   G 2 5  ? 2.571   -14.163 10.571  1.00 0.00 ? 5  G   G C2     1  
ATOM 5664   N N2     . G   G 2 5  ? 1.930   -14.698 11.610  1.00 0.00 ? 5  G   G N2     1  
ATOM 5665   N N3     . G   G 2 5  ? 2.624   -12.831 10.464  1.00 0.00 ? 5  G   G N3     1  
ATOM 5666   C C4     . G   G 2 5  ? 3.285   -12.414 9.353   1.00 0.00 ? 5  G   G C4     1  
ATOM 5667   H "H5'"  . G   G 2 5  ? 4.596   -11.225 13.580  1.00 0.00 ? 5  G   G "H5'"  1  
ATOM 5668   H "H5''" . G   G 2 5  ? 4.353   -12.058 12.039  1.00 0.00 ? 5  G   G "H5''" 1  
ATOM 5669   H "H4'"  . G   G 2 5  ? 4.388   -9.065  12.539  1.00 0.00 ? 5  G   G "H4'"  1  
ATOM 5670   H "H3'"  . G   G 2 5  ? 2.329   -11.104 12.319  1.00 0.00 ? 5  G   G "H3'"  1  
ATOM 5671   H "H2'"  . G   G 2 5  ? 1.360   -10.587 10.298  1.00 0.00 ? 5  G   G "H2'"  1  
ATOM 5672   H "HO2'" . G   G 2 5  ? 0.710   -8.490  11.044  1.00 0.00 ? 5  G   G "HO2'" 1  
ATOM 5673   H "H1'"  . G   G 2 5  ? 3.221   -9.041  9.053   1.00 0.00 ? 5  G   G "H1'"  1  
ATOM 5674   H H8     . G   G 2 5  ? 4.411   -10.334 7.170   1.00 0.00 ? 5  G   G H8     1  
ATOM 5675   H H1     . G   G 2 5  ? 3.026   -16.023 9.804   1.00 0.00 ? 5  G   G H1     1  
ATOM 5676   H H21    . G   G 2 5  ? 1.863   -15.700 11.715  1.00 0.00 ? 5  G   G H21    1  
ATOM 5677   H H22    . G   G 2 5  ? 1.519   -14.085 12.299  1.00 0.00 ? 5  G   G H22    1  
ATOM 5678   P P      . A   G 2 6  ? 0.651   -9.493  13.746  1.00 0.00 ? 6  A   G P      1  
ATOM 5679   O OP1    . A   G 2 6  ? 0.310   -8.307  14.564  1.00 0.00 ? 6  A   G OP1    1  
ATOM 5680   O OP2    . A   G 2 6  ? 0.747   -10.819 14.396  1.00 0.00 ? 6  A   G OP2    1  
ATOM 5681   O "O5'"  . A   G 2 6  ? -0.409  -9.581  12.536  1.00 0.00 ? 6  A   G "O5'"  1  
ATOM 5682   C "C5'"  . A   G 2 6  ? -0.764  -10.829 11.980  1.00 0.00 ? 6  A   G "C5'"  1  
ATOM 5683   C "C4'"  . A   G 2 6  ? -1.764  -10.665 10.838  1.00 0.00 ? 6  A   G "C4'"  1  
ATOM 5684   O "O4'"  . A   G 2 6  ? -1.202  -10.099 9.668   1.00 0.00 ? 6  A   G "O4'"  1  
ATOM 5685   C "C3'"  . A   G 2 6  ? -2.258  -12.038 10.400  1.00 0.00 ? 6  A   G "C3'"  1  
ATOM 5686   O "O3'"  . A   G 2 6  ? -3.186  -12.662 11.258  1.00 0.00 ? 6  A   G "O3'"  1  
ATOM 5687   C "C2'"  . A   G 2 6  ? -2.829  -11.709 9.028   1.00 0.00 ? 6  A   G "C2'"  1  
ATOM 5688   O "O2'"  . A   G 2 6  ? -4.084  -11.067 9.112   1.00 0.00 ? 6  A   G "O2'"  1  
ATOM 5689   C "C1'"  . A   G 2 6  ? -1.790  -10.710 8.532   1.00 0.00 ? 6  A   G "C1'"  1  
ATOM 5690   N N9     . A   G 2 6  ? -0.751  -11.437 7.777   1.00 0.00 ? 6  A   G N9     1  
ATOM 5691   C C8     . A   G 2 6  ? 0.228   -12.258 8.278   1.00 0.00 ? 6  A   G C8     1  
ATOM 5692   N N7     . A   G 2 6  ? 0.908   -12.901 7.372   1.00 0.00 ? 6  A   G N7     1  
ATOM 5693   C C5     . A   G 2 6  ? 0.351   -12.453 6.178   1.00 0.00 ? 6  A   G C5     1  
ATOM 5694   C C6     . A   G 2 6  ? 0.623   -12.731 4.828   1.00 0.00 ? 6  A   G C6     1  
ATOM 5695   N N6     . A   G 2 6  ? 1.604   -13.553 4.440   1.00 0.00 ? 6  A   G N6     1  
ATOM 5696   N N1     . A   G 2 6  ? -0.140  -12.177 3.880   1.00 0.00 ? 6  A   G N1     1  
ATOM 5697   C C2     . A   G 2 6  ? -1.113  -11.359 4.254   1.00 0.00 ? 6  A   G C2     1  
ATOM 5698   N N3     . A   G 2 6  ? -1.461  -10.985 5.477   1.00 0.00 ? 6  A   G N3     1  
ATOM 5699   C C4     . A   G 2 6  ? -0.675  -11.576 6.411   1.00 0.00 ? 6  A   G C4     1  
ATOM 5700   H "H5'"  . A   G 2 6  ? -1.220  -11.439 12.758  1.00 0.00 ? 6  A   G "H5'"  1  
ATOM 5701   H "H5''" . A   G 2 6  ? 0.118   -11.358 11.624  1.00 0.00 ? 6  A   G "H5''" 1  
ATOM 5702   H "H4'"  . A   G 2 6  ? -2.600  -10.048 11.166  1.00 0.00 ? 6  A   G "H4'"  1  
ATOM 5703   H "H3'"  . A   G 2 6  ? -1.387  -12.682 10.281  1.00 0.00 ? 6  A   G "H3'"  1  
ATOM 5704   H "H2'"  . A   G 2 6  ? -2.876  -12.595 8.395   1.00 0.00 ? 6  A   G "H2'"  1  
ATOM 5705   H "HO2'" . A   G 2 6  ? -4.691  -11.636 9.596   1.00 0.00 ? 6  A   G "HO2'" 1  
ATOM 5706   H "H1'"  . A   G 2 6  ? -2.279  -9.971  7.897   1.00 0.00 ? 6  A   G "H1'"  1  
ATOM 5707   H H8     . A   G 2 6  ? 0.406   -12.374 9.336   1.00 0.00 ? 6  A   G H8     1  
ATOM 5708   H H61    . A   G 2 6  ? 1.846   -13.615 3.462   1.00 0.00 ? 6  A   G H61    1  
ATOM 5709   H H62    . A   G 2 6  ? 2.230   -13.925 5.139   1.00 0.00 ? 6  A   G H62    1  
ATOM 5710   H H2     . A   G 2 6  ? -1.713  -10.949 3.453   1.00 0.00 ? 6  A   G H2     1  
ATOM 5711   P P      . C   G 2 7  ? -3.379  -14.257 11.170  1.00 0.00 ? 7  C   G P      1  
ATOM 5712   O OP1    . C   G 2 7  ? -3.912  -14.727 12.468  1.00 0.00 ? 7  C   G OP1    1  
ATOM 5713   O OP2    . C   G 2 7  ? -2.126  -14.842 10.640  1.00 0.00 ? 7  C   G OP2    1  
ATOM 5714   O "O5'"  . C   G 2 7  ? -4.514  -14.447 10.044  1.00 0.00 ? 7  C   G "O5'"  1  
ATOM 5715   C "C5'"  . C   G 2 7  ? -5.847  -14.049 10.290  1.00 0.00 ? 7  C   G "C5'"  1  
ATOM 5716   C "C4'"  . C   G 2 7  ? -6.829  -14.663 9.293   1.00 0.00 ? 7  C   G "C4'"  1  
ATOM 5717   O "O4'"  . C   G 2 7  ? -6.653  -16.065 9.202   1.00 0.00 ? 7  C   G "O4'"  1  
ATOM 5718   C "C3'"  . C   G 2 7  ? -8.265  -14.436 9.759   1.00 0.00 ? 7  C   G "C3'"  1  
ATOM 5719   O "O3'"  . C   G 2 7  ? -8.866  -13.244 9.293   1.00 0.00 ? 7  C   G "O3'"  1  
ATOM 5720   C "C2'"  . C   G 2 7  ? -8.973  -15.651 9.168   1.00 0.00 ? 7  C   G "C2'"  1  
ATOM 5721   O "O2'"  . C   G 2 7  ? -9.398  -15.408 7.844   1.00 0.00 ? 7  C   G "O2'"  1  
ATOM 5722   C "C1'"  . C   G 2 7  ? -7.899  -16.737 9.160   1.00 0.00 ? 7  C   G "C1'"  1  
ATOM 5723   N N1     . C   G 2 7  ? -8.060  -17.663 10.308  1.00 0.00 ? 7  C   G N1     1  
ATOM 5724   C C2     . C   G 2 7  ? -9.272  -18.321 10.473  1.00 0.00 ? 7  C   G C2     1  
ATOM 5725   O O2     . C   G 2 7  ? -10.107 -18.362 9.571   1.00 0.00 ? 7  C   G O2     1  
ATOM 5726   N N3     . C   G 2 7  ? -9.549  -18.925 11.657  1.00 0.00 ? 7  C   G N3     1  
ATOM 5727   C C4     . C   G 2 7  ? -8.612  -18.977 12.605  1.00 0.00 ? 7  C   G C4     1  
ATOM 5728   N N4     . C   G 2 7  ? -8.927  -19.557 13.763  1.00 0.00 ? 7  C   G N4     1  
ATOM 5729   C C5     . C   G 2 7  ? -7.283  -18.504 12.374  1.00 0.00 ? 7  C   G C5     1  
ATOM 5730   C C6     . C   G 2 7  ? -7.047  -17.876 11.203  1.00 0.00 ? 7  C   G C6     1  
ATOM 5731   H "H5'"  . C   G 2 7  ? -5.904  -12.963 10.228  1.00 0.00 ? 7  C   G "H5'"  1  
ATOM 5732   H "H5''" . C   G 2 7  ? -6.141  -14.350 11.295  1.00 0.00 ? 7  C   G "H5''" 1  
ATOM 5733   H "H4'"  . C   G 2 7  ? -6.694  -14.207 8.311   1.00 0.00 ? 7  C   G "H4'"  1  
ATOM 5734   H "H3'"  . C   G 2 7  ? -8.315  -14.495 10.846  1.00 0.00 ? 7  C   G "H3'"  1  
ATOM 5735   H "H2'"  . C   G 2 7  ? -9.816  -15.935 9.796   1.00 0.00 ? 7  C   G "H2'"  1  
ATOM 5736   H "HO2'" . C   G 2 7  ? -9.713  -14.499 7.797   1.00 0.00 ? 7  C   G "HO2'" 1  
ATOM 5737   H "H1'"  . C   G 2 7  ? -7.984  -17.305 8.233   1.00 0.00 ? 7  C   G "H1'"  1  
ATOM 5738   H H41    . C   G 2 7  ? -9.851  -19.942 13.883  1.00 0.00 ? 7  C   G H41    1  
ATOM 5739   H H42    . C   G 2 7  ? -8.238  -19.615 14.500  1.00 0.00 ? 7  C   G H42    1  
ATOM 5740   H H5     . C   G 2 7  ? -6.477  -18.631 13.080  1.00 0.00 ? 7  C   G H5     1  
ATOM 5741   H H6     . C   G 2 7  ? -6.041  -17.555 10.975  1.00 0.00 ? 7  C   G H6     1  
ATOM 5742   P P      . G   G 2 8  ? -8.554  -11.813 9.960   1.00 0.00 ? 8  G   G P      1  
ATOM 5743   O OP1    . G   G 2 8  ? -7.968  -12.031 11.303  1.00 0.00 ? 8  G   G OP1    1  
ATOM 5744   O OP2    . G   G 2 8  ? -9.772  -10.983 9.827   1.00 0.00 ? 8  G   G OP2    1  
ATOM 5745   O "O5'"  . G   G 2 8  ? -7.413  -11.218 8.993   1.00 0.00 ? 8  G   G "O5'"  1  
ATOM 5746   C "C5'"  . G   G 2 8  ? -7.190  -9.828  8.876   1.00 0.00 ? 8  G   G "C5'"  1  
ATOM 5747   C "C4'"  . G   G 2 8  ? -7.156  -9.379  7.413   1.00 0.00 ? 8  G   G "C4'"  1  
ATOM 5748   O "O4'"  . G   G 2 8  ? -6.075  -9.993  6.735   1.00 0.00 ? 8  G   G "O4'"  1  
ATOM 5749   C "C3'"  . G   G 2 8  ? -8.452  -9.735  6.686   1.00 0.00 ? 8  G   G "C3'"  1  
ATOM 5750   O "O3'"  . G   G 2 8  ? -8.779  -8.712  5.763   1.00 0.00 ? 8  G   G "O3'"  1  
ATOM 5751   C "C2'"  . G   G 2 8  ? -8.061  -11.055 6.030   1.00 0.00 ? 8  G   G "C2'"  1  
ATOM 5752   O "O2'"  . G   G 2 8  ? -8.745  -11.308 4.822   1.00 0.00 ? 8  G   G "O2'"  1  
ATOM 5753   C "C1'"  . G   G 2 8  ? -6.559  -10.923 5.787   1.00 0.00 ? 8  G   G "C1'"  1  
ATOM 5754   N N9     . G   G 2 8  ? -5.820  -12.200 5.901   1.00 0.00 ? 8  G   G N9     1  
ATOM 5755   C C8     . G   G 2 8  ? -4.489  -12.367 6.185   1.00 0.00 ? 8  G   G C8     1  
ATOM 5756   N N7     . G   G 2 8  ? -4.067  -13.600 6.113   1.00 0.00 ? 8  G   G N7     1  
ATOM 5757   C C5     . G   G 2 8  ? -5.201  -14.309 5.723   1.00 0.00 ? 8  G   G C5     1  
ATOM 5758   C C6     . G   G 2 8  ? -5.364  -15.692 5.428   1.00 0.00 ? 8  G   G C6     1  
ATOM 5759   O O6     . G   G 2 8  ? -4.511  -16.578 5.396   1.00 0.00 ? 8  G   G O6     1  
ATOM 5760   N N1     . G   G 2 8  ? -6.675  -16.018 5.115   1.00 0.00 ? 8  G   G N1     1  
ATOM 5761   C C2     . G   G 2 8  ? -7.684  -15.096 4.972   1.00 0.00 ? 8  G   G C2     1  
ATOM 5762   N N2     . G   G 2 8  ? -8.856  -15.545 4.527   1.00 0.00 ? 8  G   G N2     1  
ATOM 5763   N N3     . G   G 2 8  ? -7.518  -13.784 5.154   1.00 0.00 ? 8  G   G N3     1  
ATOM 5764   C C4     . G   G 2 8  ? -6.269  -13.458 5.570   1.00 0.00 ? 8  G   G C4     1  
ATOM 5765   H "H5'"  . G   G 2 8  ? -6.240  -9.575  9.347   1.00 0.00 ? 8  G   G "H5'"  1  
ATOM 5766   H "H5''" . G   G 2 8  ? -7.979  -9.278  9.389   1.00 0.00 ? 8  G   G "H5''" 1  
ATOM 5767   H "H4'"  . G   G 2 8  ? -7.021  -8.298  7.389   1.00 0.00 ? 8  G   G "H4'"  1  
ATOM 5768   H "H3'"  . G   G 2 8  ? -9.254  -9.890  7.408   1.00 0.00 ? 8  G   G "H3'"  1  
ATOM 5769   H "H2'"  . G   G 2 8  ? -8.250  -11.864 6.737   1.00 0.00 ? 8  G   G "H2'"  1  
ATOM 5770   H "HO2'" . G   G 2 8  ? -8.528  -12.210 4.562   1.00 0.00 ? 8  G   G "HO2'" 1  
ATOM 5771   H "H1'"  . G   G 2 8  ? -6.409  -10.521 4.785   1.00 0.00 ? 8  G   G "H1'"  1  
ATOM 5772   H H8     . G   G 2 8  ? -3.850  -11.538 6.453   1.00 0.00 ? 8  G   G H8     1  
ATOM 5773   H H1     . G   G 2 8  ? -6.919  -16.994 5.044   1.00 0.00 ? 8  G   G H1     1  
ATOM 5774   H H21    . G   G 2 8  ? -8.939  -16.515 4.256   1.00 0.00 ? 8  G   G H21    1  
ATOM 5775   H H22    . G   G 2 8  ? -9.606  -14.895 4.340   1.00 0.00 ? 8  G   G H22    1  
ATOM 5776   P P      . G   G 2 9  ? -10.304 -8.376  5.356   1.00 0.00 ? 9  G   G P      1  
ATOM 5777   O OP1    . G   G 2 9  ? -10.394 -6.912  5.157   1.00 0.00 ? 9  G   G OP1    1  
ATOM 5778   O OP2    . G   G 2 9  ? -11.217 -9.014  6.332   1.00 0.00 ? 9  G   G OP2    1  
ATOM 5779   O "O5'"  . G   G 2 9  ? -10.554 -9.073  3.924   1.00 0.00 ? 9  G   G "O5'"  1  
ATOM 5780   C "C5'"  . G   G 2 9  ? -9.684  -8.817  2.843   1.00 0.00 ? 9  G   G "C5'"  1  
ATOM 5781   C "C4'"  . G   G 2 9  ? -10.203 -9.350  1.507   1.00 0.00 ? 9  G   G "C4'"  1  
ATOM 5782   O "O4'"  . G   G 2 9  ? -10.062 -10.755 1.455   1.00 0.00 ? 9  G   G "O4'"  1  
ATOM 5783   C "C3'"  . G   G 2 9  ? -11.665 -9.022  1.205   1.00 0.00 ? 9  G   G "C3'"  1  
ATOM 5784   O "O3'"  . G   G 2 9  ? -11.776 -8.697  -0.166  1.00 0.00 ? 9  G   G "O3'"  1  
ATOM 5785   C "C2'"  . G   G 2 9  ? -12.364 -10.348 1.503   1.00 0.00 ? 9  G   G "C2'"  1  
ATOM 5786   O "O2'"  . G   G 2 9  ? -13.567 -10.529 0.784   1.00 0.00 ? 9  G   G "O2'"  1  
ATOM 5787   C "C1'"  . G   G 2 9  ? -11.291 -11.351 1.090   1.00 0.00 ? 9  G   G "C1'"  1  
ATOM 5788   N N9     . G   G 2 9  ? -11.432 -12.641 1.790   1.00 0.00 ? 9  G   G N9     1  
ATOM 5789   C C8     . G   G 2 9  ? -11.072 -12.928 3.078   1.00 0.00 ? 9  G   G C8     1  
ATOM 5790   N N7     . G   G 2 9  ? -11.242 -14.176 3.418   1.00 0.00 ? 9  G   G N7     1  
ATOM 5791   C C5     . G   G 2 9  ? -11.752 -14.763 2.261   1.00 0.00 ? 9  G   G C5     1  
ATOM 5792   C C6     . G   G 2 9  ? -12.126 -16.113 2.003   1.00 0.00 ? 9  G   G C6     1  
ATOM 5793   O O6     . G   G 2 9  ? -12.008 -17.097 2.729   1.00 0.00 ? 9  G   G O6     1  
ATOM 5794   N N1     . G   G 2 9  ? -12.696 -16.272 0.750   1.00 0.00 ? 9  G   G N1     1  
ATOM 5795   C C2     . G   G 2 9  ? -12.747 -15.281 -0.202  1.00 0.00 ? 9  G   G C2     1  
ATOM 5796   N N2     . G   G 2 9  ? -13.320 -15.596 -1.362  1.00 0.00 ? 9  G   G N2     1  
ATOM 5797   N N3     . G   G 2 9  ? -12.318 -14.030 -0.005  1.00 0.00 ? 9  G   G N3     1  
ATOM 5798   C C4     . G   G 2 9  ? -11.864 -13.832 1.257   1.00 0.00 ? 9  G   G C4     1  
ATOM 5799   H "H5'"  . G   G 2 9  ? -8.717  -9.271  3.055   1.00 0.00 ? 9  G   G "H5'"  1  
ATOM 5800   H "H5''" . G   G 2 9  ? -9.526  -7.745  2.744   1.00 0.00 ? 9  G   G "H5''" 1  
ATOM 5801   H "H4'"  . G   G 2 9  ? -9.587  -8.906  0.726   1.00 0.00 ? 9  G   G "H4'"  1  
ATOM 5802   H "H3'"  . G   G 2 9  ? -12.030 -8.219  1.847   1.00 0.00 ? 9  G   G "H3'"  1  
ATOM 5803   H "H2'"  . G   G 2 9  ? -12.546 -10.425 2.576   1.00 0.00 ? 9  G   G "H2'"  1  
ATOM 5804   H "HO2'" . G   G 2 9  ? -13.982 -9.667  0.668   1.00 0.00 ? 9  G   G "HO2'" 1  
ATOM 5805   H "H1'"  . G   G 2 9  ? -11.318 -11.520 0.014   1.00 0.00 ? 9  G   G "H1'"  1  
ATOM 5806   H H8     . G   G 2 9  ? -10.650 -12.173 3.722   1.00 0.00 ? 9  G   G H8     1  
ATOM 5807   H H1     . G   G 2 9  ? -13.104 -17.169 0.528   1.00 0.00 ? 9  G   G H1     1  
ATOM 5808   H H21    . G   G 2 9  ? -13.776 -16.491 -1.482  1.00 0.00 ? 9  G   G H21    1  
ATOM 5809   H H22    . G   G 2 9  ? -13.432 -14.878 -2.065  1.00 0.00 ? 9  G   G H22    1  
ATOM 5810   P P      . A   G 2 10 ? -12.700 -7.480  -0.660  1.00 0.00 ? 10 A   G P      1  
ATOM 5811   O OP1    . A   G 2 10 ? -13.938 -7.462  0.152   1.00 0.00 ? 10 A   G OP1    1  
ATOM 5812   O OP2    . A   G 2 10 ? -12.789 -7.557  -2.136  1.00 0.00 ? 10 A   G OP2    1  
ATOM 5813   O "O5'"  . A   G 2 10 ? -11.807 -6.198  -0.274  1.00 0.00 ? 10 A   G "O5'"  1  
ATOM 5814   C "C5'"  . A   G 2 10 ? -10.697 -5.848  -1.073  1.00 0.00 ? 10 A   G "C5'"  1  
ATOM 5815   C "C4'"  . A   G 2 10 ? -9.638  -5.084  -0.283  1.00 0.00 ? 10 A   G "C4'"  1  
ATOM 5816   O "O4'"  . A   G 2 10 ? -9.191  -5.810  0.846   1.00 0.00 ? 10 A   G "O4'"  1  
ATOM 5817   C "C3'"  . A   G 2 10 ? -8.399  -4.859  -1.146  1.00 0.00 ? 10 A   G "C3'"  1  
ATOM 5818   O "O3'"  . A   G 2 10 ? -8.512  -3.704  -1.955  1.00 0.00 ? 10 A   G "O3'"  1  
ATOM 5819   C "C2'"  . A   G 2 10 ? -7.303  -4.720  -0.093  1.00 0.00 ? 10 A   G "C2'"  1  
ATOM 5820   O "O2'"  . A   G 2 10 ? -7.068  -3.358  0.199   1.00 0.00 ? 10 A   G "O2'"  1  
ATOM 5821   C "C1'"  . A   G 2 10 ? -7.871  -5.407  1.150   1.00 0.00 ? 10 A   G "C1'"  1  
ATOM 5822   N N9     . A   G 2 10 ? -7.069  -6.572  1.571   1.00 0.00 ? 10 A   G N9     1  
ATOM 5823   C C8     . A   G 2 10 ? -6.667  -7.628  0.800   1.00 0.00 ? 10 A   G C8     1  
ATOM 5824   N N7     . A   G 2 10 ? -5.832  -8.436  1.387   1.00 0.00 ? 10 A   G N7     1  
ATOM 5825   C C5     . A   G 2 10 ? -5.699  -7.896  2.663   1.00 0.00 ? 10 A   G C5     1  
ATOM 5826   C C6     . A   G 2 10 ? -4.950  -8.266  3.794   1.00 0.00 ? 10 A   G C6     1  
ATOM 5827   N N6     . A   G 2 10 ? -4.143  -9.331  3.838   1.00 0.00 ? 10 A   G N6     1  
ATOM 5828   N N1     . A   G 2 10 ? -5.026  -7.515  4.900   1.00 0.00 ? 10 A   G N1     1  
ATOM 5829   C C2     . A   G 2 10 ? -5.825  -6.458  4.888   1.00 0.00 ? 10 A   G C2     1  
ATOM 5830   N N3     . A   G 2 10 ? -6.595  -6.008  3.908   1.00 0.00 ? 10 A   G N3     1  
ATOM 5831   C C4     . A   G 2 10 ? -6.477  -6.775  2.796   1.00 0.00 ? 10 A   G C4     1  
ATOM 5832   H "H5'"  . A   G 2 10 ? -11.034 -5.234  -1.908  1.00 0.00 ? 10 A   G "H5'"  1  
ATOM 5833   H "H5''" . A   G 2 10 ? -10.242 -6.754  -1.471  1.00 0.00 ? 10 A   G "H5''" 1  
ATOM 5834   H "H4'"  . A   G 2 10 ? -10.036 -4.120  0.035   1.00 0.00 ? 10 A   G "H4'"  1  
ATOM 5835   H "H3'"  . A   G 2 10 ? -8.186  -5.745  -1.745  1.00 0.00 ? 10 A   G "H3'"  1  
ATOM 5836   H "H2'"  . A   G 2 10 ? -6.398  -5.211  -0.455  1.00 0.00 ? 10 A   G "H2'"  1  
ATOM 5837   H "HO2'" . A   G 2 10 ? -7.288  -2.844  -0.585  1.00 0.00 ? 10 A   G "HO2'" 1  
ATOM 5838   H "H1'"  . A   G 2 10 ? -7.880  -4.696  1.973   1.00 0.00 ? 10 A   G "H1'"  1  
ATOM 5839   H H8     . A   G 2 10 ? -6.986  -7.745  -0.224  1.00 0.00 ? 10 A   G H8     1  
ATOM 5840   H H61    . A   G 2 10 ? -3.616  -9.516  4.679   1.00 0.00 ? 10 A   G H61    1  
ATOM 5841   H H62    . A   G 2 10 ? -4.002  -9.882  3.002   1.00 0.00 ? 10 A   G H62    1  
ATOM 5842   H H2     . A   G 2 10 ? -5.839  -5.881  5.801   1.00 0.00 ? 10 A   G H2     1  
ATOM 5843   P P      . U   G 2 11 ? -8.554  -3.798  -3.563  1.00 0.00 ? 11 U   G P      1  
ATOM 5844   O OP1    . U   G 2 11 ? -9.262  -2.600  -4.068  1.00 0.00 ? 11 U   G OP1    1  
ATOM 5845   O OP2    . U   G 2 11 ? -9.046  -5.143  -3.938  1.00 0.00 ? 11 U   G OP2    1  
ATOM 5846   O "O5'"  . U   G 2 11 ? -7.008  -3.677  -4.000  1.00 0.00 ? 11 U   G "O5'"  1  
ATOM 5847   C "C5'"  . U   G 2 11 ? -6.042  -4.526  -3.418  1.00 0.00 ? 11 U   G "C5'"  1  
ATOM 5848   C "C4'"  . U   G 2 11 ? -4.672  -4.482  -4.097  1.00 0.00 ? 11 U   G "C4'"  1  
ATOM 5849   O "O4'"  . U   G 2 11 ? -4.704  -5.165  -5.333  1.00 0.00 ? 11 U   G "O4'"  1  
ATOM 5850   C "C3'"  . U   G 2 11 ? -4.157  -3.065  -4.339  1.00 0.00 ? 11 U   G "C3'"  1  
ATOM 5851   O "O3'"  . U   G 2 11 ? -2.804  -3.025  -3.932  1.00 0.00 ? 11 U   G "O3'"  1  
ATOM 5852   C "C2'"  . U   G 2 11 ? -4.298  -2.920  -5.853  1.00 0.00 ? 11 U   G "C2'"  1  
ATOM 5853   O "O2'"  . U   G 2 11 ? -3.365  -2.025  -6.424  1.00 0.00 ? 11 U   G "O2'"  1  
ATOM 5854   C "C1'"  . U   G 2 11 ? -4.065  -4.360  -6.302  1.00 0.00 ? 11 U   G "C1'"  1  
ATOM 5855   N N1     . U   G 2 11 ? -4.622  -4.612  -7.647  1.00 0.00 ? 11 U   G N1     1  
ATOM 5856   C C2     . U   G 2 11 ? -3.743  -4.703  -8.717  1.00 0.00 ? 11 U   G C2     1  
ATOM 5857   O O2     . U   G 2 11 ? -2.525  -4.591  -8.598  1.00 0.00 ? 11 U   G O2     1  
ATOM 5858   N N3     . U   G 2 11 ? -4.306  -4.946  -9.961  1.00 0.00 ? 11 U   G N3     1  
ATOM 5859   C C4     . U   G 2 11 ? -5.658  -5.107  -10.218 1.00 0.00 ? 11 U   G C4     1  
ATOM 5860   O O4     . U   G 2 11 ? -6.053  -5.319  -11.362 1.00 0.00 ? 11 U   G O4     1  
ATOM 5861   C C5     . U   G 2 11 ? -6.497  -5.000  -9.046  1.00 0.00 ? 11 U   G C5     1  
ATOM 5862   C C6     . U   G 2 11 ? -5.972  -4.753  -7.825  1.00 0.00 ? 11 U   G C6     1  
ATOM 5863   H "H5'"  . U   G 2 11 ? -6.421  -5.547  -3.463  1.00 0.00 ? 11 U   G "H5'"  1  
ATOM 5864   H "H5''" . U   G 2 11 ? -5.911  -4.244  -2.374  1.00 0.00 ? 11 U   G "H5''" 1  
ATOM 5865   H "H4'"  . U   G 2 11 ? -3.958  -4.988  -3.447  1.00 0.00 ? 11 U   G "H4'"  1  
ATOM 5866   H "H3'"  . U   G 2 11 ? -4.760  -2.329  -3.808  1.00 0.00 ? 11 U   G "H3'"  1  
ATOM 5867   H "H2'"  . U   G 2 11 ? -5.316  -2.614  -6.092  1.00 0.00 ? 11 U   G "H2'"  1  
ATOM 5868   H "HO2'" . U   G 2 11 ? -3.113  -1.384  -5.749  1.00 0.00 ? 11 U   G "HO2'" 1  
ATOM 5869   H "H1'"  . U   G 2 11 ? -2.993  -4.565  -6.285  1.00 0.00 ? 11 U   G "H1'"  1  
ATOM 5870   H H3     . U   G 2 11 ? -3.679  -5.008  -10.747 1.00 0.00 ? 11 U   G H3     1  
ATOM 5871   H H5     . U   G 2 11 ? -7.563  -5.125  -9.157  1.00 0.00 ? 11 U   G H5     1  
ATOM 5872   H H6     . U   G 2 11 ? -6.620  -4.688  -6.961  1.00 0.00 ? 11 U   G H6     1  
ATOM 5873   P P      . A   G 2 12 ? -2.175  -1.682  -3.316  1.00 0.00 ? 12 A   G P      1  
ATOM 5874   O OP1    . A   G 2 12 ? -2.601  -0.541  -4.158  1.00 0.00 ? 12 A   G OP1    1  
ATOM 5875   O OP2    . A   G 2 12 ? -0.734  -1.926  -3.079  1.00 0.00 ? 12 A   G OP2    1  
ATOM 5876   O "O5'"  . A   G 2 12 ? -2.935  -1.597  -1.900  1.00 0.00 ? 12 A   G "O5'"  1  
ATOM 5877   C "C5'"  . A   G 2 12 ? -2.400  -2.218  -0.750  1.00 0.00 ? 12 A   G "C5'"  1  
ATOM 5878   C "C4'"  . A   G 2 12 ? -3.513  -2.593  0.230   1.00 0.00 ? 12 A   G "C4'"  1  
ATOM 5879   O "O4'"  . A   G 2 12 ? -4.043  -3.867  -0.092  1.00 0.00 ? 12 A   G "O4'"  1  
ATOM 5880   C "C3'"  . A   G 2 12 ? -3.007  -2.640  1.671   1.00 0.00 ? 12 A   G "C3'"  1  
ATOM 5881   O "O3'"  . A   G 2 12 ? -3.356  -1.507  2.440   1.00 0.00 ? 12 A   G "O3'"  1  
ATOM 5882   C "C2'"  . A   G 2 12 ? -3.684  -3.891  2.224   1.00 0.00 ? 12 A   G "C2'"  1  
ATOM 5883   O "O2'"  . A   G 2 12 ? -4.968  -3.605  2.736   1.00 0.00 ? 12 A   G "O2'"  1  
ATOM 5884   C "C1'"  . A   G 2 12 ? -3.802  -4.762  0.975   1.00 0.00 ? 12 A   G "C1'"  1  
ATOM 5885   N N9     . A   G 2 12 ? -2.550  -5.499  0.706   1.00 0.00 ? 12 A   G N9     1  
ATOM 5886   C C8     . A   G 2 12 ? -1.799  -5.496  -0.441  1.00 0.00 ? 12 A   G C8     1  
ATOM 5887   N N7     . A   G 2 12 ? -0.573  -5.906  -0.269  1.00 0.00 ? 12 A   G N7     1  
ATOM 5888   C C5     . A   G 2 12 ? -0.590  -6.414  1.029   1.00 0.00 ? 12 A   G C5     1  
ATOM 5889   C C6     . A   G 2 12 ? 0.349   -7.098  1.822   1.00 0.00 ? 12 A   G C6     1  
ATOM 5890   N N6     . A   G 2 12 ? 1.619   -7.295  1.461   1.00 0.00 ? 12 A   G N6     1  
ATOM 5891   N N1     . A   G 2 12 ? -0.014  -7.569  3.021   1.00 0.00 ? 12 A   G N1     1  
ATOM 5892   C C2     . A   G 2 12 ? -1.253  -7.349  3.436   1.00 0.00 ? 12 A   G C2     1  
ATOM 5893   N N3     . A   G 2 12 ? -2.221  -6.687  2.819   1.00 0.00 ? 12 A   G N3     1  
ATOM 5894   C C4     . A   G 2 12 ? -1.823  -6.247  1.601   1.00 0.00 ? 12 A   G C4     1  
ATOM 5895   H "H5'"  . A   G 2 12 ? -1.701  -1.538  -0.267  1.00 0.00 ? 12 A   G "H5'"  1  
ATOM 5896   H "H5''" . A   G 2 12 ? -1.850  -3.111  -1.040  1.00 0.00 ? 12 A   G "H5''" 1  
ATOM 5897   H "H4'"  . A   G 2 12 ? -4.302  -1.845  0.175   1.00 0.00 ? 12 A   G "H4'"  1  
ATOM 5898   H "H3'"  . A   G 2 12 ? -1.929  -2.795  1.680   1.00 0.00 ? 12 A   G "H3'"  1  
ATOM 5899   H "H2'"  . A   G 2 12 ? -3.062  -4.354  2.991   1.00 0.00 ? 12 A   G "H2'"  1  
ATOM 5900   H "HO2'" . A   G 2 12 ? -4.933  -2.734  3.146   1.00 0.00 ? 12 A   G "HO2'" 1  
ATOM 5901   H "H1'"  . A   G 2 12 ? -4.622  -5.470  1.090   1.00 0.00 ? 12 A   G "H1'"  1  
ATOM 5902   H H8     . A   G 2 12 ? -2.170  -5.111  -1.381  1.00 0.00 ? 12 A   G H8     1  
ATOM 5903   H H61    . A   G 2 12 ? 2.242   -7.753  2.108   1.00 0.00 ? 12 A   G H61    1  
ATOM 5904   H H62    . A   G 2 12 ? 1.977   -6.830  0.641   1.00 0.00 ? 12 A   G H62    1  
ATOM 5905   H H2     . A   G 2 12 ? -1.502  -7.749  4.407   1.00 0.00 ? 12 A   G H2     1  
ATOM 5906   P P      . G   G 2 13 ? -2.504  -0.147  2.336   1.00 0.00 ? 13 G   G P      1  
ATOM 5907   O OP1    . G   G 2 13 ? -2.792  0.678   3.531   1.00 0.00 ? 13 G   G OP1    1  
ATOM 5908   O OP2    . G   G 2 13 ? -2.708  0.435   0.990   1.00 0.00 ? 13 G   G OP2    1  
ATOM 5909   O "O5'"  . G   G 2 13 ? -0.992  -0.699  2.424   1.00 0.00 ? 13 G   G "O5'"  1  
ATOM 5910   C "C5'"  . G   G 2 13 ? -0.269  -0.748  3.637   1.00 0.00 ? 13 G   G "C5'"  1  
ATOM 5911   C "C4'"  . G   G 2 13 ? -0.954  -1.545  4.750   1.00 0.00 ? 13 G   G "C4'"  1  
ATOM 5912   O "O4'"  . G   G 2 13 ? -1.262  -2.878  4.387   1.00 0.00 ? 13 G   G "O4'"  1  
ATOM 5913   C "C3'"  . G   G 2 13 ? -0.010  -1.603  5.947   1.00 0.00 ? 13 G   G "C3'"  1  
ATOM 5914   O "O3'"  . G   G 2 13 ? -0.298  -0.589  6.886   1.00 0.00 ? 13 G   G "O3'"  1  
ATOM 5915   C "C2'"  . G   G 2 13 ? -0.240  -3.004  6.503   1.00 0.00 ? 13 G   G "C2'"  1  
ATOM 5916   O "O2'"  . G   G 2 13 ? -1.344  -3.048  7.385   1.00 0.00 ? 13 G   G "O2'"  1  
ATOM 5917   C "C1'"  . G   G 2 13 ? -0.573  -3.782  5.231   1.00 0.00 ? 13 G   G "C1'"  1  
ATOM 5918   N N9     . G   G 2 13 ? 0.630   -4.237  4.504   1.00 0.00 ? 13 G   G N9     1  
ATOM 5919   C C8     . G   G 2 13 ? 0.900   -4.048  3.172   1.00 0.00 ? 13 G   G C8     1  
ATOM 5920   N N7     . G   G 2 13 ? 2.025   -4.577  2.780   1.00 0.00 ? 13 G   G N7     1  
ATOM 5921   C C5     . G   G 2 13 ? 2.505   -5.218  3.920   1.00 0.00 ? 13 G   G C5     1  
ATOM 5922   C C6     . G   G 2 13 ? 3.650   -6.050  4.087   1.00 0.00 ? 13 G   G C6     1  
ATOM 5923   O O6     . G   G 2 13 ? 4.447   -6.446  3.239   1.00 0.00 ? 13 G   G O6     1  
ATOM 5924   N N1     . G   G 2 13 ? 3.823   -6.462  5.399   1.00 0.00 ? 13 G   G N1     1  
ATOM 5925   C C2     . G   G 2 13 ? 2.933   -6.201  6.413   1.00 0.00 ? 13 G   G C2     1  
ATOM 5926   N N2     . G   G 2 13 ? 3.278   -6.648  7.622   1.00 0.00 ? 13 G   G N2     1  
ATOM 5927   N N3     . G   G 2 13 ? 1.805   -5.499  6.246   1.00 0.00 ? 13 G   G N3     1  
ATOM 5928   C C4     . G   G 2 13 ? 1.659   -5.019  4.983   1.00 0.00 ? 13 G   G C4     1  
ATOM 5929   H "H5'"  . G   G 2 13 ? -0.112  0.273   3.990   1.00 0.00 ? 13 G   G "H5'"  1  
ATOM 5930   H "H5''" . G   G 2 13 ? 0.709   -1.188  3.439   1.00 0.00 ? 13 G   G "H5''" 1  
ATOM 5931   H "H4'"  . G   G 2 13 ? -1.872  -1.040  5.053   1.00 0.00 ? 13 G   G "H4'"  1  
ATOM 5932   H "H3'"  . G   G 2 13 ? 1.022   -1.529  5.604   1.00 0.00 ? 13 G   G "H3'"  1  
ATOM 5933   H "H2'"  . G   G 2 13 ? 0.660   -3.381  6.988   1.00 0.00 ? 13 G   G "H2'"  1  
ATOM 5934   H "HO2'" . G   G 2 13 ? -1.353  -2.230  7.892   1.00 0.00 ? 13 G   G "HO2'" 1  
ATOM 5935   H "H1'"  . G   G 2 13 ? -1.200  -4.640  5.473   1.00 0.00 ? 13 G   G "H1'"  1  
ATOM 5936   H H8     . G   G 2 13 ? 0.231   -3.514  2.510   1.00 0.00 ? 13 G   G H8     1  
ATOM 5937   H H1     . G   G 2 13 ? 4.642   -7.012  5.614   1.00 0.00 ? 13 G   G H1     1  
ATOM 5938   H H21    . G   G 2 13 ? 4.196   -7.046  7.784   1.00 0.00 ? 13 G   G H21    1  
ATOM 5939   H H22    . G   G 2 13 ? 2.639   -6.510  8.392   1.00 0.00 ? 13 G   G H22    1  
ATOM 5940   P P      . A   G 2 14 ? 0.837   0.471   7.301   1.00 0.00 ? 14 A   G P      1  
ATOM 5941   O OP1    . A   G 2 14 ? 0.227   1.479   8.198   1.00 0.00 ? 14 A   G OP1    1  
ATOM 5942   O OP2    . A   G 2 14 ? 1.543   0.911   6.076   1.00 0.00 ? 14 A   G OP2    1  
ATOM 5943   O "O5'"  . A   G 2 14 ? 1.836   -0.450  8.160   1.00 0.00 ? 14 A   G "O5'"  1  
ATOM 5944   C "C5'"  . A   G 2 14 ? 1.438   -0.952  9.418   1.00 0.00 ? 14 A   G "C5'"  1  
ATOM 5945   C "C4'"  . A   G 2 14 ? 2.448   -1.964  9.955   1.00 0.00 ? 14 A   G "C4'"  1  
ATOM 5946   O "O4'"  . A   G 2 14 ? 2.494   -3.131  9.157   1.00 0.00 ? 14 A   G "O4'"  1  
ATOM 5947   C "C3'"  . A   G 2 14 ? 3.873   -1.420  9.998   1.00 0.00 ? 14 A   G "C3'"  1  
ATOM 5948   O "O3'"  . A   G 2 14 ? 4.126   -0.580  11.105  1.00 0.00 ? 14 A   G "O3'"  1  
ATOM 5949   C "C2'"  . A   G 2 14 ? 4.643   -2.734  10.067  1.00 0.00 ? 14 A   G "C2'"  1  
ATOM 5950   O "O2'"  . A   G 2 14 ? 4.575   -3.325  11.349  1.00 0.00 ? 14 A   G "O2'"  1  
ATOM 5951   C "C1'"  . A   G 2 14 ? 3.833   -3.584  9.092   1.00 0.00 ? 14 A   G "C1'"  1  
ATOM 5952   N N9     . A   G 2 14 ? 4.364   -3.422  7.724   1.00 0.00 ? 14 A   G N9     1  
ATOM 5953   C C8     . A   G 2 14 ? 3.796   -2.808  6.636   1.00 0.00 ? 14 A   G C8     1  
ATOM 5954   N N7     . A   G 2 14 ? 4.454   -2.980  5.522   1.00 0.00 ? 14 A   G N7     1  
ATOM 5955   C C5     . A   G 2 14 ? 5.557   -3.739  5.909   1.00 0.00 ? 14 A   G C5     1  
ATOM 5956   C C6     . A   G 2 14 ? 6.635   -4.325  5.219   1.00 0.00 ? 14 A   G C6     1  
ATOM 5957   N N6     . A   G 2 14 ? 6.799   -4.281  3.894   1.00 0.00 ? 14 A   G N6     1  
ATOM 5958   N N1     . A   G 2 14 ? 7.552   -5.018  5.905   1.00 0.00 ? 14 A   G N1     1  
ATOM 5959   C C2     . A   G 2 14 ? 7.416   -5.129  7.218   1.00 0.00 ? 14 A   G C2     1  
ATOM 5960   N N3     . A   G 2 14 ? 6.449   -4.655  7.986   1.00 0.00 ? 14 A   G N3     1  
ATOM 5961   C C4     . A   G 2 14 ? 5.533   -3.971  7.258   1.00 0.00 ? 14 A   G C4     1  
ATOM 5962   H "H5'"  . A   G 2 14 ? 0.467   -1.439  9.329   1.00 0.00 ? 14 A   G "H5'"  1  
ATOM 5963   H "H5''" . A   G 2 14 ? 1.353   -0.126  10.125  1.00 0.00 ? 14 A   G "H5''" 1  
ATOM 5964   H "H4'"  . A   G 2 14 ? 2.153   -2.245  10.967  1.00 0.00 ? 14 A   G "H4'"  1  
ATOM 5965   H "H3'"  . A   G 2 14 ? 4.100   -0.908  9.063   1.00 0.00 ? 14 A   G "H3'"  1  
ATOM 5966   H "H2'"  . A   G 2 14 ? 5.675   -2.610  9.737   1.00 0.00 ? 14 A   G "H2'"  1  
ATOM 5967   H "HO2'" . A   G 2 14 ? 4.579   -2.622  12.006  1.00 0.00 ? 14 A   G "HO2'" 1  
ATOM 5968   H "H1'"  . A   G 2 14 ? 3.905   -4.632  9.385   1.00 0.00 ? 14 A   G "H1'"  1  
ATOM 5969   H H8     . A   G 2 14 ? 2.867   -2.260  6.696   1.00 0.00 ? 14 A   G H8     1  
ATOM 5970   H H61    . A   G 2 14 ? 7.550   -4.808  3.471   1.00 0.00 ? 14 A   G H61    1  
ATOM 5971   H H62    . A   G 2 14 ? 6.108   -3.819  3.322   1.00 0.00 ? 14 A   G H62    1  
ATOM 5972   H H2     . A   G 2 14 ? 8.188   -5.690  7.726   1.00 0.00 ? 14 A   G H2     1  
ATOM 5973   P P      . C   G 2 15 ? 5.330   0.488   11.049  1.00 0.00 ? 15 C   G P      1  
ATOM 5974   O OP1    . C   G 2 15 ? 5.303   1.264   12.310  1.00 0.00 ? 15 C   G OP1    1  
ATOM 5975   O OP2    . C   G 2 15 ? 5.262   1.204   9.755   1.00 0.00 ? 15 C   G OP2    1  
ATOM 5976   O "O5'"  . C   G 2 15 ? 6.652   -0.428  11.044  1.00 0.00 ? 15 C   G "O5'"  1  
ATOM 5977   C "C5'"  . C   G 2 15 ? 7.039   -1.177  12.178  1.00 0.00 ? 15 C   G "C5'"  1  
ATOM 5978   C "C4'"  . C   G 2 15 ? 8.270   -2.031  11.875  1.00 0.00 ? 15 C   G "C4'"  1  
ATOM 5979   O "O4'"  . C   G 2 15 ? 8.091   -2.874  10.753  1.00 0.00 ? 15 C   G "O4'"  1  
ATOM 5980   C "C3'"  . C   G 2 15 ? 9.483   -1.158  11.573  1.00 0.00 ? 15 C   G "C3'"  1  
ATOM 5981   O "O3'"  . C   G 2 15 ? 10.107  -0.708  12.755  1.00 0.00 ? 15 C   G "O3'"  1  
ATOM 5982   C "C2'"  . C   G 2 15 ? 10.348  -2.110  10.753  1.00 0.00 ? 15 C   G "C2'"  1  
ATOM 5983   O "O2'"  . C   G 2 15 ? 11.128  -2.970  11.559  1.00 0.00 ? 15 C   G "O2'"  1  
ATOM 5984   C "C1'"  . C   G 2 15 ? 9.301   -2.945  10.020  1.00 0.00 ? 15 C   G "C1'"  1  
ATOM 5985   N N1     . C   G 2 15 ? 9.127   -2.459  8.634   1.00 0.00 ? 15 C   G N1     1  
ATOM 5986   C C2     . C   G 2 15 ? 10.031  -2.902  7.680   1.00 0.00 ? 15 C   G C2     1  
ATOM 5987   O O2     . C   G 2 15 ? 11.000  -3.590  7.993   1.00 0.00 ? 15 C   G O2     1  
ATOM 5988   N N3     . C   G 2 15 ? 9.845   -2.575  6.376   1.00 0.00 ? 15 C   G N3     1  
ATOM 5989   C C4     . C   G 2 15 ? 8.815   -1.802  6.027   1.00 0.00 ? 15 C   G C4     1  
ATOM 5990   N N4     . C   G 2 15 ? 8.637   -1.558  4.730   1.00 0.00 ? 15 C   G N4     1  
ATOM 5991   C C5     . C   G 2 15 ? 7.895   -1.283  6.991   1.00 0.00 ? 15 C   G C5     1  
ATOM 5992   C C6     . C   G 2 15 ? 8.093   -1.636  8.280   1.00 0.00 ? 15 C   G C6     1  
ATOM 5993   H "H5'"  . C   G 2 15 ? 6.223   -1.826  12.493  1.00 0.00 ? 15 C   G "H5'"  1  
ATOM 5994   H "H5''" . C   G 2 15 ? 7.273   -0.497  12.997  1.00 0.00 ? 15 C   G "H5''" 1  
ATOM 5995   H "H4'"  . C   G 2 15 ? 8.497   -2.647  12.745  1.00 0.00 ? 15 C   G "H4'"  1  
ATOM 5996   H "H3'"  . C   G 2 15 ? 9.178   -0.316  10.950  1.00 0.00 ? 15 C   G "H3'"  1  
ATOM 5997   H "H2'"  . C   G 2 15 ? 10.975  -1.556  10.055  1.00 0.00 ? 15 C   G "H2'"  1  
ATOM 5998   H "HO2'" . C   G 2 15 ? 12.034  -2.957  11.234  1.00 0.00 ? 15 C   G "HO2'" 1  
ATOM 5999   H "H1'"  . C   G 2 15 ? 9.649   -3.978  9.987   1.00 0.00 ? 15 C   G "H1'"  1  
ATOM 6000   H H41    . C   G 2 15 ? 9.236   -2.032  4.067   1.00 0.00 ? 15 C   G H41    1  
ATOM 6001   H H42    . C   G 2 15 ? 7.840   -1.023  4.421   1.00 0.00 ? 15 C   G H42    1  
ATOM 6002   H H5     . C   G 2 15 ? 7.062   -0.648  6.728   1.00 0.00 ? 15 C   G H5     1  
ATOM 6003   H H6     . C   G 2 15 ? 7.412   -1.282  9.038   1.00 0.00 ? 15 C   G H6     1  
ATOM 6004   P P      . A   G 2 16 ? 10.973  0.644   12.748  1.00 0.00 ? 16 A   G P      1  
ATOM 6005   O OP1    . A   G 2 16 ? 11.454  0.885   14.128  1.00 0.00 ? 16 A   G OP1    1  
ATOM 6006   O OP2    . A   G 2 16 ? 10.185  1.696   12.064  1.00 0.00 ? 16 A   G OP2    1  
ATOM 6007   O "O5'"  . A   G 2 16 ? 12.241  0.295   11.819  1.00 0.00 ? 16 A   G "O5'"  1  
ATOM 6008   C "C5'"  . A   G 2 16 ? 13.341  -0.421  12.340  1.00 0.00 ? 16 A   G "C5'"  1  
ATOM 6009   C "C4'"  . A   G 2 16 ? 14.331  -0.796  11.238  1.00 0.00 ? 16 A   G "C4'"  1  
ATOM 6010   O "O4'"  . A   G 2 16 ? 13.716  -1.610  10.259  1.00 0.00 ? 16 A   G "O4'"  1  
ATOM 6011   C "C3'"  . A   G 2 16 ? 14.897  0.411   10.496  1.00 0.00 ? 16 A   G "C3'"  1  
ATOM 6012   O "O3'"  . A   G 2 16 ? 15.935  1.058   11.204  1.00 0.00 ? 16 A   G "O3'"  1  
ATOM 6013   C "C2'"  . A   G 2 16 ? 15.371  -0.254  9.206   1.00 0.00 ? 16 A   G "C2'"  1  
ATOM 6014   O "O2'"  . A   G 2 16 ? 16.643  -0.852  9.349   1.00 0.00 ? 16 A   G "O2'"  1  
ATOM 6015   C "C1'"  . A   G 2 16 ? 14.316  -1.342  9.007   1.00 0.00 ? 16 A   G "C1'"  1  
ATOM 6016   N N9     . A   G 2 16 ? 13.311  -0.876  8.032   1.00 0.00 ? 16 A   G N9     1  
ATOM 6017   C C8     . A   G 2 16 ? 12.226  -0.058  8.214   1.00 0.00 ? 16 A   G C8     1  
ATOM 6018   N N7     . A   G 2 16 ? 11.593  0.239   7.112   1.00 0.00 ? 16 A   G N7     1  
ATOM 6019   C C5     . A   G 2 16 ? 12.327  -0.417  6.126   1.00 0.00 ? 16 A   G C5     1  
ATOM 6020   C C6     . A   G 2 16 ? 12.219  -0.524  4.727   1.00 0.00 ? 16 A   G C6     1  
ATOM 6021   N N6     . A   G 2 16 ? 11.261  0.057   3.997   1.00 0.00 ? 16 A   G N6     1  
ATOM 6022   N N1     . A   G 2 16 ? 13.133  -1.229  4.050   1.00 0.00 ? 16 A   G N1     1  
ATOM 6023   C C2     . A   G 2 16 ? 14.116  -1.814  4.718   1.00 0.00 ? 16 A   G C2     1  
ATOM 6024   N N3     . A   G 2 16 ? 14.330  -1.812  6.026   1.00 0.00 ? 16 A   G N3     1  
ATOM 6025   C C4     . A   G 2 16 ? 13.385  -1.091  6.678   1.00 0.00 ? 16 A   G C4     1  
ATOM 6026   H "H5'"  . A   G 2 16 ? 12.987  -1.331  12.822  1.00 0.00 ? 16 A   G "H5'"  1  
ATOM 6027   H "H5''" . A   G 2 16 ? 13.853  0.192   13.082  1.00 0.00 ? 16 A   G "H5''" 1  
ATOM 6028   H "H4'"  . A   G 2 16 ? 15.160  -1.347  11.682  1.00 0.00 ? 16 A   G "H4'"  1  
ATOM 6029   H "H3'"  . A   G 2 16 ? 14.087  1.107   10.274  1.00 0.00 ? 16 A   G "H3'"  1  
ATOM 6030   H "H2'"  . A   G 2 16 ? 15.369  0.458   8.379   1.00 0.00 ? 16 A   G "H2'"  1  
ATOM 6031   H "HO2'" . A   G 2 16 ? 17.276  -0.164  9.578   1.00 0.00 ? 16 A   G "HO2'" 1  
ATOM 6032   H "H1'"  . A   G 2 16 ? 14.774  -2.251  8.614   1.00 0.00 ? 16 A   G "H1'"  1  
ATOM 6033   H H8     . A   G 2 16 ? 11.922  0.301   9.187   1.00 0.00 ? 16 A   G H8     1  
ATOM 6034   H H61    . A   G 2 16 ? 11.200  -0.134  3.007   1.00 0.00 ? 16 A   G H61    1  
ATOM 6035   H H62    . A   G 2 16 ? 10.526  0.565   4.467   1.00 0.00 ? 16 A   G H62    1  
ATOM 6036   H H2     . A   G 2 16 ? 14.810  -2.398  4.129   1.00 0.00 ? 16 A   G H2     1  
ATOM 6037   P P      . C   G 2 17 ? 16.339  2.583   10.880  1.00 0.00 ? 17 C   G P      1  
ATOM 6038   O OP1    . C   G 2 17 ? 17.001  3.135   12.085  1.00 0.00 ? 17 C   G OP1    1  
ATOM 6039   O OP2    . C   G 2 17 ? 15.154  3.277   10.328  1.00 0.00 ? 17 C   G OP2    1  
ATOM 6040   O "O5'"  . C   G 2 17 ? 17.434  2.471   9.703   1.00 0.00 ? 17 C   G "O5'"  1  
ATOM 6041   C "C5'"  . C   G 2 17 ? 18.800  2.254   9.992   1.00 0.00 ? 17 C   G "C5'"  1  
ATOM 6042   C "C4'"  . C   G 2 17 ? 19.662  2.343   8.733   1.00 0.00 ? 17 C   G "C4'"  1  
ATOM 6043   O "O4'"  . C   G 2 17 ? 19.249  1.395   7.766   1.00 0.00 ? 17 C   G "O4'"  1  
ATOM 6044   C "C3'"  . C   G 2 17 ? 19.597  3.713   8.063   1.00 0.00 ? 17 C   G "C3'"  1  
ATOM 6045   O "O3'"  . C   G 2 17 ? 20.471  4.660   8.644   1.00 0.00 ? 17 C   G "O3'"  1  
ATOM 6046   C "C2'"  . C   G 2 17 ? 19.966  3.357   6.624   1.00 0.00 ? 17 C   G "C2'"  1  
ATOM 6047   O "O2'"  . C   G 2 17 ? 21.364  3.288   6.433   1.00 0.00 ? 17 C   G "O2'"  1  
ATOM 6048   C "C1'"  . C   G 2 17 ? 19.389  1.949   6.472   1.00 0.00 ? 17 C   G "C1'"  1  
ATOM 6049   N N1     . C   G 2 17 ? 18.081  1.902   5.778   1.00 0.00 ? 17 C   G N1     1  
ATOM 6050   C C2     . C   G 2 17 ? 17.781  0.753   5.059   1.00 0.00 ? 17 C   G C2     1  
ATOM 6051   O O2     . C   G 2 17 ? 18.576  -0.183  4.997   1.00 0.00 ? 17 C   G O2     1  
ATOM 6052   N N3     . C   G 2 17 ? 16.598  0.663   4.398   1.00 0.00 ? 17 C   G N3     1  
ATOM 6053   C C4     . C   G 2 17 ? 15.738  1.683   4.436   1.00 0.00 ? 17 C   G C4     1  
ATOM 6054   N N4     . C   G 2 17 ? 14.586  1.551   3.781   1.00 0.00 ? 17 C   G N4     1  
ATOM 6055   C C5     . C   G 2 17 ? 16.014  2.879   5.168   1.00 0.00 ? 17 C   G C5     1  
ATOM 6056   C C6     . C   G 2 17 ? 17.190  2.940   5.830   1.00 0.00 ? 17 C   G C6     1  
ATOM 6057   H "H5'"  . C   G 2 17 ? 18.922  1.268   10.442  1.00 0.00 ? 17 C   G "H5'"  1  
ATOM 6058   H "H5''" . C   G 2 17 ? 19.145  3.006   10.700  1.00 0.00 ? 17 C   G "H5''" 1  
ATOM 6059   H "H4'"  . C   G 2 17 ? 20.699  2.141   9.000   1.00 0.00 ? 17 C   G "H4'"  1  
ATOM 6060   H "H3'"  . C   G 2 17 ? 18.573  4.083   8.106   1.00 0.00 ? 17 C   G "H3'"  1  
ATOM 6061   H "H2'"  . C   G 2 17 ? 19.521  4.059   5.917   1.00 0.00 ? 17 C   G "H2'"  1  
ATOM 6062   H "HO2'" . C   G 2 17 ? 21.724  4.176   6.534   1.00 0.00 ? 17 C   G "HO2'" 1  
ATOM 6063   H "H1'"  . C   G 2 17 ? 20.107  1.353   5.908   1.00 0.00 ? 17 C   G "H1'"  1  
ATOM 6064   H H41    . C   G 2 17 ? 14.377  0.669   3.336   1.00 0.00 ? 17 C   G H41    1  
ATOM 6065   H H42    . C   G 2 17 ? 13.913  2.302   3.791   1.00 0.00 ? 17 C   G H42    1  
ATOM 6066   H H5     . C   G 2 17 ? 15.324  3.708   5.219   1.00 0.00 ? 17 C   G H5     1  
ATOM 6067   H H6     . C   G 2 17 ? 17.418  3.822   6.409   1.00 0.00 ? 17 C   G H6     1  
ATOM 6068   P P      . A   G 2 18 ? 20.418  6.206   8.200   1.00 0.00 ? 18 A   G P      1  
ATOM 6069   O OP1    . A   G 2 18 ? 20.950  7.019   9.317   1.00 0.00 ? 18 A   G OP1    1  
ATOM 6070   O OP2    . A   G 2 18 ? 19.064  6.490   7.672   1.00 0.00 ? 18 A   G OP2    1  
ATOM 6071   O "O5'"  . A   G 2 18 ? 21.472  6.283   6.984   1.00 0.00 ? 18 A   G "O5'"  1  
ATOM 6072   C "C5'"  . A   G 2 18 ? 21.252  7.132   5.875   1.00 0.00 ? 18 A   G "C5'"  1  
ATOM 6073   C "C4'"  . A   G 2 18 ? 22.498  7.172   4.993   1.00 0.00 ? 18 A   G "C4'"  1  
ATOM 6074   O "O4'"  . A   G 2 18 ? 22.752  5.906   4.416   1.00 0.00 ? 18 A   G "O4'"  1  
ATOM 6075   C "C3'"  . A   G 2 18 ? 22.365  8.140   3.819   1.00 0.00 ? 18 A   G "C3'"  1  
ATOM 6076   O "O3'"  . A   G 2 18 ? 22.583  9.495   4.162   1.00 0.00 ? 18 A   G "O3'"  1  
ATOM 6077   C "C2'"  . A   G 2 18 ? 23.429  7.580   2.878   1.00 0.00 ? 18 A   G "C2'"  1  
ATOM 6078   O "O2'"  . A   G 2 18 ? 24.735  8.013   3.205   1.00 0.00 ? 18 A   G "O2'"  1  
ATOM 6079   C "C1'"  . A   G 2 18 ? 23.331  6.079   3.137   1.00 0.00 ? 18 A   G "C1'"  1  
ATOM 6080   N N9     . A   G 2 18 ? 22.556  5.448   2.046   1.00 0.00 ? 18 A   G N9     1  
ATOM 6081   C C8     . A   G 2 18 ? 22.996  5.198   0.771   1.00 0.00 ? 18 A   G C8     1  
ATOM 6082   N N7     . A   G 2 18 ? 22.148  4.544   0.025   1.00 0.00 ? 18 A   G N7     1  
ATOM 6083   C C5     . A   G 2 18 ? 21.058  4.351   0.871   1.00 0.00 ? 18 A   G C5     1  
ATOM 6084   C C6     . A   G 2 18 ? 19.827  3.683   0.733   1.00 0.00 ? 18 A   G C6     1  
ATOM 6085   N N6     . A   G 2 18 ? 19.448  3.019   -0.362  1.00 0.00 ? 18 A   G N6     1  
ATOM 6086   N N1     . A   G 2 18 ? 18.945  3.703   1.739   1.00 0.00 ? 18 A   G N1     1  
ATOM 6087   C C2     . A   G 2 18 ? 19.274  4.347   2.848   1.00 0.00 ? 18 A   G C2     1  
ATOM 6088   N N3     . A   G 2 18 ? 20.399  4.990   3.123   1.00 0.00 ? 18 A   G N3     1  
ATOM 6089   C C4     . A   G 2 18 ? 21.275  4.945   2.088   1.00 0.00 ? 18 A   G C4     1  
ATOM 6090   H "H5'"  . A   G 2 18 ? 21.033  8.140   6.229   1.00 0.00 ? 18 A   G "H5'"  1  
ATOM 6091   H "H5''" . A   G 2 18 ? 20.404  6.767   5.295   1.00 0.00 ? 18 A   G "H5''" 1  
ATOM 6092   H "H4'"  . A   G 2 18 ? 23.356  7.470   5.597   1.00 0.00 ? 18 A   G "H4'"  1  
ATOM 6093   H "H3'"  . A   G 2 18 ? 21.382  8.025   3.363   1.00 0.00 ? 18 A   G "H3'"  1  
ATOM 6094   H "H2'"  . A   G 2 18 ? 23.192  7.820   1.841   1.00 0.00 ? 18 A   G "H2'"  1  
ATOM 6095   H "HO2'" . A   G 2 18 ? 24.752  8.976   3.155   1.00 0.00 ? 18 A   G "HO2'" 1  
ATOM 6096   H "H1'"  . A   G 2 18 ? 24.335  5.655   3.142   1.00 0.00 ? 18 A   G "H1'"  1  
ATOM 6097   H H8     . A   G 2 18 ? 23.975  5.494   0.424   1.00 0.00 ? 18 A   G H8     1  
ATOM 6098   H H61    . A   G 2 18 ? 18.559  2.541   -0.372  1.00 0.00 ? 18 A   G H61    1  
ATOM 6099   H H62    . A   G 2 18 ? 20.035  3.020   -1.187  1.00 0.00 ? 18 A   G H62    1  
ATOM 6100   H H2     . A   G 2 18 ? 18.531  4.343   3.632   1.00 0.00 ? 18 A   G H2     1  
ATOM 6101   P P      . G   G 2 19 ? 22.798  10.602  3.012   1.00 0.00 ? 19 G   G P      1  
ATOM 6102   O OP1    . G   G 2 19 ? 21.986  10.221  1.835   1.00 0.00 ? 19 G   G OP1    1  
ATOM 6103   O OP2    . G   G 2 19 ? 24.257  10.791  2.852   1.00 0.00 ? 19 G   G OP2    1  
ATOM 6104   O "O5'"  . G   G 2 19 ? 22.191  11.965  3.619   1.00 0.00 ? 19 G   G "O5'"  1  
ATOM 6105   C "C5'"  . G   G 2 19 ? 20.801  12.155  3.783   1.00 0.00 ? 19 G   G "C5'"  1  
ATOM 6106   C "C4'"  . G   G 2 19 ? 20.372  11.791  5.202   1.00 0.00 ? 19 G   G "C4'"  1  
ATOM 6107   O "O4'"  . G   G 2 19 ? 21.106  12.450  6.214   1.00 0.00 ? 19 G   G "O4'"  1  
ATOM 6108   C "C3'"  . G   G 2 19 ? 18.885  12.052  5.452   1.00 0.00 ? 19 G   G "C3'"  1  
ATOM 6109   O "O3'"  . G   G 2 19 ? 18.257  10.792  5.575   1.00 0.00 ? 19 G   G "O3'"  1  
ATOM 6110   C "C2'"  . G   G 2 19 ? 18.925  12.959  6.683   1.00 0.00 ? 19 G   G "C2'"  1  
ATOM 6111   O "O2'"  . G   G 2 19 ? 17.822  12.888  7.560   1.00 0.00 ? 19 G   G "O2'"  1  
ATOM 6112   C "C1'"  . G   G 2 19 ? 20.232  12.501  7.319   1.00 0.00 ? 19 G   G "C1'"  1  
ATOM 6113   N N9     . G   G 2 19 ? 20.717  13.431  8.353   1.00 0.00 ? 19 G   G N9     1  
ATOM 6114   C C8     . G   G 2 19 ? 20.720  14.799  8.330   1.00 0.00 ? 19 G   G C8     1  
ATOM 6115   N N7     . G   G 2 19 ? 21.106  15.349  9.449   1.00 0.00 ? 19 G   G N7     1  
ATOM 6116   C C5     . G   G 2 19 ? 21.367  14.259  10.278  1.00 0.00 ? 19 G   G C5     1  
ATOM 6117   C C6     . G   G 2 19 ? 21.783  14.212  11.639  1.00 0.00 ? 19 G   G C6     1  
ATOM 6118   O O6     . G   G 2 19 ? 22.011  15.143  12.408  1.00 0.00 ? 19 G   G O6     1  
ATOM 6119   N N1     . G   G 2 19 ? 21.913  12.915  12.111  1.00 0.00 ? 19 G   G N1     1  
ATOM 6120   C C2     . G   G 2 19 ? 21.675  11.789  11.359  1.00 0.00 ? 19 G   G C2     1  
ATOM 6121   N N2     . G   G 2 19 ? 21.849  10.614  11.966  1.00 0.00 ? 19 G   G N2     1  
ATOM 6122   N N3     . G   G 2 19 ? 21.286  11.816  10.080  1.00 0.00 ? 19 G   G N3     1  
ATOM 6123   C C4     . G   G 2 19 ? 21.149  13.081  9.609   1.00 0.00 ? 19 G   G C4     1  
ATOM 6124   H "H5'"  . G   G 2 19 ? 20.247  11.546  3.068   1.00 0.00 ? 19 G   G "H5'"  1  
ATOM 6125   H "H5''" . G   G 2 19 ? 20.565  13.204  3.604   1.00 0.00 ? 19 G   G "H5''" 1  
ATOM 6126   H "H4'"  . G   G 2 19 ? 20.545  10.725  5.340   1.00 0.00 ? 19 G   G "H4'"  1  
ATOM 6127   H "H3'"  . G   G 2 19 ? 18.454  12.599  4.612   1.00 0.00 ? 19 G   G "H3'"  1  
ATOM 6128   H "H2'"  . G   G 2 19 ? 19.037  13.988  6.342   1.00 0.00 ? 19 G   G "H2'"  1  
ATOM 6129   H "HO2'" . G   G 2 19 ? 17.035  12.707  7.036   1.00 0.00 ? 19 G   G "HO2'" 1  
ATOM 6130   H "H1'"  . G   G 2 19 ? 20.099  11.508  7.750   1.00 0.00 ? 19 G   G "H1'"  1  
ATOM 6131   H H8     . G   G 2 19 ? 20.421  15.349  7.450   1.00 0.00 ? 19 G   G H8     1  
ATOM 6132   H H1     . G   G 2 19 ? 22.254  12.786  13.053  1.00 0.00 ? 19 G   G H1     1  
ATOM 6133   H H21    . G   G 2 19 ? 22.186  10.590  12.918  1.00 0.00 ? 19 G   G H21    1  
ATOM 6134   H H22    . G   G 2 19 ? 21.697  9.762   11.445  1.00 0.00 ? 19 G   G H22    1  
ATOM 6135   P P      . C   G 2 20 ? 16.679  10.623  5.848   1.00 0.00 ? 20 C   G P      1  
ATOM 6136   O OP1    . C   G 2 20 ? 16.207  9.413   5.137   1.00 0.00 ? 20 C   G OP1    1  
ATOM 6137   O OP2    . C   G 2 20 ? 16.015  11.924  5.602   1.00 0.00 ? 20 C   G OP2    1  
ATOM 6138   O "O5'"  . C   G 2 20 ? 16.647  10.334  7.433   1.00 0.00 ? 20 C   G "O5'"  1  
ATOM 6139   C "C5'"  . C   G 2 20 ? 17.302  9.202   7.967   1.00 0.00 ? 20 C   G "C5'"  1  
ATOM 6140   C "C4'"  . C   G 2 20 ? 17.327  9.177   9.495   1.00 0.00 ? 20 C   G "C4'"  1  
ATOM 6141   O "O4'"  . C   G 2 20 ? 18.318  10.018  10.054  1.00 0.00 ? 20 C   G "O4'"  1  
ATOM 6142   C "C3'"  . C   G 2 20 ? 16.030  9.630   10.161  1.00 0.00 ? 20 C   G "C3'"  1  
ATOM 6143   O "O3'"  . C   G 2 20 ? 14.983  8.690   10.050  1.00 0.00 ? 20 C   G "O3'"  1  
ATOM 6144   C "C2'"  . C   G 2 20 ? 16.530  9.790   11.594  1.00 0.00 ? 20 C   G "C2'"  1  
ATOM 6145   O "O2'"  . C   G 2 20 ? 16.535  8.556   12.283  1.00 0.00 ? 20 C   G "O2'"  1  
ATOM 6146   C "C1'"  . C   G 2 20 ? 17.981  10.236  11.412  1.00 0.00 ? 20 C   G "C1'"  1  
ATOM 6147   N N1     . C   G 2 20 ? 18.136  11.649  11.822  1.00 0.00 ? 20 C   G N1     1  
ATOM 6148   C C2     . C   G 2 20 ? 18.250  11.926  13.178  1.00 0.00 ? 20 C   G C2     1  
ATOM 6149   O O2     . C   G 2 20 ? 18.274  11.027  14.015  1.00 0.00 ? 20 C   G O2     1  
ATOM 6150   N N3     . C   G 2 20 ? 18.322  13.216  13.597  1.00 0.00 ? 20 C   G N3     1  
ATOM 6151   C C4     . C   G 2 20 ? 18.289  14.205  12.701  1.00 0.00 ? 20 C   G C4     1  
ATOM 6152   N N4     . C   G 2 20 ? 18.383  15.457  13.150  1.00 0.00 ? 20 C   G N4     1  
ATOM 6153   C C5     . C   G 2 20 ? 18.179  13.954  11.299  1.00 0.00 ? 20 C   G C5     1  
ATOM 6154   C C6     . C   G 2 20 ? 18.101  12.664  10.908  1.00 0.00 ? 20 C   G C6     1  
ATOM 6155   H "H5'"  . C   G 2 20 ? 18.330  9.173   7.604   1.00 0.00 ? 20 C   G "H5'"  1  
ATOM 6156   H "H5''" . C   G 2 20 ? 16.792  8.306   7.615   1.00 0.00 ? 20 C   G "H5''" 1  
ATOM 6157   H "H4'"  . C   G 2 20 ? 17.532  8.153   9.808   1.00 0.00 ? 20 C   G "H4'"  1  
ATOM 6158   H "H3'"  . C   G 2 20 ? 15.731  10.600  9.763   1.00 0.00 ? 20 C   G "H3'"  1  
ATOM 6159   H "H2'"  . C   G 2 20 ? 15.944  10.538  12.127  1.00 0.00 ? 20 C   G "H2'"  1  
ATOM 6160   H "HO2'" . C   G 2 20 ? 15.671  8.149   12.173  1.00 0.00 ? 20 C   G "HO2'" 1  
ATOM 6161   H "H1'"  . C   G 2 20 ? 18.616  9.613   12.043  1.00 0.00 ? 20 C   G "H1'"  1  
ATOM 6162   H H41    . C   G 2 20 ? 18.421  15.623  14.146  1.00 0.00 ? 20 C   G H41    1  
ATOM 6163   H H42    . C   G 2 20 ? 18.369  16.226  12.497  1.00 0.00 ? 20 C   G H42    1  
ATOM 6164   H H5     . C   G 2 20 ? 18.162  14.743  10.563  1.00 0.00 ? 20 C   G H5     1  
ATOM 6165   H H6     . C   G 2 20 ? 18.026  12.428  9.856   1.00 0.00 ? 20 C   G H6     1  
ATOM 6166   P P      . C   G 2 21 ? 13.446  9.157   10.170  1.00 0.00 ? 21 C   G P      1  
ATOM 6167   O OP1    . C   G 2 21 ? 12.604  7.951   10.000  1.00 0.00 ? 21 C   G OP1    1  
ATOM 6168   O OP2    . C   G 2 21 ? 13.239  10.319  9.277   1.00 0.00 ? 21 C   G OP2    1  
ATOM 6169   O "O5'"  . C   G 2 21 ? 13.318  9.667   11.693  1.00 0.00 ? 21 C   G "O5'"  1  
ATOM 6170   C "C5'"  . C   G 2 21 ? 13.114  8.742   12.740  1.00 0.00 ? 21 C   G "C5'"  1  
ATOM 6171   C "C4'"  . C   G 2 21 ? 13.350  9.355   14.120  1.00 0.00 ? 21 C   G "C4'"  1  
ATOM 6172   O "O4'"  . C   G 2 21 ? 14.592  10.019  14.224  1.00 0.00 ? 21 C   G "O4'"  1  
ATOM 6173   C "C3'"  . C   G 2 21 ? 12.311  10.389  14.540  1.00 0.00 ? 21 C   G "C3'"  1  
ATOM 6174   O "O3'"  . C   G 2 21 ? 11.053  9.841   14.877  1.00 0.00 ? 21 C   G "O3'"  1  
ATOM 6175   C "C2'"  . C   G 2 21 ? 13.045  10.987  15.739  1.00 0.00 ? 21 C   G "C2'"  1  
ATOM 6176   O "O2'"  . C   G 2 21 ? 12.902  10.213  16.911  1.00 0.00 ? 21 C   G "O2'"  1  
ATOM 6177   C "C1'"  . C   G 2 21 ? 14.509  10.916  15.315  1.00 0.00 ? 21 C   G "C1'"  1  
ATOM 6178   N N1     . C   G 2 21 ? 14.960  12.278  14.965  1.00 0.00 ? 21 C   G N1     1  
ATOM 6179   C C2     . C   G 2 21 ? 15.410  13.078  16.006  1.00 0.00 ? 21 C   G C2     1  
ATOM 6180   O O2     . C   G 2 21 ? 15.696  12.595  17.099  1.00 0.00 ? 21 C   G O2     1  
ATOM 6181   N N3     . C   G 2 21 ? 15.493  14.422  15.836  1.00 0.00 ? 21 C   G N3     1  
ATOM 6182   C C4     . C   G 2 21 ? 15.160  14.958  14.660  1.00 0.00 ? 21 C   G C4     1  
ATOM 6183   N N4     . C   G 2 21 ? 15.188  16.288  14.568  1.00 0.00 ? 21 C   G N4     1  
ATOM 6184   C C5     . C   G 2 21 ? 14.721  14.159  13.556  1.00 0.00 ? 21 C   G C5     1  
ATOM 6185   C C6     . C   G 2 21 ? 14.633  12.825  13.757  1.00 0.00 ? 21 C   G C6     1  
ATOM 6186   H "H5'"  . C   G 2 21 ? 13.793  7.899   12.615  1.00 0.00 ? 21 C   G "H5'"  1  
ATOM 6187   H "H5''" . C   G 2 21 ? 12.091  8.365   12.690  1.00 0.00 ? 21 C   G "H5''" 1  
ATOM 6188   H "H4'"  . C   G 2 21 ? 13.334  8.551   14.855  1.00 0.00 ? 21 C   G "H4'"  1  
ATOM 6189   H "H3'"  . C   G 2 21 ? 12.205  11.137  13.754  1.00 0.00 ? 21 C   G "H3'"  1  
ATOM 6190   H "H2'"  . C   G 2 21 ? 12.736  12.019  15.902  1.00 0.00 ? 21 C   G "H2'"  1  
ATOM 6191   H "HO2'" . C   G 2 21 ? 12.083  10.466  17.349  1.00 0.00 ? 21 C   G "HO2'" 1  
ATOM 6192   H "H1'"  . C   G 2 21 ? 15.098  10.535  16.151  1.00 0.00 ? 21 C   G "H1'"  1  
ATOM 6193   H H41    . C   G 2 21 ? 15.470  16.828  15.374  1.00 0.00 ? 21 C   G H41    1  
ATOM 6194   H H42    . C   G 2 21 ? 14.816  16.737  13.744  1.00 0.00 ? 21 C   G H42    1  
ATOM 6195   H H5     . C   G 2 21 ? 14.440  14.580  12.603  1.00 0.00 ? 21 C   G H5     1  
ATOM 6196   H H6     . C   G 2 21 ? 14.259  12.172  12.980  1.00 0.00 ? 21 C   G H6     1  
ATOM 6197   P P      . A   G 2 22 ? 9.801   10.800  15.199  1.00 0.00 ? 22 A   G P      1  
ATOM 6198   O OP1    . A   G 2 22 ? 8.568   9.987   15.092  1.00 0.00 ? 22 A   G OP1    1  
ATOM 6199   O OP2    . A   G 2 22 ? 9.932   12.027  14.378  1.00 0.00 ? 22 A   G OP2    1  
ATOM 6200   O "O5'"  . A   G 2 22 ? 10.005  11.204  16.743  1.00 0.00 ? 22 A   G "O5'"  1  
ATOM 6201   C "C5'"  . A   G 2 22 ? 9.795   10.268  17.779  1.00 0.00 ? 22 A   G "C5'"  1  
ATOM 6202   C "C4'"  . A   G 2 22 ? 10.187  10.859  19.133  1.00 0.00 ? 22 A   G "C4'"  1  
ATOM 6203   O "O4'"  . A   G 2 22 ? 11.498  11.393  19.117  1.00 0.00 ? 22 A   G "O4'"  1  
ATOM 6204   C "C3'"  . A   G 2 22 ? 9.260   11.990  19.571  1.00 0.00 ? 22 A   G "C3'"  1  
ATOM 6205   O "O3'"  . A   G 2 22 ? 8.062   11.515  20.148  1.00 0.00 ? 22 A   G "O3'"  1  
ATOM 6206   C "C2'"  . A   G 2 22 ? 10.172  12.716  20.558  1.00 0.00 ? 22 A   G "C2'"  1  
ATOM 6207   O "O2'"  . A   G 2 22 ? 10.251  12.068  21.812  1.00 0.00 ? 22 A   G "O2'"  1  
ATOM 6208   C "C1'"  . A   G 2 22 ? 11.524  12.596  19.862  1.00 0.00 ? 22 A   G "C1'"  1  
ATOM 6209   N N9     . A   G 2 22 ? 11.755  13.754  18.976  1.00 0.00 ? 22 A   G N9     1  
ATOM 6210   C C8     . A   G 2 22 ? 11.665  13.822  17.610  1.00 0.00 ? 22 A   G C8     1  
ATOM 6211   N N7     . A   G 2 22 ? 11.948  14.993  17.109  1.00 0.00 ? 22 A   G N7     1  
ATOM 6212   C C5     . A   G 2 22 ? 12.205  15.770  18.236  1.00 0.00 ? 22 A   G C5     1  
ATOM 6213   C C6     . A   G 2 22 ? 12.514  17.129  18.429  1.00 0.00 ? 22 A   G C6     1  
ATOM 6214   N N6     . A   G 2 22 ? 12.582  18.024  17.438  1.00 0.00 ? 22 A   G N6     1  
ATOM 6215   N N1     . A   G 2 22 ? 12.730  17.580  19.670  1.00 0.00 ? 22 A   G N1     1  
ATOM 6216   C C2     . A   G 2 22 ? 12.616  16.732  20.683  1.00 0.00 ? 22 A   G C2     1  
ATOM 6217   N N3     . A   G 2 22 ? 12.307  15.444  20.650  1.00 0.00 ? 22 A   G N3     1  
ATOM 6218   C C4     . A   G 2 22 ? 12.114  15.018  19.377  1.00 0.00 ? 22 A   G C4     1  
ATOM 6219   H "H5'"  . A   G 2 22 ? 10.392  9.376   17.593  1.00 0.00 ? 22 A   G "H5'"  1  
ATOM 6220   H "H5''" . A   G 2 22 ? 8.742   9.984   17.806  1.00 0.00 ? 22 A   G "H5''" 1  
ATOM 6221   H "H4'"  . A   G 2 22 ? 10.141  10.071  19.886  1.00 0.00 ? 22 A   G "H4'"  1  
ATOM 6222   H "H3'"  . A   G 2 22 ? 9.048   12.637  18.719  1.00 0.00 ? 22 A   G "H3'"  1  
ATOM 6223   H "H2'"  . A   G 2 22 ? 9.881   13.759  20.673  1.00 0.00 ? 22 A   G "H2'"  1  
ATOM 6224   H "HO2'" . A   G 2 22 ? 10.601  12.687  22.461  1.00 0.00 ? 22 A   G "HO2'" 1  
ATOM 6225   H "H1'"  . A   G 2 22 ? 12.315  12.570  20.612  1.00 0.00 ? 22 A   G "H1'"  1  
ATOM 6226   H H8     . A   G 2 22 ? 11.391  12.976  17.000  1.00 0.00 ? 22 A   G H8     1  
ATOM 6227   H H61    . A   G 2 22 ? 12.805  18.989  17.637  1.00 0.00 ? 22 A   G H61    1  
ATOM 6228   H H62    . A   G 2 22 ? 12.303  17.740  16.511  1.00 0.00 ? 22 A   G H62    1  
ATOM 6229   H H2     . A   G 2 22 ? 12.773  17.150  21.667  1.00 0.00 ? 22 A   G H2     1  
ATOM 6230   P P      . U   G 2 23 ? 6.762   12.458  20.245  1.00 0.00 ? 23 U   G P      1  
ATOM 6231   O OP1    . U   G 2 23 ? 5.658   11.652  20.813  1.00 0.00 ? 23 U   G OP1    1  
ATOM 6232   O OP2    . U   G 2 23 ? 6.567   13.122  18.935  1.00 0.00 ? 23 U   G OP2    1  
ATOM 6233   O "O5'"  . U   G 2 23 ? 7.167   13.590  21.316  1.00 0.00 ? 23 U   G "O5'"  1  
ATOM 6234   C "C5'"  . U   G 2 23 ? 7.311   13.281  22.686  1.00 0.00 ? 23 U   G "C5'"  1  
ATOM 6235   C "C4'"  . U   G 2 23 ? 7.823   14.477  23.490  1.00 0.00 ? 23 U   G "C4'"  1  
ATOM 6236   O "O4'"  . U   G 2 23 ? 9.065   14.971  23.021  1.00 0.00 ? 23 U   G "O4'"  1  
ATOM 6237   C "C3'"  . U   G 2 23 ? 6.851   15.653  23.464  1.00 0.00 ? 23 U   G "C3'"  1  
ATOM 6238   O "O3'"  . U   G 2 23 ? 5.776   15.514  24.370  1.00 0.00 ? 23 U   G "O3'"  1  
ATOM 6239   C "C2'"  . U   G 2 23 ? 7.804   16.775  23.861  1.00 0.00 ? 23 U   G "C2'"  1  
ATOM 6240   O "O2'"  . U   G 2 23 ? 8.060   16.789  25.251  1.00 0.00 ? 23 U   G "O2'"  1  
ATOM 6241   C "C1'"  . U   G 2 23 ? 9.080   16.385  23.124  1.00 0.00 ? 23 U   G "C1'"  1  
ATOM 6242   N N1     . U   G 2 23 ? 9.126   17.048  21.802  1.00 0.00 ? 23 U   G N1     1  
ATOM 6243   C C2     . U   G 2 23 ? 9.460   18.394  21.748  1.00 0.00 ? 23 U   G C2     1  
ATOM 6244   O O2     . U   G 2 23 ? 9.709   19.065  22.748  1.00 0.00 ? 23 U   G O2     1  
ATOM 6245   N N3     . U   G 2 23 ? 9.486   18.976  20.490  1.00 0.00 ? 23 U   G N3     1  
ATOM 6246   C C4     . U   G 2 23 ? 9.273   18.319  19.291  1.00 0.00 ? 23 U   G C4     1  
ATOM 6247   O O4     . U   G 2 23 ? 9.277   18.940  18.230  1.00 0.00 ? 23 U   G O4     1  
ATOM 6248   C C5     . U   G 2 23 ? 9.004   16.909  19.436  1.00 0.00 ? 23 U   G C5     1  
ATOM 6249   C C6     . U   G 2 23 ? 8.891   16.341  20.657  1.00 0.00 ? 23 U   G C6     1  
ATOM 6250   H "H5'"  . U   G 2 23 ? 8.005   12.449  22.804  1.00 0.00 ? 23 U   G "H5'"  1  
ATOM 6251   H "H5''" . U   G 2 23 ? 6.343   12.977  23.088  1.00 0.00 ? 23 U   G "H5''" 1  
ATOM 6252   H "H4'"  . U   G 2 23 ? 7.948   14.164  24.527  1.00 0.00 ? 23 U   G "H4'"  1  
ATOM 6253   H "H3'"  . U   G 2 23 ? 6.489   15.811  22.448  1.00 0.00 ? 23 U   G "H3'"  1  
ATOM 6254   H "H2'"  . U   G 2 23 ? 7.444   17.739  23.511  1.00 0.00 ? 23 U   G "H2'"  1  
ATOM 6255   H "HO2'" . U   G 2 23 ? 7.233   16.610  25.710  1.00 0.00 ? 23 U   G "HO2'" 1  
ATOM 6256   H "H1'"  . U   G 2 23 ? 9.937   16.723  23.706  1.00 0.00 ? 23 U   G "H1'"  1  
ATOM 6257   H H3     . U   G 2 23 ? 9.656   19.971  20.440  1.00 0.00 ? 23 U   G H3     1  
ATOM 6258   H H5     . U   G 2 23 ? 8.880   16.289  18.561  1.00 0.00 ? 23 U   G H5     1  
ATOM 6259   H H6     . U   G 2 23 ? 8.616   15.302  20.734  1.00 0.00 ? 23 U   G H6     1  
ATOM 6260   P P      . C   G 2 24 ? 4.405   16.330  24.151  1.00 0.00 ? 24 C   G P      1  
ATOM 6261   O OP1    . C   G 2 24 ? 3.445   15.889  25.190  1.00 0.00 ? 24 C   G OP1    1  
ATOM 6262   O OP2    . C   G 2 24 ? 4.027   16.226  22.724  1.00 0.00 ? 24 C   G OP2    1  
ATOM 6263   O "O5'"  . C   G 2 24 ? 4.808   17.859  24.449  1.00 0.00 ? 24 C   G "O5'"  1  
ATOM 6264   C "C5'"  . C   G 2 24 ? 5.048   18.311  25.765  1.00 0.00 ? 24 C   G "C5'"  1  
ATOM 6265   C "C4'"  . C   G 2 24 ? 5.664   19.711  25.761  1.00 0.00 ? 24 C   G "C4'"  1  
ATOM 6266   O "O4'"  . C   G 2 24 ? 6.781   19.789  24.896  1.00 0.00 ? 24 C   G "O4'"  1  
ATOM 6267   C "C3'"  . C   G 2 24 ? 4.673   20.780  25.309  1.00 0.00 ? 24 C   G "C3'"  1  
ATOM 6268   O "O3'"  . C   G 2 24 ? 3.861   21.238  26.371  1.00 0.00 ? 24 C   G "O3'"  1  
ATOM 6269   C "C2'"  . C   G 2 24 ? 5.631   21.863  24.821  1.00 0.00 ? 24 C   G "C2'"  1  
ATOM 6270   O "O2'"  . C   G 2 24 ? 6.096   22.662  25.890  1.00 0.00 ? 24 C   G "O2'"  1  
ATOM 6271   C "C1'"  . C   G 2 24 ? 6.804   21.056  24.266  1.00 0.00 ? 24 C   G "C1'"  1  
ATOM 6272   N N1     . C   G 2 24 ? 6.708   20.947  22.793  1.00 0.00 ? 24 C   G N1     1  
ATOM 6273   C C2     . C   G 2 24 ? 7.026   22.072  22.047  1.00 0.00 ? 24 C   G C2     1  
ATOM 6274   O O2     . C   G 2 24 ? 7.440   23.095  22.587  1.00 0.00 ? 24 C   G O2     1  
ATOM 6275   N N3     . C   G 2 24 ? 6.869   22.054  20.699  1.00 0.00 ? 24 C   G N3     1  
ATOM 6276   C C4     . C   G 2 24 ? 6.442   20.943  20.096  1.00 0.00 ? 24 C   G C4     1  
ATOM 6277   N N4     . C   G 2 24 ? 6.268   20.993  18.776  1.00 0.00 ? 24 C   G N4     1  
ATOM 6278   C C5     . C   G 2 24 ? 6.155   19.748  20.827  1.00 0.00 ? 24 C   G C5     1  
ATOM 6279   C C6     . C   G 2 24 ? 6.298   19.800  22.170  1.00 0.00 ? 24 C   G C6     1  
ATOM 6280   H "H5'"  . C   G 2 24 ? 5.730   17.627  26.270  1.00 0.00 ? 24 C   G "H5'"  1  
ATOM 6281   H "H5''" . C   G 2 24 ? 4.109   18.335  26.319  1.00 0.00 ? 24 C   G "H5''" 1  
ATOM 6282   H "H4'"  . C   G 2 24 ? 5.989   19.952  26.773  1.00 0.00 ? 24 C   G "H4'"  1  
ATOM 6283   H "H3'"  . C   G 2 24 ? 4.073   20.405  24.479  1.00 0.00 ? 24 C   G "H3'"  1  
ATOM 6284   H "H2'"  . C   G 2 24 ? 5.166   22.479  24.051  1.00 0.00 ? 24 C   G "H2'"  1  
ATOM 6285   H "HO2'" . C   G 2 24 ? 5.377   22.758  26.525  1.00 0.00 ? 24 C   G "HO2'" 1  
ATOM 6286   H "H1'"  . C   G 2 24 ? 7.732   21.569  24.521  1.00 0.00 ? 24 C   G "H1'"  1  
ATOM 6287   H H41    . C   G 2 24 ? 6.492   21.850  18.289  1.00 0.00 ? 24 C   G H41    1  
ATOM 6288   H H42    . C   G 2 24 ? 5.839   20.221  18.288  1.00 0.00 ? 24 C   G H42    1  
ATOM 6289   H H5     . C   G 2 24 ? 5.822   18.836  20.356  1.00 0.00 ? 24 C   G H5     1  
ATOM 6290   H H6     . C   G 2 24 ? 6.095   18.918  22.759  1.00 0.00 ? 24 C   G H6     1  
ATOM 6291   P P      . A   G 2 25 ? 2.331   21.660  26.113  1.00 0.00 ? 25 A   G P      1  
ATOM 6292   O OP1    . A   G 2 25 ? 1.785   22.190  27.383  1.00 0.00 ? 25 A   G OP1    1  
ATOM 6293   O OP2    . A   G 2 25 ? 1.647   20.529  25.445  1.00 0.00 ? 25 A   G OP2    1  
ATOM 6294   O "O5'"  . A   G 2 25 ? 2.444   22.870  25.056  1.00 0.00 ? 25 A   G "O5'"  1  
ATOM 6295   C "C5'"  . A   G 2 25 ? 2.795   24.175  25.468  1.00 0.00 ? 25 A   G "C5'"  1  
ATOM 6296   C "C4'"  . A   G 2 25 ? 2.976   25.105  24.268  1.00 0.00 ? 25 A   G "C4'"  1  
ATOM 6297   O "O4'"  . A   G 2 25 ? 4.046   24.684  23.443  1.00 0.00 ? 25 A   G "O4'"  1  
ATOM 6298   C "C3'"  . A   G 2 25 ? 1.739   25.172  23.376  1.00 0.00 ? 25 A   G "C3'"  1  
ATOM 6299   O "O3'"  . A   G 2 25 ? 0.745   26.066  23.832  1.00 0.00 ? 25 A   G "O3'"  1  
ATOM 6300   C "C2'"  . A   G 2 25 ? 2.365   25.633  22.064  1.00 0.00 ? 25 A   G "C2'"  1  
ATOM 6301   O "O2'"  . A   G 2 25 ? 2.602   27.025  22.052  1.00 0.00 ? 25 A   G "O2'"  1  
ATOM 6302   C "C1'"  . A   G 2 25 ? 3.706   24.904  22.086  1.00 0.00 ? 25 A   G "C1'"  1  
ATOM 6303   N N9     . A   G 2 25 ? 3.569   23.620  21.371  1.00 0.00 ? 25 A   G N9     1  
ATOM 6304   C C8     . A   G 2 25 ? 3.312   22.376  21.889  1.00 0.00 ? 25 A   G C8     1  
ATOM 6305   N N7     . A   G 2 25 ? 3.121   21.449  20.990  1.00 0.00 ? 25 A   G N7     1  
ATOM 6306   C C5     . A   G 2 25 ? 3.248   22.139  19.787  1.00 0.00 ? 25 A   G C5     1  
ATOM 6307   C C6     . A   G 2 25 ? 3.154   21.757  18.437  1.00 0.00 ? 25 A   G C6     1  
ATOM 6308   N N6     . A   G 2 25 ? 2.947   20.498  18.043  1.00 0.00 ? 25 A   G N6     1  
ATOM 6309   N N1     . A   G 2 25 ? 3.306   22.678  17.477  1.00 0.00 ? 25 A   G N1     1  
ATOM 6310   C C2     . A   G 2 25 ? 3.581   23.922  17.839  1.00 0.00 ? 25 A   G C2     1  
ATOM 6311   N N3     . A   G 2 25 ? 3.710   24.419  19.061  1.00 0.00 ? 25 A   G N3     1  
ATOM 6312   C C4     . A   G 2 25 ? 3.529   23.461  20.006  1.00 0.00 ? 25 A   G C4     1  
ATOM 6313   H "H5'"  . A   G 2 25 ? 3.727   24.142  26.033  1.00 0.00 ? 25 A   G "H5'"  1  
ATOM 6314   H "H5''" . A   G 2 25 ? 2.010   24.573  26.108  1.00 0.00 ? 25 A   G "H5''" 1  
ATOM 6315   H "H4'"  . A   G 2 25 ? 3.191   26.110  24.632  1.00 0.00 ? 25 A   G "H4'"  1  
ATOM 6316   H "H3'"  . A   G 2 25 ? 1.327   24.171  23.244  1.00 0.00 ? 25 A   G "H3'"  1  
ATOM 6317   H "H2'"  . A   G 2 25 ? 1.754   25.324  21.216  1.00 0.00 ? 25 A   G "H2'"  1  
ATOM 6318   H "HO2'" . A   G 2 25 ? 1.818   27.469  22.391  1.00 0.00 ? 25 A   G "HO2'" 1  
ATOM 6319   H "H1'"  . A   G 2 25 ? 4.467   25.514  21.598  1.00 0.00 ? 25 A   G "H1'"  1  
ATOM 6320   H H8     . A   G 2 25 ? 3.264   22.180  22.949  1.00 0.00 ? 25 A   G H8     1  
ATOM 6321   H H61    . A   G 2 25 ? 3.081   20.274  17.066  1.00 0.00 ? 25 A   G H61    1  
ATOM 6322   H H62    . A   G 2 25 ? 2.938   19.768  18.742  1.00 0.00 ? 25 A   G H62    1  
ATOM 6323   H H2     . A   G 2 25 ? 3.727   24.618  17.027  1.00 0.00 ? 25 A   G H2     1  
ATOM 6324   P P      . A   G 2 26 ? -0.780  25.569  23.952  1.00 0.00 ? 26 A   G P      1  
ATOM 6325   O OP1    . A   G 2 26 ? -1.014  25.155  25.355  1.00 0.00 ? 26 A   G OP1    1  
ATOM 6326   O OP2    . A   G 2 26 ? -1.036  24.602  22.860  1.00 0.00 ? 26 A   G OP2    1  
ATOM 6327   O "O5'"  . A   G 2 26 ? -1.667  26.883  23.669  1.00 0.00 ? 26 A   G "O5'"  1  
ATOM 6328   C "C5'"  . A   G 2 26 ? -1.765  27.429  22.372  1.00 0.00 ? 26 A   G "C5'"  1  
ATOM 6329   C "C4'"  . A   G 2 26 ? -3.085  28.165  22.127  1.00 0.00 ? 26 A   G "C4'"  1  
ATOM 6330   O "O4'"  . A   G 2 26 ? -4.126  27.219  21.956  1.00 0.00 ? 26 A   G "O4'"  1  
ATOM 6331   C "C3'"  . A   G 2 26 ? -3.563  29.137  23.207  1.00 0.00 ? 26 A   G "C3'"  1  
ATOM 6332   O "O3'"  . A   G 2 26 ? -3.057  30.449  23.087  1.00 0.00 ? 26 A   G "O3'"  1  
ATOM 6333   C "C2'"  . A   G 2 26 ? -5.068  29.137  22.939  1.00 0.00 ? 26 A   G "C2'"  1  
ATOM 6334   O "O2'"  . A   G 2 26 ? -5.400  29.956  21.837  1.00 0.00 ? 26 A   G "O2'"  1  
ATOM 6335   C "C1'"  . A   G 2 26 ? -5.312  27.675  22.583  1.00 0.00 ? 26 A   G "C1'"  1  
ATOM 6336   N N9     . A   G 2 26 ? -5.597  26.906  23.812  1.00 0.00 ? 26 A   G N9     1  
ATOM 6337   C C8     . A   G 2 26 ? -4.716  26.348  24.699  1.00 0.00 ? 26 A   G C8     1  
ATOM 6338   N N7     . A   G 2 26 ? -5.263  25.778  25.737  1.00 0.00 ? 26 A   G N7     1  
ATOM 6339   C C5     . A   G 2 26 ? -6.625  25.968  25.514  1.00 0.00 ? 26 A   G C5     1  
ATOM 6340   C C6     . A   G 2 26 ? -7.783  25.605  26.225  1.00 0.00 ? 26 A   G C6     1  
ATOM 6341   N N6     . A   G 2 26 ? -7.782  24.935  27.380  1.00 0.00 ? 26 A   G N6     1  
ATOM 6342   N N1     . A   G 2 26 ? -8.981  25.920  25.723  1.00 0.00 ? 26 A   G N1     1  
ATOM 6343   C C2     . A   G 2 26 ? -9.028  26.588  24.581  1.00 0.00 ? 26 A   G C2     1  
ATOM 6344   N N3     . A   G 2 26 ? -8.030  27.013  23.820  1.00 0.00 ? 26 A   G N3     1  
ATOM 6345   C C4     . A   G 2 26 ? -6.836  26.654  24.348  1.00 0.00 ? 26 A   G C4     1  
ATOM 6346   H "H5'"  . A   G 2 26 ? -1.690  26.630  21.636  1.00 0.00 ? 26 A   G "H5'"  1  
ATOM 6347   H "H5''" . A   G 2 26 ? -0.927  28.106  22.211  1.00 0.00 ? 26 A   G "H5''" 1  
ATOM 6348   H "H4'"  . A   G 2 26 ? -2.961  28.735  21.206  1.00 0.00 ? 26 A   G "H4'"  1  
ATOM 6349   H "H3'"  . A   G 2 26 ? -3.370  28.731  24.202  1.00 0.00 ? 26 A   G "H3'"  1  
ATOM 6350   H "H2'"  . A   G 2 26 ? -5.650  29.425  23.814  1.00 0.00 ? 26 A   G "H2'"  1  
ATOM 6351   H "HO2'" . A   G 2 26 ? -4.796  30.705  21.835  1.00 0.00 ? 26 A   G "HO2'" 1  
ATOM 6352   H "H1'"  . A   G 2 26 ? -6.173  27.580  21.920  1.00 0.00 ? 26 A   G "H1'"  1  
ATOM 6353   H H8     . A   G 2 26 ? -3.654  26.395  24.531  1.00 0.00 ? 26 A   G H8     1  
ATOM 6354   H H61    . A   G 2 26 ? -8.660  24.778  27.853  1.00 0.00 ? 26 A   G H61    1  
ATOM 6355   H H62    . A   G 2 26 ? -6.906  24.759  27.852  1.00 0.00 ? 26 A   G H62    1  
ATOM 6356   H H2     . A   G 2 26 ? -10.014 26.794  24.199  1.00 0.00 ? 26 A   G H2     1  
ATOM 6357   P P      . G   G 2 27 ? -1.654  30.872  23.749  1.00 0.00 ? 27 G   G P      1  
ATOM 6358   O OP1    . G   G 2 27 ? -1.382  30.016  24.924  1.00 0.00 ? 27 G   G OP1    1  
ATOM 6359   O OP2    . G   G 2 27 ? -1.680  32.341  23.928  1.00 0.00 ? 27 G   G OP2    1  
ATOM 6360   O "O5'"  . G   G 2 27 ? -0.582  30.540  22.597  1.00 0.00 ? 27 G   G "O5'"  1  
ATOM 6361   C "C5'"  . G   G 2 27 ? 0.801   30.731  22.810  1.00 0.00 ? 27 G   G "C5'"  1  
ATOM 6362   C "C4'"  . G   G 2 27 ? 1.570   30.814  21.489  1.00 0.00 ? 27 G   G "C4'"  1  
ATOM 6363   O "O4'"  . G   G 2 27 ? 1.564   29.559  20.835  1.00 0.00 ? 27 G   G "O4'"  1  
ATOM 6364   C "C3'"  . G   G 2 27 ? 0.949   31.851  20.555  1.00 0.00 ? 27 G   G "C3'"  1  
ATOM 6365   O "O3'"  . G   G 2 27 ? 1.948   32.563  19.849  1.00 0.00 ? 27 G   G "O3'"  1  
ATOM 6366   C "C2'"  . G   G 2 27 ? 0.078   30.962  19.673  1.00 0.00 ? 27 G   G "C2'"  1  
ATOM 6367   O "O2'"  . G   G 2 27 ? -0.167  31.476  18.382  1.00 0.00 ? 27 G   G "O2'"  1  
ATOM 6368   C "C1'"  . G   G 2 27 ? 0.884   29.668  19.603  1.00 0.00 ? 27 G   G "C1'"  1  
ATOM 6369   N N9     . G   G 2 27 ? 0.097   28.437  19.374  1.00 0.00 ? 27 G   G N9     1  
ATOM 6370   C C8     . G   G 2 27 ? 0.555   27.149  19.458  1.00 0.00 ? 27 G   G C8     1  
ATOM 6371   N N7     . G   G 2 27 ? -0.329  26.241  19.154  1.00 0.00 ? 27 G   G N7     1  
ATOM 6372   C C5     . G   G 2 27 ? -1.446  26.984  18.782  1.00 0.00 ? 27 G   G C5     1  
ATOM 6373   C C6     . G   G 2 27 ? -2.699  26.554  18.260  1.00 0.00 ? 27 G   G C6     1  
ATOM 6374   O O6     . G   G 2 27 ? -3.071  25.409  18.008  1.00 0.00 ? 27 G   G O6     1  
ATOM 6375   N N1     . G   G 2 27 ? -3.555  27.613  18.000  1.00 0.00 ? 27 G   G N1     1  
ATOM 6376   C C2     . G   G 2 27 ? -3.220  28.936  18.156  1.00 0.00 ? 27 G   G C2     1  
ATOM 6377   N N2     . G   G 2 27 ? -4.107  29.846  17.754  1.00 0.00 ? 27 G   G N2     1  
ATOM 6378   N N3     . G   G 2 27 ? -2.023  29.348  18.579  1.00 0.00 ? 27 G   G N3     1  
ATOM 6379   C C4     . G   G 2 27 ? -1.189  28.328  18.899  1.00 0.00 ? 27 G   G C4     1  
ATOM 6380   H "H5'"  . G   G 2 27 ? 1.195   29.908  23.408  1.00 0.00 ? 27 G   G "H5'"  1  
ATOM 6381   H "H5''" . G   G 2 27 ? 0.952   31.663  23.356  1.00 0.00 ? 27 G   G "H5''" 1  
ATOM 6382   H "H4'"  . G   G 2 27 ? 2.598   31.094  21.707  1.00 0.00 ? 27 G   G "H4'"  1  
ATOM 6383   H "H3'"  . G   G 2 27 ? 0.332   32.530  21.138  1.00 0.00 ? 27 G   G "H3'"  1  
ATOM 6384   H "H2'"  . G   G 2 27 ? -0.865  30.785  20.190  1.00 0.00 ? 27 G   G "H2'"  1  
ATOM 6385   H "HO2'" . G   G 2 27 ? -0.846  30.924  17.981  1.00 0.00 ? 27 G   G "HO2'" 1  
ATOM 6386   H "H1'"  . G   G 2 27 ? 1.607   29.770  18.794  1.00 0.00 ? 27 G   G "H1'"  1  
ATOM 6387   H H8     . G   G 2 27 ? 1.566   26.912  19.757  1.00 0.00 ? 27 G   G H8     1  
ATOM 6388   H H1     . G   G 2 27 ? -4.505  27.402  17.734  1.00 0.00 ? 27 G   G H1     1  
ATOM 6389   H H21    . G   G 2 27 ? -3.851  30.824  17.748  1.00 0.00 ? 27 G   G H21    1  
ATOM 6390   H H22    . G   G 2 27 ? -4.972  29.538  17.332  1.00 0.00 ? 27 G   G H22    1  
ATOM 6391   P P      . G   G 2 28 ? 1.718   34.094  19.397  1.00 0.00 ? 28 G   G P      1  
ATOM 6392   O OP1    . G   G 2 28 ? 3.044   34.734  19.253  1.00 0.00 ? 28 G   G OP1    1  
ATOM 6393   O OP2    . G   G 2 28 ? 0.726   34.710  20.309  1.00 0.00 ? 28 G   G OP2    1  
ATOM 6394   O "O5'"  . G   G 2 28 ? 1.046   34.037  17.935  1.00 0.00 ? 28 G   G "O5'"  1  
ATOM 6395   C "C5'"  . G   G 2 28 ? 1.764   33.561  16.817  1.00 0.00 ? 28 G   G "C5'"  1  
ATOM 6396   C "C4'"  . G   G 2 28 ? 1.226   34.141  15.508  1.00 0.00 ? 28 G   G "C4'"  1  
ATOM 6397   O "O4'"  . G   G 2 28 ? 0.037   33.490  15.109  1.00 0.00 ? 28 G   G "O4'"  1  
ATOM 6398   C "C3'"  . G   G 2 28 ? 0.915   35.632  15.618  1.00 0.00 ? 28 G   G "C3'"  1  
ATOM 6399   O "O3'"  . G   G 2 28 ? 1.157   36.253  14.371  1.00 0.00 ? 28 G   G "O3'"  1  
ATOM 6400   C "C2'"  . G   G 2 28 ? -0.576  35.604  15.936  1.00 0.00 ? 28 G   G "C2'"  1  
ATOM 6401   O "O2'"  . G   G 2 28 ? -1.232  36.794  15.550  1.00 0.00 ? 28 G   G "O2'"  1  
ATOM 6402   C "C1'"  . G   G 2 28 ? -1.041  34.404  15.118  1.00 0.00 ? 28 G   G "C1'"  1  
ATOM 6403   N N9     . G   G 2 28 ? -2.245  33.744  15.659  1.00 0.00 ? 28 G   G N9     1  
ATOM 6404   C C8     . G   G 2 28 ? -2.480  33.241  16.912  1.00 0.00 ? 28 G   G C8     1  
ATOM 6405   N N7     . G   G 2 28 ? -3.671  32.729  17.062  1.00 0.00 ? 28 G   G N7     1  
ATOM 6406   C C5     . G   G 2 28 ? -4.254  32.859  15.803  1.00 0.00 ? 28 G   G C5     1  
ATOM 6407   C C6     . G   G 2 28 ? -5.539  32.471  15.328  1.00 0.00 ? 28 G   G C6     1  
ATOM 6408   O O6     . G   G 2 28 ? -6.433  31.868  15.919  1.00 0.00 ? 28 G   G O6     1  
ATOM 6409   N N1     . G   G 2 28 ? -5.756  32.856  14.013  1.00 0.00 ? 28 G   G N1     1  
ATOM 6410   C C2     . G   G 2 28 ? -4.802  33.434  13.209  1.00 0.00 ? 28 G   G C2     1  
ATOM 6411   N N2     . G   G 2 28 ? -5.195  33.832  12.000  1.00 0.00 ? 28 G   G N2     1  
ATOM 6412   N N3     . G   G 2 28 ? -3.569  33.741  13.622  1.00 0.00 ? 28 G   G N3     1  
ATOM 6413   C C4     . G   G 2 28 ? -3.372  33.448  14.931  1.00 0.00 ? 28 G   G C4     1  
ATOM 6414   H "H5'"  . G   G 2 28 ? 1.707   32.473  16.782  1.00 0.00 ? 28 G   G "H5'"  1  
ATOM 6415   H "H5''" . G   G 2 28 ? 2.811   33.847  16.914  1.00 0.00 ? 28 G   G "H5''" 1  
ATOM 6416   H "H4'"  . G   G 2 28 ? 1.977   33.989  14.734  1.00 0.00 ? 28 G   G "H4'"  1  
ATOM 6417   H "H3'"  . G   G 2 28 ? 1.481   36.097  16.425  1.00 0.00 ? 28 G   G "H3'"  1  
ATOM 6418   H "H2'"  . G   G 2 28 ? -0.704  35.407  17.000  1.00 0.00 ? 28 G   G "H2'"  1  
ATOM 6419   H "HO2'" . G   G 2 28 ? -0.758  37.165  14.798  1.00 0.00 ? 28 G   G "HO2'" 1  
ATOM 6420   H "H1'"  . G   G 2 28 ? -1.263  34.739  14.104  1.00 0.00 ? 28 G   G "H1'"  1  
ATOM 6421   H H8     . G   G 2 28 ? -1.736  33.253  17.695  1.00 0.00 ? 28 G   G H8     1  
ATOM 6422   H H1     . G   G 2 28 ? -6.639  32.609  13.594  1.00 0.00 ? 28 G   G H1     1  
ATOM 6423   H H21    . G   G 2 28 ? -6.176  33.846  11.762  1.00 0.00 ? 28 G   G H21    1  
ATOM 6424   H H22    . G   G 2 28 ? -4.542  34.343  11.421  1.00 0.00 ? 28 G   G H22    1  
ATOM 6425   P P      . A   G 2 29 ? 2.124   37.532  14.252  1.00 0.00 ? 29 A   G P      1  
ATOM 6426   O OP1    . A   G 2 29 ? 1.983   38.361  15.470  1.00 0.00 ? 29 A   G OP1    1  
ATOM 6427   O OP2    . A   G 2 29 ? 1.878   38.138  12.924  1.00 0.00 ? 29 A   G OP2    1  
ATOM 6428   O "O5'"  . A   G 2 29 ? 3.601   36.892  14.230  1.00 0.00 ? 29 A   G "O5'"  1  
ATOM 6429   C "C5'"  . A   G 2 29 ? 4.069   36.078  15.284  1.00 0.00 ? 29 A   G "C5'"  1  
ATOM 6430   C "C4'"  . A   G 2 29 ? 5.576   35.858  15.165  1.00 0.00 ? 29 A   G "C4'"  1  
ATOM 6431   O "O4'"  . A   G 2 29 ? 6.023   35.059  16.243  1.00 0.00 ? 29 A   G "O4'"  1  
ATOM 6432   C "C3'"  . A   G 2 29 ? 5.927   35.135  13.862  1.00 0.00 ? 29 A   G "C3'"  1  
ATOM 6433   O "O3'"  . A   G 2 29 ? 6.548   36.003  12.938  1.00 0.00 ? 29 A   G "O3'"  1  
ATOM 6434   C "C2'"  . A   G 2 29 ? 6.869   34.016  14.305  1.00 0.00 ? 29 A   G "C2'"  1  
ATOM 6435   O "O2'"  . A   G 2 29 ? 8.216   34.443  14.308  1.00 0.00 ? 29 A   G "O2'"  1  
ATOM 6436   C "C1'"  . A   G 2 29 ? 6.447   33.801  15.759  1.00 0.00 ? 29 A   G "C1'"  1  
ATOM 6437   N N9     . A   G 2 29 ? 5.363   32.811  15.924  1.00 0.00 ? 29 A   G N9     1  
ATOM 6438   C C8     . A   G 2 29 ? 4.586   32.229  14.958  1.00 0.00 ? 29 A   G C8     1  
ATOM 6439   N N7     . A   G 2 29 ? 3.949   31.160  15.349  1.00 0.00 ? 29 A   G N7     1  
ATOM 6440   C C5     . A   G 2 29 ? 4.294   31.054  16.693  1.00 0.00 ? 29 A   G C5     1  
ATOM 6441   C C6     . A   G 2 29 ? 4.036   30.098  17.693  1.00 0.00 ? 29 A   G C6     1  
ATOM 6442   N N6     . A   G 2 29 ? 3.439   28.922  17.483  1.00 0.00 ? 29 A   G N6     1  
ATOM 6443   N N1     . A   G 2 29 ? 4.470   30.319  18.939  1.00 0.00 ? 29 A   G N1     1  
ATOM 6444   C C2     . A   G 2 29 ? 5.158   31.425  19.176  1.00 0.00 ? 29 A   G C2     1  
ATOM 6445   N N3     . A   G 2 29 ? 5.560   32.352  18.318  1.00 0.00 ? 29 A   G N3     1  
ATOM 6446   C C4     . A   G 2 29 ? 5.079   32.111  17.074  1.00 0.00 ? 29 A   G C4     1  
ATOM 6447   H "H5'"  . A   G 2 29 ? 3.583   35.106  15.232  1.00 0.00 ? 29 A   G "H5'"  1  
ATOM 6448   H "H5''" . A   G 2 29 ? 3.831   36.537  16.244  1.00 0.00 ? 29 A   G "H5''" 1  
ATOM 6449   H "H4'"  . A   G 2 29 ? 6.084   36.821  15.194  1.00 0.00 ? 29 A   G "H4'"  1  
ATOM 6450   H "H3'"  . A   G 2 29 ? 5.025   34.705  13.429  1.00 0.00 ? 29 A   G "H3'"  1  
ATOM 6451   H "H2'"  . A   G 2 29 ? 6.763   33.127  13.678  1.00 0.00 ? 29 A   G "H2'"  1  
ATOM 6452   H "HO2'" . A   G 2 29 ? 8.257   35.301  13.871  1.00 0.00 ? 29 A   G "HO2'" 1  
ATOM 6453   H "H1'"  . A   G 2 29 ? 7.308   33.457  16.332  1.00 0.00 ? 29 A   G "H1'"  1  
ATOM 6454   H H8     . A   G 2 29 ? 4.546   32.608  13.950  1.00 0.00 ? 29 A   G H8     1  
ATOM 6455   H H61    . A   G 2 29 ? 3.393   28.260  18.243  1.00 0.00 ? 29 A   G H61    1  
ATOM 6456   H H62    . A   G 2 29 ? 3.205   28.639  16.540  1.00 0.00 ? 29 A   G H62    1  
ATOM 6457   H H2     . A   G 2 29 ? 5.488   31.551  20.196  1.00 0.00 ? 29 A   G H2     1  
ATOM 6458   P P      . C   G 2 30 ? 6.202   35.897  11.372  1.00 0.00 ? 30 C   G P      1  
ATOM 6459   O OP1    . C   G 2 30 ? 7.091   36.823  10.635  1.00 0.00 ? 30 C   G OP1    1  
ATOM 6460   O OP2    . C   G 2 30 ? 4.735   36.005  11.208  1.00 0.00 ? 30 C   G OP2    1  
ATOM 6461   O "O5'"  . C   G 2 30 ? 6.632   34.388  11.026  1.00 0.00 ? 30 C   G "O5'"  1  
ATOM 6462   C "C5'"  . C   G 2 30 ? 7.992   34.020  10.957  1.00 0.00 ? 30 C   G "C5'"  1  
ATOM 6463   C "C4'"  . C   G 2 30 ? 8.078   32.496  10.942  1.00 0.00 ? 30 C   G "C4'"  1  
ATOM 6464   O "O4'"  . C   G 2 30 ? 7.643   32.037  9.679   1.00 0.00 ? 30 C   G "O4'"  1  
ATOM 6465   C "C3'"  . C   G 2 30 ? 9.509   32.008  11.137  1.00 0.00 ? 30 C   G "C3'"  1  
ATOM 6466   O "O3'"  . C   G 2 30 ? 9.470   30.718  11.713  1.00 0.00 ? 30 C   G "O3'"  1  
ATOM 6467   C "C2'"  . C   G 2 30 ? 10.005  31.961  9.695   1.00 0.00 ? 30 C   G "C2'"  1  
ATOM 6468   O "O2'"  . C   G 2 30 ? 11.103  31.090  9.515   1.00 0.00 ? 30 C   G "O2'"  1  
ATOM 6469   C "C1'"  . C   G 2 30 ? 8.741   31.482  8.987   1.00 0.00 ? 30 C   G "C1'"  1  
ATOM 6470   N N1     . C   G 2 30 ? 8.741   31.892  7.564   1.00 0.00 ? 30 C   G N1     1  
ATOM 6471   C C2     . C   G 2 30 ? 9.451   31.122  6.653   1.00 0.00 ? 30 C   G C2     1  
ATOM 6472   O O2     . C   G 2 30 ? 10.091  30.139  7.019   1.00 0.00 ? 30 C   G O2     1  
ATOM 6473   N N3     . C   G 2 30 ? 9.456   31.473  5.340   1.00 0.00 ? 30 C   G N3     1  
ATOM 6474   C C4     . C   G 2 30 ? 8.815   32.576  4.948   1.00 0.00 ? 30 C   G C4     1  
ATOM 6475   N N4     . C   G 2 30 ? 8.854   32.889  3.652   1.00 0.00 ? 30 C   G N4     1  
ATOM 6476   C C5     . C   G 2 30 ? 8.132   33.427  5.872   1.00 0.00 ? 30 C   G C5     1  
ATOM 6477   C C6     . C   G 2 30 ? 8.129   33.049  7.169   1.00 0.00 ? 30 C   G C6     1  
ATOM 6478   H "H5'"  . C   G 2 30 ? 8.526   34.406  11.825  1.00 0.00 ? 30 C   G "H5'"  1  
ATOM 6479   H "H5''" . C   G 2 30 ? 8.442   34.428  10.051  1.00 0.00 ? 30 C   G "H5''" 1  
ATOM 6480   H "H4'"  . C   G 2 30 ? 7.452   32.092  11.736  1.00 0.00 ? 30 C   G "H4'"  1  
ATOM 6481   H "H3'"  . C   G 2 30 ? 10.073  32.726  11.731  1.00 0.00 ? 30 C   G "H3'"  1  
ATOM 6482   H "H2'"  . C   G 2 30 ? 10.261  32.967  9.361   1.00 0.00 ? 30 C   G "H2'"  1  
ATOM 6483   H "HO2'" . C   G 2 30 ? 11.082  30.745  8.616   1.00 0.00 ? 30 C   G "HO2'" 1  
ATOM 6484   H "H1'"  . C   G 2 30 ? 8.660   30.401  9.103   1.00 0.00 ? 30 C   G "H1'"  1  
ATOM 6485   H H41    . C   G 2 30 ? 9.351   32.285  3.015   1.00 0.00 ? 30 C   G H41    1  
ATOM 6486   H H42    . C   G 2 30 ? 8.388   33.723  3.324   1.00 0.00 ? 30 C   G H42    1  
ATOM 6487   H H5     . C   G 2 30 ? 7.634   34.338  5.575   1.00 0.00 ? 30 C   G H5     1  
ATOM 6488   H H6     . C   G 2 30 ? 7.628   33.664  7.903   1.00 0.00 ? 30 C   G H6     1  
ATOM 6489   P P      . G   G 2 31 ? 10.483  30.273  12.880  1.00 0.00 ? 31 G   G P      1  
ATOM 6490   O OP1    . G   G 2 31 ? 11.275  31.445  13.323  1.00 0.00 ? 31 G   G OP1    1  
ATOM 6491   O OP2    . G   G 2 31 ? 11.181  29.040  12.452  1.00 0.00 ? 31 G   G OP2    1  
ATOM 6492   O "O5'"  . G   G 2 31 ? 9.444   29.878  14.045  1.00 0.00 ? 31 G   G "O5'"  1  
ATOM 6493   C "C5'"  . G   G 2 31 ? 8.645   30.861  14.669  1.00 0.00 ? 31 G   G "C5'"  1  
ATOM 6494   C "C4'"  . G   G 2 31 ? 8.633   30.719  16.191  1.00 0.00 ? 31 G   G "C4'"  1  
ATOM 6495   O "O4'"  . G   G 2 31 ? 7.375   30.262  16.648  1.00 0.00 ? 31 G   G "O4'"  1  
ATOM 6496   C "C3'"  . G   G 2 31 ? 9.659   29.732  16.743  1.00 0.00 ? 31 G   G "C3'"  1  
ATOM 6497   O "O3'"  . G   G 2 31 ? 10.972  30.251  16.805  1.00 0.00 ? 31 G   G "O3'"  1  
ATOM 6498   C "C2'"  . G   G 2 31 ? 9.049   29.438  18.109  1.00 0.00 ? 31 G   G "C2'"  1  
ATOM 6499   O "O2'"  . G   G 2 31 ? 9.272   30.473  19.047  1.00 0.00 ? 31 G   G "O2'"  1  
ATOM 6500   C "C1'"  . G   G 2 31 ? 7.564   29.404  17.759  1.00 0.00 ? 31 G   G "C1'"  1  
ATOM 6501   N N9     . G   G 2 31 ? 7.142   28.036  17.402  1.00 0.00 ? 31 G   G N9     1  
ATOM 6502   C C8     . G   G 2 31 ? 6.759   27.543  16.181  1.00 0.00 ? 31 G   G C8     1  
ATOM 6503   N N7     . G   G 2 31 ? 6.649   26.243  16.149  1.00 0.00 ? 31 G   G N7     1  
ATOM 6504   C C5     . G   G 2 31 ? 6.896   25.856  17.465  1.00 0.00 ? 31 G   G C5     1  
ATOM 6505   C C6     . G   G 2 31 ? 6.934   24.562  18.056  1.00 0.00 ? 31 G   G C6     1  
ATOM 6506   O O6     . G   G 2 31 ? 6.814   23.466  17.514  1.00 0.00 ? 31 G   G O6     1  
ATOM 6507   N N1     . G   G 2 31 ? 7.148   24.608  19.425  1.00 0.00 ? 31 G   G N1     1  
ATOM 6508   C C2     . G   G 2 31 ? 7.296   25.771  20.143  1.00 0.00 ? 31 G   G C2     1  
ATOM 6509   N N2     . G   G 2 31 ? 7.445   25.661  21.463  1.00 0.00 ? 31 G   G N2     1  
ATOM 6510   N N3     . G   G 2 31 ? 7.326   26.989  19.593  1.00 0.00 ? 31 G   G N3     1  
ATOM 6511   C C4     . G   G 2 31 ? 7.117   26.958  18.253  1.00 0.00 ? 31 G   G C4     1  
ATOM 6512   H "H5'"  . G   G 2 31 ? 7.627   30.778  14.289  1.00 0.00 ? 31 G   G "H5'"  1  
ATOM 6513   H "H5''" . G   G 2 31 ? 9.025   31.853  14.421  1.00 0.00 ? 31 G   G "H5''" 1  
ATOM 6514   H "H4'"  . G   G 2 31 ? 8.828   31.697  16.634  1.00 0.00 ? 31 G   G "H4'"  1  
ATOM 6515   H "H3'"  . G   G 2 31 ? 9.636   28.819  16.149  1.00 0.00 ? 31 G   G "H3'"  1  
ATOM 6516   H "H2'"  . G   G 2 31 ? 9.387   28.477  18.494  1.00 0.00 ? 31 G   G "H2'"  1  
ATOM 6517   H "HO2'" . G   G 2 31 ? 9.288   30.091  19.930  1.00 0.00 ? 31 G   G "HO2'" 1  
ATOM 6518   H "H1'"  . G   G 2 31 ? 6.993   29.733  18.627  1.00 0.00 ? 31 G   G "H1'"  1  
ATOM 6519   H H8     . G   G 2 31 ? 6.595   28.177  15.322  1.00 0.00 ? 31 G   G H8     1  
ATOM 6520   H H1     . G   G 2 31 ? 7.180   23.723  19.909  1.00 0.00 ? 31 G   G H1     1  
ATOM 6521   H H21    . G   G 2 31 ? 7.466   24.748  21.899  1.00 0.00 ? 31 G   G H21    1  
ATOM 6522   H H22    . G   G 2 31 ? 7.519   26.499  22.021  1.00 0.00 ? 31 G   G H22    1  
ATOM 6523   P P      . A   G 2 32 ? 12.240  29.259  16.797  1.00 0.00 ? 32 A   G P      1  
ATOM 6524   O OP1    . A   G 2 32 ? 13.468  30.073  16.635  1.00 0.00 ? 32 A   G OP1    1  
ATOM 6525   O OP2    . A   G 2 32 ? 11.965  28.155  15.847  1.00 0.00 ? 32 A   G OP2    1  
ATOM 6526   O "O5'"  . A   G 2 32 ? 12.246  28.629  18.275  1.00 0.00 ? 32 A   G "O5'"  1  
ATOM 6527   C "C5'"  . A   G 2 32 ? 12.443  29.442  19.411  1.00 0.00 ? 32 A   G "C5'"  1  
ATOM 6528   C "C4'"  . A   G 2 32 ? 12.076  28.668  20.675  1.00 0.00 ? 32 A   G "C4'"  1  
ATOM 6529   O "O4'"  . A   G 2 32 ? 10.792  28.080  20.569  1.00 0.00 ? 32 A   G "O4'"  1  
ATOM 6530   C "C3'"  . A   G 2 32 ? 13.061  27.537  20.960  1.00 0.00 ? 32 A   G "C3'"  1  
ATOM 6531   O "O3'"  . A   G 2 32 ? 14.205  27.974  21.662  1.00 0.00 ? 32 A   G "O3'"  1  
ATOM 6532   C "C2'"  . A   G 2 32 ? 12.179  26.614  21.796  1.00 0.00 ? 32 A   G "C2'"  1  
ATOM 6533   O "O2'"  . A   G 2 32 ? 12.052  27.072  23.127  1.00 0.00 ? 32 A   G "O2'"  1  
ATOM 6534   C "C1'"  . A   G 2 32 ? 10.835  26.765  21.091  1.00 0.00 ? 32 A   G "C1'"  1  
ATOM 6535   N N9     . A   G 2 32 ? 10.682  25.760  20.018  1.00 0.00 ? 32 A   G N9     1  
ATOM 6536   C C8     . A   G 2 32 ? 10.558  25.943  18.665  1.00 0.00 ? 32 A   G C8     1  
ATOM 6537   N N7     . A   G 2 32 ? 10.305  24.854  17.993  1.00 0.00 ? 32 A   G N7     1  
ATOM 6538   C C5     . A   G 2 32 ? 10.279  23.867  18.978  1.00 0.00 ? 32 A   G C5     1  
ATOM 6539   C C6     . A   G 2 32 ? 10.064  22.476  18.964  1.00 0.00 ? 32 A   G C6     1  
ATOM 6540   N N6     . A   G 2 32 ? 9.816   21.765  17.861  1.00 0.00 ? 32 A   G N6     1  
ATOM 6541   N N1     . A   G 2 32 ? 10.103  21.794  20.116  1.00 0.00 ? 32 A   G N1     1  
ATOM 6542   C C2     . A   G 2 32 ? 10.316  22.461  21.240  1.00 0.00 ? 32 A   G C2     1  
ATOM 6543   N N3     . A   G 2 32 ? 10.524  23.759  21.401  1.00 0.00 ? 32 A   G N3     1  
ATOM 6544   C C4     . A   G 2 32 ? 10.500  24.412  20.214  1.00 0.00 ? 32 A   G C4     1  
ATOM 6545   H "H5'"  . A   G 2 32 ? 11.814  30.330  19.344  1.00 0.00 ? 32 A   G "H5'"  1  
ATOM 6546   H "H5''" . A   G 2 32 ? 13.486  29.753  19.466  1.00 0.00 ? 32 A   G "H5''" 1  
ATOM 6547   H "H4'"  . A   G 2 32 ? 12.080  29.353  21.523  1.00 0.00 ? 32 A   G "H4'"  1  
ATOM 6548   H "H3'"  . A   G 2 32 ? 13.336  27.045  20.028  1.00 0.00 ? 32 A   G "H3'"  1  
ATOM 6549   H "H2'"  . A   G 2 32 ? 12.538  25.586  21.768  1.00 0.00 ? 32 A   G "H2'"  1  
ATOM 6550   H "HO2'" . A   G 2 32 ? 12.887  27.477  23.386  1.00 0.00 ? 32 A   G "HO2'" 1  
ATOM 6551   H "H1'"  . A   G 2 32 ? 10.034  26.618  21.815  1.00 0.00 ? 32 A   G "H1'"  1  
ATOM 6552   H H8     . A   G 2 32 ? 10.635  26.914  18.197  1.00 0.00 ? 32 A   G H8     1  
ATOM 6553   H H61    . A   G 2 32 ? 9.653   20.770  17.939  1.00 0.00 ? 32 A   G H61    1  
ATOM 6554   H H62    . A   G 2 32 ? 9.752   22.234  16.970  1.00 0.00 ? 32 A   G H62    1  
ATOM 6555   H H2     . A   G 2 32 ? 10.328  21.868  22.144  1.00 0.00 ? 32 A   G H2     1  
ATOM 6556   P P      . U   G 2 33 ? 15.604  27.191  21.517  1.00 0.00 ? 33 U   G P      1  
ATOM 6557   O OP1    . U   G 2 33 ? 16.607  27.893  22.348  1.00 0.00 ? 33 U   G OP1    1  
ATOM 6558   O OP2    . U   G 2 33 ? 15.874  26.985  20.075  1.00 0.00 ? 33 U   G OP2    1  
ATOM 6559   O "O5'"  . U   G 2 33 ? 15.303  25.755  22.180  1.00 0.00 ? 33 U   G "O5'"  1  
ATOM 6560   C "C5'"  . U   G 2 33 ? 15.173  25.621  23.579  1.00 0.00 ? 33 U   G "C5'"  1  
ATOM 6561   C "C4'"  . U   G 2 33 ? 14.831  24.186  23.976  1.00 0.00 ? 33 U   G "C4'"  1  
ATOM 6562   O "O4'"  . U   G 2 33 ? 13.659  23.715  23.340  1.00 0.00 ? 33 U   G "O4'"  1  
ATOM 6563   C "C3'"  . U   G 2 33 ? 15.942  23.201  23.625  1.00 0.00 ? 33 U   G "C3'"  1  
ATOM 6564   O "O3'"  . U   G 2 33 ? 16.998  23.210  24.563  1.00 0.00 ? 33 U   G "O3'"  1  
ATOM 6565   C "C2'"  . U   G 2 33 ? 15.145  21.902  23.655  1.00 0.00 ? 33 U   G "C2'"  1  
ATOM 6566   O "O2'"  . U   G 2 33 ? 14.944  21.452  24.981  1.00 0.00 ? 33 U   G "O2'"  1  
ATOM 6567   C "C1'"  . U   G 2 33 ? 13.792  22.327  23.091  1.00 0.00 ? 33 U   G "C1'"  1  
ATOM 6568   N N1     . U   G 2 33 ? 13.678  21.998  21.652  1.00 0.00 ? 33 U   G N1     1  
ATOM 6569   C C2     . U   G 2 33 ? 13.538  20.657  21.323  1.00 0.00 ? 33 U   G C2     1  
ATOM 6570   O O2     . U   G 2 33 ? 13.485  19.762  22.164  1.00 0.00 ? 33 U   G O2     1  
ATOM 6571   N N3     . U   G 2 33 ? 13.451  20.353  19.974  1.00 0.00 ? 33 U   G N3     1  
ATOM 6572   C C4     . U   G 2 33 ? 13.427  21.271  18.940  1.00 0.00 ? 33 U   G C4     1  
ATOM 6573   O O4     . U   G 2 33 ? 13.317  20.889  17.778  1.00 0.00 ? 33 U   G O4     1  
ATOM 6574   C C5     . U   G 2 33 ? 13.509  22.647  19.376  1.00 0.00 ? 33 U   G C5     1  
ATOM 6575   C C6     . U   G 2 33 ? 13.621  22.967  20.686  1.00 0.00 ? 33 U   G C6     1  
ATOM 6576   H "H5'"  . U   G 2 33 ? 14.387  26.283  23.941  1.00 0.00 ? 33 U   G "H5'"  1  
ATOM 6577   H "H5''" . U   G 2 33 ? 16.110  25.903  24.058  1.00 0.00 ? 33 U   G "H5''" 1  
ATOM 6578   H "H4'"  . U   G 2 33 ? 14.675  24.155  25.055  1.00 0.00 ? 33 U   G "H4'"  1  
ATOM 6579   H "H3'"  . U   G 2 33 ? 16.306  23.397  22.615  1.00 0.00 ? 33 U   G "H3'"  1  
ATOM 6580   H "H2'"  . U   G 2 33 ? 15.618  21.133  23.046  1.00 0.00 ? 33 U   G "H2'"  1  
ATOM 6581   H "HO2'" . U   G 2 33 ? 15.722  21.689  25.496  1.00 0.00 ? 33 U   G "HO2'" 1  
ATOM 6582   H "H1'"  . U   G 2 33 ? 13.021  21.774  23.626  1.00 0.00 ? 33 U   G "H1'"  1  
ATOM 6583   H H3     . U   G 2 33 ? 13.387  19.375  19.728  1.00 0.00 ? 33 U   G H3     1  
ATOM 6584   H H5     . U   G 2 33 ? 13.459  23.430  18.635  1.00 0.00 ? 33 U   G H5     1  
ATOM 6585   H H6     . U   G 2 33 ? 13.627  24.008  20.976  1.00 0.00 ? 33 U   G H6     1  
ATOM 6586   P P      . G   G 2 34 ? 18.448  22.622  24.185  1.00 0.00 ? 34 G   G P      1  
ATOM 6587   O OP1    . G   G 2 34 ? 19.359  22.893  25.320  1.00 0.00 ? 34 G   G OP1    1  
ATOM 6588   O OP2    . G   G 2 34 ? 18.809  23.108  22.835  1.00 0.00 ? 34 G   G OP2    1  
ATOM 6589   O "O5'"  . G   G 2 34 ? 18.213  21.032  24.093  1.00 0.00 ? 34 G   G "O5'"  1  
ATOM 6590   C "C5'"  . G   G 2 34 ? 18.012  20.256  25.256  1.00 0.00 ? 34 G   G "C5'"  1  
ATOM 6591   C "C4'"  . G   G 2 34 ? 17.608  18.825  24.898  1.00 0.00 ? 34 G   G "C4'"  1  
ATOM 6592   O "O4'"  . G   G 2 34 ? 16.621  18.806  23.887  1.00 0.00 ? 34 G   G "O4'"  1  
ATOM 6593   C "C3'"  . G   G 2 34 ? 18.810  18.020  24.410  1.00 0.00 ? 34 G   G "C3'"  1  
ATOM 6594   O "O3'"  . G   G 2 34 ? 19.403  17.343  25.502  1.00 0.00 ? 34 G   G "O3'"  1  
ATOM 6595   C "C2'"  . G   G 2 34 ? 18.195  17.086  23.368  1.00 0.00 ? 34 G   G "C2'"  1  
ATOM 6596   O "O2'"  . G   G 2 34 ? 17.970  15.784  23.868  1.00 0.00 ? 34 G   G "O2'"  1  
ATOM 6597   C "C1'"  . G   G 2 34 ? 16.829  17.689  23.047  1.00 0.00 ? 34 G   G "C1'"  1  
ATOM 6598   N N9     . G   G 2 34 ? 16.694  18.063  21.624  1.00 0.00 ? 34 G   G N9     1  
ATOM 6599   C C8     . G   G 2 34 ? 16.692  19.308  21.049  1.00 0.00 ? 34 G   G C8     1  
ATOM 6600   N N7     . G   G 2 34 ? 16.488  19.295  19.760  1.00 0.00 ? 34 G   G N7     1  
ATOM 6601   C C5     . G   G 2 34 ? 16.295  17.947  19.460  1.00 0.00 ? 34 G   G C5     1  
ATOM 6602   C C6     . G   G 2 34 ? 15.991  17.300  18.226  1.00 0.00 ? 34 G   G C6     1  
ATOM 6603   O O6     . G   G 2 34 ? 15.866  17.786  17.103  1.00 0.00 ? 34 G   G O6     1  
ATOM 6604   N N1     . G   G 2 34 ? 15.802  15.935  18.375  1.00 0.00 ? 34 G   G N1     1  
ATOM 6605   C C2     . G   G 2 34 ? 15.920  15.264  19.569  1.00 0.00 ? 34 G   G C2     1  
ATOM 6606   N N2     . G   G 2 34 ? 15.764  13.940  19.547  1.00 0.00 ? 34 G   G N2     1  
ATOM 6607   N N3     . G   G 2 34 ? 16.209  15.854  20.732  1.00 0.00 ? 34 G   G N3     1  
ATOM 6608   C C4     . G   G 2 34 ? 16.386  17.194  20.605  1.00 0.00 ? 34 G   G C4     1  
ATOM 6609   H "H5'"  . G   G 2 34 ? 17.227  20.702  25.867  1.00 0.00 ? 34 G   G "H5'"  1  
ATOM 6610   H "H5''" . G   G 2 34 ? 18.930  20.232  25.842  1.00 0.00 ? 34 G   G "H5''" 1  
ATOM 6611   H "H4'"  . G   G 2 34 ? 17.207  18.338  25.788  1.00 0.00 ? 34 G   G "H4'"  1  
ATOM 6612   H "H3'"  . G   G 2 34 ? 19.524  18.688  23.927  1.00 0.00 ? 34 G   G "H3'"  1  
ATOM 6613   H "H2'"  . G   G 2 34 ? 18.820  17.054  22.476  1.00 0.00 ? 34 G   G "H2'"  1  
ATOM 6614   H "HO2'" . G   G 2 34 ? 18.781  15.275  23.756  1.00 0.00 ? 34 G   G "HO2'" 1  
ATOM 6615   H "H1'"  . G   G 2 34 ? 16.085  16.921  23.255  1.00 0.00 ? 34 G   G "H1'"  1  
ATOM 6616   H H8     . G   G 2 34 ? 16.818  20.216  21.622  1.00 0.00 ? 34 G   G H8     1  
ATOM 6617   H H1     . G   G 2 34 ? 15.581  15.410  17.541  1.00 0.00 ? 34 G   G H1     1  
ATOM 6618   H H21    . G   G 2 34 ? 15.656  13.455  18.665  1.00 0.00 ? 34 G   G H21    1  
ATOM 6619   H H22    . G   G 2 34 ? 15.882  13.421  20.404  1.00 0.00 ? 34 G   G H22    1  
ATOM 6620   P P      . G   G 2 35 ? 20.952  16.908  25.487  1.00 0.00 ? 35 G   G P      1  
ATOM 6621   O OP1    . G   G 2 35 ? 21.291  16.379  26.828  1.00 0.00 ? 35 G   G OP1    1  
ATOM 6622   O OP2    . G   G 2 35 ? 21.743  18.032  24.934  1.00 0.00 ? 35 G   G OP2    1  
ATOM 6623   O "O5'"  . G   G 2 35 ? 21.009  15.696  24.431  1.00 0.00 ? 35 G   G "O5'"  1  
ATOM 6624   C "C5'"  . G   G 2 35 ? 20.688  14.366  24.792  1.00 0.00 ? 35 G   G "C5'"  1  
ATOM 6625   C "C4'"  . G   G 2 35 ? 20.677  13.534  23.512  1.00 0.00 ? 35 G   G "C4'"  1  
ATOM 6626   O "O4'"  . G   G 2 35 ? 19.742  13.966  22.541  1.00 0.00 ? 35 G   G "O4'"  1  
ATOM 6627   C "C3'"  . G   G 2 35 ? 22.069  13.479  22.881  1.00 0.00 ? 35 G   G "C3'"  1  
ATOM 6628   O "O3'"  . G   G 2 35 ? 22.574  12.163  23.016  1.00 0.00 ? 35 G   G "O3'"  1  
ATOM 6629   C "C2'"  . G   G 2 35 ? 21.784  14.030  21.488  1.00 0.00 ? 35 G   G "C2'"  1  
ATOM 6630   O "O2'"  . G   G 2 35 ? 22.598  13.519  20.462  1.00 0.00 ? 35 G   G "O2'"  1  
ATOM 6631   C "C1'"  . G   G 2 35 ? 20.314  13.692  21.279  1.00 0.00 ? 35 G   G "C1'"  1  
ATOM 6632   N N9     . G   G 2 35 ? 19.731  14.505  20.194  1.00 0.00 ? 35 G   G N9     1  
ATOM 6633   C C8     . G   G 2 35 ? 19.708  15.869  20.081  1.00 0.00 ? 35 G   G C8     1  
ATOM 6634   N N7     . G   G 2 35 ? 19.336  16.306  18.910  1.00 0.00 ? 35 G   G N7     1  
ATOM 6635   C C5     . G   G 2 35 ? 19.110  15.140  18.181  1.00 0.00 ? 35 G   G C5     1  
ATOM 6636   C C6     . G   G 2 35 ? 18.752  14.965  16.815  1.00 0.00 ? 35 G   G C6     1  
ATOM 6637   O O6     . G   G 2 35 ? 18.541  15.823  15.960  1.00 0.00 ? 35 G   G O6     1  
ATOM 6638   N N1     . G   G 2 35 ? 18.686  13.630  16.448  1.00 0.00 ? 35 G   G N1     1  
ATOM 6639   C C2     . G   G 2 35 ? 18.891  12.582  17.314  1.00 0.00 ? 35 G   G C2     1  
ATOM 6640   N N2     . G   G 2 35 ? 18.830  11.352  16.801  1.00 0.00 ? 35 G   G N2     1  
ATOM 6641   N N3     . G   G 2 35 ? 19.225  12.731  18.600  1.00 0.00 ? 35 G   G N3     1  
ATOM 6642   C C4     . G   G 2 35 ? 19.328  14.034  18.966  1.00 0.00 ? 35 G   G C4     1  
ATOM 6643   H "H5'"  . G   G 2 35 ? 19.707  14.330  25.266  1.00 0.00 ? 35 G   G "H5'"  1  
ATOM 6644   H "H5''" . G   G 2 35 ? 21.438  13.975  25.479  1.00 0.00 ? 35 G   G "H5''" 1  
ATOM 6645   H "H4'"  . G   G 2 35 ? 20.405  12.516  23.794  1.00 0.00 ? 35 G   G "H4'"  1  
ATOM 6646   H "H3'"  . G   G 2 35 ? 22.734  14.168  23.401  1.00 0.00 ? 35 G   G "H3'"  1  
ATOM 6647   H "H2'"  . G   G 2 35 ? 21.896  15.115  21.521  1.00 0.00 ? 35 G   G "H2'"  1  
ATOM 6648   H "HO2'" . G   G 2 35 ? 22.945  12.660  20.728  1.00 0.00 ? 35 G   G "HO2'" 1  
ATOM 6649   H "H1'"  . G   G 2 35 ? 20.223  12.634  21.032  1.00 0.00 ? 35 G   G "H1'"  1  
ATOM 6650   H H8     . G   G 2 35 ? 20.003  16.516  20.893  1.00 0.00 ? 35 G   G H8     1  
ATOM 6651   H H1     . G   G 2 35 ? 18.506  13.428  15.475  1.00 0.00 ? 35 G   G H1     1  
ATOM 6652   H H21    . G   G 2 35 ? 18.645  11.223  15.815  1.00 0.00 ? 35 G   G H21    1  
ATOM 6653   H H22    . G   G 2 35 ? 18.988  10.560  17.405  1.00 0.00 ? 35 G   G H22    1  
ATOM 6654   P P      . U   G 2 36 ? 24.086  11.757  22.634  1.00 0.00 ? 36 U   G P      1  
ATOM 6655   O OP1    . U   G 2 36 ? 24.416  10.508  23.358  1.00 0.00 ? 36 U   G OP1    1  
ATOM 6656   O OP2    . U   G 2 36 ? 24.952  12.945  22.811  1.00 0.00 ? 36 U   G OP2    1  
ATOM 6657   O "O5'"  . U   G 2 36 ? 24.003  11.420  21.060  1.00 0.00 ? 36 U   G "O5'"  1  
ATOM 6658   C "C5'"  . U   G 2 36 ? 23.309  10.283  20.588  1.00 0.00 ? 36 U   G "C5'"  1  
ATOM 6659   C "C4'"  . U   G 2 36 ? 23.173  10.255  19.063  1.00 0.00 ? 36 U   G "C4'"  1  
ATOM 6660   O "O4'"  . U   G 2 36 ? 22.273  11.227  18.574  1.00 0.00 ? 36 U   G "O4'"  1  
ATOM 6661   C "C3'"  . U   G 2 36 ? 24.469  10.509  18.297  1.00 0.00 ? 36 U   G "C3'"  1  
ATOM 6662   O "O3'"  . U   G 2 36 ? 25.331  9.387   18.326  1.00 0.00 ? 36 U   G "O3'"  1  
ATOM 6663   C "C2'"  . U   G 2 36 ? 23.917  10.832  16.909  1.00 0.00 ? 36 U   G "C2'"  1  
ATOM 6664   O "O2'"  . U   G 2 36 ? 23.782  9.677   16.107  1.00 0.00 ? 36 U   G "O2'"  1  
ATOM 6665   C "C1'"  . U   G 2 36 ? 22.517  11.381  17.188  1.00 0.00 ? 36 U   G "C1'"  1  
ATOM 6666   N N1     . U   G 2 36 ? 22.383  12.786  16.740  1.00 0.00 ? 36 U   G N1     1  
ATOM 6667   C C2     . U   G 2 36 ? 21.749  13.026  15.529  1.00 0.00 ? 36 U   G C2     1  
ATOM 6668   O O2     . U   G 2 36 ? 21.315  12.129  14.811  1.00 0.00 ? 36 U   G O2     1  
ATOM 6669   N N3     . U   G 2 36 ? 21.604  14.354  15.153  1.00 0.00 ? 36 U   G N3     1  
ATOM 6670   C C4     . U   G 2 36 ? 22.021  15.453  15.885  1.00 0.00 ? 36 U   G C4     1  
ATOM 6671   O O4     . U   G 2 36 ? 21.835  16.593  15.468  1.00 0.00 ? 36 U   G O4     1  
ATOM 6672   C C5     . U   G 2 36 ? 22.675  15.113  17.127  1.00 0.00 ? 36 U   G C5     1  
ATOM 6673   C C6     . U   G 2 36 ? 22.863  13.824  17.489  1.00 0.00 ? 36 U   G C6     1  
ATOM 6674   H "H5'"  . U   G 2 36 ? 22.311  10.261  21.025  1.00 0.00 ? 36 U   G "H5'"  1  
ATOM 6675   H "H5''" . U   G 2 36 ? 23.843  9.387   20.905  1.00 0.00 ? 36 U   G "H5''" 1  
ATOM 6676   H "H4'"  . U   G 2 36 ? 22.801  9.270   18.777  1.00 0.00 ? 36 U   G "H4'"  1  
ATOM 6677   H "H3'"  . U   G 2 36 ? 24.969  11.387  18.707  1.00 0.00 ? 36 U   G "H3'"  1  
ATOM 6678   H "H2'"  . U   G 2 36 ? 24.542  11.578  16.414  1.00 0.00 ? 36 U   G "H2'"  1  
ATOM 6679   H "HO2'" . U   G 2 36 ? 24.664  9.330   15.936  1.00 0.00 ? 36 U   G "HO2'" 1  
ATOM 6680   H "H1'"  . U   G 2 36 ? 21.799  10.769  16.642  1.00 0.00 ? 36 U   G "H1'"  1  
ATOM 6681   H H3     . U   G 2 36 ? 21.236  14.540  14.232  1.00 0.00 ? 36 U   G H3     1  
ATOM 6682   H H5     . U   G 2 36 ? 23.015  15.901  17.782  1.00 0.00 ? 36 U   G H5     1  
ATOM 6683   H H6     . U   G 2 36 ? 23.384  13.615  18.409  1.00 0.00 ? 36 U   G H6     1  
ATOM 6684   P P      . C   G 2 37 ? 26.796  9.444   17.661  1.00 0.00 ? 37 C   G P      1  
ATOM 6685   O OP1    . C   G 2 37 ? 27.593  8.324   18.213  1.00 0.00 ? 37 C   G OP1    1  
ATOM 6686   O OP2    . C   G 2 37 ? 27.312  10.827  17.771  1.00 0.00 ? 37 C   G OP2    1  
ATOM 6687   O "O5'"  . C   G 2 37 ? 26.503  9.129   16.109  1.00 0.00 ? 37 C   G "O5'"  1  
ATOM 6688   C "C5'"  . C   G 2 37 ? 27.504  9.311   15.131  1.00 0.00 ? 37 C   G "C5'"  1  
ATOM 6689   C "C4'"  . C   G 2 37 ? 26.927  9.079   13.734  1.00 0.00 ? 37 C   G "C4'"  1  
ATOM 6690   O "O4'"  . C   G 2 37 ? 25.971  10.079  13.440  1.00 0.00 ? 37 C   G "O4'"  1  
ATOM 6691   C "C3'"  . C   G 2 37 ? 28.015  9.201   12.670  1.00 0.00 ? 37 C   G "C3'"  1  
ATOM 6692   O "O3'"  . C   G 2 37 ? 27.661  8.457   11.522  1.00 0.00 ? 37 C   G "O3'"  1  
ATOM 6693   C "C2'"  . C   G 2 37 ? 28.008  10.709  12.427  1.00 0.00 ? 37 C   G "C2'"  1  
ATOM 6694   O "O2'"  . C   G 2 37 ? 28.421  11.072  11.125  1.00 0.00 ? 37 C   G "O2'"  1  
ATOM 6695   C "C1'"  . C   G 2 37 ? 26.555  11.117  12.677  1.00 0.00 ? 37 C   G "C1'"  1  
ATOM 6696   N N1     . C   G 2 37 ? 26.403  12.430  13.351  1.00 0.00 ? 37 C   G N1     1  
ATOM 6697   C C2     . C   G 2 37 ? 25.167  12.755  13.899  1.00 0.00 ? 37 C   G C2     1  
ATOM 6698   O O2     . C   G 2 37 ? 24.160  12.092  13.662  1.00 0.00 ? 37 C   G O2     1  
ATOM 6699   N N3     . C   G 2 37 ? 25.049  13.866  14.671  1.00 0.00 ? 37 C   G N3     1  
ATOM 6700   C C4     . C   G 2 37 ? 26.080  14.702  14.786  1.00 0.00 ? 37 C   G C4     1  
ATOM 6701   N N4     . C   G 2 37 ? 25.919  15.786  15.545  1.00 0.00 ? 37 C   G N4     1  
ATOM 6702   C C5     . C   G 2 37 ? 27.296  14.503  14.060  1.00 0.00 ? 37 C   G C5     1  
ATOM 6703   C C6     . C   G 2 37 ? 27.404  13.363  13.343  1.00 0.00 ? 37 C   G C6     1  
ATOM 6704   H "H5'"  . C   G 2 37 ? 28.316  8.605   15.309  1.00 0.00 ? 37 C   G "H5'"  1  
ATOM 6705   H "H5''" . C   G 2 37 ? 27.897  10.326  15.197  1.00 0.00 ? 37 C   G "H5''" 1  
ATOM 6706   H "H4'"  . C   G 2 37 ? 26.468  8.091   13.688  1.00 0.00 ? 37 C   G "H4'"  1  
ATOM 6707   H "H3'"  . C   G 2 37 ? 28.976  8.873   13.065  1.00 0.00 ? 37 C   G "H3'"  1  
ATOM 6708   H "H2'"  . C   G 2 37 ? 28.664  11.169  13.166  1.00 0.00 ? 37 C   G "H2'"  1  
ATOM 6709   H "HO2'" . C   G 2 37 ? 28.973  10.362  10.776  1.00 0.00 ? 37 C   G "HO2'" 1  
ATOM 6710   H "H1'"  . C   G 2 37 ? 26.043  11.161  11.714  1.00 0.00 ? 37 C   G "H1'"  1  
ATOM 6711   H H41    . C   G 2 37 ? 25.041  15.920  16.025  1.00 0.00 ? 37 C   G H41    1  
ATOM 6712   H H42    . C   G 2 37 ? 26.670  16.455  15.634  1.00 0.00 ? 37 C   G H42    1  
ATOM 6713   H H5     . C   G 2 37 ? 28.107  15.217  14.063  1.00 0.00 ? 37 C   G H5     1  
ATOM 6714   H H6     . C   G 2 37 ? 28.299  13.191  12.761  1.00 0.00 ? 37 C   G H6     1  
ATOM 6715   P P      . A   G 2 38 ? 28.801  7.818   10.583  1.00 0.00 ? 38 A   G P      1  
ATOM 6716   O OP1    . A   G 2 38 ? 29.257  6.555   11.206  1.00 0.00 ? 38 A   G OP1    1  
ATOM 6717   O OP2    . A   G 2 38 ? 29.789  8.877   10.281  1.00 0.00 ? 38 A   G OP2    1  
ATOM 6718   O "O5'"  . A   G 2 38 ? 28.028  7.468   9.215   1.00 0.00 ? 38 A   G "O5'"  1  
ATOM 6719   C "C5'"  . A   G 2 38 ? 27.010  6.489   9.167   1.00 0.00 ? 38 A   G "C5'"  1  
ATOM 6720   C "C4'"  . A   G 2 38 ? 27.222  5.521   8.001   1.00 0.00 ? 38 A   G "C4'"  1  
ATOM 6721   O "O4'"  . A   G 2 38 ? 27.221  6.218   6.770   1.00 0.00 ? 38 A   G "O4'"  1  
ATOM 6722   C "C3'"  . A   G 2 38 ? 28.556  4.783   8.126   1.00 0.00 ? 38 A   G "C3'"  1  
ATOM 6723   O "O3'"  . A   G 2 38 ? 28.471  3.473   7.603   1.00 0.00 ? 38 A   G "O3'"  1  
ATOM 6724   C "C2'"  . A   G 2 38 ? 29.451  5.627   7.226   1.00 0.00 ? 38 A   G "C2'"  1  
ATOM 6725   O "O2'"  . A   G 2 38 ? 30.559  4.901   6.738   1.00 0.00 ? 38 A   G "O2'"  1  
ATOM 6726   C "C1'"  . A   G 2 38 ? 28.464  6.012   6.127   1.00 0.00 ? 38 A   G "C1'"  1  
ATOM 6727   N N9     . A   G 2 38 ? 28.871  7.214   5.374   1.00 0.00 ? 38 A   G N9     1  
ATOM 6728   C C8     . A   G 2 38 ? 29.565  8.312   5.818   1.00 0.00 ? 38 A   G C8     1  
ATOM 6729   N N7     . A   G 2 38 ? 29.805  9.201   4.894   1.00 0.00 ? 38 A   G N7     1  
ATOM 6730   C C5     . A   G 2 38 ? 29.256  8.632   3.746   1.00 0.00 ? 38 A   G C5     1  
ATOM 6731   C C6     . A   G 2 38 ? 29.213  9.023   2.395   1.00 0.00 ? 38 A   G C6     1  
ATOM 6732   N N6     . A   G 2 38 ? 29.721  10.175  1.949   1.00 0.00 ? 38 A   G N6     1  
ATOM 6733   N N1     . A   G 2 38 ? 28.689  8.197   1.480   1.00 0.00 ? 38 A   G N1     1  
ATOM 6734   C C2     . A   G 2 38 ? 28.171  7.052   1.900   1.00 0.00 ? 38 A   G C2     1  
ATOM 6735   N N3     . A   G 2 38 ? 28.126  6.566   3.133   1.00 0.00 ? 38 A   G N3     1  
ATOM 6736   C C4     . A   G 2 38 ? 28.698  7.413   4.024   1.00 0.00 ? 38 A   G C4     1  
ATOM 6737   H "H5'"  . A   G 2 38 ? 26.044  6.981   9.051   1.00 0.00 ? 38 A   G "H5'"  1  
ATOM 6738   H "H5''" . A   G 2 38 ? 26.996  5.919   10.096  1.00 0.00 ? 38 A   G "H5''" 1  
ATOM 6739   H "H4'"  . A   G 2 38 ? 26.406  4.799   8.002   1.00 0.00 ? 38 A   G "H4'"  1  
ATOM 6740   H "H3'"  . A   G 2 38 ? 28.924  4.777   9.152   1.00 0.00 ? 38 A   G "H3'"  1  
ATOM 6741   H "H2'"  . A   G 2 38 ? 29.785  6.511   7.769   1.00 0.00 ? 38 A   G "H2'"  1  
ATOM 6742   H "HO2'" . A   G 2 38 ? 30.284  3.984   6.630   1.00 0.00 ? 38 A   G "HO2'" 1  
ATOM 6743   H "H1'"  . A   G 2 38 ? 28.373  5.174   5.438   1.00 0.00 ? 38 A   G "H1'"  1  
ATOM 6744   H H8     . A   G 2 38 ? 29.910  8.411   6.838   1.00 0.00 ? 38 A   G H8     1  
ATOM 6745   H H61    . A   G 2 38 ? 29.628  10.404  0.968   1.00 0.00 ? 38 A   G H61    1  
ATOM 6746   H H62    . A   G 2 38 ? 29.992  10.879  2.619   1.00 0.00 ? 38 A   G H62    1  
ATOM 6747   H H2     . A   G 2 38 ? 27.777  6.410   1.125   1.00 0.00 ? 38 A   G H2     1  
ATOM 6748   P P      . G   G 2 39 ? 27.854  2.261   8.463   1.00 0.00 ? 39 G   G P      1  
ATOM 6749   O OP1    . G   G 2 39 ? 26.913  2.808   9.467   1.00 0.00 ? 39 G   G OP1    1  
ATOM 6750   O OP2    . G   G 2 39 ? 28.970  1.394   8.904   1.00 0.00 ? 39 G   G OP2    1  
ATOM 6751   O "O5'"  . G   G 2 39 ? 27.008  1.469   7.346   1.00 0.00 ? 39 G   G "O5'"  1  
ATOM 6752   C "C5'"  . G   G 2 39 ? 25.772  1.966   6.880   1.00 0.00 ? 39 G   G "C5'"  1  
ATOM 6753   C "C4'"  . G   G 2 39 ? 25.407  1.403   5.505   1.00 0.00 ? 39 G   G "C4'"  1  
ATOM 6754   O "O4'"  . G   G 2 39 ? 26.163  2.052   4.502   1.00 0.00 ? 39 G   G "O4'"  1  
ATOM 6755   C "C3'"  . G   G 2 39 ? 25.668  -0.096  5.380   1.00 0.00 ? 39 G   G "C3'"  1  
ATOM 6756   O "O3'"  . G   G 2 39 ? 24.676  -0.640  4.531   1.00 0.00 ? 39 G   G "O3'"  1  
ATOM 6757   C "C2'"  . G   G 2 39 ? 27.071  -0.119  4.774   1.00 0.00 ? 39 G   G "C2'"  1  
ATOM 6758   O "O2'"  . G   G 2 39 ? 27.286  -1.253  3.961   1.00 0.00 ? 39 G   G "O2'"  1  
ATOM 6759   C "C1'"  . G   G 2 39 ? 27.135  1.177   3.966   1.00 0.00 ? 39 G   G "C1'"  1  
ATOM 6760   N N9     . G   G 2 39 ? 28.435  1.884   3.990   1.00 0.00 ? 39 G   G N9     1  
ATOM 6761   C C8     . G   G 2 39 ? 28.618  3.234   3.841   1.00 0.00 ? 39 G   G C8     1  
ATOM 6762   N N7     . G   G 2 39 ? 29.865  3.614   3.809   1.00 0.00 ? 39 G   G N7     1  
ATOM 6763   C C5     . G   G 2 39 ? 30.571  2.421   3.940   1.00 0.00 ? 39 G   G C5     1  
ATOM 6764   C C6     . G   G 2 39 ? 31.976  2.198   3.969   1.00 0.00 ? 39 G   G C6     1  
ATOM 6765   O O6     . G   G 2 39 ? 32.888  3.018   3.863   1.00 0.00 ? 39 G   G O6     1  
ATOM 6766   N N1     . G   G 2 39 ? 32.297  0.859   4.125   1.00 0.00 ? 39 G   G N1     1  
ATOM 6767   C C2     . G   G 2 39 ? 31.367  -0.154  4.159   1.00 0.00 ? 39 G   G C2     1  
ATOM 6768   N N2     . G   G 2 39 ? 31.849  -1.396  4.210   1.00 0.00 ? 39 G   G N2     1  
ATOM 6769   N N3     . G   G 2 39 ? 30.046  0.044   4.115   1.00 0.00 ? 39 G   G N3     1  
ATOM 6770   C C4     . G   G 2 39 ? 29.707  1.355   4.024   1.00 0.00 ? 39 G   G C4     1  
ATOM 6771   H "H5'"  . G   G 2 39 ? 25.818  3.052   6.805   1.00 0.00 ? 39 G   G "H5'"  1  
ATOM 6772   H "H5''" . G   G 2 39 ? 24.990  1.701   7.593   1.00 0.00 ? 39 G   G "H5''" 1  
ATOM 6773   H "H4'"  . G   G 2 39 ? 24.349  1.597   5.330   1.00 0.00 ? 39 G   G "H4'"  1  
ATOM 6774   H "H3'"  . G   G 2 39 ? 25.656  -0.567  6.363   1.00 0.00 ? 39 G   G "H3'"  1  
ATOM 6775   H "H2'"  . G   G 2 39 ? 27.810  -0.090  5.574   1.00 0.00 ? 39 G   G "H2'"  1  
ATOM 6776   H "HO2'" . G   G 2 39 ? 26.434  -1.580  3.653   1.00 0.00 ? 39 G   G "HO2'" 1  
ATOM 6777   H "H1'"  . G   G 2 39 ? 26.871  0.951   2.933   1.00 0.00 ? 39 G   G "H1'"  1  
ATOM 6778   H H8     . G   G 2 39 ? 27.792  3.926   3.767   1.00 0.00 ? 39 G   G H8     1  
ATOM 6779   H H1     . G   G 2 39 ? 33.272  0.610   4.205   1.00 0.00 ? 39 G   G H1     1  
ATOM 6780   H H21    . G   G 2 39 ? 32.845  -1.537  4.119   1.00 0.00 ? 39 G   G H21    1  
ATOM 6781   H H22    . G   G 2 39 ? 31.215  -2.173  4.086   1.00 0.00 ? 39 G   G H22    1  
ATOM 6782   P P      . G   G 2 40 ? 24.265  -2.197  4.574   1.00 0.00 ? 40 G   G P      1  
ATOM 6783   O OP1    . G   G 2 40 ? 22.812  -2.300  4.313   1.00 0.00 ? 40 G   G OP1    1  
ATOM 6784   O OP2    . G   G 2 40 ? 24.825  -2.811  5.799   1.00 0.00 ? 40 G   G OP2    1  
ATOM 6785   O "O5'"  . G   G 2 40 ? 25.054  -2.803  3.307   1.00 0.00 ? 40 G   G "O5'"  1  
ATOM 6786   C "C5'"  . G   G 2 40 ? 24.670  -2.478  1.986   1.00 0.00 ? 40 G   G "C5'"  1  
ATOM 6787   C "C4'"  . G   G 2 40 ? 25.528  -3.226  0.965   1.00 0.00 ? 40 G   G "C4'"  1  
ATOM 6788   O "O4'"  . G   G 2 40 ? 26.904  -2.961  1.149   1.00 0.00 ? 40 G   G "O4'"  1  
ATOM 6789   C "C3'"  . G   G 2 40 ? 25.343  -4.739  1.080   1.00 0.00 ? 40 G   G "C3'"  1  
ATOM 6790   O "O3'"  . G   G 2 40 ? 25.217  -5.275  -0.222  1.00 0.00 ? 40 G   G "O3'"  1  
ATOM 6791   C "C2'"  . G   G 2 40 ? 26.671  -5.176  1.691   1.00 0.00 ? 40 G   G "C2'"  1  
ATOM 6792   O "O2'"  . G   G 2 40 ? 26.986  -6.517  1.383   1.00 0.00 ? 40 G   G "O2'"  1  
ATOM 6793   C "C1'"  . G   G 2 40 ? 27.612  -4.178  1.032   1.00 0.00 ? 40 G   G "C1'"  1  
ATOM 6794   N N9     . G   G 2 40 ? 28.933  -4.149  1.686   1.00 0.00 ? 40 G   G N9     1  
ATOM 6795   C C8     . G   G 2 40 ? 29.269  -3.711  2.941   1.00 0.00 ? 40 G   G C8     1  
ATOM 6796   N N7     . G   G 2 40 ? 30.523  -3.893  3.249   1.00 0.00 ? 40 G   G N7     1  
ATOM 6797   C C5     . G   G 2 40 ? 31.058  -4.518  2.124   1.00 0.00 ? 40 G   G C5     1  
ATOM 6798   C C6     . G   G 2 40 ? 32.377  -4.987  1.865   1.00 0.00 ? 40 G   G C6     1  
ATOM 6799   O O6     . G   G 2 40 ? 33.393  -4.844  2.543   1.00 0.00 ? 40 G   G O6     1  
ATOM 6800   N N1     . G   G 2 40 ? 32.464  -5.699  0.678   1.00 0.00 ? 40 G   G N1     1  
ATOM 6801   C C2     . G   G 2 40 ? 31.439  -5.797  -0.235  1.00 0.00 ? 40 G   G C2     1  
ATOM 6802   N N2     . G   G 2 40 ? 31.687  -6.486  -1.349  1.00 0.00 ? 40 G   G N2     1  
ATOM 6803   N N3     . G   G 2 40 ? 30.216  -5.291  -0.041  1.00 0.00 ? 40 G   G N3     1  
ATOM 6804   C C4     . G   G 2 40 ? 30.087  -4.690  1.169   1.00 0.00 ? 40 G   G C4     1  
ATOM 6805   H "H5'"  . G   G 2 40 ? 24.767  -1.406  1.819   1.00 0.00 ? 40 G   G "H5'"  1  
ATOM 6806   H "H5''" . G   G 2 40 ? 23.626  -2.755  1.836   1.00 0.00 ? 40 G   G "H5''" 1  
ATOM 6807   H "H4'"  . G   G 2 40 ? 25.243  -2.903  -0.037  1.00 0.00 ? 40 G   G "H4'"  1  
ATOM 6808   H "H3'"  . G   G 2 40 ? 24.501  -5.001  1.721   1.00 0.00 ? 40 G   G "H3'"  1  
ATOM 6809   H "H2'"  . G   G 2 40 ? 26.686  -4.989  2.765   1.00 0.00 ? 40 G   G "H2'"  1  
ATOM 6810   H "HO2'" . G   G 2 40 ? 26.590  -6.724  0.530   1.00 0.00 ? 40 G   G "HO2'" 1  
ATOM 6811   H "H1'"  . G   G 2 40 ? 27.744  -4.447  -0.017  1.00 0.00 ? 40 G   G "H1'"  1  
ATOM 6812   H H8     . G   G 2 40 ? 28.554  -3.257  3.612   1.00 0.00 ? 40 G   G H8     1  
ATOM 6813   H H1     . G   G 2 40 ? 33.341  -6.153  0.467   1.00 0.00 ? 40 G   G H1     1  
ATOM 6814   H H21    . G   G 2 40 ? 32.560  -6.984  -1.465  1.00 0.00 ? 40 G   G H21    1  
ATOM 6815   H H22    . G   G 2 40 ? 30.954  -6.599  -2.034  1.00 0.00 ? 40 G   G H22    1  
ATOM 6816   P P      . A   G 2 41 ? 23.908  -6.097  -0.663  1.00 0.00 ? 41 A   G P      1  
ATOM 6817   O OP1    . A   G 2 41 ? 23.689  -7.192  0.309   1.00 0.00 ? 41 A   G OP1    1  
ATOM 6818   O OP2    . A   G 2 41 ? 24.075  -6.411  -2.099  1.00 0.00 ? 41 A   G OP2    1  
ATOM 6819   O "O5'"  . A   G 2 41 ? 22.717  -5.027  -0.511  1.00 0.00 ? 41 A   G "O5'"  1  
ATOM 6820   C "C5'"  . A   G 2 41 ? 22.657  -3.914  -1.377  1.00 0.00 ? 41 A   G "C5'"  1  
ATOM 6821   C "C4'"  . A   G 2 41 ? 21.489  -2.988  -1.051  1.00 0.00 ? 41 A   G "C4'"  1  
ATOM 6822   O "O4'"  . A   G 2 41 ? 21.792  -2.157  0.050   1.00 0.00 ? 41 A   G "O4'"  1  
ATOM 6823   C "C3'"  . A   G 2 41 ? 21.217  -2.095  -2.260  1.00 0.00 ? 41 A   G "C3'"  1  
ATOM 6824   O "O3'"  . A   G 2 41 ? 20.165  -2.649  -3.027  1.00 0.00 ? 41 A   G "O3'"  1  
ATOM 6825   C "C2'"  . A   G 2 41 ? 20.845  -0.749  -1.644  1.00 0.00 ? 41 A   G "C2'"  1  
ATOM 6826   O "O2'"  . A   G 2 41 ? 19.446  -0.567  -1.558  1.00 0.00 ? 41 A   G "O2'"  1  
ATOM 6827   C "C1'"  . A   G 2 41 ? 21.413  -0.824  -0.228  1.00 0.00 ? 41 A   G "C1'"  1  
ATOM 6828   N N9     . A   G 2 41 ? 22.599  0.038   -0.064  1.00 0.00 ? 41 A   G N9     1  
ATOM 6829   C C8     . A   G 2 41 ? 23.700  0.148   -0.873  1.00 0.00 ? 41 A   G C8     1  
ATOM 6830   N N7     . A   G 2 41 ? 24.588  1.005   -0.450  1.00 0.00 ? 41 A   G N7     1  
ATOM 6831   C C5     . A   G 2 41 ? 24.037  1.488   0.736   1.00 0.00 ? 41 A   G C5     1  
ATOM 6832   C C6     . A   G 2 41 ? 24.459  2.424   1.698   1.00 0.00 ? 41 A   G C6     1  
ATOM 6833   N N6     . A   G 2 41 ? 25.564  3.168   1.593   1.00 0.00 ? 41 A   G N6     1  
ATOM 6834   N N1     . A   G 2 41 ? 23.705  2.633   2.782   1.00 0.00 ? 41 A   G N1     1  
ATOM 6835   C C2     . A   G 2 41 ? 22.567  1.967   2.904   1.00 0.00 ? 41 A   G C2     1  
ATOM 6836   N N3     . A   G 2 41 ? 22.029  1.095   2.062   1.00 0.00 ? 41 A   G N3     1  
ATOM 6837   C C4     . A   G 2 41 ? 22.832  0.890   0.989   1.00 0.00 ? 41 A   G C4     1  
ATOM 6838   H "H5'"  . A   G 2 41 ? 22.565  -4.257  -2.408  1.00 0.00 ? 41 A   G "H5'"  1  
ATOM 6839   H "H5''" . A   G 2 41 ? 23.579  -3.346  -1.276  1.00 0.00 ? 41 A   G "H5''" 1  
ATOM 6840   H "H4'"  . A   G 2 41 ? 20.601  -3.577  -0.825  1.00 0.00 ? 41 A   G "H4'"  1  
ATOM 6841   H "H3'"  . A   G 2 41 ? 22.133  -1.973  -2.841  1.00 0.00 ? 41 A   G "H3'"  1  
ATOM 6842   H "H2'"  . A   G 2 41 ? 21.303  0.056   -2.222  1.00 0.00 ? 41 A   G "H2'"  1  
ATOM 6843   H "HO2'" . A   G 2 41 ? 19.055  -0.866  -2.384  1.00 0.00 ? 41 A   G "HO2'" 1  
ATOM 6844   H "H1'"  . A   G 2 41 ? 20.646  -0.507  0.479   1.00 0.00 ? 41 A   G "H1'"  1  
ATOM 6845   H H8     . A   G 2 41 ? 23.813  -0.425  -1.782  1.00 0.00 ? 41 A   G H8     1  
ATOM 6846   H H61    . A   G 2 41 ? 25.809  3.783   2.353   1.00 0.00 ? 41 A   G H61    1  
ATOM 6847   H H62    . A   G 2 41 ? 26.071  3.194   0.718   1.00 0.00 ? 41 A   G H62    1  
ATOM 6848   H H2     . A   G 2 41 ? 21.991  2.179   3.793   1.00 0.00 ? 41 A   G H2     1  
ATOM 6849   P P      . C   G 2 42 ? 20.160  -2.554  -4.632  1.00 0.00 ? 42 C   G P      1  
ATOM 6850   O OP1    . C   G 2 42 ? 18.924  -3.190  -5.139  1.00 0.00 ? 42 C   G OP1    1  
ATOM 6851   O OP2    . C   G 2 42 ? 21.474  -3.034  -5.118  1.00 0.00 ? 42 C   G OP2    1  
ATOM 6852   O "O5'"  . C   G 2 42 ? 20.048  -0.969  -4.884  1.00 0.00 ? 42 C   G "O5'"  1  
ATOM 6853   C "C5'"  . C   G 2 42 ? 21.008  -0.307  -5.674  1.00 0.00 ? 42 C   G "C5'"  1  
ATOM 6854   C "C4'"  . C   G 2 42 ? 20.943  1.212   -5.516  1.00 0.00 ? 42 C   G "C4'"  1  
ATOM 6855   O "O4'"  . C   G 2 42 ? 21.855  1.752   -6.452  1.00 0.00 ? 42 C   G "O4'"  1  
ATOM 6856   C "C3'"  . C   G 2 42 ? 19.572  1.801   -5.845  1.00 0.00 ? 42 C   G "C3'"  1  
ATOM 6857   O "O3'"  . C   G 2 42 ? 19.418  3.091   -5.288  1.00 0.00 ? 42 C   G "O3'"  1  
ATOM 6858   C "C2'"  . C   G 2 42 ? 19.676  1.924   -7.361  1.00 0.00 ? 42 C   G "C2'"  1  
ATOM 6859   O "O2'"  . C   G 2 42 ? 18.779  2.888   -7.874  1.00 0.00 ? 42 C   G "O2'"  1  
ATOM 6860   C "C1'"  . C   G 2 42 ? 21.139  2.332   -7.523  1.00 0.00 ? 42 C   G "C1'"  1  
ATOM 6861   N N1     . C   G 2 42 ? 21.666  1.916   -8.842  1.00 0.00 ? 42 C   G N1     1  
ATOM 6862   C C2     . C   G 2 42 ? 21.430  2.731   -9.941  1.00 0.00 ? 42 C   G C2     1  
ATOM 6863   O O2     . C   G 2 42 ? 20.958  3.859   -9.808  1.00 0.00 ? 42 C   G O2     1  
ATOM 6864   N N3     . C   G 2 42 ? 21.768  2.291   -11.180 1.00 0.00 ? 42 C   G N3     1  
ATOM 6865   C C4     . C   G 2 42 ? 22.367  1.107   -11.324 1.00 0.00 ? 42 C   G C4     1  
ATOM 6866   N N4     . C   G 2 42 ? 22.680  0.714   -12.558 1.00 0.00 ? 42 C   G N4     1  
ATOM 6867   C C5     . C   G 2 42 ? 22.679  0.272   -10.206 1.00 0.00 ? 42 C   G C5     1  
ATOM 6868   C C6     . C   G 2 42 ? 22.309  0.720   -8.985  1.00 0.00 ? 42 C   G C6     1  
ATOM 6869   H "H5'"  . C   G 2 42 ? 20.870  -0.565  -6.723  1.00 0.00 ? 42 C   G "H5'"  1  
ATOM 6870   H "H5''" . C   G 2 42 ? 21.998  -0.650  -5.377  1.00 0.00 ? 42 C   G "H5''" 1  
ATOM 6871   H "H4'"  . C   G 2 42 ? 21.231  1.482   -4.502  1.00 0.00 ? 42 C   G "H4'"  1  
ATOM 6872   H "H3'"  . C   G 2 42 ? 18.760  1.134   -5.555  1.00 0.00 ? 42 C   G "H3'"  1  
ATOM 6873   H "H2'"  . C   G 2 42 ? 19.500  0.954   -7.827  1.00 0.00 ? 42 C   G "H2'"  1  
ATOM 6874   H "HO2'" . C   G 2 42 ? 18.673  3.575   -7.208  1.00 0.00 ? 42 C   G "HO2'" 1  
ATOM 6875   H "H1'"  . C   G 2 42 ? 21.232  3.411   -7.406  1.00 0.00 ? 42 C   G "H1'"  1  
ATOM 6876   H H41    . C   G 2 42 ? 22.471  1.324   -13.335 1.00 0.00 ? 42 C   G H41    1  
ATOM 6877   H H42    . C   G 2 42 ? 23.146  -0.172  -12.702 1.00 0.00 ? 42 C   G H42    1  
ATOM 6878   H H5     . C   G 2 42 ? 23.184  -0.677  -10.304 1.00 0.00 ? 42 C   G H5     1  
ATOM 6879   H H6     . C   G 2 42 ? 22.526  0.139   -8.101  1.00 0.00 ? 42 C   G H6     1  
ATOM 6880   P P      . A   G 2 43 ? 19.136  3.299   -3.720  1.00 0.00 ? 43 A   G P      1  
ATOM 6881   O OP1    . A   G 2 43 ? 20.425  3.211   -2.998  1.00 0.00 ? 43 A   G OP1    1  
ATOM 6882   O OP2    . A   G 2 43 ? 17.997  2.445   -3.315  1.00 0.00 ? 43 A   G OP2    1  
ATOM 6883   O "O5'"  . A   G 2 43 ? 18.673  4.838   -3.670  1.00 0.00 ? 43 A   G "O5'"  1  
ATOM 6884   C "C5'"  . A   G 2 43 ? 18.303  5.429   -2.443  1.00 0.00 ? 43 A   G "C5'"  1  
ATOM 6885   C "C4'"  . A   G 2 43 ? 17.637  6.786   -2.671  1.00 0.00 ? 43 A   G "C4'"  1  
ATOM 6886   O "O4'"  . A   G 2 43 ? 16.405  6.628   -3.342  1.00 0.00 ? 43 A   G "O4'"  1  
ATOM 6887   C "C3'"  . A   G 2 43 ? 17.290  7.444   -1.337  1.00 0.00 ? 43 A   G "C3'"  1  
ATOM 6888   O "O3'"  . A   G 2 43 ? 17.188  8.840   -1.532  1.00 0.00 ? 43 A   G "O3'"  1  
ATOM 6889   C "C2'"  . A   G 2 43 ? 15.965  6.749   -1.022  1.00 0.00 ? 43 A   G "C2'"  1  
ATOM 6890   O "O2'"  . A   G 2 43 ? 15.055  7.528   -0.273  1.00 0.00 ? 43 A   G "O2'"  1  
ATOM 6891   C "C1'"  . A   G 2 43 ? 15.384  6.391   -2.392  1.00 0.00 ? 43 A   G "C1'"  1  
ATOM 6892   N N9     . A   G 2 43 ? 14.918  4.988   -2.415  1.00 0.00 ? 43 A   G N9     1  
ATOM 6893   C C8     . A   G 2 43 ? 14.351  4.274   -1.389  1.00 0.00 ? 43 A   G C8     1  
ATOM 6894   N N7     . A   G 2 43 ? 14.114  3.022   -1.667  1.00 0.00 ? 43 A   G N7     1  
ATOM 6895   C C5     . A   G 2 43 ? 14.504  2.912   -3.001  1.00 0.00 ? 43 A   G C5     1  
ATOM 6896   C C6     . A   G 2 43 ? 14.507  1.850   -3.924  1.00 0.00 ? 43 A   G C6     1  
ATOM 6897   N N6     . A   G 2 43 ? 14.113  0.610   -3.624  1.00 0.00 ? 43 A   G N6     1  
ATOM 6898   N N1     . A   G 2 43 ? 14.888  2.071   -5.188  1.00 0.00 ? 43 A   G N1     1  
ATOM 6899   C C2     . A   G 2 43 ? 15.267  3.297   -5.520  1.00 0.00 ? 43 A   G C2     1  
ATOM 6900   N N3     . A   G 2 43 ? 15.310  4.383   -4.762  1.00 0.00 ? 43 A   G N3     1  
ATOM 6901   C C4     . A   G 2 43 ? 14.937  4.119   -3.484  1.00 0.00 ? 43 A   G C4     1  
ATOM 6902   H "H5'"  . A   G 2 43 ? 19.191  5.563   -1.825  1.00 0.00 ? 43 A   G "H5'"  1  
ATOM 6903   H "H5''" . A   G 2 43 ? 17.613  4.767   -1.920  1.00 0.00 ? 43 A   G "H5''" 1  
ATOM 6904   H "H4'"  . A   G 2 43 ? 18.305  7.431   -3.245  1.00 0.00 ? 43 A   G "H4'"  1  
ATOM 6905   H "H3'"  . A   G 2 43 ? 18.045  7.201   -0.589  1.00 0.00 ? 43 A   G "H3'"  1  
ATOM 6906   H "H2'"  . A   G 2 43 ? 16.187  5.836   -0.469  1.00 0.00 ? 43 A   G "H2'"  1  
ATOM 6907   H "HO2'" . A   G 2 43 ? 15.156  8.449   -0.537  1.00 0.00 ? 43 A   G "HO2'" 1  
ATOM 6908   H "H1'"  . A   G 2 43 ? 14.541  7.050   -2.604  1.00 0.00 ? 43 A   G "H1'"  1  
ATOM 6909   H H8     . A   G 2 43 ? 14.150  4.707   -0.418  1.00 0.00 ? 43 A   G H8     1  
ATOM 6910   H H61    . A   G 2 43 ? 14.224  -0.130  -4.303  1.00 0.00 ? 43 A   G H61    1  
ATOM 6911   H H62    . A   G 2 43 ? 13.846  0.397   -2.674  1.00 0.00 ? 43 A   G H62    1  
ATOM 6912   H H2     . A   G 2 43 ? 15.565  3.433   -6.550  1.00 0.00 ? 43 A   G H2     1  
ATOM 6913   P P      . U   G 2 44 ? 17.373  9.889   -0.324  1.00 0.00 ? 44 U   G P      1  
ATOM 6914   O OP1    . U   G 2 44 ? 17.954  11.131  -0.883  1.00 0.00 ? 44 U   G OP1    1  
ATOM 6915   O OP2    . U   G 2 44 ? 18.063  9.207   0.795   1.00 0.00 ? 44 U   G OP2    1  
ATOM 6916   O "O5'"  . U   G 2 44 ? 15.859  10.196  0.137   1.00 0.00 ? 44 U   G "O5'"  1  
ATOM 6917   C "C5'"  . U   G 2 44 ? 15.069  11.190  -0.484  1.00 0.00 ? 44 U   G "C5'"  1  
ATOM 6918   C "C4'"  . U   G 2 44 ? 14.856  10.916  -1.972  1.00 0.00 ? 44 U   G "C4'"  1  
ATOM 6919   O "O4'"  . U   G 2 44 ? 14.308  9.630   -2.191  1.00 0.00 ? 44 U   G "O4'"  1  
ATOM 6920   C "C3'"  . U   G 2 44 ? 13.838  11.877  -2.577  1.00 0.00 ? 44 U   G "C3'"  1  
ATOM 6921   O "O3'"  . U   G 2 44 ? 14.320  13.182  -2.828  1.00 0.00 ? 44 U   G "O3'"  1  
ATOM 6922   C "C2'"  . U   G 2 44 ? 13.472  11.112  -3.846  1.00 0.00 ? 44 U   G "C2'"  1  
ATOM 6923   O "O2'"  . U   G 2 44 ? 14.440  11.252  -4.866  1.00 0.00 ? 44 U   G "O2'"  1  
ATOM 6924   C "C1'"  . U   G 2 44 ? 13.492  9.669   -3.347  1.00 0.00 ? 44 U   G "C1'"  1  
ATOM 6925   N N1     . U   G 2 44 ? 12.117  9.206   -3.059  1.00 0.00 ? 44 U   G N1     1  
ATOM 6926   C C2     . U   G 2 44 ? 11.384  8.702   -4.123  1.00 0.00 ? 44 U   G C2     1  
ATOM 6927   O O2     . U   G 2 44 ? 11.839  8.601   -5.261  1.00 0.00 ? 44 U   G O2     1  
ATOM 6928   N N3     . U   G 2 44 ? 10.080  8.322   -3.853  1.00 0.00 ? 44 U   G N3     1  
ATOM 6929   C C4     . U   G 2 44 ? 9.446   8.414   -2.626  1.00 0.00 ? 44 U   G C4     1  
ATOM 6930   O O4     . U   G 2 44 ? 8.276   8.058   -2.508  1.00 0.00 ? 44 U   G O4     1  
ATOM 6931   C C5     . U   G 2 44 ? 10.281  8.948   -1.577  1.00 0.00 ? 44 U   G C5     1  
ATOM 6932   C C6     . U   G 2 44 ? 11.559  9.323   -1.814  1.00 0.00 ? 44 U   G C6     1  
ATOM 6933   H "H5'"  . U   G 2 44 ? 15.551  12.161  -0.368  1.00 0.00 ? 44 U   G "H5'"  1  
ATOM 6934   H "H5''" . U   G 2 44 ? 14.098  11.227  0.011   1.00 0.00 ? 44 U   G "H5''" 1  
ATOM 6935   H "H4'"  . U   G 2 44 ? 15.800  11.012  -2.509  1.00 0.00 ? 44 U   G "H4'"  1  
ATOM 6936   H "H3'"  . U   G 2 44 ? 12.968  11.921  -1.923  1.00 0.00 ? 44 U   G "H3'"  1  
ATOM 6937   H "H2'"  . U   G 2 44 ? 12.483  11.398  -4.199  1.00 0.00 ? 44 U   G "H2'"  1  
ATOM 6938   H "HO2'" . U   G 2 44 ? 13.992  11.242  -5.719  1.00 0.00 ? 44 U   G "HO2'" 1  
ATOM 6939   H "H1'"  . U   G 2 44 ? 13.923  9.041   -4.128  1.00 0.00 ? 44 U   G "H1'"  1  
ATOM 6940   H H3     . U   G 2 44 ? 9.527   7.994   -4.632  1.00 0.00 ? 44 U   G H3     1  
ATOM 6941   H H5     . U   G 2 44 ? 9.870   9.047   -0.583  1.00 0.00 ? 44 U   G H5     1  
ATOM 6942   H H6     . U   G 2 44 ? 12.158  9.712   -1.002  1.00 0.00 ? 44 U   G H6     1  
ATOM 6943   P P      . C   G 2 45 ? 13.273  14.387  -3.024  1.00 0.00 ? 45 C   G P      1  
ATOM 6944   O OP1    . C   G 2 45 ? 14.016  15.655  -3.183  1.00 0.00 ? 45 C   G OP1    1  
ATOM 6945   O OP2    . C   G 2 45 ? 12.250  14.269  -1.961  1.00 0.00 ? 45 C   G OP2    1  
ATOM 6946   O "O5'"  . C   G 2 45 ? 12.552  14.069  -4.428  1.00 0.00 ? 45 C   G "O5'"  1  
ATOM 6947   C "C5'"  . C   G 2 45 ? 13.255  14.212  -5.644  1.00 0.00 ? 45 C   G "C5'"  1  
ATOM 6948   C "C4'"  . C   G 2 45 ? 12.467  13.655  -6.829  1.00 0.00 ? 45 C   G "C4'"  1  
ATOM 6949   O "O4'"  . C   G 2 45 ? 12.155  12.283  -6.672  1.00 0.00 ? 45 C   G "O4'"  1  
ATOM 6950   C "C3'"  . C   G 2 45 ? 11.129  14.352  -7.061  1.00 0.00 ? 45 C   G "C3'"  1  
ATOM 6951   O "O3'"  . C   G 2 45 ? 11.250  15.646  -7.615  1.00 0.00 ? 45 C   G "O3'"  1  
ATOM 6952   C "C2'"  . C   G 2 45 ? 10.494  13.329  -7.999  1.00 0.00 ? 45 C   G "C2'"  1  
ATOM 6953   O "O2'"  . C   G 2 45 ? 10.986  13.413  -9.322  1.00 0.00 ? 45 C   G "O2'"  1  
ATOM 6954   C "C1'"  . C   G 2 45 ? 10.970  12.008  -7.397  1.00 0.00 ? 45 C   G "C1'"  1  
ATOM 6955   N N1     . C   G 2 45 ? 9.897   11.456  -6.540  1.00 0.00 ? 45 C   G N1     1  
ATOM 6956   C C2     . C   G 2 45 ? 8.838   10.819  -7.170  1.00 0.00 ? 45 C   G C2     1  
ATOM 6957   O O2     . C   G 2 45 ? 8.857   10.599  -8.379  1.00 0.00 ? 45 C   G O2     1  
ATOM 6958   N N3     . C   G 2 45 ? 7.763   10.429  -6.441  1.00 0.00 ? 45 C   G N3     1  
ATOM 6959   C C4     . C   G 2 45 ? 7.739   10.643  -5.125  1.00 0.00 ? 45 C   G C4     1  
ATOM 6960   N N4     . C   G 2 45 ? 6.680   10.197  -4.448  1.00 0.00 ? 45 C   G N4     1  
ATOM 6961   C C5     . C   G 2 45 ? 8.821   11.275  -4.439  1.00 0.00 ? 45 C   G C5     1  
ATOM 6962   C C6     . C   G 2 45 ? 9.868   11.677  -5.192  1.00 0.00 ? 45 C   G C6     1  
ATOM 6963   H "H5'"  . C   G 2 45 ? 14.207  13.686  -5.577  1.00 0.00 ? 45 C   G "H5'"  1  
ATOM 6964   H "H5''" . C   G 2 45 ? 13.460  15.268  -5.823  1.00 0.00 ? 45 C   G "H5''" 1  
ATOM 6965   H "H4'"  . C   G 2 45 ? 13.071  13.773  -7.728  1.00 0.00 ? 45 C   G "H4'"  1  
ATOM 6966   H "H3'"  . C   G 2 45 ? 10.573  14.389  -6.123  1.00 0.00 ? 45 C   G "H3'"  1  
ATOM 6967   H "H2'"  . C   G 2 45 ? 9.407   13.405  -7.980  1.00 0.00 ? 45 C   G "H2'"  1  
ATOM 6968   H "HO2'" . C   G 2 45 ? 10.244  13.588  -9.909  1.00 0.00 ? 45 C   G "HO2'" 1  
ATOM 6969   H "H1'"  . C   G 2 45 ? 11.183  11.298  -8.198  1.00 0.00 ? 45 C   G "H1'"  1  
ATOM 6970   H H41    . C   G 2 45 ? 5.941   9.739   -4.962  1.00 0.00 ? 45 C   G H41    1  
ATOM 6971   H H42    . C   G 2 45 ? 6.645   10.288  -3.445  1.00 0.00 ? 45 C   G H42    1  
ATOM 6972   H H5     . C   G 2 45 ? 8.820   11.461  -3.375  1.00 0.00 ? 45 C   G H5     1  
ATOM 6973   H H6     . C   G 2 45 ? 10.698  12.183  -4.726  1.00 0.00 ? 45 C   G H6     1  
ATOM 6974   P P      . G   G 2 46 ? 9.990   16.648  -7.657  1.00 0.00 ? 46 G   G P      1  
ATOM 6975   O OP1    . G   G 2 46 ? 10.483  17.972  -8.101  1.00 0.00 ? 46 G   G OP1    1  
ATOM 6976   O OP2    . G   G 2 46 ? 9.266   16.540  -6.372  1.00 0.00 ? 46 G   G OP2    1  
ATOM 6977   O "O5'"  . G   G 2 46 ? 9.034   16.048  -8.802  1.00 0.00 ? 46 G   G "O5'"  1  
ATOM 6978   C "C5'"  . G   G 2 46 ? 9.393   16.113  -10.164 1.00 0.00 ? 46 G   G "C5'"  1  
ATOM 6979   C "C4'"  . G   G 2 46 ? 8.452   15.247  -11.000 1.00 0.00 ? 46 G   G "C4'"  1  
ATOM 6980   O "O4'"  . G   G 2 46 ? 8.365   13.925  -10.502 1.00 0.00 ? 46 G   G "O4'"  1  
ATOM 6981   C "C3'"  . G   G 2 46 ? 7.023   15.785  -11.022 1.00 0.00 ? 46 G   G "C3'"  1  
ATOM 6982   O "O3'"  . G   G 2 46 ? 6.848   16.865  -11.915 1.00 0.00 ? 46 G   G "O3'"  1  
ATOM 6983   C "C2'"  . G   G 2 46 ? 6.287   14.522  -11.459 1.00 0.00 ? 46 G   G "C2'"  1  
ATOM 6984   O "O2'"  . G   G 2 46 ? 6.456   14.259  -12.838 1.00 0.00 ? 46 G   G "O2'"  1  
ATOM 6985   C "C1'"  . G   G 2 46 ? 7.040   13.455  -10.668 1.00 0.00 ? 46 G   G "C1'"  1  
ATOM 6986   N N9     . G   G 2 46 ? 6.377   13.246  -9.364  1.00 0.00 ? 46 G   G N9     1  
ATOM 6987   C C8     . G   G 2 46 ? 6.719   13.733  -8.128  1.00 0.00 ? 46 G   G C8     1  
ATOM 6988   N N7     . G   G 2 46 ? 5.900   13.389  -7.174  1.00 0.00 ? 46 G   G N7     1  
ATOM 6989   C C5     . G   G 2 46 ? 4.916   12.653  -7.828  1.00 0.00 ? 46 G   G C5     1  
ATOM 6990   C C6     . G   G 2 46 ? 3.727   12.053  -7.324  1.00 0.00 ? 46 G   G C6     1  
ATOM 6991   O O6     . G   G 2 46 ? 3.327   11.998  -6.162  1.00 0.00 ? 46 G   G O6     1  
ATOM 6992   N N1     . G   G 2 46 ? 2.953   11.489  -8.327  1.00 0.00 ? 46 G   G N1     1  
ATOM 6993   C C2     . G   G 2 46 ? 3.298   11.482  -9.658  1.00 0.00 ? 46 G   G C2     1  
ATOM 6994   N N2     . G   G 2 46 ? 2.417   10.957  -10.509 1.00 0.00 ? 46 G   G N2     1  
ATOM 6995   N N3     . G   G 2 46 ? 4.435   11.998  -10.137 1.00 0.00 ? 46 G   G N3     1  
ATOM 6996   C C4     . G   G 2 46 ? 5.191   12.578  -9.171  1.00 0.00 ? 46 G   G C4     1  
ATOM 6997   H "H5'"  . G   G 2 46 ? 10.416  15.758  -10.293 1.00 0.00 ? 46 G   G "H5'"  1  
ATOM 6998   H "H5''" . G   G 2 46 ? 9.335   17.146  -10.509 1.00 0.00 ? 46 G   G "H5''" 1  
ATOM 6999   H "H4'"  . G   G 2 46 ? 8.825   15.215  -12.025 1.00 0.00 ? 46 G   G "H4'"  1  
ATOM 7000   H "H3'"  . G   G 2 46 ? 6.722   16.061  -10.012 1.00 0.00 ? 46 G   G "H3'"  1  
ATOM 7001   H "H2'"  . G   G 2 46 ? 5.232   14.561  -11.186 1.00 0.00 ? 46 G   G "H2'"  1  
ATOM 7002   H "HO2'" . G   G 2 46 ? 6.523   15.101  -13.298 1.00 0.00 ? 46 G   G "HO2'" 1  
ATOM 7003   H "H1'"  . G   G 2 46 ? 7.035   12.518  -11.226 1.00 0.00 ? 46 G   G "H1'"  1  
ATOM 7004   H H8     . G   G 2 46 ? 7.589   14.350  -7.960  1.00 0.00 ? 46 G   G H8     1  
ATOM 7005   H H1     . G   G 2 46 ? 2.074   11.075  -8.054  1.00 0.00 ? 46 G   G H1     1  
ATOM 7006   H H21    . G   G 2 46 ? 1.520   10.632  -10.174 1.00 0.00 ? 46 G   G H21    1  
ATOM 7007   H H22    . G   G 2 46 ? 2.639   10.937  -11.493 1.00 0.00 ? 46 G   G H22    1  
ATOM 7008   P P      . C   G 2 47 ? 5.632   17.903  -11.715 1.00 0.00 ? 47 C   G P      1  
ATOM 7009   O OP1    . C   G 2 47 ? 5.788   18.982  -12.718 1.00 0.00 ? 47 C   G OP1    1  
ATOM 7010   O OP2    . C   G 2 47 ? 5.546   18.253  -10.279 1.00 0.00 ? 47 C   G OP2    1  
ATOM 7011   O "O5'"  . C   G 2 47 ? 4.332   17.036  -12.101 1.00 0.00 ? 47 C   G "O5'"  1  
ATOM 7012   C "C5'"  . C   G 2 47 ? 4.116   16.589  -13.423 1.00 0.00 ? 47 C   G "C5'"  1  
ATOM 7013   C "C4'"  . C   G 2 47 ? 2.877   15.697  -13.522 1.00 0.00 ? 47 C   G "C4'"  1  
ATOM 7014   O "O4'"  . C   G 2 47 ? 2.874   14.645  -12.576 1.00 0.00 ? 47 C   G "O4'"  1  
ATOM 7015   C "C3'"  . C   G 2 47 ? 1.603   16.507  -13.311 1.00 0.00 ? 47 C   G "C3'"  1  
ATOM 7016   O "O3'"  . C   G 2 47 ? 1.204   17.123  -14.518 1.00 0.00 ? 47 C   G "O3'"  1  
ATOM 7017   C "C2'"  . C   G 2 47 ? 0.645   15.426  -12.818 1.00 0.00 ? 47 C   G "C2'"  1  
ATOM 7018   O "O2'"  . C   G 2 47 ? -0.004  14.770  -13.888 1.00 0.00 ? 47 C   G "O2'"  1  
ATOM 7019   C "C1'"  . C   G 2 47 ? 1.556   14.429  -12.104 1.00 0.00 ? 47 C   G "C1'"  1  
ATOM 7020   N N1     . C   G 2 47 ? 1.481   14.581  -10.633 1.00 0.00 ? 47 C   G N1     1  
ATOM 7021   C C2     . C   G 2 47 ? 0.406   14.013  -9.959  1.00 0.00 ? 47 C   G C2     1  
ATOM 7022   O O2     . C   G 2 47 ? -0.542  13.512  -10.562 1.00 0.00 ? 47 C   G O2     1  
ATOM 7023   N N3     . C   G 2 47 ? 0.380   14.024  -8.602  1.00 0.00 ? 47 C   G N3     1  
ATOM 7024   C C4     . C   G 2 47 ? 1.384   14.585  -7.927  1.00 0.00 ? 47 C   G C4     1  
ATOM 7025   N N4     . C   G 2 47 ? 1.322   14.576  -6.596  1.00 0.00 ? 47 C   G N4     1  
ATOM 7026   C C5     . C   G 2 47 ? 2.481   15.222  -8.585  1.00 0.00 ? 47 C   G C5     1  
ATOM 7027   C C6     . C   G 2 47 ? 2.482   15.200  -9.935  1.00 0.00 ? 47 C   G C6     1  
ATOM 7028   H "H5'"  . C   G 2 47 ? 4.983   16.030  -13.772 1.00 0.00 ? 47 C   G "H5'"  1  
ATOM 7029   H "H5''" . C   G 2 47 ? 3.982   17.451  -14.076 1.00 0.00 ? 47 C   G "H5''" 1  
ATOM 7030   H "H4'"  . C   G 2 47 ? 2.841   15.263  -14.522 1.00 0.00 ? 47 C   G "H4'"  1  
ATOM 7031   H "H3'"  . C   G 2 47 ? 1.764   17.249  -12.527 1.00 0.00 ? 47 C   G "H3'"  1  
ATOM 7032   H "H2'"  . C   G 2 47 ? -0.085  15.846  -12.127 1.00 0.00 ? 47 C   G "H2'"  1  
ATOM 7033   H "HO2'" . C   G 2 47 ? -0.530  15.423  -14.361 1.00 0.00 ? 47 C   G "HO2'" 1  
ATOM 7034   H "H1'"  . C   G 2 47 ? 1.239   13.419  -12.368 1.00 0.00 ? 47 C   G "H1'"  1  
ATOM 7035   H H41    . C   G 2 47 ? 0.540   14.144  -6.124  1.00 0.00 ? 47 C   G H41    1  
ATOM 7036   H H42    . C   G 2 47 ? 2.012   15.076  -6.055  1.00 0.00 ? 47 C   G H42    1  
ATOM 7037   H H5     . C   G 2 47 ? 3.285   15.706  -8.051  1.00 0.00 ? 47 C   G H5     1  
ATOM 7038   H H6     . C   G 2 47 ? 3.295   15.666  -10.471 1.00 0.00 ? 47 C   G H6     1  
ATOM 7039   P P      . A   G 2 48 ? 0.138   18.329  -14.527 1.00 0.00 ? 48 A   G P      1  
ATOM 7040   O OP1    . A   G 2 48 ? 0.031   18.842  -15.911 1.00 0.00 ? 48 A   G OP1    1  
ATOM 7041   O OP2    . A   G 2 48 ? 0.480   19.258  -13.427 1.00 0.00 ? 48 A   G OP2    1  
ATOM 7042   O "O5'"  . A   G 2 48 ? -1.236  17.576  -14.162 1.00 0.00 ? 48 A   G "O5'"  1  
ATOM 7043   C "C5'"  . A   G 2 48 ? -2.302  18.266  -13.546 1.00 0.00 ? 48 A   G "C5'"  1  
ATOM 7044   C "C4'"  . A   G 2 48 ? -3.183  17.284  -12.775 1.00 0.00 ? 48 A   G "C4'"  1  
ATOM 7045   O "O4'"  . A   G 2 48 ? -2.398  16.438  -11.958 1.00 0.00 ? 48 A   G "O4'"  1  
ATOM 7046   C "C3'"  . A   G 2 48 ? -4.175  18.054  -11.907 1.00 0.00 ? 48 A   G "C3'"  1  
ATOM 7047   O "O3'"  . A   G 2 48 ? -5.486  17.907  -12.417 1.00 0.00 ? 48 A   G "O3'"  1  
ATOM 7048   C "C2'"  . A   G 2 48 ? -3.956  17.498  -10.501 1.00 0.00 ? 48 A   G "C2'"  1  
ATOM 7049   O "O2'"  . A   G 2 48 ? -5.015  16.671  -10.070 1.00 0.00 ? 48 A   G "O2'"  1  
ATOM 7050   C "C1'"  . A   G 2 48 ? -2.727  16.597  -10.594 1.00 0.00 ? 48 A   G "C1'"  1  
ATOM 7051   N N9     . A   G 2 48 ? -1.567  17.129  -9.851  1.00 0.00 ? 48 A   G N9     1  
ATOM 7052   C C8     . A   G 2 48 ? -0.452  17.759  -10.341 1.00 0.00 ? 48 A   G C8     1  
ATOM 7053   N N7     . A   G 2 48 ? 0.404   18.114  -9.424  1.00 0.00 ? 48 A   G N7     1  
ATOM 7054   C C5     . A   G 2 48 ? -0.175  17.665  -8.239  1.00 0.00 ? 48 A   G C5     1  
ATOM 7055   C C6     . A   G 2 48 ? 0.171   17.785  -6.879  1.00 0.00 ? 48 A   G C6     1  
ATOM 7056   N N6     . A   G 2 48 ? 1.259   18.425  -6.442  1.00 0.00 ? 48 A   G N6     1  
ATOM 7057   N N1     . A   G 2 48 ? -0.659  17.303  -5.946  1.00 0.00 ? 48 A   G N1     1  
ATOM 7058   C C2     . A   G 2 48 ? -1.773  16.707  -6.343  1.00 0.00 ? 48 A   G C2     1  
ATOM 7059   N N3     . A   G 2 48 ? -2.225  16.529  -7.577  1.00 0.00 ? 48 A   G N3     1  
ATOM 7060   C C4     . A   G 2 48 ? -1.366  17.039  -8.493  1.00 0.00 ? 48 A   G C4     1  
ATOM 7061   H "H5'"  . A   G 2 48 ? -2.897  18.776  -14.304 1.00 0.00 ? 48 A   G "H5'"  1  
ATOM 7062   H "H5''" . A   G 2 48 ? -1.909  19.007  -12.849 1.00 0.00 ? 48 A   G "H5''" 1  
ATOM 7063   H "H4'"  . A   G 2 48 ? -3.734  16.672  -13.489 1.00 0.00 ? 48 A   G "H4'"  1  
ATOM 7064   H "H3'"  . A   G 2 48 ? -3.903  19.110  -11.911 1.00 0.00 ? 48 A   G "H3'"  1  
ATOM 7065   H "H2'"  . A   G 2 48 ? -3.791  18.331  -9.814  1.00 0.00 ? 48 A   G "H2'"  1  
ATOM 7066   H "HO2'" . A   G 2 48 ? -5.844  17.151  -10.169 1.00 0.00 ? 48 A   G "HO2'" 1  
ATOM 7067   H "H1'"  . A   G 2 48 ? -2.981  15.622  -10.175 1.00 0.00 ? 48 A   G "H1'"  1  
ATOM 7068   H H8     . A   G 2 48 ? -0.307  17.960  -11.393 1.00 0.00 ? 48 A   G H8     1  
ATOM 7069   H H61    . A   G 2 48 ? 1.450   18.459  -5.450  1.00 0.00 ? 48 A   G H61    1  
ATOM 7070   H H62    . A   G 2 48 ? 1.944   18.747  -7.110  1.00 0.00 ? 48 A   G H62    1  
ATOM 7071   H H2     . A   G 2 48 ? -2.421  16.352  -5.556  1.00 0.00 ? 48 A   G H2     1  
ATOM 7072   P P      . G   G 2 49 ? -6.693  18.875  -11.968 1.00 0.00 ? 49 G   G P      1  
ATOM 7073   O OP1    . G   G 2 49 ? -7.701  18.875  -13.052 1.00 0.00 ? 49 G   G OP1    1  
ATOM 7074   O OP2    . G   G 2 49 ? -6.121  20.161  -11.510 1.00 0.00 ? 49 G   G OP2    1  
ATOM 7075   O "O5'"  . G   G 2 49 ? -7.330  18.127  -10.691 1.00 0.00 ? 49 G   G "O5'"  1  
ATOM 7076   C "C5'"  . G   G 2 49 ? -7.974  16.876  -10.821 1.00 0.00 ? 49 G   G "C5'"  1  
ATOM 7077   C "C4'"  . G   G 2 49 ? -8.389  16.304  -9.463  1.00 0.00 ? 49 G   G "C4'"  1  
ATOM 7078   O "O4'"  . G   G 2 49 ? -7.408  16.579  -8.482  1.00 0.00 ? 49 G   G "O4'"  1  
ATOM 7079   C "C3'"  . G   G 2 49 ? -9.712  16.886  -8.973  1.00 0.00 ? 49 G   G "C3'"  1  
ATOM 7080   O "O3'"  . G   G 2 49 ? -10.429 15.898  -8.256  1.00 0.00 ? 49 G   G "O3'"  1  
ATOM 7081   C "C2'"  . G   G 2 49 ? -9.233  18.036  -8.092  1.00 0.00 ? 49 G   G "C2'"  1  
ATOM 7082   O "O2'"  . G   G 2 49 ? -10.059 18.227  -6.964  1.00 0.00 ? 49 G   G "O2'"  1  
ATOM 7083   C "C1'"  . G   G 2 49 ? -7.834  17.629  -7.635  1.00 0.00 ? 49 G   G "C1'"  1  
ATOM 7084   N N9     . G   G 2 49 ? -6.853  18.738  -7.644  1.00 0.00 ? 49 G   G N9     1  
ATOM 7085   C C8     . G   G 2 49 ? -5.488  18.628  -7.725  1.00 0.00 ? 49 G   G C8     1  
ATOM 7086   N N7     . G   G 2 49 ? -4.846  19.758  -7.628  1.00 0.00 ? 49 G   G N7     1  
ATOM 7087   C C5     . G   G 2 49 ? -5.851  20.685  -7.364  1.00 0.00 ? 49 G   G C5     1  
ATOM 7088   C C6     . G   G 2 49 ? -5.757  22.069  -7.040  1.00 0.00 ? 49 G   G C6     1  
ATOM 7089   O O6     . G   G 2 49 ? -4.752  22.772  -6.944  1.00 0.00 ? 49 G   G O6     1  
ATOM 7090   N N1     . G   G 2 49 ? -6.993  22.637  -6.770  1.00 0.00 ? 49 G   G N1     1  
ATOM 7091   C C2     . G   G 2 49 ? -8.179  21.940  -6.783  1.00 0.00 ? 49 G   G C2     1  
ATOM 7092   N N2     . G   G 2 49 ? -9.272  22.592  -6.389  1.00 0.00 ? 49 G   G N2     1  
ATOM 7093   N N3     . G   G 2 49 ? -8.274  20.643  -7.081  1.00 0.00 ? 49 G   G N3     1  
ATOM 7094   C C4     . G   G 2 49 ? -7.077  20.068  -7.362  1.00 0.00 ? 49 G   G C4     1  
ATOM 7095   H "H5'"  . G   G 2 49 ? -7.294  16.172  -11.301 1.00 0.00 ? 49 G   G "H5'"  1  
ATOM 7096   H "H5''" . G   G 2 49 ? -8.855  16.982  -11.453 1.00 0.00 ? 49 G   G "H5''" 1  
ATOM 7097   H "H4'"  . G   G 2 49 ? -8.497  15.224  -9.566  1.00 0.00 ? 49 G   G "H4'"  1  
ATOM 7098   H "H3'"  . G   G 2 49 ? -10.295 17.260  -9.816  1.00 0.00 ? 49 G   G "H3'"  1  
ATOM 7099   H "H2'"  . G   G 2 49 ? -9.185  18.944  -8.694  1.00 0.00 ? 49 G   G "H2'"  1  
ATOM 7100   H "HO2'" . G   G 2 49 ? -10.603 17.442  -6.846  1.00 0.00 ? 49 G   G "HO2'" 1  
ATOM 7101   H "H1'"  . G   G 2 49 ? -7.914  17.241  -6.620  1.00 0.00 ? 49 G   G "H1'"  1  
ATOM 7102   H H8     . G   G 2 49 ? -4.990  17.679  -7.866  1.00 0.00 ? 49 G   G H8     1  
ATOM 7103   H H1     . G   G 2 49 ? -7.034  23.636  -6.632  1.00 0.00 ? 49 G   G H1     1  
ATOM 7104   H H21    . G   G 2 49 ? -9.164  23.486  -5.931  1.00 0.00 ? 49 G   G H21    1  
ATOM 7105   H H22    . G   G 2 49 ? -10.141 22.082  -6.308  1.00 0.00 ? 49 G   G H22    1  
ATOM 7106   P P      . G   G 2 50 ? -12.029 15.970  -8.065  1.00 0.00 ? 50 G   G P      1  
ATOM 7107   O OP1    . G   G 2 50 ? -12.558 14.588  -8.119  1.00 0.00 ? 50 G   G OP1    1  
ATOM 7108   O OP2    . G   G 2 50 ? -12.576 16.987  -8.992  1.00 0.00 ? 50 G   G OP2    1  
ATOM 7109   O "O5'"  . G   G 2 50 ? -12.206 16.526  -6.562  1.00 0.00 ? 50 G   G "O5'"  1  
ATOM 7110   C "C5'"  . G   G 2 50 ? -11.926 15.708  -5.444  1.00 0.00 ? 50 G   G "C5'"  1  
ATOM 7111   C "C4'"  . G   G 2 50 ? -12.436 16.300  -4.129  1.00 0.00 ? 50 G   G "C4'"  1  
ATOM 7112   O "O4'"  . G   G 2 50 ? -11.869 17.573  -3.883  1.00 0.00 ? 50 G   G "O4'"  1  
ATOM 7113   C "C3'"  . G   G 2 50 ? -13.957 16.450  -4.134  1.00 0.00 ? 50 G   G "C3'"  1  
ATOM 7114   O "O3'"  . G   G 2 50 ? -14.477 16.145  -2.855  1.00 0.00 ? 50 G   G "O3'"  1  
ATOM 7115   C "C2'"  . G   G 2 50 ? -14.126 17.939  -4.417  1.00 0.00 ? 50 G   G "C2'"  1  
ATOM 7116   O "O2'"  . G   G 2 50 ? -15.338 18.447  -3.904  1.00 0.00 ? 50 G   G "O2'"  1  
ATOM 7117   C "C1'"  . G   G 2 50 ? -12.910 18.513  -3.697  1.00 0.00 ? 50 G   G "C1'"  1  
ATOM 7118   N N9     . G   G 2 50 ? -12.544 19.830  -4.253  1.00 0.00 ? 50 G   G N9     1  
ATOM 7119   C C8     . G   G 2 50 ? -12.102 20.117  -5.517  1.00 0.00 ? 50 G   G C8     1  
ATOM 7120   N N7     . G   G 2 50 ? -11.968 21.392  -5.759  1.00 0.00 ? 50 G   G N7     1  
ATOM 7121   C C5     . G   G 2 50 ? -12.367 22.000  -4.569  1.00 0.00 ? 50 G   G C5     1  
ATOM 7122   C C6     . G   G 2 50 ? -12.454 23.379  -4.220  1.00 0.00 ? 50 G   G C6     1  
ATOM 7123   O O6     . G   G 2 50 ? -12.112 24.365  -4.870  1.00 0.00 ? 50 G   G O6     1  
ATOM 7124   N N1     . G   G 2 50 ? -12.986 23.573  -2.954  1.00 0.00 ? 50 G   G N1     1  
ATOM 7125   C C2     . G   G 2 50 ? -13.280 22.553  -2.081  1.00 0.00 ? 50 G   G C2     1  
ATOM 7126   N N2     . G   G 2 50 ? -13.714 22.907  -0.872  1.00 0.00 ? 50 G   G N2     1  
ATOM 7127   N N3     . G   G 2 50 ? -13.158 21.254  -2.375  1.00 0.00 ? 50 G   G N3     1  
ATOM 7128   C C4     . G   G 2 50 ? -12.717 21.049  -3.642  1.00 0.00 ? 50 G   G C4     1  
ATOM 7129   H "H5'"  . G   G 2 50 ? -10.853 15.531  -5.367  1.00 0.00 ? 50 G   G "H5'"  1  
ATOM 7130   H "H5''" . G   G 2 50 ? -12.419 14.748  -5.589  1.00 0.00 ? 50 G   G "H5''" 1  
ATOM 7131   H "H4'"  . G   G 2 50 ? -12.154 15.626  -3.323  1.00 0.00 ? 50 G   G "H4'"  1  
ATOM 7132   H "H3'"  . G   G 2 50 ? -14.419 15.847  -4.917  1.00 0.00 ? 50 G   G "H3'"  1  
ATOM 7133   H "H2'"  . G   G 2 50 ? -14.053 18.122  -5.489  1.00 0.00 ? 50 G   G "H2'"  1  
ATOM 7134   H "HO2'" . G   G 2 50 ? -15.545 17.962  -3.099  1.00 0.00 ? 50 G   G "HO2'" 1  
ATOM 7135   H "H1'"  . G   G 2 50 ? -13.134 18.610  -2.635  1.00 0.00 ? 50 G   G "H1'"  1  
ATOM 7136   H H8     . G   G 2 50 ? -11.899 19.337  -6.235  1.00 0.00 ? 50 G   G H8     1  
ATOM 7137   H H1     . G   G 2 50 ? -13.120 24.522  -2.641  1.00 0.00 ? 50 G   G H1     1  
ATOM 7138   H H21    . G   G 2 50 ? -13.955 23.870  -0.681  1.00 0.00 ? 50 G   G H21    1  
ATOM 7139   H H22    . G   G 2 50 ? -13.944 22.184  -0.205  1.00 0.00 ? 50 G   G H22    1  
ATOM 7140   P P      . A   G 2 51 ? -15.436 14.875  -2.628  1.00 0.00 ? 51 A   G P      1  
ATOM 7141   O OP1    . A   G 2 51 ? -16.492 14.889  -3.665  1.00 0.00 ? 51 A   G OP1    1  
ATOM 7142   O OP2    . A   G 2 51 ? -15.819 14.845  -1.198  1.00 0.00 ? 51 A   G OP2    1  
ATOM 7143   O "O5'"  . A   G 2 51 ? -14.460 13.630  -2.915  1.00 0.00 ? 51 A   G "O5'"  1  
ATOM 7144   C "C5'"  . A   G 2 51 ? -13.408 13.324  -2.027  1.00 0.00 ? 51 A   G "C5'"  1  
ATOM 7145   C "C4'"  . A   G 2 51 ? -12.511 12.245  -2.628  1.00 0.00 ? 51 A   G "C4'"  1  
ATOM 7146   O "O4'"  . A   G 2 51 ? -11.847 12.728  -3.779  1.00 0.00 ? 51 A   G "O4'"  1  
ATOM 7147   C "C3'"  . A   G 2 51 ? -11.418 11.811  -1.655  1.00 0.00 ? 51 A   G "C3'"  1  
ATOM 7148   O "O3'"  . A   G 2 51 ? -11.853 10.833  -0.729  1.00 0.00 ? 51 A   G "O3'"  1  
ATOM 7149   C "C2'"  . A   G 2 51 ? -10.374 11.260  -2.624  1.00 0.00 ? 51 A   G "C2'"  1  
ATOM 7150   O "O2'"  . A   G 2 51 ? -10.595 9.890   -2.890  1.00 0.00 ? 51 A   G "O2'"  1  
ATOM 7151   C "C1'"  . A   G 2 51 ? -10.608 12.059  -3.904  1.00 0.00 ? 51 A   G "C1'"  1  
ATOM 7152   N N9     . A   G 2 51 ? -9.543  13.057  -4.129  1.00 0.00 ? 51 A   G N9     1  
ATOM 7153   C C8     . A   G 2 51 ? -8.990  13.933  -3.232  1.00 0.00 ? 51 A   G C8     1  
ATOM 7154   N N7     . A   G 2 51 ? -7.951  14.581  -3.683  1.00 0.00 ? 51 A   G N7     1  
ATOM 7155   C C5     . A   G 2 51 ? -7.831  14.127  -4.995  1.00 0.00 ? 51 A   G C5     1  
ATOM 7156   C C6     . A   G 2 51 ? -6.921  14.382  -6.037  1.00 0.00 ? 51 A   G C6     1  
ATOM 7157   N N6     . A   G 2 51 ? -5.847  15.171  -5.928  1.00 0.00 ? 51 A   G N6     1  
ATOM 7158   N N1     . A   G 2 51 ? -7.089  13.770  -7.215  1.00 0.00 ? 51 A   G N1     1  
ATOM 7159   C C2     . A   G 2 51 ? -8.117  12.947  -7.365  1.00 0.00 ? 51 A   G C2     1  
ATOM 7160   N N3     . A   G 2 51 ? -9.026  12.594  -6.469  1.00 0.00 ? 51 A   G N3     1  
ATOM 7161   C C4     . A   G 2 51 ? -8.824  13.228  -5.287  1.00 0.00 ? 51 A   G C4     1  
ATOM 7162   H "H5'"  . A   G 2 51 ? -13.817 12.962  -1.083  1.00 0.00 ? 51 A   G "H5'"  1  
ATOM 7163   H "H5''" . A   G 2 51 ? -12.816 14.218  -1.837  1.00 0.00 ? 51 A   G "H5''" 1  
ATOM 7164   H "H4'"  . A   G 2 51 ? -13.113 11.379  -2.902  1.00 0.00 ? 51 A   G "H4'"  1  
ATOM 7165   H "H3'"  . A   G 2 51 ? -11.012 12.681  -1.136  1.00 0.00 ? 51 A   G "H3'"  1  
ATOM 7166   H "H2'"  . A   G 2 51 ? -9.364  11.414  -2.243  1.00 0.00 ? 51 A   G "H2'"  1  
ATOM 7167   H "HO2'" . A   G 2 51 ? -11.001 9.494   -2.111  1.00 0.00 ? 51 A   G "HO2'" 1  
ATOM 7168   H "H1'"  . A   G 2 51 ? -10.636 11.371  -4.749  1.00 0.00 ? 51 A   G "H1'"  1  
ATOM 7169   H H8     . A   G 2 51 ? -9.370  14.040  -2.227  1.00 0.00 ? 51 A   G H8     1  
ATOM 7170   H H61    . A   G 2 51 ? -5.251  15.288  -6.734  1.00 0.00 ? 51 A   G H61    1  
ATOM 7171   H H62    . A   G 2 51 ? -5.608  15.590  -5.040  1.00 0.00 ? 51 A   G H62    1  
ATOM 7172   H H2     . A   G 2 51 ? -8.210  12.483  -8.337  1.00 0.00 ? 51 A   G H2     1  
ATOM 7173   P P      . A   G 2 52 ? -11.961 11.160  0.847   1.00 0.00 ? 52 A   G P      1  
ATOM 7174   O OP1    . A   G 2 52 ? -12.854 10.150  1.457   1.00 0.00 ? 52 A   G OP1    1  
ATOM 7175   O OP2    . A   G 2 52 ? -12.289 12.596  0.985   1.00 0.00 ? 52 A   G OP2    1  
ATOM 7176   O "O5'"  . A   G 2 52 ? -10.475 10.917  1.427   1.00 0.00 ? 52 A   G "O5'"  1  
ATOM 7177   C "C5'"  . A   G 2 52 ? -9.363  10.984  0.561   1.00 0.00 ? 52 A   G "C5'"  1  
ATOM 7178   C "C4'"  . A   G 2 52 ? -7.995  10.699  1.180   1.00 0.00 ? 52 A   G "C4'"  1  
ATOM 7179   O "O4'"  . A   G 2 52 ? -7.825  11.377  2.408   1.00 0.00 ? 52 A   G "O4'"  1  
ATOM 7180   C "C3'"  . A   G 2 52 ? -7.812  9.199   1.409   1.00 0.00 ? 52 A   G "C3'"  1  
ATOM 7181   O "O3'"  . A   G 2 52 ? -6.574  8.798   0.866   1.00 0.00 ? 52 A   G "O3'"  1  
ATOM 7182   C "C2'"  . A   G 2 52 ? -7.788  9.080   2.929   1.00 0.00 ? 52 A   G "C2'"  1  
ATOM 7183   O "O2'"  . A   G 2 52 ? -6.937  8.058   3.409   1.00 0.00 ? 52 A   G "O2'"  1  
ATOM 7184   C "C1'"  . A   G 2 52 ? -7.301  10.464  3.348   1.00 0.00 ? 52 A   G "C1'"  1  
ATOM 7185   N N9     . A   G 2 52 ? -7.839  10.769  4.685   1.00 0.00 ? 52 A   G N9     1  
ATOM 7186   C C8     . A   G 2 52 ? -9.140  11.049  5.010   1.00 0.00 ? 52 A   G C8     1  
ATOM 7187   N N7     . A   G 2 52 ? -9.351  11.166  6.293   1.00 0.00 ? 52 A   G N7     1  
ATOM 7188   C C5     . A   G 2 52 ? -8.096  10.932  6.854   1.00 0.00 ? 52 A   G C5     1  
ATOM 7189   C C6     . A   G 2 52 ? -7.598  10.910  8.171   1.00 0.00 ? 52 A   G C6     1  
ATOM 7190   N N6     . A   G 2 52 ? -8.342  11.137  9.257   1.00 0.00 ? 52 A   G N6     1  
ATOM 7191   N N1     . A   G 2 52 ? -6.300  10.657  8.382   1.00 0.00 ? 52 A   G N1     1  
ATOM 7192   C C2     . A   G 2 52 ? -5.521  10.425  7.336   1.00 0.00 ? 52 A   G C2     1  
ATOM 7193   N N3     . A   G 2 52 ? -5.852  10.402  6.053   1.00 0.00 ? 52 A   G N3     1  
ATOM 7194   C C4     . A   G 2 52 ? -7.168  10.676  5.879   1.00 0.00 ? 52 A   G C4     1  
ATOM 7195   H "H5'"  . A   G 2 52 ? -9.352  11.953  0.069   1.00 0.00 ? 52 A   G "H5'"  1  
ATOM 7196   H "H5''" . A   G 2 52 ? -9.518  10.226  -0.202  1.00 0.00 ? 52 A   G "H5''" 1  
ATOM 7197   H "H4'"  . A   G 2 52 ? -7.221  11.038  0.491   1.00 0.00 ? 52 A   G "H4'"  1  
ATOM 7198   H "H3'"  . A   G 2 52 ? -8.642  8.635   0.985   1.00 0.00 ? 52 A   G "H3'"  1  
ATOM 7199   H "H2'"  . A   G 2 52 ? -8.805  8.921   3.286   1.00 0.00 ? 52 A   G "H2'"  1  
ATOM 7200   H "HO2'" . A   G 2 52 ? -7.086  7.264   2.885   1.00 0.00 ? 52 A   G "HO2'" 1  
ATOM 7201   H "H1'"  . A   G 2 52 ? -6.209  10.509  3.340   1.00 0.00 ? 52 A   G "H1'"  1  
ATOM 7202   H H8     . A   G 2 52 ? -9.892  11.204  4.247   1.00 0.00 ? 52 A   G H8     1  
ATOM 7203   H H61    . A   G 2 52 ? -7.907  11.111  10.168  1.00 0.00 ? 52 A   G H61    1  
ATOM 7204   H H62    . A   G 2 52 ? -9.327  11.336  9.155   1.00 0.00 ? 52 A   G H62    1  
ATOM 7205   H H2     . A   G 2 52 ? -4.478  10.240  7.550   1.00 0.00 ? 52 A   G H2     1  
ATOM 7206   P P      . G   G 2 53 ? -6.484  7.540   -0.129  1.00 0.00 ? 53 G   G P      1  
ATOM 7207   O OP1    . G   G 2 53 ? -7.377  6.470   0.369   1.00 0.00 ? 53 G   G OP1    1  
ATOM 7208   O OP2    . G   G 2 53 ? -5.045  7.261   -0.343  1.00 0.00 ? 53 G   G OP2    1  
ATOM 7209   O "O5'"  . G   G 2 53 ? -7.093  8.135   -1.496  1.00 0.00 ? 53 G   G "O5'"  1  
ATOM 7210   C "C5'"  . G   G 2 53 ? -6.569  9.322   -2.052  1.00 0.00 ? 53 G   G "C5'"  1  
ATOM 7211   C "C4'"  . G   G 2 53 ? -6.924  9.456   -3.530  1.00 0.00 ? 53 G   G "C4'"  1  
ATOM 7212   O "O4'"  . G   G 2 53 ? -6.904  10.825  -3.892  1.00 0.00 ? 53 G   G "O4'"  1  
ATOM 7213   C "C3'"  . G   G 2 53 ? -5.920  8.728   -4.423  1.00 0.00 ? 53 G   G "C3'"  1  
ATOM 7214   O "O3'"  . G   G 2 53 ? -6.299  7.406   -4.742  1.00 0.00 ? 53 G   G "O3'"  1  
ATOM 7215   C "C2'"  . G   G 2 53 ? -5.902  9.622   -5.659  1.00 0.00 ? 53 G   G "C2'"  1  
ATOM 7216   O "O2'"  . G   G 2 53 ? -6.994  9.357   -6.517  1.00 0.00 ? 53 G   G "O2'"  1  
ATOM 7217   C "C1'"  . G   G 2 53 ? -6.089  11.000  -5.035  1.00 0.00 ? 53 G   G "C1'"  1  
ATOM 7218   N N9     . G   G 2 53 ? -4.787  11.589  -4.661  1.00 0.00 ? 53 G   G N9     1  
ATOM 7219   C C8     . G   G 2 53 ? -4.256  11.794  -3.412  1.00 0.00 ? 53 G   G C8     1  
ATOM 7220   N N7     . G   G 2 53 ? -3.069  12.332  -3.426  1.00 0.00 ? 53 G   G N7     1  
ATOM 7221   C C5     . G   G 2 53 ? -2.818  12.557  -4.777  1.00 0.00 ? 53 G   G C5     1  
ATOM 7222   C C6     . G   G 2 53 ? -1.715  13.190  -5.416  1.00 0.00 ? 53 G   G C6     1  
ATOM 7223   O O6     . G   G 2 53 ? -0.739  13.728  -4.900  1.00 0.00 ? 53 G   G O6     1  
ATOM 7224   N N1     . G   G 2 53 ? -1.810  13.167  -6.799  1.00 0.00 ? 53 G   G N1     1  
ATOM 7225   C C2     . G   G 2 53 ? -2.879  12.644  -7.487  1.00 0.00 ? 53 G   G C2     1  
ATOM 7226   N N2     . G   G 2 53 ? -2.790  12.643  -8.819  1.00 0.00 ? 53 G   G N2     1  
ATOM 7227   N N3     . G   G 2 53 ? -3.945  12.091  -6.898  1.00 0.00 ? 53 G   G N3     1  
ATOM 7228   C C4     . G   G 2 53 ? -3.852  12.081  -5.543  1.00 0.00 ? 53 G   G C4     1  
ATOM 7229   H "H5'"  . G   G 2 53 ? -5.485  9.328   -1.944  1.00 0.00 ? 53 G   G "H5'"  1  
ATOM 7230   H "H5''" . G   G 2 53 ? -6.977  10.175  -1.511  1.00 0.00 ? 53 G   G "H5''" 1  
ATOM 7231   H "H4'"  . G   G 2 53 ? -7.924  9.056   -3.706  1.00 0.00 ? 53 G   G "H4'"  1  
ATOM 7232   H "H3'"  . G   G 2 53 ? -4.936  8.742   -3.953  1.00 0.00 ? 53 G   G "H3'"  1  
ATOM 7233   H "H2'"  . G   G 2 53 ? -4.954  9.545   -6.192  1.00 0.00 ? 53 G   G "H2'"  1  
ATOM 7234   H "HO2'" . G   G 2 53 ? -7.195  8.418   -6.465  1.00 0.00 ? 53 G   G "HO2'" 1  
ATOM 7235   H "H1'"  . G   G 2 53 ? -6.575  11.650  -5.761  1.00 0.00 ? 53 G   G "H1'"  1  
ATOM 7236   H H8     . G   G 2 53 ? -4.769  11.549  -2.491  1.00 0.00 ? 53 G   G H8     1  
ATOM 7237   H H1     . G   G 2 53 ? -1.043  13.550  -7.331  1.00 0.00 ? 53 G   G H1     1  
ATOM 7238   H H21    . G   G 2 53 ? -1.962  12.996  -9.282  1.00 0.00 ? 53 G   G H21    1  
ATOM 7239   H H22    . G   G 2 53 ? -3.558  12.272  -9.357  1.00 0.00 ? 53 G   G H22    1  
ATOM 7240   P P      . C   G 2 54 ? -5.176  6.287   -5.022  1.00 0.00 ? 54 C   G P      1  
ATOM 7241   O OP1    . C   G 2 54 ? -5.866  5.030   -5.394  1.00 0.00 ? 54 C   G OP1    1  
ATOM 7242   O OP2    . C   G 2 54 ? -4.230  6.286   -3.882  1.00 0.00 ? 54 C   G OP2    1  
ATOM 7243   O "O5'"  . C   G 2 54 ? -4.389  6.844   -6.312  1.00 0.00 ? 54 C   G "O5'"  1  
ATOM 7244   C "C5'"  . C   G 2 54 ? -4.938  6.732   -7.607  1.00 0.00 ? 54 C   G "C5'"  1  
ATOM 7245   C "C4'"  . C   G 2 54 ? -3.977  7.254   -8.675  1.00 0.00 ? 54 C   G "C4'"  1  
ATOM 7246   O "O4'"  . C   G 2 54 ? -3.731  8.644   -8.560  1.00 0.00 ? 54 C   G "O4'"  1  
ATOM 7247   C "C3'"  . C   G 2 54 ? -2.608  6.580   -8.628  1.00 0.00 ? 54 C   G "C3'"  1  
ATOM 7248   O "O3'"  . C   G 2 54 ? -2.582  5.281   -9.182  1.00 0.00 ? 54 C   G "O3'"  1  
ATOM 7249   C "C2'"  . C   G 2 54 ? -1.815  7.586   -9.453  1.00 0.00 ? 54 C   G "C2'"  1  
ATOM 7250   O "O2'"  . C   G 2 54 ? -2.054  7.458   -10.839 1.00 0.00 ? 54 C   G "O2'"  1  
ATOM 7251   C "C1'"  . C   G 2 54 ? -2.399  8.907   -8.966  1.00 0.00 ? 54 C   G "C1'"  1  
ATOM 7252   N N1     . C   G 2 54 ? -1.577  9.454   -7.864  1.00 0.00 ? 54 C   G N1     1  
ATOM 7253   C C2     . C   G 2 54 ? -0.397  10.100  -8.205  1.00 0.00 ? 54 C   G C2     1  
ATOM 7254   O O2     . C   G 2 54 ? -0.066  10.242  -9.380  1.00 0.00 ? 54 C   G O2     1  
ATOM 7255   N N3     . C   G 2 54 ? 0.422   10.562  -7.228  1.00 0.00 ? 54 C   G N3     1  
ATOM 7256   C C4     . C   G 2 54 ? 0.095   10.377  -5.947  1.00 0.00 ? 54 C   G C4     1  
ATOM 7257   N N4     . C   G 2 54 ? 0.938   10.840  -5.025  1.00 0.00 ? 54 C   G N4     1  
ATOM 7258   C C5     . C   G 2 54 ? -1.122  9.733   -5.560  1.00 0.00 ? 54 C   G C5     1  
ATOM 7259   C C6     . C   G 2 54 ? -1.926  9.288   -6.552  1.00 0.00 ? 54 C   G C6     1  
ATOM 7260   H "H5'"  . C   G 2 54 ? -5.871  7.293   -7.664  1.00 0.00 ? 54 C   G "H5'"  1  
ATOM 7261   H "H5''" . C   G 2 54 ? -5.150  5.683   -7.818  1.00 0.00 ? 54 C   G "H5''" 1  
ATOM 7262   H "H4'"  . C   G 2 54 ? -4.417  7.062   -9.654  1.00 0.00 ? 54 C   G "H4'"  1  
ATOM 7263   H "H3'"  . C   G 2 54 ? -2.228  6.574   -7.606  1.00 0.00 ? 54 C   G "H3'"  1  
ATOM 7264   H "H2'"  . C   G 2 54 ? -0.752  7.527   -9.229  1.00 0.00 ? 54 C   G "H2'"  1  
ATOM 7265   H "HO2'" . C   G 2 54 ? -1.903  6.541   -11.088 1.00 0.00 ? 54 C   G "HO2'" 1  
ATOM 7266   H "H1'"  . C   G 2 54 ? -2.371  9.602   -9.804  1.00 0.00 ? 54 C   G "H1'"  1  
ATOM 7267   H H41    . C   G 2 54 ? 1.786   11.298  -5.330  1.00 0.00 ? 54 C   G H41    1  
ATOM 7268   H H42    . C   G 2 54 ? 0.721   10.743  -4.044  1.00 0.00 ? 54 C   G H42    1  
ATOM 7269   H H5     . C   G 2 54 ? -1.409  9.589   -4.529  1.00 0.00 ? 54 C   G H5     1  
ATOM 7270   H H6     . C   G 2 54 ? -2.857  8.798   -6.307  1.00 0.00 ? 54 C   G H6     1  
ATOM 7271   P P      . G   G 2 55 ? -1.345  4.296   -8.878  1.00 0.00 ? 55 G   G P      1  
ATOM 7272   O OP1    . G   G 2 55 ? -1.712  2.948   -9.368  1.00 0.00 ? 55 G   G OP1    1  
ATOM 7273   O OP2    . G   G 2 55 ? -0.944  4.468   -7.464  1.00 0.00 ? 55 G   G OP2    1  
ATOM 7274   O "O5'"  . G   G 2 55 ? -0.157  4.868   -9.803  1.00 0.00 ? 55 G   G "O5'"  1  
ATOM 7275   C "C5'"  . G   G 2 55 ? -0.123  4.608   -11.190 1.00 0.00 ? 55 G   G "C5'"  1  
ATOM 7276   C "C4'"  . G   G 2 55 ? 1.132   5.193   -11.838 1.00 0.00 ? 55 G   G "C4'"  1  
ATOM 7277   O "O4'"  . G   G 2 55 ? 1.253   6.586   -11.618 1.00 0.00 ? 55 G   G "O4'"  1  
ATOM 7278   C "C3'"  . G   G 2 55 ? 2.411   4.550   -11.308 1.00 0.00 ? 55 G   G "C3'"  1  
ATOM 7279   O "O3'"  . G   G 2 55 ? 2.668   3.297   -11.908 1.00 0.00 ? 55 G   G "O3'"  1  
ATOM 7280   C "C2'"  . G   G 2 55 ? 3.425   5.632   -11.673 1.00 0.00 ? 55 G   G "C2'"  1  
ATOM 7281   O "O2'"  . G   G 2 55 ? 3.802   5.586   -13.035 1.00 0.00 ? 55 G   G "O2'"  1  
ATOM 7282   C "C1'"  . G   G 2 55 ? 2.618   6.904   -11.420 1.00 0.00 ? 55 G   G "C1'"  1  
ATOM 7283   N N9     . G   G 2 55 ? 2.838   7.387   -10.041 1.00 0.00 ? 55 G   G N9     1  
ATOM 7284   C C8     . G   G 2 55 ? 1.993   7.337   -8.963  1.00 0.00 ? 55 G   G C8     1  
ATOM 7285   N N7     . G   G 2 55 ? 2.512   7.798   -7.859  1.00 0.00 ? 55 G   G N7     1  
ATOM 7286   C C5     . G   G 2 55 ? 3.787   8.212   -8.237  1.00 0.00 ? 55 G   G C5     1  
ATOM 7287   C C6     . G   G 2 55 ? 4.832   8.801   -7.469  1.00 0.00 ? 55 G   G C6     1  
ATOM 7288   O O6     . G   G 2 55 ? 4.850   9.039   -6.264  1.00 0.00 ? 55 G   G O6     1  
ATOM 7289   N N1     . G   G 2 55 ? 5.939   9.130   -8.236  1.00 0.00 ? 55 G   G N1     1  
ATOM 7290   C C2     . G   G 2 55 ? 6.025   8.914   -9.593  1.00 0.00 ? 55 G   G C2     1  
ATOM 7291   N N2     . G   G 2 55 ? 7.149   9.301   -10.197 1.00 0.00 ? 55 G   G N2     1  
ATOM 7292   N N3     . G   G 2 55 ? 5.071   8.323   -10.318 1.00 0.00 ? 55 G   G N3     1  
ATOM 7293   C C4     . G   G 2 55 ? 3.977   8.003   -9.581  1.00 0.00 ? 55 G   G C4     1  
ATOM 7294   H "H5'"  . G   G 2 55 ? -1.005  5.036   -11.669 1.00 0.00 ? 55 G   G "H5'"  1  
ATOM 7295   H "H5''" . G   G 2 55 ? -0.129  3.530   -11.357 1.00 0.00 ? 55 G   G "H5''" 1  
ATOM 7296   H "H4'"  . G   G 2 55 ? 1.084   5.015   -12.912 1.00 0.00 ? 55 G   G "H4'"  1  
ATOM 7297   H "H3'"  . G   G 2 55 ? 2.354   4.456   -10.223 1.00 0.00 ? 55 G   G "H3'"  1  
ATOM 7298   H "H2'"  . G   G 2 55 ? 4.301   5.582   -11.026 1.00 0.00 ? 55 G   G "H2'"  1  
ATOM 7299   H "HO2'" . G   G 2 55 ? 4.649   6.031   -13.139 1.00 0.00 ? 55 G   G "HO2'" 1  
ATOM 7300   H "H1'"  . G   G 2 55 ? 2.940   7.679   -12.114 1.00 0.00 ? 55 G   G "H1'"  1  
ATOM 7301   H H8     . G   G 2 55 ? 0.985   6.953   -9.025  1.00 0.00 ? 55 G   G H8     1  
ATOM 7302   H H1     . G   G 2 55 ? 6.734   9.532   -7.756  1.00 0.00 ? 55 G   G H1     1  
ATOM 7303   H H21    . G   G 2 55 ? 7.882   9.745   -9.658  1.00 0.00 ? 55 G   G H21    1  
ATOM 7304   H H22    . G   G 2 55 ? 7.248   9.163   -11.191 1.00 0.00 ? 55 G   G H22    1  
ATOM 7305   P P      . A   G 2 56 ? 3.556   2.186   -11.156 1.00 0.00 ? 56 A   G P      1  
ATOM 7306   O OP1    . A   G 2 56 ? 3.568   0.966   -11.994 1.00 0.00 ? 56 A   G OP1    1  
ATOM 7307   O OP2    . A   G 2 56 ? 3.095   2.095   -9.751  1.00 0.00 ? 56 A   G OP2    1  
ATOM 7308   O "O5'"  . A   G 2 56 ? 5.038   2.814   -11.149 1.00 0.00 ? 56 A   G "O5'"  1  
ATOM 7309   C "C5'"  . A   G 2 56 ? 5.805   2.868   -12.334 1.00 0.00 ? 56 A   G "C5'"  1  
ATOM 7310   C "C4'"  . A   G 2 56 ? 7.088   3.668   -12.120 1.00 0.00 ? 56 A   G "C4'"  1  
ATOM 7311   O "O4'"  . A   G 2 56 ? 6.805   4.988   -11.695 1.00 0.00 ? 56 A   G "O4'"  1  
ATOM 7312   C "C3'"  . A   G 2 56 ? 8.001   3.050   -11.064 1.00 0.00 ? 56 A   G "C3'"  1  
ATOM 7313   O "O3'"  . A   G 2 56 ? 8.793   1.991   -11.564 1.00 0.00 ? 56 A   G "O3'"  1  
ATOM 7314   C "C2'"  . A   G 2 56 ? 8.817   4.272   -10.653 1.00 0.00 ? 56 A   G "C2'"  1  
ATOM 7315   O "O2'"  . A   G 2 56 ? 9.888   4.526   -11.539 1.00 0.00 ? 56 A   G "O2'"  1  
ATOM 7316   C "C1'"  . A   G 2 56 ? 7.786   5.394   -10.761 1.00 0.00 ? 56 A   G "C1'"  1  
ATOM 7317   N N9     . A   G 2 56 ? 7.189   5.635   -9.433  1.00 0.00 ? 56 A   G N9     1  
ATOM 7318   C C8     . A   G 2 56 ? 6.004   5.187   -8.905  1.00 0.00 ? 56 A   G C8     1  
ATOM 7319   N N7     . A   G 2 56 ? 5.843   5.472   -7.641  1.00 0.00 ? 56 A   G N7     1  
ATOM 7320   C C5     . A   G 2 56 ? 7.002   6.172   -7.311  1.00 0.00 ? 56 A   G C5     1  
ATOM 7321   C C6     . A   G 2 56 ? 7.493   6.761   -6.131  1.00 0.00 ? 56 A   G C6     1  
ATOM 7322   N N6     . A   G 2 56 ? 6.867   6.733   -4.950  1.00 0.00 ? 56 A   G N6     1  
ATOM 7323   N N1     . A   G 2 56 ? 8.670   7.398   -6.158  1.00 0.00 ? 56 A   G N1     1  
ATOM 7324   C C2     . A   G 2 56 ? 9.337   7.464   -7.301  1.00 0.00 ? 56 A   G C2     1  
ATOM 7325   N N3     . A   G 2 56 ? 9.005   6.944   -8.474  1.00 0.00 ? 56 A   G N3     1  
ATOM 7326   C C4     . A   G 2 56 ? 7.813   6.302   -8.407  1.00 0.00 ? 56 A   G C4     1  
ATOM 7327   H "H5'"  . A   G 2 56 ? 5.221   3.339   -13.125 1.00 0.00 ? 56 A   G "H5'"  1  
ATOM 7328   H "H5''" . A   G 2 56 ? 6.064   1.856   -12.646 1.00 0.00 ? 56 A   G "H5''" 1  
ATOM 7329   H "H4'"  . A   G 2 56 ? 7.635   3.714   -13.063 1.00 0.00 ? 56 A   G "H4'"  1  
ATOM 7330   H "H3'"  . A   G 2 56 ? 7.404   2.709   -10.219 1.00 0.00 ? 56 A   G "H3'"  1  
ATOM 7331   H "H2'"  . A   G 2 56 ? 9.181   4.166   -9.630  1.00 0.00 ? 56 A   G "H2'"  1  
ATOM 7332   H "HO2'" . A   G 2 56 ? 10.496  3.779   -11.492 1.00 0.00 ? 56 A   G "HO2'" 1  
ATOM 7333   H "H1'"  . A   G 2 56 ? 8.273   6.313   -11.092 1.00 0.00 ? 56 A   G "H1'"  1  
ATOM 7334   H H8     . A   G 2 56 ? 5.269   4.650   -9.486  1.00 0.00 ? 56 A   G H8     1  
ATOM 7335   H H61    . A   G 2 56 ? 7.274   7.210   -4.158  1.00 0.00 ? 56 A   G H61    1  
ATOM 7336   H H62    . A   G 2 56 ? 5.960   6.293   -4.879  1.00 0.00 ? 56 A   G H62    1  
ATOM 7337   H H2     . A   G 2 56 ? 10.262  8.021   -7.279  1.00 0.00 ? 56 A   G H2     1  
ATOM 7338   P P      . U   G 2 57 ? 9.802   1.204   -10.587 1.00 0.00 ? 57 U   G P      1  
ATOM 7339   O OP1    . U   G 2 57 ? 9.100   0.949   -9.309  1.00 0.00 ? 57 U   G OP1    1  
ATOM 7340   O OP2    . U   G 2 57 ? 11.088  1.938   -10.575 1.00 0.00 ? 57 U   G OP2    1  
ATOM 7341   O "O5'"  . U   G 2 57 ? 10.029  -0.217  -11.312 1.00 0.00 ? 57 U   G "O5'"  1  
ATOM 7342   C "C5'"  . U   G 2 57 ? 10.885  -0.340  -12.428 1.00 0.00 ? 57 U   G "C5'"  1  
ATOM 7343   C "C4'"  . U   G 2 57 ? 11.107  -1.812  -12.772 1.00 0.00 ? 57 U   G "C4'"  1  
ATOM 7344   O "O4'"  . U   G 2 57 ? 10.006  -2.350  -13.478 1.00 0.00 ? 57 U   G "O4'"  1  
ATOM 7345   C "C3'"  . U   G 2 57 ? 12.317  -1.982  -13.685 1.00 0.00 ? 57 U   G "C3'"  1  
ATOM 7346   O "O3'"  . U   G 2 57 ? 13.528  -2.015  -12.958 1.00 0.00 ? 57 U   G "O3'"  1  
ATOM 7347   C "C2'"  . U   G 2 57 ? 11.999  -3.295  -14.399 1.00 0.00 ? 57 U   G "C2'"  1  
ATOM 7348   O "O2'"  . U   G 2 57 ? 12.524  -4.417  -13.720 1.00 0.00 ? 57 U   G "O2'"  1  
ATOM 7349   C "C1'"  . U   G 2 57 ? 10.473  -3.365  -14.345 1.00 0.00 ? 57 U   G "C1'"  1  
ATOM 7350   N N1     . U   G 2 57 ? 9.893   -3.269  -15.703 1.00 0.00 ? 57 U   G N1     1  
ATOM 7351   C C2     . U   G 2 57 ? 9.852   -2.043  -16.356 1.00 0.00 ? 57 U   G C2     1  
ATOM 7352   O O2     . U   G 2 57 ? 10.296  -0.998  -15.883 1.00 0.00 ? 57 U   G O2     1  
ATOM 7353   N N3     . U   G 2 57 ? 9.303   -2.036  -17.629 1.00 0.00 ? 57 U   G N3     1  
ATOM 7354   C C4     . U   G 2 57 ? 8.849   -3.145  -18.322 1.00 0.00 ? 57 U   G C4     1  
ATOM 7355   O O4     . U   G 2 57 ? 8.395   -3.028  -19.458 1.00 0.00 ? 57 U   G O4     1  
ATOM 7356   C C5     . U   G 2 57 ? 8.979   -4.384  -17.591 1.00 0.00 ? 57 U   G C5     1  
ATOM 7357   C C6     . U   G 2 57 ? 9.484   -4.412  -16.337 1.00 0.00 ? 57 U   G C6     1  
ATOM 7358   H "H5'"  . U   G 2 57 ? 11.849  0.113   -12.194 1.00 0.00 ? 57 U   G "H5'"  1  
ATOM 7359   H "H5''" . U   G 2 57 ? 10.451  0.176   -13.285 1.00 0.00 ? 57 U   G "H5''" 1  
ATOM 7360   H "H4'"  . U   G 2 57 ? 11.271  -2.383  -11.857 1.00 0.00 ? 57 U   G "H4'"  1  
ATOM 7361   H "H3'"  . U   G 2 57 ? 12.333  -1.166  -14.407 1.00 0.00 ? 57 U   G "H3'"  1  
ATOM 7362   H "H2'"  . U   G 2 57 ? 12.358  -3.264  -15.428 1.00 0.00 ? 57 U   G "H2'"  1  
ATOM 7363   H "HO2'" . U   G 2 57 ? 13.477  -4.306  -13.647 1.00 0.00 ? 57 U   G "HO2'" 1  
ATOM 7364   H "H1'"  . U   G 2 57 ? 10.196  -4.330  -13.918 1.00 0.00 ? 57 U   G "H1'"  1  
ATOM 7365   H H3     . U   G 2 57 ? 9.258   -1.148  -18.106 1.00 0.00 ? 57 U   G H3     1  
ATOM 7366   H H5     . U   G 2 57 ? 8.666   -5.303  -18.065 1.00 0.00 ? 57 U   G H5     1  
ATOM 7367   H H6     . U   G 2 57 ? 9.574   -5.358  -15.823 1.00 0.00 ? 57 U   G H6     1  
ATOM 7368   P P      . U   G 2 58 ? 14.949  -1.883  -13.706 1.00 0.00 ? 58 U   G P      1  
ATOM 7369   O OP1    . U   G 2 58 ? 15.872  -1.174  -12.791 1.00 0.00 ? 58 U   G OP1    1  
ATOM 7370   O OP2    . U   G 2 58 ? 14.720  -1.339  -15.064 1.00 0.00 ? 58 U   G OP2    1  
ATOM 7371   O "O5'"  . U   G 2 58 ? 15.440  -3.410  -13.862 1.00 0.00 ? 58 U   G "O5'"  1  
ATOM 7372   C "C5'"  . U   G 2 58 ? 15.920  -4.146  -12.757 1.00 0.00 ? 58 U   G "C5'"  1  
ATOM 7373   C "C4'"  . U   G 2 58 ? 16.713  -5.363  -13.236 1.00 0.00 ? 58 U   G "C4'"  1  
ATOM 7374   O "O4'"  . U   G 2 58 ? 17.927  -4.937  -13.833 1.00 0.00 ? 58 U   G "O4'"  1  
ATOM 7375   C "C3'"  . U   G 2 58 ? 17.079  -6.268  -12.058 1.00 0.00 ? 58 U   G "C3'"  1  
ATOM 7376   O "O3'"  . U   G 2 58 ? 17.183  -7.619  -12.462 1.00 0.00 ? 58 U   G "O3'"  1  
ATOM 7377   C "C2'"  . U   G 2 58 ? 18.462  -5.736  -11.689 1.00 0.00 ? 58 U   G "C2'"  1  
ATOM 7378   O "O2'"  . U   G 2 58 ? 19.266  -6.670  -10.996 1.00 0.00 ? 58 U   G "O2'"  1  
ATOM 7379   C "C1'"  . U   G 2 58 ? 19.013  -5.441  -13.081 1.00 0.00 ? 58 U   G "C1'"  1  
ATOM 7380   N N1     . U   G 2 58 ? 20.185  -4.537  -13.050 1.00 0.00 ? 58 U   G N1     1  
ATOM 7381   C C2     . U   G 2 58 ? 20.023  -3.202  -12.703 1.00 0.00 ? 58 U   G C2     1  
ATOM 7382   O O2     . U   G 2 58 ? 18.953  -2.713  -12.348 1.00 0.00 ? 58 U   G O2     1  
ATOM 7383   N N3     . U   G 2 58 ? 21.160  -2.409  -12.736 1.00 0.00 ? 58 U   G N3     1  
ATOM 7384   C C4     . U   G 2 58 ? 22.443  -2.846  -13.017 1.00 0.00 ? 58 U   G C4     1  
ATOM 7385   O O4     . U   G 2 58 ? 23.387  -2.060  -12.992 1.00 0.00 ? 58 U   G O4     1  
ATOM 7386   C C5     . U   G 2 58 ? 22.530  -4.256  -13.313 1.00 0.00 ? 58 U   G C5     1  
ATOM 7387   C C6     . U   G 2 58 ? 21.429  -5.043  -13.319 1.00 0.00 ? 58 U   G C6     1  
ATOM 7388   H "H5'"  . U   G 2 58 ? 15.076  -4.478  -12.150 1.00 0.00 ? 58 U   G "H5'"  1  
ATOM 7389   H "H5''" . U   G 2 58 ? 16.567  -3.519  -12.143 1.00 0.00 ? 58 U   G "H5''" 1  
ATOM 7390   H "H4'"  . U   G 2 58 ? 16.114  -5.916  -13.960 1.00 0.00 ? 58 U   G "H4'"  1  
ATOM 7391   H "H3'"  . U   G 2 58 ? 16.380  -6.155  -11.229 1.00 0.00 ? 58 U   G "H3'"  1  
ATOM 7392   H "H2'"  . U   G 2 58 ? 18.361  -4.817  -11.113 1.00 0.00 ? 58 U   G "H2'"  1  
ATOM 7393   H "HO2'" . U   G 2 58 ? 18.774  -7.005  -10.238 1.00 0.00 ? 58 U   G "HO2'" 1  
ATOM 7394   H "H1'"  . U   G 2 58 ? 19.315  -6.390  -13.522 1.00 0.00 ? 58 U   G "H1'"  1  
ATOM 7395   H H3     . U   G 2 58 ? 21.045  -1.432  -12.514 1.00 0.00 ? 58 U   G H3     1  
ATOM 7396   H H5     . U   G 2 58 ? 23.497  -4.686  -13.531 1.00 0.00 ? 58 U   G H5     1  
ATOM 7397   H H6     . U   G 2 58 ? 21.530  -6.096  -13.542 1.00 0.00 ? 58 U   G H6     1  
ATOM 7398   P P      . C   G 2 59 ? 15.892  -8.564  -12.638 1.00 0.00 ? 59 C   G P      1  
ATOM 7399   O OP1    . C   G 2 59 ? 14.678  -7.726  -12.751 1.00 0.00 ? 59 C   G OP1    1  
ATOM 7400   O OP2    . C   G 2 59 ? 15.959  -9.612  -11.595 1.00 0.00 ? 59 C   G OP2    1  
ATOM 7401   O "O5'"  . C   G 2 59 ? 16.168  -9.254  -14.069 1.00 0.00 ? 59 C   G "O5'"  1  
ATOM 7402   C "C5'"  . C   G 2 59 ? 16.491  -8.456  -15.189 1.00 0.00 ? 59 C   G "C5'"  1  
ATOM 7403   C "C4'"  . C   G 2 59 ? 16.620  -9.255  -16.486 1.00 0.00 ? 59 C   G "C4'"  1  
ATOM 7404   O "O4'"  . C   G 2 59 ? 17.634  -10.241 -16.447 1.00 0.00 ? 59 C   G "O4'"  1  
ATOM 7405   C "C3'"  . C   G 2 59 ? 15.351  -10.010 -16.866 1.00 0.00 ? 59 C   G "C3'"  1  
ATOM 7406   O "O3'"  . C   G 2 59 ? 14.316  -9.184  -17.352 1.00 0.00 ? 59 C   G "O3'"  1  
ATOM 7407   C "C2'"  . C   G 2 59 ? 15.925  -10.917 -17.950 1.00 0.00 ? 59 C   G "C2'"  1  
ATOM 7408   O "O2'"  . C   G 2 59 ? 16.109  -10.226 -19.168 1.00 0.00 ? 59 C   G "O2'"  1  
ATOM 7409   C "C1'"  . C   G 2 59 ? 17.303  -11.253 -17.383 1.00 0.00 ? 59 C   G "C1'"  1  
ATOM 7410   N N1     . C   G 2 59 ? 17.264  -12.594 -16.764 1.00 0.00 ? 59 C   G N1     1  
ATOM 7411   C C2     . C   G 2 59 ? 17.467  -13.689 -17.592 1.00 0.00 ? 59 C   G C2     1  
ATOM 7412   O O2     . C   G 2 59 ? 17.729  -13.550 -18.786 1.00 0.00 ? 59 C   G O2     1  
ATOM 7413   N N3     . C   G 2 59 ? 17.346  -14.944 -17.088 1.00 0.00 ? 59 C   G N3     1  
ATOM 7414   C C4     . C   G 2 59 ? 17.003  -15.112 -15.810 1.00 0.00 ? 59 C   G C4     1  
ATOM 7415   N N4     . C   G 2 59 ? 16.879  -16.363 -15.370 1.00 0.00 ? 59 C   G N4     1  
ATOM 7416   C C5     . C   G 2 59 ? 16.754  -14.006 -14.938 1.00 0.00 ? 59 C   G C5     1  
ATOM 7417   C C6     . C   G 2 59 ? 16.901  -12.767 -15.456 1.00 0.00 ? 59 C   G C6     1  
ATOM 7418   H "H5'"  . C   G 2 59 ? 17.434  -7.942  -15.004 1.00 0.00 ? 59 C   G "H5'"  1  
ATOM 7419   H "H5''" . C   G 2 59 ? 15.712  -7.706  -15.325 1.00 0.00 ? 59 C   G "H5''" 1  
ATOM 7420   H "H4'"  . C   G 2 59 ? 16.851  -8.555  -17.289 1.00 0.00 ? 59 C   G "H4'"  1  
ATOM 7421   H "H3'"  . C   G 2 59 ? 15.011  -10.606 -16.019 1.00 0.00 ? 59 C   G "H3'"  1  
ATOM 7422   H "H2'"  . C   G 2 59 ? 15.312  -11.808 -18.084 1.00 0.00 ? 59 C   G "H2'"  1  
ATOM 7423   H "HO2'" . C   G 2 59 ? 15.337  -9.671  -19.317 1.00 0.00 ? 59 C   G "HO2'" 1  
ATOM 7424   H "H1'"  . C   G 2 59 ? 18.021  -11.256 -18.205 1.00 0.00 ? 59 C   G "H1'"  1  
ATOM 7425   H H41    . C   G 2 59 ? 17.020  -17.120 -16.025 1.00 0.00 ? 59 C   G H41    1  
ATOM 7426   H H42    . C   G 2 59 ? 16.429  -16.535 -14.482 1.00 0.00 ? 59 C   G H42    1  
ATOM 7427   H H5     . C   G 2 59 ? 16.470  -14.127 -13.903 1.00 0.00 ? 59 C   G H5     1  
ATOM 7428   H H6     . C   G 2 59 ? 16.730  -11.898 -14.835 1.00 0.00 ? 59 C   G H6     1  
ATOM 7429   P P      . A   G 2 60 ? 12.802  -9.726  -17.367 1.00 0.00 ? 60 A   G P      1  
ATOM 7430   O OP1    . A   G 2 60 ? 11.912  -8.615  -17.769 1.00 0.00 ? 60 A   G OP1    1  
ATOM 7431   O OP2    . A   G 2 60 ? 12.543  -10.431 -16.090 1.00 0.00 ? 60 A   G OP2    1  
ATOM 7432   O "O5'"  . A   G 2 60 ? 12.769  -10.820 -18.545 1.00 0.00 ? 60 A   G "O5'"  1  
ATOM 7433   C "C5'"  . A   G 2 60 ? 12.857  -10.423 -19.897 1.00 0.00 ? 60 A   G "C5'"  1  
ATOM 7434   C "C4'"  . A   G 2 60 ? 13.140  -11.620 -20.802 1.00 0.00 ? 60 A   G "C4'"  1  
ATOM 7435   O "O4'"  . A   G 2 60 ? 14.151  -12.447 -20.264 1.00 0.00 ? 60 A   G "O4'"  1  
ATOM 7436   C "C3'"  . A   G 2 60 ? 11.922  -12.515 -21.011 1.00 0.00 ? 60 A   G "C3'"  1  
ATOM 7437   O "O3'"  . A   G 2 60 ? 11.027  -11.946 -21.946 1.00 0.00 ? 60 A   G "O3'"  1  
ATOM 7438   C "C2'"  . A   G 2 60 ? 12.613  -13.793 -21.483 1.00 0.00 ? 60 A   G "C2'"  1  
ATOM 7439   O "O2'"  . A   G 2 60 ? 12.921  -13.759 -22.863 1.00 0.00 ? 60 A   G "O2'"  1  
ATOM 7440   C "C1'"  . A   G 2 60 ? 13.919  -13.775 -20.689 1.00 0.00 ? 60 A   G "C1'"  1  
ATOM 7441   N N9     . A   G 2 60 ? 13.824  -14.694 -19.537 1.00 0.00 ? 60 A   G N9     1  
ATOM 7442   C C8     . A   G 2 60 ? 13.710  -14.421 -18.197 1.00 0.00 ? 60 A   G C8     1  
ATOM 7443   N N7     . A   G 2 60 ? 13.709  -15.482 -17.437 1.00 0.00 ? 60 A   G N7     1  
ATOM 7444   C C5     . A   G 2 60 ? 13.820  -16.538 -18.342 1.00 0.00 ? 60 A   G C5     1  
ATOM 7445   C C6     . A   G 2 60 ? 13.891  -17.938 -18.221 1.00 0.00 ? 60 A   G C6     1  
ATOM 7446   N N6     . A   G 2 60 ? 13.884  -18.599 -17.059 1.00 0.00 ? 60 A   G N6     1  
ATOM 7447   N N1     . A   G 2 60 ? 13.985  -18.689 -19.326 1.00 0.00 ? 60 A   G N1     1  
ATOM 7448   C C2     . A   G 2 60 ? 14.006  -18.087 -20.506 1.00 0.00 ? 60 A   G C2     1  
ATOM 7449   N N3     . A   G 2 60 ? 13.956  -16.790 -20.766 1.00 0.00 ? 60 A   G N3     1  
ATOM 7450   C C4     . A   G 2 60 ? 13.869  -16.063 -19.626 1.00 0.00 ? 60 A   G C4     1  
ATOM 7451   H "H5'"  . A   G 2 60 ? 13.660  -9.698  -20.014 1.00 0.00 ? 60 A   G "H5'"  1  
ATOM 7452   H "H5''" . A   G 2 60 ? 11.923  -9.951  -20.206 1.00 0.00 ? 60 A   G "H5''" 1  
ATOM 7453   H "H4'"  . A   G 2 60 ? 13.466  -11.255 -21.776 1.00 0.00 ? 60 A   G "H4'"  1  
ATOM 7454   H "H3'"  . A   G 2 60 ? 11.432  -12.689 -20.052 1.00 0.00 ? 60 A   G "H3'"  1  
ATOM 7455   H "H2'"  . A   G 2 60 ? 12.025  -14.677 -21.239 1.00 0.00 ? 60 A   G "H2'"  1  
ATOM 7456   H "HO2'" . A   G 2 60 ? 12.155  -14.076 -23.352 1.00 0.00 ? 60 A   G "HO2'" 1  
ATOM 7457   H "H1'"  . A   G 2 60 ? 14.745  -14.105 -21.321 1.00 0.00 ? 60 A   G "H1'"  1  
ATOM 7458   H H8     . A   G 2 60 ? 13.634  -13.415 -17.809 1.00 0.00 ? 60 A   G H8     1  
ATOM 7459   H H61    . A   G 2 60 ? 13.972  -19.606 -17.066 1.00 0.00 ? 60 A   G H61    1  
ATOM 7460   H H62    . A   G 2 60 ? 13.874  -18.085 -16.191 1.00 0.00 ? 60 A   G H62    1  
ATOM 7461   H H2     . A   G 2 60 ? 14.061  -18.732 -21.369 1.00 0.00 ? 60 A   G H2     1  
ATOM 7462   P P      . U   G 2 61 ? 9.465   -12.337 -21.976 1.00 0.00 ? 61 U   G P      1  
ATOM 7463   O OP1    . U   G 2 61 ? 8.759   -11.306 -22.770 1.00 0.00 ? 61 U   G OP1    1  
ATOM 7464   O OP2    . U   G 2 61 ? 9.031   -12.595 -20.585 1.00 0.00 ? 61 U   G OP2    1  
ATOM 7465   O "O5'"  . U   G 2 61 ? 9.439   -13.719 -22.800 1.00 0.00 ? 61 U   G "O5'"  1  
ATOM 7466   C "C5'"  . U   G 2 61 ? 9.680   -13.729 -24.191 1.00 0.00 ? 61 U   G "C5'"  1  
ATOM 7467   C "C4'"  . U   G 2 61 ? 9.934   -15.143 -24.714 1.00 0.00 ? 61 U   G "C4'"  1  
ATOM 7468   O "O4'"  . U   G 2 61 ? 10.987  -15.776 -24.013 1.00 0.00 ? 61 U   G "O4'"  1  
ATOM 7469   C "C3'"  . U   G 2 61 ? 8.716   -16.059 -24.613 1.00 0.00 ? 61 U   G "C3'"  1  
ATOM 7470   O "O3'"  . U   G 2 61 ? 7.806   -15.840 -25.672 1.00 0.00 ? 61 U   G "O3'"  1  
ATOM 7471   C "C2'"  . U   G 2 61 ? 9.406   -17.420 -24.660 1.00 0.00 ? 61 U   G "C2'"  1  
ATOM 7472   O "O2'"  . U   G 2 61 ? 9.739   -17.815 -25.976 1.00 0.00 ? 61 U   G "O2'"  1  
ATOM 7473   C "C1'"  . U   G 2 61 ? 10.711  -17.161 -23.912 1.00 0.00 ? 61 U   G "C1'"  1  
ATOM 7474   N N1     . U   G 2 61 ? 10.594  -17.588 -22.499 1.00 0.00 ? 61 U   G N1     1  
ATOM 7475   C C2     . U   G 2 61 ? 10.837  -18.920 -22.197 1.00 0.00 ? 61 U   G C2     1  
ATOM 7476   O O2     . U   G 2 61 ? 11.048  -19.774 -23.056 1.00 0.00 ? 61 U   G O2     1  
ATOM 7477   N N3     . U   G 2 61 ? 10.831  -19.262 -20.853 1.00 0.00 ? 61 U   G N3     1  
ATOM 7478   C C4     . U   G 2 61 ? 10.614  -18.392 -19.799 1.00 0.00 ? 61 U   G C4     1  
ATOM 7479   O O4     . U   G 2 61 ? 10.712  -18.774 -18.636 1.00 0.00 ? 61 U   G O4     1  
ATOM 7480   C C5     . U   G 2 61 ? 10.299  -17.044 -20.210 1.00 0.00 ? 61 U   G C5     1  
ATOM 7481   C C6     . U   G 2 61 ? 10.281  -16.694 -21.514 1.00 0.00 ? 61 U   G C6     1  
ATOM 7482   H "H5'"  . U   G 2 61 ? 10.552  -13.114 -24.413 1.00 0.00 ? 61 U   G "H5'"  1  
ATOM 7483   H "H5''" . U   G 2 61 ? 8.819   -13.307 -24.710 1.00 0.00 ? 61 U   G "H5''" 1  
ATOM 7484   H "H4'"  . U   G 2 61 ? 10.214  -15.075 -25.765 1.00 0.00 ? 61 U   G "H4'"  1  
ATOM 7485   H "H3'"  . U   G 2 61 ? 8.227   -15.929 -23.647 1.00 0.00 ? 61 U   G "H3'"  1  
ATOM 7486   H "H2'"  . U   G 2 61 ? 8.805   -18.177 -24.157 1.00 0.00 ? 61 U   G "H2'"  1  
ATOM 7487   H "HO2'" . U   G 2 61 ? 9.252   -18.622 -26.174 1.00 0.00 ? 61 U   G "HO2'" 1  
ATOM 7488   H "H1'"  . U   G 2 61 ? 11.513  -17.727 -24.388 1.00 0.00 ? 61 U   G "H1'"  1  
ATOM 7489   H H3     . U   G 2 61 ? 11.002  -20.231 -20.622 1.00 0.00 ? 61 U   G H3     1  
ATOM 7490   H H5     . U   G 2 61 ? 10.076  -16.301 -19.461 1.00 0.00 ? 61 U   G H5     1  
ATOM 7491   H H6     . U   G 2 61 ? 10.040  -15.675 -21.781 1.00 0.00 ? 61 U   G H6     1  
ATOM 7492   P P      . C   G 2 62 ? 6.272   -16.325 -25.577 1.00 0.00 ? 62 C   G P      1  
ATOM 7493   O OP1    . C   G 2 62 ? 5.542   -15.742 -26.726 1.00 0.00 ? 62 C   G OP1    1  
ATOM 7494   O OP2    . C   G 2 62 ? 5.785   -16.063 -24.204 1.00 0.00 ? 62 C   G OP2    1  
ATOM 7495   O "O5'"  . C   G 2 62 ? 6.338   -17.919 -25.785 1.00 0.00 ? 62 C   G "O5'"  1  
ATOM 7496   C "C5'"  . C   G 2 62 ? 6.757   -18.494 -27.004 1.00 0.00 ? 62 C   G "C5'"  1  
ATOM 7497   C "C4'"  . C   G 2 62 ? 7.178   -19.948 -26.786 1.00 0.00 ? 62 C   G "C4'"  1  
ATOM 7498   O "O4'"  . C   G 2 62 ? 8.080   -20.067 -25.704 1.00 0.00 ? 62 C   G "O4'"  1  
ATOM 7499   C "C3'"  . C   G 2 62 ? 5.991   -20.865 -26.503 1.00 0.00 ? 62 C   G "C3'"  1  
ATOM 7500   O "O3'"  . C   G 2 62 ? 5.431   -21.310 -27.724 1.00 0.00 ? 62 C   G "O3'"  1  
ATOM 7501   C "C2'"  . C   G 2 62 ? 6.638   -21.956 -25.649 1.00 0.00 ? 62 C   G "C2'"  1  
ATOM 7502   O "O2'"  . C   G 2 62 ? 7.135   -23.023 -26.432 1.00 0.00 ? 62 C   G "O2'"  1  
ATOM 7503   C "C1'"  . C   G 2 62 ? 7.815   -21.251 -24.976 1.00 0.00 ? 62 C   G "C1'"  1  
ATOM 7504   N N1     . C   G 2 62 ? 7.541   -20.949 -23.551 1.00 0.00 ? 62 C   G N1     1  
ATOM 7505   C C2     . C   G 2 62 ? 7.991   -21.848 -22.594 1.00 0.00 ? 62 C   G C2     1  
ATOM 7506   O O2     . C   G 2 62 ? 8.465   -22.937 -22.913 1.00 0.00 ? 62 C   G O2     1  
ATOM 7507   N N3     . C   G 2 62 ? 7.880   -21.539 -21.277 1.00 0.00 ? 62 C   G N3     1  
ATOM 7508   C C4     . C   G 2 62 ? 7.312   -20.389 -20.908 1.00 0.00 ? 62 C   G C4     1  
ATOM 7509   N N4     . C   G 2 62 ? 7.224   -20.126 -19.605 1.00 0.00 ? 62 C   G N4     1  
ATOM 7510   C C5     . C   G 2 62 ? 6.774   -19.474 -21.864 1.00 0.00 ? 62 C   G C5     1  
ATOM 7511   C C6     . C   G 2 62 ? 6.906   -19.800 -23.169 1.00 0.00 ? 62 C   G C6     1  
ATOM 7512   H "H5'"  . C   G 2 62 ? 7.602   -17.935 -27.404 1.00 0.00 ? 62 C   G "H5'"  1  
ATOM 7513   H "H5''" . C   G 2 62 ? 5.941   -18.456 -27.726 1.00 0.00 ? 62 C   G "H5''" 1  
ATOM 7514   H "H4'"  . C   G 2 62 ? 7.673   -20.306 -27.689 1.00 0.00 ? 62 C   G "H4'"  1  
ATOM 7515   H "H3'"  . C   G 2 62 ? 5.245   -20.333 -25.912 1.00 0.00 ? 62 C   G "H3'"  1  
ATOM 7516   H "H2'"  . C   G 2 62 ? 5.937   -22.326 -24.903 1.00 0.00 ? 62 C   G "H2'"  1  
ATOM 7517   H "HO2'" . C   G 2 62 ? 6.380   -23.418 -26.883 1.00 0.00 ? 62 C   G "HO2'" 1  
ATOM 7518   H "H1'"  . C   G 2 62 ? 8.687   -21.904 -25.036 1.00 0.00 ? 62 C   G "H1'"  1  
ATOM 7519   H H41    . C   G 2 62 ? 7.590   -20.785 -18.931 1.00 0.00 ? 62 C   G H41    1  
ATOM 7520   H H42    . C   G 2 62 ? 6.755   -19.293 -19.280 1.00 0.00 ? 62 C   G H42    1  
ATOM 7521   H H5     . C   G 2 62 ? 6.285   -18.553 -21.586 1.00 0.00 ? 62 C   G H5     1  
ATOM 7522   H H6     . C   G 2 62 ? 6.527   -19.124 -23.919 1.00 0.00 ? 62 C   G H6     1  
ATOM 7523   P P      . A   G 2 63 ? 4.185   -22.327 -27.773 1.00 0.00 ? 63 A   G P      1  
ATOM 7524   O OP1    . A   G 2 63 ? 4.682   -23.674 -27.413 1.00 0.00 ? 63 A   G OP1    1  
ATOM 7525   O OP2    . A   G 2 63 ? 3.495   -22.133 -29.068 1.00 0.00 ? 63 A   G OP2    1  
ATOM 7526   O "O5'"  . A   G 2 63 ? 3.214   -21.783 -26.609 1.00 0.00 ? 63 A   G "O5'"  1  
ATOM 7527   C "C5'"  . A   G 2 63 ? 2.239   -22.607 -26.003 1.00 0.00 ? 63 A   G "C5'"  1  
ATOM 7528   C "C4'"  . A   G 2 63 ? 2.855   -23.538 -24.958 1.00 0.00 ? 63 A   G "C4'"  1  
ATOM 7529   O "O4'"  . A   G 2 63 ? 3.760   -22.822 -24.143 1.00 0.00 ? 63 A   G "O4'"  1  
ATOM 7530   C "C3'"  . A   G 2 63 ? 1.770   -24.147 -24.072 1.00 0.00 ? 63 A   G "C3'"  1  
ATOM 7531   O "O3'"  . A   G 2 63 ? 1.491   -25.468 -24.491 1.00 0.00 ? 63 A   G "O3'"  1  
ATOM 7532   C "C2'"  . A   G 2 63 ? 2.347   -24.052 -22.660 1.00 0.00 ? 63 A   G "C2'"  1  
ATOM 7533   O "O2'"  . A   G 2 63 ? 2.846   -25.284 -22.183 1.00 0.00 ? 63 A   G "O2'"  1  
ATOM 7534   C "C1'"  . A   G 2 63 ? 3.528   -23.094 -22.778 1.00 0.00 ? 63 A   G "C1'"  1  
ATOM 7535   N N9     . A   G 2 63 ? 3.290   -21.819 -22.073 1.00 0.00 ? 63 A   G N9     1  
ATOM 7536   C C8     . A   G 2 63 ? 2.933   -20.604 -22.601 1.00 0.00 ? 63 A   G C8     1  
ATOM 7537   N N7     . A   G 2 63 ? 3.062   -19.604 -21.773 1.00 0.00 ? 63 A   G N7     1  
ATOM 7538   C C5     . A   G 2 63 ? 3.495   -20.213 -20.597 1.00 0.00 ? 63 A   G C5     1  
ATOM 7539   C C6     . A   G 2 63 ? 3.813   -19.735 -19.314 1.00 0.00 ? 63 A   G C6     1  
ATOM 7540   N N6     . A   G 2 63 ? 3.795   -18.442 -18.983 1.00 0.00 ? 63 A   G N6     1  
ATOM 7541   N N1     . A   G 2 63 ? 4.106   -20.606 -18.340 1.00 0.00 ? 63 A   G N1     1  
ATOM 7542   C C2     . A   G 2 63 ? 4.142   -21.896 -18.638 1.00 0.00 ? 63 A   G C2     1  
ATOM 7543   N N3     . A   G 2 63 ? 3.919   -22.480 -19.806 1.00 0.00 ? 63 A   G N3     1  
ATOM 7544   C C4     . A   G 2 63 ? 3.586   -21.570 -20.755 1.00 0.00 ? 63 A   G C4     1  
ATOM 7545   H "H5'"  . A   G 2 63 ? 1.733   -23.201 -26.764 1.00 0.00 ? 63 A   G "H5'"  1  
ATOM 7546   H "H5''" . A   G 2 63 ? 1.503   -21.967 -25.516 1.00 0.00 ? 63 A   G "H5''" 1  
ATOM 7547   H "H4'"  . A   G 2 63 ? 3.390   -24.346 -25.456 1.00 0.00 ? 63 A   G "H4'"  1  
ATOM 7548   H "H3'"  . A   G 2 63 ? 0.870   -23.533 -24.133 1.00 0.00 ? 63 A   G "H3'"  1  
ATOM 7549   H "H2'"  . A   G 2 63 ? 1.596   -23.652 -21.980 1.00 0.00 ? 63 A   G "H2'"  1  
ATOM 7550   H "HO2'" . A   G 2 63 ? 2.118   -25.912 -22.146 1.00 0.00 ? 63 A   G "HO2'" 1  
ATOM 7551   H "H1'"  . A   G 2 63 ? 4.409   -23.572 -22.347 1.00 0.00 ? 63 A   G "H1'"  1  
ATOM 7552   H H8     . A   G 2 63 ? 2.602   -20.482 -23.624 1.00 0.00 ? 63 A   G H8     1  
ATOM 7553   H H61    . A   G 2 63 ? 4.019   -18.169 -18.035 1.00 0.00 ? 63 A   G H61    1  
ATOM 7554   H H62    . A   G 2 63 ? 3.584   -17.749 -19.687 1.00 0.00 ? 63 A   G H62    1  
ATOM 7555   H H2     . A   G 2 63 ? 4.350   -22.561 -17.811 1.00 0.00 ? 63 A   G H2     1  
ATOM 7556   P P      . G   G 2 64 ? 0.134   -26.224 -24.069 1.00 0.00 ? 64 G   G P      1  
ATOM 7557   O OP1    . G   G 2 64 ? -0.084  -27.337 -25.021 1.00 0.00 ? 64 G   G OP1    1  
ATOM 7558   O OP2    . G   G 2 64 ? -0.929  -25.210 -23.886 1.00 0.00 ? 64 G   G OP2    1  
ATOM 7559   O "O5'"  . G   G 2 64 ? 0.476   -26.853 -22.626 1.00 0.00 ? 64 G   G "O5'"  1  
ATOM 7560   C "C5'"  . G   G 2 64 ? 1.319   -27.979 -22.487 1.00 0.00 ? 64 G   G "C5'"  1  
ATOM 7561   C "C4'"  . G   G 2 64 ? 1.496   -28.360 -21.014 1.00 0.00 ? 64 G   G "C4'"  1  
ATOM 7562   O "O4'"  . G   G 2 64 ? 1.617   -27.189 -20.228 1.00 0.00 ? 64 G   G "O4'"  1  
ATOM 7563   C "C3'"  . G   G 2 64 ? 0.298   -29.145 -20.482 1.00 0.00 ? 64 G   G "C3'"  1  
ATOM 7564   O "O3'"  . G   G 2 64 ? 0.715   -29.986 -19.420 1.00 0.00 ? 64 G   G "O3'"  1  
ATOM 7565   C "C2'"  . G   G 2 64 ? -0.583  -27.991 -20.015 1.00 0.00 ? 64 G   G "C2'"  1  
ATOM 7566   O "O2'"  . G   G 2 64 ? -1.535  -28.383 -19.052 1.00 0.00 ? 64 G   G "O2'"  1  
ATOM 7567   C "C1'"  . G   G 2 64 ? 0.448   -27.016 -19.451 1.00 0.00 ? 64 G   G "C1'"  1  
ATOM 7568   N N9     . G   G 2 64 ? 0.020   -25.598 -19.479 1.00 0.00 ? 64 G   G N9     1  
ATOM 7569   C C8     . G   G 2 64 ? 0.818   -24.495 -19.644 1.00 0.00 ? 64 G   G C8     1  
ATOM 7570   N N7     . G   G 2 64 ? 0.192   -23.354 -19.555 1.00 0.00 ? 64 G   G N7     1  
ATOM 7571   C C5     . G   G 2 64 ? -1.119  -23.720 -19.258 1.00 0.00 ? 64 G   G C5     1  
ATOM 7572   C C6     . G   G 2 64 ? -2.260  -22.909 -18.993 1.00 0.00 ? 64 G   G C6     1  
ATOM 7573   O O6     . G   G 2 64 ? -2.355  -21.684 -18.992 1.00 0.00 ? 64 G   G O6     1  
ATOM 7574   N N1     . G   G 2 64 ? -3.385  -23.658 -18.685 1.00 0.00 ? 64 G   G N1     1  
ATOM 7575   C C2     . G   G 2 64 ? -3.401  -25.031 -18.615 1.00 0.00 ? 64 G   G C2     1  
ATOM 7576   N N2     . G   G 2 64 ? -4.527  -25.598 -18.186 1.00 0.00 ? 64 G   G N2     1  
ATOM 7577   N N3     . G   G 2 64 ? -2.336  -25.800 -18.863 1.00 0.00 ? 64 G   G N3     1  
ATOM 7578   C C4     . G   G 2 64 ? -1.227  -25.089 -19.190 1.00 0.00 ? 64 G   G C4     1  
ATOM 7579   H "H5'"  . G   G 2 64 ? 2.297   -27.755 -22.914 1.00 0.00 ? 64 G   G "H5'"  1  
ATOM 7580   H "H5''" . G   G 2 64 ? 0.894   -28.825 -23.028 1.00 0.00 ? 64 G   G "H5''" 1  
ATOM 7581   H "H4'"  . G   G 2 64 ? 2.397   -28.965 -20.913 1.00 0.00 ? 64 G   G "H4'"  1  
ATOM 7582   H "H3'"  . G   G 2 64 ? -0.178  -29.711 -21.282 1.00 0.00 ? 64 G   G "H3'"  1  
ATOM 7583   H "H2'"  . G   G 2 64 ? -1.086  -27.544 -20.873 1.00 0.00 ? 64 G   G "H2'"  1  
ATOM 7584   H "HO2'" . G   G 2 64 ? -2.042  -27.597 -18.822 1.00 0.00 ? 64 G   G "HO2'" 1  
ATOM 7585   H "H1'"  . G   G 2 64 ? 0.675   -27.318 -18.428 1.00 0.00 ? 64 G   G "H1'"  1  
ATOM 7586   H H8     . G   G 2 64 ? 1.878   -24.571 -19.845 1.00 0.00 ? 64 G   G H8     1  
ATOM 7587   H H1     . G   G 2 64 ? -4.255  -23.168 -18.539 1.00 0.00 ? 64 G   G H1     1  
ATOM 7588   H H21    . G   G 2 64 ? -5.242  -25.004 -17.790 1.00 0.00 ? 64 G   G H21    1  
ATOM 7589   H H22    . G   G 2 64 ? -4.528  -26.589 -17.989 1.00 0.00 ? 64 G   G H22    1  
ATOM 7590   P P      . G   G 2 65 ? -0.060  -31.354 -19.055 1.00 0.00 ? 65 G   G P      1  
ATOM 7591   O OP1    . G   G 2 65 ? 0.948   -32.439 -19.044 1.00 0.00 ? 65 G   G OP1    1  
ATOM 7592   O OP2    . G   G 2 65 ? -1.236  -31.493 -19.945 1.00 0.00 ? 65 G   G OP2    1  
ATOM 7593   O "O5'"  . G   G 2 65 ? -0.608  -31.167 -17.548 1.00 0.00 ? 65 G   G "O5'"  1  
ATOM 7594   C "C5'"  . G   G 2 65 ? 0.219   -31.401 -16.425 1.00 0.00 ? 65 G   G "C5'"  1  
ATOM 7595   C "C4'"  . G   G 2 65 ? -0.558  -31.364 -15.108 1.00 0.00 ? 65 G   G "C4'"  1  
ATOM 7596   O "O4'"  . G   G 2 65 ? -1.275  -30.154 -14.961 1.00 0.00 ? 65 G   G "O4'"  1  
ATOM 7597   C "C3'"  . G   G 2 65 ? -1.536  -32.529 -14.966 1.00 0.00 ? 65 G   G "C3'"  1  
ATOM 7598   O "O3'"  . G   G 2 65 ? -1.359  -33.159 -13.712 1.00 0.00 ? 65 G   G "O3'"  1  
ATOM 7599   C "C2'"  . G   G 2 65 ? -2.910  -31.865 -15.007 1.00 0.00 ? 65 G   G "C2'"  1  
ATOM 7600   O "O2'"  . G   G 2 65 ? -3.804  -32.476 -14.100 1.00 0.00 ? 65 G   G "O2'"  1  
ATOM 7601   C "C1'"  . G   G 2 65 ? -2.617  -30.422 -14.606 1.00 0.00 ? 65 G   G "C1'"  1  
ATOM 7602   N N9     . G   G 2 65 ? -3.529  -29.495 -15.303 1.00 0.00 ? 65 G   G N9     1  
ATOM 7603   C C8     . G   G 2 65 ? -3.452  -29.039 -16.593 1.00 0.00 ? 65 G   G C8     1  
ATOM 7604   N N7     . G   G 2 65 ? -4.478  -28.330 -16.972 1.00 0.00 ? 65 G   G N7     1  
ATOM 7605   C C5     . G   G 2 65 ? -5.295  -28.300 -15.843 1.00 0.00 ? 65 G   G C5     1  
ATOM 7606   C C6     . G   G 2 65 ? -6.563  -27.686 -15.640 1.00 0.00 ? 65 G   G C6     1  
ATOM 7607   O O6     . G   G 2 65 ? -7.210  -26.980 -16.412 1.00 0.00 ? 65 G   G O6     1  
ATOM 7608   N N1     . G   G 2 65 ? -7.079  -27.941 -14.379 1.00 0.00 ? 65 G   G N1     1  
ATOM 7609   C C2     . G   G 2 65 ? -6.395  -28.606 -13.389 1.00 0.00 ? 65 G   G C2     1  
ATOM 7610   N N2     . G   G 2 65 ? -7.031  -28.773 -12.231 1.00 0.00 ? 65 G   G N2     1  
ATOM 7611   N N3     . G   G 2 65 ? -5.186  -29.153 -13.551 1.00 0.00 ? 65 G   G N3     1  
ATOM 7612   C C4     . G   G 2 65 ? -4.704  -28.981 -14.808 1.00 0.00 ? 65 G   G C4     1  
ATOM 7613   H "H5'"  . G   G 2 65 ? 1.018   -30.660 -16.385 1.00 0.00 ? 65 G   G "H5'"  1  
ATOM 7614   H "H5''" . G   G 2 65 ? 0.683   -32.383 -16.521 1.00 0.00 ? 65 G   G "H5''" 1  
ATOM 7615   H "H4'"  . G   G 2 65 ? 0.169   -31.430 -14.298 1.00 0.00 ? 65 G   G "H4'"  1  
ATOM 7616   H "H3'"  . G   G 2 65 ? -1.433  -33.236 -15.791 1.00 0.00 ? 65 G   G "H3'"  1  
ATOM 7617   H "H2'"  . G   G 2 65 ? -3.321  -31.897 -16.017 1.00 0.00 ? 65 G   G "H2'"  1  
ATOM 7618   H "HO2'" . G   G 2 65 ? -3.276  -32.949 -13.449 1.00 0.00 ? 65 G   G "HO2'" 1  
ATOM 7619   H "H1'"  . G   G 2 65 ? -2.747  -30.313 -13.529 1.00 0.00 ? 65 G   G "H1'"  1  
ATOM 7620   H H8     . G   G 2 65 ? -2.605  -29.257 -17.226 1.00 0.00 ? 65 G   G H8     1  
ATOM 7621   H H1     . G   G 2 65 ? -8.024  -27.641 -14.184 1.00 0.00 ? 65 G   G H1     1  
ATOM 7622   H H21    . G   G 2 65 ? -8.003  -28.509 -12.139 1.00 0.00 ? 65 G   G H21    1  
ATOM 7623   H H22    . G   G 2 65 ? -6.591  -29.330 -11.511 1.00 0.00 ? 65 G   G H22    1  
ATOM 7624   P P      . A   G 2 66 ? -0.560  -34.548 -13.571 1.00 0.00 ? 66 A   G P      1  
ATOM 7625   O OP1    . A   G 2 66 ? -0.939  -35.428 -14.701 1.00 0.00 ? 66 A   G OP1    1  
ATOM 7626   O OP2    . A   G 2 66 ? -0.737  -35.033 -12.183 1.00 0.00 ? 66 A   G OP2    1  
ATOM 7627   O "O5'"  . A   G 2 66 ? 0.978   -34.119 -13.762 1.00 0.00 ? 66 A   G "O5'"  1  
ATOM 7628   C "C5'"  . A   G 2 66 ? 1.639   -33.338 -12.789 1.00 0.00 ? 66 A   G "C5'"  1  
ATOM 7629   C "C4'"  . A   G 2 66 ? 3.078   -33.072 -13.227 1.00 0.00 ? 66 A   G "C4'"  1  
ATOM 7630   O "O4'"  . A   G 2 66 ? 3.124   -32.464 -14.501 1.00 0.00 ? 66 A   G "O4'"  1  
ATOM 7631   C "C3'"  . A   G 2 66 ? 3.801   -32.131 -12.267 1.00 0.00 ? 66 A   G "C3'"  1  
ATOM 7632   O "O3'"  . A   G 2 66 ? 4.362   -32.814 -11.166 1.00 0.00 ? 66 A   G "O3'"  1  
ATOM 7633   C "C2'"  . A   G 2 66 ? 4.859   -31.498 -13.165 1.00 0.00 ? 66 A   G "C2'"  1  
ATOM 7634   O "O2'"  . A   G 2 66 ? 6.065   -32.231 -13.146 1.00 0.00 ? 66 A   G "O2'"  1  
ATOM 7635   C "C1'"  . A   G 2 66 ? 4.234   -31.591 -14.558 1.00 0.00 ? 66 A   G "C1'"  1  
ATOM 7636   N N9     . A   G 2 66 ? 3.738   -30.286 -15.034 1.00 0.00 ? 66 A   G N9     1  
ATOM 7637   C C8     . A   G 2 66 ? 3.093   -29.309 -14.322 1.00 0.00 ? 66 A   G C8     1  
ATOM 7638   N N7     . A   G 2 66 ? 2.893   -28.209 -14.994 1.00 0.00 ? 66 A   G N7     1  
ATOM 7639   C C5     . A   G 2 66 ? 3.388   -28.506 -16.263 1.00 0.00 ? 66 A   G C5     1  
ATOM 7640   C C6     . A   G 2 66 ? 3.515   -27.775 -17.459 1.00 0.00 ? 66 A   G C6     1  
ATOM 7641   N N6     . A   G 2 66 ? 3.229   -26.475 -17.583 1.00 0.00 ? 66 A   G N6     1  
ATOM 7642   N N1     . A   G 2 66 ? 4.005   -28.380 -18.547 1.00 0.00 ? 66 A   G N1     1  
ATOM 7643   C C2     . A   G 2 66 ? 4.362   -29.652 -18.458 1.00 0.00 ? 66 A   G C2     1  
ATOM 7644   N N3     . A   G 2 66 ? 4.348   -30.442 -17.393 1.00 0.00 ? 66 A   G N3     1  
ATOM 7645   C C4     . A   G 2 66 ? 3.844   -29.796 -16.313 1.00 0.00 ? 66 A   G C4     1  
ATOM 7646   H "H5'"  . A   G 2 66 ? 1.651   -33.871 -11.838 1.00 0.00 ? 66 A   G "H5'"  1  
ATOM 7647   H "H5''" . A   G 2 66 ? 1.118   -32.390 -12.659 1.00 0.00 ? 66 A   G "H5''" 1  
ATOM 7648   H "H4'"  . A   G 2 66 ? 3.618   -34.017 -13.278 1.00 0.00 ? 66 A   G "H4'"  1  
ATOM 7649   H "H3'"  . A   G 2 66 ? 3.134   -31.344 -11.915 1.00 0.00 ? 66 A   G "H3'"  1  
ATOM 7650   H "H2'"  . A   G 2 66 ? 5.031   -30.466 -12.857 1.00 0.00 ? 66 A   G "H2'"  1  
ATOM 7651   H "HO2'" . A   G 2 66 ? 6.088   -32.750 -12.336 1.00 0.00 ? 66 A   G "HO2'" 1  
ATOM 7652   H "H1'"  . A   G 2 66 ? 4.974   -31.974 -15.263 1.00 0.00 ? 66 A   G "H1'"  1  
ATOM 7653   H H8     . A   G 2 66 ? 2.826   -29.432 -13.283 1.00 0.00 ? 66 A   G H8     1  
ATOM 7654   H H61    . A   G 2 66 ? 3.364   -26.036 -18.482 1.00 0.00 ? 66 A   G H61    1  
ATOM 7655   H H62    . A   G 2 66 ? 2.995   -25.929 -16.765 1.00 0.00 ? 66 A   G H62    1  
ATOM 7656   H H2     . A   G 2 66 ? 4.734   -30.098 -19.369 1.00 0.00 ? 66 A   G H2     1  
ATOM 7657   P P      . C   G 2 67 ? 4.016   -32.333 -9.672  1.00 0.00 ? 67 C   G P      1  
ATOM 7658   O OP1    . C   G 2 67 ? 4.750   -33.204 -8.727  1.00 0.00 ? 67 C   G OP1    1  
ATOM 7659   O OP2    . C   G 2 67 ? 2.544   -32.213 -9.561  1.00 0.00 ? 67 C   G OP2    1  
ATOM 7660   O "O5'"  . C   G 2 67 ? 4.685   -30.865 -9.651  1.00 0.00 ? 67 C   G "O5'"  1  
ATOM 7661   C "C5'"  . C   G 2 67 ? 6.092   -30.772 -9.586  1.00 0.00 ? 67 C   G "C5'"  1  
ATOM 7662   C "C4'"  . C   G 2 67 ? 6.717   -29.405 -9.864  1.00 0.00 ? 67 C   G "C4'"  1  
ATOM 7663   O "O4'"  . C   G 2 67 ? 6.341   -28.465 -8.877  1.00 0.00 ? 67 C   G "O4'"  1  
ATOM 7664   C "C3'"  . C   G 2 67 ? 8.234   -29.603 -9.780  1.00 0.00 ? 67 C   G "C3'"  1  
ATOM 7665   O "O3'"  . C   G 2 67 ? 9.022   -29.049 -10.819 1.00 0.00 ? 67 C   G "O3'"  1  
ATOM 7666   C "C2'"  . C   G 2 67 ? 8.571   -29.071 -8.390  1.00 0.00 ? 67 C   G "C2'"  1  
ATOM 7667   O "O2'"  . C   G 2 67 ? 9.873   -28.527 -8.289  1.00 0.00 ? 67 C   G "O2'"  1  
ATOM 7668   C "C1'"  . C   G 2 67 ? 7.479   -28.033 -8.156  1.00 0.00 ? 67 C   G "C1'"  1  
ATOM 7669   N N1     . C   G 2 67 ? 7.180   -27.935 -6.713  1.00 0.00 ? 67 C   G N1     1  
ATOM 7670   C C2     . C   G 2 67 ? 8.003   -27.170 -5.899  1.00 0.00 ? 67 C   G C2     1  
ATOM 7671   O O2     . C   G 2 67 ? 8.994   -26.601 -6.355  1.00 0.00 ? 67 C   G O2     1  
ATOM 7672   N N3     . C   G 2 67 ? 7.708   -27.048 -4.579  1.00 0.00 ? 67 C   G N3     1  
ATOM 7673   C C4     . C   G 2 67 ? 6.618   -27.640 -4.087  1.00 0.00 ? 67 C   G C4     1  
ATOM 7674   N N4     . C   G 2 67 ? 6.375   -27.509 -2.784  1.00 0.00 ? 67 C   G N4     1  
ATOM 7675   C C5     . C   G 2 67 ? 5.746   -28.425 -4.907  1.00 0.00 ? 67 C   G C5     1  
ATOM 7676   C C6     . C   G 2 67 ? 6.095   -28.587 -6.200  1.00 0.00 ? 67 C   G C6     1  
ATOM 7677   H "H5'"  . C   G 2 67 ? 6.484   -31.459 -10.333 1.00 0.00 ? 67 C   G "H5'"  1  
ATOM 7678   H "H5''" . C   G 2 67 ? 6.415   -31.109 -8.602  1.00 0.00 ? 67 C   G "H5''" 1  
ATOM 7679   H "H4'"  . C   G 2 67 ? 6.425   -29.056 -10.853 1.00 0.00 ? 67 C   G "H4'"  1  
ATOM 7680   H "H3'"  . C   G 2 67 ? 8.421   -30.677 -9.788  1.00 0.00 ? 67 C   G "H3'"  1  
ATOM 7681   H "H2'"  . C   G 2 67 ? 8.446   -29.876 -7.666  1.00 0.00 ? 67 C   G "H2'"  1  
ATOM 7682   H "HO2'" . C   G 2 67 ? 9.904   -27.932 -7.532  1.00 0.00 ? 67 C   G "HO2'" 1  
ATOM 7683   H "H1'"  . C   G 2 67 ? 7.797   -27.065 -8.544  1.00 0.00 ? 67 C   G "H1'"  1  
ATOM 7684   H H41    . C   G 2 67 ? 7.003   -26.953 -2.222  1.00 0.00 ? 67 C   G H41    1  
ATOM 7685   H H42    . C   G 2 67 ? 5.561   -27.946 -2.377  1.00 0.00 ? 67 C   G H42    1  
ATOM 7686   H H5     . C   G 2 67 ? 4.832   -28.875 -4.550  1.00 0.00 ? 67 C   G H5     1  
ATOM 7687   H H6     . C   G 2 67 ? 5.495   -29.199 -6.859  1.00 0.00 ? 67 C   G H6     1  
ATOM 7688   P P      . G   G 2 68 ? 8.927   -27.534 -11.369 1.00 0.00 ? 68 G   G P      1  
ATOM 7689   O OP1    . G   G 2 68 ? 10.271  -26.915 -11.326 1.00 0.00 ? 68 G   G OP1    1  
ATOM 7690   O OP2    . G   G 2 68 ? 7.783   -26.813 -10.773 1.00 0.00 ? 68 G   G OP2    1  
ATOM 7691   O "O5'"  . G   G 2 68 ? 8.558   -27.803 -12.909 1.00 0.00 ? 68 G   G "O5'"  1  
ATOM 7692   C "C5'"  . G   G 2 68 ? 7.476   -28.643 -13.244 1.00 0.00 ? 68 G   G "C5'"  1  
ATOM 7693   C "C4'"  . G   G 2 68 ? 7.461   -29.022 -14.723 1.00 0.00 ? 68 G   G "C4'"  1  
ATOM 7694   O "O4'"  . G   G 2 68 ? 6.431   -28.330 -15.398 1.00 0.00 ? 68 G   G "O4'"  1  
ATOM 7695   C "C3'"  . G   G 2 68 ? 8.769   -28.706 -15.446 1.00 0.00 ? 68 G   G "C3'"  1  
ATOM 7696   O "O3'"  . G   G 2 68 ? 9.740   -29.719 -15.280 1.00 0.00 ? 68 G   G "O3'"  1  
ATOM 7697   C "C2'"  . G   G 2 68 ? 8.264   -28.556 -16.876 1.00 0.00 ? 68 G   G "C2'"  1  
ATOM 7698   O "O2'"  . G   G 2 68 ? 8.006   -29.802 -17.491 1.00 0.00 ? 68 G   G "O2'"  1  
ATOM 7699   C "C1'"  . G   G 2 68 ? 6.943   -27.835 -16.619 1.00 0.00 ? 68 G   G "C1'"  1  
ATOM 7700   N N9     . G   G 2 68 ? 7.161   -26.381 -16.493 1.00 0.00 ? 68 G   G N9     1  
ATOM 7701   C C8     . G   G 2 68 ? 7.237   -25.608 -15.361 1.00 0.00 ? 68 G   G C8     1  
ATOM 7702   N N7     . G   G 2 68 ? 7.436   -24.341 -15.600 1.00 0.00 ? 68 G   G N7     1  
ATOM 7703   C C5     . G   G 2 68 ? 7.512   -24.270 -16.990 1.00 0.00 ? 68 G   G C5     1  
ATOM 7704   C C6     . G   G 2 68 ? 7.729   -23.155 -17.848 1.00 0.00 ? 68 G   G C6     1  
ATOM 7705   O O6     . G   G 2 68 ? 7.882   -21.973 -17.549 1.00 0.00 ? 68 G   G O6     1  
ATOM 7706   N N1     . G   G 2 68 ? 7.766   -23.514 -19.186 1.00 0.00 ? 68 G   G N1     1  
ATOM 7707   C C2     . G   G 2 68 ? 7.590   -24.796 -19.650 1.00 0.00 ? 68 G   G C2     1  
ATOM 7708   N N2     . G   G 2 68 ? 7.701   -24.984 -20.966 1.00 0.00 ? 68 G   G N2     1  
ATOM 7709   N N3     . G   G 2 68 ? 7.373   -25.849 -18.858 1.00 0.00 ? 68 G   G N3     1  
ATOM 7710   C C4     . G   G 2 68 ? 7.347   -25.515 -17.542 1.00 0.00 ? 68 G   G C4     1  
ATOM 7711   H "H5'"  . G   G 2 68 ? 6.548   -28.132 -12.996 1.00 0.00 ? 68 G   G "H5'"  1  
ATOM 7712   H "H5''" . G   G 2 68 ? 7.536   -29.565 -12.664 1.00 0.00 ? 68 G   G "H5''" 1  
ATOM 7713   H "H4'"  . G   G 2 68 ? 7.270   -30.092 -14.807 1.00 0.00 ? 68 G   G "H4'"  1  
ATOM 7714   H "H3'"  . G   G 2 68 ? 9.159   -27.743 -15.118 1.00 0.00 ? 68 G   G "H3'"  1  
ATOM 7715   H "H2'"  . G   G 2 68 ? 8.942   -27.948 -17.475 1.00 0.00 ? 68 G   G "H2'"  1  
ATOM 7716   H "HO2'" . G   G 2 68 ? 8.704   -30.414 -17.236 1.00 0.00 ? 68 G   G "HO2'" 1  
ATOM 7717   H "H1'"  . G   G 2 68 ? 6.256   -28.029 -17.441 1.00 0.00 ? 68 G   G "H1'"  1  
ATOM 7718   H H8     . G   G 2 68 ? 7.134   -26.008 -14.362 1.00 0.00 ? 68 G   G H8     1  
ATOM 7719   H H1     . G   G 2 68 ? 7.908   -22.776 -19.862 1.00 0.00 ? 68 G   G H1     1  
ATOM 7720   H H21    . G   G 2 68 ? 7.963   -24.220 -21.573 1.00 0.00 ? 68 G   G H21    1  
ATOM 7721   H H22    . G   G 2 68 ? 7.580   -25.915 -21.339 1.00 0.00 ? 68 G   G H22    1  
ATOM 7722   P P      . A   G 2 69 ? 11.305  -29.347 -15.246 1.00 0.00 ? 69 A   G P      1  
ATOM 7723   O OP1    . A   G 2 69 ? 12.068  -30.577 -14.931 1.00 0.00 ? 69 A   G OP1    1  
ATOM 7724   O OP2    . A   G 2 69 ? 11.503  -28.130 -14.425 1.00 0.00 ? 69 A   G OP2    1  
ATOM 7725   O "O5'"  . A   G 2 69 ? 11.588  -28.947 -16.777 1.00 0.00 ? 69 A   G "O5'"  1  
ATOM 7726   C "C5'"  . A   G 2 69 ? 11.526  -29.912 -17.805 1.00 0.00 ? 69 A   G "C5'"  1  
ATOM 7727   C "C4'"  . A   G 2 69 ? 11.605  -29.238 -19.174 1.00 0.00 ? 69 A   G "C4'"  1  
ATOM 7728   O "O4'"  . A   G 2 69 ? 10.546  -28.322 -19.383 1.00 0.00 ? 69 A   G "O4'"  1  
ATOM 7729   C "C3'"  . A   G 2 69 ? 12.893  -28.441 -19.346 1.00 0.00 ? 69 A   G "C3'"  1  
ATOM 7730   O "O3'"  . A   G 2 69 ? 14.005  -29.250 -19.666 1.00 0.00 ? 69 A   G "O3'"  1  
ATOM 7731   C "C2'"  . A   G 2 69 ? 12.481  -27.514 -20.484 1.00 0.00 ? 69 A   G "C2'"  1  
ATOM 7732   O "O2'"  . A   G 2 69 ? 12.497  -28.172 -21.735 1.00 0.00 ? 69 A   G "O2'"  1  
ATOM 7733   C "C1'"  . A   G 2 69 ? 11.036  -27.206 -20.100 1.00 0.00 ? 69 A   G "C1'"  1  
ATOM 7734   N N9     . A   G 2 69 ? 10.992  -25.988 -19.265 1.00 0.00 ? 69 A   G N9     1  
ATOM 7735   C C8     . A   G 2 69 ? 10.914  -25.871 -17.900 1.00 0.00 ? 69 A   G C8     1  
ATOM 7736   N N7     . A   G 2 69 ? 10.918  -24.641 -17.465 1.00 0.00 ? 69 A   G N7     1  
ATOM 7737   C C5     . A   G 2 69 ? 11.010  -23.885 -18.631 1.00 0.00 ? 69 A   G C5     1  
ATOM 7738   C C6     . A   G 2 69 ? 11.046  -22.504 -18.901 1.00 0.00 ? 69 A   G C6     1  
ATOM 7739   N N6     . A   G 2 69 ? 10.948  -21.559 -17.963 1.00 0.00 ? 69 A   G N6     1  
ATOM 7740   N N1     . A   G 2 69 ? 11.160  -22.083 -20.165 1.00 0.00 ? 69 A   G N1     1  
ATOM 7741   C C2     . A   G 2 69 ? 11.212  -22.987 -21.132 1.00 0.00 ? 69 A   G C2     1  
ATOM 7742   N N3     . A   G 2 69 ? 11.179  -24.308 -21.026 1.00 0.00 ? 69 A   G N3     1  
ATOM 7743   C C4     . A   G 2 69 ? 11.072  -24.697 -19.732 1.00 0.00 ? 69 A   G C4     1  
ATOM 7744   H "H5'"  . A   G 2 69 ? 10.593  -30.470 -17.737 1.00 0.00 ? 69 A   G "H5'"  1  
ATOM 7745   H "H5''" . A   G 2 69 ? 12.359  -30.608 -17.701 1.00 0.00 ? 69 A   G "H5''" 1  
ATOM 7746   H "H4'"  . A   G 2 69 ? 11.565  -30.006 -19.948 1.00 0.00 ? 69 A   G "H4'"  1  
ATOM 7747   H "H3'"  . A   G 2 69 ? 13.086  -27.855 -18.446 1.00 0.00 ? 69 A   G "H3'"  1  
ATOM 7748   H "H2'"  . A   G 2 69 ? 13.093  -26.611 -20.502 1.00 0.00 ? 69 A   G "H2'"  1  
ATOM 7749   H "HO2'" . A   G 2 69 ? 13.251  -28.772 -21.750 1.00 0.00 ? 69 A   G "HO2'" 1  
ATOM 7750   H "H1'"  . A   G 2 69 ? 10.448  -27.043 -21.005 1.00 0.00 ? 69 A   G "H1'"  1  
ATOM 7751   H H8     . A   G 2 69 ? 10.850  -26.727 -17.243 1.00 0.00 ? 69 A   G H8     1  
ATOM 7752   H H61    . A   G 2 69 ? 10.925  -20.586 -18.236 1.00 0.00 ? 69 A   G H61    1  
ATOM 7753   H H62    . A   G 2 69 ? 10.727  -21.827 -17.016 1.00 0.00 ? 69 A   G H62    1  
ATOM 7754   H H2     . A   G 2 69 ? 11.298  -22.598 -22.136 1.00 0.00 ? 69 A   G H2     1  
ATOM 7755   P P      . U   G 2 70 ? 15.489  -28.775 -19.270 1.00 0.00 ? 70 U   G P      1  
ATOM 7756   O OP1    . U   G 2 70 ? 16.435  -29.837 -19.686 1.00 0.00 ? 70 U   G OP1    1  
ATOM 7757   O OP2    . U   G 2 70 ? 15.482  -28.323 -17.861 1.00 0.00 ? 70 U   G OP2    1  
ATOM 7758   O "O5'"  . U   G 2 70 ? 15.723  -27.488 -20.209 1.00 0.00 ? 70 U   G "O5'"  1  
ATOM 7759   C "C5'"  . U   G 2 70 ? 15.910  -27.635 -21.600 1.00 0.00 ? 70 U   G "C5'"  1  
ATOM 7760   C "C4'"  . U   G 2 70 ? 15.892  -26.295 -22.334 1.00 0.00 ? 70 U   G "C4'"  1  
ATOM 7761   O "O4'"  . U   G 2 70 ? 14.712  -25.549 -22.100 1.00 0.00 ? 70 U   G "O4'"  1  
ATOM 7762   C "C3'"  . U   G 2 70 ? 17.053  -25.382 -21.951 1.00 0.00 ? 70 U   G "C3'"  1  
ATOM 7763   O "O3'"  . U   G 2 70 ? 18.277  -25.754 -22.549 1.00 0.00 ? 70 U   G "O3'"  1  
ATOM 7764   C "C2'"  . U   G 2 70 ? 16.503  -24.058 -22.474 1.00 0.00 ? 70 U   G "C2'"  1  
ATOM 7765   O "O2'"  . U   G 2 70 ? 16.609  -23.944 -23.880 1.00 0.00 ? 70 U   G "O2'"  1  
ATOM 7766   C "C1'"  . U   G 2 70 ? 15.024  -24.167 -22.112 1.00 0.00 ? 70 U   G "C1'"  1  
ATOM 7767   N N1     . U   G 2 70 ? 14.761  -23.526 -20.803 1.00 0.00 ? 70 U   G N1     1  
ATOM 7768   C C2     . U   G 2 70 ? 14.599  -22.148 -20.787 1.00 0.00 ? 70 U   G C2     1  
ATOM 7769   O O2     . U   G 2 70 ? 14.608  -21.459 -21.804 1.00 0.00 ? 70 U   G O2     1  
ATOM 7770   N N3     . U   G 2 70 ? 14.425  -21.557 -19.545 1.00 0.00 ? 70 U   G N3     1  
ATOM 7771   C C4     . U   G 2 70 ? 14.389  -22.220 -18.329 1.00 0.00 ? 70 U   G C4     1  
ATOM 7772   O O4     . U   G 2 70 ? 14.230  -21.593 -17.284 1.00 0.00 ? 70 U   G O4     1  
ATOM 7773   C C5     . U   G 2 70 ? 14.538  -23.652 -18.442 1.00 0.00 ? 70 U   G C5     1  
ATOM 7774   C C6     . U   G 2 70 ? 14.718  -24.249 -19.642 1.00 0.00 ? 70 U   G C6     1  
ATOM 7775   H "H5'"  . U   G 2 70 ? 15.122  -28.267 -22.008 1.00 0.00 ? 70 U   G "H5'"  1  
ATOM 7776   H "H5''" . U   G 2 70 ? 16.868  -28.124 -21.783 1.00 0.00 ? 70 U   G "H5''" 1  
ATOM 7777   H "H4'"  . U   G 2 70 ? 15.960  -26.502 -23.402 1.00 0.00 ? 70 U   G "H4'"  1  
ATOM 7778   H "H3'"  . U   G 2 70 ? 17.147  -25.341 -20.865 1.00 0.00 ? 70 U   G "H3'"  1  
ATOM 7779   H "H2'"  . U   G 2 70 ? 16.971  -23.210 -21.977 1.00 0.00 ? 70 U   G "H2'"  1  
ATOM 7780   H "HO2'" . U   G 2 70 ? 16.709  -24.822 -24.261 1.00 0.00 ? 70 U   G "HO2'" 1  
ATOM 7781   H "H1'"  . U   G 2 70 ? 14.446  -23.650 -22.881 1.00 0.00 ? 70 U   G "H1'"  1  
ATOM 7782   H H3     . U   G 2 70 ? 14.301  -20.556 -19.520 1.00 0.00 ? 70 U   G H3     1  
ATOM 7783   H H5     . U   G 2 70 ? 14.511  -24.250 -17.544 1.00 0.00 ? 70 U   G H5     1  
ATOM 7784   H H6     . U   G 2 70 ? 14.829  -25.323 -19.685 1.00 0.00 ? 70 U   G H6     1  
ATOM 7785   P P      . G   G 2 71 ? 19.675  -25.194 -21.979 1.00 0.00 ? 71 G   G P      1  
ATOM 7786   O OP1    . G   G 2 71 ? 20.769  -25.886 -22.698 1.00 0.00 ? 71 G   G OP1    1  
ATOM 7787   O OP2    . G   G 2 71 ? 19.632  -25.252 -20.500 1.00 0.00 ? 71 G   G OP2    1  
ATOM 7788   O "O5'"  . G   G 2 71 ? 19.683  -23.645 -22.413 1.00 0.00 ? 71 G   G "O5'"  1  
ATOM 7789   C "C5'"  . G   G 2 71 ? 19.843  -23.281 -23.769 1.00 0.00 ? 71 G   G "C5'"  1  
ATOM 7790   C "C4'"  . G   G 2 71 ? 19.489  -21.813 -24.003 1.00 0.00 ? 71 G   G "C4'"  1  
ATOM 7791   O "O4'"  . G   G 2 71 ? 18.210  -21.496 -23.490 1.00 0.00 ? 71 G   G "O4'"  1  
ATOM 7792   C "C3'"  . G   G 2 71 ? 20.464  -20.841 -23.341 1.00 0.00 ? 71 G   G "C3'"  1  
ATOM 7793   O "O3'"  . G   G 2 71 ? 21.656  -20.681 -24.082 1.00 0.00 ? 71 G   G "O3'"  1  
ATOM 7794   C "C2'"  . G   G 2 71 ? 19.600  -19.583 -23.313 1.00 0.00 ? 71 G   G "C2'"  1  
ATOM 7795   O "O2'"  . G   G 2 71 ? 19.601  -18.922 -24.560 1.00 0.00 ? 71 G   G "O2'"  1  
ATOM 7796   C "C1'"  . G   G 2 71 ? 18.207  -20.153 -23.048 1.00 0.00 ? 71 G   G "C1'"  1  
ATOM 7797   N N9     . G   G 2 71 ? 17.912  -20.070 -21.604 1.00 0.00 ? 71 G   G N9     1  
ATOM 7798   C C8     . G   G 2 71 ? 18.012  -21.045 -20.644 1.00 0.00 ? 71 G   G C8     1  
ATOM 7799   N N7     . G   G 2 71 ? 17.774  -20.624 -19.432 1.00 0.00 ? 71 G   G N7     1  
ATOM 7800   C C5     . G   G 2 71 ? 17.541  -19.260 -19.593 1.00 0.00 ? 71 G   G C5     1  
ATOM 7801   C C6     . G   G 2 71 ? 17.310  -18.242 -18.624 1.00 0.00 ? 71 G   G C6     1  
ATOM 7802   O O6     . G   G 2 71 ? 17.227  -18.351 -17.401 1.00 0.00 ? 71 G   G O6     1  
ATOM 7803   N N1     . G   G 2 71 ? 17.202  -16.981 -19.190 1.00 0.00 ? 71 G   G N1     1  
ATOM 7804   C C2     . G   G 2 71 ? 17.306  -16.727 -20.536 1.00 0.00 ? 71 G   G C2     1  
ATOM 7805   N N2     . G   G 2 71 ? 17.306  -15.446 -20.908 1.00 0.00 ? 71 G   G N2     1  
ATOM 7806   N N3     . G   G 2 71 ? 17.508  -17.674 -21.459 1.00 0.00 ? 71 G   G N3     1  
ATOM 7807   C C4     . G   G 2 71 ? 17.619  -18.914 -20.920 1.00 0.00 ? 71 G   G C4     1  
ATOM 7808   H "H5'"  . G   G 2 71 ? 19.192  -23.898 -24.388 1.00 0.00 ? 71 G   G "H5'"  1  
ATOM 7809   H "H5''" . G   G 2 71 ? 20.875  -23.453 -24.072 1.00 0.00 ? 71 G   G "H5''" 1  
ATOM 7810   H "H4'"  . G   G 2 71 ? 19.492  -21.621 -25.076 1.00 0.00 ? 71 G   G "H4'"  1  
ATOM 7811   H "H3'"  . G   G 2 71 ? 20.676  -21.176 -22.325 1.00 0.00 ? 71 G   G "H3'"  1  
ATOM 7812   H "H2'"  . G   G 2 71 ? 19.915  -18.915 -22.511 1.00 0.00 ? 71 G   G "H2'"  1  
ATOM 7813   H "HO2'" . G   G 2 71 ? 20.508  -18.874 -24.879 1.00 0.00 ? 71 G   G "HO2'" 1  
ATOM 7814   H "H1'"  . G   G 2 71 ? 17.453  -19.588 -23.598 1.00 0.00 ? 71 G   G "H1'"  1  
ATOM 7815   H H8     . G   G 2 71 ? 18.276  -22.068 -20.872 1.00 0.00 ? 71 G   G H8     1  
ATOM 7816   H H1     . G   G 2 71 ? 17.103  -16.197 -18.560 1.00 0.00 ? 71 G   G H1     1  
ATOM 7817   H H21    . G   G 2 71 ? 17.337  -14.718 -20.206 1.00 0.00 ? 71 G   G H21    1  
ATOM 7818   H H22    . G   G 2 71 ? 17.421  -15.222 -21.885 1.00 0.00 ? 71 G   G H22    1  
ATOM 7819   P P      . A   G 2 72 ? 22.954  -19.976 -23.440 1.00 0.00 ? 72 A   G P      1  
ATOM 7820   O OP1    . A   G 2 72 ? 24.145  -20.719 -23.910 1.00 0.00 ? 72 A   G OP1    1  
ATOM 7821   O OP2    . A   G 2 72 ? 22.736  -19.803 -21.985 1.00 0.00 ? 72 A   G OP2    1  
ATOM 7822   O "O5'"  . A   G 2 72 ? 22.983  -18.521 -24.131 1.00 0.00 ? 72 A   G "O5'"  1  
ATOM 7823   C "C5'"  . A   G 2 72 ? 22.451  -17.384 -23.485 1.00 0.00 ? 72 A   G "C5'"  1  
ATOM 7824   C "C4'"  . A   G 2 72 ? 22.558  -16.158 -24.390 1.00 0.00 ? 72 A   G "C4'"  1  
ATOM 7825   O "O4'"  . A   G 2 72 ? 21.771  -16.344 -25.551 1.00 0.00 ? 72 A   G "O4'"  1  
ATOM 7826   C "C3'"  . A   G 2 72 ? 22.028  -14.920 -23.670 1.00 0.00 ? 72 A   G "C3'"  1  
ATOM 7827   O "O3'"  . A   G 2 72 ? 22.747  -13.773 -24.078 1.00 0.00 ? 72 A   G "O3'"  1  
ATOM 7828   C "C2'"  . A   G 2 72 ? 20.579  -14.873 -24.150 1.00 0.00 ? 72 A   G "C2'"  1  
ATOM 7829   O "O2'"  . A   G 2 72 ? 20.036  -13.568 -24.140 1.00 0.00 ? 72 A   G "O2'"  1  
ATOM 7830   C "C1'"  . A   G 2 72 ? 20.697  -15.425 -25.570 1.00 0.00 ? 72 A   G "C1'"  1  
ATOM 7831   N N9     . A   G 2 72 ? 19.439  -16.062 -26.019 1.00 0.00 ? 72 A   G N9     1  
ATOM 7832   C C8     . A   G 2 72 ? 18.161  -15.828 -25.578 1.00 0.00 ? 72 A   G C8     1  
ATOM 7833   N N7     . A   G 2 72 ? 17.245  -16.542 -26.174 1.00 0.00 ? 72 A   G N7     1  
ATOM 7834   C C5     . A   G 2 72 ? 17.971  -17.286 -27.102 1.00 0.00 ? 72 A   G C5     1  
ATOM 7835   C C6     . A   G 2 72 ? 17.618  -18.247 -28.067 1.00 0.00 ? 72 A   G C6     1  
ATOM 7836   N N6     . A   G 2 72 ? 16.372  -18.686 -28.268 1.00 0.00 ? 72 A   G N6     1  
ATOM 7837   N N1     . A   G 2 72 ? 18.563  -18.765 -28.862 1.00 0.00 ? 72 A   G N1     1  
ATOM 7838   C C2     . A   G 2 72 ? 19.811  -18.348 -28.708 1.00 0.00 ? 72 A   G C2     1  
ATOM 7839   N N3     . A   G 2 72 ? 20.283  -17.458 -27.848 1.00 0.00 ? 72 A   G N3     1  
ATOM 7840   C C4     . A   G 2 72 ? 19.303  -16.967 -27.046 1.00 0.00 ? 72 A   G C4     1  
ATOM 7841   H "H5'"  . A   G 2 72 ? 23.009  -17.198 -22.567 1.00 0.00 ? 72 A   G "H5'"  1  
ATOM 7842   H "H5''" . A   G 2 72 ? 21.404  -17.552 -23.232 1.00 0.00 ? 72 A   G "H5''" 1  
ATOM 7843   H "H4'"  . A   G 2 72 ? 23.603  -16.004 -24.666 1.00 0.00 ? 72 A   G "H4'"  1  
ATOM 7844   H "H3'"  . A   G 2 72 ? 22.075  -15.039 -22.587 1.00 0.00 ? 72 A   G "H3'"  1  
ATOM 7845   H "HO3'" . A   G 2 72 ? 22.169  -13.010 -23.972 1.00 0.00 ? 72 A   G "HO3'" 1  
ATOM 7846   H "H2'"  . A   G 2 72 ? 19.976  -15.545 -23.539 1.00 0.00 ? 72 A   G "H2'"  1  
ATOM 7847   H "HO2'" . A   G 2 72 ? 19.965  -13.263 -23.228 1.00 0.00 ? 72 A   G "HO2'" 1  
ATOM 7848   H "H1'"  . A   G 2 72 ? 20.942  -14.604 -26.243 1.00 0.00 ? 72 A   G "H1'"  1  
ATOM 7849   H H8     . A   G 2 72 ? 17.932  -15.119 -24.796 1.00 0.00 ? 72 A   G H8     1  
ATOM 7850   H H61    . A   G 2 72 ? 16.199  -19.379 -28.983 1.00 0.00 ? 72 A   G H61    1  
ATOM 7851   H H62    . A   G 2 72 ? 15.619  -18.327 -27.698 1.00 0.00 ? 72 A   G H62    1  
ATOM 7852   H H2     . A   G 2 72 ? 20.539  -18.790 -29.373 1.00 0.00 ? 72 A   G H2     1  
ATOM 7853   N N      . MET A 1 1  ? 1.653   35.882  11.056  1.00 0.00 ? 1  MET A N      2  
ATOM 7854   C CA     . MET A 1 1  ? 1.483   34.492  10.597  1.00 0.00 ? 1  MET A CA     2  
ATOM 7855   C C      . MET A 1 1  ? 1.577   33.544  11.786  1.00 0.00 ? 1  MET A C      2  
ATOM 7856   O O      . MET A 1 1  ? 2.466   33.712  12.617  1.00 0.00 ? 1  MET A O      2  
ATOM 7857   C CB     . MET A 1 1  ? 2.534   34.158  9.535   1.00 0.00 ? 1  MET A CB     2  
ATOM 7858   C CG     . MET A 1 1  ? 2.135   32.945  8.696   1.00 0.00 ? 1  MET A CG     2  
ATOM 7859   S SD     . MET A 1 1  ? 3.164   32.655  7.233   1.00 0.00 ? 1  MET A SD     2  
ATOM 7860   C CE     . MET A 1 1  ? 4.734   32.211  8.015   1.00 0.00 ? 1  MET A CE     2  
ATOM 7861   H H1     . MET A 1 1  ? 1.036   36.077  11.832  1.00 0.00 ? 1  MET A H1     2  
ATOM 7862   H H2     . MET A 1 1  ? 1.454   36.526  10.304  1.00 0.00 ? 1  MET A H2     2  
ATOM 7863   H H3     . MET A 1 1  ? 2.608   36.025  11.354  1.00 0.00 ? 1  MET A H3     2  
ATOM 7864   H HA     . MET A 1 1  ? 0.492   34.390  10.153  1.00 0.00 ? 1  MET A HA     2  
ATOM 7865   H HB2    . MET A 1 1  ? 2.646   35.011  8.866   1.00 0.00 ? 1  MET A HB2    2  
ATOM 7866   H HB3    . MET A 1 1  ? 3.493   33.964  10.016  1.00 0.00 ? 1  MET A HB3    2  
ATOM 7867   H HG2    . MET A 1 1  ? 2.153   32.054  9.323   1.00 0.00 ? 1  MET A HG2    2  
ATOM 7868   H HG3    . MET A 1 1  ? 1.117   33.103  8.347   1.00 0.00 ? 1  MET A HG3    2  
ATOM 7869   H HE1    . MET A 1 1  ? 5.095   33.040  8.625   1.00 0.00 ? 1  MET A HE1    2  
ATOM 7870   H HE2    . MET A 1 1  ? 4.596   31.331  8.642   1.00 0.00 ? 1  MET A HE2    2  
ATOM 7871   H HE3    . MET A 1 1  ? 5.474   31.989  7.246   1.00 0.00 ? 1  MET A HE3    2  
ATOM 7872   N N      . LEU A 1 2  ? 0.665   32.573  11.903  1.00 0.00 ? 2  LEU A N      2  
ATOM 7873   C CA     . LEU A 1 2  ? 0.632   31.633  13.011  1.00 0.00 ? 2  LEU A CA     2  
ATOM 7874   C C      . LEU A 1 2  ? 1.295   30.326  12.581  1.00 0.00 ? 2  LEU A C      2  
ATOM 7875   O O      . LEU A 1 2  ? 0.768   29.613  11.730  1.00 0.00 ? 2  LEU A O      2  
ATOM 7876   C CB     . LEU A 1 2  ? -0.830  31.440  13.424  1.00 0.00 ? 2  LEU A CB     2  
ATOM 7877   C CG     . LEU A 1 2  ? -1.086  30.847  14.815  1.00 0.00 ? 2  LEU A CG     2  
ATOM 7878   C CD1    . LEU A 1 2  ? -2.306  29.935  14.751  1.00 0.00 ? 2  LEU A CD1    2  
ATOM 7879   C CD2    . LEU A 1 2  ? 0.074   30.071  15.435  1.00 0.00 ? 2  LEU A CD2    2  
ATOM 7880   H H      . LEU A 1 2  ? -0.024  32.434  11.176  1.00 0.00 ? 2  LEU A H      2  
ATOM 7881   H HA     . LEU A 1 2  ? 1.182   32.051  13.854  1.00 0.00 ? 2  LEU A HA     2  
ATOM 7882   H HB2    . LEU A 1 2  ? -1.324  32.411  13.393  1.00 0.00 ? 2  LEU A HB2    2  
ATOM 7883   H HB3    . LEU A 1 2  ? -1.324  30.828  12.671  1.00 0.00 ? 2  LEU A HB3    2  
ATOM 7884   H HG     . LEU A 1 2  ? -1.331  31.658  15.499  1.00 0.00 ? 2  LEU A HG     2  
ATOM 7885   H HD11   . LEU A 1 2  ? -3.169  30.517  14.427  1.00 0.00 ? 2  LEU A HD11   2  
ATOM 7886   H HD12   . LEU A 1 2  ? -2.128  29.117  14.055  1.00 0.00 ? 2  LEU A HD12   2  
ATOM 7887   H HD13   . LEU A 1 2  ? -2.509  29.534  15.743  1.00 0.00 ? 2  LEU A HD13   2  
ATOM 7888   H HD21   . LEU A 1 2  ? 0.921   30.738  15.590  1.00 0.00 ? 2  LEU A HD21   2  
ATOM 7889   H HD22   . LEU A 1 2  ? -0.235  29.686  16.407  1.00 0.00 ? 2  LEU A HD22   2  
ATOM 7890   H HD23   . LEU A 1 2  ? 0.355   29.237  14.794  1.00 0.00 ? 2  LEU A HD23   2  
ATOM 7891   N N      . ILE A 1 3  ? 2.470   30.015  13.135  1.00 0.00 ? 3  ILE A N      2  
ATOM 7892   C CA     . ILE A 1 3  ? 3.211   28.806  12.817  1.00 0.00 ? 3  ILE A CA     2  
ATOM 7893   C C      . ILE A 1 3  ? 2.834   27.722  13.817  1.00 0.00 ? 3  ILE A C      2  
ATOM 7894   O O      . ILE A 1 3  ? 2.879   27.947  15.025  1.00 0.00 ? 3  ILE A O      2  
ATOM 7895   C CB     . ILE A 1 3  ? 4.722   29.061  12.789  1.00 0.00 ? 3  ILE A CB     2  
ATOM 7896   C CG1    . ILE A 1 3  ? 5.154   29.851  11.551  1.00 0.00 ? 3  ILE A CG1    2  
ATOM 7897   C CG2    . ILE A 1 3  ? 5.503   27.746  12.752  1.00 0.00 ? 3  ILE A CG2    2  
ATOM 7898   C CD1    . ILE A 1 3  ? 4.760   31.325  11.598  1.00 0.00 ? 3  ILE A CD1    2  
ATOM 7899   H H      . ILE A 1 3  ? 2.840   30.614  13.861  1.00 0.00 ? 3  ILE A H      2  
ATOM 7900   H HA     . ILE A 1 3  ? 2.912   28.465  11.825  1.00 0.00 ? 3  ILE A HA     2  
ATOM 7901   H HB     . ILE A 1 3  ? 5.019   29.598  13.690  1.00 0.00 ? 3  ILE A HB     2  
ATOM 7902   H HG12   . ILE A 1 3  ? 6.239   29.806  11.464  1.00 0.00 ? 3  ILE A HG12   2  
ATOM 7903   H HG13   . ILE A 1 3  ? 4.723   29.395  10.660  1.00 0.00 ? 3  ILE A HG13   2  
ATOM 7904   H HG21   . ILE A 1 3  ? 5.306   27.159  13.648  1.00 0.00 ? 3  ILE A HG21   2  
ATOM 7905   H HG22   . ILE A 1 3  ? 5.221   27.168  11.871  1.00 0.00 ? 3  ILE A HG22   2  
ATOM 7906   H HG23   . ILE A 1 3  ? 6.572   27.959  12.716  1.00 0.00 ? 3  ILE A HG23   2  
ATOM 7907   H HD11   . ILE A 1 3  ? 5.182   31.840  10.737  1.00 0.00 ? 3  ILE A HD11   2  
ATOM 7908   H HD12   . ILE A 1 3  ? 3.679   31.442  11.560  1.00 0.00 ? 3  ILE A HD12   2  
ATOM 7909   H HD13   . ILE A 1 3  ? 5.163   31.765  12.509  1.00 0.00 ? 3  ILE A HD13   2  
ATOM 7910   N N      . LEU A 1 4  ? 2.491   26.538  13.304  1.00 0.00 ? 4  LEU A N      2  
ATOM 7911   C CA     . LEU A 1 4  ? 2.197   25.357  14.095  1.00 0.00 ? 4  LEU A CA     2  
ATOM 7912   C C      . LEU A 1 4  ? 2.997   24.170  13.568  1.00 0.00 ? 4  LEU A C      2  
ATOM 7913   O O      . LEU A 1 4  ? 3.451   24.161  12.426  1.00 0.00 ? 4  LEU A O      2  
ATOM 7914   C CB     . LEU A 1 4  ? 0.695   25.064  14.071  1.00 0.00 ? 4  LEU A CB     2  
ATOM 7915   C CG     . LEU A 1 4  ? -0.155  26.206  14.632  1.00 0.00 ? 4  LEU A CG     2  
ATOM 7916   C CD1    . LEU A 1 4  ? -1.646  25.913  14.495  1.00 0.00 ? 4  LEU A CD1    2  
ATOM 7917   C CD2    . LEU A 1 4  ? 0.089   26.410  16.123  1.00 0.00 ? 4  LEU A CD2    2  
ATOM 7918   H H      . LEU A 1 4  ? 2.548   26.418  12.302  1.00 0.00 ? 4  LEU A H      2  
ATOM 7919   H HA     . LEU A 1 4  ? 2.507   25.528  15.125  1.00 0.00 ? 4  LEU A HA     2  
ATOM 7920   H HB2    . LEU A 1 4  ? 0.398   24.877  13.040  1.00 0.00 ? 4  LEU A HB2    2  
ATOM 7921   H HB3    . LEU A 1 4  ? 0.499   24.162  14.652  1.00 0.00 ? 4  LEU A HB3    2  
ATOM 7922   H HG     . LEU A 1 4  ? 0.065   27.128  14.094  1.00 0.00 ? 4  LEU A HG     2  
ATOM 7923   H HD11   . LEU A 1 4  ? -1.891  25.726  13.451  1.00 0.00 ? 4  LEU A HD11   2  
ATOM 7924   H HD12   . LEU A 1 4  ? -1.906  25.043  15.098  1.00 0.00 ? 4  LEU A HD12   2  
ATOM 7925   H HD13   . LEU A 1 4  ? -2.210  26.775  14.852  1.00 0.00 ? 4  LEU A HD13   2  
ATOM 7926   H HD21   . LEU A 1 4  ? -0.538  27.231  16.468  1.00 0.00 ? 4  LEU A HD21   2  
ATOM 7927   H HD22   . LEU A 1 4  ? -0.176  25.500  16.662  1.00 0.00 ? 4  LEU A HD22   2  
ATOM 7928   H HD23   . LEU A 1 4  ? 1.131   26.659  16.313  1.00 0.00 ? 4  LEU A HD23   2  
ATOM 7929   N N      . THR A 1 5  ? 3.151   23.148  14.412  1.00 0.00 ? 5  THR A N      2  
ATOM 7930   C CA     . THR A 1 5  ? 3.960   21.978  14.119  1.00 0.00 ? 5  THR A CA     2  
ATOM 7931   C C      . THR A 1 5  ? 3.090   20.735  14.255  1.00 0.00 ? 5  THR A C      2  
ATOM 7932   O O      . THR A 1 5  ? 2.372   20.565  15.238  1.00 0.00 ? 5  THR A O      2  
ATOM 7933   C CB     . THR A 1 5  ? 5.174   21.947  15.048  1.00 0.00 ? 5  THR A CB     2  
ATOM 7934   O OG1    . THR A 1 5  ? 5.902   23.146  14.895  1.00 0.00 ? 5  THR A OG1    2  
ATOM 7935   C CG2    . THR A 1 5  ? 6.133   20.803  14.733  1.00 0.00 ? 5  THR A CG2    2  
ATOM 7936   H H      . THR A 1 5  ? 2.743   23.206  15.333  1.00 0.00 ? 5  THR A H      2  
ATOM 7937   H HA     . THR A 1 5  ? 4.322   22.036  13.093  1.00 0.00 ? 5  THR A HA     2  
ATOM 7938   H HB     . THR A 1 5  ? 4.839   21.860  16.081  1.00 0.00 ? 5  THR A HB     2  
ATOM 7939   H HG1    . THR A 1 5  ? 6.229   23.398  15.764  1.00 0.00 ? 5  THR A HG1    2  
ATOM 7940   H HG21   . THR A 1 5  ? 6.466   20.877  13.698  1.00 0.00 ? 5  THR A HG21   2  
ATOM 7941   H HG22   . THR A 1 5  ? 6.997   20.875  15.394  1.00 0.00 ? 5  THR A HG22   2  
ATOM 7942   H HG23   . THR A 1 5  ? 5.639   19.845  14.896  1.00 0.00 ? 5  THR A HG23   2  
ATOM 7943   N N      . ARG A 1 6  ? 3.104   19.883  13.229  1.00 0.00 ? 6  ARG A N      2  
ATOM 7944   C CA     . ARG A 1 6  ? 2.341   18.647  13.195  1.00 0.00 ? 6  ARG A CA     2  
ATOM 7945   C C      . ARG A 1 6  ? 3.275   17.466  12.981  1.00 0.00 ? 6  ARG A C      2  
ATOM 7946   O O      . ARG A 1 6  ? 4.463   17.641  12.726  1.00 0.00 ? 6  ARG A O      2  
ATOM 7947   C CB     . ARG A 1 6  ? 1.270   18.724  12.104  1.00 0.00 ? 6  ARG A CB     2  
ATOM 7948   C CG     . ARG A 1 6  ? 0.151   19.721  12.411  1.00 0.00 ? 6  ARG A CG     2  
ATOM 7949   C CD     . ARG A 1 6  ? -0.866  19.182  13.420  1.00 0.00 ? 6  ARG A CD     2  
ATOM 7950   N NE     . ARG A 1 6  ? -0.363  19.238  14.795  1.00 0.00 ? 6  ARG A NE     2  
ATOM 7951   C CZ     . ARG A 1 6  ? -1.040  18.920  15.903  1.00 0.00 ? 6  ARG A CZ     2  
ATOM 7952   N NH1    . ARG A 1 6  ? -2.355  18.705  15.897  1.00 0.00 ? 6  ARG A NH1    2  
ATOM 7953   N NH2    . ARG A 1 6  ? -0.395  18.844  17.064  1.00 0.00 ? 6  ARG A NH2    2  
ATOM 7954   H H      . ARG A 1 6  ? 3.722   20.074  12.451  1.00 0.00 ? 6  ARG A H      2  
ATOM 7955   H HA     . ARG A 1 6  ? 1.865   18.476  14.160  1.00 0.00 ? 6  ARG A HA     2  
ATOM 7956   H HB2    . ARG A 1 6  ? 1.749   19.016  11.169  1.00 0.00 ? 6  ARG A HB2    2  
ATOM 7957   H HB3    . ARG A 1 6  ? 0.827   17.739  11.960  1.00 0.00 ? 6  ARG A HB3    2  
ATOM 7958   H HG2    . ARG A 1 6  ? 0.572   20.657  12.775  1.00 0.00 ? 6  ARG A HG2    2  
ATOM 7959   H HG3    . ARG A 1 6  ? -0.377  19.928  11.480  1.00 0.00 ? 6  ARG A HG3    2  
ATOM 7960   H HD2    . ARG A 1 6  ? -1.776  19.775  13.350  1.00 0.00 ? 6  ARG A HD2    2  
ATOM 7961   H HD3    . ARG A 1 6  ? -1.113  18.154  13.158  1.00 0.00 ? 6  ARG A HD3    2  
ATOM 7962   H HE     . ARG A 1 6  ? 0.606   19.491  14.917  1.00 0.00 ? 6  ARG A HE     2  
ATOM 7963   H HH11   . ARG A 1 6  ? -2.894  18.913  15.069  1.00 0.00 ? 6  ARG A HH11   2  
ATOM 7964   H HH12   . ARG A 1 6  ? -2.835  18.604  16.782  1.00 0.00 ? 6  ARG A HH12   2  
ATOM 7965   H HH21   . ARG A 1 6  ? 0.612   18.777  17.067  1.00 0.00 ? 6  ARG A HH21   2  
ATOM 7966   H HH22   . ARG A 1 6  ? -0.917  18.666  17.914  1.00 0.00 ? 6  ARG A HH22   2  
ATOM 7967   N N      . LYS A 1 7  ? 2.735   16.255  13.113  1.00 0.00 ? 7  LYS A N      2  
ATOM 7968   C CA     . LYS A 1 7  ? 3.429   15.009  12.835  1.00 0.00 ? 7  LYS A CA     2  
ATOM 7969   C C      . LYS A 1 7  ? 2.499   14.139  12.007  1.00 0.00 ? 7  LYS A C      2  
ATOM 7970   O O      . LYS A 1 7  ? 1.291   14.361  12.018  1.00 0.00 ? 7  LYS A O      2  
ATOM 7971   C CB     . LYS A 1 7  ? 3.838   14.324  14.140  1.00 0.00 ? 7  LYS A CB     2  
ATOM 7972   C CG     . LYS A 1 7  ? 4.385   15.325  15.160  1.00 0.00 ? 7  LYS A CG     2  
ATOM 7973   C CD     . LYS A 1 7  ? 4.865   14.621  16.425  1.00 0.00 ? 7  LYS A CD     2  
ATOM 7974   C CE     . LYS A 1 7  ? 4.630   15.533  17.628  1.00 0.00 ? 7  LYS A CE     2  
ATOM 7975   N NZ     . LYS A 1 7  ? 4.753   14.801  18.901  1.00 0.00 ? 7  LYS A NZ     2  
ATOM 7976   H H      . LYS A 1 7  ? 1.778   16.193  13.432  1.00 0.00 ? 7  LYS A H      2  
ATOM 7977   H HA     . LYS A 1 7  ? 4.322   15.196  12.239  1.00 0.00 ? 7  LYS A HA     2  
ATOM 7978   H HB2    . LYS A 1 7  ? 2.969   13.827  14.569  1.00 0.00 ? 7  LYS A HB2    2  
ATOM 7979   H HB3    . LYS A 1 7  ? 4.599   13.575  13.920  1.00 0.00 ? 7  LYS A HB3    2  
ATOM 7980   H HG2    . LYS A 1 7  ? 5.213   15.886  14.725  1.00 0.00 ? 7  LYS A HG2    2  
ATOM 7981   H HG3    . LYS A 1 7  ? 3.599   16.028  15.436  1.00 0.00 ? 7  LYS A HG3    2  
ATOM 7982   H HD2    . LYS A 1 7  ? 4.313   13.690  16.562  1.00 0.00 ? 7  LYS A HD2    2  
ATOM 7983   H HD3    . LYS A 1 7  ? 5.927   14.408  16.306  1.00 0.00 ? 7  LYS A HD3    2  
ATOM 7984   H HE2    . LYS A 1 7  ? 5.352   16.350  17.602  1.00 0.00 ? 7  LYS A HE2    2  
ATOM 7985   H HE3    . LYS A 1 7  ? 3.628   15.958  17.558  1.00 0.00 ? 7  LYS A HE3    2  
ATOM 7986   H HZ1    . LYS A 1 7  ? 4.011   14.121  18.986  1.00 0.00 ? 7  LYS A HZ1    2  
ATOM 7987   H HZ2    . LYS A 1 7  ? 5.638   14.310  18.938  1.00 0.00 ? 7  LYS A HZ2    2  
ATOM 7988   H HZ3    . LYS A 1 7  ? 4.700   15.437  19.684  1.00 0.00 ? 7  LYS A HZ3    2  
ATOM 7989   N N      . VAL A 1 8  ? 3.052   13.186  11.255  1.00 0.00 ? 8  VAL A N      2  
ATOM 7990   C CA     . VAL A 1 8  ? 2.252   12.360  10.362  1.00 0.00 ? 8  VAL A CA     2  
ATOM 7991   C C      . VAL A 1 8  ? 1.055   11.767  11.105  1.00 0.00 ? 8  VAL A C      2  
ATOM 7992   O O      . VAL A 1 8  ? 1.224   11.041  12.083  1.00 0.00 ? 8  VAL A O      2  
ATOM 7993   C CB     . VAL A 1 8  ? 3.132   11.265  9.757   1.00 0.00 ? 8  VAL A CB     2  
ATOM 7994   C CG1    . VAL A 1 8  ? 2.284   10.262  8.979   1.00 0.00 ? 8  VAL A CG1    2  
ATOM 7995   C CG2    . VAL A 1 8  ? 4.151   11.899  8.810   1.00 0.00 ? 8  VAL A CG2    2  
ATOM 7996   H H      . VAL A 1 8  ? 4.053   13.050  11.292  1.00 0.00 ? 8  VAL A H      2  
ATOM 7997   H HA     . VAL A 1 8  ? 1.874   12.981  9.549   1.00 0.00 ? 8  VAL A HA     2  
ATOM 7998   H HB     . VAL A 1 8  ? 3.664   10.739  10.550  1.00 0.00 ? 8  VAL A HB     2  
ATOM 7999   H HG11   . VAL A 1 8  ? 1.572   10.795  8.350   1.00 0.00 ? 8  VAL A HG11   2  
ATOM 8000   H HG12   . VAL A 1 8  ? 2.927   9.635   8.362   1.00 0.00 ? 8  VAL A HG12   2  
ATOM 8001   H HG13   . VAL A 1 8  ? 1.741   9.627   9.678   1.00 0.00 ? 8  VAL A HG13   2  
ATOM 8002   H HG21   . VAL A 1 8  ? 4.720   11.115  8.310   1.00 0.00 ? 8  VAL A HG21   2  
ATOM 8003   H HG22   . VAL A 1 8  ? 3.639   12.508  8.067   1.00 0.00 ? 8  VAL A HG22   2  
ATOM 8004   H HG23   . VAL A 1 8  ? 4.837   12.530  9.373   1.00 0.00 ? 8  VAL A HG23   2  
ATOM 8005   N N      . GLY A 1 9  ? -0.156  12.109  10.656  1.00 0.00 ? 9  GLY A N      2  
ATOM 8006   C CA     . GLY A 1 9  ? -1.410  11.673  11.250  1.00 0.00 ? 9  GLY A CA     2  
ATOM 8007   C C      . GLY A 1 9  ? -2.115  12.725  12.106  1.00 0.00 ? 9  GLY A C      2  
ATOM 8008   O O      . GLY A 1 9  ? -3.229  12.476  12.562  1.00 0.00 ? 9  GLY A O      2  
ATOM 8009   H H      . GLY A 1 9  ? -0.221  12.691  9.832   1.00 0.00 ? 9  GLY A H      2  
ATOM 8010   H HA2    . GLY A 1 9  ? -2.087  11.383  10.447  1.00 0.00 ? 9  GLY A HA2    2  
ATOM 8011   H HA3    . GLY A 1 9  ? -1.230  10.794  11.870  1.00 0.00 ? 9  GLY A HA3    2  
ATOM 8012   N N      . GLU A 1 10 ? -1.503  13.891  12.336  1.00 0.00 ? 10 GLU A N      2  
ATOM 8013   C CA     . GLU A 1 10 ? -2.081  14.964  13.135  1.00 0.00 ? 10 GLU A CA     2  
ATOM 8014   C C      . GLU A 1 10 ? -2.809  15.998  12.275  1.00 0.00 ? 10 GLU A C      2  
ATOM 8015   O O      . GLU A 1 10 ? -2.654  16.019  11.055  1.00 0.00 ? 10 GLU A O      2  
ATOM 8016   C CB     . GLU A 1 10 ? -0.994  15.630  13.981  1.00 0.00 ? 10 GLU A CB     2  
ATOM 8017   C CG     . GLU A 1 10 ? -0.342  14.669  14.973  1.00 0.00 ? 10 GLU A CG     2  
ATOM 8018   C CD     . GLU A 1 10 ? 0.628   15.387  15.910  1.00 0.00 ? 10 GLU A CD     2  
ATOM 8019   O OE1    . GLU A 1 10 ? 1.077   16.501  15.562  1.00 0.00 ? 10 GLU A OE1    2  
ATOM 8020   O OE2    . GLU A 1 10 ? 0.937   14.810  16.976  1.00 0.00 ? 10 GLU A OE2    2  
ATOM 8021   H H      . GLU A 1 10 ? -0.572  14.033  11.970  1.00 0.00 ? 10 GLU A H      2  
ATOM 8022   H HA     . GLU A 1 10 ? -2.814  14.536  13.820  1.00 0.00 ? 10 GLU A HA     2  
ATOM 8023   H HB2    . GLU A 1 10 ? -0.233  16.046  13.321  1.00 0.00 ? 10 GLU A HB2    2  
ATOM 8024   H HB3    . GLU A 1 10 ? -1.451  16.441  14.547  1.00 0.00 ? 10 GLU A HB3    2  
ATOM 8025   H HG2    . GLU A 1 10 ? -1.125  14.195  15.565  1.00 0.00 ? 10 GLU A HG2    2  
ATOM 8026   H HG3    . GLU A 1 10 ? 0.199   13.895  14.428  1.00 0.00 ? 10 GLU A HG3    2  
ATOM 8027   N N      . SER A 1 11 ? -3.570  16.893  12.915  1.00 0.00 ? 11 SER A N      2  
ATOM 8028   C CA     . SER A 1 11 ? -4.502  17.777  12.228  1.00 0.00 ? 11 SER A CA     2  
ATOM 8029   C C      . SER A 1 11 ? -4.529  19.199  12.784  1.00 0.00 ? 11 SER A C      2  
ATOM 8030   O O      . SER A 1 11 ? -4.268  19.416  13.967  1.00 0.00 ? 11 SER A O      2  
ATOM 8031   C CB     . SER A 1 11 ? -5.912  17.189  12.302  1.00 0.00 ? 11 SER A CB     2  
ATOM 8032   O OG     . SER A 1 11 ? -5.969  15.903  11.724  1.00 0.00 ? 11 SER A OG     2  
ATOM 8033   H H      . SER A 1 11 ? -3.587  16.890  13.924  1.00 0.00 ? 11 SER A H      2  
ATOM 8034   H HA     . SER A 1 11 ? -4.210  17.838  11.181  1.00 0.00 ? 11 SER A HA     2  
ATOM 8035   H HB2    . SER A 1 11 ? -6.206  17.117  13.349  1.00 0.00 ? 11 SER A HB2    2  
ATOM 8036   H HB3    . SER A 1 11 ? -6.611  17.847  11.785  1.00 0.00 ? 11 SER A HB3    2  
ATOM 8037   H HG     . SER A 1 11 ? -6.125  15.998  10.777  1.00 0.00 ? 11 SER A HG     2  
ATOM 8038   N N      . ILE A 1 12 ? -4.911  20.160  11.937  1.00 0.00 ? 12 ILE A N      2  
ATOM 8039   C CA     . ILE A 1 12 ? -5.200  21.544  12.287  1.00 0.00 ? 12 ILE A CA     2  
ATOM 8040   C C      . ILE A 1 12 ? -6.642  21.875  11.904  1.00 0.00 ? 12 ILE A C      2  
ATOM 8041   O O      . ILE A 1 12 ? -7.207  21.243  11.013  1.00 0.00 ? 12 ILE A O      2  
ATOM 8042   C CB     . ILE A 1 12 ? -4.214  22.496  11.600  1.00 0.00 ? 12 ILE A CB     2  
ATOM 8043   C CG1    . ILE A 1 12 ? -2.743  22.140  11.838  1.00 0.00 ? 12 ILE A CG1    2  
ATOM 8044   C CG2    . ILE A 1 12 ? -4.440  23.947  12.028  1.00 0.00 ? 12 ILE A CG2    2  
ATOM 8045   C CD1    . ILE A 1 12 ? -2.288  22.319  13.285  1.00 0.00 ? 12 ILE A CD1    2  
ATOM 8046   H H      . ILE A 1 12 ? -5.155  19.876  10.997  1.00 0.00 ? 12 ILE A H      2  
ATOM 8047   H HA     . ILE A 1 12 ? -5.108  21.663  13.365  1.00 0.00 ? 12 ILE A HA     2  
ATOM 8048   H HB     . ILE A 1 12 ? -4.389  22.438  10.525  1.00 0.00 ? 12 ILE A HB     2  
ATOM 8049   H HG12   . ILE A 1 12 ? -2.563  21.110  11.530  1.00 0.00 ? 12 ILE A HG12   2  
ATOM 8050   H HG13   . ILE A 1 12 ? -2.126  22.780  11.206  1.00 0.00 ? 12 ILE A HG13   2  
ATOM 8051   H HG21   . ILE A 1 12 ? -4.536  24.016  13.112  1.00 0.00 ? 12 ILE A HG21   2  
ATOM 8052   H HG22   . ILE A 1 12 ? -3.591  24.558  11.720  1.00 0.00 ? 12 ILE A HG22   2  
ATOM 8053   H HG23   . ILE A 1 12 ? -5.336  24.347  11.554  1.00 0.00 ? 12 ILE A HG23   2  
ATOM 8054   H HD11   . ILE A 1 12 ? -1.223  22.097  13.361  1.00 0.00 ? 12 ILE A HD11   2  
ATOM 8055   H HD12   . ILE A 1 12 ? -2.446  23.345  13.610  1.00 0.00 ? 12 ILE A HD12   2  
ATOM 8056   H HD13   . ILE A 1 12 ? -2.841  21.642  13.935  1.00 0.00 ? 12 ILE A HD13   2  
ATOM 8057   N N      . ASN A 1 13 ? -7.242  22.878  12.549  1.00 0.00 ? 13 ASN A N      2  
ATOM 8058   C CA     . ASN A 1 13 ? -8.601  23.325  12.293  1.00 0.00 ? 13 ASN A CA     2  
ATOM 8059   C C      . ASN A 1 13 ? -8.627  24.825  12.006  1.00 0.00 ? 13 ASN A C      2  
ATOM 8060   O O      . ASN A 1 13 ? -7.905  25.593  12.641  1.00 0.00 ? 13 ASN A O      2  
ATOM 8061   C CB     . ASN A 1 13 ? -9.475  22.966  13.496  1.00 0.00 ? 13 ASN A CB     2  
ATOM 8062   C CG     . ASN A 1 13 ? -10.947 22.912  13.117  1.00 0.00 ? 13 ASN A CG     2  
ATOM 8063   O OD1    . ASN A 1 13 ? -11.558 23.928  12.795  1.00 0.00 ? 13 ASN A OD1    2  
ATOM 8064   N ND2    . ASN A 1 13 ? -11.530 21.717  13.114  1.00 0.00 ? 13 ASN A ND2    2  
ATOM 8065   H H      . ASN A 1 13 ? -6.715  23.399  13.235  1.00 0.00 ? 13 ASN A H      2  
ATOM 8066   H HA     . ASN A 1 13 ? -8.992  22.805  11.419  1.00 0.00 ? 13 ASN A HA     2  
ATOM 8067   H HB2    . ASN A 1 13 ? -9.174  21.991  13.880  1.00 0.00 ? 13 ASN A HB2    2  
ATOM 8068   H HB3    . ASN A 1 13 ? -9.335  23.704  14.285  1.00 0.00 ? 13 ASN A HB3    2  
ATOM 8069   H HD21   . ASN A 1 13 ? -11.030 20.915  13.479  1.00 0.00 ? 13 ASN A HD21   2  
ATOM 8070   H HD22   . ASN A 1 13 ? -12.491 21.633  12.820  1.00 0.00 ? 13 ASN A HD22   2  
ATOM 8071   N N      . ILE A 1 14 ? -9.447  25.242  11.038  1.00 0.00 ? 14 ILE A N      2  
ATOM 8072   C CA     . ILE A 1 14 ? -9.534  26.619  10.578  1.00 0.00 ? 14 ILE A CA     2  
ATOM 8073   C C      . ILE A 1 14 ? -11.001 27.025  10.460  1.00 0.00 ? 14 ILE A C      2  
ATOM 8074   O O      . ILE A 1 14 ? -11.809 26.317  9.859   1.00 0.00 ? 14 ILE A O      2  
ATOM 8075   C CB     . ILE A 1 14 ? -8.795  26.792  9.245   1.00 0.00 ? 14 ILE A CB     2  
ATOM 8076   C CG1    . ILE A 1 14 ? -7.348  26.293  9.346   1.00 0.00 ? 14 ILE A CG1    2  
ATOM 8077   C CG2    . ILE A 1 14 ? -8.828  28.262  8.821   1.00 0.00 ? 14 ILE A CG2    2  
ATOM 8078   C CD1    . ILE A 1 14 ? -6.550  26.473  8.056   1.00 0.00 ? 14 ILE A CD1    2  
ATOM 8079   H H      . ILE A 1 14 ? -10.077 24.574  10.614  1.00 0.00 ? 14 ILE A H      2  
ATOM 8080   H HA     . ILE A 1 14 ? -9.063  27.269  11.315  1.00 0.00 ? 14 ILE A HA     2  
ATOM 8081   H HB     . ILE A 1 14 ? -9.303  26.203  8.484   1.00 0.00 ? 14 ILE A HB     2  
ATOM 8082   H HG12   . ILE A 1 14 ? -6.839  26.819  10.154  1.00 0.00 ? 14 ILE A HG12   2  
ATOM 8083   H HG13   . ILE A 1 14 ? -7.354  25.228  9.580   1.00 0.00 ? 14 ILE A HG13   2  
ATOM 8084   H HG21   . ILE A 1 14 ? -8.282  28.870  9.544   1.00 0.00 ? 14 ILE A HG21   2  
ATOM 8085   H HG22   . ILE A 1 14 ? -8.376  28.379  7.836   1.00 0.00 ? 14 ILE A HG22   2  
ATOM 8086   H HG23   . ILE A 1 14 ? -9.856  28.615  8.757   1.00 0.00 ? 14 ILE A HG23   2  
ATOM 8087   H HD11   . ILE A 1 14 ? -6.320  27.527  7.902   1.00 0.00 ? 14 ILE A HD11   2  
ATOM 8088   H HD12   . ILE A 1 14 ? -5.614  25.920  8.134   1.00 0.00 ? 14 ILE A HD12   2  
ATOM 8089   H HD13   . ILE A 1 14 ? -7.121  26.092  7.210   1.00 0.00 ? 14 ILE A HD13   2  
ATOM 8090   N N      . GLY A 1 15 ? -11.353 28.189  11.011  1.00 0.00 ? 15 GLY A N      2  
ATOM 8091   C CA     . GLY A 1 15 ? -12.726 28.660  11.024  1.00 0.00 ? 15 GLY A CA     2  
ATOM 8092   C C      . GLY A 1 15 ? -13.604 27.755  11.880  1.00 0.00 ? 15 GLY A C      2  
ATOM 8093   O O      . GLY A 1 15 ? -13.244 27.419  13.008  1.00 0.00 ? 15 GLY A O      2  
ATOM 8094   H H      . GLY A 1 15 ? -10.669 28.700  11.552  1.00 0.00 ? 15 GLY A H      2  
ATOM 8095   H HA2    . GLY A 1 15 ? -12.760 29.675  11.420  1.00 0.00 ? 15 GLY A HA2    2  
ATOM 8096   H HA3    . GLY A 1 15 ? -13.109 28.675  10.003  1.00 0.00 ? 15 GLY A HA3    2  
ATOM 8097   N N      . ASP A 1 16 ? -14.757 27.356  11.338  1.00 0.00 ? 16 ASP A N      2  
ATOM 8098   C CA     . ASP A 1 16 ? -15.654 26.392  11.957  1.00 0.00 ? 16 ASP A CA     2  
ATOM 8099   C C      . ASP A 1 16 ? -16.073 25.271  11.004  1.00 0.00 ? 16 ASP A C      2  
ATOM 8100   O O      . ASP A 1 16 ? -16.892 24.431  11.373  1.00 0.00 ? 16 ASP A O      2  
ATOM 8101   C CB     . ASP A 1 16 ? -16.857 27.119  12.560  1.00 0.00 ? 16 ASP A CB     2  
ATOM 8102   C CG     . ASP A 1 16 ? -17.827 27.653  11.510  1.00 0.00 ? 16 ASP A CG     2  
ATOM 8103   O OD1    . ASP A 1 16 ? -17.414 28.522  10.710  1.00 0.00 ? 16 ASP A OD1    2  
ATOM 8104   O OD2    . ASP A 1 16 ? -19.011 27.248  11.549  1.00 0.00 ? 16 ASP A OD2    2  
ATOM 8105   H H      . ASP A 1 16 ? -15.055 27.774  10.469  1.00 0.00 ? 16 ASP A H      2  
ATOM 8106   H HA     . ASP A 1 16 ? -15.123 25.912  12.778  1.00 0.00 ? 16 ASP A HA     2  
ATOM 8107   H HB2    . ASP A 1 16 ? -17.384 26.427  13.219  1.00 0.00 ? 16 ASP A HB2    2  
ATOM 8108   H HB3    . ASP A 1 16 ? -16.501 27.949  13.171  1.00 0.00 ? 16 ASP A HB3    2  
ATOM 8109   N N      . ASP A 1 17 ? -15.514 25.234  9.790   1.00 0.00 ? 17 ASP A N      2  
ATOM 8110   C CA     . ASP A 1 17 ? -15.851 24.247  8.775   1.00 0.00 ? 17 ASP A CA     2  
ATOM 8111   C C      . ASP A 1 17 ? -14.635 23.515  8.208   1.00 0.00 ? 17 ASP A C      2  
ATOM 8112   O O      . ASP A 1 17 ? -14.785 22.406  7.698   1.00 0.00 ? 17 ASP A O      2  
ATOM 8113   C CB     . ASP A 1 17 ? -16.615 24.922  7.635   1.00 0.00 ? 17 ASP A CB     2  
ATOM 8114   C CG     . ASP A 1 17 ? -18.082 25.163  7.977   1.00 0.00 ? 17 ASP A CG     2  
ATOM 8115   O OD1    . ASP A 1 17 ? -18.796 24.170  8.240   1.00 0.00 ? 17 ASP A OD1    2  
ATOM 8116   O OD2    . ASP A 1 17 ? -18.519 26.332  7.893   1.00 0.00 ? 17 ASP A OD2    2  
ATOM 8117   H H      . ASP A 1 17 ? -14.836 25.944  9.553   1.00 0.00 ? 17 ASP A H      2  
ATOM 8118   H HA     . ASP A 1 17 ? -16.499 23.487  9.213   1.00 0.00 ? 17 ASP A HA     2  
ATOM 8119   H HB2    . ASP A 1 17 ? -16.129 25.865  7.382   1.00 0.00 ? 17 ASP A HB2    2  
ATOM 8120   H HB3    . ASP A 1 17 ? -16.574 24.278  6.755   1.00 0.00 ? 17 ASP A HB3    2  
ATOM 8121   N N      . ILE A 1 18 ? -13.442 24.116  8.257   1.00 0.00 ? 18 ILE A N      2  
ATOM 8122   C CA     . ILE A 1 18 ? -12.268 23.609  7.563   1.00 0.00 ? 18 ILE A CA     2  
ATOM 8123   C C      . ILE A 1 18 ? -11.363 22.850  8.527   1.00 0.00 ? 18 ILE A C      2  
ATOM 8124   O O      . ILE A 1 18 ? -11.090 23.306  9.636   1.00 0.00 ? 18 ILE A O      2  
ATOM 8125   C CB     . ILE A 1 18 ? -11.516 24.757  6.884   1.00 0.00 ? 18 ILE A CB     2  
ATOM 8126   C CG1    . ILE A 1 18 ? -12.404 25.499  5.882   1.00 0.00 ? 18 ILE A CG1    2  
ATOM 8127   C CG2    . ILE A 1 18 ? -10.262 24.235  6.180   1.00 0.00 ? 18 ILE A CG2    2  
ATOM 8128   C CD1    . ILE A 1 18 ? -11.907 26.930  5.699   1.00 0.00 ? 18 ILE A CD1    2  
ATOM 8129   H H      . ILE A 1 18 ? -13.343 24.998  8.739   1.00 0.00 ? 18 ILE A H      2  
ATOM 8130   H HA     . ILE A 1 18 ? -12.592 22.918  6.784   1.00 0.00 ? 18 ILE A HA     2  
ATOM 8131   H HB     . ILE A 1 18 ? -11.203 25.460  7.653   1.00 0.00 ? 18 ILE A HB     2  
ATOM 8132   H HG12   . ILE A 1 18 ? -12.392 24.982  4.923   1.00 0.00 ? 18 ILE A HG12   2  
ATOM 8133   H HG13   . ILE A 1 18 ? -13.433 25.544  6.236   1.00 0.00 ? 18 ILE A HG13   2  
ATOM 8134   H HG21   . ILE A 1 18 ? -9.536  23.892  6.917   1.00 0.00 ? 18 ILE A HG21   2  
ATOM 8135   H HG22   . ILE A 1 18 ? -10.523 23.409  5.517   1.00 0.00 ? 18 ILE A HG22   2  
ATOM 8136   H HG23   . ILE A 1 18 ? -9.800  25.030  5.595   1.00 0.00 ? 18 ILE A HG23   2  
ATOM 8137   H HD11   . ILE A 1 18 ? -12.539 27.442  4.973   1.00 0.00 ? 18 ILE A HD11   2  
ATOM 8138   H HD12   . ILE A 1 18 ? -11.951 27.453  6.655   1.00 0.00 ? 18 ILE A HD12   2  
ATOM 8139   H HD13   . ILE A 1 18 ? -10.878 26.918  5.341   1.00 0.00 ? 18 ILE A HD13   2  
ATOM 8140   N N      . THR A 1 19 ? -10.829 21.719  8.063   1.00 0.00 ? 19 THR A N      2  
ATOM 8141   C CA     . THR A 1 19 ? -9.871  20.913  8.807   1.00 0.00 ? 19 THR A CA     2  
ATOM 8142   C C      . THR A 1 19 ? -8.750  20.465  7.878   1.00 0.00 ? 19 THR A C      2  
ATOM 8143   O O      . THR A 1 19 ? -8.989  20.233  6.696   1.00 0.00 ? 19 THR A O      2  
ATOM 8144   C CB     . THR A 1 19 ? -10.552 19.701  9.447   1.00 0.00 ? 19 THR A CB     2  
ATOM 8145   O OG1    . THR A 1 19 ? -11.808 20.044  9.990   1.00 0.00 ? 19 THR A OG1    2  
ATOM 8146   C CG2    . THR A 1 19 ? -9.711  19.122  10.582  1.00 0.00 ? 19 THR A CG2    2  
ATOM 8147   H H      . THR A 1 19 ? -11.049 21.444  7.115   1.00 0.00 ? 19 THR A H      2  
ATOM 8148   H HA     . THR A 1 19 ? -9.428  21.524  9.594   1.00 0.00 ? 19 THR A HA     2  
ATOM 8149   H HB     . THR A 1 19 ? -10.699 18.932  8.689   1.00 0.00 ? 19 THR A HB     2  
ATOM 8150   H HG1    . THR A 1 19 ? -12.377 20.329  9.268   1.00 0.00 ? 19 THR A HG1    2  
ATOM 8151   H HG21   . THR A 1 19 ? -10.244 18.288  11.038  1.00 0.00 ? 19 THR A HG21   2  
ATOM 8152   H HG22   . THR A 1 19 ? -8.757  18.761  10.196  1.00 0.00 ? 19 THR A HG22   2  
ATOM 8153   H HG23   . THR A 1 19 ? -9.534  19.888  11.337  1.00 0.00 ? 19 THR A HG23   2  
ATOM 8154   N N      . ILE A 1 20 ? -7.525  20.354  8.394   1.00 0.00 ? 20 ILE A N      2  
ATOM 8155   C CA     . ILE A 1 20 ? -6.334  20.013  7.633   1.00 0.00 ? 20 ILE A CA     2  
ATOM 8156   C C      . ILE A 1 20 ? -5.644  18.843  8.323   1.00 0.00 ? 20 ILE A C      2  
ATOM 8157   O O      . ILE A 1 20 ? -5.580  18.823  9.550   1.00 0.00 ? 20 ILE A O      2  
ATOM 8158   C CB     . ILE A 1 20 ? -5.385  21.214  7.564   1.00 0.00 ? 20 ILE A CB     2  
ATOM 8159   C CG1    . ILE A 1 20 ? -6.080  22.546  7.261   1.00 0.00 ? 20 ILE A CG1    2  
ATOM 8160   C CG2    . ILE A 1 20 ? -4.278  20.953  6.541   1.00 0.00 ? 20 ILE A CG2    2  
ATOM 8161   C CD1    . ILE A 1 20 ? -6.699  22.634  5.868   1.00 0.00 ? 20 ILE A CD1    2  
ATOM 8162   H H      . ILE A 1 20 ? -7.401  20.533  9.381   1.00 0.00 ? 20 ILE A H      2  
ATOM 8163   H HA     . ILE A 1 20 ? -6.613  19.715  6.622   1.00 0.00 ? 20 ILE A HA     2  
ATOM 8164   H HB     . ILE A 1 20 ? -4.912  21.319  8.540   1.00 0.00 ? 20 ILE A HB     2  
ATOM 8165   H HG12   . ILE A 1 20 ? -6.853  22.736  8.006   1.00 0.00 ? 20 ILE A HG12   2  
ATOM 8166   H HG13   . ILE A 1 20 ? -5.344  23.342  7.353   1.00 0.00 ? 20 ILE A HG13   2  
ATOM 8167   H HG21   . ILE A 1 20 ? -4.712  20.691  5.575   1.00 0.00 ? 20 ILE A HG21   2  
ATOM 8168   H HG22   . ILE A 1 20 ? -3.663  21.845  6.429   1.00 0.00 ? 20 ILE A HG22   2  
ATOM 8169   H HG23   . ILE A 1 20 ? -3.644  20.134  6.880   1.00 0.00 ? 20 ILE A HG23   2  
ATOM 8170   H HD11   . ILE A 1 20 ? -7.309  23.536  5.805   1.00 0.00 ? 20 ILE A HD11   2  
ATOM 8171   H HD12   . ILE A 1 20 ? -5.913  22.686  5.115   1.00 0.00 ? 20 ILE A HD12   2  
ATOM 8172   H HD13   . ILE A 1 20 ? -7.329  21.765  5.683   1.00 0.00 ? 20 ILE A HD13   2  
ATOM 8173   N N      . THR A 1 21 ? -5.105  17.885  7.565   1.00 0.00 ? 21 THR A N      2  
ATOM 8174   C CA     . THR A 1 21 ? -4.416  16.728  8.117   1.00 0.00 ? 21 THR A CA     2  
ATOM 8175   C C      . THR A 1 21 ? -3.159  16.426  7.312   1.00 0.00 ? 21 THR A C      2  
ATOM 8176   O O      . THR A 1 21 ? -3.197  16.417  6.083   1.00 0.00 ? 21 THR A O      2  
ATOM 8177   C CB     . THR A 1 21 ? -5.346  15.515  8.139   1.00 0.00 ? 21 THR A CB     2  
ATOM 8178   O OG1    . THR A 1 21 ? -6.520  15.821  8.861   1.00 0.00 ? 21 THR A OG1    2  
ATOM 8179   C CG2    . THR A 1 21 ? -4.705  14.308  8.821   1.00 0.00 ? 21 THR A CG2    2  
ATOM 8180   H H      . THR A 1 21 ? -5.172  17.960  6.558   1.00 0.00 ? 21 THR A H      2  
ATOM 8181   H HA     . THR A 1 21 ? -4.115  16.943  9.142   1.00 0.00 ? 21 THR A HA     2  
ATOM 8182   H HB     . THR A 1 21 ? -5.617  15.247  7.117   1.00 0.00 ? 21 THR A HB     2  
ATOM 8183   H HG1    . THR A 1 21 ? -7.038  16.441  8.339   1.00 0.00 ? 21 THR A HG1    2  
ATOM 8184   H HG21   . THR A 1 21 ? -5.424  13.491  8.851   1.00 0.00 ? 21 THR A HG21   2  
ATOM 8185   H HG22   . THR A 1 21 ? -3.823  13.986  8.270   1.00 0.00 ? 21 THR A HG22   2  
ATOM 8186   H HG23   . THR A 1 21 ? -4.419  14.567  9.841   1.00 0.00 ? 21 THR A HG23   2  
ATOM 8187   N N      . ILE A 1 22 ? -2.046  16.136  7.990   1.00 0.00 ? 22 ILE A N      2  
ATOM 8188   C CA     . ILE A 1 22 ? -0.840  15.650  7.340   1.00 0.00 ? 22 ILE A CA     2  
ATOM 8189   C C      . ILE A 1 22 ? -0.947  14.135  7.192   1.00 0.00 ? 22 ILE A C      2  
ATOM 8190   O O      . ILE A 1 22 ? -0.779  13.395  8.161   1.00 0.00 ? 22 ILE A O      2  
ATOM 8191   C CB     . ILE A 1 22 ? 0.403   16.137  8.095   1.00 0.00 ? 22 ILE A CB     2  
ATOM 8192   C CG1    . ILE A 1 22 ? 1.686   15.428  7.661   1.00 0.00 ? 22 ILE A CG1    2  
ATOM 8193   C CG2    . ILE A 1 22 ? 0.270   16.030  9.613   1.00 0.00 ? 22 ILE A CG2    2  
ATOM 8194   C CD1    . ILE A 1 22 ? 1.992   15.678  6.187   1.00 0.00 ? 22 ILE A CD1    2  
ATOM 8195   H H      . ILE A 1 22 ? -2.076  16.083  8.999   1.00 0.00 ? 22 ILE A H      2  
ATOM 8196   H HA     . ILE A 1 22 ? -0.793  16.076  6.337   1.00 0.00 ? 22 ILE A HA     2  
ATOM 8197   H HB     . ILE A 1 22 ? 0.524   17.197  7.866   1.00 0.00 ? 22 ILE A HB     2  
ATOM 8198   H HG12   . ILE A 1 22 ? 2.519   15.808  8.252   1.00 0.00 ? 22 ILE A HG12   2  
ATOM 8199   H HG13   . ILE A 1 22 ? 1.607   14.355  7.833   1.00 0.00 ? 22 ILE A HG13   2  
ATOM 8200   H HG21   . ILE A 1 22 ? -0.056  15.030  9.898   1.00 0.00 ? 22 ILE A HG21   2  
ATOM 8201   H HG22   . ILE A 1 22 ? 1.231   16.241  10.083  1.00 0.00 ? 22 ILE A HG22   2  
ATOM 8202   H HG23   . ILE A 1 22 ? -0.452  16.763  9.973   1.00 0.00 ? 22 ILE A HG23   2  
ATOM 8203   H HD11   . ILE A 1 22 ? 1.254   15.176  5.562   1.00 0.00 ? 22 ILE A HD11   2  
ATOM 8204   H HD12   . ILE A 1 22 ? 1.970   16.749  5.986   1.00 0.00 ? 22 ILE A HD12   2  
ATOM 8205   H HD13   . ILE A 1 22 ? 2.981   15.284  5.957   1.00 0.00 ? 22 ILE A HD13   2  
ATOM 8206   N N      . LEU A 1 23 ? -1.300  13.666  5.992   1.00 0.00 ? 23 LEU A N      2  
ATOM 8207   C CA     . LEU A 1 23 ? -1.575  12.257  5.762   1.00 0.00 ? 23 LEU A CA     2  
ATOM 8208   C C      . LEU A 1 23 ? -0.272  11.461  5.759   1.00 0.00 ? 23 LEU A C      2  
ATOM 8209   O O      . LEU A 1 23 ? -0.256  10.309  6.189   1.00 0.00 ? 23 LEU A O      2  
ATOM 8210   C CB     . LEU A 1 23 ? -2.368  12.016  4.475   1.00 0.00 ? 23 LEU A CB     2  
ATOM 8211   C CG     . LEU A 1 23 ? -3.324  13.132  4.048   1.00 0.00 ? 23 LEU A CG     2  
ATOM 8212   C CD1    . LEU A 1 23 ? -3.964  12.751  2.717   1.00 0.00 ? 23 LEU A CD1    2  
ATOM 8213   C CD2    . LEU A 1 23 ? -4.443  13.371  5.057   1.00 0.00 ? 23 LEU A CD2    2  
ATOM 8214   H H      . LEU A 1 23 ? -1.368  14.302  5.208   1.00 0.00 ? 23 LEU A H      2  
ATOM 8215   H HA     . LEU A 1 23 ? -2.180  11.894  6.594   1.00 0.00 ? 23 LEU A HA     2  
ATOM 8216   H HB2    . LEU A 1 23 ? -1.665  11.842  3.662   1.00 0.00 ? 23 LEU A HB2    2  
ATOM 8217   H HB3    . LEU A 1 23 ? -2.943  11.098  4.600   1.00 0.00 ? 23 LEU A HB3    2  
ATOM 8218   H HG     . LEU A 1 23 ? -2.766  14.056  3.908   1.00 0.00 ? 23 LEU A HG     2  
ATOM 8219   H HD11   . LEU A 1 23 ? -4.639  13.547  2.404   1.00 0.00 ? 23 LEU A HD11   2  
ATOM 8220   H HD12   . LEU A 1 23 ? -3.187  12.620  1.963   1.00 0.00 ? 23 LEU A HD12   2  
ATOM 8221   H HD13   . LEU A 1 23 ? -4.524  11.823  2.825   1.00 0.00 ? 23 LEU A HD13   2  
ATOM 8222   H HD21   . LEU A 1 23 ? -5.089  12.494  5.105   1.00 0.00 ? 23 LEU A HD21   2  
ATOM 8223   H HD22   . LEU A 1 23 ? -4.022  13.568  6.041   1.00 0.00 ? 23 LEU A HD22   2  
ATOM 8224   H HD23   . LEU A 1 23 ? -5.035  14.230  4.744   1.00 0.00 ? 23 LEU A HD23   2  
ATOM 8225   N N      . GLY A 1 24 ? 0.831   12.077  5.320   1.00 0.00 ? 24 GLY A N      2  
ATOM 8226   C CA     . GLY A 1 24 ? 2.165   11.518  5.474   1.00 0.00 ? 24 GLY A CA     2  
ATOM 8227   C C      . GLY A 1 24 ? 3.225   12.288  4.696   1.00 0.00 ? 24 GLY A C      2  
ATOM 8228   O O      . GLY A 1 24 ? 2.960   13.380  4.198   1.00 0.00 ? 24 GLY A O      2  
ATOM 8229   H H      . GLY A 1 24 ? 0.751   12.999  4.912   1.00 0.00 ? 24 GLY A H      2  
ATOM 8230   H HA2    . GLY A 1 24 ? 2.436   11.547  6.528   1.00 0.00 ? 24 GLY A HA2    2  
ATOM 8231   H HA3    . GLY A 1 24 ? 2.166   10.476  5.159   1.00 0.00 ? 24 GLY A HA3    2  
ATOM 8232   N N      . VAL A 1 25 ? 4.444   11.746  4.618   1.00 0.00 ? 25 VAL A N      2  
ATOM 8233   C CA     . VAL A 1 25 ? 5.584   12.413  4.004   1.00 0.00 ? 25 VAL A CA     2  
ATOM 8234   C C      . VAL A 1 25 ? 6.344   11.489  3.056   1.00 0.00 ? 25 VAL A C      2  
ATOM 8235   O O      . VAL A 1 25 ? 6.273   10.267  3.173   1.00 0.00 ? 25 VAL A O      2  
ATOM 8236   C CB     . VAL A 1 25 ? 6.529   12.994  5.060   1.00 0.00 ? 25 VAL A CB     2  
ATOM 8237   C CG1    . VAL A 1 25 ? 5.844   14.089  5.876   1.00 0.00 ? 25 VAL A CG1    2  
ATOM 8238   C CG2    . VAL A 1 25 ? 7.064   11.931  6.019   1.00 0.00 ? 25 VAL A CG2    2  
ATOM 8239   H H      . VAL A 1 25 ? 4.597   10.827  5.008   1.00 0.00 ? 25 VAL A H      2  
ATOM 8240   H HA     . VAL A 1 25 ? 5.219   13.245  3.402   1.00 0.00 ? 25 VAL A HA     2  
ATOM 8241   H HB     . VAL A 1 25 ? 7.379   13.445  4.548   1.00 0.00 ? 25 VAL A HB     2  
ATOM 8242   H HG11   . VAL A 1 25 ? 5.040   13.665  6.476   1.00 0.00 ? 25 VAL A HG11   2  
ATOM 8243   H HG12   . VAL A 1 25 ? 6.572   14.561  6.536   1.00 0.00 ? 25 VAL A HG12   2  
ATOM 8244   H HG13   . VAL A 1 25 ? 5.435   14.843  5.205   1.00 0.00 ? 25 VAL A HG13   2  
ATOM 8245   H HG21   . VAL A 1 25 ? 7.738   12.401  6.736   1.00 0.00 ? 25 VAL A HG21   2  
ATOM 8246   H HG22   . VAL A 1 25 ? 6.243   11.461  6.559   1.00 0.00 ? 25 VAL A HG22   2  
ATOM 8247   H HG23   . VAL A 1 25 ? 7.615   11.172  5.464   1.00 0.00 ? 25 VAL A HG23   2  
ATOM 8248   N N      . SER A 1 26 ? 7.096   12.092  2.133   1.00 0.00 ? 26 SER A N      2  
ATOM 8249   C CA     . SER A 1 26 ? 7.922   11.405  1.151   1.00 0.00 ? 26 SER A CA     2  
ATOM 8250   C C      . SER A 1 26 ? 9.242   12.149  0.974   1.00 0.00 ? 26 SER A C      2  
ATOM 8251   O O      . SER A 1 26 ? 9.473   12.789  -0.050  1.00 0.00 ? 26 SER A O      2  
ATOM 8252   C CB     . SER A 1 26 ? 7.177   11.296  -0.180  1.00 0.00 ? 26 SER A CB     2  
ATOM 8253   O OG     . SER A 1 26 ? 6.045   10.458  -0.066  1.00 0.00 ? 26 SER A OG     2  
ATOM 8254   H H      . SER A 1 26 ? 7.125   13.103  2.126   1.00 0.00 ? 26 SER A H      2  
ATOM 8255   H HA     . SER A 1 26 ? 8.147   10.399  1.506   1.00 0.00 ? 26 SER A HA     2  
ATOM 8256   H HB2    . SER A 1 26 ? 6.856   12.287  -0.498  1.00 0.00 ? 26 SER A HB2    2  
ATOM 8257   H HB3    . SER A 1 26 ? 7.848   10.882  -0.933  1.00 0.00 ? 26 SER A HB3    2  
ATOM 8258   H HG     . SER A 1 26 ? 6.339   9.595   0.246   1.00 0.00 ? 26 SER A HG     2  
ATOM 8259   N N      . GLY A 1 27 ? 10.105  12.103  1.992   1.00 0.00 ? 27 GLY A N      2  
ATOM 8260   C CA     . GLY A 1 27 ? 11.402  12.758  1.959   1.00 0.00 ? 27 GLY A CA     2  
ATOM 8261   C C      . GLY A 1 27 ? 11.280  14.269  2.125   1.00 0.00 ? 27 GLY A C      2  
ATOM 8262   O O      . GLY A 1 27 ? 10.789  14.743  3.148   1.00 0.00 ? 27 GLY A O      2  
ATOM 8263   H H      . GLY A 1 27 ? 9.849   11.600  2.831   1.00 0.00 ? 27 GLY A H      2  
ATOM 8264   H HA2    . GLY A 1 27 ? 12.024  12.368  2.765   1.00 0.00 ? 27 GLY A HA2    2  
ATOM 8265   H HA3    . GLY A 1 27 ? 11.893  12.540  1.010   1.00 0.00 ? 27 GLY A HA3    2  
ATOM 8266   N N      . GLN A 1 28 ? 11.718  15.029  1.117   1.00 0.00 ? 28 GLN A N      2  
ATOM 8267   C CA     . GLN A 1 28 ? 11.552  16.474  1.072   1.00 0.00 ? 28 GLN A CA     2  
ATOM 8268   C C      . GLN A 1 28 ? 10.127  16.865  0.681   1.00 0.00 ? 28 GLN A C      2  
ATOM 8269   O O      . GLN A 1 28 ? 9.773   18.043  0.725   1.00 0.00 ? 28 GLN A O      2  
ATOM 8270   C CB     . GLN A 1 28 ? 12.584  17.054  0.103   1.00 0.00 ? 28 GLN A CB     2  
ATOM 8271   C CG     . GLN A 1 28 ? 12.831  18.543  0.334   1.00 0.00 ? 28 GLN A CG     2  
ATOM 8272   C CD     . GLN A 1 28 ? 13.945  19.072  -0.561  1.00 0.00 ? 28 GLN A CD     2  
ATOM 8273   O OE1    . GLN A 1 28 ? 13.693  19.720  -1.573  1.00 0.00 ? 28 GLN A OE1    2  
ATOM 8274   N NE2    . GLN A 1 28 ? 15.202  18.834  -0.193  1.00 0.00 ? 28 GLN A NE2    2  
ATOM 8275   H H      . GLN A 1 28 ? 12.067  14.581  0.280   1.00 0.00 ? 28 GLN A H      2  
ATOM 8276   H HA     . GLN A 1 28 ? 11.751  16.874  2.067   1.00 0.00 ? 28 GLN A HA     2  
ATOM 8277   H HB2    . GLN A 1 28 ? 13.527  16.523  0.229   1.00 0.00 ? 28 GLN A HB2    2  
ATOM 8278   H HB3    . GLN A 1 28 ? 12.233  16.911  -0.920  1.00 0.00 ? 28 GLN A HB3    2  
ATOM 8279   H HG2    . GLN A 1 28 ? 11.919  19.097  0.113   1.00 0.00 ? 28 GLN A HG2    2  
ATOM 8280   H HG3    . GLN A 1 28 ? 13.101  18.708  1.378   1.00 0.00 ? 28 GLN A HG3    2  
ATOM 8281   H HE21   . GLN A 1 28 ? 15.395  18.295  0.640   1.00 0.00 ? 28 GLN A HE21   2  
ATOM 8282   H HE22   . GLN A 1 28 ? 15.957  19.164  -0.775  1.00 0.00 ? 28 GLN A HE22   2  
ATOM 8283   N N      . GLN A 1 29 ? 9.297   15.882  0.321   1.00 0.00 ? 29 GLN A N      2  
ATOM 8284   C CA     . GLN A 1 29 ? 7.886   16.093  0.052   1.00 0.00 ? 29 GLN A CA     2  
ATOM 8285   C C      . GLN A 1 29 ? 7.000   15.721  1.238   1.00 0.00 ? 29 GLN A C      2  
ATOM 8286   O O      . GLN A 1 29 ? 7.370   14.929  2.103   1.00 0.00 ? 29 GLN A O      2  
ATOM 8287   C CB     . GLN A 1 29 ? 7.456   15.357  -1.216  1.00 0.00 ? 29 GLN A CB     2  
ATOM 8288   C CG     . GLN A 1 29 ? 8.074   15.994  -2.460  1.00 0.00 ? 29 GLN A CG     2  
ATOM 8289   C CD     . GLN A 1 29 ? 7.278   15.628  -3.705  1.00 0.00 ? 29 GLN A CD     2  
ATOM 8290   O OE1    . GLN A 1 29 ? 6.532   16.438  -4.247  1.00 0.00 ? 29 GLN A OE1    2  
ATOM 8291   N NE2    . GLN A 1 29 ? 7.367   14.372  -4.137  1.00 0.00 ? 29 GLN A NE2    2  
ATOM 8292   H H      . GLN A 1 29 ? 9.648   14.936  0.272   1.00 0.00 ? 29 GLN A H      2  
ATOM 8293   H HA     . GLN A 1 29 ? 7.742   17.158  -0.125  1.00 0.00 ? 29 GLN A HA     2  
ATOM 8294   H HB2    . GLN A 1 29 ? 7.748   14.309  -1.158  1.00 0.00 ? 29 GLN A HB2    2  
ATOM 8295   H HB3    . GLN A 1 29 ? 6.371   15.411  -1.301  1.00 0.00 ? 29 GLN A HB3    2  
ATOM 8296   H HG2    . GLN A 1 29 ? 8.071   17.077  -2.351  1.00 0.00 ? 29 GLN A HG2    2  
ATOM 8297   H HG3    . GLN A 1 29 ? 9.104   15.653  -2.572  1.00 0.00 ? 29 GLN A HG3    2  
ATOM 8298   H HE21   . GLN A 1 29 ? 7.960   13.713  -3.655  1.00 0.00 ? 29 GLN A HE21   2  
ATOM 8299   H HE22   . GLN A 1 29 ? 6.848   14.099  -4.961  1.00 0.00 ? 29 GLN A HE22   2  
ATOM 8300   N N      . VAL A 1 30 ? 5.799   16.302  1.242   1.00 0.00 ? 30 VAL A N      2  
ATOM 8301   C CA     . VAL A 1 30 ? 4.840   16.307  2.334   1.00 0.00 ? 30 VAL A CA     2  
ATOM 8302   C C      . VAL A 1 30 ? 3.444   16.203  1.733   1.00 0.00 ? 30 VAL A C      2  
ATOM 8303   O O      . VAL A 1 30 ? 3.087   17.008  0.876   1.00 0.00 ? 30 VAL A O      2  
ATOM 8304   C CB     . VAL A 1 30 ? 4.976   17.611  3.123   1.00 0.00 ? 30 VAL A CB     2  
ATOM 8305   C CG1    . VAL A 1 30 ? 3.977   17.668  4.276   1.00 0.00 ? 30 VAL A CG1    2  
ATOM 8306   C CG2    . VAL A 1 30 ? 6.377   17.775  3.711   1.00 0.00 ? 30 VAL A CG2    2  
ATOM 8307   H H      . VAL A 1 30 ? 5.570   16.875  0.441   1.00 0.00 ? 30 VAL A H      2  
ATOM 8308   H HA     . VAL A 1 30 ? 5.019   15.459  2.995   1.00 0.00 ? 30 VAL A HA     2  
ATOM 8309   H HB     . VAL A 1 30 ? 4.782   18.453  2.457   1.00 0.00 ? 30 VAL A HB     2  
ATOM 8310   H HG11   . VAL A 1 30 ? 4.008   18.655  4.736   1.00 0.00 ? 30 VAL A HG11   2  
ATOM 8311   H HG12   . VAL A 1 30 ? 2.967   17.483  3.908   1.00 0.00 ? 30 VAL A HG12   2  
ATOM 8312   H HG13   . VAL A 1 30 ? 4.239   16.918  5.022   1.00 0.00 ? 30 VAL A HG13   2  
ATOM 8313   H HG21   . VAL A 1 30 ? 6.396   18.635  4.379   1.00 0.00 ? 30 VAL A HG21   2  
ATOM 8314   H HG22   . VAL A 1 30 ? 6.650   16.880  4.271   1.00 0.00 ? 30 VAL A HG22   2  
ATOM 8315   H HG23   . VAL A 1 30 ? 7.101   17.939  2.912   1.00 0.00 ? 30 VAL A HG23   2  
ATOM 8316   N N      . ARG A 1 31 ? 2.646   15.221  2.161   1.00 0.00 ? 31 ARG A N      2  
ATOM 8317   C CA     . ARG A 1 31 ? 1.358   14.926  1.556   1.00 0.00 ? 31 ARG A CA     2  
ATOM 8318   C C      . ARG A 1 31 ? 0.222   15.300  2.502   1.00 0.00 ? 31 ARG A C      2  
ATOM 8319   O O      . ARG A 1 31 ? -0.067  14.594  3.466   1.00 0.00 ? 31 ARG A O      2  
ATOM 8320   C CB     . ARG A 1 31 ? 1.342   13.460  1.122   1.00 0.00 ? 31 ARG A CB     2  
ATOM 8321   C CG     . ARG A 1 31 ? 0.262   13.202  0.071   1.00 0.00 ? 31 ARG A CG     2  
ATOM 8322   C CD     . ARG A 1 31 ? 0.530   11.890  -0.667  1.00 0.00 ? 31 ARG A CD     2  
ATOM 8323   N NE     . ARG A 1 31 ? 1.664   12.010  -1.590  1.00 0.00 ? 31 ARG A NE     2  
ATOM 8324   C CZ     . ARG A 1 31 ? 2.868   11.449  -1.440  1.00 0.00 ? 31 ARG A CZ     2  
ATOM 8325   N NH1    . ARG A 1 31 ? 3.186   10.744  -0.356  1.00 0.00 ? 31 ARG A NH1    2  
ATOM 8326   N NH2    . ARG A 1 31 ? 3.797   11.604  -2.382  1.00 0.00 ? 31 ARG A NH2    2  
ATOM 8327   H H      . ARG A 1 31 ? 2.968   14.609  2.898   1.00 0.00 ? 31 ARG A H      2  
ATOM 8328   H HA     . ARG A 1 31 ? 1.247   15.533  0.658   1.00 0.00 ? 31 ARG A HA     2  
ATOM 8329   H HB2    . ARG A 1 31 ? 2.316   13.224  0.695   1.00 0.00 ? 31 ARG A HB2    2  
ATOM 8330   H HB3    . ARG A 1 31 ? 1.177   12.815  1.986   1.00 0.00 ? 31 ARG A HB3    2  
ATOM 8331   H HG2    . ARG A 1 31 ? -0.709  13.147  0.563   1.00 0.00 ? 31 ARG A HG2    2  
ATOM 8332   H HG3    . ARG A 1 31 ? 0.245   14.017  -0.652  1.00 0.00 ? 31 ARG A HG3    2  
ATOM 8333   H HD2    . ARG A 1 31 ? 0.719   11.102  0.061   1.00 0.00 ? 31 ARG A HD2    2  
ATOM 8334   H HD3    . ARG A 1 31 ? -0.361  11.626  -1.238  1.00 0.00 ? 31 ARG A HD3    2  
ATOM 8335   H HE     . ARG A 1 31 ? 1.553   12.666  -2.352  1.00 0.00 ? 31 ARG A HE     2  
ATOM 8336   H HH11   . ARG A 1 31 ? 2.501   10.593  0.369   1.00 0.00 ? 31 ARG A HH11   2  
ATOM 8337   H HH12   . ARG A 1 31 ? 4.144   10.450  -0.218  1.00 0.00 ? 31 ARG A HH12   2  
ATOM 8338   H HH21   . ARG A 1 31 ? 3.580   12.095  -3.237  1.00 0.00 ? 31 ARG A HH21   2  
ATOM 8339   H HH22   . ARG A 1 31 ? 4.702   11.173  -2.262  1.00 0.00 ? 31 ARG A HH22   2  
ATOM 8340   N N      . ILE A 1 32 ? -0.392  16.448  2.211   1.00 0.00 ? 32 ILE A N      2  
ATOM 8341   C CA     . ILE A 1 32 ? -1.354  17.132  3.061   1.00 0.00 ? 32 ILE A CA     2  
ATOM 8342   C C      . ILE A 1 32 ? -2.756  16.970  2.481   1.00 0.00 ? 32 ILE A C      2  
ATOM 8343   O O      . ILE A 1 32 ? -2.958  17.154  1.282   1.00 0.00 ? 32 ILE A O      2  
ATOM 8344   C CB     . ILE A 1 32 ? -0.988  18.617  3.176   1.00 0.00 ? 32 ILE A CB     2  
ATOM 8345   C CG1    . ILE A 1 32 ? 0.476   18.811  3.585   1.00 0.00 ? 32 ILE A CG1    2  
ATOM 8346   C CG2    . ILE A 1 32 ? -1.908  19.301  4.188   1.00 0.00 ? 32 ILE A CG2    2  
ATOM 8347   C CD1    . ILE A 1 32 ? 0.941   20.263  3.476   1.00 0.00 ? 32 ILE A CD1    2  
ATOM 8348   H H      . ILE A 1 32 ? -0.078  16.946  1.390   1.00 0.00 ? 32 ILE A H      2  
ATOM 8349   H HA     . ILE A 1 32 ? -1.333  16.690  4.057   1.00 0.00 ? 32 ILE A HA     2  
ATOM 8350   H HB     . ILE A 1 32 ? -1.135  19.084  2.202   1.00 0.00 ? 32 ILE A HB     2  
ATOM 8351   H HG12   . ILE A 1 32 ? 0.618   18.463  4.609   1.00 0.00 ? 32 ILE A HG12   2  
ATOM 8352   H HG13   . ILE A 1 32 ? 1.117   18.225  2.927   1.00 0.00 ? 32 ILE A HG13   2  
ATOM 8353   H HG21   . ILE A 1 32 ? -1.673  20.363  4.254   1.00 0.00 ? 32 ILE A HG21   2  
ATOM 8354   H HG22   . ILE A 1 32 ? -2.948  19.210  3.875   1.00 0.00 ? 32 ILE A HG22   2  
ATOM 8355   H HG23   . ILE A 1 32 ? -1.786  18.845  5.172   1.00 0.00 ? 32 ILE A HG23   2  
ATOM 8356   H HD11   . ILE A 1 32 ? 0.708   20.649  2.484   1.00 0.00 ? 32 ILE A HD11   2  
ATOM 8357   H HD12   . ILE A 1 32 ? 0.456   20.875  4.235   1.00 0.00 ? 32 ILE A HD12   2  
ATOM 8358   H HD13   . ILE A 1 32 ? 2.020   20.304  3.626   1.00 0.00 ? 32 ILE A HD13   2  
ATOM 8359   N N      . GLY A 1 33 ? -3.735  16.667  3.336   1.00 0.00 ? 33 GLY A N      2  
ATOM 8360   C CA     . GLY A 1 33 ? -5.145  16.678  2.987   1.00 0.00 ? 33 GLY A CA     2  
ATOM 8361   C C      . GLY A 1 33 ? -5.862  17.879  3.593   1.00 0.00 ? 33 GLY A C      2  
ATOM 8362   O O      . GLY A 1 33 ? -5.628  18.238  4.746   1.00 0.00 ? 33 GLY A O      2  
ATOM 8363   H H      . GLY A 1 33 ? -3.506  16.559  4.315   1.00 0.00 ? 33 GLY A H      2  
ATOM 8364   H HA2    . GLY A 1 33 ? -5.259  16.708  1.903   1.00 0.00 ? 33 GLY A HA2    2  
ATOM 8365   H HA3    . GLY A 1 33 ? -5.619  15.769  3.353   1.00 0.00 ? 33 GLY A HA3    2  
ATOM 8366   N N      . ILE A 1 34 ? -6.759  18.480  2.809   1.00 0.00 ? 34 ILE A N      2  
ATOM 8367   C CA     . ILE A 1 34 ? -7.628  19.572  3.212   1.00 0.00 ? 34 ILE A CA     2  
ATOM 8368   C C      . ILE A 1 34 ? -9.065  19.061  3.211   1.00 0.00 ? 34 ILE A C      2  
ATOM 8369   O O      . ILE A 1 34 ? -9.504  18.422  2.258   1.00 0.00 ? 34 ILE A O      2  
ATOM 8370   C CB     . ILE A 1 34 ? -7.460  20.757  2.255   1.00 0.00 ? 34 ILE A CB     2  
ATOM 8371   C CG1    . ILE A 1 34 ? -6.042  21.334  2.299   1.00 0.00 ? 34 ILE A CG1    2  
ATOM 8372   C CG2    . ILE A 1 34 ? -8.453  21.864  2.615   1.00 0.00 ? 34 ILE A CG2    2  
ATOM 8373   C CD1    . ILE A 1 34 ? -5.120  20.731  1.239   1.00 0.00 ? 34 ILE A CD1    2  
ATOM 8374   H H      . ILE A 1 34 ? -6.879  18.131  1.868   1.00 0.00 ? 34 ILE A H      2  
ATOM 8375   H HA     . ILE A 1 34 ? -7.364  19.906  4.218   1.00 0.00 ? 34 ILE A HA     2  
ATOM 8376   H HB     . ILE A 1 34 ? -7.679  20.428  1.238   1.00 0.00 ? 34 ILE A HB     2  
ATOM 8377   H HG12   . ILE A 1 34 ? -6.089  22.409  2.125   1.00 0.00 ? 34 ILE A HG12   2  
ATOM 8378   H HG13   . ILE A 1 34 ? -5.609  21.170  3.287   1.00 0.00 ? 34 ILE A HG13   2  
ATOM 8379   H HG21   . ILE A 1 34 ? -8.380  22.107  3.674   1.00 0.00 ? 34 ILE A HG21   2  
ATOM 8380   H HG22   . ILE A 1 34 ? -8.236  22.759  2.032   1.00 0.00 ? 34 ILE A HG22   2  
ATOM 8381   H HG23   . ILE A 1 34 ? -9.470  21.544  2.387   1.00 0.00 ? 34 ILE A HG23   2  
ATOM 8382   H HD11   . ILE A 1 34 ? -4.168  21.262  1.248   1.00 0.00 ? 34 ILE A HD11   2  
ATOM 8383   H HD12   . ILE A 1 34 ? -4.935  19.678  1.449   1.00 0.00 ? 34 ILE A HD12   2  
ATOM 8384   H HD13   . ILE A 1 34 ? -5.574  20.832  0.254   1.00 0.00 ? 34 ILE A HD13   2  
ATOM 8385   N N      . ASN A 1 35 ? -9.815  19.367  4.270   1.00 0.00 ? 35 ASN A N      2  
ATOM 8386   C CA     . ASN A 1 35 ? -11.207 18.989  4.431   1.00 0.00 ? 35 ASN A CA     2  
ATOM 8387   C C      . ASN A 1 35 ? -12.048 20.244  4.622   1.00 0.00 ? 35 ASN A C      2  
ATOM 8388   O O      . ASN A 1 35 ? -12.445 20.603  5.730   1.00 0.00 ? 35 ASN A O      2  
ATOM 8389   C CB     . ASN A 1 35 ? -11.319 18.032  5.615   1.00 0.00 ? 35 ASN A CB     2  
ATOM 8390   C CG     . ASN A 1 35 ? -12.696 17.395  5.733   1.00 0.00 ? 35 ASN A CG     2  
ATOM 8391   O OD1    . ASN A 1 35 ? -13.502 17.428  4.806   1.00 0.00 ? 35 ASN A OD1    2  
ATOM 8392   N ND2    . ASN A 1 35 ? -12.979 16.770  6.873   1.00 0.00 ? 35 ASN A ND2    2  
ATOM 8393   H H      . ASN A 1 35 ? -9.384  19.867  5.035   1.00 0.00 ? 35 ASN A H      2  
ATOM 8394   H HA     . ASN A 1 35 ? -11.551 18.472  3.535   1.00 0.00 ? 35 ASN A HA     2  
ATOM 8395   H HB2    . ASN A 1 35 ? -10.573 17.248  5.503   1.00 0.00 ? 35 ASN A HB2    2  
ATOM 8396   H HB3    . ASN A 1 35 ? -11.108 18.599  6.520   1.00 0.00 ? 35 ASN A HB3    2  
ATOM 8397   H HD21   . ASN A 1 35 ? -12.298 16.742  7.618   1.00 0.00 ? 35 ASN A HD21   2  
ATOM 8398   H HD22   . ASN A 1 35 ? -13.881 16.331  6.985   1.00 0.00 ? 35 ASN A HD22   2  
ATOM 8399   N N      . ALA A 1 36 ? -12.246 20.946  3.507   1.00 0.00 ? 36 ALA A N      2  
ATOM 8400   C CA     . ALA A 1 36 ? -13.083 22.128  3.402   1.00 0.00 ? 36 ALA A CA     2  
ATOM 8401   C C      . ALA A 1 36 ? -14.349 21.827  2.602   1.00 0.00 ? 36 ALA A C      2  
ATOM 8402   O O      . ALA A 1 36 ? -14.327 20.951  1.736   1.00 0.00 ? 36 ALA A O      2  
ATOM 8403   C CB     . ALA A 1 36 ? -12.267 23.242  2.751   1.00 0.00 ? 36 ALA A CB     2  
ATOM 8404   H H      . ALA A 1 36 ? -11.806 20.590  2.671   1.00 0.00 ? 36 ALA A H      2  
ATOM 8405   H HA     . ALA A 1 36 ? -13.373 22.456  4.400   1.00 0.00 ? 36 ALA A HA     2  
ATOM 8406   H HB1    . ALA A 1 36 ? -12.007 22.957  1.732   1.00 0.00 ? 36 ALA A HB1    2  
ATOM 8407   H HB2    . ALA A 1 36 ? -12.860 24.155  2.729   1.00 0.00 ? 36 ALA A HB2    2  
ATOM 8408   H HB3    . ALA A 1 36 ? -11.360 23.420  3.329   1.00 0.00 ? 36 ALA A HB3    2  
ATOM 8409   N N      . PRO A 1 37 ? -15.443 22.562  2.830   1.00 0.00 ? 37 PRO A N      2  
ATOM 8410   C CA     . PRO A 1 37 ? -16.666 22.399  2.069   1.00 0.00 ? 37 PRO A CA     2  
ATOM 8411   C C      . PRO A 1 37 ? -16.495 22.953  0.658   1.00 0.00 ? 37 PRO A C      2  
ATOM 8412   O O      . PRO A 1 37 ? -15.728 23.890  0.448   1.00 0.00 ? 37 PRO A O      2  
ATOM 8413   C CB     . PRO A 1 37 ? -17.738 23.165  2.839   1.00 0.00 ? 37 PRO A CB     2  
ATOM 8414   C CG     . PRO A 1 37 ? -16.955 24.250  3.574   1.00 0.00 ? 37 PRO A CG     2  
ATOM 8415   C CD     . PRO A 1 37 ? -15.576 23.632  3.802   1.00 0.00 ? 37 PRO A CD     2  
ATOM 8416   H HA     . PRO A 1 37 ? -16.926 21.343  2.016   1.00 0.00 ? 37 PRO A HA     2  
ATOM 8417   H HB2    . PRO A 1 37 ? -18.481 23.601  2.171   1.00 0.00 ? 37 PRO A HB2    2  
ATOM 8418   H HB3    . PRO A 1 37 ? -18.216 22.503  3.561   1.00 0.00 ? 37 PRO A HB3    2  
ATOM 8419   H HG2    . PRO A 1 37 ? -16.859 25.132  2.941   1.00 0.00 ? 37 PRO A HG2    2  
ATOM 8420   H HG3    . PRO A 1 37 ? -17.433 24.506  4.520   1.00 0.00 ? 37 PRO A HG3    2  
ATOM 8421   H HD2    . PRO A 1 37 ? -14.804 24.389  3.662   1.00 0.00 ? 37 PRO A HD2    2  
ATOM 8422   H HD3    . PRO A 1 37 ? -15.523 23.224  4.809   1.00 0.00 ? 37 PRO A HD3    2  
ATOM 8423   N N      . LYS A 1 38 ? -17.266 22.436  -0.302  1.00 0.00 ? 38 LYS A N      2  
ATOM 8424   C CA     . LYS A 1 38 ? -17.189 22.861  -1.693  1.00 0.00 ? 38 LYS A CA     2  
ATOM 8425   C C      . LYS A 1 38 ? -17.691 24.286  -1.904  1.00 0.00 ? 38 LYS A C      2  
ATOM 8426   O O      . LYS A 1 38 ? -17.585 24.824  -3.004  1.00 0.00 ? 38 LYS A O      2  
ATOM 8427   C CB     . LYS A 1 38 ? -17.945 21.875  -2.583  1.00 0.00 ? 38 LYS A CB     2  
ATOM 8428   C CG     . LYS A 1 38 ? -17.407 20.456  -2.395  1.00 0.00 ? 38 LYS A CG     2  
ATOM 8429   C CD     . LYS A 1 38 ? -17.842 19.524  -3.526  1.00 0.00 ? 38 LYS A CD     2  
ATOM 8430   C CE     . LYS A 1 38 ? -17.032 19.793  -4.794  1.00 0.00 ? 38 LYS A CE     2  
ATOM 8431   N NZ     . LYS A 1 38 ? -17.307 18.776  -5.825  1.00 0.00 ? 38 LYS A NZ     2  
ATOM 8432   H H      . LYS A 1 38 ? -17.901 21.687  -0.068  1.00 0.00 ? 38 LYS A H      2  
ATOM 8433   H HA     . LYS A 1 38 ? -16.141 22.851  -1.994  1.00 0.00 ? 38 LYS A HA     2  
ATOM 8434   H HB2    . LYS A 1 38 ? -19.007 21.895  -2.337  1.00 0.00 ? 38 LYS A HB2    2  
ATOM 8435   H HB3    . LYS A 1 38 ? -17.821 22.176  -3.624  1.00 0.00 ? 38 LYS A HB3    2  
ATOM 8436   H HG2    . LYS A 1 38 ? -16.319 20.490  -2.348  1.00 0.00 ? 38 LYS A HG2    2  
ATOM 8437   H HG3    . LYS A 1 38 ? -17.782 20.057  -1.453  1.00 0.00 ? 38 LYS A HG3    2  
ATOM 8438   H HD2    . LYS A 1 38 ? -17.680 18.495  -3.209  1.00 0.00 ? 38 LYS A HD2    2  
ATOM 8439   H HD3    . LYS A 1 38 ? -18.904 19.665  -3.729  1.00 0.00 ? 38 LYS A HD3    2  
ATOM 8440   H HE2    . LYS A 1 38 ? -17.279 20.783  -5.177  1.00 0.00 ? 38 LYS A HE2    2  
ATOM 8441   H HE3    . LYS A 1 38 ? -15.970 19.772  -4.543  1.00 0.00 ? 38 LYS A HE3    2  
ATOM 8442   H HZ1    . LYS A 1 38 ? -17.043 17.861  -5.489  1.00 0.00 ? 38 LYS A HZ1    2  
ATOM 8443   H HZ2    . LYS A 1 38 ? -18.290 18.766  -6.059  1.00 0.00 ? 38 LYS A HZ2    2  
ATOM 8444   H HZ3    . LYS A 1 38 ? -16.777 18.975  -6.663  1.00 0.00 ? 38 LYS A HZ3    2  
ATOM 8445   N N      . ASP A 1 39 ? -18.203 24.916  -0.843  1.00 0.00 ? 39 ASP A N      2  
ATOM 8446   C CA     . ASP A 1 39 ? -18.529 26.331  -0.819  1.00 0.00 ? 39 ASP A CA     2  
ATOM 8447   C C      . ASP A 1 39 ? -17.282 27.209  -0.861  1.00 0.00 ? 39 ASP A C      2  
ATOM 8448   O O      . ASP A 1 39 ? -17.354 28.340  -1.338  1.00 0.00 ? 39 ASP A O      2  
ATOM 8449   C CB     . ASP A 1 39 ? -19.358 26.637  0.428   1.00 0.00 ? 39 ASP A CB     2  
ATOM 8450   C CG     . ASP A 1 39 ? -20.727 25.966  0.369   1.00 0.00 ? 39 ASP A CG     2  
ATOM 8451   O OD1    . ASP A 1 39 ? -21.620 26.518  -0.309  1.00 0.00 ? 39 ASP A OD1    2  
ATOM 8452   O OD2    . ASP A 1 39 ? -20.886 24.901  1.007   1.00 0.00 ? 39 ASP A OD2    2  
ATOM 8453   H H      . ASP A 1 39 ? -18.264 24.404  0.025   1.00 0.00 ? 39 ASP A H      2  
ATOM 8454   H HA     . ASP A 1 39 ? -19.127 26.566  -1.699  1.00 0.00 ? 39 ASP A HA     2  
ATOM 8455   H HB2    . ASP A 1 39 ? -18.817 26.298  1.313   1.00 0.00 ? 39 ASP A HB2    2  
ATOM 8456   H HB3    . ASP A 1 39 ? -19.495 27.716  0.508   1.00 0.00 ? 39 ASP A HB3    2  
ATOM 8457   N N      . VAL A 1 40 ? -16.136 26.694  -0.403  1.00 0.00 ? 40 VAL A N      2  
ATOM 8458   C CA     . VAL A 1 40 ? -14.854 27.375  -0.507  1.00 0.00 ? 40 VAL A CA     2  
ATOM 8459   C C      . VAL A 1 40 ? -13.891 26.618  -1.415  1.00 0.00 ? 40 VAL A C      2  
ATOM 8460   O O      . VAL A 1 40 ? -13.868 25.388  -1.452  1.00 0.00 ? 40 VAL A O      2  
ATOM 8461   C CB     . VAL A 1 40 ? -14.249 27.651  0.870   1.00 0.00 ? 40 VAL A CB     2  
ATOM 8462   C CG1    . VAL A 1 40 ? -15.251 28.369  1.773   1.00 0.00 ? 40 VAL A CG1    2  
ATOM 8463   C CG2    . VAL A 1 40 ? -13.766 26.389  1.581   1.00 0.00 ? 40 VAL A CG2    2  
ATOM 8464   H H      . VAL A 1 40 ? -16.137 25.778  0.025   1.00 0.00 ? 40 VAL A H      2  
ATOM 8465   H HA     . VAL A 1 40 ? -15.023 28.347  -0.971  1.00 0.00 ? 40 VAL A HA     2  
ATOM 8466   H HB     . VAL A 1 40 ? -13.388 28.302  0.729   1.00 0.00 ? 40 VAL A HB     2  
ATOM 8467   H HG11   . VAL A 1 40 ? -14.759 28.669  2.699   1.00 0.00 ? 40 VAL A HG11   2  
ATOM 8468   H HG12   . VAL A 1 40 ? -15.629 29.257  1.267   1.00 0.00 ? 40 VAL A HG12   2  
ATOM 8469   H HG13   . VAL A 1 40 ? -16.084 27.706  2.009   1.00 0.00 ? 40 VAL A HG13   2  
ATOM 8470   H HG21   . VAL A 1 40 ? -13.340 26.659  2.548   1.00 0.00 ? 40 VAL A HG21   2  
ATOM 8471   H HG22   . VAL A 1 40 ? -14.601 25.707  1.733   1.00 0.00 ? 40 VAL A HG22   2  
ATOM 8472   H HG23   . VAL A 1 40 ? -12.995 25.903  0.983   1.00 0.00 ? 40 VAL A HG23   2  
ATOM 8473   N N      . ALA A 1 41 ? -13.084 27.372  -2.162  1.00 0.00 ? 41 ALA A N      2  
ATOM 8474   C CA     . ALA A 1 41 ? -12.106 26.836  -3.091  1.00 0.00 ? 41 ALA A CA     2  
ATOM 8475   C C      . ALA A 1 41 ? -10.807 26.492  -2.368  1.00 0.00 ? 41 ALA A C      2  
ATOM 8476   O O      . ALA A 1 41 ? -10.397 27.217  -1.463  1.00 0.00 ? 41 ALA A O      2  
ATOM 8477   C CB     . ALA A 1 41 ? -11.877 27.863  -4.199  1.00 0.00 ? 41 ALA A CB     2  
ATOM 8478   H H      . ALA A 1 41 ? -13.118 28.375  -2.046  1.00 0.00 ? 41 ALA A H      2  
ATOM 8479   H HA     . ALA A 1 41 ? -12.507 25.929  -3.543  1.00 0.00 ? 41 ALA A HA     2  
ATOM 8480   H HB1    . ALA A 1 41 ? -11.475 28.783  -3.775  1.00 0.00 ? 41 ALA A HB1    2  
ATOM 8481   H HB2    . ALA A 1 41 ? -11.170 27.463  -4.925  1.00 0.00 ? 41 ALA A HB2    2  
ATOM 8482   H HB3    . ALA A 1 41 ? -12.820 28.077  -4.701  1.00 0.00 ? 41 ALA A HB3    2  
ATOM 8483   N N      . VAL A 1 42 ? -10.143 25.403  -2.765  1.00 0.00 ? 42 VAL A N      2  
ATOM 8484   C CA     . VAL A 1 42 ? -8.831  25.048  -2.241  1.00 0.00 ? 42 VAL A CA     2  
ATOM 8485   C C      . VAL A 1 42 ? -7.876  24.713  -3.381  1.00 0.00 ? 42 VAL A C      2  
ATOM 8486   O O      . VAL A 1 42 ? -8.210  23.931  -4.268  1.00 0.00 ? 42 VAL A O      2  
ATOM 8487   C CB     . VAL A 1 42 ? -8.909  23.917  -1.212  1.00 0.00 ? 42 VAL A CB     2  
ATOM 8488   C CG1    . VAL A 1 42 ? -9.889  24.256  -0.091  1.00 0.00 ? 42 VAL A CG1    2  
ATOM 8489   C CG2    . VAL A 1 42 ? -9.344  22.579  -1.806  1.00 0.00 ? 42 VAL A CG2    2  
ATOM 8490   H H      . VAL A 1 42 ? -10.515 24.846  -3.523  1.00 0.00 ? 42 VAL A H      2  
ATOM 8491   H HA     . VAL A 1 42 ? -8.420  25.917  -1.727  1.00 0.00 ? 42 VAL A HA     2  
ATOM 8492   H HB     . VAL A 1 42 ? -7.920  23.788  -0.772  1.00 0.00 ? 42 VAL A HB     2  
ATOM 8493   H HG11   . VAL A 1 42 ? -9.624  25.219  0.343   1.00 0.00 ? 42 VAL A HG11   2  
ATOM 8494   H HG12   . VAL A 1 42 ? -10.907 24.299  -0.479  1.00 0.00 ? 42 VAL A HG12   2  
ATOM 8495   H HG13   . VAL A 1 42 ? -9.839  23.486  0.678   1.00 0.00 ? 42 VAL A HG13   2  
ATOM 8496   H HG21   . VAL A 1 42 ? -8.600  22.235  -2.522  1.00 0.00 ? 42 VAL A HG21   2  
ATOM 8497   H HG22   . VAL A 1 42 ? -9.440  21.840  -1.010  1.00 0.00 ? 42 VAL A HG22   2  
ATOM 8498   H HG23   . VAL A 1 42 ? -10.302 22.692  -2.309  1.00 0.00 ? 42 VAL A HG23   2  
ATOM 8499   N N      . HIS A 1 43 ? -6.698  25.342  -3.376  1.00 0.00 ? 43 HIS A N      2  
ATOM 8500   C CA     . HIS A 1 43 ? -5.719  25.276  -4.451  1.00 0.00 ? 43 HIS A CA     2  
ATOM 8501   C C      . HIS A 1 43 ? -4.315  25.441  -3.879  1.00 0.00 ? 43 HIS A C      2  
ATOM 8502   O O      . HIS A 1 43 ? -4.150  25.531  -2.664  1.00 0.00 ? 43 HIS A O      2  
ATOM 8503   C CB     . HIS A 1 43 ? -6.026  26.360  -5.486  1.00 0.00 ? 43 HIS A CB     2  
ATOM 8504   C CG     . HIS A 1 43 ? -7.368  26.189  -6.145  1.00 0.00 ? 43 HIS A CG     2  
ATOM 8505   N ND1    . HIS A 1 43 ? -7.742  25.110  -6.948  1.00 0.00 ? 43 HIS A ND1    2  
ATOM 8506   C CD2    . HIS A 1 43 ? -8.448  27.010  -5.967  1.00 0.00 ? 43 HIS A CD2    2  
ATOM 8507   C CE1    . HIS A 1 43 ? -9.038  25.300  -7.227  1.00 0.00 ? 43 HIS A CE1    2  
ATOM 8508   N NE2    . HIS A 1 43 ? -9.486  26.436  -6.668  1.00 0.00 ? 43 HIS A NE2    2  
ATOM 8509   H H      . HIS A 1 43 ? -6.464  25.922  -2.581  1.00 0.00 ? 43 HIS A H      2  
ATOM 8510   H HA     . HIS A 1 43 ? -5.772  24.300  -4.935  1.00 0.00 ? 43 HIS A HA     2  
ATOM 8511   H HB2    . HIS A 1 43 ? -5.990  27.337  -5.002  1.00 0.00 ? 43 HIS A HB2    2  
ATOM 8512   H HB3    . HIS A 1 43 ? -5.264  26.340  -6.265  1.00 0.00 ? 43 HIS A HB3    2  
ATOM 8513   H HD2    . HIS A 1 43 ? -8.476  27.926  -5.393  1.00 0.00 ? 43 HIS A HD2    2  
ATOM 8514   H HE1    . HIS A 1 43 ? -9.667  24.589  -7.743  1.00 0.00 ? 43 HIS A HE1    2  
ATOM 8515   H HE2    . HIS A 1 43 ? -10.437 26.776  -6.717  1.00 0.00 ? 43 HIS A HE2    2  
ATOM 8516   N N      . ARG A 1 44 ? -3.291  25.490  -4.736  1.00 0.00 ? 44 ARG A N      2  
ATOM 8517   C CA     . ARG A 1 44 ? -1.942  25.816  -4.300  1.00 0.00 ? 44 ARG A CA     2  
ATOM 8518   C C      . ARG A 1 44 ? -1.306  26.920  -5.134  1.00 0.00 ? 44 ARG A C      2  
ATOM 8519   O O      . ARG A 1 44 ? -1.785  27.222  -6.223  1.00 0.00 ? 44 ARG A O      2  
ATOM 8520   C CB     . ARG A 1 44 ? -1.088  24.551  -4.219  1.00 0.00 ? 44 ARG A CB     2  
ATOM 8521   C CG     . ARG A 1 44 ? -0.518  24.084  -5.557  1.00 0.00 ? 44 ARG A CG     2  
ATOM 8522   C CD     . ARG A 1 44 ? -1.454  23.178  -6.355  1.00 0.00 ? 44 ARG A CD     2  
ATOM 8523   N NE     . ARG A 1 44 ? -0.673  22.481  -7.378  1.00 0.00 ? 44 ARG A NE     2  
ATOM 8524   C CZ     . ARG A 1 44 ? -0.994  21.332  -7.975  1.00 0.00 ? 44 ARG A CZ     2  
ATOM 8525   N NH1    . ARG A 1 44 ? -2.197  20.780  -7.827  1.00 0.00 ? 44 ARG A NH1    2  
ATOM 8526   N NH2    . ARG A 1 44 ? -0.062  20.729  -8.710  1.00 0.00 ? 44 ARG A NH2    2  
ATOM 8527   H H      . ARG A 1 44 ? -3.473  25.439  -5.728  1.00 0.00 ? 44 ARG A H      2  
ATOM 8528   H HA     . ARG A 1 44 ? -2.016  26.229  -3.296  1.00 0.00 ? 44 ARG A HA     2  
ATOM 8529   H HB2    . ARG A 1 44 ? -0.246  24.751  -3.557  1.00 0.00 ? 44 ARG A HB2    2  
ATOM 8530   H HB3    . ARG A 1 44 ? -1.675  23.750  -3.772  1.00 0.00 ? 44 ARG A HB3    2  
ATOM 8531   H HG2    . ARG A 1 44 ? -0.251  24.939  -6.175  1.00 0.00 ? 44 ARG A HG2    2  
ATOM 8532   H HG3    . ARG A 1 44 ? 0.399   23.533  -5.352  1.00 0.00 ? 44 ARG A HG3    2  
ATOM 8533   H HD2    . ARG A 1 44 ? -1.927  22.451  -5.695  1.00 0.00 ? 44 ARG A HD2    2  
ATOM 8534   H HD3    . ARG A 1 44 ? -2.234  23.776  -6.825  1.00 0.00 ? 44 ARG A HD3    2  
ATOM 8535   H HE     . ARG A 1 44 ? 0.272   22.803  -7.534  1.00 0.00 ? 44 ARG A HE     2  
ATOM 8536   H HH11   . ARG A 1 44 ? -2.916  21.275  -7.318  1.00 0.00 ? 44 ARG A HH11   2  
ATOM 8537   H HH12   . ARG A 1 44 ? -2.425  19.903  -8.270  1.00 0.00 ? 44 ARG A HH12   2  
ATOM 8538   H HH21   . ARG A 1 44 ? 0.872   21.118  -8.703  1.00 0.00 ? 44 ARG A HH21   2  
ATOM 8539   H HH22   . ARG A 1 44 ? -0.216  19.812  -9.105  1.00 0.00 ? 44 ARG A HH22   2  
ATOM 8540   N N      . GLU A 1 45 ? -0.185  27.465  -4.660  1.00 0.00 ? 45 GLU A N      2  
ATOM 8541   C CA     . GLU A 1 45 ? 0.421   28.671  -5.200  1.00 0.00 ? 45 GLU A CA     2  
ATOM 8542   C C      . GLU A 1 45 ? 0.836   28.538  -6.664  1.00 0.00 ? 45 GLU A C      2  
ATOM 8543   O O      . GLU A 1 45 ? 0.645   29.464  -7.449  1.00 0.00 ? 45 GLU A O      2  
ATOM 8544   C CB     . GLU A 1 45 ? 1.616   29.016  -4.312  1.00 0.00 ? 45 GLU A CB     2  
ATOM 8545   C CG     . GLU A 1 45 ? 2.220   30.386  -4.613  1.00 0.00 ? 45 GLU A CG     2  
ATOM 8546   C CD     . GLU A 1 45 ? 1.261   31.521  -4.263  1.00 0.00 ? 45 GLU A CD     2  
ATOM 8547   O OE1    . GLU A 1 45 ? 0.995   31.716  -3.056  1.00 0.00 ? 45 GLU A OE1    2  
ATOM 8548   O OE2    . GLU A 1 45 ? 0.801   32.211  -5.199  1.00 0.00 ? 45 GLU A OE2    2  
ATOM 8549   H H      . GLU A 1 45 ? 0.189   27.109  -3.790  1.00 0.00 ? 45 GLU A H      2  
ATOM 8550   H HA     . GLU A 1 45 ? -0.306  29.481  -5.130  1.00 0.00 ? 45 GLU A HA     2  
ATOM 8551   H HB2    . GLU A 1 45 ? 1.289   29.002  -3.272  1.00 0.00 ? 45 GLU A HB2    2  
ATOM 8552   H HB3    . GLU A 1 45 ? 2.387   28.255  -4.439  1.00 0.00 ? 45 GLU A HB3    2  
ATOM 8553   H HG2    . GLU A 1 45 ? 3.134   30.487  -4.028  1.00 0.00 ? 45 GLU A HG2    2  
ATOM 8554   H HG3    . GLU A 1 45 ? 2.495   30.436  -5.666  1.00 0.00 ? 45 GLU A HG3    2  
ATOM 8555   N N      . GLU A 1 46 ? 1.340   27.369  -7.068  1.00 0.00 ? 46 GLU A N      2  
ATOM 8556   C CA     . GLU A 1 46 ? 1.711   27.095  -8.450  1.00 0.00 ? 46 GLU A CA     2  
ATOM 8557   C C      . GLU A 1 46 ? 0.512   26.946  -9.387  1.00 0.00 ? 46 GLU A C      2  
ATOM 8558   O O      . GLU A 1 46 ? 0.692   26.846  -10.599 1.00 0.00 ? 46 GLU A O      2  
ATOM 8559   C CB     . GLU A 1 46 ? 2.623   25.868  -8.515  1.00 0.00 ? 46 GLU A CB     2  
ATOM 8560   C CG     . GLU A 1 46 ? 1.982   24.642  -7.864  1.00 0.00 ? 46 GLU A CG     2  
ATOM 8561   C CD     . GLU A 1 46 ? 2.717   23.334  -8.142  1.00 0.00 ? 46 GLU A CD     2  
ATOM 8562   O OE1    . GLU A 1 46 ? 3.867   23.369  -8.635  1.00 0.00 ? 46 GLU A OE1    2  
ATOM 8563   O OE2    . GLU A 1 46 ? 2.117   22.281  -7.830  1.00 0.00 ? 46 GLU A OE2    2  
ATOM 8564   H H      . GLU A 1 46 ? 1.547   26.670  -6.369  1.00 0.00 ? 46 GLU A H      2  
ATOM 8565   H HA     . GLU A 1 46 ? 2.288   27.945  -8.813  1.00 0.00 ? 46 GLU A HA     2  
ATOM 8566   H HB2    . GLU A 1 46 ? 2.846   25.650  -9.559  1.00 0.00 ? 46 GLU A HB2    2  
ATOM 8567   H HB3    . GLU A 1 46 ? 3.557   26.095  -7.999  1.00 0.00 ? 46 GLU A HB3    2  
ATOM 8568   H HG2    . GLU A 1 46 ? 1.952   24.798  -6.785  1.00 0.00 ? 46 GLU A HG2    2  
ATOM 8569   H HG3    . GLU A 1 46 ? 0.958   24.547  -8.228  1.00 0.00 ? 46 GLU A HG3    2  
ATOM 8570   N N      . ILE A 1 47 ? -0.713  26.958  -8.850  1.00 0.00 ? 47 ILE A N      2  
ATOM 8571   C CA     . ILE A 1 47 ? -1.956  26.899  -9.605  1.00 0.00 ? 47 ILE A CA     2  
ATOM 8572   C C      . ILE A 1 47 ? -2.804  28.145  -9.365  1.00 0.00 ? 47 ILE A C      2  
ATOM 8573   O O      . ILE A 1 47 ? -3.557  28.550  -10.246 1.00 0.00 ? 47 ILE A O      2  
ATOM 8574   C CB     . ILE A 1 47 ? -2.698  25.606  -9.246  1.00 0.00 ? 47 ILE A CB     2  
ATOM 8575   C CG1    . ILE A 1 47 ? -2.186  24.491  -10.164 1.00 0.00 ? 47 ILE A CG1    2  
ATOM 8576   C CG2    . ILE A 1 47 ? -4.223  25.734  -9.306  1.00 0.00 ? 47 ILE A CG2    2  
ATOM 8577   C CD1    . ILE A 1 47 ? -3.032  23.219  -10.114 1.00 0.00 ? 47 ILE A CD1    2  
ATOM 8578   H H      . ILE A 1 47 ? -0.791  27.054  -7.847  1.00 0.00 ? 47 ILE A H      2  
ATOM 8579   H HA     . ILE A 1 47 ? -1.730  26.887  -10.671 1.00 0.00 ? 47 ILE A HA     2  
ATOM 8580   H HB     . ILE A 1 47 ? -2.445  25.345  -8.220  1.00 0.00 ? 47 ILE A HB     2  
ATOM 8581   H HG12   . ILE A 1 47 ? -2.169  24.845  -11.194 1.00 0.00 ? 47 ILE A HG12   2  
ATOM 8582   H HG13   . ILE A 1 47 ? -1.165  24.243  -9.873  1.00 0.00 ? 47 ILE A HG13   2  
ATOM 8583   H HG21   . ILE A 1 47 ? -4.544  25.952  -10.325 1.00 0.00 ? 47 ILE A HG21   2  
ATOM 8584   H HG22   . ILE A 1 47 ? -4.688  24.809  -8.966  1.00 0.00 ? 47 ILE A HG22   2  
ATOM 8585   H HG23   . ILE A 1 47 ? -4.563  26.525  -8.638  1.00 0.00 ? 47 ILE A HG23   2  
ATOM 8586   H HD11   . ILE A 1 47 ? -3.224  22.944  -9.077  1.00 0.00 ? 47 ILE A HD11   2  
ATOM 8587   H HD12   . ILE A 1 47 ? -3.973  23.392  -10.636 1.00 0.00 ? 47 ILE A HD12   2  
ATOM 8588   H HD13   . ILE A 1 47 ? -2.500  22.405  -10.608 1.00 0.00 ? 47 ILE A HD13   2  
ATOM 8589   N N      . TYR A 1 48 ? -2.664  28.801  -8.213  1.00 0.00 ? 48 TYR A N      2  
ATOM 8590   C CA     . TYR A 1 48 ? -3.509  29.915  -7.822  1.00 0.00 ? 48 TYR A CA     2  
ATOM 8591   C C      . TYR A 1 48 ? -3.315  31.088  -8.777  1.00 0.00 ? 48 TYR A C      2  
ATOM 8592   O O      . TYR A 1 48 ? -4.249  31.819  -9.097  1.00 0.00 ? 48 TYR A O      2  
ATOM 8593   C CB     . TYR A 1 48 ? -3.155  30.304  -6.388  1.00 0.00 ? 48 TYR A CB     2  
ATOM 8594   C CG     . TYR A 1 48 ? -3.981  31.459  -5.877  1.00 0.00 ? 48 TYR A CG     2  
ATOM 8595   C CD1    . TYR A 1 48 ? -3.590  32.773  -6.168  1.00 0.00 ? 48 TYR A CD1    2  
ATOM 8596   C CD2    . TYR A 1 48 ? -5.192  31.212  -5.217  1.00 0.00 ? 48 TYR A CD2    2  
ATOM 8597   C CE1    . TYR A 1 48 ? -4.417  33.847  -5.814  1.00 0.00 ? 48 TYR A CE1    2  
ATOM 8598   C CE2    . TYR A 1 48 ? -6.018  32.280  -4.848  1.00 0.00 ? 48 TYR A CE2    2  
ATOM 8599   C CZ     . TYR A 1 48 ? -5.633  33.605  -5.142  1.00 0.00 ? 48 TYR A CZ     2  
ATOM 8600   O OH     . TYR A 1 48 ? -6.447  34.643  -4.798  1.00 0.00 ? 48 TYR A OH     2  
ATOM 8601   H H      . TYR A 1 48 ? -1.966  28.497  -7.549  1.00 0.00 ? 48 TYR A H      2  
ATOM 8602   H HA     . TYR A 1 48 ? -4.552  29.604  -7.858  1.00 0.00 ? 48 TYR A HA     2  
ATOM 8603   H HB2    . TYR A 1 48 ? -3.316  29.443  -5.740  1.00 0.00 ? 48 TYR A HB2    2  
ATOM 8604   H HB3    . TYR A 1 48 ? -2.100  30.575  -6.341  1.00 0.00 ? 48 TYR A HB3    2  
ATOM 8605   H HD1    . TYR A 1 48 ? -2.677  32.960  -6.715  1.00 0.00 ? 48 TYR A HD1    2  
ATOM 8606   H HD2    . TYR A 1 48 ? -5.499  30.195  -5.018  1.00 0.00 ? 48 TYR A HD2    2  
ATOM 8607   H HE1    . TYR A 1 48 ? -4.131  34.846  -6.110  1.00 0.00 ? 48 TYR A HE1    2  
ATOM 8608   H HE2    . TYR A 1 48 ? -6.962  32.083  -4.360  1.00 0.00 ? 48 TYR A HE2    2  
ATOM 8609   H HH     . TYR A 1 48 ? -6.071  35.501  -5.020  1.00 0.00 ? 48 TYR A HH     2  
ATOM 8610   N N      . GLN A 1 49 ? -2.103  31.200  -9.319  1.00 0.00 ? 49 GLN A N      2  
ATOM 8611   C CA     . GLN A 1 49 ? -1.734  32.238  -10.262 1.00 0.00 ? 49 GLN A CA     2  
ATOM 8612   C C      . GLN A 1 49 ? -2.316  31.969  -11.649 1.00 0.00 ? 49 GLN A C      2  
ATOM 8613   O O      . GLN A 1 49 ? -2.360  32.877  -12.476 1.00 0.00 ? 49 GLN A O      2  
ATOM 8614   C CB     . GLN A 1 49 ? -0.209  32.323  -10.298 1.00 0.00 ? 49 GLN A CB     2  
ATOM 8615   C CG     . GLN A 1 49 ? 0.329   32.549  -8.884  1.00 0.00 ? 49 GLN A CG     2  
ATOM 8616   C CD     . GLN A 1 49 ? 1.848   32.648  -8.865  1.00 0.00 ? 49 GLN A CD     2  
ATOM 8617   O OE1    . GLN A 1 49 ? 2.430   33.667  -9.228  1.00 0.00 ? 49 GLN A OE1    2  
ATOM 8618   N NE2    . GLN A 1 49 ? 2.520   31.569  -8.470  1.00 0.00 ? 49 GLN A NE2    2  
ATOM 8619   H H      . GLN A 1 49 ? -1.378  30.566  -9.013  1.00 0.00 ? 49 GLN A H      2  
ATOM 8620   H HA     . GLN A 1 49 ? -2.133  33.186  -9.896  1.00 0.00 ? 49 GLN A HA     2  
ATOM 8621   H HB2    . GLN A 1 49 ? 0.200   31.396  -10.698 1.00 0.00 ? 49 GLN A HB2    2  
ATOM 8622   H HB3    . GLN A 1 49 ? 0.093   33.153  -10.937 1.00 0.00 ? 49 GLN A HB3    2  
ATOM 8623   H HG2    . GLN A 1 49 ? -0.121  33.452  -8.477  1.00 0.00 ? 49 GLN A HG2    2  
ATOM 8624   H HG3    . GLN A 1 49 ? 0.031   31.729  -8.234  1.00 0.00 ? 49 GLN A HG3    2  
ATOM 8625   H HE21   . GLN A 1 49 ? 2.009   30.766  -8.128  1.00 0.00 ? 49 GLN A HE21   2  
ATOM 8626   H HE22   . GLN A 1 49 ? 3.529   31.593  -8.442  1.00 0.00 ? 49 GLN A HE22   2  
ATOM 8627   N N      . ARG A 1 50 ? -2.809  30.749  -11.891 1.00 0.00 ? 50 ARG A N      2  
ATOM 8628   C CA     . ARG A 1 50 ? -3.586  30.389  -13.068 1.00 0.00 ? 50 ARG A CA     2  
ATOM 8629   C C      . ARG A 1 50 ? -5.044  30.805  -12.901 1.00 0.00 ? 50 ARG A C      2  
ATOM 8630   O O      . ARG A 1 50 ? -5.665  31.251  -13.862 1.00 0.00 ? 50 ARG A O      2  
ATOM 8631   C CB     . ARG A 1 50 ? -3.414  28.895  -13.369 1.00 0.00 ? 50 ARG A CB     2  
ATOM 8632   C CG     . ARG A 1 50 ? -4.654  28.031  -13.122 1.00 0.00 ? 50 ARG A CG     2  
ATOM 8633   C CD     . ARG A 1 50 ? -4.314  26.546  -13.196 1.00 0.00 ? 50 ARG A CD     2  
ATOM 8634   N NE     . ARG A 1 50 ? -3.998  26.122  -14.562 1.00 0.00 ? 50 ARG A NE     2  
ATOM 8635   C CZ     . ARG A 1 50 ? -3.663  24.879  -14.922 1.00 0.00 ? 50 ARG A CZ     2  
ATOM 8636   N NH1    . ARG A 1 50 ? -3.608  23.890  -14.030 1.00 0.00 ? 50 ARG A NH1    2  
ATOM 8637   N NH2    . ARG A 1 50 ? -3.374  24.608  -16.194 1.00 0.00 ? 50 ARG A NH2    2  
ATOM 8638   H H      . ARG A 1 50 ? -2.738  30.055  -11.160 1.00 0.00 ? 50 ARG A H      2  
ATOM 8639   H HA     . ARG A 1 50 ? -3.191  30.943  -13.921 1.00 0.00 ? 50 ARG A HA     2  
ATOM 8640   H HB2    . ARG A 1 50 ? -3.125  28.787  -14.414 1.00 0.00 ? 50 ARG A HB2    2  
ATOM 8641   H HB3    . ARG A 1 50 ? -2.590  28.505  -12.770 1.00 0.00 ? 50 ARG A HB3    2  
ATOM 8642   H HG2    . ARG A 1 50 ? -5.060  28.232  -12.132 1.00 0.00 ? 50 ARG A HG2    2  
ATOM 8643   H HG3    . ARG A 1 50 ? -5.422  28.244  -13.862 1.00 0.00 ? 50 ARG A HG3    2  
ATOM 8644   H HD2    . ARG A 1 50 ? -3.463  26.360  -12.543 1.00 0.00 ? 50 ARG A HD2    2  
ATOM 8645   H HD3    . ARG A 1 50 ? -5.169  25.982  -12.824 1.00 0.00 ? 50 ARG A HD3    2  
ATOM 8646   H HE     . ARG A 1 50 ? -4.043  26.823  -15.288 1.00 0.00 ? 50 ARG A HE     2  
ATOM 8647   H HH11   . ARG A 1 50 ? -3.850  24.069  -13.067 1.00 0.00 ? 50 ARG A HH11   2  
ATOM 8648   H HH12   . ARG A 1 50 ? -3.356  22.957  -14.322 1.00 0.00 ? 50 ARG A HH12   2  
ATOM 8649   H HH21   . ARG A 1 50 ? -3.409  25.339  -16.889 1.00 0.00 ? 50 ARG A HH21   2  
ATOM 8650   H HH22   . ARG A 1 50 ? -3.121  23.669  -16.467 1.00 0.00 ? 50 ARG A HH22   2  
ATOM 8651   N N      . ILE A 1 51 ? -5.563  30.738  -11.672 1.00 0.00 ? 51 ILE A N      2  
ATOM 8652   C CA     . ILE A 1 51 ? -6.883  31.241  -11.323 1.00 0.00 ? 51 ILE A CA     2  
ATOM 8653   C C      . ILE A 1 51 ? -6.901  32.750  -11.537 1.00 0.00 ? 51 ILE A C      2  
ATOM 8654   O O      . ILE A 1 51 ? -7.712  33.278  -12.294 1.00 0.00 ? 51 ILE A O      2  
ATOM 8655   C CB     . ILE A 1 51 ? -7.244  30.884  -9.877  1.00 0.00 ? 51 ILE A CB     2  
ATOM 8656   C CG1    . ILE A 1 51 ? -6.993  29.404  -9.577  1.00 0.00 ? 51 ILE A CG1    2  
ATOM 8657   C CG2    . ILE A 1 51 ? -8.707  31.219  -9.584  1.00 0.00 ? 51 ILE A CG2    2  
ATOM 8658   C CD1    . ILE A 1 51 ? -7.236  29.090  -8.103  1.00 0.00 ? 51 ILE A CD1    2  
ATOM 8659   H H      . ILE A 1 51 ? -4.997  30.344  -10.933 1.00 0.00 ? 51 ILE A H      2  
ATOM 8660   H HA     . ILE A 1 51 ? -7.625  30.782  -11.973 1.00 0.00 ? 51 ILE A HA     2  
ATOM 8661   H HB     . ILE A 1 51 ? -6.630  31.476  -9.199  1.00 0.00 ? 51 ILE A HB     2  
ATOM 8662   H HG12   . ILE A 1 51 ? -7.644  28.783  -10.193 1.00 0.00 ? 51 ILE A HG12   2  
ATOM 8663   H HG13   . ILE A 1 51 ? -5.958  29.151  -9.801  1.00 0.00 ? 51 ILE A HG13   2  
ATOM 8664   H HG21   . ILE A 1 51 ? -8.830  31.374  -8.510  1.00 0.00 ? 51 ILE A HG21   2  
ATOM 8665   H HG22   . ILE A 1 51 ? -9.008  32.124  -10.111 1.00 0.00 ? 51 ILE A HG22   2  
ATOM 8666   H HG23   . ILE A 1 51 ? -9.350  30.402  -9.912  1.00 0.00 ? 51 ILE A HG23   2  
ATOM 8667   H HD11   . ILE A 1 51 ? -6.763  29.849  -7.480  1.00 0.00 ? 51 ILE A HD11   2  
ATOM 8668   H HD12   . ILE A 1 51 ? -8.307  29.068  -7.899  1.00 0.00 ? 51 ILE A HD12   2  
ATOM 8669   H HD13   . ILE A 1 51 ? -6.801  28.118  -7.877  1.00 0.00 ? 51 ILE A HD13   2  
ATOM 8670   N N      . GLN A 1 52 ? -5.940  33.444  -10.923 1.00 0.00 ? 52 GLN A N      2  
ATOM 8671   C CA     . GLN A 1 52 ? -5.858  34.893  -10.930 1.00 0.00 ? 52 GLN A CA     2  
ATOM 8672   C C      . GLN A 1 52 ? -5.167  35.435  -12.178 1.00 0.00 ? 52 GLN A C      2  
ATOM 8673   O O      . GLN A 1 52 ? -4.967  36.643  -12.297 1.00 0.00 ? 52 GLN A O      2  
ATOM 8674   C CB     . GLN A 1 52 ? -5.273  35.385  -9.606  1.00 0.00 ? 52 GLN A CB     2  
ATOM 8675   C CG     . GLN A 1 52 ? -6.178  34.984  -8.438  1.00 0.00 ? 52 GLN A CG     2  
ATOM 8676   C CD     . GLN A 1 52 ? -7.632  35.376  -8.680  1.00 0.00 ? 52 GLN A CD     2  
ATOM 8677   O OE1    . GLN A 1 52 ? -7.998  36.547  -8.625  1.00 0.00 ? 52 GLN A OE1    2  
ATOM 8678   N NE2    . GLN A 1 52 ? -8.461  34.409  -9.067  1.00 0.00 ? 52 GLN A NE2    2  
ATOM 8679   H H      . GLN A 1 52 ? -5.225  32.942  -10.415 1.00 0.00 ? 52 GLN A H      2  
ATOM 8680   H HA     . GLN A 1 52 ? -6.876  35.276  -10.999 1.00 0.00 ? 52 GLN A HA     2  
ATOM 8681   H HB2    . GLN A 1 52 ? -4.281  34.956  -9.461  1.00 0.00 ? 52 GLN A HB2    2  
ATOM 8682   H HB3    . GLN A 1 52 ? -5.187  36.471  -9.625  1.00 0.00 ? 52 GLN A HB3    2  
ATOM 8683   H HG2    . GLN A 1 52 ? -6.117  33.906  -8.290  1.00 0.00 ? 52 GLN A HG2    2  
ATOM 8684   H HG3    . GLN A 1 52 ? -5.826  35.466  -7.528  1.00 0.00 ? 52 GLN A HG3    2  
ATOM 8685   H HE21   . GLN A 1 52 ? -8.141  33.452  -9.060  1.00 0.00 ? 52 GLN A HE21   2  
ATOM 8686   H HE22   . GLN A 1 52 ? -9.311  34.645  -9.559  1.00 0.00 ? 52 GLN A HE22   2  
ATOM 8687   N N      . ALA A 1 53 ? -4.831  34.555  -13.126 1.00 0.00 ? 53 ALA A N      2  
ATOM 8688   C CA     . ALA A 1 53 ? -4.393  34.963  -14.449 1.00 0.00 ? 53 ALA A CA     2  
ATOM 8689   C C      . ALA A 1 53 ? -5.466  35.790  -15.155 1.00 0.00 ? 53 ALA A C      2  
ATOM 8690   O O      . ALA A 1 53 ? -5.155  36.585  -16.041 1.00 0.00 ? 53 ALA A O      2  
ATOM 8691   C CB     . ALA A 1 53 ? -4.047  33.732  -15.284 1.00 0.00 ? 53 ALA A CB     2  
ATOM 8692   H H      . ALA A 1 53 ? -4.998  33.573  -12.969 1.00 0.00 ? 53 ALA A H      2  
ATOM 8693   H HA     . ALA A 1 53 ? -3.496  35.566  -14.323 1.00 0.00 ? 53 ALA A HA     2  
ATOM 8694   H HB1    . ALA A 1 53 ? -4.942  33.129  -15.443 1.00 0.00 ? 53 ALA A HB1    2  
ATOM 8695   H HB2    . ALA A 1 53 ? -3.657  34.047  -16.251 1.00 0.00 ? 53 ALA A HB2    2  
ATOM 8696   H HB3    . ALA A 1 53 ? -3.289  33.135  -14.778 1.00 0.00 ? 53 ALA A HB3    2  
ATOM 8697   N N      . GLY A 1 54 ? -6.729  35.612  -14.755 1.00 0.00 ? 54 GLY A N      2  
ATOM 8698   C CA     . GLY A 1 54 ? -7.836  36.436  -15.206 1.00 0.00 ? 54 GLY A CA     2  
ATOM 8699   C C      . GLY A 1 54 ? -9.195  35.770  -15.022 1.00 0.00 ? 54 GLY A C      2  
ATOM 8700   O O      . GLY A 1 54 ? -10.206 36.343  -15.427 1.00 0.00 ? 54 GLY A O      2  
ATOM 8701   H H      . GLY A 1 54 ? -6.909  34.963  -14.001 1.00 0.00 ? 54 GLY A H      2  
ATOM 8702   H HA2    . GLY A 1 54 ? -7.827  37.367  -14.638 1.00 0.00 ? 54 GLY A HA2    2  
ATOM 8703   H HA3    . GLY A 1 54 ? -7.708  36.668  -16.263 1.00 0.00 ? 54 GLY A HA3    2  
ATOM 8704   N N      . LEU A 1 55 ? -9.250  34.570  -14.435 1.00 0.00 ? 55 LEU A N      2  
ATOM 8705   C CA     . LEU A 1 55 ? -10.493 33.829  -14.324 1.00 0.00 ? 55 LEU A CA     2  
ATOM 8706   C C      . LEU A 1 55 ? -11.208 34.312  -13.065 1.00 0.00 ? 55 LEU A C      2  
ATOM 8707   O O      . LEU A 1 55 ? -11.080 33.709  -12.002 1.00 0.00 ? 55 LEU A O      2  
ATOM 8708   C CB     . LEU A 1 55 ? -10.177 32.332  -14.244 1.00 0.00 ? 55 LEU A CB     2  
ATOM 8709   C CG     . LEU A 1 55 ? -9.191  31.828  -15.300 1.00 0.00 ? 55 LEU A CG     2  
ATOM 8710   C CD1    . LEU A 1 55 ? -8.633  30.480  -14.848 1.00 0.00 ? 55 LEU A CD1    2  
ATOM 8711   C CD2    . LEU A 1 55 ? -9.876  31.693  -16.657 1.00 0.00 ? 55 LEU A CD2    2  
ATOM 8712   H H      . LEU A 1 55 ? -8.432  34.180  -13.990 1.00 0.00 ? 55 LEU A H      2  
ATOM 8713   H HA     . LEU A 1 55 ? -11.121 34.015  -15.196 1.00 0.00 ? 55 LEU A HA     2  
ATOM 8714   H HB2    . LEU A 1 55 ? -9.753  32.117  -13.264 1.00 0.00 ? 55 LEU A HB2    2  
ATOM 8715   H HB3    . LEU A 1 55 ? -11.108 31.770  -14.329 1.00 0.00 ? 55 LEU A HB3    2  
ATOM 8716   H HG     . LEU A 1 55 ? -8.350  32.513  -15.397 1.00 0.00 ? 55 LEU A HG     2  
ATOM 8717   H HD11   . LEU A 1 55 ? -8.169  30.605  -13.871 1.00 0.00 ? 55 LEU A HD11   2  
ATOM 8718   H HD12   . LEU A 1 55 ? -9.436  29.748  -14.774 1.00 0.00 ? 55 LEU A HD12   2  
ATOM 8719   H HD13   . LEU A 1 55 ? -7.869  30.138  -15.546 1.00 0.00 ? 55 LEU A HD13   2  
ATOM 8720   H HD21   . LEU A 1 55 ? -10.247 32.668  -16.974 1.00 0.00 ? 55 LEU A HD21   2  
ATOM 8721   H HD22   . LEU A 1 55 ? -9.160  31.327  -17.392 1.00 0.00 ? 55 LEU A HD22   2  
ATOM 8722   H HD23   . LEU A 1 55 ? -10.710 30.996  -16.583 1.00 0.00 ? 55 LEU A HD23   2  
ATOM 8723   N N      . THR A 1 56 ? -12.045 35.335  -13.255 1.00 0.00 ? 56 THR A N      2  
ATOM 8724   C CA     . THR A 1 56 ? -12.713 36.150  -12.245 1.00 0.00 ? 56 THR A CA     2  
ATOM 8725   C C      . THR A 1 56 ? -12.969 37.557  -12.777 1.00 0.00 ? 56 THR A C      2  
ATOM 8726   O O      . THR A 1 56 ? -13.883 38.235  -12.310 1.00 0.00 ? 56 THR A O      2  
ATOM 8727   C CB     . THR A 1 56 ? -11.905 36.370  -10.959 1.00 0.00 ? 56 THR A CB     2  
ATOM 8728   O OG1    . THR A 1 56 ? -10.531 36.552  -11.227 1.00 0.00 ? 56 THR A OG1    2  
ATOM 8729   C CG2    . THR A 1 56 ? -12.100 35.276  -9.910  1.00 0.00 ? 56 THR A CG2    2  
ATOM 8730   H H      . THR A 1 56 ? -12.139 35.650  -14.210 1.00 0.00 ? 56 THR A H      2  
ATOM 8731   H HA     . THR A 1 56 ? -13.669 35.688  -12.002 1.00 0.00 ? 56 THR A HA     2  
ATOM 8732   H HB     . THR A 1 56 ? -12.267 37.292  -10.503 1.00 0.00 ? 56 THR A HB     2  
ATOM 8733   H HG1    . THR A 1 56 ? -10.128 36.957  -10.452 1.00 0.00 ? 56 THR A HG1    2  
ATOM 8734   H HG21   . THR A 1 56 ? -12.411 35.730  -8.969  1.00 0.00 ? 56 THR A HG21   2  
ATOM 8735   H HG22   . THR A 1 56 ? -12.867 34.573  -10.234 1.00 0.00 ? 56 THR A HG22   2  
ATOM 8736   H HG23   . THR A 1 56 ? -11.164 34.740  -9.751  1.00 0.00 ? 56 THR A HG23   2  
ATOM 8737   N N      . ALA A 1 57 ? -12.130 38.023  -13.709 1.00 0.00 ? 57 ALA A N      2  
ATOM 8738   C CA     . ALA A 1 57 ? -12.063 39.412  -14.132 1.00 0.00 ? 57 ALA A CA     2  
ATOM 8739   C C      . ALA A 1 57 ? -13.383 39.956  -14.681 1.00 0.00 ? 57 ALA A C      2  
ATOM 8740   O O      . ALA A 1 57 ? -14.179 39.197  -15.233 1.00 0.00 ? 57 ALA A O      2  
ATOM 8741   C CB     . ALA A 1 57 ? -10.943 39.550  -15.162 1.00 0.00 ? 57 ALA A CB     2  
ATOM 8742   H H      . ALA A 1 57 ? -11.405 37.408  -14.052 1.00 0.00 ? 57 ALA A H      2  
ATOM 8743   H HA     . ALA A 1 57 ? -11.781 39.992  -13.254 1.00 0.00 ? 57 ALA A HA     2  
ATOM 8744   H HB1    . ALA A 1 57 ? -10.004 39.196  -14.734 1.00 0.00 ? 57 ALA A HB1    2  
ATOM 8745   H HB2    . ALA A 1 57 ? -11.181 38.960  -16.048 1.00 0.00 ? 57 ALA A HB2    2  
ATOM 8746   H HB3    . ALA A 1 57 ? -10.830 40.595  -15.449 1.00 0.00 ? 57 ALA A HB3    2  
ATOM 8747   N N      . PRO A 1 58 ? -13.609 41.274  -14.583 1.00 0.00 ? 58 PRO A N      2  
ATOM 8748   C CA     . PRO A 1 58 ? -14.787 41.920  -15.134 1.00 0.00 ? 58 PRO A CA     2  
ATOM 8749   C C      . PRO A 1 58 ? -14.779 41.955  -16.660 1.00 0.00 ? 58 PRO A C      2  
ATOM 8750   O O      . PRO A 1 58 ? -13.844 41.493  -17.313 1.00 0.00 ? 58 PRO A O      2  
ATOM 8751   C CB     . PRO A 1 58 ? -14.827 43.336  -14.561 1.00 0.00 ? 58 PRO A CB     2  
ATOM 8752   C CG     . PRO A 1 58 ? -13.589 43.493  -13.681 1.00 0.00 ? 58 PRO A CG     2  
ATOM 8753   C CD     . PRO A 1 58 ? -12.771 42.218  -13.867 1.00 0.00 ? 58 PRO A CD     2  
ATOM 8754   H HA     . PRO A 1 58 ? -15.675 41.384  -14.802 1.00 0.00 ? 58 PRO A HA     2  
ATOM 8755   H HB2    . PRO A 1 58 ? -14.810 44.071  -15.367 1.00 0.00 ? 58 PRO A HB2    2  
ATOM 8756   H HB3    . PRO A 1 58 ? -15.729 43.470  -13.962 1.00 0.00 ? 58 PRO A HB3    2  
ATOM 8757   H HG2    . PRO A 1 58 ? -13.009 44.364  -13.987 1.00 0.00 ? 58 PRO A HG2    2  
ATOM 8758   H HG3    . PRO A 1 58 ? -13.888 43.589  -12.637 1.00 0.00 ? 58 PRO A HG3    2  
ATOM 8759   H HD2    . PRO A 1 58 ? -11.877 42.437  -14.451 1.00 0.00 ? 58 PRO A HD2    2  
ATOM 8760   H HD3    . PRO A 1 58 ? -12.495 41.828  -12.888 1.00 0.00 ? 58 PRO A HD3    2  
ATOM 8761   N N      . ASP A 1 59 ? -15.835 42.542  -17.228 1.00 0.00 ? 59 ASP A N      2  
ATOM 8762   C CA     . ASP A 1 59 ? -16.098 42.569  -18.657 1.00 0.00 ? 59 ASP A CA     2  
ATOM 8763   C C      . ASP A 1 59 ? -16.453 43.981  -19.122 1.00 0.00 ? 59 ASP A C      2  
ATOM 8764   O O      . ASP A 1 59 ? -16.681 44.878  -18.311 1.00 0.00 ? 59 ASP A O      2  
ATOM 8765   C CB     . ASP A 1 59 ? -17.219 41.568  -18.935 1.00 0.00 ? 59 ASP A CB     2  
ATOM 8766   C CG     . ASP A 1 59 ? -17.485 41.328  -20.419 1.00 0.00 ? 59 ASP A CG     2  
ATOM 8767   O OD1    . ASP A 1 59 ? -16.549 41.505  -21.230 1.00 0.00 ? 59 ASP A OD1    2  
ATOM 8768   O OD2    . ASP A 1 59 ? -18.631 40.957  -20.753 1.00 0.00 ? 59 ASP A OD2    2  
ATOM 8769   H H      . ASP A 1 59 ? -16.527 42.969  -16.629 1.00 0.00 ? 59 ASP A H      2  
ATOM 8770   H HA     . ASP A 1 59 ? -15.206 42.250  -19.196 1.00 0.00 ? 59 ASP A HA     2  
ATOM 8771   H HB2    . ASP A 1 59 ? -16.951 40.617  -18.473 1.00 0.00 ? 59 ASP A HB2    2  
ATOM 8772   H HB3    . ASP A 1 59 ? -18.129 41.930  -18.456 1.00 0.00 ? 59 ASP A HB3    2  
ATOM 8773   N N      . MET B 1 1  ? -12.128 15.014  1.213   1.00 0.00 ? 1  MET B N      2  
ATOM 8774   C CA     . MET B 1 1  ? -10.710 15.399  1.311   1.00 0.00 ? 1  MET B CA     2  
ATOM 8775   C C      . MET B 1 1  ? -10.173 15.814  -0.051  1.00 0.00 ? 1  MET B C      2  
ATOM 8776   O O      . MET B 1 1  ? -10.340 15.072  -1.014  1.00 0.00 ? 1  MET B O      2  
ATOM 8777   C CB     . MET B 1 1  ? -9.888  14.224  1.841   1.00 0.00 ? 1  MET B CB     2  
ATOM 8778   C CG     . MET B 1 1  ? -8.495  14.635  2.310   1.00 0.00 ? 1  MET B CG     2  
ATOM 8779   S SD     . MET B 1 1  ? -8.475  15.408  3.944   1.00 0.00 ? 1  MET B SD     2  
ATOM 8780   C CE     . MET B 1 1  ? -8.594  13.863  4.878   1.00 0.00 ? 1  MET B CE     2  
ATOM 8781   H H1     . MET B 1 1  ? -12.492 14.786  2.128   1.00 0.00 ? 1  MET B H1     2  
ATOM 8782   H H2     . MET B 1 1  ? -12.221 14.200  0.621   1.00 0.00 ? 1  MET B H2     2  
ATOM 8783   H H3     . MET B 1 1  ? -12.673 15.767  0.818   1.00 0.00 ? 1  MET B H3     2  
ATOM 8784   H HA     . MET B 1 1  ? -10.609 16.237  2.001   1.00 0.00 ? 1  MET B HA     2  
ATOM 8785   H HB2    . MET B 1 1  ? -10.419 13.771  2.679   1.00 0.00 ? 1  MET B HB2    2  
ATOM 8786   H HB3    . MET B 1 1  ? -9.781  13.480  1.051   1.00 0.00 ? 1  MET B HB3    2  
ATOM 8787   H HG2    . MET B 1 1  ? -7.890  13.729  2.368   1.00 0.00 ? 1  MET B HG2    2  
ATOM 8788   H HG3    . MET B 1 1  ? -8.048  15.316  1.586   1.00 0.00 ? 1  MET B HG3    2  
ATOM 8789   H HE1    . MET B 1 1  ? -7.719  13.250  4.660   1.00 0.00 ? 1  MET B HE1    2  
ATOM 8790   H HE2    . MET B 1 1  ? -8.647  14.073  5.945   1.00 0.00 ? 1  MET B HE2    2  
ATOM 8791   H HE3    . MET B 1 1  ? -9.482  13.315  4.559   1.00 0.00 ? 1  MET B HE3    2  
ATOM 8792   N N      . LEU B 1 2  ? -9.489  16.957  -0.126  1.00 0.00 ? 2  LEU B N      2  
ATOM 8793   C CA     . LEU B 1 2  ? -8.713  17.367  -1.285  1.00 0.00 ? 2  LEU B CA     2  
ATOM 8794   C C      . LEU B 1 2  ? -7.240  17.303  -0.899  1.00 0.00 ? 2  LEU B C      2  
ATOM 8795   O O      . LEU B 1 2  ? -6.830  17.931  0.074   1.00 0.00 ? 2  LEU B O      2  
ATOM 8796   C CB     . LEU B 1 2  ? -9.164  18.763  -1.719  1.00 0.00 ? 2  LEU B CB     2  
ATOM 8797   C CG     . LEU B 1 2  ? -8.527  19.289  -3.008  1.00 0.00 ? 2  LEU B CG     2  
ATOM 8798   C CD1    . LEU B 1 2  ? -7.161  19.923  -2.759  1.00 0.00 ? 2  LEU B CD1    2  
ATOM 8799   C CD2    . LEU B 1 2  ? -8.367  18.221  -4.086  1.00 0.00 ? 2  LEU B CD2    2  
ATOM 8800   H H      . LEU B 1 2  ? -9.412  17.535  0.700   1.00 0.00 ? 2  LEU B H      2  
ATOM 8801   H HA     . LEU B 1 2  ? -8.895  16.667  -2.101  1.00 0.00 ? 2  LEU B HA     2  
ATOM 8802   H HB2    . LEU B 1 2  ? -10.243 18.735  -1.869  1.00 0.00 ? 2  LEU B HB2    2  
ATOM 8803   H HB3    . LEU B 1 2  ? -8.968  19.466  -0.911  1.00 0.00 ? 2  LEU B HB3    2  
ATOM 8804   H HG     . LEU B 1 2  ? -9.183  20.065  -3.403  1.00 0.00 ? 2  LEU B HG     2  
ATOM 8805   H HD11   . LEU B 1 2  ? -6.409  19.152  -2.593  1.00 0.00 ? 2  LEU B HD11   2  
ATOM 8806   H HD12   . LEU B 1 2  ? -6.882  20.509  -3.634  1.00 0.00 ? 2  LEU B HD12   2  
ATOM 8807   H HD13   . LEU B 1 2  ? -7.208  20.578  -1.889  1.00 0.00 ? 2  LEU B HD13   2  
ATOM 8808   H HD21   . LEU B 1 2  ? -8.001  18.694  -4.995  1.00 0.00 ? 2  LEU B HD21   2  
ATOM 8809   H HD22   . LEU B 1 2  ? -7.649  17.460  -3.781  1.00 0.00 ? 2  LEU B HD22   2  
ATOM 8810   H HD23   . LEU B 1 2  ? -9.330  17.755  -4.297  1.00 0.00 ? 2  LEU B HD23   2  
ATOM 8811   N N      . ILE B 1 3  ? -6.448  16.515  -1.630  1.00 0.00 ? 3  ILE B N      2  
ATOM 8812   C CA     . ILE B 1 3  ? -5.109  16.134  -1.208  1.00 0.00 ? 3  ILE B CA     2  
ATOM 8813   C C      . ILE B 1 3  ? -4.050  16.657  -2.168  1.00 0.00 ? 3  ILE B C      2  
ATOM 8814   O O      . ILE B 1 3  ? -4.231  16.614  -3.384  1.00 0.00 ? 3  ILE B O      2  
ATOM 8815   C CB     . ILE B 1 3  ? -5.042  14.611  -1.076  1.00 0.00 ? 3  ILE B CB     2  
ATOM 8816   C CG1    . ILE B 1 3  ? -6.151  14.156  -0.125  1.00 0.00 ? 3  ILE B CG1    2  
ATOM 8817   C CG2    . ILE B 1 3  ? -3.692  14.146  -0.531  1.00 0.00 ? 3  ILE B CG2    2  
ATOM 8818   C CD1    . ILE B 1 3  ? -6.334  12.645  -0.138  1.00 0.00 ? 3  ILE B CD1    2  
ATOM 8819   H H      . ILE B 1 3  ? -6.851  16.005  -2.404  1.00 0.00 ? 3  ILE B H      2  
ATOM 8820   H HA     . ILE B 1 3  ? -4.910  16.557  -0.223  1.00 0.00 ? 3  ILE B HA     2  
ATOM 8821   H HB     . ILE B 1 3  ? -5.200  14.163  -2.057  1.00 0.00 ? 3  ILE B HB     2  
ATOM 8822   H HG12   . ILE B 1 3  ? -5.926  14.490  0.887   1.00 0.00 ? 3  ILE B HG12   2  
ATOM 8823   H HG13   . ILE B 1 3  ? -7.109  14.580  -0.420  1.00 0.00 ? 3  ILE B HG13   2  
ATOM 8824   H HG21   . ILE B 1 3  ? -3.494  14.618  0.430   1.00 0.00 ? 3  ILE B HG21   2  
ATOM 8825   H HG22   . ILE B 1 3  ? -3.703  13.062  -0.403  1.00 0.00 ? 3  ILE B HG22   2  
ATOM 8826   H HG23   . ILE B 1 3  ? -2.897  14.399  -1.233  1.00 0.00 ? 3  ILE B HG23   2  
ATOM 8827   H HD11   . ILE B 1 3  ? -5.497  12.150  0.355   1.00 0.00 ? 3  ILE B HD11   2  
ATOM 8828   H HD12   . ILE B 1 3  ? -7.250  12.443  0.412   1.00 0.00 ? 3  ILE B HD12   2  
ATOM 8829   H HD13   . ILE B 1 3  ? -6.436  12.285  -1.162  1.00 0.00 ? 3  ILE B HD13   2  
ATOM 8830   N N      . LEU B 1 4  ? -2.935  17.126  -1.603  1.00 0.00 ? 4  LEU B N      2  
ATOM 8831   C CA     . LEU B 1 4  ? -1.830  17.711  -2.339  1.00 0.00 ? 4  LEU B CA     2  
ATOM 8832   C C      . LEU B 1 4  ? -0.493  17.186  -1.831  1.00 0.00 ? 4  LEU B C      2  
ATOM 8833   O O      . LEU B 1 4  ? -0.242  17.160  -0.626  1.00 0.00 ? 4  LEU B O      2  
ATOM 8834   C CB     . LEU B 1 4  ? -1.891  19.234  -2.221  1.00 0.00 ? 4  LEU B CB     2  
ATOM 8835   C CG     . LEU B 1 4  ? -3.055  19.842  -3.004  1.00 0.00 ? 4  LEU B CG     2  
ATOM 8836   C CD1    . LEU B 1 4  ? -3.090  21.340  -2.725  1.00 0.00 ? 4  LEU B CD1    2  
ATOM 8837   C CD2    . LEU B 1 4  ? -2.886  19.661  -4.510  1.00 0.00 ? 4  LEU B CD2    2  
ATOM 8838   H H      . LEU B 1 4  ? -2.859  17.105  -0.595  1.00 0.00 ? 4  LEU B H      2  
ATOM 8839   H HA     . LEU B 1 4  ? -1.916  17.440  -3.389  1.00 0.00 ? 4  LEU B HA     2  
ATOM 8840   H HB2    . LEU B 1 4  ? -1.988  19.502  -1.169  1.00 0.00 ? 4  LEU B HB2    2  
ATOM 8841   H HB3    . LEU B 1 4  ? -0.956  19.652  -2.595  1.00 0.00 ? 4  LEU B HB3    2  
ATOM 8842   H HG     . LEU B 1 4  ? -4.000  19.402  -2.685  1.00 0.00 ? 4  LEU B HG     2  
ATOM 8843   H HD11   . LEU B 1 4  ? -3.877  21.802  -3.321  1.00 0.00 ? 4  LEU B HD11   2  
ATOM 8844   H HD12   . LEU B 1 4  ? -3.292  21.508  -1.668  1.00 0.00 ? 4  LEU B HD12   2  
ATOM 8845   H HD13   . LEU B 1 4  ? -2.124  21.770  -2.991  1.00 0.00 ? 4  LEU B HD13   2  
ATOM 8846   H HD21   . LEU B 1 4  ? -3.589  20.309  -5.032  1.00 0.00 ? 4  LEU B HD21   2  
ATOM 8847   H HD22   . LEU B 1 4  ? -1.870  19.917  -4.808  1.00 0.00 ? 4  LEU B HD22   2  
ATOM 8848   H HD23   . LEU B 1 4  ? -3.102  18.629  -4.782  1.00 0.00 ? 4  LEU B HD23   2  
ATOM 8849   N N      . THR B 1 5  ? 0.391   16.828  -2.765  1.00 0.00 ? 5  THR B N      2  
ATOM 8850   C CA     . THR B 1 5  ? 1.780   16.530  -2.463  1.00 0.00 ? 5  THR B CA     2  
ATOM 8851   C C      . THR B 1 5  ? 2.601   17.794  -2.676  1.00 0.00 ? 5  THR B C      2  
ATOM 8852   O O      . THR B 1 5  ? 2.583   18.386  -3.753  1.00 0.00 ? 5  THR B O      2  
ATOM 8853   C CB     . THR B 1 5  ? 2.292   15.384  -3.332  1.00 0.00 ? 5  THR B CB     2  
ATOM 8854   O OG1    . THR B 1 5  ? 1.424   14.276  -3.258  1.00 0.00 ? 5  THR B OG1    2  
ATOM 8855   C CG2    . THR B 1 5  ? 3.640   14.890  -2.823  1.00 0.00 ? 5  THR B CG2    2  
ATOM 8856   H H      . THR B 1 5  ? 0.134   16.918  -3.738  1.00 0.00 ? 5  THR B H      2  
ATOM 8857   H HA     . THR B 1 5  ? 1.865   16.225  -1.420  1.00 0.00 ? 5  THR B HA     2  
ATOM 8858   H HB     . THR B 1 5  ? 2.389   15.722  -4.363  1.00 0.00 ? 5  THR B HB     2  
ATOM 8859   H HG1    . THR B 1 5  ? 0.613   14.484  -3.732  1.00 0.00 ? 5  THR B HG1    2  
ATOM 8860   H HG21   . THR B 1 5  ? 4.018   14.142  -3.520  1.00 0.00 ? 5  THR B HG21   2  
ATOM 8861   H HG22   . THR B 1 5  ? 4.340   15.723  -2.770  1.00 0.00 ? 5  THR B HG22   2  
ATOM 8862   H HG23   . THR B 1 5  ? 3.507   14.446  -1.836  1.00 0.00 ? 5  THR B HG23   2  
ATOM 8863   N N      . ARG B 1 6  ? 3.278   18.230  -1.614  1.00 0.00 ? 6  ARG B N      2  
ATOM 8864   C CA     . ARG B 1 6  ? 3.965   19.506  -1.522  1.00 0.00 ? 6  ARG B CA     2  
ATOM 8865   C C      . ARG B 1 6  ? 5.436   19.257  -1.220  1.00 0.00 ? 6  ARG B C      2  
ATOM 8866   O O      . ARG B 1 6  ? 5.765   18.180  -0.730  1.00 0.00 ? 6  ARG B O      2  
ATOM 8867   C CB     . ARG B 1 6  ? 3.290   20.298  -0.398  1.00 0.00 ? 6  ARG B CB     2  
ATOM 8868   C CG     . ARG B 1 6  ? 3.346   21.816  -0.562  1.00 0.00 ? 6  ARG B CG     2  
ATOM 8869   C CD     . ARG B 1 6  ? 2.458   22.358  -1.683  1.00 0.00 ? 6  ARG B CD     2  
ATOM 8870   N NE     . ARG B 1 6  ? 3.045   22.157  -3.010  1.00 0.00 ? 6  ARG B NE     2  
ATOM 8871   C CZ     . ARG B 1 6  ? 2.426   21.740  -4.118  1.00 0.00 ? 6  ARG B CZ     2  
ATOM 8872   N NH1    . ARG B 1 6  ? 1.139   21.393  -4.125  1.00 0.00 ? 6  ARG B NH1    2  
ATOM 8873   N NH2    . ARG B 1 6  ? 3.127   21.669  -5.247  1.00 0.00 ? 6  ARG B NH2    2  
ATOM 8874   H H      . ARG B 1 6  ? 3.229   17.685  -0.763  1.00 0.00 ? 6  ARG B H      2  
ATOM 8875   H HA     . ARG B 1 6  ? 3.892   20.026  -2.475  1.00 0.00 ? 6  ARG B HA     2  
ATOM 8876   H HB2    . ARG B 1 6  ? 2.245   20.006  -0.307  1.00 0.00 ? 6  ARG B HB2    2  
ATOM 8877   H HB3    . ARG B 1 6  ? 3.774   20.039  0.544   1.00 0.00 ? 6  ARG B HB3    2  
ATOM 8878   H HG2    . ARG B 1 6  ? 3.006   22.262  0.372   1.00 0.00 ? 6  ARG B HG2    2  
ATOM 8879   H HG3    . ARG B 1 6  ? 4.383   22.106  -0.717  1.00 0.00 ? 6  ARG B HG3    2  
ATOM 8880   H HD2    . ARG B 1 6  ? 1.478   21.886  -1.624  1.00 0.00 ? 6  ARG B HD2    2  
ATOM 8881   H HD3    . ARG B 1 6  ? 2.341   23.432  -1.531  1.00 0.00 ? 6  ARG B HD3    2  
ATOM 8882   H HE     . ARG B 1 6  ? 4.035   22.335  -3.109  1.00 0.00 ? 6  ARG B HE     2  
ATOM 8883   H HH11   . ARG B 1 6  ? 0.614   21.413  -3.264  1.00 0.00 ? 6  ARG B HH11   2  
ATOM 8884   H HH12   . ARG B 1 6  ? 0.742   20.979  -4.956  1.00 0.00 ? 6  ARG B HH12   2  
ATOM 8885   H HH21   . ARG B 1 6  ? 4.123   21.837  -5.199  1.00 0.00 ? 6  ARG B HH21   2  
ATOM 8886   H HH22   . ARG B 1 6  ? 2.669   21.583  -6.145  1.00 0.00 ? 6  ARG B HH22   2  
ATOM 8887   N N      . LYS B 1 7  ? 6.326   20.221  -1.473  1.00 0.00 ? 7  LYS B N      2  
ATOM 8888   C CA     . LYS B 1 7  ? 7.690   20.150  -0.966  1.00 0.00 ? 7  LYS B CA     2  
ATOM 8889   C C      . LYS B 1 7  ? 8.003   21.335  -0.070  1.00 0.00 ? 7  LYS B C      2  
ATOM 8890   O O      . LYS B 1 7  ? 7.279   22.329  -0.071  1.00 0.00 ? 7  LYS B O      2  
ATOM 8891   C CB     . LYS B 1 7  ? 8.721   19.961  -2.078  1.00 0.00 ? 7  LYS B CB     2  
ATOM 8892   C CG     . LYS B 1 7  ? 9.106   21.222  -2.851  1.00 0.00 ? 7  LYS B CG     2  
ATOM 8893   C CD     . LYS B 1 7  ? 10.298  20.928  -3.758  1.00 0.00 ? 7  LYS B CD     2  
ATOM 8894   C CE     . LYS B 1 7  ? 10.560  22.082  -4.726  1.00 0.00 ? 7  LYS B CE     2  
ATOM 8895   N NZ     . LYS B 1 7  ? 9.570   22.124  -5.819  1.00 0.00 ? 7  LYS B NZ     2  
ATOM 8896   H H      . LYS B 1 7  ? 6.022   21.067  -1.936  1.00 0.00 ? 7  LYS B H      2  
ATOM 8897   H HA     . LYS B 1 7  ? 7.769   19.273  -0.324  1.00 0.00 ? 7  LYS B HA     2  
ATOM 8898   H HB2    . LYS B 1 7  ? 9.623   19.529  -1.644  1.00 0.00 ? 7  LYS B HB2    2  
ATOM 8899   H HB3    . LYS B 1 7  ? 8.307   19.253  -2.791  1.00 0.00 ? 7  LYS B HB3    2  
ATOM 8900   H HG2    . LYS B 1 7  ? 8.256   21.518  -3.464  1.00 0.00 ? 7  LYS B HG2    2  
ATOM 8901   H HG3    . LYS B 1 7  ? 9.369   22.027  -2.165  1.00 0.00 ? 7  LYS B HG3    2  
ATOM 8902   H HD2    . LYS B 1 7  ? 11.183  20.782  -3.138  1.00 0.00 ? 7  LYS B HD2    2  
ATOM 8903   H HD3    . LYS B 1 7  ? 10.114  20.012  -4.320  1.00 0.00 ? 7  LYS B HD3    2  
ATOM 8904   H HE2    . LYS B 1 7  ? 10.544  23.022  -4.174  1.00 0.00 ? 7  LYS B HE2    2  
ATOM 8905   H HE3    . LYS B 1 7  ? 11.556  21.954  -5.152  1.00 0.00 ? 7  LYS B HE3    2  
ATOM 8906   H HZ1    . LYS B 1 7  ? 9.511   21.226  -6.277  1.00 0.00 ? 7  LYS B HZ1    2  
ATOM 8907   H HZ2    . LYS B 1 7  ? 8.654   22.375  -5.471  1.00 0.00 ? 7  LYS B HZ2    2  
ATOM 8908   H HZ3    . LYS B 1 7  ? 9.838   22.815  -6.505  1.00 0.00 ? 7  LYS B HZ3    2  
ATOM 8909   N N      . VAL B 1 8  ? 9.069   21.213  0.723   1.00 0.00 ? 8  VAL B N      2  
ATOM 8910   C CA     . VAL B 1 8  ? 9.376   22.239  1.706   1.00 0.00 ? 8  VAL B CA     2  
ATOM 8911   C C      . VAL B 1 8  ? 9.670   23.566  1.017   1.00 0.00 ? 8  VAL B C      2  
ATOM 8912   O O      . VAL B 1 8  ? 10.479  23.643  0.095   1.00 0.00 ? 8  VAL B O      2  
ATOM 8913   C CB     . VAL B 1 8  ? 10.481  21.809  2.670   1.00 0.00 ? 8  VAL B CB     2  
ATOM 8914   C CG1    . VAL B 1 8  ? 10.064  20.472  3.278   1.00 0.00 ? 8  VAL B CG1    2  
ATOM 8915   C CG2    . VAL B 1 8  ? 11.868  21.661  2.051   1.00 0.00 ? 8  VAL B CG2    2  
ATOM 8916   H H      . VAL B 1 8  ? 9.611   20.361  0.704   1.00 0.00 ? 8  VAL B H      2  
ATOM 8917   H HA     . VAL B 1 8  ? 8.484   22.370  2.318   1.00 0.00 ? 8  VAL B HA     2  
ATOM 8918   H HB     . VAL B 1 8  ? 10.546  22.552  3.463   1.00 0.00 ? 8  VAL B HB     2  
ATOM 8919   H HG11   . VAL B 1 8  ? 10.750  20.207  4.083   1.00 0.00 ? 8  VAL B HG11   2  
ATOM 8920   H HG12   . VAL B 1 8  ? 9.049   20.562  3.666   1.00 0.00 ? 8  VAL B HG12   2  
ATOM 8921   H HG13   . VAL B 1 8  ? 10.087  19.695  2.514   1.00 0.00 ? 8  VAL B HG13   2  
ATOM 8922   H HG21   . VAL B 1 8  ? 11.812  21.051  1.151   1.00 0.00 ? 8  VAL B HG21   2  
ATOM 8923   H HG22   . VAL B 1 8  ? 12.264  22.645  1.801   1.00 0.00 ? 8  VAL B HG22   2  
ATOM 8924   H HG23   . VAL B 1 8  ? 12.528  21.190  2.779   1.00 0.00 ? 8  VAL B HG23   2  
ATOM 8925   N N      . GLY B 1 9  ? 8.938   24.599  1.436   1.00 0.00 ? 9  GLY B N      2  
ATOM 8926   C CA     . GLY B 1 9  ? 9.028   25.938  0.874   1.00 0.00 ? 9  GLY B CA     2  
ATOM 8927   C C      . GLY B 1 9  ? 7.940   26.290  -0.136  1.00 0.00 ? 9  GLY B C      2  
ATOM 8928   O O      . GLY B 1 9  ? 7.890   27.437  -0.578  1.00 0.00 ? 9  GLY B O      2  
ATOM 8929   H H      . GLY B 1 9  ? 8.314   24.445  2.218   1.00 0.00 ? 9  GLY B H      2  
ATOM 8930   H HA2    . GLY B 1 9  ? 8.972   26.655  1.692   1.00 0.00 ? 9  GLY B HA2    2  
ATOM 8931   H HA3    . GLY B 1 9  ? 9.996   26.060  0.388   1.00 0.00 ? 9  GLY B HA3    2  
ATOM 8932   N N      . GLU B 1 10 ? 7.059   25.355  -0.504  1.00 0.00 ? 10 GLU B N      2  
ATOM 8933   C CA     . GLU B 1 10 ? 5.917   25.654  -1.357  1.00 0.00 ? 10 GLU B CA     2  
ATOM 8934   C C      . GLU B 1 10 ? 4.701   26.081  -0.534  1.00 0.00 ? 10 GLU B C      2  
ATOM 8935   O O      . GLU B 1 10 ? 4.666   25.910  0.684   1.00 0.00 ? 10 GLU B O      2  
ATOM 8936   C CB     . GLU B 1 10 ? 5.593   24.476  -2.275  1.00 0.00 ? 10 GLU B CB     2  
ATOM 8937   C CG     . GLU B 1 10 ? 6.817   23.933  -3.013  1.00 0.00 ? 10 GLU B CG     2  
ATOM 8938   C CD     . GLU B 1 10 ? 6.420   23.034  -4.176  1.00 0.00 ? 10 GLU B CD     2  
ATOM 8939   O OE1    . GLU B 1 10 ? 5.591   22.127  -3.946  1.00 0.00 ? 10 GLU B OE1    2  
ATOM 8940   O OE2    . GLU B 1 10 ? 7.027   23.174  -5.262  1.00 0.00 ? 10 GLU B OE2    2  
ATOM 8941   H H      . GLU B 1 10 ? 7.144   24.418  -0.133  1.00 0.00 ? 10 GLU B H      2  
ATOM 8942   H HA     . GLU B 1 10 ? 6.180   26.494  -2.000  1.00 0.00 ? 10 GLU B HA     2  
ATOM 8943   H HB2    . GLU B 1 10 ? 5.164   23.677  -1.676  1.00 0.00 ? 10 GLU B HB2    2  
ATOM 8944   H HB3    . GLU B 1 10 ? 4.853   24.798  -3.008  1.00 0.00 ? 10 GLU B HB3    2  
ATOM 8945   H HG2    . GLU B 1 10 ? 7.416   24.767  -3.381  1.00 0.00 ? 10 GLU B HG2    2  
ATOM 8946   H HG3    . GLU B 1 10 ? 7.419   23.338  -2.327  1.00 0.00 ? 10 GLU B HG3    2  
ATOM 8947   N N      . SER B 1 11 ? 3.690   26.646  -1.203  1.00 0.00 ? 11 SER B N      2  
ATOM 8948   C CA     . SER B 1 11 ? 2.561   27.302  -0.559  1.00 0.00 ? 11 SER B CA     2  
ATOM 8949   C C      . SER B 1 11 ? 1.221   26.810  -1.097  1.00 0.00 ? 11 SER B C      2  
ATOM 8950   O O      . SER B 1 11 ? 1.116   26.374  -2.242  1.00 0.00 ? 11 SER B O      2  
ATOM 8951   C CB     . SER B 1 11 ? 2.669   28.814  -0.742  1.00 0.00 ? 11 SER B CB     2  
ATOM 8952   O OG     . SER B 1 11 ? 3.724   29.339  0.035   1.00 0.00 ? 11 SER B OG     2  
ATOM 8953   H H      . SER B 1 11 ? 3.747   26.711  -2.209  1.00 0.00 ? 11 SER B H      2  
ATOM 8954   H HA     . SER B 1 11 ? 2.583   27.089  0.509   1.00 0.00 ? 11 SER B HA     2  
ATOM 8955   H HB2    . SER B 1 11 ? 2.855   29.030  -1.794  1.00 0.00 ? 11 SER B HB2    2  
ATOM 8956   H HB3    . SER B 1 11 ? 1.732   29.292  -0.454  1.00 0.00 ? 11 SER B HB3    2  
ATOM 8957   H HG     . SER B 1 11 ? 3.435   29.384  0.953   1.00 0.00 ? 11 SER B HG     2  
ATOM 8958   N N      . ILE B 1 12 ? 0.186   26.915  -0.260  1.00 0.00 ? 12 ILE B N      2  
ATOM 8959   C CA     . ILE B 1 12 ? -1.168  26.435  -0.492  1.00 0.00 ? 12 ILE B CA     2  
ATOM 8960   C C      . ILE B 1 12 ? -2.164  27.544  -0.160  1.00 0.00 ? 12 ILE B C      2  
ATOM 8961   O O      . ILE B 1 12 ? -1.856  28.432  0.634   1.00 0.00 ? 12 ILE B O      2  
ATOM 8962   C CB     . ILE B 1 12 ? -1.385  25.155  0.322   1.00 0.00 ? 12 ILE B CB     2  
ATOM 8963   C CG1    . ILE B 1 12 ? -0.615  24.013  -0.348  1.00 0.00 ? 12 ILE B CG1    2  
ATOM 8964   C CG2    . ILE B 1 12 ? -2.863  24.796  0.484   1.00 0.00 ? 12 ILE B CG2    2  
ATOM 8965   C CD1    . ILE B 1 12 ? -0.865  22.661  0.315   1.00 0.00 ? 12 ILE B CD1    2  
ATOM 8966   H H      . ILE B 1 12 ? 0.353   27.357  0.634   1.00 0.00 ? 12 ILE B H      2  
ATOM 8967   H HA     . ILE B 1 12 ? -1.277  26.190  -1.546  1.00 0.00 ? 12 ILE B HA     2  
ATOM 8968   H HB     . ILE B 1 12 ? -0.964  25.300  1.317   1.00 0.00 ? 12 ILE B HB     2  
ATOM 8969   H HG12   . ILE B 1 12 ? -0.903  23.943  -1.396  1.00 0.00 ? 12 ILE B HG12   2  
ATOM 8970   H HG13   . ILE B 1 12 ? 0.452   24.228  -0.293  1.00 0.00 ? 12 ILE B HG13   2  
ATOM 8971   H HG21   . ILE B 1 12 ? -2.969  23.922  1.126   1.00 0.00 ? 12 ILE B HG21   2  
ATOM 8972   H HG22   . ILE B 1 12 ? -3.403  25.612  0.964   1.00 0.00 ? 12 ILE B HG22   2  
ATOM 8973   H HG23   . ILE B 1 12 ? -3.301  24.579  -0.491  1.00 0.00 ? 12 ILE B HG23   2  
ATOM 8974   H HD11   . ILE B 1 12 ? -1.875  22.328  0.072   1.00 0.00 ? 12 ILE B HD11   2  
ATOM 8975   H HD12   . ILE B 1 12 ? -0.148  21.932  -0.062  1.00 0.00 ? 12 ILE B HD12   2  
ATOM 8976   H HD13   . ILE B 1 12 ? -0.755  22.755  1.395   1.00 0.00 ? 12 ILE B HD13   2  
ATOM 8977   N N      . ASN B 1 13 ? -3.355  27.524  -0.764  1.00 0.00 ? 13 ASN B N      2  
ATOM 8978   C CA     . ASN B 1 13 ? -4.335  28.593  -0.630  1.00 0.00 ? 13 ASN B CA     2  
ATOM 8979   C C      . ASN B 1 13 ? -5.742  28.044  -0.399  1.00 0.00 ? 13 ASN B C      2  
ATOM 8980   O O      . ASN B 1 13 ? -6.148  27.072  -1.032  1.00 0.00 ? 13 ASN B O      2  
ATOM 8981   C CB     . ASN B 1 13 ? -4.300  29.508  -1.857  1.00 0.00 ? 13 ASN B CB     2  
ATOM 8982   C CG     . ASN B 1 13 ? -2.888  29.936  -2.233  1.00 0.00 ? 13 ASN B CG     2  
ATOM 8983   O OD1    . ASN B 1 13 ? -2.280  29.366  -3.135  1.00 0.00 ? 13 ASN B OD1    2  
ATOM 8984   N ND2    . ASN B 1 13 ? -2.332  30.931  -1.547  1.00 0.00 ? 13 ASN B ND2    2  
ATOM 8985   H H      . ASN B 1 13 ? -3.610  26.701  -1.295  1.00 0.00 ? 13 ASN B H      2  
ATOM 8986   H HA     . ASN B 1 13 ? -4.078  29.201  0.237   1.00 0.00 ? 13 ASN B HA     2  
ATOM 8987   H HB2    . ASN B 1 13 ? -4.752  29.002  -2.710  1.00 0.00 ? 13 ASN B HB2    2  
ATOM 8988   H HB3    . ASN B 1 13 ? -4.890  30.401  -1.647  1.00 0.00 ? 13 ASN B HB3    2  
ATOM 8989   H HD21   . ASN B 1 13 ? -2.812  31.353  -0.764  1.00 0.00 ? 13 ASN B HD21   2  
ATOM 8990   H HD22   . ASN B 1 13 ? -1.396  31.226  -1.788  1.00 0.00 ? 13 ASN B HD22   2  
ATOM 8991   N N      . ILE B 1 14 ? -6.502  28.691  0.491   1.00 0.00 ? 14 ILE B N      2  
ATOM 8992   C CA     . ILE B 1 14 ? -7.867  28.318  0.830   1.00 0.00 ? 14 ILE B CA     2  
ATOM 8993   C C      . ILE B 1 14 ? -8.752  29.561  0.821   1.00 0.00 ? 14 ILE B C      2  
ATOM 8994   O O      . ILE B 1 14 ? -8.445  30.560  1.468   1.00 0.00 ? 14 ILE B O      2  
ATOM 8995   C CB     . ILE B 1 14 ? -7.912  27.605  2.185   1.00 0.00 ? 14 ILE B CB     2  
ATOM 8996   C CG1    . ILE B 1 14 ? -7.120  26.294  2.125   1.00 0.00 ? 14 ILE B CG1    2  
ATOM 8997   C CG2    . ILE B 1 14 ? -9.362  27.356  2.607   1.00 0.00 ? 14 ILE B CG2    2  
ATOM 8998   C CD1    . ILE B 1 14 ? -7.066  25.556  3.461   1.00 0.00 ? 14 ILE B CD1    2  
ATOM 8999   H H      . ILE B 1 14 ? -6.127  29.514  0.943   1.00 0.00 ? 14 ILE B H      2  
ATOM 9000   H HA     . ILE B 1 14 ? -8.248  27.631  0.073   1.00 0.00 ? 14 ILE B HA     2  
ATOM 9001   H HB     . ILE B 1 14 ? -7.448  28.246  2.934   1.00 0.00 ? 14 ILE B HB     2  
ATOM 9002   H HG12   . ILE B 1 14 ? -7.557  25.636  1.373   1.00 0.00 ? 14 ILE B HG12   2  
ATOM 9003   H HG13   . ILE B 1 14 ? -6.093  26.513  1.832   1.00 0.00 ? 14 ILE B HG13   2  
ATOM 9004   H HG21   . ILE B 1 14 ? -9.877  28.305  2.763   1.00 0.00 ? 14 ILE B HG21   2  
ATOM 9005   H HG22   . ILE B 1 14 ? -9.889  26.789  1.838   1.00 0.00 ? 14 ILE B HG22   2  
ATOM 9006   H HG23   . ILE B 1 14 ? -9.393  26.805  3.546   1.00 0.00 ? 14 ILE B HG23   2  
ATOM 9007   H HD11   . ILE B 1 14 ? -6.799  26.249  4.258   1.00 0.00 ? 14 ILE B HD11   2  
ATOM 9008   H HD12   . ILE B 1 14 ? -8.030  25.098  3.678   1.00 0.00 ? 14 ILE B HD12   2  
ATOM 9009   H HD13   . ILE B 1 14 ? -6.312  24.770  3.407   1.00 0.00 ? 14 ILE B HD13   2  
ATOM 9010   N N      . GLY B 1 15 ? -9.870  29.496  0.094   1.00 0.00 ? 15 GLY B N      2  
ATOM 9011   C CA     . GLY B 1 15 ? -10.755 30.630  -0.108  1.00 0.00 ? 15 GLY B CA     2  
ATOM 9012   C C      . GLY B 1 15 ? -10.012 31.799  -0.746  1.00 0.00 ? 15 GLY B C      2  
ATOM 9013   O O      . GLY B 1 15 ? -9.232  31.611  -1.679  1.00 0.00 ? 15 GLY B O      2  
ATOM 9014   H H      . GLY B 1 15 ? -10.069 28.647  -0.418  1.00 0.00 ? 15 GLY B H      2  
ATOM 9015   H HA2    . GLY B 1 15 ? -11.579 30.338  -0.760  1.00 0.00 ? 15 GLY B HA2    2  
ATOM 9016   H HA3    . GLY B 1 15 ? -11.163 30.943  0.853   1.00 0.00 ? 15 GLY B HA3    2  
ATOM 9017   N N      . ASP B 1 16 ? -10.235 33.005  -0.219  1.00 0.00 ? 16 ASP B N      2  
ATOM 9018   C CA     . ASP B 1 16 ? -9.503  34.203  -0.601  1.00 0.00 ? 16 ASP B CA     2  
ATOM 9019   C C      . ASP B 1 16 ? -8.902  34.936  0.597   1.00 0.00 ? 16 ASP B C      2  
ATOM 9020   O O      . ASP B 1 16 ? -8.296  35.993  0.426   1.00 0.00 ? 16 ASP B O      2  
ATOM 9021   C CB     . ASP B 1 16 ? -10.403 35.108  -1.444  1.00 0.00 ? 16 ASP B CB     2  
ATOM 9022   C CG     . ASP B 1 16 ? -11.540 35.735  -0.642  1.00 0.00 ? 16 ASP B CG     2  
ATOM 9023   O OD1    . ASP B 1 16 ? -12.491 34.999  -0.296  1.00 0.00 ? 16 ASP B OD1    2  
ATOM 9024   O OD2    . ASP B 1 16 ? -11.496 36.966  -0.426  1.00 0.00 ? 16 ASP B OD2    2  
ATOM 9025   H H      . ASP B 1 16 ? -10.977 33.110  0.459   1.00 0.00 ? 16 ASP B H      2  
ATOM 9026   H HA     . ASP B 1 16 ? -8.665  33.905  -1.233  1.00 0.00 ? 16 ASP B HA     2  
ATOM 9027   H HB2    . ASP B 1 16 ? -9.791  35.898  -1.881  1.00 0.00 ? 16 ASP B HB2    2  
ATOM 9028   H HB3    . ASP B 1 16 ? -10.823 34.525  -2.265  1.00 0.00 ? 16 ASP B HB3    2  
ATOM 9029   N N      . ASP B 1 17 ? -9.017  34.371  1.804   1.00 0.00 ? 17 ASP B N      2  
ATOM 9030   C CA     . ASP B 1 17 ? -8.475  34.956  3.022   1.00 0.00 ? 17 ASP B CA     2  
ATOM 9031   C C      . ASP B 1 17 ? -7.313  34.157  3.609   1.00 0.00 ? 17 ASP B C      2  
ATOM 9032   O O      . ASP B 1 17 ? -6.539  34.712  4.385   1.00 0.00 ? 17 ASP B O      2  
ATOM 9033   C CB     . ASP B 1 17 ? -9.578  35.114  4.068   1.00 0.00 ? 17 ASP B CB     2  
ATOM 9034   C CG     . ASP B 1 17 ? -10.646 36.114  3.637   1.00 0.00 ? 17 ASP B CG     2  
ATOM 9035   O OD1    . ASP B 1 17 ? -10.327 37.323  3.579   1.00 0.00 ? 17 ASP B OD1    2  
ATOM 9036   O OD2    . ASP B 1 17 ? -11.800 35.683  3.422   1.00 0.00 ? 17 ASP B OD2    2  
ATOM 9037   H H      . ASP B 1 17 ? -9.513  33.496  1.883   1.00 0.00 ? 17 ASP B H      2  
ATOM 9038   H HA     . ASP B 1 17 ? -8.093  35.953  2.802   1.00 0.00 ? 17 ASP B HA     2  
ATOM 9039   H HB2    . ASP B 1 17 ? -10.034 34.146  4.274   1.00 0.00 ? 17 ASP B HB2    2  
ATOM 9040   H HB3    . ASP B 1 17 ? -9.130  35.469  4.996   1.00 0.00 ? 17 ASP B HB3    2  
ATOM 9041   N N      . ILE B 1 18 ? -7.182  32.868  3.275   1.00 0.00 ? 18 ILE B N      2  
ATOM 9042   C CA     . ILE B 1 18 ? -6.251  31.971  3.942   1.00 0.00 ? 18 ILE B CA     2  
ATOM 9043   C C      . ILE B 1 18 ? -5.171  31.481  2.983   1.00 0.00 ? 18 ILE B C      2  
ATOM 9044   O O      . ILE B 1 18 ? -5.453  31.012  1.881   1.00 0.00 ? 18 ILE B O      2  
ATOM 9045   C CB     . ILE B 1 18 ? -6.986  30.792  4.588   1.00 0.00 ? 18 ILE B CB     2  
ATOM 9046   C CG1    . ILE B 1 18 ? -8.074  31.263  5.557   1.00 0.00 ? 18 ILE B CG1    2  
ATOM 9047   C CG2    . ILE B 1 18 ? -6.005  29.887  5.335   1.00 0.00 ? 18 ILE B CG2    2  
ATOM 9048   C CD1    . ILE B 1 18 ? -9.447  31.191  4.891   1.00 0.00 ? 18 ILE B CD1    2  
ATOM 9049   H H      . ILE B 1 18 ? -7.792  32.470  2.575   1.00 0.00 ? 18 ILE B H      2  
ATOM 9050   H HA     . ILE B 1 18 ? -5.753  32.516  4.744   1.00 0.00 ? 18 ILE B HA     2  
ATOM 9051   H HB     . ILE B 1 18 ? -7.450  30.202  3.800   1.00 0.00 ? 18 ILE B HB     2  
ATOM 9052   H HG12   . ILE B 1 18 ? -8.091  30.625  6.441   1.00 0.00 ? 18 ILE B HG12   2  
ATOM 9053   H HG13   . ILE B 1 18 ? -7.877  32.287  5.875   1.00 0.00 ? 18 ILE B HG13   2  
ATOM 9054   H HG21   . ILE B 1 18 ? -5.318  29.415  4.631   1.00 0.00 ? 18 ILE B HG21   2  
ATOM 9055   H HG22   . ILE B 1 18 ? -5.436  30.468  6.061   1.00 0.00 ? 18 ILE B HG22   2  
ATOM 9056   H HG23   . ILE B 1 18 ? -6.551  29.099  5.854   1.00 0.00 ? 18 ILE B HG23   2  
ATOM 9057   H HD11   . ILE B 1 18 ? -9.457  31.813  3.997   1.00 0.00 ? 18 ILE B HD11   2  
ATOM 9058   H HD12   . ILE B 1 18 ? -9.660  30.159  4.613   1.00 0.00 ? 18 ILE B HD12   2  
ATOM 9059   H HD13   . ILE B 1 18 ? -10.206 31.545  5.588   1.00 0.00 ? 18 ILE B HD13   2  
ATOM 9060   N N      . THR B 1 19 ? -3.929  31.502  3.470   1.00 0.00 ? 19 THR B N      2  
ATOM 9061   C CA     . THR B 1 19 ? -2.773  30.900  2.827   1.00 0.00 ? 19 THR B CA     2  
ATOM 9062   C C      . THR B 1 19 ? -2.020  30.034  3.832   1.00 0.00 ? 19 THR B C      2  
ATOM 9063   O O      . THR B 1 19 ? -2.050  30.289  5.034   1.00 0.00 ? 19 THR B O      2  
ATOM 9064   C CB     . THR B 1 19 ? -1.898  31.997  2.217   1.00 0.00 ? 19 THR B CB     2  
ATOM 9065   O OG1    . THR B 1 19 ? -2.562  32.532  1.092   1.00 0.00 ? 19 THR B OG1    2  
ATOM 9066   C CG2    . THR B 1 19 ? -0.528  31.512  1.745   1.00 0.00 ? 19 THR B CG2    2  
ATOM 9067   H H      . THR B 1 19 ? -3.790  31.927  4.377   1.00 0.00 ? 19 THR B H      2  
ATOM 9068   H HA     . THR B 1 19 ? -3.112  30.251  2.019   1.00 0.00 ? 19 THR B HA     2  
ATOM 9069   H HB     . THR B 1 19 ? -1.754  32.788  2.953   1.00 0.00 ? 19 THR B HB     2  
ATOM 9070   H HG1    . THR B 1 19 ? -2.170  33.388  0.893   1.00 0.00 ? 19 THR B HG1    2  
ATOM 9071   H HG21   . THR B 1 19 ? -0.647  30.676  1.057   1.00 0.00 ? 19 THR B HG21   2  
ATOM 9072   H HG22   . THR B 1 19 ? -0.013  32.325  1.233   1.00 0.00 ? 19 THR B HG22   2  
ATOM 9073   H HG23   . THR B 1 19 ? 0.073   31.203  2.600   1.00 0.00 ? 19 THR B HG23   2  
ATOM 9074   N N      . ILE B 1 20 ? -1.382  28.973  3.333   1.00 0.00 ? 20 ILE B N      2  
ATOM 9075   C CA     . ILE B 1 20 ? -0.638  27.989  4.103   1.00 0.00 ? 20 ILE B CA     2  
ATOM 9076   C C      . ILE B 1 20 ? 0.736   27.829  3.461   1.00 0.00 ? 20 ILE B C      2  
ATOM 9077   O O      . ILE B 1 20 ? 0.852   27.892  2.239   1.00 0.00 ? 20 ILE B O      2  
ATOM 9078   C CB     . ILE B 1 20 ? -1.396  26.656  4.107   1.00 0.00 ? 20 ILE B CB     2  
ATOM 9079   C CG1    . ILE B 1 20 ? -2.819  26.766  4.660   1.00 0.00 ? 20 ILE B CG1    2  
ATOM 9080   C CG2    . ILE B 1 20 ? -0.623  25.571  4.859   1.00 0.00 ? 20 ILE B CG2    2  
ATOM 9081   C CD1    . ILE B 1 20 ? -2.883  27.009  6.166   1.00 0.00 ? 20 ILE B CD1    2  
ATOM 9082   H H      . ILE B 1 20 ? -1.388  28.848  2.330   1.00 0.00 ? 20 ILE B H      2  
ATOM 9083   H HA     . ILE B 1 20 ? -0.510  28.340  5.128   1.00 0.00 ? 20 ILE B HA     2  
ATOM 9084   H HB     . ILE B 1 20 ? -1.489  26.335  3.071   1.00 0.00 ? 20 ILE B HB     2  
ATOM 9085   H HG12   . ILE B 1 20 ? -3.336  27.580  4.153   1.00 0.00 ? 20 ILE B HG12   2  
ATOM 9086   H HG13   . ILE B 1 20 ? -3.355  25.844  4.435   1.00 0.00 ? 20 ILE B HG13   2  
ATOM 9087   H HG21   . ILE B 1 20 ? -0.333  25.931  5.845   1.00 0.00 ? 20 ILE B HG21   2  
ATOM 9088   H HG22   . ILE B 1 20 ? -1.249  24.685  4.970   1.00 0.00 ? 20 ILE B HG22   2  
ATOM 9089   H HG23   . ILE B 1 20 ? 0.270   25.292  4.299   1.00 0.00 ? 20 ILE B HG23   2  
ATOM 9090   H HD11   . ILE B 1 20 ? -2.234  27.842  6.432   1.00 0.00 ? 20 ILE B HD11   2  
ATOM 9091   H HD12   . ILE B 1 20 ? -3.909  27.246  6.448   1.00 0.00 ? 20 ILE B HD12   2  
ATOM 9092   H HD13   . ILE B 1 20 ? -2.567  26.114  6.702   1.00 0.00 ? 20 ILE B HD13   2  
ATOM 9093   N N      . THR B 1 21 ? 1.774   27.572  4.259   1.00 0.00 ? 21 THR B N      2  
ATOM 9094   C CA     . THR B 1 21 ? 3.113   27.312  3.748   1.00 0.00 ? 21 THR B CA     2  
ATOM 9095   C C      . THR B 1 21 ? 3.761   26.173  4.523   1.00 0.00 ? 21 THR B C      2  
ATOM 9096   O O      . THR B 1 21 ? 3.765   26.183  5.752   1.00 0.00 ? 21 THR B O      2  
ATOM 9097   C CB     . THR B 1 21 ? 3.976   28.573  3.826   1.00 0.00 ? 21 THR B CB     2  
ATOM 9098   O OG1    . THR B 1 21 ? 3.329   29.648  3.179   1.00 0.00 ? 21 THR B OG1    2  
ATOM 9099   C CG2    . THR B 1 21 ? 5.322   28.375  3.133   1.00 0.00 ? 21 THR B CG2    2  
ATOM 9100   H H      . THR B 1 21 ? 1.620   27.539  5.258   1.00 0.00 ? 21 THR B H      2  
ATOM 9101   H HA     . THR B 1 21 ? 3.046   27.013  2.702   1.00 0.00 ? 21 THR B HA     2  
ATOM 9102   H HB     . THR B 1 21 ? 4.142   28.832  4.871   1.00 0.00 ? 21 THR B HB     2  
ATOM 9103   H HG1    . THR B 1 21 ? 3.836   30.449  3.350   1.00 0.00 ? 21 THR B HG1    2  
ATOM 9104   H HG21   . THR B 1 21 ? 5.865   27.545  3.584   1.00 0.00 ? 21 THR B HG21   2  
ATOM 9105   H HG22   . THR B 1 21 ? 5.166   28.163  2.075   1.00 0.00 ? 21 THR B HG22   2  
ATOM 9106   H HG23   . THR B 1 21 ? 5.919   29.282  3.232   1.00 0.00 ? 21 THR B HG23   2  
ATOM 9107   N N      . ILE B 1 22 ? 4.350   25.206  3.815   1.00 0.00 ? 22 ILE B N      2  
ATOM 9108   C CA     . ILE B 1 22 ? 5.107   24.132  4.438   1.00 0.00 ? 22 ILE B CA     2  
ATOM 9109   C C      . ILE B 1 22 ? 6.537   24.612  4.663   1.00 0.00 ? 22 ILE B C      2  
ATOM 9110   O O      . ILE B 1 22 ? 7.358   24.611  3.749   1.00 0.00 ? 22 ILE B O      2  
ATOM 9111   C CB     . ILE B 1 22 ? 4.981   22.849  3.606   1.00 0.00 ? 22 ILE B CB     2  
ATOM 9112   C CG1    . ILE B 1 22 ? 5.947   21.731  3.998   1.00 0.00 ? 22 ILE B CG1    2  
ATOM 9113   C CG2    . ILE B 1 22 ? 5.166   23.093  2.109   1.00 0.00 ? 22 ILE B CG2    2  
ATOM 9114   C CD1    . ILE B 1 22 ? 5.948   21.448  5.497   1.00 0.00 ? 22 ILE B CD1    2  
ATOM 9115   H H      . ILE B 1 22 ? 4.401   25.284  2.808   1.00 0.00 ? 22 ILE B H      2  
ATOM 9116   H HA     . ILE B 1 22 ? 4.669   23.922  5.414   1.00 0.00 ? 22 ILE B HA     2  
ATOM 9117   H HB     . ILE B 1 22 ? 3.970   22.467  3.748   1.00 0.00 ? 22 ILE B HB     2  
ATOM 9118   H HG12   . ILE B 1 22 ? 5.651   20.826  3.465   1.00 0.00 ? 22 ILE B HG12   2  
ATOM 9119   H HG13   . ILE B 1 22 ? 6.960   21.996  3.697   1.00 0.00 ? 22 ILE B HG13   2  
ATOM 9120   H HG21   . ILE B 1 22 ? 5.220   22.136  1.590   1.00 0.00 ? 22 ILE B HG21   2  
ATOM 9121   H HG22   . ILE B 1 22 ? 4.320   23.656  1.720   1.00 0.00 ? 22 ILE B HG22   2  
ATOM 9122   H HG23   . ILE B 1 22 ? 6.089   23.643  1.930   1.00 0.00 ? 22 ILE B HG23   2  
ATOM 9123   H HD11   . ILE B 1 22 ? 4.933   21.236  5.832   1.00 0.00 ? 22 ILE B HD11   2  
ATOM 9124   H HD12   . ILE B 1 22 ? 6.594   20.595  5.697   1.00 0.00 ? 22 ILE B HD12   2  
ATOM 9125   H HD13   . ILE B 1 22 ? 6.340   22.313  6.034   1.00 0.00 ? 22 ILE B HD13   2  
ATOM 9126   N N      . LEU B 1 23 ? 6.832   25.084  5.877   1.00 0.00 ? 23 LEU B N      2  
ATOM 9127   C CA     . LEU B 1 23 ? 8.121   25.681  6.184   1.00 0.00 ? 23 LEU B CA     2  
ATOM 9128   C C      . LEU B 1 23 ? 9.231   24.635  6.161   1.00 0.00 ? 23 LEU B C      2  
ATOM 9129   O O      . LEU B 1 23 ? 10.363  24.948  5.796   1.00 0.00 ? 23 LEU B O      2  
ATOM 9130   C CB     . LEU B 1 23 ? 8.090   26.370  7.549   1.00 0.00 ? 23 LEU B CB     2  
ATOM 9131   C CG     . LEU B 1 23 ? 6.969   27.391  7.754   1.00 0.00 ? 23 LEU B CG     2  
ATOM 9132   C CD1    . LEU B 1 23 ? 7.232   28.147  9.053   1.00 0.00 ? 23 LEU B CD1    2  
ATOM 9133   C CD2    . LEU B 1 23 ? 6.857   28.379  6.595   1.00 0.00 ? 23 LEU B CD2    2  
ATOM 9134   H H      . LEU B 1 23 ? 6.152   25.002  6.619   1.00 0.00 ? 23 LEU B H      2  
ATOM 9135   H HA     . LEU B 1 23 ? 8.351   26.427  5.424   1.00 0.00 ? 23 LEU B HA     2  
ATOM 9136   H HB2    . LEU B 1 23 ? 8.000   25.608  8.322   1.00 0.00 ? 23 LEU B HB2    2  
ATOM 9137   H HB3    . LEU B 1 23 ? 9.048   26.873  7.689   1.00 0.00 ? 23 LEU B HB3    2  
ATOM 9138   H HG     . LEU B 1 23 ? 6.019   26.871  7.856   1.00 0.00 ? 23 LEU B HG     2  
ATOM 9139   H HD11   . LEU B 1 23 ? 7.136   27.463  9.896   1.00 0.00 ? 23 LEU B HD11   2  
ATOM 9140   H HD12   . LEU B 1 23 ? 8.239   28.562  9.042   1.00 0.00 ? 23 LEU B HD12   2  
ATOM 9141   H HD13   . LEU B 1 23 ? 6.507   28.954  9.162   1.00 0.00 ? 23 LEU B HD13   2  
ATOM 9142   H HD21   . LEU B 1 23 ? 6.445   27.866  5.727   1.00 0.00 ? 23 LEU B HD21   2  
ATOM 9143   H HD22   . LEU B 1 23 ? 6.191   29.198  6.868   1.00 0.00 ? 23 LEU B HD22   2  
ATOM 9144   H HD23   . LEU B 1 23 ? 7.841   28.772  6.346   1.00 0.00 ? 23 LEU B HD23   2  
ATOM 9145   N N      . GLY B 1 24 ? 8.908   23.391  6.526   1.00 0.00 ? 24 GLY B N      2  
ATOM 9146   C CA     . GLY B 1 24 ? 9.823   22.273  6.360   1.00 0.00 ? 24 GLY B CA     2  
ATOM 9147   C C      . GLY B 1 24 ? 9.475   21.073  7.229   1.00 0.00 ? 24 GLY B C      2  
ATOM 9148   O O      . GLY B 1 24 ? 8.440   21.058  7.893   1.00 0.00 ? 24 GLY B O      2  
ATOM 9149   H H      . GLY B 1 24 ? 7.954   23.194  6.796   1.00 0.00 ? 24 GLY B H      2  
ATOM 9150   H HA2    . GLY B 1 24 ? 9.781   21.955  5.320   1.00 0.00 ? 24 GLY B HA2    2  
ATOM 9151   H HA3    . GLY B 1 24 ? 10.845  22.587  6.576   1.00 0.00 ? 24 GLY B HA3    2  
ATOM 9152   N N      . VAL B 1 25 ? 10.336  20.053  7.211   1.00 0.00 ? 25 VAL B N      2  
ATOM 9153   C CA     . VAL B 1 25 ? 10.170  18.855  8.019   1.00 0.00 ? 25 VAL B CA     2  
ATOM 9154   C C      . VAL B 1 25 ? 11.285  18.735  9.052   1.00 0.00 ? 25 VAL B C      2  
ATOM 9155   O O      . VAL B 1 25 ? 12.400  19.209  8.840   1.00 0.00 ? 25 VAL B O      2  
ATOM 9156   C CB     . VAL B 1 25 ? 10.029  17.591  7.163   1.00 0.00 ? 25 VAL B CB     2  
ATOM 9157   C CG1    . VAL B 1 25 ? 9.156   17.846  5.935   1.00 0.00 ? 25 VAL B CG1    2  
ATOM 9158   C CG2    . VAL B 1 25 ? 11.356  16.996  6.691   1.00 0.00 ? 25 VAL B CG2    2  
ATOM 9159   H H      . VAL B 1 25 ? 11.166  20.122  6.639   1.00 0.00 ? 25 VAL B H      2  
ATOM 9160   H HA     . VAL B 1 25 ? 9.238   18.951  8.576   1.00 0.00 ? 25 VAL B HA     2  
ATOM 9161   H HB     . VAL B 1 25 ? 9.533   16.835  7.771   1.00 0.00 ? 25 VAL B HB     2  
ATOM 9162   H HG11   . VAL B 1 25 ? 8.215   18.301  6.243   1.00 0.00 ? 25 VAL B HG11   2  
ATOM 9163   H HG12   . VAL B 1 25 ? 9.663   18.511  5.236   1.00 0.00 ? 25 VAL B HG12   2  
ATOM 9164   H HG13   . VAL B 1 25 ? 8.954   16.897  5.440   1.00 0.00 ? 25 VAL B HG13   2  
ATOM 9165   H HG21   . VAL B 1 25 ? 11.158  16.109  6.088   1.00 0.00 ? 25 VAL B HG21   2  
ATOM 9166   H HG22   . VAL B 1 25 ? 11.905  17.725  6.098   1.00 0.00 ? 25 VAL B HG22   2  
ATOM 9167   H HG23   . VAL B 1 25 ? 11.954  16.687  7.548   1.00 0.00 ? 25 VAL B HG23   2  
ATOM 9168   N N      . SER B 1 26 ? 10.976  18.078  10.171  1.00 0.00 ? 26 SER B N      2  
ATOM 9169   C CA     . SER B 1 26 ? 11.927  17.742  11.216  1.00 0.00 ? 26 SER B CA     2  
ATOM 9170   C C      . SER B 1 26 ? 11.738  16.280  11.603  1.00 0.00 ? 26 SER B C      2  
ATOM 9171   O O      . SER B 1 26 ? 11.077  15.959  12.589  1.00 0.00 ? 26 SER B O      2  
ATOM 9172   C CB     . SER B 1 26 ? 11.752  18.687  12.404  1.00 0.00 ? 26 SER B CB     2  
ATOM 9173   O OG     . SER B 1 26 ? 12.674  18.364  13.423  1.00 0.00 ? 26 SER B OG     2  
ATOM 9174   H H      . SER B 1 26 ? 10.036  17.718  10.268  1.00 0.00 ? 26 SER B H      2  
ATOM 9175   H HA     . SER B 1 26 ? 12.943  17.863  10.836  1.00 0.00 ? 26 SER B HA     2  
ATOM 9176   H HB2    . SER B 1 26 ? 11.926  19.712  12.075  1.00 0.00 ? 26 SER B HB2    2  
ATOM 9177   H HB3    . SER B 1 26 ? 10.735  18.610  12.791  1.00 0.00 ? 26 SER B HB3    2  
ATOM 9178   H HG     . SER B 1 26 ? 12.395  17.536  13.829  1.00 0.00 ? 26 SER B HG     2  
ATOM 9179   N N      . GLY B 1 27 ? 12.248  15.380  10.760  1.00 0.00 ? 27 GLY B N      2  
ATOM 9180   C CA     . GLY B 1 27 ? 12.056  13.952  10.945  1.00 0.00 ? 27 GLY B CA     2  
ATOM 9181   C C      . GLY B 1 27 ? 10.701  13.540  10.384  1.00 0.00 ? 27 GLY B C      2  
ATOM 9182   O O      . GLY B 1 27 ? 10.442  13.725  9.197   1.00 0.00 ? 27 GLY B O      2  
ATOM 9183   H H      . GLY B 1 27 ? 12.594  15.697  9.865   1.00 0.00 ? 27 GLY B H      2  
ATOM 9184   H HA2    . GLY B 1 27 ? 12.842  13.411  10.419  1.00 0.00 ? 27 GLY B HA2    2  
ATOM 9185   H HA3    . GLY B 1 27 ? 12.107  13.702  12.006  1.00 0.00 ? 27 GLY B HA3    2  
ATOM 9186   N N      . GLN B 1 28 ? 9.800   13.069  11.251  1.00 0.00 ? 28 GLN B N      2  
ATOM 9187   C CA     . GLN B 1 28 ? 8.416   12.821  10.882  1.00 0.00 ? 28 GLN B CA     2  
ATOM 9188   C C      . GLN B 1 28 ? 7.484   13.878  11.466  1.00 0.00 ? 28 GLN B C      2  
ATOM 9189   O O      . GLN B 1 28 ? 6.262   13.727  11.457  1.00 0.00 ? 28 GLN B O      2  
ATOM 9190   C CB     . GLN B 1 28 ? 8.032   11.378  11.217  1.00 0.00 ? 28 GLN B CB     2  
ATOM 9191   C CG     . GLN B 1 28 ? 7.522   10.659  9.967   1.00 0.00 ? 28 GLN B CG     2  
ATOM 9192   C CD     . GLN B 1 28 ? 8.637   10.189  9.036   1.00 0.00 ? 28 GLN B CD     2  
ATOM 9193   O OE1    . GLN B 1 28 ? 8.747   9.001   8.745   1.00 0.00 ? 28 GLN B OE1    2  
ATOM 9194   N NE2    . GLN B 1 28 ? 9.449   11.099  8.500   1.00 0.00 ? 28 GLN B NE2    2  
ATOM 9195   H H      . GLN B 1 28 ? 10.021  13.073  12.238  1.00 0.00 ? 28 GLN B H      2  
ATOM 9196   H HA     . GLN B 1 28 ? 8.326   12.945  9.803   1.00 0.00 ? 28 GLN B HA     2  
ATOM 9197   H HB2    . GLN B 1 28 ? 8.895   10.838  11.610  1.00 0.00 ? 28 GLN B HB2    2  
ATOM 9198   H HB3    . GLN B 1 28 ? 7.250   11.375  11.977  1.00 0.00 ? 28 GLN B HB3    2  
ATOM 9199   H HG2    . GLN B 1 28 ? 6.944   9.791   10.285  1.00 0.00 ? 28 GLN B HG2    2  
ATOM 9200   H HG3    . GLN B 1 28 ? 6.855   11.324  9.419   1.00 0.00 ? 28 GLN B HG3    2  
ATOM 9201   H HE21   . GLN B 1 28 ? 9.422   12.060  8.812   1.00 0.00 ? 28 GLN B HE21   2  
ATOM 9202   H HE22   . GLN B 1 28 ? 10.237  10.801  7.945   1.00 0.00 ? 28 GLN B HE22   2  
ATOM 9203   N N      . GLN B 1 29 ? 8.087   14.993  11.888  1.00 0.00 ? 29 GLN B N      2  
ATOM 9204   C CA     . GLN B 1 29 ? 7.393   16.215  12.245  1.00 0.00 ? 29 GLN B CA     2  
ATOM 9205   C C      . GLN B 1 29 ? 7.449   17.195  11.079  1.00 0.00 ? 29 GLN B C      2  
ATOM 9206   O O      . GLN B 1 29 ? 8.319   17.102  10.214  1.00 0.00 ? 29 GLN B O      2  
ATOM 9207   C CB     . GLN B 1 29 ? 8.025   16.843  13.485  1.00 0.00 ? 29 GLN B CB     2  
ATOM 9208   C CG     . GLN B 1 29 ? 8.175   15.868  14.651  1.00 0.00 ? 29 GLN B CG     2  
ATOM 9209   C CD     . GLN B 1 29 ? 8.282   16.657  15.947  1.00 0.00 ? 29 GLN B CD     2  
ATOM 9210   O OE1    . GLN B 1 29 ? 7.313   16.814  16.685  1.00 0.00 ? 29 GLN B OE1    2  
ATOM 9211   N NE2    . GLN B 1 29 ? 9.442   17.260  16.190  1.00 0.00 ? 29 GLN B NE2    2  
ATOM 9212   H H      . GLN B 1 29 ? 9.096   15.031  11.874  1.00 0.00 ? 29 GLN B H      2  
ATOM 9213   H HA     . GLN B 1 29 ? 6.350   15.988  12.465  1.00 0.00 ? 29 GLN B HA     2  
ATOM 9214   H HB2    . GLN B 1 29 ? 9.003   17.251  13.231  1.00 0.00 ? 29 GLN B HB2    2  
ATOM 9215   H HB3    . GLN B 1 29 ? 7.387   17.665  13.802  1.00 0.00 ? 29 GLN B HB3    2  
ATOM 9216   H HG2    . GLN B 1 29 ? 7.312   15.204  14.696  1.00 0.00 ? 29 GLN B HG2    2  
ATOM 9217   H HG3    . GLN B 1 29 ? 9.075   15.268  14.513  1.00 0.00 ? 29 GLN B HG3    2  
ATOM 9218   H HE21   . GLN B 1 29 ? 10.233  17.063  15.595  1.00 0.00 ? 29 GLN B HE21   2  
ATOM 9219   H HE22   . GLN B 1 29 ? 9.509   17.915  16.956  1.00 0.00 ? 29 GLN B HE22   2  
ATOM 9220   N N      . VAL B 1 30 ? 6.524   18.155  11.072  1.00 0.00 ? 30 VAL B N      2  
ATOM 9221   C CA     . VAL B 1 30 ? 6.259   19.032  9.944   1.00 0.00 ? 30 VAL B CA     2  
ATOM 9222   C C      . VAL B 1 30 ? 5.922   20.430  10.454  1.00 0.00 ? 30 VAL B C      2  
ATOM 9223   O O      . VAL B 1 30 ? 4.950   20.605  11.186  1.00 0.00 ? 30 VAL B O      2  
ATOM 9224   C CB     . VAL B 1 30 ? 5.114   18.440  9.115   1.00 0.00 ? 30 VAL B CB     2  
ATOM 9225   C CG1    . VAL B 1 30 ? 4.852   19.254  7.852   1.00 0.00 ? 30 VAL B CG1    2  
ATOM 9226   C CG2    . VAL B 1 30 ? 5.429   17.017  8.651   1.00 0.00 ? 30 VAL B CG2    2  
ATOM 9227   H H      . VAL B 1 30 ? 5.866   18.170  11.839  1.00 0.00 ? 30 VAL B H      2  
ATOM 9228   H HA     . VAL B 1 30 ? 7.146   19.095  9.313   1.00 0.00 ? 30 VAL B HA     2  
ATOM 9229   H HB     . VAL B 1 30 ? 4.205   18.420  9.716   1.00 0.00 ? 30 VAL B HB     2  
ATOM 9230   H HG11   . VAL B 1 30 ? 5.713   19.175  7.188   1.00 0.00 ? 30 VAL B HG11   2  
ATOM 9231   H HG12   . VAL B 1 30 ? 3.971   18.860  7.348   1.00 0.00 ? 30 VAL B HG12   2  
ATOM 9232   H HG13   . VAL B 1 30 ? 4.681   20.299  8.107   1.00 0.00 ? 30 VAL B HG13   2  
ATOM 9233   H HG21   . VAL B 1 30 ? 5.404   16.332  9.497   1.00 0.00 ? 30 VAL B HG21   2  
ATOM 9234   H HG22   . VAL B 1 30 ? 4.686   16.693  7.921   1.00 0.00 ? 30 VAL B HG22   2  
ATOM 9235   H HG23   . VAL B 1 30 ? 6.416   16.991  8.186   1.00 0.00 ? 30 VAL B HG23   2  
ATOM 9236   N N      . ARG B 1 31 ? 6.733   21.425  10.084  1.00 0.00 ? 31 ARG B N      2  
ATOM 9237   C CA     . ARG B 1 31 ? 6.579   22.819  10.476  1.00 0.00 ? 31 ARG B CA     2  
ATOM 9238   C C      . ARG B 1 31 ? 5.777   23.563  9.415   1.00 0.00 ? 31 ARG B C      2  
ATOM 9239   O O      . ARG B 1 31 ? 6.171   23.588  8.249   1.00 0.00 ? 31 ARG B O      2  
ATOM 9240   C CB     . ARG B 1 31 ? 7.962   23.447  10.665  1.00 0.00 ? 31 ARG B CB     2  
ATOM 9241   C CG     . ARG B 1 31 ? 8.277   23.808  12.116  1.00 0.00 ? 31 ARG B CG     2  
ATOM 9242   C CD     . ARG B 1 31 ? 7.542   25.074  12.557  1.00 0.00 ? 31 ARG B CD     2  
ATOM 9243   N NE     . ARG B 1 31 ? 8.116   25.617  13.793  1.00 0.00 ? 31 ARG B NE     2  
ATOM 9244   C CZ     . ARG B 1 31 ? 9.135   26.482  13.862  1.00 0.00 ? 31 ARG B CZ     2  
ATOM 9245   N NH1    . ARG B 1 31 ? 9.676   26.996  12.759  1.00 0.00 ? 31 ARG B NH1    2  
ATOM 9246   N NH2    . ARG B 1 31 ? 9.631   26.846  15.044  1.00 0.00 ? 31 ARG B NH2    2  
ATOM 9247   H H      . ARG B 1 31 ? 7.470   21.215  9.424   1.00 0.00 ? 31 ARG B H      2  
ATOM 9248   H HA     . ARG B 1 31 ? 6.031   22.868  11.418  1.00 0.00 ? 31 ARG B HA     2  
ATOM 9249   H HB2    . ARG B 1 31 ? 8.727   22.756  10.309  1.00 0.00 ? 31 ARG B HB2    2  
ATOM 9250   H HB3    . ARG B 1 31 ? 8.040   24.352  10.063  1.00 0.00 ? 31 ARG B HB3    2  
ATOM 9251   H HG2    . ARG B 1 31 ? 8.004   22.979  12.770  1.00 0.00 ? 31 ARG B HG2    2  
ATOM 9252   H HG3    . ARG B 1 31 ? 9.351   23.977  12.202  1.00 0.00 ? 31 ARG B HG3    2  
ATOM 9253   H HD2    . ARG B 1 31 ? 7.598   25.829  11.772  1.00 0.00 ? 31 ARG B HD2    2  
ATOM 9254   H HD3    . ARG B 1 31 ? 6.492   24.834  12.728  1.00 0.00 ? 31 ARG B HD3    2  
ATOM 9255   H HE     . ARG B 1 31 ? 7.626   25.401  14.650  1.00 0.00 ? 31 ARG B HE     2  
ATOM 9256   H HH11   . ARG B 1 31 ? 9.320   26.728  11.854  1.00 0.00 ? 31 ARG B HH11   2  
ATOM 9257   H HH12   . ARG B 1 31 ? 10.296  27.794  12.826  1.00 0.00 ? 31 ARG B HH12   2  
ATOM 9258   H HH21   . ARG B 1 31 ? 9.308   26.386  15.883  1.00 0.00 ? 31 ARG B HH21   2  
ATOM 9259   H HH22   . ARG B 1 31 ? 10.406  27.494  15.092  1.00 0.00 ? 31 ARG B HH22   2  
ATOM 9260   N N      . ILE B 1 32 ? 4.669   24.187  9.823   1.00 0.00 ? 32 ILE B N      2  
ATOM 9261   C CA     . ILE B 1 32 ? 3.673   24.750  8.924   1.00 0.00 ? 32 ILE B CA     2  
ATOM 9262   C C      . ILE B 1 32 ? 3.335   26.179  9.336   1.00 0.00 ? 32 ILE B C      2  
ATOM 9263   O O      . ILE B 1 32 ? 3.022   26.436  10.496  1.00 0.00 ? 32 ILE B O      2  
ATOM 9264   C CB     . ILE B 1 32 ? 2.398   23.898  8.910   1.00 0.00 ? 32 ILE B CB     2  
ATOM 9265   C CG1    . ILE B 1 32 ? 2.695   22.405  9.075   1.00 0.00 ? 32 ILE B CG1    2  
ATOM 9266   C CG2    . ILE B 1 32 ? 1.646   24.177  7.608   1.00 0.00 ? 32 ILE B CG2    2  
ATOM 9267   C CD1    . ILE B 1 32 ? 1.478   21.505  8.866   1.00 0.00 ? 32 ILE B CD1    2  
ATOM 9268   H H      . ILE B 1 32 ? 4.425   24.150  10.804  1.00 0.00 ? 32 ILE B H      2  
ATOM 9269   H HA     . ILE B 1 32 ? 4.084   24.769  7.915   1.00 0.00 ? 32 ILE B HA     2  
ATOM 9270   H HB     . ILE B 1 32 ? 1.764   24.204  9.742   1.00 0.00 ? 32 ILE B HB     2  
ATOM 9271   H HG12   . ILE B 1 32 ? 3.467   22.117  8.363   1.00 0.00 ? 32 ILE B HG12   2  
ATOM 9272   H HG13   . ILE B 1 32 ? 3.059   22.233  10.089  1.00 0.00 ? 32 ILE B HG13   2  
ATOM 9273   H HG21   . ILE B 1 32 ? 1.521   25.251  7.470   1.00 0.00 ? 32 ILE B HG21   2  
ATOM 9274   H HG22   . ILE B 1 32 ? 2.202   23.771  6.762   1.00 0.00 ? 32 ILE B HG22   2  
ATOM 9275   H HG23   . ILE B 1 32 ? 0.656   23.723  7.642   1.00 0.00 ? 32 ILE B HG23   2  
ATOM 9276   H HD11   . ILE B 1 32 ? 1.732   20.485  9.154   1.00 0.00 ? 32 ILE B HD11   2  
ATOM 9277   H HD12   . ILE B 1 32 ? 0.648   21.855  9.479   1.00 0.00 ? 32 ILE B HD12   2  
ATOM 9278   H HD13   . ILE B 1 32 ? 1.189   21.508  7.814   1.00 0.00 ? 32 ILE B HD13   2  
ATOM 9279   N N      . GLY B 1 33 ? 3.347   27.109  8.379   1.00 0.00 ? 33 GLY B N      2  
ATOM 9280   C CA     . GLY B 1 33 ? 2.855   28.462  8.574   1.00 0.00 ? 33 GLY B CA     2  
ATOM 9281   C C      . GLY B 1 33 ? 1.403   28.596  8.138   1.00 0.00 ? 33 GLY B C      2  
ATOM 9282   O O      . GLY B 1 33 ? 1.023   28.085  7.086   1.00 0.00 ? 33 GLY B O      2  
ATOM 9283   H H      . GLY B 1 33 ? 3.570   26.828  7.434   1.00 0.00 ? 33 GLY B H      2  
ATOM 9284   H HA2    . GLY B 1 33 ? 2.938   28.742  9.624   1.00 0.00 ? 33 GLY B HA2    2  
ATOM 9285   H HA3    . GLY B 1 33 ? 3.448   29.153  7.978   1.00 0.00 ? 33 GLY B HA3    2  
ATOM 9286   N N      . ILE B 1 34 ? 0.609   29.326  8.927   1.00 0.00 ? 34 ILE B N      2  
ATOM 9287   C CA     . ILE B 1 34 ? -0.774  29.636  8.608   1.00 0.00 ? 34 ILE B CA     2  
ATOM 9288   C C      . ILE B 1 34 ? -0.961  31.143  8.569   1.00 0.00 ? 34 ILE B C      2  
ATOM 9289   O O      . ILE B 1 34 ? -0.581  31.868  9.487   1.00 0.00 ? 34 ILE B O      2  
ATOM 9290   C CB     . ILE B 1 34 ? -1.752  28.993  9.593   1.00 0.00 ? 34 ILE B CB     2  
ATOM 9291   C CG1    . ILE B 1 34 ? -1.438  27.504  9.746   1.00 0.00 ? 34 ILE B CG1    2  
ATOM 9292   C CG2    . ILE B 1 34 ? -3.176  29.227  9.085   1.00 0.00 ? 34 ILE B CG2    2  
ATOM 9293   C CD1    . ILE B 1 34 ? -2.253  26.867  10.868  1.00 0.00 ? 34 ILE B CD1    2  
ATOM 9294   H H      . ILE B 1 34 ? 0.958   29.638  9.822   1.00 0.00 ? 34 ILE B H      2  
ATOM 9295   H HA     . ILE B 1 34 ? -0.992  29.250  7.612   1.00 0.00 ? 34 ILE B HA     2  
ATOM 9296   H HB     . ILE B 1 34 ? -1.643  29.473  10.566  1.00 0.00 ? 34 ILE B HB     2  
ATOM 9297   H HG12   . ILE B 1 34 ? -1.607  26.988  8.801   1.00 0.00 ? 34 ILE B HG12   2  
ATOM 9298   H HG13   . ILE B 1 34 ? -0.386  27.391  10.001  1.00 0.00 ? 34 ILE B HG13   2  
ATOM 9299   H HG21   . ILE B 1 34 ? -3.882  28.569  9.591   1.00 0.00 ? 34 ILE B HG21   2  
ATOM 9300   H HG22   . ILE B 1 34 ? -3.470  30.260  9.275   1.00 0.00 ? 34 ILE B HG22   2  
ATOM 9301   H HG23   . ILE B 1 34 ? -3.236  29.035  8.015   1.00 0.00 ? 34 ILE B HG23   2  
ATOM 9302   H HD11   . ILE B 1 34 ? -1.835  25.886  11.094  1.00 0.00 ? 34 ILE B HD11   2  
ATOM 9303   H HD12   . ILE B 1 34 ? -2.199  27.497  11.756  1.00 0.00 ? 34 ILE B HD12   2  
ATOM 9304   H HD13   . ILE B 1 34 ? -3.294  26.750  10.567  1.00 0.00 ? 34 ILE B HD13   2  
ATOM 9305   N N      . ASN B 1 35 ? -1.598  31.592  7.491   1.00 0.00 ? 35 ASN B N      2  
ATOM 9306   C CA     . ASN B 1 35 ? -1.677  32.992  7.119   1.00 0.00 ? 35 ASN B CA     2  
ATOM 9307   C C      . ASN B 1 35 ? -3.115  33.343  6.763   1.00 0.00 ? 35 ASN B C      2  
ATOM 9308   O O      . ASN B 1 35 ? -3.494  33.443  5.598   1.00 0.00 ? 35 ASN B O      2  
ATOM 9309   C CB     . ASN B 1 35 ? -0.675  33.250  5.994   1.00 0.00 ? 35 ASN B CB     2  
ATOM 9310   C CG     . ASN B 1 35 ? -0.329  34.723  5.839   1.00 0.00 ? 35 ASN B CG     2  
ATOM 9311   O OD1    . ASN B 1 35 ? -0.996  35.606  6.371   1.00 0.00 ? 35 ASN B OD1    2  
ATOM 9312   N ND2    . ASN B 1 35 ? 0.767   35.009  5.137   1.00 0.00 ? 35 ASN B ND2    2  
ATOM 9313   H H      . ASN B 1 35 ? -2.023  30.903  6.887   1.00 0.00 ? 35 ASN B H      2  
ATOM 9314   H HA     . ASN B 1 35 ? -1.388  33.601  7.977   1.00 0.00 ? 35 ASN B HA     2  
ATOM 9315   H HB2    . ASN B 1 35 ? 0.240   32.708  6.230   1.00 0.00 ? 35 ASN B HB2    2  
ATOM 9316   H HB3    . ASN B 1 35 ? -1.064  32.865  5.053   1.00 0.00 ? 35 ASN B HB3    2  
ATOM 9317   H HD21   . ASN B 1 35 ? 1.317   34.265  4.733   1.00 0.00 ? 35 ASN B HD21   2  
ATOM 9318   H HD22   . ASN B 1 35 ? 1.078   35.967  5.074   1.00 0.00 ? 35 ASN B HD22   2  
ATOM 9319   N N      . ALA B 1 36 ? -3.923  33.457  7.818   1.00 0.00 ? 36 ALA B N      2  
ATOM 9320   C CA     . ALA B 1 36 ? -5.301  33.903  7.771   1.00 0.00 ? 36 ALA B CA     2  
ATOM 9321   C C      . ALA B 1 36 ? -5.452  35.165  8.610   1.00 0.00 ? 36 ALA B C      2  
ATOM 9322   O O      . ALA B 1 36 ? -4.672  35.376  9.540   1.00 0.00 ? 36 ALA B O      2  
ATOM 9323   C CB     . ALA B 1 36 ? -6.197  32.792  8.317   1.00 0.00 ? 36 ALA B CB     2  
ATOM 9324   H H      . ALA B 1 36 ? -3.507  33.356  8.733   1.00 0.00 ? 36 ALA B H      2  
ATOM 9325   H HA     . ALA B 1 36 ? -5.591  34.132  6.745   1.00 0.00 ? 36 ALA B HA     2  
ATOM 9326   H HB1    . ALA B 1 36 ? -6.048  32.692  9.393   1.00 0.00 ? 36 ALA B HB1    2  
ATOM 9327   H HB2    . ALA B 1 36 ? -7.238  33.049  8.126   1.00 0.00 ? 36 ALA B HB2    2  
ATOM 9328   H HB3    . ALA B 1 36 ? -5.964  31.848  7.826   1.00 0.00 ? 36 ALA B HB3    2  
ATOM 9329   N N      . PRO B 1 37 ? -6.476  35.982  8.343   1.00 0.00 ? 37 PRO B N      2  
ATOM 9330   C CA     . PRO B 1 37 ? -6.835  37.067  9.230   1.00 0.00 ? 37 PRO B CA     2  
ATOM 9331   C C      . PRO B 1 37 ? -7.177  36.516  10.608  1.00 0.00 ? 37 PRO B C      2  
ATOM 9332   O O      . PRO B 1 37 ? -7.655  35.393  10.751  1.00 0.00 ? 37 PRO B O      2  
ATOM 9333   C CB     . PRO B 1 37 ? -8.042  37.745  8.588   1.00 0.00 ? 37 PRO B CB     2  
ATOM 9334   C CG     . PRO B 1 37 ? -8.638  36.701  7.647   1.00 0.00 ? 37 PRO B CG     2  
ATOM 9335   C CD     . PRO B 1 37 ? -7.413  35.892  7.240   1.00 0.00 ? 37 PRO B CD     2  
ATOM 9336   H HA     . PRO B 1 37 ? -6.007  37.772  9.308   1.00 0.00 ? 37 PRO B HA     2  
ATOM 9337   H HB2    . PRO B 1 37 ? -8.765  38.026  9.348   1.00 0.00 ? 37 PRO B HB2    2  
ATOM 9338   H HB3    . PRO B 1 37 ? -7.719  38.618  8.019   1.00 0.00 ? 37 PRO B HB3    2  
ATOM 9339   H HG2    . PRO B 1 37 ? -9.349  36.060  8.168   1.00 0.00 ? 37 PRO B HG2    2  
ATOM 9340   H HG3    . PRO B 1 37 ? -9.103  37.173  6.782   1.00 0.00 ? 37 PRO B HG3    2  
ATOM 9341   H HD2    . PRO B 1 37 ? -7.691  34.863  7.012   1.00 0.00 ? 37 PRO B HD2    2  
ATOM 9342   H HD3    . PRO B 1 37 ? -6.977  36.388  6.378   1.00 0.00 ? 37 PRO B HD3    2  
ATOM 9343   N N      . LYS B 1 38 ? -7.030  37.359  11.631  1.00 0.00 ? 38 LYS B N      2  
ATOM 9344   C CA     . LYS B 1 38 ? -7.419  37.046  12.997  1.00 0.00 ? 38 LYS B CA     2  
ATOM 9345   C C      . LYS B 1 38 ? -8.938  37.018  13.144  1.00 0.00 ? 38 LYS B C      2  
ATOM 9346   O O      . LYS B 1 38 ? -9.482  36.727  14.207  1.00 0.00 ? 38 LYS B O      2  
ATOM 9347   C CB     . LYS B 1 38 ? -6.753  38.048  13.933  1.00 0.00 ? 38 LYS B CB     2  
ATOM 9348   C CG     . LYS B 1 38 ? -5.255  37.787  14.098  1.00 0.00 ? 38 LYS B CG     2  
ATOM 9349   C CD     . LYS B 1 38 ? -4.434  37.600  12.819  1.00 0.00 ? 38 LYS B CD     2  
ATOM 9350   C CE     . LYS B 1 38 ? -2.938  37.485  13.108  1.00 0.00 ? 38 LYS B CE     2  
ATOM 9351   N NZ     . LYS B 1 38 ? -2.345  38.773  13.509  1.00 0.00 ? 38 LYS B NZ     2  
ATOM 9352   H H      . LYS B 1 38 ? -6.661  38.281  11.447  1.00 0.00 ? 38 LYS B H      2  
ATOM 9353   H HA     . LYS B 1 38 ? -7.060  36.047  13.249  1.00 0.00 ? 38 LYS B HA     2  
ATOM 9354   H HB2    . LYS B 1 38 ? -6.905  39.058  13.551  1.00 0.00 ? 38 LYS B HB2    2  
ATOM 9355   H HB3    . LYS B 1 38 ? -7.218  37.981  14.916  1.00 0.00 ? 38 LYS B HB3    2  
ATOM 9356   H HG2    . LYS B 1 38 ? -4.878  38.672  14.599  1.00 0.00 ? 38 LYS B HG2    2  
ATOM 9357   H HG3    . LYS B 1 38 ? -5.112  36.920  14.743  1.00 0.00 ? 38 LYS B HG3    2  
ATOM 9358   H HD2    . LYS B 1 38 ? -4.739  36.676  12.330  1.00 0.00 ? 38 LYS B HD2    2  
ATOM 9359   H HD3    . LYS B 1 38 ? -4.603  38.438  12.144  1.00 0.00 ? 38 LYS B HD3    2  
ATOM 9360   H HE2    . LYS B 1 38 ? -2.791  36.748  13.899  1.00 0.00 ? 38 LYS B HE2    2  
ATOM 9361   H HE3    . LYS B 1 38 ? -2.437  37.123  12.208  1.00 0.00 ? 38 LYS B HE3    2  
ATOM 9362   H HZ1    . LYS B 1 38 ? -1.357  38.652  13.686  1.00 0.00 ? 38 LYS B HZ1    2  
ATOM 9363   H HZ2    . LYS B 1 38 ? -2.464  39.465  12.782  1.00 0.00 ? 38 LYS B HZ2    2  
ATOM 9364   H HZ3    . LYS B 1 38 ? -2.776  39.106  14.359  1.00 0.00 ? 38 LYS B HZ3    2  
ATOM 9365   N N      . ASP B 1 39 ? -9.605  37.297  12.023  1.00 0.00 ? 39 ASP B N      2  
ATOM 9366   C CA     . ASP B 1 39 ? -11.041 37.190  11.827  1.00 0.00 ? 39 ASP B CA     2  
ATOM 9367   C C      . ASP B 1 39 ? -11.505 35.737  11.913  1.00 0.00 ? 39 ASP B C      2  
ATOM 9368   O O      . ASP B 1 39 ? -12.656 35.476  12.255  1.00 0.00 ? 39 ASP B O      2  
ATOM 9369   C CB     . ASP B 1 39 ? -11.385 37.719  10.433  1.00 0.00 ? 39 ASP B CB     2  
ATOM 9370   C CG     . ASP B 1 39 ? -12.778 38.340  10.395  1.00 0.00 ? 39 ASP B CG     2  
ATOM 9371   O OD1    . ASP B 1 39 ? -12.969 39.389  11.049  1.00 0.00 ? 39 ASP B OD1    2  
ATOM 9372   O OD2    . ASP B 1 39 ? -13.651 37.785  9.692   1.00 0.00 ? 39 ASP B OD2    2  
ATOM 9373   H H      . ASP B 1 39 ? -9.023  37.558  11.241  1.00 0.00 ? 39 ASP B H      2  
ATOM 9374   H HA     . ASP B 1 39 ? -11.554 37.779  12.588  1.00 0.00 ? 39 ASP B HA     2  
ATOM 9375   H HB2    . ASP B 1 39 ? -10.644 38.451  10.107  1.00 0.00 ? 39 ASP B HB2    2  
ATOM 9376   H HB3    . ASP B 1 39 ? -11.338 36.894  9.722   1.00 0.00 ? 39 ASP B HB3    2  
ATOM 9377   N N      . VAL B 1 40 ? -10.602 34.795  11.624  1.00 0.00 ? 40 VAL B N      2  
ATOM 9378   C CA     . VAL B 1 40 ? -10.842 33.365  11.731  1.00 0.00 ? 40 VAL B CA     2  
ATOM 9379   C C      . VAL B 1 40 ? -10.028 32.785  12.879  1.00 0.00 ? 40 VAL B C      2  
ATOM 9380   O O      . VAL B 1 40 ? -8.903  33.214  13.134  1.00 0.00 ? 40 VAL B O      2  
ATOM 9381   C CB     . VAL B 1 40 ? -10.558 32.630  10.420  1.00 0.00 ? 40 VAL B CB     2  
ATOM 9382   C CG1    . VAL B 1 40 ? -11.261 33.337  9.262   1.00 0.00 ? 40 VAL B CG1    2  
ATOM 9383   C CG2    . VAL B 1 40 ? -9.074  32.526  10.082  1.00 0.00 ? 40 VAL B CG2    2  
ATOM 9384   H H      . VAL B 1 40 ? -9.666  35.086  11.376  1.00 0.00 ? 40 VAL B H      2  
ATOM 9385   H HA     . VAL B 1 40 ? -11.895 33.208  11.965  1.00 0.00 ? 40 VAL B HA     2  
ATOM 9386   H HB     . VAL B 1 40 ? -10.923 31.606  10.509  1.00 0.00 ? 40 VAL B HB     2  
ATOM 9387   H HG11   . VAL B 1 40 ? -10.852 34.342  9.139   1.00 0.00 ? 40 VAL B HG11   2  
ATOM 9388   H HG12   . VAL B 1 40 ? -11.116 32.772  8.341   1.00 0.00 ? 40 VAL B HG12   2  
ATOM 9389   H HG13   . VAL B 1 40 ? -12.328 33.413  9.474   1.00 0.00 ? 40 VAL B HG13   2  
ATOM 9390   H HG21   . VAL B 1 40 ? -8.690  33.507  9.813   1.00 0.00 ? 40 VAL B HG21   2  
ATOM 9391   H HG22   . VAL B 1 40 ? -8.527  32.134  10.940  1.00 0.00 ? 40 VAL B HG22   2  
ATOM 9392   H HG23   . VAL B 1 40 ? -8.944  31.844  9.242   1.00 0.00 ? 40 VAL B HG23   2  
ATOM 9393   N N      . ALA B 1 41 ? -10.599 31.802  13.578  1.00 0.00 ? 41 ALA B N      2  
ATOM 9394   C CA     . ALA B 1 41 ? -9.854  31.042  14.563  1.00 0.00 ? 41 ALA B CA     2  
ATOM 9395   C C      . ALA B 1 41 ? -9.091  29.893  13.920  1.00 0.00 ? 41 ALA B C      2  
ATOM 9396   O O      . ALA B 1 41 ? -9.550  29.267  12.966  1.00 0.00 ? 41 ALA B O      2  
ATOM 9397   C CB     . ALA B 1 41 ? -10.798 30.590  15.675  1.00 0.00 ? 41 ALA B CB     2  
ATOM 9398   H H      . ALA B 1 41 ? -11.534 31.497  13.346  1.00 0.00 ? 41 ALA B H      2  
ATOM 9399   H HA     . ALA B 1 41 ? -9.083  31.695  14.971  1.00 0.00 ? 41 ALA B HA     2  
ATOM 9400   H HB1    . ALA B 1 41 ? -10.225 30.106  16.464  1.00 0.00 ? 41 ALA B HB1    2  
ATOM 9401   H HB2    . ALA B 1 41 ? -11.311 31.457  16.092  1.00 0.00 ? 41 ALA B HB2    2  
ATOM 9402   H HB3    . ALA B 1 41 ? -11.531 29.889  15.276  1.00 0.00 ? 41 ALA B HB3    2  
ATOM 9403   N N      . VAL B 1 42 ? -7.880  29.672  14.437  1.00 0.00 ? 42 VAL B N      2  
ATOM 9404   C CA     . VAL B 1 42 ? -6.876  28.823  13.822  1.00 0.00 ? 42 VAL B CA     2  
ATOM 9405   C C      . VAL B 1 42 ? -6.120  28.092  14.924  1.00 0.00 ? 42 VAL B C      2  
ATOM 9406   O O      . VAL B 1 42 ? -5.256  28.675  15.576  1.00 0.00 ? 42 VAL B O      2  
ATOM 9407   C CB     . VAL B 1 42 ? -5.942  29.707  12.990  1.00 0.00 ? 42 VAL B CB     2  
ATOM 9408   C CG1    . VAL B 1 42 ? -5.083  28.872  12.052  1.00 0.00 ? 42 VAL B CG1    2  
ATOM 9409   C CG2    . VAL B 1 42 ? -6.679  30.653  12.046  1.00 0.00 ? 42 VAL B CG2    2  
ATOM 9410   H H      . VAL B 1 42 ? -7.584  30.237  15.220  1.00 0.00 ? 42 VAL B H      2  
ATOM 9411   H HA     . VAL B 1 42 ? -7.349  28.092  13.165  1.00 0.00 ? 42 VAL B HA     2  
ATOM 9412   H HB     . VAL B 1 42 ? -5.302  30.297  13.646  1.00 0.00 ? 42 VAL B HB     2  
ATOM 9413   H HG11   . VAL B 1 42 ? -5.739  28.413  11.313  1.00 0.00 ? 42 VAL B HG11   2  
ATOM 9414   H HG12   . VAL B 1 42 ? -4.382  29.538  11.547  1.00 0.00 ? 42 VAL B HG12   2  
ATOM 9415   H HG13   . VAL B 1 42 ? -4.545  28.113  12.619  1.00 0.00 ? 42 VAL B HG13   2  
ATOM 9416   H HG21   . VAL B 1 42 ? -7.287  31.353  12.615  1.00 0.00 ? 42 VAL B HG21   2  
ATOM 9417   H HG22   . VAL B 1 42 ? -5.953  31.215  11.456  1.00 0.00 ? 42 VAL B HG22   2  
ATOM 9418   H HG23   . VAL B 1 42 ? -7.324  30.078  11.381  1.00 0.00 ? 42 VAL B HG23   2  
ATOM 9419   N N      . HIS B 1 43 ? -6.480  26.832  15.191  1.00 0.00 ? 43 HIS B N      2  
ATOM 9420   C CA     . HIS B 1 43 ? -5.791  26.019  16.183  1.00 0.00 ? 43 HIS B CA     2  
ATOM 9421   C C      . HIS B 1 43 ? -5.711  24.554  15.776  1.00 0.00 ? 43 HIS B C      2  
ATOM 9422   O O      . HIS B 1 43 ? -6.536  24.059  15.010  1.00 0.00 ? 43 HIS B O      2  
ATOM 9423   C CB     . HIS B 1 43 ? -6.396  26.135  17.588  1.00 0.00 ? 43 HIS B CB     2  
ATOM 9424   C CG     . HIS B 1 43 ? -7.093  27.432  17.897  1.00 0.00 ? 43 HIS B CG     2  
ATOM 9425   N ND1    . HIS B 1 43 ? -6.612  28.392  18.785  1.00 0.00 ? 43 HIS B ND1    2  
ATOM 9426   C CD2    . HIS B 1 43 ? -8.318  27.827  17.433  1.00 0.00 ? 43 HIS B CD2    2  
ATOM 9427   C CE1    . HIS B 1 43 ? -7.540  29.354  18.826  1.00 0.00 ? 43 HIS B CE1    2  
ATOM 9428   N NE2    . HIS B 1 43 ? -8.570  29.050  18.020  1.00 0.00 ? 43 HIS B NE2    2  
ATOM 9429   H H      . HIS B 1 43 ? -7.171  26.395  14.597  1.00 0.00 ? 43 HIS B H      2  
ATOM 9430   H HA     . HIS B 1 43 ? -4.763  26.378  16.238  1.00 0.00 ? 43 HIS B HA     2  
ATOM 9431   H HB2    . HIS B 1 43 ? -7.049  25.295  17.829  1.00 0.00 ? 43 HIS B HB2    2  
ATOM 9432   H HB3    . HIS B 1 43 ? -5.575  26.041  18.297  1.00 0.00 ? 43 HIS B HB3    2  
ATOM 9433   H HD2    . HIS B 1 43 ? -8.966  27.275  16.768  1.00 0.00 ? 43 HIS B HD2    2  
ATOM 9434   H HE1    . HIS B 1 43 ? -7.499  30.221  19.470  1.00 0.00 ? 43 HIS B HE1    2  
ATOM 9435   H HE2    . HIS B 1 43 ? -9.439  29.564  17.971  1.00 0.00 ? 43 HIS B HE2    2  
ATOM 9436   N N      . ARG B 1 44 ? -4.729  23.850  16.341  1.00 0.00 ? 44 ARG B N      2  
ATOM 9437   C CA     . ARG B 1 44 ? -4.622  22.403  16.252  1.00 0.00 ? 44 ARG B CA     2  
ATOM 9438   C C      . ARG B 1 44 ? -5.820  21.724  16.911  1.00 0.00 ? 44 ARG B C      2  
ATOM 9439   O O      . ARG B 1 44 ? -6.453  22.306  17.788  1.00 0.00 ? 44 ARG B O      2  
ATOM 9440   C CB     . ARG B 1 44 ? -3.270  21.969  16.821  1.00 0.00 ? 44 ARG B CB     2  
ATOM 9441   C CG     . ARG B 1 44 ? -3.073  22.354  18.287  1.00 0.00 ? 44 ARG B CG     2  
ATOM 9442   C CD     . ARG B 1 44 ? -1.616  22.187  18.722  1.00 0.00 ? 44 ARG B CD     2  
ATOM 9443   N NE     . ARG B 1 44 ? -1.408  22.644  20.101  1.00 0.00 ? 44 ARG B NE     2  
ATOM 9444   C CZ     . ARG B 1 44 ? -0.729  21.990  21.051  1.00 0.00 ? 44 ARG B CZ     2  
ATOM 9445   N NH1    . ARG B 1 44 ? -0.330  20.728  20.896  1.00 0.00 ? 44 ARG B NH1    2  
ATOM 9446   N NH2    . ARG B 1 44 ? -0.443  22.591  22.206  1.00 0.00 ? 44 ARG B NH2    2  
ATOM 9447   H H      . ARG B 1 44 ? -4.092  24.332  16.963  1.00 0.00 ? 44 ARG B H      2  
ATOM 9448   H HA     . ARG B 1 44 ? -4.638  22.128  15.200  1.00 0.00 ? 44 ARG B HA     2  
ATOM 9449   H HB2    . ARG B 1 44 ? -3.183  20.888  16.728  1.00 0.00 ? 44 ARG B HB2    2  
ATOM 9450   H HB3    . ARG B 1 44 ? -2.480  22.430  16.228  1.00 0.00 ? 44 ARG B HB3    2  
ATOM 9451   H HG2    . ARG B 1 44 ? -3.361  23.393  18.437  1.00 0.00 ? 44 ARG B HG2    2  
ATOM 9452   H HG3    . ARG B 1 44 ? -3.717  21.726  18.898  1.00 0.00 ? 44 ARG B HG3    2  
ATOM 9453   H HD2    . ARG B 1 44 ? -1.328  21.142  18.614  1.00 0.00 ? 44 ARG B HD2    2  
ATOM 9454   H HD3    . ARG B 1 44 ? -0.984  22.781  18.061  1.00 0.00 ? 44 ARG B HD3    2  
ATOM 9455   H HE     . ARG B 1 44 ? -1.688  23.590  20.312  1.00 0.00 ? 44 ARG B HE     2  
ATOM 9456   H HH11   . ARG B 1 44 ? -0.730  20.159  20.161  1.00 0.00 ? 44 ARG B HH11   2  
ATOM 9457   H HH12   . ARG B 1 44 ? 0.230   20.292  21.612  1.00 0.00 ? 44 ARG B HH12   2  
ATOM 9458   H HH21   . ARG B 1 44 ? -0.802  23.515  22.413  1.00 0.00 ? 44 ARG B HH21   2  
ATOM 9459   H HH22   . ARG B 1 44 ? 0.066   22.090  22.919  1.00 0.00 ? 44 ARG B HH22   2  
ATOM 9460   N N      . GLU B 1 45 ? -6.173  20.512  16.474  1.00 0.00 ? 45 GLU B N      2  
ATOM 9461   C CA     . GLU B 1 45 ? -7.379  19.825  16.920  1.00 0.00 ? 45 GLU B CA     2  
ATOM 9462   C C      . GLU B 1 45 ? -7.443  19.688  18.439  1.00 0.00 ? 45 GLU B C      2  
ATOM 9463   O O      . GLU B 1 45 ? -8.500  19.908  19.028  1.00 0.00 ? 45 GLU B O      2  
ATOM 9464   C CB     . GLU B 1 45 ? -7.435  18.435  16.285  1.00 0.00 ? 45 GLU B CB     2  
ATOM 9465   C CG     . GLU B 1 45 ? -8.191  18.465  14.958  1.00 0.00 ? 45 GLU B CG     2  
ATOM 9466   C CD     . GLU B 1 45 ? -9.678  18.753  15.145  1.00 0.00 ? 45 GLU B CD     2  
ATOM 9467   O OE1    . GLU B 1 45 ? -10.302 18.112  16.020  1.00 0.00 ? 45 GLU B OE1    2  
ATOM 9468   O OE2    . GLU B 1 45 ? -10.199 19.615  14.402  1.00 0.00 ? 45 GLU B OE2    2  
ATOM 9469   H H      . GLU B 1 45 ? -5.606  20.065  15.767  1.00 0.00 ? 45 GLU B H      2  
ATOM 9470   H HA     . GLU B 1 45 ? -8.262  20.388  16.607  1.00 0.00 ? 45 GLU B HA     2  
ATOM 9471   H HB2    . GLU B 1 45 ? -6.421  18.071  16.114  1.00 0.00 ? 45 GLU B HB2    2  
ATOM 9472   H HB3    . GLU B 1 45 ? -7.931  17.741  16.963  1.00 0.00 ? 45 GLU B HB3    2  
ATOM 9473   H HG2    . GLU B 1 45 ? -7.738  19.229  14.325  1.00 0.00 ? 45 GLU B HG2    2  
ATOM 9474   H HG3    . GLU B 1 45 ? -8.080  17.497  14.469  1.00 0.00 ? 45 GLU B HG3    2  
ATOM 9475   N N      . GLU B 1 46 ? -6.316  19.394  19.095  1.00 0.00 ? 46 GLU B N      2  
ATOM 9476   C CA     . GLU B 1 46 ? -6.276  19.253  20.541  1.00 0.00 ? 46 GLU B CA     2  
ATOM 9477   C C      . GLU B 1 46 ? -6.584  20.555  21.274  1.00 0.00 ? 46 GLU B C      2  
ATOM 9478   O O      . GLU B 1 46 ? -6.916  20.514  22.455  1.00 0.00 ? 46 GLU B O      2  
ATOM 9479   C CB     . GLU B 1 46 ? -4.941  18.681  21.024  1.00 0.00 ? 46 GLU B CB     2  
ATOM 9480   C CG     . GLU B 1 46 ? -3.702  19.507  20.681  1.00 0.00 ? 46 GLU B CG     2  
ATOM 9481   C CD     . GLU B 1 46 ? -3.014  19.037  19.401  1.00 0.00 ? 46 GLU B CD     2  
ATOM 9482   O OE1    . GLU B 1 46 ? -3.690  18.917  18.355  1.00 0.00 ? 46 GLU B OE1    2  
ATOM 9483   O OE2    . GLU B 1 46 ? -1.778  18.860  19.439  1.00 0.00 ? 46 GLU B OE2    2  
ATOM 9484   H H      . GLU B 1 46 ? -5.472  19.210  18.567  1.00 0.00 ? 46 GLU B H      2  
ATOM 9485   H HA     . GLU B 1 46 ? -7.054  18.544  20.824  1.00 0.00 ? 46 GLU B HA     2  
ATOM 9486   H HB2    . GLU B 1 46 ? -4.991  18.583  22.109  1.00 0.00 ? 46 GLU B HB2    2  
ATOM 9487   H HB3    . GLU B 1 46 ? -4.814  17.683  20.616  1.00 0.00 ? 46 GLU B HB3    2  
ATOM 9488   H HG2    . GLU B 1 46 ? -3.972  20.560  20.605  1.00 0.00 ? 46 GLU B HG2    2  
ATOM 9489   H HG3    . GLU B 1 46 ? -2.997  19.412  21.507  1.00 0.00 ? 46 GLU B HG3    2  
ATOM 9490   N N      . ILE B 1 47 ? -6.506  21.697  20.587  1.00 0.00 ? 47 ILE B N      2  
ATOM 9491   C CA     . ILE B 1 47 ? -6.936  22.987  21.101  1.00 0.00 ? 47 ILE B CA     2  
ATOM 9492   C C      . ILE B 1 47 ? -8.386  23.253  20.732  1.00 0.00 ? 47 ILE B C      2  
ATOM 9493   O O      . ILE B 1 47 ? -9.203  23.587  21.589  1.00 0.00 ? 47 ILE B O      2  
ATOM 9494   C CB     . ILE B 1 47 ? -6.028  24.082  20.533  1.00 0.00 ? 47 ILE B CB     2  
ATOM 9495   C CG1    . ILE B 1 47 ? -4.599  23.973  21.064  1.00 0.00 ? 47 ILE B CG1    2  
ATOM 9496   C CG2    . ILE B 1 47 ? -6.596  25.465  20.844  1.00 0.00 ? 47 ILE B CG2    2  
ATOM 9497   C CD1    . ILE B 1 47 ? -4.590  23.744  22.569  1.00 0.00 ? 47 ILE B CD1    2  
ATOM 9498   H H      . ILE B 1 47 ? -6.248  21.651  19.611  1.00 0.00 ? 47 ILE B H      2  
ATOM 9499   H HA     . ILE B 1 47 ? -6.882  22.984  22.189  1.00 0.00 ? 47 ILE B HA     2  
ATOM 9500   H HB     . ILE B 1 47 ? -5.983  23.983  19.450  1.00 0.00 ? 47 ILE B HB     2  
ATOM 9501   H HG12   . ILE B 1 47 ? -4.102  23.127  20.591  1.00 0.00 ? 47 ILE B HG12   2  
ATOM 9502   H HG13   . ILE B 1 47 ? -4.045  24.883  20.827  1.00 0.00 ? 47 ILE B HG13   2  
ATOM 9503   H HG21   . ILE B 1 47 ? -6.816  25.552  21.907  1.00 0.00 ? 47 ILE B HG21   2  
ATOM 9504   H HG22   . ILE B 1 47 ? -5.871  26.224  20.552  1.00 0.00 ? 47 ILE B HG22   2  
ATOM 9505   H HG23   . ILE B 1 47 ? -7.508  25.627  20.272  1.00 0.00 ? 47 ILE B HG23   2  
ATOM 9506   H HD11   . ILE B 1 47 ? -4.774  22.683  22.748  1.00 0.00 ? 47 ILE B HD11   2  
ATOM 9507   H HD12   . ILE B 1 47 ? -3.620  24.033  22.968  1.00 0.00 ? 47 ILE B HD12   2  
ATOM 9508   H HD13   . ILE B 1 47 ? -5.376  24.351  23.020  1.00 0.00 ? 47 ILE B HD13   2  
ATOM 9509   N N      . TYR B 1 48 ? -8.698  23.076  19.447  1.00 0.00 ? 48 TYR B N      2  
ATOM 9510   C CA     . TYR B 1 48 ? -10.009 23.330  18.882  1.00 0.00 ? 48 TYR B CA     2  
ATOM 9511   C C      . TYR B 1 48 ? -11.113 22.636  19.674  1.00 0.00 ? 48 TYR B C      2  
ATOM 9512   O O      . TYR B 1 48 ? -12.176 23.213  19.893  1.00 0.00 ? 48 TYR B O      2  
ATOM 9513   C CB     . TYR B 1 48 ? -9.975  22.836  17.439  1.00 0.00 ? 48 TYR B CB     2  
ATOM 9514   C CG     . TYR B 1 48 ? -11.299 22.983  16.735  1.00 0.00 ? 48 TYR B CG     2  
ATOM 9515   C CD1    . TYR B 1 48 ? -11.745 24.249  16.333  1.00 0.00 ? 48 TYR B CD1    2  
ATOM 9516   C CD2    . TYR B 1 48 ? -12.119 21.858  16.580  1.00 0.00 ? 48 TYR B CD2    2  
ATOM 9517   C CE1    . TYR B 1 48 ? -13.002 24.385  15.730  1.00 0.00 ? 48 TYR B CE1    2  
ATOM 9518   C CE2    . TYR B 1 48 ? -13.378 21.990  15.984  1.00 0.00 ? 48 TYR B CE2    2  
ATOM 9519   C CZ     . TYR B 1 48 ? -13.806 23.248  15.511  1.00 0.00 ? 48 TYR B CZ     2  
ATOM 9520   O OH     . TYR B 1 48 ? -15.018 23.379  14.901  1.00 0.00 ? 48 TYR B OH     2  
ATOM 9521   H H      . TYR B 1 48 ? -7.969  22.779  18.814  1.00 0.00 ? 48 TYR B H      2  
ATOM 9522   H HA     . TYR B 1 48 ? -10.200 24.403  18.887  1.00 0.00 ? 48 TYR B HA     2  
ATOM 9523   H HB2    . TYR B 1 48 ? -9.213  23.385  16.885  1.00 0.00 ? 48 TYR B HB2    2  
ATOM 9524   H HB3    . TYR B 1 48 ? -9.696  21.782  17.436  1.00 0.00 ? 48 TYR B HB3    2  
ATOM 9525   H HD1    . TYR B 1 48 ? -11.125 25.120  16.492  1.00 0.00 ? 48 TYR B HD1    2  
ATOM 9526   H HD2    . TYR B 1 48 ? -11.786 20.890  16.928  1.00 0.00 ? 48 TYR B HD2    2  
ATOM 9527   H HE1    . TYR B 1 48 ? -13.360 25.366  15.453  1.00 0.00 ? 48 TYR B HE1    2  
ATOM 9528   H HE2    . TYR B 1 48 ? -14.016 21.122  15.925  1.00 0.00 ? 48 TYR B HE2    2  
ATOM 9529   H HH     . TYR B 1 48 ? -15.483 22.540  14.812  1.00 0.00 ? 48 TYR B HH     2  
ATOM 9530   N N      . GLN B 1 49 ? -10.837 21.435  20.186  1.00 0.00 ? 49 GLN B N      2  
ATOM 9531   C CA     . GLN B 1 49 ? -11.813 20.627  20.897  1.00 0.00 ? 49 GLN B CA     2  
ATOM 9532   C C      . GLN B 1 49 ? -12.179 21.189  22.271  1.00 0.00 ? 49 GLN B C      2  
ATOM 9533   O O      . GLN B 1 49 ? -13.260 20.879  22.769  1.00 0.00 ? 49 GLN B O      2  
ATOM 9534   C CB     . GLN B 1 49 ? -11.285 19.197  21.002  1.00 0.00 ? 49 GLN B CB     2  
ATOM 9535   C CG     . GLN B 1 49 ? -11.320 18.508  19.636  1.00 0.00 ? 49 GLN B CG     2  
ATOM 9536   C CD     . GLN B 1 49 ? -10.579 17.176  19.634  1.00 0.00 ? 49 GLN B CD     2  
ATOM 9537   O OE1    . GLN B 1 49 ? -10.366 16.552  20.670  1.00 0.00 ? 49 GLN B OE1    2  
ATOM 9538   N NE2    . GLN B 1 49 ? -10.191 16.692  18.456  1.00 0.00 ? 49 GLN B NE2    2  
ATOM 9539   H H      . GLN B 1 49 ? -9.950  21.005  19.958  1.00 0.00 ? 49 GLN B H      2  
ATOM 9540   H HA     . GLN B 1 49 ? -12.727 20.606  20.301  1.00 0.00 ? 49 GLN B HA     2  
ATOM 9541   H HB2    . GLN B 1 49 ? -10.261 19.218  21.377  1.00 0.00 ? 49 GLN B HB2    2  
ATOM 9542   H HB3    . GLN B 1 49 ? -11.904 18.632  21.699  1.00 0.00 ? 49 GLN B HB3    2  
ATOM 9543   H HG2    . GLN B 1 49 ? -12.358 18.328  19.357  1.00 0.00 ? 49 GLN B HG2    2  
ATOM 9544   H HG3    . GLN B 1 49 ? -10.877 19.160  18.884  1.00 0.00 ? 49 GLN B HG3    2  
ATOM 9545   H HE21   . GLN B 1 49 ? -10.333 17.235  17.612  1.00 0.00 ? 49 GLN B HE21   2  
ATOM 9546   H HE22   . GLN B 1 49 ? -9.709  15.806  18.419  1.00 0.00 ? 49 GLN B HE22   2  
ATOM 9547   N N      . ARG B 1 50 ? -11.346 22.045  22.876  1.00 0.00 ? 50 ARG B N      2  
ATOM 9548   C CA     . ARG B 1 50 ? -11.732 22.792  24.067  1.00 0.00 ? 50 ARG B CA     2  
ATOM 9549   C C      . ARG B 1 50 ? -12.565 24.005  23.683  1.00 0.00 ? 50 ARG B C      2  
ATOM 9550   O O      . ARG B 1 50 ? -13.521 24.350  24.372  1.00 0.00 ? 50 ARG B O      2  
ATOM 9551   C CB     . ARG B 1 50 ? -10.531 23.314  24.854  1.00 0.00 ? 50 ARG B CB     2  
ATOM 9552   C CG     . ARG B 1 50 ? -9.642  22.236  25.468  1.00 0.00 ? 50 ARG B CG     2  
ATOM 9553   C CD     . ARG B 1 50 ? -8.422  22.050  24.572  1.00 0.00 ? 50 ARG B CD     2  
ATOM 9554   N NE     . ARG B 1 50 ? -7.512  21.034  25.106  1.00 0.00 ? 50 ARG B NE     2  
ATOM 9555   C CZ     . ARG B 1 50 ? -6.570  21.222  26.034  1.00 0.00 ? 50 ARG B CZ     2  
ATOM 9556   N NH1    . ARG B 1 50 ? -6.440  22.382  26.678  1.00 0.00 ? 50 ARG B NH1    2  
ATOM 9557   N NH2    . ARG B 1 50 ? -5.730  20.232  26.335  1.00 0.00 ? 50 ARG B NH2    2  
ATOM 9558   H H      . ARG B 1 50 ? -10.497 22.318  22.398  1.00 0.00 ? 50 ARG B H      2  
ATOM 9559   H HA     . ARG B 1 50 ? -12.332 22.158  24.722  1.00 0.00 ? 50 ARG B HA     2  
ATOM 9560   H HB2    . ARG B 1 50 ? -9.935  23.952  24.201  1.00 0.00 ? 50 ARG B HB2    2  
ATOM 9561   H HB3    . ARG B 1 50 ? -10.909 23.932  25.669  1.00 0.00 ? 50 ARG B HB3    2  
ATOM 9562   H HG2    . ARG B 1 50 ? -9.319  22.557  26.459  1.00 0.00 ? 50 ARG B HG2    2  
ATOM 9563   H HG3    . ARG B 1 50 ? -10.191 21.298  25.554  1.00 0.00 ? 50 ARG B HG3    2  
ATOM 9564   H HD2    . ARG B 1 50 ? -8.795  21.719  23.602  1.00 0.00 ? 50 ARG B HD2    2  
ATOM 9565   H HD3    . ARG B 1 50 ? -7.901  23.001  24.432  1.00 0.00 ? 50 ARG B HD3    2  
ATOM 9566   H HE     . ARG B 1 50 ? -7.488  20.158  24.602  1.00 0.00 ? 50 ARG B HE     2  
ATOM 9567   H HH11   . ARG B 1 50 ? -7.093  23.131  26.498  1.00 0.00 ? 50 ARG B HH11   2  
ATOM 9568   H HH12   . ARG B 1 50 ? -5.708  22.499  27.362  1.00 0.00 ? 50 ARG B HH12   2  
ATOM 9569   H HH21   . ARG B 1 50 ? -5.812  19.341  25.869  1.00 0.00 ? 50 ARG B HH21   2  
ATOM 9570   H HH22   . ARG B 1 50 ? -5.018  20.366  27.039  1.00 0.00 ? 50 ARG B HH22   2  
ATOM 9571   N N      . ILE B 1 51 ? -12.187 24.675  22.595  1.00 0.00 ? 51 ILE B N      2  
ATOM 9572   C CA     . ILE B 1 51 ? -12.845 25.889  22.145  1.00 0.00 ? 51 ILE B CA     2  
ATOM 9573   C C      . ILE B 1 51 ? -14.289 25.571  21.780  1.00 0.00 ? 51 ILE B C      2  
ATOM 9574   O O      . ILE B 1 51 ? -15.214 26.240  22.235  1.00 0.00 ? 51 ILE B O      2  
ATOM 9575   C CB     . ILE B 1 51 ? -12.022 26.509  21.012  1.00 0.00 ? 51 ILE B CB     2  
ATOM 9576   C CG1    . ILE B 1 51 ? -10.642 26.863  21.575  1.00 0.00 ? 51 ILE B CG1    2  
ATOM 9577   C CG2    . ILE B 1 51 ? -12.676 27.764  20.434  1.00 0.00 ? 51 ILE B CG2    2  
ATOM 9578   C CD1    . ILE B 1 51 ? -9.668  27.345  20.508  1.00 0.00 ? 51 ILE B CD1    2  
ATOM 9579   H H      . ILE B 1 51 ? -11.382 24.348  22.079  1.00 0.00 ? 51 ILE B H      2  
ATOM 9580   H HA     . ILE B 1 51 ? -12.875 26.603  22.964  1.00 0.00 ? 51 ILE B HA     2  
ATOM 9581   H HB     . ILE B 1 51 ? -11.910 25.776  20.213  1.00 0.00 ? 51 ILE B HB     2  
ATOM 9582   H HG12   . ILE B 1 51 ? -10.743 27.642  22.330  1.00 0.00 ? 51 ILE B HG12   2  
ATOM 9583   H HG13   . ILE B 1 51 ? -10.196 25.984  22.039  1.00 0.00 ? 51 ILE B HG13   2  
ATOM 9584   H HG21   . ILE B 1 51 ? -13.760 27.665  20.421  1.00 0.00 ? 51 ILE B HG21   2  
ATOM 9585   H HG22   . ILE B 1 51 ? -12.416 28.634  21.037  1.00 0.00 ? 51 ILE B HG22   2  
ATOM 9586   H HG23   . ILE B 1 51 ? -12.325 27.913  19.411  1.00 0.00 ? 51 ILE B HG23   2  
ATOM 9587   H HD11   . ILE B 1 51 ? -9.617  26.599  19.714  1.00 0.00 ? 51 ILE B HD11   2  
ATOM 9588   H HD12   . ILE B 1 51 ? -10.015 28.297  20.108  1.00 0.00 ? 51 ILE B HD12   2  
ATOM 9589   H HD13   . ILE B 1 51 ? -8.683  27.477  20.960  1.00 0.00 ? 51 ILE B HD13   2  
ATOM 9590   N N      . GLN B 1 52 ? -14.493 24.426  21.126  1.00 0.00 ? 52 GLN B N      2  
ATOM 9591   C CA     . GLN B 1 52 ? -15.823 23.921  20.824  1.00 0.00 ? 52 GLN B CA     2  
ATOM 9592   C C      . GLN B 1 52 ? -16.478 23.213  22.010  1.00 0.00 ? 52 GLN B C      2  
ATOM 9593   O O      . GLN B 1 52 ? -17.593 22.709  21.878  1.00 0.00 ? 52 GLN B O      2  
ATOM 9594   C CB     . GLN B 1 52 ? -15.769 23.048  19.569  1.00 0.00 ? 52 GLN B CB     2  
ATOM 9595   C CG     . GLN B 1 52 ? -15.206 23.782  18.351  1.00 0.00 ? 52 GLN B CG     2  
ATOM 9596   C CD     . GLN B 1 52 ? -15.550 25.266  18.314  1.00 0.00 ? 52 GLN B CD     2  
ATOM 9597   O OE1    . GLN B 1 52 ? -16.697 25.654  18.106  1.00 0.00 ? 52 GLN B OE1    2  
ATOM 9598   N NE2    . GLN B 1 52 ? -14.568 26.120  18.593  1.00 0.00 ? 52 GLN B NE2    2  
ATOM 9599   H H      . GLN B 1 52 ? -13.690 23.928  20.766  1.00 0.00 ? 52 GLN B H      2  
ATOM 9600   H HA     . GLN B 1 52 ? -16.455 24.784  20.612  1.00 0.00 ? 52 GLN B HA     2  
ATOM 9601   H HB2    . GLN B 1 52 ? -15.155 22.170  19.768  1.00 0.00 ? 52 GLN B HB2    2  
ATOM 9602   H HB3    . GLN B 1 52 ? -16.773 22.706  19.313  1.00 0.00 ? 52 GLN B HB3    2  
ATOM 9603   H HG2    . GLN B 1 52 ? -14.122 23.668  18.340  1.00 0.00 ? 52 GLN B HG2    2  
ATOM 9604   H HG3    . GLN B 1 52 ? -15.608 23.313  17.455  1.00 0.00 ? 52 GLN B HG3    2  
ATOM 9605   H HE21   . GLN B 1 52 ? -13.639 25.766  18.766  1.00 0.00 ? 52 GLN B HE21   2  
ATOM 9606   H HE22   . GLN B 1 52 ? -14.796 27.070  18.848  1.00 0.00 ? 52 GLN B HE22   2  
ATOM 9607   N N      . ALA B 1 53 ? -15.838 23.221  23.182  1.00 0.00 ? 53 ALA B N      2  
ATOM 9608   C CA     . ALA B 1 53 ? -16.451 22.788  24.427  1.00 0.00 ? 53 ALA B CA     2  
ATOM 9609   C C      . ALA B 1 53 ? -17.311 23.889  25.048  1.00 0.00 ? 53 ALA B C      2  
ATOM 9610   O O      . ALA B 1 53 ? -18.201 23.586  25.841  1.00 0.00 ? 53 ALA B O      2  
ATOM 9611   C CB     . ALA B 1 53 ? -15.379 22.287  25.396  1.00 0.00 ? 53 ALA B CB     2  
ATOM 9612   H H      . ALA B 1 53 ? -14.921 23.639  23.242  1.00 0.00 ? 53 ALA B H      2  
ATOM 9613   H HA     . ALA B 1 53 ? -17.104 21.946  24.201  1.00 0.00 ? 53 ALA B HA     2  
ATOM 9614   H HB1    . ALA B 1 53 ? -14.612 21.731  24.856  1.00 0.00 ? 53 ALA B HB1    2  
ATOM 9615   H HB2    . ALA B 1 53 ? -14.918 23.127  25.915  1.00 0.00 ? 53 ALA B HB2    2  
ATOM 9616   H HB3    . ALA B 1 53 ? -15.839 21.632  26.135  1.00 0.00 ? 53 ALA B HB3    2  
ATOM 9617   N N      . GLY B 1 54 ? -17.081 25.155  24.679  1.00 0.00 ? 54 GLY B N      2  
ATOM 9618   C CA     . GLY B 1 54 ? -17.973 26.255  25.013  1.00 0.00 ? 54 GLY B CA     2  
ATOM 9619   C C      . GLY B 1 54 ? -17.270 27.544  25.420  1.00 0.00 ? 54 GLY B C      2  
ATOM 9620   O O      . GLY B 1 54 ? -17.653 28.149  26.421  1.00 0.00 ? 54 GLY B O      2  
ATOM 9621   H H      . GLY B 1 54 ? -16.322 25.341  24.039  1.00 0.00 ? 54 GLY B H      2  
ATOM 9622   H HA2    . GLY B 1 54 ? -18.567 26.479  24.132  1.00 0.00 ? 54 GLY B HA2    2  
ATOM 9623   H HA3    . GLY B 1 54 ? -18.644 25.957  25.818  1.00 0.00 ? 54 GLY B HA3    2  
ATOM 9624   N N      . LEU B 1 55 ? -16.243 27.962  24.675  1.00 0.00 ? 55 LEU B N      2  
ATOM 9625   C CA     . LEU B 1 55 ? -15.349 29.028  25.100  1.00 0.00 ? 55 LEU B CA     2  
ATOM 9626   C C      . LEU B 1 55 ? -14.424 29.511  23.986  1.00 0.00 ? 55 LEU B C      2  
ATOM 9627   O O      . LEU B 1 55 ? -14.491 29.046  22.850  1.00 0.00 ? 55 LEU B O      2  
ATOM 9628   C CB     . LEU B 1 55 ? -14.536 28.516  26.294  1.00 0.00 ? 55 LEU B CB     2  
ATOM 9629   C CG     . LEU B 1 55 ? -13.865 27.161  26.050  1.00 0.00 ? 55 LEU B CG     2  
ATOM 9630   C CD1    . LEU B 1 55 ? -12.494 27.290  25.392  1.00 0.00 ? 55 LEU B CD1    2  
ATOM 9631   C CD2    . LEU B 1 55 ? -13.722 26.453  27.392  1.00 0.00 ? 55 LEU B CD2    2  
ATOM 9632   H H      . LEU B 1 55 ? -16.010 27.467  23.825  1.00 0.00 ? 55 LEU B H      2  
ATOM 9633   H HA     . LEU B 1 55 ? -15.944 29.881  25.430  1.00 0.00 ? 55 LEU B HA     2  
ATOM 9634   H HB2    . LEU B 1 55 ? -13.778 29.247  26.578  1.00 0.00 ? 55 LEU B HB2    2  
ATOM 9635   H HB3    . LEU B 1 55 ? -15.212 28.422  27.143  1.00 0.00 ? 55 LEU B HB3    2  
ATOM 9636   H HG     . LEU B 1 55 ? -14.487 26.528  25.417  1.00 0.00 ? 55 LEU B HG     2  
ATOM 9637   H HD11   . LEU B 1 55 ? -12.579 27.847  24.461  1.00 0.00 ? 55 LEU B HD11   2  
ATOM 9638   H HD12   . LEU B 1 55 ? -11.803 27.795  26.065  1.00 0.00 ? 55 LEU B HD12   2  
ATOM 9639   H HD13   . LEU B 1 55 ? -12.119 26.293  25.163  1.00 0.00 ? 55 LEU B HD13   2  
ATOM 9640   H HD21   . LEU B 1 55 ? -14.723 26.265  27.781  1.00 0.00 ? 55 LEU B HD21   2  
ATOM 9641   H HD22   . LEU B 1 55 ? -13.212 25.501  27.246  1.00 0.00 ? 55 LEU B HD22   2  
ATOM 9642   H HD23   . LEU B 1 55 ? -13.154 27.084  28.077  1.00 0.00 ? 55 LEU B HD23   2  
ATOM 9643   N N      . THR B 1 56 ? -13.526 30.432  24.341  1.00 0.00 ? 56 THR B N      2  
ATOM 9644   C CA     . THR B 1 56 ? -12.386 30.855  23.541  1.00 0.00 ? 56 THR B CA     2  
ATOM 9645   C C      . THR B 1 56 ? -11.112 30.728  24.374  1.00 0.00 ? 56 THR B C      2  
ATOM 9646   O O      . THR B 1 56 ? -11.164 30.257  25.510  1.00 0.00 ? 56 THR B O      2  
ATOM 9647   C CB     . THR B 1 56 ? -12.582 32.283  23.030  1.00 0.00 ? 56 THR B CB     2  
ATOM 9648   O OG1    . THR B 1 56 ? -12.891 33.153  24.097  1.00 0.00 ? 56 THR B OG1    2  
ATOM 9649   C CG2    . THR B 1 56 ? -13.710 32.341  22.002  1.00 0.00 ? 56 THR B CG2    2  
ATOM 9650   H H      . THR B 1 56 ? -13.563 30.791  25.285  1.00 0.00 ? 56 THR B H      2  
ATOM 9651   H HA     . THR B 1 56 ? -12.277 30.193  22.683  1.00 0.00 ? 56 THR B HA     2  
ATOM 9652   H HB     . THR B 1 56 ? -11.663 32.621  22.550  1.00 0.00 ? 56 THR B HB     2  
ATOM 9653   H HG1    . THR B 1 56 ? -12.961 34.046  23.743  1.00 0.00 ? 56 THR B HG1    2  
ATOM 9654   H HG21   . THR B 1 56 ? -14.662 32.098  22.476  1.00 0.00 ? 56 THR B HG21   2  
ATOM 9655   H HG22   . THR B 1 56 ? -13.766 33.343  21.578  1.00 0.00 ? 56 THR B HG22   2  
ATOM 9656   H HG23   . THR B 1 56 ? -13.512 31.627  21.203  1.00 0.00 ? 56 THR B HG23   2  
ATOM 9657   N N      . ALA B 1 57 ? -9.960  31.091  23.805  1.00 0.00 ? 57 ALA B N      2  
ATOM 9658   C CA     . ALA B 1 57 ? -8.660  30.994  24.449  1.00 0.00 ? 57 ALA B CA     2  
ATOM 9659   C C      . ALA B 1 57 ? -8.706  31.448  25.910  1.00 0.00 ? 57 ALA B C      2  
ATOM 9660   O O      . ALA B 1 57 ? -9.127  32.573  26.175  1.00 0.00 ? 57 ALA B O      2  
ATOM 9661   C CB     . ALA B 1 57 ? -7.678  31.859  23.660  1.00 0.00 ? 57 ALA B CB     2  
ATOM 9662   H H      . ALA B 1 57 ? -9.979  31.459  22.864  1.00 0.00 ? 57 ALA B H      2  
ATOM 9663   H HA     . ALA B 1 57 ? -8.312  29.964  24.380  1.00 0.00 ? 57 ALA B HA     2  
ATOM 9664   H HB1    . ALA B 1 57 ? -7.664  31.530  22.621  1.00 0.00 ? 57 ALA B HB1    2  
ATOM 9665   H HB2    . ALA B 1 57 ? -7.985  32.904  23.703  1.00 0.00 ? 57 ALA B HB2    2  
ATOM 9666   H HB3    . ALA B 1 57 ? -6.680  31.757  24.086  1.00 0.00 ? 57 ALA B HB3    2  
ATOM 9667   N N      . PRO B 1 58 ? -8.292  30.605  26.867  1.00 0.00 ? 58 PRO B N      2  
ATOM 9668   C CA     . PRO B 1 58 ? -8.438  30.898  28.282  1.00 0.00 ? 58 PRO B CA     2  
ATOM 9669   C C      . PRO B 1 58 ? -7.616  32.089  28.763  1.00 0.00 ? 58 PRO B C      2  
ATOM 9670   O O      . PRO B 1 58 ? -6.767  32.630  28.055  1.00 0.00 ? 58 PRO B O      2  
ATOM 9671   C CB     . PRO B 1 58 ? -8.001  29.648  29.038  1.00 0.00 ? 58 PRO B CB     2  
ATOM 9672   C CG     . PRO B 1 58 ? -8.217  28.522  28.034  1.00 0.00 ? 58 PRO B CG     2  
ATOM 9673   C CD     . PRO B 1 58 ? -8.008  29.195  26.679  1.00 0.00 ? 58 PRO B CD     2  
ATOM 9674   H HA     . PRO B 1 58 ? -9.497  31.065  28.488  1.00 0.00 ? 58 PRO B HA     2  
ATOM 9675   H HB2    . PRO B 1 58 ? -6.941  29.711  29.287  1.00 0.00 ? 58 PRO B HB2    2  
ATOM 9676   H HB3    . PRO B 1 58 ? -8.596  29.527  29.945  1.00 0.00 ? 58 PRO B HB3    2  
ATOM 9677   H HG2    . PRO B 1 58 ? -7.493  27.722  28.191  1.00 0.00 ? 58 PRO B HG2    2  
ATOM 9678   H HG3    . PRO B 1 58 ? -9.237  28.145  28.109  1.00 0.00 ? 58 PRO B HG3    2  
ATOM 9679   H HD2    . PRO B 1 58 ? -6.974  29.068  26.356  1.00 0.00 ? 58 PRO B HD2    2  
ATOM 9680   H HD3    . PRO B 1 58 ? -8.691  28.758  25.951  1.00 0.00 ? 58 PRO B HD3    2  
ATOM 9681   N N      . ASP B 1 59 ? -7.811  32.418  30.041  1.00 0.00 ? 59 ASP B N      2  
ATOM 9682   C CA     . ASP B 1 59 ? -7.140  33.512  30.722  1.00 0.00 ? 59 ASP B CA     2  
ATOM 9683   C C      . ASP B 1 59 ? -5.700  33.181  31.109  1.00 0.00 ? 59 ASP B C      2  
ATOM 9684   O O      . ASP B 1 59 ? -4.885  34.088  31.272  1.00 0.00 ? 59 ASP B O      2  
ATOM 9685   C CB     . ASP B 1 59 ? -7.961  33.825  31.970  1.00 0.00 ? 59 ASP B CB     2  
ATOM 9686   C CG     . ASP B 1 59 ? -7.609  35.188  32.561  1.00 0.00 ? 59 ASP B CG     2  
ATOM 9687   O OD1    . ASP B 1 59 ? -7.829  36.203  31.865  1.00 0.00 ? 59 ASP B OD1    2  
ATOM 9688   O OD2    . ASP B 1 59 ? -7.155  35.223  33.727  1.00 0.00 ? 59 ASP B OD2    2  
ATOM 9689   H H      . ASP B 1 59 ? -8.522  31.923  30.559  1.00 0.00 ? 59 ASP B H      2  
ATOM 9690   H HA     . ASP B 1 59 ? -7.134  34.385  30.069  1.00 0.00 ? 59 ASP B HA     2  
ATOM 9691   H HB2    . ASP B 1 59 ? -9.020  33.805  31.708  1.00 0.00 ? 59 ASP B HB2    2  
ATOM 9692   H HB3    . ASP B 1 59 ? -7.794  33.039  32.706  1.00 0.00 ? 59 ASP B HB3    2  
ATOM 9693   N N      . MET C 1 1  ? -10.796 -9.618  -3.576  1.00 0.00 ? 1  MET C N      2  
ATOM 9694   C CA     . MET C 1 1  ? -9.326  -9.532  -3.639  1.00 0.00 ? 1  MET C CA     2  
ATOM 9695   C C      . MET C 1 1  ? -8.734  -9.723  -2.250  1.00 0.00 ? 1  MET C C      2  
ATOM 9696   O O      . MET C 1 1  ? -8.745  -8.788  -1.456  1.00 0.00 ? 1  MET C O      2  
ATOM 9697   C CB     . MET C 1 1  ? -8.850  -8.200  -4.221  1.00 0.00 ? 1  MET C CB     2  
ATOM 9698   C CG     . MET C 1 1  ? -7.326  -8.104  -4.249  1.00 0.00 ? 1  MET C CG     2  
ATOM 9699   S SD     . MET C 1 1  ? -6.522  -9.359  -5.276  1.00 0.00 ? 1  MET C SD     2  
ATOM 9700   C CE     . MET C 1 1  ? -6.054  -8.288  -6.656  1.00 0.00 ? 1  MET C CE     2  
ATOM 9701   H H1     . MET C 1 1  ? -11.078 -10.492 -3.158  1.00 0.00 ? 1  MET C H1     2  
ATOM 9702   H H2     . MET C 1 1  ? -11.189 -9.561  -4.505  1.00 0.00 ? 1  MET C H2     2  
ATOM 9703   H H3     . MET C 1 1  ? -11.171 -8.858  -3.022  1.00 0.00 ? 1  MET C H3     2  
ATOM 9704   H HA     . MET C 1 1  ? -8.956  -10.333 -4.281  1.00 0.00 ? 1  MET C HA     2  
ATOM 9705   H HB2    . MET C 1 1  ? -9.219  -8.100  -5.240  1.00 0.00 ? 1  MET C HB2    2  
ATOM 9706   H HB3    . MET C 1 1  ? -9.227  -7.386  -3.603  1.00 0.00 ? 1  MET C HB3    2  
ATOM 9707   H HG2    . MET C 1 1  ? -7.041  -7.116  -4.611  1.00 0.00 ? 1  MET C HG2    2  
ATOM 9708   H HG3    . MET C 1 1  ? -6.945  -8.195  -3.233  1.00 0.00 ? 1  MET C HG3    2  
ATOM 9709   H HE1    . MET C 1 1  ? -5.529  -8.871  -7.414  1.00 0.00 ? 1  MET C HE1    2  
ATOM 9710   H HE2    . MET C 1 1  ? -6.949  -7.845  -7.090  1.00 0.00 ? 1  MET C HE2    2  
ATOM 9711   H HE3    . MET C 1 1  ? -5.402  -7.496  -6.285  1.00 0.00 ? 1  MET C HE3    2  
ATOM 9712   N N      . LEU C 1 2  ? -8.166  -10.898 -1.971  1.00 0.00 ? 2  LEU C N      2  
ATOM 9713   C CA     . LEU C 1 2  ? -7.394  -11.173 -0.774  1.00 0.00 ? 2  LEU C CA     2  
ATOM 9714   C C      . LEU C 1 2  ? -5.928  -11.316 -1.172  1.00 0.00 ? 2  LEU C C      2  
ATOM 9715   O O      . LEU C 1 2  ? -5.557  -12.264 -1.862  1.00 0.00 ? 2  LEU C O      2  
ATOM 9716   C CB     . LEU C 1 2  ? -7.963  -12.442 -0.134  1.00 0.00 ? 2  LEU C CB     2  
ATOM 9717   C CG     . LEU C 1 2  ? -7.620  -12.683 1.340   1.00 0.00 ? 2  LEU C CG     2  
ATOM 9718   C CD1    . LEU C 1 2  ? -6.839  -13.986 1.452   1.00 0.00 ? 2  LEU C CD1    2  
ATOM 9719   C CD2    . LEU C 1 2  ? -6.805  -11.592 2.030   1.00 0.00 ? 2  LEU C CD2    2  
ATOM 9720   H H      . LEU C 1 2  ? -8.181  -11.628 -2.671  1.00 0.00 ? 2  LEU C H      2  
ATOM 9721   H HA     . LEU C 1 2  ? -7.512  -10.343 -0.075  1.00 0.00 ? 2  LEU C HA     2  
ATOM 9722   H HB2    . LEU C 1 2  ? -9.048  -12.412 -0.220  1.00 0.00 ? 2  LEU C HB2    2  
ATOM 9723   H HB3    . LEU C 1 2  ? -7.650  -13.306 -0.720  1.00 0.00 ? 2  LEU C HB3    2  
ATOM 9724   H HG     . LEU C 1 2  ? -8.548  -12.810 1.896   1.00 0.00 ? 2  LEU C HG     2  
ATOM 9725   H HD11   . LEU C 1 2  ? -7.479  -14.802 1.120   1.00 0.00 ? 2  LEU C HD11   2  
ATOM 9726   H HD12   . LEU C 1 2  ? -5.953  -13.922 0.823   1.00 0.00 ? 2  LEU C HD12   2  
ATOM 9727   H HD13   . LEU C 1 2  ? -6.547  -14.142 2.490   1.00 0.00 ? 2  LEU C HD13   2  
ATOM 9728   H HD21   . LEU C 1 2  ? -6.615  -11.887 3.060   1.00 0.00 ? 2  LEU C HD21   2  
ATOM 9729   H HD22   . LEU C 1 2  ? -5.849  -11.453 1.526   1.00 0.00 ? 2  LEU C HD22   2  
ATOM 9730   H HD23   . LEU C 1 2  ? -7.372  -10.662 2.035   1.00 0.00 ? 2  LEU C HD23   2  
ATOM 9731   N N      . ILE C 1 3  ? -5.098  -10.337 -0.804  1.00 0.00 ? 3  ILE C N      2  
ATOM 9732   C CA     . ILE C 1 3  ? -3.662  -10.366 -1.023  1.00 0.00 ? 3  ILE C CA     2  
ATOM 9733   C C      . ILE C 1 3  ? -3.002  -11.227 0.048   1.00 0.00 ? 3  ILE C C      2  
ATOM 9734   O O      . ILE C 1 3  ? -3.245  -11.029 1.237   1.00 0.00 ? 3  ILE C O      2  
ATOM 9735   C CB     . ILE C 1 3  ? -3.054  -8.961  -1.020  1.00 0.00 ? 3  ILE C CB     2  
ATOM 9736   C CG1    . ILE C 1 3  ? -3.529  -8.143  -2.222  1.00 0.00 ? 3  ILE C CG1    2  
ATOM 9737   C CG2    . ILE C 1 3  ? -1.532  -9.096  -1.113  1.00 0.00 ? 3  ILE C CG2    2  
ATOM 9738   C CD1    . ILE C 1 3  ? -4.780  -7.327  -1.921  1.00 0.00 ? 3  ILE C CD1    2  
ATOM 9739   H H      . ILE C 1 3  ? -5.453  -9.610  -0.198  1.00 0.00 ? 3  ILE C H      2  
ATOM 9740   H HA     . ILE C 1 3  ? -3.471  -10.794 -2.007  1.00 0.00 ? 3  ILE C HA     2  
ATOM 9741   H HB     . ILE C 1 3  ? -3.317  -8.439  -0.098  1.00 0.00 ? 3  ILE C HB     2  
ATOM 9742   H HG12   . ILE C 1 3  ? -2.756  -7.437  -2.524  1.00 0.00 ? 3  ILE C HG12   2  
ATOM 9743   H HG13   . ILE C 1 3  ? -3.741  -8.813  -3.054  1.00 0.00 ? 3  ILE C HG13   2  
ATOM 9744   H HG21   . ILE C 1 3  ? -1.268  -9.804  -1.900  1.00 0.00 ? 3  ILE C HG21   2  
ATOM 9745   H HG22   . ILE C 1 3  ? -1.083  -8.134  -1.349  1.00 0.00 ? 3  ILE C HG22   2  
ATOM 9746   H HG23   . ILE C 1 3  ? -1.127  -9.440  -0.161  1.00 0.00 ? 3  ILE C HG23   2  
ATOM 9747   H HD11   . ILE C 1 3  ? -5.602  -8.001  -1.688  1.00 0.00 ? 3  ILE C HD11   2  
ATOM 9748   H HD12   . ILE C 1 3  ? -4.596  -6.653  -1.084  1.00 0.00 ? 3  ILE C HD12   2  
ATOM 9749   H HD13   . ILE C 1 3  ? -5.034  -6.750  -2.808  1.00 0.00 ? 3  ILE C HD13   2  
ATOM 9750   N N      . LEU C 1 4  ? -2.099  -12.115 -0.376  1.00 0.00 ? 4  LEU C N      2  
ATOM 9751   C CA     . LEU C 1 4  ? -1.216  -12.867 0.500   1.00 0.00 ? 4  LEU C CA     2  
ATOM 9752   C C      . LEU C 1 4  ? 0.224   -12.757 0.009   1.00 0.00 ? 4  LEU C C      2  
ATOM 9753   O O      . LEU C 1 4  ? 0.476   -12.814 -1.194  1.00 0.00 ? 4  LEU C O      2  
ATOM 9754   C CB     . LEU C 1 4  ? -1.662  -14.329 0.549   1.00 0.00 ? 4  LEU C CB     2  
ATOM 9755   C CG     . LEU C 1 4  ? -3.038  -14.517 1.190   1.00 0.00 ? 4  LEU C CG     2  
ATOM 9756   C CD1    . LEU C 1 4  ? -3.469  -15.977 1.080   1.00 0.00 ? 4  LEU C CD1    2  
ATOM 9757   C CD2    . LEU C 1 4  ? -3.030  -14.124 2.666   1.00 0.00 ? 4  LEU C CD2    2  
ATOM 9758   H H      . LEU C 1 4  ? -1.957  -12.219 -1.371  1.00 0.00 ? 4  LEU C H      2  
ATOM 9759   H HA     . LEU C 1 4  ? -1.263  -12.447 1.504   1.00 0.00 ? 4  LEU C HA     2  
ATOM 9760   H HB2    . LEU C 1 4  ? -1.693  -14.716 -0.470  1.00 0.00 ? 4  LEU C HB2    2  
ATOM 9761   H HB3    . LEU C 1 4  ? -0.927  -14.905 1.112   1.00 0.00 ? 4  LEU C HB3    2  
ATOM 9762   H HG     . LEU C 1 4  ? -3.769  -13.904 0.663   1.00 0.00 ? 4  LEU C HG     2  
ATOM 9763   H HD11   . LEU C 1 4  ? -3.575  -16.244 0.028   1.00 0.00 ? 4  LEU C HD11   2  
ATOM 9764   H HD12   . LEU C 1 4  ? -2.723  -16.624 1.542   1.00 0.00 ? 4  LEU C HD12   2  
ATOM 9765   H HD13   . LEU C 1 4  ? -4.429  -16.112 1.576   1.00 0.00 ? 4  LEU C HD13   2  
ATOM 9766   H HD21   . LEU C 1 4  ? -2.147  -14.532 3.157   1.00 0.00 ? 4  LEU C HD21   2  
ATOM 9767   H HD22   . LEU C 1 4  ? -3.020  -13.039 2.759   1.00 0.00 ? 4  LEU C HD22   2  
ATOM 9768   H HD23   . LEU C 1 4  ? -3.930  -14.503 3.151   1.00 0.00 ? 4  LEU C HD23   2  
ATOM 9769   N N      . THR C 1 5  ? 1.176   -12.628 0.935   1.00 0.00 ? 5  THR C N      2  
ATOM 9770   C CA     . THR C 1 5  ? 2.595   -12.730 0.621   1.00 0.00 ? 5  THR C CA     2  
ATOM 9771   C C      . THR C 1 5  ? 3.135   -14.104 0.994   1.00 0.00 ? 5  THR C C      2  
ATOM 9772   O O      . THR C 1 5  ? 2.773   -14.660 2.030   1.00 0.00 ? 5  THR C O      2  
ATOM 9773   C CB     . THR C 1 5  ? 3.412   -11.624 1.291   1.00 0.00 ? 5  THR C CB     2  
ATOM 9774   O OG1    . THR C 1 5  ? 3.336   -11.703 2.696   1.00 0.00 ? 5  THR C OG1    2  
ATOM 9775   C CG2    . THR C 1 5  ? 2.930   -10.241 0.869   1.00 0.00 ? 5  THR C CG2    2  
ATOM 9776   H H      . THR C 1 5  ? 0.912   -12.499 1.901   1.00 0.00 ? 5  THR C H      2  
ATOM 9777   H HA     . THR C 1 5  ? 2.719   -12.609 -0.455  1.00 0.00 ? 5  THR C HA     2  
ATOM 9778   H HB     . THR C 1 5  ? 4.454   -11.723 0.987   1.00 0.00 ? 5  THR C HB     2  
ATOM 9779   H HG1    . THR C 1 5  ? 3.917   -12.413 2.988   1.00 0.00 ? 5  THR C HG1    2  
ATOM 9780   H HG21   . THR C 1 5  ? 1.915   -10.074 1.231   1.00 0.00 ? 5  THR C HG21   2  
ATOM 9781   H HG22   . THR C 1 5  ? 3.596   -9.487  1.287   1.00 0.00 ? 5  THR C HG22   2  
ATOM 9782   H HG23   . THR C 1 5  ? 2.953   -10.174 -0.218  1.00 0.00 ? 5  THR C HG23   2  
ATOM 9783   N N      . ARG C 1 6  ? 4.010   -14.658 0.149   1.00 0.00 ? 6  ARG C N      2  
ATOM 9784   C CA     . ARG C 1 6  ? 4.698   -15.911 0.412   1.00 0.00 ? 6  ARG C CA     2  
ATOM 9785   C C      . ARG C 1 6  ? 6.168   -15.809 0.032   1.00 0.00 ? 6  ARG C C      2  
ATOM 9786   O O      . ARG C 1 6  ? 6.498   -15.262 -1.018  1.00 0.00 ? 6  ARG C O      2  
ATOM 9787   C CB     . ARG C 1 6  ? 4.051   -17.050 -0.379  1.00 0.00 ? 6  ARG C CB     2  
ATOM 9788   C CG     . ARG C 1 6  ? 2.641   -17.425 0.072   1.00 0.00 ? 6  ARG C CG     2  
ATOM 9789   C CD     . ARG C 1 6  ? 2.584   -18.308 1.318   1.00 0.00 ? 6  ARG C CD     2  
ATOM 9790   N NE     . ARG C 1 6  ? 2.876   -17.560 2.542   1.00 0.00 ? 6  ARG C NE     2  
ATOM 9791   C CZ     . ARG C 1 6  ? 2.851   -18.074 3.775   1.00 0.00 ? 6  ARG C CZ     2  
ATOM 9792   N NH1    . ARG C 1 6  ? 2.459   -19.327 4.003   1.00 0.00 ? 6  ARG C NH1    2  
ATOM 9793   N NH2    . ARG C 1 6  ? 3.178   -17.329 4.829   1.00 0.00 ? 6  ARG C NH2    2  
ATOM 9794   H H      . ARG C 1 6  ? 4.221   -14.177 -0.716  1.00 0.00 ? 6  ARG C H      2  
ATOM 9795   H HA     . ARG C 1 6  ? 4.658   -16.139 1.477   1.00 0.00 ? 6  ARG C HA     2  
ATOM 9796   H HB2    . ARG C 1 6  ? 3.990   -16.755 -1.426  1.00 0.00 ? 6  ARG C HB2    2  
ATOM 9797   H HB3    . ARG C 1 6  ? 4.684   -17.934 -0.314  1.00 0.00 ? 6  ARG C HB3    2  
ATOM 9798   H HG2    . ARG C 1 6  ? 2.052   -16.523 0.237   1.00 0.00 ? 6  ARG C HG2    2  
ATOM 9799   H HG3    . ARG C 1 6  ? 2.197   -17.987 -0.748  1.00 0.00 ? 6  ARG C HG3    2  
ATOM 9800   H HD2    . ARG C 1 6  ? 1.578   -18.719 1.398   1.00 0.00 ? 6  ARG C HD2    2  
ATOM 9801   H HD3    . ARG C 1 6  ? 3.288   -19.131 1.206   1.00 0.00 ? 6  ARG C HD3    2  
ATOM 9802   H HE     . ARG C 1 6  ? 3.105   -16.582 2.444   1.00 0.00 ? 6  ARG C HE     2  
ATOM 9803   H HH11   . ARG C 1 6  ? 2.138   -19.912 3.247   1.00 0.00 ? 6  ARG C HH11   2  
ATOM 9804   H HH12   . ARG C 1 6  ? 2.479   -19.661 4.958   1.00 0.00 ? 6  ARG C HH12   2  
ATOM 9805   H HH21   . ARG C 1 6  ? 3.553   -16.400 4.714   1.00 0.00 ? 6  ARG C HH21   2  
ATOM 9806   H HH22   . ARG C 1 6  ? 3.149   -17.757 5.746   1.00 0.00 ? 6  ARG C HH22   2  
ATOM 9807   N N      . LYS C 1 7  ? 7.034   -16.397 0.859   1.00 0.00 ? 7  LYS C N      2  
ATOM 9808   C CA     . LYS C 1 7  ? 8.445   -16.596 0.555   1.00 0.00 ? 7  LYS C CA     2  
ATOM 9809   C C      . LYS C 1 7  ? 8.569   -17.764 -0.421  1.00 0.00 ? 7  LYS C C      2  
ATOM 9810   O O      . LYS C 1 7  ? 7.701   -18.635 -0.436  1.00 0.00 ? 7  LYS C O      2  
ATOM 9811   C CB     . LYS C 1 7  ? 9.218   -16.869 1.847   1.00 0.00 ? 7  LYS C CB     2  
ATOM 9812   C CG     . LYS C 1 7  ? 10.610  -16.238 1.914   1.00 0.00 ? 7  LYS C CG     2  
ATOM 9813   C CD     . LYS C 1 7  ? 10.566  -14.719 2.087   1.00 0.00 ? 7  LYS C CD     2  
ATOM 9814   C CE     . LYS C 1 7  ? 11.934  -14.127 2.423   1.00 0.00 ? 7  LYS C CE     2  
ATOM 9815   N NZ     . LYS C 1 7  ? 12.438  -14.591 3.727   1.00 0.00 ? 7  LYS C NZ     2  
ATOM 9816   H H      . LYS C 1 7  ? 6.627   -16.930 1.616   1.00 0.00 ? 7  LYS C H      2  
ATOM 9817   H HA     . LYS C 1 7  ? 8.840   -15.703 0.074   1.00 0.00 ? 7  LYS C HA     2  
ATOM 9818   H HB2    . LYS C 1 7  ? 8.639   -16.521 2.704   1.00 0.00 ? 7  LYS C HB2    2  
ATOM 9819   H HB3    . LYS C 1 7  ? 9.355   -17.945 1.942   1.00 0.00 ? 7  LYS C HB3    2  
ATOM 9820   H HG2    . LYS C 1 7  ? 11.134  -16.678 2.763   1.00 0.00 ? 7  LYS C HG2    2  
ATOM 9821   H HG3    . LYS C 1 7  ? 11.161  -16.488 1.008   1.00 0.00 ? 7  LYS C HG3    2  
ATOM 9822   H HD2    . LYS C 1 7  ? 10.238  -14.280 1.148   1.00 0.00 ? 7  LYS C HD2    2  
ATOM 9823   H HD3    . LYS C 1 7  ? 9.859   -14.436 2.870   1.00 0.00 ? 7  LYS C HD3    2  
ATOM 9824   H HE2    . LYS C 1 7  ? 12.645  -14.407 1.647   1.00 0.00 ? 7  LYS C HE2    2  
ATOM 9825   H HE3    . LYS C 1 7  ? 11.837  -13.041 2.440   1.00 0.00 ? 7  LYS C HE3    2  
ATOM 9826   H HZ1    . LYS C 1 7  ? 13.348  -14.193 3.912   1.00 0.00 ? 7  LYS C HZ1    2  
ATOM 9827   H HZ2    . LYS C 1 7  ? 11.799  -14.291 4.453   1.00 0.00 ? 7  LYS C HZ2    2  
ATOM 9828   H HZ3    . LYS C 1 7  ? 12.510  -15.598 3.749   1.00 0.00 ? 7  LYS C HZ3    2  
ATOM 9829   N N      . VAL C 1 8  ? 9.622   -17.817 -1.243  1.00 0.00 ? 8  VAL C N      2  
ATOM 9830   C CA     . VAL C 1 8  ? 9.731   -18.874 -2.238  1.00 0.00 ? 8  VAL C CA     2  
ATOM 9831   C C      . VAL C 1 8  ? 9.737   -20.256 -1.587  1.00 0.00 ? 8  VAL C C      2  
ATOM 9832   O O      . VAL C 1 8  ? 10.415  -20.480 -0.585  1.00 0.00 ? 8  VAL C O      2  
ATOM 9833   C CB     . VAL C 1 8  ? 10.919  -18.687 -3.187  1.00 0.00 ? 8  VAL C CB     2  
ATOM 9834   C CG1    . VAL C 1 8  ? 10.876  -17.333 -3.895  1.00 0.00 ? 8  VAL C CG1    2  
ATOM 9835   C CG2    . VAL C 1 8  ? 12.287  -18.801 -2.520  1.00 0.00 ? 8  VAL C CG2    2  
ATOM 9836   H H      . VAL C 1 8  ? 10.263  -17.037 -1.283  1.00 0.00 ? 8  VAL C H      2  
ATOM 9837   H HA     . VAL C 1 8  ? 8.833   -18.820 -2.851  1.00 0.00 ? 8  VAL C HA     2  
ATOM 9838   H HB     . VAL C 1 8  ? 10.855  -19.463 -3.949  1.00 0.00 ? 8  VAL C HB     2  
ATOM 9839   H HG11   . VAL C 1 8  ? 11.279  -16.560 -3.239  1.00 0.00 ? 8  VAL C HG11   2  
ATOM 9840   H HG12   . VAL C 1 8  ? 11.496  -17.374 -4.789  1.00 0.00 ? 8  VAL C HG12   2  
ATOM 9841   H HG13   . VAL C 1 8  ? 9.853   -17.085 -4.175  1.00 0.00 ? 8  VAL C HG13   2  
ATOM 9842   H HG21   . VAL C 1 8  ? 12.370  -18.079 -1.707  1.00 0.00 ? 8  VAL C HG21   2  
ATOM 9843   H HG22   . VAL C 1 8  ? 12.430  -19.810 -2.134  1.00 0.00 ? 8  VAL C HG22   2  
ATOM 9844   H HG23   . VAL C 1 8  ? 13.057  -18.597 -3.265  1.00 0.00 ? 8  VAL C HG23   2  
ATOM 9845   N N      . GLY C 1 9  ? 8.942   -21.176 -2.139  1.00 0.00 ? 9  GLY C N      2  
ATOM 9846   C CA     . GLY C 1 9  ? 8.758   -22.525 -1.629  1.00 0.00 ? 9  GLY C CA     2  
ATOM 9847   C C      . GLY C 1 9  ? 7.600   -22.672 -0.642  1.00 0.00 ? 9  GLY C C      2  
ATOM 9848   O O      . GLY C 1 9  ? 7.328   -23.791 -0.208  1.00 0.00 ? 9  GLY C O      2  
ATOM 9849   H H      . GLY C 1 9  ? 8.402   -20.930 -2.958  1.00 0.00 ? 9  GLY C H      2  
ATOM 9850   H HA2    . GLY C 1 9  ? 8.572   -23.190 -2.472  1.00 0.00 ? 9  GLY C HA2    2  
ATOM 9851   H HA3    . GLY C 1 9  ? 9.674   -22.850 -1.136  1.00 0.00 ? 9  GLY C HA3    2  
ATOM 9852   N N      . GLU C 1 10 ? 6.910   -21.588 -0.273  1.00 0.00 ? 10 GLU C N      2  
ATOM 9853   C CA     . GLU C 1 10 ? 5.765   -21.635 0.626   1.00 0.00 ? 10 GLU C CA     2  
ATOM 9854   C C      . GLU C 1 10 ? 4.448   -21.872 -0.115  1.00 0.00 ? 10 GLU C C      2  
ATOM 9855   O O      . GLU C 1 10 ? 4.416   -21.919 -1.344  1.00 0.00 ? 10 GLU C O      2  
ATOM 9856   C CB     . GLU C 1 10 ? 5.709   -20.369 1.481   1.00 0.00 ? 10 GLU C CB     2  
ATOM 9857   C CG     . GLU C 1 10 ? 6.931   -20.222 2.385   1.00 0.00 ? 10 GLU C CG     2  
ATOM 9858   C CD     . GLU C 1 10 ? 6.773   -19.058 3.361   1.00 0.00 ? 10 GLU C CD     2  
ATOM 9859   O OE1    . GLU C 1 10 ? 6.154   -18.040 2.979   1.00 0.00 ? 10 GLU C OE1    2  
ATOM 9860   O OE2    . GLU C 1 10 ? 7.287   -19.178 4.495   1.00 0.00 ? 10 GLU C OE2    2  
ATOM 9861   H H      . GLU C 1 10 ? 7.190   -20.683 -0.628  1.00 0.00 ? 10 GLU C H      2  
ATOM 9862   H HA     . GLU C 1 10 ? 5.898   -22.476 1.307   1.00 0.00 ? 10 GLU C HA     2  
ATOM 9863   H HB2    . GLU C 1 10 ? 5.628   -19.500 0.829   1.00 0.00 ? 10 GLU C HB2    2  
ATOM 9864   H HB3    . GLU C 1 10 ? 4.825   -20.414 2.118   1.00 0.00 ? 10 GLU C HB3    2  
ATOM 9865   H HG2    . GLU C 1 10 ? 7.063   -21.148 2.946   1.00 0.00 ? 10 GLU C HG2    2  
ATOM 9866   H HG3    . GLU C 1 10 ? 7.821   -20.061 1.776   1.00 0.00 ? 10 GLU C HG3    2  
ATOM 9867   N N      . SER C 1 11 ? 3.343   -21.988 0.631   1.00 0.00 ? 11 SER C N      2  
ATOM 9868   C CA     . SER C 1 11 ? 2.075   -22.475 0.106   1.00 0.00 ? 11 SER C CA     2  
ATOM 9869   C C      . SER C 1 11 ? 0.856   -21.702 0.602   1.00 0.00 ? 11 SER C C      2  
ATOM 9870   O O      . SER C 1 11 ? 0.879   -21.073 1.659   1.00 0.00 ? 11 SER C O      2  
ATOM 9871   C CB     . SER C 1 11 ? 1.913   -23.954 0.462   1.00 0.00 ? 11 SER C CB     2  
ATOM 9872   O OG     . SER C 1 11 ? 2.966   -24.721 -0.080  1.00 0.00 ? 11 SER C OG     2  
ATOM 9873   H H      . SER C 1 11 ? 3.391   -21.767 1.616   1.00 0.00 ? 11 SER C H      2  
ATOM 9874   H HA     . SER C 1 11 ? 2.090   -22.397 -0.981  1.00 0.00 ? 11 SER C HA     2  
ATOM 9875   H HB2    . SER C 1 11 ? 1.913   -24.064 1.547   1.00 0.00 ? 11 SER C HB2    2  
ATOM 9876   H HB3    . SER C 1 11 ? 0.965   -24.319 0.067   1.00 0.00 ? 11 SER C HB3    2  
ATOM 9877   H HG     . SER C 1 11 ? 2.833   -25.642 0.167   1.00 0.00 ? 11 SER C HG     2  
ATOM 9878   N N      . ILE C 1 12 ? -0.228  -21.808 -0.171  1.00 0.00 ? 12 ILE C N      2  
ATOM 9879   C CA     . ILE C 1 12 ? -1.526  -21.174 0.013   1.00 0.00 ? 12 ILE C CA     2  
ATOM 9880   C C      . ILE C 1 12 ? -2.606  -22.193 -0.350  1.00 0.00 ? 12 ILE C C      2  
ATOM 9881   O O      . ILE C 1 12 ? -2.336  -23.152 -1.071  1.00 0.00 ? 12 ILE C O      2  
ATOM 9882   C CB     . ILE C 1 12 ? -1.598  -19.911 -0.858  1.00 0.00 ? 12 ILE C CB     2  
ATOM 9883   C CG1    . ILE C 1 12 ? -0.517  -18.911 -0.435  1.00 0.00 ? 12 ILE C CG1    2  
ATOM 9884   C CG2    . ILE C 1 12 ? -2.978  -19.252 -0.833  1.00 0.00 ? 12 ILE C CG2    2  
ATOM 9885   C CD1    . ILE C 1 12 ? -0.565  -17.586 -1.194  1.00 0.00 ? 12 ILE C CD1    2  
ATOM 9886   H H      . ILE C 1 12 ? -0.146  -22.389 -0.995  1.00 0.00 ? 12 ILE C H      2  
ATOM 9887   H HA     . ILE C 1 12 ? -1.652  -20.895 1.059   1.00 0.00 ? 12 ILE C HA     2  
ATOM 9888   H HB     . ILE C 1 12 ? -1.387  -20.201 -1.887  1.00 0.00 ? 12 ILE C HB     2  
ATOM 9889   H HG12   . ILE C 1 12 ? -0.599  -18.702 0.632   1.00 0.00 ? 12 ILE C HG12   2  
ATOM 9890   H HG13   . ILE C 1 12 ? 0.458   -19.360 -0.622  1.00 0.00 ? 12 ILE C HG13   2  
ATOM 9891   H HG21   . ILE C 1 12 ? -2.998  -18.395 -1.505  1.00 0.00 ? 12 ILE C HG21   2  
ATOM 9892   H HG22   . ILE C 1 12 ? -3.742  -19.940 -1.193  1.00 0.00 ? 12 ILE C HG22   2  
ATOM 9893   H HG23   . ILE C 1 12 ? -3.218  -18.921 0.177   1.00 0.00 ? 12 ILE C HG23   2  
ATOM 9894   H HD11   . ILE C 1 12 ? -0.555  -17.777 -2.266  1.00 0.00 ? 12 ILE C HD11   2  
ATOM 9895   H HD12   . ILE C 1 12 ? -1.462  -17.034 -0.918  1.00 0.00 ? 12 ILE C HD12   2  
ATOM 9896   H HD13   . ILE C 1 12 ? 0.302   -16.981 -0.931  1.00 0.00 ? 12 ILE C HD13   2  
ATOM 9897   N N      . ASN C 1 13 ? -3.838  -22.013 0.133   1.00 0.00 ? 13 ASN C N      2  
ATOM 9898   C CA     . ASN C 1 13 ? -4.959  -22.899 -0.138  1.00 0.00 ? 13 ASN C CA     2  
ATOM 9899   C C      . ASN C 1 13 ? -6.207  -22.132 -0.565  1.00 0.00 ? 13 ASN C C      2  
ATOM 9900   O O      . ASN C 1 13 ? -6.437  -21.009 -0.122  1.00 0.00 ? 13 ASN C O      2  
ATOM 9901   C CB     . ASN C 1 13 ? -5.249  -23.749 1.099   1.00 0.00 ? 13 ASN C CB     2  
ATOM 9902   C CG     . ASN C 1 13 ? -4.334  -24.961 1.159   1.00 0.00 ? 13 ASN C CG     2  
ATOM 9903   O OD1    . ASN C 1 13 ? -3.375  -24.997 1.926   1.00 0.00 ? 13 ASN C OD1    2  
ATOM 9904   N ND2    . ASN C 1 13 ? -4.598  -25.957 0.315   1.00 0.00 ? 13 ASN C ND2    2  
ATOM 9905   H H      . ASN C 1 13 ? -4.024  -21.178 0.671   1.00 0.00 ? 13 ASN C H      2  
ATOM 9906   H HA     . ASN C 1 13 ? -4.697  -23.566 -0.961  1.00 0.00 ? 13 ASN C HA     2  
ATOM 9907   H HB2    . ASN C 1 13 ? -5.115  -23.147 1.997   1.00 0.00 ? 13 ASN C HB2    2  
ATOM 9908   H HB3    . ASN C 1 13 ? -6.281  -24.098 1.069   1.00 0.00 ? 13 ASN C HB3    2  
ATOM 9909   H HD21   . ASN C 1 13 ? -5.347  -25.871 -0.356  1.00 0.00 ? 13 ASN C HD21   2  
ATOM 9910   H HD22   . ASN C 1 13 ? -3.958  -26.735 0.249   1.00 0.00 ? 13 ASN C HD22   2  
ATOM 9911   N N      . ILE C 1 14 ? -7.036  -22.773 -1.396  1.00 0.00 ? 14 ILE C N      2  
ATOM 9912   C CA     . ILE C 1 14 ? -8.322  -22.257 -1.840  1.00 0.00 ? 14 ILE C CA     2  
ATOM 9913   C C      . ILE C 1 14 ? -9.365  -23.368 -1.739  1.00 0.00 ? 14 ILE C C      2  
ATOM 9914   O O      . ILE C 1 14 ? -9.103  -24.516 -2.094  1.00 0.00 ? 14 ILE C O      2  
ATOM 9915   C CB     . ILE C 1 14 ? -8.214  -21.686 -3.260  1.00 0.00 ? 14 ILE C CB     2  
ATOM 9916   C CG1    . ILE C 1 14 ? -7.141  -20.596 -3.338  1.00 0.00 ? 14 ILE C CG1    2  
ATOM 9917   C CG2    . ILE C 1 14 ? -9.568  -21.133 -3.713  1.00 0.00 ? 14 ILE C CG2    2  
ATOM 9918   C CD1    . ILE C 1 14 ? -6.979  -19.998 -4.736  1.00 0.00 ? 14 ILE C CD1    2  
ATOM 9919   H H      . ILE C 1 14 ? -6.802  -23.714 -1.681  1.00 0.00 ? 14 ILE C H      2  
ATOM 9920   H HA     . ILE C 1 14 ? -8.623  -21.450 -1.173  1.00 0.00 ? 14 ILE C HA     2  
ATOM 9921   H HB     . ILE C 1 14 ? -7.928  -22.486 -3.939  1.00 0.00 ? 14 ILE C HB     2  
ATOM 9922   H HG12   . ILE C 1 14 ? -7.382  -19.796 -2.638  1.00 0.00 ? 14 ILE C HG12   2  
ATOM 9923   H HG13   . ILE C 1 14 ? -6.178  -21.021 -3.054  1.00 0.00 ? 14 ILE C HG13   2  
ATOM 9924   H HG21   . ILE C 1 14 ? -10.331 -21.909 -3.661  1.00 0.00 ? 14 ILE C HG21   2  
ATOM 9925   H HG22   . ILE C 1 14 ? -9.860  -20.296 -3.078  1.00 0.00 ? 14 ILE C HG22   2  
ATOM 9926   H HG23   . ILE C 1 14 ? -9.510  -20.798 -4.748  1.00 0.00 ? 14 ILE C HG23   2  
ATOM 9927   H HD11   . ILE C 1 14 ? -6.878  -20.797 -5.470  1.00 0.00 ? 14 ILE C HD11   2  
ATOM 9928   H HD12   . ILE C 1 14 ? -7.840  -19.377 -4.981  1.00 0.00 ? 14 ILE C HD12   2  
ATOM 9929   H HD13   . ILE C 1 14 ? -6.083  -19.376 -4.758  1.00 0.00 ? 14 ILE C HD13   2  
ATOM 9930   N N      . GLY C 1 15 ? -10.555 -23.041 -1.229  1.00 0.00 ? 15 GLY C N      2  
ATOM 9931   C CA     . GLY C 1 15 ? -11.603 -24.006 -0.941  1.00 0.00 ? 15 GLY C CA     2  
ATOM 9932   C C      . GLY C 1 15 ? -11.112 -25.103 -0.004  1.00 0.00 ? 15 GLY C C      2  
ATOM 9933   O O      . GLY C 1 15 ? -10.349 -24.843 0.924   1.00 0.00 ? 15 GLY C O      2  
ATOM 9934   H H      . GLY C 1 15 ? -10.719 -22.078 -0.970  1.00 0.00 ? 15 GLY C H      2  
ATOM 9935   H HA2    . GLY C 1 15 ? -12.449 -23.499 -0.478  1.00 0.00 ? 15 GLY C HA2    2  
ATOM 9936   H HA3    . GLY C 1 15 ? -11.937 -24.455 -1.877  1.00 0.00 ? 15 GLY C HA3    2  
ATOM 9937   N N      . ASP C 1 16 ? -11.542 -26.338 -0.269  1.00 0.00 ? 16 ASP C N      2  
ATOM 9938   C CA     . ASP C 1 16 ? -11.021 -27.540 0.363   1.00 0.00 ? 16 ASP C CA     2  
ATOM 9939   C C      . ASP C 1 16 ? -10.451 -28.518 -0.664  1.00 0.00 ? 16 ASP C C      2  
ATOM 9940   O O      . ASP C 1 16 ? -10.118 -29.654 -0.327  1.00 0.00 ? 16 ASP C O      2  
ATOM 9941   C CB     . ASP C 1 16 ? -12.100 -28.174 1.244   1.00 0.00 ? 16 ASP C CB     2  
ATOM 9942   C CG     . ASP C 1 16 ? -13.256 -28.768 0.443   1.00 0.00 ? 16 ASP C CG     2  
ATOM 9943   O OD1    . ASP C 1 16 ? -14.037 -27.980 -0.135  1.00 0.00 ? 16 ASP C OD1    2  
ATOM 9944   O OD2    . ASP C 1 16 ? -13.403 -30.010 0.461   1.00 0.00 ? 16 ASP C OD2    2  
ATOM 9945   H H      . ASP C 1 16 ? -12.270 -26.461 -0.959  1.00 0.00 ? 16 ASP C H      2  
ATOM 9946   H HA     . ASP C 1 16 ? -10.196 -27.258 1.017   1.00 0.00 ? 16 ASP C HA     2  
ATOM 9947   H HB2    . ASP C 1 16 ? -11.641 -28.955 1.851   1.00 0.00 ? 16 ASP C HB2    2  
ATOM 9948   H HB3    . ASP C 1 16 ? -12.490 -27.415 1.923   1.00 0.00 ? 16 ASP C HB3    2  
ATOM 9949   N N      . ASP C 1 17 ? -10.314 -28.077 -1.919  1.00 0.00 ? 17 ASP C N      2  
ATOM 9950   C CA     . ASP C 1 17 ? -9.873  -28.896 -3.038  1.00 0.00 ? 17 ASP C CA     2  
ATOM 9951   C C      . ASP C 1 17 ? -8.605  -28.369 -3.704  1.00 0.00 ? 17 ASP C C      2  
ATOM 9952   O O      . ASP C 1 17 ? -7.973  -29.111 -4.454  1.00 0.00 ? 17 ASP C O      2  
ATOM 9953   C CB     . ASP C 1 17 ? -11.002 -28.993 -4.066  1.00 0.00 ? 17 ASP C CB     2  
ATOM 9954   C CG     . ASP C 1 17 ? -12.098 -29.961 -3.629  1.00 0.00 ? 17 ASP C CG     2  
ATOM 9955   O OD1    . ASP C 1 17 ? -11.795 -31.167 -3.491  1.00 0.00 ? 17 ASP C OD1    2  
ATOM 9956   O OD2    . ASP C 1 17 ? -13.258 -29.512 -3.500  1.00 0.00 ? 17 ASP C OD2    2  
ATOM 9957   H H      . ASP C 1 17 ? -10.586 -27.125 -2.119  1.00 0.00 ? 17 ASP C H      2  
ATOM 9958   H HA     . ASP C 1 17 ? -9.655  -29.906 -2.694  1.00 0.00 ? 17 ASP C HA     2  
ATOM 9959   H HB2    . ASP C 1 17 ? -11.426 -28.004 -4.234  1.00 0.00 ? 17 ASP C HB2    2  
ATOM 9960   H HB3    . ASP C 1 17 ? -10.590 -29.347 -5.011  1.00 0.00 ? 17 ASP C HB3    2  
ATOM 9961   N N      . ILE C 1 18 ? -8.219  -27.111 -3.459  1.00 0.00 ? 18 ILE C N      2  
ATOM 9962   C CA     . ILE C 1 18 ? -7.163  -26.448 -4.208  1.00 0.00 ? 18 ILE C CA     2  
ATOM 9963   C C      . ILE C 1 18 ? -6.011  -26.018 -3.303  1.00 0.00 ? 18 ILE C C      2  
ATOM 9964   O O      . ILE C 1 18 ? -6.217  -25.475 -2.218  1.00 0.00 ? 18 ILE C O      2  
ATOM 9965   C CB     . ILE C 1 18 ? -7.731  -25.276 -5.017  1.00 0.00 ? 18 ILE C CB     2  
ATOM 9966   C CG1    . ILE C 1 18 ? -8.828  -25.731 -5.985  1.00 0.00 ? 18 ILE C CG1    2  
ATOM 9967   C CG2    . ILE C 1 18 ? -6.628  -24.572 -5.808  1.00 0.00 ? 18 ILE C CG2    2  
ATOM 9968   C CD1    . ILE C 1 18 ? -10.224 -25.438 -5.438  1.00 0.00 ? 18 ILE C CD1    2  
ATOM 9969   H H      . ILE C 1 18 ? -8.727  -26.558 -2.783  1.00 0.00 ? 18 ILE C H      2  
ATOM 9970   H HA     . ILE C 1 18 ? -6.760  -27.161 -4.926  1.00 0.00 ? 18 ILE C HA     2  
ATOM 9971   H HB     . ILE C 1 18 ? -8.158  -24.551 -4.327  1.00 0.00 ? 18 ILE C HB     2  
ATOM 9972   H HG12   . ILE C 1 18 ? -8.726  -25.208 -6.936  1.00 0.00 ? 18 ILE C HG12   2  
ATOM 9973   H HG13   . ILE C 1 18 ? -8.734  -26.800 -6.178  1.00 0.00 ? 18 ILE C HG13   2  
ATOM 9974   H HG21   . ILE C 1 18 ? -7.064  -23.797 -6.441  1.00 0.00 ? 18 ILE C HG21   2  
ATOM 9975   H HG22   . ILE C 1 18 ? -5.925  -24.093 -5.126  1.00 0.00 ? 18 ILE C HG22   2  
ATOM 9976   H HG23   . ILE C 1 18 ? -6.097  -25.290 -6.433  1.00 0.00 ? 18 ILE C HG23   2  
ATOM 9977   H HD11   . ILE C 1 18 ? -10.356 -25.909 -4.465  1.00 0.00 ? 18 ILE C HD11   2  
ATOM 9978   H HD12   . ILE C 1 18 ? -10.358 -24.361 -5.336  1.00 0.00 ? 18 ILE C HD12   2  
ATOM 9979   H HD13   . ILE C 1 18 ? -10.973 -25.826 -6.128  1.00 0.00 ? 18 ILE C HD13   2  
ATOM 9980   N N      . THR C 1 19 ? -4.784  -26.202 -3.796  1.00 0.00 ? 19 THR C N      2  
ATOM 9981   C CA     . THR C 1 19 ? -3.562  -25.686 -3.200  1.00 0.00 ? 19 THR C CA     2  
ATOM 9982   C C      . THR C 1 19 ? -2.800  -24.863 -4.235  1.00 0.00 ? 19 THR C C      2  
ATOM 9983   O O      . THR C 1 19 ? -2.786  -25.204 -5.415  1.00 0.00 ? 19 THR C O      2  
ATOM 9984   C CB     . THR C 1 19 ? -2.699  -26.832 -2.669  1.00 0.00 ? 19 THR C CB     2  
ATOM 9985   O OG1    . THR C 1 19 ? -3.467  -27.691 -1.855  1.00 0.00 ? 19 THR C OG1    2  
ATOM 9986   C CG2    . THR C 1 19 ? -1.531  -26.330 -1.822  1.00 0.00 ? 19 THR C CG2    2  
ATOM 9987   H H      . THR C 1 19 ? -4.697  -26.684 -4.681  1.00 0.00 ? 19 THR C H      2  
ATOM 9988   H HA     . THR C 1 19 ? -3.815  -25.035 -2.364  1.00 0.00 ? 19 THR C HA     2  
ATOM 9989   H HB     . THR C 1 19 ? -2.304  -27.403 -3.508  1.00 0.00 ? 19 THR C HB     2  
ATOM 9990   H HG1    . THR C 1 19 ? -2.975  -28.508 -1.730  1.00 0.00 ? 19 THR C HG1    2  
ATOM 9991   H HG21   . THR C 1 19 ? -0.857  -25.730 -2.434  1.00 0.00 ? 19 THR C HG21   2  
ATOM 9992   H HG22   . THR C 1 19 ? -1.906  -25.729 -0.994  1.00 0.00 ? 19 THR C HG22   2  
ATOM 9993   H HG23   . THR C 1 19 ? -0.978  -27.182 -1.425  1.00 0.00 ? 19 THR C HG23   2  
ATOM 9994   N N      . ILE C 1 20 ? -2.168  -23.772 -3.795  1.00 0.00 ? 20 ILE C N      2  
ATOM 9995   C CA     . ILE C 1 20 ? -1.357  -22.885 -4.615  1.00 0.00 ? 20 ILE C CA     2  
ATOM 9996   C C      . ILE C 1 20 ? 0.035   -22.797 -3.996  1.00 0.00 ? 20 ILE C C      2  
ATOM 9997   O O      . ILE C 1 20 ? 0.163   -22.746 -2.775  1.00 0.00 ? 20 ILE C O      2  
ATOM 9998   C CB     . ILE C 1 20 ? -2.012  -21.501 -4.695  1.00 0.00 ? 20 ILE C CB     2  
ATOM 9999   C CG1    . ILE C 1 20 ? -3.462  -21.531 -5.186  1.00 0.00 ? 20 ILE C CG1    2  
ATOM 10000  C CG2    . ILE C 1 20 ? -1.181  -20.553 -5.561  1.00 0.00 ? 20 ILE C CG2    2  
ATOM 10001  C CD1    . ILE C 1 20 ? -3.624  -22.002 -6.630  1.00 0.00 ? 20 ILE C CD1    2  
ATOM 10002  H H      . ILE C 1 20 ? -2.186  -23.579 -2.803  1.00 0.00 ? 20 ILE C H      2  
ATOM 10003  H HA     . ILE C 1 20 ? -1.265  -23.295 -5.620  1.00 0.00 ? 20 ILE C HA     2  
ATOM 10004  H HB     . ILE C 1 20 ? -2.034  -21.090 -3.686  1.00 0.00 ? 20 ILE C HB     2  
ATOM 10005  H HG12   . ILE C 1 20 ? -4.052  -22.178 -4.538  1.00 0.00 ? 20 ILE C HG12   2  
ATOM 10006  H HG13   . ILE C 1 20 ? -3.874  -20.525 -5.106  1.00 0.00 ? 20 ILE C HG13   2  
ATOM 10007  H HG21   . ILE C 1 20 ? -0.975  -21.010 -6.528  1.00 0.00 ? 20 ILE C HG21   2  
ATOM 10008  H HG22   . ILE C 1 20 ? -1.726  -19.621 -5.712  1.00 0.00 ? 20 ILE C HG22   2  
ATOM 10009  H HG23   . ILE C 1 20 ? -0.238  -20.324 -5.064  1.00 0.00 ? 20 ILE C HG23   2  
ATOM 10010  H HD11   . ILE C 1 20 ? -3.160  -22.979 -6.758  1.00 0.00 ? 20 ILE C HD11   2  
ATOM 10011  H HD12   . ILE C 1 20 ? -4.685  -22.081 -6.864  1.00 0.00 ? 20 ILE C HD12   2  
ATOM 10012  H HD13   . ILE C 1 20 ? -3.165  -21.286 -7.311  1.00 0.00 ? 20 ILE C HD13   2  
ATOM 10013  N N      . THR C 1 21 ? 1.085   -22.772 -4.820  1.00 0.00 ? 21 THR C N      2  
ATOM 10014  C CA     . THR C 1 21 ? 2.460   -22.815 -4.346  1.00 0.00 ? 21 THR C CA     2  
ATOM 10015  C C      . THR C 1 21 ? 3.320   -21.806 -5.097  1.00 0.00 ? 21 THR C C      2  
ATOM 10016  O O      . THR C 1 21 ? 3.246   -21.722 -6.320  1.00 0.00 ? 21 THR C O      2  
ATOM 10017  C CB     . THR C 1 21 ? 3.050   -24.216 -4.522  1.00 0.00 ? 21 THR C CB     2  
ATOM 10018  O OG1    . THR C 1 21 ? 2.132   -25.215 -4.134  1.00 0.00 ? 21 THR C OG1    2  
ATOM 10019  C CG2    . THR C 1 21 ? 4.304   -24.386 -3.668  1.00 0.00 ? 21 THR C CG2    2  
ATOM 10020  H H      . THR C 1 21 ? 0.927   -22.767 -5.819  1.00 0.00 ? 21 THR C H      2  
ATOM 10021  H HA     . THR C 1 21 ? 2.487   -22.564 -3.286  1.00 0.00 ? 21 THR C HA     2  
ATOM 10022  H HB     . THR C 1 21 ? 3.308   -24.366 -5.570  1.00 0.00 ? 21 THR C HB     2  
ATOM 10023  H HG1    . THR C 1 21 ? 1.403   -25.214 -4.761  1.00 0.00 ? 21 THR C HG1    2  
ATOM 10024  H HG21   . THR C 1 21 ? 5.015   -23.586 -3.870  1.00 0.00 ? 21 THR C HG21   2  
ATOM 10025  H HG22   . THR C 1 21 ? 4.035   -24.370 -2.612  1.00 0.00 ? 21 THR C HG22   2  
ATOM 10026  H HG23   . THR C 1 21 ? 4.774   -25.339 -3.908  1.00 0.00 ? 21 THR C HG23   2  
ATOM 10027  N N      . ILE C 1 22 ? 4.170   -21.062 -4.385  1.00 0.00 ? 22 ILE C N      2  
ATOM 10028  C CA     . ILE C 1 22 ? 5.208   -20.275 -5.031  1.00 0.00 ? 22 ILE C CA     2  
ATOM 10029  C C      . ILE C 1 22 ? 6.440   -21.162 -5.166  1.00 0.00 ? 22 ILE C C      2  
ATOM 10030  O O      . ILE C 1 22 ? 7.034   -21.562 -4.168  1.00 0.00 ? 22 ILE C O      2  
ATOM 10031  C CB     . ILE C 1 22 ? 5.480   -18.968 -4.278  1.00 0.00 ? 22 ILE C CB     2  
ATOM 10032  C CG1    . ILE C 1 22 ? 6.758   -18.275 -4.758  1.00 0.00 ? 22 ILE C CG1    2  
ATOM 10033  C CG2    . ILE C 1 22 ? 5.613   -19.162 -2.769  1.00 0.00 ? 22 ILE C CG2    2  
ATOM 10034  C CD1    . ILE C 1 22 ? 6.677   -17.885 -6.230  1.00 0.00 ? 22 ILE C CD1    2  
ATOM 10035  H H      . ILE C 1 22 ? 4.235   -21.200 -3.386  1.00 0.00 ? 22 ILE C H      2  
ATOM 10036  H HA     . ILE C 1 22 ? 4.874   -20.007 -6.033  1.00 0.00 ? 22 ILE C HA     2  
ATOM 10037  H HB     . ILE C 1 22 ? 4.640   -18.295 -4.453  1.00 0.00 ? 22 ILE C HB     2  
ATOM 10038  H HG12   . ILE C 1 22 ? 6.914   -17.370 -4.172  1.00 0.00 ? 22 ILE C HG12   2  
ATOM 10039  H HG13   . ILE C 1 22 ? 7.617   -18.929 -4.614  1.00 0.00 ? 22 ILE C HG13   2  
ATOM 10040  H HG21   . ILE C 1 22 ? 5.876   -18.210 -2.309  1.00 0.00 ? 22 ILE C HG21   2  
ATOM 10041  H HG22   . ILE C 1 22 ? 4.669   -19.508 -2.350  1.00 0.00 ? 22 ILE C HG22   2  
ATOM 10042  H HG23   . ILE C 1 22 ? 6.401   -19.883 -2.556  1.00 0.00 ? 22 ILE C HG23   2  
ATOM 10043  H HD11   . ILE C 1 22 ? 6.566   -18.770 -6.855  1.00 0.00 ? 22 ILE C HD11   2  
ATOM 10044  H HD12   . ILE C 1 22 ? 5.826   -17.223 -6.379  1.00 0.00 ? 22 ILE C HD12   2  
ATOM 10045  H HD13   . ILE C 1 22 ? 7.598   -17.373 -6.508  1.00 0.00 ? 22 ILE C HD13   2  
ATOM 10046  N N      . LEU C 1 23 ? 6.816   -21.513 -6.398  1.00 0.00 ? 23 LEU C N      2  
ATOM 10047  C CA     . LEU C 1 23 ? 7.975   -22.362 -6.616  1.00 0.00 ? 23 LEU C CA     2  
ATOM 10048  C C      . LEU C 1 23 ? 9.246   -21.520 -6.642  1.00 0.00 ? 23 LEU C C      2  
ATOM 10049  O O      . LEU C 1 23 ? 10.265  -21.932 -6.092  1.00 0.00 ? 23 LEU C O      2  
ATOM 10050  C CB     . LEU C 1 23 ? 7.826   -23.181 -7.897  1.00 0.00 ? 23 LEU C CB     2  
ATOM 10051  C CG     . LEU C 1 23 ? 6.456   -23.830 -8.094  1.00 0.00 ? 23 LEU C CG     2  
ATOM 10052  C CD1    . LEU C 1 23 ? 6.569   -24.812 -9.254  1.00 0.00 ? 23 LEU C CD1    2  
ATOM 10053  C CD2    . LEU C 1 23 ? 5.966   -24.607 -6.877  1.00 0.00 ? 23 LEU C CD2    2  
ATOM 10054  H H      . LEU C 1 23 ? 6.328   -21.145 -7.202  1.00 0.00 ? 23 LEU C H      2  
ATOM 10055  H HA     . LEU C 1 23 ? 8.058   -23.063 -5.785  1.00 0.00 ? 23 LEU C HA     2  
ATOM 10056  H HB2    . LEU C 1 23 ? 8.019   -22.535 -8.752  1.00 0.00 ? 23 LEU C HB2    2  
ATOM 10057  H HB3    . LEU C 1 23 ? 8.589   -23.959 -7.888  1.00 0.00 ? 23 LEU C HB3    2  
ATOM 10058  H HG     . LEU C 1 23 ? 5.722   -23.065 -8.349  1.00 0.00 ? 23 LEU C HG     2  
ATOM 10059  H HD11   . LEU C 1 23 ? 7.361   -25.531 -9.046  1.00 0.00 ? 23 LEU C HD11   2  
ATOM 10060  H HD12   . LEU C 1 23 ? 5.625   -25.346 -9.369  1.00 0.00 ? 23 LEU C HD12   2  
ATOM 10061  H HD13   . LEU C 1 23 ? 6.828   -24.264 -10.160 1.00 0.00 ? 23 LEU C HD13   2  
ATOM 10062  H HD21   . LEU C 1 23 ? 5.076   -25.177 -7.145  1.00 0.00 ? 23 LEU C HD21   2  
ATOM 10063  H HD22   . LEU C 1 23 ? 6.749   -25.284 -6.539  1.00 0.00 ? 23 LEU C HD22   2  
ATOM 10064  H HD23   . LEU C 1 23 ? 5.716   -23.914 -6.076  1.00 0.00 ? 23 LEU C HD23   2  
ATOM 10065  N N      . GLY C 1 24 ? 9.175   -20.319 -7.225  1.00 0.00 ? 24 GLY C N      2  
ATOM 10066  C CA     . GLY C 1 24 ? 10.258  -19.356 -7.096  1.00 0.00 ? 24 GLY C CA     2  
ATOM 10067  C C      . GLY C 1 24 ? 10.149  -18.166 -8.042  1.00 0.00 ? 24 GLY C C      2  
ATOM 10068  O O      . GLY C 1 24 ? 9.156   -18.025 -8.752  1.00 0.00 ? 24 GLY C O      2  
ATOM 10069  H H      . GLY C 1 24 ? 8.326   -20.047 -7.700  1.00 0.00 ? 24 GLY C H      2  
ATOM 10070  H HA2    . GLY C 1 24 ? 10.258  -18.973 -6.075  1.00 0.00 ? 24 GLY C HA2    2  
ATOM 10071  H HA3    . GLY C 1 24 ? 11.214  -19.852 -7.265  1.00 0.00 ? 24 GLY C HA3    2  
ATOM 10072  N N      . VAL C 1 25 ? 11.173  -17.308 -8.047  1.00 0.00 ? 25 VAL C N      2  
ATOM 10073  C CA     . VAL C 1 25 ? 11.270  -16.174 -8.957  1.00 0.00 ? 25 VAL C CA     2  
ATOM 10074  C C      . VAL C 1 25 ? 12.451  -16.338 -9.908  1.00 0.00 ? 25 VAL C C      2  
ATOM 10075  O O      . VAL C 1 25 ? 13.429  -17.012 -9.589  1.00 0.00 ? 25 VAL C O      2  
ATOM 10076  C CB     . VAL C 1 25 ? 11.320  -14.833 -8.214  1.00 0.00 ? 25 VAL C CB     2  
ATOM 10077  C CG1    . VAL C 1 25 ? 10.345  -14.803 -7.037  1.00 0.00 ? 25 VAL C CG1    2  
ATOM 10078  C CG2    . VAL C 1 25 ? 12.714  -14.481 -7.699  1.00 0.00 ? 25 VAL C CG2    2  
ATOM 10079  H H      . VAL C 1 25 ? 11.961  -17.487 -7.440  1.00 0.00 ? 25 VAL C H      2  
ATOM 10080  H HA     . VAL C 1 25 ? 10.369  -16.155 -9.570  1.00 0.00 ? 25 VAL C HA     2  
ATOM 10081  H HB     . VAL C 1 25 ? 11.027  -14.047 -8.912  1.00 0.00 ? 25 VAL C HB     2  
ATOM 10082  H HG11   . VAL C 1 25 ? 10.693  -15.466 -6.242  1.00 0.00 ? 25 VAL C HG11   2  
ATOM 10083  H HG12   . VAL C 1 25 ? 10.280  -13.789 -6.645  1.00 0.00 ? 25 VAL C HG12   2  
ATOM 10084  H HG13   . VAL C 1 25 ? 9.357   -15.121 -7.370  1.00 0.00 ? 25 VAL C HG13   2  
ATOM 10085  H HG21   . VAL C 1 25 ? 13.381  -14.291 -8.541  1.00 0.00 ? 25 VAL C HG21   2  
ATOM 10086  H HG22   . VAL C 1 25 ? 12.661  -13.572 -7.100  1.00 0.00 ? 25 VAL C HG22   2  
ATOM 10087  H HG23   . VAL C 1 25 ? 13.107  -15.295 -7.089  1.00 0.00 ? 25 VAL C HG23   2  
ATOM 10088  N N      . SER C 1 26 ? 12.362  -15.707 -11.081 1.00 0.00 ? 26 SER C N      2  
ATOM 10089  C CA     . SER C 1 26 ? 13.438  -15.610 -12.054 1.00 0.00 ? 26 SER C CA     2  
ATOM 10090  C C      . SER C 1 26 ? 13.340  -14.268 -12.770 1.00 0.00 ? 26 SER C C      2  
ATOM 10091  O O      . SER C 1 26 ? 12.498  -14.089 -13.647 1.00 0.00 ? 26 SER C O      2  
ATOM 10092  C CB     . SER C 1 26 ? 13.335  -16.752 -13.065 1.00 0.00 ? 26 SER C CB     2  
ATOM 10093  O OG     . SER C 1 26 ? 13.911  -17.926 -12.534 1.00 0.00 ? 26 SER C OG     2  
ATOM 10094  H H      . SER C 1 26 ? 11.509  -15.202 -11.286 1.00 0.00 ? 26 SER C H      2  
ATOM 10095  H HA     . SER C 1 26 ? 14.402  -15.668 -11.549 1.00 0.00 ? 26 SER C HA     2  
ATOM 10096  H HB2    . SER C 1 26 ? 12.288  -16.932 -13.311 1.00 0.00 ? 26 SER C HB2    2  
ATOM 10097  H HB3    . SER C 1 26 ? 13.868  -16.478 -13.975 1.00 0.00 ? 26 SER C HB3    2  
ATOM 10098  H HG     . SER C 1 26 ? 13.558  -18.064 -11.649 1.00 0.00 ? 26 SER C HG     2  
ATOM 10099  N N      . GLY C 1 27 ? 14.159  -13.296 -12.360 1.00 0.00 ? 27 GLY C N      2  
ATOM 10100  C CA     . GLY C 1 27 ? 14.007  -11.928 -12.824 1.00 0.00 ? 27 GLY C CA     2  
ATOM 10101  C C      . GLY C 1 27 ? 12.685  -11.342 -12.342 1.00 0.00 ? 27 GLY C C      2  
ATOM 10102  O O      . GLY C 1 27 ? 12.425  -11.299 -11.141 1.00 0.00 ? 27 GLY C O      2  
ATOM 10103  H H      . GLY C 1 27 ? 14.811  -13.476 -11.610 1.00 0.00 ? 27 GLY C H      2  
ATOM 10104  H HA2    . GLY C 1 27 ? 14.829  -11.314 -12.456 1.00 0.00 ? 27 GLY C HA2    2  
ATOM 10105  H HA3    . GLY C 1 27 ? 14.012  -11.924 -13.914 1.00 0.00 ? 27 GLY C HA3    2  
ATOM 10106  N N      . GLN C 1 28 ? 11.832  -10.941 -13.288 1.00 0.00 ? 28 GLN C N      2  
ATOM 10107  C CA     . GLN C 1 28 ? 10.496  -10.435 -13.015 1.00 0.00 ? 28 GLN C CA     2  
ATOM 10108  C C      . GLN C 1 28 ? 9.434   -11.511 -13.201 1.00 0.00 ? 28 GLN C C      2  
ATOM 10109  O O      . GLN C 1 28 ? 8.249   -11.235 -13.032 1.00 0.00 ? 28 GLN C O      2  
ATOM 10110  C CB     . GLN C 1 28 ? 10.226  -9.211  -13.894 1.00 0.00 ? 28 GLN C CB     2  
ATOM 10111  C CG     . GLN C 1 28 ? 10.619  -7.906  -13.196 1.00 0.00 ? 28 GLN C CG     2  
ATOM 10112  C CD     . GLN C 1 28 ? 11.888  -8.024  -12.359 1.00 0.00 ? 28 GLN C CD     2  
ATOM 10113  O OE1    . GLN C 1 28 ? 13.000  -8.004  -12.879 1.00 0.00 ? 28 GLN C OE1    2  
ATOM 10114  N NE2    . GLN C 1 28 ? 11.742  -8.211  -11.048 1.00 0.00 ? 28 GLN C NE2    2  
ATOM 10115  H H      . GLN C 1 28 ? 12.102  -11.038 -14.258 1.00 0.00 ? 28 GLN C H      2  
ATOM 10116  H HA     . GLN C 1 28 ? 10.431  -10.136 -11.970 1.00 0.00 ? 28 GLN C HA     2  
ATOM 10117  H HB2    . GLN C 1 28 ? 10.758  -9.309  -14.842 1.00 0.00 ? 28 GLN C HB2    2  
ATOM 10118  H HB3    . GLN C 1 28 ? 9.166   -9.160  -14.141 1.00 0.00 ? 28 GLN C HB3    2  
ATOM 10119  H HG2    . GLN C 1 28 ? 10.757  -7.128  -13.949 1.00 0.00 ? 28 GLN C HG2    2  
ATOM 10120  H HG3    . GLN C 1 28 ? 9.796   -7.605  -12.547 1.00 0.00 ? 28 GLN C HG3    2  
ATOM 10121  H HE21   . GLN C 1 28 ? 10.820  -8.196  -10.638 1.00 0.00 ? 28 GLN C HE21   2  
ATOM 10122  H HE22   . GLN C 1 28 ? 12.518  -8.571  -10.510 1.00 0.00 ? 28 GLN C HE22   2  
ATOM 10123  N N      . GLN C 1 29 ? 9.839   -12.737 -13.539 1.00 0.00 ? 29 GLN C N      2  
ATOM 10124  C CA     . GLN C 1 29 ? 8.932   -13.867 -13.620 1.00 0.00 ? 29 GLN C CA     2  
ATOM 10125  C C      . GLN C 1 29 ? 8.856   -14.625 -12.303 1.00 0.00 ? 29 GLN C C      2  
ATOM 10126  O O      . GLN C 1 29 ? 9.782   -14.616 -11.495 1.00 0.00 ? 29 GLN C O      2  
ATOM 10127  C CB     . GLN C 1 29 ? 9.355   -14.799 -14.752 1.00 0.00 ? 29 GLN C CB     2  
ATOM 10128  C CG     . GLN C 1 29 ? 8.823   -14.330 -16.100 1.00 0.00 ? 29 GLN C CG     2  
ATOM 10129  C CD     . GLN C 1 29 ? 9.285   -15.268 -17.204 1.00 0.00 ? 29 GLN C CD     2  
ATOM 10130  O OE1    . GLN C 1 29 ? 8.489   -15.984 -17.806 1.00 0.00 ? 29 GLN C OE1    2  
ATOM 10131  N NE2    . GLN C 1 29 ? 10.593  -15.311 -17.447 1.00 0.00 ? 29 GLN C NE2    2  
ATOM 10132  H H      . GLN C 1 29 ? 10.829  -12.927 -13.610 1.00 0.00 ? 29 GLN C H      2  
ATOM 10133  H HA     . GLN C 1 29 ? 7.929   -13.508 -13.838 1.00 0.00 ? 29 GLN C HA     2  
ATOM 10134  H HB2    . GLN C 1 29 ? 10.438  -14.807 -14.814 1.00 0.00 ? 29 GLN C HB2    2  
ATOM 10135  H HB3    . GLN C 1 29 ? 9.001   -15.807 -14.549 1.00 0.00 ? 29 GLN C HB3    2  
ATOM 10136  H HG2    . GLN C 1 29 ? 7.733   -14.305 -16.075 1.00 0.00 ? 29 GLN C HG2    2  
ATOM 10137  H HG3    . GLN C 1 29 ? 9.223   -13.336 -16.291 1.00 0.00 ? 29 GLN C HG3    2  
ATOM 10138  H HE21   . GLN C 1 29 ? 11.229  -14.779 -16.870 1.00 0.00 ? 29 GLN C HE21   2  
ATOM 10139  H HE22   . GLN C 1 29 ? 10.955  -15.995 -18.093 1.00 0.00 ? 29 GLN C HE22   2  
ATOM 10140  N N      . VAL C 1 30 ? 7.734   -15.325 -12.135 1.00 0.00 ? 30 VAL C N      2  
ATOM 10141  C CA     . VAL C 1 30 ? 7.425   -16.132 -10.969 1.00 0.00 ? 30 VAL C CA     2  
ATOM 10142  C C      . VAL C 1 30 ? 6.955   -17.501 -11.443 1.00 0.00 ? 30 VAL C C      2  
ATOM 10143  O O      . VAL C 1 30 ? 5.996   -17.576 -12.209 1.00 0.00 ? 30 VAL C O      2  
ATOM 10144  C CB     . VAL C 1 30 ? 6.334   -15.434 -10.157 1.00 0.00 ? 30 VAL C CB     2  
ATOM 10145  C CG1    . VAL C 1 30 ? 6.054   -16.214 -8.876  1.00 0.00 ? 30 VAL C CG1    2  
ATOM 10146  C CG2    . VAL C 1 30 ? 6.746   -14.017 -9.757  1.00 0.00 ? 30 VAL C CG2    2  
ATOM 10147  H H      . VAL C 1 30 ? 6.994   -15.197 -12.814 1.00 0.00 ? 30 VAL C H      2  
ATOM 10148  H HA     . VAL C 1 30 ? 8.314   -16.250 -10.350 1.00 0.00 ? 30 VAL C HA     2  
ATOM 10149  H HB     . VAL C 1 30 ? 5.418   -15.382 -10.745 1.00 0.00 ? 30 VAL C HB     2  
ATOM 10150  H HG11   . VAL C 1 30 ? 5.874   -17.265 -9.100  1.00 0.00 ? 30 VAL C HG11   2  
ATOM 10151  H HG12   . VAL C 1 30 ? 6.915   -16.125 -8.215  1.00 0.00 ? 30 VAL C HG12   2  
ATOM 10152  H HG13   . VAL C 1 30 ? 5.170   -15.803 -8.389  1.00 0.00 ? 30 VAL C HG13   2  
ATOM 10153  H HG21   . VAL C 1 30 ? 6.019   -13.607 -9.058  1.00 0.00 ? 30 VAL C HG21   2  
ATOM 10154  H HG22   . VAL C 1 30 ? 7.728   -14.036 -9.283  1.00 0.00 ? 30 VAL C HG22   2  
ATOM 10155  H HG23   . VAL C 1 30 ? 6.782   -13.377 -10.638 1.00 0.00 ? 30 VAL C HG23   2  
ATOM 10156  N N      . ARG C 1 31 ? 7.604   -18.580 -10.995 1.00 0.00 ? 31 ARG C N      2  
ATOM 10157  C CA     . ARG C 1 31 ? 7.096   -19.926 -11.207 1.00 0.00 ? 31 ARG C CA     2  
ATOM 10158  C C      . ARG C 1 31 ? 6.064   -20.253 -10.135 1.00 0.00 ? 31 ARG C C      2  
ATOM 10159  O O      . ARG C 1 31 ? 6.395   -20.312 -8.951  1.00 0.00 ? 31 ARG C O      2  
ATOM 10160  C CB     . ARG C 1 31 ? 8.213   -20.972 -11.254 1.00 0.00 ? 31 ARG C CB     2  
ATOM 10161  C CG     . ARG C 1 31 ? 7.667   -22.224 -11.939 1.00 0.00 ? 31 ARG C CG     2  
ATOM 10162  C CD     . ARG C 1 31 ? 8.690   -23.341 -12.151 1.00 0.00 ? 31 ARG C CD     2  
ATOM 10163  N NE     . ARG C 1 31 ? 9.785   -22.919 -13.033 1.00 0.00 ? 31 ARG C NE     2  
ATOM 10164  C CZ     . ARG C 1 31 ? 10.485  -23.733 -13.829 1.00 0.00 ? 31 ARG C CZ     2  
ATOM 10165  N NH1    . ARG C 1 31 ? 10.398  -25.059 -13.735 1.00 0.00 ? 31 ARG C NH1    2  
ATOM 10166  N NH2    . ARG C 1 31 ? 11.318  -23.220 -14.735 1.00 0.00 ? 31 ARG C NH2    2  
ATOM 10167  H H      . ARG C 1 31 ? 8.354   -18.455 -10.328 1.00 0.00 ? 31 ARG C H      2  
ATOM 10168  H HA     . ARG C 1 31 ? 6.593   -19.941 -12.174 1.00 0.00 ? 31 ARG C HA     2  
ATOM 10169  H HB2    . ARG C 1 31 ? 9.052   -20.609 -11.840 1.00 0.00 ? 31 ARG C HB2    2  
ATOM 10170  H HB3    . ARG C 1 31 ? 8.567   -21.198 -10.249 1.00 0.00 ? 31 ARG C HB3    2  
ATOM 10171  H HG2    . ARG C 1 31 ? 6.831   -22.602 -11.354 1.00 0.00 ? 31 ARG C HG2    2  
ATOM 10172  H HG3    . ARG C 1 31 ? 7.277   -21.926 -12.910 1.00 0.00 ? 31 ARG C HG3    2  
ATOM 10173  H HD2    . ARG C 1 31 ? 9.084   -23.676 -11.191 1.00 0.00 ? 31 ARG C HD2    2  
ATOM 10174  H HD3    . ARG C 1 31 ? 8.179   -24.185 -12.615 1.00 0.00 ? 31 ARG C HD3    2  
ATOM 10175  H HE     . ARG C 1 31 ? 9.924   -21.926 -13.146 1.00 0.00 ? 31 ARG C HE     2  
ATOM 10176  H HH11   . ARG C 1 31 ? 9.947   -25.480 -12.931 1.00 0.00 ? 31 ARG C HH11   2  
ATOM 10177  H HH12   . ARG C 1 31 ? 10.931  -25.649 -14.357 1.00 0.00 ? 31 ARG C HH12   2  
ATOM 10178  H HH21   . ARG C 1 31 ? 11.503  -22.228 -14.747 1.00 0.00 ? 31 ARG C HH21   2  
ATOM 10179  H HH22   . ARG C 1 31 ? 11.831  -23.837 -15.347 1.00 0.00 ? 31 ARG C HH22   2  
ATOM 10180  N N      . ILE C 1 32 ? 4.821   -20.457 -10.576 1.00 0.00 ? 32 ILE C N      2  
ATOM 10181  C CA     . ILE C 1 32 ? 3.654   -20.640 -9.729  1.00 0.00 ? 32 ILE C CA     2  
ATOM 10182  C C      . ILE C 1 32 ? 3.092   -22.044 -9.930  1.00 0.00 ? 32 ILE C C      2  
ATOM 10183  O O      . ILE C 1 32 ? 2.729   -22.423 -11.041 1.00 0.00 ? 32 ILE C O      2  
ATOM 10184  C CB     . ILE C 1 32 ? 2.588   -19.580 -10.030 1.00 0.00 ? 32 ILE C CB     2  
ATOM 10185  C CG1    . ILE C 1 32 ? 3.186   -18.169 -10.050 1.00 0.00 ? 32 ILE C CG1    2  
ATOM 10186  C CG2    . ILE C 1 32 ? 1.477   -19.677 -8.982  1.00 0.00 ? 32 ILE C CG2    2  
ATOM 10187  C CD1    . ILE C 1 32 ? 2.158   -17.077 -10.341 1.00 0.00 ? 32 ILE C CD1    2  
ATOM 10188  H H      . ILE C 1 32 ? 4.674   -20.421 -11.576 1.00 0.00 ? 32 ILE C H      2  
ATOM 10189  H HA     . ILE C 1 32 ? 3.953   -20.534 -8.686  1.00 0.00 ? 32 ILE C HA     2  
ATOM 10190  H HB     . ILE C 1 32 ? 2.160   -19.784 -11.011 1.00 0.00 ? 32 ILE C HB     2  
ATOM 10191  H HG12   . ILE C 1 32 ? 3.663   -17.961 -9.093  1.00 0.00 ? 32 ILE C HG12   2  
ATOM 10192  H HG13   . ILE C 1 32 ? 3.943   -18.117 -10.831 1.00 0.00 ? 32 ILE C HG13   2  
ATOM 10193  H HG21   . ILE C 1 32 ? 1.079   -20.691 -8.944  1.00 0.00 ? 32 ILE C HG21   2  
ATOM 10194  H HG22   . ILE C 1 32 ? 1.867   -19.410 -7.999  1.00 0.00 ? 32 ILE C HG22   2  
ATOM 10195  H HG23   . ILE C 1 32 ? 0.658   -19.006 -9.240  1.00 0.00 ? 32 ILE C HG23   2  
ATOM 10196  H HD11   . ILE C 1 32 ? 1.492   -16.949 -9.488  1.00 0.00 ? 32 ILE C HD11   2  
ATOM 10197  H HD12   . ILE C 1 32 ? 2.676   -16.135 -10.523 1.00 0.00 ? 32 ILE C HD12   2  
ATOM 10198  H HD13   . ILE C 1 32 ? 1.578   -17.342 -11.225 1.00 0.00 ? 32 ILE C HD13   2  
ATOM 10199  N N      . GLY C 1 33 ? 2.996   -22.806 -8.838  1.00 0.00 ? 33 GLY C N      2  
ATOM 10200  C CA     . GLY C 1 33 ? 2.321   -24.089 -8.772  1.00 0.00 ? 33 GLY C CA     2  
ATOM 10201  C C      . GLY C 1 33 ? 0.837   -23.930 -8.467  1.00 0.00 ? 33 GLY C C      2  
ATOM 10202  O O      . GLY C 1 33 ? 0.459   -23.141 -7.603  1.00 0.00 ? 33 GLY C O      2  
ATOM 10203  H H      . GLY C 1 33 ? 3.275   -22.398 -7.955  1.00 0.00 ? 33 GLY C H      2  
ATOM 10204  H HA2    . GLY C 1 33 ? 2.448   -24.642 -9.703  1.00 0.00 ? 33 GLY C HA2    2  
ATOM 10205  H HA3    . GLY C 1 33 ? 2.771   -24.669 -7.966  1.00 0.00 ? 33 GLY C HA3    2  
ATOM 10206  N N      . ILE C 1 34 ? -0.002  -24.719 -9.144  1.00 0.00 ? 34 ILE C N      2  
ATOM 10207  C CA     . ILE C 1 34 ? -1.438  -24.768 -8.923  1.00 0.00 ? 34 ILE C CA     2  
ATOM 10208  C C      . ILE C 1 34 ? -1.846  -26.232 -8.835  1.00 0.00 ? 34 ILE C C      2  
ATOM 10209  O O      . ILE C 1 34 ? -1.390  -27.053 -9.628  1.00 0.00 ? 34 ILE C O      2  
ATOM 10210  C CB     . ILE C 1 34 ? -2.185  -24.055 -10.056 1.00 0.00 ? 34 ILE C CB     2  
ATOM 10211  C CG1    . ILE C 1 34 ? -1.715  -22.607 -10.222 1.00 0.00 ? 34 ILE C CG1    2  
ATOM 10212  C CG2    . ILE C 1 34 ? -3.691  -24.095 -9.793  1.00 0.00 ? 34 ILE C CG2    2  
ATOM 10213  C CD1    . ILE C 1 34 ? -2.299  -21.937 -11.466 1.00 0.00 ? 34 ILE C CD1    2  
ATOM 10214  H H      . ILE C 1 34 ? 0.369   -25.336 -9.853  1.00 0.00 ? 34 ILE C H      2  
ATOM 10215  H HA     . ILE C 1 34 ? -1.681  -24.293 -7.973  1.00 0.00 ? 34 ILE C HA     2  
ATOM 10216  H HB     . ILE C 1 34 ? -1.988  -24.589 -10.987 1.00 0.00 ? 34 ILE C HB     2  
ATOM 10217  H HG12   . ILE C 1 34 ? -1.988  -22.030 -9.339  1.00 0.00 ? 34 ILE C HG12   2  
ATOM 10218  H HG13   . ILE C 1 34 ? -0.631  -22.589 -10.324 1.00 0.00 ? 34 ILE C HG13   2  
ATOM 10219  H HG21   . ILE C 1 34 ? -4.223  -23.565 -10.582 1.00 0.00 ? 34 ILE C HG21   2  
ATOM 10220  H HG22   . ILE C 1 34 ? -4.044  -25.126 -9.779  1.00 0.00 ? 34 ILE C HG22   2  
ATOM 10221  H HG23   . ILE C 1 34 ? -3.917  -23.623 -8.837  1.00 0.00 ? 34 ILE C HG23   2  
ATOM 10222  H HD11   . ILE C 1 34 ? -2.195  -22.598 -12.326 1.00 0.00 ? 34 ILE C HD11   2  
ATOM 10223  H HD12   . ILE C 1 34 ? -3.352  -21.703 -11.309 1.00 0.00 ? 34 ILE C HD12   2  
ATOM 10224  H HD13   . ILE C 1 34 ? -1.761  -21.009 -11.660 1.00 0.00 ? 34 ILE C HD13   2  
ATOM 10225  N N      . ASN C 1 35 ? -2.680  -26.579 -7.855  1.00 0.00 ? 35 ASN C N      2  
ATOM 10226  C CA     . ASN C 1 35 ? -3.015  -27.963 -7.575  1.00 0.00 ? 35 ASN C CA     2  
ATOM 10227  C C      . ASN C 1 35 ? -4.506  -28.093 -7.287  1.00 0.00 ? 35 ASN C C      2  
ATOM 10228  O O      . ASN C 1 35 ? -4.943  -27.898 -6.155  1.00 0.00 ? 35 ASN C O      2  
ATOM 10229  C CB     . ASN C 1 35 ? -2.145  -28.439 -6.412  1.00 0.00 ? 35 ASN C CB     2  
ATOM 10230  C CG     . ASN C 1 35 ? -1.946  -29.948 -6.398  1.00 0.00 ? 35 ASN C CG     2  
ATOM 10231  O OD1    . ASN C 1 35 ? -2.431  -30.671 -7.264  1.00 0.00 ? 35 ASN C OD1    2  
ATOM 10232  N ND2    . ASN C 1 35 ? -1.165  -30.443 -5.442  1.00 0.00 ? 35 ASN C ND2    2  
ATOM 10233  H H      . ASN C 1 35 ? -2.959  -25.880 -7.178  1.00 0.00 ? 35 ASN C H      2  
ATOM 10234  H HA     . ASN C 1 35 ? -2.788  -28.567 -8.453  1.00 0.00 ? 35 ASN C HA     2  
ATOM 10235  H HB2    . ASN C 1 35 ? -1.167  -27.967 -6.484  1.00 0.00 ? 35 ASN C HB2    2  
ATOM 10236  H HB3    . ASN C 1 35 ? -2.590  -28.119 -5.471  1.00 0.00 ? 35 ASN C HB3    2  
ATOM 10237  H HD21   . ASN C 1 35 ? -0.737  -29.825 -4.767  1.00 0.00 ? 35 ASN C HD21   2  
ATOM 10238  H HD22   . ASN C 1 35 ? -0.959  -31.432 -5.435  1.00 0.00 ? 35 ASN C HD22   2  
ATOM 10239  N N      . ALA C 1 36 ? -5.288  -28.370 -8.331  1.00 0.00 ? 36 ALA C N      2  
ATOM 10240  C CA     . ALA C 1 36 ? -6.737  -28.436 -8.266  1.00 0.00 ? 36 ALA C CA     2  
ATOM 10241  C C      . ALA C 1 36 ? -7.245  -29.687 -8.980  1.00 0.00 ? 36 ALA C C      2  
ATOM 10242  O O      . ALA C 1 36 ? -6.568  -30.185 -9.879  1.00 0.00 ? 36 ALA C O      2  
ATOM 10243  C CB     . ALA C 1 36 ? -7.297  -27.163 -8.903  1.00 0.00 ? 36 ALA C CB     2  
ATOM 10244  H H      . ALA C 1 36 ? -4.858  -28.513 -9.234  1.00 0.00 ? 36 ALA C H      2  
ATOM 10245  H HA     . ALA C 1 36 ? -7.049  -28.475 -7.223  1.00 0.00 ? 36 ALA C HA     2  
ATOM 10246  H HB1    . ALA C 1 36 ? -6.875  -26.287 -8.409  1.00 0.00 ? 36 ALA C HB1    2  
ATOM 10247  H HB2    . ALA C 1 36 ? -7.040  -27.132 -9.961  1.00 0.00 ? 36 ALA C HB2    2  
ATOM 10248  H HB3    . ALA C 1 36 ? -8.381  -27.140 -8.797  1.00 0.00 ? 36 ALA C HB3    2  
ATOM 10249  N N      . PRO C 1 37 ? -8.440  -30.189 -8.643  1.00 0.00 ? 37 PRO C N      2  
ATOM 10250  C CA     . PRO C 1 37 ? -9.083  -31.250 -9.397  1.00 0.00 ? 37 PRO C CA     2  
ATOM 10251  C C      . PRO C 1 37 ? -9.385  -30.803 -10.823 1.00 0.00 ? 37 PRO C C      2  
ATOM 10252  O O      . PRO C 1 37 ? -9.684  -29.632 -11.054 1.00 0.00 ? 37 PRO C O      2  
ATOM 10253  C CB     . PRO C 1 37 ? -10.377 -31.564 -8.649  1.00 0.00 ? 37 PRO C CB     2  
ATOM 10254  C CG     . PRO C 1 37 ? -10.687 -30.284 -7.879  1.00 0.00 ? 37 PRO C CG     2  
ATOM 10255  C CD     . PRO C 1 37 ? -9.304  -29.712 -7.579  1.00 0.00 ? 37 PRO C CD     2  
ATOM 10256  H HA     . PRO C 1 37 ? -8.445  -32.134 -9.417  1.00 0.00 ? 37 PRO C HA     2  
ATOM 10257  H HB2    . PRO C 1 37 ? -11.188 -31.805 -9.337  1.00 0.00 ? 37 PRO C HB2    2  
ATOM 10258  H HB3    . PRO C 1 37 ? -10.211 -32.385 -7.950  1.00 0.00 ? 37 PRO C HB3    2  
ATOM 10259  H HG2    . PRO C 1 37 ? -11.239 -29.587 -8.509  1.00 0.00 ? 37 PRO C HG2    2  
ATOM 10260  H HG3    . PRO C 1 37 ? -11.257 -30.495 -6.975  1.00 0.00 ? 37 PRO C HG3    2  
ATOM 10261  H HD2    . PRO C 1 37 ? -9.352  -28.623 -7.559  1.00 0.00 ? 37 PRO C HD2    2  
ATOM 10262  H HD3    . PRO C 1 37 ? -8.947  -30.093 -6.623  1.00 0.00 ? 37 PRO C HD3    2  
ATOM 10263  N N      . LYS C 1 38 ? -9.441  -31.747 -11.767 1.00 0.00 ? 38 LYS C N      2  
ATOM 10264  C CA     . LYS C 1 38 ? -9.878  -31.478 -13.130 1.00 0.00 ? 38 LYS C CA     2  
ATOM 10265  C C      . LYS C 1 38 ? -11.361 -31.118 -13.208 1.00 0.00 ? 38 LYS C C      2  
ATOM 10266  O O      . LYS C 1 38 ? -11.862 -30.789 -14.281 1.00 0.00 ? 38 LYS C O      2  
ATOM 10267  C CB     . LYS C 1 38 ? -9.535  -32.662 -14.038 1.00 0.00 ? 38 LYS C CB     2  
ATOM 10268  C CG     . LYS C 1 38 ? -8.026  -32.851 -14.220 1.00 0.00 ? 38 LYS C CG     2  
ATOM 10269  C CD     . LYS C 1 38 ? -7.367  -31.768 -15.078 1.00 0.00 ? 38 LYS C CD     2  
ATOM 10270  C CE     . LYS C 1 38 ? -7.127  -32.217 -16.519 1.00 0.00 ? 38 LYS C CE     2  
ATOM 10271  N NZ     . LYS C 1 38 ? -8.377  -32.277 -17.301 1.00 0.00 ? 38 LYS C NZ     2  
ATOM 10272  H H      . LYS C 1 38 ? -9.197  -32.698 -11.523 1.00 0.00 ? 38 LYS C H      2  
ATOM 10273  H HA     . LYS C 1 38 ? -9.337  -30.601 -13.486 1.00 0.00 ? 38 LYS C HA     2  
ATOM 10274  H HB2    . LYS C 1 38 ? -9.953  -33.570 -13.605 1.00 0.00 ? 38 LYS C HB2    2  
ATOM 10275  H HB3    . LYS C 1 38 ? -9.993  -32.511 -15.016 1.00 0.00 ? 38 LYS C HB3    2  
ATOM 10276  H HG2    . LYS C 1 38 ? -7.551  -32.854 -13.239 1.00 0.00 ? 38 LYS C HG2    2  
ATOM 10277  H HG3    . LYS C 1 38 ? -7.844  -33.823 -14.676 1.00 0.00 ? 38 LYS C HG3    2  
ATOM 10278  H HD2    . LYS C 1 38 ? -7.957  -30.853 -15.077 1.00 0.00 ? 38 LYS C HD2    2  
ATOM 10279  H HD3    . LYS C 1 38 ? -6.400  -31.534 -14.636 1.00 0.00 ? 38 LYS C HD3    2  
ATOM 10280  H HE2    . LYS C 1 38 ? -6.442  -31.509 -16.990 1.00 0.00 ? 38 LYS C HE2    2  
ATOM 10281  H HE3    . LYS C 1 38 ? -6.647  -33.196 -16.511 1.00 0.00 ? 38 LYS C HE3    2  
ATOM 10282  H HZ1    . LYS C 1 38 ? -8.845  -31.381 -17.291 1.00 0.00 ? 38 LYS C HZ1    2  
ATOM 10283  H HZ2    . LYS C 1 38 ? -8.175  -32.519 -18.260 1.00 0.00 ? 38 LYS C HZ2    2  
ATOM 10284  H HZ3    . LYS C 1 38 ? -9.000  -32.977 -16.922 1.00 0.00 ? 38 LYS C HZ3    2  
ATOM 10285  N N      . ASP C 1 39 ? -12.049 -31.120 -12.064 1.00 0.00 ? 39 ASP C N      2  
ATOM 10286  C CA     . ASP C 1 39 ? -13.387 -30.577 -11.900 1.00 0.00 ? 39 ASP C CA     2  
ATOM 10287  C C      . ASP C 1 39 ? -13.400 -29.061 -12.091 1.00 0.00 ? 39 ASP C C      2  
ATOM 10288  O O      . ASP C 1 39 ? -14.452 -28.493 -12.383 1.00 0.00 ? 39 ASP C O      2  
ATOM 10289  C CB     . ASP C 1 39 ? -13.885 -30.933 -10.500 1.00 0.00 ? 39 ASP C CB     2  
ATOM 10290  C CG     . ASP C 1 39 ? -14.344 -32.387 -10.424 1.00 0.00 ? 39 ASP C CG     2  
ATOM 10291  O OD1    . ASP C 1 39 ? -15.507 -32.653 -10.802 1.00 0.00 ? 39 ASP C OD1    2  
ATOM 10292  O OD2    . ASP C 1 39 ? -13.535 -33.235 -9.989  1.00 0.00 ? 39 ASP C OD2    2  
ATOM 10293  H H      . ASP C 1 39 ? -11.591 -31.470 -11.236 1.00 0.00 ? 39 ASP C H      2  
ATOM 10294  H HA     . ASP C 1 39 ? -14.052 -31.022 -12.641 1.00 0.00 ? 39 ASP C HA     2  
ATOM 10295  H HB2    . ASP C 1 39 ? -13.088 -30.758 -9.777  1.00 0.00 ? 39 ASP C HB2    2  
ATOM 10296  H HB3    . ASP C 1 39 ? -14.713 -30.281 -10.222 1.00 0.00 ? 39 ASP C HB3    2  
ATOM 10297  N N      . VAL C 1 40 ? -12.240 -28.407 -11.968 1.00 0.00 ? 40 VAL C N      2  
ATOM 10298  C CA     . VAL C 1 40 ? -12.066 -26.993 -12.264 1.00 0.00 ? 40 VAL C CA     2  
ATOM 10299  C C      . VAL C 1 40 ? -10.925 -26.784 -13.255 1.00 0.00 ? 40 VAL C C      2  
ATOM 10300  O O      . VAL C 1 40 ? -9.952  -27.537 -13.276 1.00 0.00 ? 40 VAL C O      2  
ATOM 10301  C CB     . VAL C 1 40 ? -11.859 -26.170 -10.989 1.00 0.00 ? 40 VAL C CB     2  
ATOM 10302  C CG1    . VAL C 1 40 ? -12.899 -26.518 -9.925  1.00 0.00 ? 40 VAL C CG1    2  
ATOM 10303  C CG2    . VAL C 1 40 ? -10.470 -26.350 -10.379 1.00 0.00 ? 40 VAL C CG2    2  
ATOM 10304  H H      . VAL C 1 40 ? -11.411 -28.928 -11.717 1.00 0.00 ? 40 VAL C H      2  
ATOM 10305  H HA     . VAL C 1 40 ? -12.976 -26.627 -12.739 1.00 0.00 ? 40 VAL C HA     2  
ATOM 10306  H HB     . VAL C 1 40 ? -11.974 -25.117 -11.245 1.00 0.00 ? 40 VAL C HB     2  
ATOM 10307  H HG11   . VAL C 1 40 ? -12.816 -25.818 -9.093  1.00 0.00 ? 40 VAL C HG11   2  
ATOM 10308  H HG12   . VAL C 1 40 ? -13.899 -26.445 -10.352 1.00 0.00 ? 40 VAL C HG12   2  
ATOM 10309  H HG13   . VAL C 1 40 ? -12.734 -27.531 -9.556  1.00 0.00 ? 40 VAL C HG13   2  
ATOM 10310  H HG21   . VAL C 1 40 ? -10.389 -25.743 -9.478  1.00 0.00 ? 40 VAL C HG21   2  
ATOM 10311  H HG22   . VAL C 1 40 ? -10.316 -27.397 -10.120 1.00 0.00 ? 40 VAL C HG22   2  
ATOM 10312  H HG23   . VAL C 1 40 ? -9.705  -26.030 -11.086 1.00 0.00 ? 40 VAL C HG23   2  
ATOM 10313  N N      . ALA C 1 41 ? -11.032 -25.736 -14.074 1.00 0.00 ? 41 ALA C N      2  
ATOM 10314  C CA     . ALA C 1 41 ? -9.996  -25.359 -15.019 1.00 0.00 ? 41 ALA C CA     2  
ATOM 10315  C C      . ALA C 1 41 ? -8.950  -24.457 -14.369 1.00 0.00 ? 41 ALA C C      2  
ATOM 10316  O O      . ALA C 1 41 ? -9.250  -23.776 -13.391 1.00 0.00 ? 41 ALA C O      2  
ATOM 10317  C CB     . ALA C 1 41 ? -10.656 -24.679 -16.216 1.00 0.00 ? 41 ALA C CB     2  
ATOM 10318  H H      . ALA C 1 41 ? -11.857 -25.156 -14.029 1.00 0.00 ? 41 ALA C H      2  
ATOM 10319  H HA     . ALA C 1 41 ? -9.501  -26.265 -15.367 1.00 0.00 ? 41 ALA C HA     2  
ATOM 10320  H HB1    . ALA C 1 41 ? -9.900  -24.458 -16.969 1.00 0.00 ? 41 ALA C HB1    2  
ATOM 10321  H HB2    . ALA C 1 41 ? -11.406 -25.341 -16.649 1.00 0.00 ? 41 ALA C HB2    2  
ATOM 10322  H HB3    . ALA C 1 41 ? -11.131 -23.750 -15.900 1.00 0.00 ? 41 ALA C HB3    2  
ATOM 10323  N N      . VAL C 1 42 ? -7.731  -24.418 -14.917 1.00 0.00 ? 42 VAL C N      2  
ATOM 10324  C CA     . VAL C 1 42 ? -6.715  -23.448 -14.531 1.00 0.00 ? 42 VAL C CA     2  
ATOM 10325  C C      . VAL C 1 42 ? -5.964  -22.959 -15.765 1.00 0.00 ? 42 VAL C C      2  
ATOM 10326  O O      . VAL C 1 42 ? -5.554  -23.770 -16.593 1.00 0.00 ? 42 VAL C O      2  
ATOM 10327  C CB     . VAL C 1 42 ? -5.755  -24.011 -13.476 1.00 0.00 ? 42 VAL C CB     2  
ATOM 10328  C CG1    . VAL C 1 42 ? -6.493  -24.581 -12.265 1.00 0.00 ? 42 VAL C CG1    2  
ATOM 10329  C CG2    . VAL C 1 42 ? -4.845  -25.120 -14.000 1.00 0.00 ? 42 VAL C CG2    2  
ATOM 10330  H H      . VAL C 1 42 ? -7.529  -25.020 -15.703 1.00 0.00 ? 42 VAL C H      2  
ATOM 10331  H HA     . VAL C 1 42 ? -7.214  -22.586 -14.088 1.00 0.00 ? 42 VAL C HA     2  
ATOM 10332  H HB     . VAL C 1 42 ? -5.121  -23.195 -13.129 1.00 0.00 ? 42 VAL C HB     2  
ATOM 10333  H HG11   . VAL C 1 42 ? -5.774  -24.916 -11.518 1.00 0.00 ? 42 VAL C HG11   2  
ATOM 10334  H HG12   . VAL C 1 42 ? -7.129  -23.812 -11.829 1.00 0.00 ? 42 VAL C HG12   2  
ATOM 10335  H HG13   . VAL C 1 42 ? -7.100  -25.437 -12.561 1.00 0.00 ? 42 VAL C HG13   2  
ATOM 10336  H HG21   . VAL C 1 42 ? -4.231  -25.503 -13.186 1.00 0.00 ? 42 VAL C HG21   2  
ATOM 10337  H HG22   . VAL C 1 42 ? -5.448  -25.931 -14.408 1.00 0.00 ? 42 VAL C HG22   2  
ATOM 10338  H HG23   . VAL C 1 42 ? -4.191  -24.731 -14.779 1.00 0.00 ? 42 VAL C HG23   2  
ATOM 10339  N N      . HIS C 1 43 ? -5.810  -21.641 -15.925 1.00 0.00 ? 43 HIS C N      2  
ATOM 10340  C CA     . HIS C 1 43 ? -5.143  -21.043 -17.075 1.00 0.00 ? 43 HIS C CA     2  
ATOM 10341  C C      . HIS C 1 43 ? -4.617  -19.650 -16.759 1.00 0.00 ? 43 HIS C C      2  
ATOM 10342  O O      . HIS C 1 43 ? -5.065  -19.018 -15.805 1.00 0.00 ? 43 HIS C O      2  
ATOM 10343  C CB     . HIS C 1 43 ? -6.116  -20.882 -18.245 1.00 0.00 ? 43 HIS C CB     2  
ATOM 10344  C CG     . HIS C 1 43 ? -6.836  -22.137 -18.650 1.00 0.00 ? 43 HIS C CG     2  
ATOM 10345  N ND1    . HIS C 1 43 ? -6.381  -23.074 -19.578 1.00 0.00 ? 43 HIS C ND1    2  
ATOM 10346  C CD2    . HIS C 1 43 ? -8.094  -22.481 -18.239 1.00 0.00 ? 43 HIS C CD2    2  
ATOM 10347  C CE1    . HIS C 1 43 ? -7.363  -23.974 -19.689 1.00 0.00 ? 43 HIS C CE1    2  
ATOM 10348  N NE2    . HIS C 1 43 ? -8.399  -23.654 -18.897 1.00 0.00 ? 43 HIS C NE2    2  
ATOM 10349  H H      . HIS C 1 43 ? -6.164  -21.015 -15.214 1.00 0.00 ? 43 HIS C H      2  
ATOM 10350  H HA     . HIS C 1 43 ? -4.309  -21.673 -17.382 1.00 0.00 ? 43 HIS C HA     2  
ATOM 10351  H HB2    . HIS C 1 43 ? -6.860  -20.129 -17.984 1.00 0.00 ? 43 HIS C HB2    2  
ATOM 10352  H HB3    . HIS C 1 43 ? -5.563  -20.516 -19.110 1.00 0.00 ? 43 HIS C HB3    2  
ATOM 10353  H HD2    . HIS C 1 43 ? -8.753  -21.862 -17.644 1.00 0.00 ? 43 HIS C HD2    2  
ATOM 10354  H HE1    . HIS C 1 43 ? -7.341  -24.829 -20.351 1.00 0.00 ? 43 HIS C HE1    2  
ATOM 10355  H HE2    . HIS C 1 43 ? -9.289  -24.134 -18.878 1.00 0.00 ? 43 HIS C HE2    2  
ATOM 10356  N N      . ARG C 1 44 ? -3.732  -19.125 -17.611 1.00 0.00 ? 44 ARG C N      2  
ATOM 10357  C CA     . ARG C 1 44 ? -3.390  -17.712 -17.583 1.00 0.00 ? 44 ARG C CA     2  
ATOM 10358  C C      . ARG C 1 44 ? -4.501  -16.906 -18.249 1.00 0.00 ? 44 ARG C C      2  
ATOM 10359  O O      . ARG C 1 44 ? -5.277  -17.450 -19.034 1.00 0.00 ? 44 ARG C O      2  
ATOM 10360  C CB     . ARG C 1 44 ? -2.021  -17.459 -18.216 1.00 0.00 ? 44 ARG C CB     2  
ATOM 10361  C CG     . ARG C 1 44 ? -1.946  -17.878 -19.683 1.00 0.00 ? 44 ARG C CG     2  
ATOM 10362  C CD     . ARG C 1 44 ? -0.645  -17.368 -20.299 1.00 0.00 ? 44 ARG C CD     2  
ATOM 10363  N NE     . ARG C 1 44 ? -0.531  -17.787 -21.698 1.00 0.00 ? 44 ARG C NE     2  
ATOM 10364  C CZ     . ARG C 1 44 ? 0.324   -17.280 -22.592 1.00 0.00 ? 44 ARG C CZ     2  
ATOM 10365  N NH1    . ARG C 1 44 ? 1.120   -16.254 -22.289 1.00 0.00 ? 44 ARG C NH1    2  
ATOM 10366  N NH2    . ARG C 1 44 ? 0.382   -17.790 -23.822 1.00 0.00 ? 44 ARG C NH2    2  
ATOM 10367  H H      . ARG C 1 44 ? -3.390  -19.692 -18.375 1.00 0.00 ? 44 ARG C H      2  
ATOM 10368  H HA     . ARG C 1 44 ? -3.330  -17.395 -16.543 1.00 0.00 ? 44 ARG C HA     2  
ATOM 10369  H HB2    . ARG C 1 44 ? -1.800  -16.394 -18.142 1.00 0.00 ? 44 ARG C HB2    2  
ATOM 10370  H HB3    . ARG C 1 44 ? -1.263  -18.004 -17.653 1.00 0.00 ? 44 ARG C HB3    2  
ATOM 10371  H HG2    . ARG C 1 44 ? -1.980  -18.965 -19.755 1.00 0.00 ? 44 ARG C HG2    2  
ATOM 10372  H HG3    . ARG C 1 44 ? -2.787  -17.454 -20.231 1.00 0.00 ? 44 ARG C HG3    2  
ATOM 10373  H HD2    . ARG C 1 44 ? -0.630  -16.279 -20.240 1.00 0.00 ? 44 ARG C HD2    2  
ATOM 10374  H HD3    . ARG C 1 44 ? 0.198   -17.767 -19.734 1.00 0.00 ? 44 ARG C HD3    2  
ATOM 10375  H HE     . ARG C 1 44 ? -1.105  -18.567 -21.987 1.00 0.00 ? 44 ARG C HE     2  
ATOM 10376  H HH11   . ARG C 1 44 ? 1.062   -15.824 -21.379 1.00 0.00 ? 44 ARG C HH11   2  
ATOM 10377  H HH12   . ARG C 1 44 ? 1.758   -15.890 -22.981 1.00 0.00 ? 44 ARG C HH12   2  
ATOM 10378  H HH21   . ARG C 1 44 ? -0.198  -18.576 -24.074 1.00 0.00 ? 44 ARG C HH21   2  
ATOM 10379  H HH22   . ARG C 1 44 ? 1.037   -17.415 -24.492 1.00 0.00 ? 44 ARG C HH22   2  
ATOM 10380  N N      . GLU C 1 45 ? -4.563  -15.602 -17.977 1.00 0.00 ? 45 GLU C N      2  
ATOM 10381  C CA     . GLU C 1 45 ? -5.661  -14.747 -18.410 1.00 0.00 ? 45 GLU C CA     2  
ATOM 10382  C C      . GLU C 1 45 ? -5.765  -14.676 -19.932 1.00 0.00 ? 45 GLU C C      2  
ATOM 10383  O O      . GLU C 1 45 ? -6.866  -14.567 -20.470 1.00 0.00 ? 45 GLU C O      2  
ATOM 10384  C CB     . GLU C 1 45 ? -5.458  -13.361 -17.794 1.00 0.00 ? 45 GLU C CB     2  
ATOM 10385  C CG     . GLU C 1 45 ? -6.730  -12.517 -17.733 1.00 0.00 ? 45 GLU C CG     2  
ATOM 10386  C CD     . GLU C 1 45 ? -7.097  -11.841 -19.049 1.00 0.00 ? 45 GLU C CD     2  
ATOM 10387  O OE1    . GLU C 1 45 ? -6.191  -11.282 -19.705 1.00 0.00 ? 45 GLU C OE1    2  
ATOM 10388  O OE2    . GLU C 1 45 ? -8.310  -11.794 -19.353 1.00 0.00 ? 45 GLU C OE2    2  
ATOM 10389  H H      . GLU C 1 45 ? -3.866  -15.202 -17.363 1.00 0.00 ? 45 GLU C H      2  
ATOM 10390  H HA     . GLU C 1 45 ? -6.596  -15.158 -18.025 1.00 0.00 ? 45 GLU C HA     2  
ATOM 10391  H HB2    . GLU C 1 45 ? -5.131  -13.504 -16.766 1.00 0.00 ? 45 GLU C HB2    2  
ATOM 10392  H HB3    . GLU C 1 45 ? -4.672  -12.829 -18.328 1.00 0.00 ? 45 GLU C HB3    2  
ATOM 10393  H HG2    . GLU C 1 45 ? -7.553  -13.149 -17.400 1.00 0.00 ? 45 GLU C HG2    2  
ATOM 10394  H HG3    . GLU C 1 45 ? -6.585  -11.730 -16.993 1.00 0.00 ? 45 GLU C HG3    2  
ATOM 10395  N N      . GLU C 1 46 ? -4.641  -14.835 -20.637 1.00 0.00 ? 46 GLU C N      2  
ATOM 10396  C CA     . GLU C 1 46 ? -4.592  -14.891 -22.090 1.00 0.00 ? 46 GLU C CA     2  
ATOM 10397  C C      . GLU C 1 46 ? -5.480  -16.007 -22.632 1.00 0.00 ? 46 GLU C C      2  
ATOM 10398  O O      . GLU C 1 46 ? -6.234  -15.801 -23.581 1.00 0.00 ? 46 GLU C O      2  
ATOM 10399  C CB     . GLU C 1 46 ? -3.147  -15.130 -22.530 1.00 0.00 ? 46 GLU C CB     2  
ATOM 10400  C CG     . GLU C 1 46 ? -2.952  -15.000 -24.040 1.00 0.00 ? 46 GLU C CG     2  
ATOM 10401  C CD     . GLU C 1 46 ? -2.991  -13.543 -24.491 1.00 0.00 ? 46 GLU C CD     2  
ATOM 10402  O OE1    . GLU C 1 46 ? -1.972  -12.841 -24.304 1.00 0.00 ? 46 GLU C OE1    2  
ATOM 10403  O OE2    . GLU C 1 46 ? -4.034  -13.120 -25.039 1.00 0.00 ? 46 GLU C OE2    2  
ATOM 10404  H H      . GLU C 1 46 ? -3.772  -14.938 -20.132 1.00 0.00 ? 46 GLU C H      2  
ATOM 10405  H HA     . GLU C 1 46 ? -4.941  -13.941 -22.493 1.00 0.00 ? 46 GLU C HA     2  
ATOM 10406  H HB2    . GLU C 1 46 ? -2.491  -14.421 -22.027 1.00 0.00 ? 46 GLU C HB2    2  
ATOM 10407  H HB3    . GLU C 1 46 ? -2.849  -16.134 -22.228 1.00 0.00 ? 46 GLU C HB3    2  
ATOM 10408  H HG2    . GLU C 1 46 ? -1.985  -15.433 -24.300 1.00 0.00 ? 46 GLU C HG2    2  
ATOM 10409  H HG3    . GLU C 1 46 ? -3.717  -15.574 -24.562 1.00 0.00 ? 46 GLU C HG3    2  
ATOM 10410  N N      . ILE C 1 47 ? -5.391  -17.196 -22.027 1.00 0.00 ? 47 ILE C N      2  
ATOM 10411  C CA     . ILE C 1 47 ? -6.098  -18.373 -22.502 1.00 0.00 ? 47 ILE C CA     2  
ATOM 10412  C C      . ILE C 1 47 ? -7.465  -18.486 -21.838 1.00 0.00 ? 47 ILE C C      2  
ATOM 10413  O O      . ILE C 1 47 ? -8.401  -18.961 -22.476 1.00 0.00 ? 47 ILE C O      2  
ATOM 10414  C CB     . ILE C 1 47 ? -5.267  -19.639 -22.275 1.00 0.00 ? 47 ILE C CB     2  
ATOM 10415  C CG1    . ILE C 1 47 ? -3.828  -19.516 -22.782 1.00 0.00 ? 47 ILE C CG1    2  
ATOM 10416  C CG2    . ILE C 1 47 ? -5.954  -20.829 -22.950 1.00 0.00 ? 47 ILE C CG2    2  
ATOM 10417  C CD1    . ILE C 1 47 ? -3.715  -19.091 -24.245 1.00 0.00 ? 47 ILE C CD1    2  
ATOM 10418  H H      . ILE C 1 47 ? -4.828  -17.280 -21.193 1.00 0.00 ? 47 ILE C H      2  
ATOM 10419  H HA     . ILE C 1 47 ? -6.264  -18.269 -23.574 1.00 0.00 ? 47 ILE C HA     2  
ATOM 10420  H HB     . ILE C 1 47 ? -5.221  -19.831 -21.204 1.00 0.00 ? 47 ILE C HB     2  
ATOM 10421  H HG12   . ILE C 1 47 ? -3.295  -18.791 -22.168 1.00 0.00 ? 47 ILE C HG12   2  
ATOM 10422  H HG13   . ILE C 1 47 ? -3.332  -20.479 -22.658 1.00 0.00 ? 47 ILE C HG13   2  
ATOM 10423  H HG21   . ILE C 1 47 ? -5.282  -21.686 -22.962 1.00 0.00 ? 47 ILE C HG21   2  
ATOM 10424  H HG22   . ILE C 1 47 ? -6.852  -21.099 -22.395 1.00 0.00 ? 47 ILE C HG22   2  
ATOM 10425  H HG23   . ILE C 1 47 ? -6.237  -20.577 -23.973 1.00 0.00 ? 47 ILE C HG23   2  
ATOM 10426  H HD11   . ILE C 1 47 ? -2.679  -19.204 -24.568 1.00 0.00 ? 47 ILE C HD11   2  
ATOM 10427  H HD12   . ILE C 1 47 ? -4.357  -19.710 -24.871 1.00 0.00 ? 47 ILE C HD12   2  
ATOM 10428  H HD13   . ILE C 1 47 ? -4.003  -18.043 -24.347 1.00 0.00 ? 47 ILE C HD13   2  
ATOM 10429  N N      . TYR C 1 48 ? -7.618  -17.983 -20.608 1.00 0.00 ? 48 TYR C N      2  
ATOM 10430  C CA     . TYR C 1 48 ? -8.890  -17.965 -19.906 1.00 0.00 ? 48 TYR C CA     2  
ATOM 10431  C C      . TYR C 1 48 ? -10.011 -17.413 -20.782 1.00 0.00 ? 48 TYR C C      2  
ATOM 10432  O O      . TYR C 1 48 ? -11.117 -17.948 -20.782 1.00 0.00 ? 48 TYR C O      2  
ATOM 10433  C CB     . TYR C 1 48 ? -8.798  -17.090 -18.660 1.00 0.00 ? 48 TYR C CB     2  
ATOM 10434  C CG     . TYR C 1 48 ? -10.127 -16.987 -17.949 1.00 0.00 ? 48 TYR C CG     2  
ATOM 10435  C CD1    . TYR C 1 48 ? -10.781 -18.145 -17.504 1.00 0.00 ? 48 TYR C CD1    2  
ATOM 10436  C CD2    . TYR C 1 48 ? -10.782 -15.749 -17.902 1.00 0.00 ? 48 TYR C CD2    2  
ATOM 10437  C CE1    . TYR C 1 48 ? -12.081 -18.062 -16.988 1.00 0.00 ? 48 TYR C CE1    2  
ATOM 10438  C CE2    . TYR C 1 48 ? -12.063 -15.651 -17.346 1.00 0.00 ? 48 TYR C CE2    2  
ATOM 10439  C CZ     . TYR C 1 48 ? -12.715 -16.808 -16.873 1.00 0.00 ? 48 TYR C CZ     2  
ATOM 10440  O OH     . TYR C 1 48 ? -13.968 -16.726 -16.341 1.00 0.00 ? 48 TYR C OH     2  
ATOM 10441  H H      . TYR C 1 48 ? -6.808  -17.620 -20.126 1.00 0.00 ? 48 TYR C H      2  
ATOM 10442  H HA     . TYR C 1 48 ? -9.131  -18.979 -19.582 1.00 0.00 ? 48 TYR C HA     2  
ATOM 10443  H HB2    . TYR C 1 48 ? -8.044  -17.492 -17.984 1.00 0.00 ? 48 TYR C HB2    2  
ATOM 10444  H HB3    . TYR C 1 48 ? -8.505  -16.086 -18.962 1.00 0.00 ? 48 TYR C HB3    2  
ATOM 10445  H HD1    . TYR C 1 48 ? -10.305 -19.110 -17.605 1.00 0.00 ? 48 TYR C HD1    2  
ATOM 10446  H HD2    . TYR C 1 48 ? -10.311 -14.871 -18.320 1.00 0.00 ? 48 TYR C HD2    2  
ATOM 10447  H HE1    . TYR C 1 48 ? -12.608 -18.961 -16.707 1.00 0.00 ? 48 TYR C HE1    2  
ATOM 10448  H HE2    . TYR C 1 48 ? -12.552 -14.690 -17.317 1.00 0.00 ? 48 TYR C HE2    2  
ATOM 10449  H HH     . TYR C 1 48 ? -14.301 -15.824 -16.311 1.00 0.00 ? 48 TYR C HH     2  
ATOM 10450  N N      . GLN C 1 49 ? -9.702  -16.381 -21.573 1.00 0.00 ? 49 GLN C N      2  
ATOM 10451  C CA     . GLN C 1 49 ? -10.587 -15.715 -22.516 1.00 0.00 ? 49 GLN C CA     2  
ATOM 10452  C C      . GLN C 1 49 ? -11.276 -16.658 -23.500 1.00 0.00 ? 49 GLN C C      2  
ATOM 10453  O O      . GLN C 1 49 ? -12.279 -16.277 -24.100 1.00 0.00 ? 49 GLN C O      2  
ATOM 10454  C CB     . GLN C 1 49 ? -9.806  -14.627 -23.251 1.00 0.00 ? 49 GLN C CB     2  
ATOM 10455  C CG     . GLN C 1 49 ? -9.587  -13.426 -22.332 1.00 0.00 ? 49 GLN C CG     2  
ATOM 10456  C CD     . GLN C 1 49 ? -8.609  -12.418 -22.922 1.00 0.00 ? 49 GLN C CD     2  
ATOM 10457  O OE1    . GLN C 1 49 ? -8.363  -12.378 -24.125 1.00 0.00 ? 49 GLN C OE1    2  
ATOM 10458  N NE2    . GLN C 1 49 ? -8.053  -11.550 -22.081 1.00 0.00 ? 49 GLN C NE2    2  
ATOM 10459  H H      . GLN C 1 49 ? -8.766  -16.011 -21.500 1.00 0.00 ? 49 GLN C H      2  
ATOM 10460  H HA     . GLN C 1 49 ? -11.378 -15.229 -21.943 1.00 0.00 ? 49 GLN C HA     2  
ATOM 10461  H HB2    . GLN C 1 49 ? -8.845  -15.027 -23.576 1.00 0.00 ? 49 GLN C HB2    2  
ATOM 10462  H HB3    . GLN C 1 49 ? -10.369 -14.302 -24.126 1.00 0.00 ? 49 GLN C HB3    2  
ATOM 10463  H HG2    . GLN C 1 49 ? -10.542 -12.927 -22.165 1.00 0.00 ? 49 GLN C HG2    2  
ATOM 10464  H HG3    . GLN C 1 49 ? -9.217  -13.769 -21.364 1.00 0.00 ? 49 GLN C HG3    2  
ATOM 10465  H HE21   . GLN C 1 49 ? -8.223  -11.648 -21.088 1.00 0.00 ? 49 GLN C HE21   2  
ATOM 10466  H HE22   . GLN C 1 49 ? -7.304  -10.950 -22.390 1.00 0.00 ? 49 GLN C HE22   2  
ATOM 10467  N N      . ARG C 1 50 ? -10.737 -17.861 -23.716 1.00 0.00 ? 50 ARG C N      2  
ATOM 10468  C CA     . ARG C 1 50 ? -11.366 -18.921 -24.490 1.00 0.00 ? 50 ARG C CA     2  
ATOM 10469  C C      . ARG C 1 50 ? -12.309 -19.840 -23.712 1.00 0.00 ? 50 ARG C C      2  
ATOM 10470  O O      . ARG C 1 50 ? -13.337 -20.242 -24.252 1.00 0.00 ? 50 ARG C O      2  
ATOM 10471  C CB     . ARG C 1 50 ? -10.235 -19.710 -25.142 1.00 0.00 ? 50 ARG C CB     2  
ATOM 10472  C CG     . ARG C 1 50 ? -10.749 -20.928 -25.900 1.00 0.00 ? 50 ARG C CG     2  
ATOM 10473  C CD     . ARG C 1 50 ? -9.527  -21.579 -26.539 1.00 0.00 ? 50 ARG C CD     2  
ATOM 10474  N NE     . ARG C 1 50 ? -9.814  -22.931 -27.026 1.00 0.00 ? 50 ARG C NE     2  
ATOM 10475  C CZ     . ARG C 1 50 ? -10.320 -23.240 -28.224 1.00 0.00 ? 50 ARG C CZ     2  
ATOM 10476  N NH1    . ARG C 1 50 ? -10.671 -22.300 -29.101 1.00 0.00 ? 50 ARG C NH1    2  
ATOM 10477  N NH2    . ARG C 1 50 ? -10.486 -24.517 -28.563 1.00 0.00 ? 50 ARG C NH2    2  
ATOM 10478  H H      . ARG C 1 50 ? -9.859  -18.077 -23.264 1.00 0.00 ? 50 ARG C H      2  
ATOM 10479  H HA     . ARG C 1 50 ? -11.953 -18.466 -25.287 1.00 0.00 ? 50 ARG C HA     2  
ATOM 10480  H HB2    . ARG C 1 50 ? -9.698  -19.056 -25.830 1.00 0.00 ? 50 ARG C HB2    2  
ATOM 10481  H HB3    . ARG C 1 50 ? -9.544  -20.051 -24.371 1.00 0.00 ? 50 ARG C HB3    2  
ATOM 10482  H HG2    . ARG C 1 50 ? -11.203 -21.621 -25.191 1.00 0.00 ? 50 ARG C HG2    2  
ATOM 10483  H HG3    . ARG C 1 50 ? -11.482 -20.628 -26.649 1.00 0.00 ? 50 ARG C HG3    2  
ATOM 10484  H HD2    . ARG C 1 50 ? -9.140  -20.949 -27.340 1.00 0.00 ? 50 ARG C HD2    2  
ATOM 10485  H HD3    . ARG C 1 50 ? -8.760  -21.622 -25.767 1.00 0.00 ? 50 ARG C HD3    2  
ATOM 10486  H HE     . ARG C 1 50 ? -9.568  -23.696 -26.415 1.00 0.00 ? 50 ARG C HE     2  
ATOM 10487  H HH11   . ARG C 1 50 ? -10.549 -21.326 -28.869 1.00 0.00 ? 50 ARG C HH11   2  
ATOM 10488  H HH12   . ARG C 1 50 ? -11.029 -22.564 -30.007 1.00 0.00 ? 50 ARG C HH12   2  
ATOM 10489  H HH21   . ARG C 1 50 ? -10.186 -25.251 -27.939 1.00 0.00 ? 50 ARG C HH21   2  
ATOM 10490  H HH22   . ARG C 1 50 ? -10.813 -24.752 -29.491 1.00 0.00 ? 50 ARG C HH22   2  
ATOM 10491  N N      . ILE C 1 51 ? -11.985 -20.197 -22.466 1.00 0.00 ? 51 ILE C N      2  
ATOM 10492  C CA     . ILE C 1 51 ? -12.644 -21.244 -21.685 1.00 0.00 ? 51 ILE C CA     2  
ATOM 10493  C C      . ILE C 1 51 ? -14.160 -21.109 -21.682 1.00 0.00 ? 51 ILE C C      2  
ATOM 10494  O O      . ILE C 1 51 ? -14.906 -22.081 -21.776 1.00 0.00 ? 51 ILE C O      2  
ATOM 10495  C CB     . ILE C 1 51 ? -12.141 -21.184 -20.238 1.00 0.00 ? 51 ILE C CB     2  
ATOM 10496  C CG1    . ILE C 1 51 ? -10.813 -21.924 -20.087 1.00 0.00 ? 51 ILE C CG1    2  
ATOM 10497  C CG2    . ILE C 1 51 ? -13.120 -21.767 -19.218 1.00 0.00 ? 51 ILE C CG2    2  
ATOM 10498  C CD1    . ILE C 1 51 ? -9.747  -21.282 -20.968 1.00 0.00 ? 51 ILE C CD1    2  
ATOM 10499  H H      . ILE C 1 51 ? -11.156 -19.781 -22.067 1.00 0.00 ? 51 ILE C H      2  
ATOM 10500  H HA     . ILE C 1 51 ? -12.388 -22.219 -22.100 1.00 0.00 ? 51 ILE C HA     2  
ATOM 10501  H HB     . ILE C 1 51 ? -11.987 -20.141 -19.961 1.00 0.00 ? 51 ILE C HB     2  
ATOM 10502  H HG12   . ILE C 1 51 ? -10.501 -21.852 -19.046 1.00 0.00 ? 51 ILE C HG12   2  
ATOM 10503  H HG13   . ILE C 1 51 ? -10.933 -22.972 -20.356 1.00 0.00 ? 51 ILE C HG13   2  
ATOM 10504  H HG21   . ILE C 1 51 ? -13.419 -22.771 -19.517 1.00 0.00 ? 51 ILE C HG21   2  
ATOM 10505  H HG22   . ILE C 1 51 ? -12.647 -21.808 -18.237 1.00 0.00 ? 51 ILE C HG22   2  
ATOM 10506  H HG23   . ILE C 1 51 ? -13.997 -21.124 -19.143 1.00 0.00 ? 51 ILE C HG23   2  
ATOM 10507  H HD11   . ILE C 1 51 ? -9.828  -21.663 -21.986 1.00 0.00 ? 51 ILE C HD11   2  
ATOM 10508  H HD12   . ILE C 1 51 ? -9.916  -20.206 -20.969 1.00 0.00 ? 51 ILE C HD12   2  
ATOM 10509  H HD13   . ILE C 1 51 ? -8.750  -21.491 -20.581 1.00 0.00 ? 51 ILE C HD13   2  
ATOM 10510  N N      . GLN C 1 52 ? -14.587 -19.858 -21.524 1.00 0.00 ? 52 GLN C N      2  
ATOM 10511  C CA     . GLN C 1 52 ? -15.948 -19.436 -21.249 1.00 0.00 ? 52 GLN C CA     2  
ATOM 10512  C C      . GLN C 1 52 ? -16.575 -18.841 -22.513 1.00 0.00 ? 52 GLN C C      2  
ATOM 10513  O O      . GLN C 1 52 ? -17.724 -18.402 -22.498 1.00 0.00 ? 52 GLN C O      2  
ATOM 10514  C CB     . GLN C 1 52 ? -15.966 -18.530 -20.010 1.00 0.00 ? 52 GLN C CB     2  
ATOM 10515  C CG     . GLN C 1 52 ? -14.682 -17.716 -19.821 1.00 0.00 ? 52 GLN C CG     2  
ATOM 10516  C CD     . GLN C 1 52 ? -14.468 -16.816 -21.025 1.00 0.00 ? 52 GLN C CD     2  
ATOM 10517  O OE1    . GLN C 1 52 ? -15.247 -15.916 -21.323 1.00 0.00 ? 52 GLN C OE1    2  
ATOM 10518  N NE2    . GLN C 1 52 ? -13.491 -17.205 -21.837 1.00 0.00 ? 52 GLN C NE2    2  
ATOM 10519  H H      . GLN C 1 52 ? -13.894 -19.134 -21.649 1.00 0.00 ? 52 GLN C H      2  
ATOM 10520  H HA     . GLN C 1 52 ? -16.522 -20.322 -20.979 1.00 0.00 ? 52 GLN C HA     2  
ATOM 10521  H HB2    . GLN C 1 52 ? -16.819 -17.852 -20.065 1.00 0.00 ? 52 GLN C HB2    2  
ATOM 10522  H HB3    . GLN C 1 52 ? -16.096 -19.158 -19.130 1.00 0.00 ? 52 GLN C HB3    2  
ATOM 10523  H HG2    . GLN C 1 52 ? -14.688 -17.119 -18.913 1.00 0.00 ? 52 GLN C HG2    2  
ATOM 10524  H HG3    . GLN C 1 52 ? -13.833 -18.391 -19.710 1.00 0.00 ? 52 GLN C HG3    2  
ATOM 10525  H HE21   . GLN C 1 52 ? -12.707 -17.706 -21.445 1.00 0.00 ? 52 GLN C HE21   2  
ATOM 10526  H HE22   . GLN C 1 52 ? -13.430 -16.827 -22.771 1.00 0.00 ? 52 GLN C HE22   2  
ATOM 10527  N N      . ALA C 1 53 ? -15.819 -18.848 -23.616 1.00 0.00 ? 53 ALA C N      2  
ATOM 10528  C CA     . ALA C 1 53 ? -16.202 -18.347 -24.927 1.00 0.00 ? 53 ALA C CA     2  
ATOM 10529  C C      . ALA C 1 53 ? -16.970 -19.374 -25.756 1.00 0.00 ? 53 ALA C C      2  
ATOM 10530  O O      . ALA C 1 53 ? -17.617 -19.011 -26.737 1.00 0.00 ? 53 ALA C O      2  
ATOM 10531  C CB     . ALA C 1 53 ? -14.926 -17.940 -25.666 1.00 0.00 ? 53 ALA C CB     2  
ATOM 10532  H H      . ALA C 1 53 ? -14.905 -19.275 -23.560 1.00 0.00 ? 53 ALA C H      2  
ATOM 10533  H HA     . ALA C 1 53 ? -16.830 -17.464 -24.800 1.00 0.00 ? 53 ALA C HA     2  
ATOM 10534  H HB1    . ALA C 1 53 ? -15.184 -17.422 -26.590 1.00 0.00 ? 53 ALA C HB1    2  
ATOM 10535  H HB2    . ALA C 1 53 ? -14.332 -17.275 -25.041 1.00 0.00 ? 53 ALA C HB2    2  
ATOM 10536  H HB3    . ALA C 1 53 ? -14.325 -18.817 -25.915 1.00 0.00 ? 53 ALA C HB3    2  
ATOM 10537  N N      . GLY C 1 54 ? -16.890 -20.655 -25.382 1.00 0.00 ? 54 GLY C N      2  
ATOM 10538  C CA     . GLY C 1 54 ? -17.360 -21.766 -26.192 1.00 0.00 ? 54 GLY C CA     2  
ATOM 10539  C C      . GLY C 1 54 ? -16.191 -22.371 -26.964 1.00 0.00 ? 54 GLY C C      2  
ATOM 10540  O O      . GLY C 1 54 ? -15.466 -21.659 -27.656 1.00 0.00 ? 54 GLY C O      2  
ATOM 10541  H H      . GLY C 1 54 ? -16.345 -20.880 -24.561 1.00 0.00 ? 54 GLY C H      2  
ATOM 10542  H HA2    . GLY C 1 54 ? -17.798 -22.524 -25.543 1.00 0.00 ? 54 GLY C HA2    2  
ATOM 10543  H HA3    . GLY C 1 54 ? -18.120 -21.431 -26.899 1.00 0.00 ? 54 GLY C HA3    2  
ATOM 10544  N N      . LEU C 1 55 ? -15.986 -23.681 -26.811 1.00 0.00 ? 55 LEU C N      2  
ATOM 10545  C CA     . LEU C 1 55 ? -14.788 -24.360 -27.275 1.00 0.00 ? 55 LEU C CA     2  
ATOM 10546  C C      . LEU C 1 55 ? -15.021 -25.086 -28.596 1.00 0.00 ? 55 LEU C C      2  
ATOM 10547  O O      . LEU C 1 55 ? -16.147 -25.456 -28.928 1.00 0.00 ? 55 LEU C O      2  
ATOM 10548  C CB     . LEU C 1 55 ? -14.291 -25.342 -26.211 1.00 0.00 ? 55 LEU C CB     2  
ATOM 10549  C CG     . LEU C 1 55 ? -13.982 -24.758 -24.828 1.00 0.00 ? 55 LEU C CG     2  
ATOM 10550  C CD1    . LEU C 1 55 ? -13.275 -23.406 -24.901 1.00 0.00 ? 55 LEU C CD1    2  
ATOM 10551  C CD2    . LEU C 1 55 ? -15.225 -24.631 -23.949 1.00 0.00 ? 55 LEU C CD2    2  
ATOM 10552  H H      . LEU C 1 55 ? -16.655 -24.223 -26.282 1.00 0.00 ? 55 LEU C H      2  
ATOM 10553  H HA     . LEU C 1 55 ? -14.006 -23.620 -27.443 1.00 0.00 ? 55 LEU C HA     2  
ATOM 10554  H HB2    . LEU C 1 55 ? -15.023 -26.143 -26.107 1.00 0.00 ? 55 LEU C HB2    2  
ATOM 10555  H HB3    . LEU C 1 55 ? -13.373 -25.795 -26.582 1.00 0.00 ? 55 LEU C HB3    2  
ATOM 10556  H HG     . LEU C 1 55 ? -13.309 -25.454 -24.330 1.00 0.00 ? 55 LEU C HG     2  
ATOM 10557  H HD11   . LEU C 1 55 ? -12.917 -23.128 -23.910 1.00 0.00 ? 55 LEU C HD11   2  
ATOM 10558  H HD12   . LEU C 1 55 ? -12.425 -23.476 -25.579 1.00 0.00 ? 55 LEU C HD12   2  
ATOM 10559  H HD13   . LEU C 1 55 ? -13.955 -22.627 -25.246 1.00 0.00 ? 55 LEU C HD13   2  
ATOM 10560  H HD21   . LEU C 1 55 ? -15.825 -23.773 -24.252 1.00 0.00 ? 55 LEU C HD21   2  
ATOM 10561  H HD22   . LEU C 1 55 ? -15.822 -25.540 -24.017 1.00 0.00 ? 55 LEU C HD22   2  
ATOM 10562  H HD23   . LEU C 1 55 ? -14.915 -24.492 -22.913 1.00 0.00 ? 55 LEU C HD23   2  
ATOM 10563  N N      . THR C 1 56 ? -13.931 -25.341 -29.325 1.00 0.00 ? 56 THR C N      2  
ATOM 10564  C CA     . THR C 1 56 ? -13.941 -26.125 -30.551 1.00 0.00 ? 56 THR C CA     2  
ATOM 10565  C C      . THR C 1 56 ? -13.622 -27.589 -30.271 1.00 0.00 ? 56 THR C C      2  
ATOM 10566  O O      . THR C 1 56 ? -12.874 -27.899 -29.344 1.00 0.00 ? 56 THR C O      2  
ATOM 10567  C CB     . THR C 1 56 ? -12.962 -25.543 -31.572 1.00 0.00 ? 56 THR C CB     2  
ATOM 10568  O OG1    . THR C 1 56 ? -11.673 -25.414 -31.010 1.00 0.00 ? 56 THR C OG1    2  
ATOM 10569  C CG2    . THR C 1 56 ? -13.414 -24.160 -32.036 1.00 0.00 ? 56 THR C CG2    2  
ATOM 10570  H H      . THR C 1 56 ? -13.032 -25.038 -28.980 1.00 0.00 ? 56 THR C H      2  
ATOM 10571  H HA     . THR C 1 56 ? -14.942 -26.080 -30.981 1.00 0.00 ? 56 THR C HA     2  
ATOM 10572  H HB     . THR C 1 56 ? -12.913 -26.203 -32.438 1.00 0.00 ? 56 THR C HB     2  
ATOM 10573  H HG1    . THR C 1 56 ? -11.177 -26.209 -31.231 1.00 0.00 ? 56 THR C HG1    2  
ATOM 10574  H HG21   . THR C 1 56 ? -13.425 -23.468 -31.194 1.00 0.00 ? 56 THR C HG21   2  
ATOM 10575  H HG22   . THR C 1 56 ? -12.725 -23.791 -32.796 1.00 0.00 ? 56 THR C HG22   2  
ATOM 10576  H HG23   . THR C 1 56 ? -14.414 -24.227 -32.463 1.00 0.00 ? 56 THR C HG23   2  
ATOM 10577  N N      . ALA C 1 57 ? -14.195 -28.486 -31.080 1.00 0.00 ? 57 ALA C N      2  
ATOM 10578  C CA     . ALA C 1 57 ? -14.114 -29.931 -30.933 1.00 0.00 ? 57 ALA C CA     2  
ATOM 10579  C C      . ALA C 1 57 ? -14.271 -30.405 -29.487 1.00 0.00 ? 57 ALA C C      2  
ATOM 10580  O O      . ALA C 1 57 ? -13.302 -30.868 -28.884 1.00 0.00 ? 57 ALA C O      2  
ATOM 10581  C CB     . ALA C 1 57 ? -12.820 -30.421 -31.584 1.00 0.00 ? 57 ALA C CB     2  
ATOM 10582  H H      . ALA C 1 57 ? -14.768 -28.141 -31.838 1.00 0.00 ? 57 ALA C H      2  
ATOM 10583  H HA     . ALA C 1 57 ? -14.939 -30.364 -31.499 1.00 0.00 ? 57 ALA C HA     2  
ATOM 10584  H HB1    . ALA C 1 57 ? -11.958 -30.003 -31.062 1.00 0.00 ? 57 ALA C HB1    2  
ATOM 10585  H HB2    . ALA C 1 57 ? -12.776 -31.509 -31.537 1.00 0.00 ? 57 ALA C HB2    2  
ATOM 10586  H HB3    . ALA C 1 57 ? -12.792 -30.109 -32.628 1.00 0.00 ? 57 ALA C HB3    2  
ATOM 10587  N N      . PRO C 1 58 ? -15.476 -30.312 -28.908 1.00 0.00 ? 58 PRO C N      2  
ATOM 10588  C CA     . PRO C 1 58 ? -15.722 -30.695 -27.528 1.00 0.00 ? 58 PRO C CA     2  
ATOM 10589  C C      . PRO C 1 58 ? -15.537 -32.186 -27.264 1.00 0.00 ? 58 PRO C C      2  
ATOM 10590  O O      . PRO C 1 58 ? -15.415 -32.997 -28.182 1.00 0.00 ? 58 PRO C O      2  
ATOM 10591  C CB     . PRO C 1 58 ? -17.156 -30.275 -27.207 1.00 0.00 ? 58 PRO C CB     2  
ATOM 10592  C CG     . PRO C 1 58 ? -17.519 -29.263 -28.289 1.00 0.00 ? 58 PRO C CG     2  
ATOM 10593  C CD     . PRO C 1 58 ? -16.649 -29.671 -29.475 1.00 0.00 ? 58 PRO C CD     2  
ATOM 10594  H HA     . PRO C 1 58 ? -15.041 -30.137 -26.886 1.00 0.00 ? 58 PRO C HA     2  
ATOM 10595  H HB2    . PRO C 1 58 ? -17.824 -31.134 -27.279 1.00 0.00 ? 58 PRO C HB2    2  
ATOM 10596  H HB3    . PRO C 1 58 ? -17.212 -29.838 -26.210 1.00 0.00 ? 58 PRO C HB3    2  
ATOM 10597  H HG2    . PRO C 1 58 ? -18.578 -29.319 -28.542 1.00 0.00 ? 58 PRO C HG2    2  
ATOM 10598  H HG3    . PRO C 1 58 ? -17.251 -28.258 -27.962 1.00 0.00 ? 58 PRO C HG3    2  
ATOM 10599  H HD2    . PRO C 1 58 ? -17.187 -30.382 -30.102 1.00 0.00 ? 58 PRO C HD2    2  
ATOM 10600  H HD3    . PRO C 1 58 ? -16.388 -28.784 -30.050 1.00 0.00 ? 58 PRO C HD3    2  
ATOM 10601  N N      . ASP C 1 59 ? -15.592 -32.552 -25.981 1.00 0.00 ? 59 ASP C N      2  
ATOM 10602  C CA     . ASP C 1 59 ? -15.443 -33.919 -25.513 1.00 0.00 ? 59 ASP C CA     2  
ATOM 10603  C C      . ASP C 1 59 ? -16.591 -34.824 -25.956 1.00 0.00 ? 59 ASP C C      2  
ATOM 10604  O O      . ASP C 1 59 ? -16.417 -36.037 -26.058 1.00 0.00 ? 59 ASP C O      2  
ATOM 10605  C CB     . ASP C 1 59 ? -15.361 -33.884 -23.988 1.00 0.00 ? 59 ASP C CB     2  
ATOM 10606  C CG     . ASP C 1 59 ? -14.857 -35.205 -23.413 1.00 0.00 ? 59 ASP C CG     2  
ATOM 10607  O OD1    . ASP C 1 59 ? -13.691 -35.560 -23.696 1.00 0.00 ? 59 ASP C OD1    2  
ATOM 10608  O OD2    . ASP C 1 59 ? -15.618 -35.846 -22.655 1.00 0.00 ? 59 ASP C OD2    2  
ATOM 10609  H H      . ASP C 1 59 ? -15.695 -31.831 -25.281 1.00 0.00 ? 59 ASP C H      2  
ATOM 10610  H HA     . ASP C 1 59 ? -14.511 -34.324 -25.908 1.00 0.00 ? 59 ASP C HA     2  
ATOM 10611  H HB2    . ASP C 1 59 ? -14.689 -33.080 -23.686 1.00 0.00 ? 59 ASP C HB2    2  
ATOM 10612  H HB3    . ASP C 1 59 ? -16.349 -33.659 -23.585 1.00 0.00 ? 59 ASP C HB3    2  
ATOM 10613  N N      . MET D 1 1  ? -0.281  -31.273 -10.247 1.00 0.00 ? 1  MET D N      2  
ATOM 10614  C CA     . MET D 1 1  ? -0.094  -29.813 -10.335 1.00 0.00 ? 1  MET D CA     2  
ATOM 10615  C C      . MET D 1 1  ? -0.066  -29.334 -11.779 1.00 0.00 ? 1  MET D C      2  
ATOM 10616  O O      . MET D 1 1  ? 0.363   -30.065 -12.668 1.00 0.00 ? 1  MET D O      2  
ATOM 10617  C CB     . MET D 1 1  ? 1.241   -29.362 -9.743  1.00 0.00 ? 1  MET D CB     2  
ATOM 10618  C CG     . MET D 1 1  ? 1.446   -29.641 -8.258  1.00 0.00 ? 1  MET D CG     2  
ATOM 10619  S SD     . MET D 1 1  ? 1.360   -28.179 -7.195  1.00 0.00 ? 1  MET D SD     2  
ATOM 10620  C CE     . MET D 1 1  ? 2.808   -27.319 -7.853  1.00 0.00 ? 1  MET D CE     2  
ATOM 10621  H H1     . MET D 1 1  ? 0.575   -31.743 -10.504 1.00 0.00 ? 1  MET D H1     2  
ATOM 10622  H H2     . MET D 1 1  ? -1.024  -31.568 -10.863 1.00 0.00 ? 1  MET D H2     2  
ATOM 10623  H H3     . MET D 1 1  ? -0.515  -31.536 -9.300  1.00 0.00 ? 1  MET D H3     2  
ATOM 10624  H HA     . MET D 1 1  ? -0.910  -29.310 -9.814  1.00 0.00 ? 1  MET D HA     2  
ATOM 10625  H HB2    . MET D 1 1  ? 2.038   -29.858 -10.294 1.00 0.00 ? 1  MET D HB2    2  
ATOM 10626  H HB3    . MET D 1 1  ? 1.346   -28.290 -9.909  1.00 0.00 ? 1  MET D HB3    2  
ATOM 10627  H HG2    . MET D 1 1  ? 0.732   -30.389 -7.915  1.00 0.00 ? 1  MET D HG2    2  
ATOM 10628  H HG3    . MET D 1 1  ? 2.455   -30.037 -8.154  1.00 0.00 ? 1  MET D HG3    2  
ATOM 10629  H HE1    . MET D 1 1  ? 3.570   -28.052 -8.117  1.00 0.00 ? 1  MET D HE1    2  
ATOM 10630  H HE2    . MET D 1 1  ? 2.528   -26.774 -8.754  1.00 0.00 ? 1  MET D HE2    2  
ATOM 10631  H HE3    . MET D 1 1  ? 3.199   -26.633 -7.102  1.00 0.00 ? 1  MET D HE3    2  
ATOM 10632  N N      . LEU D 1 2  ? -0.381  -28.051 -11.969 1.00 0.00 ? 2  LEU D N      2  
ATOM 10633  C CA     . LEU D 1 2  ? -0.161  -27.303 -13.192 1.00 0.00 ? 2  LEU D CA     2  
ATOM 10634  C C      . LEU D 1 2  ? 0.706   -26.098 -12.838 1.00 0.00 ? 2  LEU D C      2  
ATOM 10635  O O      . LEU D 1 2  ? 0.317   -25.258 -12.030 1.00 0.00 ? 2  LEU D O      2  
ATOM 10636  C CB     . LEU D 1 2  ? -1.512  -26.912 -13.792 1.00 0.00 ? 2  LEU D CB     2  
ATOM 10637  C CG     . LEU D 1 2  ? -1.450  -26.147 -15.117 1.00 0.00 ? 2  LEU D CG     2  
ATOM 10638  C CD1    . LEU D 1 2  ? -1.349  -24.641 -14.898 1.00 0.00 ? 2  LEU D CD1    2  
ATOM 10639  C CD2    . LEU D 1 2  ? -0.294  -26.561 -16.023 1.00 0.00 ? 2  LEU D CD2    2  
ATOM 10640  H H      . LEU D 1 2  ? -0.732  -27.523 -11.181 1.00 0.00 ? 2  LEU D H      2  
ATOM 10641  H HA     . LEU D 1 2  ? 0.374   -27.930 -13.905 1.00 0.00 ? 2  LEU D HA     2  
ATOM 10642  H HB2    . LEU D 1 2  ? -2.077  -27.827 -13.961 1.00 0.00 ? 2  LEU D HB2    2  
ATOM 10643  H HB3    . LEU D 1 2  ? -2.063  -26.320 -13.061 1.00 0.00 ? 2  LEU D HB3    2  
ATOM 10644  H HG     . LEU D 1 2  ? -2.382  -26.338 -15.650 1.00 0.00 ? 2  LEU D HG     2  
ATOM 10645  H HD11   . LEU D 1 2  ? -0.349  -24.378 -14.555 1.00 0.00 ? 2  LEU D HD11   2  
ATOM 10646  H HD12   . LEU D 1 2  ? -1.554  -24.132 -15.840 1.00 0.00 ? 2  LEU D HD12   2  
ATOM 10647  H HD13   . LEU D 1 2  ? -2.080  -24.325 -14.155 1.00 0.00 ? 2  LEU D HD13   2  
ATOM 10648  H HD21   . LEU D 1 2  ? -0.394  -26.042 -16.973 1.00 0.00 ? 2  LEU D HD21   2  
ATOM 10649  H HD22   . LEU D 1 2  ? 0.665   -26.269 -15.595 1.00 0.00 ? 2  LEU D HD22   2  
ATOM 10650  H HD23   . LEU D 1 2  ? -0.317  -27.639 -16.187 1.00 0.00 ? 2  LEU D HD23   2  
ATOM 10651  N N      . ILE D 1 3  ? 1.924   -26.071 -13.379 1.00 0.00 ? 3  ILE D N      2  
ATOM 10652  C CA     . ILE D 1 3  ? 2.941   -25.077 -13.083 1.00 0.00 ? 3  ILE D CA     2  
ATOM 10653  C C      . ILE D 1 3  ? 3.023   -24.100 -14.251 1.00 0.00 ? 3  ILE D C      2  
ATOM 10654  O O      . ILE D 1 3  ? 3.208   -24.508 -15.397 1.00 0.00 ? 3  ILE D O      2  
ATOM 10655  C CB     . ILE D 1 3  ? 4.276   -25.774 -12.804 1.00 0.00 ? 3  ILE D CB     2  
ATOM 10656  C CG1    . ILE D 1 3  ? 4.229   -26.602 -11.517 1.00 0.00 ? 3  ILE D CG1    2  
ATOM 10657  C CG2    . ILE D 1 3  ? 5.399   -24.755 -12.623 1.00 0.00 ? 3  ILE D CG2    2  
ATOM 10658  C CD1    . ILE D 1 3  ? 3.675   -28.007 -11.732 1.00 0.00 ? 3  ILE D CD1    2  
ATOM 10659  H H      . ILE D 1 3  ? 2.190   -26.828 -13.993 1.00 0.00 ? 3  ILE D H      2  
ATOM 10660  H HA     . ILE D 1 3  ? 2.658   -24.522 -12.189 1.00 0.00 ? 3  ILE D HA     2  
ATOM 10661  H HB     . ILE D 1 3  ? 4.531   -26.420 -13.644 1.00 0.00 ? 3  ILE D HB     2  
ATOM 10662  H HG12   . ILE D 1 3  ? 5.240   -26.718 -11.126 1.00 0.00 ? 3  ILE D HG12   2  
ATOM 10663  H HG13   . ILE D 1 3  ? 3.629   -26.089 -10.767 1.00 0.00 ? 3  ILE D HG13   2  
ATOM 10664  H HG21   . ILE D 1 3  ? 5.140   -24.071 -11.814 1.00 0.00 ? 3  ILE D HG21   2  
ATOM 10665  H HG22   . ILE D 1 3  ? 6.316   -25.288 -12.366 1.00 0.00 ? 3  ILE D HG22   2  
ATOM 10666  H HG23   . ILE D 1 3  ? 5.552   -24.193 -13.544 1.00 0.00 ? 3  ILE D HG23   2  
ATOM 10667  H HD11   . ILE D 1 3  ? 4.246   -28.490 -12.525 1.00 0.00 ? 3  ILE D HD11   2  
ATOM 10668  H HD12   . ILE D 1 3  ? 3.777   -28.574 -10.809 1.00 0.00 ? 3  ILE D HD12   2  
ATOM 10669  H HD13   . ILE D 1 3  ? 2.620   -27.973 -11.996 1.00 0.00 ? 3  ILE D HD13   2  
ATOM 10670  N N      . LEU D 1 4  ? 2.868   -22.808 -13.952 1.00 0.00 ? 4  LEU D N      2  
ATOM 10671  C CA     . LEU D 1 4  ? 3.060   -21.718 -14.894 1.00 0.00 ? 4  LEU D CA     2  
ATOM 10672  C C      . LEU D 1 4  ? 4.275   -20.890 -14.504 1.00 0.00 ? 4  LEU D C      2  
ATOM 10673  O O      . LEU D 1 4  ? 4.750   -20.950 -13.372 1.00 0.00 ? 4  LEU D O      2  
ATOM 10674  C CB     . LEU D 1 4  ? 1.835   -20.804 -14.888 1.00 0.00 ? 4  LEU D CB     2  
ATOM 10675  C CG     . LEU D 1 4  ? 0.580   -21.389 -15.532 1.00 0.00 ? 4  LEU D CG     2  
ATOM 10676  C CD1    . LEU D 1 4  ? -0.405  -20.235 -15.689 1.00 0.00 ? 4  LEU D CD1    2  
ATOM 10677  C CD2    . LEU D 1 4  ? 0.829   -21.976 -16.917 1.00 0.00 ? 4  LEU D CD2    2  
ATOM 10678  H H      . LEU D 1 4  ? 2.745   -22.559 -12.979 1.00 0.00 ? 4  LEU D H      2  
ATOM 10679  H HA     . LEU D 1 4  ? 3.222   -22.113 -15.896 1.00 0.00 ? 4  LEU D HA     2  
ATOM 10680  H HB2    . LEU D 1 4  ? 1.605   -20.531 -13.858 1.00 0.00 ? 4  LEU D HB2    2  
ATOM 10681  H HB3    . LEU D 1 4  ? 2.092   -19.889 -15.422 1.00 0.00 ? 4  LEU D HB3    2  
ATOM 10682  H HG     . LEU D 1 4  ? 0.157   -22.153 -14.881 1.00 0.00 ? 4  LEU D HG     2  
ATOM 10683  H HD11   . LEU D 1 4  ? -1.325  -20.594 -16.151 1.00 0.00 ? 4  LEU D HD11   2  
ATOM 10684  H HD12   . LEU D 1 4  ? -0.625  -19.814 -14.710 1.00 0.00 ? 4  LEU D HD12   2  
ATOM 10685  H HD13   . LEU D 1 4  ? 0.049   -19.468 -16.318 1.00 0.00 ? 4  LEU D HD13   2  
ATOM 10686  H HD21   . LEU D 1 4  ? 1.421   -22.887 -16.837 1.00 0.00 ? 4  LEU D HD21   2  
ATOM 10687  H HD22   . LEU D 1 4  ? -0.127  -22.219 -17.379 1.00 0.00 ? 4  LEU D HD22   2  
ATOM 10688  H HD23   . LEU D 1 4  ? 1.350   -21.248 -17.539 1.00 0.00 ? 4  LEU D HD23   2  
ATOM 10689  N N      . THR D 1 5  ? 4.673   -20.007 -15.420 1.00 0.00 ? 5  THR D N      2  
ATOM 10690  C CA     . THR D 1 5  ? 5.673   -18.989 -15.172 1.00 0.00 ? 5  THR D CA     2  
ATOM 10691  C C      . THR D 1 5  ? 5.199   -17.673 -15.777 1.00 0.00 ? 5  THR D C      2  
ATOM 10692  O O      . THR D 1 5  ? 5.125   -17.531 -16.996 1.00 0.00 ? 5  THR D O      2  
ATOM 10693  C CB     . THR D 1 5  ? 7.011   -19.442 -15.757 1.00 0.00 ? 5  THR D CB     2  
ATOM 10694  O OG1    . THR D 1 5  ? 7.251   -20.801 -15.466 1.00 0.00 ? 5  THR D OG1    2  
ATOM 10695  C CG2    . THR D 1 5  ? 8.142   -18.666 -15.103 1.00 0.00 ? 5  THR D CG2    2  
ATOM 10696  H H      . THR D 1 5  ? 4.226   -20.004 -16.327 1.00 0.00 ? 5  THR D H      2  
ATOM 10697  H HA     . THR D 1 5  ? 5.792   -18.865 -14.097 1.00 0.00 ? 5  THR D HA     2  
ATOM 10698  H HB     . THR D 1 5  ? 7.043   -19.265 -16.832 1.00 0.00 ? 5  THR D HB     2  
ATOM 10699  H HG1    . THR D 1 5  ? 7.503   -21.250 -16.280 1.00 0.00 ? 5  THR D HG1    2  
ATOM 10700  H HG21   . THR D 1 5  ? 8.106   -18.838 -14.027 1.00 0.00 ? 5  THR D HG21   2  
ATOM 10701  H HG22   . THR D 1 5  ? 9.084   -19.029 -15.513 1.00 0.00 ? 5  THR D HG22   2  
ATOM 10702  H HG23   . THR D 1 5  ? 8.015   -17.610 -15.330 1.00 0.00 ? 5  THR D HG23   2  
ATOM 10703  N N      . ARG D 1 6  ? 4.845   -16.710 -14.920 1.00 0.00 ? 6  ARG D N      2  
ATOM 10704  C CA     . ARG D 1 6  ? 4.270   -15.436 -15.327 1.00 0.00 ? 6  ARG D CA     2  
ATOM 10705  C C      . ARG D 1 6  ? 5.051   -14.269 -14.737 1.00 0.00 ? 6  ARG D C      2  
ATOM 10706  O O      . ARG D 1 6  ? 5.593   -14.380 -13.640 1.00 0.00 ? 6  ARG D O      2  
ATOM 10707  C CB     . ARG D 1 6  ? 2.806   -15.370 -14.887 1.00 0.00 ? 6  ARG D CB     2  
ATOM 10708  C CG     . ARG D 1 6  ? 1.900   -16.192 -15.805 1.00 0.00 ? 6  ARG D CG     2  
ATOM 10709  C CD     . ARG D 1 6  ? 0.874   -15.309 -16.510 1.00 0.00 ? 6  ARG D CD     2  
ATOM 10710  N NE     . ARG D 1 6  ? 1.505   -14.416 -17.490 1.00 0.00 ? 6  ARG D NE     2  
ATOM 10711  C CZ     . ARG D 1 6  ? 0.848   -13.764 -18.453 1.00 0.00 ? 6  ARG D CZ     2  
ATOM 10712  N NH1    . ARG D 1 6  ? -0.484  -13.722 -18.477 1.00 0.00 ? 6  ARG D NH1    2  
ATOM 10713  N NH2    . ARG D 1 6  ? 1.525   -13.130 -19.411 1.00 0.00 ? 6  ARG D NH2    2  
ATOM 10714  H H      . ARG D 1 6  ? 4.862   -16.922 -13.930 1.00 0.00 ? 6  ARG D H      2  
ATOM 10715  H HA     . ARG D 1 6  ? 4.322   -15.346 -16.412 1.00 0.00 ? 6  ARG D HA     2  
ATOM 10716  H HB2    . ARG D 1 6  ? 2.720   -15.745 -13.867 1.00 0.00 ? 6  ARG D HB2    2  
ATOM 10717  H HB3    . ARG D 1 6  ? 2.479   -14.330 -14.888 1.00 0.00 ? 6  ARG D HB3    2  
ATOM 10718  H HG2    . ARG D 1 6  ? 2.492   -16.718 -16.553 1.00 0.00 ? 6  ARG D HG2    2  
ATOM 10719  H HG3    . ARG D 1 6  ? 1.372   -16.935 -15.208 1.00 0.00 ? 6  ARG D HG3    2  
ATOM 10720  H HD2    . ARG D 1 6  ? 0.162   -15.956 -17.021 1.00 0.00 ? 6  ARG D HD2    2  
ATOM 10721  H HD3    . ARG D 1 6  ? 0.336   -14.717 -15.767 1.00 0.00 ? 6  ARG D HD3    2  
ATOM 10722  H HE     . ARG D 1 6  ? 2.501   -14.265 -17.417 1.00 0.00 ? 6  ARG D HE     2  
ATOM 10723  H HH11   . ARG D 1 6  ? -1.007  -14.097 -17.698 1.00 0.00 ? 6  ARG D HH11   2  
ATOM 10724  H HH12   . ARG D 1 6  ? -0.948  -13.132 -19.152 1.00 0.00 ? 6  ARG D HH12   2  
ATOM 10725  H HH21   . ARG D 1 6  ? 2.533   -13.161 -19.431 1.00 0.00 ? 6  ARG D HH21   2  
ATOM 10726  H HH22   . ARG D 1 6  ? 1.030   -12.544 -20.069 1.00 0.00 ? 6  ARG D HH22   2  
ATOM 10727  N N      . LYS D 1 7  ? 5.093   -13.140 -15.451 1.00 0.00 ? 7  LYS D N      2  
ATOM 10728  C CA     . LYS D 1 7  ? 5.738   -11.937 -14.951 1.00 0.00 ? 7  LYS D CA     2  
ATOM 10729  C C      . LYS D 1 7  ? 4.885   -11.237 -13.899 1.00 0.00 ? 7  LYS D C      2  
ATOM 10730  O O      . LYS D 1 7  ? 3.667   -11.392 -13.866 1.00 0.00 ? 7  LYS D O      2  
ATOM 10731  C CB     . LYS D 1 7  ? 6.051   -10.945 -16.069 1.00 0.00 ? 7  LYS D CB     2  
ATOM 10732  C CG     . LYS D 1 7  ? 7.104   -11.374 -17.088 1.00 0.00 ? 7  LYS D CG     2  
ATOM 10733  C CD     . LYS D 1 7  ? 8.458   -10.766 -16.719 1.00 0.00 ? 7  LYS D CD     2  
ATOM 10734  C CE     . LYS D 1 7  ? 9.556   -11.100 -17.726 1.00 0.00 ? 7  LYS D CE     2  
ATOM 10735  N NZ     . LYS D 1 7  ? 9.388   -10.375 -18.998 1.00 0.00 ? 7  LYS D NZ     2  
ATOM 10736  H H      . LYS D 1 7  ? 4.575   -13.087 -16.315 1.00 0.00 ? 7  LYS D H      2  
ATOM 10737  H HA     . LYS D 1 7  ? 6.677   -12.217 -14.482 1.00 0.00 ? 7  LYS D HA     2  
ATOM 10738  H HB2    . LYS D 1 7  ? 5.123   -10.708 -16.588 1.00 0.00 ? 7  LYS D HB2    2  
ATOM 10739  H HB3    . LYS D 1 7  ? 6.438   -10.049 -15.587 1.00 0.00 ? 7  LYS D HB3    2  
ATOM 10740  H HG2    . LYS D 1 7  ? 7.165   -12.461 -17.145 1.00 0.00 ? 7  LYS D HG2    2  
ATOM 10741  H HG3    . LYS D 1 7  ? 6.804   -10.984 -18.057 1.00 0.00 ? 7  LYS D HG3    2  
ATOM 10742  H HD2    . LYS D 1 7  ? 8.365   -9.682  -16.649 1.00 0.00 ? 7  LYS D HD2    2  
ATOM 10743  H HD3    . LYS D 1 7  ? 8.757   -11.146 -15.742 1.00 0.00 ? 7  LYS D HD3    2  
ATOM 10744  H HE2    . LYS D 1 7  ? 10.510  -10.822 -17.274 1.00 0.00 ? 7  LYS D HE2    2  
ATOM 10745  H HE3    . LYS D 1 7  ? 9.561   -12.174 -17.916 1.00 0.00 ? 7  LYS D HE3    2  
ATOM 10746  H HZ1    . LYS D 1 7  ? 8.519   -10.638 -19.440 1.00 0.00 ? 7  LYS D HZ1    2  
ATOM 10747  H HZ2    . LYS D 1 7  ? 9.398   -9.377  -18.841 1.00 0.00 ? 7  LYS D HZ2    2  
ATOM 10748  H HZ3    . LYS D 1 7  ? 10.143  -10.610 -19.628 1.00 0.00 ? 7  LYS D HZ3    2  
ATOM 10749  N N      . VAL D 1 8  ? 5.524   -10.375 -13.105 1.00 0.00 ? 8  VAL D N      2  
ATOM 10750  C CA     . VAL D 1 8  ? 4.837   -9.471  -12.197 1.00 0.00 ? 8  VAL D CA     2  
ATOM 10751  C C      . VAL D 1 8  ? 3.841   -8.583  -12.935 1.00 0.00 ? 8  VAL D C      2  
ATOM 10752  O O      . VAL D 1 8  ? 4.106   -8.108  -14.038 1.00 0.00 ? 8  VAL D O      2  
ATOM 10753  C CB     . VAL D 1 8  ? 5.839   -8.628  -11.408 1.00 0.00 ? 8  VAL D CB     2  
ATOM 10754  C CG1    . VAL D 1 8  ? 6.601   -9.510  -10.421 1.00 0.00 ? 8  VAL D CG1    2  
ATOM 10755  C CG2    . VAL D 1 8  ? 6.861   -7.911  -12.291 1.00 0.00 ? 8  VAL D CG2    2  
ATOM 10756  H H      . VAL D 1 8  ? 6.529   -10.301 -13.186 1.00 0.00 ? 8  VAL D H      2  
ATOM 10757  H HA     . VAL D 1 8  ? 4.269   -10.071 -11.487 1.00 0.00 ? 8  VAL D HA     2  
ATOM 10758  H HB     . VAL D 1 8  ? 5.287   -7.878  -10.841 1.00 0.00 ? 8  VAL D HB     2  
ATOM 10759  H HG11   . VAL D 1 8  ? 7.222   -8.879  -9.785  1.00 0.00 ? 8  VAL D HG11   2  
ATOM 10760  H HG12   . VAL D 1 8  ? 5.899   -10.070 -9.802  1.00 0.00 ? 8  VAL D HG12   2  
ATOM 10761  H HG13   . VAL D 1 8  ? 7.239   -10.213 -10.957 1.00 0.00 ? 8  VAL D HG13   2  
ATOM 10762  H HG21   . VAL D 1 8  ? 7.531   -7.330  -11.658 1.00 0.00 ? 8  VAL D HG21   2  
ATOM 10763  H HG22   . VAL D 1 8  ? 7.444   -8.634  -12.862 1.00 0.00 ? 8  VAL D HG22   2  
ATOM 10764  H HG23   . VAL D 1 8  ? 6.352   -7.238  -12.980 1.00 0.00 ? 8  VAL D HG23   2  
ATOM 10765  N N      . GLY D 1 9  ? 2.676   -8.374  -12.318 1.00 0.00 ? 9  GLY D N      2  
ATOM 10766  C CA     . GLY D 1 9  ? 1.583   -7.592  -12.870 1.00 0.00 ? 9  GLY D CA     2  
ATOM 10767  C C      . GLY D 1 9  ? 0.656   -8.389  -13.786 1.00 0.00 ? 9  GLY D C      2  
ATOM 10768  O O      . GLY D 1 9  ? -0.343  -7.841  -14.249 1.00 0.00 ? 9  GLY D O      2  
ATOM 10769  H H      . GLY D 1 9  ? 2.506   -8.817  -11.425 1.00 0.00 ? 9  GLY D H      2  
ATOM 10770  H HA2    . GLY D 1 9  ? 0.991   -7.193  -12.048 1.00 0.00 ? 9  GLY D HA2    2  
ATOM 10771  H HA3    . GLY D 1 9  ? 1.991   -6.754  -13.435 1.00 0.00 ? 9  GLY D HA3    2  
ATOM 10772  N N      . GLU D 1 10 ? 0.954   -9.663  -14.059 1.00 0.00 ? 10 GLU D N      2  
ATOM 10773  C CA     . GLU D 1 10 ? 0.136   -10.496 -14.928 1.00 0.00 ? 10 GLU D CA     2  
ATOM 10774  C C      . GLU D 1 10 ? -0.989  -11.209 -14.178 1.00 0.00 ? 10 GLU D C      2  
ATOM 10775  O O      . GLU D 1 10 ? -1.039  -11.209 -12.949 1.00 0.00 ? 10 GLU D O      2  
ATOM 10776  C CB     . GLU D 1 10 ? 1.015   -11.502 -15.673 1.00 0.00 ? 10 GLU D CB     2  
ATOM 10777  C CG     . GLU D 1 10 ? 2.007   -10.824 -16.618 1.00 0.00 ? 10 GLU D CG     2  
ATOM 10778  C CD     . GLU D 1 10 ? 1.316   -9.990  -17.696 1.00 0.00 ? 10 GLU D CD     2  
ATOM 10779  O OE1    . GLU D 1 10 ? 0.283   -10.451 -18.232 1.00 0.00 ? 10 GLU D OE1    2  
ATOM 10780  O OE2    . GLU D 1 10 ? 1.828   -8.893  -18.007 1.00 0.00 ? 10 GLU D OE2    2  
ATOM 10781  H H      . GLU D 1 10 ? 1.792   -10.068 -13.670 1.00 0.00 ? 10 GLU D H      2  
ATOM 10782  H HA     . GLU D 1 10 ? -0.338  -9.857  -15.672 1.00 0.00 ? 10 GLU D HA     2  
ATOM 10783  H HB2    . GLU D 1 10 ? 1.557   -12.110 -14.950 1.00 0.00 ? 10 GLU D HB2    2  
ATOM 10784  H HB3    . GLU D 1 10 ? 0.377   -12.167 -16.252 1.00 0.00 ? 10 GLU D HB3    2  
ATOM 10785  H HG2    . GLU D 1 10 ? 2.677   -10.187 -16.039 1.00 0.00 ? 10 GLU D HG2    2  
ATOM 10786  H HG3    . GLU D 1 10 ? 2.611   -11.594 -17.098 1.00 0.00 ? 10 GLU D HG3    2  
ATOM 10787  N N      . SER D 1 11 ? -1.905  -11.820 -14.937 1.00 0.00 ? 11 SER D N      2  
ATOM 10788  C CA     . SER D 1 11 ? -3.152  -12.365 -14.424 1.00 0.00 ? 11 SER D CA     2  
ATOM 10789  C C      . SER D 1 11 ? -3.365  -13.818 -14.840 1.00 0.00 ? 11 SER D C      2  
ATOM 10790  O O      . SER D 1 11 ? -2.848  -14.276 -15.858 1.00 0.00 ? 11 SER D O      2  
ATOM 10791  C CB     . SER D 1 11 ? -4.325  -11.502 -14.888 1.00 0.00 ? 11 SER D CB     2  
ATOM 10792  O OG     . SER D 1 11 ? -4.235  -10.205 -14.339 1.00 0.00 ? 11 SER D OG     2  
ATOM 10793  H H      . SER D 1 11 ? -1.764  -11.852 -15.937 1.00 0.00 ? 11 SER D H      2  
ATOM 10794  H HA     . SER D 1 11 ? -3.133  -12.336 -13.334 1.00 0.00 ? 11 SER D HA     2  
ATOM 10795  H HB2    . SER D 1 11 ? -4.319  -11.435 -15.977 1.00 0.00 ? 11 SER D HB2    2  
ATOM 10796  H HB3    . SER D 1 11 ? -5.260  -11.960 -14.565 1.00 0.00 ? 11 SER D HB3    2  
ATOM 10797  H HG     . SER D 1 11 ? -3.471  -9.762  -14.721 1.00 0.00 ? 11 SER D HG     2  
ATOM 10798  N N      . ILE D 1 12 ? -4.146  -14.534 -14.027 1.00 0.00 ? 12 ILE D N      2  
ATOM 10799  C CA     . ILE D 1 12 ? -4.374  -15.970 -14.065 1.00 0.00 ? 12 ILE D CA     2  
ATOM 10800  C C      . ILE D 1 12 ? -5.815  -16.238 -13.630 1.00 0.00 ? 12 ILE D C      2  
ATOM 10801  O O      . ILE D 1 12 ? -6.433  -15.394 -12.984 1.00 0.00 ? 12 ILE D O      2  
ATOM 10802  C CB     . ILE D 1 12 ? -3.333  -16.651 -13.165 1.00 0.00 ? 12 ILE D CB     2  
ATOM 10803  C CG1    . ILE D 1 12 ? -1.935  -16.511 -13.777 1.00 0.00 ? 12 ILE D CG1    2  
ATOM 10804  C CG2    . ILE D 1 12 ? -3.647  -18.120 -12.873 1.00 0.00 ? 12 ILE D CG2    2  
ATOM 10805  C CD1    . ILE D 1 12 ? -0.856  -17.234 -12.973 1.00 0.00 ? 12 ILE D CD1    2  
ATOM 10806  H H      . ILE D 1 12 ? -4.545  -14.056 -13.230 1.00 0.00 ? 12 ILE D H      2  
ATOM 10807  H HA     . ILE D 1 12 ? -4.258  -16.330 -15.086 1.00 0.00 ? 12 ILE D HA     2  
ATOM 10808  H HB     . ILE D 1 12 ? -3.319  -16.122 -12.212 1.00 0.00 ? 12 ILE D HB     2  
ATOM 10809  H HG12   . ILE D 1 12 ? -1.931  -16.896 -14.797 1.00 0.00 ? 12 ILE D HG12   2  
ATOM 10810  H HG13   . ILE D 1 12 ? -1.662  -15.458 -13.804 1.00 0.00 ? 12 ILE D HG13   2  
ATOM 10811  H HG21   . ILE D 1 12 ? -4.627  -18.223 -12.411 1.00 0.00 ? 12 ILE D HG21   2  
ATOM 10812  H HG22   . ILE D 1 12 ? -3.606  -18.703 -13.794 1.00 0.00 ? 12 ILE D HG22   2  
ATOM 10813  H HG23   . ILE D 1 12 ? -2.925  -18.526 -12.163 1.00 0.00 ? 12 ILE D HG23   2  
ATOM 10814  H HD11   . ILE D 1 12 ? 0.126   -16.920 -13.323 1.00 0.00 ? 12 ILE D HD11   2  
ATOM 10815  H HD12   . ILE D 1 12 ? -0.960  -16.986 -11.917 1.00 0.00 ? 12 ILE D HD12   2  
ATOM 10816  H HD13   . ILE D 1 12 ? -0.959  -18.310 -13.110 1.00 0.00 ? 12 ILE D HD13   2  
ATOM 10817  N N      . ASN D 1 13 ? -6.383  -17.395 -13.983 1.00 0.00 ? 13 ASN D N      2  
ATOM 10818  C CA     . ASN D 1 13 ? -7.753  -17.753 -13.640 1.00 0.00 ? 13 ASN D CA     2  
ATOM 10819  C C      . ASN D 1 13 ? -7.889  -19.205 -13.194 1.00 0.00 ? 13 ASN D C      2  
ATOM 10820  O O      . ASN D 1 13 ? -7.136  -20.077 -13.626 1.00 0.00 ? 13 ASN D O      2  
ATOM 10821  C CB     . ASN D 1 13 ? -8.687  -17.464 -14.815 1.00 0.00 ? 13 ASN D CB     2  
ATOM 10822  C CG     . ASN D 1 13 ? -8.937  -15.971 -14.965 1.00 0.00 ? 13 ASN D CG     2  
ATOM 10823  O OD1    . ASN D 1 13 ? -8.297  -15.294 -15.764 1.00 0.00 ? 13 ASN D OD1    2  
ATOM 10824  N ND2    . ASN D 1 13 ? -9.850  -15.434 -14.159 1.00 0.00 ? 13 ASN D ND2    2  
ATOM 10825  H H      . ASN D 1 13 ? -5.809  -18.088 -14.443 1.00 0.00 ? 13 ASN D H      2  
ATOM 10826  H HA     . ASN D 1 13 ? -8.072  -17.137 -12.799 1.00 0.00 ? 13 ASN D HA     2  
ATOM 10827  H HB2    . ASN D 1 13 ? -8.273  -17.862 -15.740 1.00 0.00 ? 13 ASN D HB2    2  
ATOM 10828  H HB3    . ASN D 1 13 ? -9.644  -17.959 -14.646 1.00 0.00 ? 13 ASN D HB3    2  
ATOM 10829  H HD21   . ASN D 1 13 ? -10.315 -16.003 -13.466 1.00 0.00 ? 13 ASN D HD21   2  
ATOM 10830  H HD22   . ASN D 1 13 ? -10.000 -14.436 -14.172 1.00 0.00 ? 13 ASN D HD22   2  
ATOM 10831  N N      . ILE D 1 14 ? -8.898  -19.455 -12.353 1.00 0.00 ? 14 ILE D N      2  
ATOM 10832  C CA     . ILE D 1 14 ? -9.269  -20.774 -11.864 1.00 0.00 ? 14 ILE D CA     2  
ATOM 10833  C C      . ILE D 1 14 ? -10.782 -20.936 -11.974 1.00 0.00 ? 14 ILE D C      2  
ATOM 10834  O O      . ILE D 1 14 ? -11.539 -20.014 -11.673 1.00 0.00 ? 14 ILE D O      2  
ATOM 10835  C CB     . ILE D 1 14 ? -8.768  -20.972 -10.428 1.00 0.00 ? 14 ILE D CB     2  
ATOM 10836  C CG1    . ILE D 1 14 ? -7.241  -20.851 -10.376 1.00 0.00 ? 14 ILE D CG1    2  
ATOM 10837  C CG2    . ILE D 1 14 ? -9.234  -22.322 -9.879  1.00 0.00 ? 14 ILE D CG2    2  
ATOM 10838  C CD1    . ILE D 1 14 ? -6.661  -21.048 -8.977  1.00 0.00 ? 14 ILE D CD1    2  
ATOM 10839  H H      . ILE D 1 14 ? -9.501  -18.689 -12.086 1.00 0.00 ? 14 ILE D H      2  
ATOM 10840  H HA     . ILE D 1 14 ? -8.799  -21.529 -12.496 1.00 0.00 ? 14 ILE D HA     2  
ATOM 10841  H HB     . ILE D 1 14 ? -9.187  -20.186 -9.801  1.00 0.00 ? 14 ILE D HB     2  
ATOM 10842  H HG12   . ILE D 1 14 ? -6.794  -21.583 -11.050 1.00 0.00 ? 14 ILE D HG12   2  
ATOM 10843  H HG13   . ILE D 1 14 ? -6.954  -19.854 -10.711 1.00 0.00 ? 14 ILE D HG13   2  
ATOM 10844  H HG21   . ILE D 1 14 ? -10.322 -22.367 -9.865  1.00 0.00 ? 14 ILE D HG21   2  
ATOM 10845  H HG22   . ILE D 1 14 ? -8.846  -23.132 -10.497 1.00 0.00 ? 14 ILE D HG22   2  
ATOM 10846  H HG23   . ILE D 1 14 ? -8.888  -22.452 -8.854  1.00 0.00 ? 14 ILE D HG23   2  
ATOM 10847  H HD11   . ILE D 1 14 ? -7.205  -20.433 -8.260  1.00 0.00 ? 14 ILE D HD11   2  
ATOM 10848  H HD12   . ILE D 1 14 ? -6.724  -22.096 -8.686  1.00 0.00 ? 14 ILE D HD12   2  
ATOM 10849  H HD13   . ILE D 1 14 ? -5.612  -20.750 -8.977  1.00 0.00 ? 14 ILE D HD13   2  
ATOM 10850  N N      . GLY D 1 15 ? -11.238 -22.111 -12.415 1.00 0.00 ? 15 GLY D N      2  
ATOM 10851  C CA     . GLY D 1 15 ? -12.645 -22.383 -12.653 1.00 0.00 ? 15 GLY D CA     2  
ATOM 10852  C C      . GLY D 1 15 ? -13.243 -21.399 -13.652 1.00 0.00 ? 15 GLY D C      2  
ATOM 10853  O O      . GLY D 1 15 ? -12.632 -21.094 -14.675 1.00 0.00 ? 15 GLY D O      2  
ATOM 10854  H H      . GLY D 1 15 ? -10.569 -22.825 -12.667 1.00 0.00 ? 15 GLY D H      2  
ATOM 10855  H HA2    . GLY D 1 15 ? -12.762 -23.395 -13.042 1.00 0.00 ? 15 GLY D HA2    2  
ATOM 10856  H HA3    . GLY D 1 15 ? -13.186 -22.311 -11.708 1.00 0.00 ? 15 GLY D HA3    2  
ATOM 10857  N N      . ASP D 1 16 ? -14.434 -20.887 -13.336 1.00 0.00 ? 16 ASP D N      2  
ATOM 10858  C CA     . ASP D 1 16 ? -15.090 -19.826 -14.084 1.00 0.00 ? 16 ASP D CA     2  
ATOM 10859  C C      . ASP D 1 16 ? -15.558 -18.681 -13.184 1.00 0.00 ? 16 ASP D C      2  
ATOM 10860  O O      . ASP D 1 16 ? -16.267 -17.789 -13.643 1.00 0.00 ? 16 ASP D O      2  
ATOM 10861  C CB     . ASP D 1 16 ? -16.223 -20.414 -14.928 1.00 0.00 ? 16 ASP D CB     2  
ATOM 10862  C CG     . ASP D 1 16 ? -17.406 -20.900 -14.094 1.00 0.00 ? 16 ASP D CG     2  
ATOM 10863  O OD1    . ASP D 1 16 ? -17.234 -21.889 -13.349 1.00 0.00 ? 16 ASP D OD1    2  
ATOM 10864  O OD2    . ASP D 1 16 ? -18.508 -20.331 -14.256 1.00 0.00 ? 16 ASP D OD2    2  
ATOM 10865  H H      . ASP D 1 16 ? -14.937 -21.278 -12.552 1.00 0.00 ? 16 ASP D H      2  
ATOM 10866  H HA     . ASP D 1 16 ? -14.364 -19.397 -14.775 1.00 0.00 ? 16 ASP D HA     2  
ATOM 10867  H HB2    . ASP D 1 16 ? -16.565 -19.652 -15.630 1.00 0.00 ? 16 ASP D HB2    2  
ATOM 10868  H HB3    . ASP D 1 16 ? -15.833 -21.248 -15.512 1.00 0.00 ? 16 ASP D HB3    2  
ATOM 10869  N N      . ASP D 1 17 ? -15.146 -18.680 -11.912 1.00 0.00 ? 17 ASP D N      2  
ATOM 10870  C CA     . ASP D 1 17 ? -15.495 -17.649 -10.946 1.00 0.00 ? 17 ASP D CA     2  
ATOM 10871  C C      . ASP D 1 17 ? -14.283 -17.003 -10.278 1.00 0.00 ? 17 ASP D C      2  
ATOM 10872  O O      . ASP D 1 17 ? -14.433 -15.958 -9.647  1.00 0.00 ? 17 ASP D O      2  
ATOM 10873  C CB     . ASP D 1 17 ? -16.418 -18.233 -9.874  1.00 0.00 ? 17 ASP D CB     2  
ATOM 10874  C CG     . ASP D 1 17 ? -17.810 -18.549 -10.414 1.00 0.00 ? 17 ASP D CG     2  
ATOM 10875  O OD1    . ASP D 1 17 ? -18.531 -17.590 -10.769 1.00 0.00 ? 17 ASP D OD1    2  
ATOM 10876  O OD2    . ASP D 1 17 ? -18.187 -19.741 -10.403 1.00 0.00 ? 17 ASP D OD2    2  
ATOM 10877  H H      . ASP D 1 17 ? -14.564 -19.444 -11.596 1.00 0.00 ? 17 ASP D H      2  
ATOM 10878  H HA     . ASP D 1 17 ? -16.037 -16.852 -11.455 1.00 0.00 ? 17 ASP D HA     2  
ATOM 10879  H HB2    . ASP D 1 17 ? -15.967 -19.132 -9.455  1.00 0.00 ? 17 ASP D HB2    2  
ATOM 10880  H HB3    . ASP D 1 17 ? -16.523 -17.507 -9.067  1.00 0.00 ? 17 ASP D HB3    2  
ATOM 10881  N N      . ILE D 1 18 ? -13.092 -17.602 -10.382 1.00 0.00 ? 18 ILE D N      2  
ATOM 10882  C CA     . ILE D 1 18 ? -11.928 -17.193 -9.610  1.00 0.00 ? 18 ILE D CA     2  
ATOM 10883  C C      . ILE D 1 18 ? -10.861 -16.578 -10.512 1.00 0.00 ? 18 ILE D C      2  
ATOM 10884  O O      . ILE D 1 18 ? -10.553 -17.094 -11.586 1.00 0.00 ? 18 ILE D O      2  
ATOM 10885  C CB     . ILE D 1 18 ? -11.384 -18.365 -8.786  1.00 0.00 ? 18 ILE D CB     2  
ATOM 10886  C CG1    . ILE D 1 18 ? -12.452 -18.951 -7.857  1.00 0.00 ? 18 ILE D CG1    2  
ATOM 10887  C CG2    . ILE D 1 18 ? -10.182 -17.927 -7.948  1.00 0.00 ? 18 ILE D CG2    2  
ATOM 10888  C CD1    . ILE D 1 18 ? -13.096 -20.205 -8.445  1.00 0.00 ? 18 ILE D CD1    2  
ATOM 10889  H H      . ILE D 1 18 ? -12.993 -18.419 -10.968 1.00 0.00 ? 18 ILE D H      2  
ATOM 10890  H HA     . ILE D 1 18 ? -12.239 -16.423 -8.904  1.00 0.00 ? 18 ILE D HA     2  
ATOM 10891  H HB     . ILE D 1 18 ? -11.045 -19.146 -9.464  1.00 0.00 ? 18 ILE D HB     2  
ATOM 10892  H HG12   . ILE D 1 18 ? -12.002 -19.223 -6.902  1.00 0.00 ? 18 ILE D HG12   2  
ATOM 10893  H HG13   . ILE D 1 18 ? -13.224 -18.206 -7.665  1.00 0.00 ? 18 ILE D HG13   2  
ATOM 10894  H HG21   . ILE D 1 18 ? -10.457 -17.083 -7.314  1.00 0.00 ? 18 ILE D HG21   2  
ATOM 10895  H HG22   . ILE D 1 18 ? -9.848  -18.754 -7.321  1.00 0.00 ? 18 ILE D HG22   2  
ATOM 10896  H HG23   . ILE D 1 18 ? -9.356  -17.638 -8.596  1.00 0.00 ? 18 ILE D HG23   2  
ATOM 10897  H HD11   . ILE D 1 18 ? -12.335 -20.970 -8.604  1.00 0.00 ? 18 ILE D HD11   2  
ATOM 10898  H HD12   . ILE D 1 18 ? -13.845 -20.587 -7.752  1.00 0.00 ? 18 ILE D HD12   2  
ATOM 10899  H HD13   . ILE D 1 18 ? -13.577 -19.976 -9.396  1.00 0.00 ? 18 ILE D HD13   2  
ATOM 10900  N N      . THR D 1 19 ? -10.250 -15.491 -10.032 1.00 0.00 ? 19 THR D N      2  
ATOM 10901  C CA     . THR D 1 19 ? -9.128  -14.825 -10.674 1.00 0.00 ? 19 THR D CA     2  
ATOM 10902  C C      . THR D 1 19 ? -7.946  -14.764 -9.713  1.00 0.00 ? 19 THR D C      2  
ATOM 10903  O O      . THR D 1 19 ? -8.123  -14.670 -8.499  1.00 0.00 ? 19 THR D O      2  
ATOM 10904  C CB     . THR D 1 19 ? -9.542  -13.429 -11.144 1.00 0.00 ? 19 THR D CB     2  
ATOM 10905  O OG1    . THR D 1 19 ? -10.679 -13.519 -11.973 1.00 0.00 ? 19 THR D OG1    2  
ATOM 10906  C CG2    . THR D 1 19 ? -8.446  -12.730 -11.945 1.00 0.00 ? 19 THR D CG2    2  
ATOM 10907  H H      . THR D 1 19 ? -10.561 -15.123 -9.144  1.00 0.00 ? 19 THR D H      2  
ATOM 10908  H HA     . THR D 1 19 ? -8.819  -15.402 -11.546 1.00 0.00 ? 19 THR D HA     2  
ATOM 10909  H HB     . THR D 1 19 ? -9.789  -12.818 -10.277 1.00 0.00 ? 19 THR D HB     2  
ATOM 10910  H HG1    . THR D 1 19 ? -11.033 -12.632 -12.098 1.00 0.00 ? 19 THR D HG1    2  
ATOM 10911  H HG21   . THR D 1 19 ? -8.832  -11.794 -12.349 1.00 0.00 ? 19 THR D HG21   2  
ATOM 10912  H HG22   . THR D 1 19 ? -7.597  -12.506 -11.299 1.00 0.00 ? 19 THR D HG22   2  
ATOM 10913  H HG23   . THR D 1 19 ? -8.124  -13.369 -12.767 1.00 0.00 ? 19 THR D HG23   2  
ATOM 10914  N N      . ILE D 1 20 ? -6.732  -14.844 -10.261 1.00 0.00 ? 20 ILE D N      2  
ATOM 10915  C CA     . ILE D 1 20 ? -5.473  -14.821 -9.535  1.00 0.00 ? 20 ILE D CA     2  
ATOM 10916  C C      . ILE D 1 20 ? -4.568  -13.786 -10.196 1.00 0.00 ? 20 ILE D C      2  
ATOM 10917  O O      . ILE D 1 20 ? -4.550  -13.673 -11.420 1.00 0.00 ? 20 ILE D O      2  
ATOM 10918  C CB     . ILE D 1 20 ? -4.833  -16.213 -9.572  1.00 0.00 ? 20 ILE D CB     2  
ATOM 10919  C CG1    . ILE D 1 20 ? -5.731  -17.323 -9.019  1.00 0.00 ? 20 ILE D CG1    2  
ATOM 10920  C CG2    . ILE D 1 20 ? -3.483  -16.218 -8.853  1.00 0.00 ? 20 ILE D CG2    2  
ATOM 10921  C CD1    . ILE D 1 20 ? -5.976  -17.233 -7.514  1.00 0.00 ? 20 ILE D CD1    2  
ATOM 10922  H H      . ILE D 1 20 ? -6.667  -14.886 -11.269 1.00 0.00 ? 20 ILE D H      2  
ATOM 10923  H HA     . ILE D 1 20 ? -5.644  -14.526 -8.501  1.00 0.00 ? 20 ILE D HA     2  
ATOM 10924  H HB     . ILE D 1 20 ? -4.652  -16.461 -10.616 1.00 0.00 ? 20 ILE D HB     2  
ATOM 10925  H HG12   . ILE D 1 20 ? -6.692  -17.303 -9.533  1.00 0.00 ? 20 ILE D HG12   2  
ATOM 10926  H HG13   . ILE D 1 20 ? -5.266  -18.284 -9.233  1.00 0.00 ? 20 ILE D HG13   2  
ATOM 10927  H HG21   . ILE D 1 20 ? -3.587  -15.794 -7.853  1.00 0.00 ? 20 ILE D HG21   2  
ATOM 10928  H HG22   . ILE D 1 20 ? -3.111  -17.239 -8.774  1.00 0.00 ? 20 ILE D HG22   2  
ATOM 10929  H HG23   . ILE D 1 20 ? -2.758  -15.630 -9.417  1.00 0.00 ? 20 ILE D HG23   2  
ATOM 10930  H HD11   . ILE D 1 20 ? -6.311  -16.230 -7.253  1.00 0.00 ? 20 ILE D HD11   2  
ATOM 10931  H HD12   . ILE D 1 20 ? -6.744  -17.953 -7.230  1.00 0.00 ? 20 ILE D HD12   2  
ATOM 10932  H HD13   . ILE D 1 20 ? -5.058  -17.465 -6.974  1.00 0.00 ? 20 ILE D HD13   2  
ATOM 10933  N N      . THR D 1 21 ? -3.799  -13.034 -9.406  1.00 0.00 ? 21 THR D N      2  
ATOM 10934  C CA     . THR D 1 21 ? -2.977  -11.946 -9.915  1.00 0.00 ? 21 THR D CA     2  
ATOM 10935  C C      . THR D 1 21 ? -1.628  -11.948 -9.209  1.00 0.00 ? 21 THR D C      2  
ATOM 10936  O O      . THR D 1 21 ? -1.581  -11.977 -7.982  1.00 0.00 ? 21 THR D O      2  
ATOM 10937  C CB     . THR D 1 21 ? -3.675  -10.601 -9.702  1.00 0.00 ? 21 THR D CB     2  
ATOM 10938  O OG1    . THR D 1 21 ? -5.042  -10.679 -10.041 1.00 0.00 ? 21 THR D OG1    2  
ATOM 10939  C CG2    . THR D 1 21 ? -3.048  -9.512  -10.568 1.00 0.00 ? 21 THR D CG2    2  
ATOM 10940  H H      . THR D 1 21 ? -3.850  -13.161 -8.404  1.00 0.00 ? 21 THR D H      2  
ATOM 10941  H HA     . THR D 1 21 ? -2.807  -12.083 -10.983 1.00 0.00 ? 21 THR D HA     2  
ATOM 10942  H HB     . THR D 1 21 ? -3.591  -10.317 -8.652  1.00 0.00 ? 21 THR D HB     2  
ATOM 10943  H HG1    . THR D 1 21 ? -5.431  -9.805  -9.934  1.00 0.00 ? 21 THR D HG1    2  
ATOM 10944  H HG21   . THR D 1 21 ? -1.982  -9.431  -10.355 1.00 0.00 ? 21 THR D HG21   2  
ATOM 10945  H HG22   . THR D 1 21 ? -3.184  -9.757  -11.622 1.00 0.00 ? 21 THR D HG22   2  
ATOM 10946  H HG23   . THR D 1 21 ? -3.528  -8.557  -10.356 1.00 0.00 ? 21 THR D HG23   2  
ATOM 10947  N N      . ILE D 1 22 ? -0.523  -11.872 -9.956  1.00 0.00 ? 22 ILE D N      2  
ATOM 10948  C CA     . ILE D 1 22 ? 0.779   -11.648 -9.352  1.00 0.00 ? 22 ILE D CA     2  
ATOM 10949  C C      . ILE D 1 22 ? 1.000   -10.144 -9.244  1.00 0.00 ? 22 ILE D C      2  
ATOM 10950  O O      . ILE D 1 22 ? 1.144   -9.451  -10.248 1.00 0.00 ? 22 ILE D O      2  
ATOM 10951  C CB     . ILE D 1 22 ? 1.873   -12.408 -10.111 1.00 0.00 ? 22 ILE D CB     2  
ATOM 10952  C CG1    . ILE D 1 22 ? 3.274   -11.958 -9.695  1.00 0.00 ? 22 ILE D CG1    2  
ATOM 10953  C CG2    . ILE D 1 22 ? 1.757   -12.281 -11.627 1.00 0.00 ? 22 ILE D CG2    2  
ATOM 10954  C CD1    . ILE D 1 22 ? 3.548   -12.246 -8.223  1.00 0.00 ? 22 ILE D CD1    2  
ATOM 10955  H H      . ILE D 1 22 ? -0.591  -11.754 -10.958 1.00 0.00 ? 22 ILE D H      2  
ATOM 10956  H HA     . ILE D 1 22 ? 0.763   -12.052 -8.340  1.00 0.00 ? 22 ILE D HA     2  
ATOM 10957  H HB     . ILE D 1 22 ? 1.773   -13.466 -9.865  1.00 0.00 ? 22 ILE D HB     2  
ATOM 10958  H HG12   . ILE D 1 22 ? 4.016   -12.485 -10.296 1.00 0.00 ? 22 ILE D HG12   2  
ATOM 10959  H HG13   . ILE D 1 22 ? 3.386   -10.889 -9.863  1.00 0.00 ? 22 ILE D HG13   2  
ATOM 10960  H HG21   . ILE D 1 22 ? 2.579   -12.820 -12.097 1.00 0.00 ? 22 ILE D HG21   2  
ATOM 10961  H HG22   . ILE D 1 22 ? 0.821   -12.723 -11.973 1.00 0.00 ? 22 ILE D HG22   2  
ATOM 10962  H HG23   . ILE D 1 22 ? 1.800   -11.232 -11.917 1.00 0.00 ? 22 ILE D HG23   2  
ATOM 10963  H HD11   . ILE D 1 22 ? 3.448   -13.315 -8.035  1.00 0.00 ? 22 ILE D HD11   2  
ATOM 10964  H HD12   . ILE D 1 22 ? 4.561   -11.920 -7.989  1.00 0.00 ? 22 ILE D HD12   2  
ATOM 10965  H HD13   . ILE D 1 22 ? 2.847   -11.696 -7.597  1.00 0.00 ? 22 ILE D HD13   2  
ATOM 10966  N N      . LEU D 1 23 ? 0.966   -9.622  -8.016  1.00 0.00 ? 23 LEU D N      2  
ATOM 10967  C CA     . LEU D 1 23 ? 0.994   -8.193  -7.754  1.00 0.00 ? 23 LEU D CA     2  
ATOM 10968  C C      . LEU D 1 23 ? 2.427   -7.670  -7.769  1.00 0.00 ? 23 LEU D C      2  
ATOM 10969  O O      . LEU D 1 23 ? 2.657   -6.518  -8.134  1.00 0.00 ? 23 LEU D O      2  
ATOM 10970  C CB     . LEU D 1 23 ? 0.315   -7.906  -6.415  1.00 0.00 ? 23 LEU D CB     2  
ATOM 10971  C CG     . LEU D 1 23 ? -1.093  -8.493  -6.319  1.00 0.00 ? 23 LEU D CG     2  
ATOM 10972  C CD1    . LEU D 1 23 ? -1.684  -8.161  -4.954  1.00 0.00 ? 23 LEU D CD1    2  
ATOM 10973  C CD2    . LEU D 1 23 ? -2.029  -7.933  -7.385  1.00 0.00 ? 23 LEU D CD2    2  
ATOM 10974  H H      . LEU D 1 23 ? 0.917   -10.243 -7.219  1.00 0.00 ? 23 LEU D H      2  
ATOM 10975  H HA     . LEU D 1 23 ? 0.447   -7.676  -8.541  1.00 0.00 ? 23 LEU D HA     2  
ATOM 10976  H HB2    . LEU D 1 23 ? 0.923   -8.342  -5.623  1.00 0.00 ? 23 LEU D HB2    2  
ATOM 10977  H HB3    . LEU D 1 23 ? 0.262   -6.829  -6.253  1.00 0.00 ? 23 LEU D HB3    2  
ATOM 10978  H HG     . LEU D 1 23 ? -1.045  -9.576  -6.424  1.00 0.00 ? 23 LEU D HG     2  
ATOM 10979  H HD11   . LEU D 1 23 ? -2.713  -8.518  -4.920  1.00 0.00 ? 23 LEU D HD11   2  
ATOM 10980  H HD12   . LEU D 1 23 ? -1.104  -8.656  -4.174  1.00 0.00 ? 23 LEU D HD12   2  
ATOM 10981  H HD13   . LEU D 1 23 ? -1.672  -7.083  -4.795  1.00 0.00 ? 23 LEU D HD13   2  
ATOM 10982  H HD21   . LEU D 1 23 ? -3.030  -8.336  -7.236  1.00 0.00 ? 23 LEU D HD21   2  
ATOM 10983  H HD22   . LEU D 1 23 ? -2.059  -6.847  -7.309  1.00 0.00 ? 23 LEU D HD22   2  
ATOM 10984  H HD23   . LEU D 1 23 ? -1.674  -8.222  -8.374  1.00 0.00 ? 23 LEU D HD23   2  
ATOM 10985  N N      . GLY D 1 24 ? 3.396   -8.522  -7.424  1.00 0.00 ? 24 GLY D N      2  
ATOM 10986  C CA     . GLY D 1 24 ? 4.807   -8.219  -7.601  1.00 0.00 ? 24 GLY D CA     2  
ATOM 10987  C C      . GLY D 1 24 ? 5.714   -9.120  -6.770  1.00 0.00 ? 24 GLY D C      2  
ATOM 10988  O O      . GLY D 1 24 ? 5.244   -10.051 -6.119  1.00 0.00 ? 24 GLY D O      2  
ATOM 10989  H H      . GLY D 1 24 ? 3.142   -9.442  -7.086  1.00 0.00 ? 24 GLY D H      2  
ATOM 10990  H HA2    . GLY D 1 24 ? 5.062   -8.335  -8.653  1.00 0.00 ? 24 GLY D HA2    2  
ATOM 10991  H HA3    . GLY D 1 24 ? 4.995   -7.183  -7.322  1.00 0.00 ? 24 GLY D HA3    2  
ATOM 10992  N N      . VAL D 1 25 ? 7.018   -8.831  -6.778  1.00 0.00 ? 25 VAL D N      2  
ATOM 10993  C CA     . VAL D 1 25 ? 7.971   -9.451  -5.868  1.00 0.00 ? 25 VAL D CA     2  
ATOM 10994  C C      . VAL D 1 25 ? 8.439   -8.457  -4.811  1.00 0.00 ? 25 VAL D C      2  
ATOM 10995  O O      . VAL D 1 25 ? 8.377   -7.245  -5.008  1.00 0.00 ? 25 VAL D O      2  
ATOM 10996  C CB     . VAL D 1 25 ? 9.174   -10.050 -6.603  1.00 0.00 ? 25 VAL D CB     2  
ATOM 10997  C CG1    . VAL D 1 25 ? 8.739   -10.993 -7.723  1.00 0.00 ? 25 VAL D CG1    2  
ATOM 10998  C CG2    . VAL D 1 25 ? 10.100  -8.966  -7.151  1.00 0.00 ? 25 VAL D CG2    2  
ATOM 10999  H H      . VAL D 1 25 ? 7.345   -8.066  -7.352  1.00 0.00 ? 25 VAL D H      2  
ATOM 11000  H HA     . VAL D 1 25 ? 7.477   -10.270 -5.347  1.00 0.00 ? 25 VAL D HA     2  
ATOM 11001  H HB     . VAL D 1 25 ? 9.747   -10.638 -5.886  1.00 0.00 ? 25 VAL D HB     2  
ATOM 11002  H HG11   . VAL D 1 25 ? 9.613   -11.504 -8.127  1.00 0.00 ? 25 VAL D HG11   2  
ATOM 11003  H HG12   . VAL D 1 25 ? 8.043   -11.735 -7.330  1.00 0.00 ? 25 VAL D HG12   2  
ATOM 11004  H HG13   . VAL D 1 25 ? 8.255   -10.433 -8.522  1.00 0.00 ? 25 VAL D HG13   2  
ATOM 11005  H HG21   . VAL D 1 25 ? 10.525  -8.401  -6.320  1.00 0.00 ? 25 VAL D HG21   2  
ATOM 11006  H HG22   . VAL D 1 25 ? 10.912  -9.429  -7.710  1.00 0.00 ? 25 VAL D HG22   2  
ATOM 11007  H HG23   . VAL D 1 25 ? 9.545   -8.293  -7.803  1.00 0.00 ? 25 VAL D HG23   2  
ATOM 11008  N N      . SER D 1 26 ? 8.971   -8.992  -3.710  1.00 0.00 ? 26 SER D N      2  
ATOM 11009  C CA     . SER D 1 26 ? 9.602   -8.232  -2.644  1.00 0.00 ? 26 SER D CA     2  
ATOM 11010  C C      . SER D 1 26 ? 10.738  -9.060  -2.052  1.00 0.00 ? 26 SER D C      2  
ATOM 11011  O O      . SER D 1 26 ? 10.579  -9.692  -1.009  1.00 0.00 ? 26 SER D O      2  
ATOM 11012  C CB     . SER D 1 26 ? 8.571   -7.887  -1.572  1.00 0.00 ? 26 SER D CB     2  
ATOM 11013  O OG     . SER D 1 26 ? 7.489   -7.151  -2.105  1.00 0.00 ? 26 SER D OG     2  
ATOM 11014  H H      . SER D 1 26 ? 8.958   -9.998  -3.610  1.00 0.00 ? 26 SER D H      2  
ATOM 11015  H HA     . SER D 1 26 ? 10.020  -7.309  -3.046  1.00 0.00 ? 26 SER D HA     2  
ATOM 11016  H HB2    . SER D 1 26 ? 8.189   -8.810  -1.137  1.00 0.00 ? 26 SER D HB2    2