data_2MIB
# 
_entry.id   2MIB 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2MIB         
WWPDB D_1000178369 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          4ILB 
_pdbx_database_related.details        
;2MIB STRUCTURE IS RELATED TO THE HUMAN INTERLEUKIN-1 BETA
STRUCTURE IN ENTRY 4ILB BY A 180 DEGREE ROTATION IN BETA
AND A 14 DEGREE ROTATION IN GAMMA WITH NO TRANSLATION.
;
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2MIB 
_pdbx_database_status.recvd_initial_deposition_date   1993-12-06 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    BNL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Priestle, J.P.'  1 
'Van Oostrum, J.' 2 
'Schmitz, A.'     3 
'Gruetter, M.G.'  4 
# 
_citation.id                        primary 
_citation.title                     'The structure of murine interleukin-1 beta at 2.8 A resolution.' 
_citation.journal_abbrev            J.Struct.Biol. 
_citation.journal_volume            107 
_citation.page_first                189 
_citation.page_last                 195 
_citation.year                      1991 
_citation.journal_id_ASTM           JSBIEM 
_citation.country                   US 
_citation.journal_id_ISSN           1047-8477 
_citation.journal_id_CSD            0803 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   1807351 
_citation.pdbx_database_id_DOI      '10.1016/1047-8477(91)90021-N' 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'van Oostrum, J.' 1 
primary 'Priestle, J.P.'  2 
primary 'Grutter, M.G.'   3 
primary 'Schmitz, A.'     4 
# 
_cell.entry_id           2MIB 
_cell.length_a           55.500 
_cell.length_b           55.500 
_cell.length_c           78.600 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2MIB 
_symmetry.space_group_name_H-M             'P 43' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                78 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'INTERLEUKIN-1 BETA' 17415.877 1  ? ? ? ? 
2 water   nat water                18.015    42 ? ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;VPIRQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVALGLKGKNLYLSCVMKDGTPTL
QLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFPNWYISTSQAEHKPVFLGNNSGQDIIDFTMESVSS
;
_entity_poly.pdbx_seq_one_letter_code_can   
;VPIRQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVALGLKGKNLYLSCVMKDGTPTL
QLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFPNWYISTSQAEHKPVFLGNNSGQDIIDFTMESVSS
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   VAL n 
1 2   PRO n 
1 3   ILE n 
1 4   ARG n 
1 5   GLN n 
1 6   LEU n 
1 7   HIS n 
1 8   TYR n 
1 9   ARG n 
1 10  LEU n 
1 11  ARG n 
1 12  ASP n 
1 13  GLU n 
1 14  GLN n 
1 15  GLN n 
1 16  LYS n 
1 17  SER n 
1 18  LEU n 
1 19  VAL n 
1 20  LEU n 
1 21  SER n 
1 22  ASP n 
1 23  PRO n 
1 24  TYR n 
1 25  GLU n 
1 26  LEU n 
1 27  LYS n 
1 28  ALA n 
1 29  LEU n 
1 30  HIS n 
1 31  LEU n 
1 32  ASN n 
1 33  GLY n 
1 34  GLN n 
1 35  ASN n 
1 36  ILE n 
1 37  ASN n 
1 38  GLN n 
1 39  GLN n 
1 40  VAL n 
1 41  ILE n 
1 42  PHE n 
1 43  SER n 
1 44  MET n 
1 45  SER n 
1 46  PHE n 
1 47  VAL n 
1 48  GLN n 
1 49  GLY n 
1 50  GLU n 
1 51  PRO n 
1 52  SER n 
1 53  ASN n 
1 54  ASP n 
1 55  LYS n 
1 56  ILE n 
1 57  PRO n 
1 58  VAL n 
1 59  ALA n 
1 60  LEU n 
1 61  GLY n 
1 62  LEU n 
1 63  LYS n 
1 64  GLY n 
1 65  LYS n 
1 66  ASN n 
1 67  LEU n 
1 68  TYR n 
1 69  LEU n 
1 70  SER n 
1 71  CYS n 
1 72  VAL n 
1 73  MET n 
1 74  LYS n 
1 75  ASP n 
1 76  GLY n 
1 77  THR n 
1 78  PRO n 
1 79  THR n 
1 80  LEU n 
1 81  GLN n 
1 82  LEU n 
1 83  GLU n 
1 84  SER n 
1 85  VAL n 
1 86  ASP n 
1 87  PRO n 
1 88  LYS n 
1 89  GLN n 
1 90  TYR n 
1 91  PRO n 
1 92  LYS n 
1 93  LYS n 
1 94  LYS n 
1 95  MET n 
1 96  GLU n 
1 97  LYS n 
1 98  ARG n 
1 99  PHE n 
1 100 VAL n 
1 101 PHE n 
1 102 ASN n 
1 103 LYS n 
1 104 ILE n 
1 105 GLU n 
1 106 VAL n 
1 107 LYS n 
1 108 SER n 
1 109 LYS n 
1 110 VAL n 
1 111 GLU n 
1 112 PHE n 
1 113 GLU n 
1 114 SER n 
1 115 ALA n 
1 116 GLU n 
1 117 PHE n 
1 118 PRO n 
1 119 ASN n 
1 120 TRP n 
1 121 TYR n 
1 122 ILE n 
1 123 SER n 
1 124 THR n 
1 125 SER n 
1 126 GLN n 
1 127 ALA n 
1 128 GLU n 
1 129 HIS n 
1 130 LYS n 
1 131 PRO n 
1 132 VAL n 
1 133 PHE n 
1 134 LEU n 
1 135 GLY n 
1 136 ASN n 
1 137 ASN n 
1 138 SER n 
1 139 GLY n 
1 140 GLN n 
1 141 ASP n 
1 142 ILE n 
1 143 ILE n 
1 144 ASP n 
1 145 PHE n 
1 146 THR n 
1 147 MET n 
1 148 GLU n 
1 149 SER n 
1 150 VAL n 
1 151 SER n 
1 152 SER n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               'house mouse' 
_entity_src_gen.gene_src_genus                     Mus 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Mus musculus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     10090 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      ? 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    IL1B_MOUSE 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P10749 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   
;MATVPELNCEMPPFDSDENDLFFEVDGPQKMKGCFQTFDLGCPDESIQLQISQQHINKSFRQAVSLIVAVEKLWQLPVSF
PWTFQDEDMSTFFSFIFEEEPILCDSWDDDDNLLVCDVPIRQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFS
MSFVQGEPSNDKIPVALGLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFPNWYIS
TSQAEHKPVFLGNNSGQDIIDFTMESVSS
;
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2MIB 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 152 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P10749 
_struct_ref_seq.db_align_beg                  118 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  269 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       153 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2MIB 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.47 
_exptl_crystal.density_percent_sol   64.59 
_exptl_crystal.description           ? 
# 
_refine.entry_id                                 2MIB 
_refine.ls_number_reflns_obs                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             10.0 
_refine.ls_d_res_high                            2.84 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          0.1730000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       ? 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1205 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             42 
_refine_hist.number_atoms_total               1247 
_refine_hist.d_res_high                       2.84 
_refine_hist.d_res_low                        10.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
p_bond_d            0.011 ? ? ? 'X-RAY DIFFRACTION' ? 
p_angle_d           1.6   ? ? ? 'X-RAY DIFFRACTION' ? 
p_angle_deg         ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_planar_d          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_hb_or_metal_coord ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_mcbond_it         ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_mcangle_it        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_scbond_it         ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_scangle_it        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_plane_restr       ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_chiral_restr      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_singtor_nbd       ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_multtor_nbd       ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_xhyhbond_nbd      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_xyhbond_nbd       ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_planar_tor        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_staggered_tor     ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_orthonormal_tor   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_transverse_tor    ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_special_tor       ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  2MIB 
_struct.title                     'THE STRUCTURE OF MURINE INTERLEUKIN-1 BETA AT 2.8 ANGSTROMS RESOLUTION' 
_struct.pdbx_descriptor           'INTERLEUKIN-1 BETA (IL-1 BETA)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2MIB 
_struct_keywords.pdbx_keywords   CYTOKINE 
_struct_keywords.text            CYTOKINE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_biol.id   1 
# 
_struct_conf.conf_type_id            HELX_P 
_struct_conf.id                      HELX_P1 
_struct_conf.pdbx_PDB_helix_id       1 
_struct_conf.beg_label_comp_id       GLU 
_struct_conf.beg_label_asym_id       A 
_struct_conf.beg_label_seq_id        96 
_struct_conf.pdbx_beg_PDB_ins_code   ? 
_struct_conf.end_label_comp_id       ARG 
_struct_conf.end_label_asym_id       A 
_struct_conf.end_label_seq_id        98 
_struct_conf.pdbx_end_PDB_ins_code   ? 
_struct_conf.beg_auth_comp_id        GLU 
_struct_conf.beg_auth_asym_id        A 
_struct_conf.beg_auth_seq_id         96 
_struct_conf.end_auth_comp_id        ARG 
_struct_conf.end_auth_asym_id        A 
_struct_conf.end_auth_seq_id         98 
_struct_conf.pdbx_PDB_helix_class    5 
_struct_conf.details                 ? 
_struct_conf.pdbx_PDB_helix_length   3 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          TYR 
_struct_mon_prot_cis.label_seq_id           90 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           TYR 
_struct_mon_prot_cis.auth_seq_id            90 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    91 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     91 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -0.12 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
S1 ? 7 ? 
S2 ? 2 ? 
S3 ? 2 ? 
S4 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
S1 1 2 ? anti-parallel 
S1 2 3 ? anti-parallel 
S1 3 4 ? anti-parallel 
S1 4 5 ? anti-parallel 
S1 5 6 ? anti-parallel 
S1 6 7 ? anti-parallel 
S2 1 2 ? anti-parallel 
S3 1 2 ? anti-parallel 
S4 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
S1 1 LEU A 6   ? ARG A 11  ? LEU A 6   ARG A 11  
S1 2 ILE A 41  ? VAL A 47  ? ILE A 41  VAL A 47  
S1 3 ILE A 56  ? LYS A 63  ? ILE A 56  LYS A 63  
S1 4 VAL A 100 ? VAL A 106 ? VAL A 100 VAL A 106 
S1 5 LYS A 109 ? ALA A 115 ? LYS A 109 ALA A 115 
S1 6 ASP A 144 ? VAL A 150 ? ASP A 145 VAL A 151 
S1 7 LEU A 6   ? ARG A 11  ? LEU A 6   ARG A 11  
S2 1 SER A 17  ? SER A 21  ? SER A 17  SER A 21  
S2 2 GLU A 25  ? LEU A 29  ? GLU A 25  LEU A 29  
S3 1 ASN A 66  ? LYS A 74  ? ASN A 66  LYS A 74  
S3 2 THR A 77  ? VAL A 85  ? THR A 77  VAL A 85  
S4 1 TRP A 120 ? THR A 124 ? TRP A 120 THR A 124 
S4 2 PHE A 133 ? GLY A 135 ? PHE A 133 GLY A 135 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
S1 1 2 O LEU A 6   ? O LEU A 6   N PHE A 42  ? N PHE A 42  
S1 2 3 O SER A 45  ? O SER A 45  N ALA A 59  ? N ALA A 59  
S1 3 4 O ILE A 56  ? O ILE A 56  N LYS A 103 ? N LYS A 103 
S1 4 5 O ILE A 104 ? O ILE A 104 N GLU A 111 ? N GLU A 111 
S1 5 6 O VAL A 110 ? O VAL A 110 N PHE A 145 ? N PHE A 146 
S2 1 2 N VAL A 19  ? N VAL A 19  O LYS A 27  ? O LYS A 27  
S3 1 2 N SER A 70  ? N SER A 70  O GLN A 81  ? O GLN A 81  
S4 1 2 N SER A 123 ? N SER A 123 O PHE A 133 ? O PHE A 133 
# 
_database_PDB_matrix.entry_id          2MIB 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2MIB 
_atom_sites.fract_transf_matrix[1][1]   0.018018 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.018018 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.012723 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
_atom_sites_footnote.id     1 
_atom_sites_footnote.text   'CIS PROLINE - PRO      91' 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ILE A 1 3   ? -15.592 19.679 -19.561 1.00 75.53 ? 3   ILE A N   1 
ATOM   2    C CA  . ILE A 1 3   ? -15.308 21.034 -19.014 1.00 75.53 ? 3   ILE A CA  1 
ATOM   3    C C   . ILE A 1 3   ? -13.871 21.031 -18.494 1.00 75.53 ? 3   ILE A C   1 
ATOM   4    O O   . ILE A 1 3   ? -13.294 19.962 -18.290 1.00 75.53 ? 3   ILE A O   1 
ATOM   5    C CB  . ILE A 1 3   ? -16.313 21.393 -17.899 1.00 75.53 ? 3   ILE A CB  1 
ATOM   6    C CG1 . ILE A 1 3   ? -16.175 20.435 -16.722 1.00 51.89 ? 3   ILE A CG1 1 
ATOM   7    C CG2 . ILE A 1 3   ? -17.727 21.289 -18.436 1.00 51.89 ? 3   ILE A CG2 1 
ATOM   8    C CD1 . ILE A 1 3   ? -17.129 20.727 -15.604 1.00 51.89 ? 3   ILE A CD1 1 
ATOM   9    N N   . ARG A 1 4   ? -13.280 22.211 -18.331 1.00 74.50 ? 4   ARG A N   1 
ATOM   10   C CA  . ARG A 1 4   ? -11.905 22.307 -17.850 1.00 74.50 ? 4   ARG A CA  1 
ATOM   11   C C   . ARG A 1 4   ? -11.790 21.722 -16.450 1.00 74.50 ? 4   ARG A C   1 
ATOM   12   O O   . ARG A 1 4   ? -12.641 21.958 -15.602 1.00 74.50 ? 4   ARG A O   1 
ATOM   13   C CB  . ARG A 1 4   ? -11.432 23.764 -17.846 1.00 74.50 ? 4   ARG A CB  1 
ATOM   14   C CG  . ARG A 1 4   ? -9.948  23.936 -17.519 1.00 99.99 ? 4   ARG A CG  1 
ATOM   15   C CD  . ARG A 1 4   ? -9.528  25.407 -17.375 1.00 99.99 ? 4   ARG A CD  1 
ATOM   16   N NE  . ARG A 1 4   ? -9.789  26.208 -18.573 1.00 99.99 ? 4   ARG A NE  1 
ATOM   17   C CZ  . ARG A 1 4   ? -9.233  26.001 -19.767 1.00 99.99 ? 4   ARG A CZ  1 
ATOM   18   N NH1 . ARG A 1 4   ? -8.367  25.008 -19.945 1.00 99.99 ? 4   ARG A NH1 1 
ATOM   19   N NH2 . ARG A 1 4   ? -9.548  26.787 -20.792 1.00 99.99 ? 4   ARG A NH2 1 
ATOM   20   N N   . GLN A 1 5   ? -10.755 20.923 -16.236 1.00 39.92 ? 5   GLN A N   1 
ATOM   21   C CA  . GLN A 1 5   ? -10.501 20.293 -14.950 1.00 39.92 ? 5   GLN A CA  1 
ATOM   22   C C   . GLN A 1 5   ? -9.060  20.553 -14.505 1.00 39.92 ? 5   GLN A C   1 
ATOM   23   O O   . GLN A 1 5   ? -8.102  20.088 -15.129 1.00 39.92 ? 5   GLN A O   1 
ATOM   24   C CB  . GLN A 1 5   ? -10.774 18.787 -15.026 1.00 39.92 ? 5   GLN A CB  1 
ATOM   25   C CG  . GLN A 1 5   ? -12.241 18.430 -15.232 1.00 53.91 ? 5   GLN A CG  1 
ATOM   26   C CD  . GLN A 1 5   ? -12.502 16.928 -15.231 1.00 53.91 ? 5   GLN A CD  1 
ATOM   27   O OE1 . GLN A 1 5   ? -12.163 16.228 -16.190 1.00 53.91 ? 5   GLN A OE1 1 
ATOM   28   N NE2 . GLN A 1 5   ? -13.127 16.430 -14.163 1.00 53.91 ? 5   GLN A NE2 1 
ATOM   29   N N   . LEU A 1 6   ? -8.925  21.303 -13.419 1.00 28.11 ? 6   LEU A N   1 
ATOM   30   C CA  . LEU A 1 6   ? -7.635  21.668 -12.849 1.00 28.11 ? 6   LEU A CA  1 
ATOM   31   C C   . LEU A 1 6   ? -7.116  20.565 -11.929 1.00 28.11 ? 6   LEU A C   1 
ATOM   32   O O   . LEU A 1 6   ? -7.826  20.120 -11.033 1.00 28.11 ? 6   LEU A O   1 
ATOM   33   C CB  . LEU A 1 6   ? -7.805  22.956 -12.062 1.00 28.11 ? 6   LEU A CB  1 
ATOM   34   C CG  . LEU A 1 6   ? -8.567  23.994 -12.861 1.00 27.59 ? 6   LEU A CG  1 
ATOM   35   C CD1 . LEU A 1 6   ? -8.767  25.261 -12.066 1.00 27.59 ? 6   LEU A CD1 1 
ATOM   36   C CD2 . LEU A 1 6   ? -7.772  24.266 -14.101 1.00 27.59 ? 6   LEU A CD2 1 
ATOM   37   N N   . HIS A 1 7   ? -5.872  20.147 -12.102 1.00 21.29 ? 7   HIS A N   1 
ATOM   38   C CA  . HIS A 1 7   ? -5.352  19.093 -11.260 1.00 21.29 ? 7   HIS A CA  1 
ATOM   39   C C   . HIS A 1 7   ? -4.545  19.621 -10.121 1.00 21.29 ? 7   HIS A C   1 
ATOM   40   O O   . HIS A 1 7   ? -3.693  20.474 -10.317 1.00 21.29 ? 7   HIS A O   1 
ATOM   41   C CB  . HIS A 1 7   ? -4.576  18.122 -12.108 1.00 21.29 ? 7   HIS A CB  1 
ATOM   42   C CG  . HIS A 1 7   ? -5.390  17.592 -13.231 1.00 28.90 ? 7   HIS A CG  1 
ATOM   43   N ND1 . HIS A 1 7   ? -5.227  18.021 -14.526 1.00 28.90 ? 7   HIS A ND1 1 
ATOM   44   C CD2 . HIS A 1 7   ? -6.481  16.791 -13.232 1.00 28.90 ? 7   HIS A CD2 1 
ATOM   45   C CE1 . HIS A 1 7   ? -6.192  17.518 -15.277 1.00 28.90 ? 7   HIS A CE1 1 
ATOM   46   N NE2 . HIS A 1 7   ? -6.966  16.767 -14.516 1.00 28.90 ? 7   HIS A NE2 1 
ATOM   47   N N   . TYR A 1 8   ? -4.811  19.092 -8.933  1.00 20.24 ? 8   TYR A N   1 
ATOM   48   C CA  . TYR A 1 8   ? -4.150  19.511 -7.702  1.00 20.24 ? 8   TYR A CA  1 
ATOM   49   C C   . TYR A 1 8   ? -3.867  18.350 -6.789  1.00 20.24 ? 8   TYR A C   1 
ATOM   50   O O   . TYR A 1 8   ? -4.431  17.282 -6.939  1.00 20.24 ? 8   TYR A O   1 
ATOM   51   C CB  . TYR A 1 8   ? -5.078  20.406 -6.895  1.00 20.24 ? 8   TYR A CB  1 
ATOM   52   C CG  . TYR A 1 8   ? -5.375  21.728 -7.505  1.00 33.77 ? 8   TYR A CG  1 
ATOM   53   C CD1 . TYR A 1 8   ? -4.497  22.800 -7.329  1.00 33.77 ? 8   TYR A CD1 1 
ATOM   54   C CD2 . TYR A 1 8   ? -6.538  21.929 -8.246  1.00 33.77 ? 8   TYR A CD2 1 
ATOM   55   C CE1 . TYR A 1 8   ? -4.765  24.059 -7.879  1.00 33.77 ? 8   TYR A CE1 1 
ATOM   56   C CE2 . TYR A 1 8   ? -6.825  23.184 -8.804  1.00 33.77 ? 8   TYR A CE2 1 
ATOM   57   C CZ  . TYR A 1 8   ? -5.929  24.247 -8.618  1.00 33.77 ? 8   TYR A CZ  1 
ATOM   58   O OH  . TYR A 1 8   ? -6.164  25.480 -9.190  1.00 33.77 ? 8   TYR A OH  1 
ATOM   59   N N   . ARG A 1 9   ? -3.093  18.629 -5.756  1.00 24.27 ? 9   ARG A N   1 
ATOM   60   C CA  . ARG A 1 9   ? -2.759  17.670 -4.730  1.00 24.27 ? 9   ARG A CA  1 
ATOM   61   C C   . ARG A 1 9   ? -3.036  18.442 -3.448  1.00 24.27 ? 9   ARG A C   1 
ATOM   62   O O   . ARG A 1 9   ? -2.818  19.648 -3.399  1.00 24.27 ? 9   ARG A O   1 
ATOM   63   C CB  . ARG A 1 9   ? -1.294  17.280 -4.820  1.00 24.27 ? 9   ARG A CB  1 
ATOM   64   C CG  . ARG A 1 9   ? -1.074  15.872 -5.356  1.00 48.14 ? 9   ARG A CG  1 
ATOM   65   C CD  . ARG A 1 9   ? 0.381   15.406 -5.191  1.00 48.14 ? 9   ARG A CD  1 
ATOM   66   N NE  . ARG A 1 9   ? 1.297   16.061 -6.125  1.00 48.14 ? 9   ARG A NE  1 
ATOM   67   C CZ  . ARG A 1 9   ? 1.778   15.494 -7.233  1.00 48.14 ? 9   ARG A CZ  1 
ATOM   68   N NH1 . ARG A 1 9   ? 1.446   14.245 -7.564  1.00 48.14 ? 9   ARG A NH1 1 
ATOM   69   N NH2 . ARG A 1 9   ? 2.571   16.193 -8.033  1.00 48.14 ? 9   ARG A NH2 1 
ATOM   70   N N   . LEU A 1 10  ? -3.559  17.770 -2.431  1.00 15.42 ? 10  LEU A N   1 
ATOM   71   C CA  . LEU A 1 10  ? -3.900  18.409 -1.158  1.00 15.42 ? 10  LEU A CA  1 
ATOM   72   C C   . LEU A 1 10  ? -3.048  17.881 -0.026  1.00 15.42 ? 10  LEU A C   1 
ATOM   73   O O   . LEU A 1 10  ? -2.678  16.706 -0.024  1.00 15.42 ? 10  LEU A O   1 
ATOM   74   C CB  . LEU A 1 10  ? -5.345  18.099 -0.799  1.00 15.42 ? 10  LEU A CB  1 
ATOM   75   C CG  . LEU A 1 10  ? -6.548  18.890 -1.287  1.00 14.74 ? 10  LEU A CG  1 
ATOM   76   C CD1 . LEU A 1 10  ? -6.424  19.415 -2.693  1.00 14.74 ? 10  LEU A CD1 1 
ATOM   77   C CD2 . LEU A 1 10  ? -7.687  17.927 -1.162  1.00 14.74 ? 10  LEU A CD2 1 
ATOM   78   N N   . ARG A 1 11  ? -2.801  18.730 0.962   1.00 19.50 ? 11  ARG A N   1 
ATOM   79   C CA  . ARG A 1 11  ? -2.031  18.362 2.140   1.00 19.50 ? 11  ARG A CA  1 
ATOM   80   C C   . ARG A 1 11  ? -2.713  19.110 3.266   1.00 19.50 ? 11  ARG A C   1 
ATOM   81   O O   . ARG A 1 11  ? -2.828  20.327 3.178   1.00 19.50 ? 11  ARG A O   1 
ATOM   82   C CB  . ARG A 1 11  ? -0.587  18.844 2.003   1.00 19.50 ? 11  ARG A CB  1 
ATOM   83   C CG  . ARG A 1 11  ? 0.393   17.766 1.619   1.00 36.20 ? 11  ARG A CG  1 
ATOM   84   C CD  . ARG A 1 11  ? 1.843   18.246 1.695   1.00 36.20 ? 11  ARG A CD  1 
ATOM   85   N NE  . ARG A 1 11  ? 2.336   18.776 0.420   1.00 36.20 ? 11  ARG A NE  1 
ATOM   86   C CZ  . ARG A 1 11  ? 2.495   18.048 -0.688  1.00 36.20 ? 11  ARG A CZ  1 
ATOM   87   N NH1 . ARG A 1 11  ? 2.206   16.748 -0.695  1.00 36.20 ? 11  ARG A NH1 1 
ATOM   88   N NH2 . ARG A 1 11  ? 2.929   18.625 -1.803  1.00 36.20 ? 11  ARG A NH2 1 
ATOM   89   N N   . ASP A 1 12  ? -3.181  18.432 4.314   1.00 12.74 ? 12  ASP A N   1 
ATOM   90   C CA  . ASP A 1 12  ? -3.863  19.174 5.381   1.00 12.74 ? 12  ASP A CA  1 
ATOM   91   C C   . ASP A 1 12  ? -2.900  20.160 6.010   1.00 12.74 ? 12  ASP A C   1 
ATOM   92   O O   . ASP A 1 12  ? -1.724  20.146 5.661   1.00 12.74 ? 12  ASP A O   1 
ATOM   93   C CB  . ASP A 1 12  ? -4.543  18.253 6.405   1.00 12.74 ? 12  ASP A CB  1 
ATOM   94   C CG  . ASP A 1 12  ? -3.573  17.542 7.314   1.00 20.66 ? 12  ASP A CG  1 
ATOM   95   O OD1 . ASP A 1 12  ? -2.351  17.690 7.127   1.00 20.66 ? 12  ASP A OD1 1 
ATOM   96   O OD2 . ASP A 1 12  ? -4.039  16.818 8.225   1.00 20.66 ? 12  ASP A OD2 1 
ATOM   97   N N   . GLU A 1 13  ? -3.358  20.992 6.937   1.00 23.76 ? 13  GLU A N   1 
ATOM   98   C CA  . GLU A 1 13  ? -2.468  21.984 7.534   1.00 23.76 ? 13  GLU A CA  1 
ATOM   99   C C   . GLU A 1 13  ? -1.294  21.432 8.332   1.00 23.76 ? 13  GLU A C   1 
ATOM   100  O O   . GLU A 1 13  ? -0.381  22.172 8.669   1.00 23.76 ? 13  GLU A O   1 
ATOM   101  C CB  . GLU A 1 13  ? -3.260  23.003 8.343   1.00 23.76 ? 13  GLU A CB  1 
ATOM   102  C CG  . GLU A 1 13  ? -3.088  22.926 9.846   1.00 56.16 ? 13  GLU A CG  1 
ATOM   103  C CD  . GLU A 1 13  ? -4.124  23.761 10.584  1.00 56.16 ? 13  GLU A CD  1 
ATOM   104  O OE1 . GLU A 1 13  ? -4.341  24.939 10.192  1.00 56.16 ? 13  GLU A OE1 1 
ATOM   105  O OE2 . GLU A 1 13  ? -4.740  23.232 11.545  1.00 56.16 ? 13  GLU A OE2 1 
ATOM   106  N N   . GLN A 1 14  ? -1.317  20.129 8.614   1.00 23.81 ? 14  GLN A N   1 
ATOM   107  C CA  . GLN A 1 14  ? -0.249  19.447 9.359   1.00 23.81 ? 14  GLN A CA  1 
ATOM   108  C C   . GLN A 1 14  ? 0.786   18.856 8.431   1.00 23.81 ? 14  GLN A C   1 
ATOM   109  O O   . GLN A 1 14  ? 1.683   18.156 8.881   1.00 23.81 ? 14  GLN A O   1 
ATOM   110  C CB  . GLN A 1 14  ? -0.812  18.292 10.159  1.00 23.81 ? 14  GLN A CB  1 
ATOM   111  C CG  . GLN A 1 14  ? -1.841  18.681 11.140  1.00 38.66 ? 14  GLN A CG  1 
ATOM   112  C CD  . GLN A 1 14  ? -1.265  19.057 12.470  1.00 38.66 ? 14  GLN A CD  1 
ATOM   113  O OE1 . GLN A 1 14  ? -1.936  18.927 13.497  1.00 38.66 ? 14  GLN A OE1 1 
ATOM   114  N NE2 . GLN A 1 14  ? -0.016  19.528 12.477  1.00 38.66 ? 14  GLN A NE2 1 
ATOM   115  N N   . GLN A 1 15  ? 0.610   19.077 7.136   1.00 21.59 ? 15  GLN A N   1 
ATOM   116  C CA  . GLN A 1 15  ? 1.506   18.576 6.116   1.00 21.59 ? 15  GLN A CA  1 
ATOM   117  C C   . GLN A 1 15  ? 1.306   17.098 5.841   1.00 21.59 ? 15  GLN A C   1 
ATOM   118  O O   . GLN A 1 15  ? 2.271   16.386 5.565   1.00 21.59 ? 15  GLN A O   1 
ATOM   119  C CB  . GLN A 1 15  ? 2.969   18.848 6.471   1.00 21.59 ? 15  GLN A CB  1 
ATOM   120  C CG  . GLN A 1 15  ? 3.302   20.299 6.671   1.00 36.79 ? 15  GLN A CG  1 
ATOM   121  C CD  . GLN A 1 15  ? 2.974   21.159 5.454   1.00 36.79 ? 15  GLN A CD  1 
ATOM   122  O OE1 . GLN A 1 15  ? 2.400   20.686 4.454   1.00 36.79 ? 15  GLN A OE1 1 
ATOM   123  N NE2 . GLN A 1 15  ? 3.345   22.434 5.526   1.00 36.79 ? 15  GLN A NE2 1 
ATOM   124  N N   . LYS A 1 16  ? 0.069   16.623 5.939   1.00 17.50 ? 16  LYS A N   1 
ATOM   125  C CA  . LYS A 1 16  ? -0.211  15.212 5.650   1.00 17.50 ? 16  LYS A CA  1 
ATOM   126  C C   . LYS A 1 16  ? -0.766  15.085 4.229   1.00 17.50 ? 16  LYS A C   1 
ATOM   127  O O   . LYS A 1 16  ? -1.700  15.793 3.856   1.00 17.50 ? 16  LYS A O   1 
ATOM   128  C CB  . LYS A 1 16  ? -1.187  14.606 6.667   1.00 17.50 ? 16  LYS A CB  1 
ATOM   129  C CG  . LYS A 1 16  ? -0.715  14.747 8.105   1.00 16.71 ? 16  LYS A CG  1 
ATOM   130  C CD  . LYS A 1 16  ? -1.166  13.588 9.001   1.00 16.71 ? 16  LYS A CD  1 
ATOM   131  C CE  . LYS A 1 16  ? -2.649  13.596 9.266   1.00 16.71 ? 16  LYS A CE  1 
ATOM   132  N NZ  . LYS A 1 16  ? -3.056  14.884 9.874   1.00 16.71 ? 16  LYS A NZ  1 
ATOM   133  N N   . SER A 1 17  ? -0.138  14.251 3.419   1.00 24.68 ? 17  SER A N   1 
ATOM   134  C CA  . SER A 1 17  ? -0.586  14.046 2.055   1.00 24.68 ? 17  SER A CA  1 
ATOM   135  C C   . SER A 1 17  ? -1.755  13.072 2.064   1.00 24.68 ? 17  SER A C   1 
ATOM   136  O O   . SER A 1 17  ? -1.865  12.268 2.998   1.00 24.68 ? 17  SER A O   1 
ATOM   137  C CB  . SER A 1 17  ? 0.547   13.447 1.253   1.00 24.68 ? 17  SER A CB  1 
ATOM   138  O OG  . SER A 1 17  ? 1.690   14.263 1.355   1.00 33.15 ? 17  SER A OG  1 
ATOM   139  N N   . LEU A 1 18  ? -2.628  13.136 1.051   1.00 14.30 ? 18  LEU A N   1 
ATOM   140  C CA  . LEU A 1 18  ? -3.776  12.217 0.980   1.00 14.30 ? 18  LEU A CA  1 
ATOM   141  C C   . LEU A 1 18  ? -3.449  11.062 0.020   1.00 14.30 ? 18  LEU A C   1 
ATOM   142  O O   . LEU A 1 18  ? -2.756  11.262 -0.959  1.00 14.30 ? 18  LEU A O   1 
ATOM   143  C CB  . LEU A 1 18  ? -5.073  12.943 0.557   1.00 14.30 ? 18  LEU A CB  1 
ATOM   144  C CG  . LEU A 1 18  ? -5.501  14.279 1.205   1.00 18.33 ? 18  LEU A CG  1 
ATOM   145  C CD1 . LEU A 1 18  ? -6.954  14.639 0.864   1.00 18.33 ? 18  LEU A CD1 1 
ATOM   146  C CD2 . LEU A 1 18  ? -5.331  14.245 2.698   1.00 18.33 ? 18  LEU A CD2 1 
ATOM   147  N N   . VAL A 1 19  ? -3.909  9.854  0.325   1.00 24.84 ? 19  VAL A N   1 
ATOM   148  C CA  . VAL A 1 19  ? -3.656  8.696  -0.522  1.00 24.84 ? 19  VAL A CA  1 
ATOM   149  C C   . VAL A 1 19  ? -4.887  7.826  -0.569  1.00 24.84 ? 19  VAL A C   1 
ATOM   150  O O   . VAL A 1 19  ? -5.659  7.787  0.381   1.00 24.84 ? 19  VAL A O   1 
ATOM   151  C CB  . VAL A 1 19  ? -2.487  7.812  -0.003  1.00 24.84 ? 19  VAL A CB  1 
ATOM   152  C CG1 . VAL A 1 19  ? -1.184  8.617  0.067   1.00 19.54 ? 19  VAL A CG1 1 
ATOM   153  C CG2 . VAL A 1 19  ? -2.836  7.191  1.341   1.00 19.54 ? 19  VAL A CG2 1 
ATOM   154  N N   . LEU A 1 20  ? -5.030  7.083  -1.655  1.00 21.86 ? 20  LEU A N   1 
ATOM   155  C CA  . LEU A 1 20  ? -6.167  6.185  -1.867  1.00 21.86 ? 20  LEU A CA  1 
ATOM   156  C C   . LEU A 1 20  ? -5.810  4.783  -1.372  1.00 21.86 ? 20  LEU A C   1 
ATOM   157  O O   . LEU A 1 20  ? -4.897  4.164  -1.918  1.00 21.86 ? 20  LEU A O   1 
ATOM   158  C CB  . LEU A 1 20  ? -6.465  6.137  -3.365  1.00 21.86 ? 20  LEU A CB  1 
ATOM   159  C CG  . LEU A 1 20  ? -7.731  5.486  -3.889  1.00 14.40 ? 20  LEU A CG  1 
ATOM   160  C CD1 . LEU A 1 20  ? -8.954  6.203  -3.356  1.00 14.40 ? 20  LEU A CD1 1 
ATOM   161  C CD2 . LEU A 1 20  ? -7.695  5.553  -5.388  1.00 14.40 ? 20  LEU A CD2 1 
ATOM   162  N N   . SER A 1 21  ? -6.505  4.272  -0.360  1.00 70.16 ? 21  SER A N   1 
ATOM   163  C CA  . SER A 1 21  ? -6.198  2.937  0.157   1.00 70.16 ? 21  SER A CA  1 
ATOM   164  C C   . SER A 1 21  ? -7.280  1.898  -0.163  1.00 70.16 ? 21  SER A C   1 
ATOM   165  O O   . SER A 1 21  ? -7.172  1.173  -1.154  1.00 70.16 ? 21  SER A O   1 
ATOM   166  C CB  . SER A 1 21  ? -5.907  3.004  1.655   1.00 70.16 ? 21  SER A CB  1 
ATOM   167  O OG  . SER A 1 21  ? -6.891  3.770  2.326   1.00 99.99 ? 21  SER A OG  1 
ATOM   168  N N   . ASP A 1 22  ? -8.282  1.772  0.702   1.00 99.99 ? 22  ASP A N   1 
ATOM   169  C CA  . ASP A 1 22  ? -9.395  0.846  0.457   1.00 99.99 ? 22  ASP A CA  1 
ATOM   170  C C   . ASP A 1 22  ? -9.912  1.317  -0.917  1.00 99.99 ? 22  ASP A C   1 
ATOM   171  O O   . ASP A 1 22  ? -9.945  2.527  -1.180  1.00 99.99 ? 22  ASP A O   1 
ATOM   172  C CB  . ASP A 1 22  ? -10.463 1.040  1.562   1.00 99.99 ? 22  ASP A CB  1 
ATOM   173  C CG  . ASP A 1 22  ? -11.766 0.271  1.305   1.00 99.99 ? 22  ASP A CG  1 
ATOM   174  O OD1 . ASP A 1 22  ? -11.837 -0.916 1.685   1.00 99.99 ? 22  ASP A OD1 1 
ATOM   175  O OD2 . ASP A 1 22  ? -12.734 0.865  0.768   1.00 99.99 ? 22  ASP A OD2 1 
ATOM   176  N N   . PRO A 1 23  ? -10.308 0.384  -1.809  1.00 99.99 ? 23  PRO A N   1 
ATOM   177  C CA  . PRO A 1 23  ? -10.813 0.712  -3.155  1.00 99.99 ? 23  PRO A CA  1 
ATOM   178  C C   . PRO A 1 23  ? -11.623 2.008  -3.303  1.00 99.99 ? 23  PRO A C   1 
ATOM   179  O O   . PRO A 1 23  ? -11.638 2.622  -4.376  1.00 99.99 ? 23  PRO A O   1 
ATOM   180  C CB  . PRO A 1 23  ? -11.653 -0.520 -3.519  1.00 99.99 ? 23  PRO A CB  1 
ATOM   181  C CG  . PRO A 1 23  ? -11.882 -1.231 -2.183  1.00 77.54 ? 23  PRO A CG  1 
ATOM   182  C CD  . PRO A 1 23  ? -10.558 -1.033 -1.512  1.00 77.54 ? 23  PRO A CD  1 
ATOM   183  N N   . TYR A 1 24  ? -12.299 2.407  -2.229  1.00 59.31 ? 24  TYR A N   1 
ATOM   184  C CA  . TYR A 1 24  ? -13.113 3.608  -2.218  1.00 59.31 ? 24  TYR A CA  1 
ATOM   185  C C   . TYR A 1 24  ? -12.873 4.421  -0.932  1.00 59.31 ? 24  TYR A C   1 
ATOM   186  O O   . TYR A 1 24  ? -13.821 4.910  -0.313  1.00 59.31 ? 24  TYR A O   1 
ATOM   187  C CB  . TYR A 1 24  ? -14.599 3.224  -2.300  1.00 59.31 ? 24  TYR A CB  1 
ATOM   188  C CG  . TYR A 1 24  ? -15.145 2.777  -3.657  1.00 85.75 ? 24  TYR A CG  1 
ATOM   189  C CD1 . TYR A 1 24  ? -14.382 2.019  -4.550  1.00 85.75 ? 24  TYR A CD1 1 
ATOM   190  C CD2 . TYR A 1 24  ? -16.461 3.084  -4.018  1.00 85.75 ? 24  TYR A CD2 1 
ATOM   191  C CE1 . TYR A 1 24  ? -14.917 1.576  -5.765  1.00 85.75 ? 24  TYR A CE1 1 
ATOM   192  C CE2 . TYR A 1 24  ? -17.008 2.650  -5.225  1.00 85.75 ? 24  TYR A CE2 1 
ATOM   193  C CZ  . TYR A 1 24  ? -16.236 1.898  -6.094  1.00 85.75 ? 24  TYR A CZ  1 
ATOM   194  O OH  . TYR A 1 24  ? -16.791 1.482  -7.287  1.00 85.75 ? 24  TYR A OH  1 
ATOM   195  N N   . GLU A 1 25  ? -11.616 4.604  -0.546  1.00 43.17 ? 25  GLU A N   1 
ATOM   196  C CA  . GLU A 1 25  ? -11.317 5.348  0.673   1.00 43.17 ? 25  GLU A CA  1 
ATOM   197  C C   . GLU A 1 25  ? -9.995  6.110  0.652   1.00 43.17 ? 25  GLU A C   1 
ATOM   198  O O   . GLU A 1 25  ? -8.973  5.576  0.235   1.00 43.17 ? 25  GLU A O   1 
ATOM   199  C CB  . GLU A 1 25  ? -11.337 4.396  1.861   1.00 43.17 ? 25  GLU A CB  1 
ATOM   200  C CG  . GLU A 1 25  ? -11.217 5.058  3.215   1.00 57.46 ? 25  GLU A CG  1 
ATOM   201  C CD  . GLU A 1 25  ? -11.502 4.098  4.353   1.00 57.46 ? 25  GLU A CD  1 
ATOM   202  O OE1 . GLU A 1 25  ? -11.050 2.933  4.280   1.00 57.46 ? 25  GLU A OE1 1 
ATOM   203  O OE2 . GLU A 1 25  ? -12.185 4.509  5.319   1.00 57.46 ? 25  GLU A OE2 1 
ATOM   204  N N   . LEU A 1 26  ? -10.024 7.348  1.141   1.00 16.34 ? 26  LEU A N   1 
ATOM   205  C CA  . LEU A 1 26  ? -8.854  8.222  1.200   1.00 16.34 ? 26  LEU A CA  1 
ATOM   206  C C   . LEU A 1 26  ? -8.293  8.280  2.621   1.00 16.34 ? 26  LEU A C   1 
ATOM   207  O O   . LEU A 1 26  ? -9.040  8.415  3.595   1.00 16.34 ? 26  LEU A O   1 
ATOM   208  C CB  . LEU A 1 26  ? -9.238  9.647  0.798   1.00 16.34 ? 26  LEU A CB  1 
ATOM   209  C CG  . LEU A 1 26  ? -9.715  9.931  -0.617  1.00 12.42 ? 26  LEU A CG  1 
ATOM   210  C CD1 . LEU A 1 26  ? -10.437 11.261 -0.662  1.00 12.42 ? 26  LEU A CD1 1 
ATOM   211  C CD2 . LEU A 1 26  ? -8.525  9.906  -1.554  1.00 12.42 ? 26  LEU A CD2 1 
ATOM   212  N N   . LYS A 1 27  ? -6.980  8.202  2.743   1.00 21.10 ? 27  LYS A N   1 
ATOM   213  C CA  . LYS A 1 27  ? -6.367  8.283  4.039   1.00 21.10 ? 27  LYS A CA  1 
ATOM   214  C C   . LYS A 1 27  ? -5.312  9.350  3.965   1.00 21.10 ? 27  LYS A C   1 
ATOM   215  O O   . LYS A 1 27  ? -4.778  9.625  2.902   1.00 21.10 ? 27  LYS A O   1 
ATOM   216  C CB  . LYS A 1 27  ? -5.785  6.944  4.449   1.00 21.10 ? 27  LYS A CB  1 
ATOM   217  C CG  . LYS A 1 27  ? -6.852  5.965  4.909   1.00 48.84 ? 27  LYS A CG  1 
ATOM   218  C CD  . LYS A 1 27  ? -6.217  4.781  5.628   1.00 48.84 ? 27  LYS A CD  1 
ATOM   219  C CE  . LYS A 1 27  ? -7.250  3.917  6.338   1.00 48.84 ? 27  LYS A CE  1 
ATOM   220  N NZ  . LYS A 1 27  ? -8.180  3.296  5.356   1.00 48.84 ? 27  LYS A NZ  1 
ATOM   221  N N   . ALA A 1 28  ? -5.038  9.973  5.097   1.00 17.07 ? 28  ALA A N   1 
ATOM   222  C CA  . ALA A 1 28  ? -4.068  11.049 5.166   1.00 17.07 ? 28  ALA A CA  1 
ATOM   223  C C   . ALA A 1 28  ? -2.968  10.570 6.062   1.00 17.07 ? 28  ALA A C   1 
ATOM   224  O O   . ALA A 1 28  ? -3.242  9.976  7.104   1.00 17.07 ? 28  ALA A O   1 
ATOM   225  C CB  . ALA A 1 28  ? -4.716  12.315 5.761   1.00 17.07 ? 28  ALA A CB  1 
ATOM   226  N N   . LEU A 1 29  ? -1.728  10.809 5.647   1.00 25.06 ? 29  LEU A N   1 
ATOM   227  C CA  . LEU A 1 29  ? -0.562  10.409 6.416   1.00 25.06 ? 29  LEU A CA  1 
ATOM   228  C C   . LEU A 1 29  ? 0.628   11.273 6.036   1.00 25.06 ? 29  LEU A C   1 
ATOM   229  O O   . LEU A 1 29  ? 0.523   12.066 5.114   1.00 25.06 ? 29  LEU A O   1 
ATOM   230  C CB  . LEU A 1 29  ? -0.278  8.915  6.234   1.00 25.06 ? 29  LEU A CB  1 
ATOM   231  C CG  . LEU A 1 29  ? 0.236   8.260  4.962   1.00 24.11 ? 29  LEU A CG  1 
ATOM   232  C CD1 . LEU A 1 29  ? -0.300  6.861  4.970   1.00 24.11 ? 29  LEU A CD1 1 
ATOM   233  C CD2 . LEU A 1 29  ? -0.239  8.947  3.724   1.00 24.11 ? 29  LEU A CD2 1 
ATOM   234  N N   . HIS A 1 30  ? 1.729   11.153 6.784   1.00 23.54 ? 30  HIS A N   1 
ATOM   235  C CA  . HIS A 1 30  ? 2.950   11.939 6.568   1.00 23.54 ? 30  HIS A CA  1 
ATOM   236  C C   . HIS A 1 30  ? 3.879   11.297 5.573   1.00 23.54 ? 30  HIS A C   1 
ATOM   237  O O   . HIS A 1 30  ? 4.451   10.245 5.858   1.00 23.54 ? 30  HIS A O   1 
ATOM   238  C CB  . HIS A 1 30  ? 3.709   12.127 7.879   1.00 23.54 ? 30  HIS A CB  1 
ATOM   239  C CG  . HIS A 1 30  ? 3.081   13.112 8.806   1.00 17.84 ? 30  HIS A CG  1 
ATOM   240  N ND1 . HIS A 1 30  ? 2.360   12.734 9.918   1.00 17.84 ? 30  HIS A ND1 1 
ATOM   241  C CD2 . HIS A 1 30  ? 3.048   14.466 8.776   1.00 17.84 ? 30  HIS A CD2 1 
ATOM   242  C CE1 . HIS A 1 30  ? 1.908   13.813 10.534  1.00 17.84 ? 30  HIS A CE1 1 
ATOM   243  N NE2 . HIS A 1 30  ? 2.312   14.878 9.863   1.00 17.84 ? 30  HIS A NE2 1 
ATOM   244  N N   . LEU A 1 31  ? 4.051   11.947 4.429   1.00 17.08 ? 31  LEU A N   1 
ATOM   245  C CA  . LEU A 1 31  ? 4.915   11.449 3.381   1.00 17.08 ? 31  LEU A CA  1 
ATOM   246  C C   . LEU A 1 31  ? 6.000   12.458 3.166   1.00 17.08 ? 31  LEU A C   1 
ATOM   247  O O   . LEU A 1 31  ? 5.733   13.656 3.178   1.00 17.08 ? 31  LEU A O   1 
ATOM   248  C CB  . LEU A 1 31  ? 4.129   11.295 2.086   1.00 17.08 ? 31  LEU A CB  1 
ATOM   249  C CG  . LEU A 1 31  ? 3.053   10.203 2.112   1.00 21.21 ? 31  LEU A CG  1 
ATOM   250  C CD1 . LEU A 1 31  ? 2.376   10.131 0.750   1.00 21.21 ? 31  LEU A CD1 1 
ATOM   251  C CD2 . LEU A 1 31  ? 3.683   8.857  2.471   1.00 21.21 ? 31  LEU A CD2 1 
ATOM   252  N N   . ASN A 1 32  ? 7.232   11.986 3.023   1.00 32.55 ? 32  ASN A N   1 
ATOM   253  C CA  . ASN A 1 32  ? 8.367   12.873 2.782   1.00 32.55 ? 32  ASN A CA  1 
ATOM   254  C C   . ASN A 1 32  ? 8.507   13.115 1.283   1.00 32.55 ? 32  ASN A C   1 
ATOM   255  O O   . ASN A 1 32  ? 7.847   12.451 0.487   1.00 32.55 ? 32  ASN A O   1 
ATOM   256  C CB  . ASN A 1 32  ? 9.654   12.277 3.341   1.00 32.55 ? 32  ASN A CB  1 
ATOM   257  C CG  . ASN A 1 32  ? 10.020  10.950 2.701   1.00 40.62 ? 32  ASN A CG  1 
ATOM   258  O OD1 . ASN A 1 32  ? 9.285   10.407 1.879   1.00 40.62 ? 32  ASN A OD1 1 
ATOM   259  N ND2 . ASN A 1 32  ? 11.176  10.425 3.072   1.00 40.62 ? 32  ASN A ND2 1 
ATOM   260  N N   . GLY A 1 33  ? 9.371   14.050 0.900   1.00 45.79 ? 33  GLY A N   1 
ATOM   261  C CA  . GLY A 1 33  ? 9.568   14.356 -0.505  1.00 45.79 ? 33  GLY A CA  1 
ATOM   262  C C   . GLY A 1 33  ? 9.869   13.165 -1.405  1.00 45.79 ? 33  GLY A C   1 
ATOM   263  O O   . GLY A 1 33  ? 9.667   13.254 -2.617  1.00 45.79 ? 33  GLY A O   1 
ATOM   264  N N   . GLN A 1 34  ? 10.353  12.060 -0.832  1.00 68.35 ? 34  GLN A N   1 
ATOM   265  C CA  . GLN A 1 34  ? 10.676  10.868 -1.617  1.00 68.35 ? 34  GLN A CA  1 
ATOM   266  C C   . GLN A 1 34  ? 9.414   10.059 -1.894  1.00 68.35 ? 34  GLN A C   1 
ATOM   267  O O   . GLN A 1 34  ? 9.377   9.268  -2.828  1.00 68.35 ? 34  GLN A O   1 
ATOM   268  C CB  . GLN A 1 34  ? 11.789  10.009 -0.942  1.00 68.35 ? 34  GLN A CB  1 
ATOM   269  C CG  . GLN A 1 34  ? 11.375  9.059  0.245   1.00 99.99 ? 34  GLN A CG  1 
ATOM   270  C CD  . GLN A 1 34  ? 12.565  8.353  1.011   1.00 99.99 ? 34  GLN A CD  1 
ATOM   271  O OE1 . GLN A 1 34  ? 12.341  7.589  1.975   1.00 99.99 ? 34  GLN A OE1 1 
ATOM   272  N NE2 . GLN A 1 34  ? 13.805  8.627  0.597   1.00 99.99 ? 34  GLN A NE2 1 
ATOM   273  N N   . ASN A 1 35  ? 8.359   10.333 -1.130  1.00 52.97 ? 35  ASN A N   1 
ATOM   274  C CA  . ASN A 1 35  ? 7.079   9.637  -1.272  1.00 52.97 ? 35  ASN A CA  1 
ATOM   275  C C   . ASN A 1 35  ? 5.890   10.451 -1.796  1.00 52.97 ? 35  ASN A C   1 
ATOM   276  O O   . ASN A 1 35  ? 4.782   9.925  -1.914  1.00 52.97 ? 35  ASN A O   1 
ATOM   277  C CB  . ASN A 1 35  ? 6.666   9.030  0.063   1.00 52.97 ? 35  ASN A CB  1 
ATOM   278  C CG  . ASN A 1 35  ? 7.517   7.861  0.454   1.00 70.65 ? 35  ASN A CG  1 
ATOM   279  O OD1 . ASN A 1 35  ? 8.066   7.165  -0.399  1.00 70.65 ? 35  ASN A OD1 1 
ATOM   280  N ND2 . ASN A 1 35  ? 7.638   7.628  1.758   1.00 70.65 ? 35  ASN A ND2 1 
ATOM   281  N N   . ILE A 1 36  ? 6.085   11.732 -2.079  1.00 69.01 ? 36  ILE A N   1 
ATOM   282  C CA  . ILE A 1 36  ? 4.981   12.551 -2.567  1.00 69.01 ? 36  ILE A CA  1 
ATOM   283  C C   . ILE A 1 36  ? 4.726   12.362 -4.057  1.00 69.01 ? 36  ILE A C   1 
ATOM   284  O O   . ILE A 1 36  ? 4.823   13.289 -4.850  1.00 69.01 ? 36  ILE A O   1 
ATOM   285  C CB  . ILE A 1 36  ? 5.152   14.047 -2.170  1.00 69.01 ? 36  ILE A CB  1 
ATOM   286  C CG1 . ILE A 1 36  ? 6.569   14.559 -2.470  1.00 64.41 ? 36  ILE A CG1 1 
ATOM   287  C CG2 . ILE A 1 36  ? 4.898   14.198 -0.677  1.00 64.41 ? 36  ILE A CG2 1 
ATOM   288  C CD1 . ILE A 1 36  ? 6.875   14.865 -3.917  1.00 64.41 ? 36  ILE A CD1 1 
ATOM   289  N N   . ASN A 1 37  ? 4.379   11.138 -4.421  1.00 62.31 ? 37  ASN A N   1 
ATOM   290  C CA  . ASN A 1 37  ? 4.107   10.791 -5.805  1.00 62.31 ? 37  ASN A CA  1 
ATOM   291  C C   . ASN A 1 37  ? 3.015   9.747  -5.811  1.00 62.31 ? 37  ASN A C   1 
ATOM   292  O O   . ASN A 1 37  ? 2.380   9.493  -6.828  1.00 62.31 ? 37  ASN A O   1 
ATOM   293  C CB  . ASN A 1 37  ? 5.367   10.222 -6.463  1.00 62.31 ? 37  ASN A CB  1 
ATOM   294  C CG  . ASN A 1 37  ? 5.913   8.988  -5.734  1.00 99.99 ? 37  ASN A CG  1 
ATOM   295  O OD1 . ASN A 1 37  ? 5.160   8.073  -5.381  1.00 99.99 ? 37  ASN A OD1 1 
ATOM   296  N ND2 . ASN A 1 37  ? 7.227   8.963  -5.505  1.00 99.99 ? 37  ASN A ND2 1 
ATOM   297  N N   . GLN A 1 38  ? 2.849   9.108  -4.662  1.00 43.92 ? 38  GLN A N   1 
ATOM   298  C CA  . GLN A 1 38  ? 1.841   8.078  -4.460  1.00 43.92 ? 38  GLN A CA  1 
ATOM   299  C C   . GLN A 1 38  ? 0.558   8.693  -3.901  1.00 43.92 ? 38  GLN A C   1 
ATOM   300  O O   . GLN A 1 38  ? -0.354  7.994  -3.456  1.00 43.92 ? 38  GLN A O   1 
ATOM   301  C CB  . GLN A 1 38  ? 2.382   7.014  -3.502  1.00 43.92 ? 38  GLN A CB  1 
ATOM   302  C CG  . GLN A 1 38  ? 2.882   7.545  -2.172  1.00 54.18 ? 38  GLN A CG  1 
ATOM   303  C CD  . GLN A 1 38  ? 3.577   6.483  -1.347  1.00 54.18 ? 38  GLN A CD  1 
ATOM   304  O OE1 . GLN A 1 38  ? 4.731   6.125  -1.611  1.00 54.18 ? 38  GLN A OE1 1 
ATOM   305  N NE2 . GLN A 1 38  ? 2.882   5.971  -0.336  1.00 54.18 ? 38  GLN A NE2 1 
ATOM   306  N N   . GLN A 1 39  ? 0.516   10.014 -3.859  1.00 21.54 ? 39  GLN A N   1 
ATOM   307  C CA  . GLN A 1 39  ? -0.665  10.673 -3.368  1.00 21.54 ? 39  GLN A CA  1 
ATOM   308  C C   . GLN A 1 39  ? -1.600  11.008 -4.530  1.00 21.54 ? 39  GLN A C   1 
ATOM   309  O O   . GLN A 1 39  ? -1.169  11.146 -5.676  1.00 21.54 ? 39  GLN A O   1 
ATOM   310  C CB  . GLN A 1 39  ? -0.304  11.892 -2.512  1.00 21.54 ? 39  GLN A CB  1 
ATOM   311  C CG  . GLN A 1 39  ? 0.548   12.925 -3.170  1.00 29.69 ? 39  GLN A CG  1 
ATOM   312  C CD  . GLN A 1 39  ? 1.233   13.816 -2.148  1.00 29.69 ? 39  GLN A CD  1 
ATOM   313  O OE1 . GLN A 1 39  ? 1.047   15.033 -2.137  1.00 29.69 ? 39  GLN A OE1 1 
ATOM   314  N NE2 . GLN A 1 39  ? 2.048   13.208 -1.285  1.00 29.69 ? 39  GLN A NE2 1 
ATOM   315  N N   . VAL A 1 40  ? -2.887  11.056 -4.204  1.00 16.96 ? 40  VAL A N   1 
ATOM   316  C CA  . VAL A 1 40  ? -3.978  11.327 -5.123  1.00 16.96 ? 40  VAL A CA  1 
ATOM   317  C C   . VAL A 1 40  ? -3.933  12.732 -5.733  1.00 16.96 ? 40  VAL A C   1 
ATOM   318  O O   . VAL A 1 40  ? -3.670  13.704 -5.026  1.00 16.96 ? 40  VAL A O   1 
ATOM   319  C CB  . VAL A 1 40  ? -5.329  11.201 -4.373  1.00 16.96 ? 40  VAL A CB  1 
ATOM   320  C CG1 . VAL A 1 40  ? -6.470  11.083 -5.350  1.00 27.96 ? 40  VAL A CG1 1 
ATOM   321  C CG2 . VAL A 1 40  ? -5.322  10.022 -3.448  1.00 27.96 ? 40  VAL A CG2 1 
ATOM   322  N N   . ILE A 1 41  ? -4.175  12.828 -7.043  1.00 22.69 ? 41  ILE A N   1 
ATOM   323  C CA  . ILE A 1 41  ? -4.248  14.118 -7.735  1.00 22.69 ? 41  ILE A CA  1 
ATOM   324  C C   . ILE A 1 41  ? -5.747  14.276 -7.993  1.00 22.69 ? 41  ILE A C   1 
ATOM   325  O O   . ILE A 1 41  ? -6.377  13.393 -8.573  1.00 22.69 ? 41  ILE A O   1 
ATOM   326  C CB  . ILE A 1 41  ? -3.474  14.141 -9.080  1.00 22.69 ? 41  ILE A CB  1 
ATOM   327  C CG1 . ILE A 1 41  ? -1.966  14.231 -8.820  1.00 13.92 ? 41  ILE A CG1 1 
ATOM   328  C CG2 . ILE A 1 41  ? -3.893  15.335 -9.907  1.00 13.92 ? 41  ILE A CG2 1 
ATOM   329  C CD1 . ILE A 1 41  ? -1.121  13.351 -9.731  1.00 13.92 ? 41  ILE A CD1 1 
ATOM   330  N N   . PHE A 1 42  ? -6.336  15.327 -7.442  1.00 15.72 ? 42  PHE A N   1 
ATOM   331  C CA  . PHE A 1 42  ? -7.752  15.573 -7.591  1.00 15.72 ? 42  PHE A CA  1 
ATOM   332  C C   . PHE A 1 42  ? -7.956  16.361 -8.863  1.00 15.72 ? 42  PHE A C   1 
ATOM   333  O O   . PHE A 1 42  ? -6.996  16.884 -9.419  1.00 15.72 ? 42  PHE A O   1 
ATOM   334  C CB  . PHE A 1 42  ? -8.238  16.374 -6.395  1.00 15.72 ? 42  PHE A CB  1 
ATOM   335  C CG  . PHE A 1 42  ? -8.231  15.599 -5.120  1.00 13.80 ? 42  PHE A CG  1 
ATOM   336  C CD1 . PHE A 1 42  ? -9.304  14.763 -4.794  1.00 13.80 ? 42  PHE A CD1 1 
ATOM   337  C CD2 . PHE A 1 42  ? -7.141  15.647 -4.272  1.00 13.80 ? 42  PHE A CD2 1 
ATOM   338  C CE1 . PHE A 1 42  ? -9.282  13.978 -3.640  1.00 13.80 ? 42  PHE A CE1 1 
ATOM   339  C CE2 . PHE A 1 42  ? -7.109  14.868 -3.120  1.00 13.80 ? 42  PHE A CE2 1 
ATOM   340  C CZ  . PHE A 1 42  ? -8.179  14.031 -2.804  1.00 13.80 ? 42  PHE A CZ  1 
ATOM   341  N N   . SER A 1 43  ? -9.189  16.413 -9.349  1.00 12.65 ? 43  SER A N   1 
ATOM   342  C CA  . SER A 1 43  ? -9.514  17.162 -10.538 1.00 12.65 ? 43  SER A CA  1 
ATOM   343  C C   . SER A 1 43  ? -10.666 18.018 -10.098 1.00 12.65 ? 43  SER A C   1 
ATOM   344  O O   . SER A 1 43  ? -11.739 17.515 -9.778  1.00 12.65 ? 43  SER A O   1 
ATOM   345  C CB  . SER A 1 43  ? -9.990  16.252 -11.660 1.00 12.65 ? 43  SER A CB  1 
ATOM   346  O OG  . SER A 1 43  ? -9.005  15.302 -12.040 1.00 34.40 ? 43  SER A OG  1 
ATOM   347  N N   . MET A 1 44  ? -10.435 19.318 -10.064 1.00 17.63 ? 44  MET A N   1 
ATOM   348  C CA  . MET A 1 44  ? -11.443 20.267 -9.664  1.00 17.63 ? 44  MET A CA  1 
ATOM   349  C C   . MET A 1 44  ? -12.046 20.941 -10.885 1.00 17.63 ? 44  MET A C   1 
ATOM   350  O O   . MET A 1 44  ? -11.326 21.317 -11.805 1.00 17.63 ? 44  MET A O   1 
ATOM   351  C CB  . MET A 1 44  ? -10.798 21.303 -8.759  1.00 17.63 ? 44  MET A CB  1 
ATOM   352  C CG  . MET A 1 44  ? -11.658 22.471 -8.435  1.00 26.86 ? 44  MET A CG  1 
ATOM   353  S SD  . MET A 1 44  ? -10.749 23.595 -7.395  1.00 26.86 ? 44  MET A SD  1 
ATOM   354  C CE  . MET A 1 44  ? -10.672 22.619 -5.893  1.00 26.86 ? 44  MET A CE  1 
ATOM   355  N N   . SER A 1 45  ? -13.370 21.059 -10.899 1.00 11.28 ? 45  SER A N   1 
ATOM   356  C CA  . SER A 1 45  ? -14.086 21.717 -11.977 1.00 11.28 ? 45  SER A CA  1 
ATOM   357  C C   . SER A 1 45  ? -15.186 22.499 -11.313 1.00 11.28 ? 45  SER A C   1 
ATOM   358  O O   . SER A 1 45  ? -15.601 22.151 -10.219 1.00 11.28 ? 45  SER A O   1 
ATOM   359  C CB  . SER A 1 45  ? -14.682 20.702 -12.942 1.00 11.28 ? 45  SER A CB  1 
ATOM   360  O OG  . SER A 1 45  ? -15.543 19.796 -12.278 1.00 20.04 ? 45  SER A OG  1 
ATOM   361  N N   . PHE A 1 46  ? -15.588 23.589 -11.954 1.00 17.53 ? 46  PHE A N   1 
ATOM   362  C CA  . PHE A 1 46  ? -16.632 24.503 -11.508 1.00 17.53 ? 46  PHE A CA  1 
ATOM   363  C C   . PHE A 1 46  ? -18.011 23.881 -11.736 1.00 17.53 ? 46  PHE A C   1 
ATOM   364  O O   . PHE A 1 46  ? -18.199 23.146 -12.697 1.00 17.53 ? 46  PHE A O   1 
ATOM   365  C CB  . PHE A 1 46  ? -16.493 25.778 -12.350 1.00 17.53 ? 46  PHE A CB  1 
ATOM   366  C CG  . PHE A 1 46  ? -17.478 26.859 -12.018 1.00 26.20 ? 46  PHE A CG  1 
ATOM   367  C CD1 . PHE A 1 46  ? -17.172 27.827 -11.044 1.00 26.20 ? 46  PHE A CD1 1 
ATOM   368  C CD2 . PHE A 1 46  ? -18.701 26.940 -12.691 1.00 26.20 ? 46  PHE A CD2 1 
ATOM   369  C CE1 . PHE A 1 46  ? -18.073 28.864 -10.743 1.00 26.20 ? 46  PHE A CE1 1 
ATOM   370  C CE2 . PHE A 1 46  ? -19.599 27.962 -12.405 1.00 26.20 ? 46  PHE A CE2 1 
ATOM   371  C CZ  . PHE A 1 46  ? -19.282 28.928 -11.426 1.00 26.20 ? 46  PHE A CZ  1 
ATOM   372  N N   . VAL A 1 47  ? -18.979 24.174 -10.873 1.00 14.68 ? 47  VAL A N   1 
ATOM   373  C CA  . VAL A 1 47  ? -20.321 23.637 -11.053 1.00 14.68 ? 47  VAL A CA  1 
ATOM   374  C C   . VAL A 1 47  ? -21.335 24.775 -11.169 1.00 14.68 ? 47  VAL A C   1 
ATOM   375  O O   . VAL A 1 47  ? -21.398 25.647 -10.313 1.00 14.68 ? 47  VAL A O   1 
ATOM   376  C CB  . VAL A 1 47  ? -20.716 22.642 -9.932  1.00 14.68 ? 47  VAL A CB  1 
ATOM   377  C CG1 . VAL A 1 47  ? -19.722 21.511 -9.869  1.00 18.32 ? 47  VAL A CG1 1 
ATOM   378  C CG2 . VAL A 1 47  ? -20.790 23.327 -8.614  1.00 18.32 ? 47  VAL A CG2 1 
ATOM   379  N N   . GLN A 1 48  ? -22.123 24.756 -12.236 1.00 56.77 ? 48  GLN A N   1 
ATOM   380  C CA  . GLN A 1 48  ? -23.101 25.798 -12.504 1.00 56.77 ? 48  GLN A CA  1 
ATOM   381  C C   . GLN A 1 48  ? -24.289 25.945 -11.573 1.00 56.77 ? 48  GLN A C   1 
ATOM   382  O O   . GLN A 1 48  ? -25.062 26.894 -11.717 1.00 56.77 ? 48  GLN A O   1 
ATOM   383  C CB  . GLN A 1 48  ? -23.580 25.722 -13.954 1.00 56.77 ? 48  GLN A CB  1 
ATOM   384  C CG  . GLN A 1 48  ? -22.479 26.000 -14.979 1.00 63.72 ? 48  GLN A CG  1 
ATOM   385  C CD  . GLN A 1 48  ? -22.985 25.991 -16.412 1.00 63.72 ? 48  GLN A CD  1 
ATOM   386  O OE1 . GLN A 1 48  ? -23.950 25.303 -16.737 1.00 63.72 ? 48  GLN A OE1 1 
ATOM   387  N NE2 . GLN A 1 48  ? -22.327 26.745 -17.277 1.00 63.72 ? 48  GLN A NE2 1 
ATOM   388  N N   . GLY A 1 49  ? -24.482 24.998 -10.662 1.00 99.99 ? 49  GLY A N   1 
ATOM   389  C CA  . GLY A 1 49  ? -25.583 25.110 -9.713  1.00 99.99 ? 49  GLY A CA  1 
ATOM   390  C C   . GLY A 1 49  ? -24.944 25.766 -8.514  1.00 99.99 ? 49  GLY A C   1 
ATOM   391  O O   . GLY A 1 49  ? -24.726 25.137 -7.471  1.00 99.99 ? 49  GLY A O   1 
ATOM   392  N N   . GLU A 1 50  ? -24.699 27.061 -8.664  1.00 99.99 ? 50  GLU A N   1 
ATOM   393  C CA  . GLU A 1 50  ? -23.987 27.843 -7.669  1.00 99.99 ? 50  GLU A CA  1 
ATOM   394  C C   . GLU A 1 50  ? -24.668 28.964 -6.905  1.00 99.99 ? 50  GLU A C   1 
ATOM   395  O O   . GLU A 1 50  ? -25.462 29.724 -7.448  1.00 99.99 ? 50  GLU A O   1 
ATOM   396  C CB  . GLU A 1 50  ? -22.791 28.470 -8.362  1.00 99.99 ? 50  GLU A CB  1 
ATOM   397  C CG  . GLU A 1 50  ? -23.233 29.461 -9.406  1.00 99.99 ? 50  GLU A CG  1 
ATOM   398  C CD  . GLU A 1 50  ? -22.119 29.910 -10.277 1.00 99.99 ? 50  GLU A CD  1 
ATOM   399  O OE1 . GLU A 1 50  ? -21.225 30.611 -9.762  1.00 99.99 ? 50  GLU A OE1 1 
ATOM   400  O OE2 . GLU A 1 50  ? -22.143 29.558 -11.476 1.00 99.99 ? 50  GLU A OE2 1 
ATOM   401  N N   . PRO A 1 51  ? -24.348 29.078 -5.615  1.00 99.99 ? 51  PRO A N   1 
ATOM   402  C CA  . PRO A 1 51  ? -24.915 30.134 -4.783  1.00 99.99 ? 51  PRO A CA  1 
ATOM   403  C C   . PRO A 1 51  ? -23.898 31.274 -4.863  1.00 99.99 ? 51  PRO A C   1 
ATOM   404  O O   . PRO A 1 51  ? -24.225 32.437 -4.618  1.00 99.99 ? 51  PRO A O   1 
ATOM   405  C CB  . PRO A 1 51  ? -24.891 29.517 -3.379  1.00 99.99 ? 51  PRO A CB  1 
ATOM   406  C CG  . PRO A 1 51  ? -24.768 28.026 -3.618  1.00 99.99 ? 51  PRO A CG  1 
ATOM   407  C CD  . PRO A 1 51  ? -23.821 27.991 -4.773  1.00 99.99 ? 51  PRO A CD  1 
ATOM   408  N N   . SER A 1 52  ? -22.665 30.912 -5.230  1.00 99.99 ? 52  SER A N   1 
ATOM   409  C CA  . SER A 1 52  ? -21.537 31.835 -5.325  1.00 99.99 ? 52  SER A CA  1 
ATOM   410  C C   . SER A 1 52  ? -21.271 32.330 -3.899  1.00 99.99 ? 52  SER A C   1 
ATOM   411  O O   . SER A 1 52  ? -20.446 31.749 -3.193  1.00 99.99 ? 52  SER A O   1 
ATOM   412  C CB  . SER A 1 52  ? -21.837 32.975 -6.302  1.00 99.99 ? 52  SER A CB  1 
ATOM   413  O OG  . SER A 1 52  ? -22.168 32.453 -7.579  1.00 87.86 ? 52  SER A OG  1 
ATOM   414  N N   . ASN A 1 53  ? -22.031 33.322 -3.440  1.00 88.76 ? 53  ASN A N   1 
ATOM   415  C CA  . ASN A 1 53  ? -21.887 33.847 -2.083  1.00 88.76 ? 53  ASN A CA  1 
ATOM   416  C C   . ASN A 1 53  ? -20.539 34.549 -1.880  1.00 88.76 ? 53  ASN A C   1 
ATOM   417  O O   . ASN A 1 53  ? -20.471 35.776 -1.865  1.00 88.76 ? 53  ASN A O   1 
ATOM   418  C CB  . ASN A 1 53  ? -22.075 32.703 -1.069  1.00 88.76 ? 53  ASN A CB  1 
ATOM   419  C CG  . ASN A 1 53  ? -22.362 33.194 0.341   1.00 99.99 ? 53  ASN A CG  1 
ATOM   420  O OD1 . ASN A 1 53  ? -22.199 34.374 0.652   1.00 99.99 ? 53  ASN A OD1 1 
ATOM   421  N ND2 . ASN A 1 53  ? -22.790 32.280 1.207   1.00 99.99 ? 53  ASN A ND2 1 
ATOM   422  N N   . ASP A 1 54  ? -19.474 33.767 -1.750  1.00 97.56 ? 54  ASP A N   1 
ATOM   423  C CA  . ASP A 1 54  ? -18.111 34.278 -1.553  1.00 97.56 ? 54  ASP A CA  1 
ATOM   424  C C   . ASP A 1 54  ? -17.149 33.089 -1.617  1.00 97.56 ? 54  ASP A C   1 
ATOM   425  O O   . ASP A 1 54  ? -15.950 33.208 -1.353  1.00 97.56 ? 54  ASP A O   1 
ATOM   426  C CB  . ASP A 1 54  ? -17.992 34.956 -0.181  1.00 97.56 ? 54  ASP A CB  1 
ATOM   427  C CG  . ASP A 1 54  ? -18.313 34.005 0.980   1.00 99.99 ? 54  ASP A CG  1 
ATOM   428  O OD1 . ASP A 1 54  ? -17.394 33.292 1.448   1.00 99.99 ? 54  ASP A OD1 1 
ATOM   429  O OD2 . ASP A 1 54  ? -19.483 33.971 1.427   1.00 99.99 ? 54  ASP A OD2 1 
ATOM   430  N N   . LYS A 1 55  ? -17.714 31.940 -1.959  1.00 29.04 ? 55  LYS A N   1 
ATOM   431  C CA  . LYS A 1 55  ? -17.013 30.685 -2.051  1.00 29.04 ? 55  LYS A CA  1 
ATOM   432  C C   . LYS A 1 55  ? -17.284 30.207 -3.458  1.00 29.04 ? 55  LYS A C   1 
ATOM   433  O O   . LYS A 1 55  ? -18.285 30.573 -4.060  1.00 29.04 ? 55  LYS A O   1 
ATOM   434  C CB  . LYS A 1 55  ? -17.633 29.701 -1.070  1.00 29.04 ? 55  LYS A CB  1 
ATOM   435  C CG  . LYS A 1 55  ? -18.329 30.341 0.122   1.00 36.73 ? 55  LYS A CG  1 
ATOM   436  C CD  . LYS A 1 55  ? -18.616 29.323 1.211   1.00 36.73 ? 55  LYS A CD  1 
ATOM   437  C CE  . LYS A 1 55  ? -19.692 29.788 2.175   1.00 36.73 ? 55  LYS A CE  1 
ATOM   438  N NZ  . LYS A 1 55  ? -21.053 29.826 1.516   1.00 36.73 ? 55  LYS A NZ  1 
ATOM   439  N N   . ILE A 1 56  ? -16.422 29.358 -3.982  1.00 15.98 ? 56  ILE A N   1 
ATOM   440  C CA  . ILE A 1 56  ? -16.606 28.862 -5.335  1.00 15.98 ? 56  ILE A CA  1 
ATOM   441  C C   . ILE A 1 56  ? -17.069 27.410 -5.260  1.00 15.98 ? 56  ILE A C   1 
ATOM   442  O O   . ILE A 1 56  ? -16.483 26.610 -4.522  1.00 15.98 ? 56  ILE A O   1 
ATOM   443  C CB  . ILE A 1 56  ? -15.282 28.993 -6.086  1.00 15.98 ? 56  ILE A CB  1 
ATOM   444  C CG1 . ILE A 1 56  ? -14.912 30.460 -6.125  1.00 13.72 ? 56  ILE A CG1 1 
ATOM   445  C CG2 . ILE A 1 56  ? -15.373 28.460 -7.501  1.00 13.72 ? 56  ILE A CG2 1 
ATOM   446  C CD1 . ILE A 1 56  ? -13.526 30.694 -6.581  1.00 13.72 ? 56  ILE A CD1 1 
ATOM   447  N N   . PRO A 1 57  ? -18.212 27.080 -5.896  1.00 43.05 ? 57  PRO A N   1 
ATOM   448  C CA  . PRO A 1 57  ? -18.719 25.697 -5.873  1.00 43.05 ? 57  PRO A CA  1 
ATOM   449  C C   . PRO A 1 57  ? -17.869 24.876 -6.829  1.00 43.05 ? 57  PRO A C   1 
ATOM   450  O O   . PRO A 1 57  ? -17.672 25.293 -7.968  1.00 43.05 ? 57  PRO A O   1 
ATOM   451  C CB  . PRO A 1 57  ? -20.143 25.841 -6.420  1.00 43.05 ? 57  PRO A CB  1 
ATOM   452  C CG  . PRO A 1 57  ? -20.479 27.237 -6.139  1.00 40.04 ? 57  PRO A CG  1 
ATOM   453  C CD  . PRO A 1 57  ? -19.217 27.976 -6.479  1.00 40.04 ? 57  PRO A CD  1 
ATOM   454  N N   . VAL A 1 58  ? -17.373 23.724 -6.387  1.00 14.86 ? 58  VAL A N   1 
ATOM   455  C CA  . VAL A 1 58  ? -16.531 22.874 -7.235  1.00 14.86 ? 58  VAL A CA  1 
ATOM   456  C C   . VAL A 1 58  ? -16.849 21.404 -7.016  1.00 14.86 ? 58  VAL A C   1 
ATOM   457  O O   . VAL A 1 58  ? -17.508 21.053 -6.043  1.00 14.86 ? 58  VAL A O   1 
ATOM   458  C CB  . VAL A 1 58  ? -15.038 23.085 -6.946  1.00 14.86 ? 58  VAL A CB  1 
ATOM   459  C CG1 . VAL A 1 58  ? -14.611 24.456 -7.389  1.00 2.00  ? 58  VAL A CG1 1 
ATOM   460  C CG2 . VAL A 1 58  ? -14.765 22.890 -5.456  1.00 2.00  ? 58  VAL A CG2 1 
ATOM   461  N N   . ALA A 1 59  ? -16.459 20.558 -7.955  1.00 10.66 ? 59  ALA A N   1 
ATOM   462  C CA  . ALA A 1 59  ? -16.682 19.139 -7.810  1.00 10.66 ? 59  ALA A CA  1 
ATOM   463  C C   . ALA A 1 59  ? -15.261 18.579 -7.758  1.00 10.66 ? 59  ALA A C   1 
ATOM   464  O O   . ALA A 1 59  ? -14.353 19.106 -8.414  1.00 10.66 ? 59  ALA A O   1 
ATOM   465  C CB  . ALA A 1 59  ? -17.432 18.600 -8.983  1.00 10.66 ? 59  ALA A CB  1 
ATOM   466  N N   . LEU A 1 60  ? -15.055 17.541 -6.955  1.00 20.57 ? 60  LEU A N   1 
ATOM   467  C CA  . LEU A 1 60  ? -13.741 16.945 -6.811  1.00 20.57 ? 60  LEU A CA  1 
ATOM   468  C C   . LEU A 1 60  ? -13.688 15.464 -7.199  1.00 20.57 ? 60  LEU A C   1 
ATOM   469  O O   . LEU A 1 60  ? -14.154 14.603 -6.451  1.00 20.57 ? 60  LEU A O   1 
ATOM   470  C CB  . LEU A 1 60  ? -13.244 17.125 -5.370  1.00 20.57 ? 60  LEU A CB  1 
ATOM   471  C CG  . LEU A 1 60  ? -12.954 18.542 -4.886  1.00 10.87 ? 60  LEU A CG  1 
ATOM   472  C CD1 . LEU A 1 60  ? -12.532 18.505 -3.449  1.00 10.87 ? 60  LEU A CD1 1 
ATOM   473  C CD2 . LEU A 1 60  ? -11.868 19.144 -5.736  1.00 10.87 ? 60  LEU A CD2 1 
ATOM   474  N N   . GLY A 1 61  ? -13.120 15.165 -8.363  1.00 18.19 ? 61  GLY A N   1 
ATOM   475  C CA  . GLY A 1 61  ? -12.988 13.780 -8.780  1.00 18.19 ? 61  GLY A CA  1 
ATOM   476  C C   . GLY A 1 61  ? -11.521 13.411 -8.702  1.00 18.19 ? 61  GLY A C   1 
ATOM   477  O O   . GLY A 1 61  ? -10.694 14.268 -8.400  1.00 18.19 ? 61  GLY A O   1 
ATOM   478  N N   . LEU A 1 62  ? -11.184 12.145 -8.895  1.00 23.26 ? 62  LEU A N   1 
ATOM   479  C CA  . LEU A 1 62  ? -9.785  11.747 -8.856  1.00 23.26 ? 62  LEU A CA  1 
ATOM   480  C C   . LEU A 1 62  ? -9.295  11.794 -10.287 1.00 23.26 ? 62  LEU A C   1 
ATOM   481  O O   . LEU A 1 62  ? -10.057 11.500 -11.200 1.00 23.26 ? 62  LEU A O   1 
ATOM   482  C CB  . LEU A 1 62  ? -9.651  10.358 -8.258  1.00 23.26 ? 62  LEU A CB  1 
ATOM   483  C CG  . LEU A 1 62  ? -9.532  10.346 -6.734  1.00 25.97 ? 62  LEU A CG  1 
ATOM   484  C CD1 . LEU A 1 62  ? -10.160 11.580 -6.092  1.00 25.97 ? 62  LEU A CD1 1 
ATOM   485  C CD2 . LEU A 1 62  ? -10.152 9.082  -6.203  1.00 25.97 ? 62  LEU A CD2 1 
ATOM   486  N N   . LYS A 1 63  ? -8.050  12.178 -10.509 1.00 17.77 ? 63  LYS A N   1 
ATOM   487  C CA  . LYS A 1 63  ? -7.572  12.284 -11.870 1.00 17.77 ? 63  LYS A CA  1 
ATOM   488  C C   . LYS A 1 63  ? -7.450  10.960 -12.595 1.00 17.77 ? 63  LYS A C   1 
ATOM   489  O O   . LYS A 1 63  ? -6.836  10.021 -12.105 1.00 17.77 ? 63  LYS A O   1 
ATOM   490  C CB  . LYS A 1 63  ? -6.255  13.025 -11.922 1.00 17.77 ? 63  LYS A CB  1 
ATOM   491  C CG  . LYS A 1 63  ? -5.687  13.138 -13.314 1.00 38.52 ? 63  LYS A CG  1 
ATOM   492  C CD  . LYS A 1 63  ? -4.230  13.516 -13.250 1.00 38.52 ? 63  LYS A CD  1 
ATOM   493  C CE  . LYS A 1 63  ? -3.486  13.100 -14.506 1.00 38.52 ? 63  LYS A CE  1 
ATOM   494  N NZ  . LYS A 1 63  ? -1.998  12.953 -14.246 1.00 38.52 ? 63  LYS A NZ  1 
ATOM   495  N N   . GLY A 1 64  ? -8.046  10.897 -13.777 1.00 22.22 ? 64  GLY A N   1 
ATOM   496  C CA  . GLY A 1 64  ? -7.994  9.691  -14.581 1.00 22.22 ? 64  GLY A CA  1 
ATOM   497  C C   . GLY A 1 64  ? -9.075  8.666  -14.297 1.00 22.22 ? 64  GLY A C   1 
ATOM   498  O O   . GLY A 1 64  ? -9.303  7.767  -15.114 1.00 22.22 ? 64  GLY A O   1 
ATOM   499  N N   . LYS A 1 65  ? -9.774  8.837  -13.174 1.00 17.66 ? 65  LYS A N   1 
ATOM   500  C CA  . LYS A 1 65  ? -10.821 7.919  -12.757 1.00 17.66 ? 65  LYS A CA  1 
ATOM   501  C C   . LYS A 1 65  ? -12.179 8.555  -12.715 1.00 17.66 ? 65  LYS A C   1 
ATOM   502  O O   . LYS A 1 65  ? -12.315 9.762  -12.549 1.00 17.66 ? 65  LYS A O   1 
ATOM   503  C CB  . LYS A 1 65  ? -10.526 7.399  -11.369 1.00 17.66 ? 65  LYS A CB  1 
ATOM   504  C CG  . LYS A 1 65  ? -9.261  6.653  -11.306 1.00 23.00 ? 65  LYS A CG  1 
ATOM   505  C CD  . LYS A 1 65  ? -8.904  6.367  -9.888  1.00 23.00 ? 65  LYS A CD  1 
ATOM   506  C CE  . LYS A 1 65  ? -7.553  5.732  -9.869  1.00 23.00 ? 65  LYS A CE  1 
ATOM   507  N NZ  . LYS A 1 65  ? -7.581  4.619  -10.864 1.00 23.00 ? 65  LYS A NZ  1 
ATOM   508  N N   . ASN A 1 66  ? -13.188 7.708  -12.839 1.00 22.66 ? 66  ASN A N   1 
ATOM   509  C CA  . ASN A 1 66  ? -14.572 8.123  -12.795 1.00 22.66 ? 66  ASN A CA  1 
ATOM   510  C C   . ASN A 1 66  ? -15.055 7.983  -11.357 1.00 22.66 ? 66  ASN A C   1 
ATOM   511  O O   . ASN A 1 66  ? -16.070 7.342  -11.090 1.00 22.66 ? 66  ASN A O   1 
ATOM   512  C CB  . ASN A 1 66  ? -15.425 7.275  -13.765 1.00 22.66 ? 66  ASN A CB  1 
ATOM   513  C CG  . ASN A 1 66  ? -15.205 5.763  -13.612 1.00 27.87 ? 66  ASN A CG  1 
ATOM   514  O OD1 . ASN A 1 66  ? -14.073 5.293  -13.515 1.00 27.87 ? 66  ASN A OD1 1 
ATOM   515  N ND2 . ASN A 1 66  ? -16.286 5.003  -13.619 1.00 27.87 ? 66  ASN A ND2 1 
ATOM   516  N N   . LEU A 1 67  ? -14.293 8.555  -10.427 1.00 18.66 ? 67  LEU A N   1 
ATOM   517  C CA  . LEU A 1 67  ? -14.631 8.514  -9.005  1.00 18.66 ? 67  LEU A CA  1 
ATOM   518  C C   . LEU A 1 67  ? -14.696 9.962  -8.527  1.00 18.66 ? 67  LEU A C   1 
ATOM   519  O O   . LEU A 1 67  ? -13.817 10.767 -8.855  1.00 18.66 ? 67  LEU A O   1 
ATOM   520  C CB  . LEU A 1 67  ? -13.565 7.745  -8.210  1.00 18.66 ? 67  LEU A CB  1 
ATOM   521  C CG  . LEU A 1 67  ? -13.411 6.213  -8.346  1.00 7.37  ? 67  LEU A CG  1 
ATOM   522  C CD1 . LEU A 1 67  ? -12.107 5.776  -7.705  1.00 7.37  ? 67  LEU A CD1 1 
ATOM   523  C CD2 . LEU A 1 67  ? -14.573 5.483  -7.702  1.00 7.37  ? 67  LEU A CD2 1 
ATOM   524  N N   . TYR A 1 68  ? -15.760 10.301 -7.800  1.00 12.62 ? 68  TYR A N   1 
ATOM   525  C CA  . TYR A 1 68  ? -15.973 11.651 -7.286  1.00 12.62 ? 68  TYR A CA  1 
ATOM   526  C C   . TYR A 1 68  ? -16.287 11.587 -5.804  1.00 12.62 ? 68  TYR A C   1 
ATOM   527  O O   . TYR A 1 68  ? -16.782 10.580 -5.323  1.00 12.62 ? 68  TYR A O   1 
ATOM   528  C CB  . TYR A 1 68  ? -17.155 12.297 -8.003  1.00 12.62 ? 68  TYR A CB  1 
ATOM   529  C CG  . TYR A 1 68  ? -16.792 12.873 -9.337  1.00 15.20 ? 68  TYR A CG  1 
ATOM   530  C CD1 . TYR A 1 68  ? -16.741 12.076 -10.485 1.00 15.20 ? 68  TYR A CD1 1 
ATOM   531  C CD2 . TYR A 1 68  ? -16.422 14.205 -9.446  1.00 15.20 ? 68  TYR A CD2 1 
ATOM   532  C CE1 . TYR A 1 68  ? -16.319 12.598 -11.704 1.00 15.20 ? 68  TYR A CE1 1 
ATOM   533  C CE2 . TYR A 1 68  ? -15.995 14.736 -10.652 1.00 15.20 ? 68  TYR A CE2 1 
ATOM   534  C CZ  . TYR A 1 68  ? -15.939 13.935 -11.774 1.00 15.20 ? 68  TYR A CZ  1 
ATOM   535  O OH  . TYR A 1 68  ? -15.449 14.482 -12.943 1.00 15.20 ? 68  TYR A OH  1 
ATOM   536  N N   . LEU A 1 69  ? -15.950 12.640 -5.075  1.00 14.39 ? 69  LEU A N   1 
ATOM   537  C CA  . LEU A 1 69  ? -16.240 12.709 -3.660  1.00 14.39 ? 69  LEU A CA  1 
ATOM   538  C C   . LEU A 1 69  ? -17.651 13.249 -3.588  1.00 14.39 ? 69  LEU A C   1 
ATOM   539  O O   . LEU A 1 69  ? -17.940 14.264 -4.230  1.00 14.39 ? 69  LEU A O   1 
ATOM   540  C CB  . LEU A 1 69  ? -15.336 13.720 -2.985  1.00 14.39 ? 69  LEU A CB  1 
ATOM   541  C CG  . LEU A 1 69  ? -13.943 13.337 -2.561  1.00 13.98 ? 69  LEU A CG  1 
ATOM   542  C CD1 . LEU A 1 69  ? -13.079 13.037 -3.753  1.00 13.98 ? 69  LEU A CD1 1 
ATOM   543  C CD2 . LEU A 1 69  ? -13.396 14.519 -1.831  1.00 13.98 ? 69  LEU A CD2 1 
ATOM   544  N N   . SER A 1 70  ? -18.516 12.623 -2.795  1.00 9.31  ? 70  SER A N   1 
ATOM   545  C CA  . SER A 1 70  ? -19.892 13.082 -2.668  1.00 9.31  ? 70  SER A CA  1 
ATOM   546  C C   . SER A 1 70  ? -20.283 12.942 -1.206  1.00 9.31  ? 70  SER A C   1 
ATOM   547  O O   . SER A 1 70  ? -19.674 12.170 -0.481  1.00 9.31  ? 70  SER A O   1 
ATOM   548  C CB  . SER A 1 70  ? -20.803 12.227 -3.528  1.00 9.31  ? 70  SER A CB  1 
ATOM   549  O OG  . SER A 1 70  ? -20.879 10.924 -2.985  1.00 12.83 ? 70  SER A OG  1 
ATOM   550  N N   . CYS A 1 71  ? -21.293 13.676 -0.765  1.00 19.42 ? 71  CYS A N   1 
ATOM   551  C CA  . CYS A 1 71  ? -21.724 13.615 0.624   1.00 19.42 ? 71  CYS A CA  1 
ATOM   552  C C   . CYS A 1 71  ? -23.132 13.073 0.719   1.00 19.42 ? 71  CYS A C   1 
ATOM   553  O O   . CYS A 1 71  ? -24.037 13.529 0.010   1.00 19.42 ? 71  CYS A O   1 
ATOM   554  C CB  . CYS A 1 71  ? -21.676 15.005 1.233   1.00 19.42 ? 71  CYS A CB  1 
ATOM   555  S SG  . CYS A 1 71  ? -20.162 15.842 0.855   1.00 16.82 ? 71  CYS A SG  1 
ATOM   556  N N   . VAL A 1 72  ? -23.317 12.098 1.599   1.00 19.61 ? 72  VAL A N   1 
ATOM   557  C CA  . VAL A 1 72  ? -24.622 11.477 1.775   1.00 19.61 ? 72  VAL A CA  1 
ATOM   558  C C   . VAL A 1 72  ? -24.913 11.299 3.240   1.00 19.61 ? 72  VAL A C   1 
ATOM   559  O O   . VAL A 1 72  ? -23.989 11.181 4.059   1.00 19.61 ? 72  VAL A O   1 
ATOM   560  C CB  . VAL A 1 72  ? -24.692 10.101 1.111   1.00 19.61 ? 72  VAL A CB  1 
ATOM   561  C CG1 . VAL A 1 72  ? -24.376 10.221 -0.333  1.00 3.62  ? 72  VAL A CG1 1 
ATOM   562  C CG2 . VAL A 1 72  ? -23.733 9.174  1.743   1.00 3.62  ? 72  VAL A CG2 1 
ATOM   563  N N   . MET A 1 73  ? -26.202 11.342 3.562   1.00 26.55 ? 73  MET A N   1 
ATOM   564  C CA  . MET A 1 73  ? -26.712 11.156 4.912   1.00 26.55 ? 73  MET A CA  1 
ATOM   565  C C   . MET A 1 73  ? -26.708 9.634  5.093   1.00 26.55 ? 73  MET A C   1 
ATOM   566  O O   . MET A 1 73  ? -27.523 8.936  4.495   1.00 26.55 ? 73  MET A O   1 
ATOM   567  C CB  . MET A 1 73  ? -28.147 11.693 4.963   1.00 26.55 ? 73  MET A CB  1 
ATOM   568  C CG  . MET A 1 73  ? -28.809 11.657 6.308   1.00 40.23 ? 73  MET A CG  1 
ATOM   569  S SD  . MET A 1 73  ? -28.008 12.769 7.459   1.00 40.23 ? 73  MET A SD  1 
ATOM   570  C CE  . MET A 1 73  ? -28.909 12.360 9.012   1.00 40.23 ? 73  MET A CE  1 
ATOM   571  N N   . LYS A 1 74  ? -25.739 9.112  5.834   1.00 37.70 ? 74  LYS A N   1 
ATOM   572  C CA  . LYS A 1 74  ? -25.653 7.675  6.052   1.00 37.70 ? 74  LYS A CA  1 
ATOM   573  C C   . LYS A 1 74  ? -25.456 7.366  7.514   1.00 37.70 ? 74  LYS A C   1 
ATOM   574  O O   . LYS A 1 74  ? -24.600 7.939  8.171   1.00 37.70 ? 74  LYS A O   1 
ATOM   575  C CB  . LYS A 1 74  ? -24.520 7.066  5.231   1.00 37.70 ? 74  LYS A CB  1 
ATOM   576  C CG  . LYS A 1 74  ? -24.205 5.613  5.577   1.00 99.99 ? 74  LYS A CG  1 
ATOM   577  C CD  . LYS A 1 74  ? -23.284 4.955  4.543   1.00 99.99 ? 74  LYS A CD  1 
ATOM   578  C CE  . LYS A 1 74  ? -23.956 4.810  3.158   1.00 99.99 ? 74  LYS A CE  1 
ATOM   579  N NZ  . LYS A 1 74  ? -25.117 3.841  3.136   1.00 99.99 ? 74  LYS A NZ  1 
ATOM   580  N N   . ASP A 1 75  ? -26.271 6.453  8.016   1.00 53.00 ? 75  ASP A N   1 
ATOM   581  C CA  . ASP A 1 75  ? -26.216 6.054  9.409   1.00 53.00 ? 75  ASP A CA  1 
ATOM   582  C C   . ASP A 1 75  ? -26.331 7.213  10.364  1.00 53.00 ? 75  ASP A C   1 
ATOM   583  O O   . ASP A 1 75  ? -25.526 7.376  11.279  1.00 53.00 ? 75  ASP A O   1 
ATOM   584  C CB  . ASP A 1 75  ? -24.972 5.217  9.700   1.00 53.00 ? 75  ASP A CB  1 
ATOM   585  C CG  . ASP A 1 75  ? -25.247 3.720  9.589   1.00 99.99 ? 75  ASP A CG  1 
ATOM   586  O OD1 . ASP A 1 75  ? -26.383 3.299  9.948   1.00 99.99 ? 75  ASP A OD1 1 
ATOM   587  O OD2 . ASP A 1 75  ? -24.340 2.972  9.143   1.00 99.99 ? 75  ASP A OD2 1 
ATOM   588  N N   . GLY A 1 76  ? -27.357 8.017  10.122  1.00 29.91 ? 76  GLY A N   1 
ATOM   589  C CA  . GLY A 1 76  ? -27.637 9.165  10.958  1.00 29.91 ? 76  GLY A CA  1 
ATOM   590  C C   . GLY A 1 76  ? -26.554 10.224 10.994  1.00 29.91 ? 76  GLY A C   1 
ATOM   591  O O   . GLY A 1 76  ? -26.542 11.074 11.892  1.00 29.91 ? 76  GLY A O   1 
ATOM   592  N N   . THR A 1 77  ? -25.670 10.202 10.001  1.00 29.22 ? 77  THR A N   1 
ATOM   593  C CA  . THR A 1 77  ? -24.586 11.161 9.953   1.00 29.22 ? 77  THR A CA  1 
ATOM   594  C C   . THR A 1 77  ? -24.102 11.431 8.544   1.00 29.22 ? 77  THR A C   1 
ATOM   595  O O   . THR A 1 77  ? -24.094 10.545 7.691   1.00 29.22 ? 77  THR A O   1 
ATOM   596  C CB  . THR A 1 77  ? -23.391 10.713 10.864  1.00 29.22 ? 77  THR A CB  1 
ATOM   597  O OG1 . THR A 1 77  ? -22.347 11.694 10.824  1.00 21.86 ? 77  THR A OG1 1 
ATOM   598  C CG2 . THR A 1 77  ? -22.842 9.365  10.427  1.00 21.86 ? 77  THR A CG2 1 
ATOM   599  N N   . PRO A 1 78  ? -23.819 12.706 8.249   1.00 25.10 ? 78  PRO A N   1 
ATOM   600  C CA  . PRO A 1 78  ? -23.327 13.104 6.928   1.00 25.10 ? 78  PRO A CA  1 
ATOM   601  C C   . PRO A 1 78  ? -22.020 12.346 6.708   1.00 25.10 ? 78  PRO A C   1 
ATOM   602  O O   . PRO A 1 78  ? -21.199 12.228 7.619   1.00 25.10 ? 78  PRO A O   1 
ATOM   603  C CB  . PRO A 1 78  ? -23.100 14.603 7.099   1.00 25.10 ? 78  PRO A CB  1 
ATOM   604  C CG  . PRO A 1 78  ? -24.204 14.992 8.067   1.00 17.24 ? 78  PRO A CG  1 
ATOM   605  C CD  . PRO A 1 78  ? -24.091 13.889 9.089   1.00 17.24 ? 78  PRO A CD  1 
ATOM   606  N N   . THR A 1 79  ? -21.808 11.881 5.495   1.00 18.50 ? 79  THR A N   1 
ATOM   607  C CA  . THR A 1 79  ? -20.646 11.086 5.228   1.00 18.50 ? 79  THR A CA  1 
ATOM   608  C C   . THR A 1 79  ? -19.993 11.412 3.906   1.00 18.50 ? 79  THR A C   1 
ATOM   609  O O   . THR A 1 79  ? -20.687 11.602 2.893   1.00 18.50 ? 79  THR A O   1 
ATOM   610  C CB  . THR A 1 79  ? -21.090 9.637  5.179   1.00 18.50 ? 79  THR A CB  1 
ATOM   611  O OG1 . THR A 1 79  ? -21.659 9.287  6.443   1.00 26.21 ? 79  THR A OG1 1 
ATOM   612  C CG2 . THR A 1 79  ? -19.944 8.721  4.827   1.00 26.21 ? 79  THR A CG2 1 
ATOM   613  N N   . LEU A 1 80  ? -18.660 11.457 3.915   1.00 14.87 ? 80  LEU A N   1 
ATOM   614  C CA  . LEU A 1 80  ? -17.887 11.718 2.696   1.00 14.87 ? 80  LEU A CA  1 
ATOM   615  C C   . LEU A 1 80  ? -17.739 10.351 2.095   1.00 14.87 ? 80  LEU A C   1 
ATOM   616  O O   . LEU A 1 80  ? -17.523 9.402  2.833   1.00 14.87 ? 80  LEU A O   1 
ATOM   617  C CB  . LEU A 1 80  ? -16.493 12.256 3.029   1.00 14.87 ? 80  LEU A CB  1 
ATOM   618  C CG  . LEU A 1 80  ? -15.563 12.480 1.846   1.00 5.13  ? 80  LEU A CG  1 
ATOM   619  C CD1 . LEU A 1 80  ? -16.182 13.461 0.926   1.00 5.13  ? 80  LEU A CD1 1 
ATOM   620  C CD2 . LEU A 1 80  ? -14.238 12.989 2.320   1.00 5.13  ? 80  LEU A CD2 1 
ATOM   621  N N   . GLN A 1 81  ? -17.893 10.224 0.787   1.00 24.67 ? 81  GLN A N   1 
ATOM   622  C CA  . GLN A 1 81  ? -17.739 8.922  0.157   1.00 24.67 ? 81  GLN A CA  1 
ATOM   623  C C   . GLN A 1 81  ? -17.226 9.098  -1.256  1.00 24.67 ? 81  GLN A C   1 
ATOM   624  O O   . GLN A 1 81  ? -17.492 10.119 -1.889  1.00 24.67 ? 81  GLN A O   1 
ATOM   625  C CB  . GLN A 1 81  ? -19.063 8.162  0.146   1.00 24.67 ? 81  GLN A CB  1 
ATOM   626  C CG  . GLN A 1 81  ? -20.084 8.740  -0.796  1.00 51.14 ? 81  GLN A CG  1 
ATOM   627  C CD  . GLN A 1 81  ? -21.347 7.901  -0.895  1.00 51.14 ? 81  GLN A CD  1 
ATOM   628  O OE1 . GLN A 1 81  ? -21.509 6.898  -0.176  1.00 51.14 ? 81  GLN A OE1 1 
ATOM   629  N NE2 . GLN A 1 81  ? -22.258 8.304  -1.790  1.00 51.14 ? 81  GLN A NE2 1 
ATOM   630  N N   . LEU A 1 82  ? -16.457 8.124  -1.728  1.00 20.61 ? 82  LEU A N   1 
ATOM   631  C CA  . LEU A 1 82  ? -15.896 8.142  -3.075  1.00 20.61 ? 82  LEU A CA  1 
ATOM   632  C C   . LEU A 1 82  ? -16.903 7.390  -3.969  1.00 20.61 ? 82  LEU A C   1 
ATOM   633  O O   . LEU A 1 82  ? -17.006 6.177  -3.922  1.00 20.61 ? 82  LEU A O   1 
ATOM   634  C CB  . LEU A 1 82  ? -14.533 7.458  -3.043  1.00 20.61 ? 82  LEU A CB  1 
ATOM   635  C CG  . LEU A 1 82  ? -13.350 8.077  -3.764  1.00 20.24 ? 82  LEU A CG  1 
ATOM   636  C CD1 . LEU A 1 82  ? -13.321 9.551  -3.573  1.00 20.24 ? 82  LEU A CD1 1 
ATOM   637  C CD2 . LEU A 1 82  ? -12.085 7.478  -3.227  1.00 20.24 ? 82  LEU A CD2 1 
ATOM   638  N N   . GLU A 1 83  ? -17.642 8.122  -4.783  1.00 21.78 ? 83  GLU A N   1 
ATOM   639  C CA  . GLU A 1 83  ? -18.684 7.554  -5.618  1.00 21.78 ? 83  GLU A CA  1 
ATOM   640  C C   . GLU A 1 83  ? -18.379 7.428  -7.098  1.00 21.78 ? 83  GLU A C   1 
ATOM   641  O O   . GLU A 1 83  ? -18.054 8.416  -7.754  1.00 21.78 ? 83  GLU A O   1 
ATOM   642  C CB  . GLU A 1 83  ? -19.921 8.415  -5.404  1.00 21.78 ? 83  GLU A CB  1 
ATOM   643  C CG  . GLU A 1 83  ? -21.018 8.291  -6.404  1.00 36.89 ? 83  GLU A CG  1 
ATOM   644  C CD  . GLU A 1 83  ? -22.288 8.998  -5.936  1.00 36.89 ? 83  GLU A CD  1 
ATOM   645  O OE1 . GLU A 1 83  ? -22.222 9.806  -4.972  1.00 36.89 ? 83  GLU A OE1 1 
ATOM   646  O OE2 . GLU A 1 83  ? -23.367 8.725  -6.518  1.00 36.89 ? 83  GLU A OE2 1 
ATOM   647  N N   . SER A 1 84  ? -18.504 6.223  -7.641  1.00 22.93 ? 84  SER A N   1 
ATOM   648  C CA  . SER A 1 84  ? -18.258 6.027  -9.069  1.00 22.93 ? 84  SER A CA  1 
ATOM   649  C C   . SER A 1 84  ? -19.429 6.579  -9.883  1.00 22.93 ? 84  SER A C   1 
ATOM   650  O O   . SER A 1 84  ? -20.576 6.607  -9.420  1.00 22.93 ? 84  SER A O   1 
ATOM   651  C CB  . SER A 1 84  ? -18.029 4.556  -9.388  1.00 22.93 ? 84  SER A CB  1 
ATOM   652  O OG  . SER A 1 84  ? -19.045 3.774  -8.808  1.00 34.75 ? 84  SER A OG  1 
ATOM   653  N N   . VAL A 1 85  ? -19.140 7.026  -11.097 1.00 22.69 ? 85  VAL A N   1 
ATOM   654  C CA  . VAL A 1 85  ? -20.165 7.612  -11.954 1.00 22.69 ? 85  VAL A CA  1 
ATOM   655  C C   . VAL A 1 85  ? -19.982 7.165  -13.406 1.00 22.69 ? 85  VAL A C   1 
ATOM   656  O O   . VAL A 1 85  ? -18.984 6.534  -13.738 1.00 22.69 ? 85  VAL A O   1 
ATOM   657  C CB  . VAL A 1 85  ? -20.108 9.151  -11.854 1.00 22.69 ? 85  VAL A CB  1 
ATOM   658  C CG1 . VAL A 1 85  ? -20.404 9.585  -10.430 1.00 14.18 ? 85  VAL A CG1 1 
ATOM   659  C CG2 . VAL A 1 85  ? -18.737 9.663  -12.283 1.00 14.18 ? 85  VAL A CG2 1 
ATOM   660  N N   . ASP A 1 86  ? -20.940 7.465  -14.271 1.00 31.64 ? 86  ASP A N   1 
ATOM   661  C CA  . ASP A 1 86  ? -20.813 7.051  -15.660 1.00 31.64 ? 86  ASP A CA  1 
ATOM   662  C C   . ASP A 1 86  ? -19.684 7.790  -16.331 1.00 31.64 ? 86  ASP A C   1 
ATOM   663  O O   . ASP A 1 86  ? -19.757 9.000  -16.502 1.00 31.64 ? 86  ASP A O   1 
ATOM   664  C CB  . ASP A 1 86  ? -22.098 7.333  -16.430 1.00 31.64 ? 86  ASP A CB  1 
ATOM   665  C CG  . ASP A 1 86  ? -22.128 6.656  -17.797 1.00 44.32 ? 86  ASP A CG  1 
ATOM   666  O OD1 . ASP A 1 86  ? -21.055 6.388  -18.384 1.00 44.32 ? 86  ASP A OD1 1 
ATOM   667  O OD2 . ASP A 1 86  ? -23.245 6.379  -18.285 1.00 44.32 ? 86  ASP A OD2 1 
ATOM   668  N N   . PRO A 1 87  ? -18.697 7.061  -16.859 1.00 21.27 ? 87  PRO A N   1 
ATOM   669  C CA  . PRO A 1 87  ? -17.581 7.734  -17.516 1.00 21.27 ? 87  PRO A CA  1 
ATOM   670  C C   . PRO A 1 87  ? -18.012 8.570  -18.712 1.00 21.27 ? 87  PRO A C   1 
ATOM   671  O O   . PRO A 1 87  ? -17.247 9.380  -19.209 1.00 21.27 ? 87  PRO A O   1 
ATOM   672  C CB  . PRO A 1 87  ? -16.679 6.568  -17.925 1.00 21.27 ? 87  PRO A CB  1 
ATOM   673  C CG  . PRO A 1 87  ? -17.630 5.466  -18.137 1.00 17.97 ? 87  PRO A CG  1 
ATOM   674  C CD  . PRO A 1 87  ? -18.560 5.602  -16.971 1.00 17.97 ? 87  PRO A CD  1 
ATOM   675  N N   . LYS A 1 88  ? -19.245 8.390  -19.154 1.00 65.97 ? 88  LYS A N   1 
ATOM   676  C CA  . LYS A 1 88  ? -19.742 9.125  -20.297 1.00 65.97 ? 88  LYS A CA  1 
ATOM   677  C C   . LYS A 1 88  ? -20.417 10.435 -19.928 1.00 65.97 ? 88  LYS A C   1 
ATOM   678  O O   . LYS A 1 88  ? -20.258 11.414 -20.636 1.00 65.97 ? 88  LYS A O   1 
ATOM   679  C CB  . LYS A 1 88  ? -20.713 8.259  -21.110 1.00 65.97 ? 88  LYS A CB  1 
ATOM   680  C CG  . LYS A 1 88  ? -20.138 6.943  -21.661 1.00 84.32 ? 88  LYS A CG  1 
ATOM   681  C CD  . LYS A 1 88  ? -19.685 7.062  -23.117 1.00 84.32 ? 88  LYS A CD  1 
ATOM   682  C CE  . LYS A 1 88  ? -18.524 8.034  -23.275 1.00 84.32 ? 88  LYS A CE  1 
ATOM   683  N NZ  . LYS A 1 88  ? -18.041 8.136  -24.681 1.00 84.32 ? 88  LYS A NZ  1 
ATOM   684  N N   . GLN A 1 89  ? -21.164 10.461 -18.826 1.00 46.44 ? 89  GLN A N   1 
ATOM   685  C CA  . GLN A 1 89  ? -21.890 11.670 -18.401 1.00 46.44 ? 89  GLN A CA  1 
ATOM   686  C C   . GLN A 1 89  ? -21.092 12.705 -17.591 1.00 46.44 ? 89  GLN A C   1 
ATOM   687  O O   . GLN A 1 89  ? -21.496 13.865 -17.484 1.00 46.44 ? 89  GLN A O   1 
ATOM   688  C CB  . GLN A 1 89  ? -23.106 11.278 -17.555 1.00 46.44 ? 89  GLN A CB  1 
ATOM   689  C CG  . GLN A 1 89  ? -24.186 10.432 -18.228 1.00 99.99 ? 89  GLN A CG  1 
ATOM   690  C CD  . GLN A 1 89  ? -25.293 9.985  -17.242 1.00 99.99 ? 89  GLN A CD  1 
ATOM   691  O OE1 . GLN A 1 89  ? -25.393 10.481 -16.105 1.00 99.99 ? 89  GLN A OE1 1 
ATOM   692  N NE2 . GLN A 1 89  ? -26.120 9.037  -17.678 1.00 99.99 ? 89  GLN A NE2 1 
ATOM   693  N N   . TYR A 1 90  ? -19.965 12.277 -17.029 1.00 34.45 ? 90  TYR A N   1 
ATOM   694  C CA  . TYR A 1 90  ? -19.140 13.111 -16.156 1.00 34.45 ? 90  TYR A CA  1 
ATOM   695  C C   . TYR A 1 90  ? -17.746 13.533 -16.646 1.00 34.45 ? 90  TYR A C   1 
ATOM   696  O O   . TYR A 1 90  ? -17.082 12.798 -17.406 1.00 34.45 ? 90  TYR A O   1 
ATOM   697  C CB  . TYR A 1 90  ? -19.030 12.410 -14.793 1.00 34.45 ? 90  TYR A CB  1 
ATOM   698  C CG  . TYR A 1 90  ? -20.347 12.364 -14.049 1.00 21.21 ? 90  TYR A CG  1 
ATOM   699  C CD1 . TYR A 1 90  ? -21.254 11.353 -14.292 1.00 21.21 ? 90  TYR A CD1 1 
ATOM   700  C CD2 . TYR A 1 90  ? -20.712 13.387 -13.172 1.00 21.21 ? 90  TYR A CD2 1 
ATOM   701  C CE1 . TYR A 1 90  ? -22.484 11.359 -13.700 1.00 21.21 ? 90  TYR A CE1 1 
ATOM   702  C CE2 . TYR A 1 90  ? -21.933 13.403 -12.575 1.00 21.21 ? 90  TYR A CE2 1 
ATOM   703  C CZ  . TYR A 1 90  ? -22.820 12.386 -12.846 1.00 21.21 ? 90  TYR A CZ  1 
ATOM   704  O OH  . TYR A 1 90  ? -24.072 12.383 -12.283 1.00 21.21 ? 90  TYR A OH  1 
ATOM   705  N N   . PRO A 1 91  ? -17.257 14.705 -16.168 1.00 33.43 ? 91  PRO A N   1 
ATOM   706  C CA  . PRO A 1 91  ? -17.973 15.575 -15.230 1.00 33.43 ? 91  PRO A CA  1 
ATOM   707  C C   . PRO A 1 91  ? -18.990 16.404 -16.001 1.00 33.43 ? 91  PRO A C   1 
ATOM   708  O O   . PRO A 1 91  ? -18.838 16.601 -17.210 1.00 33.43 ? 91  PRO A O   1 
ATOM   709  C CB  . PRO A 1 91  ? -16.855 16.457 -14.693 1.00 33.43 ? 91  PRO A CB  1 
ATOM   710  C CG  . PRO A 1 91  ? -16.029 16.678 -15.911 1.00 23.25 ? 91  PRO A CG  1 
ATOM   711  C CD  . PRO A 1 91  ? -15.948 15.295 -16.512 1.00 23.25 ? 91  PRO A CD  1 
ATOM   712  N N   . LYS A 1 92  ? -20.040 16.856 -15.327 1.00 32.85 ? 92  LYS A N   1 
ATOM   713  C CA  . LYS A 1 92  ? -21.027 17.686 -16.001 1.00 32.85 ? 92  LYS A CA  1 
ATOM   714  C C   . LYS A 1 92  ? -20.989 19.112 -15.433 1.00 32.85 ? 92  LYS A C   1 
ATOM   715  O O   . LYS A 1 92  ? -20.504 19.339 -14.323 1.00 32.85 ? 92  LYS A O   1 
ATOM   716  C CB  . LYS A 1 92  ? -22.421 17.073 -15.908 1.00 32.85 ? 92  LYS A CB  1 
ATOM   717  C CG  . LYS A 1 92  ? -23.011 17.048 -14.539 1.00 33.22 ? 92  LYS A CG  1 
ATOM   718  C CD  . LYS A 1 92  ? -24.440 16.549 -14.596 1.00 33.22 ? 92  LYS A CD  1 
ATOM   719  C CE  . LYS A 1 92  ? -24.519 15.136 -15.152 1.00 33.22 ? 92  LYS A CE  1 
ATOM   720  N NZ  . LYS A 1 92  ? -25.879 14.493 -15.012 1.00 33.22 ? 92  LYS A NZ  1 
ATOM   721  N N   . LYS A 1 93  ? -21.448 20.080 -16.211 1.00 27.41 ? 93  LYS A N   1 
ATOM   722  C CA  . LYS A 1 93  ? -21.434 21.455 -15.762 1.00 27.41 ? 93  LYS A CA  1 
ATOM   723  C C   . LYS A 1 93  ? -22.309 21.679 -14.560 1.00 27.41 ? 93  LYS A C   1 
ATOM   724  O O   . LYS A 1 93  ? -22.024 22.537 -13.745 1.00 27.41 ? 93  LYS A O   1 
ATOM   725  C CB  . LYS A 1 93  ? -21.851 22.389 -16.883 1.00 27.41 ? 93  LYS A CB  1 
ATOM   726  C CG  . LYS A 1 93  ? -20.708 23.225 -17.399 1.00 74.52 ? 93  LYS A CG  1 
ATOM   727  C CD  . LYS A 1 93  ? -20.170 24.139 -16.288 1.00 74.52 ? 93  LYS A CD  1 
ATOM   728  C CE  . LYS A 1 93  ? -19.217 25.216 -16.843 1.00 74.52 ? 93  LYS A CE  1 
ATOM   729  N NZ  . LYS A 1 93  ? -19.769 25.863 -18.096 1.00 74.52 ? 93  LYS A NZ  1 
ATOM   730  N N   . LYS A 1 94  ? -23.401 20.941 -14.467 1.00 30.94 ? 94  LYS A N   1 
ATOM   731  C CA  . LYS A 1 94  ? -24.285 21.087 -13.333 1.00 30.94 ? 94  LYS A CA  1 
ATOM   732  C C   . LYS A 1 94  ? -24.374 19.742 -12.619 1.00 30.94 ? 94  LYS A C   1 
ATOM   733  O O   . LYS A 1 94  ? -25.273 18.939 -12.869 1.00 30.94 ? 94  LYS A O   1 
ATOM   734  C CB  . LYS A 1 94  ? -25.661 21.584 -13.777 1.00 30.94 ? 94  LYS A CB  1 
ATOM   735  C CG  . LYS A 1 94  ? -26.396 22.409 -12.704 1.00 78.05 ? 94  LYS A CG  1 
ATOM   736  C CD  . LYS A 1 94  ? -25.796 22.192 -11.281 1.00 78.05 ? 94  LYS A CD  1 
ATOM   737  C CE  . LYS A 1 94  ? -26.848 22.190 -10.132 1.00 78.05 ? 94  LYS A CE  1 
ATOM   738  N NZ  . LYS A 1 94  ? -26.234 21.886 -8.773  1.00 78.05 ? 94  LYS A NZ  1 
ATOM   739  N N   . MET A 1 95  ? -23.405 19.508 -11.740 1.00 19.87 ? 95  MET A N   1 
ATOM   740  C CA  . MET A 1 95  ? -23.299 18.280 -10.970 1.00 19.87 ? 95  MET A CA  1 
ATOM   741  C C   . MET A 1 95  ? -24.427 18.211 -9.964  1.00 19.87 ? 95  MET A C   1 
ATOM   742  O O   . MET A 1 95  ? -24.993 19.234 -9.578  1.00 19.87 ? 95  MET A O   1 
ATOM   743  C CB  . MET A 1 95  ? -21.978 18.272 -10.210 1.00 19.87 ? 95  MET A CB  1 
ATOM   744  C CG  . MET A 1 95  ? -20.746 18.206 -11.068 1.00 22.34 ? 95  MET A CG  1 
ATOM   745  S SD  . MET A 1 95  ? -20.543 16.591 -11.788 1.00 22.34 ? 95  MET A SD  1 
ATOM   746  C CE  . MET A 1 95  ? -19.870 15.696 -10.414 1.00 22.34 ? 95  MET A CE  1 
ATOM   747  N N   . GLU A 1 96  ? -24.744 17.006 -9.523  1.00 24.25 ? 96  GLU A N   1 
ATOM   748  C CA  . GLU A 1 96  ? -25.781 16.833 -8.533  1.00 24.25 ? 96  GLU A CA  1 
ATOM   749  C C   . GLU A 1 96  ? -25.260 17.474 -7.254  1.00 24.25 ? 96  GLU A C   1 
ATOM   750  O O   . GLU A 1 96  ? -24.066 17.459 -6.977  1.00 24.25 ? 96  GLU A O   1 
ATOM   751  C CB  . GLU A 1 96  ? -26.092 15.348 -8.321  1.00 24.25 ? 96  GLU A CB  1 
ATOM   752  C CG  . GLU A 1 96  ? -26.871 14.674 -9.462  1.00 42.61 ? 96  GLU A CG  1 
ATOM   753  C CD  . GLU A 1 96  ? -26.032 14.330 -10.700 1.00 42.61 ? 96  GLU A CD  1 
ATOM   754  O OE1 . GLU A 1 96  ? -24.789 14.225 -10.598 1.00 42.61 ? 96  GLU A OE1 1 
ATOM   755  O OE2 . GLU A 1 96  ? -26.625 14.132 -11.787 1.00 42.61 ? 96  GLU A OE2 1 
ATOM   756  N N   . LYS A 1 97  ? -26.165 18.026 -6.470  1.00 30.69 ? 97  LYS A N   1 
ATOM   757  C CA  . LYS A 1 97  ? -25.802 18.700 -5.242  1.00 30.69 ? 97  LYS A CA  1 
ATOM   758  C C   . LYS A 1 97  ? -24.900 17.913 -4.313  1.00 30.69 ? 97  LYS A C   1 
ATOM   759  O O   . LYS A 1 97  ? -24.065 18.494 -3.630  1.00 30.69 ? 97  LYS A O   1 
ATOM   760  C CB  . LYS A 1 97  ? -27.055 19.132 -4.491  1.00 30.69 ? 97  LYS A CB  1 
ATOM   761  C CG  . LYS A 1 97  ? -26.789 19.971 -3.260  1.00 56.51 ? 97  LYS A CG  1 
ATOM   762  C CD  . LYS A 1 97  ? -26.170 21.325 -3.609  1.00 56.51 ? 97  LYS A CD  1 
ATOM   763  C CE  . LYS A 1 97  ? -27.164 22.293 -4.275  1.00 56.51 ? 97  LYS A CE  1 
ATOM   764  N NZ  . LYS A 1 97  ? -28.255 22.764 -3.342  1.00 56.51 ? 97  LYS A NZ  1 
ATOM   765  N N   . ARG A 1 98  ? -25.030 16.600 -4.267  1.00 18.55 ? 98  ARG A N   1 
ATOM   766  C CA  . ARG A 1 98  ? -24.173 15.875 -3.343  1.00 18.55 ? 98  ARG A CA  1 
ATOM   767  C C   . ARG A 1 98  ? -22.700 15.912 -3.737  1.00 18.55 ? 98  ARG A C   1 
ATOM   768  O O   . ARG A 1 98  ? -21.835 15.660 -2.909  1.00 18.55 ? 98  ARG A O   1 
ATOM   769  C CB  . ARG A 1 98  ? -24.651 14.436 -3.137  1.00 18.55 ? 98  ARG A CB  1 
ATOM   770  C CG  . ARG A 1 98  ? -24.645 13.598 -4.388  1.00 26.22 ? 98  ARG A CG  1 
ATOM   771  C CD  . ARG A 1 98  ? -24.810 12.116 -4.086  1.00 26.22 ? 98  ARG A CD  1 
ATOM   772  N NE  . ARG A 1 98  ? -24.640 11.314 -5.294  1.00 26.22 ? 98  ARG A NE  1 
ATOM   773  C CZ  . ARG A 1 98  ? -25.466 11.347 -6.339  1.00 26.22 ? 98  ARG A CZ  1 
ATOM   774  N NH1 . ARG A 1 98  ? -26.540 12.132 -6.329  1.00 26.22 ? 98  ARG A NH1 1 
ATOM   775  N NH2 . ARG A 1 98  ? -25.180 10.655 -7.434  1.00 26.22 ? 98  ARG A NH2 1 
ATOM   776  N N   . PHE A 1 99  ? -22.402 16.265 -4.980  1.00 15.77 ? 99  PHE A N   1 
ATOM   777  C CA  . PHE A 1 99  ? -21.014 16.299 -5.422  1.00 15.77 ? 99  PHE A CA  1 
ATOM   778  C C   . PHE A 1 99  ? -20.363 17.640 -5.173  1.00 15.77 ? 99  PHE A C   1 
ATOM   779  O O   . PHE A 1 99  ? -19.141 17.751 -5.174  1.00 15.77 ? 99  PHE A O   1 
ATOM   780  C CB  . PHE A 1 99  ? -20.914 16.006 -6.913  1.00 15.77 ? 99  PHE A CB  1 
ATOM   781  C CG  . PHE A 1 99  ? -21.206 14.588 -7.277  1.00 17.49 ? 99  PHE A CG  1 
ATOM   782  C CD1 . PHE A 1 99  ? -20.296 13.583 -6.990  1.00 17.49 ? 99  PHE A CD1 1 
ATOM   783  C CD2 . PHE A 1 99  ? -22.387 14.253 -7.913  1.00 17.49 ? 99  PHE A CD2 1 
ATOM   784  C CE1 . PHE A 1 99  ? -20.551 12.271 -7.328  1.00 17.49 ? 99  PHE A CE1 1 
ATOM   785  C CE2 . PHE A 1 99  ? -22.654 12.938 -8.260  1.00 17.49 ? 99  PHE A CE2 1 
ATOM   786  C CZ  . PHE A 1 99  ? -21.729 11.939 -7.964  1.00 17.49 ? 99  PHE A CZ  1 
ATOM   787  N N   . VAL A 1 100 ? -21.186 18.654 -4.943  1.00 9.51  ? 100 VAL A N   1 
ATOM   788  C CA  . VAL A 1 100 ? -20.738 20.022 -4.762  1.00 9.51  ? 100 VAL A CA  1 
ATOM   789  C C   . VAL A 1 100 ? -20.138 20.380 -3.427  1.00 9.51  ? 100 VAL A C   1 
ATOM   790  O O   . VAL A 1 100 ? -20.712 20.108 -2.375  1.00 9.51  ? 100 VAL A O   1 
ATOM   791  C CB  . VAL A 1 100 ? -21.904 20.994 -5.060  1.00 9.51  ? 100 VAL A CB  1 
ATOM   792  C CG1 . VAL A 1 100 ? -21.449 22.425 -4.999  1.00 6.37  ? 100 VAL A CG1 1 
ATOM   793  C CG2 . VAL A 1 100 ? -22.470 20.698 -6.407  1.00 6.37  ? 100 VAL A CG2 1 
ATOM   794  N N   . PHE A 1 101 ? -19.016 21.083 -3.507  1.00 18.80 ? 101 PHE A N   1 
ATOM   795  C CA  . PHE A 1 101 ? -18.271 21.586 -2.364  1.00 18.80 ? 101 PHE A CA  1 
ATOM   796  C C   . PHE A 1 101 ? -18.026 23.070 -2.614  1.00 18.80 ? 101 PHE A C   1 
ATOM   797  O O   . PHE A 1 101 ? -17.791 23.485 -3.749  1.00 18.80 ? 101 PHE A O   1 
ATOM   798  C CB  . PHE A 1 101 ? -16.912 20.899 -2.256  1.00 18.80 ? 101 PHE A CB  1 
ATOM   799  C CG  . PHE A 1 101 ? -16.996 19.480 -1.843  1.00 9.40  ? 101 PHE A CG  1 
ATOM   800  C CD1 . PHE A 1 101 ? -17.135 18.478 -2.793  1.00 9.40  ? 101 PHE A CD1 1 
ATOM   801  C CD2 . PHE A 1 101 ? -16.948 19.134 -0.505  1.00 9.40  ? 101 PHE A CD2 1 
ATOM   802  C CE1 . PHE A 1 101 ? -17.231 17.138 -2.414  1.00 9.40  ? 101 PHE A CE1 1 
ATOM   803  C CE2 . PHE A 1 101 ? -17.042 17.794 -0.106  1.00 9.40  ? 101 PHE A CE2 1 
ATOM   804  C CZ  . PHE A 1 101 ? -17.184 16.797 -1.062  1.00 9.40  ? 101 PHE A CZ  1 
ATOM   805  N N   . ASN A 1 102 ? -18.110 23.880 -1.570  1.00 19.22 ? 102 ASN A N   1 
ATOM   806  C CA  . ASN A 1 102 ? -17.853 25.295 -1.722  1.00 19.22 ? 102 ASN A CA  1 
ATOM   807  C C   . ASN A 1 102 ? -16.412 25.509 -1.307  1.00 19.22 ? 102 ASN A C   1 
ATOM   808  O O   . ASN A 1 102 ? -16.072 25.308 -0.143  1.00 19.22 ? 102 ASN A O   1 
ATOM   809  C CB  . ASN A 1 102 ? -18.765 26.115 -0.809  1.00 19.22 ? 102 ASN A CB  1 
ATOM   810  C CG  . ASN A 1 102 ? -20.203 26.135 -1.270  1.00 21.81 ? 102 ASN A CG  1 
ATOM   811  O OD1 . ASN A 1 102 ? -21.105 25.990 -0.467  1.00 21.81 ? 102 ASN A OD1 1 
ATOM   812  N ND2 . ASN A 1 102 ? -20.427 26.329 -2.558  1.00 21.81 ? 102 ASN A ND2 1 
ATOM   813  N N   . LYS A 1 103 ? -15.548 25.816 -2.264  1.00 14.75 ? 103 LYS A N   1 
ATOM   814  C CA  . LYS A 1 103 ? -14.151 26.075 -1.966  1.00 14.75 ? 103 LYS A CA  1 
ATOM   815  C C   . LYS A 1 103 ? -14.107 27.445 -1.319  1.00 14.75 ? 103 LYS A C   1 
ATOM   816  O O   . LYS A 1 103 ? -14.535 28.428 -1.935  1.00 14.75 ? 103 LYS A O   1 
ATOM   817  C CB  . LYS A 1 103 ? -13.324 26.086 -3.251  1.00 14.75 ? 103 LYS A CB  1 
ATOM   818  C CG  . LYS A 1 103 ? -11.850 26.429 -3.058  1.00 9.90  ? 103 LYS A CG  1 
ATOM   819  C CD  . LYS A 1 103 ? -11.038 26.096 -4.299  1.00 9.90  ? 103 LYS A CD  1 
ATOM   820  C CE  . LYS A 1 103 ? -11.353 27.032 -5.436  1.00 9.90  ? 103 LYS A CE  1 
ATOM   821  N NZ  . LYS A 1 103 ? -10.952 28.428 -5.109  1.00 9.90  ? 103 LYS A NZ  1 
ATOM   822  N N   . ILE A 1 104 ? -13.630 27.507 -0.077  1.00 20.00 ? 104 ILE A N   1 
ATOM   823  C CA  . ILE A 1 104 ? -13.527 28.763 0.670   1.00 20.00 ? 104 ILE A CA  1 
ATOM   824  C C   . ILE A 1 104 ? -12.048 29.054 0.876   1.00 20.00 ? 104 ILE A C   1 
ATOM   825  O O   . ILE A 1 104 ? -11.301 28.149 1.228   1.00 20.00 ? 104 ILE A O   1 
ATOM   826  C CB  . ILE A 1 104 ? -14.135 28.613 2.081   1.00 20.00 ? 104 ILE A CB  1 
ATOM   827  C CG1 . ILE A 1 104 ? -15.543 28.063 1.996   1.00 16.49 ? 104 ILE A CG1 1 
ATOM   828  C CG2 . ILE A 1 104 ? -14.147 29.940 2.810   1.00 16.49 ? 104 ILE A CG2 1 
ATOM   829  C CD1 . ILE A 1 104 ? -16.129 27.798 3.330   1.00 16.49 ? 104 ILE A CD1 1 
ATOM   830  N N   . GLU A 1 105 ? -11.610 30.290 0.687   1.00 36.61 ? 105 GLU A N   1 
ATOM   831  C CA  . GLU A 1 105 ? -10.205 30.580 0.905   1.00 36.61 ? 105 GLU A CA  1 
ATOM   832  C C   . GLU A 1 105 ? -10.010 31.528 2.058   1.00 36.61 ? 105 GLU A C   1 
ATOM   833  O O   . GLU A 1 105 ? -10.615 32.591 2.092   1.00 36.61 ? 105 GLU A O   1 
ATOM   834  C CB  . GLU A 1 105 ? -9.565  31.145 -0.345  1.00 36.61 ? 105 GLU A CB  1 
ATOM   835  C CG  . GLU A 1 105 ? -9.475  30.133 -1.466  1.00 98.09 ? 105 GLU A CG  1 
ATOM   836  C CD  . GLU A 1 105 ? -8.541  30.563 -2.587  1.00 98.09 ? 105 GLU A CD  1 
ATOM   837  O OE1 . GLU A 1 105 ? -8.141  31.758 -2.593  1.00 98.09 ? 105 GLU A OE1 1 
ATOM   838  O OE2 . GLU A 1 105 ? -8.208  29.703 -3.453  1.00 98.09 ? 105 GLU A OE2 1 
ATOM   839  N N   . VAL A 1 106 ? -9.209  31.110 3.031   1.00 57.33 ? 106 VAL A N   1 
ATOM   840  C CA  . VAL A 1 106 ? -8.927  31.934 4.198   1.00 57.33 ? 106 VAL A CA  1 
ATOM   841  C C   . VAL A 1 106 ? -7.578  32.651 4.057   1.00 57.33 ? 106 VAL A C   1 
ATOM   842  O O   . VAL A 1 106 ? -7.515  33.883 3.987   1.00 57.33 ? 106 VAL A O   1 
ATOM   843  C CB  . VAL A 1 106 ? -8.984  31.123 5.504   1.00 57.33 ? 106 VAL A CB  1 
ATOM   844  C CG1 . VAL A 1 106 ? -10.387 30.674 5.760   1.00 34.59 ? 106 VAL A CG1 1 
ATOM   845  C CG2 . VAL A 1 106 ? -8.075  29.934 5.431   1.00 34.59 ? 106 VAL A CG2 1 
ATOM   846  N N   . LYS A 1 107 ? -6.499  31.894 3.988   1.00 81.99 ? 107 LYS A N   1 
ATOM   847  C CA  . LYS A 1 107 ? -5.195  32.501 3.840   1.00 81.99 ? 107 LYS A CA  1 
ATOM   848  C C   . LYS A 1 107 ? -4.626  31.875 2.584   1.00 81.99 ? 107 LYS A C   1 
ATOM   849  O O   . LYS A 1 107 ? -4.968  32.275 1.469   1.00 81.99 ? 107 LYS A O   1 
ATOM   850  C CB  . LYS A 1 107 ? -4.346  32.197 5.070   1.00 81.99 ? 107 LYS A CB  1 
ATOM   851  C CG  . LYS A 1 107 ? -4.881  32.841 6.332   1.00 99.99 ? 107 LYS A CG  1 
ATOM   852  C CD  . LYS A 1 107 ? -5.031  34.347 6.134   1.00 99.99 ? 107 LYS A CD  1 
ATOM   853  C CE  . LYS A 1 107 ? -5.415  35.057 7.425   1.00 99.99 ? 107 LYS A CE  1 
ATOM   854  N NZ  . LYS A 1 107 ? -4.322  35.017 8.446   1.00 99.99 ? 107 LYS A NZ  1 
ATOM   855  N N   . SER A 1 108 ? -3.758  30.890 2.768   1.00 85.34 ? 108 SER A N   1 
ATOM   856  C CA  . SER A 1 108 ? -3.183  30.149 1.659   1.00 85.34 ? 108 SER A CA  1 
ATOM   857  C C   . SER A 1 108 ? -3.873  28.783 1.751   1.00 85.34 ? 108 SER A C   1 
ATOM   858  O O   . SER A 1 108 ? -3.740  27.920 0.880   1.00 85.34 ? 108 SER A O   1 
ATOM   859  C CB  . SER A 1 108 ? -1.675  30.037 1.858   1.00 85.34 ? 108 SER A CB  1 
ATOM   860  O OG  . SER A 1 108 ? -1.137  31.313 2.188   1.00 99.99 ? 108 SER A OG  1 
ATOM   861  N N   . LYS A 1 109 ? -4.643  28.644 2.827   1.00 24.27 ? 109 LYS A N   1 
ATOM   862  C CA  . LYS A 1 109 ? -5.414  27.465 3.143   1.00 24.27 ? 109 LYS A CA  1 
ATOM   863  C C   . LYS A 1 109 ? -6.754  27.540 2.431   1.00 24.27 ? 109 LYS A C   1 
ATOM   864  O O   . LYS A 1 109 ? -7.281  28.631 2.210   1.00 24.27 ? 109 LYS A O   1 
ATOM   865  C CB  . LYS A 1 109 ? -5.690  27.435 4.642   1.00 24.27 ? 109 LYS A CB  1 
ATOM   866  C CG  . LYS A 1 109 ? -4.481  27.612 5.507   1.00 35.79 ? 109 LYS A CG  1 
ATOM   867  C CD  . LYS A 1 109 ? -3.485  26.571 5.138   1.00 35.79 ? 109 LYS A CD  1 
ATOM   868  C CE  . LYS A 1 109 ? -2.380  26.503 6.141   1.00 35.79 ? 109 LYS A CE  1 
ATOM   869  N NZ  . LYS A 1 109 ? -1.451  25.419 5.706   1.00 35.79 ? 109 LYS A NZ  1 
ATOM   870  N N   . VAL A 1 110 ? -7.293  26.379 2.076   1.00 23.81 ? 110 VAL A N   1 
ATOM   871  C CA  . VAL A 1 110 ? -8.600  26.292 1.440   1.00 23.81 ? 110 VAL A CA  1 
ATOM   872  C C   . VAL A 1 110 ? -9.400  25.340 2.311   1.00 23.81 ? 110 VAL A C   1 
ATOM   873  O O   . VAL A 1 110 ? -8.823  24.513 3.031   1.00 23.81 ? 110 VAL A O   1 
ATOM   874  C CB  . VAL A 1 110 ? -8.542  25.719 0.006   1.00 23.81 ? 110 VAL A CB  1 
ATOM   875  C CG1 . VAL A 1 110 ? -7.667  26.569 -0.845  1.00 31.40 ? 110 VAL A CG1 1 
ATOM   876  C CG2 . VAL A 1 110 ? -8.014  24.325 0.018   1.00 31.40 ? 110 VAL A CG2 1 
ATOM   877  N N   . GLU A 1 111 ? -10.713 25.503 2.303   1.00 17.38 ? 111 GLU A N   1 
ATOM   878  C CA  . GLU A 1 111 ? -11.591 24.639 3.065   1.00 17.38 ? 111 GLU A CA  1 
ATOM   879  C C   . GLU A 1 111 ? -12.686 24.259 2.103   1.00 17.38 ? 111 GLU A C   1 
ATOM   880  O O   . GLU A 1 111 ? -13.080 25.071 1.256   1.00 17.38 ? 111 GLU A O   1 
ATOM   881  C CB  . GLU A 1 111 ? -12.174 25.381 4.237   1.00 17.38 ? 111 GLU A CB  1 
ATOM   882  C CG  . GLU A 1 111 ? -11.120 25.884 5.141   1.00 22.27 ? 111 GLU A CG  1 
ATOM   883  C CD  . GLU A 1 111 ? -11.674 26.709 6.250   1.00 22.27 ? 111 GLU A CD  1 
ATOM   884  O OE1 . GLU A 1 111 ? -12.891 26.956 6.272   1.00 22.27 ? 111 GLU A OE1 1 
ATOM   885  O OE2 . GLU A 1 111 ? -10.902 27.120 7.117   1.00 22.27 ? 111 GLU A OE2 1 
ATOM   886  N N   . PHE A 1 112 ? -13.166 23.032 2.203   1.00 10.49 ? 112 PHE A N   1 
ATOM   887  C CA  . PHE A 1 112 ? -14.202 22.586 1.305   1.00 10.49 ? 112 PHE A CA  1 
ATOM   888  C C   . PHE A 1 112 ? -15.433 22.220 2.105   1.00 10.49 ? 112 PHE A C   1 
ATOM   889  O O   . PHE A 1 112 ? -15.467 21.210 2.817   1.00 10.49 ? 112 PHE A O   1 
ATOM   890  C CB  . PHE A 1 112 ? -13.700 21.383 0.520   1.00 10.49 ? 112 PHE A CB  1 
ATOM   891  C CG  . PHE A 1 112 ? -12.452 21.651 -0.275  1.00 8.15  ? 112 PHE A CG  1 
ATOM   892  C CD1 . PHE A 1 112 ? -12.535 22.158 -1.576  1.00 8.15  ? 112 PHE A CD1 1 
ATOM   893  C CD2 . PHE A 1 112 ? -11.194 21.378 0.268   1.00 8.15  ? 112 PHE A CD2 1 
ATOM   894  C CE1 . PHE A 1 112 ? -11.376 22.384 -2.318  1.00 8.15  ? 112 PHE A CE1 1 
ATOM   895  C CE2 . PHE A 1 112 ? -10.035 21.601 -0.471  1.00 8.15  ? 112 PHE A CE2 1 
ATOM   896  C CZ  . PHE A 1 112 ? -10.128 22.106 -1.767  1.00 8.15  ? 112 PHE A CZ  1 
ATOM   897  N N   . GLU A 1 113 ? -16.452 23.044 1.999   1.00 15.84 ? 113 GLU A N   1 
ATOM   898  C CA  . GLU A 1 113 ? -17.666 22.798 2.740   1.00 15.84 ? 113 GLU A CA  1 
ATOM   899  C C   . GLU A 1 113 ? -18.619 22.005 1.894   1.00 15.84 ? 113 GLU A C   1 
ATOM   900  O O   . GLU A 1 113 ? -18.671 22.202 0.696   1.00 15.84 ? 113 GLU A O   1 
ATOM   901  C CB  . GLU A 1 113 ? -18.296 24.134 3.110   1.00 15.84 ? 113 GLU A CB  1 
ATOM   902  C CG  . GLU A 1 113 ? -19.585 24.007 3.857   1.00 22.48 ? 113 GLU A CG  1 
ATOM   903  C CD  . GLU A 1 113 ? -20.244 25.327 4.092   1.00 22.48 ? 113 GLU A CD  1 
ATOM   904  O OE1 . GLU A 1 113 ? -20.462 26.043 3.092   1.00 22.48 ? 113 GLU A OE1 1 
ATOM   905  O OE2 . GLU A 1 113 ? -20.560 25.640 5.265   1.00 22.48 ? 113 GLU A OE2 1 
ATOM   906  N N   . SER A 1 114 ? -19.366 21.091 2.483   1.00 15.52 ? 114 SER A N   1 
ATOM   907  C CA  . SER A 1 114 ? -20.315 20.349 1.681   1.00 15.52 ? 114 SER A CA  1 
ATOM   908  C C   . SER A 1 114 ? -21.459 21.296 1.345   1.00 15.52 ? 114 SER A C   1 
ATOM   909  O O   . SER A 1 114 ? -21.924 22.046 2.207   1.00 15.52 ? 114 SER A O   1 
ATOM   910  C CB  . SER A 1 114 ? -20.854 19.155 2.437   1.00 15.52 ? 114 SER A CB  1 
ATOM   911  O OG  . SER A 1 114 ? -21.843 18.523 1.654   1.00 13.74 ? 114 SER A OG  1 
ATOM   912  N N   . ALA A 1 115 ? -21.875 21.306 0.081   1.00 26.59 ? 115 ALA A N   1 
ATOM   913  C CA  . ALA A 1 115 ? -22.976 22.166 -0.351  1.00 26.59 ? 115 ALA A CA  1 
ATOM   914  C C   . ALA A 1 115 ? -24.269 21.597 0.203   1.00 26.59 ? 115 ALA A C   1 
ATOM   915  O O   . ALA A 1 115 ? -25.166 22.319 0.621   1.00 26.59 ? 115 ALA A O   1 
ATOM   916  C CB  . ALA A 1 115 ? -23.039 22.202 -1.858  1.00 26.59 ? 115 ALA A CB  1 
ATOM   917  N N   . GLU A 1 116 ? -24.340 20.277 0.193   1.00 31.68 ? 116 GLU A N   1 
ATOM   918  C CA  . GLU A 1 116 ? -25.484 19.537 0.672   1.00 31.68 ? 116 GLU A CA  1 
ATOM   919  C C   . GLU A 1 116 ? -25.637 19.711 2.168   1.00 31.68 ? 116 GLU A C   1 
ATOM   920  O O   . GLU A 1 116 ? -26.715 19.997 2.654   1.00 31.68 ? 116 GLU A O   1 
ATOM   921  C CB  . GLU A 1 116 ? -25.281 18.061 0.355   1.00 31.68 ? 116 GLU A CB  1 
ATOM   922  C CG  . GLU A 1 116 ? -26.448 17.185 0.720   1.00 44.02 ? 116 GLU A CG  1 
ATOM   923  C CD  . GLU A 1 116 ? -27.459 17.073 -0.397  1.00 44.02 ? 116 GLU A CD  1 
ATOM   924  O OE1 . GLU A 1 116 ? -28.088 18.096 -0.751  1.00 44.02 ? 116 GLU A OE1 1 
ATOM   925  O OE2 . GLU A 1 116 ? -27.612 15.946 -0.919  1.00 44.02 ? 116 GLU A OE2 1 
ATOM   926  N N   . PHE A 1 117 ? -24.550 19.506 2.901   1.00 24.17 ? 117 PHE A N   1 
ATOM   927  C CA  . PHE A 1 117 ? -24.555 19.625 4.352   1.00 24.17 ? 117 PHE A CA  1 
ATOM   928  C C   . PHE A 1 117 ? -23.680 20.780 4.769   1.00 24.17 ? 117 PHE A C   1 
ATOM   929  O O   . PHE A 1 117 ? -22.497 20.605 5.030   1.00 24.17 ? 117 PHE A O   1 
ATOM   930  C CB  . PHE A 1 117 ? -24.033 18.342 4.992   1.00 24.17 ? 117 PHE A CB  1 
ATOM   931  C CG  . PHE A 1 117 ? -24.835 17.137 4.644   1.00 24.01 ? 117 PHE A CG  1 
ATOM   932  C CD1 . PHE A 1 117 ? -26.054 16.907 5.248   1.00 24.01 ? 117 PHE A CD1 1 
ATOM   933  C CD2 . PHE A 1 117 ? -24.396 16.255 3.684   1.00 24.01 ? 117 PHE A CD2 1 
ATOM   934  C CE1 . PHE A 1 117 ? -26.831 15.810 4.889   1.00 24.01 ? 117 PHE A CE1 1 
ATOM   935  C CE2 . PHE A 1 117 ? -25.166 15.160 3.322   1.00 24.01 ? 117 PHE A CE2 1 
ATOM   936  C CZ  . PHE A 1 117 ? -26.386 14.939 3.925   1.00 24.01 ? 117 PHE A CZ  1 
ATOM   937  N N   . PRO A 1 118 ? -24.249 21.989 4.803   1.00 21.88 ? 118 PRO A N   1 
ATOM   938  C CA  . PRO A 1 118 ? -23.588 23.237 5.179   1.00 21.88 ? 118 PRO A CA  1 
ATOM   939  C C   . PRO A 1 118 ? -22.958 23.073 6.552   1.00 21.88 ? 118 PRO A C   1 
ATOM   940  O O   . PRO A 1 118 ? -23.543 22.435 7.412   1.00 21.88 ? 118 PRO A O   1 
ATOM   941  C CB  . PRO A 1 118 ? -24.754 24.196 5.234   1.00 21.88 ? 118 PRO A CB  1 
ATOM   942  C CG  . PRO A 1 118 ? -25.636 23.694 4.161   1.00 15.66 ? 118 PRO A CG  1 
ATOM   943  C CD  . PRO A 1 118 ? -25.653 22.240 4.458   1.00 15.66 ? 118 PRO A CD  1 
ATOM   944  N N   . ASN A 1 119 ? -21.762 23.620 6.744   1.00 32.40 ? 119 ASN A N   1 
ATOM   945  C CA  . ASN A 1 119 ? -21.032 23.512 8.007   1.00 32.40 ? 119 ASN A CA  1 
ATOM   946  C C   . ASN A 1 119 ? -20.298 22.184 8.177   1.00 32.40 ? 119 ASN A C   1 
ATOM   947  O O   . ASN A 1 119 ? -19.781 21.886 9.256   1.00 32.40 ? 119 ASN A O   1 
ATOM   948  C CB  . ASN A 1 119 ? -21.946 23.722 9.206   1.00 32.40 ? 119 ASN A CB  1 
ATOM   949  C CG  . ASN A 1 119 ? -22.550 25.076 9.228   1.00 36.48 ? 119 ASN A CG  1 
ATOM   950  O OD1 . ASN A 1 119 ? -22.040 26.008 8.611   1.00 36.48 ? 119 ASN A OD1 1 
ATOM   951  N ND2 . ASN A 1 119 ? -23.639 25.209 9.946   1.00 36.48 ? 119 ASN A ND2 1 
ATOM   952  N N   . TRP A 1 120 ? -20.296 21.360 7.142   1.00 14.92 ? 120 TRP A N   1 
ATOM   953  C CA  . TRP A 1 120 ? -19.594 20.105 7.218   1.00 14.92 ? 120 TRP A CA  1 
ATOM   954  C C   . TRP A 1 120 ? -18.477 20.201 6.205   1.00 14.92 ? 120 TRP A C   1 
ATOM   955  O O   . TRP A 1 120 ? -18.708 20.631 5.079   1.00 14.92 ? 120 TRP A O   1 
ATOM   956  C CB  . TRP A 1 120 ? -20.547 18.952 6.952   1.00 14.92 ? 120 TRP A CB  1 
ATOM   957  C CG  . TRP A 1 120 ? -21.457 18.799 8.094   1.00 24.38 ? 120 TRP A CG  1 
ATOM   958  C CD1 . TRP A 1 120 ? -22.423 19.671 8.476   1.00 24.38 ? 120 TRP A CD1 1 
ATOM   959  C CD2 . TRP A 1 120 ? -21.421 17.773 9.091   1.00 24.38 ? 120 TRP A CD2 1 
ATOM   960  N NE1 . TRP A 1 120 ? -22.985 19.265 9.661   1.00 24.38 ? 120 TRP A NE1 1 
ATOM   961  C CE2 . TRP A 1 120 ? -22.390 18.100 10.059  1.00 24.38 ? 120 TRP A CE2 1 
ATOM   962  C CE3 . TRP A 1 120 ? -20.653 16.619 9.270   1.00 24.38 ? 120 TRP A CE3 1 
ATOM   963  C CZ2 . TRP A 1 120 ? -22.617 17.313 11.193  1.00 24.38 ? 120 TRP A CZ2 1 
ATOM   964  C CZ3 . TRP A 1 120 ? -20.874 15.832 10.409  1.00 24.38 ? 120 TRP A CZ3 1 
ATOM   965  C CH2 . TRP A 1 120 ? -21.850 16.187 11.351  1.00 24.38 ? 120 TRP A CH2 1 
ATOM   966  N N   . TYR A 1 121 ? -17.262 19.859 6.631   1.00 19.11 ? 121 TYR A N   1 
ATOM   967  C CA  . TYR A 1 121 ? -16.083 19.965 5.789   1.00 19.11 ? 121 TYR A CA  1 
ATOM   968  C C   . TYR A 1 121 ? -15.343 18.669 5.596   1.00 19.11 ? 121 TYR A C   1 
ATOM   969  O O   . TYR A 1 121 ? -15.397 17.769 6.441   1.00 19.11 ? 121 TYR A O   1 
ATOM   970  C CB  . TYR A 1 121 ? -15.074 20.929 6.425   1.00 19.11 ? 121 TYR A CB  1 
ATOM   971  C CG  . TYR A 1 121 ? -15.644 22.245 6.849   1.00 22.49 ? 121 TYR A CG  1 
ATOM   972  C CD1 . TYR A 1 121 ? -16.455 22.344 7.978   1.00 22.49 ? 121 TYR A CD1 1 
ATOM   973  C CD2 . TYR A 1 121 ? -15.438 23.380 6.082   1.00 22.49 ? 121 TYR A CD2 1 
ATOM   974  C CE1 . TYR A 1 121 ? -17.064 23.544 8.327   1.00 22.49 ? 121 TYR A CE1 1 
ATOM   975  C CE2 . TYR A 1 121 ? -16.033 24.592 6.415   1.00 22.49 ? 121 TYR A CE2 1 
ATOM   976  C CZ  . TYR A 1 121 ? -16.848 24.671 7.539   1.00 22.49 ? 121 TYR A CZ  1 
ATOM   977  O OH  . TYR A 1 121 ? -17.432 25.881 7.865   1.00 22.49 ? 121 TYR A OH  1 
ATOM   978  N N   . ILE A 1 122 ? -14.618 18.609 4.480   1.00 14.11 ? 122 ILE A N   1 
ATOM   979  C CA  . ILE A 1 122 ? -13.751 17.485 4.153   1.00 14.11 ? 122 ILE A CA  1 
ATOM   980  C C   . ILE A 1 122 ? -12.716 17.744 5.236   1.00 14.11 ? 122 ILE A C   1 
ATOM   981  O O   . ILE A 1 122 ? -12.149 18.843 5.279   1.00 14.11 ? 122 ILE A O   1 
ATOM   982  C CB  . ILE A 1 122 ? -13.064 17.689 2.769   1.00 14.11 ? 122 ILE A CB  1 
ATOM   983  C CG1 . ILE A 1 122 ? -14.047 17.437 1.634   1.00 8.89  ? 122 ILE A CG1 1 
ATOM   984  C CG2 . ILE A 1 122 ? -11.859 16.783 2.617   1.00 8.89  ? 122 ILE A CG2 1 
ATOM   985  C CD1 . ILE A 1 122 ? -13.415 17.476 0.262   1.00 8.89  ? 122 ILE A CD1 1 
ATOM   986  N N   . SER A 1 123 ? -12.514 16.786 6.136   1.00 16.83 ? 123 SER A N   1 
ATOM   987  C CA  . SER A 1 123 ? -11.563 16.969 7.234   1.00 16.83 ? 123 SER A CA  1 
ATOM   988  C C   . SER A 1 123 ? -10.645 15.766 7.409   1.00 16.83 ? 123 SER A C   1 
ATOM   989  O O   . SER A 1 123 ? -10.913 14.678 6.873   1.00 16.83 ? 123 SER A O   1 
ATOM   990  C CB  . SER A 1 123 ? -12.309 17.174 8.557   1.00 16.83 ? 123 SER A CB  1 
ATOM   991  O OG  . SER A 1 123 ? -13.572 17.781 8.368   1.00 12.26 ? 123 SER A OG  1 
ATOM   992  N N   . THR A 1 124 ? -9.539  15.974 8.123   1.00 7.82  ? 124 THR A N   1 
ATOM   993  C CA  . THR A 1 124 ? -8.624  14.884 8.436   1.00 7.82  ? 124 THR A CA  1 
ATOM   994  C C   . THR A 1 124 ? -8.446  14.912 9.945   1.00 7.82  ? 124 THR A C   1 
ATOM   995  O O   . THR A 1 124 ? -8.693  15.941 10.599  1.00 7.82  ? 124 THR A O   1 
ATOM   996  C CB  . THR A 1 124 ? -7.270  15.064 7.815   1.00 7.82  ? 124 THR A CB  1 
ATOM   997  O OG1 . THR A 1 124 ? -6.794  16.378 8.132   1.00 11.98 ? 124 THR A OG1 1 
ATOM   998  C CG2 . THR A 1 124 ? -7.339  14.842 6.305   1.00 11.98 ? 124 THR A CG2 1 
ATOM   999  N N   . SER A 1 125 ? -8.051  13.777 10.496  1.00 26.54 ? 125 SER A N   1 
ATOM   1000 C CA  . SER A 1 125 ? -7.832  13.673 11.921  1.00 26.54 ? 125 SER A CA  1 
ATOM   1001 C C   . SER A 1 125 ? -6.389  14.036 12.229  1.00 26.54 ? 125 SER A C   1 
ATOM   1002 O O   . SER A 1 125 ? -5.597  14.252 11.315  1.00 26.54 ? 125 SER A O   1 
ATOM   1003 C CB  . SER A 1 125 ? -8.155  12.252 12.393  1.00 26.54 ? 125 SER A CB  1 
ATOM   1004 O OG  . SER A 1 125 ? -7.471  11.286 11.615  1.00 42.07 ? 125 SER A OG  1 
ATOM   1005 N N   . GLN A 1 126 ? -6.061  14.130 13.513  1.00 37.80 ? 126 GLN A N   1 
ATOM   1006 C CA  . GLN A 1 126 ? -4.708  14.463 13.935  1.00 37.80 ? 126 GLN A CA  1 
ATOM   1007 C C   . GLN A 1 126 ? -3.748  13.303 13.714  1.00 37.80 ? 126 GLN A C   1 
ATOM   1008 O O   . GLN A 1 126 ? -2.592  13.494 13.336  1.00 37.80 ? 126 GLN A O   1 
ATOM   1009 C CB  . GLN A 1 126 ? -4.707  14.833 15.409  1.00 37.80 ? 126 GLN A CB  1 
ATOM   1010 C CG  . GLN A 1 126 ? -5.285  16.184 15.683  1.00 65.54 ? 126 GLN A CG  1 
ATOM   1011 C CD  . GLN A 1 126 ? -4.427  17.284 15.114  1.00 65.54 ? 126 GLN A CD  1 
ATOM   1012 O OE1 . GLN A 1 126 ? -3.242  17.077 14.857  1.00 65.54 ? 126 GLN A OE1 1 
ATOM   1013 N NE2 . GLN A 1 126 ? -5.013  18.462 14.911  1.00 65.54 ? 126 GLN A NE2 1 
ATOM   1014 N N   . ALA A 1 127 ? -4.247  12.094 13.946  1.00 25.24 ? 127 ALA A N   1 
ATOM   1015 C CA  . ALA A 1 127 ? -3.465  10.872 13.813  1.00 25.24 ? 127 ALA A CA  1 
ATOM   1016 C C   . ALA A 1 127 ? -3.182  10.476 12.372  1.00 25.24 ? 127 ALA A C   1 
ATOM   1017 O O   . ALA A 1 127 ? -3.773  11.009 11.447  1.00 25.24 ? 127 ALA A O   1 
ATOM   1018 C CB  . ALA A 1 127 ? -4.182  9.757  14.517  1.00 25.24 ? 127 ALA A CB  1 
ATOM   1019 N N   . GLU A 1 128 ? -2.287  9.526  12.169  1.00 36.15 ? 128 GLU A N   1 
ATOM   1020 C CA  . GLU A 1 128 ? -1.996  9.105  10.817  1.00 36.15 ? 128 GLU A CA  1 
ATOM   1021 C C   . GLU A 1 128 ? -2.844  7.932  10.400  1.00 36.15 ? 128 GLU A C   1 
ATOM   1022 O O   . GLU A 1 128 ? -3.431  7.265  11.239  1.00 36.15 ? 128 GLU A O   1 
ATOM   1023 C CB  . GLU A 1 128 ? -0.546  8.725  10.692  1.00 36.15 ? 128 GLU A CB  1 
ATOM   1024 C CG  . GLU A 1 128 ? 0.352   9.882  10.612  1.00 45.39 ? 128 GLU A CG  1 
ATOM   1025 C CD  . GLU A 1 128 ? 1.694   9.425  10.221  1.00 45.39 ? 128 GLU A CD  1 
ATOM   1026 O OE1 . GLU A 1 128 ? 1.893   9.123  9.029   1.00 45.39 ? 128 GLU A OE1 1 
ATOM   1027 O OE2 . GLU A 1 128 ? 2.541   9.301  11.120  1.00 45.39 ? 128 GLU A OE2 1 
ATOM   1028 N N   . HIS A 1 129 ? -2.911  7.686  9.099   1.00 43.26 ? 129 HIS A N   1 
ATOM   1029 C CA  . HIS A 1 129 ? -3.654  6.558  8.553   1.00 43.26 ? 129 HIS A CA  1 
ATOM   1030 C C   . HIS A 1 129 ? -5.140  6.580  8.769   1.00 43.26 ? 129 HIS A C   1 
ATOM   1031 O O   . HIS A 1 129 ? -5.823  5.617  8.436   1.00 43.26 ? 129 HIS A O   1 
ATOM   1032 C CB  . HIS A 1 129 ? -3.115  5.234  9.084   1.00 43.26 ? 129 HIS A CB  1 
ATOM   1033 C CG  . HIS A 1 129 ? -1.659  5.038  8.826   1.00 62.90 ? 129 HIS A CG  1 
ATOM   1034 N ND1 . HIS A 1 129 ? -1.117  5.085  7.560   1.00 62.90 ? 129 HIS A ND1 1 
ATOM   1035 C CD2 . HIS A 1 129 ? -0.624  4.836  9.675   1.00 62.90 ? 129 HIS A CD2 1 
ATOM   1036 C CE1 . HIS A 1 129 ? 0.192   4.925  7.641   1.00 62.90 ? 129 HIS A CE1 1 
ATOM   1037 N NE2 . HIS A 1 129 ? 0.517   4.773  8.913   1.00 62.90 ? 129 HIS A NE2 1 
ATOM   1038 N N   . LYS A 1 130 ? -5.660  7.632  9.365   1.00 35.21 ? 130 LYS A N   1 
ATOM   1039 C CA  . LYS A 1 130 ? -7.086  7.654  9.536   1.00 35.21 ? 130 LYS A CA  1 
ATOM   1040 C C   . LYS A 1 130 ? -7.652  8.223  8.262   1.00 35.21 ? 130 LYS A C   1 
ATOM   1041 O O   . LYS A 1 130 ? -6.994  8.990  7.574   1.00 35.21 ? 130 LYS A O   1 
ATOM   1042 C CB  . LYS A 1 130 ? -7.491  8.467  10.754  1.00 35.21 ? 130 LYS A CB  1 
ATOM   1043 C CG  . LYS A 1 130 ? -7.019  7.835  12.045  1.00 90.54 ? 130 LYS A CG  1 
ATOM   1044 C CD  . LYS A 1 130 ? -8.093  7.885  13.113  1.00 90.54 ? 130 LYS A CD  1 
ATOM   1045 C CE  . LYS A 1 130 ? -9.341  7.082  12.704  1.00 90.54 ? 130 LYS A CE  1 
ATOM   1046 N NZ  . LYS A 1 130 ? -10.297 6.839  13.849  1.00 90.54 ? 130 LYS A NZ  1 
ATOM   1047 N N   . PRO A 1 131 ? -8.821  7.738  7.856   1.00 24.87 ? 131 PRO A N   1 
ATOM   1048 C CA  . PRO A 1 131 ? -9.485  8.195  6.646   1.00 24.87 ? 131 PRO A CA  1 
ATOM   1049 C C   . PRO A 1 131 ? -9.974  9.638  6.722   1.00 24.87 ? 131 PRO A C   1 
ATOM   1050 O O   . PRO A 1 131 ? -10.268 10.163 7.811   1.00 24.87 ? 131 PRO A O   1 
ATOM   1051 C CB  . PRO A 1 131 ? -10.648 7.205  6.511   1.00 24.87 ? 131 PRO A CB  1 
ATOM   1052 C CG  . PRO A 1 131 ? -10.946 6.848  7.886   1.00 18.73 ? 131 PRO A CG  1 
ATOM   1053 C CD  . PRO A 1 131 ? -9.575  6.626  8.449   1.00 18.73 ? 131 PRO A CD  1 
ATOM   1054 N N   . VAL A 1 132 ? -9.972  10.283 5.555   1.00 21.25 ? 132 VAL A N   1 
ATOM   1055 C CA  . VAL A 1 132 ? -10.426 11.659 5.378   1.00 21.25 ? 132 VAL A CA  1 
ATOM   1056 C C   . VAL A 1 132 ? -11.936 11.522 5.551   1.00 21.25 ? 132 VAL A C   1 
ATOM   1057 O O   . VAL A 1 132 ? -12.503 10.533 5.088   1.00 21.25 ? 132 VAL A O   1 
ATOM   1058 C CB  . VAL A 1 132 ? -10.096 12.100 3.950   1.00 21.25 ? 132 VAL A CB  1 
ATOM   1059 C CG1 . VAL A 1 132 ? -10.744 13.393 3.617   1.00 9.41  ? 132 VAL A CG1 1 
ATOM   1060 C CG2 . VAL A 1 132 ? -8.611  12.191 3.785   1.00 9.41  ? 132 VAL A CG2 1 
ATOM   1061 N N   . PHE A 1 133 ? -12.588 12.475 6.206   1.00 13.64 ? 133 PHE A N   1 
ATOM   1062 C CA  . PHE A 1 133 ? -14.028 12.381 6.438   1.00 13.64 ? 133 PHE A CA  1 
ATOM   1063 C C   . PHE A 1 133 ? -14.780 13.708 6.339   1.00 13.64 ? 133 PHE A C   1 
ATOM   1064 O O   . PHE A 1 133 ? -14.175 14.763 6.129   1.00 13.64 ? 133 PHE A O   1 
ATOM   1065 C CB  . PHE A 1 133 ? -14.262 11.792 7.824   1.00 13.64 ? 133 PHE A CB  1 
ATOM   1066 C CG  . PHE A 1 133 ? -13.526 12.511 8.915   1.00 12.84 ? 133 PHE A CG  1 
ATOM   1067 C CD1 . PHE A 1 133 ? -12.161 12.296 9.114   1.00 12.84 ? 133 PHE A CD1 1 
ATOM   1068 C CD2 . PHE A 1 133 ? -14.180 13.418 9.739   1.00 12.84 ? 133 PHE A CD2 1 
ATOM   1069 C CE1 . PHE A 1 133 ? -11.462 12.989 10.129  1.00 12.84 ? 133 PHE A CE1 1 
ATOM   1070 C CE2 . PHE A 1 133 ? -13.490 14.115 10.755  1.00 12.84 ? 133 PHE A CE2 1 
ATOM   1071 C CZ  . PHE A 1 133 ? -12.142 13.902 10.946  1.00 12.84 ? 133 PHE A CZ  1 
ATOM   1072 N N   . LEU A 1 134 ? -16.101 13.662 6.514   1.00 21.63 ? 134 LEU A N   1 
ATOM   1073 C CA  . LEU A 1 134 ? -16.923 14.874 6.492   1.00 21.63 ? 134 LEU A CA  1 
ATOM   1074 C C   . LEU A 1 134 ? -17.150 15.215 7.955   1.00 21.63 ? 134 LEU A C   1 
ATOM   1075 O O   . LEU A 1 134 ? -17.982 14.600 8.616   1.00 21.63 ? 134 LEU A O   1 
ATOM   1076 C CB  . LEU A 1 134 ? -18.264 14.607 5.808   1.00 21.63 ? 134 LEU A CB  1 
ATOM   1077 C CG  . LEU A 1 134 ? -19.072 15.853 5.476   1.00 17.62 ? 134 LEU A CG  1 
ATOM   1078 C CD1 . LEU A 1 134 ? -18.192 16.743 4.680   1.00 17.62 ? 134 LEU A CD1 1 
ATOM   1079 C CD2 . LEU A 1 134 ? -20.301 15.528 4.682   1.00 17.62 ? 134 LEU A CD2 1 
ATOM   1080 N N   . GLY A 1 135 ? -16.353 16.117 8.498   1.00 26.55 ? 135 GLY A N   1 
ATOM   1081 C CA  . GLY A 1 135 ? -16.526 16.455 9.896   1.00 26.55 ? 135 GLY A CA  1 
ATOM   1082 C C   . GLY A 1 135 ? -17.182 17.803 9.974   1.00 26.55 ? 135 GLY A C   1 
ATOM   1083 O O   . GLY A 1 135 ? -17.517 18.369 8.936   1.00 26.55 ? 135 GLY A O   1 
ATOM   1084 N N   . ASN A 1 136 ? -17.363 18.334 11.176  1.00 43.31 ? 136 ASN A N   1 
ATOM   1085 C CA  . ASN A 1 136 ? -17.978 19.646 11.301  1.00 43.31 ? 136 ASN A CA  1 
ATOM   1086 C C   . ASN A 1 136 ? -17.071 20.639 11.972  1.00 43.31 ? 136 ASN A C   1 
ATOM   1087 O O   . ASN A 1 136 ? -17.529 21.690 12.401  1.00 43.31 ? 136 ASN A O   1 
ATOM   1088 C CB  . ASN A 1 136 ? -19.313 19.589 12.048  1.00 43.31 ? 136 ASN A CB  1 
ATOM   1089 C CG  . ASN A 1 136 ? -19.155 19.193 13.498  1.00 71.11 ? 136 ASN A CG  1 
ATOM   1090 O OD1 . ASN A 1 136 ? -19.549 18.093 13.897  1.00 71.11 ? 136 ASN A OD1 1 
ATOM   1091 N ND2 . ASN A 1 136 ? -18.597 20.089 14.304  1.00 71.11 ? 136 ASN A ND2 1 
ATOM   1092 N N   . ASN A 1 137 ? -15.793 20.299 12.081  1.00 62.04 ? 137 ASN A N   1 
ATOM   1093 C CA  . ASN A 1 137 ? -14.803 21.178 12.699  1.00 62.04 ? 137 ASN A CA  1 
ATOM   1094 C C   . ASN A 1 137 ? -14.896 21.195 14.234  1.00 62.04 ? 137 ASN A C   1 
ATOM   1095 O O   . ASN A 1 137 ? -15.427 22.132 14.837  1.00 62.04 ? 137 ASN A O   1 
ATOM   1096 C CB  . ASN A 1 137 ? -14.923 22.593 12.117  1.00 62.04 ? 137 ASN A CB  1 
ATOM   1097 C CG  . ASN A 1 137 ? -13.788 23.495 12.529  1.00 78.79 ? 137 ASN A CG  1 
ATOM   1098 O OD1 . ASN A 1 137 ? -13.961 24.706 12.640  1.00 78.79 ? 137 ASN A OD1 1 
ATOM   1099 N ND2 . ASN A 1 137 ? -12.604 22.921 12.716  1.00 78.79 ? 137 ASN A ND2 1 
ATOM   1100 N N   . SER A 1 138 ? -14.337 20.160 14.857  1.00 98.54 ? 138 SER A N   1 
ATOM   1101 C CA  . SER A 1 138 ? -14.355 20.031 16.307  1.00 98.54 ? 138 SER A CA  1 
ATOM   1102 C C   . SER A 1 138 ? -13.115 19.320 16.852  1.00 98.54 ? 138 SER A C   1 
ATOM   1103 O O   . SER A 1 138 ? -12.952 18.117 16.652  1.00 98.54 ? 138 SER A O   1 
ATOM   1104 C CB  . SER A 1 138 ? -15.605 19.259 16.741  1.00 98.54 ? 138 SER A CB  1 
ATOM   1105 O OG  . SER A 1 138 ? -16.787 19.919 16.333  1.00 82.35 ? 138 SER A OG  1 
ATOM   1106 N N   . GLY A 1 139 ? -12.237 20.072 17.516  1.00 99.99 ? 140 GLY A N   1 
ATOM   1107 C CA  . GLY A 1 139 ? -11.043 19.495 18.120  1.00 99.99 ? 140 GLY A CA  1 
ATOM   1108 C C   . GLY A 1 139 ? -10.007 18.887 17.193  1.00 99.99 ? 140 GLY A C   1 
ATOM   1109 O O   . GLY A 1 139 ? -9.413  19.595 16.380  1.00 99.99 ? 140 GLY A O   1 
ATOM   1110 N N   . GLN A 1 140 ? -9.788  17.578 17.313  1.00 99.99 ? 141 GLN A N   1 
ATOM   1111 C CA  . GLN A 1 140 ? -8.812  16.863 16.483  1.00 99.99 ? 141 GLN A CA  1 
ATOM   1112 C C   . GLN A 1 140 ? -9.188  16.845 15.000  1.00 99.99 ? 141 GLN A C   1 
ATOM   1113 O O   . GLN A 1 140 ? -8.783  15.940 14.269  1.00 99.99 ? 141 GLN A O   1 
ATOM   1114 C CB  . GLN A 1 140 ? -8.630  15.407 16.960  1.00 99.99 ? 141 GLN A CB  1 
ATOM   1115 C CG  . GLN A 1 140 ? -7.726  15.187 18.194  1.00 99.99 ? 141 GLN A CG  1 
ATOM   1116 C CD  . GLN A 1 140 ? -7.263  13.722 18.344  1.00 99.99 ? 141 GLN A CD  1 
ATOM   1117 O OE1 . GLN A 1 140 ? -6.885  13.068 17.361  1.00 99.99 ? 141 GLN A OE1 1 
ATOM   1118 N NE2 . GLN A 1 140 ? -7.283  13.213 19.577  1.00 99.99 ? 141 GLN A NE2 1 
ATOM   1119 N N   . ASP A 1 141 ? -9.965  17.828 14.562  1.00 43.50 ? 142 ASP A N   1 
ATOM   1120 C CA  . ASP A 1 141 ? -10.390 17.910 13.180  1.00 43.50 ? 142 ASP A CA  1 
ATOM   1121 C C   . ASP A 1 141 ? -9.662  19.027 12.455  1.00 43.50 ? 142 ASP A C   1 
ATOM   1122 O O   . ASP A 1 141 ? -9.727  20.200 12.855  1.00 43.50 ? 142 ASP A O   1 
ATOM   1123 C CB  . ASP A 1 141 ? -11.904 18.140 13.084  1.00 43.50 ? 142 ASP A CB  1 
ATOM   1124 C CG  . ASP A 1 141 ? -12.719 16.927 13.532  1.00 52.92 ? 142 ASP A CG  1 
ATOM   1125 O OD1 . ASP A 1 141 ? -12.124 15.847 13.772  1.00 52.92 ? 142 ASP A OD1 1 
ATOM   1126 O OD2 . ASP A 1 141 ? -13.960 17.052 13.646  1.00 52.92 ? 142 ASP A OD2 1 
ATOM   1127 N N   . ILE A 1 142 ? -8.938  18.645 11.408  1.00 26.81 ? 143 ILE A N   1 
ATOM   1128 C CA  . ILE A 1 142 ? -8.214  19.589 10.579  1.00 26.81 ? 143 ILE A CA  1 
ATOM   1129 C C   . ILE A 1 142 ? -9.076  19.754 9.338   1.00 26.81 ? 143 ILE A C   1 
ATOM   1130 O O   . ILE A 1 142 ? -9.439  18.748 8.701   1.00 26.81 ? 143 ILE A O   1 
ATOM   1131 C CB  . ILE A 1 142 ? -6.853  19.033 10.208  1.00 26.81 ? 143 ILE A CB  1 
ATOM   1132 C CG1 . ILE A 1 142 ? -5.995  18.953 11.468  1.00 18.50 ? 143 ILE A CG1 1 
ATOM   1133 C CG2 . ILE A 1 142 ? -6.197  19.913 9.174   1.00 18.50 ? 143 ILE A CG2 1 
ATOM   1134 C CD1 . ILE A 1 142 ? -4.874  18.014 11.369  1.00 18.50 ? 143 ILE A CD1 1 
ATOM   1135 N N   . ILE A 1 143 ? -9.485  20.998 9.060   1.00 16.72 ? 144 ILE A N   1 
ATOM   1136 C CA  . ILE A 1 143 ? -10.327 21.280 7.903   1.00 16.72 ? 144 ILE A CA  1 
ATOM   1137 C C   . ILE A 1 143 ? -9.627  22.179 6.904   1.00 16.72 ? 144 ILE A C   1 
ATOM   1138 O O   . ILE A 1 143 ? -10.172 22.466 5.833   1.00 16.72 ? 144 ILE A O   1 
ATOM   1139 C CB  . ILE A 1 143 ? -11.687 21.937 8.275   1.00 16.72 ? 144 ILE A CB  1 
ATOM   1140 C CG1 . ILE A 1 143 ? -11.472 23.350 8.814   1.00 20.22 ? 144 ILE A CG1 1 
ATOM   1141 C CG2 . ILE A 1 143 ? -12.445 21.093 9.286   1.00 20.22 ? 144 ILE A CG2 1 
ATOM   1142 C CD1 . ILE A 1 143 ? -12.768 24.145 9.010   1.00 20.22 ? 144 ILE A CD1 1 
ATOM   1143 N N   . ASP A 1 144 ? -8.426  22.632 7.235   1.00 17.43 ? 145 ASP A N   1 
ATOM   1144 C CA  . ASP A 1 144 ? -7.703  23.500 6.316   1.00 17.43 ? 145 ASP A CA  1 
ATOM   1145 C C   . ASP A 1 144 ? -6.689  22.749 5.496   1.00 17.43 ? 145 ASP A C   1 
ATOM   1146 O O   . ASP A 1 144 ? -5.936  21.946 6.030   1.00 17.43 ? 145 ASP A O   1 
ATOM   1147 C CB  . ASP A 1 144 ? -7.053  24.635 7.076   1.00 17.43 ? 145 ASP A CB  1 
ATOM   1148 C CG  . ASP A 1 144 ? -8.069  25.613 7.592   1.00 13.93 ? 145 ASP A CG  1 
ATOM   1149 O OD1 . ASP A 1 144 ? -8.439  26.513 6.837   1.00 13.93 ? 145 ASP A OD1 1 
ATOM   1150 O OD2 . ASP A 1 144 ? -8.533  25.466 8.730   1.00 13.93 ? 145 ASP A OD2 1 
ATOM   1151 N N   . PHE A 1 145 ? -6.685  23.000 4.193   1.00 15.75 ? 146 PHE A N   1 
ATOM   1152 C CA  . PHE A 1 145 ? -5.771  22.342 3.270   1.00 15.75 ? 146 PHE A CA  1 
ATOM   1153 C C   . PHE A 1 145 ? -4.969  23.332 2.430   1.00 15.75 ? 146 PHE A C   1 
ATOM   1154 O O   . PHE A 1 145 ? -5.344  24.501 2.289   1.00 15.75 ? 146 PHE A O   1 
ATOM   1155 C CB  . PHE A 1 145 ? -6.555  21.439 2.318   1.00 15.75 ? 146 PHE A CB  1 
ATOM   1156 C CG  . PHE A 1 145 ? -7.189  20.266 2.979   1.00 9.47  ? 146 PHE A CG  1 
ATOM   1157 C CD1 . PHE A 1 145 ? -8.356  20.405 3.700   1.00 9.47  ? 146 PHE A CD1 1 
ATOM   1158 C CD2 . PHE A 1 145 ? -6.633  19.013 2.863   1.00 9.47  ? 146 PHE A CD2 1 
ATOM   1159 C CE1 . PHE A 1 145 ? -8.960  19.293 4.296   1.00 9.47  ? 146 PHE A CE1 1 
ATOM   1160 C CE2 . PHE A 1 145 ? -7.227  17.901 3.457   1.00 9.47  ? 146 PHE A CE2 1 
ATOM   1161 C CZ  . PHE A 1 145 ? -8.390  18.039 4.172   1.00 9.47  ? 146 PHE A CZ  1 
ATOM   1162 N N   . THR A 1 146 ? -3.899  22.825 1.836   1.00 23.97 ? 147 THR A N   1 
ATOM   1163 C CA  . THR A 1 146 ? -3.007  23.565 0.955   1.00 23.97 ? 147 THR A CA  1 
ATOM   1164 C C   . THR A 1 146 ? -3.286  22.922 -0.391  1.00 23.97 ? 147 THR A C   1 
ATOM   1165 O O   . THR A 1 146 ? -3.550  21.722 -0.436  1.00 23.97 ? 147 THR A O   1 
ATOM   1166 C CB  . THR A 1 146 ? -1.548  23.230 1.309   1.00 23.97 ? 147 THR A CB  1 
ATOM   1167 O OG1 . THR A 1 146 ? -1.185  23.904 2.508   1.00 29.68 ? 147 THR A OG1 1 
ATOM   1168 C CG2 . THR A 1 146 ? -0.596  23.608 0.211   1.00 29.68 ? 147 THR A CG2 1 
ATOM   1169 N N   . MET A 1 147 ? -3.249  23.683 -1.479  1.00 24.42 ? 148 MET A N   1 
ATOM   1170 C CA  . MET A 1 147 ? -3.467  23.089 -2.796  1.00 24.42 ? 148 MET A CA  1 
ATOM   1171 C C   . MET A 1 147 ? -2.247  23.265 -3.666  1.00 24.42 ? 148 MET A C   1 
ATOM   1172 O O   . MET A 1 147 ? -1.885  24.393 -3.990  1.00 24.42 ? 148 MET A O   1 
ATOM   1173 C CB  . MET A 1 147 ? -4.629  23.729 -3.513  1.00 24.42 ? 148 MET A CB  1 
ATOM   1174 C CG  . MET A 1 147 ? -5.949  23.466 -2.888  1.00 28.21 ? 148 MET A CG  1 
ATOM   1175 S SD  . MET A 1 147 ? -7.169  24.075 -3.996  1.00 28.21 ? 148 MET A SD  1 
ATOM   1176 C CE  . MET A 1 147 ? -6.531  25.720 -4.307  1.00 28.21 ? 148 MET A CE  1 
ATOM   1177 N N   . GLU A 1 148 ? -1.599  22.164 -4.024  1.00 39.12 ? 149 GLU A N   1 
ATOM   1178 C CA  . GLU A 1 148 ? -0.431  22.203 -4.883  1.00 39.12 ? 149 GLU A CA  1 
ATOM   1179 C C   . GLU A 1 148 ? -0.933  21.880 -6.286  1.00 39.12 ? 149 GLU A C   1 
ATOM   1180 O O   . GLU A 1 148 ? -1.612  20.882 -6.496  1.00 39.12 ? 149 GLU A O   1 
ATOM   1181 C CB  . GLU A 1 148 ? 0.600   21.164 -4.414  1.00 39.12 ? 149 GLU A CB  1 
ATOM   1182 C CG  . GLU A 1 148 ? 1.781   20.920 -5.367  1.00 64.14 ? 149 GLU A CG  1 
ATOM   1183 C CD  . GLU A 1 148 ? 2.783   19.890 -4.837  1.00 64.14 ? 149 GLU A CD  1 
ATOM   1184 O OE1 . GLU A 1 148 ? 3.732   20.289 -4.121  1.00 64.14 ? 149 GLU A OE1 1 
ATOM   1185 O OE2 . GLU A 1 148 ? 2.633   18.683 -5.145  1.00 64.14 ? 149 GLU A OE2 1 
ATOM   1186 N N   . SER A 1 149 ? -0.661  22.755 -7.237  1.00 36.13 ? 150 SER A N   1 
ATOM   1187 C CA  . SER A 1 149 ? -1.094  22.518 -8.600  1.00 36.13 ? 150 SER A CA  1 
ATOM   1188 C C   . SER A 1 149 ? -0.215  21.460 -9.280  1.00 36.13 ? 150 SER A C   1 
ATOM   1189 O O   . SER A 1 149 ? 1.009   21.535 -9.242  1.00 36.13 ? 150 SER A O   1 
ATOM   1190 C CB  . SER A 1 149 ? -1.069  23.826 -9.384  1.00 36.13 ? 150 SER A CB  1 
ATOM   1191 O OG  . SER A 1 149 ? -1.583  23.645 -10.691 1.00 62.08 ? 150 SER A OG  1 
ATOM   1192 N N   . VAL A 1 150 ? -0.847  20.444 -9.849  1.00 38.46 ? 151 VAL A N   1 
ATOM   1193 C CA  . VAL A 1 150 ? -0.139  19.372 -10.540 1.00 38.46 ? 151 VAL A CA  1 
ATOM   1194 C C   . VAL A 1 150 ? -0.393  19.687 -12.009 1.00 38.46 ? 151 VAL A C   1 
ATOM   1195 O O   . VAL A 1 150 ? -0.493  20.861 -12.355 1.00 38.46 ? 151 VAL A O   1 
ATOM   1196 C CB  . VAL A 1 150 ? -0.728  18.007 -10.155 1.00 38.46 ? 151 VAL A CB  1 
ATOM   1197 C CG1 . VAL A 1 150 ? 0.132   16.895 -10.672 1.00 42.20 ? 151 VAL A CG1 1 
ATOM   1198 C CG2 . VAL A 1 150 ? -0.849  17.899 -8.642  1.00 42.20 ? 151 VAL A CG2 1 
ATOM   1199 N N   . SER A 1 151 ? -0.519  18.687 -12.875 1.00 99.99 ? 152 SER A N   1 
ATOM   1200 C CA  . SER A 1 151 ? -0.778  18.942 -14.295 1.00 99.99 ? 152 SER A CA  1 
ATOM   1201 C C   . SER A 1 151 ? -1.769  17.926 -14.877 1.00 99.99 ? 152 SER A C   1 
ATOM   1202 O O   . SER A 1 151 ? -2.466  18.283 -15.855 1.00 99.99 ? 152 SER A O   1 
ATOM   1203 C CB  . SER A 1 151 ? 0.532   18.953 -15.108 1.00 99.99 ? 152 SER A CB  1 
ATOM   1204 O OG  . SER A 1 151 ? 1.407   19.985 -14.673 1.00 70.63 ? 152 SER A OG  1 
HETATM 1205 O O   . HOH B 2 .   ? -22.090 17.989 -1.031  1.00 8.91  ? 154 HOH A O   1 
HETATM 1206 O O   . HOH B 2 .   ? 3.046   14.557 3.699   1.00 16.44 ? 155 HOH A O   1 
HETATM 1207 O O   . HOH B 2 .   ? -3.805  14.929 -2.883  1.00 16.55 ? 156 HOH A O   1 
HETATM 1208 O O   . HOH B 2 .   ? -14.069 18.552 10.887  1.00 18.63 ? 157 HOH A O   1 
HETATM 1209 O O   . HOH B 2 .   ? -17.491 10.776 6.386   1.00 19.16 ? 158 HOH A O   1 
HETATM 1210 O O   . HOH B 2 .   ? -7.440  11.783 8.806   1.00 19.53 ? 159 HOH A O   1 
HETATM 1211 O O   . HOH B 2 .   ? -14.421 17.275 -11.875 1.00 21.90 ? 160 HOH A O   1 
HETATM 1212 O O   . HOH B 2 .   ? -18.753 11.973 8.461   1.00 22.48 ? 161 HOH A O   1 
HETATM 1213 O O   . HOH B 2 .   ? -7.797  23.415 10.123  1.00 23.89 ? 162 HOH A O   1 
HETATM 1214 O O   . HOH B 2 .   ? -17.305 16.180 -6.403  1.00 24.56 ? 163 HOH A O   1 
HETATM 1215 O O   . HOH B 2 .   ? -12.730 8.588  2.426   1.00 24.86 ? 164 HOH A O   1 
HETATM 1216 O O   . HOH B 2 .   ? -1.450  14.600 -1.087  1.00 26.25 ? 165 HOH A O   1 
HETATM 1217 O O   . HOH B 2 .   ? -1.522  15.833 12.131  1.00 26.72 ? 166 HOH A O   1 
HETATM 1218 O O   . HOH B 2 .   ? -12.170 21.464 4.329   1.00 27.04 ? 167 HOH A O   1 
HETATM 1219 O O   . HOH B 2 .   ? -26.617 13.201 -0.526  1.00 28.81 ? 168 HOH A O   1 
HETATM 1220 O O   . HOH B 2 .   ? 14.087  8.530  3.822   1.00 28.99 ? 169 HOH A O   1 
HETATM 1221 O O   . HOH B 2 .   ? -27.562 14.832 -4.804  1.00 30.35 ? 170 HOH A O   1 
HETATM 1222 O O   . HOH B 2 .   ? -14.213 23.898 -14.605 1.00 31.28 ? 171 HOH A O   1 
HETATM 1223 O O   . HOH B 2 .   ? -0.423  22.107 4.466   1.00 32.95 ? 172 HOH A O   1 
HETATM 1224 O O   . HOH B 2 .   ? -12.425 27.355 -17.742 1.00 33.99 ? 173 HOH A O   1 
HETATM 1225 O O   . HOH B 2 .   ? -4.963  10.766 9.085   1.00 34.78 ? 174 HOH A O   1 
HETATM 1226 O O   . HOH B 2 .   ? -3.396  22.976 -12.354 1.00 37.35 ? 175 HOH A O   1 
HETATM 1227 O O   . HOH B 2 .   ? 3.046   20.963 1.752   1.00 38.99 ? 176 HOH A O   1 
HETATM 1228 O O   . HOH B 2 .   ? -23.852 7.786  -13.234 1.00 39.85 ? 177 HOH A O   1 
HETATM 1229 O O   . HOH B 2 .   ? -24.728 20.366 -17.336 1.00 40.51 ? 178 HOH A O   1 
HETATM 1230 O O   . HOH B 2 .   ? -18.175 20.310 -12.710 1.00 42.32 ? 179 HOH A O   1 
HETATM 1231 O O   . HOH B 2 .   ? -27.404 4.042  6.040   1.00 43.77 ? 180 HOH A O   1 
HETATM 1232 O O   . HOH B 2 .   ? 0.606   11.753 -7.608  1.00 43.84 ? 181 HOH A O   1 
HETATM 1233 O O   . HOH B 2 .   ? -5.893  9.822  -9.260  1.00 43.86 ? 182 HOH A O   1 
HETATM 1234 O O   . HOH B 2 .   ? -22.155 19.680 -18.902 1.00 44.53 ? 183 HOH A O   1 
HETATM 1235 O O   . HOH B 2 .   ? -25.018 10.337 -10.819 1.00 46.08 ? 184 HOH A O   1 
HETATM 1236 O O   . HOH B 2 .   ? -10.152 13.136 -13.807 1.00 48.07 ? 185 HOH A O   1 
HETATM 1237 O O   . HOH B 2 .   ? 1.893   8.637  13.881  1.00 48.98 ? 186 HOH A O   1 
HETATM 1238 O O   . HOH B 2 .   ? -29.413 17.268 -6.614  1.00 50.08 ? 187 HOH A O   1 
HETATM 1239 O O   . HOH B 2 .   ? -16.544 16.125 13.453  1.00 50.77 ? 188 HOH A O   1 
HETATM 1240 O O   . HOH B 2 .   ? -1.858  4.245  -2.793  1.00 52.90 ? 189 HOH A O   1 
HETATM 1241 O O   . HOH B 2 .   ? 0.626   20.742 -1.423  1.00 54.37 ? 190 HOH A O   1 
HETATM 1242 O O   . HOH B 2 .   ? -19.613 23.539 11.417  1.00 55.08 ? 191 HOH A O   1 
HETATM 1243 O O   . HOH B 2 .   ? -12.463 30.344 -3.332  1.00 55.81 ? 192 HOH A O   1 
HETATM 1244 O O   . HOH B 2 .   ? -14.134 12.060 -15.274 1.00 56.83 ? 193 HOH A O   1 
HETATM 1245 O O   . HOH B 2 .   ? -15.420 19.161 -22.053 1.00 57.34 ? 194 HOH A O   1 
HETATM 1246 O O   . HOH B 2 .   ? -3.140  6.992  -3.914  1.00 59.89 ? 195 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   VAL 1   1   ?   ?   ?   A . n 
A 1 2   PRO 2   2   ?   ?   ?   A . n 
A 1 3   ILE 3   3   3   ILE ILE A . n 
A 1 4   ARG 4   4   4   ARG ARG A . n 
A 1 5   GLN 5   5   5   GLN GLN A . n 
A 1 6   LEU 6   6   6   LEU LEU A . n 
A 1 7   HIS 7   7   7   HIS HIS A . n 
A 1 8   TYR 8   8   8   TYR TYR A . n 
A 1 9   ARG 9   9   9   ARG ARG A . n 
A 1 10  LEU 10  10  10  LEU LEU A . n 
A 1 11  ARG 11  11  11  ARG ARG A . n 
A 1 12  ASP 12  12  12  ASP ASP A . n 
A 1 13  GLU 13  13  13  GLU GLU A . n 
A 1 14  GLN 14  14  14  GLN GLN A . n 
A 1 15  GLN 15  15  15  GLN GLN A . n 
A 1 16  LYS 16  16  16  LYS LYS A . n 
A 1 17  SER 17  17  17  SER SER A . n 
A 1 18  LEU 18  18  18  LEU LEU A . n 
A 1 19  VAL 19  19  19  VAL VAL A . n 
A 1 20  LEU 20  20  20  LEU LEU A . n 
A 1 21  SER 21  21  21  SER SER A . n 
A 1 22  ASP 22  22  22  ASP ASP A . n 
A 1 23  PRO 23  23  23  PRO PRO A . n 
A 1 24  TYR 24  24  24  TYR TYR A . n 
A 1 25  GLU 25  25  25  GLU GLU A . n 
A 1 26  LEU 26  26  26  LEU LEU A . n 
A 1 27  LYS 27  27  27  LYS LYS A . n 
A 1 28  ALA 28  28  28  ALA ALA A . n 
A 1 29  LEU 29  29  29  LEU LEU A . n 
A 1 30  HIS 30  30  30  HIS HIS A . n 
A 1 31  LEU 31  31  31  LEU LEU A . n 
A 1 32  ASN 32  32  32  ASN ASN A . n 
A 1 33  GLY 33  33  33  GLY GLY A . n 
A 1 34  GLN 34  34  34  GLN GLN A . n 
A 1 35  ASN 35  35  35  ASN ASN A . n 
A 1 36  ILE 36  36  36  ILE ILE A . n 
A 1 37  ASN 37  37  37  ASN ASN A . n 
A 1 38  GLN 38  38  38  GLN GLN A . n 
A 1 39  GLN 39  39  39  GLN GLN A . n 
A 1 40  VAL 40  40  40  VAL VAL A . n 
A 1 41  ILE 41  41  41  ILE ILE A . n 
A 1 42  PHE 42  42  42  PHE PHE A . n 
A 1 43  SER 43  43  43  SER SER A . n 
A 1 44  MET 44  44  44  MET MET A . n 
A 1 45  SER 45  45  45  SER SER A . n 
A 1 46  PHE 46  46  46  PHE PHE A . n 
A 1 47  VAL 47  47  47  VAL VAL A . n 
A 1 48  GLN 48  48  48  GLN GLN A . n 
A 1 49  GLY 49  49  49  GLY GLY A . n 
A 1 50  GLU 50  50  50  GLU GLU A . n 
A 1 51  PRO 51  51  51  PRO PRO A . n 
A 1 52  SER 52  52  52  SER SER A . n 
A 1 53  ASN 53  53  53  ASN ASN A . n 
A 1 54  ASP 54  54  54  ASP ASP A . n 
A 1 55  LYS 55  55  55  LYS LYS A . n 
A 1 56  ILE 56  56  56  ILE ILE A . n 
A 1 57  PRO 57  57  57  PRO PRO A . n 
A 1 58  VAL 58  58  58  VAL VAL A . n 
A 1 59  ALA 59  59  59  ALA ALA A . n 
A 1 60  LEU 60  60  60  LEU LEU A . n 
A 1 61  GLY 61  61  61  GLY GLY A . n 
A 1 62  LEU 62  62  62  LEU LEU A . n 
A 1 63  LYS 63  63  63  LYS LYS A . n 
A 1 64  GLY 64  64  64  GLY GLY A . n 
A 1 65  LYS 65  65  65  LYS LYS A . n 
A 1 66  ASN 66  66  66  ASN ASN A . n 
A 1 67  LEU 67  67  67  LEU LEU A . n 
A 1 68  TYR 68  68  68  TYR TYR A . n 
A 1 69  LEU 69  69  69  LEU LEU A . n 
A 1 70  SER 70  70  70  SER SER A . n 
A 1 71  CYS 71  71  71  CYS CYS A . n 
A 1 72  VAL 72  72  72  VAL VAL A . n 
A 1 73  MET 73  73  73  MET MET A . n 
A 1 74  LYS 74  74  74  LYS LYS A . n 
A 1 75  ASP 75  75  75  ASP ASP A . n 
A 1 76  GLY 76  76  76  GLY GLY A . n 
A 1 77  THR 77  77  77  THR THR A . n 
A 1 78  PRO 78  78  78  PRO PRO A . n 
A 1 79  THR 79  79  79  THR THR A . n 
A 1 80  LEU 80  80  80  LEU LEU A . n 
A 1 81  GLN 81  81  81  GLN GLN A . n 
A 1 82  LEU 82  82  82  LEU LEU A . n 
A 1 83  GLU 83  83  83  GLU GLU A . n 
A 1 84  SER 84  84  84  SER SER A . n 
A 1 85  VAL 85  85  85  VAL VAL A . n 
A 1 86  ASP 86  86  86  ASP ASP A . n 
A 1 87  PRO 87  87  87  PRO PRO A . n 
A 1 88  LYS 88  88  88  LYS LYS A . n 
A 1 89  GLN 89  89  89  GLN GLN A . n 
A 1 90  TYR 90  90  90  TYR TYR A . n 
A 1 91  PRO 91  91  91  PRO PRO A . n 
A 1 92  LYS 92  92  92  LYS LYS A . n 
A 1 93  LYS 93  93  93  LYS LYS A . n 
A 1 94  LYS 94  94  94  LYS LYS A . n 
A 1 95  MET 95  95  95  MET MET A . n 
A 1 96  GLU 96  96  96  GLU GLU A . n 
A 1 97  LYS 97  97  97  LYS LYS A . n 
A 1 98  ARG 98  98  98  ARG ARG A . n 
A 1 99  PHE 99  99  99  PHE PHE A . n 
A 1 100 VAL 100 100 100 VAL VAL A . n 
A 1 101 PHE 101 101 101 PHE PHE A . n 
A 1 102 ASN 102 102 102 ASN ASN A . n 
A 1 103 LYS 103 103 103 LYS LYS A . n 
A 1 104 ILE 104 104 104 ILE ILE A . n 
A 1 105 GLU 105 105 105 GLU GLU A . n 
A 1 106 VAL 106 106 106 VAL VAL A . n 
A 1 107 LYS 107 107 107 LYS LYS A . n 
A 1 108 SER 108 108 108 SER SER A . n 
A 1 109 LYS 109 109 109 LYS LYS A . n 
A 1 110 VAL 110 110 110 VAL VAL A . n 
A 1 111 GLU 111 111 111 GLU GLU A . n 
A 1 112 PHE 112 112 112 PHE PHE A . n 
A 1 113 GLU 113 113 113 GLU GLU A . n 
A 1 114 SER 114 114 114 SER SER A . n 
A 1 115 ALA 115 115 115 ALA ALA A . n 
A 1 116 GLU 116 116 116 GLU GLU A . n 
A 1 117 PHE 117 117 117 PHE PHE A . n 
A 1 118 PRO 118 118 118 PRO PRO A . n 
A 1 119 ASN 119 119 119 ASN ASN A . n 
A 1 120 TRP 120 120 120 TRP TRP A . n 
A 1 121 TYR 121 121 121 TYR TYR A . n 
A 1 122 ILE 122 122 122 ILE ILE A . n 
A 1 123 SER 123 123 123 SER SER A . n 
A 1 124 THR 124 124 124 THR THR A . n 
A 1 125 SER 125 125 125 SER SER A . n 
A 1 126 GLN 126 126 126 GLN GLN A . n 
A 1 127 ALA 127 127 127 ALA ALA A . n 
A 1 128 GLU 128 128 128 GLU GLU A . n 
A 1 129 HIS 129 129 129 HIS HIS A . n 
A 1 130 LYS 130 130 130 LYS LYS A . n 
A 1 131 PRO 131 131 131 PRO PRO A . n 
A 1 132 VAL 132 132 132 VAL VAL A . n 
A 1 133 PHE 133 133 133 PHE PHE A . n 
A 1 134 LEU 134 134 134 LEU LEU A . n 
A 1 135 GLY 135 135 135 GLY GLY A . n 
A 1 136 ASN 136 136 136 ASN ASN A . n 
A 1 137 ASN 137 137 137 ASN ASN A . n 
A 1 138 SER 138 138 138 SER SER A . n 
A 1 139 GLY 139 140 140 GLY GLY A . n 
A 1 140 GLN 140 141 141 GLN GLN A . n 
A 1 141 ASP 141 142 142 ASP ASP A . n 
A 1 142 ILE 142 143 143 ILE ILE A . n 
A 1 143 ILE 143 144 144 ILE ILE A . n 
A 1 144 ASP 144 145 145 ASP ASP A . n 
A 1 145 PHE 145 146 146 PHE PHE A . n 
A 1 146 THR 146 147 147 THR THR A . n 
A 1 147 MET 147 148 148 MET MET A . n 
A 1 148 GLU 148 149 149 GLU GLU A . n 
A 1 149 SER 149 150 150 SER SER A . n 
A 1 150 VAL 150 151 151 VAL VAL A . n 
A 1 151 SER 151 152 152 SER SER A . n 
A 1 152 SER 152 153 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 HOH 1  154 1  HOH HOH A . 
B 2 HOH 2  155 2  HOH HOH A . 
B 2 HOH 3  156 3  HOH HOH A . 
B 2 HOH 4  157 4  HOH HOH A . 
B 2 HOH 5  158 5  HOH HOH A . 
B 2 HOH 6  159 6  HOH HOH A . 
B 2 HOH 7  160 7  HOH HOH A . 
B 2 HOH 8  161 8  HOH HOH A . 
B 2 HOH 9  162 9  HOH HOH A . 
B 2 HOH 10 163 10 HOH HOH A . 
B 2 HOH 11 164 11 HOH HOH A . 
B 2 HOH 12 165 12 HOH HOH A . 
B 2 HOH 13 166 13 HOH HOH A . 
B 2 HOH 14 167 14 HOH HOH A . 
B 2 HOH 15 168 15 HOH HOH A . 
B 2 HOH 16 169 16 HOH HOH A . 
B 2 HOH 17 170 17 HOH HOH A . 
B 2 HOH 18 171 18 HOH HOH A . 
B 2 HOH 19 172 19 HOH HOH A . 
B 2 HOH 20 173 20 HOH HOH A . 
B 2 HOH 21 174 21 HOH HOH A . 
B 2 HOH 22 175 22 HOH HOH A . 
B 2 HOH 23 176 23 HOH HOH A . 
B 2 HOH 24 177 24 HOH HOH A . 
B 2 HOH 25 178 25 HOH HOH A . 
B 2 HOH 26 179 26 HOH HOH A . 
B 2 HOH 27 180 27 HOH HOH A . 
B 2 HOH 28 181 28 HOH HOH A . 
B 2 HOH 29 182 29 HOH HOH A . 
B 2 HOH 30 183 30 HOH HOH A . 
B 2 HOH 31 184 31 HOH HOH A . 
B 2 HOH 32 185 32 HOH HOH A . 
B 2 HOH 33 186 33 HOH HOH A . 
B 2 HOH 34 187 34 HOH HOH A . 
B 2 HOH 35 188 35 HOH HOH A . 
B 2 HOH 36 189 36 HOH HOH A . 
B 2 HOH 37 190 37 HOH HOH A . 
B 2 HOH 38 191 38 HOH HOH A . 
B 2 HOH 39 192 39 HOH HOH A . 
B 2 HOH 40 193 40 HOH HOH A . 
B 2 HOH 41 194 41 HOH HOH A . 
B 2 HOH 42 195 42 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1994-01-31 
2 'Structure model' 1 1 2008-03-24 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2017-11-29 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Derived calculations'      
4 4 'Structure model' Other                       
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' pdbx_database_status 
2 4 'Structure model' struct_conf          
3 4 'Structure model' struct_conf_type     
# 
_pdbx_audit_revision_item.ordinal             1 
_pdbx_audit_revision_item.revision_ordinal    4 
_pdbx_audit_revision_item.data_content_type   'Structure model' 
_pdbx_audit_revision_item.item                '_pdbx_database_status.process_site' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
X-PLOR 'model building' . ? 1 
PROLSQ refinement       . ? 2 
TNT    refinement       . ? 3 
X-PLOR refinement       . ? 4 
X-PLOR phasing          . ? 5 
# 
_pdbx_database_remark.id     700 
_pdbx_database_remark.text   
;SHEET
THE SHEET PRESENTED AS *S1* ON SHEET RECORDS BELOW IS
ACTUALLY A SIX-STRANDED BETA BARREL.  THIS IS REPRESENTED
BY A SEVEN-STRANDED SHEET IN WHICH THE FIRST AND LAST
STRANDS ARE IDENTICAL.
;
# 
_pdbx_entry_details.entry_id             2MIB 
_pdbx_entry_details.compound_details     ? 
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     
;THE SEQUENCE IS ALIGNED TO THE HUMAN INTERLEUKIN-1 BETA
SEQUENCE.  THIS RESULTS IN THE DELETION OF RESIDUE 139 IN
MURINE SEQUENCE.
;
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 GLN A 15  ? ? 76.65   34.06   
2  1 SER A 21  ? ? -109.86 -88.31  
3  1 PRO A 23  ? ? -34.05  -28.84  
4  1 ASN A 37  ? ? -145.91 -19.38  
5  1 SER A 52  ? ? 64.88   -81.85  
6  1 ASN A 53  ? ? 66.47   -75.38  
7  1 ASP A 54  ? ? -173.30 6.47    
8  1 ASN A 66  ? ? -93.29  51.09   
9  1 VAL A 106 ? ? -99.14  -63.33  
10 1 LYS A 107 ? ? -123.49 -100.24 
11 1 ASN A 119 ? ? 80.51   6.26    
12 1 ASN A 137 ? ? 76.21   79.37   
13 1 GLN A 141 ? ? -65.19  25.27   
14 1 VAL A 151 ? ? -105.15 -146.16 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A VAL 1   ? A VAL 1   
2 1 Y 1 A PRO 2   ? A PRO 2   
3 1 Y 1 A SER 153 ? A SER 152 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#