data_2MKJ
# 
_entry.id   2MKJ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2MKJ         
RCSB  RCSB103724   
BMRB  19777        
WWPDB D_1000103724 
# 
loop_
_pdbx_database_related.db_id 
_pdbx_database_related.db_name 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
19777 BMRB unspecified . 
2MKE  PDB  unspecified . 
2MKH  PDB  unspecified . 
2MKI  PDB  unspecified . 
2MKK  PDB  unspecified . 
# 
_pdbx_database_status.deposit_site                    BMRB 
_pdbx_database_status.entry_id                        2MKJ 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.recvd_initial_deposition_date   2014-02-07 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  REL 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Afroz, T.'       1 
'Skrisovska, L.'  2 
'Belloc, E.'      3 
'Boixet, J.G.'    4 
'Mendez, R.'      5 
'Allain, F.H.-T.' 6 
# 
_citation.id                        primary 
_citation.title                     'A fly trap mechanism provides sequence-specific RNA recognition by CPEB proteins' 
_citation.journal_abbrev            'Genes Dev.' 
_citation.journal_volume            28 
_citation.page_first                1498 
_citation.page_last                 1514 
_citation.year                      2014 
_citation.journal_id_ASTM           GEDEEP 
_citation.country                   US 
_citation.journal_id_ISSN           0890-9369 
_citation.journal_id_CSD            2056 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   24990967 
_citation.pdbx_database_id_DOI      10.1101/gad.241133.114 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Afroz, T.'          1 
primary 'Skrisovska, L.'     2 
primary 'Belloc, E.'         3 
primary 'Guillen-Boixet, J.' 4 
primary 'Mendez, R.'         5 
primary 'Allain, F.H.-T.'    6 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'Cytoplasmic polyadenylation element-binding protein 4' 
_entity.formula_weight             22825.979 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'UNP residues 53-254' 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'CPE-BP4, CPE-binding protein 4, hCPEB-4' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;SHQNGERVERYSRKVFVGGLPPDIDEDEITASFRRFGPLIVDWPHKAESKSYFPPKGYAFLLFQDESSVQALIDACIEED
GKLYLCVSSPTIKDKPVQIRPWNLSDSDFVMDGSQPLDPRKTIFVGGVPRPLRAVELAMIMDRLYGGVCYAGIDTDPELK
YPKGAGRVAFSNQQSYIAAISARFVQLQHGEIDKRVEVKPYVL
;
_entity_poly.pdbx_seq_one_letter_code_can   
;SHQNGERVERYSRKVFVGGLPPDIDEDEITASFRRFGPLIVDWPHKAESKSYFPPKGYAFLLFQDESSVQALIDACIEED
GKLYLCVSSPTIKDKPVQIRPWNLSDSDFVMDGSQPLDPRKTIFVGGVPRPLRAVELAMIMDRLYGGVCYAGIDTDPELK
YPKGAGRVAFSNQQSYIAAISARFVQLQHGEIDKRVEVKPYVL
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   HIS n 
1 3   GLN n 
1 4   ASN n 
1 5   GLY n 
1 6   GLU n 
1 7   ARG n 
1 8   VAL n 
1 9   GLU n 
1 10  ARG n 
1 11  TYR n 
1 12  SER n 
1 13  ARG n 
1 14  LYS n 
1 15  VAL n 
1 16  PHE n 
1 17  VAL n 
1 18  GLY n 
1 19  GLY n 
1 20  LEU n 
1 21  PRO n 
1 22  PRO n 
1 23  ASP n 
1 24  ILE n 
1 25  ASP n 
1 26  GLU n 
1 27  ASP n 
1 28  GLU n 
1 29  ILE n 
1 30  THR n 
1 31  ALA n 
1 32  SER n 
1 33  PHE n 
1 34  ARG n 
1 35  ARG n 
1 36  PHE n 
1 37  GLY n 
1 38  PRO n 
1 39  LEU n 
1 40  ILE n 
1 41  VAL n 
1 42  ASP n 
1 43  TRP n 
1 44  PRO n 
1 45  HIS n 
1 46  LYS n 
1 47  ALA n 
1 48  GLU n 
1 49  SER n 
1 50  LYS n 
1 51  SER n 
1 52  TYR n 
1 53  PHE n 
1 54  PRO n 
1 55  PRO n 
1 56  LYS n 
1 57  GLY n 
1 58  TYR n 
1 59  ALA n 
1 60  PHE n 
1 61  LEU n 
1 62  LEU n 
1 63  PHE n 
1 64  GLN n 
1 65  ASP n 
1 66  GLU n 
1 67  SER n 
1 68  SER n 
1 69  VAL n 
1 70  GLN n 
1 71  ALA n 
1 72  LEU n 
1 73  ILE n 
1 74  ASP n 
1 75  ALA n 
1 76  CYS n 
1 77  ILE n 
1 78  GLU n 
1 79  GLU n 
1 80  ASP n 
1 81  GLY n 
1 82  LYS n 
1 83  LEU n 
1 84  TYR n 
1 85  LEU n 
1 86  CYS n 
1 87  VAL n 
1 88  SER n 
1 89  SER n 
1 90  PRO n 
1 91  THR n 
1 92  ILE n 
1 93  LYS n 
1 94  ASP n 
1 95  LYS n 
1 96  PRO n 
1 97  VAL n 
1 98  GLN n 
1 99  ILE n 
1 100 ARG n 
1 101 PRO n 
1 102 TRP n 
1 103 ASN n 
1 104 LEU n 
1 105 SER n 
1 106 ASP n 
1 107 SER n 
1 108 ASP n 
1 109 PHE n 
1 110 VAL n 
1 111 MET n 
1 112 ASP n 
1 113 GLY n 
1 114 SER n 
1 115 GLN n 
1 116 PRO n 
1 117 LEU n 
1 118 ASP n 
1 119 PRO n 
1 120 ARG n 
1 121 LYS n 
1 122 THR n 
1 123 ILE n 
1 124 PHE n 
1 125 VAL n 
1 126 GLY n 
1 127 GLY n 
1 128 VAL n 
1 129 PRO n 
1 130 ARG n 
1 131 PRO n 
1 132 LEU n 
1 133 ARG n 
1 134 ALA n 
1 135 VAL n 
1 136 GLU n 
1 137 LEU n 
1 138 ALA n 
1 139 MET n 
1 140 ILE n 
1 141 MET n 
1 142 ASP n 
1 143 ARG n 
1 144 LEU n 
1 145 TYR n 
1 146 GLY n 
1 147 GLY n 
1 148 VAL n 
1 149 CYS n 
1 150 TYR n 
1 151 ALA n 
1 152 GLY n 
1 153 ILE n 
1 154 ASP n 
1 155 THR n 
1 156 ASP n 
1 157 PRO n 
1 158 GLU n 
1 159 LEU n 
1 160 LYS n 
1 161 TYR n 
1 162 PRO n 
1 163 LYS n 
1 164 GLY n 
1 165 ALA n 
1 166 GLY n 
1 167 ARG n 
1 168 VAL n 
1 169 ALA n 
1 170 PHE n 
1 171 SER n 
1 172 ASN n 
1 173 GLN n 
1 174 GLN n 
1 175 SER n 
1 176 TYR n 
1 177 ILE n 
1 178 ALA n 
1 179 ALA n 
1 180 ILE n 
1 181 SER n 
1 182 ALA n 
1 183 ARG n 
1 184 PHE n 
1 185 VAL n 
1 186 GLN n 
1 187 LEU n 
1 188 GLN n 
1 189 HIS n 
1 190 GLY n 
1 191 GLU n 
1 192 ILE n 
1 193 ASP n 
1 194 LYS n 
1 195 ARG n 
1 196 VAL n 
1 197 GLU n 
1 198 VAL n 
1 199 LYS n 
1 200 PRO n 
1 201 TYR n 
1 202 VAL n 
1 203 LEU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'CPEB4, KIAA1673' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          vector 
_entity_src_gen.pdbx_host_org_vector               'pET28A(+)' 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    CPEB4_HUMAN 
_struct_ref.pdbx_db_accession          Q17RY0 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;SHQNGERVERYSRKVFVGGLPPDIDEDEITASFRRFGPLIVDWPHKAESKSYFPPKGYAFLLFQDESSVQALIDACIEED
GKLYLCVSSPTIKDKPVQIRPWNLSDSDFVMDGSQPLDPRKTIFVGGVPRPLRAVELAMIMDRLYGGVCYAGIDTDPELK
YPKGAGRVAFSNQQSYIAAISARFVQLQHGEIDKRVEVKPYVL
;
_struct_ref.pdbx_align_begin           53 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2MKJ 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 203 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q17RY0 
_struct_ref_seq.db_align_beg                  53 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  255 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       53 
_struct_ref_seq.pdbx_auth_seq_align_end       255 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.type 
1 1  3 '2D 1H-15N HSQC'            
1 2  3 '2D TROSY'                  
1 3  1 '2D 1H-13C HSQC'            
1 4  1 '2D 1H-13C HSQC aliphatic'  
1 5  1 '2D 1H-13C HSQC aromatic'   
1 6  4 '2D 1H-1H TOCSY'            
1 7  4 '2D 1H-1H NOESY'            
1 8  2 '3D CBCA(CO)NH'             
1 9  2 '3D trHNCACB'               
1 10 2 '3D trHNCA'                 
1 11 2 '3D trHN(CO)CA'             
1 12 3 '3D trHNCO'                 
1 13 2 '3D trHCACO'                
1 14 1 '3D HCCH-TOCSY'             
1 15 1 '3D HCCH-TOCSY'             
1 16 2 '3D 1H-15N NOESY'           
1 17 1 '3D 1H-13C NOESY aliphatic' 
1 18 1 '3D 1H-13C NOESY aromatic'  
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      0.15 
_pdbx_nmr_exptl_sample_conditions.pH                  7.0 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature         303 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
loop_
_pdbx_nmr_sample_details.contents 
_pdbx_nmr_sample_details.solution_id 
_pdbx_nmr_sample_details.solvent_system 

'0.4-0.6 mM [U-100% 13C; U-100% 15N] CPEB4RRM12-1, 100 mM sodium chloride-2, 50 mM sodium phosphate-3, 1 mM DTT-4, 90% H2O/10% D2O' 
1 '90% H2O/10% D2O' 
;0.4-0.6 mM [U-100% 13C; U-100% 15N; U-80% 2H] CPEB4RRM12-5, 100 mM sodium chloride-6, 50 mM sodium phosphate-7, 1 mM DTT-8, 90% H2O/10% D2O
;
2 '90% H2O/10% D2O' 
'0.4-0.6 mM [U-100% 15N] CPEB4RRM12-9, 100 mM sodium chloride-10, 50 mM sodium phosphate-11, 1 mM DTT-12, 90% H2O/10% D2O' 3 
'90% H2O/10% D2O' 
'0.4-0.6 mM [U-100% 15N] CPEB4RRM12-13, 100 mM sodium chloride-14, 50 mM sodium phosphate-15, 1 mM DTT-16, 100% D2O' 4 '100% D2O' 
# 
loop_
_pdbx_nmr_spectrometer.field_strength 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.type 
900 Bruker Avance 1 'Bruker Avance' 
700 Bruker Avance 2 'Bruker Avance' 
600 Bruker Avance 3 'Bruker Avance' 
500 Bruker Avance 4 'Bruker Avance' 
# 
_pdbx_nmr_refine.entry_id           2MKJ 
_pdbx_nmr_refine.method             'simulated annealing' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy' 
_pdbx_nmr_ensemble.conformers_calculated_total_number            30 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.entry_id                                      2MKJ 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.representative_conformer                      4 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.entry_id             2MKJ 
_pdbx_nmr_representative.selection_criteria   'closest to the average' 
# 
loop_
_pdbx_nmr_software.authors 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.ordinal 
_pdbx_nmr_software.version 
'Case, Darden, Cheatham, III, Simmerling, Wang, Duke, Luo, ... and Kollman' refinement                  AMBER   1 ? 
'Guntert, Mumenthaler and Wuthrich'                                         'structure solution'        CYANA   2 ? 
Goddard                                                                     'chemical shift assignment' SPARKY  3 ? 
'Bruker Biospin'                                                            processing                  TOPSPIN 4 ? 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.entry_id                   2MKJ 
_exptl.method                     'SOLUTION NMR' 
_exptl.method_details             ? 
# 
_struct.entry_id                  2MKJ 
_struct.title                     
'Solution structure of tandem RRM domains of cytoplasmic polyadenylation element binding protein 4 (CPEB4) in free state' 
_struct.pdbx_descriptor           'Cytoplasmic polyadenylation element-binding protein 4' 
_struct.pdbx_model_details        'closest to the average, model4' 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2MKJ 
_struct_keywords.pdbx_keywords   'TRANSLATION REGULATOR' 
_struct_keywords.text            
'CPEB4, RNA recognition motif (RRM), Cytoplasmic polyadenylation, Translational regulation, TRANSLATION REGULATOR' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ASP A 25  ? PHE A 33  ? ASP A 77  PHE A 85  1 ? 9  
HELX_P HELX_P2 2 SER A 67  ? ALA A 75  ? SER A 119 ALA A 127 1 ? 9  
HELX_P HELX_P3 3 ALA A 134 ? TYR A 145 ? ALA A 186 TYR A 197 1 ? 12 
HELX_P HELX_P4 4 GLN A 173 ? SER A 181 ? GLN A 225 SER A 233 1 ? 9  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 5 ? 
C ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
C 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LEU A 39  ? ASP A 42  ? LEU A 91  ASP A 94  
A 2 ALA A 59  ? PHE A 63  ? ALA A 111 PHE A 115 
A 3 SER A 12  ? VAL A 17  ? SER A 64  VAL A 69  
A 4 VAL A 97  ? TRP A 102 ? VAL A 149 TRP A 154 
A 5 LEU A 83  ? LEU A 85  ? LEU A 135 LEU A 137 
A 6 ILE A 77  ? GLU A 78  ? ILE A 129 GLU A 130 
B 1 ASP A 108 ? VAL A 110 ? ASP A 160 VAL A 162 
B 2 TYR A 150 ? ASP A 156 ? TYR A 202 ASP A 208 
B 3 TYR A 161 ? ALA A 169 ? TYR A 213 ALA A 221 
B 4 THR A 122 ? GLY A 126 ? THR A 174 GLY A 178 
B 5 GLU A 197 ? PRO A 200 ? GLU A 249 PRO A 252 
C 1 GLN A 186 ? HIS A 189 ? GLN A 238 HIS A 241 
C 2 ILE A 192 ? LYS A 194 ? ILE A 244 LYS A 246 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ILE A 40  ? N ILE A 92  O LEU A 62  ? O LEU A 114 
A 2 3 O ALA A 59  ? O ALA A 111 N VAL A 17  ? N VAL A 69  
A 3 4 N SER A 12  ? N SER A 64  O TRP A 102 ? O TRP A 154 
A 4 5 O ILE A 99  ? O ILE A 151 N LEU A 83  ? N LEU A 135 
A 5 6 O TYR A 84  ? O TYR A 136 N ILE A 77  ? N ILE A 129 
B 1 2 N PHE A 109 ? N PHE A 161 O ALA A 151 ? O ALA A 203 
B 2 3 N ASP A 154 ? N ASP A 206 O ALA A 165 ? O ALA A 217 
B 3 4 O VAL A 168 ? O VAL A 220 N ILE A 123 ? N ILE A 175 
B 4 5 N PHE A 124 ? N PHE A 176 O LYS A 199 ? O LYS A 251 
C 1 2 N LEU A 187 ? N LEU A 239 O ASP A 193 ? O ASP A 245 
# 
_atom_sites.entry_id                    2MKJ 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . SER A 1 1   ? 29.908  -14.588 1.817   1.00 0.00 ? 53  SER A N    1  
ATOM 2     C CA   . SER A 1 1   ? 28.918  -15.611 1.431   1.00 0.00 ? 53  SER A CA   1  
ATOM 3     C C    . SER A 1 1   ? 27.984  -15.082 0.350   1.00 0.00 ? 53  SER A C    1  
ATOM 4     O O    . SER A 1 1   ? 27.873  -13.873 0.159   1.00 0.00 ? 53  SER A O    1  
ATOM 5     C CB   . SER A 1 1   ? 28.117  -16.071 2.648   1.00 0.00 ? 53  SER A CB   1  
ATOM 6     O OG   . SER A 1 1   ? 29.003  -16.577 3.625   1.00 0.00 ? 53  SER A OG   1  
ATOM 7     H H1   . SER A 1 1   ? 29.433  -13.776 2.181   1.00 0.00 ? 53  SER A H1   1  
ATOM 8     H H2   . SER A 1 1   ? 30.456  -14.324 1.011   1.00 0.00 ? 53  SER A H2   1  
ATOM 9     H H3   . SER A 1 1   ? 30.518  -14.965 2.528   1.00 0.00 ? 53  SER A H3   1  
ATOM 10    H HA   . SER A 1 1   ? 29.452  -16.472 1.029   1.00 0.00 ? 53  SER A HA   1  
ATOM 11    H HB2  . SER A 1 1   ? 27.564  -15.228 3.060   1.00 0.00 ? 53  SER A HB2  1  
ATOM 12    H HB3  . SER A 1 1   ? 27.418  -16.853 2.351   1.00 0.00 ? 53  SER A HB3  1  
ATOM 13    H HG   . SER A 1 1   ? 28.488  -16.864 4.381   1.00 0.00 ? 53  SER A HG   1  
ATOM 14    N N    . HIS A 1 2   ? 27.309  -15.992 -0.360  1.00 0.00 ? 54  HIS A N    1  
ATOM 15    C CA   . HIS A 1 2   ? 26.378  -15.641 -1.421  1.00 0.00 ? 54  HIS A CA   1  
ATOM 16    C C    . HIS A 1 2   ? 25.247  -16.664 -1.491  1.00 0.00 ? 54  HIS A C    1  
ATOM 17    O O    . HIS A 1 2   ? 25.435  -17.823 -1.120  1.00 0.00 ? 54  HIS A O    1  
ATOM 18    C CB   . HIS A 1 2   ? 27.132  -15.586 -2.751  1.00 0.00 ? 54  HIS A CB   1  
ATOM 19    C CG   . HIS A 1 2   ? 26.260  -15.177 -3.908  1.00 0.00 ? 54  HIS A CG   1  
ATOM 20    N ND1  . HIS A 1 2   ? 25.777  -13.885 -4.138  1.00 0.00 ? 54  HIS A ND1  1  
ATOM 21    C CD2  . HIS A 1 2   ? 25.816  -16.007 -4.896  1.00 0.00 ? 54  HIS A CD2  1  
ATOM 22    C CE1  . HIS A 1 2   ? 25.055  -13.974 -5.265  1.00 0.00 ? 54  HIS A CE1  1  
ATOM 23    N NE2  . HIS A 1 2   ? 25.059  -15.231 -5.741  1.00 0.00 ? 54  HIS A NE2  1  
ATOM 24    H H    . HIS A 1 2   ? 27.441  -16.974 -0.162  1.00 0.00 ? 54  HIS A H    1  
ATOM 25    H HA   . HIS A 1 2   ? 25.950  -14.660 -1.217  1.00 0.00 ? 54  HIS A HA   1  
ATOM 26    H HB2  . HIS A 1 2   ? 27.949  -14.869 -2.662  1.00 0.00 ? 54  HIS A HB2  1  
ATOM 27    H HB3  . HIS A 1 2   ? 27.558  -16.566 -2.959  1.00 0.00 ? 54  HIS A HB3  1  
ATOM 28    H HD2  . HIS A 1 2   ? 26.023  -17.063 -4.994  1.00 0.00 ? 54  HIS A HD2  1  
ATOM 29    H HE1  . HIS A 1 2   ? 24.539  -13.145 -5.729  1.00 0.00 ? 54  HIS A HE1  1  
ATOM 30    H HE2  . HIS A 1 2   ? 24.586  -15.548 -6.576  1.00 0.00 ? 54  HIS A HE2  1  
ATOM 31    N N    . GLN A 1 3   ? 24.075  -16.235 -1.966  1.00 0.00 ? 55  GLN A N    1  
ATOM 32    C CA   . GLN A 1 3   ? 22.917  -17.109 -2.098  1.00 0.00 ? 55  GLN A CA   1  
ATOM 33    C C    . GLN A 1 3   ? 22.006  -16.635 -3.232  1.00 0.00 ? 55  GLN A C    1  
ATOM 34    O O    . GLN A 1 3   ? 21.369  -17.452 -3.894  1.00 0.00 ? 55  GLN A O    1  
ATOM 35    C CB   . GLN A 1 3   ? 22.157  -17.107 -0.766  1.00 0.00 ? 55  GLN A CB   1  
ATOM 36    C CG   . GLN A 1 3   ? 20.933  -18.027 -0.783  1.00 0.00 ? 55  GLN A CG   1  
ATOM 37    C CD   . GLN A 1 3   ? 21.291  -19.503 -0.939  1.00 0.00 ? 55  GLN A CD   1  
ATOM 38    O OE1  . GLN A 1 3   ? 22.453  -19.893 -0.858  1.00 0.00 ? 55  GLN A OE1  1  
ATOM 39    N NE2  . GLN A 1 3   ? 20.286  -20.344 -1.168  1.00 0.00 ? 55  GLN A NE2  1  
ATOM 40    H H    . GLN A 1 3   ? 23.980  -15.269 -2.246  1.00 0.00 ? 55  GLN A H    1  
ATOM 41    H HA   . GLN A 1 3   ? 23.258  -18.120 -2.323  1.00 0.00 ? 55  GLN A HA   1  
ATOM 42    H HB2  . GLN A 1 3   ? 22.828  -17.425 0.031   1.00 0.00 ? 55  GLN A HB2  1  
ATOM 43    H HB3  . GLN A 1 3   ? 21.826  -16.090 -0.552  1.00 0.00 ? 55  GLN A HB3  1  
ATOM 44    H HG2  . GLN A 1 3   ? 20.389  -17.906 0.154   1.00 0.00 ? 55  GLN A HG2  1  
ATOM 45    H HG3  . GLN A 1 3   ? 20.264  -17.733 -1.592  1.00 0.00 ? 55  GLN A HG3  1  
ATOM 46    H HE21 . GLN A 1 3   ? 19.340  -19.994 -1.233  1.00 0.00 ? 55  GLN A HE21 1  
ATOM 47    H HE22 . GLN A 1 3   ? 20.474  -21.330 -1.276  1.00 0.00 ? 55  GLN A HE22 1  
ATOM 48    N N    . ASN A 1 4   ? 21.939  -15.320 -3.460  1.00 0.00 ? 56  ASN A N    1  
ATOM 49    C CA   . ASN A 1 4   ? 21.123  -14.746 -4.519  1.00 0.00 ? 56  ASN A CA   1  
ATOM 50    C C    . ASN A 1 4   ? 21.672  -13.372 -4.911  1.00 0.00 ? 56  ASN A C    1  
ATOM 51    O O    . ASN A 1 4   ? 22.376  -12.738 -4.127  1.00 0.00 ? 56  ASN A O    1  
ATOM 52    C CB   . ASN A 1 4   ? 19.676  -14.632 -4.028  1.00 0.00 ? 56  ASN A CB   1  
ATOM 53    C CG   . ASN A 1 4   ? 18.733  -14.251 -5.157  1.00 0.00 ? 56  ASN A CG   1  
ATOM 54    O OD1  . ASN A 1 4   ? 18.345  -13.094 -5.289  1.00 0.00 ? 56  ASN A OD1  1  
ATOM 55    N ND2  . ASN A 1 4   ? 18.358  -15.225 -5.981  1.00 0.00 ? 56  ASN A ND2  1  
ATOM 56    H H    . ASN A 1 4   ? 22.471  -14.684 -2.882  1.00 0.00 ? 56  ASN A H    1  
ATOM 57    H HA   . ASN A 1 4   ? 21.156  -15.401 -5.389  1.00 0.00 ? 56  ASN A HA   1  
ATOM 58    H HB2  . ASN A 1 4   ? 19.363  -15.595 -3.625  1.00 0.00 ? 56  ASN A HB2  1  
ATOM 59    H HB3  . ASN A 1 4   ? 19.616  -13.885 -3.237  1.00 0.00 ? 56  ASN A HB3  1  
ATOM 60    H HD21 . ASN A 1 4   ? 18.701  -16.164 -5.840  1.00 0.00 ? 56  ASN A HD21 1  
ATOM 61    H HD22 . ASN A 1 4   ? 17.728  -15.026 -6.745  1.00 0.00 ? 56  ASN A HD22 1  
ATOM 62    N N    . GLY A 1 5   ? 21.351  -12.911 -6.123  1.00 0.00 ? 57  GLY A N    1  
ATOM 63    C CA   . GLY A 1 5   ? 21.823  -11.629 -6.630  1.00 0.00 ? 57  GLY A CA   1  
ATOM 64    C C    . GLY A 1 5   ? 20.762  -10.911 -7.464  1.00 0.00 ? 57  GLY A C    1  
ATOM 65    O O    . GLY A 1 5   ? 21.074  -9.949  -8.164  1.00 0.00 ? 57  GLY A O    1  
ATOM 66    H H    . GLY A 1 5   ? 20.756  -13.465 -6.723  1.00 0.00 ? 57  GLY A H    1  
ATOM 67    H HA2  . GLY A 1 5   ? 22.090  -10.988 -5.790  1.00 0.00 ? 57  GLY A HA2  1  
ATOM 68    H HA3  . GLY A 1 5   ? 22.708  -11.793 -7.245  1.00 0.00 ? 57  GLY A HA3  1  
ATOM 69    N N    . GLU A 1 6   ? 19.510  -11.373 -7.398  1.00 0.00 ? 58  GLU A N    1  
ATOM 70    C CA   . GLU A 1 6   ? 18.415  -10.808 -8.173  1.00 0.00 ? 58  GLU A CA   1  
ATOM 71    C C    . GLU A 1 6   ? 17.864  -9.552  -7.498  1.00 0.00 ? 58  GLU A C    1  
ATOM 72    O O    . GLU A 1 6   ? 18.105  -9.315  -6.314  1.00 0.00 ? 58  GLU A O    1  
ATOM 73    C CB   . GLU A 1 6   ? 17.314  -11.858 -8.347  1.00 0.00 ? 58  GLU A CB   1  
ATOM 74    C CG   . GLU A 1 6   ? 17.843  -13.089 -9.086  1.00 0.00 ? 58  GLU A CG   1  
ATOM 75    C CD   . GLU A 1 6   ? 16.762  -14.160 -9.203  1.00 0.00 ? 58  GLU A CD   1  
ATOM 76    O OE1  . GLU A 1 6   ? 16.644  -14.965 -8.251  1.00 0.00 ? 58  GLU A OE1  1  
ATOM 77    O OE2  . GLU A 1 6   ? 16.063  -14.168 -10.241 1.00 0.00 ? 58  GLU A OE2  1  
ATOM 78    H H    . GLU A 1 6   ? 19.297  -12.148 -6.786  1.00 0.00 ? 58  GLU A H    1  
ATOM 79    H HA   . GLU A 1 6   ? 18.784  -10.532 -9.161  1.00 0.00 ? 58  GLU A HA   1  
ATOM 80    H HB2  . GLU A 1 6   ? 16.944  -12.158 -7.367  1.00 0.00 ? 58  GLU A HB2  1  
ATOM 81    H HB3  . GLU A 1 6   ? 16.492  -11.427 -8.919  1.00 0.00 ? 58  GLU A HB3  1  
ATOM 82    H HG2  . GLU A 1 6   ? 18.173  -12.793 -10.081 1.00 0.00 ? 58  GLU A HG2  1  
ATOM 83    H HG3  . GLU A 1 6   ? 18.693  -13.503 -8.542  1.00 0.00 ? 58  GLU A HG3  1  
ATOM 84    N N    . ARG A 1 7   ? 17.117  -8.744  -8.260  1.00 0.00 ? 59  ARG A N    1  
ATOM 85    C CA   . ARG A 1 7   ? 16.518  -7.509  -7.770  1.00 0.00 ? 59  ARG A CA   1  
ATOM 86    C C    . ARG A 1 7   ? 15.100  -7.364  -8.317  1.00 0.00 ? 59  ARG A C    1  
ATOM 87    O O    . ARG A 1 7   ? 14.766  -7.949  -9.345  1.00 0.00 ? 59  ARG A O    1  
ATOM 88    C CB   . ARG A 1 7   ? 17.373  -6.306  -8.187  1.00 0.00 ? 59  ARG A CB   1  
ATOM 89    C CG   . ARG A 1 7   ? 18.777  -6.382  -7.582  1.00 0.00 ? 59  ARG A CG   1  
ATOM 90    C CD   . ARG A 1 7   ? 19.587  -5.138  -7.946  1.00 0.00 ? 59  ARG A CD   1  
ATOM 91    N NE   . ARG A 1 7   ? 19.800  -5.040  -9.396  1.00 0.00 ? 59  ARG A NE   1  
ATOM 92    C CZ   . ARG A 1 7   ? 20.426  -4.018  -9.988  1.00 0.00 ? 59  ARG A CZ   1  
ATOM 93    N NH1  . ARG A 1 7   ? 20.907  -3.006  -9.271  1.00 0.00 ? 59  ARG A NH1  1  
ATOM 94    N NH2  . ARG A 1 7   ? 20.573  -4.007  -11.310 1.00 0.00 ? 59  ARG A NH2  1  
ATOM 95    H H    . ARG A 1 7   ? 16.953  -8.991  -9.225  1.00 0.00 ? 59  ARG A H    1  
ATOM 96    H HA   . ARG A 1 7   ? 16.462  -7.539  -6.682  1.00 0.00 ? 59  ARG A HA   1  
ATOM 97    H HB2  . ARG A 1 7   ? 17.445  -6.280  -9.274  1.00 0.00 ? 59  ARG A HB2  1  
ATOM 98    H HB3  . ARG A 1 7   ? 16.889  -5.393  -7.842  1.00 0.00 ? 59  ARG A HB3  1  
ATOM 99    H HG2  . ARG A 1 7   ? 18.697  -6.448  -6.497  1.00 0.00 ? 59  ARG A HG2  1  
ATOM 100   H HG3  . ARG A 1 7   ? 19.292  -7.266  -7.957  1.00 0.00 ? 59  ARG A HG3  1  
ATOM 101   H HD2  . ARG A 1 7   ? 19.054  -4.254  -7.596  1.00 0.00 ? 59  ARG A HD2  1  
ATOM 102   H HD3  . ARG A 1 7   ? 20.554  -5.188  -7.446  1.00 0.00 ? 59  ARG A HD3  1  
ATOM 103   H HE   . ARG A 1 7   ? 19.450  -5.790  -9.972  1.00 0.00 ? 59  ARG A HE   1  
ATOM 104   H HH11 . ARG A 1 7   ? 20.803  -3.008  -8.266  1.00 0.00 ? 59  ARG A HH11 1  
ATOM 105   H HH12 . ARG A 1 7   ? 21.376  -2.238  -9.730  1.00 0.00 ? 59  ARG A HH12 1  
ATOM 106   H HH21 . ARG A 1 7   ? 20.210  -4.769  -11.866 1.00 0.00 ? 59  ARG A HH21 1  
ATOM 107   H HH22 . ARG A 1 7   ? 21.046  -3.237  -11.759 1.00 0.00 ? 59  ARG A HH22 1  
ATOM 108   N N    . VAL A 1 8   ? 14.271  -6.580  -7.625  1.00 0.00 ? 60  VAL A N    1  
ATOM 109   C CA   . VAL A 1 8   ? 12.889  -6.332  -8.015  1.00 0.00 ? 60  VAL A CA   1  
ATOM 110   C C    . VAL A 1 8   ? 12.559  -4.862  -7.775  1.00 0.00 ? 60  VAL A C    1  
ATOM 111   O O    . VAL A 1 8   ? 13.003  -4.281  -6.789  1.00 0.00 ? 60  VAL A O    1  
ATOM 112   C CB   . VAL A 1 8   ? 11.941  -7.242  -7.221  1.00 0.00 ? 60  VAL A CB   1  
ATOM 113   C CG1  . VAL A 1 8   ? 10.485  -6.992  -7.614  1.00 0.00 ? 60  VAL A CG1  1  
ATOM 114   C CG2  . VAL A 1 8   ? 12.255  -8.716  -7.480  1.00 0.00 ? 60  VAL A CG2  1  
ATOM 115   H H    . VAL A 1 8   ? 14.606  -6.128  -6.785  1.00 0.00 ? 60  VAL A H    1  
ATOM 116   H HA   . VAL A 1 8   ? 12.773  -6.549  -9.078  1.00 0.00 ? 60  VAL A HA   1  
ATOM 117   H HB   . VAL A 1 8   ? 12.059  -7.037  -6.158  1.00 0.00 ? 60  VAL A HB   1  
ATOM 118   H HG11 . VAL A 1 8   ? 10.364  -7.132  -8.688  1.00 0.00 ? 60  VAL A HG11 1  
ATOM 119   H HG12 . VAL A 1 8   ? 9.839   -7.692  -7.084  1.00 0.00 ? 60  VAL A HG12 1  
ATOM 120   H HG13 . VAL A 1 8   ? 10.201  -5.977  -7.339  1.00 0.00 ? 60  VAL A HG13 1  
ATOM 121   H HG21 . VAL A 1 8   ? 13.261  -8.951  -7.130  1.00 0.00 ? 60  VAL A HG21 1  
ATOM 122   H HG22 . VAL A 1 8   ? 11.539  -9.338  -6.942  1.00 0.00 ? 60  VAL A HG22 1  
ATOM 123   H HG23 . VAL A 1 8   ? 12.182  -8.927  -8.547  1.00 0.00 ? 60  VAL A HG23 1  
ATOM 124   N N    . GLU A 1 9   ? 11.780  -4.267  -8.682  1.00 0.00 ? 61  GLU A N    1  
ATOM 125   C CA   . GLU A 1 9   ? 11.398  -2.860  -8.614  1.00 0.00 ? 61  GLU A CA   1  
ATOM 126   C C    . GLU A 1 9   ? 9.888   -2.686  -8.805  1.00 0.00 ? 61  GLU A C    1  
ATOM 127   O O    . GLU A 1 9   ? 9.409   -1.577  -9.037  1.00 0.00 ? 61  GLU A O    1  
ATOM 128   C CB   . GLU A 1 9   ? 12.197  -2.060  -9.647  1.00 0.00 ? 61  GLU A CB   1  
ATOM 129   C CG   . GLU A 1 9   ? 11.922  -2.551  -11.072 1.00 0.00 ? 61  GLU A CG   1  
ATOM 130   C CD   . GLU A 1 9   ? 12.704  -1.732  -12.094 1.00 0.00 ? 61  GLU A CD   1  
ATOM 131   O OE1  . GLU A 1 9   ? 13.912  -2.011  -12.260 1.00 0.00 ? 61  GLU A OE1  1  
ATOM 132   O OE2  . GLU A 1 9   ? 12.089  -0.829  -12.705 1.00 0.00 ? 61  GLU A OE2  1  
ATOM 133   H H    . GLU A 1 9   ? 11.434  -4.807  -9.462  1.00 0.00 ? 61  GLU A H    1  
ATOM 134   H HA   . GLU A 1 9   ? 11.649  -2.484  -7.623  1.00 0.00 ? 61  GLU A HA   1  
ATOM 135   H HB2  . GLU A 1 9   ? 11.926  -1.006  -9.576  1.00 0.00 ? 61  GLU A HB2  1  
ATOM 136   H HB3  . GLU A 1 9   ? 13.260  -2.164  -9.432  1.00 0.00 ? 61  GLU A HB3  1  
ATOM 137   H HG2  . GLU A 1 9   ? 12.211  -3.599  -11.156 1.00 0.00 ? 61  GLU A HG2  1  
ATOM 138   H HG3  . GLU A 1 9   ? 10.856  -2.469  -11.283 1.00 0.00 ? 61  GLU A HG3  1  
ATOM 139   N N    . ARG A 1 10  ? 9.140   -3.790  -8.708  1.00 0.00 ? 62  ARG A N    1  
ATOM 140   C CA   . ARG A 1 10  ? 7.701   -3.825  -8.927  1.00 0.00 ? 62  ARG A CA   1  
ATOM 141   C C    . ARG A 1 10  ? 6.931   -3.653  -7.617  1.00 0.00 ? 62  ARG A C    1  
ATOM 142   O O    . ARG A 1 10  ? 5.798   -4.108  -7.481  1.00 0.00 ? 62  ARG A O    1  
ATOM 143   C CB   . ARG A 1 10  ? 7.363   -5.100  -9.693  1.00 0.00 ? 62  ARG A CB   1  
ATOM 144   C CG   . ARG A 1 10  ? 5.930   -5.155  -10.228 1.00 0.00 ? 62  ARG A CG   1  
ATOM 145   C CD   . ARG A 1 10  ? 5.707   -6.473  -10.968 1.00 0.00 ? 62  ARG A CD   1  
ATOM 146   N NE   . ARG A 1 10  ? 6.503   -6.544  -12.198 1.00 0.00 ? 62  ARG A NE   1  
ATOM 147   C CZ   . ARG A 1 10  ? 6.083   -6.109  -13.391 1.00 0.00 ? 62  ARG A CZ   1  
ATOM 148   N NH1  . ARG A 1 10  ? 4.871   -5.577  -13.538 1.00 0.00 ? 62  ARG A NH1  1  
ATOM 149   N NH2  . ARG A 1 10  ? 6.881   -6.207  -14.451 1.00 0.00 ? 62  ARG A NH2  1  
ATOM 150   H H    . ARG A 1 10  ? 9.594   -4.662  -8.472  1.00 0.00 ? 62  ARG A H    1  
ATOM 151   H HA   . ARG A 1 10  ? 7.446   -2.977  -9.564  1.00 0.00 ? 62  ARG A HA   1  
ATOM 152   H HB2  . ARG A 1 10  ? 8.045   -5.149  -10.542 1.00 0.00 ? 62  ARG A HB2  1  
ATOM 153   H HB3  . ARG A 1 10  ? 7.537   -5.952  -9.036  1.00 0.00 ? 62  ARG A HB3  1  
ATOM 154   H HG2  . ARG A 1 10  ? 5.224   -5.110  -9.399  1.00 0.00 ? 62  ARG A HG2  1  
ATOM 155   H HG3  . ARG A 1 10  ? 5.755   -4.317  -10.903 1.00 0.00 ? 62  ARG A HG3  1  
ATOM 156   H HD2  . ARG A 1 10  ? 5.985   -7.298  -10.312 1.00 0.00 ? 62  ARG A HD2  1  
ATOM 157   H HD3  . ARG A 1 10  ? 4.648   -6.572  -11.211 1.00 0.00 ? 62  ARG A HD3  1  
ATOM 158   H HE   . ARG A 1 10  ? 7.426   -6.947  -12.131 1.00 0.00 ? 62  ARG A HE   1  
ATOM 159   H HH11 . ARG A 1 10  ? 4.253   -5.502  -12.742 1.00 0.00 ? 62  ARG A HH11 1  
ATOM 160   H HH12 . ARG A 1 10  ? 4.570   -5.249  -14.443 1.00 0.00 ? 62  ARG A HH12 1  
ATOM 161   H HH21 . ARG A 1 10  ? 7.802   -6.608  -14.352 1.00 0.00 ? 62  ARG A HH21 1  
ATOM 162   H HH22 . ARG A 1 10  ? 6.565   -5.881  -15.352 1.00 0.00 ? 62  ARG A HH22 1  
ATOM 163   N N    . TYR A 1 11  ? 7.549   -2.990  -6.641  1.00 0.00 ? 63  TYR A N    1  
ATOM 164   C CA   . TYR A 1 11  ? 6.862   -2.580  -5.428  1.00 0.00 ? 63  TYR A CA   1  
ATOM 165   C C    . TYR A 1 11  ? 6.937   -1.067  -5.298  1.00 0.00 ? 63  TYR A C    1  
ATOM 166   O O    . TYR A 1 11  ? 7.911   -0.445  -5.719  1.00 0.00 ? 63  TYR A O    1  
ATOM 167   C CB   . TYR A 1 11  ? 7.451   -3.280  -4.205  1.00 0.00 ? 63  TYR A CB   1  
ATOM 168   C CG   . TYR A 1 11  ? 6.787   -4.603  -3.912  1.00 0.00 ? 63  TYR A CG   1  
ATOM 169   C CD1  . TYR A 1 11  ? 7.017   -5.715  -4.735  1.00 0.00 ? 63  TYR A CD1  1  
ATOM 170   C CD2  . TYR A 1 11  ? 5.930   -4.707  -2.807  1.00 0.00 ? 63  TYR A CD2  1  
ATOM 171   C CE1  . TYR A 1 11  ? 6.382   -6.934  -4.458  1.00 0.00 ? 63  TYR A CE1  1  
ATOM 172   C CE2  . TYR A 1 11  ? 5.300   -5.923  -2.518  1.00 0.00 ? 63  TYR A CE2  1  
ATOM 173   C CZ   . TYR A 1 11  ? 5.522   -7.043  -3.345  1.00 0.00 ? 63  TYR A CZ   1  
ATOM 174   O OH   . TYR A 1 11  ? 4.906   -8.226  -3.067  1.00 0.00 ? 63  TYR A OH   1  
ATOM 175   H H    . TYR A 1 11  ? 8.526   -2.749  -6.735  1.00 0.00 ? 63  TYR A H    1  
ATOM 176   H HA   . TYR A 1 11  ? 5.808   -2.850  -5.496  1.00 0.00 ? 63  TYR A HA   1  
ATOM 177   H HB2  . TYR A 1 11  ? 8.521   -3.425  -4.344  1.00 0.00 ? 63  TYR A HB2  1  
ATOM 178   H HB3  . TYR A 1 11  ? 7.300   -2.636  -3.339  1.00 0.00 ? 63  TYR A HB3  1  
ATOM 179   H HD1  . TYR A 1 11  ? 7.680   -5.635  -5.583  1.00 0.00 ? 63  TYR A HD1  1  
ATOM 180   H HD2  . TYR A 1 11  ? 5.755   -3.847  -2.177  1.00 0.00 ? 63  TYR A HD2  1  
ATOM 181   H HE1  . TYR A 1 11  ? 6.553   -7.787  -5.099  1.00 0.00 ? 63  TYR A HE1  1  
ATOM 182   H HE2  . TYR A 1 11  ? 4.643   -5.998  -1.663  1.00 0.00 ? 63  TYR A HE2  1  
ATOM 183   H HH   . TYR A 1 11  ? 5.134   -8.920  -3.689  1.00 0.00 ? 63  TYR A HH   1  
ATOM 184   N N    . SER A 1 12  ? 5.895   -0.477  -4.710  1.00 0.00 ? 64  SER A N    1  
ATOM 185   C CA   . SER A 1 12  ? 5.803   0.962   -4.570  1.00 0.00 ? 64  SER A CA   1  
ATOM 186   C C    . SER A 1 12  ? 6.710   1.397   -3.439  1.00 0.00 ? 64  SER A C    1  
ATOM 187   O O    . SER A 1 12  ? 6.531   0.981   -2.290  1.00 0.00 ? 64  SER A O    1  
ATOM 188   C CB   . SER A 1 12  ? 4.368   1.385   -4.300  1.00 0.00 ? 64  SER A CB   1  
ATOM 189   O OG   . SER A 1 12  ? 4.314   2.785   -4.136  1.00 0.00 ? 64  SER A OG   1  
ATOM 190   H H    . SER A 1 12  ? 5.138   -1.039  -4.344  1.00 0.00 ? 64  SER A H    1  
ATOM 191   H HA   . SER A 1 12  ? 6.137   1.431   -5.495  1.00 0.00 ? 64  SER A HA   1  
ATOM 192   H HB2  . SER A 1 12  ? 3.730   1.088   -5.133  1.00 0.00 ? 64  SER A HB2  1  
ATOM 193   H HB3  . SER A 1 12  ? 4.033   0.893   -3.387  1.00 0.00 ? 64  SER A HB3  1  
ATOM 194   H HG   . SER A 1 12  ? 3.399   3.049   -4.014  1.00 0.00 ? 64  SER A HG   1  
ATOM 195   N N    . ARG A 1 13  ? 7.674   2.239   -3.823  1.00 0.00 ? 65  ARG A N    1  
ATOM 196   C CA   . ARG A 1 13  ? 8.741   2.687   -2.937  1.00 0.00 ? 65  ARG A CA   1  
ATOM 197   C C    . ARG A 1 13  ? 8.275   3.605   -1.811  1.00 0.00 ? 65  ARG A C    1  
ATOM 198   O O    . ARG A 1 13  ? 9.080   3.947   -0.947  1.00 0.00 ? 65  ARG A O    1  
ATOM 199   C CB   . ARG A 1 13  ? 9.832   3.378   -3.759  1.00 0.00 ? 65  ARG A CB   1  
ATOM 200   C CG   . ARG A 1 13  ? 9.291   4.628   -4.459  1.00 0.00 ? 65  ARG A CG   1  
ATOM 201   C CD   . ARG A 1 13  ? 10.431  5.385   -5.139  1.00 0.00 ? 65  ARG A CD   1  
ATOM 202   N NE   . ARG A 1 13  ? 9.926   6.570   -5.844  1.00 0.00 ? 65  ARG A NE   1  
ATOM 203   C CZ   . ARG A 1 13  ? 10.588  7.726   -5.956  1.00 0.00 ? 65  ARG A CZ   1  
ATOM 204   N NH1  . ARG A 1 13  ? 11.791  7.890   -5.411  1.00 0.00 ? 65  ARG A NH1  1  
ATOM 205   N NH2  . ARG A 1 13  ? 10.037  8.737   -6.623  1.00 0.00 ? 65  ARG A NH2  1  
ATOM 206   H H    . ARG A 1 13  ? 7.678   2.579   -4.773  1.00 0.00 ? 65  ARG A H    1  
ATOM 207   H HA   . ARG A 1 13  ? 9.173   1.802   -2.470  1.00 0.00 ? 65  ARG A HA   1  
ATOM 208   H HB2  . ARG A 1 13  ? 10.650  3.662   -3.097  1.00 0.00 ? 65  ARG A HB2  1  
ATOM 209   H HB3  . ARG A 1 13  ? 10.211  2.682   -4.509  1.00 0.00 ? 65  ARG A HB3  1  
ATOM 210   H HG2  . ARG A 1 13  ? 8.551   4.340   -5.206  1.00 0.00 ? 65  ARG A HG2  1  
ATOM 211   H HG3  . ARG A 1 13  ? 8.822   5.285   -3.725  1.00 0.00 ? 65  ARG A HG3  1  
ATOM 212   H HD2  . ARG A 1 13  ? 11.152  5.688   -4.378  1.00 0.00 ? 65  ARG A HD2  1  
ATOM 213   H HD3  . ARG A 1 13  ? 10.926  4.729   -5.856  1.00 0.00 ? 65  ARG A HD3  1  
ATOM 214   H HE   . ARG A 1 13  ? 9.014   6.497   -6.271  1.00 0.00 ? 65  ARG A HE   1  
ATOM 215   H HH11 . ARG A 1 13  ? 12.220  7.135   -4.894  1.00 0.00 ? 65  ARG A HH11 1  
ATOM 216   H HH12 . ARG A 1 13  ? 12.278  8.768   -5.516  1.00 0.00 ? 65  ARG A HH12 1  
ATOM 217   H HH21 . ARG A 1 13  ? 9.124   8.630   -7.042  1.00 0.00 ? 65  ARG A HH21 1  
ATOM 218   H HH22 . ARG A 1 13  ? 10.531  9.613   -6.713  1.00 0.00 ? 65  ARG A HH22 1  
ATOM 219   N N    . LYS A 1 14  ? 7.003   4.014   -1.791  1.00 0.00 ? 66  LYS A N    1  
ATOM 220   C CA   . LYS A 1 14  ? 6.508   4.815   -0.681  1.00 0.00 ? 66  LYS A CA   1  
ATOM 221   C C    . LYS A 1 14  ? 6.172   3.881   0.470   1.00 0.00 ? 66  LYS A C    1  
ATOM 222   O O    . LYS A 1 14  ? 5.455   2.900   0.281   1.00 0.00 ? 66  LYS A O    1  
ATOM 223   C CB   . LYS A 1 14  ? 5.309   5.668   -1.103  1.00 0.00 ? 66  LYS A CB   1  
ATOM 224   C CG   . LYS A 1 14  ? 4.945   6.614   0.046   1.00 0.00 ? 66  LYS A CG   1  
ATOM 225   C CD   . LYS A 1 14  ? 3.798   7.554   -0.327  1.00 0.00 ? 66  LYS A CD   1  
ATOM 226   C CE   . LYS A 1 14  ? 2.516   6.769   -0.601  1.00 0.00 ? 66  LYS A CE   1  
ATOM 227   N NZ   . LYS A 1 14  ? 1.387   7.682   -0.854  1.00 0.00 ? 66  LYS A NZ   1  
ATOM 228   H H    . LYS A 1 14  ? 6.373   3.766   -2.540  1.00 0.00 ? 66  LYS A H    1  
ATOM 229   H HA   . LYS A 1 14  ? 7.303   5.484   -0.352  1.00 0.00 ? 66  LYS A HA   1  
ATOM 230   H HB2  . LYS A 1 14  ? 5.579   6.256   -1.981  1.00 0.00 ? 66  LYS A HB2  1  
ATOM 231   H HB3  . LYS A 1 14  ? 4.465   5.022   -1.344  1.00 0.00 ? 66  LYS A HB3  1  
ATOM 232   H HG2  . LYS A 1 14  ? 4.654   6.031   0.921   1.00 0.00 ? 66  LYS A HG2  1  
ATOM 233   H HG3  . LYS A 1 14  ? 5.818   7.214   0.301   1.00 0.00 ? 66  LYS A HG3  1  
ATOM 234   H HD2  . LYS A 1 14  ? 3.624   8.241   0.501   1.00 0.00 ? 66  LYS A HD2  1  
ATOM 235   H HD3  . LYS A 1 14  ? 4.073   8.128   -1.212  1.00 0.00 ? 66  LYS A HD3  1  
ATOM 236   H HE2  . LYS A 1 14  ? 2.664   6.125   -1.468  1.00 0.00 ? 66  LYS A HE2  1  
ATOM 237   H HE3  . LYS A 1 14  ? 2.287   6.144   0.263   1.00 0.00 ? 66  LYS A HE3  1  
ATOM 238   H HZ1  . LYS A 1 14  ? 1.588   8.272   -1.649  1.00 0.00 ? 66  LYS A HZ1  1  
ATOM 239   H HZ2  . LYS A 1 14  ? 0.550   7.149   -1.041  1.00 0.00 ? 66  LYS A HZ2  1  
ATOM 240   H HZ3  . LYS A 1 14  ? 1.229   8.266   -0.044  1.00 0.00 ? 66  LYS A HZ3  1  
ATOM 241   N N    . VAL A 1 15  ? 6.691   4.185   1.661   1.00 0.00 ? 67  VAL A N    1  
ATOM 242   C CA   . VAL A 1 15  ? 6.505   3.336   2.824   1.00 0.00 ? 67  VAL A CA   1  
ATOM 243   C C    . VAL A 1 15  ? 6.060   4.186   4.009   1.00 0.00 ? 67  VAL A C    1  
ATOM 244   O O    . VAL A 1 15  ? 6.695   5.186   4.343   1.00 0.00 ? 67  VAL A O    1  
ATOM 245   C CB   . VAL A 1 15  ? 7.803   2.573   3.127   1.00 0.00 ? 67  VAL A CB   1  
ATOM 246   C CG1  . VAL A 1 15  ? 7.579   1.507   4.200   1.00 0.00 ? 67  VAL A CG1  1  
ATOM 247   C CG2  . VAL A 1 15  ? 8.327   1.854   1.883   1.00 0.00 ? 67  VAL A CG2  1  
ATOM 248   H H    . VAL A 1 15  ? 7.234   5.030   1.770   1.00 0.00 ? 67  VAL A H    1  
ATOM 249   H HA   . VAL A 1 15  ? 5.723   2.609   2.607   1.00 0.00 ? 67  VAL A HA   1  
ATOM 250   H HB   . VAL A 1 15  ? 8.563   3.273   3.474   1.00 0.00 ? 67  VAL A HB   1  
ATOM 251   H HG11 . VAL A 1 15  ? 6.815   0.805   3.867   1.00 0.00 ? 67  VAL A HG11 1  
ATOM 252   H HG12 . VAL A 1 15  ? 8.507   0.962   4.373   1.00 0.00 ? 67  VAL A HG12 1  
ATOM 253   H HG13 . VAL A 1 15  ? 7.263   1.980   5.130   1.00 0.00 ? 67  VAL A HG13 1  
ATOM 254   H HG21 . VAL A 1 15  ? 8.598   2.584   1.121   1.00 0.00 ? 67  VAL A HG21 1  
ATOM 255   H HG22 . VAL A 1 15  ? 9.211   1.273   2.145   1.00 0.00 ? 67  VAL A HG22 1  
ATOM 256   H HG23 . VAL A 1 15  ? 7.560   1.186   1.491   1.00 0.00 ? 67  VAL A HG23 1  
ATOM 257   N N    . PHE A 1 16  ? 4.960   3.775   4.643   1.00 0.00 ? 68  PHE A N    1  
ATOM 258   C CA   . PHE A 1 16  ? 4.474   4.416   5.854   1.00 0.00 ? 68  PHE A CA   1  
ATOM 259   C C    . PHE A 1 16  ? 5.160   3.795   7.063   1.00 0.00 ? 68  PHE A C    1  
ATOM 260   O O    . PHE A 1 16  ? 5.450   2.599   7.067   1.00 0.00 ? 68  PHE A O    1  
ATOM 261   C CB   . PHE A 1 16  ? 2.956   4.263   5.945   1.00 0.00 ? 68  PHE A CB   1  
ATOM 262   C CG   . PHE A 1 16  ? 2.407   4.498   7.335   1.00 0.00 ? 68  PHE A CG   1  
ATOM 263   C CD1  . PHE A 1 16  ? 2.159   5.801   7.786   1.00 0.00 ? 68  PHE A CD1  1  
ATOM 264   C CD2  . PHE A 1 16  ? 2.150   3.404   8.174   1.00 0.00 ? 68  PHE A CD2  1  
ATOM 265   C CE1  . PHE A 1 16  ? 1.646   6.010   9.074   1.00 0.00 ? 68  PHE A CE1  1  
ATOM 266   C CE2  . PHE A 1 16  ? 1.635   3.613   9.460   1.00 0.00 ? 68  PHE A CE2  1  
ATOM 267   C CZ   . PHE A 1 16  ? 1.381   4.917   9.910   1.00 0.00 ? 68  PHE A CZ   1  
ATOM 268   H H    . PHE A 1 16  ? 4.437   2.991   4.280   1.00 0.00 ? 68  PHE A H    1  
ATOM 269   H HA   . PHE A 1 16  ? 4.714   5.479   5.827   1.00 0.00 ? 68  PHE A HA   1  
ATOM 270   H HB2  . PHE A 1 16  ? 2.484   4.953   5.246   1.00 0.00 ? 68  PHE A HB2  1  
ATOM 271   H HB3  . PHE A 1 16  ? 2.694   3.248   5.646   1.00 0.00 ? 68  PHE A HB3  1  
ATOM 272   H HD1  . PHE A 1 16  ? 2.362   6.643   7.142   1.00 0.00 ? 68  PHE A HD1  1  
ATOM 273   H HD2  . PHE A 1 16  ? 2.352   2.400   7.829   1.00 0.00 ? 68  PHE A HD2  1  
ATOM 274   H HE1  . PHE A 1 16  ? 1.453   7.015   9.420   1.00 0.00 ? 68  PHE A HE1  1  
ATOM 275   H HE2  . PHE A 1 16  ? 1.432   2.767   10.101  1.00 0.00 ? 68  PHE A HE2  1  
ATOM 276   H HZ   . PHE A 1 16  ? 0.984   5.080   10.901  1.00 0.00 ? 68  PHE A HZ   1  
ATOM 277   N N    . VAL A 1 17  ? 5.418   4.612   8.088   1.00 0.00 ? 69  VAL A N    1  
ATOM 278   C CA   . VAL A 1 17  ? 6.084   4.156   9.296   1.00 0.00 ? 69  VAL A CA   1  
ATOM 279   C C    . VAL A 1 17  ? 5.405   4.780   10.512  1.00 0.00 ? 69  VAL A C    1  
ATOM 280   O O    . VAL A 1 17  ? 4.854   5.874   10.415  1.00 0.00 ? 69  VAL A O    1  
ATOM 281   C CB   . VAL A 1 17  ? 7.566   4.539   9.238   1.00 0.00 ? 69  VAL A CB   1  
ATOM 282   C CG1  . VAL A 1 17  ? 8.342   3.741   10.279  1.00 0.00 ? 69  VAL A CG1  1  
ATOM 283   C CG2  . VAL A 1 17  ? 8.182   4.238   7.871   1.00 0.00 ? 69  VAL A CG2  1  
ATOM 284   H H    . VAL A 1 17  ? 5.150   5.585   8.037   1.00 0.00 ? 69  VAL A H    1  
ATOM 285   H HA   . VAL A 1 17  ? 6.006   3.070   9.364   1.00 0.00 ? 69  VAL A HA   1  
ATOM 286   H HB   . VAL A 1 17  ? 7.671   5.604   9.443   1.00 0.00 ? 69  VAL A HB   1  
ATOM 287   H HG11 . VAL A 1 17  ? 8.230   2.674   10.085  1.00 0.00 ? 69  VAL A HG11 1  
ATOM 288   H HG12 . VAL A 1 17  ? 9.396   4.010   10.217  1.00 0.00 ? 69  VAL A HG12 1  
ATOM 289   H HG13 . VAL A 1 17  ? 7.964   3.974   11.274  1.00 0.00 ? 69  VAL A HG13 1  
ATOM 290   H HG21 . VAL A 1 17  ? 7.693   4.838   7.104   1.00 0.00 ? 69  VAL A HG21 1  
ATOM 291   H HG22 . VAL A 1 17  ? 9.241   4.495   7.892   1.00 0.00 ? 69  VAL A HG22 1  
ATOM 292   H HG23 . VAL A 1 17  ? 8.070   3.179   7.641   1.00 0.00 ? 69  VAL A HG23 1  
ATOM 293   N N    . GLY A 1 18  ? 5.442   4.094   11.657  1.00 0.00 ? 70  GLY A N    1  
ATOM 294   C CA   . GLY A 1 18  ? 4.842   4.614   12.879  1.00 0.00 ? 70  GLY A CA   1  
ATOM 295   C C    . GLY A 1 18  ? 5.633   4.259   14.136  1.00 0.00 ? 70  GLY A C    1  
ATOM 296   O O    . GLY A 1 18  ? 5.331   4.767   15.213  1.00 0.00 ? 70  GLY A O    1  
ATOM 297   H H    . GLY A 1 18  ? 5.891   3.190   11.683  1.00 0.00 ? 70  GLY A H    1  
ATOM 298   H HA2  . GLY A 1 18  ? 4.767   5.699   12.810  1.00 0.00 ? 70  GLY A HA2  1  
ATOM 299   H HA3  . GLY A 1 18  ? 3.839   4.199   12.974  1.00 0.00 ? 70  GLY A HA3  1  
ATOM 300   N N    . GLY A 1 19  ? 6.643   3.392   14.009  1.00 0.00 ? 71  GLY A N    1  
ATOM 301   C CA   . GLY A 1 19  ? 7.413   2.928   15.154  1.00 0.00 ? 71  GLY A CA   1  
ATOM 302   C C    . GLY A 1 19  ? 8.601   3.818   15.520  1.00 0.00 ? 71  GLY A C    1  
ATOM 303   O O    . GLY A 1 19  ? 9.378   3.449   16.399  1.00 0.00 ? 71  GLY A O    1  
ATOM 304   H H    . GLY A 1 19  ? 6.885   3.031   13.097  1.00 0.00 ? 71  GLY A H    1  
ATOM 305   H HA2  . GLY A 1 19  ? 6.750   2.876   16.019  1.00 0.00 ? 71  GLY A HA2  1  
ATOM 306   H HA3  . GLY A 1 19  ? 7.777   1.921   14.948  1.00 0.00 ? 71  GLY A HA3  1  
ATOM 307   N N    . LEU A 1 20  ? 8.761   4.973   14.869  1.00 0.00 ? 72  LEU A N    1  
ATOM 308   C CA   . LEU A 1 20  ? 9.877   5.865   15.161  1.00 0.00 ? 72  LEU A CA   1  
ATOM 309   C C    . LEU A 1 20  ? 9.845   6.291   16.630  1.00 0.00 ? 72  LEU A C    1  
ATOM 310   O O    . LEU A 1 20  ? 8.775   6.356   17.236  1.00 0.00 ? 72  LEU A O    1  
ATOM 311   C CB   . LEU A 1 20  ? 9.829   7.087   14.237  1.00 0.00 ? 72  LEU A CB   1  
ATOM 312   C CG   . LEU A 1 20  ? 10.555  6.856   12.907  1.00 0.00 ? 72  LEU A CG   1  
ATOM 313   C CD1  . LEU A 1 20  ? 10.168  5.535   12.254  1.00 0.00 ? 72  LEU A CD1  1  
ATOM 314   C CD2  . LEU A 1 20  ? 10.192  7.973   11.932  1.00 0.00 ? 72  LEU A CD2  1  
ATOM 315   H H    . LEU A 1 20  ? 8.099   5.248   14.156  1.00 0.00 ? 72  LEU A H    1  
ATOM 316   H HA   . LEU A 1 20  ? 10.809  5.328   14.985  1.00 0.00 ? 72  LEU A HA   1  
ATOM 317   H HB2  . LEU A 1 20  ? 8.787   7.344   14.045  1.00 0.00 ? 72  LEU A HB2  1  
ATOM 318   H HB3  . LEU A 1 20  ? 10.301  7.931   14.739  1.00 0.00 ? 72  LEU A HB3  1  
ATOM 319   H HG   . LEU A 1 20  ? 11.631  6.863   13.081  1.00 0.00 ? 72  LEU A HG   1  
ATOM 320   H HD11 . LEU A 1 20  ? 10.663  5.454   11.287  1.00 0.00 ? 72  LEU A HD11 1  
ATOM 321   H HD12 . LEU A 1 20  ? 10.478  4.701   12.882  1.00 0.00 ? 72  LEU A HD12 1  
ATOM 322   H HD13 . LEU A 1 20  ? 9.087   5.515   12.116  1.00 0.00 ? 72  LEU A HD13 1  
ATOM 323   H HD21 . LEU A 1 20  ? 10.418  8.941   12.380  1.00 0.00 ? 72  LEU A HD21 1  
ATOM 324   H HD22 . LEU A 1 20  ? 10.766  7.857   11.013  1.00 0.00 ? 72  LEU A HD22 1  
ATOM 325   H HD23 . LEU A 1 20  ? 9.128   7.922   11.701  1.00 0.00 ? 72  LEU A HD23 1  
ATOM 326   N N    . PRO A 1 21  ? 11.018  6.584   17.207  1.00 0.00 ? 73  PRO A N    1  
ATOM 327   C CA   . PRO A 1 21  ? 11.163  6.965   18.601  1.00 0.00 ? 73  PRO A CA   1  
ATOM 328   C C    . PRO A 1 21  ? 10.432  8.273   18.905  1.00 0.00 ? 73  PRO A C    1  
ATOM 329   O O    . PRO A 1 21  ? 10.080  9.019   17.991  1.00 0.00 ? 73  PRO A O    1  
ATOM 330   C CB   . PRO A 1 21  ? 12.671  7.096   18.832  1.00 0.00 ? 73  PRO A CB   1  
ATOM 331   C CG   . PRO A 1 21  ? 13.235  7.364   17.440  1.00 0.00 ? 73  PRO A CG   1  
ATOM 332   C CD   . PRO A 1 21  ? 12.304  6.562   16.538  1.00 0.00 ? 73  PRO A CD   1  
ATOM 333   H HA   . PRO A 1 21  ? 10.768  6.177   19.241  1.00 0.00 ? 73  PRO A HA   1  
ATOM 334   H HB2  . PRO A 1 21  ? 12.906  7.912   19.516  1.00 0.00 ? 73  PRO A HB2  1  
ATOM 335   H HB3  . PRO A 1 21  ? 13.065  6.151   19.208  1.00 0.00 ? 73  PRO A HB3  1  
ATOM 336   H HG2  . PRO A 1 21  ? 13.141  8.424   17.207  1.00 0.00 ? 73  PRO A HG2  1  
ATOM 337   H HG3  . PRO A 1 21  ? 14.270  7.034   17.350  1.00 0.00 ? 73  PRO A HG3  1  
ATOM 338   H HD2  . PRO A 1 21  ? 12.251  7.018   15.550  1.00 0.00 ? 73  PRO A HD2  1  
ATOM 339   H HD3  . PRO A 1 21  ? 12.658  5.533   16.465  1.00 0.00 ? 73  PRO A HD3  1  
ATOM 340   N N    . PRO A 1 22  ? 10.201  8.560   20.195  1.00 0.00 ? 74  PRO A N    1  
ATOM 341   C CA   . PRO A 1 22  ? 9.524   9.765   20.652  1.00 0.00 ? 74  PRO A CA   1  
ATOM 342   C C    . PRO A 1 22  ? 10.339  11.026  20.358  1.00 0.00 ? 74  PRO A C    1  
ATOM 343   O O    . PRO A 1 22  ? 9.862   12.137  20.582  1.00 0.00 ? 74  PRO A O    1  
ATOM 344   C CB   . PRO A 1 22  ? 9.322   9.562   22.155  1.00 0.00 ? 74  PRO A CB   1  
ATOM 345   C CG   . PRO A 1 22  ? 10.469  8.630   22.541  1.00 0.00 ? 74  PRO A CG   1  
ATOM 346   C CD   . PRO A 1 22  ? 10.585  7.725   21.319  1.00 0.00 ? 74  PRO A CD   1  
ATOM 347   H HA   . PRO A 1 22  ? 8.555   9.852   20.162  1.00 0.00 ? 74  PRO A HA   1  
ATOM 348   H HB2  . PRO A 1 22  ? 9.365   10.503  22.703  1.00 0.00 ? 74  PRO A HB2  1  
ATOM 349   H HB3  . PRO A 1 22  ? 8.373   9.056   22.329  1.00 0.00 ? 74  PRO A HB3  1  
ATOM 350   H HG2  . PRO A 1 22  ? 11.385  9.208   22.659  1.00 0.00 ? 74  PRO A HG2  1  
ATOM 351   H HG3  . PRO A 1 22  ? 10.245  8.063   23.445  1.00 0.00 ? 74  PRO A HG3  1  
ATOM 352   H HD2  . PRO A 1 22  ? 11.604  7.352   21.217  1.00 0.00 ? 74  PRO A HD2  1  
ATOM 353   H HD3  . PRO A 1 22  ? 9.887   6.891   21.406  1.00 0.00 ? 74  PRO A HD3  1  
ATOM 354   N N    . ASP A 1 23  ? 11.566  10.860  19.854  1.00 0.00 ? 75  ASP A N    1  
ATOM 355   C CA   . ASP A 1 23  ? 12.407  11.955  19.406  1.00 0.00 ? 75  ASP A CA   1  
ATOM 356   C C    . ASP A 1 23  ? 13.107  11.515  18.125  1.00 0.00 ? 75  ASP A C    1  
ATOM 357   O O    . ASP A 1 23  ? 13.941  10.610  18.150  1.00 0.00 ? 75  ASP A O    1  
ATOM 358   C CB   . ASP A 1 23  ? 13.412  12.310  20.503  1.00 0.00 ? 75  ASP A CB   1  
ATOM 359   C CG   . ASP A 1 23  ? 14.324  13.457  20.074  1.00 0.00 ? 75  ASP A CG   1  
ATOM 360   O OD1  . ASP A 1 23  ? 13.782  14.550  19.800  1.00 0.00 ? 75  ASP A OD1  1  
ATOM 361   O OD2  . ASP A 1 23  ? 15.553  13.232  20.022  1.00 0.00 ? 75  ASP A OD2  1  
ATOM 362   H H    . ASP A 1 23  ? 11.939  9.926   19.769  1.00 0.00 ? 75  ASP A H    1  
ATOM 363   H HA   . ASP A 1 23  ? 11.790  12.828  19.194  1.00 0.00 ? 75  ASP A HA   1  
ATOM 364   H HB2  . ASP A 1 23  ? 12.871  12.604  21.402  1.00 0.00 ? 75  ASP A HB2  1  
ATOM 365   H HB3  . ASP A 1 23  ? 14.017  11.432  20.732  1.00 0.00 ? 75  ASP A HB3  1  
ATOM 366   N N    . ILE A 1 24  ? 12.766  12.155  17.002  1.00 0.00 ? 76  ILE A N    1  
ATOM 367   C CA   . ILE A 1 24  ? 13.266  11.759  15.694  1.00 0.00 ? 76  ILE A CA   1  
ATOM 368   C C    . ILE A 1 24  ? 13.448  12.970  14.785  1.00 0.00 ? 76  ILE A C    1  
ATOM 369   O O    . ILE A 1 24  ? 12.709  13.948  14.870  1.00 0.00 ? 76  ILE A O    1  
ATOM 370   C CB   . ILE A 1 24  ? 12.311  10.721  15.073  1.00 0.00 ? 76  ILE A CB   1  
ATOM 371   C CG1  . ILE A 1 24  ? 12.713  10.309  13.643  1.00 0.00 ? 76  ILE A CG1  1  
ATOM 372   C CG2  . ILE A 1 24  ? 10.854  11.201  15.117  1.00 0.00 ? 76  ILE A CG2  1  
ATOM 373   C CD1  . ILE A 1 24  ? 12.098  11.175  12.536  1.00 0.00 ? 76  ILE A CD1  1  
ATOM 374   H H    . ILE A 1 24  ? 12.134  12.942  17.047  1.00 0.00 ? 76  ILE A H    1  
ATOM 375   H HA   . ILE A 1 24  ? 14.241  11.288  15.818  1.00 0.00 ? 76  ILE A HA   1  
ATOM 376   H HB   . ILE A 1 24  ? 12.374  9.826   15.692  1.00 0.00 ? 76  ILE A HB   1  
ATOM 377   H HG12 . ILE A 1 24  ? 13.798  10.326  13.546  1.00 0.00 ? 76  ILE A HG12 1  
ATOM 378   H HG13 . ILE A 1 24  ? 12.387  9.282   13.477  1.00 0.00 ? 76  ILE A HG13 1  
ATOM 379   H HG21 . ILE A 1 24  ? 10.209  10.454  14.654  1.00 0.00 ? 76  ILE A HG21 1  
ATOM 380   H HG22 . ILE A 1 24  ? 10.540  11.337  16.152  1.00 0.00 ? 76  ILE A HG22 1  
ATOM 381   H HG23 . ILE A 1 24  ? 10.754  12.146  14.583  1.00 0.00 ? 76  ILE A HG23 1  
ATOM 382   H HD11 . ILE A 1 24  ? 12.469  10.836  11.569  1.00 0.00 ? 76  ILE A HD11 1  
ATOM 383   H HD12 . ILE A 1 24  ? 11.013  11.080  12.545  1.00 0.00 ? 76  ILE A HD12 1  
ATOM 384   H HD13 . ILE A 1 24  ? 12.364  12.224  12.669  1.00 0.00 ? 76  ILE A HD13 1  
ATOM 385   N N    . ASP A 1 25  ? 14.450  12.878  13.911  1.00 0.00 ? 77  ASP A N    1  
ATOM 386   C CA   . ASP A 1 25  ? 14.698  13.822  12.837  1.00 0.00 ? 77  ASP A CA   1  
ATOM 387   C C    . ASP A 1 25  ? 15.102  13.009  11.607  1.00 0.00 ? 77  ASP A C    1  
ATOM 388   O O    . ASP A 1 25  ? 15.367  11.815  11.724  1.00 0.00 ? 77  ASP A O    1  
ATOM 389   C CB   . ASP A 1 25  ? 15.769  14.831  13.252  1.00 0.00 ? 77  ASP A CB   1  
ATOM 390   C CG   . ASP A 1 25  ? 17.124  14.165  13.465  1.00 0.00 ? 77  ASP A CG   1  
ATOM 391   O OD1  . ASP A 1 25  ? 17.877  14.083  12.471  1.00 0.00 ? 77  ASP A OD1  1  
ATOM 392   O OD2  . ASP A 1 25  ? 17.394  13.745  14.612  1.00 0.00 ? 77  ASP A OD2  1  
ATOM 393   H H    . ASP A 1 25  ? 15.085  12.096  13.982  1.00 0.00 ? 77  ASP A H    1  
ATOM 394   H HA   . ASP A 1 25  ? 13.778  14.364  12.616  1.00 0.00 ? 77  ASP A HA   1  
ATOM 395   H HB2  . ASP A 1 25  ? 15.864  15.586  12.471  1.00 0.00 ? 77  ASP A HB2  1  
ATOM 396   H HB3  . ASP A 1 25  ? 15.459  15.325  14.172  1.00 0.00 ? 77  ASP A HB3  1  
ATOM 397   N N    . GLU A 1 26  ? 15.154  13.629  10.427  1.00 0.00 ? 78  GLU A N    1  
ATOM 398   C CA   . GLU A 1 26  ? 15.392  12.908  9.186   1.00 0.00 ? 78  GLU A CA   1  
ATOM 399   C C    . GLU A 1 26  ? 16.709  12.124  9.178   1.00 0.00 ? 78  GLU A C    1  
ATOM 400   O O    . GLU A 1 26  ? 16.845  11.201  8.381   1.00 0.00 ? 78  GLU A O    1  
ATOM 401   C CB   . GLU A 1 26  ? 15.340  13.892  8.012   1.00 0.00 ? 78  GLU A CB   1  
ATOM 402   C CG   . GLU A 1 26  ? 16.382  14.999  8.162   1.00 0.00 ? 78  GLU A CG   1  
ATOM 403   C CD   . GLU A 1 26  ? 16.366  15.934  6.955   1.00 0.00 ? 78  GLU A CD   1  
ATOM 404   O OE1  . GLU A 1 26  ? 15.587  16.913  6.991   1.00 0.00 ? 78  GLU A OE1  1  
ATOM 405   O OE2  . GLU A 1 26  ? 17.132  15.664  6.003   1.00 0.00 ? 78  GLU A OE2  1  
ATOM 406   H H    . GLU A 1 26  ? 15.020  14.630  10.376  1.00 0.00 ? 78  GLU A H    1  
ATOM 407   H HA   . GLU A 1 26  ? 14.584  12.189  9.054   1.00 0.00 ? 78  GLU A HA   1  
ATOM 408   H HB2  . GLU A 1 26  ? 15.523  13.349  7.084   1.00 0.00 ? 78  GLU A HB2  1  
ATOM 409   H HB3  . GLU A 1 26  ? 14.351  14.346  7.964   1.00 0.00 ? 78  GLU A HB3  1  
ATOM 410   H HG2  . GLU A 1 26  ? 16.174  15.573  9.065   1.00 0.00 ? 78  GLU A HG2  1  
ATOM 411   H HG3  . GLU A 1 26  ? 17.369  14.545  8.258   1.00 0.00 ? 78  GLU A HG3  1  
ATOM 412   N N    . ASP A 1 27  ? 17.680  12.456  10.037  1.00 0.00 ? 79  ASP A N    1  
ATOM 413   C CA   . ASP A 1 27  ? 18.948  11.736  10.058  1.00 0.00 ? 79  ASP A CA   1  
ATOM 414   C C    . ASP A 1 27  ? 18.864  10.505  10.964  1.00 0.00 ? 79  ASP A C    1  
ATOM 415   O O    . ASP A 1 27  ? 19.635  9.561   10.798  1.00 0.00 ? 79  ASP A O    1  
ATOM 416   C CB   . ASP A 1 27  ? 20.066  12.678  10.504  1.00 0.00 ? 79  ASP A CB   1  
ATOM 417   C CG   . ASP A 1 27  ? 21.436  12.015  10.377  1.00 0.00 ? 79  ASP A CG   1  
ATOM 418   O OD1  . ASP A 1 27  ? 21.839  11.742  9.224   1.00 0.00 ? 79  ASP A OD1  1  
ATOM 419   O OD2  . ASP A 1 27  ? 22.069  11.787  11.433  1.00 0.00 ? 79  ASP A OD2  1  
ATOM 420   H H    . ASP A 1 27  ? 17.548  13.216  10.689  1.00 0.00 ? 79  ASP A H    1  
ATOM 421   H HA   . ASP A 1 27  ? 19.173  11.402  9.045   1.00 0.00 ? 79  ASP A HA   1  
ATOM 422   H HB2  . ASP A 1 27  ? 20.048  13.573  9.883   1.00 0.00 ? 79  ASP A HB2  1  
ATOM 423   H HB3  . ASP A 1 27  ? 19.901  12.965  11.543  1.00 0.00 ? 79  ASP A HB3  1  
ATOM 424   N N    . GLU A 1 28  ? 17.931  10.509  11.919  1.00 0.00 ? 80  GLU A N    1  
ATOM 425   C CA   . GLU A 1 28  ? 17.725  9.381   12.816  1.00 0.00 ? 80  GLU A CA   1  
ATOM 426   C C    . GLU A 1 28  ? 17.103  8.231   12.034  1.00 0.00 ? 80  GLU A C    1  
ATOM 427   O O    . GLU A 1 28  ? 17.493  7.077   12.192  1.00 0.00 ? 80  GLU A O    1  
ATOM 428   C CB   . GLU A 1 28  ? 16.784  9.818   13.942  1.00 0.00 ? 80  GLU A CB   1  
ATOM 429   C CG   . GLU A 1 28  ? 16.427  8.667   14.883  1.00 0.00 ? 80  GLU A CG   1  
ATOM 430   C CD   . GLU A 1 28  ? 17.616  8.268   15.755  1.00 0.00 ? 80  GLU A CD   1  
ATOM 431   O OE1  . GLU A 1 28  ? 17.865  8.981   16.753  1.00 0.00 ? 80  GLU A OE1  1  
ATOM 432   O OE2  . GLU A 1 28  ? 18.269  7.255   15.419  1.00 0.00 ? 80  GLU A OE2  1  
ATOM 433   H H    . GLU A 1 28  ? 17.338  11.319  12.030  1.00 0.00 ? 80  GLU A H    1  
ATOM 434   H HA   . GLU A 1 28  ? 18.679  9.061   13.236  1.00 0.00 ? 80  GLU A HA   1  
ATOM 435   H HB2  . GLU A 1 28  ? 17.245  10.627  14.509  1.00 0.00 ? 80  GLU A HB2  1  
ATOM 436   H HB3  . GLU A 1 28  ? 15.864  10.192  13.493  1.00 0.00 ? 80  GLU A HB3  1  
ATOM 437   H HG2  . GLU A 1 28  ? 15.599  8.985   15.517  1.00 0.00 ? 80  GLU A HG2  1  
ATOM 438   H HG3  . GLU A 1 28  ? 16.085  7.809   14.305  1.00 0.00 ? 80  GLU A HG3  1  
ATOM 439   N N    . ILE A 1 29  ? 16.127  8.553   11.182  1.00 0.00 ? 81  ILE A N    1  
ATOM 440   C CA   . ILE A 1 29  ? 15.444  7.555   10.376  1.00 0.00 ? 81  ILE A CA   1  
ATOM 441   C C    . ILE A 1 29  ? 16.326  7.135   9.202   1.00 0.00 ? 81  ILE A C    1  
ATOM 442   O O    . ILE A 1 29  ? 16.191  6.020   8.702   1.00 0.00 ? 81  ILE A O    1  
ATOM 443   C CB   . ILE A 1 29  ? 14.058  8.081   9.976   1.00 0.00 ? 81  ILE A CB   1  
ATOM 444   C CG1  . ILE A 1 29  ? 13.394  7.209   8.908   1.00 0.00 ? 81  ILE A CG1  1  
ATOM 445   C CG2  . ILE A 1 29  ? 14.099  9.543   9.525   1.00 0.00 ? 81  ILE A CG2  1  
ATOM 446   C CD1  . ILE A 1 29  ? 13.759  7.638   7.485   1.00 0.00 ? 81  ILE A CD1  1  
ATOM 447   H H    . ILE A 1 29  ? 15.848  9.519   11.088  1.00 0.00 ? 81  ILE A H    1  
ATOM 448   H HA   . ILE A 1 29  ? 15.288  6.670   10.993  1.00 0.00 ? 81  ILE A HA   1  
ATOM 449   H HB   . ILE A 1 29  ? 13.431  8.029   10.866  1.00 0.00 ? 81  ILE A HB   1  
ATOM 450   H HG12 . ILE A 1 29  ? 13.678  6.170   9.069   1.00 0.00 ? 81  ILE A HG12 1  
ATOM 451   H HG13 . ILE A 1 29  ? 12.313  7.290   9.021   1.00 0.00 ? 81  ILE A HG13 1  
ATOM 452   H HG21 . ILE A 1 29  ? 14.812  9.664   8.709   1.00 0.00 ? 81  ILE A HG21 1  
ATOM 453   H HG22 . ILE A 1 29  ? 13.105  9.840   9.190   1.00 0.00 ? 81  ILE A HG22 1  
ATOM 454   H HG23 . ILE A 1 29  ? 14.390  10.178  10.361  1.00 0.00 ? 81  ILE A HG23 1  
ATOM 455   H HD11 . ILE A 1 29  ? 13.326  8.617   7.274   1.00 0.00 ? 81  ILE A HD11 1  
ATOM 456   H HD12 . ILE A 1 29  ? 14.841  7.700   7.366   1.00 0.00 ? 81  ILE A HD12 1  
ATOM 457   H HD13 . ILE A 1 29  ? 13.365  6.910   6.775   1.00 0.00 ? 81  ILE A HD13 1  
ATOM 458   N N    . THR A 1 30  ? 17.227  8.013   8.753   1.00 0.00 ? 82  THR A N    1  
ATOM 459   C CA   . THR A 1 30  ? 18.168  7.644   7.699   1.00 0.00 ? 82  THR A CA   1  
ATOM 460   C C    . THR A 1 30  ? 19.153  6.604   8.230   1.00 0.00 ? 82  THR A C    1  
ATOM 461   O O    . THR A 1 30  ? 19.686  5.803   7.464   1.00 0.00 ? 82  THR A O    1  
ATOM 462   C CB   . THR A 1 30  ? 18.910  8.882   7.183   1.00 0.00 ? 82  THR A CB   1  
ATOM 463   O OG1  . THR A 1 30  ? 18.002  9.768   6.572   1.00 0.00 ? 82  THR A OG1  1  
ATOM 464   C CG2  . THR A 1 30  ? 19.955  8.504   6.133   1.00 0.00 ? 82  THR A CG2  1  
ATOM 465   H H    . THR A 1 30  ? 17.262  8.941   9.150   1.00 0.00 ? 82  THR A H    1  
ATOM 466   H HA   . THR A 1 30  ? 17.610  7.203   6.873   1.00 0.00 ? 82  THR A HA   1  
ATOM 467   H HB   . THR A 1 30  ? 19.404  9.387   8.013   1.00 0.00 ? 82  THR A HB   1  
ATOM 468   H HG1  . THR A 1 30  ? 17.492  10.204  7.258   1.00 0.00 ? 82  THR A HG1  1  
ATOM 469   H HG21 . THR A 1 30  ? 19.485  7.918   5.342   1.00 0.00 ? 82  THR A HG21 1  
ATOM 470   H HG22 . THR A 1 30  ? 20.381  9.411   5.705   1.00 0.00 ? 82  THR A HG22 1  
ATOM 471   H HG23 . THR A 1 30  ? 20.753  7.923   6.594   1.00 0.00 ? 82  THR A HG23 1  
ATOM 472   N N    . ALA A 1 31  ? 19.400  6.611   9.543   1.00 0.00 ? 83  ALA A N    1  
ATOM 473   C CA   . ALA A 1 31  ? 20.259  5.628   10.181  1.00 0.00 ? 83  ALA A CA   1  
ATOM 474   C C    . ALA A 1 31  ? 19.453  4.414   10.651  1.00 0.00 ? 83  ALA A C    1  
ATOM 475   O O    . ALA A 1 31  ? 20.028  3.372   10.961  1.00 0.00 ? 83  ALA A O    1  
ATOM 476   C CB   . ALA A 1 31  ? 20.986  6.294   11.348  1.00 0.00 ? 83  ALA A CB   1  
ATOM 477   H H    . ALA A 1 31  ? 18.980  7.320   10.127  1.00 0.00 ? 83  ALA A H    1  
ATOM 478   H HA   . ALA A 1 31  ? 21.003  5.288   9.460   1.00 0.00 ? 83  ALA A HA   1  
ATOM 479   H HB1  . ALA A 1 31  ? 20.260  6.652   12.077  1.00 0.00 ? 83  ALA A HB1  1  
ATOM 480   H HB2  . ALA A 1 31  ? 21.648  5.570   11.826  1.00 0.00 ? 83  ALA A HB2  1  
ATOM 481   H HB3  . ALA A 1 31  ? 21.575  7.134   10.981  1.00 0.00 ? 83  ALA A HB3  1  
ATOM 482   N N    . SER A 1 32  ? 18.122  4.545   10.703  1.00 0.00 ? 84  SER A N    1  
ATOM 483   C CA   . SER A 1 32  ? 17.253  3.451   11.112  1.00 0.00 ? 84  SER A CA   1  
ATOM 484   C C    . SER A 1 32  ? 17.128  2.414   10.002  1.00 0.00 ? 84  SER A C    1  
ATOM 485   O O    . SER A 1 32  ? 17.185  1.215   10.273  1.00 0.00 ? 84  SER A O    1  
ATOM 486   C CB   . SER A 1 32  ? 15.876  4.003   11.485  1.00 0.00 ? 84  SER A CB   1  
ATOM 487   O OG   . SER A 1 32  ? 15.975  4.807   12.641  1.00 0.00 ? 84  SER A OG   1  
ATOM 488   H H    . SER A 1 32  ? 17.695  5.426   10.459  1.00 0.00 ? 84  SER A H    1  
ATOM 489   H HA   . SER A 1 32  ? 17.680  2.964   11.989  1.00 0.00 ? 84  SER A HA   1  
ATOM 490   H HB2  . SER A 1 32  ? 15.479  4.590   10.658  1.00 0.00 ? 84  SER A HB2  1  
ATOM 491   H HB3  . SER A 1 32  ? 15.194  3.176   11.687  1.00 0.00 ? 84  SER A HB3  1  
ATOM 492   H HG   . SER A 1 32  ? 16.584  5.529   12.465  1.00 0.00 ? 84  SER A HG   1  
ATOM 493   N N    . PHE A 1 33  ? 16.957  2.854   8.752   1.00 0.00 ? 85  PHE A N    1  
ATOM 494   C CA   . PHE A 1 33  ? 16.891  1.940   7.623   1.00 0.00 ? 85  PHE A CA   1  
ATOM 495   C C    . PHE A 1 33  ? 18.265  1.751   6.991   1.00 0.00 ? 85  PHE A C    1  
ATOM 496   O O    . PHE A 1 33  ? 19.134  2.615   7.104   1.00 0.00 ? 85  PHE A O    1  
ATOM 497   C CB   . PHE A 1 33  ? 15.887  2.435   6.581   1.00 0.00 ? 85  PHE A CB   1  
ATOM 498   C CG   . PHE A 1 33  ? 14.476  2.643   7.089   1.00 0.00 ? 85  PHE A CG   1  
ATOM 499   C CD1  . PHE A 1 33  ? 13.910  1.753   8.014   1.00 0.00 ? 85  PHE A CD1  1  
ATOM 500   C CD2  . PHE A 1 33  ? 13.726  3.732   6.625   1.00 0.00 ? 85  PHE A CD2  1  
ATOM 501   C CE1  . PHE A 1 33  ? 12.595  1.945   8.459   1.00 0.00 ? 85  PHE A CE1  1  
ATOM 502   C CE2  . PHE A 1 33  ? 12.403  3.906   7.043   1.00 0.00 ? 85  PHE A CE2  1  
ATOM 503   C CZ   . PHE A 1 33  ? 11.839  3.021   7.976   1.00 0.00 ? 85  PHE A CZ   1  
ATOM 504   H H    . PHE A 1 33  ? 16.869  3.843   8.571   1.00 0.00 ? 85  PHE A H    1  
ATOM 505   H HA   . PHE A 1 33  ? 16.554  0.967   7.981   1.00 0.00 ? 85  PHE A HA   1  
ATOM 506   H HB2  . PHE A 1 33  ? 16.253  3.365   6.145   1.00 0.00 ? 85  PHE A HB2  1  
ATOM 507   H HB3  . PHE A 1 33  ? 15.844  1.694   5.781   1.00 0.00 ? 85  PHE A HB3  1  
ATOM 508   H HD1  . PHE A 1 33  ? 14.484  0.917   8.387   1.00 0.00 ? 85  PHE A HD1  1  
ATOM 509   H HD2  . PHE A 1 33  ? 14.166  4.440   5.939   1.00 0.00 ? 85  PHE A HD2  1  
ATOM 510   H HE1  . PHE A 1 33  ? 12.164  1.261   9.176   1.00 0.00 ? 85  PHE A HE1  1  
ATOM 511   H HE2  . PHE A 1 33  ? 11.829  4.726   6.639   1.00 0.00 ? 85  PHE A HE2  1  
ATOM 512   H HZ   . PHE A 1 33  ? 10.826  3.162   8.323   1.00 0.00 ? 85  PHE A HZ   1  
ATOM 513   N N    . ARG A 1 34  ? 18.448  0.610   6.323   1.00 0.00 ? 86  ARG A N    1  
ATOM 514   C CA   . ARG A 1 34  ? 19.669  0.269   5.609   1.00 0.00 ? 86  ARG A CA   1  
ATOM 515   C C    . ARG A 1 34  ? 19.323  -0.001  4.148   1.00 0.00 ? 86  ARG A C    1  
ATOM 516   O O    . ARG A 1 34  ? 18.158  -0.218  3.820   1.00 0.00 ? 86  ARG A O    1  
ATOM 517   C CB   . ARG A 1 34  ? 20.332  -0.956  6.251   1.00 0.00 ? 86  ARG A CB   1  
ATOM 518   C CG   . ARG A 1 34  ? 20.776  -0.740  7.704   1.00 0.00 ? 86  ARG A CG   1  
ATOM 519   C CD   . ARG A 1 34  ? 21.986  0.192   7.831   1.00 0.00 ? 86  ARG A CD   1  
ATOM 520   N NE   . ARG A 1 34  ? 21.622  1.597   7.622   1.00 0.00 ? 86  ARG A NE   1  
ATOM 521   C CZ   . ARG A 1 34  ? 22.496  2.599   7.512   1.00 0.00 ? 86  ARG A CZ   1  
ATOM 522   N NH1  . ARG A 1 34  ? 23.805  2.377   7.605   1.00 0.00 ? 86  ARG A NH1  1  
ATOM 523   N NH2  . ARG A 1 34  ? 22.054  3.837   7.307   1.00 0.00 ? 86  ARG A NH2  1  
ATOM 524   H H    . ARG A 1 34  ? 17.698  -0.067  6.303   1.00 0.00 ? 86  ARG A H    1  
ATOM 525   H HA   . ARG A 1 34  ? 20.363  1.109   5.636   1.00 0.00 ? 86  ARG A HA   1  
ATOM 526   H HB2  . ARG A 1 34  ? 19.621  -1.781  6.227   1.00 0.00 ? 86  ARG A HB2  1  
ATOM 527   H HB3  . ARG A 1 34  ? 21.203  -1.242  5.661   1.00 0.00 ? 86  ARG A HB3  1  
ATOM 528   H HG2  . ARG A 1 34  ? 19.946  -0.352  8.294   1.00 0.00 ? 86  ARG A HG2  1  
ATOM 529   H HG3  . ARG A 1 34  ? 21.058  -1.711  8.113   1.00 0.00 ? 86  ARG A HG3  1  
ATOM 530   H HD2  . ARG A 1 34  ? 22.400  0.088   8.834   1.00 0.00 ? 86  ARG A HD2  1  
ATOM 531   H HD3  . ARG A 1 34  ? 22.744  -0.106  7.108   1.00 0.00 ? 86  ARG A HD3  1  
ATOM 532   H HE   . ARG A 1 34  ? 20.638  1.816   7.555   1.00 0.00 ? 86  ARG A HE   1  
ATOM 533   H HH11 . ARG A 1 34  ? 24.146  1.440   7.764   1.00 0.00 ? 86  ARG A HH11 1  
ATOM 534   H HH12 . ARG A 1 34  ? 24.456  3.145   7.518   1.00 0.00 ? 86  ARG A HH12 1  
ATOM 535   H HH21 . ARG A 1 34  ? 21.063  4.016   7.235   1.00 0.00 ? 86  ARG A HH21 1  
ATOM 536   H HH22 . ARG A 1 34  ? 22.710  4.601   7.224   1.00 0.00 ? 86  ARG A HH22 1  
ATOM 537   N N    . ARG A 1 35  ? 20.340  0.013   3.282   1.00 0.00 ? 87  ARG A N    1  
ATOM 538   C CA   . ARG A 1 35  ? 20.224  -0.167  1.834   1.00 0.00 ? 87  ARG A CA   1  
ATOM 539   C C    . ARG A 1 35  ? 19.360  0.891   1.137   1.00 0.00 ? 87  ARG A C    1  
ATOM 540   O O    . ARG A 1 35  ? 19.451  1.032   -0.081  1.00 0.00 ? 87  ARG A O    1  
ATOM 541   C CB   . ARG A 1 35  ? 19.732  -1.586  1.518   1.00 0.00 ? 87  ARG A CB   1  
ATOM 542   C CG   . ARG A 1 35  ? 20.649  -2.652  2.121   1.00 0.00 ? 87  ARG A CG   1  
ATOM 543   C CD   . ARG A 1 35  ? 20.100  -4.045  1.811   1.00 0.00 ? 87  ARG A CD   1  
ATOM 544   N NE   . ARG A 1 35  ? 20.977  -5.087  2.354   1.00 0.00 ? 87  ARG A NE   1  
ATOM 545   C CZ   . ARG A 1 35  ? 20.617  -6.363  2.527   1.00 0.00 ? 87  ARG A CZ   1  
ATOM 546   N NH1  . ARG A 1 35  ? 19.391  -6.777  2.214   1.00 0.00 ? 87  ARG A NH1  1  
ATOM 547   N NH2  . ARG A 1 35  ? 21.489  -7.237  3.021   1.00 0.00 ? 87  ARG A NH2  1  
ATOM 548   H H    . ARG A 1 35  ? 21.270  0.162   3.645   1.00 0.00 ? 87  ARG A H    1  
ATOM 549   H HA   . ARG A 1 35  ? 21.224  -0.070  1.415   1.00 0.00 ? 87  ARG A HA   1  
ATOM 550   H HB2  . ARG A 1 35  ? 18.724  -1.717  1.910   1.00 0.00 ? 87  ARG A HB2  1  
ATOM 551   H HB3  . ARG A 1 35  ? 19.704  -1.718  0.436   1.00 0.00 ? 87  ARG A HB3  1  
ATOM 552   H HG2  . ARG A 1 35  ? 21.649  -2.554  1.697   1.00 0.00 ? 87  ARG A HG2  1  
ATOM 553   H HG3  . ARG A 1 35  ? 20.701  -2.525  3.202   1.00 0.00 ? 87  ARG A HG3  1  
ATOM 554   H HD2  . ARG A 1 35  ? 19.108  -4.140  2.253   1.00 0.00 ? 87  ARG A HD2  1  
ATOM 555   H HD3  . ARG A 1 35  ? 20.022  -4.169  0.731   1.00 0.00 ? 87  ARG A HD3  1  
ATOM 556   H HE   . ARG A 1 35  ? 21.916  -4.816  2.611   1.00 0.00 ? 87  ARG A HE   1  
ATOM 557   H HH11 . ARG A 1 35  ? 18.714  -6.124  1.846   1.00 0.00 ? 87  ARG A HH11 1  
ATOM 558   H HH12 . ARG A 1 35  ? 19.137  -7.745  2.342   1.00 0.00 ? 87  ARG A HH12 1  
ATOM 559   H HH21 . ARG A 1 35  ? 22.424  -6.940  3.260   1.00 0.00 ? 87  ARG A HH21 1  
ATOM 560   H HH22 . ARG A 1 35  ? 21.218  -8.201  3.156   1.00 0.00 ? 87  ARG A HH22 1  
ATOM 561   N N    . PHE A 1 36  ? 18.529  1.637   1.873   1.00 0.00 ? 88  PHE A N    1  
ATOM 562   C CA   . PHE A 1 36  ? 17.681  2.670   1.291   1.00 0.00 ? 88  PHE A CA   1  
ATOM 563   C C    . PHE A 1 36  ? 18.508  3.866   0.815   1.00 0.00 ? 88  PHE A C    1  
ATOM 564   O O    . PHE A 1 36  ? 18.016  4.664   0.019   1.00 0.00 ? 88  PHE A O    1  
ATOM 565   C CB   . PHE A 1 36  ? 16.645  3.128   2.323   1.00 0.00 ? 88  PHE A CB   1  
ATOM 566   C CG   . PHE A 1 36  ? 15.423  2.248   2.510   1.00 0.00 ? 88  PHE A CG   1  
ATOM 567   C CD1  . PHE A 1 36  ? 15.162  1.143   1.683   1.00 0.00 ? 88  PHE A CD1  1  
ATOM 568   C CD2  . PHE A 1 36  ? 14.525  2.561   3.540   1.00 0.00 ? 88  PHE A CD2  1  
ATOM 569   C CE1  . PHE A 1 36  ? 14.003  0.381   1.873   1.00 0.00 ? 88  PHE A CE1  1  
ATOM 570   C CE2  . PHE A 1 36  ? 13.374  1.788   3.741   1.00 0.00 ? 88  PHE A CE2  1  
ATOM 571   C CZ   . PHE A 1 36  ? 13.109  0.699   2.903   1.00 0.00 ? 88  PHE A CZ   1  
ATOM 572   H H    . PHE A 1 36  ? 18.474  1.488   2.870   1.00 0.00 ? 88  PHE A H    1  
ATOM 573   H HA   . PHE A 1 36  ? 17.158  2.264   0.425   1.00 0.00 ? 88  PHE A HA   1  
ATOM 574   H HB2  . PHE A 1 36  ? 17.142  3.251   3.285   1.00 0.00 ? 88  PHE A HB2  1  
ATOM 575   H HB3  . PHE A 1 36  ? 16.277  4.105   2.015   1.00 0.00 ? 88  PHE A HB3  1  
ATOM 576   H HD1  . PHE A 1 36  ? 15.846  0.868   0.893   1.00 0.00 ? 88  PHE A HD1  1  
ATOM 577   H HD2  . PHE A 1 36  ? 14.723  3.408   4.180   1.00 0.00 ? 88  PHE A HD2  1  
ATOM 578   H HE1  . PHE A 1 36  ? 13.799  -0.455  1.220   1.00 0.00 ? 88  PHE A HE1  1  
ATOM 579   H HE2  . PHE A 1 36  ? 12.693  2.032   4.543   1.00 0.00 ? 88  PHE A HE2  1  
ATOM 580   H HZ   . PHE A 1 36  ? 12.218  0.107   3.050   1.00 0.00 ? 88  PHE A HZ   1  
ATOM 581   N N    . GLY A 1 37  ? 19.753  4.001   1.285   1.00 0.00 ? 89  GLY A N    1  
ATOM 582   C CA   . GLY A 1 37  ? 20.611  5.107   0.885   1.00 0.00 ? 89  GLY A CA   1  
ATOM 583   C C    . GLY A 1 37  ? 19.973  6.446   1.257   1.00 0.00 ? 89  GLY A C    1  
ATOM 584   O O    . GLY A 1 37  ? 19.224  6.519   2.233   1.00 0.00 ? 89  GLY A O    1  
ATOM 585   H H    . GLY A 1 37  ? 20.118  3.323   1.938   1.00 0.00 ? 89  GLY A H    1  
ATOM 586   H HA2  . GLY A 1 37  ? 21.579  5.021   1.377   1.00 0.00 ? 89  GLY A HA2  1  
ATOM 587   H HA3  . GLY A 1 37  ? 20.758  5.060   -0.193  1.00 0.00 ? 89  GLY A HA3  1  
ATOM 588   N N    . PRO A 1 38  ? 20.255  7.513   0.498   1.00 0.00 ? 90  PRO A N    1  
ATOM 589   C CA   . PRO A 1 38  ? 19.629  8.807   0.694   1.00 0.00 ? 90  PRO A CA   1  
ATOM 590   C C    . PRO A 1 38  ? 18.155  8.721   0.306   1.00 0.00 ? 90  PRO A C    1  
ATOM 591   O O    . PRO A 1 38  ? 17.790  7.983   -0.610  1.00 0.00 ? 90  PRO A O    1  
ATOM 592   C CB   . PRO A 1 38  ? 20.403  9.772   -0.202  1.00 0.00 ? 90  PRO A CB   1  
ATOM 593   C CG   . PRO A 1 38  ? 20.900  8.869   -1.330  1.00 0.00 ? 90  PRO A CG   1  
ATOM 594   C CD   . PRO A 1 38  ? 21.189  7.552   -0.611  1.00 0.00 ? 90  PRO A CD   1  
ATOM 595   H HA   . PRO A 1 38  ? 19.714  9.119   1.736   1.00 0.00 ? 90  PRO A HA   1  
ATOM 596   H HB2  . PRO A 1 38  ? 19.771  10.577  -0.576  1.00 0.00 ? 90  PRO A HB2  1  
ATOM 597   H HB3  . PRO A 1 38  ? 21.258  10.170  0.345   1.00 0.00 ? 90  PRO A HB3  1  
ATOM 598   H HG2  . PRO A 1 38  ? 20.100  8.721   -2.055  1.00 0.00 ? 90  PRO A HG2  1  
ATOM 599   H HG3  . PRO A 1 38  ? 21.792  9.273   -1.809  1.00 0.00 ? 90  PRO A HG3  1  
ATOM 600   H HD2  . PRO A 1 38  ? 21.040  6.714   -1.293  1.00 0.00 ? 90  PRO A HD2  1  
ATOM 601   H HD3  . PRO A 1 38  ? 22.208  7.556   -0.226  1.00 0.00 ? 90  PRO A HD3  1  
ATOM 602   N N    . LEU A 1 39  ? 17.302  9.476   1.001   1.00 0.00 ? 91  LEU A N    1  
ATOM 603   C CA   . LEU A 1 39  ? 15.865  9.411   0.790   1.00 0.00 ? 91  LEU A CA   1  
ATOM 604   C C    . LEU A 1 39  ? 15.193  10.747  1.104   1.00 0.00 ? 91  LEU A C    1  
ATOM 605   O O    . LEU A 1 39  ? 15.827  11.658  1.636   1.00 0.00 ? 91  LEU A O    1  
ATOM 606   C CB   . LEU A 1 39  ? 15.280  8.282   1.651   1.00 0.00 ? 91  LEU A CB   1  
ATOM 607   C CG   . LEU A 1 39  ? 15.120  8.604   3.139   1.00 0.00 ? 91  LEU A CG   1  
ATOM 608   C CD1  . LEU A 1 39  ? 14.324  7.473   3.782   1.00 0.00 ? 91  LEU A CD1  1  
ATOM 609   C CD2  . LEU A 1 39  ? 16.460  8.708   3.858   1.00 0.00 ? 91  LEU A CD2  1  
ATOM 610   H H    . LEU A 1 39  ? 17.652  10.113  1.702   1.00 0.00 ? 91  LEU A H    1  
ATOM 611   H HA   . LEU A 1 39  ? 15.677  9.165   -0.254  1.00 0.00 ? 91  LEU A HA   1  
ATOM 612   H HB2  . LEU A 1 39  ? 14.291  8.040   1.263   1.00 0.00 ? 91  LEU A HB2  1  
ATOM 613   H HB3  . LEU A 1 39  ? 15.910  7.398   1.545   1.00 0.00 ? 91  LEU A HB3  1  
ATOM 614   H HG   . LEU A 1 39  ? 14.566  9.535   3.260   1.00 0.00 ? 91  LEU A HG   1  
ATOM 615   H HD11 . LEU A 1 39  ? 14.869  6.534   3.683   1.00 0.00 ? 91  LEU A HD11 1  
ATOM 616   H HD12 . LEU A 1 39  ? 14.173  7.696   4.839   1.00 0.00 ? 91  LEU A HD12 1  
ATOM 617   H HD13 . LEU A 1 39  ? 13.355  7.384   3.292   1.00 0.00 ? 91  LEU A HD13 1  
ATOM 618   H HD21 . LEU A 1 39  ? 17.038  7.800   3.685   1.00 0.00 ? 91  LEU A HD21 1  
ATOM 619   H HD22 . LEU A 1 39  ? 17.012  9.574   3.492   1.00 0.00 ? 91  LEU A HD22 1  
ATOM 620   H HD23 . LEU A 1 39  ? 16.281  8.826   4.926   1.00 0.00 ? 91  LEU A HD23 1  
ATOM 621   N N    . ILE A 1 40  ? 13.904  10.852  0.771   1.00 0.00 ? 92  ILE A N    1  
ATOM 622   C CA   . ILE A 1 40  ? 13.093  12.035  1.034   1.00 0.00 ? 92  ILE A CA   1  
ATOM 623   C C    . ILE A 1 40  ? 12.016  11.666  2.051   1.00 0.00 ? 92  ILE A C    1  
ATOM 624   O O    . ILE A 1 40  ? 11.515  10.543  2.051   1.00 0.00 ? 92  ILE A O    1  
ATOM 625   C CB   . ILE A 1 40  ? 12.494  12.568  -0.275  1.00 0.00 ? 92  ILE A CB   1  
ATOM 626   C CG1  . ILE A 1 40  ? 13.578  12.856  -1.325  1.00 0.00 ? 92  ILE A CG1  1  
ATOM 627   C CG2  . ILE A 1 40  ? 11.672  13.832  -0.006  1.00 0.00 ? 92  ILE A CG2  1  
ATOM 628   C CD1  . ILE A 1 40  ? 14.573  13.934  -0.888  1.00 0.00 ? 92  ILE A CD1  1  
ATOM 629   H H    . ILE A 1 40  ? 13.450  10.074  0.316   1.00 0.00 ? 92  ILE A H    1  
ATOM 630   H HA   . ILE A 1 40  ? 13.722  12.810  1.473   1.00 0.00 ? 92  ILE A HA   1  
ATOM 631   H HB   . ILE A 1 40  ? 11.826  11.808  -0.683  1.00 0.00 ? 92  ILE A HB   1  
ATOM 632   H HG12 . ILE A 1 40  ? 14.123  11.936  -1.535  1.00 0.00 ? 92  ILE A HG12 1  
ATOM 633   H HG13 . ILE A 1 40  ? 13.095  13.181  -2.246  1.00 0.00 ? 92  ILE A HG13 1  
ATOM 634   H HG21 . ILE A 1 40  ? 12.285  14.575  0.505   1.00 0.00 ? 92  ILE A HG21 1  
ATOM 635   H HG22 . ILE A 1 40  ? 11.318  14.242  -0.952  1.00 0.00 ? 92  ILE A HG22 1  
ATOM 636   H HG23 . ILE A 1 40  ? 10.810  13.589  0.614   1.00 0.00 ? 92  ILE A HG23 1  
ATOM 637   H HD11 . ILE A 1 40  ? 14.053  14.877  -0.723  1.00 0.00 ? 92  ILE A HD11 1  
ATOM 638   H HD12 . ILE A 1 40  ? 15.076  13.629  0.030   1.00 0.00 ? 92  ILE A HD12 1  
ATOM 639   H HD13 . ILE A 1 40  ? 15.317  14.074  -1.672  1.00 0.00 ? 92  ILE A HD13 1  
ATOM 640   N N    . VAL A 1 41  ? 11.657  12.611  2.923   1.00 0.00 ? 93  VAL A N    1  
ATOM 641   C CA   . VAL A 1 41  ? 10.727  12.350  4.013   1.00 0.00 ? 93  VAL A CA   1  
ATOM 642   C C    . VAL A 1 41  ? 9.721   13.486  4.167   1.00 0.00 ? 93  VAL A C    1  
ATOM 643   O O    . VAL A 1 41  ? 9.964   14.609  3.728   1.00 0.00 ? 93  VAL A O    1  
ATOM 644   C CB   . VAL A 1 41  ? 11.499  12.149  5.322   1.00 0.00 ? 93  VAL A CB   1  
ATOM 645   C CG1  . VAL A 1 41  ? 12.481  10.982  5.220   1.00 0.00 ? 93  VAL A CG1  1  
ATOM 646   C CG2  . VAL A 1 41  ? 12.281  13.408  5.696   1.00 0.00 ? 93  VAL A CG2  1  
ATOM 647   H H    . VAL A 1 41  ? 12.039  13.542  2.840   1.00 0.00 ? 93  VAL A H    1  
ATOM 648   H HA   . VAL A 1 41  ? 10.172  11.435  3.799   1.00 0.00 ? 93  VAL A HA   1  
ATOM 649   H HB   . VAL A 1 41  ? 10.782  11.927  6.114   1.00 0.00 ? 93  VAL A HB   1  
ATOM 650   H HG11 . VAL A 1 41  ? 13.244  11.203  4.473   1.00 0.00 ? 93  VAL A HG11 1  
ATOM 651   H HG12 . VAL A 1 41  ? 12.963  10.828  6.185   1.00 0.00 ? 93  VAL A HG12 1  
ATOM 652   H HG13 . VAL A 1 41  ? 11.948  10.075  4.936   1.00 0.00 ? 93  VAL A HG13 1  
ATOM 653   H HG21 . VAL A 1 41  ? 11.593  14.240  5.849   1.00 0.00 ? 93  VAL A HG21 1  
ATOM 654   H HG22 . VAL A 1 41  ? 12.832  13.228  6.618   1.00 0.00 ? 93  VAL A HG22 1  
ATOM 655   H HG23 . VAL A 1 41  ? 12.985  13.660  4.904   1.00 0.00 ? 93  VAL A HG23 1  
ATOM 656   N N    . ASP A 1 42  ? 8.584   13.182  4.800   1.00 0.00 ? 94  ASP A N    1  
ATOM 657   C CA   . ASP A 1 42  ? 7.577   14.180  5.118   1.00 0.00 ? 94  ASP A CA   1  
ATOM 658   C C    . ASP A 1 42  ? 6.901   13.813  6.437   1.00 0.00 ? 94  ASP A C    1  
ATOM 659   O O    . ASP A 1 42  ? 6.701   12.632  6.728   1.00 0.00 ? 94  ASP A O    1  
ATOM 660   C CB   . ASP A 1 42  ? 6.558   14.270  3.981   1.00 0.00 ? 94  ASP A CB   1  
ATOM 661   C CG   . ASP A 1 42  ? 5.533   15.371  4.248   1.00 0.00 ? 94  ASP A CG   1  
ATOM 662   O OD1  . ASP A 1 42  ? 5.968   16.488  4.609   1.00 0.00 ? 94  ASP A OD1  1  
ATOM 663   O OD2  . ASP A 1 42  ? 4.324   15.087  4.089   1.00 0.00 ? 94  ASP A OD2  1  
ATOM 664   H H    . ASP A 1 42  ? 8.405   12.229  5.077   1.00 0.00 ? 94  ASP A H    1  
ATOM 665   H HA   . ASP A 1 42  ? 8.061   15.151  5.233   1.00 0.00 ? 94  ASP A HA   1  
ATOM 666   H HB2  . ASP A 1 42  ? 7.080   14.491  3.050   1.00 0.00 ? 94  ASP A HB2  1  
ATOM 667   H HB3  . ASP A 1 42  ? 6.047   13.313  3.881   1.00 0.00 ? 94  ASP A HB3  1  
ATOM 668   N N    . TRP A 1 43  ? 6.550   14.822  7.237   1.00 0.00 ? 95  TRP A N    1  
ATOM 669   C CA   . TRP A 1 43  ? 6.000   14.610  8.566   1.00 0.00 ? 95  TRP A CA   1  
ATOM 670   C C    . TRP A 1 43  ? 4.539   15.054  8.635   1.00 0.00 ? 95  TRP A C    1  
ATOM 671   O O    . TRP A 1 43  ? 4.120   15.913  7.859   1.00 0.00 ? 95  TRP A O    1  
ATOM 672   C CB   . TRP A 1 43  ? 6.826   15.397  9.584   1.00 0.00 ? 95  TRP A CB   1  
ATOM 673   C CG   . TRP A 1 43  ? 8.319   15.265  9.519   1.00 0.00 ? 95  TRP A CG   1  
ATOM 674   C CD1  . TRP A 1 43  ? 9.178   16.286  9.729   1.00 0.00 ? 95  TRP A CD1  1  
ATOM 675   C CD2  . TRP A 1 43  ? 9.163   14.101  9.240   1.00 0.00 ? 95  TRP A CD2  1  
ATOM 676   N NE1  . TRP A 1 43  ? 10.476  15.847  9.604   1.00 0.00 ? 95  TRP A NE1  1  
ATOM 677   C CE2  . TRP A 1 43  ? 10.528  14.505  9.303   1.00 0.00 ? 95  TRP A CE2  1  
ATOM 678   C CE3  . TRP A 1 43  ? 8.921   12.746  8.943   1.00 0.00 ? 95  TRP A CE3  1  
ATOM 679   C CZ2  . TRP A 1 43  ? 11.591  13.621  9.083   1.00 0.00 ? 95  TRP A CZ2  1  
ATOM 680   C CZ3  . TRP A 1 43  ? 9.977   11.854  8.704   1.00 0.00 ? 95  TRP A CZ3  1  
ATOM 681   C CH2  . TRP A 1 43  ? 11.309  12.285  8.779   1.00 0.00 ? 95  TRP A CH2  1  
ATOM 682   H H    . TRP A 1 43  ? 6.669   15.774  6.918   1.00 0.00 ? 95  TRP A H    1  
ATOM 683   H HA   . TRP A 1 43  ? 6.062   13.550  8.811   1.00 0.00 ? 95  TRP A HA   1  
ATOM 684   H HB2  . TRP A 1 43  ? 6.586   16.453  9.452   1.00 0.00 ? 95  TRP A HB2  1  
ATOM 685   H HB3  . TRP A 1 43  ? 6.497   15.114  10.584  1.00 0.00 ? 95  TRP A HB3  1  
ATOM 686   H HD1  . TRP A 1 43  ? 8.889   17.300  9.963   1.00 0.00 ? 95  TRP A HD1  1  
ATOM 687   H HE1  . TRP A 1 43  ? 11.273  16.456  9.725   1.00 0.00 ? 95  TRP A HE1  1  
ATOM 688   H HE3  . TRP A 1 43  ? 7.904   12.385  8.896   1.00 0.00 ? 95  TRP A HE3  1  
ATOM 689   H HZ2  . TRP A 1 43  ? 12.613  13.964  9.146   1.00 0.00 ? 95  TRP A HZ2  1  
ATOM 690   H HZ3  . TRP A 1 43  ? 9.766   10.823  8.458   1.00 0.00 ? 95  TRP A HZ3  1  
ATOM 691   H HH2  . TRP A 1 43  ? 12.115  11.589  8.602   1.00 0.00 ? 95  TRP A HH2  1  
ATOM 692   N N    . PRO A 1 44  ? 3.751   14.480  9.557   1.00 0.00 ? 96  PRO A N    1  
ATOM 693   C CA   . PRO A 1 44  ? 2.383   14.900  9.804   1.00 0.00 ? 96  PRO A CA   1  
ATOM 694   C C    . PRO A 1 44  ? 2.356   16.261  10.505  1.00 0.00 ? 96  PRO A C    1  
ATOM 695   O O    . PRO A 1 44  ? 1.312   16.907  10.557  1.00 0.00 ? 96  PRO A O    1  
ATOM 696   C CB   . PRO A 1 44  ? 1.794   13.801  10.691  1.00 0.00 ? 96  PRO A CB   1  
ATOM 697   C CG   . PRO A 1 44  ? 3.008   13.302  11.469  1.00 0.00 ? 96  PRO A CG   1  
ATOM 698   C CD   . PRO A 1 44  ? 4.125   13.384  10.430  1.00 0.00 ? 96  PRO A CD   1  
ATOM 699   H HA   . PRO A 1 44  ? 1.828   14.962  8.868   1.00 0.00 ? 96  PRO A HA   1  
ATOM 700   H HB2  . PRO A 1 44  ? 1.016   14.184  11.351  1.00 0.00 ? 96  PRO A HB2  1  
ATOM 701   H HB3  . PRO A 1 44  ? 1.412   12.995  10.063  1.00 0.00 ? 96  PRO A HB3  1  
ATOM 702   H HG2  . PRO A 1 44  ? 3.221   13.984  12.292  1.00 0.00 ? 96  PRO A HG2  1  
ATOM 703   H HG3  . PRO A 1 44  ? 2.867   12.283  11.831  1.00 0.00 ? 96  PRO A HG3  1  
ATOM 704   H HD2  . PRO A 1 44  ? 5.084   13.567  10.918  1.00 0.00 ? 96  PRO A HD2  1  
ATOM 705   H HD3  . PRO A 1 44  ? 4.160   12.459  9.855   1.00 0.00 ? 96  PRO A HD3  1  
ATOM 706   N N    . HIS A 1 45  ? 3.502   16.693  11.045  1.00 0.00 ? 97  HIS A N    1  
ATOM 707   C CA   . HIS A 1 45  ? 3.657   17.993  11.680  1.00 0.00 ? 97  HIS A CA   1  
ATOM 708   C C    . HIS A 1 45  ? 5.111   18.437  11.542  1.00 0.00 ? 97  HIS A C    1  
ATOM 709   O O    . HIS A 1 45  ? 6.024   17.677  11.865  1.00 0.00 ? 97  HIS A O    1  
ATOM 710   C CB   . HIS A 1 45  ? 3.257   17.892  13.153  1.00 0.00 ? 97  HIS A CB   1  
ATOM 711   C CG   . HIS A 1 45  ? 3.323   19.205  13.890  1.00 0.00 ? 97  HIS A CG   1  
ATOM 712   N ND1  . HIS A 1 45  ? 3.443   20.468  13.303  1.00 0.00 ? 97  HIS A ND1  1  
ATOM 713   C CD2  . HIS A 1 45  ? 3.272   19.343  15.246  1.00 0.00 ? 97  HIS A CD2  1  
ATOM 714   C CE1  . HIS A 1 45  ? 3.463   21.335  14.329  1.00 0.00 ? 97  HIS A CE1  1  
ATOM 715   N NE2  . HIS A 1 45  ? 3.361   20.689  15.505  1.00 0.00 ? 97  HIS A NE2  1  
ATOM 716   H H    . HIS A 1 45  ? 4.314   16.093  11.013  1.00 0.00 ? 97  HIS A H    1  
ATOM 717   H HA   . HIS A 1 45  ? 3.012   18.718  11.182  1.00 0.00 ? 97  HIS A HA   1  
ATOM 718   H HB2  . HIS A 1 45  ? 2.235   17.516  13.214  1.00 0.00 ? 97  HIS A HB2  1  
ATOM 719   H HB3  . HIS A 1 45  ? 3.913   17.177  13.650  1.00 0.00 ? 97  HIS A HB3  1  
ATOM 720   H HD2  . HIS A 1 45  ? 3.180   18.548  15.971  1.00 0.00 ? 97  HIS A HD2  1  
ATOM 721   H HE1  . HIS A 1 45  ? 3.549   22.406  14.225  1.00 0.00 ? 97  HIS A HE1  1  
ATOM 722   H HE2  . HIS A 1 45  ? 3.350   21.122  16.417  1.00 0.00 ? 97  HIS A HE2  1  
ATOM 723   N N    . LYS A 1 46  ? 5.326   19.667  11.063  1.00 0.00 ? 98  LYS A N    1  
ATOM 724   C CA   . LYS A 1 46  ? 6.661   20.204  10.832  1.00 0.00 ? 98  LYS A CA   1  
ATOM 725   C C    . LYS A 1 46  ? 6.673   21.734  10.855  1.00 0.00 ? 98  LYS A C    1  
ATOM 726   O O    . LYS A 1 46  ? 7.662   22.348  10.458  1.00 0.00 ? 98  LYS A O    1  
ATOM 727   C CB   . LYS A 1 46  ? 7.189   19.677  9.493   1.00 0.00 ? 98  LYS A CB   1  
ATOM 728   C CG   . LYS A 1 46  ? 6.305   20.113  8.321   1.00 0.00 ? 98  LYS A CG   1  
ATOM 729   C CD   . LYS A 1 46  ? 6.807   19.469  7.029   1.00 0.00 ? 98  LYS A CD   1  
ATOM 730   C CE   . LYS A 1 46  ? 5.913   19.893  5.864   1.00 0.00 ? 98  LYS A CE   1  
ATOM 731   N NZ   . LYS A 1 46  ? 6.330   19.242  4.608   1.00 0.00 ? 98  LYS A NZ   1  
ATOM 732   H H    . LYS A 1 46  ? 4.533   20.254  10.846  1.00 0.00 ? 98  LYS A H    1  
ATOM 733   H HA   . LYS A 1 46  ? 7.317   19.855  11.630  1.00 0.00 ? 98  LYS A HA   1  
ATOM 734   H HB2  . LYS A 1 46  ? 8.205   20.041  9.334   1.00 0.00 ? 98  LYS A HB2  1  
ATOM 735   H HB3  . LYS A 1 46  ? 7.212   18.588  9.531   1.00 0.00 ? 98  LYS A HB3  1  
ATOM 736   H HG2  . LYS A 1 46  ? 5.277   19.795  8.499   1.00 0.00 ? 98  LYS A HG2  1  
ATOM 737   H HG3  . LYS A 1 46  ? 6.335   21.198  8.221   1.00 0.00 ? 98  LYS A HG3  1  
ATOM 738   H HD2  . LYS A 1 46  ? 7.831   19.787  6.837   1.00 0.00 ? 98  LYS A HD2  1  
ATOM 739   H HD3  . LYS A 1 46  ? 6.780   18.383  7.131   1.00 0.00 ? 98  LYS A HD3  1  
ATOM 740   H HE2  . LYS A 1 46  ? 4.883   19.616  6.088   1.00 0.00 ? 98  LYS A HE2  1  
ATOM 741   H HE3  . LYS A 1 46  ? 5.967   20.975  5.751   1.00 0.00 ? 98  LYS A HE3  1  
ATOM 742   H HZ1  . LYS A 1 46  ? 6.246   18.240  4.695   1.00 0.00 ? 98  LYS A HZ1  1  
ATOM 743   H HZ2  . LYS A 1 46  ? 5.739   19.552  3.849   1.00 0.00 ? 98  LYS A HZ2  1  
ATOM 744   H HZ3  . LYS A 1 46  ? 7.289   19.476  4.395   1.00 0.00 ? 98  LYS A HZ3  1  
ATOM 745   N N    . ALA A 1 47  ? 5.583   22.354  11.315  1.00 0.00 ? 99  ALA A N    1  
ATOM 746   C CA   . ALA A 1 47  ? 5.454   23.802  11.308  1.00 0.00 ? 99  ALA A CA   1  
ATOM 747   C C    . ALA A 1 47  ? 6.303   24.445  12.404  1.00 0.00 ? 99  ALA A C    1  
ATOM 748   O O    . ALA A 1 47  ? 6.620   23.818  13.414  1.00 0.00 ? 99  ALA A O    1  
ATOM 749   C CB   . ALA A 1 47  ? 3.981   24.179  11.461  1.00 0.00 ? 99  ALA A CB   1  
ATOM 750   H H    . ALA A 1 47  ? 4.816   21.810  11.681  1.00 0.00 ? 99  ALA A H    1  
ATOM 751   H HA   . ALA A 1 47  ? 5.802   24.176  10.346  1.00 0.00 ? 99  ALA A HA   1  
ATOM 752   H HB1  . ALA A 1 47  ? 3.605   23.820  12.419  1.00 0.00 ? 99  ALA A HB1  1  
ATOM 753   H HB2  . ALA A 1 47  ? 3.875   25.264  11.415  1.00 0.00 ? 99  ALA A HB2  1  
ATOM 754   H HB3  . ALA A 1 47  ? 3.404   23.728  10.654  1.00 0.00 ? 99  ALA A HB3  1  
ATOM 755   N N    . GLU A 1 48  ? 6.673   25.713  12.200  1.00 0.00 ? 100 GLU A N    1  
ATOM 756   C CA   . GLU A 1 48  ? 7.511   26.459  13.132  1.00 0.00 ? 100 GLU A CA   1  
ATOM 757   C C    . GLU A 1 48  ? 6.763   26.785  14.428  1.00 0.00 ? 100 GLU A C    1  
ATOM 758   O O    . GLU A 1 48  ? 7.315   27.442  15.311  1.00 0.00 ? 100 GLU A O    1  
ATOM 759   C CB   . GLU A 1 48  ? 8.000   27.743  12.457  1.00 0.00 ? 100 GLU A CB   1  
ATOM 760   C CG   . GLU A 1 48  ? 8.853   27.434  11.227  1.00 0.00 ? 100 GLU A CG   1  
ATOM 761   C CD   . GLU A 1 48  ? 9.331   28.722  10.560  1.00 0.00 ? 100 GLU A CD   1  
ATOM 762   O OE1  . GLU A 1 48  ? 10.352  29.273  11.029  1.00 0.00 ? 100 GLU A OE1  1  
ATOM 763   O OE2  . GLU A 1 48  ? 8.671   29.148  9.586   1.00 0.00 ? 100 GLU A OE2  1  
ATOM 764   H H    . GLU A 1 48  ? 6.365   26.188  11.363  1.00 0.00 ? 100 GLU A H    1  
ATOM 765   H HA   . GLU A 1 48  ? 8.376   25.847  13.383  1.00 0.00 ? 100 GLU A HA   1  
ATOM 766   H HB2  . GLU A 1 48  ? 7.141   28.344  12.161  1.00 0.00 ? 100 GLU A HB2  1  
ATOM 767   H HB3  . GLU A 1 48  ? 8.601   28.311  13.167  1.00 0.00 ? 100 GLU A HB3  1  
ATOM 768   H HG2  . GLU A 1 48  ? 9.715   26.838  11.528  1.00 0.00 ? 100 GLU A HG2  1  
ATOM 769   H HG3  . GLU A 1 48  ? 8.263   26.859  10.512  1.00 0.00 ? 100 GLU A HG3  1  
ATOM 770   N N    . SER A 1 49  ? 5.512   26.332  14.551  1.00 0.00 ? 101 SER A N    1  
ATOM 771   C CA   . SER A 1 49  ? 4.692   26.589  15.724  1.00 0.00 ? 101 SER A CA   1  
ATOM 772   C C    . SER A 1 49  ? 5.124   25.725  16.913  1.00 0.00 ? 101 SER A C    1  
ATOM 773   O O    . SER A 1 49  ? 4.735   26.004  18.045  1.00 0.00 ? 101 SER A O    1  
ATOM 774   C CB   . SER A 1 49  ? 3.228   26.335  15.360  1.00 0.00 ? 101 SER A CB   1  
ATOM 775   O OG   . SER A 1 49  ? 2.381   26.713  16.425  1.00 0.00 ? 101 SER A OG   1  
ATOM 776   H H    . SER A 1 49  ? 5.109   25.787  13.802  1.00 0.00 ? 101 SER A H    1  
ATOM 777   H HA   . SER A 1 49  ? 4.804   27.637  16.000  1.00 0.00 ? 101 SER A HA   1  
ATOM 778   H HB2  . SER A 1 49  ? 2.973   26.921  14.477  1.00 0.00 ? 101 SER A HB2  1  
ATOM 779   H HB3  . SER A 1 49  ? 3.088   25.277  15.140  1.00 0.00 ? 101 SER A HB3  1  
ATOM 780   H HG   . SER A 1 49  ? 1.472   26.545  16.165  1.00 0.00 ? 101 SER A HG   1  
ATOM 781   N N    . LYS A 1 50  ? 5.924   24.677  16.673  1.00 0.00 ? 102 LYS A N    1  
ATOM 782   C CA   . LYS A 1 50  ? 6.403   23.821  17.752  1.00 0.00 ? 102 LYS A CA   1  
ATOM 783   C C    . LYS A 1 50  ? 7.758   23.193  17.433  1.00 0.00 ? 102 LYS A C    1  
ATOM 784   O O    . LYS A 1 50  ? 8.690   23.335  18.222  1.00 0.00 ? 102 LYS A O    1  
ATOM 785   C CB   . LYS A 1 50  ? 5.358   22.732  18.023  1.00 0.00 ? 102 LYS A CB   1  
ATOM 786   C CG   . LYS A 1 50  ? 5.754   21.819  19.189  1.00 0.00 ? 102 LYS A CG   1  
ATOM 787   C CD   . LYS A 1 50  ? 5.886   22.607  20.495  1.00 0.00 ? 102 LYS A CD   1  
ATOM 788   C CE   . LYS A 1 50  ? 6.166   21.666  21.668  1.00 0.00 ? 102 LYS A CE   1  
ATOM 789   N NZ   . LYS A 1 50  ? 7.475   20.999  21.528  1.00 0.00 ? 102 LYS A NZ   1  
ATOM 790   H H    . LYS A 1 50  ? 6.209   24.470  15.726  1.00 0.00 ? 102 LYS A H    1  
ATOM 791   H HA   . LYS A 1 50  ? 6.518   24.431  18.647  1.00 0.00 ? 102 LYS A HA   1  
ATOM 792   H HB2  . LYS A 1 50  ? 4.403   23.202  18.255  1.00 0.00 ? 102 LYS A HB2  1  
ATOM 793   H HB3  . LYS A 1 50  ? 5.237   22.123  17.127  1.00 0.00 ? 102 LYS A HB3  1  
ATOM 794   H HG2  . LYS A 1 50  ? 4.984   21.058  19.312  1.00 0.00 ? 102 LYS A HG2  1  
ATOM 795   H HG3  . LYS A 1 50  ? 6.700   21.329  18.960  1.00 0.00 ? 102 LYS A HG3  1  
ATOM 796   H HD2  . LYS A 1 50  ? 6.698   23.330  20.415  1.00 0.00 ? 102 LYS A HD2  1  
ATOM 797   H HD3  . LYS A 1 50  ? 4.954   23.140  20.685  1.00 0.00 ? 102 LYS A HD3  1  
ATOM 798   H HE2  . LYS A 1 50  ? 6.157   22.244  22.592  1.00 0.00 ? 102 LYS A HE2  1  
ATOM 799   H HE3  . LYS A 1 50  ? 5.378   20.915  21.720  1.00 0.00 ? 102 LYS A HE3  1  
ATOM 800   H HZ1  . LYS A 1 50  ? 8.211   21.689  21.479  1.00 0.00 ? 102 LYS A HZ1  1  
ATOM 801   H HZ2  . LYS A 1 50  ? 7.640   20.401  22.325  1.00 0.00 ? 102 LYS A HZ2  1  
ATOM 802   H HZ3  . LYS A 1 50  ? 7.493   20.437  20.690  1.00 0.00 ? 102 LYS A HZ3  1  
ATOM 803   N N    . SER A 1 51  ? 7.880   22.506  16.293  1.00 0.00 ? 103 SER A N    1  
ATOM 804   C CA   . SER A 1 51  ? 9.121   21.834  15.931  1.00 0.00 ? 103 SER A CA   1  
ATOM 805   C C    . SER A 1 51  ? 9.148   21.467  14.449  1.00 0.00 ? 103 SER A C    1  
ATOM 806   O O    . SER A 1 51  ? 8.105   21.369  13.804  1.00 0.00 ? 103 SER A O    1  
ATOM 807   C CB   . SER A 1 51  ? 9.262   20.560  16.766  1.00 0.00 ? 103 SER A CB   1  
ATOM 808   O OG   . SER A 1 51  ? 10.485  19.924  16.467  1.00 0.00 ? 103 SER A OG   1  
ATOM 809   H H    . SER A 1 51  ? 7.099   22.440  15.656  1.00 0.00 ? 103 SER A H    1  
ATOM 810   H HA   . SER A 1 51  ? 9.962   22.492  16.147  1.00 0.00 ? 103 SER A HA   1  
ATOM 811   H HB2  . SER A 1 51  ? 9.238   20.814  17.825  1.00 0.00 ? 103 SER A HB2  1  
ATOM 812   H HB3  . SER A 1 51  ? 8.435   19.886  16.539  1.00 0.00 ? 103 SER A HB3  1  
ATOM 813   H HG   . SER A 1 51  ? 10.559  19.134  17.007  1.00 0.00 ? 103 SER A HG   1  
ATOM 814   N N    . TYR A 1 52  ? 10.353  21.261  13.908  1.00 0.00 ? 104 TYR A N    1  
ATOM 815   C CA   . TYR A 1 52  ? 10.546  20.879  12.517  1.00 0.00 ? 104 TYR A CA   1  
ATOM 816   C C    . TYR A 1 52  ? 10.319  19.379  12.315  1.00 0.00 ? 104 TYR A C    1  
ATOM 817   O O    . TYR A 1 52  ? 10.423  18.888  11.191  1.00 0.00 ? 104 TYR A O    1  
ATOM 818   C CB   . TYR A 1 52  ? 11.956  21.276  12.076  1.00 0.00 ? 104 TYR A CB   1  
ATOM 819   C CG   . TYR A 1 52  ? 12.247  22.752  12.221  1.00 0.00 ? 104 TYR A CG   1  
ATOM 820   C CD1  . TYR A 1 52  ? 11.748  23.659  11.275  1.00 0.00 ? 104 TYR A CD1  1  
ATOM 821   C CD2  . TYR A 1 52  ? 13.015  23.213  13.302  1.00 0.00 ? 104 TYR A CD2  1  
ATOM 822   C CE1  . TYR A 1 52  ? 12.016  25.029  11.404  1.00 0.00 ? 104 TYR A CE1  1  
ATOM 823   C CE2  . TYR A 1 52  ? 13.286  24.582  13.438  1.00 0.00 ? 104 TYR A CE2  1  
ATOM 824   C CZ   . TYR A 1 52  ? 12.787  25.496  12.488  1.00 0.00 ? 104 TYR A CZ   1  
ATOM 825   O OH   . TYR A 1 52  ? 13.046  26.828  12.616  1.00 0.00 ? 104 TYR A OH   1  
ATOM 826   H H    . TYR A 1 52  ? 11.175  21.371  14.484  1.00 0.00 ? 104 TYR A H    1  
ATOM 827   H HA   . TYR A 1 52  ? 9.824   21.419  11.905  1.00 0.00 ? 104 TYR A HA   1  
ATOM 828   H HB2  . TYR A 1 52  ? 12.679  20.713  12.666  1.00 0.00 ? 104 TYR A HB2  1  
ATOM 829   H HB3  . TYR A 1 52  ? 12.085  21.001  11.029  1.00 0.00 ? 104 TYR A HB3  1  
ATOM 830   H HD1  . TYR A 1 52  ? 11.155  23.302  10.445  1.00 0.00 ? 104 TYR A HD1  1  
ATOM 831   H HD2  . TYR A 1 52  ? 13.399  22.513  14.029  1.00 0.00 ? 104 TYR A HD2  1  
ATOM 832   H HE1  . TYR A 1 52  ? 11.634  25.727  10.675  1.00 0.00 ? 104 TYR A HE1  1  
ATOM 833   H HE2  . TYR A 1 52  ? 13.877  24.936  14.270  1.00 0.00 ? 104 TYR A HE2  1  
ATOM 834   H HH   . TYR A 1 52  ? 13.575  27.032  13.391  1.00 0.00 ? 104 TYR A HH   1  
ATOM 835   N N    . PHE A 1 53  ? 10.014  18.651  13.394  1.00 0.00 ? 105 PHE A N    1  
ATOM 836   C CA   . PHE A 1 53  ? 9.744   17.221  13.351  1.00 0.00 ? 105 PHE A CA   1  
ATOM 837   C C    . PHE A 1 53  ? 8.542   16.895  14.243  1.00 0.00 ? 105 PHE A C    1  
ATOM 838   O O    . PHE A 1 53  ? 8.248   17.643  15.176  1.00 0.00 ? 105 PHE A O    1  
ATOM 839   C CB   . PHE A 1 53  ? 11.007  16.452  13.753  1.00 0.00 ? 105 PHE A CB   1  
ATOM 840   C CG   . PHE A 1 53  ? 11.537  16.777  15.131  1.00 0.00 ? 105 PHE A CG   1  
ATOM 841   C CD1  . PHE A 1 53  ? 10.994  16.148  16.261  1.00 0.00 ? 105 PHE A CD1  1  
ATOM 842   C CD2  . PHE A 1 53  ? 12.579  17.704  15.279  1.00 0.00 ? 105 PHE A CD2  1  
ATOM 843   C CE1  . PHE A 1 53  ? 11.491  16.448  17.536  1.00 0.00 ? 105 PHE A CE1  1  
ATOM 844   C CE2  . PHE A 1 53  ? 13.078  18.001  16.555  1.00 0.00 ? 105 PHE A CE2  1  
ATOM 845   C CZ   . PHE A 1 53  ? 12.533  17.375  17.684  1.00 0.00 ? 105 PHE A CZ   1  
ATOM 846   H H    . PHE A 1 53  ? 9.962   19.106  14.294  1.00 0.00 ? 105 PHE A H    1  
ATOM 847   H HA   . PHE A 1 53  ? 9.488   16.944  12.328  1.00 0.00 ? 105 PHE A HA   1  
ATOM 848   H HB2  . PHE A 1 53  ? 10.802  15.382  13.706  1.00 0.00 ? 105 PHE A HB2  1  
ATOM 849   H HB3  . PHE A 1 53  ? 11.786  16.669  13.023  1.00 0.00 ? 105 PHE A HB3  1  
ATOM 850   H HD1  . PHE A 1 53  ? 10.194  15.432  16.149  1.00 0.00 ? 105 PHE A HD1  1  
ATOM 851   H HD2  . PHE A 1 53  ? 12.997  18.190  14.410  1.00 0.00 ? 105 PHE A HD2  1  
ATOM 852   H HE1  . PHE A 1 53  ? 11.071  15.966  18.406  1.00 0.00 ? 105 PHE A HE1  1  
ATOM 853   H HE2  . PHE A 1 53  ? 13.883  18.713  16.666  1.00 0.00 ? 105 PHE A HE2  1  
ATOM 854   H HZ   . PHE A 1 53  ? 12.916  17.604  18.667  1.00 0.00 ? 105 PHE A HZ   1  
ATOM 855   N N    . PRO A 1 54  ? 7.838   15.788  13.975  1.00 0.00 ? 106 PRO A N    1  
ATOM 856   C CA   . PRO A 1 54  ? 6.593   15.453  14.640  1.00 0.00 ? 106 PRO A CA   1  
ATOM 857   C C    . PRO A 1 54  ? 6.827   14.923  16.055  1.00 0.00 ? 106 PRO A C    1  
ATOM 858   O O    . PRO A 1 54  ? 7.862   14.317  16.330  1.00 0.00 ? 106 PRO A O    1  
ATOM 859   C CB   . PRO A 1 54  ? 5.947   14.395  13.748  1.00 0.00 ? 106 PRO A CB   1  
ATOM 860   C CG   . PRO A 1 54  ? 7.157   13.657  13.180  1.00 0.00 ? 106 PRO A CG   1  
ATOM 861   C CD   . PRO A 1 54  ? 8.182   14.775  12.992  1.00 0.00 ? 106 PRO A CD   1  
ATOM 862   H HA   . PRO A 1 54  ? 5.952   16.335  14.680  1.00 0.00 ? 106 PRO A HA   1  
ATOM 863   H HB2  . PRO A 1 54  ? 5.289   13.729  14.306  1.00 0.00 ? 106 PRO A HB2  1  
ATOM 864   H HB3  . PRO A 1 54  ? 5.409   14.887  12.937  1.00 0.00 ? 106 PRO A HB3  1  
ATOM 865   H HG2  . PRO A 1 54  ? 7.528   12.943  13.916  1.00 0.00 ? 106 PRO A HG2  1  
ATOM 866   H HG3  . PRO A 1 54  ? 6.924   13.159  12.238  1.00 0.00 ? 106 PRO A HG3  1  
ATOM 867   H HD2  . PRO A 1 54  ? 9.188   14.386  13.149  1.00 0.00 ? 106 PRO A HD2  1  
ATOM 868   H HD3  . PRO A 1 54  ? 8.088   15.202  11.994  1.00 0.00 ? 106 PRO A HD3  1  
ATOM 869   N N    . PRO A 1 55  ? 5.864   15.150  16.959  1.00 0.00 ? 107 PRO A N    1  
ATOM 870   C CA   . PRO A 1 55  ? 5.899   14.674  18.332  1.00 0.00 ? 107 PRO A CA   1  
ATOM 871   C C    . PRO A 1 55  ? 5.529   13.190  18.433  1.00 0.00 ? 107 PRO A C    1  
ATOM 872   O O    . PRO A 1 55  ? 5.511   12.637  19.532  1.00 0.00 ? 107 PRO A O    1  
ATOM 873   C CB   . PRO A 1 55  ? 4.878   15.547  19.062  1.00 0.00 ? 107 PRO A CB   1  
ATOM 874   C CG   . PRO A 1 55  ? 3.821   15.789  17.986  1.00 0.00 ? 107 PRO A CG   1  
ATOM 875   C CD   . PRO A 1 55  ? 4.651   15.908  16.709  1.00 0.00 ? 107 PRO A CD   1  
ATOM 876   H HA   . PRO A 1 55  ? 6.891   14.827  18.758  1.00 0.00 ? 107 PRO A HA   1  
ATOM 877   H HB2  . PRO A 1 55  ? 4.461   15.050  19.938  1.00 0.00 ? 107 PRO A HB2  1  
ATOM 878   H HB3  . PRO A 1 55  ? 5.338   16.496  19.335  1.00 0.00 ? 107 PRO A HB3  1  
ATOM 879   H HG2  . PRO A 1 55  ? 3.165   14.920  17.915  1.00 0.00 ? 107 PRO A HG2  1  
ATOM 880   H HG3  . PRO A 1 55  ? 3.246   16.694  18.180  1.00 0.00 ? 107 PRO A HG3  1  
ATOM 881   H HD2  . PRO A 1 55  ? 4.100   15.507  15.858  1.00 0.00 ? 107 PRO A HD2  1  
ATOM 882   H HD3  . PRO A 1 55  ? 4.909   16.952  16.538  1.00 0.00 ? 107 PRO A HD3  1  
ATOM 883   N N    . LYS A 1 56  ? 5.235   12.543  17.300  1.00 0.00 ? 108 LYS A N    1  
ATOM 884   C CA   . LYS A 1 56  ? 4.832   11.141  17.255  1.00 0.00 ? 108 LYS A CA   1  
ATOM 885   C C    . LYS A 1 56  ? 5.678   10.368  16.248  1.00 0.00 ? 108 LYS A C    1  
ATOM 886   O O    . LYS A 1 56  ? 6.357   10.958  15.410  1.00 0.00 ? 108 LYS A O    1  
ATOM 887   C CB   . LYS A 1 56  ? 3.343   11.036  16.912  1.00 0.00 ? 108 LYS A CB   1  
ATOM 888   C CG   . LYS A 1 56  ? 2.490   11.674  18.010  1.00 0.00 ? 108 LYS A CG   1  
ATOM 889   C CD   . LYS A 1 56  ? 1.007   11.520  17.678  1.00 0.00 ? 108 LYS A CD   1  
ATOM 890   C CE   . LYS A 1 56  ? 0.170   12.183  18.770  1.00 0.00 ? 108 LYS A CE   1  
ATOM 891   N NZ   . LYS A 1 56  ? -1.273  12.056  18.490  1.00 0.00 ? 108 LYS A NZ   1  
ATOM 892   H H    . LYS A 1 56  ? 5.291   13.040  16.422  1.00 0.00 ? 108 LYS A H    1  
ATOM 893   H HA   . LYS A 1 56  ? 4.990   10.694  18.237  1.00 0.00 ? 108 LYS A HA   1  
ATOM 894   H HB2  . LYS A 1 56  ? 3.153   11.538  15.963  1.00 0.00 ? 108 LYS A HB2  1  
ATOM 895   H HB3  . LYS A 1 56  ? 3.069   9.985   16.820  1.00 0.00 ? 108 LYS A HB3  1  
ATOM 896   H HG2  . LYS A 1 56  ? 2.700   11.183  18.960  1.00 0.00 ? 108 LYS A HG2  1  
ATOM 897   H HG3  . LYS A 1 56  ? 2.732   12.733  18.090  1.00 0.00 ? 108 LYS A HG3  1  
ATOM 898   H HD2  . LYS A 1 56  ? 0.799   11.997  16.720  1.00 0.00 ? 108 LYS A HD2  1  
ATOM 899   H HD3  . LYS A 1 56  ? 0.757   10.461  17.619  1.00 0.00 ? 108 LYS A HD3  1  
ATOM 900   H HE2  . LYS A 1 56  ? 0.396   11.714  19.728  1.00 0.00 ? 108 LYS A HE2  1  
ATOM 901   H HE3  . LYS A 1 56  ? 0.435   13.239  18.826  1.00 0.00 ? 108 LYS A HE3  1  
ATOM 902   H HZ1  . LYS A 1 56  ? -1.532  11.081  18.452  1.00 0.00 ? 108 LYS A HZ1  1  
ATOM 903   H HZ2  . LYS A 1 56  ? -1.805  12.508  19.221  1.00 0.00 ? 108 LYS A HZ2  1  
ATOM 904   H HZ3  . LYS A 1 56  ? -1.494  12.492  17.607  1.00 0.00 ? 108 LYS A HZ3  1  
ATOM 905   N N    . GLY A 1 57  ? 5.629   9.036   16.339  1.00 0.00 ? 109 GLY A N    1  
ATOM 906   C CA   . GLY A 1 57  ? 6.422   8.149   15.500  1.00 0.00 ? 109 GLY A CA   1  
ATOM 907   C C    . GLY A 1 57  ? 5.883   8.012   14.076  1.00 0.00 ? 109 GLY A C    1  
ATOM 908   O O    . GLY A 1 57  ? 6.481   7.305   13.267  1.00 0.00 ? 109 GLY A O    1  
ATOM 909   H H    . GLY A 1 57  ? 5.020   8.612   17.023  1.00 0.00 ? 109 GLY A H    1  
ATOM 910   H HA2  . GLY A 1 57  ? 7.443   8.528   15.455  1.00 0.00 ? 109 GLY A HA2  1  
ATOM 911   H HA3  . GLY A 1 57  ? 6.430   7.161   15.959  1.00 0.00 ? 109 GLY A HA3  1  
ATOM 912   N N    . TYR A 1 58  ? 4.767   8.673   13.754  1.00 0.00 ? 110 TYR A N    1  
ATOM 913   C CA   . TYR A 1 58  ? 4.153   8.554   12.439  1.00 0.00 ? 110 TYR A CA   1  
ATOM 914   C C    . TYR A 1 58  ? 4.964   9.313   11.392  1.00 0.00 ? 110 TYR A C    1  
ATOM 915   O O    . TYR A 1 58  ? 5.383   10.447  11.627  1.00 0.00 ? 110 TYR A O    1  
ATOM 916   C CB   . TYR A 1 58  ? 2.709   9.056   12.497  1.00 0.00 ? 110 TYR A CB   1  
ATOM 917   C CG   . TYR A 1 58  ? 1.885   8.454   13.616  1.00 0.00 ? 110 TYR A CG   1  
ATOM 918   C CD1  . TYR A 1 58  ? 2.066   7.114   13.992  1.00 0.00 ? 110 TYR A CD1  1  
ATOM 919   C CD2  . TYR A 1 58  ? 0.935   9.245   14.281  1.00 0.00 ? 110 TYR A CD2  1  
ATOM 920   C CE1  . TYR A 1 58  ? 1.317   6.569   15.043  1.00 0.00 ? 110 TYR A CE1  1  
ATOM 921   C CE2  . TYR A 1 58  ? 0.174   8.703   15.327  1.00 0.00 ? 110 TYR A CE2  1  
ATOM 922   C CZ   . TYR A 1 58  ? 0.365   7.361   15.714  1.00 0.00 ? 110 TYR A CZ   1  
ATOM 923   O OH   . TYR A 1 58  ? -0.367  6.830   16.735  1.00 0.00 ? 110 TYR A OH   1  
ATOM 924   H H    . TYR A 1 58  ? 4.323   9.275   14.433  1.00 0.00 ? 110 TYR A H    1  
ATOM 925   H HA   . TYR A 1 58  ? 4.138   7.503   12.152  1.00 0.00 ? 110 TYR A HA   1  
ATOM 926   H HB2  . TYR A 1 58  ? 2.727   10.138  12.626  1.00 0.00 ? 110 TYR A HB2  1  
ATOM 927   H HB3  . TYR A 1 58  ? 2.222   8.833   11.547  1.00 0.00 ? 110 TYR A HB3  1  
ATOM 928   H HD1  . TYR A 1 58  ? 2.786   6.496   13.474  1.00 0.00 ? 110 TYR A HD1  1  
ATOM 929   H HD2  . TYR A 1 58  ? 0.790   10.274  13.986  1.00 0.00 ? 110 TYR A HD2  1  
ATOM 930   H HE1  . TYR A 1 58  ? 1.469   5.541   15.338  1.00 0.00 ? 110 TYR A HE1  1  
ATOM 931   H HE2  . TYR A 1 58  ? -0.558  9.312   15.836  1.00 0.00 ? 110 TYR A HE2  1  
ATOM 932   H HH   . TYR A 1 58  ? -0.984  7.457   17.118  1.00 0.00 ? 110 TYR A HH   1  
ATOM 933   N N    . ALA A 1 59  ? 5.184   8.682   10.235  1.00 0.00 ? 111 ALA A N    1  
ATOM 934   C CA   . ALA A 1 59  ? 5.967   9.273   9.164   1.00 0.00 ? 111 ALA A CA   1  
ATOM 935   C C    . ALA A 1 59  ? 5.575   8.710   7.798   1.00 0.00 ? 111 ALA A C    1  
ATOM 936   O O    . ALA A 1 59  ? 5.031   7.611   7.698   1.00 0.00 ? 111 ALA A O    1  
ATOM 937   C CB   . ALA A 1 59  ? 7.449   9.005   9.426   1.00 0.00 ? 111 ALA A CB   1  
ATOM 938   H H    . ALA A 1 59  ? 4.801   7.760   10.087  1.00 0.00 ? 111 ALA A H    1  
ATOM 939   H HA   . ALA A 1 59  ? 5.806   10.351  9.158   1.00 0.00 ? 111 ALA A HA   1  
ATOM 940   H HB1  . ALA A 1 59  ? 7.627   7.930   9.461   1.00 0.00 ? 111 ALA A HB1  1  
ATOM 941   H HB2  . ALA A 1 59  ? 8.042   9.440   8.621   1.00 0.00 ? 111 ALA A HB2  1  
ATOM 942   H HB3  . ALA A 1 59  ? 7.743   9.454   10.374  1.00 0.00 ? 111 ALA A HB3  1  
ATOM 943   N N    . PHE A 1 60  ? 5.863   9.486   6.749   1.00 0.00 ? 112 PHE A N    1  
ATOM 944   C CA   . PHE A 1 60  ? 5.672   9.054   5.373   1.00 0.00 ? 112 PHE A CA   1  
ATOM 945   C C    . PHE A 1 60  ? 6.957   9.376   4.617   1.00 0.00 ? 112 PHE A C    1  
ATOM 946   O O    . PHE A 1 60  ? 7.456   10.497  4.704   1.00 0.00 ? 112 PHE A O    1  
ATOM 947   C CB   . PHE A 1 60  ? 4.475   9.776   4.750   1.00 0.00 ? 112 PHE A CB   1  
ATOM 948   C CG   . PHE A 1 60  ? 3.152   9.489   5.423   1.00 0.00 ? 112 PHE A CG   1  
ATOM 949   C CD1  . PHE A 1 60  ? 2.772   10.205  6.568   1.00 0.00 ? 112 PHE A CD1  1  
ATOM 950   C CD2  . PHE A 1 60  ? 2.299   8.505   4.898   1.00 0.00 ? 112 PHE A CD2  1  
ATOM 951   C CE1  . PHE A 1 60  ? 1.543   9.938   7.187   1.00 0.00 ? 112 PHE A CE1  1  
ATOM 952   C CE2  . PHE A 1 60  ? 1.067   8.243   5.515   1.00 0.00 ? 112 PHE A CE2  1  
ATOM 953   C CZ   . PHE A 1 60  ? 0.691   8.959   6.659   1.00 0.00 ? 112 PHE A CZ   1  
ATOM 954   H H    . PHE A 1 60  ? 6.235   10.412  6.901   1.00 0.00 ? 112 PHE A H    1  
ATOM 955   H HA   . PHE A 1 60  ? 5.499   7.979   5.342   1.00 0.00 ? 112 PHE A HA   1  
ATOM 956   H HB2  . PHE A 1 60  ? 4.657   10.850  4.785   1.00 0.00 ? 112 PHE A HB2  1  
ATOM 957   H HB3  . PHE A 1 60  ? 4.403   9.484   3.703   1.00 0.00 ? 112 PHE A HB3  1  
ATOM 958   H HD1  . PHE A 1 60  ? 3.426   10.964  6.972   1.00 0.00 ? 112 PHE A HD1  1  
ATOM 959   H HD2  . PHE A 1 60  ? 2.591   7.950   4.020   1.00 0.00 ? 112 PHE A HD2  1  
ATOM 960   H HE1  . PHE A 1 60  ? 1.253   10.487  8.070   1.00 0.00 ? 112 PHE A HE1  1  
ATOM 961   H HE2  . PHE A 1 60  ? 0.409   7.491   5.108   1.00 0.00 ? 112 PHE A HE2  1  
ATOM 962   H HZ   . PHE A 1 60  ? -0.257  8.756   7.137   1.00 0.00 ? 112 PHE A HZ   1  
ATOM 963   N N    . LEU A 1 61  ? 7.502   8.411   3.875   1.00 0.00 ? 113 LEU A N    1  
ATOM 964   C CA   . LEU A 1 61  ? 8.793   8.589   3.230   1.00 0.00 ? 113 LEU A CA   1  
ATOM 965   C C    . LEU A 1 61  ? 8.973   7.668   2.027   1.00 0.00 ? 113 LEU A C    1  
ATOM 966   O O    . LEU A 1 61  ? 8.246   6.690   1.857   1.00 0.00 ? 113 LEU A O    1  
ATOM 967   C CB   . LEU A 1 61  ? 9.888   8.370   4.281   1.00 0.00 ? 113 LEU A CB   1  
ATOM 968   C CG   . LEU A 1 61  ? 9.771   7.035   5.031   1.00 0.00 ? 113 LEU A CG   1  
ATOM 969   C CD1  . LEU A 1 61  ? 10.558  5.926   4.336   1.00 0.00 ? 113 LEU A CD1  1  
ATOM 970   C CD2  . LEU A 1 61  ? 10.330  7.226   6.438   1.00 0.00 ? 113 LEU A CD2  1  
ATOM 971   H H    . LEU A 1 61  ? 7.026   7.528   3.754   1.00 0.00 ? 113 LEU A H    1  
ATOM 972   H HA   . LEU A 1 61  ? 8.873   9.617   2.877   1.00 0.00 ? 113 LEU A HA   1  
ATOM 973   H HB2  . LEU A 1 61  ? 10.869  8.441   3.812   1.00 0.00 ? 113 LEU A HB2  1  
ATOM 974   H HB3  . LEU A 1 61  ? 9.804   9.176   5.010   1.00 0.00 ? 113 LEU A HB3  1  
ATOM 975   H HG   . LEU A 1 61  ? 8.725   6.737   5.117   1.00 0.00 ? 113 LEU A HG   1  
ATOM 976   H HD11 . LEU A 1 61  ? 11.615  6.193   4.300   1.00 0.00 ? 113 LEU A HD11 1  
ATOM 977   H HD12 . LEU A 1 61  ? 10.440  4.997   4.894   1.00 0.00 ? 113 LEU A HD12 1  
ATOM 978   H HD13 . LEU A 1 61  ? 10.183  5.782   3.323   1.00 0.00 ? 113 LEU A HD13 1  
ATOM 979   H HD21 . LEU A 1 61  ? 11.362  7.568   6.372   1.00 0.00 ? 113 LEU A HD21 1  
ATOM 980   H HD22 . LEU A 1 61  ? 9.736   7.971   6.967   1.00 0.00 ? 113 LEU A HD22 1  
ATOM 981   H HD23 . LEU A 1 61  ? 10.286  6.283   6.984   1.00 0.00 ? 113 LEU A HD23 1  
ATOM 982   N N    . LEU A 1 62  ? 9.962   8.002   1.193   1.00 0.00 ? 114 LEU A N    1  
ATOM 983   C CA   . LEU A 1 62  ? 10.337  7.230   0.023   1.00 0.00 ? 114 LEU A CA   1  
ATOM 984   C C    . LEU A 1 62  ? 11.806  7.506   -0.283  1.00 0.00 ? 114 LEU A C    1  
ATOM 985   O O    . LEU A 1 62  ? 12.347  8.526   0.133   1.00 0.00 ? 114 LEU A O    1  
ATOM 986   C CB   . LEU A 1 62  ? 9.402   7.527   -1.160  1.00 0.00 ? 114 LEU A CB   1  
ATOM 987   C CG   . LEU A 1 62  ? 9.120   9.005   -1.454  1.00 0.00 ? 114 LEU A CG   1  
ATOM 988   C CD1  . LEU A 1 62  ? 10.327  9.734   -2.037  1.00 0.00 ? 114 LEU A CD1  1  
ATOM 989   C CD2  . LEU A 1 62  ? 7.995   9.078   -2.483  1.00 0.00 ? 114 LEU A CD2  1  
ATOM 990   H H    . LEU A 1 62  ? 10.497  8.838   1.378   1.00 0.00 ? 114 LEU A H    1  
ATOM 991   H HA   . LEU A 1 62  ? 10.246  6.170   0.264   1.00 0.00 ? 114 LEU A HA   1  
ATOM 992   H HB2  . LEU A 1 62  ? 9.804   7.053   -2.056  1.00 0.00 ? 114 LEU A HB2  1  
ATOM 993   H HB3  . LEU A 1 62  ? 8.443   7.056   -0.939  1.00 0.00 ? 114 LEU A HB3  1  
ATOM 994   H HG   . LEU A 1 62  ? 8.793   9.512   -0.545  1.00 0.00 ? 114 LEU A HG   1  
ATOM 995   H HD11 . LEU A 1 62  ? 10.710  9.183   -2.897  1.00 0.00 ? 114 LEU A HD11 1  
ATOM 996   H HD12 . LEU A 1 62  ? 10.025  10.733  -2.354  1.00 0.00 ? 114 LEU A HD12 1  
ATOM 997   H HD13 . LEU A 1 62  ? 11.103  9.828   -1.278  1.00 0.00 ? 114 LEU A HD13 1  
ATOM 998   H HD21 . LEU A 1 62  ? 7.764   10.122  -2.698  1.00 0.00 ? 114 LEU A HD21 1  
ATOM 999   H HD22 . LEU A 1 62  ? 8.304   8.579   -3.401  1.00 0.00 ? 114 LEU A HD22 1  
ATOM 1000  H HD23 . LEU A 1 62  ? 7.104   8.592   -2.088  1.00 0.00 ? 114 LEU A HD23 1  
ATOM 1001  N N    . PHE A 1 63  ? 12.458  6.599   -1.012  1.00 0.00 ? 115 PHE A N    1  
ATOM 1002  C CA   . PHE A 1 63  ? 13.891  6.679   -1.256  1.00 0.00 ? 115 PHE A CA   1  
ATOM 1003  C C    . PHE A 1 63  ? 14.200  6.657   -2.752  1.00 0.00 ? 115 PHE A C    1  
ATOM 1004  O O    . PHE A 1 63  ? 13.322  6.399   -3.574  1.00 0.00 ? 115 PHE A O    1  
ATOM 1005  C CB   . PHE A 1 63  ? 14.594  5.591   -0.442  1.00 0.00 ? 115 PHE A CB   1  
ATOM 1006  C CG   . PHE A 1 63  ? 13.816  4.303   -0.363  1.00 0.00 ? 115 PHE A CG   1  
ATOM 1007  C CD1  . PHE A 1 63  ? 13.925  3.381   -1.408  1.00 0.00 ? 115 PHE A CD1  1  
ATOM 1008  C CD2  . PHE A 1 63  ? 12.990  4.032   0.740   1.00 0.00 ? 115 PHE A CD2  1  
ATOM 1009  C CE1  . PHE A 1 63  ? 13.207  2.181   -1.358  1.00 0.00 ? 115 PHE A CE1  1  
ATOM 1010  C CE2  . PHE A 1 63  ? 12.253  2.840   0.776   1.00 0.00 ? 115 PHE A CE2  1  
ATOM 1011  C CZ   . PHE A 1 63  ? 12.363  1.915   -0.270  1.00 0.00 ? 115 PHE A CZ   1  
ATOM 1012  H H    . PHE A 1 63  ? 11.954  5.819   -1.408  1.00 0.00 ? 115 PHE A H    1  
ATOM 1013  H HA   . PHE A 1 63  ? 14.255  7.639   -0.888  1.00 0.00 ? 115 PHE A HA   1  
ATOM 1014  H HB2  . PHE A 1 63  ? 15.582  5.399   -0.861  1.00 0.00 ? 115 PHE A HB2  1  
ATOM 1015  H HB3  . PHE A 1 63  ? 14.722  5.952   0.579   1.00 0.00 ? 115 PHE A HB3  1  
ATOM 1016  H HD1  . PHE A 1 63  ? 14.564  3.606   -2.249  1.00 0.00 ? 115 PHE A HD1  1  
ATOM 1017  H HD2  . PHE A 1 63  ? 12.913  4.727   1.562   1.00 0.00 ? 115 PHE A HD2  1  
ATOM 1018  H HE1  . PHE A 1 63  ? 13.306  1.462   -2.158  1.00 0.00 ? 115 PHE A HE1  1  
ATOM 1019  H HE2  . PHE A 1 63  ? 11.602  2.635   1.613   1.00 0.00 ? 115 PHE A HE2  1  
ATOM 1020  H HZ   . PHE A 1 63  ? 11.797  0.995   -0.236  1.00 0.00 ? 115 PHE A HZ   1  
ATOM 1021  N N    . GLN A 1 64  ? 15.459  6.934   -3.101  1.00 0.00 ? 116 GLN A N    1  
ATOM 1022  C CA   . GLN A 1 64  ? 15.859  7.206   -4.476  1.00 0.00 ? 116 GLN A CA   1  
ATOM 1023  C C    . GLN A 1 64  ? 15.768  6.019   -5.438  1.00 0.00 ? 116 GLN A C    1  
ATOM 1024  O O    . GLN A 1 64  ? 15.579  6.236   -6.634  1.00 0.00 ? 116 GLN A O    1  
ATOM 1025  C CB   . GLN A 1 64  ? 17.279  7.782   -4.448  1.00 0.00 ? 116 GLN A CB   1  
ATOM 1026  C CG   . GLN A 1 64  ? 17.707  8.293   -5.826  1.00 0.00 ? 116 GLN A CG   1  
ATOM 1027  C CD   . GLN A 1 64  ? 19.090  8.936   -5.797  1.00 0.00 ? 116 GLN A CD   1  
ATOM 1028  O OE1  . GLN A 1 64  ? 19.745  8.994   -4.760  1.00 0.00 ? 116 GLN A OE1  1  
ATOM 1029  N NE2  . GLN A 1 64  ? 19.547  9.426   -6.945  1.00 0.00 ? 116 GLN A NE2  1  
ATOM 1030  H H    . GLN A 1 64  ? 16.175  6.974   -2.390  1.00 0.00 ? 116 GLN A H    1  
ATOM 1031  H HA   . GLN A 1 64  ? 15.185  7.975   -4.851  1.00 0.00 ? 116 GLN A HA   1  
ATOM 1032  H HB2  . GLN A 1 64  ? 17.308  8.611   -3.741  1.00 0.00 ? 116 GLN A HB2  1  
ATOM 1033  H HB3  . GLN A 1 64  ? 17.973  7.012   -4.114  1.00 0.00 ? 116 GLN A HB3  1  
ATOM 1034  H HG2  . GLN A 1 64  ? 17.726  7.464   -6.534  1.00 0.00 ? 116 GLN A HG2  1  
ATOM 1035  H HG3  . GLN A 1 64  ? 16.984  9.029   -6.176  1.00 0.00 ? 116 GLN A HG3  1  
ATOM 1036  H HE21 . GLN A 1 64  ? 18.985  9.365   -7.782  1.00 0.00 ? 116 GLN A HE21 1  
ATOM 1037  H HE22 . GLN A 1 64  ? 20.460  9.859   -6.975  1.00 0.00 ? 116 GLN A HE22 1  
ATOM 1038  N N    . ASP A 1 65  ? 15.896  4.778   -4.961  1.00 0.00 ? 117 ASP A N    1  
ATOM 1039  C CA   . ASP A 1 65  ? 15.871  3.615   -5.844  1.00 0.00 ? 117 ASP A CA   1  
ATOM 1040  C C    . ASP A 1 65  ? 14.758  2.637   -5.477  1.00 0.00 ? 117 ASP A C    1  
ATOM 1041  O O    . ASP A 1 65  ? 14.347  2.558   -4.323  1.00 0.00 ? 117 ASP A O    1  
ATOM 1042  C CB   . ASP A 1 65  ? 17.239  2.932   -5.855  1.00 0.00 ? 117 ASP A CB   1  
ATOM 1043  C CG   . ASP A 1 65  ? 17.525  2.226   -4.532  1.00 0.00 ? 117 ASP A CG   1  
ATOM 1044  O OD1  . ASP A 1 65  ? 18.068  2.893   -3.625  1.00 0.00 ? 117 ASP A OD1  1  
ATOM 1045  O OD2  . ASP A 1 65  ? 17.197  1.022   -4.448  1.00 0.00 ? 117 ASP A OD2  1  
ATOM 1046  H H    . ASP A 1 65  ? 16.020  4.627   -3.970  1.00 0.00 ? 117 ASP A H    1  
ATOM 1047  H HA   . ASP A 1 65  ? 15.676  3.960   -6.860  1.00 0.00 ? 117 ASP A HA   1  
ATOM 1048  H HB2  . ASP A 1 65  ? 17.260  2.196   -6.659  1.00 0.00 ? 117 ASP A HB2  1  
ATOM 1049  H HB3  . ASP A 1 65  ? 18.011  3.676   -6.048  1.00 0.00 ? 117 ASP A HB3  1  
ATOM 1050  N N    . GLU A 1 66  ? 14.266  1.884   -6.465  1.00 0.00 ? 118 GLU A N    1  
ATOM 1051  C CA   . GLU A 1 66  ? 13.173  0.947   -6.249  1.00 0.00 ? 118 GLU A CA   1  
ATOM 1052  C C    . GLU A 1 66  ? 13.670  -0.482  -6.017  1.00 0.00 ? 118 GLU A C    1  
ATOM 1053  O O    . GLU A 1 66  ? 12.873  -1.360  -5.697  1.00 0.00 ? 118 GLU A O    1  
ATOM 1054  C CB   . GLU A 1 66  ? 12.214  1.007   -7.439  1.00 0.00 ? 118 GLU A CB   1  
ATOM 1055  C CG   . GLU A 1 66  ? 11.565  2.389   -7.524  1.00 0.00 ? 118 GLU A CG   1  
ATOM 1056  C CD   . GLU A 1 66  ? 10.597  2.478   -8.703  1.00 0.00 ? 118 GLU A CD   1  
ATOM 1057  O OE1  . GLU A 1 66  ? 11.089  2.506   -9.853  1.00 0.00 ? 118 GLU A OE1  1  
ATOM 1058  O OE2  . GLU A 1 66  ? 9.373   2.518   -8.444  1.00 0.00 ? 118 GLU A OE2  1  
ATOM 1059  H H    . GLU A 1 66  ? 14.647  1.958   -7.397  1.00 0.00 ? 118 GLU A H    1  
ATOM 1060  H HA   . GLU A 1 66  ? 12.622  1.257   -5.360  1.00 0.00 ? 118 GLU A HA   1  
ATOM 1061  H HB2  . GLU A 1 66  ? 12.763  0.802   -8.358  1.00 0.00 ? 118 GLU A HB2  1  
ATOM 1062  H HB3  . GLU A 1 66  ? 11.434  0.257   -7.310  1.00 0.00 ? 118 GLU A HB3  1  
ATOM 1063  H HG2  . GLU A 1 66  ? 11.023  2.581   -6.599  1.00 0.00 ? 118 GLU A HG2  1  
ATOM 1064  H HG3  . GLU A 1 66  ? 12.338  3.149   -7.641  1.00 0.00 ? 118 GLU A HG3  1  
ATOM 1065  N N    . SER A 1 67  ? 14.974  -0.731  -6.173  1.00 0.00 ? 119 SER A N    1  
ATOM 1066  C CA   . SER A 1 67  ? 15.531  -2.067  -5.989  1.00 0.00 ? 119 SER A CA   1  
ATOM 1067  C C    . SER A 1 67  ? 15.701  -2.397  -4.505  1.00 0.00 ? 119 SER A C    1  
ATOM 1068  O O    . SER A 1 67  ? 15.686  -3.564  -4.113  1.00 0.00 ? 119 SER A O    1  
ATOM 1069  C CB   . SER A 1 67  ? 16.875  -2.157  -6.709  1.00 0.00 ? 119 SER A CB   1  
ATOM 1070  O OG   . SER A 1 67  ? 16.704  -1.885  -8.085  1.00 0.00 ? 119 SER A OG   1  
ATOM 1071  H H    . SER A 1 67  ? 15.606  0.017   -6.424  1.00 0.00 ? 119 SER A H    1  
ATOM 1072  H HA   . SER A 1 67  ? 14.850  -2.797  -6.428  1.00 0.00 ? 119 SER A HA   1  
ATOM 1073  H HB2  . SER A 1 67  ? 17.564  -1.429  -6.279  1.00 0.00 ? 119 SER A HB2  1  
ATOM 1074  H HB3  . SER A 1 67  ? 17.286  -3.159  -6.584  1.00 0.00 ? 119 SER A HB3  1  
ATOM 1075  H HG   . SER A 1 67  ? 17.563  -1.917  -8.512  1.00 0.00 ? 119 SER A HG   1  
ATOM 1076  N N    . SER A 1 68  ? 15.865  -1.371  -3.668  1.00 0.00 ? 120 SER A N    1  
ATOM 1077  C CA   . SER A 1 68  ? 16.038  -1.577  -2.244  1.00 0.00 ? 120 SER A CA   1  
ATOM 1078  C C    . SER A 1 68  ? 14.688  -1.773  -1.566  1.00 0.00 ? 120 SER A C    1  
ATOM 1079  O O    . SER A 1 68  ? 14.639  -2.129  -0.389  1.00 0.00 ? 120 SER A O    1  
ATOM 1080  C CB   . SER A 1 68  ? 16.819  -0.423  -1.622  1.00 0.00 ? 120 SER A CB   1  
ATOM 1081  O OG   . SER A 1 68  ? 17.151  -0.777  -0.296  1.00 0.00 ? 120 SER A OG   1  
ATOM 1082  H H    . SER A 1 68  ? 15.867  -0.424  -4.019  1.00 0.00 ? 120 SER A H    1  
ATOM 1083  H HA   . SER A 1 68  ? 16.624  -2.486  -2.104  1.00 0.00 ? 120 SER A HA   1  
ATOM 1084  H HB2  . SER A 1 68  ? 17.734  -0.254  -2.190  1.00 0.00 ? 120 SER A HB2  1  
ATOM 1085  H HB3  . SER A 1 68  ? 16.209  0.481   -1.628  1.00 0.00 ? 120 SER A HB3  1  
ATOM 1086  H HG   . SER A 1 68  ? 16.344  -1.005  0.172   1.00 0.00 ? 120 SER A HG   1  
ATOM 1087  N N    . VAL A 1 69  ? 13.590  -1.546  -2.294  1.00 0.00 ? 121 VAL A N    1  
ATOM 1088  C CA   . VAL A 1 69  ? 12.260  -1.794  -1.759  1.00 0.00 ? 121 VAL A CA   1  
ATOM 1089  C C    . VAL A 1 69  ? 12.164  -3.273  -1.422  1.00 0.00 ? 121 VAL A C    1  
ATOM 1090  O O    . VAL A 1 69  ? 11.624  -3.639  -0.383  1.00 0.00 ? 121 VAL A O    1  
ATOM 1091  C CB   . VAL A 1 69  ? 11.188  -1.423  -2.792  1.00 0.00 ? 121 VAL A CB   1  
ATOM 1092  C CG1  . VAL A 1 69  ? 9.788   -1.647  -2.220  1.00 0.00 ? 121 VAL A CG1  1  
ATOM 1093  C CG2  . VAL A 1 69  ? 11.296  0.043   -3.202  1.00 0.00 ? 121 VAL A CG2  1  
ATOM 1094  H H    . VAL A 1 69  ? 13.672  -1.198  -3.238  1.00 0.00 ? 121 VAL A H    1  
ATOM 1095  H HA   . VAL A 1 69  ? 12.113  -1.206  -0.854  1.00 0.00 ? 121 VAL A HA   1  
ATOM 1096  H HB   . VAL A 1 69  ? 11.313  -2.047  -3.679  1.00 0.00 ? 121 VAL A HB   1  
ATOM 1097  H HG11 . VAL A 1 69  ? 9.673   -1.084  -1.294  1.00 0.00 ? 121 VAL A HG11 1  
ATOM 1098  H HG12 . VAL A 1 69  ? 9.047   -1.303  -2.942  1.00 0.00 ? 121 VAL A HG12 1  
ATOM 1099  H HG13 . VAL A 1 69  ? 9.635   -2.708  -2.025  1.00 0.00 ? 121 VAL A HG13 1  
ATOM 1100  H HG21 . VAL A 1 69  ? 11.102  0.680   -2.338  1.00 0.00 ? 121 VAL A HG21 1  
ATOM 1101  H HG22 . VAL A 1 69  ? 12.294  0.247   -3.587  1.00 0.00 ? 121 VAL A HG22 1  
ATOM 1102  H HG23 . VAL A 1 69  ? 10.560  0.261   -3.976  1.00 0.00 ? 121 VAL A HG23 1  
ATOM 1103  N N    . GLN A 1 70  ? 12.690  -4.129  -2.301  1.00 0.00 ? 122 GLN A N    1  
ATOM 1104  C CA   . GLN A 1 70  ? 12.639  -5.562  -2.094  1.00 0.00 ? 122 GLN A CA   1  
ATOM 1105  C C    . GLN A 1 70  ? 13.790  -6.021  -1.205  1.00 0.00 ? 122 GLN A C    1  
ATOM 1106  O O    . GLN A 1 70  ? 13.621  -6.972  -0.445  1.00 0.00 ? 122 GLN A O    1  
ATOM 1107  C CB   . GLN A 1 70  ? 12.666  -6.261  -3.457  1.00 0.00 ? 122 GLN A CB   1  
ATOM 1108  C CG   . GLN A 1 70  ? 12.579  -7.784  -3.321  1.00 0.00 ? 122 GLN A CG   1  
ATOM 1109  C CD   . GLN A 1 70  ? 11.284  -8.229  -2.653  1.00 0.00 ? 122 GLN A CD   1  
ATOM 1110  O OE1  . GLN A 1 70  ? 10.283  -8.473  -3.319  1.00 0.00 ? 122 GLN A OE1  1  
ATOM 1111  N NE2  . GLN A 1 70  ? 11.294  -8.339  -1.326  1.00 0.00 ? 122 GLN A NE2  1  
ATOM 1112  H H    . GLN A 1 70  ? 13.137  -3.784  -3.138  1.00 0.00 ? 122 GLN A H    1  
ATOM 1113  H HA   . GLN A 1 70  ? 11.701  -5.805  -1.595  1.00 0.00 ? 122 GLN A HA   1  
ATOM 1114  H HB2  . GLN A 1 70  ? 11.826  -5.908  -4.055  1.00 0.00 ? 122 GLN A HB2  1  
ATOM 1115  H HB3  . GLN A 1 70  ? 13.592  -6.002  -3.968  1.00 0.00 ? 122 GLN A HB3  1  
ATOM 1116  H HG2  . GLN A 1 70  ? 12.633  -8.232  -4.314  1.00 0.00 ? 122 GLN A HG2  1  
ATOM 1117  H HG3  . GLN A 1 70  ? 13.425  -8.143  -2.736  1.00 0.00 ? 122 GLN A HG3  1  
ATOM 1118  H HE21 . GLN A 1 70  ? 12.135  -8.127  -0.810  1.00 0.00 ? 122 GLN A HE21 1  
ATOM 1119  H HE22 . GLN A 1 70  ? 10.458  -8.633  -0.841  1.00 0.00 ? 122 GLN A HE22 1  
ATOM 1120  N N    . ALA A 1 71  ? 14.959  -5.373  -1.276  1.00 0.00 ? 123 ALA A N    1  
ATOM 1121  C CA   . ALA A 1 71  ? 16.104  -5.791  -0.479  1.00 0.00 ? 123 ALA A CA   1  
ATOM 1122  C C    . ALA A 1 71  ? 15.905  -5.509  1.012   1.00 0.00 ? 123 ALA A C    1  
ATOM 1123  O O    . ALA A 1 71  ? 16.302  -6.318  1.851   1.00 0.00 ? 123 ALA A O    1  
ATOM 1124  C CB   . ALA A 1 71  ? 17.353  -5.077  -0.993  1.00 0.00 ? 123 ALA A CB   1  
ATOM 1125  H H    . ALA A 1 71  ? 15.069  -4.582  -1.895  1.00 0.00 ? 123 ALA A H    1  
ATOM 1126  H HA   . ALA A 1 71  ? 16.239  -6.865  -0.609  1.00 0.00 ? 123 ALA A HA   1  
ATOM 1127  H HB1  . ALA A 1 71  ? 17.260  -4.006  -0.814  1.00 0.00 ? 123 ALA A HB1  1  
ATOM 1128  H HB2  . ALA A 1 71  ? 18.228  -5.458  -0.468  1.00 0.00 ? 123 ALA A HB2  1  
ATOM 1129  H HB3  . ALA A 1 71  ? 17.465  -5.261  -2.062  1.00 0.00 ? 123 ALA A HB3  1  
ATOM 1130  N N    . LEU A 1 72  ? 15.293  -4.372  1.361   1.00 0.00 ? 124 LEU A N    1  
ATOM 1131  C CA   . LEU A 1 72  ? 15.112  -4.003  2.757   1.00 0.00 ? 124 LEU A CA   1  
ATOM 1132  C C    . LEU A 1 72  ? 13.889  -4.717  3.327   1.00 0.00 ? 124 LEU A C    1  
ATOM 1133  O O    . LEU A 1 72  ? 13.924  -5.185  4.463   1.00 0.00 ? 124 LEU A O    1  
ATOM 1134  C CB   . LEU A 1 72  ? 15.008  -2.477  2.842   1.00 0.00 ? 124 LEU A CB   1  
ATOM 1135  C CG   . LEU A 1 72  ? 15.076  -1.870  4.252   1.00 0.00 ? 124 LEU A CG   1  
ATOM 1136  C CD1  . LEU A 1 72  ? 13.744  -1.977  4.991   1.00 0.00 ? 124 LEU A CD1  1  
ATOM 1137  C CD2  . LEU A 1 72  ? 16.163  -2.527  5.101   1.00 0.00 ? 124 LEU A CD2  1  
ATOM 1138  H H    . LEU A 1 72  ? 14.949  -3.745  0.649   1.00 0.00 ? 124 LEU A H    1  
ATOM 1139  H HA   . LEU A 1 72  ? 15.990  -4.328  3.314   1.00 0.00 ? 124 LEU A HA   1  
ATOM 1140  H HB2  . LEU A 1 72  ? 15.836  -2.058  2.269   1.00 0.00 ? 124 LEU A HB2  1  
ATOM 1141  H HB3  . LEU A 1 72  ? 14.076  -2.169  2.371   1.00 0.00 ? 124 LEU A HB3  1  
ATOM 1142  H HG   . LEU A 1 72  ? 15.312  -0.811  4.145   1.00 0.00 ? 124 LEU A HG   1  
ATOM 1143  H HD11 . LEU A 1 72  ? 13.521  -3.019  5.220   1.00 0.00 ? 124 LEU A HD11 1  
ATOM 1144  H HD12 . LEU A 1 72  ? 13.802  -1.417  5.926   1.00 0.00 ? 124 LEU A HD12 1  
ATOM 1145  H HD13 . LEU A 1 72  ? 12.945  -1.564  4.376   1.00 0.00 ? 124 LEU A HD13 1  
ATOM 1146  H HD21 . LEU A 1 72  ? 17.115  -2.491  4.573   1.00 0.00 ? 124 LEU A HD21 1  
ATOM 1147  H HD22 . LEU A 1 72  ? 16.253  -1.992  6.047   1.00 0.00 ? 124 LEU A HD22 1  
ATOM 1148  H HD23 . LEU A 1 72  ? 15.899  -3.564  5.309   1.00 0.00 ? 124 LEU A HD23 1  
ATOM 1149  N N    . ILE A 1 73  ? 12.807  -4.805  2.547   1.00 0.00 ? 125 ILE A N    1  
ATOM 1150  C CA   . ILE A 1 73  ? 11.622  -5.531  2.989   1.00 0.00 ? 125 ILE A CA   1  
ATOM 1151  C C    . ILE A 1 73  ? 11.947  -7.020  3.165   1.00 0.00 ? 125 ILE A C    1  
ATOM 1152  O O    . ILE A 1 73  ? 11.289  -7.706  3.944   1.00 0.00 ? 125 ILE A O    1  
ATOM 1153  C CB   . ILE A 1 73  ? 10.478  -5.311  1.992   1.00 0.00 ? 125 ILE A CB   1  
ATOM 1154  C CG1  . ILE A 1 73  ? 9.996   -3.860  2.134   1.00 0.00 ? 125 ILE A CG1  1  
ATOM 1155  C CG2  . ILE A 1 73  ? 9.330   -6.286  2.270   1.00 0.00 ? 125 ILE A CG2  1  
ATOM 1156  C CD1  . ILE A 1 73  ? 8.881   -3.526  1.142   1.00 0.00 ? 125 ILE A CD1  1  
ATOM 1157  H H    . ILE A 1 73  ? 12.801  -4.365  1.638   1.00 0.00 ? 125 ILE A H    1  
ATOM 1158  H HA   . ILE A 1 73  ? 11.307  -5.120  3.947   1.00 0.00 ? 125 ILE A HA   1  
ATOM 1159  H HB   . ILE A 1 73  ? 10.841  -5.486  0.979   1.00 0.00 ? 125 ILE A HB   1  
ATOM 1160  H HG12 . ILE A 1 73  ? 9.634   -3.696  3.148   1.00 0.00 ? 125 ILE A HG12 1  
ATOM 1161  H HG13 . ILE A 1 73  ? 10.834  -3.186  1.957   1.00 0.00 ? 125 ILE A HG13 1  
ATOM 1162  H HG21 . ILE A 1 73  ? 9.010   -6.182  3.307   1.00 0.00 ? 125 ILE A HG21 1  
ATOM 1163  H HG22 . ILE A 1 73  ? 8.493   -6.083  1.602   1.00 0.00 ? 125 ILE A HG22 1  
ATOM 1164  H HG23 . ILE A 1 73  ? 9.663   -7.309  2.097   1.00 0.00 ? 125 ILE A HG23 1  
ATOM 1165  H HD11 . ILE A 1 73  ? 7.984   -4.092  1.390   1.00 0.00 ? 125 ILE A HD11 1  
ATOM 1166  H HD12 . ILE A 1 73  ? 8.659   -2.461  1.193   1.00 0.00 ? 125 ILE A HD12 1  
ATOM 1167  H HD13 . ILE A 1 73  ? 9.197   -3.778  0.129   1.00 0.00 ? 125 ILE A HD13 1  
ATOM 1168  N N    . ASP A 1 74  ? 12.956  -7.534  2.454   1.00 0.00 ? 126 ASP A N    1  
ATOM 1169  C CA   . ASP A 1 74  ? 13.369  -8.925  2.607   1.00 0.00 ? 126 ASP A CA   1  
ATOM 1170  C C    . ASP A 1 74  ? 14.308  -9.082  3.805   1.00 0.00 ? 126 ASP A C    1  
ATOM 1171  O O    . ASP A 1 74  ? 14.438  -10.177 4.349   1.00 0.00 ? 126 ASP A O    1  
ATOM 1172  C CB   . ASP A 1 74  ? 14.042  -9.396  1.319   1.00 0.00 ? 126 ASP A CB   1  
ATOM 1173  C CG   . ASP A 1 74  ? 14.468  -10.859 1.411   1.00 0.00 ? 126 ASP A CG   1  
ATOM 1174  O OD1  . ASP A 1 74  ? 13.566  -11.726 1.410   1.00 0.00 ? 126 ASP A OD1  1  
ATOM 1175  O OD2  . ASP A 1 74  ? 15.695  -11.098 1.480   1.00 0.00 ? 126 ASP A OD2  1  
ATOM 1176  H H    . ASP A 1 74  ? 13.453  -6.957  1.790   1.00 0.00 ? 126 ASP A H    1  
ATOM 1177  H HA   . ASP A 1 74  ? 12.486  -9.539  2.782   1.00 0.00 ? 126 ASP A HA   1  
ATOM 1178  H HB2  . ASP A 1 74  ? 13.340  -9.287  0.493   1.00 0.00 ? 126 ASP A HB2  1  
ATOM 1179  H HB3  . ASP A 1 74  ? 14.917  -8.776  1.125   1.00 0.00 ? 126 ASP A HB3  1  
ATOM 1180  N N    . ALA A 1 75  ? 14.963  -7.992  4.216   1.00 0.00 ? 127 ALA A N    1  
ATOM 1181  C CA   . ALA A 1 75  ? 15.840  -7.989  5.377   1.00 0.00 ? 127 ALA A CA   1  
ATOM 1182  C C    . ALA A 1 75  ? 15.068  -7.789  6.687   1.00 0.00 ? 127 ALA A C    1  
ATOM 1183  O O    . ALA A 1 75  ? 15.681  -7.558  7.729   1.00 0.00 ? 127 ALA A O    1  
ATOM 1184  C CB   . ALA A 1 75  ? 16.914  -6.917  5.190   1.00 0.00 ? 127 ALA A CB   1  
ATOM 1185  H H    . ALA A 1 75  ? 14.855  -7.126  3.709   1.00 0.00 ? 127 ALA A H    1  
ATOM 1186  H HA   . ALA A 1 75  ? 16.336  -8.958  5.424   1.00 0.00 ? 127 ALA A HA   1  
ATOM 1187  H HB1  . ALA A 1 75  ? 16.448  -5.933  5.147   1.00 0.00 ? 127 ALA A HB1  1  
ATOM 1188  H HB2  . ALA A 1 75  ? 17.616  -6.952  6.024   1.00 0.00 ? 127 ALA A HB2  1  
ATOM 1189  H HB3  . ALA A 1 75  ? 17.454  -7.104  4.262   1.00 0.00 ? 127 ALA A HB3  1  
ATOM 1190  N N    . CYS A 1 76  ? 13.733  -7.875  6.650   1.00 0.00 ? 128 CYS A N    1  
ATOM 1191  C CA   . CYS A 1 76  ? 12.899  -7.676  7.827   1.00 0.00 ? 128 CYS A CA   1  
ATOM 1192  C C    . CYS A 1 76  ? 11.745  -8.681  7.883   1.00 0.00 ? 128 CYS A C    1  
ATOM 1193  O O    . CYS A 1 76  ? 11.656  -9.582  7.048   1.00 0.00 ? 128 CYS A O    1  
ATOM 1194  C CB   . CYS A 1 76  ? 12.388  -6.235  7.831   1.00 0.00 ? 128 CYS A CB   1  
ATOM 1195  S SG   . CYS A 1 76  ? 11.191  -5.998  6.493   1.00 0.00 ? 128 CYS A SG   1  
ATOM 1196  H H    . CYS A 1 76  ? 13.273  -8.084  5.774   1.00 0.00 ? 128 CYS A H    1  
ATOM 1197  H HA   . CYS A 1 76  ? 13.509  -7.818  8.718   1.00 0.00 ? 128 CYS A HA   1  
ATOM 1198  H HB2  . CYS A 1 76  ? 11.905  -6.029  8.786   1.00 0.00 ? 128 CYS A HB2  1  
ATOM 1199  H HB3  . CYS A 1 76  ? 13.228  -5.553  7.698   1.00 0.00 ? 128 CYS A HB3  1  
ATOM 1200  H HG   . CYS A 1 76  ? 12.034  -6.292  5.498   1.00 0.00 ? 128 CYS A HG   1  
ATOM 1201  N N    . ILE A 1 77  ? 10.859  -8.525  8.873   1.00 0.00 ? 129 ILE A N    1  
ATOM 1202  C CA   . ILE A 1 77  ? 9.751   -9.444  9.111   1.00 0.00 ? 129 ILE A CA   1  
ATOM 1203  C C    . ILE A 1 77  ? 8.479   -8.941  8.424   1.00 0.00 ? 129 ILE A C    1  
ATOM 1204  O O    . ILE A 1 77  ? 8.295   -7.738  8.244   1.00 0.00 ? 129 ILE A O    1  
ATOM 1205  C CB   . ILE A 1 77  ? 9.556   -9.627  10.625  1.00 0.00 ? 129 ILE A CB   1  
ATOM 1206  C CG1  . ILE A 1 77  ? 10.844  -10.201 11.232  1.00 0.00 ? 129 ILE A CG1  1  
ATOM 1207  C CG2  . ILE A 1 77  ? 8.374   -10.558 10.914  1.00 0.00 ? 129 ILE A CG2  1  
ATOM 1208  C CD1  . ILE A 1 77  ? 10.743  -10.377 12.748  1.00 0.00 ? 129 ILE A CD1  1  
ATOM 1209  H H    . ILE A 1 77  ? 10.950  -7.735  9.495   1.00 0.00 ? 129 ILE A H    1  
ATOM 1210  H HA   . ILE A 1 77  ? 10.003  -10.414 8.682   1.00 0.00 ? 129 ILE A HA   1  
ATOM 1211  H HB   . ILE A 1 77  ? 9.354   -8.655  11.076  1.00 0.00 ? 129 ILE A HB   1  
ATOM 1212  H HG12 . ILE A 1 77  ? 11.064  -11.165 10.775  1.00 0.00 ? 129 ILE A HG12 1  
ATOM 1213  H HG13 . ILE A 1 77  ? 11.670  -9.521  11.023  1.00 0.00 ? 129 ILE A HG13 1  
ATOM 1214  H HG21 . ILE A 1 77  ? 8.551   -11.531 10.456  1.00 0.00 ? 129 ILE A HG21 1  
ATOM 1215  H HG22 . ILE A 1 77  ? 8.250   -10.680 11.990  1.00 0.00 ? 129 ILE A HG22 1  
ATOM 1216  H HG23 . ILE A 1 77  ? 7.455   -10.127 10.517  1.00 0.00 ? 129 ILE A HG23 1  
ATOM 1217  H HD11 . ILE A 1 77  ? 10.023  -11.158 12.988  1.00 0.00 ? 129 ILE A HD11 1  
ATOM 1218  H HD12 . ILE A 1 77  ? 11.718  -10.669 13.141  1.00 0.00 ? 129 ILE A HD12 1  
ATOM 1219  H HD13 . ILE A 1 77  ? 10.435  -9.438  13.208  1.00 0.00 ? 129 ILE A HD13 1  
ATOM 1220  N N    . GLU A 1 78  ? 7.597   -9.867  8.036   1.00 0.00 ? 130 GLU A N    1  
ATOM 1221  C CA   . GLU A 1 78  ? 6.350   -9.531  7.370   1.00 0.00 ? 130 GLU A CA   1  
ATOM 1222  C C    . GLU A 1 78  ? 5.175   -10.346 7.913   1.00 0.00 ? 130 GLU A C    1  
ATOM 1223  O O    . GLU A 1 78  ? 5.360   -11.373 8.566   1.00 0.00 ? 130 GLU A O    1  
ATOM 1224  C CB   . GLU A 1 78  ? 6.495   -9.712  5.854   1.00 0.00 ? 130 GLU A CB   1  
ATOM 1225  C CG   . GLU A 1 78  ? 6.649   -11.176 5.428   1.00 0.00 ? 130 GLU A CG   1  
ATOM 1226  C CD   . GLU A 1 78  ? 7.991   -11.774 5.850   1.00 0.00 ? 130 GLU A CD   1  
ATOM 1227  O OE1  . GLU A 1 78  ? 8.984   -11.528 5.129   1.00 0.00 ? 130 GLU A OE1  1  
ATOM 1228  O OE2  . GLU A 1 78  ? 8.018   -12.474 6.887   1.00 0.00 ? 130 GLU A OE2  1  
ATOM 1229  H H    . GLU A 1 78  ? 7.789   -10.844 8.207   1.00 0.00 ? 130 GLU A H    1  
ATOM 1230  H HA   . GLU A 1 78  ? 6.134   -8.478  7.553   1.00 0.00 ? 130 GLU A HA   1  
ATOM 1231  H HB2  . GLU A 1 78  ? 5.603   -9.311  5.375   1.00 0.00 ? 130 GLU A HB2  1  
ATOM 1232  H HB3  . GLU A 1 78  ? 7.356   -9.142  5.505   1.00 0.00 ? 130 GLU A HB3  1  
ATOM 1233  H HG2  . GLU A 1 78  ? 5.834   -11.765 5.847   1.00 0.00 ? 130 GLU A HG2  1  
ATOM 1234  H HG3  . GLU A 1 78  ? 6.571   -11.223 4.341   1.00 0.00 ? 130 GLU A HG3  1  
ATOM 1235  N N    . GLU A 1 79  ? 3.962   -9.869  7.634   1.00 0.00 ? 131 GLU A N    1  
ATOM 1236  C CA   . GLU A 1 79  ? 2.712   -10.513 8.004   1.00 0.00 ? 131 GLU A CA   1  
ATOM 1237  C C    . GLU A 1 79  ? 1.707   -10.284 6.878   1.00 0.00 ? 131 GLU A C    1  
ATOM 1238  O O    . GLU A 1 79  ? 1.831   -9.323  6.121   1.00 0.00 ? 131 GLU A O    1  
ATOM 1239  C CB   . GLU A 1 79  ? 2.202   -9.917  9.322   1.00 0.00 ? 131 GLU A CB   1  
ATOM 1240  C CG   . GLU A 1 79  ? 0.946   -10.615 9.847   1.00 0.00 ? 131 GLU A CG   1  
ATOM 1241  C CD   . GLU A 1 79  ? 1.176   -12.108 10.060  1.00 0.00 ? 131 GLU A CD   1  
ATOM 1242  O OE1  . GLU A 1 79  ? 1.657   -12.471 11.156  1.00 0.00 ? 131 GLU A OE1  1  
ATOM 1243  O OE2  . GLU A 1 79  ? 0.869   -12.878 9.121   1.00 0.00 ? 131 GLU A OE2  1  
ATOM 1244  H H    . GLU A 1 79  ? 3.885   -8.999  7.128   1.00 0.00 ? 131 GLU A H    1  
ATOM 1245  H HA   . GLU A 1 79  ? 2.880   -11.583 8.125   1.00 0.00 ? 131 GLU A HA   1  
ATOM 1246  H HB2  . GLU A 1 79  ? 2.985   -9.993  10.077  1.00 0.00 ? 131 GLU A HB2  1  
ATOM 1247  H HB3  . GLU A 1 79  ? 1.976   -8.861  9.173   1.00 0.00 ? 131 GLU A HB3  1  
ATOM 1248  H HG2  . GLU A 1 79  ? 0.661   -10.156 10.794  1.00 0.00 ? 131 GLU A HG2  1  
ATOM 1249  H HG3  . GLU A 1 79  ? 0.126   -10.469 9.142   1.00 0.00 ? 131 GLU A HG3  1  
ATOM 1250  N N    . ASP A 1 80  ? 0.706   -11.159 6.758   1.00 0.00 ? 132 ASP A N    1  
ATOM 1251  C CA   . ASP A 1 80  ? -0.308  -11.027 5.723   1.00 0.00 ? 132 ASP A CA   1  
ATOM 1252  C C    . ASP A 1 80  ? -1.108  -9.731  5.900   1.00 0.00 ? 132 ASP A C    1  
ATOM 1253  O O    . ASP A 1 80  ? -1.838  -9.326  4.997   1.00 0.00 ? 132 ASP A O    1  
ATOM 1254  C CB   . ASP A 1 80  ? -1.219  -12.252 5.779   1.00 0.00 ? 132 ASP A CB   1  
ATOM 1255  C CG   . ASP A 1 80  ? -2.254  -12.244 4.656   1.00 0.00 ? 132 ASP A CG   1  
ATOM 1256  O OD1  . ASP A 1 80  ? -1.831  -12.324 3.481   1.00 0.00 ? 132 ASP A OD1  1  
ATOM 1257  O OD2  . ASP A 1 80  ? -3.458  -12.159 4.982   1.00 0.00 ? 132 ASP A OD2  1  
ATOM 1258  H H    . ASP A 1 80  ? 0.639   -11.937 7.398   1.00 0.00 ? 132 ASP A H    1  
ATOM 1259  H HA   . ASP A 1 80  ? 0.186   -10.998 4.751   1.00 0.00 ? 132 ASP A HA   1  
ATOM 1260  H HB2  . ASP A 1 80  ? -0.610  -13.152 5.691   1.00 0.00 ? 132 ASP A HB2  1  
ATOM 1261  H HB3  . ASP A 1 80  ? -1.730  -12.272 6.742   1.00 0.00 ? 132 ASP A HB3  1  
ATOM 1262  N N    . GLY A 1 81  ? -0.973  -9.083  7.062   1.00 0.00 ? 133 GLY A N    1  
ATOM 1263  C CA   . GLY A 1 81  ? -1.681  -7.851  7.367   1.00 0.00 ? 133 GLY A CA   1  
ATOM 1264  C C    . GLY A 1 81  ? -0.795  -6.606  7.290   1.00 0.00 ? 133 GLY A C    1  
ATOM 1265  O O    . GLY A 1 81  ? -1.304  -5.522  7.007   1.00 0.00 ? 133 GLY A O    1  
ATOM 1266  H H    . GLY A 1 81  ? -0.356  -9.461  7.767   1.00 0.00 ? 133 GLY A H    1  
ATOM 1267  H HA2  . GLY A 1 81  ? -2.523  -7.732  6.685   1.00 0.00 ? 133 GLY A HA2  1  
ATOM 1268  H HA3  . GLY A 1 81  ? -2.058  -7.931  8.386   1.00 0.00 ? 133 GLY A HA3  1  
ATOM 1269  N N    . LYS A 1 82  ? 0.516   -6.738  7.538   1.00 0.00 ? 134 LYS A N    1  
ATOM 1270  C CA   . LYS A 1 82  ? 1.418   -5.589  7.600   1.00 0.00 ? 134 LYS A CA   1  
ATOM 1271  C C    . LYS A 1 82  ? 2.875   -6.047  7.621   1.00 0.00 ? 134 LYS A C    1  
ATOM 1272  O O    . LYS A 1 82  ? 3.149   -7.244  7.637   1.00 0.00 ? 134 LYS A O    1  
ATOM 1273  C CB   . LYS A 1 82  ? 1.119   -4.786  8.870   1.00 0.00 ? 134 LYS A CB   1  
ATOM 1274  C CG   . LYS A 1 82  ? 1.628   -5.496  10.124  1.00 0.00 ? 134 LYS A CG   1  
ATOM 1275  C CD   . LYS A 1 82  ? 0.734   -5.154  11.314  1.00 0.00 ? 134 LYS A CD   1  
ATOM 1276  C CE   . LYS A 1 82  ? -0.614  -5.862  11.183  1.00 0.00 ? 134 LYS A CE   1  
ATOM 1277  N NZ   . LYS A 1 82  ? -1.476  -5.581  12.347  1.00 0.00 ? 134 LYS A NZ   1  
ATOM 1278  H H    . LYS A 1 82  ? 0.906   -7.656  7.690   1.00 0.00 ? 134 LYS A H    1  
ATOM 1279  H HA   . LYS A 1 82  ? 1.255   -4.955  6.729   1.00 0.00 ? 134 LYS A HA   1  
ATOM 1280  H HB2  . LYS A 1 82  ? 1.596   -3.808  8.802   1.00 0.00 ? 134 LYS A HB2  1  
ATOM 1281  H HB3  . LYS A 1 82  ? 0.042   -4.640  8.965   1.00 0.00 ? 134 LYS A HB3  1  
ATOM 1282  H HG2  . LYS A 1 82  ? 1.622   -6.576  9.976   1.00 0.00 ? 134 LYS A HG2  1  
ATOM 1283  H HG3  . LYS A 1 82  ? 2.650   -5.175  10.327  1.00 0.00 ? 134 LYS A HG3  1  
ATOM 1284  H HD2  . LYS A 1 82  ? 1.219   -5.501  12.225  1.00 0.00 ? 134 LYS A HD2  1  
ATOM 1285  H HD3  . LYS A 1 82  ? 0.587   -4.076  11.372  1.00 0.00 ? 134 LYS A HD3  1  
ATOM 1286  H HE2  . LYS A 1 82  ? -1.115  -5.531  10.272  1.00 0.00 ? 134 LYS A HE2  1  
ATOM 1287  H HE3  . LYS A 1 82  ? -0.435  -6.934  11.115  1.00 0.00 ? 134 LYS A HE3  1  
ATOM 1288  H HZ1  . LYS A 1 82  ? -1.650  -4.590  12.419  1.00 0.00 ? 134 LYS A HZ1  1  
ATOM 1289  H HZ2  . LYS A 1 82  ? -2.357  -6.065  12.250  1.00 0.00 ? 134 LYS A HZ2  1  
ATOM 1290  H HZ3  . LYS A 1 82  ? -1.023  -5.898  13.193  1.00 0.00 ? 134 LYS A HZ3  1  
ATOM 1291  N N    . LEU A 1 83  ? 3.812   -5.098  7.621   1.00 0.00 ? 135 LEU A N    1  
ATOM 1292  C CA   . LEU A 1 83  ? 5.234   -5.401  7.714   1.00 0.00 ? 135 LEU A CA   1  
ATOM 1293  C C    . LEU A 1 83  ? 5.796   -4.837  9.020   1.00 0.00 ? 135 LEU A C    1  
ATOM 1294  O O    . LEU A 1 83  ? 5.176   -3.980  9.648   1.00 0.00 ? 135 LEU A O    1  
ATOM 1295  C CB   . LEU A 1 83  ? 5.981   -4.825  6.507   1.00 0.00 ? 135 LEU A CB   1  
ATOM 1296  C CG   . LEU A 1 83  ? 5.847   -5.654  5.226   1.00 0.00 ? 135 LEU A CG   1  
ATOM 1297  C CD1  . LEU A 1 83  ? 4.428   -5.668  4.663   1.00 0.00 ? 135 LEU A CD1  1  
ATOM 1298  C CD2  . LEU A 1 83  ? 6.760   -5.026  4.180   1.00 0.00 ? 135 LEU A CD2  1  
ATOM 1299  H H    . LEU A 1 83  ? 3.540   -4.128  7.559   1.00 0.00 ? 135 LEU A H    1  
ATOM 1300  H HA   . LEU A 1 83  ? 5.381   -6.481  7.730   1.00 0.00 ? 135 LEU A HA   1  
ATOM 1301  H HB2  . LEU A 1 83  ? 5.628   -3.811  6.316   1.00 0.00 ? 135 LEU A HB2  1  
ATOM 1302  H HB3  . LEU A 1 83  ? 7.041   -4.777  6.758   1.00 0.00 ? 135 LEU A HB3  1  
ATOM 1303  H HG   . LEU A 1 83  ? 6.174   -6.676  5.419   1.00 0.00 ? 135 LEU A HG   1  
ATOM 1304  H HD11 . LEU A 1 83  ? 4.047   -4.649  4.588   1.00 0.00 ? 135 LEU A HD11 1  
ATOM 1305  H HD12 . LEU A 1 83  ? 4.438   -6.121  3.671   1.00 0.00 ? 135 LEU A HD12 1  
ATOM 1306  H HD13 . LEU A 1 83  ? 3.777   -6.262  5.306   1.00 0.00 ? 135 LEU A HD13 1  
ATOM 1307  H HD21 . LEU A 1 83  ? 7.781   -5.001  4.561   1.00 0.00 ? 135 LEU A HD21 1  
ATOM 1308  H HD22 . LEU A 1 83  ? 6.725   -5.616  3.263   1.00 0.00 ? 135 LEU A HD22 1  
ATOM 1309  H HD23 . LEU A 1 83  ? 6.433   -4.008  3.969   1.00 0.00 ? 135 LEU A HD23 1  
ATOM 1310  N N    . TYR A 1 84  ? 6.975   -5.321  9.424   1.00 0.00 ? 136 TYR A N    1  
ATOM 1311  C CA   . TYR A 1 84  ? 7.637   -4.853  10.633  1.00 0.00 ? 136 TYR A CA   1  
ATOM 1312  C C    . TYR A 1 84  ? 9.150   -4.796  10.433  1.00 0.00 ? 136 TYR A C    1  
ATOM 1313  O O    . TYR A 1 84  ? 9.726   -5.655  9.768   1.00 0.00 ? 136 TYR A O    1  
ATOM 1314  C CB   . TYR A 1 84  ? 7.318   -5.784  11.806  1.00 0.00 ? 136 TYR A CB   1  
ATOM 1315  C CG   . TYR A 1 84  ? 5.976   -5.553  12.467  1.00 0.00 ? 136 TYR A CG   1  
ATOM 1316  C CD1  . TYR A 1 84  ? 5.781   -4.402  13.243  1.00 0.00 ? 136 TYR A CD1  1  
ATOM 1317  C CD2  . TYR A 1 84  ? 4.936   -6.482  12.314  1.00 0.00 ? 136 TYR A CD2  1  
ATOM 1318  C CE1  . TYR A 1 84  ? 4.553   -4.180  13.884  1.00 0.00 ? 136 TYR A CE1  1  
ATOM 1319  C CE2  . TYR A 1 84  ? 3.709   -6.273  12.960  1.00 0.00 ? 136 TYR A CE2  1  
ATOM 1320  C CZ   . TYR A 1 84  ? 3.514   -5.123  13.753  1.00 0.00 ? 136 TYR A CZ   1  
ATOM 1321  O OH   . TYR A 1 84  ? 2.325   -4.922  14.391  1.00 0.00 ? 136 TYR A OH   1  
ATOM 1322  H H    . TYR A 1 84  ? 7.436   -6.038  8.881   1.00 0.00 ? 136 TYR A H    1  
ATOM 1323  H HA   . TYR A 1 84  ? 7.283   -3.850  10.870  1.00 0.00 ? 136 TYR A HA   1  
ATOM 1324  H HB2  . TYR A 1 84  ? 7.383   -6.817  11.467  1.00 0.00 ? 136 TYR A HB2  1  
ATOM 1325  H HB3  . TYR A 1 84  ? 8.083   -5.639  12.569  1.00 0.00 ? 136 TYR A HB3  1  
ATOM 1326  H HD1  . TYR A 1 84  ? 6.579   -3.684  13.350  1.00 0.00 ? 136 TYR A HD1  1  
ATOM 1327  H HD2  . TYR A 1 84  ? 5.076   -7.359  11.701  1.00 0.00 ? 136 TYR A HD2  1  
ATOM 1328  H HE1  . TYR A 1 84  ? 4.407   -3.290  14.477  1.00 0.00 ? 136 TYR A HE1  1  
ATOM 1329  H HE2  . TYR A 1 84  ? 2.911   -6.993  12.853  1.00 0.00 ? 136 TYR A HE2  1  
ATOM 1330  H HH   . TYR A 1 84  ? 2.306   -4.106  14.896  1.00 0.00 ? 136 TYR A HH   1  
ATOM 1331  N N    . LEU A 1 85  ? 9.793   -3.777  11.014  1.00 0.00 ? 137 LEU A N    1  
ATOM 1332  C CA   . LEU A 1 85  ? 11.244  -3.639  10.979  1.00 0.00 ? 137 LEU A CA   1  
ATOM 1333  C C    . LEU A 1 85  ? 11.805  -3.852  12.385  1.00 0.00 ? 137 LEU A C    1  
ATOM 1334  O O    . LEU A 1 85  ? 11.237  -3.367  13.364  1.00 0.00 ? 137 LEU A O    1  
ATOM 1335  C CB   . LEU A 1 85  ? 11.636  -2.265  10.410  1.00 0.00 ? 137 LEU A CB   1  
ATOM 1336  C CG   . LEU A 1 85  ? 12.490  -2.327  9.140   1.00 0.00 ? 137 LEU A CG   1  
ATOM 1337  C CD1  . LEU A 1 85  ? 13.767  -3.135  9.367   1.00 0.00 ? 137 LEU A CD1  1  
ATOM 1338  C CD2  . LEU A 1 85  ? 11.695  -2.923  7.980   1.00 0.00 ? 137 LEU A CD2  1  
ATOM 1339  H H    . LEU A 1 85  ? 9.261   -3.072  11.504  1.00 0.00 ? 137 LEU A H    1  
ATOM 1340  H HA   . LEU A 1 85  ? 11.646  -4.416  10.330  1.00 0.00 ? 137 LEU A HA   1  
ATOM 1341  H HB2  . LEU A 1 85  ? 10.730  -1.702  10.183  1.00 0.00 ? 137 LEU A HB2  1  
ATOM 1342  H HB3  . LEU A 1 85  ? 12.196  -1.718  11.169  1.00 0.00 ? 137 LEU A HB3  1  
ATOM 1343  H HG   . LEU A 1 85  ? 12.777  -1.311  8.869   1.00 0.00 ? 137 LEU A HG   1  
ATOM 1344  H HD11 . LEU A 1 85  ? 13.525  -4.178  9.573   1.00 0.00 ? 137 LEU A HD11 1  
ATOM 1345  H HD12 . LEU A 1 85  ? 14.385  -3.087  8.470   1.00 0.00 ? 137 LEU A HD12 1  
ATOM 1346  H HD13 . LEU A 1 85  ? 14.321  -2.713  10.206  1.00 0.00 ? 137 LEU A HD13 1  
ATOM 1347  H HD21 . LEU A 1 85  ? 12.350  -3.063  7.120   1.00 0.00 ? 137 LEU A HD21 1  
ATOM 1348  H HD22 . LEU A 1 85  ? 11.272  -3.884  8.273   1.00 0.00 ? 137 LEU A HD22 1  
ATOM 1349  H HD23 . LEU A 1 85  ? 10.889  -2.245  7.702   1.00 0.00 ? 137 LEU A HD23 1  
ATOM 1350  N N    . CYS A 1 86  ? 12.920  -4.579  12.484  1.00 0.00 ? 138 CYS A N    1  
ATOM 1351  C CA   . CYS A 1 86  ? 13.538  -4.944  13.753  1.00 0.00 ? 138 CYS A CA   1  
ATOM 1352  C C    . CYS A 1 86  ? 14.569  -3.902  14.193  1.00 0.00 ? 138 CYS A C    1  
ATOM 1353  O O    . CYS A 1 86  ? 15.629  -4.251  14.712  1.00 0.00 ? 138 CYS A O    1  
ATOM 1354  C CB   . CYS A 1 86  ? 14.151  -6.340  13.633  1.00 0.00 ? 138 CYS A CB   1  
ATOM 1355  S SG   . CYS A 1 86  ? 12.862  -7.517  13.150  1.00 0.00 ? 138 CYS A SG   1  
ATOM 1356  H H    . CYS A 1 86  ? 13.370  -4.905  11.640  1.00 0.00 ? 138 CYS A H    1  
ATOM 1357  H HA   . CYS A 1 86  ? 12.757  -4.979  14.511  1.00 0.00 ? 138 CYS A HA   1  
ATOM 1358  H HB2  . CYS A 1 86  ? 14.938  -6.330  12.879  1.00 0.00 ? 138 CYS A HB2  1  
ATOM 1359  H HB3  . CYS A 1 86  ? 14.574  -6.639  14.592  1.00 0.00 ? 138 CYS A HB3  1  
ATOM 1360  H HG   . CYS A 1 86  ? 12.083  -7.331  14.219  1.00 0.00 ? 138 CYS A HG   1  
ATOM 1361  N N    . VAL A 1 87  ? 14.258  -2.620  13.987  1.00 0.00 ? 139 VAL A N    1  
ATOM 1362  C CA   . VAL A 1 87  ? 15.186  -1.522  14.228  1.00 0.00 ? 139 VAL A CA   1  
ATOM 1363  C C    . VAL A 1 87  ? 15.222  -1.082  15.697  1.00 0.00 ? 139 VAL A C    1  
ATOM 1364  O O    . VAL A 1 87  ? 15.797  -0.043  16.016  1.00 0.00 ? 139 VAL A O    1  
ATOM 1365  C CB   . VAL A 1 87  ? 14.867  -0.387  13.249  1.00 0.00 ? 139 VAL A CB   1  
ATOM 1366  C CG1  . VAL A 1 87  ? 13.557  0.310   13.612  1.00 0.00 ? 139 VAL A CG1  1  
ATOM 1367  C CG2  . VAL A 1 87  ? 15.995  0.640   13.173  1.00 0.00 ? 139 VAL A CG2  1  
ATOM 1368  H H    . VAL A 1 87  ? 13.338  -2.388  13.640  1.00 0.00 ? 139 VAL A H    1  
ATOM 1369  H HA   . VAL A 1 87  ? 16.182  -1.889  13.983  1.00 0.00 ? 139 VAL A HA   1  
ATOM 1370  H HB   . VAL A 1 87  ? 14.756  -0.824  12.257  1.00 0.00 ? 139 VAL A HB   1  
ATOM 1371  H HG11 . VAL A 1 87  ? 13.333  1.074   12.868  1.00 0.00 ? 139 VAL A HG11 1  
ATOM 1372  H HG12 . VAL A 1 87  ? 12.749  -0.421  13.629  1.00 0.00 ? 139 VAL A HG12 1  
ATOM 1373  H HG13 . VAL A 1 87  ? 13.646  0.781   14.592  1.00 0.00 ? 139 VAL A HG13 1  
ATOM 1374  H HG21 . VAL A 1 87  ? 16.940  0.134   12.982  1.00 0.00 ? 139 VAL A HG21 1  
ATOM 1375  H HG22 . VAL A 1 87  ? 15.787  1.330   12.354  1.00 0.00 ? 139 VAL A HG22 1  
ATOM 1376  H HG23 . VAL A 1 87  ? 16.059  1.210   14.100  1.00 0.00 ? 139 VAL A HG23 1  
ATOM 1377  N N    . SER A 1 88  ? 14.616  -1.856  16.605  1.00 0.00 ? 140 SER A N    1  
ATOM 1378  C CA   . SER A 1 88  ? 14.643  -1.555  18.032  1.00 0.00 ? 140 SER A CA   1  
ATOM 1379  C C    . SER A 1 88  ? 16.090  -1.391  18.496  1.00 0.00 ? 140 SER A C    1  
ATOM 1380  O O    . SER A 1 88  ? 16.836  -2.367  18.559  1.00 0.00 ? 140 SER A O    1  
ATOM 1381  C CB   . SER A 1 88  ? 13.977  -2.697  18.801  1.00 0.00 ? 140 SER A CB   1  
ATOM 1382  O OG   . SER A 1 88  ? 12.674  -2.920  18.307  1.00 0.00 ? 140 SER A OG   1  
ATOM 1383  H H    . SER A 1 88  ? 14.118  -2.683  16.306  1.00 0.00 ? 140 SER A H    1  
ATOM 1384  H HA   . SER A 1 88  ? 14.094  -0.633  18.219  1.00 0.00 ? 140 SER A HA   1  
ATOM 1385  H HB2  . SER A 1 88  ? 14.564  -3.608  18.681  1.00 0.00 ? 140 SER A HB2  1  
ATOM 1386  H HB3  . SER A 1 88  ? 13.926  -2.443  19.860  1.00 0.00 ? 140 SER A HB3  1  
ATOM 1387  H HG   . SER A 1 88  ? 12.314  -3.699  18.738  1.00 0.00 ? 140 SER A HG   1  
ATOM 1388  N N    . SER A 1 89  ? 16.488  -0.156  18.821  1.00 0.00 ? 141 SER A N    1  
ATOM 1389  C CA   . SER A 1 89  ? 17.871  0.151   19.166  1.00 0.00 ? 141 SER A CA   1  
ATOM 1390  C C    . SER A 1 89  ? 18.047  1.537   19.798  1.00 0.00 ? 141 SER A C    1  
ATOM 1391  O O    . SER A 1 89  ? 18.761  1.636   20.795  1.00 0.00 ? 141 SER A O    1  
ATOM 1392  C CB   . SER A 1 89  ? 18.726  0.066   17.899  1.00 0.00 ? 141 SER A CB   1  
ATOM 1393  O OG   . SER A 1 89  ? 20.076  0.331   18.213  1.00 0.00 ? 141 SER A OG   1  
ATOM 1394  H H    . SER A 1 89  ? 15.814  0.597   18.828  1.00 0.00 ? 141 SER A H    1  
ATOM 1395  H HA   . SER A 1 89  ? 18.228  -0.598  19.873  1.00 0.00 ? 141 SER A HA   1  
ATOM 1396  H HB2  . SER A 1 89  ? 18.646  -0.934  17.473  1.00 0.00 ? 141 SER A HB2  1  
ATOM 1397  H HB3  . SER A 1 89  ? 18.375  0.792   17.165  1.00 0.00 ? 141 SER A HB3  1  
ATOM 1398  H HG   . SER A 1 89  ? 20.596  0.260   17.409  1.00 0.00 ? 141 SER A HG   1  
ATOM 1399  N N    . PRO A 1 90  ? 17.429  2.609   19.269  1.00 0.00 ? 142 PRO A N    1  
ATOM 1400  C CA   . PRO A 1 90  ? 17.542  3.946   19.840  1.00 0.00 ? 142 PRO A CA   1  
ATOM 1401  C C    . PRO A 1 90  ? 16.692  4.048   21.110  1.00 0.00 ? 142 PRO A C    1  
ATOM 1402  O O    . PRO A 1 90  ? 16.567  3.073   21.848  1.00 0.00 ? 142 PRO A O    1  
ATOM 1403  C CB   . PRO A 1 90  ? 17.097  4.885   18.716  1.00 0.00 ? 142 PRO A CB   1  
ATOM 1404  C CG   . PRO A 1 90  ? 16.041  4.065   17.987  1.00 0.00 ? 142 PRO A CG   1  
ATOM 1405  C CD   . PRO A 1 90  ? 16.586  2.642   18.081  1.00 0.00 ? 142 PRO A CD   1  
ATOM 1406  H HA   . PRO A 1 90  ? 18.579  4.165   20.094  1.00 0.00 ? 142 PRO A HA   1  
ATOM 1407  H HB2  . PRO A 1 90  ? 16.698  5.830   19.084  1.00 0.00 ? 142 PRO A HB2  1  
ATOM 1408  H HB3  . PRO A 1 90  ? 17.938  5.064   18.045  1.00 0.00 ? 142 PRO A HB3  1  
ATOM 1409  H HG2  . PRO A 1 90  ? 15.097  4.133   18.528  1.00 0.00 ? 142 PRO A HG2  1  
ATOM 1410  H HG3  . PRO A 1 90  ? 15.920  4.385   16.952  1.00 0.00 ? 142 PRO A HG3  1  
ATOM 1411  H HD2  . PRO A 1 90  ? 15.751  1.945   18.154  1.00 0.00 ? 142 PRO A HD2  1  
ATOM 1412  H HD3  . PRO A 1 90  ? 17.190  2.425   17.201  1.00 0.00 ? 142 PRO A HD3  1  
ATOM 1413  N N    . THR A 1 91  ? 16.102  5.218   21.379  1.00 0.00 ? 143 THR A N    1  
ATOM 1414  C CA   . THR A 1 91  ? 15.316  5.464   22.586  1.00 0.00 ? 143 THR A CA   1  
ATOM 1415  C C    . THR A 1 91  ? 14.027  4.635   22.646  1.00 0.00 ? 143 THR A C    1  
ATOM 1416  O O    . THR A 1 91  ? 13.183  4.872   23.509  1.00 0.00 ? 143 THR A O    1  
ATOM 1417  C CB   . THR A 1 91  ? 15.009  6.958   22.720  1.00 0.00 ? 143 THR A CB   1  
ATOM 1418  O OG1  . THR A 1 91  ? 14.326  7.408   21.571  1.00 0.00 ? 143 THR A OG1  1  
ATOM 1419  C CG2  . THR A 1 91  ? 16.300  7.761   22.868  1.00 0.00 ? 143 THR A CG2  1  
ATOM 1420  H H    . THR A 1 91  ? 16.197  5.982   20.725  1.00 0.00 ? 143 THR A H    1  
ATOM 1421  H HA   . THR A 1 91  ? 15.927  5.173   23.441  1.00 0.00 ? 143 THR A HA   1  
ATOM 1422  H HB   . THR A 1 91  ? 14.387  7.123   23.599  1.00 0.00 ? 143 THR A HB   1  
ATOM 1423  H HG1  . THR A 1 91  ? 14.126  8.339   21.688  1.00 0.00 ? 143 THR A HG1  1  
ATOM 1424  H HG21 . THR A 1 91  ? 16.851  7.407   23.739  1.00 0.00 ? 143 THR A HG21 1  
ATOM 1425  H HG22 . THR A 1 91  ? 16.917  7.643   21.977  1.00 0.00 ? 143 THR A HG22 1  
ATOM 1426  H HG23 . THR A 1 91  ? 16.055  8.814   23.002  1.00 0.00 ? 143 THR A HG23 1  
ATOM 1427  N N    . ILE A 1 92  ? 13.869  3.667   21.739  1.00 0.00 ? 144 ILE A N    1  
ATOM 1428  C CA   . ILE A 1 92  ? 12.751  2.734   21.732  1.00 0.00 ? 144 ILE A CA   1  
ATOM 1429  C C    . ILE A 1 92  ? 13.302  1.314   21.611  1.00 0.00 ? 144 ILE A C    1  
ATOM 1430  O O    . ILE A 1 92  ? 14.223  1.066   20.832  1.00 0.00 ? 144 ILE A O    1  
ATOM 1431  C CB   . ILE A 1 92  ? 11.750  3.130   20.634  1.00 0.00 ? 144 ILE A CB   1  
ATOM 1432  C CG1  . ILE A 1 92  ? 10.502  2.237   20.628  1.00 0.00 ? 144 ILE A CG1  1  
ATOM 1433  C CG2  . ILE A 1 92  ? 12.399  3.172   19.249  1.00 0.00 ? 144 ILE A CG2  1  
ATOM 1434  C CD1  . ILE A 1 92  ? 10.671  0.940   19.837  1.00 0.00 ? 144 ILE A CD1  1  
ATOM 1435  H H    . ILE A 1 92  ? 14.563  3.558   21.013  1.00 0.00 ? 144 ILE A H    1  
ATOM 1436  H HA   . ILE A 1 92  ? 12.237  2.808   22.691  1.00 0.00 ? 144 ILE A HA   1  
ATOM 1437  H HB   . ILE A 1 92  ? 11.417  4.142   20.866  1.00 0.00 ? 144 ILE A HB   1  
ATOM 1438  H HG12 . ILE A 1 92  ? 10.225  2.002   21.656  1.00 0.00 ? 144 ILE A HG12 1  
ATOM 1439  H HG13 . ILE A 1 92  ? 9.684   2.798   20.176  1.00 0.00 ? 144 ILE A HG13 1  
ATOM 1440  H HG21 . ILE A 1 92  ? 12.835  2.203   19.005  1.00 0.00 ? 144 ILE A HG21 1  
ATOM 1441  H HG22 . ILE A 1 92  ? 11.648  3.429   18.502  1.00 0.00 ? 144 ILE A HG22 1  
ATOM 1442  H HG23 . ILE A 1 92  ? 13.180  3.932   19.239  1.00 0.00 ? 144 ILE A HG23 1  
ATOM 1443  H HD11 . ILE A 1 92  ? 11.501  0.354   20.230  1.00 0.00 ? 144 ILE A HD11 1  
ATOM 1444  H HD12 . ILE A 1 92  ? 9.753   0.357   19.912  1.00 0.00 ? 144 ILE A HD12 1  
ATOM 1445  H HD13 . ILE A 1 92  ? 10.854  1.168   18.786  1.00 0.00 ? 144 ILE A HD13 1  
ATOM 1446  N N    . LYS A 1 93  ? 12.736  0.381   22.386  1.00 0.00 ? 145 LYS A N    1  
ATOM 1447  C CA   . LYS A 1 93  ? 13.228  -0.987  22.491  1.00 0.00 ? 145 LYS A CA   1  
ATOM 1448  C C    . LYS A 1 93  ? 12.089  -2.003  22.514  1.00 0.00 ? 145 LYS A C    1  
ATOM 1449  O O    . LYS A 1 93  ? 10.933  -1.652  22.742  1.00 0.00 ? 145 LYS A O    1  
ATOM 1450  C CB   . LYS A 1 93  ? 14.020  -1.138  23.796  1.00 0.00 ? 145 LYS A CB   1  
ATOM 1451  C CG   . LYS A 1 93  ? 15.289  -0.289  23.867  1.00 0.00 ? 145 LYS A CG   1  
ATOM 1452  C CD   . LYS A 1 93  ? 16.328  -0.739  22.838  1.00 0.00 ? 145 LYS A CD   1  
ATOM 1453  C CE   . LYS A 1 93  ? 17.726  -0.267  23.245  1.00 0.00 ? 145 LYS A CE   1  
ATOM 1454  N NZ   . LYS A 1 93  ? 17.777  1.192   23.450  1.00 0.00 ? 145 LYS A NZ   1  
ATOM 1455  H H    . LYS A 1 93  ? 11.927  0.629   22.938  1.00 0.00 ? 145 LYS A H    1  
ATOM 1456  H HA   . LYS A 1 93  ? 13.881  -1.210  21.647  1.00 0.00 ? 145 LYS A HA   1  
ATOM 1457  H HB2  . LYS A 1 93  ? 13.371  -0.862  24.628  1.00 0.00 ? 145 LYS A HB2  1  
ATOM 1458  H HB3  . LYS A 1 93  ? 14.299  -2.185  23.921  1.00 0.00 ? 145 LYS A HB3  1  
ATOM 1459  H HG2  . LYS A 1 93  ? 15.039  0.760   23.705  1.00 0.00 ? 145 LYS A HG2  1  
ATOM 1460  H HG3  . LYS A 1 93  ? 15.713  -0.402  24.865  1.00 0.00 ? 145 LYS A HG3  1  
ATOM 1461  H HD2  . LYS A 1 93  ? 16.334  -1.828  22.783  1.00 0.00 ? 145 LYS A HD2  1  
ATOM 1462  H HD3  . LYS A 1 93  ? 16.072  -0.337  21.858  1.00 0.00 ? 145 LYS A HD3  1  
ATOM 1463  H HE2  . LYS A 1 93  ? 18.011  -0.767  24.171  1.00 0.00 ? 145 LYS A HE2  1  
ATOM 1464  H HE3  . LYS A 1 93  ? 18.435  -0.549  22.466  1.00 0.00 ? 145 LYS A HE3  1  
ATOM 1465  H HZ1  . LYS A 1 93  ? 18.714  1.471   23.708  1.00 0.00 ? 145 LYS A HZ1  1  
ATOM 1466  H HZ2  . LYS A 1 93  ? 17.521  1.669   22.597  1.00 0.00 ? 145 LYS A HZ2  1  
ATOM 1467  H HZ3  . LYS A 1 93  ? 17.139  1.463   24.184  1.00 0.00 ? 145 LYS A HZ3  1  
ATOM 1468  N N    . ASP A 1 94  ? 12.449  -3.268  22.272  1.00 0.00 ? 146 ASP A N    1  
ATOM 1469  C CA   . ASP A 1 94  ? 11.587  -4.440  22.389  1.00 0.00 ? 146 ASP A CA   1  
ATOM 1470  C C    . ASP A 1 94  ? 10.276  -4.371  21.593  1.00 0.00 ? 146 ASP A C    1  
ATOM 1471  O O    . ASP A 1 94  ? 9.389   -5.196  21.808  1.00 0.00 ? 146 ASP A O    1  
ATOM 1472  C CB   . ASP A 1 94  ? 11.363  -4.743  23.874  1.00 0.00 ? 146 ASP A CB   1  
ATOM 1473  C CG   . ASP A 1 94  ? 10.743  -6.121  24.104  1.00 0.00 ? 146 ASP A CG   1  
ATOM 1474  O OD1  . ASP A 1 94  ? 11.319  -7.108  23.595  1.00 0.00 ? 146 ASP A OD1  1  
ATOM 1475  O OD2  . ASP A 1 94  ? 9.696   -6.175  24.788  1.00 0.00 ? 146 ASP A OD2  1  
ATOM 1476  H H    . ASP A 1 94  ? 13.404  -3.442  21.990  1.00 0.00 ? 146 ASP A H    1  
ATOM 1477  H HA   . ASP A 1 94  ? 12.154  -5.272  21.971  1.00 0.00 ? 146 ASP A HA   1  
ATOM 1478  H HB2  . ASP A 1 94  ? 12.325  -4.707  24.386  1.00 0.00 ? 146 ASP A HB2  1  
ATOM 1479  H HB3  . ASP A 1 94  ? 10.716  -3.977  24.300  1.00 0.00 ? 146 ASP A HB3  1  
ATOM 1480  N N    . LYS A 1 95  ? 10.133  -3.406  20.678  1.00 0.00 ? 147 LYS A N    1  
ATOM 1481  C CA   . LYS A 1 95  ? 8.933   -3.284  19.861  1.00 0.00 ? 147 LYS A CA   1  
ATOM 1482  C C    . LYS A 1 95  ? 9.312   -2.894  18.432  1.00 0.00 ? 147 LYS A C    1  
ATOM 1483  O O    . LYS A 1 95  ? 9.771   -1.774  18.209  1.00 0.00 ? 147 LYS A O    1  
ATOM 1484  C CB   . LYS A 1 95  ? 7.993   -2.237  20.468  1.00 0.00 ? 147 LYS A CB   1  
ATOM 1485  C CG   . LYS A 1 95  ? 7.473   -2.677  21.837  1.00 0.00 ? 147 LYS A CG   1  
ATOM 1486  C CD   . LYS A 1 95  ? 6.509   -1.629  22.391  1.00 0.00 ? 147 LYS A CD   1  
ATOM 1487  C CE   . LYS A 1 95  ? 5.954   -2.071  23.746  1.00 0.00 ? 147 LYS A CE   1  
ATOM 1488  N NZ   . LYS A 1 95  ? 7.022   -2.200  24.755  1.00 0.00 ? 147 LYS A NZ   1  
ATOM 1489  H H    . LYS A 1 95  ? 10.874  -2.735  20.538  1.00 0.00 ? 147 LYS A H    1  
ATOM 1490  H HA   . LYS A 1 95  ? 8.409   -4.240  19.845  1.00 0.00 ? 147 LYS A HA   1  
ATOM 1491  H HB2  . LYS A 1 95  ? 8.524   -1.291  20.573  1.00 0.00 ? 147 LYS A HB2  1  
ATOM 1492  H HB3  . LYS A 1 95  ? 7.144   -2.096  19.798  1.00 0.00 ? 147 LYS A HB3  1  
ATOM 1493  H HG2  . LYS A 1 95  ? 6.954   -3.630  21.736  1.00 0.00 ? 147 LYS A HG2  1  
ATOM 1494  H HG3  . LYS A 1 95  ? 8.312   -2.794  22.524  1.00 0.00 ? 147 LYS A HG3  1  
ATOM 1495  H HD2  . LYS A 1 95  ? 7.028   -0.677  22.505  1.00 0.00 ? 147 LYS A HD2  1  
ATOM 1496  H HD3  . LYS A 1 95  ? 5.681   -1.500  21.694  1.00 0.00 ? 147 LYS A HD3  1  
ATOM 1497  H HE2  . LYS A 1 95  ? 5.228   -1.334  24.087  1.00 0.00 ? 147 LYS A HE2  1  
ATOM 1498  H HE3  . LYS A 1 95  ? 5.448   -3.029  23.628  1.00 0.00 ? 147 LYS A HE3  1  
ATOM 1499  H HZ1  . LYS A 1 95  ? 7.690   -2.900  24.465  1.00 0.00 ? 147 LYS A HZ1  1  
ATOM 1500  H HZ2  . LYS A 1 95  ? 7.496   -1.316  24.870  1.00 0.00 ? 147 LYS A HZ2  1  
ATOM 1501  H HZ3  . LYS A 1 95  ? 6.624   -2.475  25.642  1.00 0.00 ? 147 LYS A HZ3  1  
ATOM 1502  N N    . PRO A 1 96  ? 9.126   -3.802  17.463  1.00 0.00 ? 148 PRO A N    1  
ATOM 1503  C CA   . PRO A 1 96  ? 9.346   -3.530  16.052  1.00 0.00 ? 148 PRO A CA   1  
ATOM 1504  C C    . PRO A 1 96  ? 8.532   -2.329  15.575  1.00 0.00 ? 148 PRO A C    1  
ATOM 1505  O O    . PRO A 1 96  ? 7.568   -1.925  16.225  1.00 0.00 ? 148 PRO A O    1  
ATOM 1506  C CB   . PRO A 1 96  ? 8.923   -4.807  15.322  1.00 0.00 ? 148 PRO A CB   1  
ATOM 1507  C CG   . PRO A 1 96  ? 9.096   -5.897  16.377  1.00 0.00 ? 148 PRO A CG   1  
ATOM 1508  C CD   . PRO A 1 96  ? 8.695   -5.172  17.658  1.00 0.00 ? 148 PRO A CD   1  
ATOM 1509  H HA   . PRO A 1 96  ? 10.407  -3.350  15.884  1.00 0.00 ? 148 PRO A HA   1  
ATOM 1510  H HB2  . PRO A 1 96  ? 7.870   -4.740  15.050  1.00 0.00 ? 148 PRO A HB2  1  
ATOM 1511  H HB3  . PRO A 1 96  ? 9.539   -4.997  14.443  1.00 0.00 ? 148 PRO A HB3  1  
ATOM 1512  H HG2  . PRO A 1 96  ? 8.459   -6.760  16.180  1.00 0.00 ? 148 PRO A HG2  1  
ATOM 1513  H HG3  . PRO A 1 96  ? 10.144  -6.189  16.434  1.00 0.00 ? 148 PRO A HG3  1  
ATOM 1514  H HD2  . PRO A 1 96  ? 7.612   -5.201  17.778  1.00 0.00 ? 148 PRO A HD2  1  
ATOM 1515  H HD3  . PRO A 1 96  ? 9.191   -5.626  18.517  1.00 0.00 ? 148 PRO A HD3  1  
ATOM 1516  N N    . VAL A 1 97  ? 8.922   -1.754  14.433  1.00 0.00 ? 149 VAL A N    1  
ATOM 1517  C CA   . VAL A 1 97  ? 8.246   -0.582  13.895  1.00 0.00 ? 149 VAL A CA   1  
ATOM 1518  C C    . VAL A 1 97  ? 7.254   -0.986  12.812  1.00 0.00 ? 149 VAL A C    1  
ATOM 1519  O O    . VAL A 1 97  ? 7.526   -1.892  12.028  1.00 0.00 ? 149 VAL A O    1  
ATOM 1520  C CB   . VAL A 1 97  ? 9.253   0.457   13.386  1.00 0.00 ? 149 VAL A CB   1  
ATOM 1521  C CG1  . VAL A 1 97  ? 10.223  0.840   14.501  1.00 0.00 ? 149 VAL A CG1  1  
ATOM 1522  C CG2  . VAL A 1 97  ? 10.063  -0.069  12.206  1.00 0.00 ? 149 VAL A CG2  1  
ATOM 1523  H H    . VAL A 1 97  ? 9.702   -2.135  13.919  1.00 0.00 ? 149 VAL A H    1  
ATOM 1524  H HA   . VAL A 1 97  ? 7.679   -0.118  14.703  1.00 0.00 ? 149 VAL A HA   1  
ATOM 1525  H HB   . VAL A 1 97  ? 8.712   1.346   13.065  1.00 0.00 ? 149 VAL A HB   1  
ATOM 1526  H HG11 . VAL A 1 97  ? 10.861  1.655   14.159  1.00 0.00 ? 149 VAL A HG11 1  
ATOM 1527  H HG12 . VAL A 1 97  ? 9.666   1.161   15.382  1.00 0.00 ? 149 VAL A HG12 1  
ATOM 1528  H HG13 . VAL A 1 97  ? 10.839  -0.018  14.767  1.00 0.00 ? 149 VAL A HG13 1  
ATOM 1529  H HG21 . VAL A 1 97  ? 10.785  0.686   11.896  1.00 0.00 ? 149 VAL A HG21 1  
ATOM 1530  H HG22 . VAL A 1 97  ? 10.591  -0.974  12.503  1.00 0.00 ? 149 VAL A HG22 1  
ATOM 1531  H HG23 . VAL A 1 97  ? 9.397   -0.287  11.371  1.00 0.00 ? 149 VAL A HG23 1  
ATOM 1532  N N    . GLN A 1 98  ? 6.103   -0.309  12.771  1.00 0.00 ? 150 GLN A N    1  
ATOM 1533  C CA   . GLN A 1 98  ? 5.066   -0.569  11.783  1.00 0.00 ? 150 GLN A CA   1  
ATOM 1534  C C    . GLN A 1 98  ? 5.565   -0.160  10.399  1.00 0.00 ? 150 GLN A C    1  
ATOM 1535  O O    . GLN A 1 98  ? 6.213   0.876   10.265  1.00 0.00 ? 150 GLN A O    1  
ATOM 1536  C CB   . GLN A 1 98  ? 3.813   0.217   12.188  1.00 0.00 ? 150 GLN A CB   1  
ATOM 1537  C CG   . GLN A 1 98  ? 2.662   0.104   11.184  1.00 0.00 ? 150 GLN A CG   1  
ATOM 1538  C CD   . GLN A 1 98  ? 2.044   -1.290  11.128  1.00 0.00 ? 150 GLN A CD   1  
ATOM 1539  O OE1  . GLN A 1 98  ? 2.528   -2.234  11.744  1.00 0.00 ? 150 GLN A OE1  1  
ATOM 1540  N NE2  . GLN A 1 98  ? 0.953   -1.427  10.378  1.00 0.00 ? 150 GLN A NE2  1  
ATOM 1541  H H    . GLN A 1 98  ? 5.932   0.421   13.448  1.00 0.00 ? 150 GLN A H    1  
ATOM 1542  H HA   . GLN A 1 98  ? 4.841   -1.636  11.778  1.00 0.00 ? 150 GLN A HA   1  
ATOM 1543  H HB2  . GLN A 1 98  ? 3.473   -0.132  13.162  1.00 0.00 ? 150 GLN A HB2  1  
ATOM 1544  H HB3  . GLN A 1 98  ? 4.084   1.269   12.278  1.00 0.00 ? 150 GLN A HB3  1  
ATOM 1545  H HG2  . GLN A 1 98  ? 1.882   0.808   11.474  1.00 0.00 ? 150 GLN A HG2  1  
ATOM 1546  H HG3  . GLN A 1 98  ? 3.009   0.384   10.189  1.00 0.00 ? 150 GLN A HG3  1  
ATOM 1547  H HE21 . GLN A 1 98  ? 0.574   -0.631  9.885   1.00 0.00 ? 150 GLN A HE21 1  
ATOM 1548  H HE22 . GLN A 1 98  ? 0.509   -2.330  10.307  1.00 0.00 ? 150 GLN A HE22 1  
ATOM 1549  N N    . ILE A 1 99  ? 5.265   -0.970  9.379   1.00 0.00 ? 151 ILE A N    1  
ATOM 1550  C CA   . ILE A 1 99  ? 5.704   -0.718  8.012   1.00 0.00 ? 151 ILE A CA   1  
ATOM 1551  C C    . ILE A 1 99  ? 4.578   -1.056  7.037   1.00 0.00 ? 151 ILE A C    1  
ATOM 1552  O O    . ILE A 1 99  ? 3.916   -2.082  7.190   1.00 0.00 ? 151 ILE A O    1  
ATOM 1553  C CB   . ILE A 1 99  ? 6.943   -1.575  7.706   1.00 0.00 ? 151 ILE A CB   1  
ATOM 1554  C CG1  . ILE A 1 99  ? 8.141   -1.227  8.598   1.00 0.00 ? 151 ILE A CG1  1  
ATOM 1555  C CG2  . ILE A 1 99  ? 7.335   -1.457  6.232   1.00 0.00 ? 151 ILE A CG2  1  
ATOM 1556  C CD1  . ILE A 1 99  ? 8.762   0.135   8.285   1.00 0.00 ? 151 ILE A CD1  1  
ATOM 1557  H H    . ILE A 1 99  ? 4.714   -1.799  9.547   1.00 0.00 ? 151 ILE A H    1  
ATOM 1558  H HA   . ILE A 1 99  ? 5.961   0.335   7.897   1.00 0.00 ? 151 ILE A HA   1  
ATOM 1559  H HB   . ILE A 1 99  ? 6.685   -2.617  7.901   1.00 0.00 ? 151 ILE A HB   1  
ATOM 1560  H HG12 . ILE A 1 99  ? 7.832   -1.248  9.643   1.00 0.00 ? 151 ILE A HG12 1  
ATOM 1561  H HG13 . ILE A 1 99  ? 8.904   -1.993  8.464   1.00 0.00 ? 151 ILE A HG13 1  
ATOM 1562  H HG21 . ILE A 1 99  ? 6.539   -1.849  5.602   1.00 0.00 ? 151 ILE A HG21 1  
ATOM 1563  H HG22 . ILE A 1 99  ? 7.508   -0.411  5.979   1.00 0.00 ? 151 ILE A HG22 1  
ATOM 1564  H HG23 . ILE A 1 99  ? 8.242   -2.032  6.046   1.00 0.00 ? 151 ILE A HG23 1  
ATOM 1565  H HD11 . ILE A 1 99  ? 9.563   0.336   8.998   1.00 0.00 ? 151 ILE A HD11 1  
ATOM 1566  H HD12 . ILE A 1 99  ? 9.181   0.129   7.278   1.00 0.00 ? 151 ILE A HD12 1  
ATOM 1567  H HD13 . ILE A 1 99  ? 8.008   0.918   8.366   1.00 0.00 ? 151 ILE A HD13 1  
ATOM 1568  N N    . ARG A 1 100 ? 4.362   -0.197  6.033   1.00 0.00 ? 152 ARG A N    1  
ATOM 1569  C CA   . ARG A 1 100 ? 3.390   -0.449  4.973   1.00 0.00 ? 152 ARG A CA   1  
ATOM 1570  C C    . ARG A 1 100 ? 3.864   0.165   3.652   1.00 0.00 ? 152 ARG A C    1  
ATOM 1571  O O    . ARG A 1 100 ? 3.753   1.377   3.466   1.00 0.00 ? 152 ARG A O    1  
ATOM 1572  C CB   . ARG A 1 100 ? 2.021   0.137   5.341   1.00 0.00 ? 152 ARG A CB   1  
ATOM 1573  C CG   . ARG A 1 100 ? 1.427   -0.512  6.591   1.00 0.00 ? 152 ARG A CG   1  
ATOM 1574  C CD   . ARG A 1 100 ? -0.031  -0.084  6.773   1.00 0.00 ? 152 ARG A CD   1  
ATOM 1575  N NE   . ARG A 1 100 ? -0.898  -0.667  5.740   1.00 0.00 ? 152 ARG A NE   1  
ATOM 1576  C CZ   . ARG A 1 100 ? -1.340  -1.929  5.760   1.00 0.00 ? 152 ARG A CZ   1  
ATOM 1577  N NH1  . ARG A 1 100 ? -0.999  -2.750  6.751   1.00 0.00 ? 152 ARG A NH1  1  
ATOM 1578  N NH2  . ARG A 1 100 ? -2.127  -2.381  4.788   1.00 0.00 ? 152 ARG A NH2  1  
ATOM 1579  H H    . ARG A 1 100 ? 4.890   0.663   5.997   1.00 0.00 ? 152 ARG A H    1  
ATOM 1580  H HA   . ARG A 1 100 ? 3.274   -1.525  4.847   1.00 0.00 ? 152 ARG A HA   1  
ATOM 1581  H HB2  . ARG A 1 100 ? 2.115   1.210   5.508   1.00 0.00 ? 152 ARG A HB2  1  
ATOM 1582  H HB3  . ARG A 1 100 ? 1.341   -0.026  4.505   1.00 0.00 ? 152 ARG A HB3  1  
ATOM 1583  H HG2  . ARG A 1 100 ? 1.473   -1.597  6.495   1.00 0.00 ? 152 ARG A HG2  1  
ATOM 1584  H HG3  . ARG A 1 100 ? 2.001   -0.204  7.465   1.00 0.00 ? 152 ARG A HG3  1  
ATOM 1585  H HD2  . ARG A 1 100 ? -0.377  -0.410  7.754   1.00 0.00 ? 152 ARG A HD2  1  
ATOM 1586  H HD3  . ARG A 1 100 ? -0.093  1.003   6.726   1.00 0.00 ? 152 ARG A HD3  1  
ATOM 1587  H HE   . ARG A 1 100 ? -1.171  -0.072  4.972   1.00 0.00 ? 152 ARG A HE   1  
ATOM 1588  H HH11 . ARG A 1 100 ? -0.409  -2.414  7.499   1.00 0.00 ? 152 ARG A HH11 1  
ATOM 1589  H HH12 . ARG A 1 100 ? -1.328  -3.705  6.756   1.00 0.00 ? 152 ARG A HH12 1  
ATOM 1590  H HH21 . ARG A 1 100 ? -2.403  -1.772  4.031   1.00 0.00 ? 152 ARG A HH21 1  
ATOM 1591  H HH22 . ARG A 1 100 ? -2.452  -3.337  4.808   1.00 0.00 ? 152 ARG A HH22 1  
ATOM 1592  N N    . PRO A 1 101 ? 4.390   -0.655  2.731   1.00 0.00 ? 153 PRO A N    1  
ATOM 1593  C CA   . PRO A 1 101 ? 4.729   -0.267  1.370   1.00 0.00 ? 153 PRO A CA   1  
ATOM 1594  C C    . PRO A 1 101 ? 3.465   -0.355  0.513   1.00 0.00 ? 153 PRO A C    1  
ATOM 1595  O O    . PRO A 1 101 ? 2.364   -0.419  1.058   1.00 0.00 ? 153 PRO A O    1  
ATOM 1596  C CB   . PRO A 1 101 ? 5.759   -1.310  0.940   1.00 0.00 ? 153 PRO A CB   1  
ATOM 1597  C CG   . PRO A 1 101 ? 5.220   -2.574  1.603   1.00 0.00 ? 153 PRO A CG   1  
ATOM 1598  C CD   . PRO A 1 101 ? 4.703   -2.057  2.944   1.00 0.00 ? 153 PRO A CD   1  
ATOM 1599  H HA   . PRO A 1 101 ? 5.155   0.735   1.326   1.00 0.00 ? 153 PRO A HA   1  
ATOM 1600  H HB2  . PRO A 1 101 ? 5.823   -1.412  -0.143  1.00 0.00 ? 153 PRO A HB2  1  
ATOM 1601  H HB3  . PRO A 1 101 ? 6.731   -1.060  1.366   1.00 0.00 ? 153 PRO A HB3  1  
ATOM 1602  H HG2  . PRO A 1 101 ? 4.388   -2.965  1.016   1.00 0.00 ? 153 PRO A HG2  1  
ATOM 1603  H HG3  . PRO A 1 101 ? 5.993   -3.332  1.729   1.00 0.00 ? 153 PRO A HG3  1  
ATOM 1604  H HD2  . PRO A 1 101 ? 3.820   -2.620  3.246   1.00 0.00 ? 153 PRO A HD2  1  
ATOM 1605  H HD3  . PRO A 1 101 ? 5.485   -2.137  3.700   1.00 0.00 ? 153 PRO A HD3  1  
ATOM 1606  N N    . TRP A 1 102 ? 3.589   -0.364  -0.818  1.00 0.00 ? 154 TRP A N    1  
ATOM 1607  C CA   . TRP A 1 102 ? 2.441   -0.647  -1.674  1.00 0.00 ? 154 TRP A CA   1  
ATOM 1608  C C    . TRP A 1 102 ? 2.845   -1.506  -2.871  1.00 0.00 ? 154 TRP A C    1  
ATOM 1609  O O    . TRP A 1 102 ? 4.030   -1.688  -3.139  1.00 0.00 ? 154 TRP A O    1  
ATOM 1610  C CB   . TRP A 1 102 ? 1.720   0.644   -2.079  1.00 0.00 ? 154 TRP A CB   1  
ATOM 1611  C CG   . TRP A 1 102 ? 0.623   0.437   -3.074  1.00 0.00 ? 154 TRP A CG   1  
ATOM 1612  C CD1  . TRP A 1 102 ? 0.706   0.662   -4.404  1.00 0.00 ? 154 TRP A CD1  1  
ATOM 1613  C CD2  . TRP A 1 102 ? -0.735  -0.045  -2.842  1.00 0.00 ? 154 TRP A CD2  1  
ATOM 1614  N NE1  . TRP A 1 102 ? -0.483  0.316   -5.011  1.00 0.00 ? 154 TRP A NE1  1  
ATOM 1615  C CE2  . TRP A 1 102 ? -1.408  -0.129  -4.093  1.00 0.00 ? 154 TRP A CE2  1  
ATOM 1616  C CE3  . TRP A 1 102 ? -1.461  -0.436  -1.700  1.00 0.00 ? 154 TRP A CE3  1  
ATOM 1617  C CZ2  . TRP A 1 102 ? -2.727  -0.576  -4.209  1.00 0.00 ? 154 TRP A CZ2  1  
ATOM 1618  C CZ3  . TRP A 1 102 ? -2.791  -0.871  -1.804  1.00 0.00 ? 154 TRP A CZ3  1  
ATOM 1619  C CH2  . TRP A 1 102 ? -3.426  -0.935  -3.053  1.00 0.00 ? 154 TRP A CH2  1  
ATOM 1620  H H    . TRP A 1 102 ? 4.485   -0.191  -1.252  1.00 0.00 ? 154 TRP A H    1  
ATOM 1621  H HA   . TRP A 1 102 ? 1.733   -1.245  -1.100  1.00 0.00 ? 154 TRP A HA   1  
ATOM 1622  H HB2  . TRP A 1 102 ? 1.291   1.090   -1.182  1.00 0.00 ? 154 TRP A HB2  1  
ATOM 1623  H HB3  . TRP A 1 102 ? 2.433   1.360   -2.490  1.00 0.00 ? 154 TRP A HB3  1  
ATOM 1624  H HD1  . TRP A 1 102 ? 1.571   1.050   -4.920  1.00 0.00 ? 154 TRP A HD1  1  
ATOM 1625  H HE1  . TRP A 1 102 ? -0.635  0.386   -6.006  1.00 0.00 ? 154 TRP A HE1  1  
ATOM 1626  H HE3  . TRP A 1 102 ? -0.986  -0.398  -0.731  1.00 0.00 ? 154 TRP A HE3  1  
ATOM 1627  H HZ2  . TRP A 1 102 ? -3.202  -0.644  -5.176  1.00 0.00 ? 154 TRP A HZ2  1  
ATOM 1628  H HZ3  . TRP A 1 102 ? -3.330  -1.159  -0.914  1.00 0.00 ? 154 TRP A HZ3  1  
ATOM 1629  H HH2  . TRP A 1 102 ? -4.453  -1.259  -3.130  1.00 0.00 ? 154 TRP A HH2  1  
ATOM 1630  N N    . ASN A 1 103 ? 1.852   -2.034  -3.591  1.00 0.00 ? 155 ASN A N    1  
ATOM 1631  C CA   . ASN A 1 103 ? 2.068   -2.876  -4.755  1.00 0.00 ? 155 ASN A CA   1  
ATOM 1632  C C    . ASN A 1 103 ? 1.496   -2.181  -5.991  1.00 0.00 ? 155 ASN A C    1  
ATOM 1633  O O    . ASN A 1 103 ? 0.371   -2.452  -6.407  1.00 0.00 ? 155 ASN A O    1  
ATOM 1634  C CB   . ASN A 1 103 ? 1.426   -4.250  -4.536  1.00 0.00 ? 155 ASN A CB   1  
ATOM 1635  C CG   . ASN A 1 103 ? 2.031   -5.031  -3.374  1.00 0.00 ? 155 ASN A CG   1  
ATOM 1636  O OD1  . ASN A 1 103 ? 2.356   -4.476  -2.329  1.00 0.00 ? 155 ASN A OD1  1  
ATOM 1637  N ND2  . ASN A 1 103 ? 2.186   -6.338  -3.554  1.00 0.00 ? 155 ASN A ND2  1  
ATOM 1638  H H    . ASN A 1 103 ? 0.897   -1.844  -3.321  1.00 0.00 ? 155 ASN A H    1  
ATOM 1639  H HA   . ASN A 1 103 ? 3.138   -3.017  -4.904  1.00 0.00 ? 155 ASN A HA   1  
ATOM 1640  H HB2  . ASN A 1 103 ? 0.358   -4.127  -4.353  1.00 0.00 ? 155 ASN A HB2  1  
ATOM 1641  H HB3  . ASN A 1 103 ? 1.557   -4.834  -5.446  1.00 0.00 ? 155 ASN A HB3  1  
ATOM 1642  H HD21 . ASN A 1 103 ? 1.902   -6.770  -4.422  1.00 0.00 ? 155 ASN A HD21 1  
ATOM 1643  H HD22 . ASN A 1 103 ? 2.592   -6.900  -2.819  1.00 0.00 ? 155 ASN A HD22 1  
ATOM 1644  N N    . LEU A 1 104 ? 2.287   -1.278  -6.578  1.00 0.00 ? 156 LEU A N    1  
ATOM 1645  C CA   . LEU A 1 104 ? 1.914   -0.493  -7.750  1.00 0.00 ? 156 LEU A CA   1  
ATOM 1646  C C    . LEU A 1 104 ? 1.565   -1.351  -8.970  1.00 0.00 ? 156 LEU A C    1  
ATOM 1647  O O    . LEU A 1 104 ? 1.052   -0.822  -9.954  1.00 0.00 ? 156 LEU A O    1  
ATOM 1648  C CB   . LEU A 1 104 ? 3.039   0.500   -8.094  1.00 0.00 ? 156 LEU A CB   1  
ATOM 1649  C CG   . LEU A 1 104 ? 4.453   -0.011  -7.784  1.00 0.00 ? 156 LEU A CG   1  
ATOM 1650  C CD1  . LEU A 1 104 ? 4.774   -1.369  -8.377  1.00 0.00 ? 156 LEU A CD1  1  
ATOM 1651  C CD2  . LEU A 1 104 ? 5.526   0.920   -8.335  1.00 0.00 ? 156 LEU A CD2  1  
ATOM 1652  H H    . LEU A 1 104 ? 3.207   -1.119  -6.190  1.00 0.00 ? 156 LEU A H    1  
ATOM 1653  H HA   . LEU A 1 104 ? 1.022   0.085   -7.504  1.00 0.00 ? 156 LEU A HA   1  
ATOM 1654  H HB2  . LEU A 1 104 ? 2.975   0.756   -9.151  1.00 0.00 ? 156 LEU A HB2  1  
ATOM 1655  H HB3  . LEU A 1 104 ? 2.882   1.409   -7.513  1.00 0.00 ? 156 LEU A HB3  1  
ATOM 1656  H HG   . LEU A 1 104 ? 4.568   -0.074  -6.702  1.00 0.00 ? 156 LEU A HG   1  
ATOM 1657  H HD11 . LEU A 1 104 ? 4.578   -1.360  -9.449  1.00 0.00 ? 156 LEU A HD11 1  
ATOM 1658  H HD12 . LEU A 1 104 ? 5.833   -1.551  -8.197  1.00 0.00 ? 156 LEU A HD12 1  
ATOM 1659  H HD13 . LEU A 1 104 ? 4.187   -2.145  -7.886  1.00 0.00 ? 156 LEU A HD13 1  
ATOM 1660  H HD21 . LEU A 1 104 ? 6.505   0.508   -8.089  1.00 0.00 ? 156 LEU A HD21 1  
ATOM 1661  H HD22 . LEU A 1 104 ? 5.434   0.971   -9.420  1.00 0.00 ? 156 LEU A HD22 1  
ATOM 1662  H HD23 . LEU A 1 104 ? 5.418   1.910   -7.894  1.00 0.00 ? 156 LEU A HD23 1  
ATOM 1663  N N    . SER A 1 105 ? 1.831   -2.662  -8.923  1.00 0.00 ? 157 SER A N    1  
ATOM 1664  C CA   . SER A 1 105 ? 1.510   -3.554  -10.030 1.00 0.00 ? 157 SER A CA   1  
ATOM 1665  C C    . SER A 1 105 ? 0.439   -4.584  -9.665  1.00 0.00 ? 157 SER A C    1  
ATOM 1666  O O    . SER A 1 105 ? -0.104  -5.236  -10.555 1.00 0.00 ? 157 SER A O    1  
ATOM 1667  C CB   . SER A 1 105 ? 2.801   -4.222  -10.499 1.00 0.00 ? 157 SER A CB   1  
ATOM 1668  O OG   . SER A 1 105 ? 2.592   -4.939  -11.698 1.00 0.00 ? 157 SER A OG   1  
ATOM 1669  H H    . SER A 1 105 ? 2.274   -3.056  -8.107  1.00 0.00 ? 157 SER A H    1  
ATOM 1670  H HA   . SER A 1 105 ? 1.123   -2.955  -10.854 1.00 0.00 ? 157 SER A HA   1  
ATOM 1671  H HB2  . SER A 1 105 ? 3.555   -3.454  -10.671 1.00 0.00 ? 157 SER A HB2  1  
ATOM 1672  H HB3  . SER A 1 105 ? 3.154   -4.902  -9.724  1.00 0.00 ? 157 SER A HB3  1  
ATOM 1673  H HG   . SER A 1 105 ? 2.244   -4.336  -12.358 1.00 0.00 ? 157 SER A HG   1  
ATOM 1674  N N    . ASP A 1 106 ? 0.116   -4.749  -8.376  1.00 0.00 ? 158 ASP A N    1  
ATOM 1675  C CA   . ASP A 1 106 ? -0.928  -5.678  -7.959  1.00 0.00 ? 158 ASP A CA   1  
ATOM 1676  C C    . ASP A 1 106 ? -2.279  -4.965  -7.878  1.00 0.00 ? 158 ASP A C    1  
ATOM 1677  O O    . ASP A 1 106 ? -3.312  -5.614  -7.740  1.00 0.00 ? 158 ASP A O    1  
ATOM 1678  C CB   . ASP A 1 106 ? -0.543  -6.304  -6.618  1.00 0.00 ? 158 ASP A CB   1  
ATOM 1679  C CG   . ASP A 1 106 ? -1.486  -7.442  -6.232  1.00 0.00 ? 158 ASP A CG   1  
ATOM 1680  O OD1  . ASP A 1 106 ? -1.557  -8.419  -7.011  1.00 0.00 ? 158 ASP A OD1  1  
ATOM 1681  O OD2  . ASP A 1 106 ? -2.126  -7.322  -5.164  1.00 0.00 ? 158 ASP A OD2  1  
ATOM 1682  H H    . ASP A 1 106 ? 0.598   -4.227  -7.659  1.00 0.00 ? 158 ASP A H    1  
ATOM 1683  H HA   . ASP A 1 106 ? -1.006  -6.473  -8.701  1.00 0.00 ? 158 ASP A HA   1  
ATOM 1684  H HB2  . ASP A 1 106 ? 0.473   -6.695  -6.684  1.00 0.00 ? 158 ASP A HB2  1  
ATOM 1685  H HB3  . ASP A 1 106 ? -0.574  -5.534  -5.848  1.00 0.00 ? 158 ASP A HB3  1  
ATOM 1686  N N    . SER A 1 107 ? -2.253  -3.628  -7.965  1.00 0.00 ? 159 SER A N    1  
ATOM 1687  C CA   . SER A 1 107 ? -3.457  -2.805  -8.059  1.00 0.00 ? 159 SER A CA   1  
ATOM 1688  C C    . SER A 1 107 ? -4.453  -3.251  -9.136  1.00 0.00 ? 159 SER A C    1  
ATOM 1689  O O    . SER A 1 107 ? -5.523  -2.659  -9.253  1.00 0.00 ? 159 SER A O    1  
ATOM 1690  C CB   . SER A 1 107 ? -3.047  -1.365  -8.365  1.00 0.00 ? 159 SER A CB   1  
ATOM 1691  O OG   . SER A 1 107 ? -2.187  -0.864  -7.364  1.00 0.00 ? 159 SER A OG   1  
ATOM 1692  H H    . SER A 1 107 ? -1.362  -3.153  -7.952  1.00 0.00 ? 159 SER A H    1  
ATOM 1693  H HA   . SER A 1 107 ? -3.966  -2.829  -7.095  1.00 0.00 ? 159 SER A HA   1  
ATOM 1694  H HB2  . SER A 1 107 ? -2.535  -1.335  -9.327  1.00 0.00 ? 159 SER A HB2  1  
ATOM 1695  H HB3  . SER A 1 107 ? -3.945  -0.751  -8.421  1.00 0.00 ? 159 SER A HB3  1  
ATOM 1696  H HG   . SER A 1 107 ? -1.414  -1.431  -7.308  1.00 0.00 ? 159 SER A HG   1  
ATOM 1697  N N    . ASP A 1 108 ? -4.124  -4.280  -9.921  1.00 0.00 ? 160 ASP A N    1  
ATOM 1698  C CA   . ASP A 1 108 ? -4.980  -4.785  -10.981 1.00 0.00 ? 160 ASP A CA   1  
ATOM 1699  C C    . ASP A 1 108 ? -5.369  -6.228  -10.672 1.00 0.00 ? 160 ASP A C    1  
ATOM 1700  O O    . ASP A 1 108 ? -4.545  -7.139  -10.749 1.00 0.00 ? 160 ASP A O    1  
ATOM 1701  C CB   . ASP A 1 108 ? -4.251  -4.685  -12.324 1.00 0.00 ? 160 ASP A CB   1  
ATOM 1702  C CG   . ASP A 1 108 ? -3.909  -3.241  -12.680 1.00 0.00 ? 160 ASP A CG   1  
ATOM 1703  O OD1  . ASP A 1 108 ? -2.811  -2.792  -12.280 1.00 0.00 ? 160 ASP A OD1  1  
ATOM 1704  O OD2  . ASP A 1 108 ? -4.747  -2.597  -13.348 1.00 0.00 ? 160 ASP A OD2  1  
ATOM 1705  H H    . ASP A 1 108 ? -3.236  -4.741  -9.775  1.00 0.00 ? 160 ASP A H    1  
ATOM 1706  H HA   . ASP A 1 108 ? -5.886  -4.182  -11.027 1.00 0.00 ? 160 ASP A HA   1  
ATOM 1707  H HB2  . ASP A 1 108 ? -3.333  -5.271  -12.277 1.00 0.00 ? 160 ASP A HB2  1  
ATOM 1708  H HB3  . ASP A 1 108 ? -4.888  -5.104  -13.103 1.00 0.00 ? 160 ASP A HB3  1  
ATOM 1709  N N    . PHE A 1 109 ? -6.642  -6.422  -10.318 1.00 0.00 ? 161 PHE A N    1  
ATOM 1710  C CA   . PHE A 1 109 ? -7.173  -7.734  -9.977  1.00 0.00 ? 161 PHE A CA   1  
ATOM 1711  C C    . PHE A 1 109 ? -7.928  -8.317  -11.171 1.00 0.00 ? 161 PHE A C    1  
ATOM 1712  O O    . PHE A 1 109 ? -9.158  -8.313  -11.201 1.00 0.00 ? 161 PHE A O    1  
ATOM 1713  C CB   . PHE A 1 109 ? -8.089  -7.628  -8.751  1.00 0.00 ? 161 PHE A CB   1  
ATOM 1714  C CG   . PHE A 1 109 ? -7.398  -7.470  -7.412  1.00 0.00 ? 161 PHE A CG   1  
ATOM 1715  C CD1  . PHE A 1 109 ? -6.375  -6.526  -7.218  1.00 0.00 ? 161 PHE A CD1  1  
ATOM 1716  C CD2  . PHE A 1 109 ? -7.800  -8.284  -6.344  1.00 0.00 ? 161 PHE A CD2  1  
ATOM 1717  C CE1  . PHE A 1 109 ? -5.752  -6.415  -5.967  1.00 0.00 ? 161 PHE A CE1  1  
ATOM 1718  C CE2  . PHE A 1 109 ? -7.186  -8.163  -5.092  1.00 0.00 ? 161 PHE A CE2  1  
ATOM 1719  C CZ   . PHE A 1 109 ? -6.154  -7.236  -4.905  1.00 0.00 ? 161 PHE A CZ   1  
ATOM 1720  H H    . PHE A 1 109 ? -7.274  -5.635  -10.280 1.00 0.00 ? 161 PHE A H    1  
ATOM 1721  H HA   . PHE A 1 109 ? -6.350  -8.407  -9.734  1.00 0.00 ? 161 PHE A HA   1  
ATOM 1722  H HB2  . PHE A 1 109 ? -8.775  -6.792  -8.888  1.00 0.00 ? 161 PHE A HB2  1  
ATOM 1723  H HB3  . PHE A 1 109 ? -8.686  -8.539  -8.703  1.00 0.00 ? 161 PHE A HB3  1  
ATOM 1724  H HD1  . PHE A 1 109 ? -6.062  -5.878  -8.023  1.00 0.00 ? 161 PHE A HD1  1  
ATOM 1725  H HD2  . PHE A 1 109 ? -8.589  -9.009  -6.487  1.00 0.00 ? 161 PHE A HD2  1  
ATOM 1726  H HE1  . PHE A 1 109 ? -4.961  -5.695  -5.821  1.00 0.00 ? 161 PHE A HE1  1  
ATOM 1727  H HE2  . PHE A 1 109 ? -7.513  -8.786  -4.272  1.00 0.00 ? 161 PHE A HE2  1  
ATOM 1728  H HZ   . PHE A 1 109 ? -5.667  -7.153  -3.944  1.00 0.00 ? 161 PHE A HZ   1  
ATOM 1729  N N    . VAL A 1 110 ? -7.191  -8.822  -12.164 1.00 0.00 ? 162 VAL A N    1  
ATOM 1730  C CA   . VAL A 1 110 ? -7.795  -9.475  -13.318 1.00 0.00 ? 162 VAL A CA   1  
ATOM 1731  C C    . VAL A 1 110 ? -8.424  -10.796 -12.875 1.00 0.00 ? 162 VAL A C    1  
ATOM 1732  O O    . VAL A 1 110 ? -7.924  -11.441 -11.955 1.00 0.00 ? 162 VAL A O    1  
ATOM 1733  C CB   . VAL A 1 110 ? -6.740  -9.693  -14.407 1.00 0.00 ? 162 VAL A CB   1  
ATOM 1734  C CG1  . VAL A 1 110 ? -7.355  -10.347 -15.646 1.00 0.00 ? 162 VAL A CG1  1  
ATOM 1735  C CG2  . VAL A 1 110 ? -6.127  -8.357  -14.830 1.00 0.00 ? 162 VAL A CG2  1  
ATOM 1736  H H    . VAL A 1 110 ? -6.183  -8.759  -12.127 1.00 0.00 ? 162 VAL A H    1  
ATOM 1737  H HA   . VAL A 1 110 ? -8.581  -8.834  -13.717 1.00 0.00 ? 162 VAL A HA   1  
ATOM 1738  H HB   . VAL A 1 110 ? -5.950  -10.337 -14.021 1.00 0.00 ? 162 VAL A HB   1  
ATOM 1739  H HG11 . VAL A 1 110 ? -8.177  -9.735  -16.016 1.00 0.00 ? 162 VAL A HG11 1  
ATOM 1740  H HG12 . VAL A 1 110 ? -6.594  -10.436 -16.423 1.00 0.00 ? 162 VAL A HG12 1  
ATOM 1741  H HG13 . VAL A 1 110 ? -7.721  -11.343 -15.399 1.00 0.00 ? 162 VAL A HG13 1  
ATOM 1742  H HG21 . VAL A 1 110 ? -6.907  -7.703  -15.218 1.00 0.00 ? 162 VAL A HG21 1  
ATOM 1743  H HG22 . VAL A 1 110 ? -5.644  -7.881  -13.977 1.00 0.00 ? 162 VAL A HG22 1  
ATOM 1744  H HG23 . VAL A 1 110 ? -5.383  -8.528  -15.608 1.00 0.00 ? 162 VAL A HG23 1  
ATOM 1745  N N    . MET A 1 111 ? -9.519  -11.201 -13.525 1.00 0.00 ? 163 MET A N    1  
ATOM 1746  C CA   . MET A 1 111 ? -10.212 -12.433 -13.177 1.00 0.00 ? 163 MET A CA   1  
ATOM 1747  C C    . MET A 1 111 ? -10.574 -13.243 -14.424 1.00 0.00 ? 163 MET A C    1  
ATOM 1748  O O    . MET A 1 111 ? -10.629 -14.470 -14.359 1.00 0.00 ? 163 MET A O    1  
ATOM 1749  C CB   . MET A 1 111 ? -11.468 -12.073 -12.377 1.00 0.00 ? 163 MET A CB   1  
ATOM 1750  C CG   . MET A 1 111 ? -12.178 -13.324 -11.858 1.00 0.00 ? 163 MET A CG   1  
ATOM 1751  S SD   . MET A 1 111 ? -11.187 -14.331 -10.723 1.00 0.00 ? 163 MET A SD   1  
ATOM 1752  C CE   . MET A 1 111 ? -12.396 -15.631 -10.366 1.00 0.00 ? 163 MET A CE   1  
ATOM 1753  H H    . MET A 1 111 ? -9.888  -10.643 -14.281 1.00 0.00 ? 163 MET A H    1  
ATOM 1754  H HA   . MET A 1 111 ? -9.560  -13.043 -12.552 1.00 0.00 ? 163 MET A HA   1  
ATOM 1755  H HB2  . MET A 1 111 ? -11.191 -11.447 -11.528 1.00 0.00 ? 163 MET A HB2  1  
ATOM 1756  H HB3  . MET A 1 111 ? -12.150 -11.513 -13.016 1.00 0.00 ? 163 MET A HB3  1  
ATOM 1757  H HG2  . MET A 1 111 ? -13.087 -13.016 -11.341 1.00 0.00 ? 163 MET A HG2  1  
ATOM 1758  H HG3  . MET A 1 111 ? -12.471 -13.942 -12.707 1.00 0.00 ? 163 MET A HG3  1  
ATOM 1759  H HE1  . MET A 1 111 ? -13.281 -15.189 -9.908  1.00 0.00 ? 163 MET A HE1  1  
ATOM 1760  H HE2  . MET A 1 111 ? -12.680 -16.129 -11.294 1.00 0.00 ? 163 MET A HE2  1  
ATOM 1761  H HE3  . MET A 1 111 ? -11.957 -16.358 -9.684  1.00 0.00 ? 163 MET A HE3  1  
ATOM 1762  N N    . ASP A 1 112 ? -10.818 -12.576 -15.557 1.00 0.00 ? 164 ASP A N    1  
ATOM 1763  C CA   . ASP A 1 112 ? -11.131 -13.265 -16.802 1.00 0.00 ? 164 ASP A CA   1  
ATOM 1764  C C    . ASP A 1 112 ? -10.772 -12.383 -18.000 1.00 0.00 ? 164 ASP A C    1  
ATOM 1765  O O    . ASP A 1 112 ? -10.890 -11.161 -17.933 1.00 0.00 ? 164 ASP A O    1  
ATOM 1766  C CB   . ASP A 1 112 ? -12.615 -13.636 -16.819 1.00 0.00 ? 164 ASP A CB   1  
ATOM 1767  C CG   . ASP A 1 112 ? -12.900 -14.734 -17.841 1.00 0.00 ? 164 ASP A CG   1  
ATOM 1768  O OD1  . ASP A 1 112 ? -12.844 -14.425 -19.050 1.00 0.00 ? 164 ASP A OD1  1  
ATOM 1769  O OD2  . ASP A 1 112 ? -13.171 -15.873 -17.402 1.00 0.00 ? 164 ASP A OD2  1  
ATOM 1770  H H    . ASP A 1 112 ? -10.788 -11.567 -15.567 1.00 0.00 ? 164 ASP A H    1  
ATOM 1771  H HA   . ASP A 1 112 ? -10.543 -14.181 -16.850 1.00 0.00 ? 164 ASP A HA   1  
ATOM 1772  H HB2  . ASP A 1 112 ? -12.902 -13.997 -15.831 1.00 0.00 ? 164 ASP A HB2  1  
ATOM 1773  H HB3  . ASP A 1 112 ? -13.206 -12.751 -17.052 1.00 0.00 ? 164 ASP A HB3  1  
ATOM 1774  N N    . GLY A 1 113 ? -10.331 -13.003 -19.099 1.00 0.00 ? 165 GLY A N    1  
ATOM 1775  C CA   . GLY A 1 113 ? -9.894  -12.292 -20.292 1.00 0.00 ? 165 GLY A CA   1  
ATOM 1776  C C    . GLY A 1 113 ? -11.007 -12.092 -21.322 1.00 0.00 ? 165 GLY A C    1  
ATOM 1777  O O    . GLY A 1 113 ? -10.742 -11.591 -22.414 1.00 0.00 ? 165 GLY A O    1  
ATOM 1778  H H    . GLY A 1 113 ? -10.293 -14.012 -19.111 1.00 0.00 ? 165 GLY A H    1  
ATOM 1779  H HA2  . GLY A 1 113 ? -9.510  -11.314 -20.002 1.00 0.00 ? 165 GLY A HA2  1  
ATOM 1780  H HA3  . GLY A 1 113 ? -9.088  -12.858 -20.759 1.00 0.00 ? 165 GLY A HA3  1  
ATOM 1781  N N    . SER A 1 114 ? -12.246 -12.473 -20.999 1.00 0.00 ? 166 SER A N    1  
ATOM 1782  C CA   . SER A 1 114 ? -13.358 -12.392 -21.938 1.00 0.00 ? 166 SER A CA   1  
ATOM 1783  C C    . SER A 1 114 ? -13.877 -10.967 -22.082 1.00 0.00 ? 166 SER A C    1  
ATOM 1784  O O    . SER A 1 114 ? -14.643 -10.681 -23.001 1.00 0.00 ? 166 SER A O    1  
ATOM 1785  C CB   . SER A 1 114 ? -14.499 -13.290 -21.461 1.00 0.00 ? 166 SER A CB   1  
ATOM 1786  O OG   . SER A 1 114 ? -14.076 -14.636 -21.427 1.00 0.00 ? 166 SER A OG   1  
ATOM 1787  H H    . SER A 1 114 ? -12.433 -12.839 -20.076 1.00 0.00 ? 166 SER A H    1  
ATOM 1788  H HA   . SER A 1 114 ? -13.024 -12.737 -22.916 1.00 0.00 ? 166 SER A HA   1  
ATOM 1789  H HB2  . SER A 1 114 ? -14.809 -12.986 -20.461 1.00 0.00 ? 166 SER A HB2  1  
ATOM 1790  H HB3  . SER A 1 114 ? -15.345 -13.184 -22.139 1.00 0.00 ? 166 SER A HB3  1  
ATOM 1791  H HG   . SER A 1 114 ? -13.495 -14.737 -20.670 1.00 0.00 ? 166 SER A HG   1  
ATOM 1792  N N    . GLN A 1 115 ? -13.468 -10.071 -21.181 1.00 0.00 ? 167 GLN A N    1  
ATOM 1793  C CA   . GLN A 1 115 ? -13.950 -8.703  -21.184 1.00 0.00 ? 167 GLN A CA   1  
ATOM 1794  C C    . GLN A 1 115 ? -12.915 -7.783  -20.533 1.00 0.00 ? 167 GLN A C    1  
ATOM 1795  O O    . GLN A 1 115 ? -12.782 -7.775  -19.309 1.00 0.00 ? 167 GLN A O    1  
ATOM 1796  C CB   . GLN A 1 115 ? -15.278 -8.681  -20.422 1.00 0.00 ? 167 GLN A CB   1  
ATOM 1797  C CG   . GLN A 1 115 ? -15.836 -7.271  -20.240 1.00 0.00 ? 167 GLN A CG   1  
ATOM 1798  C CD   . GLN A 1 115 ? -16.166 -6.634  -21.585 1.00 0.00 ? 167 GLN A CD   1  
ATOM 1799  O OE1  . GLN A 1 115 ? -17.164 -6.973  -22.215 1.00 0.00 ? 167 GLN A OE1  1  
ATOM 1800  N NE2  . GLN A 1 115 ? -15.333 -5.705  -22.039 1.00 0.00 ? 167 GLN A NE2  1  
ATOM 1801  H H    . GLN A 1 115 ? -12.806 -10.345 -20.470 1.00 0.00 ? 167 GLN A H    1  
ATOM 1802  H HA   . GLN A 1 115 ? -14.131 -8.385  -22.211 1.00 0.00 ? 167 GLN A HA   1  
ATOM 1803  H HB2  . GLN A 1 115 ? -16.010 -9.267  -20.980 1.00 0.00 ? 167 GLN A HB2  1  
ATOM 1804  H HB3  . GLN A 1 115 ? -15.136 -9.143  -19.445 1.00 0.00 ? 167 GLN A HB3  1  
ATOM 1805  H HG2  . GLN A 1 115 ? -16.744 -7.324  -19.640 1.00 0.00 ? 167 GLN A HG2  1  
ATOM 1806  H HG3  . GLN A 1 115 ? -15.106 -6.658  -19.711 1.00 0.00 ? 167 GLN A HG3  1  
ATOM 1807  H HE21 . GLN A 1 115 ? -14.537 -5.422  -21.485 1.00 0.00 ? 167 GLN A HE21 1  
ATOM 1808  H HE22 . GLN A 1 115 ? -15.503 -5.286  -22.942 1.00 0.00 ? 167 GLN A HE22 1  
ATOM 1809  N N    . PRO A 1 116 ? -12.177 -7.005  -21.337 1.00 0.00 ? 168 PRO A N    1  
ATOM 1810  C CA   . PRO A 1 116 ? -11.234 -6.011  -20.855 1.00 0.00 ? 168 PRO A CA   1  
ATOM 1811  C C    . PRO A 1 116 ? -11.984 -4.771  -20.374 1.00 0.00 ? 168 PRO A C    1  
ATOM 1812  O O    . PRO A 1 116 ? -13.211 -4.712  -20.458 1.00 0.00 ? 168 PRO A O    1  
ATOM 1813  C CB   . PRO A 1 116 ? -10.350 -5.698  -22.062 1.00 0.00 ? 168 PRO A CB   1  
ATOM 1814  C CG   . PRO A 1 116 ? -11.320 -5.857  -23.231 1.00 0.00 ? 168 PRO A CG   1  
ATOM 1815  C CD   . PRO A 1 116 ? -12.195 -7.028  -22.789 1.00 0.00 ? 168 PRO A CD   1  
ATOM 1816  H HA   . PRO A 1 116 ? -10.627 -6.408  -20.041 1.00 0.00 ? 168 PRO A HA   1  
ATOM 1817  H HB2  . PRO A 1 116 ? -9.927  -4.695  -22.016 1.00 0.00 ? 168 PRO A HB2  1  
ATOM 1818  H HB3  . PRO A 1 116 ? -9.563  -6.448  -22.140 1.00 0.00 ? 168 PRO A HB3  1  
ATOM 1819  H HG2  . PRO A 1 116 ? -11.931 -4.959  -23.320 1.00 0.00 ? 168 PRO A HG2  1  
ATOM 1820  H HG3  . PRO A 1 116 ? -10.799 -6.068  -24.165 1.00 0.00 ? 168 PRO A HG3  1  
ATOM 1821  H HD2  . PRO A 1 116 ? -13.205 -6.904  -23.178 1.00 0.00 ? 168 PRO A HD2  1  
ATOM 1822  H HD3  . PRO A 1 116 ? -11.765 -7.965  -23.142 1.00 0.00 ? 168 PRO A HD3  1  
ATOM 1823  N N    . LEU A 1 117 ? -11.251 -3.778  -19.866 1.00 0.00 ? 169 LEU A N    1  
ATOM 1824  C CA   . LEU A 1 117 ? -11.853 -2.543  -19.392 1.00 0.00 ? 169 LEU A CA   1  
ATOM 1825  C C    . LEU A 1 117 ? -12.511 -1.819  -20.565 1.00 0.00 ? 169 LEU A C    1  
ATOM 1826  O O    . LEU A 1 117 ? -11.902 -1.659  -21.621 1.00 0.00 ? 169 LEU A O    1  
ATOM 1827  C CB   . LEU A 1 117 ? -10.792 -1.641  -18.752 1.00 0.00 ? 169 LEU A CB   1  
ATOM 1828  C CG   . LEU A 1 117 ? -10.295 -2.128  -17.385 1.00 0.00 ? 169 LEU A CG   1  
ATOM 1829  C CD1  . LEU A 1 117 ? -9.554  -3.462  -17.463 1.00 0.00 ? 169 LEU A CD1  1  
ATOM 1830  C CD2  . LEU A 1 117 ? -9.329  -1.085  -16.829 1.00 0.00 ? 169 LEU A CD2  1  
ATOM 1831  H H    . LEU A 1 117 ? -10.248 -3.874  -19.807 1.00 0.00 ? 169 LEU A H    1  
ATOM 1832  H HA   . LEU A 1 117 ? -12.617 -2.775  -18.649 1.00 0.00 ? 169 LEU A HA   1  
ATOM 1833  H HB2  . LEU A 1 117 ? -9.944  -1.548  -19.433 1.00 0.00 ? 169 LEU A HB2  1  
ATOM 1834  H HB3  . LEU A 1 117 ? -11.228 -0.652  -18.616 1.00 0.00 ? 169 LEU A HB3  1  
ATOM 1835  H HG   . LEU A 1 117 ? -11.141 -2.224  -16.706 1.00 0.00 ? 169 LEU A HG   1  
ATOM 1836  H HD11 . LEU A 1 117 ? -8.779  -3.409  -18.227 1.00 0.00 ? 169 LEU A HD11 1  
ATOM 1837  H HD12 . LEU A 1 117 ? -9.091  -3.673  -16.499 1.00 0.00 ? 169 LEU A HD12 1  
ATOM 1838  H HD13 . LEU A 1 117 ? -10.253 -4.266  -17.693 1.00 0.00 ? 169 LEU A HD13 1  
ATOM 1839  H HD21 . LEU A 1 117 ? -9.840  -0.126  -16.736 1.00 0.00 ? 169 LEU A HD21 1  
ATOM 1840  H HD22 . LEU A 1 117 ? -8.978  -1.401  -15.846 1.00 0.00 ? 169 LEU A HD22 1  
ATOM 1841  H HD23 . LEU A 1 117 ? -8.476  -0.977  -17.499 1.00 0.00 ? 169 LEU A HD23 1  
ATOM 1842  N N    . ASP A 1 118 ? -13.759 -1.384  -20.377 1.00 0.00 ? 170 ASP A N    1  
ATOM 1843  C CA   . ASP A 1 118 ? -14.504 -0.656  -21.391 1.00 0.00 ? 170 ASP A CA   1  
ATOM 1844  C C    . ASP A 1 118 ? -15.565 0.219   -20.715 1.00 0.00 ? 170 ASP A C    1  
ATOM 1845  O O    . ASP A 1 118 ? -16.210 -0.238  -19.774 1.00 0.00 ? 170 ASP A O    1  
ATOM 1846  C CB   . ASP A 1 118 ? -15.158 -1.656  -22.347 1.00 0.00 ? 170 ASP A CB   1  
ATOM 1847  C CG   . ASP A 1 118 ? -15.915 -0.943  -23.460 1.00 0.00 ? 170 ASP A CG   1  
ATOM 1848  O OD1  . ASP A 1 118 ? -17.076 -0.561  -23.202 1.00 0.00 ? 170 ASP A OD1  1  
ATOM 1849  O OD2  . ASP A 1 118 ? -15.335 -0.784  -24.555 1.00 0.00 ? 170 ASP A OD2  1  
ATOM 1850  H H    . ASP A 1 118 ? -14.217 -1.562  -19.495 1.00 0.00 ? 170 ASP A H    1  
ATOM 1851  H HA   . ASP A 1 118 ? -13.811 -0.031  -21.955 1.00 0.00 ? 170 ASP A HA   1  
ATOM 1852  H HB2  . ASP A 1 118 ? -14.387 -2.286  -22.790 1.00 0.00 ? 170 ASP A HB2  1  
ATOM 1853  H HB3  . ASP A 1 118 ? -15.849 -2.287  -21.788 1.00 0.00 ? 170 ASP A HB3  1  
ATOM 1854  N N    . PRO A 1 119 ? -15.766 1.466   -21.165 1.00 0.00 ? 171 PRO A N    1  
ATOM 1855  C CA   . PRO A 1 119 ? -16.706 2.398   -20.555 1.00 0.00 ? 171 PRO A CA   1  
ATOM 1856  C C    . PRO A 1 119 ? -18.152 1.898   -20.483 1.00 0.00 ? 171 PRO A C    1  
ATOM 1857  O O    . PRO A 1 119 ? -18.937 2.440   -19.710 1.00 0.00 ? 171 PRO A O    1  
ATOM 1858  C CB   . PRO A 1 119 ? -16.628 3.665   -21.411 1.00 0.00 ? 171 PRO A CB   1  
ATOM 1859  C CG   . PRO A 1 119 ? -15.248 3.587   -22.056 1.00 0.00 ? 171 PRO A CG   1  
ATOM 1860  C CD   . PRO A 1 119 ? -15.084 2.089   -22.285 1.00 0.00 ? 171 PRO A CD   1  
ATOM 1861  H HA   . PRO A 1 119 ? -16.356 2.628   -19.549 1.00 0.00 ? 171 PRO A HA   1  
ATOM 1862  H HB2  . PRO A 1 119 ? -17.387 3.625   -22.193 1.00 0.00 ? 171 PRO A HB2  1  
ATOM 1863  H HB3  . PRO A 1 119 ? -16.741 4.565   -20.807 1.00 0.00 ? 171 PRO A HB3  1  
ATOM 1864  H HG2  . PRO A 1 119 ? -15.200 4.147   -22.989 1.00 0.00 ? 171 PRO A HG2  1  
ATOM 1865  H HG3  . PRO A 1 119 ? -14.495 3.934   -21.348 1.00 0.00 ? 171 PRO A HG3  1  
ATOM 1866  H HD2  . PRO A 1 119 ? -15.568 1.799   -23.216 1.00 0.00 ? 171 PRO A HD2  1  
ATOM 1867  H HD3  . PRO A 1 119 ? -14.024 1.835   -22.308 1.00 0.00 ? 171 PRO A HD3  1  
ATOM 1868  N N    . ARG A 1 120 ? -18.516 0.878   -21.271 1.00 0.00 ? 172 ARG A N    1  
ATOM 1869  C CA   . ARG A 1 120 ? -19.873 0.338   -21.285 1.00 0.00 ? 172 ARG A CA   1  
ATOM 1870  C C    . ARG A 1 120 ? -19.989 -0.898  -20.394 1.00 0.00 ? 172 ARG A C    1  
ATOM 1871  O O    . ARG A 1 120 ? -21.092 -1.410  -20.207 1.00 0.00 ? 172 ARG A O    1  
ATOM 1872  C CB   . ARG A 1 120 ? -20.308 0.013   -22.720 1.00 0.00 ? 172 ARG A CB   1  
ATOM 1873  C CG   . ARG A 1 120 ? -20.678 1.246   -23.555 1.00 0.00 ? 172 ARG A CG   1  
ATOM 1874  C CD   . ARG A 1 120 ? -19.531 2.241   -23.754 1.00 0.00 ? 172 ARG A CD   1  
ATOM 1875  N NE   . ARG A 1 120 ? -18.354 1.598   -24.351 1.00 0.00 ? 172 ARG A NE   1  
ATOM 1876  C CZ   . ARG A 1 120 ? -17.659 2.078   -25.386 1.00 0.00 ? 172 ARG A CZ   1  
ATOM 1877  N NH1  . ARG A 1 120 ? -18.012 3.216   -25.981 1.00 0.00 ? 172 ARG A NH1  1  
ATOM 1878  N NH2  . ARG A 1 120 ? -16.599 1.413   -25.835 1.00 0.00 ? 172 ARG A NH2  1  
ATOM 1879  H H    . ARG A 1 120 ? -17.834 0.457   -21.886 1.00 0.00 ? 172 ARG A H    1  
ATOM 1880  H HA   . ARG A 1 120 ? -20.555 1.089   -20.885 1.00 0.00 ? 172 ARG A HA   1  
ATOM 1881  H HB2  . ARG A 1 120 ? -19.520 -0.547  -23.223 1.00 0.00 ? 172 ARG A HB2  1  
ATOM 1882  H HB3  . ARG A 1 120 ? -21.193 -0.622  -22.673 1.00 0.00 ? 172 ARG A HB3  1  
ATOM 1883  H HG2  . ARG A 1 120 ? -21.011 0.908   -24.536 1.00 0.00 ? 172 ARG A HG2  1  
ATOM 1884  H HG3  . ARG A 1 120 ? -21.508 1.761   -23.072 1.00 0.00 ? 172 ARG A HG3  1  
ATOM 1885  H HD2  . ARG A 1 120 ? -19.883 3.044   -24.401 1.00 0.00 ? 172 ARG A HD2  1  
ATOM 1886  H HD3  . ARG A 1 120 ? -19.258 2.673   -22.791 1.00 0.00 ? 172 ARG A HD3  1  
ATOM 1887  H HE   . ARG A 1 120 ? -18.049 0.724   -23.945 1.00 0.00 ? 172 ARG A HE   1  
ATOM 1888  H HH11 . ARG A 1 120 ? -18.815 3.732   -25.649 1.00 0.00 ? 172 ARG A HH11 1  
ATOM 1889  H HH12 . ARG A 1 120 ? -17.477 3.565   -26.763 1.00 0.00 ? 172 ARG A HH12 1  
ATOM 1890  H HH21 . ARG A 1 120 ? -16.314 0.554   -25.386 1.00 0.00 ? 172 ARG A HH21 1  
ATOM 1891  H HH22 . ARG A 1 120 ? -16.076 1.766   -26.624 1.00 0.00 ? 172 ARG A HH22 1  
ATOM 1892  N N    . LYS A 1 121 ? -18.868 -1.382  -19.845 1.00 0.00 ? 173 LYS A N    1  
ATOM 1893  C CA   . LYS A 1 121 ? -18.856 -2.549  -18.969 1.00 0.00 ? 173 LYS A CA   1  
ATOM 1894  C C    . LYS A 1 121 ? -18.169 -2.244  -17.639 1.00 0.00 ? 173 LYS A C    1  
ATOM 1895  O O    . LYS A 1 121 ? -18.036 -3.134  -16.801 1.00 0.00 ? 173 LYS A O    1  
ATOM 1896  C CB   . LYS A 1 121 ? -18.194 -3.749  -19.658 1.00 0.00 ? 173 LYS A CB   1  
ATOM 1897  C CG   . LYS A 1 121 ? -19.009 -4.264  -20.850 1.00 0.00 ? 173 LYS A CG   1  
ATOM 1898  C CD   . LYS A 1 121 ? -18.630 -3.559  -22.155 1.00 0.00 ? 173 LYS A CD   1  
ATOM 1899  C CE   . LYS A 1 121 ? -19.544 -4.013  -23.294 1.00 0.00 ? 173 LYS A CE   1  
ATOM 1900  N NZ   . LYS A 1 121 ? -19.386 -5.454  -23.579 1.00 0.00 ? 173 LYS A NZ   1  
ATOM 1901  H H    . LYS A 1 121 ? -17.989 -0.926  -20.042 1.00 0.00 ? 173 LYS A H    1  
ATOM 1902  H HA   . LYS A 1 121 ? -19.887 -2.821  -18.743 1.00 0.00 ? 173 LYS A HA   1  
ATOM 1903  H HB2  . LYS A 1 121 ? -17.185 -3.489  -19.979 1.00 0.00 ? 173 LYS A HB2  1  
ATOM 1904  H HB3  . LYS A 1 121 ? -18.124 -4.557  -18.930 1.00 0.00 ? 173 LYS A HB3  1  
ATOM 1905  H HG2  . LYS A 1 121 ? -18.818 -5.330  -20.963 1.00 0.00 ? 173 LYS A HG2  1  
ATOM 1906  H HG3  . LYS A 1 121 ? -20.071 -4.121  -20.650 1.00 0.00 ? 173 LYS A HG3  1  
ATOM 1907  H HD2  . LYS A 1 121 ? -18.731 -2.480  -22.037 1.00 0.00 ? 173 LYS A HD2  1  
ATOM 1908  H HD3  . LYS A 1 121 ? -17.595 -3.789  -22.406 1.00 0.00 ? 173 LYS A HD3  1  
ATOM 1909  H HE2  . LYS A 1 121 ? -20.579 -3.806  -23.024 1.00 0.00 ? 173 LYS A HE2  1  
ATOM 1910  H HE3  . LYS A 1 121 ? -19.297 -3.440  -24.187 1.00 0.00 ? 173 LYS A HE3  1  
ATOM 1911  H HZ1  . LYS A 1 121 ? -19.628 -5.996  -22.763 1.00 0.00 ? 173 LYS A HZ1  1  
ATOM 1912  H HZ2  . LYS A 1 121 ? -19.990 -5.720  -24.343 1.00 0.00 ? 173 LYS A HZ2  1  
ATOM 1913  H HZ3  . LYS A 1 121 ? -18.430 -5.654  -23.832 1.00 0.00 ? 173 LYS A HZ3  1  
ATOM 1914  N N    . THR A 1 122 ? -17.732 -0.998  -17.432 1.00 0.00 ? 174 THR A N    1  
ATOM 1915  C CA   . THR A 1 122 ? -17.087 -0.607  -16.187 1.00 0.00 ? 174 THR A CA   1  
ATOM 1916  C C    . THR A 1 122 ? -18.143 -0.267  -15.141 1.00 0.00 ? 174 THR A C    1  
ATOM 1917  O O    . THR A 1 122 ? -19.230 0.207   -15.468 1.00 0.00 ? 174 THR A O    1  
ATOM 1918  C CB   . THR A 1 122 ? -16.127 0.563   -16.419 1.00 0.00 ? 174 THR A CB   1  
ATOM 1919  O OG1  . THR A 1 122 ? -15.131 0.182   -17.342 1.00 0.00 ? 174 THR A OG1  1  
ATOM 1920  C CG2  . THR A 1 122 ? -15.420 0.967   -15.126 1.00 0.00 ? 174 THR A CG2  1  
ATOM 1921  H H    . THR A 1 122 ? -17.848 -0.298  -18.151 1.00 0.00 ? 174 THR A H    1  
ATOM 1922  H HA   . THR A 1 122 ? -16.503 -1.448  -15.817 1.00 0.00 ? 174 THR A HA   1  
ATOM 1923  H HB   . THR A 1 122 ? -16.676 1.421   -16.807 1.00 0.00 ? 174 THR A HB   1  
ATOM 1924  H HG1  . THR A 1 122 ? -15.552 -0.001  -18.184 1.00 0.00 ? 174 THR A HG1  1  
ATOM 1925  H HG21 . THR A 1 122 ? -14.875 0.112   -14.723 1.00 0.00 ? 174 THR A HG21 1  
ATOM 1926  H HG22 . THR A 1 122 ? -14.728 1.783   -15.331 1.00 0.00 ? 174 THR A HG22 1  
ATOM 1927  H HG23 . THR A 1 122 ? -16.147 1.311   -14.391 1.00 0.00 ? 174 THR A HG23 1  
ATOM 1928  N N    . ILE A 1 123 ? -17.802 -0.519  -13.876 1.00 0.00 ? 175 ILE A N    1  
ATOM 1929  C CA   . ILE A 1 123 ? -18.672 -0.233  -12.749 1.00 0.00 ? 175 ILE A CA   1  
ATOM 1930  C C    . ILE A 1 123 ? -17.813 0.422   -11.668 1.00 0.00 ? 175 ILE A C    1  
ATOM 1931  O O    . ILE A 1 123 ? -16.605 0.196   -11.614 1.00 0.00 ? 175 ILE A O    1  
ATOM 1932  C CB   . ILE A 1 123 ? -19.324 -1.536  -12.260 1.00 0.00 ? 175 ILE A CB   1  
ATOM 1933  C CG1  . ILE A 1 123 ? -20.108 -2.188  -13.408 1.00 0.00 ? 175 ILE A CG1  1  
ATOM 1934  C CG2  . ILE A 1 123 ? -20.253 -1.288  -11.067 1.00 0.00 ? 175 ILE A CG2  1  
ATOM 1935  C CD1  . ILE A 1 123 ? -20.743 -3.515  -12.991 1.00 0.00 ? 175 ILE A CD1  1  
ATOM 1936  H H    . ILE A 1 123 ? -16.901 -0.925  -13.677 1.00 0.00 ? 175 ILE A H    1  
ATOM 1937  H HA   . ILE A 1 123 ? -19.454 0.464   -13.052 1.00 0.00 ? 175 ILE A HA   1  
ATOM 1938  H HB   . ILE A 1 123 ? -18.534 -2.220  -11.949 1.00 0.00 ? 175 ILE A HB   1  
ATOM 1939  H HG12 . ILE A 1 123 ? -20.890 -1.510  -13.747 1.00 0.00 ? 175 ILE A HG12 1  
ATOM 1940  H HG13 . ILE A 1 123 ? -19.431 -2.386  -14.239 1.00 0.00 ? 175 ILE A HG13 1  
ATOM 1941  H HG21 . ILE A 1 123 ? -21.076 -0.644  -11.374 1.00 0.00 ? 175 ILE A HG21 1  
ATOM 1942  H HG22 . ILE A 1 123 ? -20.647 -2.237  -10.701 1.00 0.00 ? 175 ILE A HG22 1  
ATOM 1943  H HG23 . ILE A 1 123 ? -19.698 -0.821  -10.254 1.00 0.00 ? 175 ILE A HG23 1  
ATOM 1944  H HD11 . ILE A 1 123 ? -21.521 -3.344  -12.248 1.00 0.00 ? 175 ILE A HD11 1  
ATOM 1945  H HD12 . ILE A 1 123 ? -21.185 -3.992  -13.865 1.00 0.00 ? 175 ILE A HD12 1  
ATOM 1946  H HD13 . ILE A 1 123 ? -19.978 -4.172  -12.575 1.00 0.00 ? 175 ILE A HD13 1  
ATOM 1947  N N    . PHE A 1 124 ? -18.430 1.230   -10.807 1.00 0.00 ? 176 PHE A N    1  
ATOM 1948  C CA   . PHE A 1 124 ? -17.715 1.960   -9.772  1.00 0.00 ? 176 PHE A CA   1  
ATOM 1949  C C    . PHE A 1 124 ? -18.041 1.354   -8.412  1.00 0.00 ? 176 PHE A C    1  
ATOM 1950  O O    . PHE A 1 124 ? -19.158 0.892   -8.193  1.00 0.00 ? 176 PHE A O    1  
ATOM 1951  C CB   . PHE A 1 124 ? -18.116 3.435   -9.841  1.00 0.00 ? 176 PHE A CB   1  
ATOM 1952  C CG   . PHE A 1 124 ? -17.683 4.249   -8.641  1.00 0.00 ? 176 PHE A CG   1  
ATOM 1953  C CD1  . PHE A 1 124 ? -16.422 4.859   -8.616  1.00 0.00 ? 176 PHE A CD1  1  
ATOM 1954  C CD2  . PHE A 1 124 ? -18.553 4.390   -7.549  1.00 0.00 ? 176 PHE A CD2  1  
ATOM 1955  C CE1  . PHE A 1 124 ? -16.034 5.617   -7.503  1.00 0.00 ? 176 PHE A CE1  1  
ATOM 1956  C CE2  . PHE A 1 124 ? -18.162 5.145   -6.434  1.00 0.00 ? 176 PHE A CE2  1  
ATOM 1957  C CZ   . PHE A 1 124 ? -16.904 5.761   -6.413  1.00 0.00 ? 176 PHE A CZ   1  
ATOM 1958  H H    . PHE A 1 124 ? -19.432 1.346   -10.856 1.00 0.00 ? 176 PHE A H    1  
ATOM 1959  H HA   . PHE A 1 124 ? -16.641 1.882   -9.938  1.00 0.00 ? 176 PHE A HA   1  
ATOM 1960  H HB2  . PHE A 1 124 ? -17.688 3.875   -10.742 1.00 0.00 ? 176 PHE A HB2  1  
ATOM 1961  H HB3  . PHE A 1 124 ? -19.201 3.498   -9.922  1.00 0.00 ? 176 PHE A HB3  1  
ATOM 1962  H HD1  . PHE A 1 124 ? -15.749 4.746   -9.455  1.00 0.00 ? 176 PHE A HD1  1  
ATOM 1963  H HD2  . PHE A 1 124 ? -19.523 3.918   -7.564  1.00 0.00 ? 176 PHE A HD2  1  
ATOM 1964  H HE1  . PHE A 1 124 ? -15.063 6.091   -7.486  1.00 0.00 ? 176 PHE A HE1  1  
ATOM 1965  H HE2  . PHE A 1 124 ? -18.829 5.253   -5.592  1.00 0.00 ? 176 PHE A HE2  1  
ATOM 1966  H HZ   . PHE A 1 124 ? -16.603 6.346   -5.558  1.00 0.00 ? 176 PHE A HZ   1  
ATOM 1967  N N    . VAL A 1 125 ? -17.064 1.358   -7.500  1.00 0.00 ? 177 VAL A N    1  
ATOM 1968  C CA   . VAL A 1 125 ? -17.245 0.842   -6.150  1.00 0.00 ? 177 VAL A CA   1  
ATOM 1969  C C    . VAL A 1 125 ? -16.589 1.808   -5.169  1.00 0.00 ? 177 VAL A C    1  
ATOM 1970  O O    . VAL A 1 125 ? -15.369 1.952   -5.159  1.00 0.00 ? 177 VAL A O    1  
ATOM 1971  C CB   . VAL A 1 125 ? -16.639 -0.561  -6.025  1.00 0.00 ? 177 VAL A CB   1  
ATOM 1972  C CG1  . VAL A 1 125 ? -16.962 -1.137  -4.648  1.00 0.00 ? 177 VAL A CG1  1  
ATOM 1973  C CG2  . VAL A 1 125 ? -17.209 -1.507  -7.083  1.00 0.00 ? 177 VAL A CG2  1  
ATOM 1974  H H    . VAL A 1 125 ? -16.159 1.734   -7.741  1.00 0.00 ? 177 VAL A H    1  
ATOM 1975  H HA   . VAL A 1 125 ? -18.311 0.783   -5.934  1.00 0.00 ? 177 VAL A HA   1  
ATOM 1976  H HB   . VAL A 1 125 ? -15.558 -0.500  -6.147  1.00 0.00 ? 177 VAL A HB   1  
ATOM 1977  H HG11 . VAL A 1 125 ? -18.043 -1.180  -4.517  1.00 0.00 ? 177 VAL A HG11 1  
ATOM 1978  H HG12 . VAL A 1 125 ? -16.554 -2.145  -4.569  1.00 0.00 ? 177 VAL A HG12 1  
ATOM 1979  H HG13 . VAL A 1 125 ? -16.526 -0.509  -3.871  1.00 0.00 ? 177 VAL A HG13 1  
ATOM 1980  H HG21 . VAL A 1 125 ? -16.938 -1.158  -8.079  1.00 0.00 ? 177 VAL A HG21 1  
ATOM 1981  H HG22 . VAL A 1 125 ? -16.799 -2.506  -6.933  1.00 0.00 ? 177 VAL A HG22 1  
ATOM 1982  H HG23 . VAL A 1 125 ? -18.295 -1.545  -6.992  1.00 0.00 ? 177 VAL A HG23 1  
ATOM 1983  N N    . GLY A 1 126 ? -17.395 2.473   -4.338  1.00 0.00 ? 178 GLY A N    1  
ATOM 1984  C CA   . GLY A 1 126 ? -16.899 3.501   -3.434  1.00 0.00 ? 178 GLY A CA   1  
ATOM 1985  C C    . GLY A 1 126 ? -16.848 3.037   -1.983  1.00 0.00 ? 178 GLY A C    1  
ATOM 1986  O O    . GLY A 1 126 ? -17.520 2.080   -1.600  1.00 0.00 ? 178 GLY A O    1  
ATOM 1987  H H    . GLY A 1 126 ? -18.384 2.268   -4.328  1.00 0.00 ? 178 GLY A H    1  
ATOM 1988  H HA2  . GLY A 1 126 ? -15.894 3.797   -3.740  1.00 0.00 ? 178 GLY A HA2  1  
ATOM 1989  H HA3  . GLY A 1 126 ? -17.543 4.378   -3.501  1.00 0.00 ? 178 GLY A HA3  1  
ATOM 1990  N N    . GLY A 1 127 ? -16.040 3.733   -1.178  1.00 0.00 ? 179 GLY A N    1  
ATOM 1991  C CA   . GLY A 1 127 ? -15.950 3.498   0.255   1.00 0.00 ? 179 GLY A CA   1  
ATOM 1992  C C    . GLY A 1 127 ? -14.706 2.725   0.694   1.00 0.00 ? 179 GLY A C    1  
ATOM 1993  O O    . GLY A 1 127 ? -14.605 2.394   1.873   1.00 0.00 ? 179 GLY A O    1  
ATOM 1994  H H    . GLY A 1 127 ? -15.464 4.464   -1.571  1.00 0.00 ? 179 GLY A H    1  
ATOM 1995  H HA2  . GLY A 1 127 ? -15.947 4.464   0.759   1.00 0.00 ? 179 GLY A HA2  1  
ATOM 1996  H HA3  . GLY A 1 127 ? -16.831 2.945   0.579   1.00 0.00 ? 179 GLY A HA3  1  
ATOM 1997  N N    . VAL A 1 128 ? -13.758 2.427   -0.203  1.00 0.00 ? 180 VAL A N    1  
ATOM 1998  C CA   . VAL A 1 128 ? -12.576 1.672   0.209   1.00 0.00 ? 180 VAL A CA   1  
ATOM 1999  C C    . VAL A 1 128 ? -11.513 2.618   0.777   1.00 0.00 ? 180 VAL A C    1  
ATOM 2000  O O    . VAL A 1 128 ? -11.313 3.705   0.237   1.00 0.00 ? 180 VAL A O    1  
ATOM 2001  C CB   . VAL A 1 128 ? -12.004 0.811   -0.927  1.00 0.00 ? 180 VAL A CB   1  
ATOM 2002  C CG1  . VAL A 1 128 ? -13.095 -0.016  -1.609  1.00 0.00 ? 180 VAL A CG1  1  
ATOM 2003  C CG2  . VAL A 1 128 ? -11.325 1.655   -2.001  1.00 0.00 ? 180 VAL A CG2  1  
ATOM 2004  H H    . VAL A 1 128 ? -13.846 2.719   -1.166  1.00 0.00 ? 180 VAL A H    1  
ATOM 2005  H HA   . VAL A 1 128 ? -12.886 0.980   0.993   1.00 0.00 ? 180 VAL A HA   1  
ATOM 2006  H HB   . VAL A 1 128 ? -11.264 0.134   -0.500  1.00 0.00 ? 180 VAL A HB   1  
ATOM 2007  H HG11 . VAL A 1 128 ? -13.816 0.643   -2.093  1.00 0.00 ? 180 VAL A HG11 1  
ATOM 2008  H HG12 . VAL A 1 128 ? -12.640 -0.656  -2.365  1.00 0.00 ? 180 VAL A HG12 1  
ATOM 2009  H HG13 . VAL A 1 128 ? -13.605 -0.633  -0.869  1.00 0.00 ? 180 VAL A HG13 1  
ATOM 2010  H HG21 . VAL A 1 128 ? -10.460 2.165   -1.577  1.00 0.00 ? 180 VAL A HG21 1  
ATOM 2011  H HG22 . VAL A 1 128 ? -10.989 1.010   -2.814  1.00 0.00 ? 180 VAL A HG22 1  
ATOM 2012  H HG23 . VAL A 1 128 ? -12.029 2.389   -2.394  1.00 0.00 ? 180 VAL A HG23 1  
ATOM 2013  N N    . PRO A 1 129 ? -10.823 2.230   1.859   1.00 0.00 ? 181 PRO A N    1  
ATOM 2014  C CA   . PRO A 1 129 ? -9.679  2.957   2.387   1.00 0.00 ? 181 PRO A CA   1  
ATOM 2015  C C    . PRO A 1 129 ? -8.483  2.864   1.439   1.00 0.00 ? 181 PRO A C    1  
ATOM 2016  O O    . PRO A 1 129 ? -8.489  2.067   0.502   1.00 0.00 ? 181 PRO A O    1  
ATOM 2017  C CB   . PRO A 1 129 ? -9.348  2.294   3.728   1.00 0.00 ? 181 PRO A CB   1  
ATOM 2018  C CG   . PRO A 1 129 ? -10.574 1.445   4.057   1.00 0.00 ? 181 PRO A CG   1  
ATOM 2019  C CD   . PRO A 1 129 ? -11.095 1.065   2.675   1.00 0.00 ? 181 PRO A CD   1  
ATOM 2020  H HA   . PRO A 1 129 ? -9.950  4.000   2.549   1.00 0.00 ? 181 PRO A HA   1  
ATOM 2021  H HB2  . PRO A 1 129 ? -8.486  1.638   3.604   1.00 0.00 ? 181 PRO A HB2  1  
ATOM 2022  H HB3  . PRO A 1 129 ? -9.158  3.036   4.504   1.00 0.00 ? 181 PRO A HB3  1  
ATOM 2023  H HG2  . PRO A 1 129 ? -10.315 0.568   4.650   1.00 0.00 ? 181 PRO A HG2  1  
ATOM 2024  H HG3  . PRO A 1 129 ? -11.314 2.059   4.568   1.00 0.00 ? 181 PRO A HG3  1  
ATOM 2025  H HD2  . PRO A 1 129 ? -10.544 0.210   2.286   1.00 0.00 ? 181 PRO A HD2  1  
ATOM 2026  H HD3  . PRO A 1 129 ? -12.161 0.845   2.732   1.00 0.00 ? 181 PRO A HD3  1  
ATOM 2027  N N    . ARG A 1 130 ? -7.450  3.680   1.678   1.00 0.00 ? 182 ARG A N    1  
ATOM 2028  C CA   . ARG A 1 130 ? -6.242  3.671   0.860   1.00 0.00 ? 182 ARG A CA   1  
ATOM 2029  C C    . ARG A 1 130 ? -5.243  2.581   1.270   1.00 0.00 ? 182 ARG A C    1  
ATOM 2030  O O    . ARG A 1 130 ? -4.650  1.968   0.385   1.00 0.00 ? 182 ARG A O    1  
ATOM 2031  C CB   . ARG A 1 130 ? -5.567  5.047   0.911   1.00 0.00 ? 182 ARG A CB   1  
ATOM 2032  C CG   . ARG A 1 130 ? -6.452  6.138   0.306   1.00 0.00 ? 182 ARG A CG   1  
ATOM 2033  C CD   . ARG A 1 130 ? -5.717  7.477   0.399   1.00 0.00 ? 182 ARG A CD   1  
ATOM 2034  N NE   . ARG A 1 130 ? -6.500  8.560   -0.205  1.00 0.00 ? 182 ARG A NE   1  
ATOM 2035  C CZ   . ARG A 1 130 ? -6.178  9.853   -0.122  1.00 0.00 ? 182 ARG A CZ   1  
ATOM 2036  N NH1  . ARG A 1 130 ? -5.107  10.247  0.564   1.00 0.00 ? 182 ARG A NH1  1  
ATOM 2037  N NH2  . ARG A 1 130 ? -6.937  10.761  -0.731  1.00 0.00 ? 182 ARG A NH2  1  
ATOM 2038  H H    . ARG A 1 130 ? -7.497  4.328   2.451   1.00 0.00 ? 182 ARG A H    1  
ATOM 2039  H HA   . ARG A 1 130 ? -6.528  3.477   -0.174  1.00 0.00 ? 182 ARG A HA   1  
ATOM 2040  H HB2  . ARG A 1 130 ? -5.338  5.302   1.946   1.00 0.00 ? 182 ARG A HB2  1  
ATOM 2041  H HB3  . ARG A 1 130 ? -4.632  5.001   0.351   1.00 0.00 ? 182 ARG A HB3  1  
ATOM 2042  H HG2  . ARG A 1 130 ? -6.653  5.905   -0.739  1.00 0.00 ? 182 ARG A HG2  1  
ATOM 2043  H HG3  . ARG A 1 130 ? -7.392  6.201   0.854   1.00 0.00 ? 182 ARG A HG3  1  
ATOM 2044  H HD2  . ARG A 1 130 ? -5.535  7.709   1.449   1.00 0.00 ? 182 ARG A HD2  1  
ATOM 2045  H HD3  . ARG A 1 130 ? -4.761  7.396   -0.117  1.00 0.00 ? 182 ARG A HD3  1  
ATOM 2046  H HE   . ARG A 1 130 ? -7.332  8.307   -0.718  1.00 0.00 ? 182 ARG A HE   1  
ATOM 2047  H HH11 . ARG A 1 130 ? -4.525  9.563   1.026   1.00 0.00 ? 182 ARG A HH11 1  
ATOM 2048  H HH12 . ARG A 1 130 ? -4.877  11.229  0.623   1.00 0.00 ? 182 ARG A HH12 1  
ATOM 2049  H HH21 . ARG A 1 130 ? -7.740  10.463  -1.265  1.00 0.00 ? 182 ARG A HH21 1  
ATOM 2050  H HH22 . ARG A 1 130 ? -6.710  11.742  -0.659  1.00 0.00 ? 182 ARG A HH22 1  
ATOM 2051  N N    . PRO A 1 131 ? -5.030  2.314   2.572   1.00 0.00 ? 183 PRO A N    1  
ATOM 2052  C CA   . PRO A 1 131 ? -4.085  1.306   3.037   1.00 0.00 ? 183 PRO A CA   1  
ATOM 2053  C C    . PRO A 1 131 ? -4.407  -0.127  2.600   1.00 0.00 ? 183 PRO A C    1  
ATOM 2054  O O    . PRO A 1 131 ? -3.551  -0.999  2.740   1.00 0.00 ? 183 PRO A O    1  
ATOM 2055  C CB   . PRO A 1 131 ? -4.103  1.404   4.566   1.00 0.00 ? 183 PRO A CB   1  
ATOM 2056  C CG   . PRO A 1 131 ? -4.644  2.802   4.840   1.00 0.00 ? 183 PRO A CG   1  
ATOM 2057  C CD   . PRO A 1 131 ? -5.646  2.975   3.706   1.00 0.00 ? 183 PRO A CD   1  
ATOM 2058  H HA   . PRO A 1 131 ? -3.093  1.575   2.674   1.00 0.00 ? 183 PRO A HA   1  
ATOM 2059  H HB2  . PRO A 1 131 ? -4.799  0.669   4.972   1.00 0.00 ? 183 PRO A HB2  1  
ATOM 2060  H HB3  . PRO A 1 131 ? -3.110  1.269   4.991   1.00 0.00 ? 183 PRO A HB3  1  
ATOM 2061  H HG2  . PRO A 1 131 ? -5.118  2.871   5.820   1.00 0.00 ? 183 PRO A HG2  1  
ATOM 2062  H HG3  . PRO A 1 131 ? -3.842  3.533   4.739   1.00 0.00 ? 183 PRO A HG3  1  
ATOM 2063  H HD2  . PRO A 1 131 ? -6.579  2.472   3.961   1.00 0.00 ? 183 PRO A HD2  1  
ATOM 2064  H HD3  . PRO A 1 131 ? -5.818  4.034   3.517   1.00 0.00 ? 183 PRO A HD3  1  
ATOM 2065  N N    . LEU A 1 132 ? -5.611  -0.391  2.077   1.00 0.00 ? 184 LEU A N    1  
ATOM 2066  C CA   . LEU A 1 132 ? -5.997  -1.738  1.669   1.00 0.00 ? 184 LEU A CA   1  
ATOM 2067  C C    . LEU A 1 132 ? -5.856  -1.907  0.160   1.00 0.00 ? 184 LEU A C    1  
ATOM 2068  O O    . LEU A 1 132 ? -5.871  -0.939  -0.597  1.00 0.00 ? 184 LEU A O    1  
ATOM 2069  C CB   . LEU A 1 132 ? -7.447  -2.053  2.053   1.00 0.00 ? 184 LEU A CB   1  
ATOM 2070  C CG   . LEU A 1 132 ? -7.723  -2.260  3.548   1.00 0.00 ? 184 LEU A CG   1  
ATOM 2071  C CD1  . LEU A 1 132 ? -7.229  -1.120  4.435   1.00 0.00 ? 184 LEU A CD1  1  
ATOM 2072  C CD2  . LEU A 1 132 ? -9.237  -2.383  3.708   1.00 0.00 ? 184 LEU A CD2  1  
ATOM 2073  H H    . LEU A 1 132 ? -6.281  0.355   1.956   1.00 0.00 ? 184 LEU A H    1  
ATOM 2074  H HA   . LEU A 1 132 ? -5.345  -2.462  2.158   1.00 0.00 ? 184 LEU A HA   1  
ATOM 2075  H HB2  . LEU A 1 132 ? -8.093  -1.264  1.668   1.00 0.00 ? 184 LEU A HB2  1  
ATOM 2076  H HB3  . LEU A 1 132 ? -7.733  -2.975  1.545   1.00 0.00 ? 184 LEU A HB3  1  
ATOM 2077  H HG   . LEU A 1 132 ? -7.251  -3.186  3.876   1.00 0.00 ? 184 LEU A HG   1  
ATOM 2078  H HD11 . LEU A 1 132 ? -7.576  -1.276  5.457   1.00 0.00 ? 184 LEU A HD11 1  
ATOM 2079  H HD12 . LEU A 1 132 ? -6.139  -1.105  4.439   1.00 0.00 ? 184 LEU A HD12 1  
ATOM 2080  H HD13 . LEU A 1 132 ? -7.613  -0.169  4.067   1.00 0.00 ? 184 LEU A HD13 1  
ATOM 2081  H HD21 . LEU A 1 132 ? -9.586  -3.261  3.162   1.00 0.00 ? 184 LEU A HD21 1  
ATOM 2082  H HD22 . LEU A 1 132 ? -9.490  -2.494  4.763   1.00 0.00 ? 184 LEU A HD22 1  
ATOM 2083  H HD23 . LEU A 1 132 ? -9.727  -1.498  3.302   1.00 0.00 ? 184 LEU A HD23 1  
ATOM 2084  N N    . ARG A 1 133 ? -5.720  -3.166  -0.266  1.00 0.00 ? 185 ARG A N    1  
ATOM 2085  C CA   . ARG A 1 133 ? -5.714  -3.539  -1.671  1.00 0.00 ? 185 ARG A CA   1  
ATOM 2086  C C    . ARG A 1 133 ? -7.147  -3.836  -2.110  1.00 0.00 ? 185 ARG A C    1  
ATOM 2087  O O    . ARG A 1 133 ? -8.065  -3.786  -1.295  1.00 0.00 ? 185 ARG A O    1  
ATOM 2088  C CB   . ARG A 1 133 ? -4.780  -4.734  -1.868  1.00 0.00 ? 185 ARG A CB   1  
ATOM 2089  C CG   . ARG A 1 133 ? -3.331  -4.344  -1.572  1.00 0.00 ? 185 ARG A CG   1  
ATOM 2090  C CD   . ARG A 1 133 ? -2.416  -5.560  -1.725  1.00 0.00 ? 185 ARG A CD   1  
ATOM 2091  N NE   . ARG A 1 133 ? -1.023  -5.218  -1.415  1.00 0.00 ? 185 ARG A NE   1  
ATOM 2092  C CZ   . ARG A 1 133 ? -0.504  -5.215  -0.184  1.00 0.00 ? 185 ARG A CZ   1  
ATOM 2093  N NH1  . ARG A 1 133 ? -1.249  -5.537  0.871   1.00 0.00 ? 185 ARG A NH1  1  
ATOM 2094  N NH2  . ARG A 1 133 ? 0.772   -4.888  -0.003  1.00 0.00 ? 185 ARG A NH2  1  
ATOM 2095  H H    . ARG A 1 133 ? -5.622  -3.905  0.414   1.00 0.00 ? 185 ARG A H    1  
ATOM 2096  H HA   . ARG A 1 133 ? -5.345  -2.706  -2.270  1.00 0.00 ? 185 ARG A HA   1  
ATOM 2097  H HB2  . ARG A 1 133 ? -5.077  -5.535  -1.192  1.00 0.00 ? 185 ARG A HB2  1  
ATOM 2098  H HB3  . ARG A 1 133 ? -4.850  -5.086  -2.898  1.00 0.00 ? 185 ARG A HB3  1  
ATOM 2099  H HG2  . ARG A 1 133 ? -3.013  -3.569  -2.269  1.00 0.00 ? 185 ARG A HG2  1  
ATOM 2100  H HG3  . ARG A 1 133 ? -3.256  -3.963  -0.554  1.00 0.00 ? 185 ARG A HG3  1  
ATOM 2101  H HD2  . ARG A 1 133 ? -2.754  -6.353  -1.058  1.00 0.00 ? 185 ARG A HD2  1  
ATOM 2102  H HD3  . ARG A 1 133 ? -2.475  -5.919  -2.752  1.00 0.00 ? 185 ARG A HD3  1  
ATOM 2103  H HE   . ARG A 1 133 ? -0.424  -4.970  -2.189  1.00 0.00 ? 185 ARG A HE   1  
ATOM 2104  H HH11 . ARG A 1 133 ? -2.219  -5.788  0.746   1.00 0.00 ? 185 ARG A HH11 1  
ATOM 2105  H HH12 . ARG A 1 133 ? -0.844  -5.530  1.796   1.00 0.00 ? 185 ARG A HH12 1  
ATOM 2106  H HH21 . ARG A 1 133 ? 1.353   -4.653  -0.796  1.00 0.00 ? 185 ARG A HH21 1  
ATOM 2107  H HH22 . ARG A 1 133 ? 1.164   -4.875  0.928   1.00 0.00 ? 185 ARG A HH22 1  
ATOM 2108  N N    . ALA A 1 134 ? -7.349  -4.145  -3.394  1.00 0.00 ? 186 ALA A N    1  
ATOM 2109  C CA   . ALA A 1 134 ? -8.668  -4.479  -3.916  1.00 0.00 ? 186 ALA A CA   1  
ATOM 2110  C C    . ALA A 1 134 ? -9.148  -5.840  -3.389  1.00 0.00 ? 186 ALA A C    1  
ATOM 2111  O O    . ALA A 1 134 ? -10.116 -6.400  -3.899  1.00 0.00 ? 186 ALA A O    1  
ATOM 2112  C CB   . ALA A 1 134 ? -8.639  -4.427  -5.446  1.00 0.00 ? 186 ALA A CB   1  
ATOM 2113  H H    . ALA A 1 134 ? -6.567  -4.154  -4.034  1.00 0.00 ? 186 ALA A H    1  
ATOM 2114  H HA   . ALA A 1 134 ? -9.366  -3.721  -3.562  1.00 0.00 ? 186 ALA A HA   1  
ATOM 2115  H HB1  . ALA A 1 134 ? -7.991  -5.214  -5.831  1.00 0.00 ? 186 ALA A HB1  1  
ATOM 2116  H HB2  . ALA A 1 134 ? -9.646  -4.568  -5.840  1.00 0.00 ? 186 ALA A HB2  1  
ATOM 2117  H HB3  . ALA A 1 134 ? -8.253  -3.463  -5.776  1.00 0.00 ? 186 ALA A HB3  1  
ATOM 2118  N N    . VAL A 1 135 ? -8.464  -6.365  -2.365  1.00 0.00 ? 187 VAL A N    1  
ATOM 2119  C CA   . VAL A 1 135 ? -8.776  -7.663  -1.781  1.00 0.00 ? 187 VAL A CA   1  
ATOM 2120  C C    . VAL A 1 135 ? -10.192 -7.714  -1.240  1.00 0.00 ? 187 VAL A C    1  
ATOM 2121  O O    . VAL A 1 135 ? -10.923 -8.661  -1.517  1.00 0.00 ? 187 VAL A O    1  
ATOM 2122  C CB   . VAL A 1 135 ? -7.782  -7.929  -0.642  1.00 0.00 ? 187 VAL A CB   1  
ATOM 2123  C CG1  . VAL A 1 135 ? -8.150  -9.193  0.135   1.00 0.00 ? 187 VAL A CG1  1  
ATOM 2124  C CG2  . VAL A 1 135 ? -6.380  -8.116  -1.219  1.00 0.00 ? 187 VAL A CG2  1  
ATOM 2125  H H    . VAL A 1 135 ? -7.690  -5.849  -1.971  1.00 0.00 ? 187 VAL A H    1  
ATOM 2126  H HA   . VAL A 1 135 ? -8.681  -8.440  -2.540  1.00 0.00 ? 187 VAL A HA   1  
ATOM 2127  H HB   . VAL A 1 135 ? -7.781  -7.074  0.033   1.00 0.00 ? 187 VAL A HB   1  
ATOM 2128  H HG11 . VAL A 1 135 ? -8.198  -10.042 -0.545  1.00 0.00 ? 187 VAL A HG11 1  
ATOM 2129  H HG12 . VAL A 1 135 ? -7.392  -9.383  0.896   1.00 0.00 ? 187 VAL A HG12 1  
ATOM 2130  H HG13 . VAL A 1 135 ? -9.117  -9.061  0.623   1.00 0.00 ? 187 VAL A HG13 1  
ATOM 2131  H HG21 . VAL A 1 135 ? -5.667  -8.243  -0.405  1.00 0.00 ? 187 VAL A HG21 1  
ATOM 2132  H HG22 . VAL A 1 135 ? -6.363  -8.998  -1.860  1.00 0.00 ? 187 VAL A HG22 1  
ATOM 2133  H HG23 . VAL A 1 135 ? -6.107  -7.240  -1.807  1.00 0.00 ? 187 VAL A HG23 1  
ATOM 2134  N N    . GLU A 1 136 ? -10.586 -6.701  -0.470  1.00 0.00 ? 188 GLU A N    1  
ATOM 2135  C CA   . GLU A 1 136 ? -11.897 -6.684  0.157   1.00 0.00 ? 188 GLU A CA   1  
ATOM 2136  C C    . GLU A 1 136 ? -12.990 -6.404  -0.870  1.00 0.00 ? 188 GLU A C    1  
ATOM 2137  O O    . GLU A 1 136 ? -14.134 -6.794  -0.663  1.00 0.00 ? 188 GLU A O    1  
ATOM 2138  C CB   . GLU A 1 136 ? -11.923 -5.621  1.254   1.00 0.00 ? 188 GLU A CB   1  
ATOM 2139  C CG   . GLU A 1 136 ? -11.327 -4.305  0.749   1.00 0.00 ? 188 GLU A CG   1  
ATOM 2140  C CD   . GLU A 1 136 ? -11.803 -3.115  1.584   1.00 0.00 ? 188 GLU A CD   1  
ATOM 2141  O OE1  . GLU A 1 136 ? -12.222 -3.340  2.742   1.00 0.00 ? 188 GLU A OE1  1  
ATOM 2142  O OE2  . GLU A 1 136 ? -11.742 -1.985  1.051   1.00 0.00 ? 188 GLU A OE2  1  
ATOM 2143  H H    . GLU A 1 136 ? -9.967  -5.920  -0.309  1.00 0.00 ? 188 GLU A H    1  
ATOM 2144  H HA   . GLU A 1 136 ? -12.095 -7.657  0.606   1.00 0.00 ? 188 GLU A HA   1  
ATOM 2145  H HB2  . GLU A 1 136 ? -12.958 -5.466  1.557   1.00 0.00 ? 188 GLU A HB2  1  
ATOM 2146  H HB3  . GLU A 1 136 ? -11.345 -5.964  2.113   1.00 0.00 ? 188 GLU A HB3  1  
ATOM 2147  H HG2  . GLU A 1 136 ? -10.241 -4.371  0.787   1.00 0.00 ? 188 GLU A HG2  1  
ATOM 2148  H HG3  . GLU A 1 136 ? -11.618 -4.158  -0.291  1.00 0.00 ? 188 GLU A HG3  1  
ATOM 2149  N N    . LEU A 1 137 ? -12.637 -5.733  -1.969  1.00 0.00 ? 189 LEU A N    1  
ATOM 2150  C CA   . LEU A 1 137 ? -13.563 -5.276  -2.988  1.00 0.00 ? 189 LEU A CA   1  
ATOM 2151  C C    . LEU A 1 137 ? -13.923 -6.415  -3.933  1.00 0.00 ? 189 LEU A C    1  
ATOM 2152  O O    . LEU A 1 137 ? -15.101 -6.682  -4.175  1.00 0.00 ? 189 LEU A O    1  
ATOM 2153  C CB   . LEU A 1 137 ? -12.873 -4.110  -3.708  1.00 0.00 ? 189 LEU A CB   1  
ATOM 2154  C CG   . LEU A 1 137 ? -13.628 -3.545  -4.918  1.00 0.00 ? 189 LEU A CG   1  
ATOM 2155  C CD1  . LEU A 1 137 ? -13.060 -2.166  -5.242  1.00 0.00 ? 189 LEU A CD1  1  
ATOM 2156  C CD2  . LEU A 1 137 ? -13.429 -4.404  -6.165  1.00 0.00 ? 189 LEU A CD2  1  
ATOM 2157  H H    . LEU A 1 137 ? -11.660 -5.517  -2.108  1.00 0.00 ? 189 LEU A H    1  
ATOM 2158  H HA   . LEU A 1 137 ? -14.476 -4.913  -2.514  1.00 0.00 ? 189 LEU A HA   1  
ATOM 2159  H HB2  . LEU A 1 137 ? -12.739 -3.309  -2.981  1.00 0.00 ? 189 LEU A HB2  1  
ATOM 2160  H HB3  . LEU A 1 137 ? -11.884 -4.431  -4.035  1.00 0.00 ? 189 LEU A HB3  1  
ATOM 2161  H HG   . LEU A 1 137 ? -14.689 -3.449  -4.690  1.00 0.00 ? 189 LEU A HG   1  
ATOM 2162  H HD11 . LEU A 1 137 ? -11.996 -2.254  -5.459  1.00 0.00 ? 189 LEU A HD11 1  
ATOM 2163  H HD12 . LEU A 1 137 ? -13.570 -1.758  -6.115  1.00 0.00 ? 189 LEU A HD12 1  
ATOM 2164  H HD13 . LEU A 1 137 ? -13.209 -1.500  -4.393  1.00 0.00 ? 189 LEU A HD13 1  
ATOM 2165  H HD21 . LEU A 1 137 ? -12.373 -4.647  -6.282  1.00 0.00 ? 189 LEU A HD21 1  
ATOM 2166  H HD22 . LEU A 1 137 ? -14.013 -5.322  -6.098  1.00 0.00 ? 189 LEU A HD22 1  
ATOM 2167  H HD23 . LEU A 1 137 ? -13.764 -3.845  -7.039  1.00 0.00 ? 189 LEU A HD23 1  
ATOM 2168  N N    . ALA A 1 138 ? -12.910 -7.091  -4.474  1.00 0.00 ? 190 ALA A N    1  
ATOM 2169  C CA   . ALA A 1 138 ? -13.145 -8.131  -5.454  1.00 0.00 ? 190 ALA A CA   1  
ATOM 2170  C C    . ALA A 1 138 ? -13.690 -9.391  -4.784  1.00 0.00 ? 190 ALA A C    1  
ATOM 2171  O O    . ALA A 1 138 ? -14.410 -10.158 -5.420  1.00 0.00 ? 190 ALA A O    1  
ATOM 2172  C CB   . ALA A 1 138 ? -11.831 -8.420  -6.180  1.00 0.00 ? 190 ALA A CB   1  
ATOM 2173  H H    . ALA A 1 138 ? -11.959 -6.880  -4.206  1.00 0.00 ? 190 ALA A H    1  
ATOM 2174  H HA   . ALA A 1 138 ? -13.875 -7.766  -6.177  1.00 0.00 ? 190 ALA A HA   1  
ATOM 2175  H HB1  . ALA A 1 138 ? -11.090 -8.787  -5.470  1.00 0.00 ? 190 ALA A HB1  1  
ATOM 2176  H HB2  . ALA A 1 138 ? -11.999 -9.171  -6.952  1.00 0.00 ? 190 ALA A HB2  1  
ATOM 2177  H HB3  . ALA A 1 138 ? -11.462 -7.504  -6.641  1.00 0.00 ? 190 ALA A HB3  1  
ATOM 2178  N N    . MET A 1 139 ? -13.358 -9.617  -3.506  1.00 0.00 ? 191 MET A N    1  
ATOM 2179  C CA   . MET A 1 139 ? -13.774 -10.831 -2.822  1.00 0.00 ? 191 MET A CA   1  
ATOM 2180  C C    . MET A 1 139 ? -15.226 -10.744 -2.365  1.00 0.00 ? 191 MET A C    1  
ATOM 2181  O O    . MET A 1 139 ? -15.935 -11.744 -2.438  1.00 0.00 ? 191 MET A O    1  
ATOM 2182  C CB   . MET A 1 139 ? -12.793 -11.179 -1.697  1.00 0.00 ? 191 MET A CB   1  
ATOM 2183  C CG   . MET A 1 139 ? -12.976 -10.362 -0.414  1.00 0.00 ? 191 MET A CG   1  
ATOM 2184  S SD   . MET A 1 139 ? -14.316 -10.934 0.662   1.00 0.00 ? 191 MET A SD   1  
ATOM 2185  C CE   . MET A 1 139 ? -13.972 -9.905  2.111   1.00 0.00 ? 191 MET A CE   1  
ATOM 2186  H H    . MET A 1 139 ? -12.804 -8.944  -2.997  1.00 0.00 ? 191 MET A H    1  
ATOM 2187  H HA   . MET A 1 139 ? -13.715 -11.640 -3.549  1.00 0.00 ? 191 MET A HA   1  
ATOM 2188  H HB2  . MET A 1 139 ? -12.896 -12.235 -1.448  1.00 0.00 ? 191 MET A HB2  1  
ATOM 2189  H HB3  . MET A 1 139 ? -11.781 -11.024 -2.071  1.00 0.00 ? 191 MET A HB3  1  
ATOM 2190  H HG2  . MET A 1 139 ? -12.048 -10.427 0.156   1.00 0.00 ? 191 MET A HG2  1  
ATOM 2191  H HG3  . MET A 1 139 ? -13.145 -9.317  -0.674  1.00 0.00 ? 191 MET A HG3  1  
ATOM 2192  H HE1  . MET A 1 139 ? -14.719 -10.098 2.881   1.00 0.00 ? 191 MET A HE1  1  
ATOM 2193  H HE2  . MET A 1 139 ? -12.982 -10.146 2.500   1.00 0.00 ? 191 MET A HE2  1  
ATOM 2194  H HE3  . MET A 1 139 ? -14.004 -8.852  1.834   1.00 0.00 ? 191 MET A HE3  1  
ATOM 2195  N N    . ILE A 1 140 ? -15.703 -9.584  -1.896  1.00 0.00 ? 192 ILE A N    1  
ATOM 2196  C CA   . ILE A 1 140 ? -17.104 -9.510  -1.499  1.00 0.00 ? 192 ILE A CA   1  
ATOM 2197  C C    . ILE A 1 140 ? -17.995 -9.658  -2.727  1.00 0.00 ? 192 ILE A C    1  
ATOM 2198  O O    . ILE A 1 140 ? -18.978 -10.396 -2.685  1.00 0.00 ? 192 ILE A O    1  
ATOM 2199  C CB   . ILE A 1 140 ? -17.412 -8.218  -0.731  1.00 0.00 ? 192 ILE A CB   1  
ATOM 2200  C CG1  . ILE A 1 140 ? -16.995 -6.978  -1.533  1.00 0.00 ? 192 ILE A CG1  1  
ATOM 2201  C CG2  . ILE A 1 140 ? -16.718 -8.288  0.632   1.00 0.00 ? 192 ILE A CG2  1  
ATOM 2202  C CD1  . ILE A 1 140 ? -17.106 -5.688  -0.719  1.00 0.00 ? 192 ILE A CD1  1  
ATOM 2203  H H    . ILE A 1 140 ? -15.117 -8.766  -1.810  1.00 0.00 ? 192 ILE A H    1  
ATOM 2204  H HA   . ILE A 1 140 ? -17.318 -10.349 -0.837  1.00 0.00 ? 192 ILE A HA   1  
ATOM 2205  H HB   . ILE A 1 140 ? -18.487 -8.170  -0.558  1.00 0.00 ? 192 ILE A HB   1  
ATOM 2206  H HG12 . ILE A 1 140 ? -15.970 -7.104  -1.885  1.00 0.00 ? 192 ILE A HG12 1  
ATOM 2207  H HG13 . ILE A 1 140 ? -17.625 -6.882  -2.418  1.00 0.00 ? 192 ILE A HG13 1  
ATOM 2208  H HG21 . ILE A 1 140 ? -15.636 -8.277  0.497   1.00 0.00 ? 192 ILE A HG21 1  
ATOM 2209  H HG22 . ILE A 1 140 ? -17.017 -7.443  1.252   1.00 0.00 ? 192 ILE A HG22 1  
ATOM 2210  H HG23 . ILE A 1 140 ? -17.007 -9.209  1.138   1.00 0.00 ? 192 ILE A HG23 1  
ATOM 2211  H HD11 . ILE A 1 140 ? -16.446 -5.730  0.148   1.00 0.00 ? 192 ILE A HD11 1  
ATOM 2212  H HD12 . ILE A 1 140 ? -16.820 -4.841  -1.343  1.00 0.00 ? 192 ILE A HD12 1  
ATOM 2213  H HD13 . ILE A 1 140 ? -18.136 -5.555  -0.390  1.00 0.00 ? 192 ILE A HD13 1  
ATOM 2214  N N    . MET A 1 141 ? -17.669 -8.967  -3.824  1.00 0.00 ? 193 MET A N    1  
ATOM 2215  C CA   . MET A 1 141 ? -18.530 -9.034  -4.993  1.00 0.00 ? 193 MET A CA   1  
ATOM 2216  C C    . MET A 1 141 ? -18.478 -10.414 -5.629  1.00 0.00 ? 193 MET A C    1  
ATOM 2217  O O    . MET A 1 141 ? -19.383 -10.781 -6.373  1.00 0.00 ? 193 MET A O    1  
ATOM 2218  C CB   . MET A 1 141 ? -18.153 -7.956  -6.009  1.00 0.00 ? 193 MET A CB   1  
ATOM 2219  C CG   . MET A 1 141 ? -18.210 -6.570  -5.375  1.00 0.00 ? 193 MET A CG   1  
ATOM 2220  S SD   . MET A 1 141 ? -19.829 -6.111  -4.707  1.00 0.00 ? 193 MET A SD   1  
ATOM 2221  C CE   . MET A 1 141 ? -19.373 -4.539  -3.932  1.00 0.00 ? 193 MET A CE   1  
ATOM 2222  H H    . MET A 1 141 ? -16.838 -8.396  -3.856  1.00 0.00 ? 193 MET A H    1  
ATOM 2223  H HA   . MET A 1 141 ? -19.554 -8.868  -4.660  1.00 0.00 ? 193 MET A HA   1  
ATOM 2224  H HB2  . MET A 1 141 ? -17.144 -8.145  -6.376  1.00 0.00 ? 193 MET A HB2  1  
ATOM 2225  H HB3  . MET A 1 141 ? -18.853 -7.996  -6.843  1.00 0.00 ? 193 MET A HB3  1  
ATOM 2226  H HG2  . MET A 1 141 ? -17.482 -6.545  -4.565  1.00 0.00 ? 193 MET A HG2  1  
ATOM 2227  H HG3  . MET A 1 141 ? -17.918 -5.831  -6.122  1.00 0.00 ? 193 MET A HG3  1  
ATOM 2228  H HE1  . MET A 1 141 ? -20.244 -4.111  -3.437  1.00 0.00 ? 193 MET A HE1  1  
ATOM 2229  H HE2  . MET A 1 141 ? -18.589 -4.711  -3.194  1.00 0.00 ? 193 MET A HE2  1  
ATOM 2230  H HE3  . MET A 1 141 ? -19.011 -3.849  -4.694  1.00 0.00 ? 193 MET A HE3  1  
ATOM 2231  N N    . ASP A 1 142 ? -17.427 -11.184 -5.348  1.00 0.00 ? 194 ASP A N    1  
ATOM 2232  C CA   . ASP A 1 142 ? -17.311 -12.531 -5.870  1.00 0.00 ? 194 ASP A CA   1  
ATOM 2233  C C    . ASP A 1 142 ? -17.971 -13.560 -4.950  1.00 0.00 ? 194 ASP A C    1  
ATOM 2234  O O    . ASP A 1 142 ? -18.154 -14.707 -5.354  1.00 0.00 ? 194 ASP A O    1  
ATOM 2235  C CB   . ASP A 1 142 ? -15.833 -12.828 -6.117  1.00 0.00 ? 194 ASP A CB   1  
ATOM 2236  C CG   . ASP A 1 142 ? -15.614 -14.227 -6.690  1.00 0.00 ? 194 ASP A CG   1  
ATOM 2237  O OD1  . ASP A 1 142 ? -16.072 -14.456 -7.833  1.00 0.00 ? 194 ASP A OD1  1  
ATOM 2238  O OD2  . ASP A 1 142 ? -14.994 -15.052 -5.983  1.00 0.00 ? 194 ASP A OD2  1  
ATOM 2239  H H    . ASP A 1 142 ? -16.685 -10.834 -4.757  1.00 0.00 ? 194 ASP A H    1  
ATOM 2240  H HA   . ASP A 1 142 ? -17.839 -12.566 -6.823  1.00 0.00 ? 194 ASP A HA   1  
ATOM 2241  H HB2  . ASP A 1 142 ? -15.439 -12.098 -6.825  1.00 0.00 ? 194 ASP A HB2  1  
ATOM 2242  H HB3  . ASP A 1 142 ? -15.290 -12.716 -5.177  1.00 0.00 ? 194 ASP A HB3  1  
ATOM 2243  N N    . ARG A 1 143 ? -18.334 -13.173 -3.721  1.00 0.00 ? 195 ARG A N    1  
ATOM 2244  C CA   . ARG A 1 143 ? -19.002 -14.082 -2.795  1.00 0.00 ? 195 ARG A CA   1  
ATOM 2245  C C    . ARG A 1 143 ? -20.523 -13.970 -2.856  1.00 0.00 ? 195 ARG A C    1  
ATOM 2246  O O    . ARG A 1 143 ? -21.205 -14.877 -2.381  1.00 0.00 ? 195 ARG A O    1  
ATOM 2247  C CB   . ARG A 1 143 ? -18.496 -13.822 -1.376  1.00 0.00 ? 195 ARG A CB   1  
ATOM 2248  C CG   . ARG A 1 143 ? -17.067 -14.340 -1.247  1.00 0.00 ? 195 ARG A CG   1  
ATOM 2249  C CD   . ARG A 1 143 ? -16.501 -13.956 0.120   1.00 0.00 ? 195 ARG A CD   1  
ATOM 2250  N NE   . ARG A 1 143 ? -15.123 -14.434 0.274   1.00 0.00 ? 195 ARG A NE   1  
ATOM 2251  C CZ   . ARG A 1 143 ? -14.439 -14.387 1.422   1.00 0.00 ? 195 ARG A CZ   1  
ATOM 2252  N NH1  . ARG A 1 143 ? -14.992 -13.886 2.525   1.00 0.00 ? 195 ARG A NH1  1  
ATOM 2253  N NH2  . ARG A 1 143 ? -13.190 -14.843 1.468   1.00 0.00 ? 195 ARG A NH2  1  
ATOM 2254  H H    . ARG A 1 143 ? -18.146 -12.231 -3.410  1.00 0.00 ? 195 ARG A H    1  
ATOM 2255  H HA   . ARG A 1 143 ? -18.746 -15.107 -3.062  1.00 0.00 ? 195 ARG A HA   1  
ATOM 2256  H HB2  . ARG A 1 143 ? -18.529 -12.754 -1.165  1.00 0.00 ? 195 ARG A HB2  1  
ATOM 2257  H HB3  . ARG A 1 143 ? -19.129 -14.349 -0.661  1.00 0.00 ? 195 ARG A HB3  1  
ATOM 2258  H HG2  . ARG A 1 143 ? -17.064 -15.424 -1.356  1.00 0.00 ? 195 ARG A HG2  1  
ATOM 2259  H HG3  . ARG A 1 143 ? -16.454 -13.904 -2.036  1.00 0.00 ? 195 ARG A HG3  1  
ATOM 2260  H HD2  . ARG A 1 143 ? -16.519 -12.870 0.220   1.00 0.00 ? 195 ARG A HD2  1  
ATOM 2261  H HD3  . ARG A 1 143 ? -17.125 -14.395 0.898   1.00 0.00 ? 195 ARG A HD3  1  
ATOM 2262  H HE   . ARG A 1 143 ? -14.672 -14.823 -0.541  1.00 0.00 ? 195 ARG A HE   1  
ATOM 2263  H HH11 . ARG A 1 143 ? -15.938 -13.533 2.500   1.00 0.00 ? 195 ARG A HH11 1  
ATOM 2264  H HH12 . ARG A 1 143 ? -14.466 -13.859 3.387   1.00 0.00 ? 195 ARG A HH12 1  
ATOM 2265  H HH21 . ARG A 1 143 ? -12.760 -15.228 0.639   1.00 0.00 ? 195 ARG A HH21 1  
ATOM 2266  H HH22 . ARG A 1 143 ? -12.669 -14.807 2.333   1.00 0.00 ? 195 ARG A HH22 1  
ATOM 2267  N N    . LEU A 1 144 ? -21.068 -12.889 -3.424  1.00 0.00 ? 196 LEU A N    1  
ATOM 2268  C CA   . LEU A 1 144 ? -22.518 -12.732 -3.527  1.00 0.00 ? 196 LEU A CA   1  
ATOM 2269  C C    . LEU A 1 144 ? -23.031 -12.349 -4.922  1.00 0.00 ? 196 LEU A C    1  
ATOM 2270  O O    . LEU A 1 144 ? -24.205 -12.578 -5.204  1.00 0.00 ? 196 LEU A O    1  
ATOM 2271  C CB   . LEU A 1 144 ? -22.996 -11.740 -2.459  1.00 0.00 ? 196 LEU A CB   1  
ATOM 2272  C CG   . LEU A 1 144 ? -22.048 -10.554 -2.230  1.00 0.00 ? 196 LEU A CG   1  
ATOM 2273  C CD1  . LEU A 1 144 ? -21.749 -9.779  -3.506  1.00 0.00 ? 196 LEU A CD1  1  
ATOM 2274  C CD2  . LEU A 1 144 ? -22.699 -9.574  -1.259  1.00 0.00 ? 196 LEU A CD2  1  
ATOM 2275  H H    . LEU A 1 144 ? -20.478 -12.153 -3.785  1.00 0.00 ? 196 LEU A H    1  
ATOM 2276  H HA   . LEU A 1 144 ? -22.979 -13.693 -3.298  1.00 0.00 ? 196 LEU A HA   1  
ATOM 2277  H HB2  . LEU A 1 144 ? -23.983 -11.368 -2.738  1.00 0.00 ? 196 LEU A HB2  1  
ATOM 2278  H HB3  . LEU A 1 144 ? -23.091 -12.277 -1.516  1.00 0.00 ? 196 LEU A HB3  1  
ATOM 2279  H HG   . LEU A 1 144 ? -21.112 -10.917 -1.806  1.00 0.00 ? 196 LEU A HG   1  
ATOM 2280  H HD11 . LEU A 1 144 ? -22.687 -9.569  -4.018  1.00 0.00 ? 196 LEU A HD11 1  
ATOM 2281  H HD12 . LEU A 1 144 ? -21.252 -8.842  -3.253  1.00 0.00 ? 196 LEU A HD12 1  
ATOM 2282  H HD13 . LEU A 1 144 ? -21.091 -10.363 -4.149  1.00 0.00 ? 196 LEU A HD13 1  
ATOM 2283  H HD21 . LEU A 1 144 ? -23.614 -9.184  -1.706  1.00 0.00 ? 196 LEU A HD21 1  
ATOM 2284  H HD22 . LEU A 1 144 ? -22.930 -10.081 -0.322  1.00 0.00 ? 196 LEU A HD22 1  
ATOM 2285  H HD23 . LEU A 1 144 ? -22.013 -8.749  -1.069  1.00 0.00 ? 196 LEU A HD23 1  
ATOM 2286  N N    . TYR A 1 145 ? -22.192 -11.778 -5.792  1.00 0.00 ? 197 TYR A N    1  
ATOM 2287  C CA   . TYR A 1 145 ? -22.588 -11.348 -7.130  1.00 0.00 ? 197 TYR A CA   1  
ATOM 2288  C C    . TYR A 1 145 ? -21.469 -11.659 -8.128  1.00 0.00 ? 197 TYR A C    1  
ATOM 2289  O O    . TYR A 1 145 ? -21.153 -10.842 -8.992  1.00 0.00 ? 197 TYR A O    1  
ATOM 2290  C CB   . TYR A 1 145 ? -22.929 -9.852  -7.128  1.00 0.00 ? 197 TYR A CB   1  
ATOM 2291  C CG   . TYR A 1 145 ? -24.120 -9.446  -6.283  1.00 0.00 ? 197 TYR A CG   1  
ATOM 2292  C CD1  . TYR A 1 145 ? -25.306 -10.195 -6.317  1.00 0.00 ? 197 TYR A CD1  1  
ATOM 2293  C CD2  . TYR A 1 145 ? -24.037 -8.311  -5.463  1.00 0.00 ? 197 TYR A CD2  1  
ATOM 2294  C CE1  . TYR A 1 145 ? -26.389 -9.837  -5.502  1.00 0.00 ? 197 TYR A CE1  1  
ATOM 2295  C CE2  . TYR A 1 145 ? -25.118 -7.942  -4.650  1.00 0.00 ? 197 TYR A CE2  1  
ATOM 2296  C CZ   . TYR A 1 145 ? -26.299 -8.709  -4.662  1.00 0.00 ? 197 TYR A CZ   1  
ATOM 2297  O OH   . TYR A 1 145 ? -27.351 -8.364  -3.867  1.00 0.00 ? 197 TYR A OH   1  
ATOM 2298  H H    . TYR A 1 145 ? -21.231 -11.625 -5.524  1.00 0.00 ? 197 TYR A H    1  
ATOM 2299  H HA   . TYR A 1 145 ? -23.470 -11.911 -7.435  1.00 0.00 ? 197 TYR A HA   1  
ATOM 2300  H HB2  . TYR A 1 145 ? -22.054 -9.300  -6.785  1.00 0.00 ? 197 TYR A HB2  1  
ATOM 2301  H HB3  . TYR A 1 145 ? -23.134 -9.543  -8.152  1.00 0.00 ? 197 TYR A HB3  1  
ATOM 2302  H HD1  . TYR A 1 145 ? -25.392 -11.051 -6.970  1.00 0.00 ? 197 TYR A HD1  1  
ATOM 2303  H HD2  . TYR A 1 145 ? -23.135 -7.718  -5.453  1.00 0.00 ? 197 TYR A HD2  1  
ATOM 2304  H HE1  . TYR A 1 145 ? -27.294 -10.425 -5.519  1.00 0.00 ? 197 TYR A HE1  1  
ATOM 2305  H HE2  . TYR A 1 145 ? -25.044 -7.071  -4.016  1.00 0.00 ? 197 TYR A HE2  1  
ATOM 2306  H HH   . TYR A 1 145 ? -27.178 -7.583  -3.337  1.00 0.00 ? 197 TYR A HH   1  
ATOM 2307  N N    . GLY A 1 146 ? -20.867 -12.846 -8.001  1.00 0.00 ? 198 GLY A N    1  
ATOM 2308  C CA   . GLY A 1 146 ? -19.701 -13.241 -8.781  1.00 0.00 ? 198 GLY A CA   1  
ATOM 2309  C C    . GLY A 1 146 ? -19.945 -13.250 -10.287 1.00 0.00 ? 198 GLY A C    1  
ATOM 2310  O O    . GLY A 1 146 ? -21.084 -13.226 -10.750 1.00 0.00 ? 198 GLY A O    1  
ATOM 2311  H H    . GLY A 1 146 ? -21.228 -13.510 -7.331  1.00 0.00 ? 198 GLY A H    1  
ATOM 2312  H HA2  . GLY A 1 146 ? -18.892 -12.540 -8.575  1.00 0.00 ? 198 GLY A HA2  1  
ATOM 2313  H HA3  . GLY A 1 146 ? -19.377 -14.234 -8.470  1.00 0.00 ? 198 GLY A HA3  1  
ATOM 2314  N N    . GLY A 1 147 ? -18.848 -13.284 -11.049 1.00 0.00 ? 199 GLY A N    1  
ATOM 2315  C CA   . GLY A 1 147 ? -18.876 -13.200 -12.504 1.00 0.00 ? 199 GLY A CA   1  
ATOM 2316  C C    . GLY A 1 147 ? -17.977 -12.069 -13.006 1.00 0.00 ? 199 GLY A C    1  
ATOM 2317  O O    . GLY A 1 147 ? -18.016 -11.729 -14.188 1.00 0.00 ? 199 GLY A O    1  
ATOM 2318  H H    . GLY A 1 147 ? -17.946 -13.371 -10.603 1.00 0.00 ? 199 GLY A H    1  
ATOM 2319  H HA2  . GLY A 1 147 ? -18.522 -14.144 -12.917 1.00 0.00 ? 199 GLY A HA2  1  
ATOM 2320  H HA3  . GLY A 1 147 ? -19.897 -13.018 -12.841 1.00 0.00 ? 199 GLY A HA3  1  
ATOM 2321  N N    . VAL A 1 148 ? -17.169 -11.486 -12.112 1.00 0.00 ? 200 VAL A N    1  
ATOM 2322  C CA   . VAL A 1 148 ? -16.286 -10.373 -12.437 1.00 0.00 ? 200 VAL A CA   1  
ATOM 2323  C C    . VAL A 1 148 ? -15.197 -10.801 -13.421 1.00 0.00 ? 200 VAL A C    1  
ATOM 2324  O O    . VAL A 1 148 ? -14.767 -11.954 -13.408 1.00 0.00 ? 200 VAL A O    1  
ATOM 2325  C CB   . VAL A 1 148 ? -15.701 -9.789  -11.146 1.00 0.00 ? 200 VAL A CB   1  
ATOM 2326  C CG1  . VAL A 1 148 ? -14.692 -10.741 -10.503 1.00 0.00 ? 200 VAL A CG1  1  
ATOM 2327  C CG2  . VAL A 1 148 ? -15.015 -8.451  -11.417 1.00 0.00 ? 200 VAL A CG2  1  
ATOM 2328  H H    . VAL A 1 148 ? -17.163 -11.825 -11.161 1.00 0.00 ? 200 VAL A H    1  
ATOM 2329  H HA   . VAL A 1 148 ? -16.886 -9.592  -12.906 1.00 0.00 ? 200 VAL A HA   1  
ATOM 2330  H HB   . VAL A 1 148 ? -16.518 -9.620  -10.444 1.00 0.00 ? 200 VAL A HB   1  
ATOM 2331  H HG11 . VAL A 1 148 ? -13.839 -10.875 -11.167 1.00 0.00 ? 200 VAL A HG11 1  
ATOM 2332  H HG12 . VAL A 1 148 ? -14.347 -10.319 -9.559  1.00 0.00 ? 200 VAL A HG12 1  
ATOM 2333  H HG13 . VAL A 1 148 ? -15.163 -11.706 -10.316 1.00 0.00 ? 200 VAL A HG13 1  
ATOM 2334  H HG21 . VAL A 1 148 ? -14.688 -8.016  -10.472 1.00 0.00 ? 200 VAL A HG21 1  
ATOM 2335  H HG22 . VAL A 1 148 ? -14.146 -8.602  -12.057 1.00 0.00 ? 200 VAL A HG22 1  
ATOM 2336  H HG23 . VAL A 1 148 ? -15.716 -7.770  -11.901 1.00 0.00 ? 200 VAL A HG23 1  
ATOM 2337  N N    . CYS A 1 149 ? -14.753 -9.871  -14.273 1.00 0.00 ? 201 CYS A N    1  
ATOM 2338  C CA   . CYS A 1 149 ? -13.676 -10.135 -15.219 1.00 0.00 ? 201 CYS A CA   1  
ATOM 2339  C C    . CYS A 1 149 ? -12.447 -9.287  -14.885 1.00 0.00 ? 201 CYS A C    1  
ATOM 2340  O O    . CYS A 1 149 ? -11.320 -9.701  -15.152 1.00 0.00 ? 201 CYS A O    1  
ATOM 2341  C CB   . CYS A 1 149 ? -14.167 -9.853  -16.638 1.00 0.00 ? 201 CYS A CB   1  
ATOM 2342  S SG   . CYS A 1 149 ? -15.616 -10.881 -17.000 1.00 0.00 ? 201 CYS A SG   1  
ATOM 2343  H H    . CYS A 1 149 ? -15.168 -8.950  -14.273 1.00 0.00 ? 201 CYS A H    1  
ATOM 2344  H HA   . CYS A 1 149 ? -13.392 -11.186 -15.157 1.00 0.00 ? 201 CYS A HA   1  
ATOM 2345  H HB2  . CYS A 1 149 ? -14.435 -8.800  -16.732 1.00 0.00 ? 201 CYS A HB2  1  
ATOM 2346  H HB3  . CYS A 1 149 ? -13.372 -10.083 -17.346 1.00 0.00 ? 201 CYS A HB3  1  
ATOM 2347  H HG   . CYS A 1 149 ? -15.017 -12.057 -16.799 1.00 0.00 ? 201 CYS A HG   1  
ATOM 2348  N N    . TYR A 1 150 ? -12.665 -8.103  -14.306 1.00 0.00 ? 202 TYR A N    1  
ATOM 2349  C CA   . TYR A 1 150 ? -11.581 -7.260  -13.826 1.00 0.00 ? 202 TYR A CA   1  
ATOM 2350  C C    . TYR A 1 150 ? -12.038 -6.456  -12.612 1.00 0.00 ? 202 TYR A C    1  
ATOM 2351  O O    . TYR A 1 150 ? -13.214 -6.118  -12.489 1.00 0.00 ? 202 TYR A O    1  
ATOM 2352  C CB   . TYR A 1 150 ? -11.125 -6.315  -14.940 1.00 0.00 ? 202 TYR A CB   1  
ATOM 2353  C CG   . TYR A 1 150 ? -10.305 -5.151  -14.427 1.00 0.00 ? 202 TYR A CG   1  
ATOM 2354  C CD1  . TYR A 1 150 ? -8.932  -5.306  -14.181 1.00 0.00 ? 202 TYR A CD1  1  
ATOM 2355  C CD2  . TYR A 1 150 ? -10.926 -3.915  -14.194 1.00 0.00 ? 202 TYR A CD2  1  
ATOM 2356  C CE1  . TYR A 1 150 ? -8.180  -4.230  -13.688 1.00 0.00 ? 202 TYR A CE1  1  
ATOM 2357  C CE2  . TYR A 1 150 ? -10.181 -2.835  -13.700 1.00 0.00 ? 202 TYR A CE2  1  
ATOM 2358  C CZ   . TYR A 1 150 ? -8.805  -2.990  -13.441 1.00 0.00 ? 202 TYR A CZ   1  
ATOM 2359  O OH   . TYR A 1 150 ? -8.079  -1.944  -12.954 1.00 0.00 ? 202 TYR A OH   1  
ATOM 2360  H H    . TYR A 1 150 ? -13.610 -7.769  -14.187 1.00 0.00 ? 202 TYR A H    1  
ATOM 2361  H HA   . TYR A 1 150 ? -10.737 -7.882  -13.528 1.00 0.00 ? 202 TYR A HA   1  
ATOM 2362  H HB2  . TYR A 1 150 ? -10.542 -6.878  -15.667 1.00 0.00 ? 202 TYR A HB2  1  
ATOM 2363  H HB3  . TYR A 1 150 ? -12.007 -5.919  -15.442 1.00 0.00 ? 202 TYR A HB3  1  
ATOM 2364  H HD1  . TYR A 1 150 ? -8.454  -6.256  -14.369 1.00 0.00 ? 202 TYR A HD1  1  
ATOM 2365  H HD2  . TYR A 1 150 ? -11.980 -3.795  -14.395 1.00 0.00 ? 202 TYR A HD2  1  
ATOM 2366  H HE1  . TYR A 1 150 ? -7.125  -4.347  -13.496 1.00 0.00 ? 202 TYR A HE1  1  
ATOM 2367  H HE2  . TYR A 1 150 ? -10.662 -1.886  -13.517 1.00 0.00 ? 202 TYR A HE2  1  
ATOM 2368  H HH   . TYR A 1 150 ? -8.604  -1.151  -12.824 1.00 0.00 ? 202 TYR A HH   1  
ATOM 2369  N N    . ALA A 1 151 ? -11.095 -6.156  -11.718 1.00 0.00 ? 203 ALA A N    1  
ATOM 2370  C CA   . ALA A 1 151 ? -11.342 -5.357  -10.532 1.00 0.00 ? 203 ALA A CA   1  
ATOM 2371  C C    . ALA A 1 151 ? -10.068 -4.611  -10.140 1.00 0.00 ? 203 ALA A C    1  
ATOM 2372  O O    . ALA A 1 151 ? -8.970  -5.013  -10.517 1.00 0.00 ? 203 ALA A O    1  
ATOM 2373  C CB   . ALA A 1 151 ? -11.805 -6.277  -9.403  1.00 0.00 ? 203 ALA A CB   1  
ATOM 2374  H H    . ALA A 1 151 ? -10.154 -6.493  -11.860 1.00 0.00 ? 203 ALA A H    1  
ATOM 2375  H HA   . ALA A 1 151 ? -12.123 -4.626  -10.741 1.00 0.00 ? 203 ALA A HA   1  
ATOM 2376  H HB1  . ALA A 1 151 ? -12.730 -6.772  -9.696  1.00 0.00 ? 203 ALA A HB1  1  
ATOM 2377  H HB2  . ALA A 1 151 ? -11.042 -7.031  -9.209  1.00 0.00 ? 203 ALA A HB2  1  
ATOM 2378  H HB3  . ALA A 1 151 ? -11.976 -5.694  -8.498  1.00 0.00 ? 203 ALA A HB3  1  
ATOM 2379  N N    . GLY A 1 152 ? -10.203 -3.521  -9.383  1.00 0.00 ? 204 GLY A N    1  
ATOM 2380  C CA   . GLY A 1 152 ? -9.057  -2.795  -8.861  1.00 0.00 ? 204 GLY A CA   1  
ATOM 2381  C C    . GLY A 1 152 ? -9.510  -1.580  -8.058  1.00 0.00 ? 204 GLY A C    1  
ATOM 2382  O O    . GLY A 1 152 ? -10.706 -1.371  -7.865  1.00 0.00 ? 204 GLY A O    1  
ATOM 2383  H H    . GLY A 1 152 ? -11.125 -3.173  -9.159  1.00 0.00 ? 204 GLY A H    1  
ATOM 2384  H HA2  . GLY A 1 152 ? -8.469  -3.451  -8.219  1.00 0.00 ? 204 GLY A HA2  1  
ATOM 2385  H HA3  . GLY A 1 152 ? -8.431  -2.462  -9.688  1.00 0.00 ? 204 GLY A HA3  1  
ATOM 2386  N N    . ILE A 1 153 ? -8.556  -0.772  -7.588  1.00 0.00 ? 205 ILE A N    1  
ATOM 2387  C CA   . ILE A 1 153 ? -8.880  0.436   -6.843  1.00 0.00 ? 205 ILE A CA   1  
ATOM 2388  C C    . ILE A 1 153 ? -8.335  1.682   -7.543  1.00 0.00 ? 205 ILE A C    1  
ATOM 2389  O O    . ILE A 1 153 ? -7.421  1.604   -8.360  1.00 0.00 ? 205 ILE A O    1  
ATOM 2390  C CB   . ILE A 1 153 ? -8.448  0.310   -5.374  1.00 0.00 ? 205 ILE A CB   1  
ATOM 2391  C CG1  . ILE A 1 153 ? -7.048  -0.284  -5.171  1.00 0.00 ? 205 ILE A CG1  1  
ATOM 2392  C CG2  . ILE A 1 153 ? -9.447  -0.595  -4.649  1.00 0.00 ? 205 ILE A CG2  1  
ATOM 2393  C CD1  . ILE A 1 153 ? -5.963  0.581   -5.806  1.00 0.00 ? 205 ILE A CD1  1  
ATOM 2394  H H    . ILE A 1 153 ? -7.582  -0.988  -7.743  1.00 0.00 ? 205 ILE A H    1  
ATOM 2395  H HA   . ILE A 1 153 ? -9.964  0.544   -6.837  1.00 0.00 ? 205 ILE A HA   1  
ATOM 2396  H HB   . ILE A 1 153 ? -8.484  1.296   -4.912  1.00 0.00 ? 205 ILE A HB   1  
ATOM 2397  H HG12 . ILE A 1 153 ? -6.853  -0.348  -4.100  1.00 0.00 ? 205 ILE A HG12 1  
ATOM 2398  H HG13 . ILE A 1 153 ? -6.999  -1.288  -5.592  1.00 0.00 ? 205 ILE A HG13 1  
ATOM 2399  H HG21 . ILE A 1 153 ? -9.433  -1.591  -5.093  1.00 0.00 ? 205 ILE A HG21 1  
ATOM 2400  H HG22 . ILE A 1 153 ? -9.178  -0.666  -3.595  1.00 0.00 ? 205 ILE A HG22 1  
ATOM 2401  H HG23 . ILE A 1 153 ? -10.450 -0.179  -4.735  1.00 0.00 ? 205 ILE A HG23 1  
ATOM 2402  H HD11 . ILE A 1 153 ? -6.104  1.623   -5.519  1.00 0.00 ? 205 ILE A HD11 1  
ATOM 2403  H HD12 . ILE A 1 153 ? -4.987  0.243   -5.458  1.00 0.00 ? 205 ILE A HD12 1  
ATOM 2404  H HD13 . ILE A 1 153 ? -5.998  0.480   -6.890  1.00 0.00 ? 205 ILE A HD13 1  
ATOM 2405  N N    . ASP A 1 154 ? -8.911  2.842   -7.214  1.00 0.00 ? 206 ASP A N    1  
ATOM 2406  C CA   . ASP A 1 154 ? -8.498  4.105   -7.806  1.00 0.00 ? 206 ASP A CA   1  
ATOM 2407  C C    . ASP A 1 154 ? -7.093  4.464   -7.340  1.00 0.00 ? 206 ASP A C    1  
ATOM 2408  O O    . ASP A 1 154 ? -6.782  4.361   -6.154  1.00 0.00 ? 206 ASP A O    1  
ATOM 2409  C CB   . ASP A 1 154 ? -9.496  5.204   -7.446  1.00 0.00 ? 206 ASP A CB   1  
ATOM 2410  C CG   . ASP A 1 154 ? -9.126  6.524   -8.118  1.00 0.00 ? 206 ASP A CG   1  
ATOM 2411  O OD1  . ASP A 1 154 ? -9.132  6.553   -9.369  1.00 0.00 ? 206 ASP A OD1  1  
ATOM 2412  O OD2  . ASP A 1 154 ? -8.838  7.490   -7.376  1.00 0.00 ? 206 ASP A OD2  1  
ATOM 2413  H H    . ASP A 1 154 ? -9.660  2.854   -6.538  1.00 0.00 ? 206 ASP A H    1  
ATOM 2414  H HA   . ASP A 1 154 ? -8.488  3.992   -8.890  1.00 0.00 ? 206 ASP A HA   1  
ATOM 2415  H HB2  . ASP A 1 154 ? -10.493 4.906   -7.767  1.00 0.00 ? 206 ASP A HB2  1  
ATOM 2416  H HB3  . ASP A 1 154 ? -9.501  5.344   -6.365  1.00 0.00 ? 206 ASP A HB3  1  
ATOM 2417  N N    . THR A 1 155 ? -6.246  4.887   -8.283  1.00 0.00 ? 207 THR A N    1  
ATOM 2418  C CA   . THR A 1 155 ? -4.847  5.179   -8.008  1.00 0.00 ? 207 THR A CA   1  
ATOM 2419  C C    . THR A 1 155 ? -4.382  6.475   -8.650  1.00 0.00 ? 207 THR A C    1  
ATOM 2420  O O    . THR A 1 155 ? -4.981  6.983   -9.596  1.00 0.00 ? 207 THR A O    1  
ATOM 2421  C CB   . THR A 1 155 ? -3.939  4.048   -8.499  1.00 0.00 ? 207 THR A CB   1  
ATOM 2422  O OG1  . THR A 1 155 ? -4.395  3.531   -9.730  1.00 0.00 ? 207 THR A OG1  1  
ATOM 2423  C CG2  . THR A 1 155 ? -3.885  2.933   -7.465  1.00 0.00 ? 207 THR A CG2  1  
ATOM 2424  H H    . THR A 1 155 ? -6.581  5.006   -9.228  1.00 0.00 ? 207 THR A H    1  
ATOM 2425  H HA   . THR A 1 155 ? -4.713  5.282   -6.931  1.00 0.00 ? 207 THR A HA   1  
ATOM 2426  H HB   . THR A 1 155 ? -2.929  4.435   -8.629  1.00 0.00 ? 207 THR A HB   1  
ATOM 2427  H HG1  . THR A 1 155 ? -5.247  3.114   -9.584  1.00 0.00 ? 207 THR A HG1  1  
ATOM 2428  H HG21 . THR A 1 155 ? -3.239  2.132   -7.824  1.00 0.00 ? 207 THR A HG21 1  
ATOM 2429  H HG22 . THR A 1 155 ? -3.471  3.339   -6.542  1.00 0.00 ? 207 THR A HG22 1  
ATOM 2430  H HG23 . THR A 1 155 ? -4.890  2.554   -7.281  1.00 0.00 ? 207 THR A HG23 1  
ATOM 2431  N N    . ASP A 1 156 ? -3.287  6.992   -8.097  1.00 0.00 ? 208 ASP A N    1  
ATOM 2432  C CA   . ASP A 1 156 ? -2.584  8.154   -8.596  1.00 0.00 ? 208 ASP A CA   1  
ATOM 2433  C C    . ASP A 1 156 ? -1.575  7.695   -9.638  1.00 0.00 ? 208 ASP A C    1  
ATOM 2434  O O    . ASP A 1 156 ? -0.743  6.852   -9.308  1.00 0.00 ? 208 ASP A O    1  
ATOM 2435  C CB   . ASP A 1 156 ? -1.824  8.768   -7.423  1.00 0.00 ? 208 ASP A CB   1  
ATOM 2436  C CG   . ASP A 1 156 ? -1.363  10.198  -7.690  1.00 0.00 ? 208 ASP A CG   1  
ATOM 2437  O OD1  . ASP A 1 156 ? -1.446  10.627  -8.861  1.00 0.00 ? 208 ASP A OD1  1  
ATOM 2438  O OD2  . ASP A 1 156 ? -0.931  10.849  -6.713  1.00 0.00 ? 208 ASP A OD2  1  
ATOM 2439  H H    . ASP A 1 156 ? -2.906  6.549   -7.274  1.00 0.00 ? 208 ASP A H    1  
ATOM 2440  H HA   . ASP A 1 156 ? -3.292  8.873   -9.008  1.00 0.00 ? 208 ASP A HA   1  
ATOM 2441  H HB2  . ASP A 1 156 ? -2.470  8.746   -6.545  1.00 0.00 ? 208 ASP A HB2  1  
ATOM 2442  H HB3  . ASP A 1 156 ? -0.961  8.140   -7.198  1.00 0.00 ? 208 ASP A HB3  1  
ATOM 2443  N N    . PRO A 1 157 ? -1.617  8.212   -10.872 1.00 0.00 ? 209 PRO A N    1  
ATOM 2444  C CA   . PRO A 1 157 ? -0.629  7.896   -11.890 1.00 0.00 ? 209 PRO A CA   1  
ATOM 2445  C C    . PRO A 1 157 ? 0.733   8.502   -11.540 1.00 0.00 ? 209 PRO A C    1  
ATOM 2446  O O    . PRO A 1 157 ? 1.712   8.262   -12.246 1.00 0.00 ? 209 PRO A O    1  
ATOM 2447  C CB   . PRO A 1 157 ? -1.192  8.484   -13.185 1.00 0.00 ? 209 PRO A CB   1  
ATOM 2448  C CG   . PRO A 1 157 ? -2.022  9.669   -12.690 1.00 0.00 ? 209 PRO A CG   1  
ATOM 2449  C CD   . PRO A 1 157 ? -2.608  9.138   -11.385 1.00 0.00 ? 209 PRO A CD   1  
ATOM 2450  H HA   . PRO A 1 157 ? -0.524  6.815   -11.988 1.00 0.00 ? 209 PRO A HA   1  
ATOM 2451  H HB2  . PRO A 1 157 ? -0.403  8.799   -13.869 1.00 0.00 ? 209 PRO A HB2  1  
ATOM 2452  H HB3  . PRO A 1 157 ? -1.850  7.756   -13.658 1.00 0.00 ? 209 PRO A HB3  1  
ATOM 2453  H HG2  . PRO A 1 157 ? -1.366  10.512  -12.480 1.00 0.00 ? 209 PRO A HG2  1  
ATOM 2454  H HG3  . PRO A 1 157 ? -2.801  9.945   -13.401 1.00 0.00 ? 209 PRO A HG3  1  
ATOM 2455  H HD2  . PRO A 1 157 ? -2.794  9.959   -10.692 1.00 0.00 ? 209 PRO A HD2  1  
ATOM 2456  H HD3  . PRO A 1 157 ? -3.535  8.600   -11.588 1.00 0.00 ? 209 PRO A HD3  1  
ATOM 2457  N N    . GLU A 1 158 ? 0.805   9.285   -10.458 1.00 0.00 ? 210 GLU A N    1  
ATOM 2458  C CA   . GLU A 1 158 ? 2.043   9.908   -10.018 1.00 0.00 ? 210 GLU A CA   1  
ATOM 2459  C C    . GLU A 1 158 ? 3.012   8.875   -9.456  1.00 0.00 ? 210 GLU A C    1  
ATOM 2460  O O    . GLU A 1 158 ? 4.199   8.902   -9.781  1.00 0.00 ? 210 GLU A O    1  
ATOM 2461  C CB   . GLU A 1 158 ? 1.707   10.924  -8.930  1.00 0.00 ? 210 GLU A CB   1  
ATOM 2462  C CG   . GLU A 1 158 ? 2.897   11.826  -8.601  1.00 0.00 ? 210 GLU A CG   1  
ATOM 2463  C CD   . GLU A 1 158 ? 3.257   12.729  -9.781  1.00 0.00 ? 210 GLU A CD   1  
ATOM 2464  O OE1  . GLU A 1 158 ? 2.534   13.731  -9.984  1.00 0.00 ? 210 GLU A OE1  1  
ATOM 2465  O OE2  . GLU A 1 158 ? 4.251   12.412  -10.472 1.00 0.00 ? 210 GLU A OE2  1  
ATOM 2466  H H    . GLU A 1 158 ? -0.028  9.462   -9.915  1.00 0.00 ? 210 GLU A H    1  
ATOM 2467  H HA   . GLU A 1 158 ? 2.505   10.419  -10.862 1.00 0.00 ? 210 GLU A HA   1  
ATOM 2468  H HB2  . GLU A 1 158 ? 0.865   11.524  -9.272  1.00 0.00 ? 210 GLU A HB2  1  
ATOM 2469  H HB3  . GLU A 1 158 ? 1.406   10.389  -8.029  1.00 0.00 ? 210 GLU A HB3  1  
ATOM 2470  H HG2  . GLU A 1 158 ? 2.640   12.447  -7.742  1.00 0.00 ? 210 GLU A HG2  1  
ATOM 2471  H HG3  . GLU A 1 158 ? 3.754   11.208  -8.331  1.00 0.00 ? 210 GLU A HG3  1  
ATOM 2472  N N    . LEU A 1 159 ? 2.508   7.966   -8.615  1.00 0.00 ? 211 LEU A N    1  
ATOM 2473  C CA   . LEU A 1 159 ? 3.340   6.910   -8.057  1.00 0.00 ? 211 LEU A CA   1  
ATOM 2474  C C    . LEU A 1 159 ? 2.593   5.580   -8.013  1.00 0.00 ? 211 LEU A C    1  
ATOM 2475  O O    . LEU A 1 159 ? 3.039   4.636   -7.361  1.00 0.00 ? 211 LEU A O    1  
ATOM 2476  C CB   . LEU A 1 159 ? 3.920   7.327   -6.700  1.00 0.00 ? 211 LEU A CB   1  
ATOM 2477  C CG   . LEU A 1 159 ? 2.936   7.276   -5.526  1.00 0.00 ? 211 LEU A CG   1  
ATOM 2478  C CD1  . LEU A 1 159 ? 3.718   7.581   -4.252  1.00 0.00 ? 211 LEU A CD1  1  
ATOM 2479  C CD2  . LEU A 1 159 ? 1.784   8.275   -5.655  1.00 0.00 ? 211 LEU A CD2  1  
ATOM 2480  H H    . LEU A 1 159 ? 1.533   8.004   -8.352  1.00 0.00 ? 211 LEU A H    1  
ATOM 2481  H HA   . LEU A 1 159 ? 4.181   6.771   -8.738  1.00 0.00 ? 211 LEU A HA   1  
ATOM 2482  H HB2  . LEU A 1 159 ? 4.742   6.648   -6.471  1.00 0.00 ? 211 LEU A HB2  1  
ATOM 2483  H HB3  . LEU A 1 159 ? 4.327   8.335   -6.783  1.00 0.00 ? 211 LEU A HB3  1  
ATOM 2484  H HG   . LEU A 1 159 ? 2.526   6.268   -5.447  1.00 0.00 ? 211 LEU A HG   1  
ATOM 2485  H HD11 . LEU A 1 159 ? 4.139   8.585   -4.313  1.00 0.00 ? 211 LEU A HD11 1  
ATOM 2486  H HD12 . LEU A 1 159 ? 3.053   7.519   -3.392  1.00 0.00 ? 211 LEU A HD12 1  
ATOM 2487  H HD13 . LEU A 1 159 ? 4.523   6.855   -4.138  1.00 0.00 ? 211 LEU A HD13 1  
ATOM 2488  H HD21 . LEU A 1 159 ? 1.141   7.993   -6.489  1.00 0.00 ? 211 LEU A HD21 1  
ATOM 2489  H HD22 . LEU A 1 159 ? 1.185   8.270   -4.743  1.00 0.00 ? 211 LEU A HD22 1  
ATOM 2490  H HD23 . LEU A 1 159 ? 2.179   9.277   -5.816  1.00 0.00 ? 211 LEU A HD23 1  
ATOM 2491  N N    . LYS A 1 160 ? 1.453   5.515   -8.710  1.00 0.00 ? 212 LYS A N    1  
ATOM 2492  C CA   . LYS A 1 160 ? 0.639   4.308   -8.811  1.00 0.00 ? 212 LYS A CA   1  
ATOM 2493  C C    . LYS A 1 160 ? 0.215   3.832   -7.425  1.00 0.00 ? 212 LYS A C    1  
ATOM 2494  O O    . LYS A 1 160 ? 0.358   2.658   -7.086  1.00 0.00 ? 212 LYS A O    1  
ATOM 2495  C CB   . LYS A 1 160 ? 1.352   3.234   -9.636  1.00 0.00 ? 212 LYS A CB   1  
ATOM 2496  C CG   . LYS A 1 160 ? 1.596   3.723   -11.064 1.00 0.00 ? 212 LYS A CG   1  
ATOM 2497  C CD   . LYS A 1 160 ? 2.260   2.617   -11.886 1.00 0.00 ? 212 LYS A CD   1  
ATOM 2498  C CE   . LYS A 1 160 ? 2.497   3.114   -13.311 1.00 0.00 ? 212 LYS A CE   1  
ATOM 2499  N NZ   . LYS A 1 160 ? 3.114   2.067   -14.145 1.00 0.00 ? 212 LYS A NZ   1  
ATOM 2500  H H    . LYS A 1 160 ? 1.130   6.342   -9.191  1.00 0.00 ? 212 LYS A H    1  
ATOM 2501  H HA   . LYS A 1 160 ? -0.277  4.568   -9.343  1.00 0.00 ? 212 LYS A HA   1  
ATOM 2502  H HB2  . LYS A 1 160 ? 2.308   2.991   -9.170  1.00 0.00 ? 212 LYS A HB2  1  
ATOM 2503  H HB3  . LYS A 1 160 ? 0.733   2.337   -9.668  1.00 0.00 ? 212 LYS A HB3  1  
ATOM 2504  H HG2  . LYS A 1 160 ? 0.645   3.993   -11.522 1.00 0.00 ? 212 LYS A HG2  1  
ATOM 2505  H HG3  . LYS A 1 160 ? 2.247   4.597   -11.046 1.00 0.00 ? 212 LYS A HG3  1  
ATOM 2506  H HD2  . LYS A 1 160 ? 3.213   2.347   -11.432 1.00 0.00 ? 212 LYS A HD2  1  
ATOM 2507  H HD3  . LYS A 1 160 ? 1.609   1.743   -11.907 1.00 0.00 ? 212 LYS A HD3  1  
ATOM 2508  H HE2  . LYS A 1 160 ? 1.543   3.408   -13.750 1.00 0.00 ? 212 LYS A HE2  1  
ATOM 2509  H HE3  . LYS A 1 160 ? 3.150   3.985   -13.280 1.00 0.00 ? 212 LYS A HE3  1  
ATOM 2510  H HZ1  . LYS A 1 160 ? 4.006   1.795   -13.755 1.00 0.00 ? 212 LYS A HZ1  1  
ATOM 2511  H HZ2  . LYS A 1 160 ? 2.511   1.258   -14.184 1.00 0.00 ? 212 LYS A HZ2  1  
ATOM 2512  H HZ3  . LYS A 1 160 ? 3.258   2.418   -15.082 1.00 0.00 ? 212 LYS A HZ3  1  
ATOM 2513  N N    . TYR A 1 161 ? -0.308  4.768   -6.627  1.00 0.00 ? 213 TYR A N    1  
ATOM 2514  C CA   . TYR A 1 161 ? -0.698  4.504   -5.246  1.00 0.00 ? 213 TYR A CA   1  
ATOM 2515  C C    . TYR A 1 161 ? -2.155  4.915   -5.027  1.00 0.00 ? 213 TYR A C    1  
ATOM 2516  O O    . TYR A 1 161 ? -2.599  5.897   -5.619  1.00 0.00 ? 213 TYR A O    1  
ATOM 2517  C CB   . TYR A 1 161 ? 0.252   5.248   -4.306  1.00 0.00 ? 213 TYR A CB   1  
ATOM 2518  C CG   . TYR A 1 161 ? -0.053  5.086   -2.834  1.00 0.00 ? 213 TYR A CG   1  
ATOM 2519  C CD1  . TYR A 1 161 ? -0.949  5.962   -2.206  1.00 0.00 ? 213 TYR A CD1  1  
ATOM 2520  C CD2  . TYR A 1 161 ? 0.562   4.062   -2.100  1.00 0.00 ? 213 TYR A CD2  1  
ATOM 2521  C CE1  . TYR A 1 161 ? -1.246  5.806   -0.845  1.00 0.00 ? 213 TYR A CE1  1  
ATOM 2522  C CE2  . TYR A 1 161 ? 0.272   3.903   -0.738  1.00 0.00 ? 213 TYR A CE2  1  
ATOM 2523  C CZ   . TYR A 1 161 ? -0.637  4.774   -0.105  1.00 0.00 ? 213 TYR A CZ   1  
ATOM 2524  O OH   . TYR A 1 161 ? -0.926  4.619   1.218   1.00 0.00 ? 213 TYR A OH   1  
ATOM 2525  H H    . TYR A 1 161 ? -0.436  5.698   -7.000  1.00 0.00 ? 213 TYR A H    1  
ATOM 2526  H HA   . TYR A 1 161 ? -0.597  3.436   -5.056  1.00 0.00 ? 213 TYR A HA   1  
ATOM 2527  H HB2  . TYR A 1 161 ? 1.264   4.885   -4.486  1.00 0.00 ? 213 TYR A HB2  1  
ATOM 2528  H HB3  . TYR A 1 161 ? 0.215   6.310   -4.552  1.00 0.00 ? 213 TYR A HB3  1  
ATOM 2529  H HD1  . TYR A 1 161 ? -1.412  6.756   -2.774  1.00 0.00 ? 213 TYR A HD1  1  
ATOM 2530  H HD2  . TYR A 1 161 ? 1.259   3.395   -2.586  1.00 0.00 ? 213 TYR A HD2  1  
ATOM 2531  H HE1  . TYR A 1 161 ? -1.943  6.476   -0.364  1.00 0.00 ? 213 TYR A HE1  1  
ATOM 2532  H HE2  . TYR A 1 161 ? 0.745   3.113   -0.172  1.00 0.00 ? 213 TYR A HE2  1  
ATOM 2533  H HH   . TYR A 1 161 ? -0.455  3.886   1.620   1.00 0.00 ? 213 TYR A HH   1  
ATOM 2534  N N    . PRO A 1 162 ? -2.911  4.185   -4.191  1.00 0.00 ? 214 PRO A N    1  
ATOM 2535  C CA   . PRO A 1 162 ? -4.325  4.430   -3.955  1.00 0.00 ? 214 PRO A CA   1  
ATOM 2536  C C    . PRO A 1 162 ? -4.630  5.865   -3.543  1.00 0.00 ? 214 PRO A C    1  
ATOM 2537  O O    . PRO A 1 162 ? -3.847  6.497   -2.836  1.00 0.00 ? 214 PRO A O    1  
ATOM 2538  C CB   . PRO A 1 162 ? -4.737  3.445   -2.859  1.00 0.00 ? 214 PRO A CB   1  
ATOM 2539  C CG   . PRO A 1 162 ? -3.745  2.301   -3.050  1.00 0.00 ? 214 PRO A CG   1  
ATOM 2540  C CD   . PRO A 1 162 ? -2.466  3.045   -3.414  1.00 0.00 ? 214 PRO A CD   1  
ATOM 2541  H HA   . PRO A 1 162 ? -4.870  4.191   -4.867  1.00 0.00 ? 214 PRO A HA   1  
ATOM 2542  H HB2  . PRO A 1 162 ? -4.582  3.898   -1.880  1.00 0.00 ? 214 PRO A HB2  1  
ATOM 2543  H HB3  . PRO A 1 162 ? -5.767  3.112   -2.979  1.00 0.00 ? 214 PRO A HB3  1  
ATOM 2544  H HG2  . PRO A 1 162 ? -3.622  1.704   -2.147  1.00 0.00 ? 214 PRO A HG2  1  
ATOM 2545  H HG3  . PRO A 1 162 ? -4.062  1.686   -3.892  1.00 0.00 ? 214 PRO A HG3  1  
ATOM 2546  H HD2  . PRO A 1 162 ? -1.972  3.389   -2.504  1.00 0.00 ? 214 PRO A HD2  1  
ATOM 2547  H HD3  . PRO A 1 162 ? -1.808  2.396   -3.991  1.00 0.00 ? 214 PRO A HD3  1  
ATOM 2548  N N    . LYS A 1 163 ? -5.779  6.384   -3.987  1.00 0.00 ? 215 LYS A N    1  
ATOM 2549  C CA   . LYS A 1 163 ? -6.187  7.746   -3.666  1.00 0.00 ? 215 LYS A CA   1  
ATOM 2550  C C    . LYS A 1 163 ? -7.638  7.825   -3.184  1.00 0.00 ? 215 LYS A C    1  
ATOM 2551  O O    . LYS A 1 163 ? -8.051  8.877   -2.704  1.00 0.00 ? 215 LYS A O    1  
ATOM 2552  C CB   . LYS A 1 163 ? -5.979  8.645   -4.888  1.00 0.00 ? 215 LYS A CB   1  
ATOM 2553  C CG   . LYS A 1 163 ? -4.508  9.020   -5.110  1.00 0.00 ? 215 LYS A CG   1  
ATOM 2554  C CD   . LYS A 1 163 ? -3.961  9.833   -3.934  1.00 0.00 ? 215 LYS A CD   1  
ATOM 2555  C CE   . LYS A 1 163 ? -2.564  10.346  -4.272  1.00 0.00 ? 215 LYS A CE   1  
ATOM 2556  N NZ   . LYS A 1 163 ? -2.015  11.172  -3.181  1.00 0.00 ? 215 LYS A NZ   1  
ATOM 2557  H H    . LYS A 1 163 ? -6.387  5.821   -4.566  1.00 0.00 ? 215 LYS A H    1  
ATOM 2558  H HA   . LYS A 1 163 ? -5.552  8.113   -2.860  1.00 0.00 ? 215 LYS A HA   1  
ATOM 2559  H HB2  . LYS A 1 163 ? -6.363  8.143   -5.776  1.00 0.00 ? 215 LYS A HB2  1  
ATOM 2560  H HB3  . LYS A 1 163 ? -6.545  9.567   -4.747  1.00 0.00 ? 215 LYS A HB3  1  
ATOM 2561  H HG2  . LYS A 1 163 ? -3.900  8.127   -5.253  1.00 0.00 ? 215 LYS A HG2  1  
ATOM 2562  H HG3  . LYS A 1 163 ? -4.446  9.629   -6.011  1.00 0.00 ? 215 LYS A HG3  1  
ATOM 2563  H HD2  . LYS A 1 163 ? -4.619  10.680  -3.743  1.00 0.00 ? 215 LYS A HD2  1  
ATOM 2564  H HD3  . LYS A 1 163 ? -3.902  9.209   -3.043  1.00 0.00 ? 215 LYS A HD3  1  
ATOM 2565  H HE2  . LYS A 1 163 ? -1.904  9.497   -4.451  1.00 0.00 ? 215 LYS A HE2  1  
ATOM 2566  H HE3  . LYS A 1 163 ? -2.619  10.944  -5.182  1.00 0.00 ? 215 LYS A HE3  1  
ATOM 2567  H HZ1  . LYS A 1 163 ? -1.094  11.502  -3.432  1.00 0.00 ? 215 LYS A HZ1  1  
ATOM 2568  H HZ2  . LYS A 1 163 ? -2.616  11.967  -3.017  1.00 0.00 ? 215 LYS A HZ2  1  
ATOM 2569  H HZ3  . LYS A 1 163 ? -1.951  10.627  -2.334  1.00 0.00 ? 215 LYS A HZ3  1  
ATOM 2570  N N    . GLY A 1 164 ? -8.420  6.746   -3.297  1.00 0.00 ? 216 GLY A N    1  
ATOM 2571  C CA   . GLY A 1 164 ? -9.798  6.765   -2.831  1.00 0.00 ? 216 GLY A CA   1  
ATOM 2572  C C    . GLY A 1 164 ? -10.524 5.461   -3.142  1.00 0.00 ? 216 GLY A C    1  
ATOM 2573  O O    . GLY A 1 164 ? -10.025 4.382   -2.834  1.00 0.00 ? 216 GLY A O    1  
ATOM 2574  H H    . GLY A 1 164 ? -8.071  5.892   -3.710  1.00 0.00 ? 216 GLY A H    1  
ATOM 2575  H HA2  . GLY A 1 164 ? -9.817  6.932   -1.754  1.00 0.00 ? 216 GLY A HA2  1  
ATOM 2576  H HA3  . GLY A 1 164 ? -10.324 7.587   -3.318  1.00 0.00 ? 216 GLY A HA3  1  
ATOM 2577  N N    . ALA A 1 165 ? -11.703 5.601   -3.755  1.00 0.00 ? 217 ALA A N    1  
ATOM 2578  C CA   . ALA A 1 165 ? -12.604 4.542   -4.183  1.00 0.00 ? 217 ALA A CA   1  
ATOM 2579  C C    . ALA A 1 165 ? -11.948 3.520   -5.121  1.00 0.00 ? 217 ALA A C    1  
ATOM 2580  O O    . ALA A 1 165 ? -10.728 3.458   -5.240  1.00 0.00 ? 217 ALA A O    1  
ATOM 2581  C CB   . ALA A 1 165 ? -13.759 5.237   -4.902  1.00 0.00 ? 217 ALA A CB   1  
ATOM 2582  H H    . ALA A 1 165 ? -12.017 6.542   -3.947  1.00 0.00 ? 217 ALA A H    1  
ATOM 2583  H HA   . ALA A 1 165 ? -12.999 4.023   -3.310  1.00 0.00 ? 217 ALA A HA   1  
ATOM 2584  H HB1  . ALA A 1 165 ? -13.364 5.771   -5.766  1.00 0.00 ? 217 ALA A HB1  1  
ATOM 2585  H HB2  . ALA A 1 165 ? -14.495 4.503   -5.229  1.00 0.00 ? 217 ALA A HB2  1  
ATOM 2586  H HB3  . ALA A 1 165 ? -14.233 5.947   -4.225  1.00 0.00 ? 217 ALA A HB3  1  
ATOM 2587  N N    . GLY A 1 166 ? -12.768 2.707   -5.795  1.00 0.00 ? 218 GLY A N    1  
ATOM 2588  C CA   . GLY A 1 166 ? -12.276 1.687   -6.707  1.00 0.00 ? 218 GLY A CA   1  
ATOM 2589  C C    . GLY A 1 166 ? -13.269 1.403   -7.831  1.00 0.00 ? 218 GLY A C    1  
ATOM 2590  O O    . GLY A 1 166 ? -14.265 2.110   -7.984  1.00 0.00 ? 218 GLY A O    1  
ATOM 2591  H H    . GLY A 1 166 ? -13.768 2.793   -5.680  1.00 0.00 ? 218 GLY A H    1  
ATOM 2592  H HA2  . GLY A 1 166 ? -11.341 2.021   -7.155  1.00 0.00 ? 218 GLY A HA2  1  
ATOM 2593  H HA3  . GLY A 1 166 ? -12.094 0.766   -6.153  1.00 0.00 ? 218 GLY A HA3  1  
ATOM 2594  N N    . ARG A 1 167 ? -12.992 0.361   -8.621  1.00 0.00 ? 219 ARG A N    1  
ATOM 2595  C CA   . ARG A 1 167 ? -13.797 0.036   -9.791  1.00 0.00 ? 219 ARG A CA   1  
ATOM 2596  C C    . ARG A 1 167 ? -13.669 -1.435  -10.172 1.00 0.00 ? 219 ARG A C    1  
ATOM 2597  O O    . ARG A 1 167 ? -12.747 -2.122  -9.737  1.00 0.00 ? 219 ARG A O    1  
ATOM 2598  C CB   . ARG A 1 167 ? -13.358 0.914   -10.971 1.00 0.00 ? 219 ARG A CB   1  
ATOM 2599  C CG   . ARG A 1 167 ? -11.883 0.684   -11.321 1.00 0.00 ? 219 ARG A CG   1  
ATOM 2600  C CD   . ARG A 1 167 ? -11.439 1.578   -12.482 1.00 0.00 ? 219 ARG A CD   1  
ATOM 2601  N NE   . ARG A 1 167 ? -12.068 1.186   -13.749 1.00 0.00 ? 219 ARG A NE   1  
ATOM 2602  C CZ   . ARG A 1 167 ? -11.684 1.655   -14.942 1.00 0.00 ? 219 ARG A CZ   1  
ATOM 2603  N NH1  . ARG A 1 167 ? -10.692 2.538   -15.036 1.00 0.00 ? 219 ARG A NH1  1  
ATOM 2604  N NH2  . ARG A 1 167 ? -12.291 1.247   -16.055 1.00 0.00 ? 219 ARG A NH2  1  
ATOM 2605  H H    . ARG A 1 167 ? -12.198 -0.229  -8.414  1.00 0.00 ? 219 ARG A H    1  
ATOM 2606  H HA   . ARG A 1 167 ? -14.845 0.243   -9.573  1.00 0.00 ? 219 ARG A HA   1  
ATOM 2607  H HB2  . ARG A 1 167 ? -13.973 0.678   -11.840 1.00 0.00 ? 219 ARG A HB2  1  
ATOM 2608  H HB3  . ARG A 1 167 ? -13.504 1.962   -10.710 1.00 0.00 ? 219 ARG A HB3  1  
ATOM 2609  H HG2  . ARG A 1 167 ? -11.271 0.921   -10.451 1.00 0.00 ? 219 ARG A HG2  1  
ATOM 2610  H HG3  . ARG A 1 167 ? -11.723 -0.359  -11.591 1.00 0.00 ? 219 ARG A HG3  1  
ATOM 2611  H HD2  . ARG A 1 167 ? -11.692 2.614   -12.252 1.00 0.00 ? 219 ARG A HD2  1  
ATOM 2612  H HD3  . ARG A 1 167 ? -10.358 1.494   -12.588 1.00 0.00 ? 219 ARG A HD3  1  
ATOM 2613  H HE   . ARG A 1 167 ? -12.831 0.524   -13.710 1.00 0.00 ? 219 ARG A HE   1  
ATOM 2614  H HH11 . ARG A 1 167 ? -10.219 2.857   -14.201 1.00 0.00 ? 219 ARG A HH11 1  
ATOM 2615  H HH12 . ARG A 1 167 ? -10.411 2.887   -15.940 1.00 0.00 ? 219 ARG A HH12 1  
ATOM 2616  H HH21 . ARG A 1 167 ? -13.049 0.580   -16.009 1.00 0.00 ? 219 ARG A HH21 1  
ATOM 2617  H HH22 . ARG A 1 167 ? -11.995 1.605   -16.951 1.00 0.00 ? 219 ARG A HH22 1  
ATOM 2618  N N    . VAL A 1 168 ? -14.605 -1.910  -10.993 1.00 0.00 ? 220 VAL A N    1  
ATOM 2619  C CA   . VAL A 1 168 ? -14.575 -3.250  -11.564 1.00 0.00 ? 220 VAL A CA   1  
ATOM 2620  C C    . VAL A 1 168 ? -15.096 -3.180  -12.992 1.00 0.00 ? 220 VAL A C    1  
ATOM 2621  O O    . VAL A 1 168 ? -15.632 -2.156  -13.405 1.00 0.00 ? 220 VAL A O    1  
ATOM 2622  C CB   . VAL A 1 168 ? -15.404 -4.244  -10.738 1.00 0.00 ? 220 VAL A CB   1  
ATOM 2623  C CG1  . VAL A 1 168 ? -14.910 -4.319  -9.300  1.00 0.00 ? 220 VAL A CG1  1  
ATOM 2624  C CG2  . VAL A 1 168 ? -16.885 -3.883  -10.691 1.00 0.00 ? 220 VAL A CG2  1  
ATOM 2625  H H    . VAL A 1 168 ? -15.380 -1.315  -11.248 1.00 0.00 ? 220 VAL A H    1  
ATOM 2626  H HA   . VAL A 1 168 ? -13.543 -3.598  -11.599 1.00 0.00 ? 220 VAL A HA   1  
ATOM 2627  H HB   . VAL A 1 168 ? -15.308 -5.234  -11.183 1.00 0.00 ? 220 VAL A HB   1  
ATOM 2628  H HG11 . VAL A 1 168 ? -13.843 -4.542  -9.294  1.00 0.00 ? 220 VAL A HG11 1  
ATOM 2629  H HG12 . VAL A 1 168 ? -15.089 -3.367  -8.799  1.00 0.00 ? 220 VAL A HG12 1  
ATOM 2630  H HG13 . VAL A 1 168 ? -15.449 -5.107  -8.776  1.00 0.00 ? 220 VAL A HG13 1  
ATOM 2631  H HG21 . VAL A 1 168 ? -17.303 -3.937  -11.696 1.00 0.00 ? 220 VAL A HG21 1  
ATOM 2632  H HG22 . VAL A 1 168 ? -17.406 -4.592  -10.049 1.00 0.00 ? 220 VAL A HG22 1  
ATOM 2633  H HG23 . VAL A 1 168 ? -17.008 -2.877  -10.288 1.00 0.00 ? 220 VAL A HG23 1  
ATOM 2634  N N    . ALA A 1 169 ? -14.942 -4.261  -13.755 1.00 0.00 ? 221 ALA A N    1  
ATOM 2635  C CA   . ALA A 1 169 ? -15.468 -4.319  -15.104 1.00 0.00 ? 221 ALA A CA   1  
ATOM 2636  C C    . ALA A 1 169 ? -16.007 -5.715  -15.399 1.00 0.00 ? 221 ALA A C    1  
ATOM 2637  O O    . ALA A 1 169 ? -15.245 -6.650  -15.647 1.00 0.00 ? 221 ALA A O    1  
ATOM 2638  C CB   . ALA A 1 169 ? -14.384 -3.909  -16.100 1.00 0.00 ? 221 ALA A CB   1  
ATOM 2639  H H    . ALA A 1 169 ? -14.453 -5.070  -13.397 1.00 0.00 ? 221 ALA A H    1  
ATOM 2640  H HA   . ALA A 1 169 ? -16.294 -3.612  -15.187 1.00 0.00 ? 221 ALA A HA   1  
ATOM 2641  H HB1  . ALA A 1 169 ? -13.548 -4.608  -16.046 1.00 0.00 ? 221 ALA A HB1  1  
ATOM 2642  H HB2  . ALA A 1 169 ? -14.796 -3.921  -17.109 1.00 0.00 ? 221 ALA A HB2  1  
ATOM 2643  H HB3  . ALA A 1 169 ? -14.034 -2.904  -15.865 1.00 0.00 ? 221 ALA A HB3  1  
ATOM 2644  N N    . PHE A 1 170 ? -17.336 -5.837  -15.368 1.00 0.00 ? 222 PHE A N    1  
ATOM 2645  C CA   . PHE A 1 170 ? -18.040 -7.027  -15.813 1.00 0.00 ? 222 PHE A CA   1  
ATOM 2646  C C    . PHE A 1 170 ? -19.485 -6.676  -16.168 1.00 0.00 ? 222 PHE A C    1  
ATOM 2647  O O    . PHE A 1 170 ? -20.083 -5.785  -15.567 1.00 0.00 ? 222 PHE A O    1  
ATOM 2648  C CB   . PHE A 1 170 ? -17.967 -8.139  -14.762 1.00 0.00 ? 222 PHE A CB   1  
ATOM 2649  C CG   . PHE A 1 170 ? -18.768 -7.936  -13.488 1.00 0.00 ? 222 PHE A CG   1  
ATOM 2650  C CD1  . PHE A 1 170 ? -18.566 -6.808  -12.679 1.00 0.00 ? 222 PHE A CD1  1  
ATOM 2651  C CD2  . PHE A 1 170 ? -19.716 -8.900  -13.110 1.00 0.00 ? 222 PHE A CD2  1  
ATOM 2652  C CE1  . PHE A 1 170 ? -19.310 -6.646  -11.502 1.00 0.00 ? 222 PHE A CE1  1  
ATOM 2653  C CE2  . PHE A 1 170 ? -20.456 -8.740  -11.932 1.00 0.00 ? 222 PHE A CE2  1  
ATOM 2654  C CZ   . PHE A 1 170 ? -20.254 -7.611  -11.126 1.00 0.00 ? 222 PHE A CZ   1  
ATOM 2655  H H    . PHE A 1 170 ? -17.891 -5.065  -15.027 1.00 0.00 ? 222 PHE A H    1  
ATOM 2656  H HA   . PHE A 1 170 ? -17.548 -7.386  -16.717 1.00 0.00 ? 222 PHE A HA   1  
ATOM 2657  H HB2  . PHE A 1 170 ? -18.310 -9.060  -15.232 1.00 0.00 ? 222 PHE A HB2  1  
ATOM 2658  H HB3  . PHE A 1 170 ? -16.920 -8.276  -14.493 1.00 0.00 ? 222 PHE A HB3  1  
ATOM 2659  H HD1  . PHE A 1 170 ? -17.838 -6.062  -12.958 1.00 0.00 ? 222 PHE A HD1  1  
ATOM 2660  H HD2  . PHE A 1 170 ? -19.877 -9.773  -13.726 1.00 0.00 ? 222 PHE A HD2  1  
ATOM 2661  H HE1  . PHE A 1 170 ? -19.157 -5.776  -10.881 1.00 0.00 ? 222 PHE A HE1  1  
ATOM 2662  H HE2  . PHE A 1 170 ? -21.182 -9.485  -11.643 1.00 0.00 ? 222 PHE A HE2  1  
ATOM 2663  H HZ   . PHE A 1 170 ? -20.822 -7.486  -10.217 1.00 0.00 ? 222 PHE A HZ   1  
ATOM 2664  N N    . SER A 1 171 ? -20.038 -7.390  -17.151 1.00 0.00 ? 223 SER A N    1  
ATOM 2665  C CA   . SER A 1 171 ? -21.396 -7.186  -17.641 1.00 0.00 ? 223 SER A CA   1  
ATOM 2666  C C    . SER A 1 171 ? -21.950 -8.530  -18.126 1.00 0.00 ? 223 SER A C    1  
ATOM 2667  O O    . SER A 1 171 ? -22.829 -8.591  -18.983 1.00 0.00 ? 223 SER A O    1  
ATOM 2668  C CB   . SER A 1 171 ? -21.363 -6.144  -18.763 1.00 0.00 ? 223 SER A CB   1  
ATOM 2669  O OG   . SER A 1 171 ? -22.667 -5.774  -19.158 1.00 0.00 ? 223 SER A OG   1  
ATOM 2670  H H    . SER A 1 171 ? -19.490 -8.115  -17.591 1.00 0.00 ? 223 SER A H    1  
ATOM 2671  H HA   . SER A 1 171 ? -22.007 -6.805  -16.823 1.00 0.00 ? 223 SER A HA   1  
ATOM 2672  H HB2  . SER A 1 171 ? -20.836 -5.258  -18.410 1.00 0.00 ? 223 SER A HB2  1  
ATOM 2673  H HB3  . SER A 1 171 ? -20.827 -6.555  -19.620 1.00 0.00 ? 223 SER A HB3  1  
ATOM 2674  H HG   . SER A 1 171 ? -23.107 -5.364  -18.409 1.00 0.00 ? 223 SER A HG   1  
ATOM 2675  N N    . ASN A 1 172 ? -21.420 -9.620  -17.561 1.00 0.00 ? 224 ASN A N    1  
ATOM 2676  C CA   . ASN A 1 172 ? -21.647 -10.977 -18.030 1.00 0.00 ? 224 ASN A CA   1  
ATOM 2677  C C    . ASN A 1 172 ? -23.066 -11.500 -17.793 1.00 0.00 ? 224 ASN A C    1  
ATOM 2678  O O    . ASN A 1 172 ? -23.589 -12.218 -18.645 1.00 0.00 ? 224 ASN A O    1  
ATOM 2679  C CB   . ASN A 1 172 ? -20.621 -11.871 -17.326 1.00 0.00 ? 224 ASN A CB   1  
ATOM 2680  C CG   . ASN A 1 172 ? -20.950 -13.350 -17.475 1.00 0.00 ? 224 ASN A CG   1  
ATOM 2681  O OD1  . ASN A 1 172 ? -20.777 -13.932 -18.541 1.00 0.00 ? 224 ASN A OD1  1  
ATOM 2682  N ND2  . ASN A 1 172 ? -21.428 -13.959 -16.393 1.00 0.00 ? 224 ASN A ND2  1  
ATOM 2683  H H    . ASN A 1 172 ? -20.810 -9.504  -16.763 1.00 0.00 ? 224 ASN A H    1  
ATOM 2684  H HA   . ASN A 1 172 ? -21.457 -11.012 -19.104 1.00 0.00 ? 224 ASN A HA   1  
ATOM 2685  H HB2  . ASN A 1 172 ? -19.628 -11.676 -17.730 1.00 0.00 ? 224 ASN A HB2  1  
ATOM 2686  H HB3  . ASN A 1 172 ? -20.613 -11.625 -16.264 1.00 0.00 ? 224 ASN A HB3  1  
ATOM 2687  H HD21 . ASN A 1 172 ? -21.533 -13.447 -15.529 1.00 0.00 ? 224 ASN A HD21 1  
ATOM 2688  H HD22 . ASN A 1 172 ? -21.689 -14.934 -16.435 1.00 0.00 ? 224 ASN A HD22 1  
ATOM 2689  N N    . GLN A 1 173 ? -23.701 -11.165 -16.664 1.00 0.00 ? 225 GLN A N    1  
ATOM 2690  C CA   . GLN A 1 173 ? -24.980 -11.778 -16.323 1.00 0.00 ? 225 GLN A CA   1  
ATOM 2691  C C    . GLN A 1 173 ? -25.761 -10.936 -15.312 1.00 0.00 ? 225 GLN A C    1  
ATOM 2692  O O    . GLN A 1 173 ? -25.313 -9.875  -14.875 1.00 0.00 ? 225 GLN A O    1  
ATOM 2693  C CB   . GLN A 1 173 ? -24.675 -13.181 -15.766 1.00 0.00 ? 225 GLN A CB   1  
ATOM 2694  C CG   . GLN A 1 173 ? -25.889 -14.113 -15.705 1.00 0.00 ? 225 GLN A CG   1  
ATOM 2695  C CD   . GLN A 1 173 ? -25.484 -15.549 -15.392 1.00 0.00 ? 225 GLN A CD   1  
ATOM 2696  O OE1  . GLN A 1 173 ? -24.310 -15.851 -15.192 1.00 0.00 ? 225 GLN A OE1  1  
ATOM 2697  N NE2  . GLN A 1 173 ? -26.458 -16.454 -15.345 1.00 0.00 ? 225 GLN A NE2  1  
ATOM 2698  H H    . GLN A 1 173 ? -23.300 -10.490 -16.028 1.00 0.00 ? 225 GLN A H    1  
ATOM 2699  H HA   . GLN A 1 173 ? -25.577 -11.881 -17.228 1.00 0.00 ? 225 GLN A HA   1  
ATOM 2700  H HB2  . GLN A 1 173 ? -23.944 -13.647 -16.427 1.00 0.00 ? 225 GLN A HB2  1  
ATOM 2701  H HB3  . GLN A 1 173 ? -24.233 -13.091 -14.774 1.00 0.00 ? 225 GLN A HB3  1  
ATOM 2702  H HG2  . GLN A 1 173 ? -26.582 -13.780 -14.932 1.00 0.00 ? 225 GLN A HG2  1  
ATOM 2703  H HG3  . GLN A 1 173 ? -26.402 -14.100 -16.667 1.00 0.00 ? 225 GLN A HG3  1  
ATOM 2704  H HE21 . GLN A 1 173 ? -27.415 -16.178 -15.514 1.00 0.00 ? 225 GLN A HE21 1  
ATOM 2705  H HE22 . GLN A 1 173 ? -26.235 -17.418 -15.141 1.00 0.00 ? 225 GLN A HE22 1  
ATOM 2706  N N    . GLN A 1 174 ? -26.947 -11.421 -14.936 1.00 0.00 ? 226 GLN A N    1  
ATOM 2707  C CA   . GLN A 1 174 ? -27.772 -10.773 -13.930 1.00 0.00 ? 226 GLN A CA   1  
ATOM 2708  C C    . GLN A 1 174 ? -27.000 -10.601 -12.617 1.00 0.00 ? 226 GLN A C    1  
ATOM 2709  O O    . GLN A 1 174 ? -27.452 -9.886  -11.728 1.00 0.00 ? 226 GLN A O    1  
ATOM 2710  C CB   . GLN A 1 174 ? -29.025 -11.622 -13.704 1.00 0.00 ? 226 GLN A CB   1  
ATOM 2711  C CG   . GLN A 1 174 ? -30.125 -10.825 -12.999 1.00 0.00 ? 226 GLN A CG   1  
ATOM 2712  C CD   . GLN A 1 174 ? -31.129 -11.761 -12.342 1.00 0.00 ? 226 GLN A CD   1  
ATOM 2713  O OE1  . GLN A 1 174 ? -32.216 -11.997 -12.864 1.00 0.00 ? 226 GLN A OE1  1  
ATOM 2714  N NE2  . GLN A 1 174 ? -30.767 -12.303 -11.181 1.00 0.00 ? 226 GLN A NE2  1  
ATOM 2715  H H    . GLN A 1 174 ? -27.299 -12.271 -15.355 1.00 0.00 ? 226 GLN A H    1  
ATOM 2716  H HA   . GLN A 1 174 ? -28.067 -9.794  -14.306 1.00 0.00 ? 226 GLN A HA   1  
ATOM 2717  H HB2  . GLN A 1 174 ? -29.408 -11.970 -14.663 1.00 0.00 ? 226 GLN A HB2  1  
ATOM 2718  H HB3  . GLN A 1 174 ? -28.755 -12.489 -13.100 1.00 0.00 ? 226 GLN A HB3  1  
ATOM 2719  H HG2  . GLN A 1 174 ? -29.689 -10.192 -12.227 1.00 0.00 ? 226 GLN A HG2  1  
ATOM 2720  H HG3  . GLN A 1 174 ? -30.632 -10.188 -13.724 1.00 0.00 ? 226 GLN A HG3  1  
ATOM 2721  H HE21 . GLN A 1 174 ? -29.866 -12.083 -10.782 1.00 0.00 ? 226 GLN A HE21 1  
ATOM 2722  H HE22 . GLN A 1 174 ? -31.392 -12.935 -10.701 1.00 0.00 ? 226 GLN A HE22 1  
ATOM 2723  N N    . SER A 1 175 ? -25.836 -11.245 -12.473 1.00 0.00 ? 227 SER A N    1  
ATOM 2724  C CA   . SER A 1 175 ? -25.018 -11.063 -11.284 1.00 0.00 ? 227 SER A CA   1  
ATOM 2725  C C    . SER A 1 175 ? -24.476 -9.637  -11.251 1.00 0.00 ? 227 SER A C    1  
ATOM 2726  O O    . SER A 1 175 ? -24.355 -9.044  -10.180 1.00 0.00 ? 227 SER A O    1  
ATOM 2727  C CB   . SER A 1 175 ? -23.871 -12.070 -11.292 1.00 0.00 ? 227 SER A CB   1  
ATOM 2728  O OG   . SER A 1 175 ? -24.387 -13.382 -11.379 1.00 0.00 ? 227 SER A OG   1  
ATOM 2729  H H    . SER A 1 175 ? -25.503 -11.871 -13.194 1.00 0.00 ? 227 SER A H    1  
ATOM 2730  H HA   . SER A 1 175 ? -25.629 -11.229 -10.396 1.00 0.00 ? 227 SER A HA   1  
ATOM 2731  H HB2  . SER A 1 175 ? -23.224 -11.879 -12.147 1.00 0.00 ? 227 SER A HB2  1  
ATOM 2732  H HB3  . SER A 1 175 ? -23.294 -11.966 -10.373 1.00 0.00 ? 227 SER A HB3  1  
ATOM 2733  H HG   . SER A 1 175 ? -23.651 -13.999 -11.358 1.00 0.00 ? 227 SER A HG   1  
ATOM 2734  N N    . TYR A 1 176 ? -24.147 -9.070  -12.418 1.00 0.00 ? 228 TYR A N    1  
ATOM 2735  C CA   . TYR A 1 176 ? -23.695 -7.691  -12.490 1.00 0.00 ? 228 TYR A CA   1  
ATOM 2736  C C    . TYR A 1 176 ? -24.899 -6.772  -12.316 1.00 0.00 ? 228 TYR A C    1  
ATOM 2737  O O    . TYR A 1 176 ? -24.773 -5.688  -11.749 1.00 0.00 ? 228 TYR A O    1  
ATOM 2738  C CB   . TYR A 1 176 ? -22.947 -7.435  -13.806 1.00 0.00 ? 228 TYR A CB   1  
ATOM 2739  C CG   . TYR A 1 176 ? -23.674 -6.564  -14.813 1.00 0.00 ? 228 TYR A CG   1  
ATOM 2740  C CD1  . TYR A 1 176 ? -23.735 -5.178  -14.616 1.00 0.00 ? 228 TYR A CD1  1  
ATOM 2741  C CD2  . TYR A 1 176 ? -24.278 -7.139  -15.941 1.00 0.00 ? 228 TYR A CD2  1  
ATOM 2742  C CE1  . TYR A 1 176 ? -24.387 -4.359  -15.548 1.00 0.00 ? 228 TYR A CE1  1  
ATOM 2743  C CE2  . TYR A 1 176 ? -24.933 -6.327  -16.877 1.00 0.00 ? 228 TYR A CE2  1  
ATOM 2744  C CZ   . TYR A 1 176 ? -24.989 -4.932  -16.687 1.00 0.00 ? 228 TYR A CZ   1  
ATOM 2745  O OH   . TYR A 1 176 ? -25.621 -4.142  -17.600 1.00 0.00 ? 228 TYR A OH   1  
ATOM 2746  H H    . TYR A 1 176 ? -24.210 -9.599  -13.275 1.00 0.00 ? 228 TYR A H    1  
ATOM 2747  H HA   . TYR A 1 176 ? -23.006 -7.512  -11.665 1.00 0.00 ? 228 TYR A HA   1  
ATOM 2748  H HB2  . TYR A 1 176 ? -22.010 -6.934  -13.562 1.00 0.00 ? 228 TYR A HB2  1  
ATOM 2749  H HB3  . TYR A 1 176 ? -22.699 -8.391  -14.269 1.00 0.00 ? 228 TYR A HB3  1  
ATOM 2750  H HD1  . TYR A 1 176 ? -23.278 -4.735  -13.743 1.00 0.00 ? 228 TYR A HD1  1  
ATOM 2751  H HD2  . TYR A 1 176 ? -24.239 -8.207  -16.094 1.00 0.00 ? 228 TYR A HD2  1  
ATOM 2752  H HE1  . TYR A 1 176 ? -24.428 -3.291  -15.394 1.00 0.00 ? 228 TYR A HE1  1  
ATOM 2753  H HE2  . TYR A 1 176 ? -25.396 -6.770  -17.747 1.00 0.00 ? 228 TYR A HE2  1  
ATOM 2754  H HH   . TYR A 1 176 ? -25.599 -3.211  -17.368 1.00 0.00 ? 228 TYR A HH   1  
ATOM 2755  N N    . ILE A 1 177 ? -26.070 -7.201  -12.800 1.00 0.00 ? 229 ILE A N    1  
ATOM 2756  C CA   . ILE A 1 177 ? -27.302 -6.447  -12.598 1.00 0.00 ? 229 ILE A CA   1  
ATOM 2757  C C    . ILE A 1 177 ? -27.644 -6.419  -11.108 1.00 0.00 ? 229 ILE A C    1  
ATOM 2758  O O    . ILE A 1 177 ? -28.215 -5.447  -10.617 1.00 0.00 ? 229 ILE A O    1  
ATOM 2759  C CB   . ILE A 1 177 ? -28.446 -7.096  -13.389 1.00 0.00 ? 229 ILE A CB   1  
ATOM 2760  C CG1  . ILE A 1 177 ? -28.125 -7.199  -14.886 1.00 0.00 ? 229 ILE A CG1  1  
ATOM 2761  C CG2  . ILE A 1 177 ? -29.748 -6.315  -13.188 1.00 0.00 ? 229 ILE A CG2  1  
ATOM 2762  C CD1  . ILE A 1 177 ? -27.968 -5.833  -15.553 1.00 0.00 ? 229 ILE A CD1  1  
ATOM 2763  H H    . ILE A 1 177 ? -26.116 -8.066  -13.319 1.00 0.00 ? 229 ILE A H    1  
ATOM 2764  H HA   . ILE A 1 177 ? -27.159 -5.424  -12.945 1.00 0.00 ? 229 ILE A HA   1  
ATOM 2765  H HB   . ILE A 1 177 ? -28.600 -8.105  -13.007 1.00 0.00 ? 229 ILE A HB   1  
ATOM 2766  H HG12 . ILE A 1 177 ? -27.203 -7.765  -15.021 1.00 0.00 ? 229 ILE A HG12 1  
ATOM 2767  H HG13 . ILE A 1 177 ? -28.932 -7.736  -15.383 1.00 0.00 ? 229 ILE A HG13 1  
ATOM 2768  H HG21 . ILE A 1 177 ? -29.597 -5.266  -13.440 1.00 0.00 ? 229 ILE A HG21 1  
ATOM 2769  H HG22 . ILE A 1 177 ? -30.528 -6.733  -13.824 1.00 0.00 ? 229 ILE A HG22 1  
ATOM 2770  H HG23 . ILE A 1 177 ? -30.062 -6.389  -12.147 1.00 0.00 ? 229 ILE A HG23 1  
ATOM 2771  H HD11 . ILE A 1 177 ? -27.171 -5.273  -15.064 1.00 0.00 ? 229 ILE A HD11 1  
ATOM 2772  H HD12 . ILE A 1 177 ? -27.717 -5.978  -16.604 1.00 0.00 ? 229 ILE A HD12 1  
ATOM 2773  H HD13 . ILE A 1 177 ? -28.901 -5.276  -15.485 1.00 0.00 ? 229 ILE A HD13 1  
ATOM 2774  N N    . ALA A 1 178 ? -27.299 -7.486  -10.383 1.00 0.00 ? 230 ALA A N    1  
ATOM 2775  C CA   . ALA A 1 178 ? -27.630 -7.606  -8.976  1.00 0.00 ? 230 ALA A CA   1  
ATOM 2776  C C    . ALA A 1 178 ? -26.704 -6.771  -8.095  1.00 0.00 ? 230 ALA A C    1  
ATOM 2777  O O    . ALA A 1 178 ? -27.108 -6.382  -7.002  1.00 0.00 ? 230 ALA A O    1  
ATOM 2778  C CB   . ALA A 1 178 ? -27.582 -9.081  -8.588  1.00 0.00 ? 230 ALA A CB   1  
ATOM 2779  H H    . ALA A 1 178 ? -26.794 -8.246  -10.817 1.00 0.00 ? 230 ALA A H    1  
ATOM 2780  H HA   . ALA A 1 178 ? -28.650 -7.252  -8.825  1.00 0.00 ? 230 ALA A HA   1  
ATOM 2781  H HB1  . ALA A 1 178 ? -26.570 -9.465  -8.716  1.00 0.00 ? 230 ALA A HB1  1  
ATOM 2782  H HB2  . ALA A 1 178 ? -27.888 -9.191  -7.548  1.00 0.00 ? 230 ALA A HB2  1  
ATOM 2783  H HB3  . ALA A 1 178 ? -28.268 -9.645  -9.220  1.00 0.00 ? 230 ALA A HB3  1  
ATOM 2784  N N    . ALA A 1 179 ? -25.475 -6.486  -8.542  1.00 0.00 ? 231 ALA A N    1  
ATOM 2785  C CA   . ALA A 1 179 ? -24.554 -5.660  -7.774  1.00 0.00 ? 231 ALA A CA   1  
ATOM 2786  C C    . ALA A 1 179 ? -24.652 -4.189  -8.163  1.00 0.00 ? 231 ALA A C    1  
ATOM 2787  O O    . ALA A 1 179 ? -24.342 -3.324  -7.346  1.00 0.00 ? 231 ALA A O    1  
ATOM 2788  C CB   . ALA A 1 179 ? -23.128 -6.171  -7.985  1.00 0.00 ? 231 ALA A CB   1  
ATOM 2789  H H    . ALA A 1 179 ? -25.163 -6.848  -9.432  1.00 0.00 ? 231 ALA A H    1  
ATOM 2790  H HA   . ALA A 1 179 ? -24.809 -5.733  -6.717  1.00 0.00 ? 231 ALA A HA   1  
ATOM 2791  H HB1  . ALA A 1 179 ? -23.073 -7.227  -7.721  1.00 0.00 ? 231 ALA A HB1  1  
ATOM 2792  H HB2  . ALA A 1 179 ? -22.846 -6.047  -9.031  1.00 0.00 ? 231 ALA A HB2  1  
ATOM 2793  H HB3  . ALA A 1 179 ? -22.438 -5.611  -7.354  1.00 0.00 ? 231 ALA A HB3  1  
ATOM 2794  N N    . ILE A 1 180 ? -25.076 -3.888  -9.396  1.00 0.00 ? 232 ILE A N    1  
ATOM 2795  C CA   . ILE A 1 180 ? -25.181 -2.509  -9.848  1.00 0.00 ? 232 ILE A CA   1  
ATOM 2796  C C    . ILE A 1 180 ? -26.505 -1.891  -9.397  1.00 0.00 ? 232 ILE A C    1  
ATOM 2797  O O    . ILE A 1 180 ? -26.649 -0.670  -9.394  1.00 0.00 ? 232 ILE A O    1  
ATOM 2798  C CB   . ILE A 1 180 ? -24.959 -2.450  -11.363 1.00 0.00 ? 232 ILE A CB   1  
ATOM 2799  C CG1  . ILE A 1 180 ? -24.326 -1.108  -11.735 1.00 0.00 ? 232 ILE A CG1  1  
ATOM 2800  C CG2  . ILE A 1 180 ? -26.265 -2.665  -12.128 1.00 0.00 ? 232 ILE A CG2  1  
ATOM 2801  C CD1  . ILE A 1 180 ? -23.896 -1.098  -13.200 1.00 0.00 ? 232 ILE A CD1  1  
ATOM 2802  H H    . ILE A 1 180 ? -25.330 -4.623  -10.039 1.00 0.00 ? 232 ILE A H    1  
ATOM 2803  H HA   . ILE A 1 180 ? -24.374 -1.950  -9.373  1.00 0.00 ? 232 ILE A HA   1  
ATOM 2804  H HB   . ILE A 1 180 ? -24.255 -3.236  -11.634 1.00 0.00 ? 232 ILE A HB   1  
ATOM 2805  H HG12 . ILE A 1 180 ? -25.037 -0.301  -11.557 1.00 0.00 ? 232 ILE A HG12 1  
ATOM 2806  H HG13 . ILE A 1 180 ? -23.444 -0.949  -11.113 1.00 0.00 ? 232 ILE A HG13 1  
ATOM 2807  H HG21 . ILE A 1 180 ? -26.926 -1.811  -11.974 1.00 0.00 ? 232 ILE A HG21 1  
ATOM 2808  H HG22 . ILE A 1 180 ? -26.057 -2.770  -13.193 1.00 0.00 ? 232 ILE A HG22 1  
ATOM 2809  H HG23 . ILE A 1 180 ? -26.753 -3.572  -11.771 1.00 0.00 ? 232 ILE A HG23 1  
ATOM 2810  H HD11 . ILE A 1 180 ? -24.772 -1.140  -13.847 1.00 0.00 ? 232 ILE A HD11 1  
ATOM 2811  H HD12 . ILE A 1 180 ? -23.347 -0.177  -13.399 1.00 0.00 ? 232 ILE A HD12 1  
ATOM 2812  H HD13 . ILE A 1 180 ? -23.253 -1.954  -13.405 1.00 0.00 ? 232 ILE A HD13 1  
ATOM 2813  N N    . SER A 1 181 ? -27.472 -2.735  -9.014  1.00 0.00 ? 233 SER A N    1  
ATOM 2814  C CA   . SER A 1 181 ? -28.722 -2.273  -8.423  1.00 0.00 ? 233 SER A CA   1  
ATOM 2815  C C    . SER A 1 181 ? -28.666 -2.391  -6.898  1.00 0.00 ? 233 SER A C    1  
ATOM 2816  O O    . SER A 1 181 ? -29.513 -1.826  -6.208  1.00 0.00 ? 233 SER A O    1  
ATOM 2817  C CB   . SER A 1 181 ? -29.894 -3.071  -8.993  1.00 0.00 ? 233 SER A CB   1  
ATOM 2818  O OG   . SER A 1 181 ? -29.998 -2.837  -10.383 1.00 0.00 ? 233 SER A OG   1  
ATOM 2819  H H    . SER A 1 181 ? -27.344 -3.730  -9.129  1.00 0.00 ? 233 SER A H    1  
ATOM 2820  H HA   . SER A 1 181 ? -28.867 -1.223  -8.675  1.00 0.00 ? 233 SER A HA   1  
ATOM 2821  H HB2  . SER A 1 181 ? -29.735 -4.134  -8.809  1.00 0.00 ? 233 SER A HB2  1  
ATOM 2822  H HB3  . SER A 1 181 ? -30.816 -2.756  -8.506  1.00 0.00 ? 233 SER A HB3  1  
ATOM 2823  H HG   . SER A 1 181 ? -30.720 -3.367  -10.727 1.00 0.00 ? 233 SER A HG   1  
ATOM 2824  N N    . ALA A 1 182 ? -27.673 -3.119  -6.377  1.00 0.00 ? 234 ALA A N    1  
ATOM 2825  C CA   . ALA A 1 182 ? -27.455 -3.232  -4.943  1.00 0.00 ? 234 ALA A CA   1  
ATOM 2826  C C    . ALA A 1 182 ? -26.452 -2.159  -4.535  1.00 0.00 ? 234 ALA A C    1  
ATOM 2827  O O    . ALA A 1 182 ? -25.342 -2.455  -4.093  1.00 0.00 ? 234 ALA A O    1  
ATOM 2828  C CB   . ALA A 1 182 ? -26.984 -4.639  -4.581  1.00 0.00 ? 234 ALA A CB   1  
ATOM 2829  H H    . ALA A 1 182 ? -27.036 -3.608  -6.989  1.00 0.00 ? 234 ALA A H    1  
ATOM 2830  H HA   . ALA A 1 182 ? -28.394 -3.039  -4.424  1.00 0.00 ? 234 ALA A HA   1  
ATOM 2831  H HB1  . ALA A 1 182 ? -26.062 -4.868  -5.114  1.00 0.00 ? 234 ALA A HB1  1  
ATOM 2832  H HB2  . ALA A 1 182 ? -26.803 -4.696  -3.506  1.00 0.00 ? 234 ALA A HB2  1  
ATOM 2833  H HB3  . ALA A 1 182 ? -27.755 -5.361  -4.850  1.00 0.00 ? 234 ALA A HB3  1  
ATOM 2834  N N    . ARG A 1 183 ? -26.869 -0.900  -4.694  1.00 0.00 ? 235 ARG A N    1  
ATOM 2835  C CA   . ARG A 1 183 ? -25.997 0.246   -4.478  1.00 0.00 ? 235 ARG A CA   1  
ATOM 2836  C C    . ARG A 1 183 ? -25.682 0.464   -2.998  1.00 0.00 ? 235 ARG A C    1  
ATOM 2837  O O    . ARG A 1 183 ? -24.900 1.351   -2.668  1.00 0.00 ? 235 ARG A O    1  
ATOM 2838  C CB   . ARG A 1 183 ? -26.560 1.492   -5.176  1.00 0.00 ? 235 ARG A CB   1  
ATOM 2839  C CG   . ARG A 1 183 ? -27.600 2.281   -4.373  1.00 0.00 ? 235 ARG A CG   1  
ATOM 2840  C CD   . ARG A 1 183 ? -28.825 1.467   -3.950  1.00 0.00 ? 235 ARG A CD   1  
ATOM 2841  N NE   . ARG A 1 183 ? -29.532 0.884   -5.097  1.00 0.00 ? 235 ARG A NE   1  
ATOM 2842  C CZ   . ARG A 1 183 ? -30.306 1.571   -5.943  1.00 0.00 ? 235 ARG A CZ   1  
ATOM 2843  N NH1  . ARG A 1 183 ? -30.490 2.883   -5.797  1.00 0.00 ? 235 ARG A NH1  1  
ATOM 2844  N NH2  . ARG A 1 183 ? -30.904 0.936   -6.946  1.00 0.00 ? 235 ARG A NH2  1  
ATOM 2845  H H    . ARG A 1 183 ? -27.823 -0.724  -4.976  1.00 0.00 ? 235 ARG A H    1  
ATOM 2846  H HA   . ARG A 1 183 ? -25.052 0.008   -4.968  1.00 0.00 ? 235 ARG A HA   1  
ATOM 2847  H HB2  . ARG A 1 183 ? -25.730 2.168   -5.384  1.00 0.00 ? 235 ARG A HB2  1  
ATOM 2848  H HB3  . ARG A 1 183 ? -26.993 1.197   -6.133  1.00 0.00 ? 235 ARG A HB3  1  
ATOM 2849  H HG2  . ARG A 1 183 ? -27.118 2.677   -3.478  1.00 0.00 ? 235 ARG A HG2  1  
ATOM 2850  H HG3  . ARG A 1 183 ? -27.930 3.127   -4.977  1.00 0.00 ? 235 ARG A HG3  1  
ATOM 2851  H HD2  . ARG A 1 183 ? -28.507 0.672   -3.274  1.00 0.00 ? 235 ARG A HD2  1  
ATOM 2852  H HD3  . ARG A 1 183 ? -29.508 2.118   -3.405  1.00 0.00 ? 235 ARG A HD3  1  
ATOM 2853  H HE   . ARG A 1 183 ? -29.429 -0.108  -5.257  1.00 0.00 ? 235 ARG A HE   1  
ATOM 2854  H HH11 . ARG A 1 183 ? -30.042 3.374   -5.037  1.00 0.00 ? 235 ARG A HH11 1  
ATOM 2855  H HH12 . ARG A 1 183 ? -31.077 3.389   -6.446  1.00 0.00 ? 235 ARG A HH12 1  
ATOM 2856  H HH21 . ARG A 1 183 ? -30.775 -0.059  -7.060  1.00 0.00 ? 235 ARG A HH21 1  
ATOM 2857  H HH22 . ARG A 1 183 ? -31.486 1.448   -7.594  1.00 0.00 ? 235 ARG A HH22 1  
ATOM 2858  N N    . PHE A 1 184 ? -26.287 -0.342  -2.117  1.00 0.00 ? 236 PHE A N    1  
ATOM 2859  C CA   . PHE A 1 184 ? -25.934 -0.382  -0.706  1.00 0.00 ? 236 PHE A CA   1  
ATOM 2860  C C    . PHE A 1 184 ? -26.077 -1.830  -0.242  1.00 0.00 ? 236 PHE A C    1  
ATOM 2861  O O    . PHE A 1 184 ? -27.018 -2.514  -0.646  1.00 0.00 ? 236 PHE A O    1  
ATOM 2862  C CB   . PHE A 1 184 ? -26.865 0.508   0.122   1.00 0.00 ? 236 PHE A CB   1  
ATOM 2863  C CG   . PHE A 1 184 ? -26.881 1.964   -0.278  1.00 0.00 ? 236 PHE A CG   1  
ATOM 2864  C CD1  . PHE A 1 184 ? -25.755 2.773   -0.061  1.00 0.00 ? 236 PHE A CD1  1  
ATOM 2865  C CD2  . PHE A 1 184 ? -28.030 2.507   -0.867  1.00 0.00 ? 236 PHE A CD2  1  
ATOM 2866  C CE1  . PHE A 1 184 ? -25.773 4.117   -0.457  1.00 0.00 ? 236 PHE A CE1  1  
ATOM 2867  C CE2  . PHE A 1 184 ? -28.051 3.852   -1.256  1.00 0.00 ? 236 PHE A CE2  1  
ATOM 2868  C CZ   . PHE A 1 184 ? -26.920 4.654   -1.058  1.00 0.00 ? 236 PHE A CZ   1  
ATOM 2869  H H    . PHE A 1 184 ? -27.017 -0.967  -2.427  1.00 0.00 ? 236 PHE A H    1  
ATOM 2870  H HA   . PHE A 1 184 ? -24.902 -0.056  -0.573  1.00 0.00 ? 236 PHE A HA   1  
ATOM 2871  H HB2  . PHE A 1 184 ? -27.879 0.116   0.039   1.00 0.00 ? 236 PHE A HB2  1  
ATOM 2872  H HB3  . PHE A 1 184 ? -26.566 0.444   1.168   1.00 0.00 ? 236 PHE A HB3  1  
ATOM 2873  H HD1  . PHE A 1 184 ? -24.874 2.361   0.408   1.00 0.00 ? 236 PHE A HD1  1  
ATOM 2874  H HD2  . PHE A 1 184 ? -28.903 1.890   -1.022  1.00 0.00 ? 236 PHE A HD2  1  
ATOM 2875  H HE1  . PHE A 1 184 ? -24.904 4.737   -0.298  1.00 0.00 ? 236 PHE A HE1  1  
ATOM 2876  H HE2  . PHE A 1 184 ? -28.936 4.271   -1.711  1.00 0.00 ? 236 PHE A HE2  1  
ATOM 2877  H HZ   . PHE A 1 184 ? -26.934 5.688   -1.370  1.00 0.00 ? 236 PHE A HZ   1  
ATOM 2878  N N    . VAL A 1 185 ? -25.157 -2.306  0.599   1.00 0.00 ? 237 VAL A N    1  
ATOM 2879  C CA   . VAL A 1 185 ? -25.211 -3.665  1.121   1.00 0.00 ? 237 VAL A CA   1  
ATOM 2880  C C    . VAL A 1 185 ? -24.421 -3.736  2.427   1.00 0.00 ? 237 VAL A C    1  
ATOM 2881  O O    . VAL A 1 185 ? -23.860 -2.732  2.862   1.00 0.00 ? 237 VAL A O    1  
ATOM 2882  C CB   . VAL A 1 185 ? -24.658 -4.637  0.067   1.00 0.00 ? 237 VAL A CB   1  
ATOM 2883  C CG1  . VAL A 1 185 ? -23.145 -4.804  0.203   1.00 0.00 ? 237 VAL A CG1  1  
ATOM 2884  C CG2  . VAL A 1 185 ? -25.321 -6.009  0.190   1.00 0.00 ? 237 VAL A CG2  1  
ATOM 2885  H H    . VAL A 1 185 ? -24.393 -1.715  0.895   1.00 0.00 ? 237 VAL A H    1  
ATOM 2886  H HA   . VAL A 1 185 ? -26.251 -3.924  1.322   1.00 0.00 ? 237 VAL A HA   1  
ATOM 2887  H HB   . VAL A 1 185 ? -24.880 -4.244  -0.925  1.00 0.00 ? 237 VAL A HB   1  
ATOM 2888  H HG11 . VAL A 1 185 ? -22.921 -5.295  1.150   1.00 0.00 ? 237 VAL A HG11 1  
ATOM 2889  H HG12 . VAL A 1 185 ? -22.770 -5.420  -0.613  1.00 0.00 ? 237 VAL A HG12 1  
ATOM 2890  H HG13 . VAL A 1 185 ? -22.666 -3.825  0.175   1.00 0.00 ? 237 VAL A HG13 1  
ATOM 2891  H HG21 . VAL A 1 185 ? -26.402 -5.900  0.101   1.00 0.00 ? 237 VAL A HG21 1  
ATOM 2892  H HG22 . VAL A 1 185 ? -24.960 -6.658  -0.608  1.00 0.00 ? 237 VAL A HG22 1  
ATOM 2893  H HG23 . VAL A 1 185 ? -25.081 -6.463  1.151   1.00 0.00 ? 237 VAL A HG23 1  
ATOM 2894  N N    . GLN A 1 186 ? -24.378 -4.915  3.050   1.00 0.00 ? 238 GLN A N    1  
ATOM 2895  C CA   . GLN A 1 186 ? -23.654 -5.127  4.292   1.00 0.00 ? 238 GLN A CA   1  
ATOM 2896  C C    . GLN A 1 186 ? -22.574 -6.191  4.106   1.00 0.00 ? 238 GLN A C    1  
ATOM 2897  O O    . GLN A 1 186 ? -22.813 -7.203  3.447   1.00 0.00 ? 238 GLN A O    1  
ATOM 2898  C CB   . GLN A 1 186 ? -24.666 -5.526  5.356   1.00 0.00 ? 238 GLN A CB   1  
ATOM 2899  C CG   . GLN A 1 186 ? -24.082 -5.378  6.760   1.00 0.00 ? 238 GLN A CG   1  
ATOM 2900  C CD   . GLN A 1 186 ? -25.021 -5.959  7.806   1.00 0.00 ? 238 GLN A CD   1  
ATOM 2901  O OE1  . GLN A 1 186 ? -25.704 -5.229  8.520   1.00 0.00 ? 238 GLN A OE1  1  
ATOM 2902  N NE2  . GLN A 1 186 ? -25.062 -7.284  7.902   1.00 0.00 ? 238 GLN A NE2  1  
ATOM 2903  H H    . GLN A 1 186 ? -24.866 -5.706  2.654   1.00 0.00 ? 238 GLN A H    1  
ATOM 2904  H HA   . GLN A 1 186 ? -23.183 -4.191  4.592   1.00 0.00 ? 238 GLN A HA   1  
ATOM 2905  H HB2  . GLN A 1 186 ? -25.532 -4.874  5.243   1.00 0.00 ? 238 GLN A HB2  1  
ATOM 2906  H HB3  . GLN A 1 186 ? -24.976 -6.558  5.188   1.00 0.00 ? 238 GLN A HB3  1  
ATOM 2907  H HG2  . GLN A 1 186 ? -23.131 -5.909  6.811   1.00 0.00 ? 238 GLN A HG2  1  
ATOM 2908  H HG3  . GLN A 1 186 ? -23.913 -4.324  6.973   1.00 0.00 ? 238 GLN A HG3  1  
ATOM 2909  H HE21 . GLN A 1 186 ? -24.492 -7.856  7.294   1.00 0.00 ? 238 GLN A HE21 1  
ATOM 2910  H HE22 . GLN A 1 186 ? -25.664 -7.719  8.586   1.00 0.00 ? 238 GLN A HE22 1  
ATOM 2911  N N    . LEU A 1 187 ? -21.391 -5.960  4.687   1.00 0.00 ? 239 LEU A N    1  
ATOM 2912  C CA   . LEU A 1 187 ? -20.228 -6.822  4.498   1.00 0.00 ? 239 LEU A CA   1  
ATOM 2913  C C    . LEU A 1 187 ? -19.619 -7.250  5.830   1.00 0.00 ? 239 LEU A C    1  
ATOM 2914  O O    . LEU A 1 187 ? -19.057 -8.339  5.921   1.00 0.00 ? 239 LEU A O    1  
ATOM 2915  C CB   . LEU A 1 187 ? -19.132 -6.077  3.716   1.00 0.00 ? 239 LEU A CB   1  
ATOM 2916  C CG   . LEU A 1 187 ? -19.436 -5.703  2.261   1.00 0.00 ? 239 LEU A CG   1  
ATOM 2917  C CD1  . LEU A 1 187 ? -20.057 -6.870  1.498   1.00 0.00 ? 239 LEU A CD1  1  
ATOM 2918  C CD2  . LEU A 1 187 ? -20.334 -4.473  2.150   1.00 0.00 ? 239 LEU A CD2  1  
ATOM 2919  H H    . LEU A 1 187 ? -21.291 -5.151  5.284   1.00 0.00 ? 239 LEU A H    1  
ATOM 2920  H HA   . LEU A 1 187 ? -20.516 -7.719  3.949   1.00 0.00 ? 239 LEU A HA   1  
ATOM 2921  H HB2  . LEU A 1 187 ? -18.864 -5.171  4.260   1.00 0.00 ? 239 LEU A HB2  1  
ATOM 2922  H HB3  . LEU A 1 187 ? -18.254 -6.723  3.704   1.00 0.00 ? 239 LEU A HB3  1  
ATOM 2923  H HG   . LEU A 1 187 ? -18.485 -5.454  1.789   1.00 0.00 ? 239 LEU A HG   1  
ATOM 2924  H HD11 . LEU A 1 187 ? -19.425 -7.752  1.605   1.00 0.00 ? 239 LEU A HD11 1  
ATOM 2925  H HD12 . LEU A 1 187 ? -21.050 -7.086  1.893   1.00 0.00 ? 239 LEU A HD12 1  
ATOM 2926  H HD13 . LEU A 1 187 ? -20.143 -6.612  0.443   1.00 0.00 ? 239 LEU A HD13 1  
ATOM 2927  H HD21 . LEU A 1 187 ? -21.317 -4.677  2.574   1.00 0.00 ? 239 LEU A HD21 1  
ATOM 2928  H HD22 . LEU A 1 187 ? -19.876 -3.636  2.677   1.00 0.00 ? 239 LEU A HD22 1  
ATOM 2929  H HD23 . LEU A 1 187 ? -20.451 -4.214  1.097   1.00 0.00 ? 239 LEU A HD23 1  
ATOM 2930  N N    . GLN A 1 188 ? -19.728 -6.401  6.856   1.00 0.00 ? 240 GLN A N    1  
ATOM 2931  C CA   . GLN A 1 188 ? -19.095 -6.635  8.151   1.00 0.00 ? 240 GLN A CA   1  
ATOM 2932  C C    . GLN A 1 188 ? -17.624 -7.035  7.988   1.00 0.00 ? 240 GLN A C    1  
ATOM 2933  O O    . GLN A 1 188 ? -17.155 -7.961  8.651   1.00 0.00 ? 240 GLN A O    1  
ATOM 2934  C CB   . GLN A 1 188 ? -19.894 -7.650  8.973   1.00 0.00 ? 240 GLN A CB   1  
ATOM 2935  C CG   . GLN A 1 188 ? -21.299 -7.128  9.280   1.00 0.00 ? 240 GLN A CG   1  
ATOM 2936  C CD   . GLN A 1 188 ? -22.077 -8.081  10.184  1.00 0.00 ? 240 GLN A CD   1  
ATOM 2937  O OE1  . GLN A 1 188 ? -21.623 -9.178  10.500  1.00 0.00 ? 240 GLN A OE1  1  
ATOM 2938  N NE2  . GLN A 1 188 ? -23.267 -7.667  10.610  1.00 0.00 ? 240 GLN A NE2  1  
ATOM 2939  H H    . GLN A 1 188 ? -20.264 -5.554  6.736   1.00 0.00 ? 240 GLN A H    1  
ATOM 2940  H HA   . GLN A 1 188 ? -19.106 -5.691  8.697   1.00 0.00 ? 240 GLN A HA   1  
ATOM 2941  H HB2  . GLN A 1 188 ? -19.967 -8.589  8.425   1.00 0.00 ? 240 GLN A HB2  1  
ATOM 2942  H HB3  . GLN A 1 188 ? -19.375 -7.828  9.915   1.00 0.00 ? 240 GLN A HB3  1  
ATOM 2943  H HG2  . GLN A 1 188 ? -21.223 -6.160  9.774   1.00 0.00 ? 240 GLN A HG2  1  
ATOM 2944  H HG3  . GLN A 1 188 ? -21.850 -7.000  8.348   1.00 0.00 ? 240 GLN A HG3  1  
ATOM 2945  H HE21 . GLN A 1 188 ? -23.616 -6.760  10.335  1.00 0.00 ? 240 GLN A HE21 1  
ATOM 2946  H HE22 . GLN A 1 188 ? -23.818 -8.265  11.209  1.00 0.00 ? 240 GLN A HE22 1  
ATOM 2947  N N    . HIS A 1 189 ? -16.894 -6.343  7.105   1.00 0.00 ? 241 HIS A N    1  
ATOM 2948  C CA   . HIS A 1 189 ? -15.509 -6.676  6.794   1.00 0.00 ? 241 HIS A CA   1  
ATOM 2949  C C    . HIS A 1 189 ? -14.583 -5.494  7.069   1.00 0.00 ? 241 HIS A C    1  
ATOM 2950  O O    . HIS A 1 189 ? -14.838 -4.381  6.613   1.00 0.00 ? 241 HIS A O    1  
ATOM 2951  C CB   . HIS A 1 189 ? -15.391 -7.109  5.331   1.00 0.00 ? 241 HIS A CB   1  
ATOM 2952  C CG   . HIS A 1 189 ? -13.999 -7.572  4.998   1.00 0.00 ? 241 HIS A CG   1  
ATOM 2953  N ND1  . HIS A 1 189 ? -13.475 -8.832  5.303   1.00 0.00 ? 241 HIS A ND1  1  
ATOM 2954  C CD2  . HIS A 1 189 ? -13.047 -6.832  4.358   1.00 0.00 ? 241 HIS A CD2  1  
ATOM 2955  C CE1  . HIS A 1 189 ? -12.215 -8.814  4.837   1.00 0.00 ? 241 HIS A CE1  1  
ATOM 2956  N NE2  . HIS A 1 189 ? -11.931 -7.630  4.266   1.00 0.00 ? 241 HIS A NE2  1  
ATOM 2957  H H    . HIS A 1 189 ? -17.307 -5.554  6.628   1.00 0.00 ? 241 HIS A H    1  
ATOM 2958  H HA   . HIS A 1 189 ? -15.196 -7.511  7.421   1.00 0.00 ? 241 HIS A HA   1  
ATOM 2959  H HB2  . HIS A 1 189 ? -16.091 -7.919  5.130   1.00 0.00 ? 241 HIS A HB2  1  
ATOM 2960  H HB3  . HIS A 1 189 ? -15.647 -6.266  4.688   1.00 0.00 ? 241 HIS A HB3  1  
ATOM 2961  H HD2  . HIS A 1 189 ? -13.153 -5.819  3.997   1.00 0.00 ? 241 HIS A HD2  1  
ATOM 2962  H HE1  . HIS A 1 189 ? -11.523 -9.639  4.911   1.00 0.00 ? 241 HIS A HE1  1  
ATOM 2963  H HE2  . HIS A 1 189 ? -11.050 -7.375  3.845   1.00 0.00 ? 241 HIS A HE2  1  
ATOM 2964  N N    . GLY A 1 190 ? -13.501 -5.733  7.815   1.00 0.00 ? 242 GLY A N    1  
ATOM 2965  C CA   . GLY A 1 190 ? -12.556 -4.682  8.163   1.00 0.00 ? 242 GLY A CA   1  
ATOM 2966  C C    . GLY A 1 190 ? -13.213 -3.639  9.064   1.00 0.00 ? 242 GLY A C    1  
ATOM 2967  O O    . GLY A 1 190 ? -14.055 -3.971  9.896   1.00 0.00 ? 242 GLY A O    1  
ATOM 2968  H H    . GLY A 1 190 ? -13.324 -6.668  8.157   1.00 0.00 ? 242 GLY A H    1  
ATOM 2969  H HA2  . GLY A 1 190 ? -11.698 -5.112  8.679   1.00 0.00 ? 242 GLY A HA2  1  
ATOM 2970  H HA3  . GLY A 1 190 ? -12.210 -4.198  7.250   1.00 0.00 ? 242 GLY A HA3  1  
ATOM 2971  N N    . GLU A 1 191 ? -12.822 -2.373  8.894   1.00 0.00 ? 243 GLU A N    1  
ATOM 2972  C CA   . GLU A 1 191 ? -13.369 -1.260  9.660   1.00 0.00 ? 243 GLU A CA   1  
ATOM 2973  C C    . GLU A 1 191 ? -14.681 -0.761  9.041   1.00 0.00 ? 243 GLU A C    1  
ATOM 2974  O O    . GLU A 1 191 ? -15.202 0.284   9.429   1.00 0.00 ? 243 GLU A O    1  
ATOM 2975  C CB   . GLU A 1 191 ? -12.305 -0.162  9.763   1.00 0.00 ? 243 GLU A CB   1  
ATOM 2976  C CG   . GLU A 1 191 ? -12.610 0.836   10.884  1.00 0.00 ? 243 GLU A CG   1  
ATOM 2977  C CD   . GLU A 1 191 ? -11.458 1.824   11.055  1.00 0.00 ? 243 GLU A CD   1  
ATOM 2978  O OE1  . GLU A 1 191 ? -11.475 2.863   10.357  1.00 0.00 ? 243 GLU A OE1  1  
ATOM 2979  O OE2  . GLU A 1 191 ? -10.565 1.537   11.885  1.00 0.00 ? 243 GLU A OE2  1  
ATOM 2980  H H    . GLU A 1 191 ? -12.114 -2.163  8.205   1.00 0.00 ? 243 GLU A H    1  
ATOM 2981  H HA   . GLU A 1 191 ? -13.585 -1.623  10.664  1.00 0.00 ? 243 GLU A HA   1  
ATOM 2982  H HB2  . GLU A 1 191 ? -11.345 -0.630  9.981   1.00 0.00 ? 243 GLU A HB2  1  
ATOM 2983  H HB3  . GLU A 1 191 ? -12.228 0.366   8.813   1.00 0.00 ? 243 GLU A HB3  1  
ATOM 2984  H HG2  . GLU A 1 191 ? -13.520 1.391   10.653  1.00 0.00 ? 243 GLU A HG2  1  
ATOM 2985  H HG3  . GLU A 1 191 ? -12.757 0.292   11.817  1.00 0.00 ? 243 GLU A HG3  1  
ATOM 2986  N N    . ILE A 1 192 ? -15.221 -1.510  8.072   1.00 0.00 ? 244 ILE A N    1  
ATOM 2987  C CA   . ILE A 1 192 ? -16.439 -1.152  7.359   1.00 0.00 ? 244 ILE A CA   1  
ATOM 2988  C C    . ILE A 1 192 ? -17.495 -2.232  7.582   1.00 0.00 ? 244 ILE A C    1  
ATOM 2989  O O    . ILE A 1 192 ? -17.165 -3.401  7.769   1.00 0.00 ? 244 ILE A O    1  
ATOM 2990  C CB   . ILE A 1 192 ? -16.120 -0.961  5.869   1.00 0.00 ? 244 ILE A CB   1  
ATOM 2991  C CG1  . ILE A 1 192 ? -15.064 0.143   5.708   1.00 0.00 ? 244 ILE A CG1  1  
ATOM 2992  C CG2  . ILE A 1 192 ? -17.388 -0.604  5.085   1.00 0.00 ? 244 ILE A CG2  1  
ATOM 2993  C CD1  . ILE A 1 192 ? -14.629 0.312   4.252   1.00 0.00 ? 244 ILE A CD1  1  
ATOM 2994  H H    . ILE A 1 192 ? -14.770 -2.374  7.809   1.00 0.00 ? 244 ILE A H    1  
ATOM 2995  H HA   . ILE A 1 192 ? -16.824 -0.211  7.753   1.00 0.00 ? 244 ILE A HA   1  
ATOM 2996  H HB   . ILE A 1 192 ? -15.715 -1.895  5.476   1.00 0.00 ? 244 ILE A HB   1  
ATOM 2997  H HG12 . ILE A 1 192 ? -15.469 1.087   6.073   1.00 0.00 ? 244 ILE A HG12 1  
ATOM 2998  H HG13 . ILE A 1 192 ? -14.183 -0.111  6.297   1.00 0.00 ? 244 ILE A HG13 1  
ATOM 2999  H HG21 . ILE A 1 192 ? -17.811 0.324   5.470   1.00 0.00 ? 244 ILE A HG21 1  
ATOM 3000  H HG22 . ILE A 1 192 ? -17.150 -0.484  4.029   1.00 0.00 ? 244 ILE A HG22 1  
ATOM 3001  H HG23 . ILE A 1 192 ? -18.121 -1.406  5.177   1.00 0.00 ? 244 ILE A HG23 1  
ATOM 3002  H HD11 . ILE A 1 192 ? -13.833 1.055   4.202   1.00 0.00 ? 244 ILE A HD11 1  
ATOM 3003  H HD12 . ILE A 1 192 ? -14.260 -0.639  3.868   1.00 0.00 ? 244 ILE A HD12 1  
ATOM 3004  H HD13 . ILE A 1 192 ? -15.467 0.654   3.646   1.00 0.00 ? 244 ILE A HD13 1  
ATOM 3005  N N    . ASP A 1 193 ? -18.774 -1.851  7.567   1.00 0.00 ? 245 ASP A N    1  
ATOM 3006  C CA   . ASP A 1 193 ? -19.855 -2.800  7.782   1.00 0.00 ? 245 ASP A CA   1  
ATOM 3007  C C    . ASP A 1 193 ? -20.960 -2.690  6.743   1.00 0.00 ? 245 ASP A C    1  
ATOM 3008  O O    . ASP A 1 193 ? -21.574 -3.706  6.420   1.00 0.00 ? 245 ASP A O    1  
ATOM 3009  C CB   . ASP A 1 193 ? -20.476 -2.572  9.162   1.00 0.00 ? 245 ASP A CB   1  
ATOM 3010  C CG   . ASP A 1 193 ? -19.459 -2.738  10.287  1.00 0.00 ? 245 ASP A CG   1  
ATOM 3011  O OD1  . ASP A 1 193 ? -19.175 -3.906  10.640  1.00 0.00 ? 245 ASP A OD1  1  
ATOM 3012  O OD2  . ASP A 1 193 ? -18.973 -1.699  10.787  1.00 0.00 ? 245 ASP A OD2  1  
ATOM 3013  H H    . ASP A 1 193 ? -19.012 -0.883  7.406   1.00 0.00 ? 245 ASP A H    1  
ATOM 3014  H HA   . ASP A 1 193 ? -19.456 -3.814  7.745   1.00 0.00 ? 245 ASP A HA   1  
ATOM 3015  H HB2  . ASP A 1 193 ? -20.912 -1.573  9.195   1.00 0.00 ? 245 ASP A HB2  1  
ATOM 3016  H HB3  . ASP A 1 193 ? -21.288 -3.285  9.306   1.00 0.00 ? 245 ASP A HB3  1  
ATOM 3017  N N    . LYS A 1 194 ? -21.228 -1.491  6.216   1.00 0.00 ? 246 LYS A N    1  
ATOM 3018  C CA   . LYS A 1 194 ? -22.428 -1.294  5.418   1.00 0.00 ? 246 LYS A CA   1  
ATOM 3019  C C    . LYS A 1 194 ? -22.337 -0.082  4.490   1.00 0.00 ? 246 LYS A C    1  
ATOM 3020  O O    . LYS A 1 194 ? -21.333 0.628   4.477   1.00 0.00 ? 246 LYS A O    1  
ATOM 3021  C CB   . LYS A 1 194 ? -23.562 -1.125  6.437   1.00 0.00 ? 246 LYS A CB   1  
ATOM 3022  C CG   . LYS A 1 194 ? -24.953 -1.420  5.882   1.00 0.00 ? 246 LYS A CG   1  
ATOM 3023  C CD   . LYS A 1 194 ? -25.911 -1.626  7.057   1.00 0.00 ? 246 LYS A CD   1  
ATOM 3024  C CE   . LYS A 1 194 ? -25.945 -0.391  7.957   1.00 0.00 ? 246 LYS A CE   1  
ATOM 3025  N NZ   . LYS A 1 194 ? -26.920 -0.558  9.052   1.00 0.00 ? 246 LYS A NZ   1  
ATOM 3026  H H    . LYS A 1 194 ? -20.610 -0.707  6.372   1.00 0.00 ? 246 LYS A H    1  
ATOM 3027  H HA   . LYS A 1 194 ? -22.611 -2.186  4.820   1.00 0.00 ? 246 LYS A HA   1  
ATOM 3028  H HB2  . LYS A 1 194 ? -23.385 -1.825  7.254   1.00 0.00 ? 246 LYS A HB2  1  
ATOM 3029  H HB3  . LYS A 1 194 ? -23.532 -0.114  6.845   1.00 0.00 ? 246 LYS A HB3  1  
ATOM 3030  H HG2  . LYS A 1 194 ? -25.299 -0.589  5.266   1.00 0.00 ? 246 LYS A HG2  1  
ATOM 3031  H HG3  . LYS A 1 194 ? -24.925 -2.333  5.286   1.00 0.00 ? 246 LYS A HG3  1  
ATOM 3032  H HD2  . LYS A 1 194 ? -26.911 -1.827  6.673   1.00 0.00 ? 246 LYS A HD2  1  
ATOM 3033  H HD3  . LYS A 1 194 ? -25.565 -2.478  7.643   1.00 0.00 ? 246 LYS A HD3  1  
ATOM 3034  H HE2  . LYS A 1 194 ? -24.953 -0.233  8.380   1.00 0.00 ? 246 LYS A HE2  1  
ATOM 3035  H HE3  . LYS A 1 194 ? -26.220 0.478   7.359   1.00 0.00 ? 246 LYS A HE3  1  
ATOM 3036  H HZ1  . LYS A 1 194 ? -26.670 -1.357  9.617   1.00 0.00 ? 246 LYS A HZ1  1  
ATOM 3037  H HZ2  . LYS A 1 194 ? -26.928 0.267   9.634   1.00 0.00 ? 246 LYS A HZ2  1  
ATOM 3038  H HZ3  . LYS A 1 194 ? -27.845 -0.698  8.672   1.00 0.00 ? 246 LYS A HZ3  1  
ATOM 3039  N N    . ARG A 1 195 ? -23.411 0.131   3.719   1.00 0.00 ? 247 ARG A N    1  
ATOM 3040  C CA   . ARG A 1 195 ? -23.655 1.273   2.839   1.00 0.00 ? 247 ARG A CA   1  
ATOM 3041  C C    . ARG A 1 195 ? -22.523 1.615   1.870   1.00 0.00 ? 247 ARG A C    1  
ATOM 3042  O O    . ARG A 1 195 ? -22.391 2.768   1.464   1.00 0.00 ? 247 ARG A O    1  
ATOM 3043  C CB   . ARG A 1 195 ? -24.160 2.488   3.625   1.00 0.00 ? 247 ARG A CB   1  
ATOM 3044  C CG   . ARG A 1 195 ? -23.084 3.086   4.533   1.00 0.00 ? 247 ARG A CG   1  
ATOM 3045  C CD   . ARG A 1 195 ? -23.602 4.351   5.210   1.00 0.00 ? 247 ARG A CD   1  
ATOM 3046  N NE   . ARG A 1 195 ? -23.867 5.411   4.231   1.00 0.00 ? 247 ARG A NE   1  
ATOM 3047  C CZ   . ARG A 1 195 ? -24.455 6.573   4.530   1.00 0.00 ? 247 ARG A CZ   1  
ATOM 3048  N NH1  . ARG A 1 195 ? -24.845 6.840   5.776   1.00 0.00 ? 247 ARG A NH1  1  
ATOM 3049  N NH2  . ARG A 1 195 ? -24.656 7.480   3.578   1.00 0.00 ? 247 ARG A NH2  1  
ATOM 3050  H H    . ARG A 1 195 ? -24.140 -0.568  3.747   1.00 0.00 ? 247 ARG A H    1  
ATOM 3051  H HA   . ARG A 1 195 ? -24.485 0.970   2.201   1.00 0.00 ? 247 ARG A HA   1  
ATOM 3052  H HB2  . ARG A 1 195 ? -24.491 3.246   2.916   1.00 0.00 ? 247 ARG A HB2  1  
ATOM 3053  H HB3  . ARG A 1 195 ? -25.013 2.189   4.233   1.00 0.00 ? 247 ARG A HB3  1  
ATOM 3054  H HG2  . ARG A 1 195 ? -22.828 2.357   5.303   1.00 0.00 ? 247 ARG A HG2  1  
ATOM 3055  H HG3  . ARG A 1 195 ? -22.194 3.328   3.953   1.00 0.00 ? 247 ARG A HG3  1  
ATOM 3056  H HD2  . ARG A 1 195 ? -24.518 4.113   5.750   1.00 0.00 ? 247 ARG A HD2  1  
ATOM 3057  H HD3  . ARG A 1 195 ? -22.849 4.698   5.918   1.00 0.00 ? 247 ARG A HD3  1  
ATOM 3058  H HE   . ARG A 1 195 ? -23.584 5.247   3.277   1.00 0.00 ? 247 ARG A HE   1  
ATOM 3059  H HH11 . ARG A 1 195 ? -24.695 6.159   6.506   1.00 0.00 ? 247 ARG A HH11 1  
ATOM 3060  H HH12 . ARG A 1 195 ? -25.290 7.721   5.989   1.00 0.00 ? 247 ARG A HH12 1  
ATOM 3061  H HH21 . ARG A 1 195 ? -24.366 7.291   2.630   1.00 0.00 ? 247 ARG A HH21 1  
ATOM 3062  H HH22 . ARG A 1 195 ? -25.102 8.358   3.804   1.00 0.00 ? 247 ARG A HH22 1  
ATOM 3063  N N    . VAL A 1 196 ? -21.707 0.630   1.491   1.00 0.00 ? 248 VAL A N    1  
ATOM 3064  C CA   . VAL A 1 196 ? -20.715 0.826   0.440   1.00 0.00 ? 248 VAL A CA   1  
ATOM 3065  C C    . VAL A 1 196 ? -21.457 1.018   -0.877  1.00 0.00 ? 248 VAL A C    1  
ATOM 3066  O O    . VAL A 1 196 ? -22.541 0.467   -1.064  1.00 0.00 ? 248 VAL A O    1  
ATOM 3067  C CB   . VAL A 1 196 ? -19.723 -0.338  0.367   1.00 0.00 ? 248 VAL A CB   1  
ATOM 3068  C CG1  . VAL A 1 196 ? -18.964 -0.467  1.687   1.00 0.00 ? 248 VAL A CG1  1  
ATOM 3069  C CG2  . VAL A 1 196 ? -20.422 -1.663  0.060   1.00 0.00 ? 248 VAL A CG2  1  
ATOM 3070  H H    . VAL A 1 196 ? -21.774 -0.279  1.925   1.00 0.00 ? 248 VAL A H    1  
ATOM 3071  H HA   . VAL A 1 196 ? -20.162 1.744   0.636   1.00 0.00 ? 248 VAL A HA   1  
ATOM 3072  H HB   . VAL A 1 196 ? -19.007 -0.131  -0.429  1.00 0.00 ? 248 VAL A HB   1  
ATOM 3073  H HG11 . VAL A 1 196 ? -19.658 -0.697  2.496   1.00 0.00 ? 248 VAL A HG11 1  
ATOM 3074  H HG12 . VAL A 1 196 ? -18.231 -1.269  1.608   1.00 0.00 ? 248 VAL A HG12 1  
ATOM 3075  H HG13 . VAL A 1 196 ? -18.451 0.469   1.907   1.00 0.00 ? 248 VAL A HG13 1  
ATOM 3076  H HG21 . VAL A 1 196 ? -20.943 -1.593  -0.896  1.00 0.00 ? 248 VAL A HG21 1  
ATOM 3077  H HG22 . VAL A 1 196 ? -19.677 -2.455  -0.004  1.00 0.00 ? 248 VAL A HG22 1  
ATOM 3078  H HG23 . VAL A 1 196 ? -21.137 -1.899  0.848   1.00 0.00 ? 248 VAL A HG23 1  
ATOM 3079  N N    . GLU A 1 197 ? -20.882 1.799   -1.792  1.00 0.00 ? 249 GLU A N    1  
ATOM 3080  C CA   . GLU A 1 197 ? -21.581 2.192   -3.003  1.00 0.00 ? 249 GLU A CA   1  
ATOM 3081  C C    . GLU A 1 197 ? -21.141 1.376   -4.213  1.00 0.00 ? 249 GLU A C    1  
ATOM 3082  O O    . GLU A 1 197 ? -19.964 1.051   -4.351  1.00 0.00 ? 249 GLU A O    1  
ATOM 3083  C CB   . GLU A 1 197 ? -21.370 3.684   -3.252  1.00 0.00 ? 249 GLU A CB   1  
ATOM 3084  C CG   . GLU A 1 197 ? -22.129 4.525   -2.229  1.00 0.00 ? 249 GLU A CG   1  
ATOM 3085  C CD   . GLU A 1 197 ? -22.082 6.003   -2.605  1.00 0.00 ? 249 GLU A CD   1  
ATOM 3086  O OE1  . GLU A 1 197 ? -22.734 6.360   -3.613  1.00 0.00 ? 249 GLU A OE1  1  
ATOM 3087  O OE2  . GLU A 1 197 ? -21.395 6.764   -1.888  1.00 0.00 ? 249 GLU A OE2  1  
ATOM 3088  H H    . GLU A 1 197 ? -19.941 2.139   -1.648  1.00 0.00 ? 249 GLU A H    1  
ATOM 3089  H HA   . GLU A 1 197 ? -22.649 2.025   -2.863  1.00 0.00 ? 249 GLU A HA   1  
ATOM 3090  H HB2  . GLU A 1 197 ? -20.307 3.920   -3.212  1.00 0.00 ? 249 GLU A HB2  1  
ATOM 3091  H HB3  . GLU A 1 197 ? -21.747 3.922   -4.247  1.00 0.00 ? 249 GLU A HB3  1  
ATOM 3092  H HG2  . GLU A 1 197 ? -23.169 4.201   -2.199  1.00 0.00 ? 249 GLU A HG2  1  
ATOM 3093  H HG3  . GLU A 1 197 ? -21.688 4.381   -1.242  1.00 0.00 ? 249 GLU A HG3  1  
ATOM 3094  N N    . VAL A 1 198 ? -22.099 1.048   -5.087  1.00 0.00 ? 250 VAL A N    1  
ATOM 3095  C CA   . VAL A 1 198 ? -21.840 0.351   -6.342  1.00 0.00 ? 250 VAL A CA   1  
ATOM 3096  C C    . VAL A 1 198 ? -22.803 0.875   -7.407  1.00 0.00 ? 250 VAL A C    1  
ATOM 3097  O O    . VAL A 1 198 ? -24.014 0.699   -7.279  1.00 0.00 ? 250 VAL A O    1  
ATOM 3098  C CB   . VAL A 1 198 ? -22.017 -1.163  -6.174  1.00 0.00 ? 250 VAL A CB   1  
ATOM 3099  C CG1  . VAL A 1 198 ? -21.528 -1.869  -7.438  1.00 0.00 ? 250 VAL A CG1  1  
ATOM 3100  C CG2  . VAL A 1 198 ? -21.221 -1.714  -4.993  1.00 0.00 ? 250 VAL A CG2  1  
ATOM 3101  H H    . VAL A 1 198 ? -23.057 1.294   -4.881  1.00 0.00 ? 250 VAL A H    1  
ATOM 3102  H HA   . VAL A 1 198 ? -20.814 0.551   -6.652  1.00 0.00 ? 250 VAL A HA   1  
ATOM 3103  H HB   . VAL A 1 198 ? -23.073 -1.388  -6.017  1.00 0.00 ? 250 VAL A HB   1  
ATOM 3104  H HG11 . VAL A 1 198 ? -20.475 -1.639  -7.597  1.00 0.00 ? 250 VAL A HG11 1  
ATOM 3105  H HG12 . VAL A 1 198 ? -21.648 -2.947  -7.322  1.00 0.00 ? 250 VAL A HG12 1  
ATOM 3106  H HG13 . VAL A 1 198 ? -22.108 -1.534  -8.299  1.00 0.00 ? 250 VAL A HG13 1  
ATOM 3107  H HG21 . VAL A 1 198 ? -21.578 -1.270  -4.062  1.00 0.00 ? 250 VAL A HG21 1  
ATOM 3108  H HG22 . VAL A 1 198 ? -21.355 -2.794  -4.943  1.00 0.00 ? 250 VAL A HG22 1  
ATOM 3109  H HG23 . VAL A 1 198 ? -20.164 -1.484  -5.127  1.00 0.00 ? 250 VAL A HG23 1  
ATOM 3110  N N    . LYS A 1 199 ? -22.269 1.517   -8.454  1.00 0.00 ? 251 LYS A N    1  
ATOM 3111  C CA   . LYS A 1 199 ? -23.086 2.128   -9.500  1.00 0.00 ? 251 LYS A CA   1  
ATOM 3112  C C    . LYS A 1 199 ? -22.362 2.073   -10.848 1.00 0.00 ? 251 LYS A C    1  
ATOM 3113  O O    . LYS A 1 199 ? -21.168 1.784   -10.878 1.00 0.00 ? 251 LYS A O    1  
ATOM 3114  C CB   . LYS A 1 199 ? -23.397 3.597   -9.178  1.00 0.00 ? 251 LYS A CB   1  
ATOM 3115  C CG   . LYS A 1 199 ? -24.022 3.854   -7.801  1.00 0.00 ? 251 LYS A CG   1  
ATOM 3116  C CD   . LYS A 1 199 ? -22.972 4.055   -6.699  1.00 0.00 ? 251 LYS A CD   1  
ATOM 3117  C CE   . LYS A 1 199 ? -22.231 5.385   -6.860  1.00 0.00 ? 251 LYS A CE   1  
ATOM 3118  N NZ   . LYS A 1 199 ? -23.068 6.523   -6.434  1.00 0.00 ? 251 LYS A NZ   1  
ATOM 3119  H H    . LYS A 1 199 ? -21.264 1.590   -8.534  1.00 0.00 ? 251 LYS A H    1  
ATOM 3120  H HA   . LYS A 1 199 ? -24.025 1.580   -9.581  1.00 0.00 ? 251 LYS A HA   1  
ATOM 3121  H HB2  . LYS A 1 199 ? -22.487 4.189   -9.277  1.00 0.00 ? 251 LYS A HB2  1  
ATOM 3122  H HB3  . LYS A 1 199 ? -24.105 3.935   -9.935  1.00 0.00 ? 251 LYS A HB3  1  
ATOM 3123  H HG2  . LYS A 1 199 ? -24.632 4.757   -7.856  1.00 0.00 ? 251 LYS A HG2  1  
ATOM 3124  H HG3  . LYS A 1 199 ? -24.676 3.021   -7.543  1.00 0.00 ? 251 LYS A HG3  1  
ATOM 3125  H HD2  . LYS A 1 199 ? -23.464 4.035   -5.727  1.00 0.00 ? 251 LYS A HD2  1  
ATOM 3126  H HD3  . LYS A 1 199 ? -22.240 3.248   -6.735  1.00 0.00 ? 251 LYS A HD3  1  
ATOM 3127  H HE2  . LYS A 1 199 ? -21.335 5.364   -6.241  1.00 0.00 ? 251 LYS A HE2  1  
ATOM 3128  H HE3  . LYS A 1 199 ? -21.934 5.512   -7.901  1.00 0.00 ? 251 LYS A HE3  1  
ATOM 3129  H HZ1  . LYS A 1 199 ? -22.572 7.389   -6.593  1.00 0.00 ? 251 LYS A HZ1  1  
ATOM 3130  H HZ2  . LYS A 1 199 ? -23.933 6.539   -6.953  1.00 0.00 ? 251 LYS A HZ2  1  
ATOM 3131  H HZ3  . LYS A 1 199 ? -23.267 6.445   -5.447  1.00 0.00 ? 251 LYS A HZ3  1  
ATOM 3132  N N    . PRO A 1 200 ? -23.054 2.343   -11.966 1.00 0.00 ? 252 PRO A N    1  
ATOM 3133  C CA   . PRO A 1 200 ? -22.445 2.403   -13.285 1.00 0.00 ? 252 PRO A CA   1  
ATOM 3134  C C    . PRO A 1 200 ? -21.307 3.420   -13.348 1.00 0.00 ? 252 PRO A C    1  
ATOM 3135  O O    . PRO A 1 200 ? -21.253 4.354   -12.551 1.00 0.00 ? 252 PRO A O    1  
ATOM 3136  C CB   . PRO A 1 200 ? -23.573 2.789   -14.247 1.00 0.00 ? 252 PRO A CB   1  
ATOM 3137  C CG   . PRO A 1 200 ? -24.842 2.353   -13.515 1.00 0.00 ? 252 PRO A CG   1  
ATOM 3138  C CD   . PRO A 1 200 ? -24.479 2.604   -12.055 1.00 0.00 ? 252 PRO A CD   1  
ATOM 3139  H HA   . PRO A 1 200 ? -22.063 1.417   -13.549 1.00 0.00 ? 252 PRO A HA   1  
ATOM 3140  H HB2  . PRO A 1 200 ? -23.587 3.871   -14.376 1.00 0.00 ? 252 PRO A HB2  1  
ATOM 3141  H HB3  . PRO A 1 200 ? -23.470 2.287   -15.209 1.00 0.00 ? 252 PRO A HB3  1  
ATOM 3142  H HG2  . PRO A 1 200 ? -25.708 2.938   -13.823 1.00 0.00 ? 252 PRO A HG2  1  
ATOM 3143  H HG3  . PRO A 1 200 ? -25.015 1.289   -13.676 1.00 0.00 ? 252 PRO A HG3  1  
ATOM 3144  H HD2  . PRO A 1 200 ? -24.672 3.651   -11.819 1.00 0.00 ? 252 PRO A HD2  1  
ATOM 3145  H HD3  . PRO A 1 200 ? -25.052 1.948   -11.400 1.00 0.00 ? 252 PRO A HD3  1  
ATOM 3146  N N    . TYR A 1 201 ? -20.396 3.231   -14.306 1.00 0.00 ? 253 TYR A N    1  
ATOM 3147  C CA   . TYR A 1 201 ? -19.253 4.103   -14.491 1.00 0.00 ? 253 TYR A CA   1  
ATOM 3148  C C    . TYR A 1 201 ? -19.648 5.376   -15.242 1.00 0.00 ? 253 TYR A C    1  
ATOM 3149  O O    . TYR A 1 201 ? -20.669 5.405   -15.929 1.00 0.00 ? 253 TYR A O    1  
ATOM 3150  C CB   . TYR A 1 201 ? -18.170 3.324   -15.231 1.00 0.00 ? 253 TYR A CB   1  
ATOM 3151  C CG   . TYR A 1 201 ? -16.842 4.030   -15.298 1.00 0.00 ? 253 TYR A CG   1  
ATOM 3152  C CD1  . TYR A 1 201 ? -16.117 4.263   -14.119 1.00 0.00 ? 253 TYR A CD1  1  
ATOM 3153  C CD2  . TYR A 1 201 ? -16.335 4.452   -16.535 1.00 0.00 ? 253 TYR A CD2  1  
ATOM 3154  C CE1  . TYR A 1 201 ? -14.881 4.919   -14.175 1.00 0.00 ? 253 TYR A CE1  1  
ATOM 3155  C CE2  . TYR A 1 201 ? -15.098 5.105   -16.597 1.00 0.00 ? 253 TYR A CE2  1  
ATOM 3156  C CZ   . TYR A 1 201 ? -14.365 5.342   -15.417 1.00 0.00 ? 253 TYR A CZ   1  
ATOM 3157  O OH   . TYR A 1 201 ? -13.158 5.974   -15.478 1.00 0.00 ? 253 TYR A OH   1  
ATOM 3158  H H    . TYR A 1 201 ? -20.486 2.450   -14.939 1.00 0.00 ? 253 TYR A H    1  
ATOM 3159  H HA   . TYR A 1 201 ? -18.863 4.383   -13.512 1.00 0.00 ? 253 TYR A HA   1  
ATOM 3160  H HB2  . TYR A 1 201 ? -18.021 2.377   -14.710 1.00 0.00 ? 253 TYR A HB2  1  
ATOM 3161  H HB3  . TYR A 1 201 ? -18.518 3.107   -16.241 1.00 0.00 ? 253 TYR A HB3  1  
ATOM 3162  H HD1  . TYR A 1 201 ? -16.510 3.935   -13.169 1.00 0.00 ? 253 TYR A HD1  1  
ATOM 3163  H HD2  . TYR A 1 201 ? -16.896 4.272   -17.439 1.00 0.00 ? 253 TYR A HD2  1  
ATOM 3164  H HE1  . TYR A 1 201 ? -14.331 5.098   -13.264 1.00 0.00 ? 253 TYR A HE1  1  
ATOM 3165  H HE2  . TYR A 1 201 ? -14.710 5.429   -17.551 1.00 0.00 ? 253 TYR A HE2  1  
ATOM 3166  H HH   . TYR A 1 201 ? -12.750 6.084   -14.617 1.00 0.00 ? 253 TYR A HH   1  
ATOM 3167  N N    . VAL A 1 202 ? -18.831 6.427   -15.106 1.00 0.00 ? 254 VAL A N    1  
ATOM 3168  C CA   . VAL A 1 202 ? -19.072 7.722   -15.736 1.00 0.00 ? 254 VAL A CA   1  
ATOM 3169  C C    . VAL A 1 202 ? -17.760 8.281   -16.279 1.00 0.00 ? 254 VAL A C    1  
ATOM 3170  O O    . VAL A 1 202 ? -17.681 8.455   -17.514 1.00 0.00 ? 254 VAL A O    1  
ATOM 3171  C CB   . VAL A 1 202 ? -19.703 8.692   -14.731 1.00 0.00 ? 254 VAL A CB   1  
ATOM 3172  C CG1  . VAL A 1 202 ? -19.979 10.036  -15.405 1.00 0.00 ? 254 VAL A CG1  1  
ATOM 3173  C CG2  . VAL A 1 202 ? -21.029 8.147   -14.197 1.00 0.00 ? 254 VAL A CG2  1  
ATOM 3174  H H    . VAL A 1 202 ? -18.000 6.334   -14.539 1.00 0.00 ? 254 VAL A H    1  
ATOM 3175  H HA   . VAL A 1 202 ? -19.759 7.590   -16.572 1.00 0.00 ? 254 VAL A HA   1  
ATOM 3176  H HB   . VAL A 1 202 ? -19.020 8.844   -13.895 1.00 0.00 ? 254 VAL A HB   1  
ATOM 3177  H HG11 . VAL A 1 202 ? -19.042 10.472  -15.755 1.00 0.00 ? 254 VAL A HG11 1  
ATOM 3178  H HG12 . VAL A 1 202 ? -20.652 9.894   -16.250 1.00 0.00 ? 254 VAL A HG12 1  
ATOM 3179  H HG13 . VAL A 1 202 ? -20.438 10.717  -14.689 1.00 0.00 ? 254 VAL A HG13 1  
ATOM 3180  H HG21 . VAL A 1 202 ? -20.856 7.221   -13.648 1.00 0.00 ? 254 VAL A HG21 1  
ATOM 3181  H HG22 . VAL A 1 202 ? -21.478 8.877   -13.524 1.00 0.00 ? 254 VAL A HG22 1  
ATOM 3182  H HG23 . VAL A 1 202 ? -21.708 7.959   -15.028 1.00 0.00 ? 254 VAL A HG23 1  
ATOM 3183  N N    . SER A 1 1   ? 15.024  -26.054 -12.280 1.00 0.00 ? 53  SER A N    2  
ATOM 3184  C CA   . SER A 1 1   ? 16.350  -26.511 -12.735 1.00 0.00 ? 53  SER A CA   2  
ATOM 3185  C C    . SER A 1 1   ? 17.431  -25.488 -12.402 1.00 0.00 ? 53  SER A C    2  
ATOM 3186  O O    . SER A 1 1   ? 18.339  -25.781 -11.626 1.00 0.00 ? 53  SER A O    2  
ATOM 3187  C CB   . SER A 1 1   ? 16.341  -26.817 -14.231 1.00 0.00 ? 53  SER A CB   2  
ATOM 3188  O OG   . SER A 1 1   ? 15.362  -27.801 -14.501 1.00 0.00 ? 53  SER A OG   2  
ATOM 3189  H H1   . SER A 1 1   ? 15.041  -25.896 -11.282 1.00 0.00 ? 53  SER A H1   2  
ATOM 3190  H H2   . SER A 1 1   ? 14.335  -26.760 -12.494 1.00 0.00 ? 53  SER A H2   2  
ATOM 3191  H H3   . SER A 1 1   ? 14.775  -25.193 -12.749 1.00 0.00 ? 53  SER A H3   2  
ATOM 3192  H HA   . SER A 1 1   ? 16.589  -27.434 -12.206 1.00 0.00 ? 53  SER A HA   2  
ATOM 3193  H HB2  . SER A 1 1   ? 16.107  -25.912 -14.792 1.00 0.00 ? 53  SER A HB2  2  
ATOM 3194  H HB3  . SER A 1 1   ? 17.321  -27.186 -14.534 1.00 0.00 ? 53  SER A HB3  2  
ATOM 3195  H HG   . SER A 1 1   ? 15.375  -27.990 -15.443 1.00 0.00 ? 53  SER A HG   2  
ATOM 3196  N N    . HIS A 1 2   ? 17.339  -24.286 -12.984 1.00 0.00 ? 54  HIS A N    2  
ATOM 3197  C CA   . HIS A 1 2   ? 18.306  -23.219 -12.761 1.00 0.00 ? 54  HIS A CA   2  
ATOM 3198  C C    . HIS A 1 2   ? 17.625  -21.854 -12.841 1.00 0.00 ? 54  HIS A C    2  
ATOM 3199  O O    . HIS A 1 2   ? 16.452  -21.761 -13.201 1.00 0.00 ? 54  HIS A O    2  
ATOM 3200  C CB   . HIS A 1 2   ? 19.421  -23.327 -13.803 1.00 0.00 ? 54  HIS A CB   2  
ATOM 3201  C CG   . HIS A 1 2   ? 18.937  -23.126 -15.216 1.00 0.00 ? 54  HIS A CG   2  
ATOM 3202  N ND1  . HIS A 1 2   ? 18.307  -24.098 -16.001 1.00 0.00 ? 54  HIS A ND1  2  
ATOM 3203  C CD2  . HIS A 1 2   ? 19.044  -21.970 -15.931 1.00 0.00 ? 54  HIS A CD2  2  
ATOM 3204  C CE1  . HIS A 1 2   ? 18.049  -23.493 -17.173 1.00 0.00 ? 54  HIS A CE1  2  
ATOM 3205  N NE2  . HIS A 1 2   ? 18.479  -22.219 -17.160 1.00 0.00 ? 54  HIS A NE2  2  
ATOM 3206  H H    . HIS A 1 2   ? 16.572  -24.090 -13.610 1.00 0.00 ? 54  HIS A H    2  
ATOM 3207  H HA   . HIS A 1 2   ? 18.746  -23.329 -11.770 1.00 0.00 ? 54  HIS A HA   2  
ATOM 3208  H HB2  . HIS A 1 2   ? 20.182  -22.576 -13.585 1.00 0.00 ? 54  HIS A HB2  2  
ATOM 3209  H HB3  . HIS A 1 2   ? 19.883  -24.311 -13.727 1.00 0.00 ? 54  HIS A HB3  2  
ATOM 3210  H HD2  . HIS A 1 2   ? 19.485  -21.042 -15.597 1.00 0.00 ? 54  HIS A HD2  2  
ATOM 3211  H HE1  . HIS A 1 2   ? 17.561  -23.967 -18.011 1.00 0.00 ? 54  HIS A HE1  2  
ATOM 3212  H HE2  . HIS A 1 2   ? 18.399  -21.562 -17.924 1.00 0.00 ? 54  HIS A HE2  2  
ATOM 3213  N N    . GLN A 1 3   ? 18.368  -20.797 -12.504 1.00 0.00 ? 55  GLN A N    2  
ATOM 3214  C CA   . GLN A 1 3   ? 17.868  -19.430 -12.529 1.00 0.00 ? 55  GLN A CA   2  
ATOM 3215  C C    . GLN A 1 3   ? 18.893  -18.508 -13.190 1.00 0.00 ? 55  GLN A C    2  
ATOM 3216  O O    . GLN A 1 3   ? 20.046  -18.891 -13.383 1.00 0.00 ? 55  GLN A O    2  
ATOM 3217  C CB   . GLN A 1 3   ? 17.567  -18.958 -11.103 1.00 0.00 ? 55  GLN A CB   2  
ATOM 3218  C CG   . GLN A 1 3   ? 16.479  -19.807 -10.444 1.00 0.00 ? 55  GLN A CG   2  
ATOM 3219  C CD   . GLN A 1 3   ? 16.124  -19.272 -9.062  1.00 0.00 ? 55  GLN A CD   2  
ATOM 3220  O OE1  . GLN A 1 3   ? 15.078  -18.656 -8.876  1.00 0.00 ? 55  GLN A OE1  2  
ATOM 3221  N NE2  . GLN A 1 3   ? 16.992  -19.501 -8.079  1.00 0.00 ? 55  GLN A NE2  2  
ATOM 3222  H H    . GLN A 1 3   ? 19.326  -20.939 -12.218 1.00 0.00 ? 55  GLN A H    2  
ATOM 3223  H HA   . GLN A 1 3   ? 16.947  -19.390 -13.111 1.00 0.00 ? 55  GLN A HA   2  
ATOM 3224  H HB2  . GLN A 1 3   ? 18.478  -19.013 -10.506 1.00 0.00 ? 55  GLN A HB2  2  
ATOM 3225  H HB3  . GLN A 1 3   ? 17.232  -17.921 -11.136 1.00 0.00 ? 55  GLN A HB3  2  
ATOM 3226  H HG2  . GLN A 1 3   ? 15.586  -19.797 -11.071 1.00 0.00 ? 55  GLN A HG2  2  
ATOM 3227  H HG3  . GLN A 1 3   ? 16.831  -20.834 -10.346 1.00 0.00 ? 55  GLN A HG3  2  
ATOM 3228  H HE21 . GLN A 1 3   ? 17.843  -20.013 -8.261  1.00 0.00 ? 55  GLN A HE21 2  
ATOM 3229  H HE22 . GLN A 1 3   ? 16.794  -19.160 -7.149  1.00 0.00 ? 55  GLN A HE22 2  
ATOM 3230  N N    . ASN A 1 4   ? 18.464  -17.290 -13.534 1.00 0.00 ? 56  ASN A N    2  
ATOM 3231  C CA   . ASN A 1 4   ? 19.322  -16.294 -14.162 1.00 0.00 ? 56  ASN A CA   2  
ATOM 3232  C C    . ASN A 1 4   ? 19.224  -14.952 -13.427 1.00 0.00 ? 56  ASN A C    2  
ATOM 3233  O O    . ASN A 1 4   ? 19.738  -13.938 -13.895 1.00 0.00 ? 56  ASN A O    2  
ATOM 3234  C CB   . ASN A 1 4   ? 18.942  -16.175 -15.642 1.00 0.00 ? 56  ASN A CB   2  
ATOM 3235  C CG   . ASN A 1 4   ? 19.991  -15.432 -16.462 1.00 0.00 ? 56  ASN A CG   2  
ATOM 3236  O OD1  . ASN A 1 4   ? 21.132  -15.266 -16.039 1.00 0.00 ? 56  ASN A OD1  2  
ATOM 3237  N ND2  . ASN A 1 4   ? 19.605  -14.977 -17.651 1.00 0.00 ? 56  ASN A ND2  2  
ATOM 3238  H H    . ASN A 1 4   ? 17.504  -17.036 -13.359 1.00 0.00 ? 56  ASN A H    2  
ATOM 3239  H HA   . ASN A 1 4   ? 20.354  -16.641 -14.095 1.00 0.00 ? 56  ASN A HA   2  
ATOM 3240  H HB2  . ASN A 1 4   ? 18.831  -17.174 -16.062 1.00 0.00 ? 56  ASN A HB2  2  
ATOM 3241  H HB3  . ASN A 1 4   ? 17.986  -15.659 -15.727 1.00 0.00 ? 56  ASN A HB3  2  
ATOM 3242  H HD21 . ASN A 1 4   ? 18.658  -15.129 -17.968 1.00 0.00 ? 56  ASN A HD21 2  
ATOM 3243  H HD22 . ASN A 1 4   ? 20.263  -14.478 -18.233 1.00 0.00 ? 56  ASN A HD22 2  
ATOM 3244  N N    . GLY A 1 5   ? 18.560  -14.944 -12.267 1.00 0.00 ? 57  GLY A N    2  
ATOM 3245  C CA   . GLY A 1 5   ? 18.396  -13.749 -11.453 1.00 0.00 ? 57  GLY A CA   2  
ATOM 3246  C C    . GLY A 1 5   ? 17.501  -14.030 -10.251 1.00 0.00 ? 57  GLY A C    2  
ATOM 3247  O O    . GLY A 1 5   ? 16.784  -15.030 -10.228 1.00 0.00 ? 57  GLY A O    2  
ATOM 3248  H H    . GLY A 1 5   ? 18.146  -15.799 -11.926 1.00 0.00 ? 57  GLY A H    2  
ATOM 3249  H HA2  . GLY A 1 5   ? 19.373  -13.418 -11.100 1.00 0.00 ? 57  GLY A HA2  2  
ATOM 3250  H HA3  . GLY A 1 5   ? 17.951  -12.953 -12.051 1.00 0.00 ? 57  GLY A HA3  2  
ATOM 3251  N N    . GLU A 1 6   ? 17.545  -13.145 -9.254  1.00 0.00 ? 58  GLU A N    2  
ATOM 3252  C CA   . GLU A 1 6   ? 16.754  -13.265 -8.037  1.00 0.00 ? 58  GLU A CA   2  
ATOM 3253  C C    . GLU A 1 6   ? 16.275  -11.886 -7.584  1.00 0.00 ? 58  GLU A C    2  
ATOM 3254  O O    . GLU A 1 6   ? 16.767  -10.866 -8.069  1.00 0.00 ? 58  GLU A O    2  
ATOM 3255  C CB   . GLU A 1 6   ? 17.587  -13.921 -6.931  1.00 0.00 ? 58  GLU A CB   2  
ATOM 3256  C CG   . GLU A 1 6   ? 17.987  -15.351 -7.299  1.00 0.00 ? 58  GLU A CG   2  
ATOM 3257  C CD   . GLU A 1 6   ? 18.723  -16.025 -6.143  1.00 0.00 ? 58  GLU A CD   2  
ATOM 3258  O OE1  . GLU A 1 6   ? 19.950  -15.807 -6.032  1.00 0.00 ? 58  GLU A OE1  2  
ATOM 3259  O OE2  . GLU A 1 6   ? 18.053  -16.756 -5.379  1.00 0.00 ? 58  GLU A OE2  2  
ATOM 3260  H H    . GLU A 1 6   ? 18.154  -12.343 -9.333  1.00 0.00 ? 58  GLU A H    2  
ATOM 3261  H HA   . GLU A 1 6   ? 15.880  -13.887 -8.230  1.00 0.00 ? 58  GLU A HA   2  
ATOM 3262  H HB2  . GLU A 1 6   ? 18.484  -13.329 -6.753  1.00 0.00 ? 58  GLU A HB2  2  
ATOM 3263  H HB3  . GLU A 1 6   ? 16.997  -13.949 -6.015  1.00 0.00 ? 58  GLU A HB3  2  
ATOM 3264  H HG2  . GLU A 1 6   ? 17.090  -15.923 -7.534  1.00 0.00 ? 58  GLU A HG2  2  
ATOM 3265  H HG3  . GLU A 1 6   ? 18.635  -15.335 -8.175  1.00 0.00 ? 58  GLU A HG3  2  
ATOM 3266  N N    . ARG A 1 7   ? 15.313  -11.866 -6.653  1.00 0.00 ? 59  ARG A N    2  
ATOM 3267  C CA   . ARG A 1 7   ? 14.691  -10.650 -6.131  1.00 0.00 ? 59  ARG A CA   2  
ATOM 3268  C C    . ARG A 1 7   ? 13.992  -9.848  -7.236  1.00 0.00 ? 59  ARG A C    2  
ATOM 3269  O O    . ARG A 1 7   ? 14.114  -10.164 -8.419  1.00 0.00 ? 59  ARG A O    2  
ATOM 3270  C CB   . ARG A 1 7   ? 15.747  -9.851  -5.353  1.00 0.00 ? 59  ARG A CB   2  
ATOM 3271  C CG   . ARG A 1 7   ? 15.125  -8.854  -4.370  1.00 0.00 ? 59  ARG A CG   2  
ATOM 3272  C CD   . ARG A 1 7   ? 16.212  -8.148  -3.553  1.00 0.00 ? 59  ARG A CD   2  
ATOM 3273  N NE   . ARG A 1 7   ? 17.027  -9.100  -2.787  1.00 0.00 ? 59  ARG A NE   2  
ATOM 3274  C CZ   . ARG A 1 7   ? 16.627  -9.714  -1.669  1.00 0.00 ? 59  ARG A CZ   2  
ATOM 3275  N NH1  . ARG A 1 7   ? 15.425  -9.483  -1.151  1.00 0.00 ? 59  ARG A NH1  2  
ATOM 3276  N NH2  . ARG A 1 7   ? 17.438  -10.572 -1.056  1.00 0.00 ? 59  ARG A NH2  2  
ATOM 3277  H H    . ARG A 1 7   ? 14.984  -12.746 -6.281  1.00 0.00 ? 59  ARG A H    2  
ATOM 3278  H HA   . ARG A 1 7   ? 13.926  -10.959 -5.419  1.00 0.00 ? 59  ARG A HA   2  
ATOM 3279  H HB2  . ARG A 1 7   ? 16.357  -10.555 -4.787  1.00 0.00 ? 59  ARG A HB2  2  
ATOM 3280  H HB3  . ARG A 1 7   ? 16.392  -9.317  -6.052  1.00 0.00 ? 59  ARG A HB3  2  
ATOM 3281  H HG2  . ARG A 1 7   ? 14.560  -8.098  -4.915  1.00 0.00 ? 59  ARG A HG2  2  
ATOM 3282  H HG3  . ARG A 1 7   ? 14.454  -9.387  -3.696  1.00 0.00 ? 59  ARG A HG3  2  
ATOM 3283  H HD2  . ARG A 1 7   ? 16.858  -7.595  -4.234  1.00 0.00 ? 59  ARG A HD2  2  
ATOM 3284  H HD3  . ARG A 1 7   ? 15.743  -7.440  -2.870  1.00 0.00 ? 59  ARG A HD3  2  
ATOM 3285  H HE   . ARG A 1 7   ? 17.953  -9.299  -3.134  1.00 0.00 ? 59  ARG A HE   2  
ATOM 3286  H HH11 . ARG A 1 7   ? 14.798  -8.827  -1.593  1.00 0.00 ? 59  ARG A HH11 2  
ATOM 3287  H HH12 . ARG A 1 7   ? 15.143  -9.970  -0.312  1.00 0.00 ? 59  ARG A HH12 2  
ATOM 3288  H HH21 . ARG A 1 7   ? 18.355  -10.761 -1.434  1.00 0.00 ? 59  ARG A HH21 2  
ATOM 3289  H HH22 . ARG A 1 7   ? 17.135  -11.035 -0.210  1.00 0.00 ? 59  ARG A HH22 2  
ATOM 3290  N N    . VAL A 1 8   ? 13.254  -8.804  -6.852  1.00 0.00 ? 60  VAL A N    2  
ATOM 3291  C CA   . VAL A 1 8   ? 12.546  -7.942  -7.791  1.00 0.00 ? 60  VAL A CA   2  
ATOM 3292  C C    . VAL A 1 8   ? 12.756  -6.477  -7.414  1.00 0.00 ? 60  VAL A C    2  
ATOM 3293  O O    . VAL A 1 8   ? 13.068  -6.164  -6.267  1.00 0.00 ? 60  VAL A O    2  
ATOM 3294  C CB   . VAL A 1 8   ? 11.064  -8.343  -7.845  1.00 0.00 ? 60  VAL A CB   2  
ATOM 3295  C CG1  . VAL A 1 8   ? 10.347  -8.042  -6.529  1.00 0.00 ? 60  VAL A CG1  2  
ATOM 3296  C CG2  . VAL A 1 8   ? 10.333  -7.628  -8.982  1.00 0.00 ? 60  VAL A CG2  2  
ATOM 3297  H H    . VAL A 1 8   ? 13.175  -8.589  -5.869  1.00 0.00 ? 60  VAL A H    2  
ATOM 3298  H HA   . VAL A 1 8   ? 12.968  -8.094  -8.785  1.00 0.00 ? 60  VAL A HA   2  
ATOM 3299  H HB   . VAL A 1 8   ? 11.008  -9.416  -8.031  1.00 0.00 ? 60  VAL A HB   2  
ATOM 3300  H HG11 . VAL A 1 8   ? 10.378  -6.972  -6.322  1.00 0.00 ? 60  VAL A HG11 2  
ATOM 3301  H HG12 . VAL A 1 8   ? 9.306   -8.357  -6.605  1.00 0.00 ? 60  VAL A HG12 2  
ATOM 3302  H HG13 . VAL A 1 8   ? 10.825  -8.587  -5.716  1.00 0.00 ? 60  VAL A HG13 2  
ATOM 3303  H HG21 . VAL A 1 8   ? 10.854  -7.810  -9.921  1.00 0.00 ? 60  VAL A HG21 2  
ATOM 3304  H HG22 . VAL A 1 8   ? 9.317   -8.017  -9.056  1.00 0.00 ? 60  VAL A HG22 2  
ATOM 3305  H HG23 . VAL A 1 8   ? 10.289  -6.557  -8.784  1.00 0.00 ? 60  VAL A HG23 2  
ATOM 3306  N N    . GLU A 1 9   ? 12.584  -5.580  -8.387  1.00 0.00 ? 61  GLU A N    2  
ATOM 3307  C CA   . GLU A 1 9   ? 12.785  -4.148  -8.219  1.00 0.00 ? 61  GLU A CA   2  
ATOM 3308  C C    . GLU A 1 9   ? 11.647  -3.389  -8.902  1.00 0.00 ? 61  GLU A C    2  
ATOM 3309  O O    . GLU A 1 9   ? 11.877  -2.496  -9.717  1.00 0.00 ? 61  GLU A O    2  
ATOM 3310  C CB   . GLU A 1 9   ? 14.170  -3.753  -8.743  1.00 0.00 ? 61  GLU A CB   2  
ATOM 3311  C CG   . GLU A 1 9   ? 14.406  -4.201  -10.188 1.00 0.00 ? 61  GLU A CG   2  
ATOM 3312  C CD   . GLU A 1 9   ? 15.799  -3.788  -10.660 1.00 0.00 ? 61  GLU A CD   2  
ATOM 3313  O OE1  . GLU A 1 9   ? 16.750  -4.554  -10.391 1.00 0.00 ? 61  GLU A OE1  2  
ATOM 3314  O OE2  . GLU A 1 9   ? 15.901  -2.709  -11.286 1.00 0.00 ? 61  GLU A OE2  2  
ATOM 3315  H H    . GLU A 1 9   ? 12.300  -5.902  -9.302  1.00 0.00 ? 61  GLU A H    2  
ATOM 3316  H HA   . GLU A 1 9   ? 12.744  -3.915  -7.155  1.00 0.00 ? 61  GLU A HA   2  
ATOM 3317  H HB2  . GLU A 1 9   ? 14.288  -2.672  -8.674  1.00 0.00 ? 61  GLU A HB2  2  
ATOM 3318  H HB3  . GLU A 1 9   ? 14.922  -4.224  -8.109  1.00 0.00 ? 61  GLU A HB3  2  
ATOM 3319  H HG2  . GLU A 1 9   ? 14.315  -5.285  -10.251 1.00 0.00 ? 61  GLU A HG2  2  
ATOM 3320  H HG3  . GLU A 1 9   ? 13.657  -3.751  -10.840 1.00 0.00 ? 61  GLU A HG3  2  
ATOM 3321  N N    . ARG A 1 10  ? 10.407  -3.755  -8.561  1.00 0.00 ? 62  ARG A N    2  
ATOM 3322  C CA   . ARG A 1 10  ? 9.214   -3.228  -9.208  1.00 0.00 ? 62  ARG A CA   2  
ATOM 3323  C C    . ARG A 1 10  ? 8.128   -2.872  -8.190  1.00 0.00 ? 62  ARG A C    2  
ATOM 3324  O O    . ARG A 1 10  ? 6.946   -3.103  -8.431  1.00 0.00 ? 62  ARG A O    2  
ATOM 3325  C CB   . ARG A 1 10  ? 8.711   -4.262  -10.216 1.00 0.00 ? 62  ARG A CB   2  
ATOM 3326  C CG   . ARG A 1 10  ? 7.771   -3.622  -11.236 1.00 0.00 ? 62  ARG A CG   2  
ATOM 3327  C CD   . ARG A 1 10  ? 6.849   -4.708  -11.778 1.00 0.00 ? 62  ARG A CD   2  
ATOM 3328  N NE   . ARG A 1 10  ? 5.946   -4.176  -12.804 1.00 0.00 ? 62  ARG A NE   2  
ATOM 3329  C CZ   . ARG A 1 10  ? 6.267   -4.023  -14.092 1.00 0.00 ? 62  ARG A CZ   2  
ATOM 3330  N NH1  . ARG A 1 10  ? 7.474   -4.361  -14.541 1.00 0.00 ? 62  ARG A NH1  2  
ATOM 3331  N NH2  . ARG A 1 10  ? 5.373   -3.528  -14.944 1.00 0.00 ? 62  ARG A NH2  2  
ATOM 3332  H H    . ARG A 1 10  ? 10.281  -4.435  -7.826  1.00 0.00 ? 62  ARG A H    2  
ATOM 3333  H HA   . ARG A 1 10  ? 9.487   -2.320  -9.746  1.00 0.00 ? 62  ARG A HA   2  
ATOM 3334  H HB2  . ARG A 1 10  ? 9.556   -4.701  -10.748 1.00 0.00 ? 62  ARG A HB2  2  
ATOM 3335  H HB3  . ARG A 1 10  ? 8.191   -5.051  -9.675  1.00 0.00 ? 62  ARG A HB3  2  
ATOM 3336  H HG2  . ARG A 1 10  ? 7.166   -2.848  -10.766 1.00 0.00 ? 62  ARG A HG2  2  
ATOM 3337  H HG3  . ARG A 1 10  ? 8.355   -3.181  -12.044 1.00 0.00 ? 62  ARG A HG3  2  
ATOM 3338  H HD2  . ARG A 1 10  ? 7.446   -5.520  -12.193 1.00 0.00 ? 62  ARG A HD2  2  
ATOM 3339  H HD3  . ARG A 1 10  ? 6.266   -5.094  -10.943 1.00 0.00 ? 62  ARG A HD3  2  
ATOM 3340  H HE   . ARG A 1 10  ? 5.019   -3.907  -12.507 1.00 0.00 ? 62  ARG A HE   2  
ATOM 3341  H HH11 . ARG A 1 10  ? 8.161   -4.739  -13.904 1.00 0.00 ? 62  ARG A HH11 2  
ATOM 3342  H HH12 . ARG A 1 10  ? 7.701   -4.241  -15.518 1.00 0.00 ? 62  ARG A HH12 2  
ATOM 3343  H HH21 . ARG A 1 10  ? 4.455   -3.267  -14.614 1.00 0.00 ? 62  ARG A HH21 2  
ATOM 3344  H HH22 . ARG A 1 10  ? 5.612   -3.411  -15.918 1.00 0.00 ? 62  ARG A HH22 2  
ATOM 3345  N N    . TYR A 1 11  ? 8.518   -2.308  -7.044  1.00 0.00 ? 63  TYR A N    2  
ATOM 3346  C CA   . TYR A 1 11  ? 7.572   -1.946  -5.997  1.00 0.00 ? 63  TYR A CA   2  
ATOM 3347  C C    . TYR A 1 11  ? 7.421   -0.434  -5.896  1.00 0.00 ? 63  TYR A C    2  
ATOM 3348  O O    . TYR A 1 11  ? 8.317   0.318   -6.278  1.00 0.00 ? 63  TYR A O    2  
ATOM 3349  C CB   . TYR A 1 11  ? 8.024   -2.528  -4.658  1.00 0.00 ? 63  TYR A CB   2  
ATOM 3350  C CG   . TYR A 1 11  ? 7.437   -3.886  -4.341  1.00 0.00 ? 63  TYR A CG   2  
ATOM 3351  C CD1  . TYR A 1 11  ? 7.061   -4.765  -5.369  1.00 0.00 ? 63  TYR A CD1  2  
ATOM 3352  C CD2  . TYR A 1 11  ? 7.265   -4.261  -3.002  1.00 0.00 ? 63  TYR A CD2  2  
ATOM 3353  C CE1  . TYR A 1 11  ? 6.497   -6.008  -5.065  1.00 0.00 ? 63  TYR A CE1  2  
ATOM 3354  C CE2  . TYR A 1 11  ? 6.709   -5.507  -2.685  1.00 0.00 ? 63  TYR A CE2  2  
ATOM 3355  C CZ   . TYR A 1 11  ? 6.317   -6.387  -3.717  1.00 0.00 ? 63  TYR A CZ   2  
ATOM 3356  O OH   . TYR A 1 11  ? 5.765   -7.596  -3.414  1.00 0.00 ? 63  TYR A OH   2  
ATOM 3357  H H    . TYR A 1 11  ? 9.497   -2.117  -6.885  1.00 0.00 ? 63  TYR A H    2  
ATOM 3358  H HA   . TYR A 1 11  ? 6.589   -2.356  -6.228  1.00 0.00 ? 63  TYR A HA   2  
ATOM 3359  H HB2  . TYR A 1 11  ? 9.112   -2.589  -4.640  1.00 0.00 ? 63  TYR A HB2  2  
ATOM 3360  H HB3  . TYR A 1 11  ? 7.711   -1.847  -3.867  1.00 0.00 ? 63  TYR A HB3  2  
ATOM 3361  H HD1  . TYR A 1 11  ? 7.203   -4.490  -6.404  1.00 0.00 ? 63  TYR A HD1  2  
ATOM 3362  H HD2  . TYR A 1 11  ? 7.564   -3.587  -2.212  1.00 0.00 ? 63  TYR A HD2  2  
ATOM 3363  H HE1  . TYR A 1 11  ? 6.203   -6.666  -5.870  1.00 0.00 ? 63  TYR A HE1  2  
ATOM 3364  H HE2  . TYR A 1 11  ? 6.581   -5.787  -1.649  1.00 0.00 ? 63  TYR A HE2  2  
ATOM 3365  H HH   . TYR A 1 11  ? 5.546   -8.111  -4.195  1.00 0.00 ? 63  TYR A HH   2  
ATOM 3366  N N    . SER A 1 12  ? 6.275   0.012   -5.376  1.00 0.00 ? 64  SER A N    2  
ATOM 3367  C CA   . SER A 1 12  ? 6.034   1.421   -5.143  1.00 0.00 ? 64  SER A CA   2  
ATOM 3368  C C    . SER A 1 12  ? 6.942   1.848   -4.011  1.00 0.00 ? 64  SER A C    2  
ATOM 3369  O O    . SER A 1 12  ? 6.879   1.273   -2.920  1.00 0.00 ? 64  SER A O    2  
ATOM 3370  C CB   . SER A 1 12  ? 4.591   1.662   -4.728  1.00 0.00 ? 64  SER A CB   2  
ATOM 3371  O OG   . SER A 1 12  ? 4.406   3.033   -4.455  1.00 0.00 ? 64  SER A OG   2  
ATOM 3372  H H    . SER A 1 12  ? 5.547   -0.641  -5.123  1.00 0.00 ? 64  SER A H    2  
ATOM 3373  H HA   . SER A 1 12  ? 6.260   1.990   -6.045  1.00 0.00 ? 64  SER A HA   2  
ATOM 3374  H HB2  . SER A 1 12  ? 3.908   1.340   -5.515  1.00 0.00 ? 64  SER A HB2  2  
ATOM 3375  H HB3  . SER A 1 12  ? 4.401   1.091   -3.818  1.00 0.00 ? 64  SER A HB3  2  
ATOM 3376  H HG   . SER A 1 12  ? 4.407   3.519   -5.283  1.00 0.00 ? 64  SER A HG   2  
ATOM 3377  N N    . ARG A 1 13  ? 7.771   2.857   -4.303  1.00 0.00 ? 65  ARG A N    2  
ATOM 3378  C CA   . ARG A 1 13  ? 8.796   3.324   -3.381  1.00 0.00 ? 65  ARG A CA   2  
ATOM 3379  C C    . ARG A 1 13  ? 8.210   4.161   -2.253  1.00 0.00 ? 65  ARG A C    2  
ATOM 3380  O O    . ARG A 1 13  ? 8.941   4.547   -1.346  1.00 0.00 ? 65  ARG A O    2  
ATOM 3381  C CB   . ARG A 1 13  ? 9.858   4.128   -4.134  1.00 0.00 ? 65  ARG A CB   2  
ATOM 3382  C CG   . ARG A 1 13  ? 10.456  3.325   -5.290  1.00 0.00 ? 65  ARG A CG   2  
ATOM 3383  C CD   . ARG A 1 13  ? 11.647  4.074   -5.890  1.00 0.00 ? 65  ARG A CD   2  
ATOM 3384  N NE   . ARG A 1 13  ? 11.276  5.419   -6.343  1.00 0.00 ? 65  ARG A NE   2  
ATOM 3385  C CZ   . ARG A 1 13  ? 10.754  5.704   -7.539  1.00 0.00 ? 65  ARG A CZ   2  
ATOM 3386  N NH1  . ARG A 1 13  ? 10.534  4.745   -8.436  1.00 0.00 ? 65  ARG A NH1  2  
ATOM 3387  N NH2  . ARG A 1 13  ? 10.446  6.961   -7.845  1.00 0.00 ? 65  ARG A NH2  2  
ATOM 3388  H H    . ARG A 1 13  ? 7.697   3.317   -5.198  1.00 0.00 ? 65  ARG A H    2  
ATOM 3389  H HA   . ARG A 1 13  ? 9.274   2.451   -2.934  1.00 0.00 ? 65  ARG A HA   2  
ATOM 3390  H HB2  . ARG A 1 13  ? 9.407   5.041   -4.525  1.00 0.00 ? 65  ARG A HB2  2  
ATOM 3391  H HB3  . ARG A 1 13  ? 10.653  4.394   -3.439  1.00 0.00 ? 65  ARG A HB3  2  
ATOM 3392  H HG2  . ARG A 1 13  ? 10.797  2.359   -4.918  1.00 0.00 ? 65  ARG A HG2  2  
ATOM 3393  H HG3  . ARG A 1 13  ? 9.699   3.169   -6.058  1.00 0.00 ? 65  ARG A HG3  2  
ATOM 3394  H HD2  . ARG A 1 13  ? 12.423  4.162   -5.130  1.00 0.00 ? 65  ARG A HD2  2  
ATOM 3395  H HD3  . ARG A 1 13  ? 12.049  3.502   -6.726  1.00 0.00 ? 65  ARG A HD3  2  
ATOM 3396  H HE   . ARG A 1 13  ? 11.432  6.177   -5.693  1.00 0.00 ? 65  ARG A HE   2  
ATOM 3397  H HH11 . ARG A 1 13  ? 10.766  3.786   -8.219  1.00 0.00 ? 65  ARG A HH11 2  
ATOM 3398  H HH12 . ARG A 1 13  ? 10.137  4.977   -9.335  1.00 0.00 ? 65  ARG A HH12 2  
ATOM 3399  H HH21 . ARG A 1 13  ? 10.606  7.699   -7.175  1.00 0.00 ? 65  ARG A HH21 2  
ATOM 3400  H HH22 . ARG A 1 13  ? 10.051  7.179   -8.749  1.00 0.00 ? 65  ARG A HH22 2  
ATOM 3401  N N    . LYS A 1 14  ? 6.905   4.444   -2.301  1.00 0.00 ? 66  LYS A N    2  
ATOM 3402  C CA   . LYS A 1 14  ? 6.229   5.156   -1.231  1.00 0.00 ? 66  LYS A CA   2  
ATOM 3403  C C    . LYS A 1 14  ? 6.037   4.184   -0.075  1.00 0.00 ? 66  LYS A C    2  
ATOM 3404  O O    . LYS A 1 14  ? 5.411   3.140   -0.249  1.00 0.00 ? 66  LYS A O    2  
ATOM 3405  C CB   . LYS A 1 14  ? 4.894   5.698   -1.751  1.00 0.00 ? 66  LYS A CB   2  
ATOM 3406  C CG   . LYS A 1 14  ? 4.101   6.449   -0.678  1.00 0.00 ? 66  LYS A CG   2  
ATOM 3407  C CD   . LYS A 1 14  ? 4.842   7.703   -0.210  1.00 0.00 ? 66  LYS A CD   2  
ATOM 3408  C CE   . LYS A 1 14  ? 4.024   8.456   0.842   1.00 0.00 ? 66  LYS A CE   2  
ATOM 3409  N NZ   . LYS A 1 14  ? 2.752   8.962   0.290   1.00 0.00 ? 66  LYS A NZ   2  
ATOM 3410  H H    . LYS A 1 14  ? 6.360   4.152   -3.100  1.00 0.00 ? 66  LYS A H    2  
ATOM 3411  H HA   . LYS A 1 14  ? 6.857   5.984   -0.901  1.00 0.00 ? 66  LYS A HA   2  
ATOM 3412  H HB2  . LYS A 1 14  ? 5.085   6.373   -2.586  1.00 0.00 ? 66  LYS A HB2  2  
ATOM 3413  H HB3  . LYS A 1 14  ? 4.293   4.864   -2.111  1.00 0.00 ? 66  LYS A HB3  2  
ATOM 3414  H HG2  . LYS A 1 14  ? 3.139   6.740   -1.100  1.00 0.00 ? 66  LYS A HG2  2  
ATOM 3415  H HG3  . LYS A 1 14  ? 3.927   5.791   0.173   1.00 0.00 ? 66  LYS A HG3  2  
ATOM 3416  H HD2  . LYS A 1 14  ? 5.796   7.417   0.233   1.00 0.00 ? 66  LYS A HD2  2  
ATOM 3417  H HD3  . LYS A 1 14  ? 5.028   8.358   -1.061  1.00 0.00 ? 66  LYS A HD3  2  
ATOM 3418  H HE2  . LYS A 1 14  ? 3.816   7.787   1.677   1.00 0.00 ? 66  LYS A HE2  2  
ATOM 3419  H HE3  . LYS A 1 14  ? 4.613   9.297   1.209   1.00 0.00 ? 66  LYS A HE3  2  
ATOM 3420  H HZ1  . LYS A 1 14  ? 2.241   9.459   1.005   1.00 0.00 ? 66  LYS A HZ1  2  
ATOM 3421  H HZ2  . LYS A 1 14  ? 2.936   9.592   -0.478  1.00 0.00 ? 66  LYS A HZ2  2  
ATOM 3422  H HZ3  . LYS A 1 14  ? 2.185   8.194   -0.039  1.00 0.00 ? 66  LYS A HZ3  2  
ATOM 3423  N N    . VAL A 1 15  ? 6.571   4.521   1.101   1.00 0.00 ? 67  VAL A N    2  
ATOM 3424  C CA   . VAL A 1 15  ? 6.498   3.647   2.263   1.00 0.00 ? 67  VAL A CA   2  
ATOM 3425  C C    . VAL A 1 15  ? 6.009   4.435   3.470   1.00 0.00 ? 67  VAL A C    2  
ATOM 3426  O O    . VAL A 1 15  ? 6.620   5.421   3.874   1.00 0.00 ? 67  VAL A O    2  
ATOM 3427  C CB   . VAL A 1 15  ? 7.864   3.000   2.531   1.00 0.00 ? 67  VAL A CB   2  
ATOM 3428  C CG1  . VAL A 1 15  ? 7.767   1.985   3.671   1.00 0.00 ? 67  VAL A CG1  2  
ATOM 3429  C CG2  . VAL A 1 15  ? 8.375   2.258   1.296   1.00 0.00 ? 67  VAL A CG2  2  
ATOM 3430  H H    . VAL A 1 15  ? 7.046   5.406   1.203   1.00 0.00 ? 67  VAL A H    2  
ATOM 3431  H HA   . VAL A 1 15  ? 5.782   2.851   2.057   1.00 0.00 ? 67  VAL A HA   2  
ATOM 3432  H HB   . VAL A 1 15  ? 8.584   3.773   2.801   1.00 0.00 ? 67  VAL A HB   2  
ATOM 3433  H HG11 . VAL A 1 15  ? 7.039   1.216   3.413   1.00 0.00 ? 67  VAL A HG11 2  
ATOM 3434  H HG12 . VAL A 1 15  ? 8.736   1.513   3.827   1.00 0.00 ? 67  VAL A HG12 2  
ATOM 3435  H HG13 . VAL A 1 15  ? 7.459   2.484   4.589   1.00 0.00 ? 67  VAL A HG13 2  
ATOM 3436  H HG21 . VAL A 1 15  ? 8.538   2.961   0.479   1.00 0.00 ? 67  VAL A HG21 2  
ATOM 3437  H HG22 . VAL A 1 15  ? 9.320   1.768   1.528   1.00 0.00 ? 67  VAL A HG22 2  
ATOM 3438  H HG23 . VAL A 1 15  ? 7.644   1.511   0.989   1.00 0.00 ? 67  VAL A HG23 2  
ATOM 3439  N N    . PHE A 1 16  ? 4.893   3.987   4.047   1.00 0.00 ? 68  PHE A N    2  
ATOM 3440  C CA   . PHE A 1 16  ? 4.342   4.591   5.247   1.00 0.00 ? 68  PHE A CA   2  
ATOM 3441  C C    . PHE A 1 16  ? 4.995   3.964   6.474   1.00 0.00 ? 68  PHE A C    2  
ATOM 3442  O O    . PHE A 1 16  ? 5.286   2.767   6.475   1.00 0.00 ? 68  PHE A O    2  
ATOM 3443  C CB   . PHE A 1 16  ? 2.828   4.389   5.255   1.00 0.00 ? 68  PHE A CB   2  
ATOM 3444  C CG   . PHE A 1 16  ? 2.203   4.490   6.628   1.00 0.00 ? 68  PHE A CG   2  
ATOM 3445  C CD1  . PHE A 1 16  ? 1.962   5.744   7.208   1.00 0.00 ? 68  PHE A CD1  2  
ATOM 3446  C CD2  . PHE A 1 16  ? 1.868   3.321   7.326   1.00 0.00 ? 68  PHE A CD2  2  
ATOM 3447  C CE1  . PHE A 1 16  ? 1.383   5.825   8.480   1.00 0.00 ? 68  PHE A CE1  2  
ATOM 3448  C CE2  . PHE A 1 16  ? 1.288   3.402   8.598   1.00 0.00 ? 68  PHE A CE2  2  
ATOM 3449  C CZ   . PHE A 1 16  ? 1.046   4.657   9.177   1.00 0.00 ? 68  PHE A CZ   2  
ATOM 3450  H H    . PHE A 1 16  ? 4.403   3.199   3.647   1.00 0.00 ? 68  PHE A H    2  
ATOM 3451  H HA   . PHE A 1 16  ? 4.554   5.660   5.251   1.00 0.00 ? 68  PHE A HA   2  
ATOM 3452  H HB2  . PHE A 1 16  ? 2.366   5.121   4.594   1.00 0.00 ? 68  PHE A HB2  2  
ATOM 3453  H HB3  . PHE A 1 16  ? 2.613   3.396   4.859   1.00 0.00 ? 68  PHE A HB3  2  
ATOM 3454  H HD1  . PHE A 1 16  ? 2.224   6.646   6.674   1.00 0.00 ? 68  PHE A HD1  2  
ATOM 3455  H HD2  . PHE A 1 16  ? 2.056   2.355   6.883   1.00 0.00 ? 68  PHE A HD2  2  
ATOM 3456  H HE1  . PHE A 1 16  ? 1.196   6.791   8.926   1.00 0.00 ? 68  PHE A HE1  2  
ATOM 3457  H HE2  . PHE A 1 16  ? 1.030   2.497   9.129   1.00 0.00 ? 68  PHE A HE2  2  
ATOM 3458  H HZ   . PHE A 1 16  ? 0.600   4.722   10.158  1.00 0.00 ? 68  PHE A HZ   2  
ATOM 3459  N N    . VAL A 1 17  ? 5.224   4.772   7.515   1.00 0.00 ? 69  VAL A N    2  
ATOM 3460  C CA   . VAL A 1 17  ? 5.825   4.295   8.749   1.00 0.00 ? 69  VAL A CA   2  
ATOM 3461  C C    . VAL A 1 17  ? 5.059   4.854   9.942   1.00 0.00 ? 69  VAL A C    2  
ATOM 3462  O O    . VAL A 1 17  ? 4.547   5.970   9.884   1.00 0.00 ? 69  VAL A O    2  
ATOM 3463  C CB   . VAL A 1 17  ? 7.293   4.723   8.806   1.00 0.00 ? 69  VAL A CB   2  
ATOM 3464  C CG1  . VAL A 1 17  ? 7.995   4.009   9.956   1.00 0.00 ? 69  VAL A CG1  2  
ATOM 3465  C CG2  . VAL A 1 17  ? 8.018   4.376   7.508   1.00 0.00 ? 69  VAL A CG2  2  
ATOM 3466  H H    . VAL A 1 17  ? 4.979   5.750   7.458   1.00 0.00 ? 69  VAL A H    2  
ATOM 3467  H HA   . VAL A 1 17  ? 5.774   3.207   8.774   1.00 0.00 ? 69  VAL A HA   2  
ATOM 3468  H HB   . VAL A 1 17  ? 7.354   5.800   8.963   1.00 0.00 ? 69  VAL A HB   2  
ATOM 3469  H HG11 . VAL A 1 17  ? 7.830   2.934   9.877   1.00 0.00 ? 69  VAL A HG11 2  
ATOM 3470  H HG12 . VAL A 1 17  ? 9.065   4.209   9.902   1.00 0.00 ? 69  VAL A HG12 2  
ATOM 3471  H HG13 . VAL A 1 17  ? 7.604   4.377   10.905  1.00 0.00 ? 69  VAL A HG13 2  
ATOM 3472  H HG21 . VAL A 1 17  ? 7.585   4.941   6.683   1.00 0.00 ? 69  VAL A HG21 2  
ATOM 3473  H HG22 . VAL A 1 17  ? 9.070   4.645   7.605   1.00 0.00 ? 69  VAL A HG22 2  
ATOM 3474  H HG23 . VAL A 1 17  ? 7.928   3.309   7.310   1.00 0.00 ? 69  VAL A HG23 2  
ATOM 3475  N N    . GLY A 1 18  ? 4.980   4.081   11.028  1.00 0.00 ? 70  GLY A N    2  
ATOM 3476  C CA   . GLY A 1 18  ? 4.289   4.523   12.230  1.00 0.00 ? 70  GLY A CA   2  
ATOM 3477  C C    . GLY A 1 18  ? 5.023   4.136   13.511  1.00 0.00 ? 70  GLY A C    2  
ATOM 3478  O O    . GLY A 1 18  ? 4.641   4.579   14.592  1.00 0.00 ? 70  GLY A O    2  
ATOM 3479  H H    . GLY A 1 18  ? 5.404   3.165   11.019  1.00 0.00 ? 70  GLY A H    2  
ATOM 3480  H HA2  . GLY A 1 18  ? 4.184   5.608   12.206  1.00 0.00 ? 70  GLY A HA2  2  
ATOM 3481  H HA3  . GLY A 1 18  ? 3.296   4.074   12.250  1.00 0.00 ? 70  GLY A HA3  2  
ATOM 3482  N N    . GLY A 1 19  ? 6.074   3.316   13.403  1.00 0.00 ? 71  GLY A N    2  
ATOM 3483  C CA   . GLY A 1 19  ? 6.806   2.845   14.570  1.00 0.00 ? 71  GLY A CA   2  
ATOM 3484  C C    . GLY A 1 19  ? 8.034   3.689   14.905  1.00 0.00 ? 71  GLY A C    2  
ATOM 3485  O O    . GLY A 1 19  ? 8.863   3.258   15.704  1.00 0.00 ? 71  GLY A O    2  
ATOM 3486  H H    . GLY A 1 19  ? 6.373   3.001   12.491  1.00 0.00 ? 71  GLY A H    2  
ATOM 3487  H HA2  . GLY A 1 19  ? 6.139   2.860   15.432  1.00 0.00 ? 71  GLY A HA2  2  
ATOM 3488  H HA3  . GLY A 1 19  ? 7.117   1.813   14.401  1.00 0.00 ? 71  GLY A HA3  2  
ATOM 3489  N N    . LEU A 1 20  ? 8.171   4.879   14.314  1.00 0.00 ? 72  LEU A N    2  
ATOM 3490  C CA   . LEU A 1 20  ? 9.351   5.703   14.528  1.00 0.00 ? 72  LEU A CA   2  
ATOM 3491  C C    . LEU A 1 20  ? 9.554   6.014   16.014  1.00 0.00 ? 72  LEU A C    2  
ATOM 3492  O O    . LEU A 1 20  ? 8.579   6.121   16.758  1.00 0.00 ? 72  LEU A O    2  
ATOM 3493  C CB   . LEU A 1 20  ? 9.235   7.009   13.739  1.00 0.00 ? 72  LEU A CB   2  
ATOM 3494  C CG   . LEU A 1 20  ? 9.090   6.795   12.231  1.00 0.00 ? 72  LEU A CG   2  
ATOM 3495  C CD1  . LEU A 1 20  ? 9.149   8.149   11.532  1.00 0.00 ? 72  LEU A CD1  2  
ATOM 3496  C CD2  . LEU A 1 20  ? 10.216  5.935   11.663  1.00 0.00 ? 72  LEU A CD2  2  
ATOM 3497  H H    . LEU A 1 20  ? 7.446   5.223   13.700  1.00 0.00 ? 72  LEU A H    2  
ATOM 3498  H HA   . LEU A 1 20  ? 10.218  5.150   14.164  1.00 0.00 ? 72  LEU A HA   2  
ATOM 3499  H HB2  . LEU A 1 20  ? 8.373   7.569   14.101  1.00 0.00 ? 72  LEU A HB2  2  
ATOM 3500  H HB3  . LEU A 1 20  ? 10.129  7.602   13.927  1.00 0.00 ? 72  LEU A HB3  2  
ATOM 3501  H HG   . LEU A 1 20  ? 8.131   6.323   12.016  1.00 0.00 ? 72  LEU A HG   2  
ATOM 3502  H HD11 . LEU A 1 20  ? 10.100  8.634   11.752  1.00 0.00 ? 72  LEU A HD11 2  
ATOM 3503  H HD12 . LEU A 1 20  ? 9.067   8.001   10.455  1.00 0.00 ? 72  LEU A HD12 2  
ATOM 3504  H HD13 . LEU A 1 20  ? 8.331   8.778   11.884  1.00 0.00 ? 72  LEU A HD13 2  
ATOM 3505  H HD21 . LEU A 1 20  ? 10.128  5.916   10.576  1.00 0.00 ? 72  LEU A HD21 2  
ATOM 3506  H HD22 . LEU A 1 20  ? 11.183  6.352   11.943  1.00 0.00 ? 72  LEU A HD22 2  
ATOM 3507  H HD23 . LEU A 1 20  ? 10.131  4.916   12.041  1.00 0.00 ? 72  LEU A HD23 2  
ATOM 3508  N N    . PRO A 1 21  ? 10.814  6.160   16.452  1.00 0.00 ? 73  PRO A N    2  
ATOM 3509  C CA   . PRO A 1 21  ? 11.175  6.508   17.820  1.00 0.00 ? 73  PRO A CA   2  
ATOM 3510  C C    . PRO A 1 21  ? 10.415  7.725   18.358  1.00 0.00 ? 73  PRO A C    2  
ATOM 3511  O O    . PRO A 1 21  ? 9.954   8.563   17.584  1.00 0.00 ? 73  PRO A O    2  
ATOM 3512  C CB   . PRO A 1 21  ? 12.682  6.776   17.782  1.00 0.00 ? 73  PRO A CB   2  
ATOM 3513  C CG   . PRO A 1 21  ? 13.159  5.891   16.635  1.00 0.00 ? 73  PRO A CG   2  
ATOM 3514  C CD   . PRO A 1 21  ? 12.007  5.984   15.639  1.00 0.00 ? 73  PRO A CD   2  
ATOM 3515  H HA   . PRO A 1 21  ? 10.983  5.642   18.453  1.00 0.00 ? 73  PRO A HA   2  
ATOM 3516  H HB2  . PRO A 1 21  ? 12.863  7.822   17.533  1.00 0.00 ? 73  PRO A HB2  2  
ATOM 3517  H HB3  . PRO A 1 21  ? 13.164  6.509   18.721  1.00 0.00 ? 73  PRO A HB3  2  
ATOM 3518  H HG2  . PRO A 1 21  ? 14.096  6.250   16.208  1.00 0.00 ? 73  PRO A HG2  2  
ATOM 3519  H HG3  . PRO A 1 21  ? 13.257  4.862   16.985  1.00 0.00 ? 73  PRO A HG3  2  
ATOM 3520  H HD2  . PRO A 1 21  ? 12.144  6.853   14.996  1.00 0.00 ? 73  PRO A HD2  2  
ATOM 3521  H HD3  . PRO A 1 21  ? 11.964  5.072   15.043  1.00 0.00 ? 73  PRO A HD3  2  
ATOM 3522  N N    . PRO A 1 22  ? 10.279  7.834   19.688  1.00 0.00 ? 74  PRO A N    2  
ATOM 3523  C CA   . PRO A 1 22  ? 9.552   8.906   20.355  1.00 0.00 ? 74  PRO A CA   2  
ATOM 3524  C C    . PRO A 1 22  ? 10.319  10.232  20.339  1.00 0.00 ? 74  PRO A C    2  
ATOM 3525  O O    . PRO A 1 22  ? 9.822   11.236  20.847  1.00 0.00 ? 74  PRO A O    2  
ATOM 3526  C CB   . PRO A 1 22  ? 9.356   8.401   21.785  1.00 0.00 ? 74  PRO A CB   2  
ATOM 3527  C CG   . PRO A 1 22  ? 10.609  7.560   22.020  1.00 0.00 ? 74  PRO A CG   2  
ATOM 3528  C CD   . PRO A 1 22  ? 10.824  6.902   20.658  1.00 0.00 ? 74  PRO A CD   2  
ATOM 3529  H HA   . PRO A 1 22  ? 8.583   9.051   19.878  1.00 0.00 ? 74  PRO A HA   2  
ATOM 3530  H HB2  . PRO A 1 22  ? 9.275   9.218   22.504  1.00 0.00 ? 74  PRO A HB2  2  
ATOM 3531  H HB3  . PRO A 1 22  ? 8.477   7.759   21.826  1.00 0.00 ? 74  PRO A HB3  2  
ATOM 3532  H HG2  . PRO A 1 22  ? 11.451  8.215   22.248  1.00 0.00 ? 74  PRO A HG2  2  
ATOM 3533  H HG3  . PRO A 1 22  ? 10.461  6.822   22.808  1.00 0.00 ? 74  PRO A HG3  2  
ATOM 3534  H HD2  . PRO A 1 22  ? 11.886  6.725   20.488  1.00 0.00 ? 74  PRO A HD2  2  
ATOM 3535  H HD3  . PRO A 1 22  ? 10.269  5.966   20.611  1.00 0.00 ? 74  PRO A HD3  2  
ATOM 3536  N N    . ASP A 1 23  ? 11.523  10.243  19.759  1.00 0.00 ? 75  ASP A N    2  
ATOM 3537  C CA   . ASP A 1 23  ? 12.375  11.422  19.675  1.00 0.00 ? 75  ASP A CA   2  
ATOM 3538  C C    . ASP A 1 23  ? 12.939  11.540  18.257  1.00 0.00 ? 75  ASP A C    2  
ATOM 3539  O O    . ASP A 1 23  ? 14.050  12.026  18.048  1.00 0.00 ? 75  ASP A O    2  
ATOM 3540  C CB   . ASP A 1 23  ? 13.472  11.322  20.741  1.00 0.00 ? 75  ASP A CB   2  
ATOM 3541  C CG   . ASP A 1 23  ? 14.312  12.595  20.837  1.00 0.00 ? 75  ASP A CG   2  
ATOM 3542  O OD1  . ASP A 1 23  ? 13.706  13.688  20.903  1.00 0.00 ? 75  ASP A OD1  2  
ATOM 3543  O OD2  . ASP A 1 23  ? 15.557  12.466  20.845  1.00 0.00 ? 75  ASP A OD2  2  
ATOM 3544  H H    . ASP A 1 23  ? 11.874  9.387   19.353  1.00 0.00 ? 75  ASP A H    2  
ATOM 3545  H HA   . ASP A 1 23  ? 11.767  12.304  19.875  1.00 0.00 ? 75  ASP A HA   2  
ATOM 3546  H HB2  . ASP A 1 23  ? 13.004  11.142  21.708  1.00 0.00 ? 75  ASP A HB2  2  
ATOM 3547  H HB3  . ASP A 1 23  ? 14.118  10.476  20.506  1.00 0.00 ? 75  ASP A HB3  2  
ATOM 3548  N N    . ILE A 1 24  ? 12.155  11.082  17.277  1.00 0.00 ? 76  ILE A N    2  
ATOM 3549  C CA   . ILE A 1 24  ? 12.586  10.974  15.893  1.00 0.00 ? 76  ILE A CA   2  
ATOM 3550  C C    . ILE A 1 24  ? 12.833  12.325  15.227  1.00 0.00 ? 76  ILE A C    2  
ATOM 3551  O O    . ILE A 1 24  ? 12.153  13.318  15.485  1.00 0.00 ? 76  ILE A O    2  
ATOM 3552  C CB   . ILE A 1 24  ? 11.579  10.115  15.111  1.00 0.00 ? 76  ILE A CB   2  
ATOM 3553  C CG1  . ILE A 1 24  ? 12.043  9.864   13.667  1.00 0.00 ? 76  ILE A CG1  2  
ATOM 3554  C CG2  . ILE A 1 24  ? 10.174  10.724  15.153  1.00 0.00 ? 76  ILE A CG2  2  
ATOM 3555  C CD1  . ILE A 1 24  ? 11.541  10.894  12.650  1.00 0.00 ? 76  ILE A CD1  2  
ATOM 3556  H H    . ILE A 1 24  ? 11.215  10.786  17.498  1.00 0.00 ? 76  ILE A H    2  
ATOM 3557  H HA   . ILE A 1 24  ? 13.535  10.437  15.893  1.00 0.00 ? 76  ILE A HA   2  
ATOM 3558  H HB   . ILE A 1 24  ? 11.538  9.145   15.606  1.00 0.00 ? 76  ILE A HB   2  
ATOM 3559  H HG12 . ILE A 1 24  ? 13.132  9.831   13.639  1.00 0.00 ? 76  ILE A HG12 2  
ATOM 3560  H HG13 . ILE A 1 24  ? 11.677  8.887   13.353  1.00 0.00 ? 76  ILE A HG13 2  
ATOM 3561  H HG21 . ILE A 1 24  ? 9.833   10.792  16.186  1.00 0.00 ? 76  ILE A HG21 2  
ATOM 3562  H HG22 . ILE A 1 24  ? 10.180  11.719  14.711  1.00 0.00 ? 76  ILE A HG22 2  
ATOM 3563  H HG23 . ILE A 1 24  ? 9.488   10.084  14.598  1.00 0.00 ? 76  ILE A HG23 2  
ATOM 3564  H HD11 . ILE A 1 24  ? 11.974  10.675  11.674  1.00 0.00 ? 76  ILE A HD11 2  
ATOM 3565  H HD12 . ILE A 1 24  ? 10.455  10.842  12.574  1.00 0.00 ? 76  ILE A HD12 2  
ATOM 3566  H HD13 . ILE A 1 24  ? 11.832  11.903  12.945  1.00 0.00 ? 76  ILE A HD13 2  
ATOM 3567  N N    . ASP A 1 25  ? 13.839  12.322  14.353  1.00 0.00 ? 77  ASP A N    2  
ATOM 3568  C CA   . ASP A 1 25  ? 14.188  13.398  13.443  1.00 0.00 ? 77  ASP A CA   2  
ATOM 3569  C C    . ASP A 1 25  ? 14.705  12.730  12.169  1.00 0.00 ? 77  ASP A C    2  
ATOM 3570  O O    . ASP A 1 25  ? 15.044  11.550  12.214  1.00 0.00 ? 77  ASP A O    2  
ATOM 3571  C CB   . ASP A 1 25  ? 15.248  14.293  14.083  1.00 0.00 ? 77  ASP A CB   2  
ATOM 3572  C CG   . ASP A 1 25  ? 15.527  15.513  13.214  1.00 0.00 ? 77  ASP A CG   2  
ATOM 3573  O OD1  . ASP A 1 25  ? 14.566  16.285  12.999  1.00 0.00 ? 77  ASP A OD1  2  
ATOM 3574  O OD2  . ASP A 1 25  ? 16.689  15.660  12.776  1.00 0.00 ? 77  ASP A OD2  2  
ATOM 3575  H H    . ASP A 1 25  ? 14.418  11.496  14.298  1.00 0.00 ? 77  ASP A H    2  
ATOM 3576  H HA   . ASP A 1 25  ? 13.299  13.987  13.211  1.00 0.00 ? 77  ASP A HA   2  
ATOM 3577  H HB2  . ASP A 1 25  ? 14.890  14.628  15.055  1.00 0.00 ? 77  ASP A HB2  2  
ATOM 3578  H HB3  . ASP A 1 25  ? 16.165  13.722  14.223  1.00 0.00 ? 77  ASP A HB3  2  
ATOM 3579  N N    . GLU A 1 26  ? 14.776  13.439  11.039  1.00 0.00 ? 78  GLU A N    2  
ATOM 3580  C CA   . GLU A 1 26  ? 15.184  12.842  9.774   1.00 0.00 ? 78  GLU A CA   2  
ATOM 3581  C C    . GLU A 1 26  ? 16.521  12.102  9.866   1.00 0.00 ? 78  GLU A C    2  
ATOM 3582  O O    . GLU A 1 26  ? 16.753  11.180  9.088   1.00 0.00 ? 78  GLU A O    2  
ATOM 3583  C CB   . GLU A 1 26  ? 15.236  13.918  8.684   1.00 0.00 ? 78  GLU A CB   2  
ATOM 3584  C CG   . GLU A 1 26  ? 16.176  15.065  9.053   1.00 0.00 ? 78  GLU A CG   2  
ATOM 3585  C CD   . GLU A 1 26  ? 16.257  16.086  7.919   1.00 0.00 ? 78  GLU A CD   2  
ATOM 3586  O OE1  . GLU A 1 26  ? 15.388  16.985  7.888   1.00 0.00 ? 78  GLU A OE1  2  
ATOM 3587  O OE2  . GLU A 1 26  ? 17.188  15.959  7.092   1.00 0.00 ? 78  GLU A OE2  2  
ATOM 3588  H H    . GLU A 1 26  ? 14.539  14.422  11.043  1.00 0.00 ? 78  GLU A H    2  
ATOM 3589  H HA   . GLU A 1 26  ? 14.429  12.111  9.484   1.00 0.00 ? 78  GLU A HA   2  
ATOM 3590  H HB2  . GLU A 1 26  ? 15.574  13.462  7.754   1.00 0.00 ? 78  GLU A HB2  2  
ATOM 3591  H HB3  . GLU A 1 26  ? 14.234  14.321  8.529   1.00 0.00 ? 78  GLU A HB3  2  
ATOM 3592  H HG2  . GLU A 1 26  ? 15.811  15.558  9.953   1.00 0.00 ? 78  GLU A HG2  2  
ATOM 3593  H HG3  . GLU A 1 26  ? 17.171  14.665  9.251   1.00 0.00 ? 78  GLU A HG3  2  
ATOM 3594  N N    . ASP A 1 27  ? 17.406  12.478  10.795  1.00 0.00 ? 79  ASP A N    2  
ATOM 3595  C CA   . ASP A 1 27  ? 18.678  11.790  10.949  1.00 0.00 ? 79  ASP A CA   2  
ATOM 3596  C C    . ASP A 1 27  ? 18.496  10.493  11.740  1.00 0.00 ? 79  ASP A C    2  
ATOM 3597  O O    . ASP A 1 27  ? 19.235  9.530   11.538  1.00 0.00 ? 79  ASP A O    2  
ATOM 3598  C CB   . ASP A 1 27  ? 19.664  12.727  11.648  1.00 0.00 ? 79  ASP A CB   2  
ATOM 3599  C CG   . ASP A 1 27  ? 21.041  12.085  11.787  1.00 0.00 ? 79  ASP A CG   2  
ATOM 3600  O OD1  . ASP A 1 27  ? 21.709  11.924  10.741  1.00 0.00 ? 79  ASP A OD1  2  
ATOM 3601  O OD2  . ASP A 1 27  ? 21.417  11.760  12.935  1.00 0.00 ? 79  ASP A OD2  2  
ATOM 3602  H H    . ASP A 1 27  ? 17.197  13.253  11.408  1.00 0.00 ? 79  ASP A H    2  
ATOM 3603  H HA   . ASP A 1 27  ? 19.073  11.545  9.962   1.00 0.00 ? 79  ASP A HA   2  
ATOM 3604  H HB2  . ASP A 1 27  ? 19.756  13.644  11.066  1.00 0.00 ? 79  ASP A HB2  2  
ATOM 3605  H HB3  . ASP A 1 27  ? 19.279  12.977  12.637  1.00 0.00 ? 79  ASP A HB3  2  
ATOM 3606  N N    . GLU A 1 28  ? 17.511  10.466  12.641  1.00 0.00 ? 80  GLU A N    2  
ATOM 3607  C CA   . GLU A 1 28  ? 17.237  9.305   13.469  1.00 0.00 ? 80  GLU A CA   2  
ATOM 3608  C C    . GLU A 1 28  ? 16.642  8.191   12.622  1.00 0.00 ? 80  GLU A C    2  
ATOM 3609  O O    . GLU A 1 28  ? 17.073  7.045   12.712  1.00 0.00 ? 80  GLU A O    2  
ATOM 3610  C CB   . GLU A 1 28  ? 16.234  9.692   14.559  1.00 0.00 ? 80  GLU A CB   2  
ATOM 3611  C CG   . GLU A 1 28  ? 15.957  8.532   15.516  1.00 0.00 ? 80  GLU A CG   2  
ATOM 3612  C CD   . GLU A 1 28  ? 17.177  8.213   16.377  1.00 0.00 ? 80  GLU A CD   2  
ATOM 3613  O OE1  . GLU A 1 28  ? 17.344  8.892   17.414  1.00 0.00 ? 80  GLU A OE1  2  
ATOM 3614  O OE2  . GLU A 1 28  ? 17.936  7.293   15.996  1.00 0.00 ? 80  GLU A OE2  2  
ATOM 3615  H H    . GLU A 1 28  ? 16.924  11.279  12.759  1.00 0.00 ? 80  GLU A H    2  
ATOM 3616  H HA   . GLU A 1 28  ? 18.163  8.957   13.926  1.00 0.00 ? 80  GLU A HA   2  
ATOM 3617  H HB2  . GLU A 1 28  ? 16.606  10.552  15.116  1.00 0.00 ? 80  GLU A HB2  2  
ATOM 3618  H HB3  . GLU A 1 28  ? 15.294  9.974   14.085  1.00 0.00 ? 80  GLU A HB3  2  
ATOM 3619  H HG2  . GLU A 1 28  ? 15.121  8.802   16.162  1.00 0.00 ? 80  GLU A HG2  2  
ATOM 3620  H HG3  . GLU A 1 28  ? 15.665  7.651   14.943  1.00 0.00 ? 80  GLU A HG3  2  
ATOM 3621  N N    . ILE A 1 29  ? 15.650  8.528   11.794  1.00 0.00 ? 81  ILE A N    2  
ATOM 3622  C CA   . ILE A 1 29  ? 14.946  7.537   10.998  1.00 0.00 ? 81  ILE A CA   2  
ATOM 3623  C C    . ILE A 1 29  ? 15.828  7.039   9.857   1.00 0.00 ? 81  ILE A C    2  
ATOM 3624  O O    . ILE A 1 29  ? 15.702  5.885   9.449   1.00 0.00 ? 81  ILE A O    2  
ATOM 3625  C CB   . ILE A 1 29  ? 13.603  8.120   10.531  1.00 0.00 ? 81  ILE A CB   2  
ATOM 3626  C CG1  . ILE A 1 29  ? 12.885  7.183   9.553   1.00 0.00 ? 81  ILE A CG1  2  
ATOM 3627  C CG2  . ILE A 1 29  ? 13.763  9.507   9.909   1.00 0.00 ? 81  ILE A CG2  2  
ATOM 3628  C CD1  . ILE A 1 29  ? 13.263  7.452   8.095   1.00 0.00 ? 81  ILE A CD1  2  
ATOM 3629  H H    . ILE A 1 29  ? 15.371  9.496   11.716  1.00 0.00 ? 81  ILE A H    2  
ATOM 3630  H HA   . ILE A 1 29  ? 14.726  6.683   11.638  1.00 0.00 ? 81  ILE A HA   2  
ATOM 3631  H HB   . ILE A 1 29  ? 12.971  8.221   11.413  1.00 0.00 ? 81  ILE A HB   2  
ATOM 3632  H HG12 . ILE A 1 29  ? 13.117  6.151   9.815   1.00 0.00 ? 81  ILE A HG12 2  
ATOM 3633  H HG13 . ILE A 1 29  ? 11.811  7.335   9.658   1.00 0.00 ? 81  ILE A HG13 2  
ATOM 3634  H HG21 . ILE A 1 29  ? 14.487  9.478   9.095   1.00 0.00 ? 81  ILE A HG21 2  
ATOM 3635  H HG22 . ILE A 1 29  ? 12.797  9.845   9.533   1.00 0.00 ? 81  ILE A HG22 2  
ATOM 3636  H HG23 . ILE A 1 29  ? 14.109  10.208  10.669  1.00 0.00 ? 81  ILE A HG23 2  
ATOM 3637  H HD11 . ILE A 1 29  ? 12.867  8.420   7.788   1.00 0.00 ? 81  ILE A HD11 2  
ATOM 3638  H HD12 . ILE A 1 29  ? 14.346  7.462   7.971   1.00 0.00 ? 81  ILE A HD12 2  
ATOM 3639  H HD13 . ILE A 1 29  ? 12.843  6.667   7.464   1.00 0.00 ? 81  ILE A HD13 2  
ATOM 3640  N N    . THR A 1 30  ? 16.719  7.886   9.336   1.00 0.00 ? 82  THR A N    2  
ATOM 3641  C CA   . THR A 1 30  ? 17.616  7.462   8.270   1.00 0.00 ? 82  THR A CA   2  
ATOM 3642  C C    . THR A 1 30  ? 18.636  6.467   8.824   1.00 0.00 ? 82  THR A C    2  
ATOM 3643  O O    . THR A 1 30  ? 19.132  5.618   8.087   1.00 0.00 ? 82  THR A O    2  
ATOM 3644  C CB   . THR A 1 30  ? 18.321  8.681   7.666   1.00 0.00 ? 82  THR A CB   2  
ATOM 3645  O OG1  . THR A 1 30  ? 17.362  9.565   7.131   1.00 0.00 ? 82  THR A OG1  2  
ATOM 3646  C CG2  . THR A 1 30  ? 19.255  8.273   6.528   1.00 0.00 ? 82  THR A CG2  2  
ATOM 3647  H H    . THR A 1 30  ? 16.783  8.834   9.676   1.00 0.00 ? 82  THR A H    2  
ATOM 3648  H HA   . THR A 1 30  ? 17.028  6.970   7.494   1.00 0.00 ? 82  THR A HA   2  
ATOM 3649  H HB   . THR A 1 30  ? 18.896  9.196   8.434   1.00 0.00 ? 82  THR A HB   2  
ATOM 3650  H HG1  . THR A 1 30  ? 17.007  10.091  7.851   1.00 0.00 ? 82  THR A HG1  2  
ATOM 3651  H HG21 . THR A 1 30  ? 18.695  7.700   5.789   1.00 0.00 ? 82  THR A HG21 2  
ATOM 3652  H HG22 . THR A 1 30  ? 19.667  9.168   6.060   1.00 0.00 ? 82  THR A HG22 2  
ATOM 3653  H HG23 . THR A 1 30  ? 20.071  7.665   6.917   1.00 0.00 ? 82  THR A HG23 2  
ATOM 3654  N N    . ALA A 1 31  ? 18.952  6.567   10.121  1.00 0.00 ? 83  ALA A N    2  
ATOM 3655  C CA   . ALA A 1 31  ? 19.865  5.643   10.774  1.00 0.00 ? 83  ALA A CA   2  
ATOM 3656  C C    . ALA A 1 31  ? 19.123  4.478   11.435  1.00 0.00 ? 83  ALA A C    2  
ATOM 3657  O O    . ALA A 1 31  ? 19.748  3.479   11.795  1.00 0.00 ? 83  ALA A O    2  
ATOM 3658  C CB   . ALA A 1 31  ? 20.696  6.415   11.796  1.00 0.00 ? 83  ALA A CB   2  
ATOM 3659  H H    . ALA A 1 31  ? 18.550  7.308   10.679  1.00 0.00 ? 83  ALA A H    2  
ATOM 3660  H HA   . ALA A 1 31  ? 20.541  5.230   10.026  1.00 0.00 ? 83  ALA A HA   2  
ATOM 3661  H HB1  . ALA A 1 31  ? 20.040  6.840   12.557  1.00 0.00 ? 83  ALA A HB1  2  
ATOM 3662  H HB2  . ALA A 1 31  ? 21.410  5.741   12.270  1.00 0.00 ? 83  ALA A HB2  2  
ATOM 3663  H HB3  . ALA A 1 31  ? 21.236  7.220   11.296  1.00 0.00 ? 83  ALA A HB3  2  
ATOM 3664  N N    . SER A 1 32  ? 17.801  4.591   11.603  1.00 0.00 ? 84  SER A N    2  
ATOM 3665  C CA   . SER A 1 32  ? 17.005  3.533   12.206  1.00 0.00 ? 84  SER A CA   2  
ATOM 3666  C C    . SER A 1 32  ? 16.850  2.359   11.247  1.00 0.00 ? 84  SER A C    2  
ATOM 3667  O O    . SER A 1 32  ? 17.093  1.216   11.632  1.00 0.00 ? 84  SER A O    2  
ATOM 3668  C CB   . SER A 1 32  ? 15.631  4.075   12.603  1.00 0.00 ? 84  SER A CB   2  
ATOM 3669  O OG   . SER A 1 32  ? 15.755  4.982   13.676  1.00 0.00 ? 84  SER A OG   2  
ATOM 3670  H H    . SER A 1 32  ? 17.327  5.434   11.310  1.00 0.00 ? 84  SER A H    2  
ATOM 3671  H HA   . SER A 1 32  ? 17.508  3.176   13.105  1.00 0.00 ? 84  SER A HA   2  
ATOM 3672  H HB2  . SER A 1 32  ? 15.170  4.571   11.748  1.00 0.00 ? 84  SER A HB2  2  
ATOM 3673  H HB3  . SER A 1 32  ? 14.991  3.249   12.915  1.00 0.00 ? 84  SER A HB3  2  
ATOM 3674  H HG   . SER A 1 32  ? 16.304  5.716   13.391  1.00 0.00 ? 84  SER A HG   2  
ATOM 3675  N N    . PHE A 1 33  ? 16.450  2.627   10.001  1.00 0.00 ? 85  PHE A N    2  
ATOM 3676  C CA   . PHE A 1 33  ? 16.280  1.576   9.006   1.00 0.00 ? 85  PHE A CA   2  
ATOM 3677  C C    . PHE A 1 33  ? 17.616  0.869   8.768   1.00 0.00 ? 85  PHE A C    2  
ATOM 3678  O O    . PHE A 1 33  ? 18.682  1.452   8.966   1.00 0.00 ? 85  PHE A O    2  
ATOM 3679  C CB   . PHE A 1 33  ? 15.706  2.164   7.718   1.00 0.00 ? 85  PHE A CB   2  
ATOM 3680  C CG   . PHE A 1 33  ? 14.207  2.384   7.693   1.00 0.00 ? 85  PHE A CG   2  
ATOM 3681  C CD1  . PHE A 1 33  ? 13.486  2.738   8.843   1.00 0.00 ? 85  PHE A CD1  2  
ATOM 3682  C CD2  . PHE A 1 33  ? 13.534  2.228   6.475   1.00 0.00 ? 85  PHE A CD2  2  
ATOM 3683  C CE1  . PHE A 1 33  ? 12.097  2.913   8.769   1.00 0.00 ? 85  PHE A CE1  2  
ATOM 3684  C CE2  . PHE A 1 33  ? 12.152  2.445   6.385   1.00 0.00 ? 85  PHE A CE2  2  
ATOM 3685  C CZ   . PHE A 1 33  ? 11.426  2.762   7.547   1.00 0.00 ? 85  PHE A CZ   2  
ATOM 3686  H H    . PHE A 1 33  ? 16.253  3.579   9.726   1.00 0.00 ? 85  PHE A H    2  
ATOM 3687  H HA   . PHE A 1 33  ? 15.572  0.838   9.381   1.00 0.00 ? 85  PHE A HA   2  
ATOM 3688  H HB2  . PHE A 1 33  ? 16.209  3.105   7.500   1.00 0.00 ? 85  PHE A HB2  2  
ATOM 3689  H HB3  . PHE A 1 33  ? 15.924  1.464   6.912   1.00 0.00 ? 85  PHE A HB3  2  
ATOM 3690  H HD1  . PHE A 1 33  ? 13.991  2.875   9.787   1.00 0.00 ? 85  PHE A HD1  2  
ATOM 3691  H HD2  . PHE A 1 33  ? 14.090  1.937   5.597   1.00 0.00 ? 85  PHE A HD2  2  
ATOM 3692  H HE1  . PHE A 1 33  ? 11.538  3.167   9.658   1.00 0.00 ? 85  PHE A HE1  2  
ATOM 3693  H HE2  . PHE A 1 33  ? 11.680  2.363   5.418   1.00 0.00 ? 85  PHE A HE2  2  
ATOM 3694  H HZ   . PHE A 1 33  ? 10.354  2.895   7.524   1.00 0.00 ? 85  PHE A HZ   2  
ATOM 3695  N N    . ARG A 1 34  ? 17.558  -0.398  8.341   1.00 0.00 ? 86  ARG A N    2  
ATOM 3696  C CA   . ARG A 1 34  ? 18.734  -1.260  8.279   1.00 0.00 ? 86  ARG A CA   2  
ATOM 3697  C C    . ARG A 1 34  ? 19.529  -1.138  6.977   1.00 0.00 ? 86  ARG A C    2  
ATOM 3698  O O    . ARG A 1 34  ? 20.694  -1.530  6.952   1.00 0.00 ? 86  ARG A O    2  
ATOM 3699  C CB   . ARG A 1 34  ? 18.295  -2.713  8.494   1.00 0.00 ? 86  ARG A CB   2  
ATOM 3700  C CG   . ARG A 1 34  ? 17.535  -2.947  9.807   1.00 0.00 ? 86  ARG A CG   2  
ATOM 3701  C CD   . ARG A 1 34  ? 18.406  -2.758  11.052  1.00 0.00 ? 86  ARG A CD   2  
ATOM 3702  N NE   . ARG A 1 34  ? 18.638  -1.341  11.358  1.00 0.00 ? 86  ARG A NE   2  
ATOM 3703  C CZ   . ARG A 1 34  ? 19.757  -0.860  11.907  1.00 0.00 ? 86  ARG A CZ   2  
ATOM 3704  N NH1  . ARG A 1 34  ? 20.767  -1.667  12.227  1.00 0.00 ? 86  ARG A NH1  2  
ATOM 3705  N NH2  . ARG A 1 34  ? 19.869  0.445   12.140  1.00 0.00 ? 86  ARG A NH2  2  
ATOM 3706  H H    . ARG A 1 34  ? 16.669  -0.787  8.059   1.00 0.00 ? 86  ARG A H    2  
ATOM 3707  H HA   . ARG A 1 34  ? 19.410  -0.981  9.089   1.00 0.00 ? 86  ARG A HA   2  
ATOM 3708  H HB2  . ARG A 1 34  ? 17.649  -3.004  7.666   1.00 0.00 ? 86  ARG A HB2  2  
ATOM 3709  H HB3  . ARG A 1 34  ? 19.176  -3.356  8.481   1.00 0.00 ? 86  ARG A HB3  2  
ATOM 3710  H HG2  . ARG A 1 34  ? 16.669  -2.288  9.862   1.00 0.00 ? 86  ARG A HG2  2  
ATOM 3711  H HG3  . ARG A 1 34  ? 17.176  -3.977  9.802   1.00 0.00 ? 86  ARG A HG3  2  
ATOM 3712  H HD2  . ARG A 1 34  ? 17.898  -3.213  11.903  1.00 0.00 ? 86  ARG A HD2  2  
ATOM 3713  H HD3  . ARG A 1 34  ? 19.356  -3.270  10.900  1.00 0.00 ? 86  ARG A HD3  2  
ATOM 3714  H HE   . ARG A 1 34  ? 17.898  -0.688  11.138  1.00 0.00 ? 86  ARG A HE   2  
ATOM 3715  H HH11 . ARG A 1 34  ? 20.688  -2.660  12.058  1.00 0.00 ? 86  ARG A HH11 2  
ATOM 3716  H HH12 . ARG A 1 34  ? 21.607  -1.289  12.638  1.00 0.00 ? 86  ARG A HH12 2  
ATOM 3717  H HH21 . ARG A 1 34  ? 19.106  1.063   11.903  1.00 0.00 ? 86  ARG A HH21 2  
ATOM 3718  H HH22 . ARG A 1 34  ? 20.713  0.818   12.550  1.00 0.00 ? 86  ARG A HH22 2  
ATOM 3719  N N    . ARG A 1 35  ? 18.930  -0.608  5.903   1.00 0.00 ? 87  ARG A N    2  
ATOM 3720  C CA   . ARG A 1 35  ? 19.616  -0.491  4.614   1.00 0.00 ? 87  ARG A CA   2  
ATOM 3721  C C    . ARG A 1 35  ? 19.280  0.805   3.878   1.00 0.00 ? 87  ARG A C    2  
ATOM 3722  O O    . ARG A 1 35  ? 19.814  1.044   2.798   1.00 0.00 ? 87  ARG A O    2  
ATOM 3723  C CB   . ARG A 1 35  ? 19.266  -1.687  3.722   1.00 0.00 ? 87  ARG A CB   2  
ATOM 3724  C CG   . ARG A 1 35  ? 19.693  -3.022  4.339   1.00 0.00 ? 87  ARG A CG   2  
ATOM 3725  C CD   . ARG A 1 35  ? 19.381  -4.179  3.387   1.00 0.00 ? 87  ARG A CD   2  
ATOM 3726  N NE   . ARG A 1 35  ? 20.140  -4.071  2.136   1.00 0.00 ? 87  ARG A NE   2  
ATOM 3727  C CZ   . ARG A 1 35  ? 21.384  -4.532  1.965   1.00 0.00 ? 87  ARG A CZ   2  
ATOM 3728  N NH1  . ARG A 1 35  ? 22.031  -5.140  2.957   1.00 0.00 ? 87  ARG A NH1  2  
ATOM 3729  N NH2  . ARG A 1 35  ? 21.990  -4.384  0.790   1.00 0.00 ? 87  ARG A NH2  2  
ATOM 3730  H H    . ARG A 1 35  ? 17.977  -0.280  5.975   1.00 0.00 ? 87  ARG A H    2  
ATOM 3731  H HA   . ARG A 1 35  ? 20.692  -0.495  4.790   1.00 0.00 ? 87  ARG A HA   2  
ATOM 3732  H HB2  . ARG A 1 35  ? 18.190  -1.703  3.546   1.00 0.00 ? 87  ARG A HB2  2  
ATOM 3733  H HB3  . ARG A 1 35  ? 19.773  -1.565  2.765   1.00 0.00 ? 87  ARG A HB3  2  
ATOM 3734  H HG2  . ARG A 1 35  ? 20.765  -3.003  4.541   1.00 0.00 ? 87  ARG A HG2  2  
ATOM 3735  H HG3  . ARG A 1 35  ? 19.156  -3.182  5.274   1.00 0.00 ? 87  ARG A HG3  2  
ATOM 3736  H HD2  . ARG A 1 35  ? 19.621  -5.123  3.877   1.00 0.00 ? 87  ARG A HD2  2  
ATOM 3737  H HD3  . ARG A 1 35  ? 18.315  -4.172  3.157   1.00 0.00 ? 87  ARG A HD3  2  
ATOM 3738  H HE   . ARG A 1 35  ? 19.687  -3.617  1.356   1.00 0.00 ? 87  ARG A HE   2  
ATOM 3739  H HH11 . ARG A 1 35  ? 21.579  -5.258  3.853   1.00 0.00 ? 87  ARG A HH11 2  
ATOM 3740  H HH12 . ARG A 1 35  ? 22.970  -5.481  2.814   1.00 0.00 ? 87  ARG A HH12 2  
ATOM 3741  H HH21 . ARG A 1 35  ? 21.515  -3.921  0.028   1.00 0.00 ? 87  ARG A HH21 2  
ATOM 3742  H HH22 . ARG A 1 35  ? 22.928  -4.734  0.658   1.00 0.00 ? 87  ARG A HH22 2  
ATOM 3743  N N    . PHE A 1 36  ? 18.405  1.643   4.442   1.00 0.00 ? 88  PHE A N    2  
ATOM 3744  C CA   . PHE A 1 36  ? 18.006  2.888   3.802   1.00 0.00 ? 88  PHE A CA   2  
ATOM 3745  C C    . PHE A 1 36  ? 19.022  3.997   4.084   1.00 0.00 ? 88  PHE A C    2  
ATOM 3746  O O    . PHE A 1 36  ? 19.797  3.914   5.036   1.00 0.00 ? 88  PHE A O    2  
ATOM 3747  C CB   . PHE A 1 36  ? 16.600  3.285   4.264   1.00 0.00 ? 88  PHE A CB   2  
ATOM 3748  C CG   . PHE A 1 36  ? 15.448  2.632   3.519   1.00 0.00 ? 88  PHE A CG   2  
ATOM 3749  C CD1  . PHE A 1 36  ? 15.626  1.467   2.752   1.00 0.00 ? 88  PHE A CD1  2  
ATOM 3750  C CD2  . PHE A 1 36  ? 14.175  3.217   3.595   1.00 0.00 ? 88  PHE A CD2  2  
ATOM 3751  C CE1  . PHE A 1 36  ? 14.545  0.918   2.047   1.00 0.00 ? 88  PHE A CE1  2  
ATOM 3752  C CE2  . PHE A 1 36  ? 13.092  2.658   2.904   1.00 0.00 ? 88  PHE A CE2  2  
ATOM 3753  C CZ   . PHE A 1 36  ? 13.278  1.510   2.123   1.00 0.00 ? 88  PHE A CZ   2  
ATOM 3754  H H    . PHE A 1 36  ? 18.004  1.418   5.341   1.00 0.00 ? 88  PHE A H    2  
ATOM 3755  H HA   . PHE A 1 36  ? 17.983  2.734   2.723   1.00 0.00 ? 88  PHE A HA   2  
ATOM 3756  H HB2  . PHE A 1 36  ? 16.503  3.076   5.329   1.00 0.00 ? 88  PHE A HB2  2  
ATOM 3757  H HB3  . PHE A 1 36  ? 16.498  4.362   4.132   1.00 0.00 ? 88  PHE A HB3  2  
ATOM 3758  H HD1  . PHE A 1 36  ? 16.588  0.981   2.694   1.00 0.00 ? 88  PHE A HD1  2  
ATOM 3759  H HD2  . PHE A 1 36  ? 14.025  4.105   4.193   1.00 0.00 ? 88  PHE A HD2  2  
ATOM 3760  H HE1  . PHE A 1 36  ? 14.692  0.037   1.442   1.00 0.00 ? 88  PHE A HE1  2  
ATOM 3761  H HE2  . PHE A 1 36  ? 12.116  3.113   2.972   1.00 0.00 ? 88  PHE A HE2  2  
ATOM 3762  H HZ   . PHE A 1 36  ? 12.447  1.082   1.583   1.00 0.00 ? 88  PHE A HZ   2  
ATOM 3763  N N    . GLY A 1 37  ? 19.014  5.041   3.246   1.00 0.00 ? 89  GLY A N    2  
ATOM 3764  C CA   . GLY A 1 37  ? 19.922  6.173   3.383   1.00 0.00 ? 89  GLY A CA   2  
ATOM 3765  C C    . GLY A 1 37  ? 19.591  7.283   2.383   1.00 0.00 ? 89  GLY A C    2  
ATOM 3766  O O    . GLY A 1 37  ? 19.281  8.399   2.794   1.00 0.00 ? 89  GLY A O    2  
ATOM 3767  H H    . GLY A 1 37  ? 18.355  5.056   2.481   1.00 0.00 ? 89  GLY A H    2  
ATOM 3768  H HA2  . GLY A 1 37  ? 19.851  6.571   4.395   1.00 0.00 ? 89  GLY A HA2  2  
ATOM 3769  H HA3  . GLY A 1 37  ? 20.944  5.833   3.213   1.00 0.00 ? 89  GLY A HA3  2  
ATOM 3770  N N    . PRO A 1 38  ? 19.655  6.996   1.074   1.00 0.00 ? 90  PRO A N    2  
ATOM 3771  C CA   . PRO A 1 38  ? 19.278  7.900   -0.008  1.00 0.00 ? 90  PRO A CA   2  
ATOM 3772  C C    . PRO A 1 38  ? 17.788  8.265   -0.046  1.00 0.00 ? 90  PRO A C    2  
ATOM 3773  O O    . PRO A 1 38  ? 17.332  8.860   -1.021  1.00 0.00 ? 90  PRO A O    2  
ATOM 3774  C CB   . PRO A 1 38  ? 19.673  7.177   -1.302  1.00 0.00 ? 90  PRO A CB   2  
ATOM 3775  C CG   . PRO A 1 38  ? 20.669  6.111   -0.852  1.00 0.00 ? 90  PRO A CG   2  
ATOM 3776  C CD   . PRO A 1 38  ? 20.136  5.744   0.527   1.00 0.00 ? 90  PRO A CD   2  
ATOM 3777  H HA   . PRO A 1 38  ? 19.866  8.813   0.086   1.00 0.00 ? 90  PRO A HA   2  
ATOM 3778  H HB2  . PRO A 1 38  ? 18.795  6.687   -1.723  1.00 0.00 ? 90  PRO A HB2  2  
ATOM 3779  H HB3  . PRO A 1 38  ? 20.117  7.860   -2.025  1.00 0.00 ? 90  PRO A HB3  2  
ATOM 3780  H HG2  . PRO A 1 38  ? 20.680  5.254   -1.527  1.00 0.00 ? 90  PRO A HG2  2  
ATOM 3781  H HG3  . PRO A 1 38  ? 21.661  6.553   -0.757  1.00 0.00 ? 90  PRO A HG3  2  
ATOM 3782  H HD2  . PRO A 1 38  ? 19.304  5.046   0.430   1.00 0.00 ? 90  PRO A HD2  2  
ATOM 3783  H HD3  . PRO A 1 38  ? 20.932  5.316   1.137   1.00 0.00 ? 90  PRO A HD3  2  
ATOM 3784  N N    . LEU A 1 39  ? 17.022  7.919   0.994   1.00 0.00 ? 91  LEU A N    2  
ATOM 3785  C CA   . LEU A 1 39  ? 15.582  8.146   1.023   1.00 0.00 ? 91  LEU A CA   2  
ATOM 3786  C C    . LEU A 1 39  ? 15.234  9.628   1.187   1.00 0.00 ? 91  LEU A C    2  
ATOM 3787  O O    . LEU A 1 39  ? 16.104  10.457  1.451   1.00 0.00 ? 91  LEU A O    2  
ATOM 3788  C CB   . LEU A 1 39  ? 14.947  7.291   2.131   1.00 0.00 ? 91  LEU A CB   2  
ATOM 3789  C CG   . LEU A 1 39  ? 14.990  7.938   3.522   1.00 0.00 ? 91  LEU A CG   2  
ATOM 3790  C CD1  . LEU A 1 39  ? 14.356  6.997   4.539   1.00 0.00 ? 91  LEU A CD1  2  
ATOM 3791  C CD2  . LEU A 1 39  ? 16.412  8.226   3.986   1.00 0.00 ? 91  LEU A CD2  2  
ATOM 3792  H H    . LEU A 1 39  ? 17.445  7.482   1.799   1.00 0.00 ? 91  LEU A H    2  
ATOM 3793  H HA   . LEU A 1 39  ? 15.172  7.806   0.072   1.00 0.00 ? 91  LEU A HA   2  
ATOM 3794  H HB2  . LEU A 1 39  ? 13.901  7.117   1.878   1.00 0.00 ? 91  LEU A HB2  2  
ATOM 3795  H HB3  . LEU A 1 39  ? 15.448  6.324   2.165   1.00 0.00 ? 91  LEU A HB3  2  
ATOM 3796  H HG   . LEU A 1 39  ? 14.423  8.868   3.508   1.00 0.00 ? 91  LEU A HG   2  
ATOM 3797  H HD11 . LEU A 1 39  ? 14.938  6.076   4.600   1.00 0.00 ? 91  LEU A HD11 2  
ATOM 3798  H HD12 . LEU A 1 39  ? 14.339  7.480   5.516   1.00 0.00 ? 91  LEU A HD12 2  
ATOM 3799  H HD13 . LEU A 1 39  ? 13.336  6.763   4.236   1.00 0.00 ? 91  LEU A HD13 2  
ATOM 3800  H HD21 . LEU A 1 39  ? 16.864  8.979   3.339   1.00 0.00 ? 91  LEU A HD21 2  
ATOM 3801  H HD22 . LEU A 1 39  ? 16.382  8.613   5.005   1.00 0.00 ? 91  LEU A HD22 2  
ATOM 3802  H HD23 . LEU A 1 39  ? 17.003  7.311   3.961   1.00 0.00 ? 91  LEU A HD23 2  
ATOM 3803  N N    . ILE A 1 40  ? 13.947  9.955   1.028   1.00 0.00 ? 92  ILE A N    2  
ATOM 3804  C CA   . ILE A 1 40  ? 13.426  11.300  1.244   1.00 0.00 ? 92  ILE A CA   2  
ATOM 3805  C C    . ILE A 1 40  ? 12.186  11.187  2.128   1.00 0.00 ? 92  ILE A C    2  
ATOM 3806  O O    . ILE A 1 40  ? 11.446  10.208  2.031   1.00 0.00 ? 92  ILE A O    2  
ATOM 3807  C CB   . ILE A 1 40  ? 13.121  11.984  -0.096  1.00 0.00 ? 92  ILE A CB   2  
ATOM 3808  C CG1  . ILE A 1 40  ? 14.382  12.008  -0.973  1.00 0.00 ? 92  ILE A CG1  2  
ATOM 3809  C CG2  . ILE A 1 40  ? 12.613  13.409  0.147   1.00 0.00 ? 92  ILE A CG2  2  
ATOM 3810  C CD1  . ILE A 1 40  ? 14.127  12.646  -2.340  1.00 0.00 ? 92  ILE A CD1  2  
ATOM 3811  H H    . ILE A 1 40  ? 13.290  9.240   0.751   1.00 0.00 ? 92  ILE A H    2  
ATOM 3812  H HA   . ILE A 1 40  ? 14.174  11.894  1.771   1.00 0.00 ? 92  ILE A HA   2  
ATOM 3813  H HB   . ILE A 1 40  ? 12.344  11.420  -0.611  1.00 0.00 ? 92  ILE A HB   2  
ATOM 3814  H HG12 . ILE A 1 40  ? 15.170  12.561  -0.461  1.00 0.00 ? 92  ILE A HG12 2  
ATOM 3815  H HG13 . ILE A 1 40  ? 14.722  10.985  -1.134  1.00 0.00 ? 92  ILE A HG13 2  
ATOM 3816  H HG21 . ILE A 1 40  ? 11.711  13.383  0.758   1.00 0.00 ? 92  ILE A HG21 2  
ATOM 3817  H HG22 . ILE A 1 40  ? 13.379  13.995  0.655   1.00 0.00 ? 92  ILE A HG22 2  
ATOM 3818  H HG23 . ILE A 1 40  ? 12.366  13.885  -0.803  1.00 0.00 ? 92  ILE A HG23 2  
ATOM 3819  H HD11 . ILE A 1 40  ? 13.290  12.142  -2.826  1.00 0.00 ? 92  ILE A HD11 2  
ATOM 3820  H HD12 . ILE A 1 40  ? 13.902  13.705  -2.223  1.00 0.00 ? 92  ILE A HD12 2  
ATOM 3821  H HD13 . ILE A 1 40  ? 15.018  12.543  -2.958  1.00 0.00 ? 92  ILE A HD13 2  
ATOM 3822  N N    . VAL A 1 41  ? 11.955  12.182  2.989   1.00 0.00 ? 93  VAL A N    2  
ATOM 3823  C CA   . VAL A 1 41  ? 10.899  12.121  3.996   1.00 0.00 ? 93  VAL A CA   2  
ATOM 3824  C C    . VAL A 1 41  ? 9.955   13.317  3.906   1.00 0.00 ? 93  VAL A C    2  
ATOM 3825  O O    . VAL A 1 41  ? 10.302  14.350  3.336   1.00 0.00 ? 93  VAL A O    2  
ATOM 3826  C CB   . VAL A 1 41  ? 11.521  12.035  5.395   1.00 0.00 ? 93  VAL A CB   2  
ATOM 3827  C CG1  . VAL A 1 41  ? 12.423  10.808  5.524   1.00 0.00 ? 93  VAL A CG1  2  
ATOM 3828  C CG2  . VAL A 1 41  ? 12.350  13.284  5.708   1.00 0.00 ? 93  VAL A CG2  2  
ATOM 3829  H H    . VAL A 1 41  ? 12.531  13.011  2.957   1.00 0.00 ? 93  VAL A H    2  
ATOM 3830  H HA   . VAL A 1 41  ? 10.309  11.219  3.835   1.00 0.00 ? 93  VAL A HA   2  
ATOM 3831  H HB   . VAL A 1 41  ? 10.714  11.955  6.124   1.00 0.00 ? 93  VAL A HB   2  
ATOM 3832  H HG11 . VAL A 1 41  ? 12.800  10.742  6.545   1.00 0.00 ? 93  VAL A HG11 2  
ATOM 3833  H HG12 . VAL A 1 41  ? 11.855  9.907   5.294   1.00 0.00 ? 93  VAL A HG12 2  
ATOM 3834  H HG13 . VAL A 1 41  ? 13.265  10.889  4.836   1.00 0.00 ? 93  VAL A HG13 2  
ATOM 3835  H HG21 . VAL A 1 41  ? 13.157  13.386  4.982   1.00 0.00 ? 93  VAL A HG21 2  
ATOM 3836  H HG22 . VAL A 1 41  ? 11.715  14.169  5.669   1.00 0.00 ? 93  VAL A HG22 2  
ATOM 3837  H HG23 . VAL A 1 41  ? 12.778  13.195  6.707   1.00 0.00 ? 93  VAL A HG23 2  
ATOM 3838  N N    . ASP A 1 42  ? 8.754   13.169  4.474   1.00 0.00 ? 94  ASP A N    2  
ATOM 3839  C CA   . ASP A 1 42  ? 7.771   14.240  4.507   1.00 0.00 ? 94  ASP A CA   2  
ATOM 3840  C C    . ASP A 1 42  ? 6.884   14.136  5.749   1.00 0.00 ? 94  ASP A C    2  
ATOM 3841  O O    . ASP A 1 42  ? 6.341   13.073  6.056   1.00 0.00 ? 94  ASP A O    2  
ATOM 3842  C CB   . ASP A 1 42  ? 6.912   14.185  3.242   1.00 0.00 ? 94  ASP A CB   2  
ATOM 3843  C CG   . ASP A 1 42  ? 5.890   15.319  3.227   1.00 0.00 ? 94  ASP A CG   2  
ATOM 3844  O OD1  . ASP A 1 42  ? 6.328   16.490  3.201   1.00 0.00 ? 94  ASP A OD1  2  
ATOM 3845  O OD2  . ASP A 1 42  ? 4.678   15.005  3.241   1.00 0.00 ? 94  ASP A OD2  2  
ATOM 3846  H H    . ASP A 1 42  ? 8.506   12.287  4.900   1.00 0.00 ? 94  ASP A H    2  
ATOM 3847  H HA   . ASP A 1 42  ? 8.291   15.197  4.534   1.00 0.00 ? 94  ASP A HA   2  
ATOM 3848  H HB2  . ASP A 1 42  ? 7.556   14.273  2.367   1.00 0.00 ? 94  ASP A HB2  2  
ATOM 3849  H HB3  . ASP A 1 42  ? 6.393   13.228  3.204   1.00 0.00 ? 94  ASP A HB3  2  
ATOM 3850  N N    . TRP A 1 43  ? 6.746   15.260  6.459   1.00 0.00 ? 95  TRP A N    2  
ATOM 3851  C CA   . TRP A 1 43  ? 5.893   15.397  7.630   1.00 0.00 ? 95  TRP A CA   2  
ATOM 3852  C C    . TRP A 1 43  ? 5.721   16.884  7.960   1.00 0.00 ? 95  TRP A C    2  
ATOM 3853  O O    . TRP A 1 43  ? 6.476   17.710  7.446   1.00 0.00 ? 95  TRP A O    2  
ATOM 3854  C CB   . TRP A 1 43  ? 6.511   14.640  8.809   1.00 0.00 ? 95  TRP A CB   2  
ATOM 3855  C CG   . TRP A 1 43  ? 7.976   14.833  9.050   1.00 0.00 ? 95  TRP A CG   2  
ATOM 3856  C CD1  . TRP A 1 43  ? 8.584   15.983  9.413   1.00 0.00 ? 95  TRP A CD1  2  
ATOM 3857  C CD2  . TRP A 1 43  ? 9.044   13.842  8.949   1.00 0.00 ? 95  TRP A CD2  2  
ATOM 3858  N NE1  . TRP A 1 43  ? 9.939   15.772  9.558   1.00 0.00 ? 95  TRP A NE1  2  
ATOM 3859  C CE2  . TRP A 1 43  ? 10.279  14.461  9.295   1.00 0.00 ? 95  TRP A CE2  2  
ATOM 3860  C CE3  . TRP A 1 43  ? 9.088   12.480  8.604   1.00 0.00 ? 95  TRP A CE3  2  
ATOM 3861  C CZ2  . TRP A 1 43  ? 11.489  13.760  9.315   1.00 0.00 ? 95  TRP A CZ2  2  
ATOM 3862  C CZ3  . TRP A 1 43  ? 10.296  11.766  8.614   1.00 0.00 ? 95  TRP A CZ3  2  
ATOM 3863  C CH2  . TRP A 1 43  ? 11.494  12.402  8.970   1.00 0.00 ? 95  TRP A CH2  2  
ATOM 3864  H H    . TRP A 1 43  ? 7.259   16.081  6.173   1.00 0.00 ? 95  TRP A H    2  
ATOM 3865  H HA   . TRP A 1 43  ? 4.913   14.971  7.413   1.00 0.00 ? 95  TRP A HA   2  
ATOM 3866  H HB2  . TRP A 1 43  ? 5.979   14.913  9.720   1.00 0.00 ? 95  TRP A HB2  2  
ATOM 3867  H HB3  . TRP A 1 43  ? 6.344   13.575  8.647   1.00 0.00 ? 95  TRP A HB3  2  
ATOM 3868  H HD1  . TRP A 1 43  ? 8.085   16.928  9.569   1.00 0.00 ? 95  TRP A HD1  2  
ATOM 3869  H HE1  . TRP A 1 43  ? 10.582  16.503  9.827   1.00 0.00 ? 95  TRP A HE1  2  
ATOM 3870  H HE3  . TRP A 1 43  ? 8.173   11.978  8.327   1.00 0.00 ? 95  TRP A HE3  2  
ATOM 3871  H HZ2  . TRP A 1 43  ? 12.407  14.257  9.591   1.00 0.00 ? 95  TRP A HZ2  2  
ATOM 3872  H HZ3  . TRP A 1 43  ? 10.303  10.722  8.343   1.00 0.00 ? 95  TRP A HZ3  2  
ATOM 3873  H HH2  . TRP A 1 43  ? 12.420  11.848  8.976   1.00 0.00 ? 95  TRP A HH2  2  
ATOM 3874  N N    . PRO A 1 44  ? 4.743   17.244  8.807   1.00 0.00 ? 96  PRO A N    2  
ATOM 3875  C CA   . PRO A 1 44  ? 4.510   18.615  9.237   1.00 0.00 ? 96  PRO A CA   2  
ATOM 3876  C C    . PRO A 1 44  ? 5.773   19.277  9.784   1.00 0.00 ? 96  PRO A C    2  
ATOM 3877  O O    . PRO A 1 44  ? 6.676   18.601  10.274  1.00 0.00 ? 96  PRO A O    2  
ATOM 3878  C CB   . PRO A 1 44  ? 3.415   18.527  10.301  1.00 0.00 ? 96  PRO A CB   2  
ATOM 3879  C CG   . PRO A 1 44  ? 2.652   17.266  9.903   1.00 0.00 ? 96  PRO A CG   2  
ATOM 3880  C CD   . PRO A 1 44  ? 3.772   16.353  9.414   1.00 0.00 ? 96  PRO A CD   2  
ATOM 3881  H HA   . PRO A 1 44  ? 4.136   19.188  8.388   1.00 0.00 ? 96  PRO A HA   2  
ATOM 3882  H HB2  . PRO A 1 44  ? 3.868   18.381  11.282  1.00 0.00 ? 96  PRO A HB2  2  
ATOM 3883  H HB3  . PRO A 1 44  ? 2.774   19.409  10.296  1.00 0.00 ? 96  PRO A HB3  2  
ATOM 3884  H HG2  . PRO A 1 44  ? 2.114   16.834  10.746  1.00 0.00 ? 96  PRO A HG2  2  
ATOM 3885  H HG3  . PRO A 1 44  ? 1.976   17.491  9.077   1.00 0.00 ? 96  PRO A HG3  2  
ATOM 3886  H HD2  . PRO A 1 44  ? 4.223   15.845  10.266  1.00 0.00 ? 96  PRO A HD2  2  
ATOM 3887  H HD3  . PRO A 1 44  ? 3.386   15.632  8.693   1.00 0.00 ? 96  PRO A HD3  2  
ATOM 3888  N N    . HIS A 1 45  ? 5.838   20.608  9.699   1.00 0.00 ? 97  HIS A N    2  
ATOM 3889  C CA   . HIS A 1 45  ? 7.032   21.358  10.063  1.00 0.00 ? 97  HIS A CA   2  
ATOM 3890  C C    . HIS A 1 45  ? 7.379   21.212  11.543  1.00 0.00 ? 97  HIS A C    2  
ATOM 3891  O O    . HIS A 1 45  ? 6.503   21.008  12.384  1.00 0.00 ? 97  HIS A O    2  
ATOM 3892  C CB   . HIS A 1 45  ? 6.843   22.830  9.692   1.00 0.00 ? 97  HIS A CB   2  
ATOM 3893  C CG   . HIS A 1 45  ? 5.709   23.491  10.433  1.00 0.00 ? 97  HIS A CG   2  
ATOM 3894  N ND1  . HIS A 1 45  ? 4.358   23.413  10.080  1.00 0.00 ? 97  HIS A ND1  2  
ATOM 3895  C CD2  . HIS A 1 45  ? 5.837   24.260  11.554  1.00 0.00 ? 97  HIS A CD2  2  
ATOM 3896  C CE1  . HIS A 1 45  ? 3.707   24.140  11.005  1.00 0.00 ? 97  HIS A CE1  2  
ATOM 3897  N NE2  . HIS A 1 45  ? 4.567   24.658  11.899  1.00 0.00 ? 97  HIS A NE2  2  
ATOM 3898  H H    . HIS A 1 45  ? 5.038   21.128  9.366   1.00 0.00 ? 97  HIS A H    2  
ATOM 3899  H HA   . HIS A 1 45  ? 7.867   20.969  9.482   1.00 0.00 ? 97  HIS A HA   2  
ATOM 3900  H HB2  . HIS A 1 45  ? 7.765   23.371  9.905   1.00 0.00 ? 97  HIS A HB2  2  
ATOM 3901  H HB3  . HIS A 1 45  ? 6.647   22.899  8.622   1.00 0.00 ? 97  HIS A HB3  2  
ATOM 3902  H HD2  . HIS A 1 45  ? 6.755   24.506  12.067  1.00 0.00 ? 97  HIS A HD2  2  
ATOM 3903  H HE1  . HIS A 1 45  ? 2.637   24.287  11.026  1.00 0.00 ? 97  HIS A HE1  2  
ATOM 3904  H HE2  . HIS A 1 45  ? 4.320   25.240  12.687  1.00 0.00 ? 97  HIS A HE2  2  
ATOM 3905  N N    . LYS A 1 46  ? 8.677   21.318  11.848  1.00 0.00 ? 98  LYS A N    2  
ATOM 3906  C CA   . LYS A 1 46  ? 9.202   21.228  13.205  1.00 0.00 ? 98  LYS A CA   2  
ATOM 3907  C C    . LYS A 1 46  ? 10.390  22.172  13.403  1.00 0.00 ? 98  LYS A C    2  
ATOM 3908  O O    . LYS A 1 46  ? 11.096  22.078  14.406  1.00 0.00 ? 98  LYS A O    2  
ATOM 3909  C CB   . LYS A 1 46  ? 9.585   19.777  13.520  1.00 0.00 ? 98  LYS A CB   2  
ATOM 3910  C CG   . LYS A 1 46  ? 10.689  19.279  12.582  1.00 0.00 ? 98  LYS A CG   2  
ATOM 3911  C CD   . LYS A 1 46  ? 11.125  17.856  12.936  1.00 0.00 ? 98  LYS A CD   2  
ATOM 3912  C CE   . LYS A 1 46  ? 11.678  17.795  14.361  1.00 0.00 ? 98  LYS A CE   2  
ATOM 3913  N NZ   . LYS A 1 46  ? 12.272  16.476  14.646  1.00 0.00 ? 98  LYS A NZ   2  
ATOM 3914  H H    . LYS A 1 46  ? 9.340   21.470  11.101  1.00 0.00 ? 98  LYS A H    2  
ATOM 3915  H HA   . LYS A 1 46  ? 8.417   21.535  13.896  1.00 0.00 ? 98  LYS A HA   2  
ATOM 3916  H HB2  . LYS A 1 46  ? 9.931   19.724  14.552  1.00 0.00 ? 98  LYS A HB2  2  
ATOM 3917  H HB3  . LYS A 1 46  ? 8.706   19.141  13.412  1.00 0.00 ? 98  LYS A HB3  2  
ATOM 3918  H HG2  . LYS A 1 46  ? 10.325  19.292  11.555  1.00 0.00 ? 98  LYS A HG2  2  
ATOM 3919  H HG3  . LYS A 1 46  ? 11.553  19.939  12.659  1.00 0.00 ? 98  LYS A HG3  2  
ATOM 3920  H HD2  . LYS A 1 46  ? 10.273  17.181  12.848  1.00 0.00 ? 98  LYS A HD2  2  
ATOM 3921  H HD3  . LYS A 1 46  ? 11.901  17.544  12.237  1.00 0.00 ? 98  LYS A HD3  2  
ATOM 3922  H HE2  . LYS A 1 46  ? 12.443  18.562  14.476  1.00 0.00 ? 98  LYS A HE2  2  
ATOM 3923  H HE3  . LYS A 1 46  ? 10.872  17.993  15.068  1.00 0.00 ? 98  LYS A HE3  2  
ATOM 3924  H HZ1  . LYS A 1 46  ? 12.621  16.455  15.593  1.00 0.00 ? 98  LYS A HZ1  2  
ATOM 3925  H HZ2  . LYS A 1 46  ? 11.578  15.750  14.534  1.00 0.00 ? 98  LYS A HZ2  2  
ATOM 3926  H HZ3  . LYS A 1 46  ? 13.038  16.308  14.010  1.00 0.00 ? 98  LYS A HZ3  2  
ATOM 3927  N N    . ALA A 1 47  ? 10.612  23.081  12.450  1.00 0.00 ? 99  ALA A N    2  
ATOM 3928  C CA   . ALA A 1 47  ? 11.736  24.005  12.479  1.00 0.00 ? 99  ALA A CA   2  
ATOM 3929  C C    . ALA A 1 47  ? 11.581  25.035  13.599  1.00 0.00 ? 99  ALA A C    2  
ATOM 3930  O O    . ALA A 1 47  ? 10.498  25.196  14.162  1.00 0.00 ? 99  ALA A O    2  
ATOM 3931  C CB   . ALA A 1 47  ? 11.852  24.689  11.116  1.00 0.00 ? 99  ALA A CB   2  
ATOM 3932  H H    . ALA A 1 47  ? 9.979   23.140  11.665  1.00 0.00 ? 99  ALA A H    2  
ATOM 3933  H HA   . ALA A 1 47  ? 12.650  23.439  12.656  1.00 0.00 ? 99  ALA A HA   2  
ATOM 3934  H HB1  . ALA A 1 47  ? 10.948  25.265  10.916  1.00 0.00 ? 99  ALA A HB1  2  
ATOM 3935  H HB2  . ALA A 1 47  ? 12.713  25.357  11.113  1.00 0.00 ? 99  ALA A HB2  2  
ATOM 3936  H HB3  . ALA A 1 47  ? 11.981  23.935  10.340  1.00 0.00 ? 99  ALA A HB3  2  
ATOM 3937  N N    . GLU A 1 48  ? 12.679  25.731  13.917  1.00 0.00 ? 100 GLU A N    2  
ATOM 3938  C CA   . GLU A 1 48  ? 12.739  26.723  14.985  1.00 0.00 ? 100 GLU A CA   2  
ATOM 3939  C C    . GLU A 1 48  ? 12.270  26.161  16.331  1.00 0.00 ? 100 GLU A C    2  
ATOM 3940  O O    . GLU A 1 48  ? 11.867  26.915  17.215  1.00 0.00 ? 100 GLU A O    2  
ATOM 3941  C CB   . GLU A 1 48  ? 11.986  27.996  14.583  1.00 0.00 ? 100 GLU A CB   2  
ATOM 3942  C CG   . GLU A 1 48  ? 12.523  28.585  13.276  1.00 0.00 ? 100 GLU A CG   2  
ATOM 3943  C CD   . GLU A 1 48  ? 14.001  28.958  13.395  1.00 0.00 ? 100 GLU A CD   2  
ATOM 3944  O OE1  . GLU A 1 48  ? 14.286  30.005  14.018  1.00 0.00 ? 100 GLU A OE1  2  
ATOM 3945  O OE2  . GLU A 1 48  ? 14.836  28.194  12.862  1.00 0.00 ? 100 GLU A OE2  2  
ATOM 3946  H H    . GLU A 1 48  ? 13.527  25.569  13.392  1.00 0.00 ? 100 GLU A H    2  
ATOM 3947  H HA   . GLU A 1 48  ? 13.788  26.989  15.111  1.00 0.00 ? 100 GLU A HA   2  
ATOM 3948  H HB2  . GLU A 1 48  ? 10.927  27.768  14.462  1.00 0.00 ? 100 GLU A HB2  2  
ATOM 3949  H HB3  . GLU A 1 48  ? 12.093  28.740  15.373  1.00 0.00 ? 100 GLU A HB3  2  
ATOM 3950  H HG2  . GLU A 1 48  ? 12.391  27.862  12.471  1.00 0.00 ? 100 GLU A HG2  2  
ATOM 3951  H HG3  . GLU A 1 48  ? 11.949  29.477  13.030  1.00 0.00 ? 100 GLU A HG3  2  
ATOM 3952  N N    . SER A 1 49  ? 12.323  24.835  16.487  1.00 0.00 ? 101 SER A N    2  
ATOM 3953  C CA   . SER A 1 49  ? 11.908  24.154  17.704  1.00 0.00 ? 101 SER A CA   2  
ATOM 3954  C C    . SER A 1 49  ? 12.739  22.891  17.911  1.00 0.00 ? 101 SER A C    2  
ATOM 3955  O O    . SER A 1 49  ? 13.459  22.459  17.011  1.00 0.00 ? 101 SER A O    2  
ATOM 3956  C CB   . SER A 1 49  ? 10.423  23.809  17.605  1.00 0.00 ? 101 SER A CB   2  
ATOM 3957  O OG   . SER A 1 49  ? 9.987   23.188  18.798  1.00 0.00 ? 101 SER A OG   2  
ATOM 3958  H H    . SER A 1 49  ? 12.665  24.264  15.727  1.00 0.00 ? 101 SER A H    2  
ATOM 3959  H HA   . SER A 1 49  ? 12.058  24.815  18.557  1.00 0.00 ? 101 SER A HA   2  
ATOM 3960  H HB2  . SER A 1 49  ? 9.850   24.724  17.448  1.00 0.00 ? 101 SER A HB2  2  
ATOM 3961  H HB3  . SER A 1 49  ? 10.263  23.135  16.764  1.00 0.00 ? 101 SER A HB3  2  
ATOM 3962  H HG   . SER A 1 49  ? 9.042   23.040  18.735  1.00 0.00 ? 101 SER A HG   2  
ATOM 3963  N N    . LYS A 1 50  ? 12.635  22.300  19.106  1.00 0.00 ? 102 LYS A N    2  
ATOM 3964  C CA   . LYS A 1 50  ? 13.360  21.092  19.478  1.00 0.00 ? 102 LYS A CA   2  
ATOM 3965  C C    . LYS A 1 50  ? 12.433  20.116  20.211  1.00 0.00 ? 102 LYS A C    2  
ATOM 3966  O O    . LYS A 1 50  ? 12.884  19.109  20.752  1.00 0.00 ? 102 LYS A O    2  
ATOM 3967  C CB   . LYS A 1 50  ? 14.582  21.493  20.314  1.00 0.00 ? 102 LYS A CB   2  
ATOM 3968  C CG   . LYS A 1 50  ? 15.608  20.363  20.427  1.00 0.00 ? 102 LYS A CG   2  
ATOM 3969  C CD   . LYS A 1 50  ? 16.846  20.867  21.170  1.00 0.00 ? 102 LYS A CD   2  
ATOM 3970  C CE   . LYS A 1 50  ? 17.871  19.741  21.285  1.00 0.00 ? 102 LYS A CE   2  
ATOM 3971  N NZ   . LYS A 1 50  ? 19.080  20.194  22.001  1.00 0.00 ? 102 LYS A NZ   2  
ATOM 3972  H H    . LYS A 1 50  ? 12.020  22.711  19.794  1.00 0.00 ? 102 LYS A H    2  
ATOM 3973  H HA   . LYS A 1 50  ? 13.705  20.606  18.566  1.00 0.00 ? 102 LYS A HA   2  
ATOM 3974  H HB2  . LYS A 1 50  ? 15.065  22.344  19.835  1.00 0.00 ? 102 LYS A HB2  2  
ATOM 3975  H HB3  . LYS A 1 50  ? 14.256  21.796  21.310  1.00 0.00 ? 102 LYS A HB3  2  
ATOM 3976  H HG2  . LYS A 1 50  ? 15.184  19.523  20.978  1.00 0.00 ? 102 LYS A HG2  2  
ATOM 3977  H HG3  . LYS A 1 50  ? 15.895  20.035  19.429  1.00 0.00 ? 102 LYS A HG3  2  
ATOM 3978  H HD2  . LYS A 1 50  ? 17.283  21.701  20.622  1.00 0.00 ? 102 LYS A HD2  2  
ATOM 3979  H HD3  . LYS A 1 50  ? 16.559  21.201  22.167  1.00 0.00 ? 102 LYS A HD3  2  
ATOM 3980  H HE2  . LYS A 1 50  ? 17.424  18.903  21.820  1.00 0.00 ? 102 LYS A HE2  2  
ATOM 3981  H HE3  . LYS A 1 50  ? 18.147  19.409  20.283  1.00 0.00 ? 102 LYS A HE3  2  
ATOM 3982  H HZ1  . LYS A 1 50  ? 19.503  20.967  21.508  1.00 0.00 ? 102 LYS A HZ1  2  
ATOM 3983  H HZ2  . LYS A 1 50  ? 18.835  20.489  22.935  1.00 0.00 ? 102 LYS A HZ2  2  
ATOM 3984  H HZ3  . LYS A 1 50  ? 19.746  19.436  22.060  1.00 0.00 ? 102 LYS A HZ3  2  
ATOM 3985  N N    . SER A 1 51  ? 11.130  20.412  20.230  1.00 0.00 ? 103 SER A N    2  
ATOM 3986  C CA   . SER A 1 51  ? 10.143  19.595  20.922  1.00 0.00 ? 103 SER A CA   2  
ATOM 3987  C C    . SER A 1 51  ? 8.925   19.289  20.048  1.00 0.00 ? 103 SER A C    2  
ATOM 3988  O O    . SER A 1 51  ? 7.957   18.705  20.531  1.00 0.00 ? 103 SER A O    2  
ATOM 3989  C CB   . SER A 1 51  ? 9.725   20.291  22.217  1.00 0.00 ? 103 SER A CB   2  
ATOM 3990  O OG   . SER A 1 51  ? 9.141   21.543  21.923  1.00 0.00 ? 103 SER A OG   2  
ATOM 3991  H H    . SER A 1 51  ? 10.802  21.238  19.749  1.00 0.00 ? 103 SER A H    2  
ATOM 3992  H HA   . SER A 1 51  ? 10.605  18.642  21.183  1.00 0.00 ? 103 SER A HA   2  
ATOM 3993  H HB2  . SER A 1 51  ? 9.006   19.669  22.751  1.00 0.00 ? 103 SER A HB2  2  
ATOM 3994  H HB3  . SER A 1 51  ? 10.604  20.441  22.845  1.00 0.00 ? 103 SER A HB3  2  
ATOM 3995  H HG   . SER A 1 51  ? 8.891   21.962  22.750  1.00 0.00 ? 103 SER A HG   2  
ATOM 3996  N N    . TYR A 1 52  ? 8.959   19.676  18.768  1.00 0.00 ? 104 TYR A N    2  
ATOM 3997  C CA   . TYR A 1 52  ? 7.866   19.397  17.848  1.00 0.00 ? 104 TYR A CA   2  
ATOM 3998  C C    . TYR A 1 52  ? 8.096   18.064  17.139  1.00 0.00 ? 104 TYR A C    2  
ATOM 3999  O O    . TYR A 1 52  ? 9.228   17.725  16.793  1.00 0.00 ? 104 TYR A O    2  
ATOM 4000  C CB   . TYR A 1 52  ? 7.713   20.538  16.837  1.00 0.00 ? 104 TYR A CB   2  
ATOM 4001  C CG   . TYR A 1 52  ? 7.313   21.885  17.411  1.00 0.00 ? 104 TYR A CG   2  
ATOM 4002  C CD1  . TYR A 1 52  ? 6.878   22.015  18.741  1.00 0.00 ? 104 TYR A CD1  2  
ATOM 4003  C CD2  . TYR A 1 52  ? 7.380   23.021  16.589  1.00 0.00 ? 104 TYR A CD2  2  
ATOM 4004  C CE1  . TYR A 1 52  ? 6.516   23.272  19.245  1.00 0.00 ? 104 TYR A CE1  2  
ATOM 4005  C CE2  . TYR A 1 52  ? 7.019   24.282  17.086  1.00 0.00 ? 104 TYR A CE2  2  
ATOM 4006  C CZ   . TYR A 1 52  ? 6.585   24.413  18.420  1.00 0.00 ? 104 TYR A CZ   2  
ATOM 4007  O OH   . TYR A 1 52  ? 6.232   25.635  18.913  1.00 0.00 ? 104 TYR A OH   2  
ATOM 4008  H H    . TYR A 1 52  ? 9.763   20.175  18.415  1.00 0.00 ? 104 TYR A H    2  
ATOM 4009  H HA   . TYR A 1 52  ? 6.937   19.315  18.411  1.00 0.00 ? 104 TYR A HA   2  
ATOM 4010  H HB2  . TYR A 1 52  ? 8.657   20.656  16.304  1.00 0.00 ? 104 TYR A HB2  2  
ATOM 4011  H HB3  . TYR A 1 52  ? 6.955   20.248  16.111  1.00 0.00 ? 104 TYR A HB3  2  
ATOM 4012  H HD1  . TYR A 1 52  ? 6.819   21.151  19.385  1.00 0.00 ? 104 TYR A HD1  2  
ATOM 4013  H HD2  . TYR A 1 52  ? 7.712   22.925  15.565  1.00 0.00 ? 104 TYR A HD2  2  
ATOM 4014  H HE1  . TYR A 1 52  ? 6.182   23.369  20.268  1.00 0.00 ? 104 TYR A HE1  2  
ATOM 4015  H HE2  . TYR A 1 52  ? 7.074   25.151  16.448  1.00 0.00 ? 104 TYR A HE2  2  
ATOM 4016  H HH   . TYR A 1 52  ? 6.324   26.337  18.265  1.00 0.00 ? 104 TYR A HH   2  
ATOM 4017  N N    . PHE A 1 53  ? 7.012   17.313  16.926  1.00 0.00 ? 105 PHE A N    2  
ATOM 4018  C CA   . PHE A 1 53  ? 7.047   15.995  16.305  1.00 0.00 ? 105 PHE A CA   2  
ATOM 4019  C C    . PHE A 1 53  ? 5.763   15.776  15.504  1.00 0.00 ? 105 PHE A C    2  
ATOM 4020  O O    . PHE A 1 53  ? 4.749   16.417  15.787  1.00 0.00 ? 105 PHE A O    2  
ATOM 4021  C CB   . PHE A 1 53  ? 7.181   14.930  17.396  1.00 0.00 ? 105 PHE A CB   2  
ATOM 4022  C CG   . PHE A 1 53  ? 8.457   15.034  18.200  1.00 0.00 ? 105 PHE A CG   2  
ATOM 4023  C CD1  . PHE A 1 53  ? 9.666   14.570  17.662  1.00 0.00 ? 105 PHE A CD1  2  
ATOM 4024  C CD2  . PHE A 1 53  ? 8.434   15.595  19.486  1.00 0.00 ? 105 PHE A CD2  2  
ATOM 4025  C CE1  . PHE A 1 53  ? 10.850  14.672  18.405  1.00 0.00 ? 105 PHE A CE1  2  
ATOM 4026  C CE2  . PHE A 1 53  ? 9.617   15.697  20.228  1.00 0.00 ? 105 PHE A CE2  2  
ATOM 4027  C CZ   . PHE A 1 53  ? 10.825  15.236  19.688  1.00 0.00 ? 105 PHE A CZ   2  
ATOM 4028  H H    . PHE A 1 53  ? 6.109   17.664  17.208  1.00 0.00 ? 105 PHE A H    2  
ATOM 4029  H HA   . PHE A 1 53  ? 7.902   15.932  15.633  1.00 0.00 ? 105 PHE A HA   2  
ATOM 4030  H HB2  . PHE A 1 53  ? 6.332   15.016  18.074  1.00 0.00 ? 105 PHE A HB2  2  
ATOM 4031  H HB3  . PHE A 1 53  ? 7.144   13.941  16.939  1.00 0.00 ? 105 PHE A HB3  2  
ATOM 4032  H HD1  . PHE A 1 53  ? 9.686   14.133  16.675  1.00 0.00 ? 105 PHE A HD1  2  
ATOM 4033  H HD2  . PHE A 1 53  ? 7.503   15.950  19.904  1.00 0.00 ? 105 PHE A HD2  2  
ATOM 4034  H HE1  . PHE A 1 53  ? 11.782  14.316  17.990  1.00 0.00 ? 105 PHE A HE1  2  
ATOM 4035  H HE2  . PHE A 1 53  ? 9.599   16.131  21.217  1.00 0.00 ? 105 PHE A HE2  2  
ATOM 4036  H HZ   . PHE A 1 53  ? 11.738  15.316  20.259  1.00 0.00 ? 105 PHE A HZ   2  
ATOM 4037  N N    . PRO A 1 54  ? 5.780   14.881  14.505  1.00 0.00 ? 106 PRO A N    2  
ATOM 4038  C CA   . PRO A 1 54  ? 4.614   14.583  13.690  1.00 0.00 ? 106 PRO A CA   2  
ATOM 4039  C C    . PRO A 1 54  ? 3.553   13.846  14.509  1.00 0.00 ? 106 PRO A C    2  
ATOM 4040  O O    . PRO A 1 54  ? 3.880   13.204  15.508  1.00 0.00 ? 106 PRO A O    2  
ATOM 4041  C CB   . PRO A 1 54  ? 5.136   13.717  12.546  1.00 0.00 ? 106 PRO A CB   2  
ATOM 4042  C CG   . PRO A 1 54  ? 6.343   13.014  13.166  1.00 0.00 ? 106 PRO A CG   2  
ATOM 4043  C CD   . PRO A 1 54  ? 6.921   14.092  14.081  1.00 0.00 ? 106 PRO A CD   2  
ATOM 4044  H HA   . PRO A 1 54  ? 4.198   15.508  13.292  1.00 0.00 ? 106 PRO A HA   2  
ATOM 4045  H HB2  . PRO A 1 54  ? 4.385   13.010  12.194  1.00 0.00 ? 106 PRO A HB2  2  
ATOM 4046  H HB3  . PRO A 1 54  ? 5.476   14.362  11.734  1.00 0.00 ? 106 PRO A HB3  2  
ATOM 4047  H HG2  . PRO A 1 54  ? 6.004   12.168  13.765  1.00 0.00 ? 106 PRO A HG2  2  
ATOM 4048  H HG3  . PRO A 1 54  ? 7.061   12.698  12.409  1.00 0.00 ? 106 PRO A HG3  2  
ATOM 4049  H HD2  . PRO A 1 54  ? 7.434   13.632  14.926  1.00 0.00 ? 106 PRO A HD2  2  
ATOM 4050  H HD3  . PRO A 1 54  ? 7.607   14.723  13.518  1.00 0.00 ? 106 PRO A HD3  2  
ATOM 4051  N N    . PRO A 1 55  ? 2.279   13.930  14.102  1.00 0.00 ? 107 PRO A N    2  
ATOM 4052  C CA   . PRO A 1 55  ? 1.167   13.313  14.806  1.00 0.00 ? 107 PRO A CA   2  
ATOM 4053  C C    . PRO A 1 55  ? 1.371   11.815  15.021  1.00 0.00 ? 107 PRO A C    2  
ATOM 4054  O O    . PRO A 1 55  ? 1.779   11.102  14.106  1.00 0.00 ? 107 PRO A O    2  
ATOM 4055  C CB   . PRO A 1 55  ? -0.065  13.578  13.938  1.00 0.00 ? 107 PRO A CB   2  
ATOM 4056  C CG   . PRO A 1 55  ? 0.314   14.838  13.164  1.00 0.00 ? 107 PRO A CG   2  
ATOM 4057  C CD   . PRO A 1 55  ? 1.808   14.643  12.929  1.00 0.00 ? 107 PRO A CD   2  
ATOM 4058  H HA   . PRO A 1 55  ? 1.045   13.811  15.768  1.00 0.00 ? 107 PRO A HA   2  
ATOM 4059  H HB2  . PRO A 1 55  ? -0.205  12.754  13.238  1.00 0.00 ? 107 PRO A HB2  2  
ATOM 4060  H HB3  . PRO A 1 55  ? -0.961  13.727  14.542  1.00 0.00 ? 107 PRO A HB3  2  
ATOM 4061  H HG2  . PRO A 1 55  ? -0.236  14.919  12.226  1.00 0.00 ? 107 PRO A HG2  2  
ATOM 4062  H HG3  . PRO A 1 55  ? 0.154   15.715  13.792  1.00 0.00 ? 107 PRO A HG3  2  
ATOM 4063  H HD2  . PRO A 1 55  ? 1.970   14.031  12.042  1.00 0.00 ? 107 PRO A HD2  2  
ATOM 4064  H HD3  . PRO A 1 55  ? 2.297   15.612  12.823  1.00 0.00 ? 107 PRO A HD3  2  
ATOM 4065  N N    . LYS A 1 56  ? 1.081   11.352  16.243  1.00 0.00 ? 108 LYS A N    2  
ATOM 4066  C CA   . LYS A 1 56  ? 1.170   9.950   16.650  1.00 0.00 ? 108 LYS A CA   2  
ATOM 4067  C C    . LYS A 1 56  ? 2.517   9.291   16.339  1.00 0.00 ? 108 LYS A C    2  
ATOM 4068  O O    . LYS A 1 56  ? 2.625   8.067   16.408  1.00 0.00 ? 108 LYS A O    2  
ATOM 4069  C CB   . LYS A 1 56  ? 0.002   9.154   16.056  1.00 0.00 ? 108 LYS A CB   2  
ATOM 4070  C CG   . LYS A 1 56  ? -1.365  9.749   16.409  1.00 0.00 ? 108 LYS A CG   2  
ATOM 4071  C CD   . LYS A 1 56  ? -1.603  9.772   17.920  1.00 0.00 ? 108 LYS A CD   2  
ATOM 4072  C CE   . LYS A 1 56  ? -3.010  10.294  18.208  1.00 0.00 ? 108 LYS A CE   2  
ATOM 4073  N NZ   . LYS A 1 56  ? -3.277  10.335  19.658  1.00 0.00 ? 108 LYS A NZ   2  
ATOM 4074  H H    . LYS A 1 56  ? 0.774   12.011  16.942  1.00 0.00 ? 108 LYS A H    2  
ATOM 4075  H HA   . LYS A 1 56  ? 1.069   9.927   17.736  1.00 0.00 ? 108 LYS A HA   2  
ATOM 4076  H HB2  . LYS A 1 56  ? 0.106   9.134   14.971  1.00 0.00 ? 108 LYS A HB2  2  
ATOM 4077  H HB3  . LYS A 1 56  ? 0.044   8.130   16.428  1.00 0.00 ? 108 LYS A HB3  2  
ATOM 4078  H HG2  . LYS A 1 56  ? -1.434  10.765  16.018  1.00 0.00 ? 108 LYS A HG2  2  
ATOM 4079  H HG3  . LYS A 1 56  ? -2.140  9.143   15.940  1.00 0.00 ? 108 LYS A HG3  2  
ATOM 4080  H HD2  . LYS A 1 56  ? -1.503  8.763   18.319  1.00 0.00 ? 108 LYS A HD2  2  
ATOM 4081  H HD3  . LYS A 1 56  ? -0.874  10.425  18.399  1.00 0.00 ? 108 LYS A HD3  2  
ATOM 4082  H HE2  . LYS A 1 56  ? -3.109  11.299  17.794  1.00 0.00 ? 108 LYS A HE2  2  
ATOM 4083  H HE3  . LYS A 1 56  ? -3.737  9.643   17.723  1.00 0.00 ? 108 LYS A HE3  2  
ATOM 4084  H HZ1  . LYS A 1 56  ? -2.614  10.944  20.116  1.00 0.00 ? 108 LYS A HZ1  2  
ATOM 4085  H HZ2  . LYS A 1 56  ? -4.212  10.682  19.825  1.00 0.00 ? 108 LYS A HZ2  2  
ATOM 4086  H HZ3  . LYS A 1 56  ? -3.198  9.407   20.048  1.00 0.00 ? 108 LYS A HZ3  2  
ATOM 4087  N N    . GLY A 1 57  ? 3.544   10.075  15.996  1.00 0.00 ? 109 GLY A N    2  
ATOM 4088  C CA   . GLY A 1 57  ? 4.849   9.534   15.648  1.00 0.00 ? 109 GLY A CA   2  
ATOM 4089  C C    . GLY A 1 57  ? 4.854   8.892   14.260  1.00 0.00 ? 109 GLY A C    2  
ATOM 4090  O O    . GLY A 1 57  ? 5.797   8.181   13.916  1.00 0.00 ? 109 GLY A O    2  
ATOM 4091  H H    . GLY A 1 57  ? 3.422   11.077  15.973  1.00 0.00 ? 109 GLY A H    2  
ATOM 4092  H HA2  . GLY A 1 57  ? 5.580   10.343  15.663  1.00 0.00 ? 109 GLY A HA2  2  
ATOM 4093  H HA3  . GLY A 1 57  ? 5.135   8.783   16.385  1.00 0.00 ? 109 GLY A HA3  2  
ATOM 4094  N N    . TYR A 1 58  ? 3.812   9.135   13.459  1.00 0.00 ? 110 TYR A N    2  
ATOM 4095  C CA   . TYR A 1 58  ? 3.706   8.561   12.125  1.00 0.00 ? 110 TYR A CA   2  
ATOM 4096  C C    . TYR A 1 58  ? 4.463   9.425   11.122  1.00 0.00 ? 110 TYR A C    2  
ATOM 4097  O O    . TYR A 1 58  ? 4.725   10.599  11.379  1.00 0.00 ? 110 TYR A O    2  
ATOM 4098  C CB   . TYR A 1 58  ? 2.234   8.429   11.721  1.00 0.00 ? 110 TYR A CB   2  
ATOM 4099  C CG   . TYR A 1 58  ? 1.370   7.564   12.621  1.00 0.00 ? 110 TYR A CG   2  
ATOM 4100  C CD1  . TYR A 1 58  ? 1.938   6.719   13.587  1.00 0.00 ? 110 TYR A CD1  2  
ATOM 4101  C CD2  . TYR A 1 58  ? -0.025  7.614   12.475  1.00 0.00 ? 110 TYR A CD2  2  
ATOM 4102  C CE1  . TYR A 1 58  ? 1.117   5.927   14.403  1.00 0.00 ? 110 TYR A CE1  2  
ATOM 4103  C CE2  . TYR A 1 58  ? -0.853  6.828   13.288  1.00 0.00 ? 110 TYR A CE2  2  
ATOM 4104  C CZ   . TYR A 1 58  ? -0.284  5.980   14.258  1.00 0.00 ? 110 TYR A CZ   2  
ATOM 4105  O OH   . TYR A 1 58  ? -1.082  5.211   15.052  1.00 0.00 ? 110 TYR A OH   2  
ATOM 4106  H H    . TYR A 1 58  ? 3.066   9.739   13.774  1.00 0.00 ? 110 TYR A H    2  
ATOM 4107  H HA   . TYR A 1 58  ? 4.161   7.572   12.117  1.00 0.00 ? 110 TYR A HA   2  
ATOM 4108  H HB2  . TYR A 1 58  ? 1.798   9.428   11.687  1.00 0.00 ? 110 TYR A HB2  2  
ATOM 4109  H HB3  . TYR A 1 58  ? 2.194   8.013   10.715  1.00 0.00 ? 110 TYR A HB3  2  
ATOM 4110  H HD1  . TYR A 1 58  ? 3.009   6.670   13.712  1.00 0.00 ? 110 TYR A HD1  2  
ATOM 4111  H HD2  . TYR A 1 58  ? -0.463  8.265   11.733  1.00 0.00 ? 110 TYR A HD2  2  
ATOM 4112  H HE1  . TYR A 1 58  ? 1.559   5.278   15.145  1.00 0.00 ? 110 TYR A HE1  2  
ATOM 4113  H HE2  . TYR A 1 58  ? -1.926  6.872   13.170  1.00 0.00 ? 110 TYR A HE2  2  
ATOM 4114  H HH   . TYR A 1 58  ? -2.016  5.325   14.863  1.00 0.00 ? 110 TYR A HH   2  
ATOM 4115  N N    . ALA A 1 59  ? 4.818   8.842   9.975   1.00 0.00 ? 111 ALA A N    2  
ATOM 4116  C CA   . ALA A 1 59  ? 5.569   9.549   8.955   1.00 0.00 ? 111 ALA A CA   2  
ATOM 4117  C C    . ALA A 1 59  ? 5.300   8.988   7.563   1.00 0.00 ? 111 ALA A C    2  
ATOM 4118  O O    . ALA A 1 59  ? 4.819   7.866   7.412   1.00 0.00 ? 111 ALA A O    2  
ATOM 4119  C CB   . ALA A 1 59  ? 7.056   9.423   9.266   1.00 0.00 ? 111 ALA A CB   2  
ATOM 4120  H H    . ALA A 1 59  ? 4.564   7.881   9.798   1.00 0.00 ? 111 ALA A H    2  
ATOM 4121  H HA   . ALA A 1 59  ? 5.296   10.604  8.969   1.00 0.00 ? 111 ALA A HA   2  
ATOM 4122  H HB1  . ALA A 1 59  ? 7.326   8.367   9.299   1.00 0.00 ? 111 ALA A HB1  2  
ATOM 4123  H HB2  . ALA A 1 59  ? 7.637   9.914   8.485   1.00 0.00 ? 111 ALA A HB2  2  
ATOM 4124  H HB3  . ALA A 1 59  ? 7.270   9.888   10.228  1.00 0.00 ? 111 ALA A HB3  2  
ATOM 4125  N N    . PHE A 1 60  ? 5.620   9.791   6.547   1.00 0.00 ? 112 PHE A N    2  
ATOM 4126  C CA   . PHE A 1 60  ? 5.567   9.353   5.166   1.00 0.00 ? 112 PHE A CA   2  
ATOM 4127  C C    . PHE A 1 60  ? 6.939   9.585   4.548   1.00 0.00 ? 112 PHE A C    2  
ATOM 4128  O O    . PHE A 1 60  ? 7.544   10.638  4.749   1.00 0.00 ? 112 PHE A O    2  
ATOM 4129  C CB   . PHE A 1 60  ? 4.474   10.107  4.414   1.00 0.00 ? 112 PHE A CB   2  
ATOM 4130  C CG   . PHE A 1 60  ? 3.084   9.863   4.960   1.00 0.00 ? 112 PHE A CG   2  
ATOM 4131  C CD1  . PHE A 1 60  ? 2.357   8.734   4.555   1.00 0.00 ? 112 PHE A CD1  2  
ATOM 4132  C CD2  . PHE A 1 60  ? 2.522   10.764  5.874   1.00 0.00 ? 112 PHE A CD2  2  
ATOM 4133  C CE1  . PHE A 1 60  ? 1.068   8.510   5.060   1.00 0.00 ? 112 PHE A CE1  2  
ATOM 4134  C CE2  . PHE A 1 60  ? 1.235   10.542  6.380   1.00 0.00 ? 112 PHE A CE2  2  
ATOM 4135  C CZ   . PHE A 1 60  ? 0.507   9.414   5.974   1.00 0.00 ? 112 PHE A CZ   2  
ATOM 4136  H H    . PHE A 1 60  ? 5.919   10.738  6.728   1.00 0.00 ? 112 PHE A H    2  
ATOM 4137  H HA   . PHE A 1 60  ? 5.346   8.286   5.129   1.00 0.00 ? 112 PHE A HA   2  
ATOM 4138  H HB2  . PHE A 1 60  ? 4.688   11.175  4.461   1.00 0.00 ? 112 PHE A HB2  2  
ATOM 4139  H HB3  . PHE A 1 60  ? 4.494   9.801   3.368   1.00 0.00 ? 112 PHE A HB3  2  
ATOM 4140  H HD1  . PHE A 1 60  ? 2.789   8.036   3.853   1.00 0.00 ? 112 PHE A HD1  2  
ATOM 4141  H HD2  . PHE A 1 60  ? 3.082   11.633  6.187   1.00 0.00 ? 112 PHE A HD2  2  
ATOM 4142  H HE1  . PHE A 1 60  ? 0.509   7.642   4.747   1.00 0.00 ? 112 PHE A HE1  2  
ATOM 4143  H HE2  . PHE A 1 60  ? 0.802   11.236  7.085   1.00 0.00 ? 112 PHE A HE2  2  
ATOM 4144  H HZ   . PHE A 1 60  ? -0.485  9.240   6.364   1.00 0.00 ? 112 PHE A HZ   2  
ATOM 4145  N N    . LEU A 1 61  ? 7.435   8.605   3.794   1.00 0.00 ? 113 LEU A N    2  
ATOM 4146  C CA   . LEU A 1 61  ? 8.742   8.699   3.171   1.00 0.00 ? 113 LEU A CA   2  
ATOM 4147  C C    . LEU A 1 61  ? 8.782   7.815   1.936   1.00 0.00 ? 113 LEU A C    2  
ATOM 4148  O O    . LEU A 1 61  ? 7.913   6.967   1.741   1.00 0.00 ? 113 LEU A O    2  
ATOM 4149  C CB   . LEU A 1 61  ? 9.830   8.351   4.196   1.00 0.00 ? 113 LEU A CB   2  
ATOM 4150  C CG   . LEU A 1 61  ? 9.703   6.973   4.861   1.00 0.00 ? 113 LEU A CG   2  
ATOM 4151  C CD1  . LEU A 1 61  ? 10.343  5.861   4.030   1.00 0.00 ? 113 LEU A CD1  2  
ATOM 4152  C CD2  . LEU A 1 61  ? 10.457  7.036   6.185   1.00 0.00 ? 113 LEU A CD2  2  
ATOM 4153  H H    . LEU A 1 61  ? 6.897   7.764   3.642   1.00 0.00 ? 113 LEU A H    2  
ATOM 4154  H HA   . LEU A 1 61  ? 8.908   9.727   2.849   1.00 0.00 ? 113 LEU A HA   2  
ATOM 4155  H HB2  . LEU A 1 61  ? 10.809  8.429   3.726   1.00 0.00 ? 113 LEU A HB2  2  
ATOM 4156  H HB3  . LEU A 1 61  ? 9.779   9.103   4.983   1.00 0.00 ? 113 LEU A HB3  2  
ATOM 4157  H HG   . LEU A 1 61  ? 8.657   6.740   5.058   1.00 0.00 ? 113 LEU A HG   2  
ATOM 4158  H HD11 . LEU A 1 61  ? 9.822   5.756   3.078   1.00 0.00 ? 113 LEU A HD11 2  
ATOM 4159  H HD12 . LEU A 1 61  ? 11.393  6.092   3.852   1.00 0.00 ? 113 LEU A HD12 2  
ATOM 4160  H HD13 . LEU A 1 61  ? 10.281  4.921   4.578   1.00 0.00 ? 113 LEU A HD13 2  
ATOM 4161  H HD21 . LEU A 1 61  ? 9.977   7.757   6.847   1.00 0.00 ? 113 LEU A HD21 2  
ATOM 4162  H HD22 . LEU A 1 61  ? 10.456  6.054   6.659   1.00 0.00 ? 113 LEU A HD22 2  
ATOM 4163  H HD23 . LEU A 1 61  ? 11.484  7.347   5.995   1.00 0.00 ? 113 LEU A HD23 2  
ATOM 4164  N N    . LEU A 1 62  ? 9.796   8.014   1.095   1.00 0.00 ? 114 LEU A N    2  
ATOM 4165  C CA   . LEU A 1 62  ? 9.938   7.238   -0.121  1.00 0.00 ? 114 LEU A CA   2  
ATOM 4166  C C    . LEU A 1 62  ? 11.410  7.031   -0.442  1.00 0.00 ? 114 LEU A C    2  
ATOM 4167  O O    . LEU A 1 62  ? 12.280  7.682   0.135   1.00 0.00 ? 114 LEU A O    2  
ATOM 4168  C CB   . LEU A 1 62  ? 9.143   7.879   -1.269  1.00 0.00 ? 114 LEU A CB   2  
ATOM 4169  C CG   . LEU A 1 62  ? 9.392   9.376   -1.489  1.00 0.00 ? 114 LEU A CG   2  
ATOM 4170  C CD1  . LEU A 1 62  ? 10.816  9.670   -1.952  1.00 0.00 ? 114 LEU A CD1  2  
ATOM 4171  C CD2  . LEU A 1 62  ? 8.429   9.869   -2.566  1.00 0.00 ? 114 LEU A CD2  2  
ATOM 4172  H H    . LEU A 1 62  ? 10.491  8.717   1.299   1.00 0.00 ? 114 LEU A H    2  
ATOM 4173  H HA   . LEU A 1 62  ? 9.512   6.251   0.061   1.00 0.00 ? 114 LEU A HA   2  
ATOM 4174  H HB2  . LEU A 1 62  ? 9.356   7.342   -2.192  1.00 0.00 ? 114 LEU A HB2  2  
ATOM 4175  H HB3  . LEU A 1 62  ? 8.083   7.753   -1.046  1.00 0.00 ? 114 LEU A HB3  2  
ATOM 4176  H HG   . LEU A 1 62  ? 9.195   9.923   -0.567  1.00 0.00 ? 114 LEU A HG   2  
ATOM 4177  H HD11 . LEU A 1 62  ? 11.510  9.484   -1.133  1.00 0.00 ? 114 LEU A HD11 2  
ATOM 4178  H HD12 . LEU A 1 62  ? 11.066  9.038   -2.805  1.00 0.00 ? 114 LEU A HD12 2  
ATOM 4179  H HD13 . LEU A 1 62  ? 10.892  10.718  -2.243  1.00 0.00 ? 114 LEU A HD13 2  
ATOM 4180  H HD21 . LEU A 1 62  ? 8.617   9.334   -3.497  1.00 0.00 ? 114 LEU A HD21 2  
ATOM 4181  H HD22 . LEU A 1 62  ? 7.401   9.690   -2.249  1.00 0.00 ? 114 LEU A HD22 2  
ATOM 4182  H HD23 . LEU A 1 62  ? 8.572   10.938  -2.727  1.00 0.00 ? 114 LEU A HD23 2  
ATOM 4183  N N    . PHE A 1 63  ? 11.687  6.114   -1.369  1.00 0.00 ? 115 PHE A N    2  
ATOM 4184  C CA   . PHE A 1 63  ? 13.049  5.751   -1.710  1.00 0.00 ? 115 PHE A CA   2  
ATOM 4185  C C    . PHE A 1 63  ? 13.378  6.159   -3.146  1.00 0.00 ? 115 PHE A C    2  
ATOM 4186  O O    . PHE A 1 63  ? 12.478  6.422   -3.941  1.00 0.00 ? 115 PHE A O    2  
ATOM 4187  C CB   . PHE A 1 63  ? 13.240  4.259   -1.433  1.00 0.00 ? 115 PHE A CB   2  
ATOM 4188  C CG   . PHE A 1 63  ? 14.639  3.946   -0.967  1.00 0.00 ? 115 PHE A CG   2  
ATOM 4189  C CD1  . PHE A 1 63  ? 14.962  4.033   0.396   1.00 0.00 ? 115 PHE A CD1  2  
ATOM 4190  C CD2  . PHE A 1 63  ? 15.614  3.577   -1.902  1.00 0.00 ? 115 PHE A CD2  2  
ATOM 4191  C CE1  . PHE A 1 63  ? 16.291  3.837   0.793   1.00 0.00 ? 115 PHE A CE1  2  
ATOM 4192  C CE2  . PHE A 1 63  ? 16.933  3.350   -1.494  1.00 0.00 ? 115 PHE A CE2  2  
ATOM 4193  C CZ   . PHE A 1 63  ? 17.272  3.484   -0.143  1.00 0.00 ? 115 PHE A CZ   2  
ATOM 4194  H H    . PHE A 1 63  ? 10.933  5.650   -1.854  1.00 0.00 ? 115 PHE A H    2  
ATOM 4195  H HA   . PHE A 1 63  ? 13.720  6.296   -1.047  1.00 0.00 ? 115 PHE A HA   2  
ATOM 4196  H HB2  . PHE A 1 63  ? 12.548  3.958   -0.646  1.00 0.00 ? 115 PHE A HB2  2  
ATOM 4197  H HB3  . PHE A 1 63  ? 13.011  3.692   -2.335  1.00 0.00 ? 115 PHE A HB3  2  
ATOM 4198  H HD1  . PHE A 1 63  ? 14.206  4.249   1.137   1.00 0.00 ? 115 PHE A HD1  2  
ATOM 4199  H HD2  . PHE A 1 63  ? 15.348  3.467   -2.944  1.00 0.00 ? 115 PHE A HD2  2  
ATOM 4200  H HE1  . PHE A 1 63  ? 16.561  3.959   1.832   1.00 0.00 ? 115 PHE A HE1  2  
ATOM 4201  H HE2  . PHE A 1 63  ? 17.685  3.073   -2.218  1.00 0.00 ? 115 PHE A HE2  2  
ATOM 4202  H HZ   . PHE A 1 63  ? 18.289  3.312   0.176   1.00 0.00 ? 115 PHE A HZ   2  
ATOM 4203  N N    . GLN A 1 64  ? 14.671  6.213   -3.484  1.00 0.00 ? 116 GLN A N    2  
ATOM 4204  C CA   . GLN A 1 64  ? 15.119  6.674   -4.793  1.00 0.00 ? 116 GLN A CA   2  
ATOM 4205  C C    . GLN A 1 64  ? 15.156  5.539   -5.821  1.00 0.00 ? 116 GLN A C    2  
ATOM 4206  O O    . GLN A 1 64  ? 15.107  5.796   -7.022  1.00 0.00 ? 116 GLN A O    2  
ATOM 4207  C CB   . GLN A 1 64  ? 16.493  7.326   -4.616  1.00 0.00 ? 116 GLN A CB   2  
ATOM 4208  C CG   . GLN A 1 64  ? 17.037  7.944   -5.909  1.00 0.00 ? 116 GLN A CG   2  
ATOM 4209  C CD   . GLN A 1 64  ? 16.119  9.031   -6.459  1.00 0.00 ? 116 GLN A CD   2  
ATOM 4210  O OE1  . GLN A 1 64  ? 16.254  10.203  -6.114  1.00 0.00 ? 116 GLN A OE1  2  
ATOM 4211  N NE2  . GLN A 1 64  ? 15.177  8.654   -7.320  1.00 0.00 ? 116 GLN A NE2  2  
ATOM 4212  H H    . GLN A 1 64  ? 15.373  5.932   -2.814  1.00 0.00 ? 116 GLN A H    2  
ATOM 4213  H HA   . GLN A 1 64  ? 14.418  7.430   -5.145  1.00 0.00 ? 116 GLN A HA   2  
ATOM 4214  H HB2  . GLN A 1 64  ? 16.417  8.111   -3.863  1.00 0.00 ? 116 GLN A HB2  2  
ATOM 4215  H HB3  . GLN A 1 64  ? 17.200  6.577   -4.260  1.00 0.00 ? 116 GLN A HB3  2  
ATOM 4216  H HG2  . GLN A 1 64  ? 18.015  8.378   -5.706  1.00 0.00 ? 116 GLN A HG2  2  
ATOM 4217  H HG3  . GLN A 1 64  ? 17.162  7.164   -6.660  1.00 0.00 ? 116 GLN A HG3  2  
ATOM 4218  H HE21 . GLN A 1 64  ? 15.095  7.681   -7.578  1.00 0.00 ? 116 GLN A HE21 2  
ATOM 4219  H HE22 . GLN A 1 64  ? 14.550  9.341   -7.710  1.00 0.00 ? 116 GLN A HE22 2  
ATOM 4220  N N    . ASP A 1 65  ? 15.240  4.289   -5.358  1.00 0.00 ? 117 ASP A N    2  
ATOM 4221  C CA   . ASP A 1 65  ? 15.290  3.129   -6.238  1.00 0.00 ? 117 ASP A CA   2  
ATOM 4222  C C    . ASP A 1 65  ? 14.313  2.056   -5.765  1.00 0.00 ? 117 ASP A C    2  
ATOM 4223  O O    . ASP A 1 65  ? 13.943  2.018   -4.594  1.00 0.00 ? 117 ASP A O    2  
ATOM 4224  C CB   . ASP A 1 65  ? 16.715  2.575   -6.285  1.00 0.00 ? 117 ASP A CB   2  
ATOM 4225  C CG   . ASP A 1 65  ? 17.693  3.590   -6.873  1.00 0.00 ? 117 ASP A CG   2  
ATOM 4226  O OD1  . ASP A 1 65  ? 17.732  3.695   -8.120  1.00 0.00 ? 117 ASP A OD1  2  
ATOM 4227  O OD2  . ASP A 1 65  ? 18.393  4.251   -6.075  1.00 0.00 ? 117 ASP A OD2  2  
ATOM 4228  H H    . ASP A 1 65  ? 15.276  4.127   -4.362  1.00 0.00 ? 117 ASP A H    2  
ATOM 4229  H HA   . ASP A 1 65  ? 15.002  3.429   -7.246  1.00 0.00 ? 117 ASP A HA   2  
ATOM 4230  H HB2  . ASP A 1 65  ? 17.032  2.311   -5.277  1.00 0.00 ? 117 ASP A HB2  2  
ATOM 4231  H HB3  . ASP A 1 65  ? 16.727  1.675   -6.899  1.00 0.00 ? 117 ASP A HB3  2  
ATOM 4232  N N    . GLU A 1 66  ? 13.895  1.179   -6.682  1.00 0.00 ? 118 GLU A N    2  
ATOM 4233  C CA   . GLU A 1 66  ? 12.913  0.145   -6.381  1.00 0.00 ? 118 GLU A CA   2  
ATOM 4234  C C    . GLU A 1 66  ? 13.573  -1.149  -5.906  1.00 0.00 ? 118 GLU A C    2  
ATOM 4235  O O    . GLU A 1 66  ? 12.884  -2.042  -5.415  1.00 0.00 ? 118 GLU A O    2  
ATOM 4236  C CB   . GLU A 1 66  ? 12.071  -0.126  -7.630  1.00 0.00 ? 118 GLU A CB   2  
ATOM 4237  C CG   . GLU A 1 66  ? 11.288  1.117   -8.050  1.00 0.00 ? 118 GLU A CG   2  
ATOM 4238  C CD   . GLU A 1 66  ? 10.509  0.871   -9.340  1.00 0.00 ? 118 GLU A CD   2  
ATOM 4239  O OE1  . GLU A 1 66  ? 9.480   0.162   -9.274  1.00 0.00 ? 118 GLU A OE1  2  
ATOM 4240  O OE2  . GLU A 1 66  ? 10.950  1.395   -10.387 1.00 0.00 ? 118 GLU A OE2  2  
ATOM 4241  H H    . GLU A 1 66  ? 14.260  1.225   -7.623  1.00 0.00 ? 118 GLU A H    2  
ATOM 4242  H HA   . GLU A 1 66  ? 12.256  0.502   -5.588  1.00 0.00 ? 118 GLU A HA   2  
ATOM 4243  H HB2  . GLU A 1 66  ? 12.730  -0.427  -8.444  1.00 0.00 ? 118 GLU A HB2  2  
ATOM 4244  H HB3  . GLU A 1 66  ? 11.368  -0.932  -7.424  1.00 0.00 ? 118 GLU A HB3  2  
ATOM 4245  H HG2  . GLU A 1 66  ? 10.597  1.390   -7.253  1.00 0.00 ? 118 GLU A HG2  2  
ATOM 4246  H HG3  . GLU A 1 66  ? 11.984  1.941   -8.209  1.00 0.00 ? 118 GLU A HG3  2  
ATOM 4247  N N    . SER A 1 67  ? 14.898  -1.265  -6.043  1.00 0.00 ? 119 SER A N    2  
ATOM 4248  C CA   . SER A 1 67  ? 15.608  -2.481  -5.674  1.00 0.00 ? 119 SER A CA   2  
ATOM 4249  C C    . SER A 1 67  ? 15.960  -2.502  -4.189  1.00 0.00 ? 119 SER A C    2  
ATOM 4250  O O    . SER A 1 67  ? 16.048  -3.576  -3.592  1.00 0.00 ? 119 SER A O    2  
ATOM 4251  C CB   . SER A 1 67  ? 16.874  -2.594  -6.524  1.00 0.00 ? 119 SER A CB   2  
ATOM 4252  O OG   . SER A 1 67  ? 17.691  -1.460  -6.321  1.00 0.00 ? 119 SER A OG   2  
ATOM 4253  H H    . SER A 1 67  ? 15.436  -0.496  -6.415  1.00 0.00 ? 119 SER A H    2  
ATOM 4254  H HA   . SER A 1 67  ? 14.973  -3.342  -5.887  1.00 0.00 ? 119 SER A HA   2  
ATOM 4255  H HB2  . SER A 1 67  ? 17.419  -3.496  -6.246  1.00 0.00 ? 119 SER A HB2  2  
ATOM 4256  H HB3  . SER A 1 67  ? 16.598  -2.657  -7.577  1.00 0.00 ? 119 SER A HB3  2  
ATOM 4257  H HG   . SER A 1 67  ? 18.480  -1.552  -6.861  1.00 0.00 ? 119 SER A HG   2  
ATOM 4258  N N    . SER A 1 68  ? 16.161  -1.329  -3.583  1.00 0.00 ? 120 SER A N    2  
ATOM 4259  C CA   . SER A 1 68  ? 16.518  -1.245  -2.175  1.00 0.00 ? 120 SER A CA   2  
ATOM 4260  C C    . SER A 1 68  ? 15.273  -1.365  -1.303  1.00 0.00 ? 120 SER A C    2  
ATOM 4261  O O    . SER A 1 68  ? 15.356  -1.815  -0.162  1.00 0.00 ? 120 SER A O    2  
ATOM 4262  C CB   . SER A 1 68  ? 17.249  0.070   -1.920  1.00 0.00 ? 120 SER A CB   2  
ATOM 4263  O OG   . SER A 1 68  ? 17.699  0.117   -0.582  1.00 0.00 ? 120 SER A OG   2  
ATOM 4264  H H    . SER A 1 68  ? 16.068  -0.468  -4.104  1.00 0.00 ? 120 SER A H    2  
ATOM 4265  H HA   . SER A 1 68  ? 17.193  -2.066  -1.933  1.00 0.00 ? 120 SER A HA   2  
ATOM 4266  H HB2  . SER A 1 68  ? 18.105  0.146   -2.591  1.00 0.00 ? 120 SER A HB2  2  
ATOM 4267  H HB3  . SER A 1 68  ? 16.570  0.902   -2.107  1.00 0.00 ? 120 SER A HB3  2  
ATOM 4268  H HG   . SER A 1 68  ? 18.149  0.953   -0.442  1.00 0.00 ? 120 SER A HG   2  
ATOM 4269  N N    . VAL A 1 69  ? 14.113  -0.963  -1.835  1.00 0.00 ? 121 VAL A N    2  
ATOM 4270  C CA   . VAL A 1 69  ? 12.853  -1.056  -1.114  1.00 0.00 ? 121 VAL A CA   2  
ATOM 4271  C C    . VAL A 1 69  ? 12.491  -2.521  -0.902  1.00 0.00 ? 121 VAL A C    2  
ATOM 4272  O O    . VAL A 1 69  ? 11.900  -2.870  0.116   1.00 0.00 ? 121 VAL A O    2  
ATOM 4273  C CB   . VAL A 1 69  ? 11.762  -0.333  -1.914  1.00 0.00 ? 121 VAL A CB   2  
ATOM 4274  C CG1  . VAL A 1 69  ? 10.377  -0.527  -1.295  1.00 0.00 ? 121 VAL A CG1  2  
ATOM 4275  C CG2  . VAL A 1 69  ? 12.065  1.163   -1.942  1.00 0.00 ? 121 VAL A CG2  2  
ATOM 4276  H H    . VAL A 1 69  ? 14.104  -0.581  -2.769  1.00 0.00 ? 121 VAL A H    2  
ATOM 4277  H HA   . VAL A 1 69  ? 12.955  -0.579  -0.139  1.00 0.00 ? 121 VAL A HA   2  
ATOM 4278  H HB   . VAL A 1 69  ? 11.750  -0.716  -2.934  1.00 0.00 ? 121 VAL A HB   2  
ATOM 4279  H HG11 . VAL A 1 69  ? 10.103  -1.582  -1.316  1.00 0.00 ? 121 VAL A HG11 2  
ATOM 4280  H HG12 . VAL A 1 69  ? 10.382  -0.172  -0.264  1.00 0.00 ? 121 VAL A HG12 2  
ATOM 4281  H HG13 . VAL A 1 69  ? 9.643   0.038   -1.869  1.00 0.00 ? 121 VAL A HG13 2  
ATOM 4282  H HG21 . VAL A 1 69  ? 13.052  1.331   -2.373  1.00 0.00 ? 121 VAL A HG21 2  
ATOM 4283  H HG22 . VAL A 1 69  ? 11.317  1.676   -2.544  1.00 0.00 ? 121 VAL A HG22 2  
ATOM 4284  H HG23 . VAL A 1 69  ? 12.045  1.558   -0.925  1.00 0.00 ? 121 VAL A HG23 2  
ATOM 4285  N N    . GLN A 1 70  ? 12.842  -3.388  -1.854  1.00 0.00 ? 122 GLN A N    2  
ATOM 4286  C CA   . GLN A 1 70  ? 12.533  -4.802  -1.749  1.00 0.00 ? 122 GLN A CA   2  
ATOM 4287  C C    . GLN A 1 70  ? 13.618  -5.548  -0.973  1.00 0.00 ? 122 GLN A C    2  
ATOM 4288  O O    . GLN A 1 70  ? 13.338  -6.590  -0.388  1.00 0.00 ? 122 GLN A O    2  
ATOM 4289  C CB   . GLN A 1 70  ? 12.341  -5.372  -3.156  1.00 0.00 ? 122 GLN A CB   2  
ATOM 4290  C CG   . GLN A 1 70  ? 11.937  -6.849  -3.131  1.00 0.00 ? 122 GLN A CG   2  
ATOM 4291  C CD   . GLN A 1 70  ? 10.618  -7.080  -2.402  1.00 0.00 ? 122 GLN A CD   2  
ATOM 4292  O OE1  . GLN A 1 70  ? 9.554   -7.083  -3.013  1.00 0.00 ? 122 GLN A OE1  2  
ATOM 4293  N NE2  . GLN A 1 70  ? 10.678  -7.276  -1.087  1.00 0.00 ? 122 GLN A NE2  2  
ATOM 4294  H H    . GLN A 1 70  ? 13.333  -3.066  -2.676  1.00 0.00 ? 122 GLN A H    2  
ATOM 4295  H HA   . GLN A 1 70  ? 11.595  -4.907  -1.204  1.00 0.00 ? 122 GLN A HA   2  
ATOM 4296  H HB2  . GLN A 1 70  ? 11.565  -4.802  -3.667  1.00 0.00 ? 122 GLN A HB2  2  
ATOM 4297  H HB3  . GLN A 1 70  ? 13.274  -5.269  -3.710  1.00 0.00 ? 122 GLN A HB3  2  
ATOM 4298  H HG2  . GLN A 1 70  ? 11.833  -7.201  -4.157  1.00 0.00 ? 122 GLN A HG2  2  
ATOM 4299  H HG3  . GLN A 1 70  ? 12.720  -7.429  -2.643  1.00 0.00 ? 122 GLN A HG3  2  
ATOM 4300  H HE21 . GLN A 1 70  ? 11.571  -7.263  -0.614  1.00 0.00 ? 122 GLN A HE21 2  
ATOM 4301  H HE22 . GLN A 1 70  ? 9.828   -7.437  -0.566  1.00 0.00 ? 122 GLN A HE22 2  
ATOM 4302  N N    . ALA A 1 71  ? 14.853  -5.037  -0.955  1.00 0.00 ? 123 ALA A N    2  
ATOM 4303  C CA   . ALA A 1 71  ? 15.935  -5.685  -0.231  1.00 0.00 ? 123 ALA A CA   2  
ATOM 4304  C C    . ALA A 1 71  ? 15.856  -5.386  1.266   1.00 0.00 ? 123 ALA A C    2  
ATOM 4305  O O    . ALA A 1 71  ? 16.186  -6.240  2.087   1.00 0.00 ? 123 ALA A O    2  
ATOM 4306  C CB   . ALA A 1 71  ? 17.264  -5.201  -0.809  1.00 0.00 ? 123 ALA A CB   2  
ATOM 4307  H H    . ALA A 1 71  ? 15.056  -4.182  -1.453  1.00 0.00 ? 123 ALA A H    2  
ATOM 4308  H HA   . ALA A 1 71  ? 15.859  -6.763  -0.371  1.00 0.00 ? 123 ALA A HA   2  
ATOM 4309  H HB1  . ALA A 1 71  ? 17.351  -4.123  -0.667  1.00 0.00 ? 123 ALA A HB1  2  
ATOM 4310  H HB2  . ALA A 1 71  ? 18.086  -5.700  -0.296  1.00 0.00 ? 123 ALA A HB2  2  
ATOM 4311  H HB3  . ALA A 1 71  ? 17.307  -5.430  -1.873  1.00 0.00 ? 123 ALA A HB3  2  
ATOM 4312  N N    . LEU A 1 72  ? 15.419  -4.176  1.623   1.00 0.00 ? 124 LEU A N    2  
ATOM 4313  C CA   . LEU A 1 72  ? 15.302  -3.756  3.009   1.00 0.00 ? 124 LEU A CA   2  
ATOM 4314  C C    . LEU A 1 72  ? 14.075  -4.403  3.645   1.00 0.00 ? 124 LEU A C    2  
ATOM 4315  O O    . LEU A 1 72  ? 14.167  -4.975  4.727   1.00 0.00 ? 124 LEU A O    2  
ATOM 4316  C CB   . LEU A 1 72  ? 15.248  -2.224  3.017   1.00 0.00 ? 124 LEU A CB   2  
ATOM 4317  C CG   . LEU A 1 72  ? 15.009  -1.545  4.372   1.00 0.00 ? 124 LEU A CG   2  
ATOM 4318  C CD1  . LEU A 1 72  ? 13.517  -1.488  4.683   1.00 0.00 ? 124 LEU A CD1  2  
ATOM 4319  C CD2  . LEU A 1 72  ? 15.762  -2.212  5.522   1.00 0.00 ? 124 LEU A CD2  2  
ATOM 4320  H H    . LEU A 1 72  ? 15.157  -3.513  0.907   1.00 0.00 ? 124 LEU A H    2  
ATOM 4321  H HA   . LEU A 1 72  ? 16.184  -4.081  3.562   1.00 0.00 ? 124 LEU A HA   2  
ATOM 4322  H HB2  . LEU A 1 72  ? 16.195  -1.860  2.618   1.00 0.00 ? 124 LEU A HB2  2  
ATOM 4323  H HB3  . LEU A 1 72  ? 14.461  -1.903  2.335   1.00 0.00 ? 124 LEU A HB3  2  
ATOM 4324  H HG   . LEU A 1 72  ? 15.366  -0.518  4.293   1.00 0.00 ? 124 LEU A HG   2  
ATOM 4325  H HD11 . LEU A 1 72  ? 12.977  -1.107  3.815   1.00 0.00 ? 124 LEU A HD11 2  
ATOM 4326  H HD12 . LEU A 1 72  ? 13.147  -2.481  4.936   1.00 0.00 ? 124 LEU A HD12 2  
ATOM 4327  H HD13 . LEU A 1 72  ? 13.346  -0.809  5.518   1.00 0.00 ? 124 LEU A HD13 2  
ATOM 4328  H HD21 . LEU A 1 72  ? 15.646  -1.611  6.425   1.00 0.00 ? 124 LEU A HD21 2  
ATOM 4329  H HD22 . LEU A 1 72  ? 15.362  -3.207  5.711   1.00 0.00 ? 124 LEU A HD22 2  
ATOM 4330  H HD23 . LEU A 1 72  ? 16.821  -2.289  5.274   1.00 0.00 ? 124 LEU A HD23 2  
ATOM 4331  N N    . ILE A 1 73  ? 12.923  -4.317  2.978   1.00 0.00 ? 125 ILE A N    2  
ATOM 4332  C CA   . ILE A 1 73  ? 11.692  -4.875  3.521   1.00 0.00 ? 125 ILE A CA   2  
ATOM 4333  C C    . ILE A 1 73  ? 11.767  -6.405  3.587   1.00 0.00 ? 125 ILE A C    2  
ATOM 4334  O O    . ILE A 1 73  ? 11.124  -7.011  4.442   1.00 0.00 ? 125 ILE A O    2  
ATOM 4335  C CB   . ILE A 1 73  ? 10.515  -4.388  2.672   1.00 0.00 ? 125 ILE A CB   2  
ATOM 4336  C CG1  . ILE A 1 73  ? 10.418  -2.861  2.816   1.00 0.00 ? 125 ILE A CG1  2  
ATOM 4337  C CG2  . ILE A 1 73  ? 9.208   -5.046  3.119   1.00 0.00 ? 125 ILE A CG2  2  
ATOM 4338  C CD1  . ILE A 1 73  ? 9.298   -2.305  1.936   1.00 0.00 ? 125 ILE A CD1  2  
ATOM 4339  H H    . ILE A 1 73  ? 12.894  -3.852  2.082   1.00 0.00 ? 125 ILE A H    2  
ATOM 4340  H HA   . ILE A 1 73  ? 11.550  -4.489  4.530   1.00 0.00 ? 125 ILE A HA   2  
ATOM 4341  H HB   . ILE A 1 73  ? 10.700  -4.644  1.629   1.00 0.00 ? 125 ILE A HB   2  
ATOM 4342  H HG12 . ILE A 1 73  ? 10.234  -2.597  3.857   1.00 0.00 ? 125 ILE A HG12 2  
ATOM 4343  H HG13 . ILE A 1 73  ? 11.359  -2.405  2.511   1.00 0.00 ? 125 ILE A HG13 2  
ATOM 4344  H HG21 . ILE A 1 73  ? 9.002   -4.787  4.158   1.00 0.00 ? 125 ILE A HG21 2  
ATOM 4345  H HG22 . ILE A 1 73  ? 8.387   -4.704  2.487   1.00 0.00 ? 125 ILE A HG22 2  
ATOM 4346  H HG23 . ILE A 1 73  ? 9.285   -6.128  3.020   1.00 0.00 ? 125 ILE A HG23 2  
ATOM 4347  H HD11 . ILE A 1 73  ? 9.393   -2.703  0.926   1.00 0.00 ? 125 ILE A HD11 2  
ATOM 4348  H HD12 . ILE A 1 73  ? 8.331   -2.592  2.349   1.00 0.00 ? 125 ILE A HD12 2  
ATOM 4349  H HD13 . ILE A 1 73  ? 9.363   -1.217  1.909   1.00 0.00 ? 125 ILE A HD13 2  
ATOM 4350  N N    . ASP A 1 74  ? 12.543  -7.042  2.702   1.00 0.00 ? 126 ASP A N    2  
ATOM 4351  C CA   . ASP A 1 74  ? 12.698  -8.494  2.718   1.00 0.00 ? 126 ASP A CA   2  
ATOM 4352  C C    . ASP A 1 74  ? 13.707  -8.930  3.782   1.00 0.00 ? 126 ASP A C    2  
ATOM 4353  O O    . ASP A 1 74  ? 13.682  -10.077 4.224   1.00 0.00 ? 126 ASP A O    2  
ATOM 4354  C CB   . ASP A 1 74  ? 13.131  -8.968  1.331   1.00 0.00 ? 126 ASP A CB   2  
ATOM 4355  C CG   . ASP A 1 74  ? 13.323  -10.481 1.280   1.00 0.00 ? 126 ASP A CG   2  
ATOM 4356  O OD1  . ASP A 1 74  ? 12.319  -11.204 1.469   1.00 0.00 ? 126 ASP A OD1  2  
ATOM 4357  O OD2  . ASP A 1 74  ? 14.479  -10.901 1.053   1.00 0.00 ? 126 ASP A OD2  2  
ATOM 4358  H H    . ASP A 1 74  ? 13.041  -6.515  1.998   1.00 0.00 ? 126 ASP A H    2  
ATOM 4359  H HA   . ASP A 1 74  ? 11.736  -8.948  2.953   1.00 0.00 ? 126 ASP A HA   2  
ATOM 4360  H HB2  . ASP A 1 74  ? 12.373  -8.684  0.601   1.00 0.00 ? 126 ASP A HB2  2  
ATOM 4361  H HB3  . ASP A 1 74  ? 14.073  -8.484  1.071   1.00 0.00 ? 126 ASP A HB3  2  
ATOM 4362  N N    . ALA A 1 75  ? 14.593  -8.020  4.198   1.00 0.00 ? 127 ALA A N    2  
ATOM 4363  C CA   . ALA A 1 75  ? 15.524  -8.278  5.286   1.00 0.00 ? 127 ALA A CA   2  
ATOM 4364  C C    . ALA A 1 75  ? 14.832  -8.094  6.640   1.00 0.00 ? 127 ALA A C    2  
ATOM 4365  O O    . ALA A 1 75  ? 15.480  -8.158  7.685   1.00 0.00 ? 127 ALA A O    2  
ATOM 4366  C CB   . ALA A 1 75  ? 16.733  -7.351  5.147   1.00 0.00 ? 127 ALA A CB   2  
ATOM 4367  H H    . ALA A 1 75  ? 14.626  -7.115  3.753   1.00 0.00 ? 127 ALA A H    2  
ATOM 4368  H HA   . ALA A 1 75  ? 15.866  -9.310  5.213   1.00 0.00 ? 127 ALA A HA   2  
ATOM 4369  H HB1  . ALA A 1 75  ? 16.408  -6.314  5.219   1.00 0.00 ? 127 ALA A HB1  2  
ATOM 4370  H HB2  . ALA A 1 75  ? 17.449  -7.564  5.940   1.00 0.00 ? 127 ALA A HB2  2  
ATOM 4371  H HB3  . ALA A 1 75  ? 17.210  -7.518  4.180   1.00 0.00 ? 127 ALA A HB3  2  
ATOM 4372  N N    . CYS A 1 76  ? 13.514  -7.863  6.618   1.00 0.00 ? 128 CYS A N    2  
ATOM 4373  C CA   . CYS A 1 76  ? 12.718  -7.569  7.797   1.00 0.00 ? 128 CYS A CA   2  
ATOM 4374  C C    . CYS A 1 76  ? 11.481  -8.471  7.855   1.00 0.00 ? 128 CYS A C    2  
ATOM 4375  O O    . CYS A 1 76  ? 11.344  -9.395  7.053   1.00 0.00 ? 128 CYS A O    2  
ATOM 4376  C CB   . CYS A 1 76  ? 12.361  -6.086  7.772   1.00 0.00 ? 128 CYS A CB   2  
ATOM 4377  S SG   . CYS A 1 76  ? 13.907  -5.139  7.770   1.00 0.00 ? 128 CYS A SG   2  
ATOM 4378  H H    . CYS A 1 76  ? 13.031  -7.888  5.731   1.00 0.00 ? 128 CYS A H    2  
ATOM 4379  H HA   . CYS A 1 76  ? 13.314  -7.743  8.692   1.00 0.00 ? 128 CYS A HA   2  
ATOM 4380  H HB2  . CYS A 1 76  ? 11.782  -5.854  6.878   1.00 0.00 ? 128 CYS A HB2  2  
ATOM 4381  H HB3  . CYS A 1 76  ? 11.786  -5.835  8.663   1.00 0.00 ? 128 CYS A HB3  2  
ATOM 4382  H HG   . CYS A 1 76  ? 14.304  -5.514  6.551   1.00 0.00 ? 128 CYS A HG   2  
ATOM 4383  N N    . ILE A 1 77  ? 10.577  -8.204  8.803   1.00 0.00 ? 129 ILE A N    2  
ATOM 4384  C CA   . ILE A 1 77  ? 9.415   -9.051  9.058   1.00 0.00 ? 129 ILE A CA   2  
ATOM 4385  C C    . ILE A 1 77  ? 8.288   -8.753  8.064   1.00 0.00 ? 129 ILE A C    2  
ATOM 4386  O O    . ILE A 1 77  ? 8.193   -7.650  7.528   1.00 0.00 ? 129 ILE A O    2  
ATOM 4387  C CB   . ILE A 1 77  ? 8.975   -8.876  10.520  1.00 0.00 ? 129 ILE A CB   2  
ATOM 4388  C CG1  . ILE A 1 77  ? 10.103  -9.368  11.437  1.00 0.00 ? 129 ILE A CG1  2  
ATOM 4389  C CG2  . ILE A 1 77  ? 7.683   -9.645  10.813  1.00 0.00 ? 129 ILE A CG2  2  
ATOM 4390  C CD1  . ILE A 1 77  ? 9.762   -9.198  12.919  1.00 0.00 ? 129 ILE A CD1  2  
ATOM 4391  H H    . ILE A 1 77  ? 10.692  -7.383  9.380   1.00 0.00 ? 129 ILE A H    2  
ATOM 4392  H HA   . ILE A 1 77  ? 9.709   -10.091 8.920   1.00 0.00 ? 129 ILE A HA   2  
ATOM 4393  H HB   . ILE A 1 77  ? 8.804   -7.817  10.713  1.00 0.00 ? 129 ILE A HB   2  
ATOM 4394  H HG12 . ILE A 1 77  ? 10.297  -10.423 11.239  1.00 0.00 ? 129 ILE A HG12 2  
ATOM 4395  H HG13 . ILE A 1 77  ? 11.009  -8.801  11.229  1.00 0.00 ? 129 ILE A HG13 2  
ATOM 4396  H HG21 . ILE A 1 77  ? 7.831   -10.707 10.612  1.00 0.00 ? 129 ILE A HG21 2  
ATOM 4397  H HG22 . ILE A 1 77  ? 7.396   -9.510  11.855  1.00 0.00 ? 129 ILE A HG22 2  
ATOM 4398  H HG23 . ILE A 1 77  ? 6.871   -9.267  10.190  1.00 0.00 ? 129 ILE A HG23 2  
ATOM 4399  H HD11 . ILE A 1 77  ? 8.942   -9.861  13.196  1.00 0.00 ? 129 ILE A HD11 2  
ATOM 4400  H HD12 . ILE A 1 77  ? 10.636  -9.449  13.520  1.00 0.00 ? 129 ILE A HD12 2  
ATOM 4401  H HD13 . ILE A 1 77  ? 9.478   -8.164  13.113  1.00 0.00 ? 129 ILE A HD13 2  
ATOM 4402  N N    . GLU A 1 78  ? 7.428   -9.746  7.819   1.00 0.00 ? 130 GLU A N    2  
ATOM 4403  C CA   . GLU A 1 78  ? 6.317   -9.627  6.885   1.00 0.00 ? 130 GLU A CA   2  
ATOM 4404  C C    . GLU A 1 78  ? 5.033   -10.204 7.485   1.00 0.00 ? 130 GLU A C    2  
ATOM 4405  O O    . GLU A 1 78  ? 5.078   -11.031 8.395   1.00 0.00 ? 130 GLU A O    2  
ATOM 4406  C CB   . GLU A 1 78  ? 6.648   -10.361 5.582   1.00 0.00 ? 130 GLU A CB   2  
ATOM 4407  C CG   . GLU A 1 78  ? 7.934   -9.839  4.939   1.00 0.00 ? 130 GLU A CG   2  
ATOM 4408  C CD   . GLU A 1 78  ? 8.193   -10.542 3.609   1.00 0.00 ? 130 GLU A CD   2  
ATOM 4409  O OE1  . GLU A 1 78  ? 8.645   -11.709 3.649   1.00 0.00 ? 130 GLU A OE1  2  
ATOM 4410  O OE2  . GLU A 1 78  ? 7.937   -9.909  2.560   1.00 0.00 ? 130 GLU A OE2  2  
ATOM 4411  H H    . GLU A 1 78  ? 7.540   -10.629 8.298   1.00 0.00 ? 130 GLU A H    2  
ATOM 4412  H HA   . GLU A 1 78  ? 6.148   -8.575  6.657   1.00 0.00 ? 130 GLU A HA   2  
ATOM 4413  H HB2  . GLU A 1 78  ? 6.758   -11.426 5.788   1.00 0.00 ? 130 GLU A HB2  2  
ATOM 4414  H HB3  . GLU A 1 78  ? 5.823   -10.223 4.883   1.00 0.00 ? 130 GLU A HB3  2  
ATOM 4415  H HG2  . GLU A 1 78  ? 7.844   -8.766  4.773   1.00 0.00 ? 130 GLU A HG2  2  
ATOM 4416  H HG3  . GLU A 1 78  ? 8.776   -10.022 5.607   1.00 0.00 ? 130 GLU A HG3  2  
ATOM 4417  N N    . GLU A 1 79  ? 3.885   -9.761  6.966   1.00 0.00 ? 131 GLU A N    2  
ATOM 4418  C CA   . GLU A 1 79  ? 2.572   -10.255 7.354   1.00 0.00 ? 131 GLU A CA   2  
ATOM 4419  C C    . GLU A 1 79  ? 1.660   -10.231 6.130   1.00 0.00 ? 131 GLU A C    2  
ATOM 4420  O O    . GLU A 1 79  ? 1.856   -9.420  5.225   1.00 0.00 ? 131 GLU A O    2  
ATOM 4421  C CB   . GLU A 1 79  ? 2.000   -9.375  8.476   1.00 0.00 ? 131 GLU A CB   2  
ATOM 4422  C CG   . GLU A 1 79  ? 0.671   -9.899  9.022   1.00 0.00 ? 131 GLU A CG   2  
ATOM 4423  C CD   . GLU A 1 79  ? 0.812   -11.313 9.581   1.00 0.00 ? 131 GLU A CD   2  
ATOM 4424  O OE1  . GLU A 1 79  ? 1.165   -11.431 10.775  1.00 0.00 ? 131 GLU A OE1  2  
ATOM 4425  O OE2  . GLU A 1 79  ? 0.563   -12.263 8.808   1.00 0.00 ? 131 GLU A OE2  2  
ATOM 4426  H H    . GLU A 1 79  ? 3.908   -9.042  6.256   1.00 0.00 ? 131 GLU A H    2  
ATOM 4427  H HA   . GLU A 1 79  ? 2.664   -11.281 7.711   1.00 0.00 ? 131 GLU A HA   2  
ATOM 4428  H HB2  . GLU A 1 79  ? 2.714   -9.327  9.297   1.00 0.00 ? 131 GLU A HB2  2  
ATOM 4429  H HB3  . GLU A 1 79  ? 1.844   -8.365  8.098   1.00 0.00 ? 131 GLU A HB3  2  
ATOM 4430  H HG2  . GLU A 1 79  ? 0.332   -9.231  9.813   1.00 0.00 ? 131 GLU A HG2  2  
ATOM 4431  H HG3  . GLU A 1 79  ? -0.078  -9.891  8.231   1.00 0.00 ? 131 GLU A HG3  2  
ATOM 4432  N N    . ASP A 1 80  ? 0.659   -11.112 6.088   1.00 0.00 ? 132 ASP A N    2  
ATOM 4433  C CA   . ASP A 1 80  ? -0.265  -11.168 4.963   1.00 0.00 ? 132 ASP A CA   2  
ATOM 4434  C C    . ASP A 1 80  ? -1.153  -9.920  4.909   1.00 0.00 ? 132 ASP A C    2  
ATOM 4435  O O    . ASP A 1 80  ? -1.949  -9.770  3.983   1.00 0.00 ? 132 ASP A O    2  
ATOM 4436  C CB   . ASP A 1 80  ? -1.117  -12.436 5.060   1.00 0.00 ? 132 ASP A CB   2  
ATOM 4437  C CG   . ASP A 1 80  ? -0.264  -13.696 4.945   1.00 0.00 ? 132 ASP A CG   2  
ATOM 4438  O OD1  . ASP A 1 80  ? 0.370   -13.870 3.880   1.00 0.00 ? 132 ASP A OD1  2  
ATOM 4439  O OD2  . ASP A 1 80  ? -0.251  -14.479 5.922   1.00 0.00 ? 132 ASP A OD2  2  
ATOM 4440  H H    . ASP A 1 80  ? 0.529   -11.763 6.849   1.00 0.00 ? 132 ASP A H    2  
ATOM 4441  H HA   . ASP A 1 80  ? 0.315   -11.209 4.043   1.00 0.00 ? 132 ASP A HA   2  
ATOM 4442  H HB2  . ASP A 1 80  ? -1.649  -12.438 6.011   1.00 0.00 ? 132 ASP A HB2  2  
ATOM 4443  H HB3  . ASP A 1 80  ? -1.849  -12.434 4.253   1.00 0.00 ? 132 ASP A HB3  2  
ATOM 4444  N N    . GLY A 1 81  ? -1.018  -9.027  5.897   1.00 0.00 ? 133 GLY A N    2  
ATOM 4445  C CA   . GLY A 1 81  ? -1.793  -7.798  5.972   1.00 0.00 ? 133 GLY A CA   2  
ATOM 4446  C C    . GLY A 1 81  ? -0.934  -6.537  5.871   1.00 0.00 ? 133 GLY A C    2  
ATOM 4447  O O    . GLY A 1 81  ? -1.455  -5.478  5.524   1.00 0.00 ? 133 GLY A O    2  
ATOM 4448  H H    . GLY A 1 81  ? -0.350  -9.207  6.632   1.00 0.00 ? 133 GLY A H    2  
ATOM 4449  H HA2  . GLY A 1 81  ? -2.542  -7.782  5.180   1.00 0.00 ? 133 GLY A HA2  2  
ATOM 4450  H HA3  . GLY A 1 81  ? -2.296  -7.784  6.938   1.00 0.00 ? 133 GLY A HA3  2  
ATOM 4451  N N    . LYS A 1 82  ? 0.369   -6.630  6.169   1.00 0.00 ? 134 LYS A N    2  
ATOM 4452  C CA   . LYS A 1 82  ? 1.251   -5.467  6.185   1.00 0.00 ? 134 LYS A CA   2  
ATOM 4453  C C    . LYS A 1 82  ? 2.712   -5.896  6.290   1.00 0.00 ? 134 LYS A C    2  
ATOM 4454  O O    . LYS A 1 82  ? 3.012   -7.085  6.353   1.00 0.00 ? 134 LYS A O    2  
ATOM 4455  C CB   . LYS A 1 82  ? 0.884   -4.573  7.376   1.00 0.00 ? 134 LYS A CB   2  
ATOM 4456  C CG   . LYS A 1 82  ? 1.308   -5.182  8.710   1.00 0.00 ? 134 LYS A CG   2  
ATOM 4457  C CD   . LYS A 1 82  ? 0.549   -4.491  9.839   1.00 0.00 ? 134 LYS A CD   2  
ATOM 4458  C CE   . LYS A 1 82  ? -0.907  -4.953  9.867   1.00 0.00 ? 134 LYS A CE   2  
ATOM 4459  N NZ   . LYS A 1 82  ? -1.627  -4.374  11.017  1.00 0.00 ? 134 LYS A NZ   2  
ATOM 4460  H H    . LYS A 1 82  ? 0.767   -7.532  6.391   1.00 0.00 ? 134 LYS A H    2  
ATOM 4461  H HA   . LYS A 1 82  ? 1.114   -4.901  5.263   1.00 0.00 ? 134 LYS A HA   2  
ATOM 4462  H HB2  . LYS A 1 82  ? 1.368   -3.603  7.264   1.00 0.00 ? 134 LYS A HB2  2  
ATOM 4463  H HB3  . LYS A 1 82  ? -0.194  -4.418  7.401   1.00 0.00 ? 134 LYS A HB3  2  
ATOM 4464  H HG2  . LYS A 1 82  ? 1.085   -6.249  8.727   1.00 0.00 ? 134 LYS A HG2  2  
ATOM 4465  H HG3  . LYS A 1 82  ? 2.380   -5.037  8.849   1.00 0.00 ? 134 LYS A HG3  2  
ATOM 4466  H HD2  . LYS A 1 82  ? 1.019   -4.760  10.785  1.00 0.00 ? 134 LYS A HD2  2  
ATOM 4467  H HD3  . LYS A 1 82  ? 0.599   -3.409  9.710   1.00 0.00 ? 134 LYS A HD3  2  
ATOM 4468  H HE2  . LYS A 1 82  ? -1.401  -4.656  8.942   1.00 0.00 ? 134 LYS A HE2  2  
ATOM 4469  H HE3  . LYS A 1 82  ? -0.925  -6.040  9.942   1.00 0.00 ? 134 LYS A HE3  2  
ATOM 4470  H HZ1  . LYS A 1 82  ? -1.625  -3.366  10.961  1.00 0.00 ? 134 LYS A HZ1  2  
ATOM 4471  H HZ2  . LYS A 1 82  ? -2.583  -4.700  11.025  1.00 0.00 ? 134 LYS A HZ2  2  
ATOM 4472  H HZ3  . LYS A 1 82  ? -1.180  -4.655  11.879  1.00 0.00 ? 134 LYS A HZ3  2  
ATOM 4473  N N    . LEU A 1 83  ? 3.626   -4.924  6.310   1.00 0.00 ? 135 LEU A N    2  
ATOM 4474  C CA   . LEU A 1 83  ? 5.047   -5.189  6.469   1.00 0.00 ? 135 LEU A CA   2  
ATOM 4475  C C    . LEU A 1 83  ? 5.502   -4.682  7.838   1.00 0.00 ? 135 LEU A C    2  
ATOM 4476  O O    . LEU A 1 83  ? 4.825   -3.856  8.452   1.00 0.00 ? 135 LEU A O    2  
ATOM 4477  C CB   . LEU A 1 83  ? 5.843   -4.532  5.334   1.00 0.00 ? 135 LEU A CB   2  
ATOM 4478  C CG   . LEU A 1 83  ? 5.701   -5.196  3.956   1.00 0.00 ? 135 LEU A CG   2  
ATOM 4479  C CD1  . LEU A 1 83  ? 6.203   -6.637  3.993   1.00 0.00 ? 135 LEU A CD1  2  
ATOM 4480  C CD2  . LEU A 1 83  ? 4.269   -5.194  3.425   1.00 0.00 ? 135 LEU A CD2  2  
ATOM 4481  H H    . LEU A 1 83  ? 3.334   -3.962  6.215   1.00 0.00 ? 135 LEU A H    2  
ATOM 4482  H HA   . LEU A 1 83  ? 5.222   -6.265  6.442   1.00 0.00 ? 135 LEU A HA   2  
ATOM 4483  H HB2  . LEU A 1 83  ? 5.538   -3.489  5.247   1.00 0.00 ? 135 LEU A HB2  2  
ATOM 4484  H HB3  . LEU A 1 83  ? 6.900   -4.549  5.603   1.00 0.00 ? 135 LEU A HB3  2  
ATOM 4485  H HG   . LEU A 1 83  ? 6.319   -4.633  3.257   1.00 0.00 ? 135 LEU A HG   2  
ATOM 4486  H HD11 . LEU A 1 83  ? 6.203   -7.046  2.981   1.00 0.00 ? 135 LEU A HD11 2  
ATOM 4487  H HD12 . LEU A 1 83  ? 7.218   -6.657  4.390   1.00 0.00 ? 135 LEU A HD12 2  
ATOM 4488  H HD13 . LEU A 1 83  ? 5.553   -7.244  4.623   1.00 0.00 ? 135 LEU A HD13 2  
ATOM 4489  H HD21 . LEU A 1 83  ? 3.831   -4.203  3.547   1.00 0.00 ? 135 LEU A HD21 2  
ATOM 4490  H HD22 . LEU A 1 83  ? 4.281   -5.452  2.365   1.00 0.00 ? 135 LEU A HD22 2  
ATOM 4491  H HD23 . LEU A 1 83  ? 3.670   -5.932  3.958   1.00 0.00 ? 135 LEU A HD23 2  
ATOM 4492  N N    . TYR A 1 84  ? 6.645   -5.177  8.317   1.00 0.00 ? 136 TYR A N    2  
ATOM 4493  C CA   . TYR A 1 84  ? 7.189   -4.775  9.607   1.00 0.00 ? 136 TYR A CA   2  
ATOM 4494  C C    . TYR A 1 84  ? 8.708   -4.648  9.537   1.00 0.00 ? 136 TYR A C    2  
ATOM 4495  O O    . TYR A 1 84  ? 9.370   -5.403  8.828   1.00 0.00 ? 136 TYR A O    2  
ATOM 4496  C CB   . TYR A 1 84  ? 6.821   -5.806  10.677  1.00 0.00 ? 136 TYR A CB   2  
ATOM 4497  C CG   . TYR A 1 84  ? 5.458   -5.631  11.308  1.00 0.00 ? 136 TYR A CG   2  
ATOM 4498  C CD1  . TYR A 1 84  ? 5.286   -4.676  12.321  1.00 0.00 ? 136 TYR A CD1  2  
ATOM 4499  C CD2  . TYR A 1 84  ? 4.375   -6.420  10.894  1.00 0.00 ? 136 TYR A CD2  2  
ATOM 4500  C CE1  . TYR A 1 84  ? 4.037   -4.516  12.936  1.00 0.00 ? 136 TYR A CE1  2  
ATOM 4501  C CE2  . TYR A 1 84  ? 3.124   -6.273  11.511  1.00 0.00 ? 136 TYR A CE2  2  
ATOM 4502  C CZ   . TYR A 1 84  ? 2.952   -5.322  12.538  1.00 0.00 ? 136 TYR A CZ   2  
ATOM 4503  O OH   . TYR A 1 84  ? 1.739   -5.182  13.144  1.00 0.00 ? 136 TYR A OH   2  
ATOM 4504  H H    . TYR A 1 84  ? 7.164   -5.855  7.777   1.00 0.00 ? 136 TYR A H    2  
ATOM 4505  H HA   . TYR A 1 84  ? 6.774   -3.808  9.890   1.00 0.00 ? 136 TYR A HA   2  
ATOM 4506  H HB2  . TYR A 1 84  ? 6.885   -6.803  10.241  1.00 0.00 ? 136 TYR A HB2  2  
ATOM 4507  H HB3  . TYR A 1 84  ? 7.560   -5.745  11.475  1.00 0.00 ? 136 TYR A HB3  2  
ATOM 4508  H HD1  . TYR A 1 84  ? 6.121   -4.065  12.630  1.00 0.00 ? 136 TYR A HD1  2  
ATOM 4509  H HD2  . TYR A 1 84  ? 4.503   -7.144  10.103  1.00 0.00 ? 136 TYR A HD2  2  
ATOM 4510  H HE1  . TYR A 1 84  ? 3.908   -3.778  13.714  1.00 0.00 ? 136 TYR A HE1  2  
ATOM 4511  H HE2  . TYR A 1 84  ? 2.291   -6.887  11.200  1.00 0.00 ? 136 TYR A HE2  2  
ATOM 4512  H HH   . TYR A 1 84  ? 1.743   -4.514  13.834  1.00 0.00 ? 136 TYR A HH   2  
ATOM 4513  N N    . LEU A 1 85  ? 9.260   -3.684  10.281  1.00 0.00 ? 137 LEU A N    2  
ATOM 4514  C CA   . LEU A 1 85  ? 10.699  -3.492  10.384  1.00 0.00 ? 137 LEU A CA   2  
ATOM 4515  C C    . LEU A 1 85  ? 11.141  -3.634  11.840  1.00 0.00 ? 137 LEU A C    2  
ATOM 4516  O O    . LEU A 1 85  ? 10.321  -3.547  12.750  1.00 0.00 ? 137 LEU A O    2  
ATOM 4517  C CB   . LEU A 1 85  ? 11.125  -2.146  9.783   1.00 0.00 ? 137 LEU A CB   2  
ATOM 4518  C CG   . LEU A 1 85  ? 12.062  -2.386  8.599   1.00 0.00 ? 137 LEU A CG   2  
ATOM 4519  C CD1  . LEU A 1 85  ? 11.292  -2.831  7.357   1.00 0.00 ? 137 LEU A CD1  2  
ATOM 4520  C CD2  . LEU A 1 85  ? 12.828  -1.125  8.227   1.00 0.00 ? 137 LEU A CD2  2  
ATOM 4521  H H    . LEU A 1 85  ? 8.661   -3.059  10.801  1.00 0.00 ? 137 LEU A H    2  
ATOM 4522  H HA   . LEU A 1 85  ? 11.192  -4.284  9.820   1.00 0.00 ? 137 LEU A HA   2  
ATOM 4523  H HB2  . LEU A 1 85  ? 10.254  -1.578  9.456   1.00 0.00 ? 137 LEU A HB2  2  
ATOM 4524  H HB3  . LEU A 1 85  ? 11.660  -1.577  10.542  1.00 0.00 ? 137 LEU A HB3  2  
ATOM 4525  H HG   . LEU A 1 85  ? 12.783  -3.150  8.886   1.00 0.00 ? 137 LEU A HG   2  
ATOM 4526  H HD11 . LEU A 1 85  ? 11.999  -3.149  6.590   1.00 0.00 ? 137 LEU A HD11 2  
ATOM 4527  H HD12 . LEU A 1 85  ? 10.632  -3.662  7.604   1.00 0.00 ? 137 LEU A HD12 2  
ATOM 4528  H HD13 . LEU A 1 85  ? 10.709  -1.993  6.974   1.00 0.00 ? 137 LEU A HD13 2  
ATOM 4529  H HD21 . LEU A 1 85  ? 13.568  -1.384  7.469   1.00 0.00 ? 137 LEU A HD21 2  
ATOM 4530  H HD22 . LEU A 1 85  ? 12.137  -0.382  7.825   1.00 0.00 ? 137 LEU A HD22 2  
ATOM 4531  H HD23 . LEU A 1 85  ? 13.336  -0.731  9.106   1.00 0.00 ? 137 LEU A HD23 2  
ATOM 4532  N N    . CYS A 1 86  ? 12.441  -3.853  12.058  1.00 0.00 ? 138 CYS A N    2  
ATOM 4533  C CA   . CYS A 1 86  ? 12.992  -4.123  13.380  1.00 0.00 ? 138 CYS A CA   2  
ATOM 4534  C C    . CYS A 1 86  ? 14.078  -3.112  13.741  1.00 0.00 ? 138 CYS A C    2  
ATOM 4535  O O    . CYS A 1 86  ? 15.192  -3.492  14.100  1.00 0.00 ? 138 CYS A O    2  
ATOM 4536  C CB   . CYS A 1 86  ? 13.517  -5.559  13.425  1.00 0.00 ? 138 CYS A CB   2  
ATOM 4537  S SG   . CYS A 1 86  ? 12.168  -6.710  13.044  1.00 0.00 ? 138 CYS A SG   2  
ATOM 4538  H H    . CYS A 1 86  ? 13.084  -3.837  11.278  1.00 0.00 ? 138 CYS A H    2  
ATOM 4539  H HA   . CYS A 1 86  ? 12.193  -4.029  14.116  1.00 0.00 ? 138 CYS A HA   2  
ATOM 4540  H HB2  . CYS A 1 86  ? 14.317  -5.681  12.694  1.00 0.00 ? 138 CYS A HB2  2  
ATOM 4541  H HB3  . CYS A 1 86  ? 13.906  -5.775  14.420  1.00 0.00 ? 138 CYS A HB3  2  
ATOM 4542  H HG   . CYS A 1 86  ? 11.379  -6.352  14.061  1.00 0.00 ? 138 CYS A HG   2  
ATOM 4543  N N    . VAL A 1 87  ? 13.760  -1.817  13.644  1.00 0.00 ? 139 VAL A N    2  
ATOM 4544  C CA   . VAL A 1 87  ? 14.731  -0.762  13.913  1.00 0.00 ? 139 VAL A CA   2  
ATOM 4545  C C    . VAL A 1 87  ? 14.927  -0.511  15.410  1.00 0.00 ? 139 VAL A C    2  
ATOM 4546  O O    . VAL A 1 87  ? 15.750  0.319   15.787  1.00 0.00 ? 139 VAL A O    2  
ATOM 4547  C CB   . VAL A 1 87  ? 14.363  0.526   13.172  1.00 0.00 ? 139 VAL A CB   2  
ATOM 4548  C CG1  . VAL A 1 87  ? 14.131  0.257   11.687  1.00 0.00 ? 139 VAL A CG1  2  
ATOM 4549  C CG2  . VAL A 1 87  ? 13.086  1.169   13.702  1.00 0.00 ? 139 VAL A CG2  2  
ATOM 4550  H H    . VAL A 1 87  ? 12.825  -1.550  13.374  1.00 0.00 ? 139 VAL A H    2  
ATOM 4551  H HA   . VAL A 1 87  ? 15.691  -1.097  13.519  1.00 0.00 ? 139 VAL A HA   2  
ATOM 4552  H HB   . VAL A 1 87  ? 15.184  1.235   13.282  1.00 0.00 ? 139 VAL A HB   2  
ATOM 4553  H HG11 . VAL A 1 87  ? 13.255  -0.379  11.559  1.00 0.00 ? 139 VAL A HG11 2  
ATOM 4554  H HG12 . VAL A 1 87  ? 13.954  1.206   11.182  1.00 0.00 ? 139 VAL A HG12 2  
ATOM 4555  H HG13 . VAL A 1 87  ? 15.007  -0.234  11.260  1.00 0.00 ? 139 VAL A HG13 2  
ATOM 4556  H HG21 . VAL A 1 87  ? 12.872  2.060   13.112  1.00 0.00 ? 139 VAL A HG21 2  
ATOM 4557  H HG22 . VAL A 1 87  ? 12.258  0.467   13.603  1.00 0.00 ? 139 VAL A HG22 2  
ATOM 4558  H HG23 . VAL A 1 87  ? 13.216  1.447   14.748  1.00 0.00 ? 139 VAL A HG23 2  
ATOM 4559  N N    . SER A 1 88  ? 14.181  -1.216  16.268  1.00 0.00 ? 140 SER A N    2  
ATOM 4560  C CA   . SER A 1 88  ? 14.352  -1.120  17.711  1.00 0.00 ? 140 SER A CA   2  
ATOM 4561  C C    . SER A 1 88  ? 15.629  -1.853  18.119  1.00 0.00 ? 140 SER A C    2  
ATOM 4562  O O    . SER A 1 88  ? 15.938  -2.921  17.591  1.00 0.00 ? 140 SER A O    2  
ATOM 4563  C CB   . SER A 1 88  ? 13.110  -1.660  18.422  1.00 0.00 ? 140 SER A CB   2  
ATOM 4564  O OG   . SER A 1 88  ? 12.882  -3.010  18.075  1.00 0.00 ? 140 SER A OG   2  
ATOM 4565  H H    . SER A 1 88  ? 13.472  -1.845  15.919  1.00 0.00 ? 140 SER A H    2  
ATOM 4566  H HA   . SER A 1 88  ? 14.461  -0.072  17.992  1.00 0.00 ? 140 SER A HA   2  
ATOM 4567  H HB2  . SER A 1 88  ? 13.231  -1.571  19.503  1.00 0.00 ? 140 SER A HB2  2  
ATOM 4568  H HB3  . SER A 1 88  ? 12.248  -1.066  18.121  1.00 0.00 ? 140 SER A HB3  2  
ATOM 4569  H HG   . SER A 1 88  ? 13.633  -3.535  18.364  1.00 0.00 ? 140 SER A HG   2  
ATOM 4570  N N    . SER A 1 89  ? 16.372  -1.274  19.066  1.00 0.00 ? 141 SER A N    2  
ATOM 4571  C CA   . SER A 1 89  ? 17.659  -1.794  19.506  1.00 0.00 ? 141 SER A CA   2  
ATOM 4572  C C    . SER A 1 89  ? 17.825  -1.529  21.003  1.00 0.00 ? 141 SER A C    2  
ATOM 4573  O O    . SER A 1 89  ? 16.997  -0.831  21.583  1.00 0.00 ? 141 SER A O    2  
ATOM 4574  C CB   . SER A 1 89  ? 18.759  -1.115  18.688  1.00 0.00 ? 141 SER A CB   2  
ATOM 4575  O OG   . SER A 1 89  ? 18.769  0.270   18.956  1.00 0.00 ? 141 SER A OG   2  
ATOM 4576  H H    . SER A 1 89  ? 16.041  -0.427  19.505  1.00 0.00 ? 141 SER A H    2  
ATOM 4577  H HA   . SER A 1 89  ? 17.700  -2.869  19.332  1.00 0.00 ? 141 SER A HA   2  
ATOM 4578  H HB2  . SER A 1 89  ? 19.732  -1.539  18.938  1.00 0.00 ? 141 SER A HB2  2  
ATOM 4579  H HB3  . SER A 1 89  ? 18.569  -1.276  17.627  1.00 0.00 ? 141 SER A HB3  2  
ATOM 4580  H HG   . SER A 1 89  ? 19.462  0.679   18.432  1.00 0.00 ? 141 SER A HG   2  
ATOM 4581  N N    . PRO A 1 90  ? 18.873  -2.065  21.646  1.00 0.00 ? 142 PRO A N    2  
ATOM 4582  C CA   . PRO A 1 90  ? 19.119  -1.923  23.075  1.00 0.00 ? 142 PRO A CA   2  
ATOM 4583  C C    . PRO A 1 90  ? 19.168  -0.480  23.588  1.00 0.00 ? 142 PRO A C    2  
ATOM 4584  O O    . PRO A 1 90  ? 19.278  -0.276  24.796  1.00 0.00 ? 142 PRO A O    2  
ATOM 4585  C CB   . PRO A 1 90  ? 20.452  -2.631  23.326  1.00 0.00 ? 142 PRO A CB   2  
ATOM 4586  C CG   . PRO A 1 90  ? 20.528  -3.655  22.197  1.00 0.00 ? 142 PRO A CG   2  
ATOM 4587  C CD   . PRO A 1 90  ? 19.907  -2.883  21.039  1.00 0.00 ? 142 PRO A CD   2  
ATOM 4588  H HA   . PRO A 1 90  ? 18.331  -2.453  23.612  1.00 0.00 ? 142 PRO A HA   2  
ATOM 4589  H HB2  . PRO A 1 90  ? 21.269  -1.917  23.220  1.00 0.00 ? 142 PRO A HB2  2  
ATOM 4590  H HB3  . PRO A 1 90  ? 20.476  -3.107  24.307  1.00 0.00 ? 142 PRO A HB3  2  
ATOM 4591  H HG2  . PRO A 1 90  ? 21.554  -3.951  21.984  1.00 0.00 ? 142 PRO A HG2  2  
ATOM 4592  H HG3  . PRO A 1 90  ? 19.908  -4.518  22.442  1.00 0.00 ? 142 PRO A HG3  2  
ATOM 4593  H HD2  . PRO A 1 90  ? 20.661  -2.239  20.587  1.00 0.00 ? 142 PRO A HD2  2  
ATOM 4594  H HD3  . PRO A 1 90  ? 19.495  -3.570  20.300  1.00 0.00 ? 142 PRO A HD3  2  
ATOM 4595  N N    . THR A 1 91  ? 19.090  0.523   22.706  1.00 0.00 ? 143 THR A N    2  
ATOM 4596  C CA   . THR A 1 91  ? 19.129  1.917   23.124  1.00 0.00 ? 143 THR A CA   2  
ATOM 4597  C C    . THR A 1 91  ? 17.729  2.483   23.364  1.00 0.00 ? 143 THR A C    2  
ATOM 4598  O O    . THR A 1 91  ? 17.599  3.477   24.077  1.00 0.00 ? 143 THR A O    2  
ATOM 4599  C CB   . THR A 1 91  ? 19.879  2.758   22.090  1.00 0.00 ? 143 THR A CB   2  
ATOM 4600  O OG1  . THR A 1 91  ? 19.228  2.676   20.842  1.00 0.00 ? 143 THR A OG1  2  
ATOM 4601  C CG2  . THR A 1 91  ? 21.316  2.265   21.933  1.00 0.00 ? 143 THR A CG2  2  
ATOM 4602  H H    . THR A 1 91  ? 19.002  0.325   21.720  1.00 0.00 ? 143 THR A H    2  
ATOM 4603  H HA   . THR A 1 91  ? 19.676  1.982   24.066  1.00 0.00 ? 143 THR A HA   2  
ATOM 4604  H HB   . THR A 1 91  ? 19.893  3.797   22.419  1.00 0.00 ? 143 THR A HB   2  
ATOM 4605  H HG1  . THR A 1 91  ? 19.693  3.243   20.222  1.00 0.00 ? 143 THR A HG1  2  
ATOM 4606  H HG21 . THR A 1 91  ? 21.320  1.240   21.563  1.00 0.00 ? 143 THR A HG21 2  
ATOM 4607  H HG22 . THR A 1 91  ? 21.846  2.906   21.228  1.00 0.00 ? 143 THR A HG22 2  
ATOM 4608  H HG23 . THR A 1 91  ? 21.820  2.302   22.899  1.00 0.00 ? 143 THR A HG23 2  
ATOM 4609  N N    . ILE A 1 92  ? 16.684  1.874   22.786  1.00 0.00 ? 144 ILE A N    2  
ATOM 4610  C CA   . ILE A 1 92  ? 15.311  2.339   22.982  1.00 0.00 ? 144 ILE A CA   2  
ATOM 4611  C C    . ILE A 1 92  ? 14.293  1.198   23.064  1.00 0.00 ? 144 ILE A C    2  
ATOM 4612  O O    . ILE A 1 92  ? 13.241  1.377   23.675  1.00 0.00 ? 144 ILE A O    2  
ATOM 4613  C CB   . ILE A 1 92  ? 14.890  3.332   21.881  1.00 0.00 ? 144 ILE A CB   2  
ATOM 4614  C CG1  . ILE A 1 92  ? 14.689  2.706   20.490  1.00 0.00 ? 144 ILE A CG1  2  
ATOM 4615  C CG2  . ILE A 1 92  ? 15.851  4.520   21.797  1.00 0.00 ? 144 ILE A CG2  2  
ATOM 4616  C CD1  . ILE A 1 92  ? 15.965  2.213   19.805  1.00 0.00 ? 144 ILE A CD1  2  
ATOM 4617  H H    . ILE A 1 92  ? 16.845  1.068   22.199  1.00 0.00 ? 144 ILE A H    2  
ATOM 4618  H HA   . ILE A 1 92  ? 15.275  2.869   23.934  1.00 0.00 ? 144 ILE A HA   2  
ATOM 4619  H HB   . ILE A 1 92  ? 13.921  3.732   22.182  1.00 0.00 ? 144 ILE A HB   2  
ATOM 4620  H HG12 . ILE A 1 92  ? 13.992  1.872   20.570  1.00 0.00 ? 144 ILE A HG12 2  
ATOM 4621  H HG13 . ILE A 1 92  ? 14.233  3.458   19.845  1.00 0.00 ? 144 ILE A HG13 2  
ATOM 4622  H HG21 . ILE A 1 92  ? 16.847  4.182   21.511  1.00 0.00 ? 144 ILE A HG21 2  
ATOM 4623  H HG22 . ILE A 1 92  ? 15.487  5.232   21.056  1.00 0.00 ? 144 ILE A HG22 2  
ATOM 4624  H HG23 . ILE A 1 92  ? 15.906  5.012   22.768  1.00 0.00 ? 144 ILE A HG23 2  
ATOM 4625  H HD11 . ILE A 1 92  ? 16.423  1.416   20.389  1.00 0.00 ? 144 ILE A HD11 2  
ATOM 4626  H HD12 . ILE A 1 92  ? 15.711  1.824   18.818  1.00 0.00 ? 144 ILE A HD12 2  
ATOM 4627  H HD13 . ILE A 1 92  ? 16.667  3.038   19.688  1.00 0.00 ? 144 ILE A HD13 2  
ATOM 4628  N N    . LYS A 1 93  ? 14.590  0.036   22.464  1.00 0.00 ? 145 LYS A N    2  
ATOM 4629  C CA   . LYS A 1 93  ? 13.695  -1.121  22.430  1.00 0.00 ? 145 LYS A CA   2  
ATOM 4630  C C    . LYS A 1 93  ? 12.245  -0.710  22.164  1.00 0.00 ? 145 LYS A C    2  
ATOM 4631  O O    . LYS A 1 93  ? 11.325  -1.205  22.811  1.00 0.00 ? 145 LYS A O    2  
ATOM 4632  C CB   . LYS A 1 93  ? 13.832  -1.940  23.716  1.00 0.00 ? 145 LYS A CB   2  
ATOM 4633  C CG   . LYS A 1 93  ? 15.177  -2.663  23.823  1.00 0.00 ? 145 LYS A CG   2  
ATOM 4634  C CD   . LYS A 1 93  ? 15.303  -3.746  22.746  1.00 0.00 ? 145 LYS A CD   2  
ATOM 4635  C CE   . LYS A 1 93  ? 16.554  -4.603  22.955  1.00 0.00 ? 145 LYS A CE   2  
ATOM 4636  N NZ   . LYS A 1 93  ? 16.498  -5.350  24.226  1.00 0.00 ? 145 LYS A NZ   2  
ATOM 4637  H H    . LYS A 1 93  ? 15.483  -0.059  22.003  1.00 0.00 ? 145 LYS A H    2  
ATOM 4638  H HA   . LYS A 1 93  ? 13.996  -1.750  21.593  1.00 0.00 ? 145 LYS A HA   2  
ATOM 4639  H HB2  . LYS A 1 93  ? 13.711  -1.276  24.572  1.00 0.00 ? 145 LYS A HB2  2  
ATOM 4640  H HB3  . LYS A 1 93  ? 13.042  -2.691  23.742  1.00 0.00 ? 145 LYS A HB3  2  
ATOM 4641  H HG2  . LYS A 1 93  ? 15.993  -1.946  23.726  1.00 0.00 ? 145 LYS A HG2  2  
ATOM 4642  H HG3  . LYS A 1 93  ? 15.235  -3.131  24.805  1.00 0.00 ? 145 LYS A HG3  2  
ATOM 4643  H HD2  . LYS A 1 93  ? 14.424  -4.391  22.776  1.00 0.00 ? 145 LYS A HD2  2  
ATOM 4644  H HD3  . LYS A 1 93  ? 15.363  -3.276  21.765  1.00 0.00 ? 145 LYS A HD3  2  
ATOM 4645  H HE2  . LYS A 1 93  ? 16.636  -5.310  22.130  1.00 0.00 ? 145 LYS A HE2  2  
ATOM 4646  H HE3  . LYS A 1 93  ? 17.435  -3.962  22.947  1.00 0.00 ? 145 LYS A HE3  2  
ATOM 4647  H HZ1  . LYS A 1 93  ? 15.690  -5.957  24.235  1.00 0.00 ? 145 LYS A HZ1  2  
ATOM 4648  H HZ2  . LYS A 1 93  ? 17.329  -5.914  24.333  1.00 0.00 ? 145 LYS A HZ2  2  
ATOM 4649  H HZ3  . LYS A 1 93  ? 16.436  -4.709  25.005  1.00 0.00 ? 145 LYS A HZ3  2  
ATOM 4650  N N    . ASP A 1 94  ? 12.043  0.200   21.209  1.00 0.00 ? 146 ASP A N    2  
ATOM 4651  C CA   . ASP A 1 94  ? 10.738  0.786   20.936  1.00 0.00 ? 146 ASP A CA   2  
ATOM 4652  C C    . ASP A 1 94  ? 9.837   -0.113  20.080  1.00 0.00 ? 146 ASP A C    2  
ATOM 4653  O O    . ASP A 1 94  ? 8.978   0.392   19.359  1.00 0.00 ? 146 ASP A O    2  
ATOM 4654  C CB   . ASP A 1 94  ? 10.924  2.185   20.345  1.00 0.00 ? 146 ASP A CB   2  
ATOM 4655  C CG   . ASP A 1 94  ? 9.622   2.986   20.352  1.00 0.00 ? 146 ASP A CG   2  
ATOM 4656  O OD1  . ASP A 1 94  ? 8.938   2.965   21.400  1.00 0.00 ? 146 ASP A OD1  2  
ATOM 4657  O OD2  . ASP A 1 94  ? 9.322   3.611   19.311  1.00 0.00 ? 146 ASP A OD2  2  
ATOM 4658  H H    . ASP A 1 94  ? 12.824  0.509   20.648  1.00 0.00 ? 146 ASP A H    2  
ATOM 4659  H HA   . ASP A 1 94  ? 10.246  0.896   21.902  1.00 0.00 ? 146 ASP A HA   2  
ATOM 4660  H HB2  . ASP A 1 94  ? 11.663  2.722   20.938  1.00 0.00 ? 146 ASP A HB2  2  
ATOM 4661  H HB3  . ASP A 1 94  ? 11.296  2.095   19.324  1.00 0.00 ? 146 ASP A HB3  2  
ATOM 4662  N N    . LYS A 1 95  ? 10.038  -1.438  20.161  1.00 0.00 ? 147 LYS A N    2  
ATOM 4663  C CA   . LYS A 1 95  ? 9.284   -2.444  19.413  1.00 0.00 ? 147 LYS A CA   2  
ATOM 4664  C C    . LYS A 1 95  ? 9.452   -2.301  17.894  1.00 0.00 ? 147 LYS A C    2  
ATOM 4665  O O    . LYS A 1 95  ? 9.861   -1.247  17.408  1.00 0.00 ? 147 LYS A O    2  
ATOM 4666  C CB   . LYS A 1 95  ? 7.809   -2.398  19.852  1.00 0.00 ? 147 LYS A CB   2  
ATOM 4667  C CG   . LYS A 1 95  ? 7.637   -2.593  21.362  1.00 0.00 ? 147 LYS A CG   2  
ATOM 4668  C CD   . LYS A 1 95  ? 8.165   -3.951  21.826  1.00 0.00 ? 147 LYS A CD   2  
ATOM 4669  C CE   . LYS A 1 95  ? 7.889   -4.114  23.320  1.00 0.00 ? 147 LYS A CE   2  
ATOM 4670  N NZ   . LYS A 1 95  ? 8.382   -5.413  23.817  1.00 0.00 ? 147 LYS A NZ   2  
ATOM 4671  H H    . LYS A 1 95  ? 10.760  -1.773  20.783  1.00 0.00 ? 147 LYS A H    2  
ATOM 4672  H HA   . LYS A 1 95  ? 9.683   -3.422  19.682  1.00 0.00 ? 147 LYS A HA   2  
ATOM 4673  H HB2  . LYS A 1 95  ? 7.384   -1.433  19.575  1.00 0.00 ? 147 LYS A HB2  2  
ATOM 4674  H HB3  . LYS A 1 95  ? 7.239   -3.168  19.333  1.00 0.00 ? 147 LYS A HB3  2  
ATOM 4675  H HG2  . LYS A 1 95  ? 8.161   -1.801  21.896  1.00 0.00 ? 147 LYS A HG2  2  
ATOM 4676  H HG3  . LYS A 1 95  ? 6.574   -2.528  21.600  1.00 0.00 ? 147 LYS A HG3  2  
ATOM 4677  H HD2  . LYS A 1 95  ? 7.661   -4.745  21.274  1.00 0.00 ? 147 LYS A HD2  2  
ATOM 4678  H HD3  . LYS A 1 95  ? 9.239   -4.011  21.652  1.00 0.00 ? 147 LYS A HD3  2  
ATOM 4679  H HE2  . LYS A 1 95  ? 8.381   -3.308  23.863  1.00 0.00 ? 147 LYS A HE2  2  
ATOM 4680  H HE3  . LYS A 1 95  ? 6.815   -4.046  23.494  1.00 0.00 ? 147 LYS A HE3  2  
ATOM 4681  H HZ1  . LYS A 1 95  ? 7.924   -6.166  23.324  1.00 0.00 ? 147 LYS A HZ1  2  
ATOM 4682  H HZ2  . LYS A 1 95  ? 9.379   -5.483  23.674  1.00 0.00 ? 147 LYS A HZ2  2  
ATOM 4683  H HZ3  . LYS A 1 95  ? 8.183   -5.500  24.804  1.00 0.00 ? 147 LYS A HZ3  2  
ATOM 4684  N N    . PRO A 1 96  ? 9.142   -3.354  17.120  1.00 0.00 ? 148 PRO A N    2  
ATOM 4685  C CA   . PRO A 1 96  ? 9.166   -3.298  15.668  1.00 0.00 ? 148 PRO A CA   2  
ATOM 4686  C C    . PRO A 1 96  ? 8.197   -2.235  15.147  1.00 0.00 ? 148 PRO A C    2  
ATOM 4687  O O    . PRO A 1 96  ? 7.309   -1.782  15.869  1.00 0.00 ? 148 PRO A O    2  
ATOM 4688  C CB   . PRO A 1 96  ? 8.786   -4.702  15.190  1.00 0.00 ? 148 PRO A CB   2  
ATOM 4689  C CG   . PRO A 1 96  ? 8.022   -5.291  16.375  1.00 0.00 ? 148 PRO A CG   2  
ATOM 4690  C CD   . PRO A 1 96  ? 8.744   -4.676  17.568  1.00 0.00 ? 148 PRO A CD   2  
ATOM 4691  H HA   . PRO A 1 96  ? 10.171  -3.061  15.319  1.00 0.00 ? 148 PRO A HA   2  
ATOM 4692  H HB2  . PRO A 1 96  ? 8.174   -4.674  14.288  1.00 0.00 ? 148 PRO A HB2  2  
ATOM 4693  H HB3  . PRO A 1 96  ? 9.693   -5.282  15.024  1.00 0.00 ? 148 PRO A HB3  2  
ATOM 4694  H HG2  . PRO A 1 96  ? 6.990   -4.941  16.353  1.00 0.00 ? 148 PRO A HG2  2  
ATOM 4695  H HG3  . PRO A 1 96  ? 8.068   -6.380  16.390  1.00 0.00 ? 148 PRO A HG3  2  
ATOM 4696  H HD2  . PRO A 1 96  ? 8.083   -4.643  18.434  1.00 0.00 ? 148 PRO A HD2  2  
ATOM 4697  H HD3  . PRO A 1 96  ? 9.636   -5.258  17.799  1.00 0.00 ? 148 PRO A HD3  2  
ATOM 4698  N N    . VAL A 1 97  ? 8.378   -1.839  13.883  1.00 0.00 ? 149 VAL A N    2  
ATOM 4699  C CA   . VAL A 1 97  ? 7.638   -0.728  13.301  1.00 0.00 ? 149 VAL A CA   2  
ATOM 4700  C C    . VAL A 1 97  ? 6.750   -1.204  12.160  1.00 0.00 ? 149 VAL A C    2  
ATOM 4701  O O    . VAL A 1 97  ? 7.103   -2.142  11.450  1.00 0.00 ? 149 VAL A O    2  
ATOM 4702  C CB   . VAL A 1 97  ? 8.612   0.361   12.829  1.00 0.00 ? 149 VAL A CB   2  
ATOM 4703  C CG1  . VAL A 1 97  ? 9.568   0.744   13.954  1.00 0.00 ? 149 VAL A CG1  2  
ATOM 4704  C CG2  . VAL A 1 97  ? 9.457   -0.106  11.646  1.00 0.00 ? 149 VAL A CG2  2  
ATOM 4705  H H    . VAL A 1 97  ? 9.053   -2.314  13.302  1.00 0.00 ? 149 VAL A H    2  
ATOM 4706  H HA   . VAL A 1 97  ? 6.998   -0.293  14.067  1.00 0.00 ? 149 VAL A HA   2  
ATOM 4707  H HB   . VAL A 1 97  ? 8.045   1.240   12.524  1.00 0.00 ? 149 VAL A HB   2  
ATOM 4708  H HG11 . VAL A 1 97  ? 10.237  -0.088  14.170  1.00 0.00 ? 149 VAL A HG11 2  
ATOM 4709  H HG12 . VAL A 1 97  ? 10.154  1.610   13.649  1.00 0.00 ? 149 VAL A HG12 2  
ATOM 4710  H HG13 . VAL A 1 97  ? 9.001   0.981   14.854  1.00 0.00 ? 149 VAL A HG13 2  
ATOM 4711  H HG21 . VAL A 1 97  ? 8.809   -0.342  10.802  1.00 0.00 ? 149 VAL A HG21 2  
ATOM 4712  H HG22 . VAL A 1 97  ? 10.144  0.688   11.356  1.00 0.00 ? 149 VAL A HG22 2  
ATOM 4713  H HG23 . VAL A 1 97  ? 10.025  -0.989  11.935  1.00 0.00 ? 149 VAL A HG23 2  
ATOM 4714  N N    . GLN A 1 98  ? 5.597   -0.554  11.984  1.00 0.00 ? 150 GLN A N    2  
ATOM 4715  C CA   . GLN A 1 98  ? 4.682   -0.878  10.901  1.00 0.00 ? 150 GLN A CA   2  
ATOM 4716  C C    . GLN A 1 98  ? 5.193   -0.259  9.600   1.00 0.00 ? 150 GLN A C    2  
ATOM 4717  O O    . GLN A 1 98  ? 5.705   0.858   9.611   1.00 0.00 ? 150 GLN A O    2  
ATOM 4718  C CB   . GLN A 1 98  ? 3.279   -0.385  11.256  1.00 0.00 ? 150 GLN A CB   2  
ATOM 4719  C CG   . GLN A 1 98  ? 2.278   -0.748  10.157  1.00 0.00 ? 150 GLN A CG   2  
ATOM 4720  C CD   . GLN A 1 98  ? 0.859   -0.328  10.516  1.00 0.00 ? 150 GLN A CD   2  
ATOM 4721  O OE1  . GLN A 1 98  ? 0.607   0.231   11.579  1.00 0.00 ? 150 GLN A OE1  2  
ATOM 4722  N NE2  . GLN A 1 98  ? -0.089  -0.599  9.622   1.00 0.00 ? 150 GLN A NE2  2  
ATOM 4723  H H    . GLN A 1 98  ? 5.340   0.191   12.614  1.00 0.00 ? 150 GLN A H    2  
ATOM 4724  H HA   . GLN A 1 98  ? 4.649   -1.961  10.781  1.00 0.00 ? 150 GLN A HA   2  
ATOM 4725  H HB2  . GLN A 1 98  ? 2.969   -0.850  12.192  1.00 0.00 ? 150 GLN A HB2  2  
ATOM 4726  H HB3  . GLN A 1 98  ? 3.296   0.698   11.384  1.00 0.00 ? 150 GLN A HB3  2  
ATOM 4727  H HG2  . GLN A 1 98  ? 2.562   -0.255  9.228   1.00 0.00 ? 150 GLN A HG2  2  
ATOM 4728  H HG3  . GLN A 1 98  ? 2.297   -1.826  9.995   1.00 0.00 ? 150 GLN A HG3  2  
ATOM 4729  H HE21 . GLN A 1 98  ? 0.151   -1.065  8.759   1.00 0.00 ? 150 GLN A HE21 2  
ATOM 4730  H HE22 . GLN A 1 98  ? -1.045  -0.333  9.815   1.00 0.00 ? 150 GLN A HE22 2  
ATOM 4731  N N    . ILE A 1 99  ? 5.050   -0.988  8.488   1.00 0.00 ? 151 ILE A N    2  
ATOM 4732  C CA   . ILE A 1 99  ? 5.557   -0.575  7.185   1.00 0.00 ? 151 ILE A CA   2  
ATOM 4733  C C    . ILE A 1 99  ? 4.528   -0.904  6.103   1.00 0.00 ? 151 ILE A C    2  
ATOM 4734  O O    . ILE A 1 99  ? 3.847   -1.923  6.191   1.00 0.00 ? 151 ILE A O    2  
ATOM 4735  C CB   . ILE A 1 99  ? 6.875   -1.316  6.910   1.00 0.00 ? 151 ILE A CB   2  
ATOM 4736  C CG1  . ILE A 1 99  ? 7.944   -1.022  7.970   1.00 0.00 ? 151 ILE A CG1  2  
ATOM 4737  C CG2  . ILE A 1 99  ? 7.423   -0.972  5.525   1.00 0.00 ? 151 ILE A CG2  2  
ATOM 4738  C CD1  . ILE A 1 99  ? 8.469   0.415   7.926   1.00 0.00 ? 151 ILE A CD1  2  
ATOM 4739  H H    . ILE A 1 99  ? 4.573   -1.876  8.539   1.00 0.00 ? 151 ILE A H    2  
ATOM 4740  H HA   . ILE A 1 99  ? 5.738   0.500   7.186   1.00 0.00 ? 151 ILE A HA   2  
ATOM 4741  H HB   . ILE A 1 99  ? 6.673   -2.387  6.936   1.00 0.00 ? 151 ILE A HB   2  
ATOM 4742  H HG12 . ILE A 1 99  ? 7.539   -1.226  8.962   1.00 0.00 ? 151 ILE A HG12 2  
ATOM 4743  H HG13 . ILE A 1 99  ? 8.780   -1.701  7.805   1.00 0.00 ? 151 ILE A HG13 2  
ATOM 4744  H HG21 . ILE A 1 99  ? 7.538   0.108   5.436   1.00 0.00 ? 151 ILE A HG21 2  
ATOM 4745  H HG22 . ILE A 1 99  ? 8.390   -1.452  5.383   1.00 0.00 ? 151 ILE A HG22 2  
ATOM 4746  H HG23 . ILE A 1 99  ? 6.736   -1.325  4.756   1.00 0.00 ? 151 ILE A HG23 2  
ATOM 4747  H HD11 . ILE A 1 99  ? 8.970   0.600   6.975   1.00 0.00 ? 151 ILE A HD11 2  
ATOM 4748  H HD12 . ILE A 1 99  ? 7.645   1.118   8.048   1.00 0.00 ? 151 ILE A HD12 2  
ATOM 4749  H HD13 . ILE A 1 99  ? 9.188   0.562   8.731   1.00 0.00 ? 151 ILE A HD13 2  
ATOM 4750  N N    . ARG A 1 100 ? 4.412   -0.046  5.080   1.00 0.00 ? 152 ARG A N    2  
ATOM 4751  C CA   . ARG A 1 100 ? 3.534   -0.306  3.941   1.00 0.00 ? 152 ARG A CA   2  
ATOM 4752  C C    . ARG A 1 100 ? 4.083   0.293   2.642   1.00 0.00 ? 152 ARG A C    2  
ATOM 4753  O O    . ARG A 1 100 ? 3.895   1.484   2.400   1.00 0.00 ? 152 ARG A O    2  
ATOM 4754  C CB   . ARG A 1 100 ? 2.142   0.284   4.203   1.00 0.00 ? 152 ARG A CB   2  
ATOM 4755  C CG   . ARG A 1 100 ? 1.342   -0.512  5.237   1.00 0.00 ? 152 ARG A CG   2  
ATOM 4756  C CD   . ARG A 1 100 ? -0.109  -0.025  5.206   1.00 0.00 ? 152 ARG A CD   2  
ATOM 4757  N NE   . ARG A 1 100 ? -0.966  -0.788  6.121   1.00 0.00 ? 152 ARG A NE   2  
ATOM 4758  C CZ   . ARG A 1 100 ? -1.375  -2.044  5.908   1.00 0.00 ? 152 ARG A CZ   2  
ATOM 4759  N NH1  . ARG A 1 100 ? -1.005  -2.714  4.818   1.00 0.00 ? 152 ARG A NH1  2  
ATOM 4760  N NH2  . ARG A 1 100 ? -2.164  -2.645  6.793   1.00 0.00 ? 152 ARG A NH2  2  
ATOM 4761  H H    . ARG A 1 100 ? 4.949   0.810   5.089   1.00 0.00 ? 152 ARG A H    2  
ATOM 4762  H HA   . ARG A 1 100 ? 3.427   -1.383  3.809   1.00 0.00 ? 152 ARG A HA   2  
ATOM 4763  H HB2  . ARG A 1 100 ? 2.239   1.318   4.534   1.00 0.00 ? 152 ARG A HB2  2  
ATOM 4764  H HB3  . ARG A 1 100 ? 1.584   0.274   3.266   1.00 0.00 ? 152 ARG A HB3  2  
ATOM 4765  H HG2  . ARG A 1 100 ? 1.377   -1.570  4.982   1.00 0.00 ? 152 ARG A HG2  2  
ATOM 4766  H HG3  . ARG A 1 100 ? 1.763   -0.357  6.231   1.00 0.00 ? 152 ARG A HG3  2  
ATOM 4767  H HD2  . ARG A 1 100 ? -0.133  1.028   5.489   1.00 0.00 ? 152 ARG A HD2  2  
ATOM 4768  H HD3  . ARG A 1 100 ? -0.497  -0.117  4.192   1.00 0.00 ? 152 ARG A HD3  2  
ATOM 4769  H HE   . ARG A 1 100 ? -1.268  -0.324  6.966   1.00 0.00 ? 152 ARG A HE   2  
ATOM 4770  H HH11 . ARG A 1 100 ? -0.421  -2.271  4.123   1.00 0.00 ? 152 ARG A HH11 2  
ATOM 4771  H HH12 . ARG A 1 100 ? -1.310  -3.668  4.691   1.00 0.00 ? 152 ARG A HH12 2  
ATOM 4772  H HH21 . ARG A 1 100 ? -2.464  -2.153  7.623   1.00 0.00 ? 152 ARG A HH21 2  
ATOM 4773  H HH22 . ARG A 1 100 ? -2.464  -3.595  6.629   1.00 0.00 ? 152 ARG A HH22 2  
ATOM 4774  N N    . PRO A 1 101 ? 4.756   -0.513  1.807   1.00 0.00 ? 153 PRO A N    2  
ATOM 4775  C CA   . PRO A 1 101 ? 5.141   -0.168  0.445   1.00 0.00 ? 153 PRO A CA   2  
ATOM 4776  C C    . PRO A 1 101 ? 3.944   -0.494  -0.450  1.00 0.00 ? 153 PRO A C    2  
ATOM 4777  O O    . PRO A 1 101 ? 2.832   -0.625  0.060   1.00 0.00 ? 153 PRO A O    2  
ATOM 4778  C CB   . PRO A 1 101 ? 6.311   -1.103  0.144   1.00 0.00 ? 153 PRO A CB   2  
ATOM 4779  C CG   . PRO A 1 101 ? 5.856   -2.385  0.839   1.00 0.00 ? 153 PRO A CG   2  
ATOM 4780  C CD   . PRO A 1 101 ? 5.204   -1.859  2.118   1.00 0.00 ? 153 PRO A CD   2  
ATOM 4781  H HA   . PRO A 1 101 ? 5.433   0.878   0.350   1.00 0.00 ? 153 PRO A HA   2  
ATOM 4782  H HB2  . PRO A 1 101 ? 6.463   -1.250  -0.925  1.00 0.00 ? 153 PRO A HB2  2  
ATOM 4783  H HB3  . PRO A 1 101 ? 7.217   -0.727  0.620   1.00 0.00 ? 153 PRO A HB3  2  
ATOM 4784  H HG2  . PRO A 1 101 ? 5.107   -2.886  0.226   1.00 0.00 ? 153 PRO A HG2  2  
ATOM 4785  H HG3  . PRO A 1 101 ? 6.689   -3.056  1.050   1.00 0.00 ? 153 PRO A HG3  2  
ATOM 4786  H HD2  . PRO A 1 101 ? 4.366   -2.498  2.399   1.00 0.00 ? 153 PRO A HD2  2  
ATOM 4787  H HD3  . PRO A 1 101 ? 5.943   -1.820  2.918   1.00 0.00 ? 153 PRO A HD3  2  
ATOM 4788  N N    . TRP A 1 102 ? 4.115   -0.635  -1.771  1.00 0.00 ? 154 TRP A N    2  
ATOM 4789  C CA   . TRP A 1 102 ? 3.035   -1.176  -2.590  1.00 0.00 ? 154 TRP A CA   2  
ATOM 4790  C C    . TRP A 1 102 ? 3.550   -2.003  -3.763  1.00 0.00 ? 154 TRP A C    2  
ATOM 4791  O O    . TRP A 1 102 ? 4.701   -1.874  -4.170  1.00 0.00 ? 154 TRP A O    2  
ATOM 4792  C CB   . TRP A 1 102 ? 2.055   -0.093  -3.046  1.00 0.00 ? 154 TRP A CB   2  
ATOM 4793  C CG   . TRP A 1 102 ? 0.822   -0.658  -3.673  1.00 0.00 ? 154 TRP A CG   2  
ATOM 4794  C CD1  . TRP A 1 102 ? 0.485   -0.564  -4.978  1.00 0.00 ? 154 TRP A CD1  2  
ATOM 4795  C CD2  . TRP A 1 102 ? -0.251  -1.417  -3.039  1.00 0.00 ? 154 TRP A CD2  2  
ATOM 4796  N NE1  . TRP A 1 102 ? -0.702  -1.230  -5.196  1.00 0.00 ? 154 TRP A NE1  2  
ATOM 4797  C CE2  . TRP A 1 102 ? -1.201  -1.779  -4.035  1.00 0.00 ? 154 TRP A CE2  2  
ATOM 4798  C CE3  . TRP A 1 102 ? -0.510  -1.844  -1.724  1.00 0.00 ? 154 TRP A CE3  2  
ATOM 4799  C CZ2  . TRP A 1 102 ? -2.342  -2.536  -3.749  1.00 0.00 ? 154 TRP A CZ2  2  
ATOM 4800  C CZ3  . TRP A 1 102 ? -1.650  -2.604  -1.425  1.00 0.00 ? 154 TRP A CZ3  2  
ATOM 4801  C CH2  . TRP A 1 102 ? -2.556  -2.958  -2.432  1.00 0.00 ? 154 TRP A CH2  2  
ATOM 4802  H H    . TRP A 1 102 ? 4.989   -0.389  -2.213  1.00 0.00 ? 154 TRP A H    2  
ATOM 4803  H HA   . TRP A 1 102 ? 2.472   -1.862  -1.958  1.00 0.00 ? 154 TRP A HA   2  
ATOM 4804  H HB2  . TRP A 1 102 ? 1.757   0.495   -2.177  1.00 0.00 ? 154 TRP A HB2  2  
ATOM 4805  H HB3  . TRP A 1 102 ? 2.534   0.570   -3.765  1.00 0.00 ? 154 TRP A HB3  2  
ATOM 4806  H HD1  . TRP A 1 102 ? 1.060   -0.050  -5.735  1.00 0.00 ? 154 TRP A HD1  2  
ATOM 4807  H HE1  . TRP A 1 102 ? -1.135  -1.298  -6.106  1.00 0.00 ? 154 TRP A HE1  2  
ATOM 4808  H HE3  . TRP A 1 102 ? 0.180   -1.583  -0.936  1.00 0.00 ? 154 TRP A HE3  2  
ATOM 4809  H HZ2  . TRP A 1 102 ? -3.044  -2.790  -4.529  1.00 0.00 ? 154 TRP A HZ2  2  
ATOM 4810  H HZ3  . TRP A 1 102 ? -1.832  -2.921  -0.408  1.00 0.00 ? 154 TRP A HZ3  2  
ATOM 4811  H HH2  . TRP A 1 102 ? -3.420  -3.558  -2.189  1.00 0.00 ? 154 TRP A HH2  2  
ATOM 4812  N N    . ASN A 1 103 ? 2.675   -2.857  -4.301  1.00 0.00 ? 155 ASN A N    2  
ATOM 4813  C CA   . ASN A 1 103 ? 2.973   -3.693  -5.448  1.00 0.00 ? 155 ASN A CA   2  
ATOM 4814  C C    . ASN A 1 103 ? 1.996   -3.340  -6.567  1.00 0.00 ? 155 ASN A C    2  
ATOM 4815  O O    . ASN A 1 103 ? 0.899   -3.891  -6.659  1.00 0.00 ? 155 ASN A O    2  
ATOM 4816  C CB   . ASN A 1 103 ? 2.897   -5.162  -5.035  1.00 0.00 ? 155 ASN A CB   2  
ATOM 4817  C CG   . ASN A 1 103 ? 3.204   -6.103  -6.192  1.00 0.00 ? 155 ASN A CG   2  
ATOM 4818  O OD1  . ASN A 1 103 ? 3.450   -5.670  -7.314  1.00 0.00 ? 155 ASN A OD1  2  
ATOM 4819  N ND2  . ASN A 1 103 ? 3.188   -7.405  -5.925  1.00 0.00 ? 155 ASN A ND2  2  
ATOM 4820  H H    . ASN A 1 103 ? 1.751   -2.932  -3.902  1.00 0.00 ? 155 ASN A H    2  
ATOM 4821  H HA   . ASN A 1 103 ? 3.986   -3.483  -5.793  1.00 0.00 ? 155 ASN A HA   2  
ATOM 4822  H HB2  . ASN A 1 103 ? 3.613   -5.344  -4.234  1.00 0.00 ? 155 ASN A HB2  2  
ATOM 4823  H HB3  . ASN A 1 103 ? 1.897   -5.376  -4.659  1.00 0.00 ? 155 ASN A HB3  2  
ATOM 4824  H HD21 . ASN A 1 103 ? 2.981   -7.728  -4.991  1.00 0.00 ? 155 ASN A HD21 2  
ATOM 4825  H HD22 . ASN A 1 103 ? 3.381   -8.068  -6.662  1.00 0.00 ? 155 ASN A HD22 2  
ATOM 4826  N N    . LEU A 1 104 ? 2.423   -2.406  -7.418  1.00 0.00 ? 156 LEU A N    2  
ATOM 4827  C CA   . LEU A 1 104 ? 1.628   -1.875  -8.513  1.00 0.00 ? 156 LEU A CA   2  
ATOM 4828  C C    . LEU A 1 104 ? 1.401   -2.892  -9.636  1.00 0.00 ? 156 LEU A C    2  
ATOM 4829  O O    . LEU A 1 104 ? 0.854   -2.535  -10.677 1.00 0.00 ? 156 LEU A O    2  
ATOM 4830  C CB   . LEU A 1 104 ? 2.205   -0.541  -9.017  1.00 0.00 ? 156 LEU A CB   2  
ATOM 4831  C CG   . LEU A 1 104 ? 3.731   -0.426  -9.175  1.00 0.00 ? 156 LEU A CG   2  
ATOM 4832  C CD1  . LEU A 1 104 ? 4.398   0.002   -7.871  1.00 0.00 ? 156 LEU A CD1  2  
ATOM 4833  C CD2  . LEU A 1 104 ? 4.433   -1.702  -9.617  1.00 0.00 ? 156 LEU A CD2  2  
ATOM 4834  H H    . LEU A 1 104 ? 3.355   -2.035  -7.304  1.00 0.00 ? 156 LEU A H    2  
ATOM 4835  H HA   . LEU A 1 104 ? 0.640   -1.657  -8.108  1.00 0.00 ? 156 LEU A HA   2  
ATOM 4836  H HB2  . LEU A 1 104 ? 1.749   -0.327  -9.983  1.00 0.00 ? 156 LEU A HB2  2  
ATOM 4837  H HB3  . LEU A 1 104 ? 1.884   0.246   -8.335  1.00 0.00 ? 156 LEU A HB3  2  
ATOM 4838  H HG   . LEU A 1 104 ? 3.930   0.350   -9.914  1.00 0.00 ? 156 LEU A HG   2  
ATOM 4839  H HD11 . LEU A 1 104 ? 4.259   -0.762  -7.106  1.00 0.00 ? 156 LEU A HD11 2  
ATOM 4840  H HD12 . LEU A 1 104 ? 5.466   0.132   -8.048  1.00 0.00 ? 156 LEU A HD12 2  
ATOM 4841  H HD13 . LEU A 1 104 ? 3.968   0.948   -7.540  1.00 0.00 ? 156 LEU A HD13 2  
ATOM 4842  H HD21 . LEU A 1 104 ? 4.391   -2.443  -8.819  1.00 0.00 ? 156 LEU A HD21 2  
ATOM 4843  H HD22 . LEU A 1 104 ? 3.968   -2.087  -10.526 1.00 0.00 ? 156 LEU A HD22 2  
ATOM 4844  H HD23 . LEU A 1 104 ? 5.480   -1.467  -9.807  1.00 0.00 ? 156 LEU A HD23 2  
ATOM 4845  N N    . SER A 1 105 ? 1.812   -4.150  -9.440  1.00 0.00 ? 157 SER A N    2  
ATOM 4846  C CA   . SER A 1 105 ? 1.534   -5.212  -10.397 1.00 0.00 ? 157 SER A CA   2  
ATOM 4847  C C    . SER A 1 105 ? 0.416   -6.124  -9.905  1.00 0.00 ? 157 SER A C    2  
ATOM 4848  O O    . SER A 1 105 ? -0.203  -6.814  -10.714 1.00 0.00 ? 157 SER A O    2  
ATOM 4849  C CB   . SER A 1 105 ? 2.798   -6.023  -10.660 1.00 0.00 ? 157 SER A CB   2  
ATOM 4850  O OG   . SER A 1 105 ? 3.774   -5.196  -11.248 1.00 0.00 ? 157 SER A OG   2  
ATOM 4851  H H    . SER A 1 105 ? 2.330   -4.386  -8.606  1.00 0.00 ? 157 SER A H    2  
ATOM 4852  H HA   . SER A 1 105 ? 1.216   -4.766  -11.340 1.00 0.00 ? 157 SER A HA   2  
ATOM 4853  H HB2  . SER A 1 105 ? 3.174   -6.431  -9.721  1.00 0.00 ? 157 SER A HB2  2  
ATOM 4854  H HB3  . SER A 1 105 ? 2.566   -6.842  -11.340 1.00 0.00 ? 157 SER A HB3  2  
ATOM 4855  H HG   . SER A 1 105 ? 4.537   -5.739  -11.457 1.00 0.00 ? 157 SER A HG   2  
ATOM 4856  N N    . ASP A 1 106 ? 0.140   -6.144  -8.596  1.00 0.00 ? 158 ASP A N    2  
ATOM 4857  C CA   . ASP A 1 106 ? -0.933  -6.962  -8.049  1.00 0.00 ? 158 ASP A CA   2  
ATOM 4858  C C    . ASP A 1 106 ? -2.221  -6.146  -7.920  1.00 0.00 ? 158 ASP A C    2  
ATOM 4859  O O    . ASP A 1 106 ? -3.302  -6.715  -7.775  1.00 0.00 ? 158 ASP A O    2  
ATOM 4860  C CB   . ASP A 1 106 ? -0.475  -7.533  -6.704  1.00 0.00 ? 158 ASP A CB   2  
ATOM 4861  C CG   . ASP A 1 106 ? -1.402  -8.634  -6.193  1.00 0.00 ? 158 ASP A CG   2  
ATOM 4862  O OD1  . ASP A 1 106 ? -1.830  -9.467  -7.020  1.00 0.00 ? 158 ASP A OD1  2  
ATOM 4863  O OD2  . ASP A 1 106 ? -1.673  -8.631  -4.971  1.00 0.00 ? 158 ASP A OD2  2  
ATOM 4864  H H    . ASP A 1 106 ? 0.682   -5.586  -7.952  1.00 0.00 ? 158 ASP A H    2  
ATOM 4865  H HA   . ASP A 1 106 ? -1.118  -7.793  -8.729  1.00 0.00 ? 158 ASP A HA   2  
ATOM 4866  H HB2  . ASP A 1 106 ? 0.523   -7.956  -6.827  1.00 0.00 ? 158 ASP A HB2  2  
ATOM 4867  H HB3  . ASP A 1 106 ? -0.420  -6.729  -5.971  1.00 0.00 ? 158 ASP A HB3  2  
ATOM 4868  N N    . SER A 1 107 ? -2.097  -4.812  -7.975  1.00 0.00 ? 159 SER A N    2  
ATOM 4869  C CA   . SER A 1 107 ? -3.241  -3.910  -8.087  1.00 0.00 ? 159 SER A CA   2  
ATOM 4870  C C    . SER A 1 107 ? -4.301  -4.343  -9.091  1.00 0.00 ? 159 SER A C    2  
ATOM 4871  O O    . SER A 1 107 ? -5.426  -3.852  -9.014  1.00 0.00 ? 159 SER A O    2  
ATOM 4872  C CB   . SER A 1 107 ? -2.762  -2.543  -8.567  1.00 0.00 ? 159 SER A CB   2  
ATOM 4873  O OG   . SER A 1 107 ? -1.851  -1.968  -7.661  1.00 0.00 ? 159 SER A OG   2  
ATOM 4874  H H    . SER A 1 107 ? -1.177  -4.400  -7.921  1.00 0.00 ? 159 SER A H    2  
ATOM 4875  H HA   . SER A 1 107 ? -3.725  -3.813  -7.114  1.00 0.00 ? 159 SER A HA   2  
ATOM 4876  H HB2  . SER A 1 107 ? -2.279  -2.654  -9.538  1.00 0.00 ? 159 SER A HB2  2  
ATOM 4877  H HB3  . SER A 1 107 ? -3.630  -1.894  -8.679  1.00 0.00 ? 159 SER A HB3  2  
ATOM 4878  H HG   . SER A 1 107 ? -1.576  -1.120  -8.017  1.00 0.00 ? 159 SER A HG   2  
ATOM 4879  N N    . ASP A 1 108 ? -3.974  -5.239  -10.021 1.00 0.00 ? 160 ASP A N    2  
ATOM 4880  C CA   . ASP A 1 108 ? -4.913  -5.652  -11.045 1.00 0.00 ? 160 ASP A CA   2  
ATOM 4881  C C    . ASP A 1 108 ? -5.292  -7.112  -10.845 1.00 0.00 ? 160 ASP A C    2  
ATOM 4882  O O    . ASP A 1 108 ? -4.437  -7.997  -10.841 1.00 0.00 ? 160 ASP A O    2  
ATOM 4883  C CB   . ASP A 1 108 ? -4.321  -5.410  -12.434 1.00 0.00 ? 160 ASP A CB   2  
ATOM 4884  C CG   . ASP A 1 108 ? -4.023  -3.930  -12.659 1.00 0.00 ? 160 ASP A CG   2  
ATOM 4885  O OD1  . ASP A 1 108 ? -4.995  -3.143  -12.696 1.00 0.00 ? 160 ASP A OD1  2  
ATOM 4886  O OD2  . ASP A 1 108 ? -2.824  -3.596  -12.792 1.00 0.00 ? 160 ASP A OD2  2  
ATOM 4887  H H    . ASP A 1 108 ? -3.052  -5.649  -10.022 1.00 0.00 ? 160 ASP A H    2  
ATOM 4888  H HA   . ASP A 1 108 ? -5.821  -5.056  -10.955 1.00 0.00 ? 160 ASP A HA   2  
ATOM 4889  H HB2  . ASP A 1 108 ? -3.403  -5.988  -12.538 1.00 0.00 ? 160 ASP A HB2  2  
ATOM 4890  H HB3  . ASP A 1 108 ? -5.033  -5.747  -13.188 1.00 0.00 ? 160 ASP A HB3  2  
ATOM 4891  N N    . PHE A 1 109 ? -6.595  -7.340  -10.679 1.00 0.00 ? 161 PHE A N    2  
ATOM 4892  C CA   . PHE A 1 109 ? -7.141  -8.679  -10.518 1.00 0.00 ? 161 PHE A CA   2  
ATOM 4893  C C    . PHE A 1 109 ? -8.127  -8.983  -11.644 1.00 0.00 ? 161 PHE A C    2  
ATOM 4894  O O    . PHE A 1 109 ? -9.290  -8.587  -11.603 1.00 0.00 ? 161 PHE A O    2  
ATOM 4895  C CB   . PHE A 1 109 ? -7.737  -8.848  -9.115  1.00 0.00 ? 161 PHE A CB   2  
ATOM 4896  C CG   . PHE A 1 109 ? -8.811  -7.860  -8.704  1.00 0.00 ? 161 PHE A CG   2  
ATOM 4897  C CD1  . PHE A 1 109 ? -8.494  -6.509  -8.497  1.00 0.00 ? 161 PHE A CD1  2  
ATOM 4898  C CD2  . PHE A 1 109 ? -10.130 -8.300  -8.518  1.00 0.00 ? 161 PHE A CD2  2  
ATOM 4899  C CE1  . PHE A 1 109 ? -9.487  -5.608  -8.089  1.00 0.00 ? 161 PHE A CE1  2  
ATOM 4900  C CE2  . PHE A 1 109 ? -11.123 -7.398  -8.109  1.00 0.00 ? 161 PHE A CE2  2  
ATOM 4901  C CZ   . PHE A 1 109 ? -10.801 -6.051  -7.894  1.00 0.00 ? 161 PHE A CZ   2  
ATOM 4902  H H    . PHE A 1 109 ? -7.240  -6.562  -10.665 1.00 0.00 ? 161 PHE A H    2  
ATOM 4903  H HA   . PHE A 1 109 ? -6.324  -9.394  -10.606 1.00 0.00 ? 161 PHE A HA   2  
ATOM 4904  H HB2  . PHE A 1 109 ? -8.154  -9.852  -9.038  1.00 0.00 ? 161 PHE A HB2  2  
ATOM 4905  H HB3  . PHE A 1 109 ? -6.924  -8.774  -8.393  1.00 0.00 ? 161 PHE A HB3  2  
ATOM 4906  H HD1  . PHE A 1 109 ? -7.483  -6.158  -8.646  1.00 0.00 ? 161 PHE A HD1  2  
ATOM 4907  H HD2  . PHE A 1 109 ? -10.382 -9.337  -8.690  1.00 0.00 ? 161 PHE A HD2  2  
ATOM 4908  H HE1  . PHE A 1 109 ? -9.241  -4.569  -7.924  1.00 0.00 ? 161 PHE A HE1  2  
ATOM 4909  H HE2  . PHE A 1 109 ? -12.137 -7.738  -7.960  1.00 0.00 ? 161 PHE A HE2  2  
ATOM 4910  H HZ   . PHE A 1 109 ? -11.562 -5.353  -7.579  1.00 0.00 ? 161 PHE A HZ   2  
ATOM 4911  N N    . VAL A 1 110 ? -7.635  -9.698  -12.658 1.00 0.00 ? 162 VAL A N    2  
ATOM 4912  C CA   . VAL A 1 110 ? -8.445  -10.120 -13.792 1.00 0.00 ? 162 VAL A CA   2  
ATOM 4913  C C    . VAL A 1 110 ? -8.806  -11.601 -13.672 1.00 0.00 ? 162 VAL A C    2  
ATOM 4914  O O    . VAL A 1 110 ? -8.069  -12.373 -13.058 1.00 0.00 ? 162 VAL A O    2  
ATOM 4915  C CB   . VAL A 1 110 ? -7.687  -9.804  -15.089 1.00 0.00 ? 162 VAL A CB   2  
ATOM 4916  C CG1  . VAL A 1 110 ? -6.371  -10.578 -15.171 1.00 0.00 ? 162 VAL A CG1  2  
ATOM 4917  C CG2  . VAL A 1 110 ? -8.522  -10.130 -16.326 1.00 0.00 ? 162 VAL A CG2  2  
ATOM 4918  H H    . VAL A 1 110 ? -6.658  -9.960  -12.658 1.00 0.00 ? 162 VAL A H    2  
ATOM 4919  H HA   . VAL A 1 110 ? -9.372  -9.547  -13.794 1.00 0.00 ? 162 VAL A HA   2  
ATOM 4920  H HB   . VAL A 1 110 ? -7.460  -8.737  -15.102 1.00 0.00 ? 162 VAL A HB   2  
ATOM 4921  H HG11 . VAL A 1 110 ? -5.847  -10.305 -16.087 1.00 0.00 ? 162 VAL A HG11 2  
ATOM 4922  H HG12 . VAL A 1 110 ? -5.740  -10.330 -14.316 1.00 0.00 ? 162 VAL A HG12 2  
ATOM 4923  H HG13 . VAL A 1 110 ? -6.568  -11.650 -15.178 1.00 0.00 ? 162 VAL A HG13 2  
ATOM 4924  H HG21 . VAL A 1 110 ? -9.465  -9.586  -16.281 1.00 0.00 ? 162 VAL A HG21 2  
ATOM 4925  H HG22 . VAL A 1 110 ? -7.976  -9.826  -17.219 1.00 0.00 ? 162 VAL A HG22 2  
ATOM 4926  H HG23 . VAL A 1 110 ? -8.712  -11.203 -16.375 1.00 0.00 ? 162 VAL A HG23 2  
ATOM 4927  N N    . MET A 1 111 ? -9.940  -11.996 -14.257 1.00 0.00 ? 163 MET A N    2  
ATOM 4928  C CA   . MET A 1 111 ? -10.387 -13.383 -14.229 1.00 0.00 ? 163 MET A CA   2  
ATOM 4929  C C    . MET A 1 111 ? -10.986 -13.802 -15.576 1.00 0.00 ? 163 MET A C    2  
ATOM 4930  O O    . MET A 1 111 ? -11.414 -14.944 -15.732 1.00 0.00 ? 163 MET A O    2  
ATOM 4931  C CB   . MET A 1 111 ? -11.390 -13.545 -13.081 1.00 0.00 ? 163 MET A CB   2  
ATOM 4932  C CG   . MET A 1 111 ? -11.676 -15.015 -12.777 1.00 0.00 ? 163 MET A CG   2  
ATOM 4933  S SD   . MET A 1 111 ? -12.666 -15.272 -11.284 1.00 0.00 ? 163 MET A SD   2  
ATOM 4934  C CE   . MET A 1 111 ? -12.755 -17.080 -11.308 1.00 0.00 ? 163 MET A CE   2  
ATOM 4935  H H    . MET A 1 111 ? -10.519 -11.322 -14.737 1.00 0.00 ? 163 MET A H    2  
ATOM 4936  H HA   . MET A 1 111 ? -9.525  -14.020 -14.032 1.00 0.00 ? 163 MET A HA   2  
ATOM 4937  H HB2  . MET A 1 111 ? -10.974 -13.085 -12.184 1.00 0.00 ? 163 MET A HB2  2  
ATOM 4938  H HB3  . MET A 1 111 ? -12.321 -13.036 -13.335 1.00 0.00 ? 163 MET A HB3  2  
ATOM 4939  H HG2  . MET A 1 111 ? -12.207 -15.459 -13.620 1.00 0.00 ? 163 MET A HG2  2  
ATOM 4940  H HG3  . MET A 1 111 ? -10.726 -15.536 -12.656 1.00 0.00 ? 163 MET A HG3  2  
ATOM 4941  H HE1  . MET A 1 111 ? -11.748 -17.495 -11.246 1.00 0.00 ? 163 MET A HE1  2  
ATOM 4942  H HE2  . MET A 1 111 ? -13.344 -17.426 -10.459 1.00 0.00 ? 163 MET A HE2  2  
ATOM 4943  H HE3  . MET A 1 111 ? -13.227 -17.410 -12.234 1.00 0.00 ? 163 MET A HE3  2  
ATOM 4944  N N    . ASP A 1 112 ? -11.018 -12.878 -16.545 1.00 0.00 ? 164 ASP A N    2  
ATOM 4945  C CA   . ASP A 1 112 ? -11.641 -13.060 -17.851 1.00 0.00 ? 164 ASP A CA   2  
ATOM 4946  C C    . ASP A 1 112 ? -13.137 -13.371 -17.743 1.00 0.00 ? 164 ASP A C    2  
ATOM 4947  O O    . ASP A 1 112 ? -13.660 -13.635 -16.660 1.00 0.00 ? 164 ASP A O    2  
ATOM 4948  C CB   . ASP A 1 112 ? -10.880 -14.104 -18.674 1.00 0.00 ? 164 ASP A CB   2  
ATOM 4949  C CG   . ASP A 1 112 ? -9.415  -13.712 -18.853 1.00 0.00 ? 164 ASP A CG   2  
ATOM 4950  O OD1  . ASP A 1 112 ? -9.162  -12.764 -19.631 1.00 0.00 ? 164 ASP A OD1  2  
ATOM 4951  O OD2  . ASP A 1 112 ? -8.559  -14.361 -18.211 1.00 0.00 ? 164 ASP A OD2  2  
ATOM 4952  H H    . ASP A 1 112 ? -10.587 -11.982 -16.371 1.00 0.00 ? 164 ASP A H    2  
ATOM 4953  H HA   . ASP A 1 112 ? -11.556 -12.113 -18.384 1.00 0.00 ? 164 ASP A HA   2  
ATOM 4954  H HB2  . ASP A 1 112 ? -10.942 -15.075 -18.182 1.00 0.00 ? 164 ASP A HB2  2  
ATOM 4955  H HB3  . ASP A 1 112 ? -11.342 -14.188 -19.656 1.00 0.00 ? 164 ASP A HB3  2  
ATOM 4956  N N    . GLY A 1 113 ? -13.835 -13.342 -18.881 1.00 0.00 ? 165 GLY A N    2  
ATOM 4957  C CA   . GLY A 1 113 ? -15.270 -13.573 -18.904 1.00 0.00 ? 165 GLY A CA   2  
ATOM 4958  C C    . GLY A 1 113 ? -15.840 -13.472 -20.314 1.00 0.00 ? 165 GLY A C    2  
ATOM 4959  O O    . GLY A 1 113 ? -15.104 -13.500 -21.300 1.00 0.00 ? 165 GLY A O    2  
ATOM 4960  H H    . GLY A 1 113 ? -13.366 -13.155 -19.755 1.00 0.00 ? 165 GLY A H    2  
ATOM 4961  H HA2  . GLY A 1 113 ? -15.486 -14.564 -18.506 1.00 0.00 ? 165 GLY A HA2  2  
ATOM 4962  H HA3  . GLY A 1 113 ? -15.759 -12.833 -18.271 1.00 0.00 ? 165 GLY A HA3  2  
ATOM 4963  N N    . SER A 1 114 ? -17.167 -13.353 -20.396 1.00 0.00 ? 166 SER A N    2  
ATOM 4964  C CA   . SER A 1 114 ? -17.902 -13.302 -21.653 1.00 0.00 ? 166 SER A CA   2  
ATOM 4965  C C    . SER A 1 114 ? -17.956 -11.896 -22.249 1.00 0.00 ? 166 SER A C    2  
ATOM 4966  O O    . SER A 1 114 ? -18.811 -11.627 -23.091 1.00 0.00 ? 166 SER A O    2  
ATOM 4967  C CB   . SER A 1 114 ? -19.318 -13.836 -21.435 1.00 0.00 ? 166 SER A CB   2  
ATOM 4968  O OG   . SER A 1 114 ? -19.270 -15.181 -21.005 1.00 0.00 ? 166 SER A OG   2  
ATOM 4969  H H    . SER A 1 114 ? -17.705 -13.299 -19.543 1.00 0.00 ? 166 SER A H    2  
ATOM 4970  H HA   . SER A 1 114 ? -17.397 -13.949 -22.370 1.00 0.00 ? 166 SER A HA   2  
ATOM 4971  H HB2  . SER A 1 114 ? -19.818 -13.233 -20.677 1.00 0.00 ? 166 SER A HB2  2  
ATOM 4972  H HB3  . SER A 1 114 ? -19.877 -13.766 -22.368 1.00 0.00 ? 166 SER A HB3  2  
ATOM 4973  H HG   . SER A 1 114 ? -18.888 -15.712 -21.707 1.00 0.00 ? 166 SER A HG   2  
ATOM 4974  N N    . GLN A 1 115 ? -17.062 -10.991 -21.832 1.00 0.00 ? 167 GLN A N    2  
ATOM 4975  C CA   . GLN A 1 115 ? -17.108 -9.612  -22.296 1.00 0.00 ? 167 GLN A CA   2  
ATOM 4976  C C    . GLN A 1 115 ? -15.721 -9.031  -22.562 1.00 0.00 ? 167 GLN A C    2  
ATOM 4977  O O    . GLN A 1 115 ? -14.740 -9.458  -21.952 1.00 0.00 ? 167 GLN A O    2  
ATOM 4978  C CB   . GLN A 1 115 ? -17.844 -8.756  -21.262 1.00 0.00 ? 167 GLN A CB   2  
ATOM 4979  C CG   . GLN A 1 115 ? -17.057 -8.636  -19.954 1.00 0.00 ? 167 GLN A CG   2  
ATOM 4980  C CD   . GLN A 1 115 ? -17.620 -7.526  -19.081 1.00 0.00 ? 167 GLN A CD   2  
ATOM 4981  O OE1  . GLN A 1 115 ? -18.448 -7.770  -18.211 1.00 0.00 ? 167 GLN A OE1  2  
ATOM 4982  N NE2  . GLN A 1 115 ? -17.171 -6.293  -19.311 1.00 0.00 ? 167 GLN A NE2  2  
ATOM 4983  H H    . GLN A 1 115 ? -16.337 -11.257 -21.182 1.00 0.00 ? 167 GLN A H    2  
ATOM 4984  H HA   . GLN A 1 115 ? -17.677 -9.583  -23.226 1.00 0.00 ? 167 GLN A HA   2  
ATOM 4985  H HB2  . GLN A 1 115 ? -17.998 -7.758  -21.677 1.00 0.00 ? 167 GLN A HB2  2  
ATOM 4986  H HB3  . GLN A 1 115 ? -18.814 -9.206  -21.047 1.00 0.00 ? 167 GLN A HB3  2  
ATOM 4987  H HG2  . GLN A 1 115 ? -17.096 -9.582  -19.415 1.00 0.00 ? 167 GLN A HG2  2  
ATOM 4988  H HG3  . GLN A 1 115 ? -16.016 -8.393  -20.170 1.00 0.00 ? 167 GLN A HG3  2  
ATOM 4989  H HE21 . GLN A 1 115 ? -16.492 -6.133  -20.041 1.00 0.00 ? 167 GLN A HE21 2  
ATOM 4990  H HE22 . GLN A 1 115 ? -17.513 -5.524  -18.754 1.00 0.00 ? 167 GLN A HE22 2  
ATOM 4991  N N    . PRO A 1 116 ? -15.631 -8.053  -23.475 1.00 0.00 ? 168 PRO A N    2  
ATOM 4992  C CA   . PRO A 1 116 ? -14.447 -7.243  -23.686 1.00 0.00 ? 168 PRO A CA   2  
ATOM 4993  C C    . PRO A 1 116 ? -14.362 -6.157  -22.621 1.00 0.00 ? 168 PRO A C    2  
ATOM 4994  O O    . PRO A 1 116 ? -15.153 -6.130  -21.677 1.00 0.00 ? 168 PRO A O    2  
ATOM 4995  C CB   . PRO A 1 116 ? -14.623 -6.645  -25.078 1.00 0.00 ? 168 PRO A CB   2  
ATOM 4996  C CG   . PRO A 1 116 ? -16.138 -6.462  -25.169 1.00 0.00 ? 168 PRO A CG   2  
ATOM 4997  C CD   . PRO A 1 116 ? -16.689 -7.653  -24.386 1.00 0.00 ? 168 PRO A CD   2  
ATOM 4998  H HA   . PRO A 1 116 ? -13.541 -7.846  -23.651 1.00 0.00 ? 168 PRO A HA   2  
ATOM 4999  H HB2  . PRO A 1 116 ? -14.095 -5.699  -25.194 1.00 0.00 ? 168 PRO A HB2  2  
ATOM 5000  H HB3  . PRO A 1 116 ? -14.276 -7.368  -25.815 1.00 0.00 ? 168 PRO A HB3  2  
ATOM 5001  H HG2  . PRO A 1 116 ? -16.421 -5.537  -24.666 1.00 0.00 ? 168 PRO A HG2  2  
ATOM 5002  H HG3  . PRO A 1 116 ? -16.486 -6.462  -26.202 1.00 0.00 ? 168 PRO A HG3  2  
ATOM 5003  H HD2  . PRO A 1 116 ? -17.592 -7.368  -23.848 1.00 0.00 ? 168 PRO A HD2  2  
ATOM 5004  H HD3  . PRO A 1 116 ? -16.899 -8.473  -25.072 1.00 0.00 ? 168 PRO A HD3  2  
ATOM 5005  N N    . LEU A 1 117 ? -13.391 -5.257  -22.778 1.00 0.00 ? 169 LEU A N    2  
ATOM 5006  C CA   . LEU A 1 117 ? -13.106 -4.230  -21.795 1.00 0.00 ? 169 LEU A CA   2  
ATOM 5007  C C    . LEU A 1 117 ? -13.237 -2.846  -22.420 1.00 0.00 ? 169 LEU A C    2  
ATOM 5008  O O    . LEU A 1 117 ? -12.594 -2.537  -23.423 1.00 0.00 ? 169 LEU A O    2  
ATOM 5009  C CB   . LEU A 1 117 ? -11.708 -4.482  -21.234 1.00 0.00 ? 169 LEU A CB   2  
ATOM 5010  C CG   . LEU A 1 117 ? -11.612 -5.888  -20.632 1.00 0.00 ? 169 LEU A CG   2  
ATOM 5011  C CD1  . LEU A 1 117 ? -10.153 -6.214  -20.349 1.00 0.00 ? 169 LEU A CD1  2  
ATOM 5012  C CD2  . LEU A 1 117 ? -12.424 -5.988  -19.343 1.00 0.00 ? 169 LEU A CD2  2  
ATOM 5013  H H    . LEU A 1 117 ? -12.817 -5.285  -23.609 1.00 0.00 ? 169 LEU A H    2  
ATOM 5014  H HA   . LEU A 1 117 ? -13.828 -4.304  -20.980 1.00 0.00 ? 169 LEU A HA   2  
ATOM 5015  H HB2  . LEU A 1 117 ? -10.985 -4.392  -22.044 1.00 0.00 ? 169 LEU A HB2  2  
ATOM 5016  H HB3  . LEU A 1 117 ? -11.479 -3.740  -20.469 1.00 0.00 ? 169 LEU A HB3  2  
ATOM 5017  H HG   . LEU A 1 117 ? -11.985 -6.624  -21.343 1.00 0.00 ? 169 LEU A HG   2  
ATOM 5018  H HD11 . LEU A 1 117 ? -9.745  -5.485  -19.648 1.00 0.00 ? 169 LEU A HD11 2  
ATOM 5019  H HD12 . LEU A 1 117 ? -10.086 -7.216  -19.925 1.00 0.00 ? 169 LEU A HD12 2  
ATOM 5020  H HD13 . LEU A 1 117 ? -9.600  -6.181  -21.287 1.00 0.00 ? 169 LEU A HD13 2  
ATOM 5021  H HD21 . LEU A 1 117 ? -13.479 -5.807  -19.550 1.00 0.00 ? 169 LEU A HD21 2  
ATOM 5022  H HD22 . LEU A 1 117 ? -12.313 -6.987  -18.925 1.00 0.00 ? 169 LEU A HD22 2  
ATOM 5023  H HD23 . LEU A 1 117 ? -12.064 -5.248  -18.628 1.00 0.00 ? 169 LEU A HD23 2  
ATOM 5024  N N    . ASP A 1 118 ? -14.080 -2.018  -21.805 1.00 0.00 ? 170 ASP A N    2  
ATOM 5025  C CA   . ASP A 1 118 ? -14.364 -0.664  -22.254 1.00 0.00 ? 170 ASP A CA   2  
ATOM 5026  C C    . ASP A 1 118 ? -14.855 0.162   -21.059 1.00 0.00 ? 170 ASP A C    2  
ATOM 5027  O O    . ASP A 1 118 ? -15.500 -0.396  -20.173 1.00 0.00 ? 170 ASP A O    2  
ATOM 5028  C CB   . ASP A 1 118 ? -15.437 -0.737  -23.346 1.00 0.00 ? 170 ASP A CB   2  
ATOM 5029  C CG   . ASP A 1 118 ? -15.750 0.630   -23.940 1.00 0.00 ? 170 ASP A CG   2  
ATOM 5030  O OD1  . ASP A 1 118 ? -16.631 1.312   -23.374 1.00 0.00 ? 170 ASP A OD1  2  
ATOM 5031  O OD2  . ASP A 1 118 ? -15.108 0.980   -24.955 1.00 0.00 ? 170 ASP A OD2  2  
ATOM 5032  H H    . ASP A 1 118 ? -14.558 -2.347  -20.978 1.00 0.00 ? 170 ASP A H    2  
ATOM 5033  H HA   . ASP A 1 118 ? -13.458 -0.221  -22.668 1.00 0.00 ? 170 ASP A HA   2  
ATOM 5034  H HB2  . ASP A 1 118 ? -15.088 -1.395  -24.141 1.00 0.00 ? 170 ASP A HB2  2  
ATOM 5035  H HB3  . ASP A 1 118 ? -16.347 -1.160  -22.921 1.00 0.00 ? 170 ASP A HB3  2  
ATOM 5036  N N    . PRO A 1 119 ? -14.572 1.473   -21.005 1.00 0.00 ? 171 PRO A N    2  
ATOM 5037  C CA   . PRO A 1 119 ? -15.006 2.341   -19.917 1.00 0.00 ? 171 PRO A CA   2  
ATOM 5038  C C    . PRO A 1 119 ? -16.517 2.328   -19.674 1.00 0.00 ? 171 PRO A C    2  
ATOM 5039  O O    . PRO A 1 119 ? -16.960 2.708   -18.589 1.00 0.00 ? 171 PRO A O    2  
ATOM 5040  C CB   . PRO A 1 119 ? -14.541 3.743   -20.316 1.00 0.00 ? 171 PRO A CB   2  
ATOM 5041  C CG   . PRO A 1 119 ? -13.347 3.474   -21.230 1.00 0.00 ? 171 PRO A CG   2  
ATOM 5042  C CD   . PRO A 1 119 ? -13.794 2.222   -21.975 1.00 0.00 ? 171 PRO A CD   2  
ATOM 5043  H HA   . PRO A 1 119 ? -14.491 2.039   -19.005 1.00 0.00 ? 171 PRO A HA   2  
ATOM 5044  H HB2  . PRO A 1 119 ? -15.326 4.239   -20.887 1.00 0.00 ? 171 PRO A HB2  2  
ATOM 5045  H HB3  . PRO A 1 119 ? -14.258 4.338   -19.448 1.00 0.00 ? 171 PRO A HB3  2  
ATOM 5046  H HG2  . PRO A 1 119 ? -13.157 4.305   -21.909 1.00 0.00 ? 171 PRO A HG2  2  
ATOM 5047  H HG3  . PRO A 1 119 ? -12.467 3.250   -20.627 1.00 0.00 ? 171 PRO A HG3  2  
ATOM 5048  H HD2  . PRO A 1 119 ? -14.427 2.506   -22.815 1.00 0.00 ? 171 PRO A HD2  2  
ATOM 5049  H HD3  . PRO A 1 119 ? -12.925 1.660   -22.317 1.00 0.00 ? 171 PRO A HD3  2  
ATOM 5050  N N    . ARG A 1 120 ? -17.316 1.899   -20.659 1.00 0.00 ? 172 ARG A N    2  
ATOM 5051  C CA   . ARG A 1 120 ? -18.768 1.819   -20.524 1.00 0.00 ? 172 ARG A CA   2  
ATOM 5052  C C    . ARG A 1 120 ? -19.205 0.451   -20.001 1.00 0.00 ? 172 ARG A C    2  
ATOM 5053  O O    . ARG A 1 120 ? -20.400 0.164   -19.949 1.00 0.00 ? 172 ARG A O    2  
ATOM 5054  C CB   . ARG A 1 120 ? -19.444 2.178   -21.854 1.00 0.00 ? 172 ARG A CB   2  
ATOM 5055  C CG   . ARG A 1 120 ? -19.037 3.574   -22.335 1.00 0.00 ? 172 ARG A CG   2  
ATOM 5056  C CD   . ARG A 1 120 ? -19.386 4.641   -21.297 1.00 0.00 ? 172 ARG A CD   2  
ATOM 5057  N NE   . ARG A 1 120 ? -18.956 5.977   -21.729 1.00 0.00 ? 172 ARG A NE   2  
ATOM 5058  C CZ   . ARG A 1 120 ? -18.496 6.917   -20.897 1.00 0.00 ? 172 ARG A CZ   2  
ATOM 5059  N NH1  . ARG A 1 120 ? -18.409 6.685   -19.590 1.00 0.00 ? 172 ARG A NH1  2  
ATOM 5060  N NH2  . ARG A 1 120 ? -18.120 8.102   -21.369 1.00 0.00 ? 172 ARG A NH2  2  
ATOM 5061  H H    . ARG A 1 120 ? -16.910 1.616   -21.539 1.00 0.00 ? 172 ARG A H    2  
ATOM 5062  H HA   . ARG A 1 120 ? -19.083 2.544   -19.774 1.00 0.00 ? 172 ARG A HA   2  
ATOM 5063  H HB2  . ARG A 1 120 ? -19.167 1.442   -22.609 1.00 0.00 ? 172 ARG A HB2  2  
ATOM 5064  H HB3  . ARG A 1 120 ? -20.526 2.150   -21.722 1.00 0.00 ? 172 ARG A HB3  2  
ATOM 5065  H HG2  . ARG A 1 120 ? -17.963 3.596   -22.523 1.00 0.00 ? 172 ARG A HG2  2  
ATOM 5066  H HG3  . ARG A 1 120 ? -19.559 3.796   -23.267 1.00 0.00 ? 172 ARG A HG3  2  
ATOM 5067  H HD2  . ARG A 1 120 ? -20.464 4.645   -21.133 1.00 0.00 ? 172 ARG A HD2  2  
ATOM 5068  H HD3  . ARG A 1 120 ? -18.886 4.399   -20.359 1.00 0.00 ? 172 ARG A HD3  2  
ATOM 5069  H HE   . ARG A 1 120 ? -19.014 6.189   -22.715 1.00 0.00 ? 172 ARG A HE   2  
ATOM 5070  H HH11 . ARG A 1 120 ? -18.700 5.793   -19.213 1.00 0.00 ? 172 ARG A HH11 2  
ATOM 5071  H HH12 . ARG A 1 120 ? -18.051 7.398   -18.971 1.00 0.00 ? 172 ARG A HH12 2  
ATOM 5072  H HH21 . ARG A 1 120 ? -18.181 8.299   -22.358 1.00 0.00 ? 172 ARG A HH21 2  
ATOM 5073  H HH22 . ARG A 1 120 ? -17.772 8.808   -20.736 1.00 0.00 ? 172 ARG A HH22 2  
ATOM 5074  N N    . LYS A 1 121 ? -18.236 -0.382  -19.617 1.00 0.00 ? 173 LYS A N    2  
ATOM 5075  C CA   . LYS A 1 121 ? -18.457 -1.695  -19.024 1.00 0.00 ? 173 LYS A CA   2  
ATOM 5076  C C    . LYS A 1 121 ? -17.718 -1.786  -17.691 1.00 0.00 ? 173 LYS A C    2  
ATOM 5077  O O    . LYS A 1 121 ? -17.509 -2.879  -17.166 1.00 0.00 ? 173 LYS A O    2  
ATOM 5078  C CB   . LYS A 1 121 ? -18.015 -2.793  -19.997 1.00 0.00 ? 173 LYS A CB   2  
ATOM 5079  C CG   . LYS A 1 121 ? -18.728 -2.691  -21.350 1.00 0.00 ? 173 LYS A CG   2  
ATOM 5080  C CD   . LYS A 1 121 ? -20.231 -2.941  -21.220 1.00 0.00 ? 173 LYS A CD   2  
ATOM 5081  C CE   . LYS A 1 121 ? -20.905 -2.662  -22.561 1.00 0.00 ? 173 LYS A CE   2  
ATOM 5082  N NZ   . LYS A 1 121 ? -22.359 -2.903  -22.487 1.00 0.00 ? 173 LYS A NZ   2  
ATOM 5083  H H    . LYS A 1 121 ? -17.275 -0.092  -19.740 1.00 0.00 ? 173 LYS A H    2  
ATOM 5084  H HA   . LYS A 1 121 ? -19.521 -1.805  -18.814 1.00 0.00 ? 173 LYS A HA   2  
ATOM 5085  H HB2  . LYS A 1 121 ? -16.941 -2.710  -20.161 1.00 0.00 ? 173 LYS A HB2  2  
ATOM 5086  H HB3  . LYS A 1 121 ? -18.227 -3.768  -19.558 1.00 0.00 ? 173 LYS A HB3  2  
ATOM 5087  H HG2  . LYS A 1 121 ? -18.561 -1.700  -21.772 1.00 0.00 ? 173 LYS A HG2  2  
ATOM 5088  H HG3  . LYS A 1 121 ? -18.306 -3.433  -22.028 1.00 0.00 ? 173 LYS A HG3  2  
ATOM 5089  H HD2  . LYS A 1 121 ? -20.402 -3.977  -20.929 1.00 0.00 ? 173 LYS A HD2  2  
ATOM 5090  H HD3  . LYS A 1 121 ? -20.657 -2.280  -20.465 1.00 0.00 ? 173 LYS A HD3  2  
ATOM 5091  H HE2  . LYS A 1 121 ? -20.724 -1.621  -22.831 1.00 0.00 ? 173 LYS A HE2  2  
ATOM 5092  H HE3  . LYS A 1 121 ? -20.467 -3.307  -23.322 1.00 0.00 ? 173 LYS A HE3  2  
ATOM 5093  H HZ1  . LYS A 1 121 ? -22.773 -2.301  -21.791 1.00 0.00 ? 173 LYS A HZ1  2  
ATOM 5094  H HZ2  . LYS A 1 121 ? -22.785 -2.710  -23.382 1.00 0.00 ? 173 LYS A HZ2  2  
ATOM 5095  H HZ3  . LYS A 1 121 ? -22.535 -3.866  -22.241 1.00 0.00 ? 173 LYS A HZ3  2  
ATOM 5096  N N    . THR A 1 122 ? -17.325 -0.626  -17.152 1.00 0.00 ? 174 THR A N    2  
ATOM 5097  C CA   . THR A 1 122 ? -16.588 -0.548  -15.898 1.00 0.00 ? 174 THR A CA   2  
ATOM 5098  C C    . THR A 1 122 ? -17.480 0.043   -14.810 1.00 0.00 ? 174 THR A C    2  
ATOM 5099  O O    . THR A 1 122 ? -18.411 0.795   -15.098 1.00 0.00 ? 174 THR A O    2  
ATOM 5100  C CB   . THR A 1 122 ? -15.308 0.274   -16.097 1.00 0.00 ? 174 THR A CB   2  
ATOM 5101  O OG1  . THR A 1 122 ? -14.556 -0.290  -17.148 1.00 0.00 ? 174 THR A OG1  2  
ATOM 5102  C CG2  . THR A 1 122 ? -14.435 0.282   -14.843 1.00 0.00 ? 174 THR A CG2  2  
ATOM 5103  H H    . THR A 1 122 ? -17.543 0.241   -17.622 1.00 0.00 ? 174 THR A H    2  
ATOM 5104  H HA   . THR A 1 122 ? -16.299 -1.554  -15.591 1.00 0.00 ? 174 THR A HA   2  
ATOM 5105  H HB   . THR A 1 122 ? -15.570 1.299   -16.358 1.00 0.00 ? 174 THR A HB   2  
ATOM 5106  H HG1  . THR A 1 122 ? -13.783 0.259   -17.294 1.00 0.00 ? 174 THR A HG1  2  
ATOM 5107  H HG21 . THR A 1 122 ? -14.222 -0.741  -14.535 1.00 0.00 ? 174 THR A HG21 2  
ATOM 5108  H HG22 . THR A 1 122 ? -13.499 0.796   -15.059 1.00 0.00 ? 174 THR A HG22 2  
ATOM 5109  H HG23 . THR A 1 122 ? -14.944 0.809   -14.037 1.00 0.00 ? 174 THR A HG23 2  
ATOM 5110  N N    . ILE A 1 123 ? -17.186 -0.305  -13.555 1.00 0.00 ? 175 ILE A N    2  
ATOM 5111  C CA   . ILE A 1 123 ? -17.959 0.148   -12.410 1.00 0.00 ? 175 ILE A CA   2  
ATOM 5112  C C    . ILE A 1 123 ? -16.985 0.661   -11.349 1.00 0.00 ? 175 ILE A C    2  
ATOM 5113  O O    . ILE A 1 123 ? -15.816 0.279   -11.338 1.00 0.00 ? 175 ILE A O    2  
ATOM 5114  C CB   . ILE A 1 123 ? -18.818 -1.017  -11.884 1.00 0.00 ? 175 ILE A CB   2  
ATOM 5115  C CG1  . ILE A 1 123 ? -19.667 -1.614  -13.017 1.00 0.00 ? 175 ILE A CG1  2  
ATOM 5116  C CG2  . ILE A 1 123 ? -19.734 -0.560  -10.744 1.00 0.00 ? 175 ILE A CG2  2  
ATOM 5117  C CD1  . ILE A 1 123 ? -20.459 -2.837  -12.555 1.00 0.00 ? 175 ILE A CD1  2  
ATOM 5118  H H    . ILE A 1 123 ? -16.398 -0.909  -13.376 1.00 0.00 ? 175 ILE A H    2  
ATOM 5119  H HA   . ILE A 1 123 ? -18.616 0.965   -12.710 1.00 0.00 ? 175 ILE A HA   2  
ATOM 5120  H HB   . ILE A 1 123 ? -18.153 -1.793  -11.505 1.00 0.00 ? 175 ILE A HB   2  
ATOM 5121  H HG12 . ILE A 1 123 ? -20.356 -0.858  -13.395 1.00 0.00 ? 175 ILE A HG12 2  
ATOM 5122  H HG13 . ILE A 1 123 ? -19.011 -1.928  -13.829 1.00 0.00 ? 175 ILE A HG13 2  
ATOM 5123  H HG21 . ILE A 1 123 ? -20.420 0.205   -11.105 1.00 0.00 ? 175 ILE A HG21 2  
ATOM 5124  H HG22 . ILE A 1 123 ? -20.304 -1.408  -10.364 1.00 0.00 ? 175 ILE A HG22 2  
ATOM 5125  H HG23 . ILE A 1 123 ? -19.138 -0.164  -9.921  1.00 0.00 ? 175 ILE A HG23 2  
ATOM 5126  H HD11 . ILE A 1 123 ? -21.217 -2.548  -11.826 1.00 0.00 ? 175 ILE A HD11 2  
ATOM 5127  H HD12 . ILE A 1 123 ? -20.949 -3.293  -13.416 1.00 0.00 ? 175 ILE A HD12 2  
ATOM 5128  H HD13 . ILE A 1 123 ? -19.778 -3.562  -12.109 1.00 0.00 ? 175 ILE A HD13 2  
ATOM 5129  N N    . PHE A 1 124 ? -17.465 1.525   -10.456 1.00 0.00 ? 176 PHE A N    2  
ATOM 5130  C CA   . PHE A 1 124 ? -16.654 2.088   -9.390  1.00 0.00 ? 176 PHE A CA   2  
ATOM 5131  C C    . PHE A 1 124 ? -17.144 1.521   -8.065  1.00 0.00 ? 176 PHE A C    2  
ATOM 5132  O O    . PHE A 1 124 ? -18.329 1.221   -7.923  1.00 0.00 ? 176 PHE A O    2  
ATOM 5133  C CB   . PHE A 1 124 ? -16.775 3.614   -9.414  1.00 0.00 ? 176 PHE A CB   2  
ATOM 5134  C CG   . PHE A 1 124 ? -16.410 4.289   -8.109  1.00 0.00 ? 176 PHE A CG   2  
ATOM 5135  C CD1  . PHE A 1 124 ? -17.332 4.305   -7.049  1.00 0.00 ? 176 PHE A CD1  2  
ATOM 5136  C CD2  . PHE A 1 124 ? -15.155 4.896   -7.954  1.00 0.00 ? 176 PHE A CD2  2  
ATOM 5137  C CE1  . PHE A 1 124 ? -16.991 4.907   -5.830  1.00 0.00 ? 176 PHE A CE1  2  
ATOM 5138  C CE2  . PHE A 1 124 ? -14.823 5.512   -6.740  1.00 0.00 ? 176 PHE A CE2  2  
ATOM 5139  C CZ   . PHE A 1 124 ? -15.739 5.514   -5.678  1.00 0.00 ? 176 PHE A CZ   2  
ATOM 5140  H H    . PHE A 1 124 ? -18.435 1.804   -10.501 1.00 0.00 ? 176 PHE A H    2  
ATOM 5141  H HA   . PHE A 1 124 ? -15.607 1.813   -9.523  1.00 0.00 ? 176 PHE A HA   2  
ATOM 5142  H HB2  . PHE A 1 124 ? -16.149 4.005   -10.215 1.00 0.00 ? 176 PHE A HB2  2  
ATOM 5143  H HB3  . PHE A 1 124 ? -17.811 3.868   -9.641  1.00 0.00 ? 176 PHE A HB3  2  
ATOM 5144  H HD1  . PHE A 1 124 ? -18.304 3.851   -7.172  1.00 0.00 ? 176 PHE A HD1  2  
ATOM 5145  H HD2  . PHE A 1 124 ? -14.445 4.889   -8.768  1.00 0.00 ? 176 PHE A HD2  2  
ATOM 5146  H HE1  . PHE A 1 124 ? -17.688 4.906   -5.004  1.00 0.00 ? 176 PHE A HE1  2  
ATOM 5147  H HE2  . PHE A 1 124 ? -13.860 5.986   -6.621  1.00 0.00 ? 176 PHE A HE2  2  
ATOM 5148  H HZ   . PHE A 1 124 ? -15.482 5.983   -4.740  1.00 0.00 ? 176 PHE A HZ   2  
ATOM 5149  N N    . VAL A 1 125 ? -16.240 1.372   -7.092  1.00 0.00 ? 177 VAL A N    2  
ATOM 5150  C CA   . VAL A 1 125 ? -16.621 0.898   -5.772  1.00 0.00 ? 177 VAL A CA   2  
ATOM 5151  C C    . VAL A 1 125 ? -15.967 1.761   -4.704  1.00 0.00 ? 177 VAL A C    2  
ATOM 5152  O O    . VAL A 1 125 ? -14.758 1.989   -4.727  1.00 0.00 ? 177 VAL A O    2  
ATOM 5153  C CB   . VAL A 1 125 ? -16.256 -0.578  -5.585  1.00 0.00 ? 177 VAL A CB   2  
ATOM 5154  C CG1  . VAL A 1 125 ? -16.861 -1.075  -4.271  1.00 0.00 ? 177 VAL A CG1  2  
ATOM 5155  C CG2  . VAL A 1 125 ? -16.811 -1.425  -6.729  1.00 0.00 ? 177 VAL A CG2  2  
ATOM 5156  H H    . VAL A 1 125 ? -15.270 1.594   -7.261  1.00 0.00 ? 177 VAL A H    2  
ATOM 5157  H HA   . VAL A 1 125 ? -17.702 0.991   -5.671  1.00 0.00 ? 177 VAL A HA   2  
ATOM 5158  H HB   . VAL A 1 125 ? -15.172 -0.688  -5.553  1.00 0.00 ? 177 VAL A HB   2  
ATOM 5159  H HG11 . VAL A 1 125 ? -16.670 -2.142  -4.154  1.00 0.00 ? 177 VAL A HG11 2  
ATOM 5160  H HG12 . VAL A 1 125 ? -16.415 -0.539  -3.433  1.00 0.00 ? 177 VAL A HG12 2  
ATOM 5161  H HG13 . VAL A 1 125 ? -17.937 -0.907  -4.279  1.00 0.00 ? 177 VAL A HG13 2  
ATOM 5162  H HG21 . VAL A 1 125 ? -16.353 -1.113  -7.668  1.00 0.00 ? 177 VAL A HG21 2  
ATOM 5163  H HG22 . VAL A 1 125 ? -16.585 -2.477  -6.553  1.00 0.00 ? 177 VAL A HG22 2  
ATOM 5164  H HG23 . VAL A 1 125 ? -17.892 -1.295  -6.790  1.00 0.00 ? 177 VAL A HG23 2  
ATOM 5165  N N    . GLY A 1 126 ? -16.787 2.237   -3.766  1.00 0.00 ? 178 GLY A N    2  
ATOM 5166  C CA   . GLY A 1 126 ? -16.321 3.060   -2.666  1.00 0.00 ? 178 GLY A CA   2  
ATOM 5167  C C    . GLY A 1 126 ? -16.506 2.333   -1.339  1.00 0.00 ? 178 GLY A C    2  
ATOM 5168  O O    . GLY A 1 126 ? -17.128 1.273   -1.282  1.00 0.00 ? 178 GLY A O    2  
ATOM 5169  H H    . GLY A 1 126 ? -17.774 2.024   -3.811  1.00 0.00 ? 178 GLY A H    2  
ATOM 5170  H HA2  . GLY A 1 126 ? -15.266 3.296   -2.799  1.00 0.00 ? 178 GLY A HA2  2  
ATOM 5171  H HA3  . GLY A 1 126 ? -16.886 3.992   -2.643  1.00 0.00 ? 178 GLY A HA3  2  
ATOM 5172  N N    . GLY A 1 127 ? -15.960 2.915   -0.271  1.00 0.00 ? 179 GLY A N    2  
ATOM 5173  C CA   . GLY A 1 127 ? -16.057 2.348   1.065   1.00 0.00 ? 179 GLY A CA   2  
ATOM 5174  C C    . GLY A 1 127 ? -14.828 1.533   1.470   1.00 0.00 ? 179 GLY A C    2  
ATOM 5175  O O    . GLY A 1 127 ? -14.856 0.884   2.514   1.00 0.00 ? 179 GLY A O    2  
ATOM 5176  H H    . GLY A 1 127 ? -15.460 3.785   -0.391  1.00 0.00 ? 179 GLY A H    2  
ATOM 5177  H HA2  . GLY A 1 127 ? -16.178 3.164   1.778   1.00 0.00 ? 179 GLY A HA2  2  
ATOM 5178  H HA3  . GLY A 1 127 ? -16.935 1.706   1.119   1.00 0.00 ? 179 GLY A HA3  2  
ATOM 5179  N N    . VAL A 1 128 ? -13.754 1.546   0.673   1.00 0.00 ? 180 VAL A N    2  
ATOM 5180  C CA   . VAL A 1 128 ? -12.509 0.891   1.067   1.00 0.00 ? 180 VAL A CA   2  
ATOM 5181  C C    . VAL A 1 128 ? -11.863 1.745   2.169   1.00 0.00 ? 180 VAL A C    2  
ATOM 5182  O O    . VAL A 1 128 ? -11.588 2.924   1.948   1.00 0.00 ? 180 VAL A O    2  
ATOM 5183  C CB   . VAL A 1 128 ? -11.587 0.679   -0.145  1.00 0.00 ? 180 VAL A CB   2  
ATOM 5184  C CG1  . VAL A 1 128 ? -12.275 -0.196  -1.196  1.00 0.00 ? 180 VAL A CG1  2  
ATOM 5185  C CG2  . VAL A 1 128 ? -11.182 1.988   -0.822  1.00 0.00 ? 180 VAL A CG2  2  
ATOM 5186  H H    . VAL A 1 128 ? -13.790 2.024   -0.216  1.00 0.00 ? 180 VAL A H    2  
ATOM 5187  H HA   . VAL A 1 128 ? -12.746 -0.094  1.469   1.00 0.00 ? 180 VAL A HA   2  
ATOM 5188  H HB   . VAL A 1 128 ? -10.684 0.167   0.191   1.00 0.00 ? 180 VAL A HB   2  
ATOM 5189  H HG11 . VAL A 1 128 ? -13.170 0.302   -1.569  1.00 0.00 ? 180 VAL A HG11 2  
ATOM 5190  H HG12 . VAL A 1 128 ? -11.597 -0.369  -2.032  1.00 0.00 ? 180 VAL A HG12 2  
ATOM 5191  H HG13 . VAL A 1 128 ? -12.547 -1.155  -0.754  1.00 0.00 ? 180 VAL A HG13 2  
ATOM 5192  H HG21 . VAL A 1 128 ? -12.073 2.555   -1.096  1.00 0.00 ? 180 VAL A HG21 2  
ATOM 5193  H HG22 . VAL A 1 128 ? -10.563 2.579   -0.146  1.00 0.00 ? 180 VAL A HG22 2  
ATOM 5194  H HG23 . VAL A 1 128 ? -10.604 1.761   -1.718  1.00 0.00 ? 180 VAL A HG23 2  
ATOM 5195  N N    . PRO A 1 129 ? -11.612 1.181   3.358   1.00 0.00 ? 181 PRO A N    2  
ATOM 5196  C CA   . PRO A 1 129 ? -11.104 1.927   4.499   1.00 0.00 ? 181 PRO A CA   2  
ATOM 5197  C C    . PRO A 1 129 ? -9.597  2.164   4.427   1.00 0.00 ? 181 PRO A C    2  
ATOM 5198  O O    . PRO A 1 129 ? -9.110  3.182   4.920   1.00 0.00 ? 181 PRO A O    2  
ATOM 5199  C CB   . PRO A 1 129 ? -11.437 1.039   5.699   1.00 0.00 ? 181 PRO A CB   2  
ATOM 5200  C CG   . PRO A 1 129 ? -11.318 -0.374  5.129   1.00 0.00 ? 181 PRO A CG   2  
ATOM 5201  C CD   . PRO A 1 129 ? -11.822 -0.215  3.696   1.00 0.00 ? 181 PRO A CD   2  
ATOM 5202  H HA   . PRO A 1 129 ? -11.619 2.883   4.593   1.00 0.00 ? 181 PRO A HA   2  
ATOM 5203  H HB2  . PRO A 1 129 ? -10.750 1.200   6.530   1.00 0.00 ? 181 PRO A HB2  2  
ATOM 5204  H HB3  . PRO A 1 129 ? -12.467 1.219   6.008   1.00 0.00 ? 181 PRO A HB3  2  
ATOM 5205  H HG2  . PRO A 1 129 ? -10.270 -0.677  5.117   1.00 0.00 ? 181 PRO A HG2  2  
ATOM 5206  H HG3  . PRO A 1 129 ? -11.920 -1.088  5.690   1.00 0.00 ? 181 PRO A HG3  2  
ATOM 5207  H HD2  . PRO A 1 129 ? -11.273 -0.873  3.022   1.00 0.00 ? 181 PRO A HD2  2  
ATOM 5208  H HD3  . PRO A 1 129 ? -12.889 -0.432  3.657   1.00 0.00 ? 181 PRO A HD3  2  
ATOM 5209  N N    . ARG A 1 130 ? -8.864  1.230   3.815   1.00 0.00 ? 182 ARG A N    2  
ATOM 5210  C CA   . ARG A 1 130 ? -7.409  1.244   3.746   1.00 0.00 ? 182 ARG A CA   2  
ATOM 5211  C C    . ARG A 1 130 ? -6.972  0.558   2.451   1.00 0.00 ? 182 ARG A C    2  
ATOM 5212  O O    . ARG A 1 130 ? -7.798  -0.087  1.806   1.00 0.00 ? 182 ARG A O    2  
ATOM 5213  C CB   . ARG A 1 130 ? -6.840  0.495   4.959   1.00 0.00 ? 182 ARG A CB   2  
ATOM 5214  C CG   . ARG A 1 130 ? -7.152  1.217   6.271   1.00 0.00 ? 182 ARG A CG   2  
ATOM 5215  C CD   . ARG A 1 130 ? -6.487  0.498   7.444   1.00 0.00 ? 182 ARG A CD   2  
ATOM 5216  N NE   . ARG A 1 130 ? -6.781  1.179   8.710   1.00 0.00 ? 182 ARG A NE   2  
ATOM 5217  C CZ   . ARG A 1 130 ? -6.075  2.198   9.207   1.00 0.00 ? 182 ARG A CZ   2  
ATOM 5218  N NH1  . ARG A 1 130 ? -5.010  2.677   8.565   1.00 0.00 ? 182 ARG A NH1  2  
ATOM 5219  N NH2  . ARG A 1 130 ? -6.439  2.746   10.362  1.00 0.00 ? 182 ARG A NH2  2  
ATOM 5220  H H    . ARG A 1 130 ? -9.336  0.456   3.372   1.00 0.00 ? 182 ARG A H    2  
ATOM 5221  H HA   . ARG A 1 130 ? -7.046  2.272   3.746   1.00 0.00 ? 182 ARG A HA   2  
ATOM 5222  H HB2  . ARG A 1 130 ? -7.266  -0.509  4.994   1.00 0.00 ? 182 ARG A HB2  2  
ATOM 5223  H HB3  . ARG A 1 130 ? -5.758  0.407   4.860   1.00 0.00 ? 182 ARG A HB3  2  
ATOM 5224  H HG2  . ARG A 1 130 ? -6.778  2.239   6.217   1.00 0.00 ? 182 ARG A HG2  2  
ATOM 5225  H HG3  . ARG A 1 130 ? -8.229  1.234   6.434   1.00 0.00 ? 182 ARG A HG3  2  
ATOM 5226  H HD2  . ARG A 1 130 ? -6.865  -0.522  7.492   1.00 0.00 ? 182 ARG A HD2  2  
ATOM 5227  H HD3  . ARG A 1 130 ? -5.409  0.466   7.287   1.00 0.00 ? 182 ARG A HD3  2  
ATOM 5228  H HE   . ARG A 1 130 ? -7.575  0.852   9.242   1.00 0.00 ? 182 ARG A HE   2  
ATOM 5229  H HH11 . ARG A 1 130 ? -4.723  2.265   7.688   1.00 0.00 ? 182 ARG A HH11 2  
ATOM 5230  H HH12 . ARG A 1 130 ? -4.492  3.452   8.953   1.00 0.00 ? 182 ARG A HH12 2  
ATOM 5231  H HH21 . ARG A 1 130 ? -7.248  2.382   10.846  1.00 0.00 ? 182 ARG A HH21 2  
ATOM 5232  H HH22 . ARG A 1 130 ? -5.915  3.515   10.752  1.00 0.00 ? 182 ARG A HH22 2  
ATOM 5233  N N    . PRO A 1 131 ? -5.697  0.681   2.057   1.00 0.00 ? 183 PRO A N    2  
ATOM 5234  C CA   . PRO A 1 131 ? -5.157  -0.023  0.909   1.00 0.00 ? 183 PRO A CA   2  
ATOM 5235  C C    . PRO A 1 131 ? -5.500  -1.509  0.970   1.00 0.00 ? 183 PRO A C    2  
ATOM 5236  O O    . PRO A 1 131 ? -5.456  -2.119  2.037   1.00 0.00 ? 183 PRO A O    2  
ATOM 5237  C CB   . PRO A 1 131 ? -3.649  0.217   0.961   1.00 0.00 ? 183 PRO A CB   2  
ATOM 5238  C CG   . PRO A 1 131 ? -3.551  1.579   1.648   1.00 0.00 ? 183 PRO A CG   2  
ATOM 5239  C CD   . PRO A 1 131 ? -4.675  1.503   2.677   1.00 0.00 ? 183 PRO A CD   2  
ATOM 5240  H HA   . PRO A 1 131 ? -5.563  0.415   -0.003  1.00 0.00 ? 183 PRO A HA   2  
ATOM 5241  H HB2  . PRO A 1 131 ? -3.176  -0.539  1.588   1.00 0.00 ? 183 PRO A HB2  2  
ATOM 5242  H HB3  . PRO A 1 131 ? -3.206  0.229   -0.035  1.00 0.00 ? 183 PRO A HB3  2  
ATOM 5243  H HG2  . PRO A 1 131 ? -2.577  1.726   2.117   1.00 0.00 ? 183 PRO A HG2  2  
ATOM 5244  H HG3  . PRO A 1 131 ? -3.763  2.368   0.926   1.00 0.00 ? 183 PRO A HG3  2  
ATOM 5245  H HD2  . PRO A 1 131 ? -4.305  1.015   3.579   1.00 0.00 ? 183 PRO A HD2  2  
ATOM 5246  H HD3  . PRO A 1 131 ? -5.051  2.501   2.906   1.00 0.00 ? 183 PRO A HD3  2  
ATOM 5247  N N    . LEU A 1 132 ? -5.841  -2.089  -0.183  1.00 0.00 ? 184 LEU A N    2  
ATOM 5248  C CA   . LEU A 1 132 ? -6.269  -3.474  -0.273  1.00 0.00 ? 184 LEU A CA   2  
ATOM 5249  C C    . LEU A 1 132 ? -5.773  -4.098  -1.572  1.00 0.00 ? 184 LEU A C    2  
ATOM 5250  O O    . LEU A 1 132 ? -5.762  -3.440  -2.610  1.00 0.00 ? 184 LEU A O    2  
ATOM 5251  C CB   . LEU A 1 132 ? -7.800  -3.568  -0.171  1.00 0.00 ? 184 LEU A CB   2  
ATOM 5252  C CG   . LEU A 1 132 ? -8.556  -3.014  -1.392  1.00 0.00 ? 184 LEU A CG   2  
ATOM 5253  C CD1  . LEU A 1 132 ? -10.037 -3.350  -1.260  1.00 0.00 ? 184 LEU A CD1  2  
ATOM 5254  C CD2  . LEU A 1 132 ? -8.438  -1.496  -1.534  1.00 0.00 ? 184 LEU A CD2  2  
ATOM 5255  H H    . LEU A 1 132 ? -5.807  -1.553  -1.038  1.00 0.00 ? 184 LEU A H    2  
ATOM 5256  H HA   . LEU A 1 132 ? -5.835  -4.025  0.561   1.00 0.00 ? 184 LEU A HA   2  
ATOM 5257  H HB2  . LEU A 1 132 ? -8.065  -4.620  -0.059  1.00 0.00 ? 184 LEU A HB2  2  
ATOM 5258  H HB3  . LEU A 1 132 ? -8.131  -3.040  0.723   1.00 0.00 ? 184 LEU A HB3  2  
ATOM 5259  H HG   . LEU A 1 132 ? -8.185  -3.491  -2.299  1.00 0.00 ? 184 LEU A HG   2  
ATOM 5260  H HD11 . LEU A 1 132 ? -10.578 -2.942  -2.113  1.00 0.00 ? 184 LEU A HD11 2  
ATOM 5261  H HD12 . LEU A 1 132 ? -10.159 -4.434  -1.243  1.00 0.00 ? 184 LEU A HD12 2  
ATOM 5262  H HD13 . LEU A 1 132 ? -10.429 -2.918  -0.340  1.00 0.00 ? 184 LEU A HD13 2  
ATOM 5263  H HD21 . LEU A 1 132 ? -9.109  -1.155  -2.324  1.00 0.00 ? 184 LEU A HD21 2  
ATOM 5264  H HD22 . LEU A 1 132 ? -8.714  -1.018  -0.596  1.00 0.00 ? 184 LEU A HD22 2  
ATOM 5265  H HD23 . LEU A 1 132 ? -7.418  -1.223  -1.804  1.00 0.00 ? 184 LEU A HD23 2  
ATOM 5266  N N    . ARG A 1 133 ? -5.366  -5.370  -1.515  1.00 0.00 ? 185 ARG A N    2  
ATOM 5267  C CA   . ARG A 1 133 ? -4.911  -6.095  -2.695  1.00 0.00 ? 185 ARG A CA   2  
ATOM 5268  C C    . ARG A 1 133 ? -6.070  -6.874  -3.314  1.00 0.00 ? 185 ARG A C    2  
ATOM 5269  O O    . ARG A 1 133 ? -5.947  -8.049  -3.650  1.00 0.00 ? 185 ARG A O    2  
ATOM 5270  C CB   . ARG A 1 133 ? -3.647  -6.910  -2.393  1.00 0.00 ? 185 ARG A CB   2  
ATOM 5271  C CG   . ARG A 1 133 ? -3.863  -8.034  -1.378  1.00 0.00 ? 185 ARG A CG   2  
ATOM 5272  C CD   . ARG A 1 133 ? -2.521  -8.657  -0.990  1.00 0.00 ? 185 ARG A CD   2  
ATOM 5273  N NE   . ARG A 1 133 ? -1.818  -9.180  -2.166  1.00 0.00 ? 185 ARG A NE   2  
ATOM 5274  C CZ   . ARG A 1 133 ? -0.839  -10.086 -2.125  1.00 0.00 ? 185 ARG A CZ   2  
ATOM 5275  N NH1  . ARG A 1 133 ? -0.420  -10.596 -0.969  1.00 0.00 ? 185 ARG A NH1  2  
ATOM 5276  N NH2  . ARG A 1 133 ? -0.277  -10.485 -3.263  1.00 0.00 ? 185 ARG A NH2  2  
ATOM 5277  H H    . ARG A 1 133 ? -5.371  -5.855  -0.630  1.00 0.00 ? 185 ARG A H    2  
ATOM 5278  H HA   . ARG A 1 133 ? -4.621  -5.349  -3.435  1.00 0.00 ? 185 ARG A HA   2  
ATOM 5279  H HB2  . ARG A 1 133 ? -3.281  -7.339  -3.326  1.00 0.00 ? 185 ARG A HB2  2  
ATOM 5280  H HB3  . ARG A 1 133 ? -2.888  -6.232  -2.006  1.00 0.00 ? 185 ARG A HB3  2  
ATOM 5281  H HG2  . ARG A 1 133 ? -4.341  -7.637  -0.482  1.00 0.00 ? 185 ARG A HG2  2  
ATOM 5282  H HG3  . ARG A 1 133 ? -4.490  -8.808  -1.820  1.00 0.00 ? 185 ARG A HG3  2  
ATOM 5283  H HD2  . ARG A 1 133 ? -1.903  -7.901  -0.507  1.00 0.00 ? 185 ARG A HD2  2  
ATOM 5284  H HD3  . ARG A 1 133 ? -2.703  -9.468  -0.284  1.00 0.00 ? 185 ARG A HD3  2  
ATOM 5285  H HE   . ARG A 1 133 ? -2.094  -8.825  -3.071  1.00 0.00 ? 185 ARG A HE   2  
ATOM 5286  H HH11 . ARG A 1 133 ? -0.843  -10.298 -0.102  1.00 0.00 ? 185 ARG A HH11 2  
ATOM 5287  H HH12 . ARG A 1 133 ? 0.324   -11.279 -0.956  1.00 0.00 ? 185 ARG A HH12 2  
ATOM 5288  H HH21 . ARG A 1 133 ? -0.602  -10.086 -4.133  1.00 0.00 ? 185 ARG A HH21 2  
ATOM 5289  H HH22 . ARG A 1 133 ? 0.460   -11.174 -3.257  1.00 0.00 ? 185 ARG A HH22 2  
ATOM 5290  N N    . ALA A 1 134 ? -7.203  -6.176  -3.454  1.00 0.00 ? 186 ALA A N    2  
ATOM 5291  C CA   . ALA A 1 134 ? -8.438  -6.682  -4.035  1.00 0.00 ? 186 ALA A CA   2  
ATOM 5292  C C    . ALA A 1 134 ? -9.074  -7.856  -3.279  1.00 0.00 ? 186 ALA A C    2  
ATOM 5293  O O    . ALA A 1 134 ? -9.949  -8.530  -3.821  1.00 0.00 ? 186 ALA A O    2  
ATOM 5294  C CB   . ALA A 1 134 ? -8.197  -6.989  -5.512  1.00 0.00 ? 186 ALA A CB   2  
ATOM 5295  H H    . ALA A 1 134 ? -7.210  -5.217  -3.137  1.00 0.00 ? 186 ALA A H    2  
ATOM 5296  H HA   . ALA A 1 134 ? -9.157  -5.864  -3.994  1.00 0.00 ? 186 ALA A HA   2  
ATOM 5297  H HB1  . ALA A 1 134 ? -7.507  -7.827  -5.614  1.00 0.00 ? 186 ALA A HB1  2  
ATOM 5298  H HB2  . ALA A 1 134 ? -9.144  -7.246  -5.988  1.00 0.00 ? 186 ALA A HB2  2  
ATOM 5299  H HB3  . ALA A 1 134 ? -7.764  -6.117  -6.002  1.00 0.00 ? 186 ALA A HB3  2  
ATOM 5300  N N    . VAL A 1 135 ? -8.650  -8.113  -2.036  1.00 0.00 ? 187 VAL A N    2  
ATOM 5301  C CA   . VAL A 1 135 ? -9.155  -9.248  -1.269  1.00 0.00 ? 187 VAL A CA   2  
ATOM 5302  C C    . VAL A 1 135 ? -10.569 -9.023  -0.762  1.00 0.00 ? 187 VAL A C    2  
ATOM 5303  O O    . VAL A 1 135 ? -11.458 -9.816  -1.061  1.00 0.00 ? 187 VAL A O    2  
ATOM 5304  C CB   . VAL A 1 135 ? -8.212  -9.572  -0.106  1.00 0.00 ? 187 VAL A CB   2  
ATOM 5305  C CG1  . VAL A 1 135 ? -8.734  -10.763 0.698   1.00 0.00 ? 187 VAL A CG1  2  
ATOM 5306  C CG2  . VAL A 1 135 ? -6.828  -9.925  -0.639  1.00 0.00 ? 187 VAL A CG2  2  
ATOM 5307  H H    . VAL A 1 135 ? -7.957  -7.517  -1.608  1.00 0.00 ? 187 VAL A H    2  
ATOM 5308  H HA   . VAL A 1 135 ? -9.206  -10.115 -1.928  1.00 0.00 ? 187 VAL A HA   2  
ATOM 5309  H HB   . VAL A 1 135 ? -8.133  -8.704  0.550   1.00 0.00 ? 187 VAL A HB   2  
ATOM 5310  H HG11 . VAL A 1 135 ? -8.839  -11.629 0.044   1.00 0.00 ? 187 VAL A HG11 2  
ATOM 5311  H HG12 . VAL A 1 135 ? -8.030  -10.997 1.496   1.00 0.00 ? 187 VAL A HG12 2  
ATOM 5312  H HG13 . VAL A 1 135 ? -9.702  -10.519 1.136   1.00 0.00 ? 187 VAL A HG13 2  
ATOM 5313  H HG21 . VAL A 1 135 ? -6.433  -9.076  -1.195  1.00 0.00 ? 187 VAL A HG21 2  
ATOM 5314  H HG22 . VAL A 1 135 ? -6.163  -10.153 0.194   1.00 0.00 ? 187 VAL A HG22 2  
ATOM 5315  H HG23 . VAL A 1 135 ? -6.896  -10.791 -1.298  1.00 0.00 ? 187 VAL A HG23 2  
ATOM 5316  N N    . GLU A 1 136 ? -10.791 -7.954  0.002   1.00 0.00 ? 188 GLU A N    2  
ATOM 5317  C CA   . GLU A 1 136 ? -12.085 -7.720  0.620   1.00 0.00 ? 188 GLU A CA   2  
ATOM 5318  C C    . GLU A 1 136 ? -13.130 -7.315  -0.417  1.00 0.00 ? 188 GLU A C    2  
ATOM 5319  O O    . GLU A 1 136 ? -14.314 -7.552  -0.206  1.00 0.00 ? 188 GLU A O    2  
ATOM 5320  C CB   . GLU A 1 136 ? -11.950 -6.649  1.706   1.00 0.00 ? 188 GLU A CB   2  
ATOM 5321  C CG   . GLU A 1 136 ? -11.203 -5.428  1.172   1.00 0.00 ? 188 GLU A CG   2  
ATOM 5322  C CD   . GLU A 1 136 ? -11.418 -4.211  2.067   1.00 0.00 ? 188 GLU A CD   2  
ATOM 5323  O OE1  . GLU A 1 136 ? -10.844 -4.207  3.179   1.00 0.00 ? 188 GLU A OE1  2  
ATOM 5324  O OE2  . GLU A 1 136 ? -12.154 -3.298  1.634   1.00 0.00 ? 188 GLU A OE2  2  
ATOM 5325  H H    . GLU A 1 136 ? -10.051 -7.286  0.166   1.00 0.00 ? 188 GLU A H    2  
ATOM 5326  H HA   . GLU A 1 136 ? -12.422 -8.643  1.092   1.00 0.00 ? 188 GLU A HA   2  
ATOM 5327  H HB2  . GLU A 1 136 ? -12.946 -6.353  2.034   1.00 0.00 ? 188 GLU A HB2  2  
ATOM 5328  H HB3  . GLU A 1 136 ? -11.401 -7.058  2.556   1.00 0.00 ? 188 GLU A HB3  2  
ATOM 5329  H HG2  . GLU A 1 136 ? -10.137 -5.646  1.117   1.00 0.00 ? 188 GLU A HG2  2  
ATOM 5330  H HG3  . GLU A 1 136 ? -11.552 -5.220  0.161   1.00 0.00 ? 188 GLU A HG3  2  
ATOM 5331  N N    . LEU A 1 137 ? -12.701 -6.711  -1.529  1.00 0.00 ? 189 LEU A N    2  
ATOM 5332  C CA   . LEU A 1 137 ? -13.575 -6.186  -2.565  1.00 0.00 ? 189 LEU A CA   2  
ATOM 5333  C C    . LEU A 1 137 ? -14.175 -7.316  -3.393  1.00 0.00 ? 189 LEU A C    2  
ATOM 5334  O O    . LEU A 1 137 ? -15.392 -7.378  -3.571  1.00 0.00 ? 189 LEU A O    2  
ATOM 5335  C CB   . LEU A 1 137 ? -12.732 -5.230  -3.422  1.00 0.00 ? 189 LEU A CB   2  
ATOM 5336  C CG   . LEU A 1 137 ? -13.433 -4.589  -4.626  1.00 0.00 ? 189 LEU A CG   2  
ATOM 5337  C CD1  . LEU A 1 137 ? -13.653 -5.575  -5.774  1.00 0.00 ? 189 LEU A CD1  2  
ATOM 5338  C CD2  . LEU A 1 137 ? -14.769 -3.969  -4.231  1.00 0.00 ? 189 LEU A CD2  2  
ATOM 5339  H H    . LEU A 1 137 ? -11.707 -6.601  -1.667  1.00 0.00 ? 189 LEU A H    2  
ATOM 5340  H HA   . LEU A 1 137 ? -14.386 -5.627  -2.097  1.00 0.00 ? 189 LEU A HA   2  
ATOM 5341  H HB2  . LEU A 1 137 ? -12.384 -4.426  -2.773  1.00 0.00 ? 189 LEU A HB2  2  
ATOM 5342  H HB3  . LEU A 1 137 ? -11.854 -5.765  -3.784  1.00 0.00 ? 189 LEU A HB3  2  
ATOM 5343  H HG   . LEU A 1 137 ? -12.782 -3.796  -4.996  1.00 0.00 ? 189 LEU A HG   2  
ATOM 5344  H HD11 . LEU A 1 137 ? -14.488 -6.240  -5.555  1.00 0.00 ? 189 LEU A HD11 2  
ATOM 5345  H HD12 . LEU A 1 137 ? -13.881 -5.019  -6.684  1.00 0.00 ? 189 LEU A HD12 2  
ATOM 5346  H HD13 . LEU A 1 137 ? -12.750 -6.163  -5.932  1.00 0.00 ? 189 LEU A HD13 2  
ATOM 5347  H HD21 . LEU A 1 137 ? -15.457 -4.743  -3.891  1.00 0.00 ? 189 LEU A HD21 2  
ATOM 5348  H HD22 . LEU A 1 137 ? -14.614 -3.242  -3.433  1.00 0.00 ? 189 LEU A HD22 2  
ATOM 5349  H HD23 . LEU A 1 137 ? -15.196 -3.468  -5.099  1.00 0.00 ? 189 LEU A HD23 2  
ATOM 5350  N N    . ALA A 1 138 ? -13.330 -8.213  -3.903  1.00 0.00 ? 190 ALA A N    2  
ATOM 5351  C CA   . ALA A 1 138 ? -13.802 -9.267  -4.781  1.00 0.00 ? 190 ALA A CA   2  
ATOM 5352  C C    . ALA A 1 138 ? -14.564 -10.329 -3.994  1.00 0.00 ? 190 ALA A C    2  
ATOM 5353  O O    . ALA A 1 138 ? -15.459 -10.967 -4.541  1.00 0.00 ? 190 ALA A O    2  
ATOM 5354  C CB   . ALA A 1 138 ? -12.597 -9.882  -5.489  1.00 0.00 ? 190 ALA A CB   2  
ATOM 5355  H H    . ALA A 1 138 ? -12.344 -8.168  -3.687  1.00 0.00 ? 190 ALA A H    2  
ATOM 5356  H HA   . ALA A 1 138 ? -14.463 -8.837  -5.533  1.00 0.00 ? 190 ALA A HA   2  
ATOM 5357  H HB1  . ALA A 1 138 ? -11.927 -10.329 -4.755  1.00 0.00 ? 190 ALA A HB1  2  
ATOM 5358  H HB2  . ALA A 1 138 ? -12.935 -10.651 -6.184  1.00 0.00 ? 190 ALA A HB2  2  
ATOM 5359  H HB3  . ALA A 1 138 ? -12.062 -9.109  -6.041  1.00 0.00 ? 190 ALA A HB3  2  
ATOM 5360  N N    . MET A 1 139 ? -14.222 -10.528 -2.717  1.00 0.00 ? 191 MET A N    2  
ATOM 5361  C CA   . MET A 1 139 ? -14.803 -11.605 -1.932  1.00 0.00 ? 191 MET A CA   2  
ATOM 5362  C C    . MET A 1 139 ? -16.186 -11.247 -1.390  1.00 0.00 ? 191 MET A C    2  
ATOM 5363  O O    . MET A 1 139 ? -16.999 -12.145 -1.176  1.00 0.00 ? 191 MET A O    2  
ATOM 5364  C CB   . MET A 1 139 ? -13.808 -12.040 -0.851  1.00 0.00 ? 191 MET A CB   2  
ATOM 5365  C CG   . MET A 1 139 ? -13.713 -11.078 0.334   1.00 0.00 ? 191 MET A CG   2  
ATOM 5366  S SD   . MET A 1 139 ? -15.029 -11.258 1.566   1.00 0.00 ? 191 MET A SD   2  
ATOM 5367  C CE   . MET A 1 139 ? -14.376 -10.166 2.854   1.00 0.00 ? 191 MET A CE   2  
ATOM 5368  H H    . MET A 1 139 ? -13.539 -9.929  -2.275  1.00 0.00 ? 191 MET A H    2  
ATOM 5369  H HA   . MET A 1 139 ? -14.933 -12.455 -2.602  1.00 0.00 ? 191 MET A HA   2  
ATOM 5370  H HB2  . MET A 1 139 ? -14.081 -13.027 -0.477  1.00 0.00 ? 191 MET A HB2  2  
ATOM 5371  H HB3  . MET A 1 139 ? -12.822 -12.123 -1.310  1.00 0.00 ? 191 MET A HB3  2  
ATOM 5372  H HG2  . MET A 1 139 ? -12.764 -11.259 0.840   1.00 0.00 ? 191 MET A HG2  2  
ATOM 5373  H HG3  . MET A 1 139 ? -13.709 -10.053 -0.038  1.00 0.00 ? 191 MET A HG3  2  
ATOM 5374  H HE1  . MET A 1 139 ? -14.255 -9.160  2.452   1.00 0.00 ? 191 MET A HE1  2  
ATOM 5375  H HE2  . MET A 1 139 ? -15.071 -10.138 3.694   1.00 0.00 ? 191 MET A HE2  2  
ATOM 5376  H HE3  . MET A 1 139 ? -13.409 -10.539 3.194   1.00 0.00 ? 191 MET A HE3  2  
ATOM 5377  N N    . ILE A 1 140 ? -16.476 -9.959  -1.161  1.00 0.00 ? 192 ILE A N    2  
ATOM 5378  C CA   . ILE A 1 140 ? -17.812 -9.583  -0.713  1.00 0.00 ? 192 ILE A CA   2  
ATOM 5379  C C    . ILE A 1 140 ? -18.784 -9.523  -1.886  1.00 0.00 ? 192 ILE A C    2  
ATOM 5380  O O    . ILE A 1 140 ? -19.892 -10.043 -1.791  1.00 0.00 ? 192 ILE A O    2  
ATOM 5381  C CB   . ILE A 1 140 ? -17.801 -8.266  0.072   1.00 0.00 ? 192 ILE A CB   2  
ATOM 5382  C CG1  . ILE A 1 140 ? -17.216 -7.110  -0.756  1.00 0.00 ? 192 ILE A CG1  2  
ATOM 5383  C CG2  . ILE A 1 140 ? -17.041 -8.476  1.383   1.00 0.00 ? 192 ILE A CG2  2  
ATOM 5384  C CD1  . ILE A 1 140 ? -16.940 -5.859  0.082   1.00 0.00 ? 192 ILE A CD1  2  
ATOM 5385  H H    . ILE A 1 140 ? -15.781 -9.239  -1.294  1.00 0.00 ? 192 ILE A H    2  
ATOM 5386  H HA   . ILE A 1 140 ? -18.170 -10.355 -0.032  1.00 0.00 ? 192 ILE A HA   2  
ATOM 5387  H HB   . ILE A 1 140 ? -18.834 -8.029  0.325   1.00 0.00 ? 192 ILE A HB   2  
ATOM 5388  H HG12 . ILE A 1 140 ? -16.291 -7.438  -1.229  1.00 0.00 ? 192 ILE A HG12 2  
ATOM 5389  H HG13 . ILE A 1 140 ? -17.904 -6.843  -1.558  1.00 0.00 ? 192 ILE A HG13 2  
ATOM 5390  H HG21 . ILE A 1 140 ? -15.986 -8.648  1.172   1.00 0.00 ? 192 ILE A HG21 2  
ATOM 5391  H HG22 . ILE A 1 140 ? -17.147 -7.598  2.020   1.00 0.00 ? 192 ILE A HG22 2  
ATOM 5392  H HG23 . ILE A 1 140 ? -17.452 -9.339  1.907   1.00 0.00 ? 192 ILE A HG23 2  
ATOM 5393  H HD11 . ILE A 1 140 ? -16.162 -6.064  0.817   1.00 0.00 ? 192 ILE A HD11 2  
ATOM 5394  H HD12 . ILE A 1 140 ? -16.605 -5.053  -0.572  1.00 0.00 ? 192 ILE A HD12 2  
ATOM 5395  H HD13 . ILE A 1 140 ? -17.847 -5.548  0.600   1.00 0.00 ? 192 ILE A HD13 2  
ATOM 5396  N N    . MET A 1 141 ? -18.394 -8.899  -3.001  1.00 0.00 ? 193 MET A N    2  
ATOM 5397  C CA   . MET A 1 141 ? -19.317 -8.767  -4.120  1.00 0.00 ? 193 MET A CA   2  
ATOM 5398  C C    . MET A 1 141 ? -19.617 -10.136 -4.711  1.00 0.00 ? 193 MET A C    2  
ATOM 5399  O O    . MET A 1 141 ? -20.668 -10.330 -5.319  1.00 0.00 ? 193 MET A O    2  
ATOM 5400  C CB   . MET A 1 141 ? -18.728 -7.853  -5.193  1.00 0.00 ? 193 MET A CB   2  
ATOM 5401  C CG   . MET A 1 141 ? -18.518 -6.444  -4.649  1.00 0.00 ? 193 MET A CG   2  
ATOM 5402  S SD   . MET A 1 141 ? -20.035 -5.607  -4.119  1.00 0.00 ? 193 MET A SD   2  
ATOM 5403  C CE   . MET A 1 141 ? -19.307 -4.068  -3.502  1.00 0.00 ? 193 MET A CE   2  
ATOM 5404  H H    . MET A 1 141 ? -17.463 -8.516  -3.078  1.00 0.00 ? 193 MET A H    2  
ATOM 5405  H HA   . MET A 1 141 ? -20.251 -8.335  -3.760  1.00 0.00 ? 193 MET A HA   2  
ATOM 5406  H HB2  . MET A 1 141 ? -17.773 -8.256  -5.528  1.00 0.00 ? 193 MET A HB2  2  
ATOM 5407  H HB3  . MET A 1 141 ? -19.415 -7.808  -6.040  1.00 0.00 ? 193 MET A HB3  2  
ATOM 5408  H HG2  . MET A 1 141 ? -17.844 -6.514  -3.795  1.00 0.00 ? 193 MET A HG2  2  
ATOM 5409  H HG3  . MET A 1 141 ? -18.038 -5.840  -5.419  1.00 0.00 ? 193 MET A HG3  2  
ATOM 5410  H HE1  . MET A 1 141 ? -18.787 -3.559  -4.313  1.00 0.00 ? 193 MET A HE1  2  
ATOM 5411  H HE2  . MET A 1 141 ? -20.096 -3.423  -3.114  1.00 0.00 ? 193 MET A HE2  2  
ATOM 5412  H HE3  . MET A 1 141 ? -18.599 -4.293  -2.704  1.00 0.00 ? 193 MET A HE3  2  
ATOM 5413  N N    . ASP A 1 142 ? -18.697 -11.088 -4.535  1.00 0.00 ? 194 ASP A N    2  
ATOM 5414  C CA   . ASP A 1 142 ? -18.870 -12.412 -5.091  1.00 0.00 ? 194 ASP A CA   2  
ATOM 5415  C C    . ASP A 1 142 ? -19.568 -13.370 -4.132  1.00 0.00 ? 194 ASP A C    2  
ATOM 5416  O O    . ASP A 1 142 ? -20.061 -14.405 -4.580  1.00 0.00 ? 194 ASP A O    2  
ATOM 5417  C CB   . ASP A 1 142 ? -17.510 -12.934 -5.545  1.00 0.00 ? 194 ASP A CB   2  
ATOM 5418  C CG   . ASP A 1 142 ? -17.605 -14.320 -6.177  1.00 0.00 ? 194 ASP A CG   2  
ATOM 5419  O OD1  . ASP A 1 142 ? -18.167 -14.407 -7.292  1.00 0.00 ? 194 ASP A OD1  2  
ATOM 5420  O OD2  . ASP A 1 142 ? -17.116 -15.281 -5.542  1.00 0.00 ? 194 ASP A OD2  2  
ATOM 5421  H H    . ASP A 1 142 ? -17.854 -10.894 -4.012  1.00 0.00 ? 194 ASP A H    2  
ATOM 5422  H HA   . ASP A 1 142 ? -19.527 -12.311 -5.954  1.00 0.00 ? 194 ASP A HA   2  
ATOM 5423  H HB2  . ASP A 1 142 ? -17.090 -12.242 -6.274  1.00 0.00 ? 194 ASP A HB2  2  
ATOM 5424  H HB3  . ASP A 1 142 ? -16.848 -12.969 -4.680  1.00 0.00 ? 194 ASP A HB3  2  
ATOM 5425  N N    . ARG A 1 143 ? -19.633 -13.070 -2.828  1.00 0.00 ? 195 ARG A N    2  
ATOM 5426  C CA   . ARG A 1 143 ? -20.425 -13.878 -1.914  1.00 0.00 ? 195 ARG A CA   2  
ATOM 5427  C C    . ARG A 1 143 ? -21.849 -13.330 -1.836  1.00 0.00 ? 195 ARG A C    2  
ATOM 5428  O O    . ARG A 1 143 ? -22.707 -13.931 -1.192  1.00 0.00 ? 195 ARG A O    2  
ATOM 5429  C CB   . ARG A 1 143 ? -19.730 -14.017 -0.557  1.00 0.00 ? 195 ARG A CB   2  
ATOM 5430  C CG   . ARG A 1 143 ? -19.884 -12.788 0.339   1.00 0.00 ? 195 ARG A CG   2  
ATOM 5431  C CD   . ARG A 1 143 ? -19.155 -13.006 1.666   1.00 0.00 ? 195 ARG A CD   2  
ATOM 5432  N NE   . ARG A 1 143 ? -17.741 -13.334 1.456   1.00 0.00 ? 195 ARG A NE   2  
ATOM 5433  C CZ   . ARG A 1 143 ? -17.027 -14.131 2.259   1.00 0.00 ? 195 ARG A CZ   2  
ATOM 5434  N NH1  . ARG A 1 143 ? -17.570 -14.662 3.353   1.00 0.00 ? 195 ARG A NH1  2  
ATOM 5435  N NH2  . ARG A 1 143 ? -15.756 -14.402 1.968   1.00 0.00 ? 195 ARG A NH2  2  
ATOM 5436  H H    . ARG A 1 143 ? -19.135 -12.274 -2.456  1.00 0.00 ? 195 ARG A H    2  
ATOM 5437  H HA   . ARG A 1 143 ? -20.494 -14.879 -2.339  1.00 0.00 ? 195 ARG A HA   2  
ATOM 5438  H HB2  . ARG A 1 143 ? -20.150 -14.877 -0.034  1.00 0.00 ? 195 ARG A HB2  2  
ATOM 5439  H HB3  . ARG A 1 143 ? -18.669 -14.195 -0.735  1.00 0.00 ? 195 ARG A HB3  2  
ATOM 5440  H HG2  . ARG A 1 143 ? -19.469 -11.917 -0.169  1.00 0.00 ? 195 ARG A HG2  2  
ATOM 5441  H HG3  . ARG A 1 143 ? -20.940 -12.623 0.546   1.00 0.00 ? 195 ARG A HG3  2  
ATOM 5442  H HD2  . ARG A 1 143 ? -19.229 -12.100 2.267   1.00 0.00 ? 195 ARG A HD2  2  
ATOM 5443  H HD3  . ARG A 1 143 ? -19.644 -13.823 2.198   1.00 0.00 ? 195 ARG A HD3  2  
ATOM 5444  H HE   . ARG A 1 143 ? -17.288 -12.929 0.651   1.00 0.00 ? 195 ARG A HE   2  
ATOM 5445  H HH11 . ARG A 1 143 ? -18.531 -14.462 3.587   1.00 0.00 ? 195 ARG A HH11 2  
ATOM 5446  H HH12 . ARG A 1 143 ? -17.022 -15.266 3.948   1.00 0.00 ? 195 ARG A HH12 2  
ATOM 5447  H HH21 . ARG A 1 143 ? -15.331 -14.001 1.145   1.00 0.00 ? 195 ARG A HH21 2  
ATOM 5448  H HH22 . ARG A 1 143 ? -15.217 -15.008 2.570   1.00 0.00 ? 195 ARG A HH22 2  
ATOM 5449  N N    . LEU A 1 144 ? -22.088 -12.188 -2.493  1.00 0.00 ? 196 LEU A N    2  
ATOM 5450  C CA   . LEU A 1 144 ? -23.418 -11.613 -2.603  1.00 0.00 ? 196 LEU A CA   2  
ATOM 5451  C C    . LEU A 1 144 ? -24.041 -11.832 -3.976  1.00 0.00 ? 196 LEU A C    2  
ATOM 5452  O O    . LEU A 1 144 ? -24.958 -12.641 -4.121  1.00 0.00 ? 196 LEU A O    2  
ATOM 5453  C CB   . LEU A 1 144 ? -23.368 -10.111 -2.320  1.00 0.00 ? 196 LEU A CB   2  
ATOM 5454  C CG   . LEU A 1 144 ? -23.528 -9.839  -0.832  1.00 0.00 ? 196 LEU A CG   2  
ATOM 5455  C CD1  . LEU A 1 144 ? -22.230 -9.962  -0.043  1.00 0.00 ? 196 LEU A CD1  2  
ATOM 5456  C CD2  . LEU A 1 144 ? -24.065 -8.423  -0.666  1.00 0.00 ? 196 LEU A CD2  2  
ATOM 5457  H H    . LEU A 1 144 ? -21.325 -11.695 -2.935  1.00 0.00 ? 196 LEU A H    2  
ATOM 5458  H HA   . LEU A 1 144 ? -24.074 -12.082 -1.871  1.00 0.00 ? 196 LEU A HA   2  
ATOM 5459  H HB2  . LEU A 1 144 ? -22.443 -9.672  -2.695  1.00 0.00 ? 196 LEU A HB2  2  
ATOM 5460  H HB3  . LEU A 1 144 ? -24.211 -9.648  -2.831  1.00 0.00 ? 196 LEU A HB3  2  
ATOM 5461  H HG   . LEU A 1 144 ? -24.246 -10.567 -0.452  1.00 0.00 ? 196 LEU A HG   2  
ATOM 5462  H HD11 . LEU A 1 144 ? -21.551 -9.159  -0.330  1.00 0.00 ? 196 LEU A HD11 2  
ATOM 5463  H HD12 . LEU A 1 144 ? -22.444 -9.890  1.023   1.00 0.00 ? 196 LEU A HD12 2  
ATOM 5464  H HD13 . LEU A 1 144 ? -21.766 -10.926 -0.253  1.00 0.00 ? 196 LEU A HD13 2  
ATOM 5465  H HD21 . LEU A 1 144 ? -25.009 -8.328  -1.202  1.00 0.00 ? 196 LEU A HD21 2  
ATOM 5466  H HD22 . LEU A 1 144 ? -24.222 -8.211  0.391   1.00 0.00 ? 196 LEU A HD22 2  
ATOM 5467  H HD23 . LEU A 1 144 ? -23.343 -7.719  -1.083  1.00 0.00 ? 196 LEU A HD23 2  
ATOM 5468  N N    . TYR A 1 145 ? -23.541 -11.107 -4.980  1.00 0.00 ? 197 TYR A N    2  
ATOM 5469  C CA   . TYR A 1 145 ? -24.175 -11.040 -6.288  1.00 0.00 ? 197 TYR A CA   2  
ATOM 5470  C C    . TYR A 1 145 ? -23.378 -11.751 -7.381  1.00 0.00 ? 197 TYR A C    2  
ATOM 5471  O O    . TYR A 1 145 ? -23.923 -12.036 -8.446  1.00 0.00 ? 197 TYR A O    2  
ATOM 5472  C CB   . TYR A 1 145 ? -24.390 -9.563  -6.625  1.00 0.00 ? 197 TYR A CB   2  
ATOM 5473  C CG   . TYR A 1 145 ? -25.185 -8.812  -5.576  1.00 0.00 ? 197 TYR A CG   2  
ATOM 5474  C CD1  . TYR A 1 145 ? -26.542 -9.117  -5.382  1.00 0.00 ? 197 TYR A CD1  2  
ATOM 5475  C CD2  . TYR A 1 145 ? -24.572 -7.818  -4.798  1.00 0.00 ? 197 TYR A CD2  2  
ATOM 5476  C CE1  . TYR A 1 145 ? -27.289 -8.426  -4.418  1.00 0.00 ? 197 TYR A CE1  2  
ATOM 5477  C CE2  . TYR A 1 145 ? -25.313 -7.120  -3.834  1.00 0.00 ? 197 TYR A CE2  2  
ATOM 5478  C CZ   . TYR A 1 145 ? -26.676 -7.423  -3.640  1.00 0.00 ? 197 TYR A CZ   2  
ATOM 5479  O OH   . TYR A 1 145 ? -27.401 -6.751  -2.702  1.00 0.00 ? 197 TYR A OH   2  
ATOM 5480  H H    . TYR A 1 145 ? -22.698 -10.572 -4.828  1.00 0.00 ? 197 TYR A H    2  
ATOM 5481  H HA   . TYR A 1 145 ? -25.152 -11.520 -6.226  1.00 0.00 ? 197 TYR A HA   2  
ATOM 5482  H HB2  . TYR A 1 145 ? -23.418 -9.084  -6.739  1.00 0.00 ? 197 TYR A HB2  2  
ATOM 5483  H HB3  . TYR A 1 145 ? -24.918 -9.494  -7.576  1.00 0.00 ? 197 TYR A HB3  2  
ATOM 5484  H HD1  . TYR A 1 145 ? -27.012 -9.887  -5.976  1.00 0.00 ? 197 TYR A HD1  2  
ATOM 5485  H HD2  . TYR A 1 145 ? -23.527 -7.583  -4.935  1.00 0.00 ? 197 TYR A HD2  2  
ATOM 5486  H HE1  . TYR A 1 145 ? -28.333 -8.659  -4.272  1.00 0.00 ? 197 TYR A HE1  2  
ATOM 5487  H HE2  . TYR A 1 145 ? -24.842 -6.350  -3.240  1.00 0.00 ? 197 TYR A HE2  2  
ATOM 5488  H HH   . TYR A 1 145 ? -26.885 -6.089  -2.237  1.00 0.00 ? 197 TYR A HH   2  
ATOM 5489  N N    . GLY A 1 146 ? -22.099 -12.040 -7.132  1.00 0.00 ? 198 GLY A N    2  
ATOM 5490  C CA   . GLY A 1 146 ? -21.259 -12.761 -8.077  1.00 0.00 ? 198 GLY A CA   2  
ATOM 5491  C C    . GLY A 1 146 ? -20.896 -11.927 -9.294  1.00 0.00 ? 198 GLY A C    2  
ATOM 5492  O O    . GLY A 1 146 ? -21.124 -10.719 -9.325  1.00 0.00 ? 198 GLY A O    2  
ATOM 5493  H H    . GLY A 1 146 ? -21.686 -11.752 -6.256  1.00 0.00 ? 198 GLY A H    2  
ATOM 5494  H HA2  . GLY A 1 146 ? -20.320 -13.047 -7.603  1.00 0.00 ? 198 GLY A HA2  2  
ATOM 5495  H HA3  . GLY A 1 146 ? -21.775 -13.663 -8.404  1.00 0.00 ? 198 GLY A HA3  2  
ATOM 5496  N N    . GLY A 1 147 ? -20.321 -12.598 -10.296 1.00 0.00 ? 199 GLY A N    2  
ATOM 5497  C CA   . GLY A 1 147 ? -19.889 -11.981 -11.536 1.00 0.00 ? 199 GLY A CA   2  
ATOM 5498  C C    . GLY A 1 147 ? -18.581 -11.213 -11.357 1.00 0.00 ? 199 GLY A C    2  
ATOM 5499  O O    . GLY A 1 147 ? -18.384 -10.508 -10.369 1.00 0.00 ? 199 GLY A O    2  
ATOM 5500  H H    . GLY A 1 147 ? -20.176 -13.592 -10.194 1.00 0.00 ? 199 GLY A H    2  
ATOM 5501  H HA2  . GLY A 1 147 ? -19.742 -12.760 -12.283 1.00 0.00 ? 199 GLY A HA2  2  
ATOM 5502  H HA3  . GLY A 1 147 ? -20.663 -11.303 -11.895 1.00 0.00 ? 199 GLY A HA3  2  
ATOM 5503  N N    . VAL A 1 148 ? -17.686 -11.364 -12.337 1.00 0.00 ? 200 VAL A N    2  
ATOM 5504  C CA   . VAL A 1 148 ? -16.390 -10.697 -12.385 1.00 0.00 ? 200 VAL A CA   2  
ATOM 5505  C C    . VAL A 1 148 ? -15.765 -10.947 -13.761 1.00 0.00 ? 200 VAL A C    2  
ATOM 5506  O O    . VAL A 1 148 ? -16.111 -11.926 -14.421 1.00 0.00 ? 200 VAL A O    2  
ATOM 5507  C CB   . VAL A 1 148 ? -15.484 -11.231 -11.262 1.00 0.00 ? 200 VAL A CB   2  
ATOM 5508  C CG1  . VAL A 1 148 ? -15.065 -12.680 -11.505 1.00 0.00 ? 200 VAL A CG1  2  
ATOM 5509  C CG2  . VAL A 1 148 ? -14.242 -10.354 -11.097 1.00 0.00 ? 200 VAL A CG2  2  
ATOM 5510  H H    . VAL A 1 148 ? -17.919 -11.977 -13.105 1.00 0.00 ? 200 VAL A H    2  
ATOM 5511  H HA   . VAL A 1 148 ? -16.535 -9.627  -12.238 1.00 0.00 ? 200 VAL A HA   2  
ATOM 5512  H HB   . VAL A 1 148 ? -16.036 -11.191 -10.322 1.00 0.00 ? 200 VAL A HB   2  
ATOM 5513  H HG11 . VAL A 1 148 ? -14.464 -12.750 -12.411 1.00 0.00 ? 200 VAL A HG11 2  
ATOM 5514  H HG12 . VAL A 1 148 ? -14.478 -13.032 -10.657 1.00 0.00 ? 200 VAL A HG12 2  
ATOM 5515  H HG13 . VAL A 1 148 ? -15.953 -13.305 -11.608 1.00 0.00 ? 200 VAL A HG13 2  
ATOM 5516  H HG21 . VAL A 1 148 ? -14.549 -9.319  -10.943 1.00 0.00 ? 200 VAL A HG21 2  
ATOM 5517  H HG22 . VAL A 1 148 ? -13.681 -10.688 -10.225 1.00 0.00 ? 200 VAL A HG22 2  
ATOM 5518  H HG23 . VAL A 1 148 ? -13.610 -10.424 -11.981 1.00 0.00 ? 200 VAL A HG23 2  
ATOM 5519  N N    . CYS A 1 149 ? -14.853 -10.078 -14.206 1.00 0.00 ? 201 CYS A N    2  
ATOM 5520  C CA   . CYS A 1 149 ? -14.128 -10.293 -15.453 1.00 0.00 ? 201 CYS A CA   2  
ATOM 5521  C C    . CYS A 1 149 ? -12.770 -9.594  -15.421 1.00 0.00 ? 201 CYS A C    2  
ATOM 5522  O O    . CYS A 1 149 ? -11.750 -10.218 -15.711 1.00 0.00 ? 201 CYS A O    2  
ATOM 5523  C CB   . CYS A 1 149 ? -14.977 -9.802  -16.629 1.00 0.00 ? 201 CYS A CB   2  
ATOM 5524  S SG   . CYS A 1 149 ? -14.049 -10.029 -18.168 1.00 0.00 ? 201 CYS A SG   2  
ATOM 5525  H H    . CYS A 1 149 ? -14.644 -9.247  -13.670 1.00 0.00 ? 201 CYS A H    2  
ATOM 5526  H HA   . CYS A 1 149 ? -13.950 -11.362 -15.575 1.00 0.00 ? 201 CYS A HA   2  
ATOM 5527  H HB2  . CYS A 1 149 ? -15.899 -10.383 -16.672 1.00 0.00 ? 201 CYS A HB2  2  
ATOM 5528  H HB3  . CYS A 1 149 ? -15.226 -8.748  -16.509 1.00 0.00 ? 201 CYS A HB3  2  
ATOM 5529  H HG   . CYS A 1 149 ? -14.991 -9.542  -18.982 1.00 0.00 ? 201 CYS A HG   2  
ATOM 5530  N N    . TYR A 1 150 ? -12.747 -8.306  -15.072 1.00 0.00 ? 202 TYR A N    2  
ATOM 5531  C CA   . TYR A 1 150 ? -11.508 -7.549  -14.971 1.00 0.00 ? 202 TYR A CA   2  
ATOM 5532  C C    . TYR A 1 150 ? -11.669 -6.482  -13.897 1.00 0.00 ? 202 TYR A C    2  
ATOM 5533  O O    . TYR A 1 150 ? -12.730 -5.874  -13.795 1.00 0.00 ? 202 TYR A O    2  
ATOM 5534  C CB   . TYR A 1 150 ? -11.207 -6.897  -16.322 1.00 0.00 ? 202 TYR A CB   2  
ATOM 5535  C CG   . TYR A 1 150 ? -9.991  -5.996  -16.320 1.00 0.00 ? 202 TYR A CG   2  
ATOM 5536  C CD1  . TYR A 1 150 ? -10.112 -4.656  -15.925 1.00 0.00 ? 202 TYR A CD1  2  
ATOM 5537  C CD2  . TYR A 1 150 ? -8.743  -6.501  -16.715 1.00 0.00 ? 202 TYR A CD2  2  
ATOM 5538  C CE1  . TYR A 1 150 ? -8.987  -3.819  -15.916 1.00 0.00 ? 202 TYR A CE1  2  
ATOM 5539  C CE2  . TYR A 1 150 ? -7.613  -5.671  -16.709 1.00 0.00 ? 202 TYR A CE2  2  
ATOM 5540  C CZ   . TYR A 1 150 ? -7.731  -4.325  -16.309 1.00 0.00 ? 202 TYR A CZ   2  
ATOM 5541  O OH   . TYR A 1 150 ? -6.635  -3.516  -16.304 1.00 0.00 ? 202 TYR A OH   2  
ATOM 5542  H H    . TYR A 1 150 ? -13.612 -7.825  -14.869 1.00 0.00 ? 202 TYR A H    2  
ATOM 5543  H HA   . TYR A 1 150 ? -10.688 -8.211  -14.698 1.00 0.00 ? 202 TYR A HA   2  
ATOM 5544  H HB2  . TYR A 1 150 ? -11.062 -7.682  -17.064 1.00 0.00 ? 202 TYR A HB2  2  
ATOM 5545  H HB3  . TYR A 1 150 ? -12.072 -6.303  -16.614 1.00 0.00 ? 202 TYR A HB3  2  
ATOM 5546  H HD1  . TYR A 1 150 ? -11.074 -4.266  -15.627 1.00 0.00 ? 202 TYR A HD1  2  
ATOM 5547  H HD2  . TYR A 1 150 ? -8.650  -7.531  -17.025 1.00 0.00 ? 202 TYR A HD2  2  
ATOM 5548  H HE1  . TYR A 1 150 ? -9.081  -2.788  -15.608 1.00 0.00 ? 202 TYR A HE1  2  
ATOM 5549  H HE2  . TYR A 1 150 ? -6.653  -6.060  -17.010 1.00 0.00 ? 202 TYR A HE2  2  
ATOM 5550  H HH   . TYR A 1 150 ? -6.832  -2.623  -16.014 1.00 0.00 ? 202 TYR A HH   2  
ATOM 5551  N N    . ALA A 1 151 ? -10.632 -6.244  -13.091 1.00 0.00 ? 203 ALA A N    2  
ATOM 5552  C CA   . ALA A 1 151 ? -10.720 -5.232  -12.055 1.00 0.00 ? 203 ALA A CA   2  
ATOM 5553  C C    . ALA A 1 151 ? -9.344  -4.813  -11.544 1.00 0.00 ? 203 ALA A C    2  
ATOM 5554  O O    . ALA A 1 151 ? -8.330  -5.427  -11.875 1.00 0.00 ? 203 ALA A O    2  
ATOM 5555  C CB   . ALA A 1 151 ? -11.534 -5.815  -10.907 1.00 0.00 ? 203 ALA A CB   2  
ATOM 5556  H H    . ALA A 1 151 ? -9.772  -6.766  -13.184 1.00 0.00 ? 203 ALA A H    2  
ATOM 5557  H HA   . ALA A 1 151 ? -11.232 -4.354  -12.448 1.00 0.00 ? 203 ALA A HA   2  
ATOM 5558  H HB1  . ALA A 1 151 ? -12.508 -6.130  -11.280 1.00 0.00 ? 203 ALA A HB1  2  
ATOM 5559  H HB2  . ALA A 1 151 ? -11.010 -6.683  -10.507 1.00 0.00 ? 203 ALA A HB2  2  
ATOM 5560  H HB3  . ALA A 1 151 ? -11.666 -5.065  -10.127 1.00 0.00 ? 203 ALA A HB3  2  
ATOM 5561  N N    . GLY A 1 152 ? -9.322  -3.759  -10.726 1.00 0.00 ? 204 GLY A N    2  
ATOM 5562  C CA   . GLY A 1 152 ? -8.103  -3.298  -10.082 1.00 0.00 ? 204 GLY A CA   2  
ATOM 5563  C C    . GLY A 1 152 ? -8.425  -2.203  -9.069  1.00 0.00 ? 204 GLY A C    2  
ATOM 5564  O O    . GLY A 1 152 ? -9.509  -1.625  -9.112  1.00 0.00 ? 204 GLY A O    2  
ATOM 5565  H H    . GLY A 1 152 ? -10.175 -3.252  -10.538 1.00 0.00 ? 204 GLY A H    2  
ATOM 5566  H HA2  . GLY A 1 152 ? -7.636  -4.136  -9.564  1.00 0.00 ? 204 GLY A HA2  2  
ATOM 5567  H HA3  . GLY A 1 152 ? -7.410  -2.909  -10.828 1.00 0.00 ? 204 GLY A HA3  2  
ATOM 5568  N N    . ILE A 1 153 ? -7.498  -1.910  -8.154  1.00 0.00 ? 205 ILE A N    2  
ATOM 5569  C CA   . ILE A 1 153 ? -7.715  -0.835  -7.197  1.00 0.00 ? 205 ILE A CA   2  
ATOM 5570  C C    . ILE A 1 153 ? -7.213  0.488   -7.771  1.00 0.00 ? 205 ILE A C    2  
ATOM 5571  O O    . ILE A 1 153 ? -6.341  0.508   -8.638  1.00 0.00 ? 205 ILE A O    2  
ATOM 5572  C CB   . ILE A 1 153 ? -7.148  -1.192  -5.815  1.00 0.00 ? 205 ILE A CB   2  
ATOM 5573  C CG1  . ILE A 1 153 ? -5.696  -1.689  -5.802  1.00 0.00 ? 205 ILE A CG1  2  
ATOM 5574  C CG2  . ILE A 1 153 ? -8.018  -2.308  -5.232  1.00 0.00 ? 205 ILE A CG2  2  
ATOM 5575  C CD1  . ILE A 1 153 ? -4.687  -0.591  -6.130  1.00 0.00 ? 205 ILE A CD1  2  
ATOM 5576  H H    . ILE A 1 153 ? -6.629  -2.424  -8.114  1.00 0.00 ? 205 ILE A H    2  
ATOM 5577  H HA   . ILE A 1 153 ? -8.792  -0.719  -7.066  1.00 0.00 ? 205 ILE A HA   2  
ATOM 5578  H HB   . ILE A 1 153 ? -7.230  -0.321  -5.164  1.00 0.00 ? 205 ILE A HB   2  
ATOM 5579  H HG12 . ILE A 1 153 ? -5.470  -2.057  -4.801  1.00 0.00 ? 205 ILE A HG12 2  
ATOM 5580  H HG13 . ILE A 1 153 ? -5.579  -2.513  -6.506  1.00 0.00 ? 205 ILE A HG13 2  
ATOM 5581  H HG21 . ILE A 1 153 ? -7.952  -3.195  -5.862  1.00 0.00 ? 205 ILE A HG21 2  
ATOM 5582  H HG22 . ILE A 1 153 ? -7.668  -2.551  -4.229  1.00 0.00 ? 205 ILE A HG22 2  
ATOM 5583  H HG23 . ILE A 1 153 ? -9.055  -1.976  -5.181  1.00 0.00 ? 205 ILE A HG23 2  
ATOM 5584  H HD11 . ILE A 1 153 ? -4.751  -0.327  -7.186  1.00 0.00 ? 205 ILE A HD11 2  
ATOM 5585  H HD12 . ILE A 1 153 ? -4.887  0.287   -5.516  1.00 0.00 ? 205 ILE A HD12 2  
ATOM 5586  H HD13 . ILE A 1 153 ? -3.681  -0.955  -5.921  1.00 0.00 ? 205 ILE A HD13 2  
ATOM 5587  N N    . ASP A 1 154 ? -7.765  1.604   -7.290  1.00 0.00 ? 206 ASP A N    2  
ATOM 5588  C CA   . ASP A 1 154 ? -7.362  2.915   -7.766  1.00 0.00 ? 206 ASP A CA   2  
ATOM 5589  C C    . ASP A 1 154 ? -6.037  3.330   -7.135  1.00 0.00 ? 206 ASP A C    2  
ATOM 5590  O O    . ASP A 1 154 ? -5.773  3.058   -5.963  1.00 0.00 ? 206 ASP A O    2  
ATOM 5591  C CB   . ASP A 1 154 ? -8.465  3.945   -7.519  1.00 0.00 ? 206 ASP A CB   2  
ATOM 5592  C CG   . ASP A 1 154 ? -9.724  3.670   -8.342  1.00 0.00 ? 206 ASP A CG   2  
ATOM 5593  O OD1  . ASP A 1 154 ? -9.662  2.807   -9.246  1.00 0.00 ? 206 ASP A OD1  2  
ATOM 5594  O OD2  . ASP A 1 154 ? -10.745 4.332   -8.055  1.00 0.00 ? 206 ASP A OD2  2  
ATOM 5595  H H    . ASP A 1 154 ? -8.483  1.550   -6.583  1.00 0.00 ? 206 ASP A H    2  
ATOM 5596  H HA   . ASP A 1 154 ? -7.203  2.855   -8.843  1.00 0.00 ? 206 ASP A HA   2  
ATOM 5597  H HB2  . ASP A 1 154 ? -8.721  3.942   -6.460  1.00 0.00 ? 206 ASP A HB2  2  
ATOM 5598  H HB3  . ASP A 1 154 ? -8.087  4.934   -7.780  1.00 0.00 ? 206 ASP A HB3  2  
ATOM 5599  N N    . THR A 1 155 ? -5.199  3.997   -7.932  1.00 0.00 ? 207 THR A N    2  
ATOM 5600  C CA   . THR A 1 155 ? -3.854  4.382   -7.535  1.00 0.00 ? 207 THR A CA   2  
ATOM 5601  C C    . THR A 1 155 ? -3.482  5.773   -8.020  1.00 0.00 ? 207 THR A C    2  
ATOM 5602  O O    . THR A 1 155 ? -4.112  6.344   -8.909  1.00 0.00 ? 207 THR A O    2  
ATOM 5603  C CB   . THR A 1 155 ? -2.821  3.393   -8.085  1.00 0.00 ? 207 THR A CB   2  
ATOM 5604  O OG1  . THR A 1 155 ? -3.178  2.969   -9.384  1.00 0.00 ? 207 THR A OG1  2  
ATOM 5605  C CG2  . THR A 1 155 ? -2.702  2.187   -7.164  1.00 0.00 ? 207 THR A CG2  2  
ATOM 5606  H H    . THR A 1 155 ? -5.505  4.246   -8.862  1.00 0.00 ? 207 THR A H    2  
ATOM 5607  H HA   . THR A 1 155 ? -3.786  4.382   -6.447  1.00 0.00 ? 207 THR A HA   2  
ATOM 5608  H HB   . THR A 1 155 ? -1.847  3.880   -8.126  1.00 0.00 ? 207 THR A HB   2  
ATOM 5609  H HG1  . THR A 1 155 ? -2.483  2.398   -9.718  1.00 0.00 ? 207 THR A HG1  2  
ATOM 5610  H HG21 . THR A 1 155 ? -1.987  1.477   -7.580  1.00 0.00 ? 207 THR A HG21 2  
ATOM 5611  H HG22 . THR A 1 155 ? -2.347  2.525   -6.190  1.00 0.00 ? 207 THR A HG22 2  
ATOM 5612  H HG23 . THR A 1 155 ? -3.676  1.713   -7.051  1.00 0.00 ? 207 THR A HG23 2  
ATOM 5613  N N    . ASP A 1 156 ? -2.428  6.300   -7.401  1.00 0.00 ? 208 ASP A N    2  
ATOM 5614  C CA   . ASP A 1 156 ? -1.806  7.555   -7.757  1.00 0.00 ? 208 ASP A CA   2  
ATOM 5615  C C    . ASP A 1 156 ? -0.750  7.271   -8.816  1.00 0.00 ? 208 ASP A C    2  
ATOM 5616  O O    . ASP A 1 156 ? 0.134   6.456   -8.559  1.00 0.00 ? 208 ASP A O    2  
ATOM 5617  C CB   . ASP A 1 156 ? -1.129  8.108   -6.504  1.00 0.00 ? 208 ASP A CB   2  
ATOM 5618  C CG   . ASP A 1 156 ? -0.854  9.605   -6.619  1.00 0.00 ? 208 ASP A CG   2  
ATOM 5619  O OD1  . ASP A 1 156 ? -0.454  10.029  -7.725  1.00 0.00 ? 208 ASP A OD1  2  
ATOM 5620  O OD2  . ASP A 1 156 ? -1.047  10.307  -5.602  1.00 0.00 ? 208 ASP A OD2  2  
ATOM 5621  H H    . ASP A 1 156 ? -2.018  5.794   -6.629  1.00 0.00 ? 208 ASP A H    2  
ATOM 5622  H HA   . ASP A 1 156 ? -2.560  8.254   -8.117  1.00 0.00 ? 208 ASP A HA   2  
ATOM 5623  H HB2  . ASP A 1 156 ? -1.772  7.916   -5.646  1.00 0.00 ? 208 ASP A HB2  2  
ATOM 5624  H HB3  . ASP A 1 156 ? -0.196  7.570   -6.335  1.00 0.00 ? 208 ASP A HB3  2  
ATOM 5625  N N    . PRO A 1 157 ? -0.814  7.913   -9.989  1.00 0.00 ? 209 PRO A N    2  
ATOM 5626  C CA   . PRO A 1 157 ? 0.162   7.720   -11.047 1.00 0.00 ? 209 PRO A CA   2  
ATOM 5627  C C    . PRO A 1 157 ? 1.501   8.366   -10.688 1.00 0.00 ? 209 PRO A C    2  
ATOM 5628  O O    . PRO A 1 157 ? 2.486   8.173   -11.399 1.00 0.00 ? 209 PRO A O    2  
ATOM 5629  C CB   . PRO A 1 157 ? -0.462  8.381   -12.276 1.00 0.00 ? 209 PRO A CB   2  
ATOM 5630  C CG   . PRO A 1 157 ? -1.309  9.502   -11.672 1.00 0.00 ? 209 PRO A CG   2  
ATOM 5631  C CD   . PRO A 1 157 ? -1.834  8.867   -10.386 1.00 0.00 ? 209 PRO A CD   2  
ATOM 5632  H HA   . PRO A 1 157 ? 0.313   6.657   -11.234 1.00 0.00 ? 209 PRO A HA   2  
ATOM 5633  H HB2  . PRO A 1 157 ? 0.293   8.768   -12.960 1.00 0.00 ? 209 PRO A HB2  2  
ATOM 5634  H HB3  . PRO A 1 157 ? -1.114  7.668   -12.781 1.00 0.00 ? 209 PRO A HB3  2  
ATOM 5635  H HG2  . PRO A 1 157 ? -0.668  10.349  -11.427 1.00 0.00 ? 209 PRO A HG2  2  
ATOM 5636  H HG3  . PRO A 1 157 ? -2.120  9.800   -12.337 1.00 0.00 ? 209 PRO A HG3  2  
ATOM 5637  H HD2  . PRO A 1 157 ? -1.986  9.629   -9.623  1.00 0.00 ? 209 PRO A HD2  2  
ATOM 5638  H HD3  . PRO A 1 157 ? -2.764  8.338   -10.590 1.00 0.00 ? 209 PRO A HD3  2  
ATOM 5639  N N    . GLU A 1 158 ? 1.547   9.130   -9.593  1.00 0.00 ? 210 GLU A N    2  
ATOM 5640  C CA   . GLU A 1 158 ? 2.751   9.825   -9.163  1.00 0.00 ? 210 GLU A CA   2  
ATOM 5641  C C    . GLU A 1 158 ? 3.590   8.958   -8.230  1.00 0.00 ? 210 GLU A C    2  
ATOM 5642  O O    . GLU A 1 158 ? 4.810   8.888   -8.383  1.00 0.00 ? 210 GLU A O    2  
ATOM 5643  C CB   . GLU A 1 158 ? 2.322   11.108  -8.457  1.00 0.00 ? 210 GLU A CB   2  
ATOM 5644  C CG   . GLU A 1 158 ? 3.500   12.054  -8.217  1.00 0.00 ? 210 GLU A CG   2  
ATOM 5645  C CD   . GLU A 1 158 ? 4.096   12.549  -9.534  1.00 0.00 ? 210 GLU A CD   2  
ATOM 5646  O OE1  . GLU A 1 158 ? 3.444   13.398  -10.182 1.00 0.00 ? 210 GLU A OE1  2  
ATOM 5647  O OE2  . GLU A 1 158 ? 5.201   12.076  -9.885  1.00 0.00 ? 210 GLU A OE2  2  
ATOM 5648  H H    . GLU A 1 158 ? 0.717   9.243   -9.030  1.00 0.00 ? 210 GLU A H    2  
ATOM 5649  H HA   . GLU A 1 158 ? 3.346   10.080  -10.040 1.00 0.00 ? 210 GLU A HA   2  
ATOM 5650  H HB2  . GLU A 1 158 ? 1.574   11.600  -9.079  1.00 0.00 ? 210 GLU A HB2  2  
ATOM 5651  H HB3  . GLU A 1 158 ? 1.863   10.854  -7.502  1.00 0.00 ? 210 GLU A HB3  2  
ATOM 5652  H HG2  . GLU A 1 158 ? 3.152   12.911  -7.642  1.00 0.00 ? 210 GLU A HG2  2  
ATOM 5653  H HG3  . GLU A 1 158 ? 4.265   11.540  -7.637  1.00 0.00 ? 210 GLU A HG3  2  
ATOM 5654  N N    . LEU A 1 159 ? 2.944   8.294   -7.265  1.00 0.00 ? 211 LEU A N    2  
ATOM 5655  C CA   . LEU A 1 159 ? 3.636   7.383   -6.367  1.00 0.00 ? 211 LEU A CA   2  
ATOM 5656  C C    . LEU A 1 159 ? 3.467   5.947   -6.841  1.00 0.00 ? 211 LEU A C    2  
ATOM 5657  O O    . LEU A 1 159 ? 4.105   5.044   -6.304  1.00 0.00 ? 211 LEU A O    2  
ATOM 5658  C CB   . LEU A 1 159 ? 3.075   7.503   -4.944  1.00 0.00 ? 211 LEU A CB   2  
ATOM 5659  C CG   . LEU A 1 159 ? 3.454   8.773   -4.179  1.00 0.00 ? 211 LEU A CG   2  
ATOM 5660  C CD1  . LEU A 1 159 ? 4.948   9.040   -4.318  1.00 0.00 ? 211 LEU A CD1  2  
ATOM 5661  C CD2  . LEU A 1 159 ? 2.649   9.982   -4.647  1.00 0.00 ? 211 LEU A CD2  2  
ATOM 5662  H H    . LEU A 1 159 ? 1.949   8.419   -7.147  1.00 0.00 ? 211 LEU A H    2  
ATOM 5663  H HA   . LEU A 1 159 ? 4.702   7.607   -6.361  1.00 0.00 ? 211 LEU A HA   2  
ATOM 5664  H HB2  . LEU A 1 159 ? 1.989   7.419   -4.977  1.00 0.00 ? 211 LEU A HB2  2  
ATOM 5665  H HB3  . LEU A 1 159 ? 3.462   6.660   -4.371  1.00 0.00 ? 211 LEU A HB3  2  
ATOM 5666  H HG   . LEU A 1 159 ? 3.228   8.605   -3.125  1.00 0.00 ? 211 LEU A HG   2  
ATOM 5667  H HD11 . LEU A 1 159 ? 5.176   9.328   -5.345  1.00 0.00 ? 211 LEU A HD11 2  
ATOM 5668  H HD12 . LEU A 1 159 ? 5.241   9.846   -3.645  1.00 0.00 ? 211 LEU A HD12 2  
ATOM 5669  H HD13 . LEU A 1 159 ? 5.501   8.134   -4.070  1.00 0.00 ? 211 LEU A HD13 2  
ATOM 5670  H HD21 . LEU A 1 159 ? 2.916   10.233  -5.674  1.00 0.00 ? 211 LEU A HD21 2  
ATOM 5671  H HD22 . LEU A 1 159 ? 1.585   9.756   -4.587  1.00 0.00 ? 211 LEU A HD22 2  
ATOM 5672  H HD23 . LEU A 1 159 ? 2.870   10.834  -4.004  1.00 0.00 ? 211 LEU A HD23 2  
ATOM 5673  N N    . LYS A 1 160 ? 2.609   5.735   -7.844  1.00 0.00 ? 212 LYS A N    2  
ATOM 5674  C CA   . LYS A 1 160 ? 2.186   4.395   -8.237  1.00 0.00 ? 212 LYS A CA   2  
ATOM 5675  C C    . LYS A 1 160 ? 1.677   3.656   -6.999  1.00 0.00 ? 212 LYS A C    2  
ATOM 5676  O O    . LYS A 1 160 ? 1.817   2.442   -6.878  1.00 0.00 ? 212 LYS A O    2  
ATOM 5677  C CB   . LYS A 1 160 ? 3.294   3.655   -8.990  1.00 0.00 ? 212 LYS A CB   2  
ATOM 5678  C CG   . LYS A 1 160 ? 3.718   4.445   -10.229 1.00 0.00 ? 212 LYS A CG   2  
ATOM 5679  C CD   . LYS A 1 160 ? 4.783   3.667   -11.004 1.00 0.00 ? 212 LYS A CD   2  
ATOM 5680  C CE   . LYS A 1 160 ? 5.278   4.473   -12.205 1.00 0.00 ? 212 LYS A CE   2  
ATOM 5681  N NZ   . LYS A 1 160 ? 4.199   4.721   -13.182 1.00 0.00 ? 212 LYS A NZ   2  
ATOM 5682  H H    . LYS A 1 160 ? 2.227   6.528   -8.340  1.00 0.00 ? 212 LYS A H    2  
ATOM 5683  H HA   . LYS A 1 160 ? 1.333   4.507   -8.908  1.00 0.00 ? 212 LYS A HA   2  
ATOM 5684  H HB2  . LYS A 1 160 ? 4.155   3.520   -8.335  1.00 0.00 ? 212 LYS A HB2  2  
ATOM 5685  H HB3  . LYS A 1 160 ? 2.925   2.678   -9.300  1.00 0.00 ? 212 LYS A HB3  2  
ATOM 5686  H HG2  . LYS A 1 160 ? 2.851   4.611   -10.868 1.00 0.00 ? 212 LYS A HG2  2  
ATOM 5687  H HG3  . LYS A 1 160 ? 4.131   5.407   -9.924  1.00 0.00 ? 212 LYS A HG3  2  
ATOM 5688  H HD2  . LYS A 1 160 ? 5.627   3.464   -10.345 1.00 0.00 ? 212 LYS A HD2  2  
ATOM 5689  H HD3  . LYS A 1 160 ? 4.364   2.720   -11.345 1.00 0.00 ? 212 LYS A HD3  2  
ATOM 5690  H HE2  . LYS A 1 160 ? 5.675   5.425   -11.855 1.00 0.00 ? 212 LYS A HE2  2  
ATOM 5691  H HE3  . LYS A 1 160 ? 6.080   3.920   -12.696 1.00 0.00 ? 212 LYS A HE3  2  
ATOM 5692  H HZ1  . LYS A 1 160 ? 4.559   5.249   -13.963 1.00 0.00 ? 212 LYS A HZ1  2  
ATOM 5693  H HZ2  . LYS A 1 160 ? 3.832   3.844   -13.521 1.00 0.00 ? 212 LYS A HZ2  2  
ATOM 5694  H HZ3  . LYS A 1 160 ? 3.453   5.246   -12.746 1.00 0.00 ? 212 LYS A HZ3  2  
ATOM 5695  N N    . TYR A 1 161 ? 1.084   4.425   -6.081  1.00 0.00 ? 213 TYR A N    2  
ATOM 5696  C CA   . TYR A 1 161 ? 0.671   3.959   -4.761  1.00 0.00 ? 213 TYR A CA   2  
ATOM 5697  C C    . TYR A 1 161 ? -0.833  4.175   -4.585  1.00 0.00 ? 213 TYR A C    2  
ATOM 5698  O O    . TYR A 1 161 ? -1.374  5.110   -5.171  1.00 0.00 ? 213 TYR A O    2  
ATOM 5699  C CB   . TYR A 1 161 ? 1.473   4.742   -3.715  1.00 0.00 ? 213 TYR A CB   2  
ATOM 5700  C CG   . TYR A 1 161 ? 1.321   4.288   -2.280  1.00 0.00 ? 213 TYR A CG   2  
ATOM 5701  C CD1  . TYR A 1 161 ? 2.121   3.246   -1.788  1.00 0.00 ? 213 TYR A CD1  2  
ATOM 5702  C CD2  . TYR A 1 161 ? 0.388   4.912   -1.440  1.00 0.00 ? 213 TYR A CD2  2  
ATOM 5703  C CE1  . TYR A 1 161 ? 1.997   2.831   -0.456  1.00 0.00 ? 213 TYR A CE1  2  
ATOM 5704  C CE2  . TYR A 1 161 ? 0.257   4.500   -0.105  1.00 0.00 ? 213 TYR A CE2  2  
ATOM 5705  C CZ   . TYR A 1 161 ? 1.064   3.458   0.393   1.00 0.00 ? 213 TYR A CZ   2  
ATOM 5706  O OH   . TYR A 1 161 ? 0.941   3.061   1.691   1.00 0.00 ? 213 TYR A OH   2  
ATOM 5707  H H    . TYR A 1 161 ? 0.916   5.392   -6.317  1.00 0.00 ? 213 TYR A H    2  
ATOM 5708  H HA   . TYR A 1 161 ? 0.905   2.899   -4.667  1.00 0.00 ? 213 TYR A HA   2  
ATOM 5709  H HB2  . TYR A 1 161 ? 2.529   4.676   -3.976  1.00 0.00 ? 213 TYR A HB2  2  
ATOM 5710  H HB3  . TYR A 1 161 ? 1.178   5.789   -3.774  1.00 0.00 ? 213 TYR A HB3  2  
ATOM 5711  H HD1  . TYR A 1 161 ? 2.837   2.762   -2.437  1.00 0.00 ? 213 TYR A HD1  2  
ATOM 5712  H HD2  . TYR A 1 161 ? -0.230  5.712   -1.819  1.00 0.00 ? 213 TYR A HD2  2  
ATOM 5713  H HE1  . TYR A 1 161 ? 2.618   2.032   -0.079  1.00 0.00 ? 213 TYR A HE1  2  
ATOM 5714  H HE2  . TYR A 1 161 ? -0.462  4.979   0.542   1.00 0.00 ? 213 TYR A HE2  2  
ATOM 5715  H HH   . TYR A 1 161 ? 1.553   2.357   1.920   1.00 0.00 ? 213 TYR A HH   2  
ATOM 5716  N N    . PRO A 1 162 ? -1.524  3.341   -3.796  1.00 0.00 ? 214 PRO A N    2  
ATOM 5717  C CA   . PRO A 1 162 ? -2.952  3.470   -3.560  1.00 0.00 ? 214 PRO A CA   2  
ATOM 5718  C C    . PRO A 1 162 ? -3.349  4.892   -3.174  1.00 0.00 ? 214 PRO A C    2  
ATOM 5719  O O    . PRO A 1 162 ? -2.664  5.546   -2.389  1.00 0.00 ? 214 PRO A O    2  
ATOM 5720  C CB   . PRO A 1 162 ? -3.270  2.466   -2.452  1.00 0.00 ? 214 PRO A CB   2  
ATOM 5721  C CG   . PRO A 1 162 ? -2.216  1.384   -2.677  1.00 0.00 ? 214 PRO A CG   2  
ATOM 5722  C CD   . PRO A 1 162 ? -0.993  2.202   -3.078  1.00 0.00 ? 214 PRO A CD   2  
ATOM 5723  H HA   . PRO A 1 162 ? -3.483  3.177   -4.466  1.00 0.00 ? 214 PRO A HA   2  
ATOM 5724  H HB2  . PRO A 1 162 ? -3.114  2.927   -1.477  1.00 0.00 ? 214 PRO A HB2  2  
ATOM 5725  H HB3  . PRO A 1 162 ? -4.283  2.071   -2.543  1.00 0.00 ? 214 PRO A HB3  2  
ATOM 5726  H HG2  . PRO A 1 162 ? -2.030  0.798   -1.777  1.00 0.00 ? 214 PRO A HG2  2  
ATOM 5727  H HG3  . PRO A 1 162 ? -2.520  0.747   -3.508  1.00 0.00 ? 214 PRO A HG3  2  
ATOM 5728  H HD2  . PRO A 1 162 ? -0.473  2.541   -2.182  1.00 0.00 ? 214 PRO A HD2  2  
ATOM 5729  H HD3  . PRO A 1 162 ? -0.329  1.610   -3.709  1.00 0.00 ? 214 PRO A HD3  2  
ATOM 5730  N N    . LYS A 1 163 ? -4.466  5.365   -3.736  1.00 0.00 ? 215 LYS A N    2  
ATOM 5731  C CA   . LYS A 1 163 ? -4.957  6.721   -3.527  1.00 0.00 ? 215 LYS A CA   2  
ATOM 5732  C C    . LYS A 1 163 ? -6.373  6.697   -2.940  1.00 0.00 ? 215 LYS A C    2  
ATOM 5733  O O    . LYS A 1 163 ? -7.022  7.735   -2.833  1.00 0.00 ? 215 LYS A O    2  
ATOM 5734  C CB   . LYS A 1 163 ? -4.901  7.478   -4.860  1.00 0.00 ? 215 LYS A CB   2  
ATOM 5735  C CG   . LYS A 1 163 ? -4.172  8.819   -4.739  1.00 0.00 ? 215 LYS A CG   2  
ATOM 5736  C CD   . LYS A 1 163 ? -4.886  9.775   -3.786  1.00 0.00 ? 215 LYS A CD   2  
ATOM 5737  C CE   . LYS A 1 163 ? -4.148  11.113  -3.794  1.00 0.00 ? 215 LYS A CE   2  
ATOM 5738  N NZ   . LYS A 1 163 ? -4.804  12.090  -2.904  1.00 0.00 ? 215 LYS A NZ   2  
ATOM 5739  H H    . LYS A 1 163 ? -5.002  4.762   -4.343  1.00 0.00 ? 215 LYS A H    2  
ATOM 5740  H HA   . LYS A 1 163 ? -4.293  7.220   -2.820  1.00 0.00 ? 215 LYS A HA   2  
ATOM 5741  H HB2  . LYS A 1 163 ? -4.371  6.869   -5.591  1.00 0.00 ? 215 LYS A HB2  2  
ATOM 5742  H HB3  . LYS A 1 163 ? -5.913  7.650   -5.227  1.00 0.00 ? 215 LYS A HB3  2  
ATOM 5743  H HG2  . LYS A 1 163 ? -3.154  8.651   -4.389  1.00 0.00 ? 215 LYS A HG2  2  
ATOM 5744  H HG3  . LYS A 1 163 ? -4.125  9.277   -5.726  1.00 0.00 ? 215 LYS A HG3  2  
ATOM 5745  H HD2  . LYS A 1 163 ? -5.912  9.926   -4.119  1.00 0.00 ? 215 LYS A HD2  2  
ATOM 5746  H HD3  . LYS A 1 163 ? -4.883  9.367   -2.775  1.00 0.00 ? 215 LYS A HD3  2  
ATOM 5747  H HE2  . LYS A 1 163 ? -3.121  10.953  -3.466  1.00 0.00 ? 215 LYS A HE2  2  
ATOM 5748  H HE3  . LYS A 1 163 ? -4.133  11.500  -4.812  1.00 0.00 ? 215 LYS A HE3  2  
ATOM 5749  H HZ1  . LYS A 1 163 ? -5.755  12.246  -3.205  1.00 0.00 ? 215 LYS A HZ1  2  
ATOM 5750  H HZ2  . LYS A 1 163 ? -4.809  11.743  -1.955  1.00 0.00 ? 215 LYS A HZ2  2  
ATOM 5751  H HZ3  . LYS A 1 163 ? -4.300  12.965  -2.928  1.00 0.00 ? 215 LYS A HZ3  2  
ATOM 5752  N N    . GLY A 1 164 ? -6.850  5.506   -2.559  1.00 0.00 ? 216 GLY A N    2  
ATOM 5753  C CA   . GLY A 1 164 ? -8.195  5.297   -2.047  1.00 0.00 ? 216 GLY A CA   2  
ATOM 5754  C C    . GLY A 1 164 ? -9.141  4.904   -3.177  1.00 0.00 ? 216 GLY A C    2  
ATOM 5755  O O    . GLY A 1 164 ? -8.813  5.083   -4.349  1.00 0.00 ? 216 GLY A O    2  
ATOM 5756  H H    . GLY A 1 164 ? -6.253  4.695   -2.633  1.00 0.00 ? 216 GLY A H    2  
ATOM 5757  H HA2  . GLY A 1 164 ? -8.178  4.498   -1.306  1.00 0.00 ? 216 GLY A HA2  2  
ATOM 5758  H HA3  . GLY A 1 164 ? -8.560  6.207   -1.569  1.00 0.00 ? 216 GLY A HA3  2  
ATOM 5759  N N    . ALA A 1 165 ? -10.314 4.369   -2.817  1.00 0.00 ? 217 ALA A N    2  
ATOM 5760  C CA   . ALA A 1 165 ? -11.316 3.868   -3.753  1.00 0.00 ? 217 ALA A CA   2  
ATOM 5761  C C    . ALA A 1 165 ? -10.794 2.740   -4.653  1.00 0.00 ? 217 ALA A C    2  
ATOM 5762  O O    . ALA A 1 165 ? -9.620  2.373   -4.605  1.00 0.00 ? 217 ALA A O    2  
ATOM 5763  C CB   . ALA A 1 165 ? -11.884 5.037   -4.556  1.00 0.00 ? 217 ALA A CB   2  
ATOM 5764  H H    . ALA A 1 165 ? -10.529 4.297   -1.833  1.00 0.00 ? 217 ALA A H    2  
ATOM 5765  H HA   . ALA A 1 165 ? -12.136 3.454   -3.166  1.00 0.00 ? 217 ALA A HA   2  
ATOM 5766  H HB1  . ALA A 1 165 ? -11.101 5.465   -5.182  1.00 0.00 ? 217 ALA A HB1  2  
ATOM 5767  H HB2  . ALA A 1 165 ? -12.697 4.681   -5.189  1.00 0.00 ? 217 ALA A HB2  2  
ATOM 5768  H HB3  . ALA A 1 165 ? -12.261 5.798   -3.873  1.00 0.00 ? 217 ALA A HB3  2  
ATOM 5769  N N    . GLY A 1 166 ? -11.680 2.184   -5.485  1.00 0.00 ? 218 GLY A N    2  
ATOM 5770  C CA   . GLY A 1 166 ? -11.319 1.119   -6.405  1.00 0.00 ? 218 GLY A CA   2  
ATOM 5771  C C    . GLY A 1 166 ? -12.375 0.945   -7.492  1.00 0.00 ? 218 GLY A C    2  
ATOM 5772  O O    . GLY A 1 166 ? -13.323 1.726   -7.581  1.00 0.00 ? 218 GLY A O    2  
ATOM 5773  H H    . GLY A 1 166 ? -12.639 2.504   -5.487  1.00 0.00 ? 218 GLY A H    2  
ATOM 5774  H HA2  . GLY A 1 166 ? -10.365 1.355   -6.877  1.00 0.00 ? 218 GLY A HA2  2  
ATOM 5775  H HA3  . GLY A 1 166 ? -11.213 0.184   -5.856  1.00 0.00 ? 218 GLY A HA3  2  
ATOM 5776  N N    . ARG A 1 167 ? -12.207 -0.088  -8.326  1.00 0.00 ? 219 ARG A N    2  
ATOM 5777  C CA   . ARG A 1 167 ? -13.080 -0.310  -9.472  1.00 0.00 ? 219 ARG A CA   2  
ATOM 5778  C C    . ARG A 1 167 ? -13.141 -1.786  -9.862  1.00 0.00 ? 219 ARG A C    2  
ATOM 5779  O O    . ARG A 1 167 ? -12.262 -2.572  -9.510  1.00 0.00 ? 219 ARG A O    2  
ATOM 5780  C CB   . ARG A 1 167 ? -12.589 0.542   -10.649 1.00 0.00 ? 219 ARG A CB   2  
ATOM 5781  C CG   . ARG A 1 167 ? -11.174 0.144   -11.070 1.00 0.00 ? 219 ARG A CG   2  
ATOM 5782  C CD   . ARG A 1 167 ? -10.658 1.046   -12.190 1.00 0.00 ? 219 ARG A CD   2  
ATOM 5783  N NE   . ARG A 1 167 ? -9.378  0.550   -12.711 1.00 0.00 ? 219 ARG A NE   2  
ATOM 5784  C CZ   . ARG A 1 167 ? -8.221  0.575   -12.039 1.00 0.00 ? 219 ARG A CZ   2  
ATOM 5785  N NH1  . ARG A 1 167 ? -8.136  1.118   -10.828 1.00 0.00 ? 219 ARG A NH1  2  
ATOM 5786  N NH2  . ARG A 1 167 ? -7.128  0.048   -12.586 1.00 0.00 ? 219 ARG A NH2  2  
ATOM 5787  H H    . ARG A 1 167 ? -11.454 -0.742  -8.167  1.00 0.00 ? 219 ARG A H    2  
ATOM 5788  H HA   . ARG A 1 167 ? -14.089 0.012   -9.216  1.00 0.00 ? 219 ARG A HA   2  
ATOM 5789  H HB2  . ARG A 1 167 ? -13.262 0.410   -11.498 1.00 0.00 ? 219 ARG A HB2  2  
ATOM 5790  H HB3  . ARG A 1 167 ? -12.594 1.591   -10.354 1.00 0.00 ? 219 ARG A HB3  2  
ATOM 5791  H HG2  . ARG A 1 167 ? -10.507 0.234   -10.213 1.00 0.00 ? 219 ARG A HG2  2  
ATOM 5792  H HG3  . ARG A 1 167 ? -11.179 -0.890  -11.417 1.00 0.00 ? 219 ARG A HG3  2  
ATOM 5793  H HD2  . ARG A 1 167 ? -11.387 1.057   -13.000 1.00 0.00 ? 219 ARG A HD2  2  
ATOM 5794  H HD3  . ARG A 1 167 ? -10.535 2.061   -11.813 1.00 0.00 ? 219 ARG A HD3  2  
ATOM 5795  H HE   . ARG A 1 167 ? -9.381  0.162   -13.643 1.00 0.00 ? 219 ARG A HE   2  
ATOM 5796  H HH11 . ARG A 1 167 ? -8.943  1.556   -10.408 1.00 0.00 ? 219 ARG A HH11 2  
ATOM 5797  H HH12 . ARG A 1 167 ? -7.261  1.093   -10.323 1.00 0.00 ? 219 ARG A HH12 2  
ATOM 5798  H HH21 . ARG A 1 167 ? -7.171  -0.368  -13.505 1.00 0.00 ? 219 ARG A HH21 2  
ATOM 5799  H HH22 . ARG A 1 167 ? -6.253  0.064   -12.083 1.00 0.00 ? 219 ARG A HH22 2  
ATOM 5800  N N    . VAL A 1 168 ? -14.193 -2.155  -10.597 1.00 0.00 ? 220 VAL A N    2  
ATOM 5801  C CA   . VAL A 1 168 ? -14.412 -3.513  -11.083 1.00 0.00 ? 220 VAL A CA   2  
ATOM 5802  C C    . VAL A 1 168 ? -15.188 -3.445  -12.394 1.00 0.00 ? 220 VAL A C    2  
ATOM 5803  O O    . VAL A 1 168 ? -15.983 -2.530  -12.591 1.00 0.00 ? 220 VAL A O    2  
ATOM 5804  C CB   . VAL A 1 168 ? -15.144 -4.337  -10.011 1.00 0.00 ? 220 VAL A CB   2  
ATOM 5805  C CG1  . VAL A 1 168 ? -16.494 -3.724  -9.639  1.00 0.00 ? 220 VAL A CG1  2  
ATOM 5806  C CG2  . VAL A 1 168 ? -15.396 -5.774  -10.467 1.00 0.00 ? 220 VAL A CG2  2  
ATOM 5807  H H    . VAL A 1 168 ? -14.883 -1.460  -10.841 1.00 0.00 ? 220 VAL A H    2  
ATOM 5808  H HA   . VAL A 1 168 ? -13.445 -3.978  -11.279 1.00 0.00 ? 220 VAL A HA   2  
ATOM 5809  H HB   . VAL A 1 168 ? -14.522 -4.366  -9.115  1.00 0.00 ? 220 VAL A HB   2  
ATOM 5810  H HG11 . VAL A 1 168 ? -17.156 -3.732  -10.503 1.00 0.00 ? 220 VAL A HG11 2  
ATOM 5811  H HG12 . VAL A 1 168 ? -16.945 -4.310  -8.837  1.00 0.00 ? 220 VAL A HG12 2  
ATOM 5812  H HG13 . VAL A 1 168 ? -16.355 -2.699  -9.296  1.00 0.00 ? 220 VAL A HG13 2  
ATOM 5813  H HG21 . VAL A 1 168 ? -15.887 -6.327  -9.667  1.00 0.00 ? 220 VAL A HG21 2  
ATOM 5814  H HG22 . VAL A 1 168 ? -16.039 -5.778  -11.348 1.00 0.00 ? 220 VAL A HG22 2  
ATOM 5815  H HG23 . VAL A 1 168 ? -14.450 -6.261  -10.703 1.00 0.00 ? 220 VAL A HG23 2  
ATOM 5816  N N    . ALA A 1 169 ? -14.968 -4.404  -13.295 1.00 0.00 ? 221 ALA A N    2  
ATOM 5817  C CA   . ALA A 1 169 ? -15.648 -4.432  -14.579 1.00 0.00 ? 221 ALA A CA   2  
ATOM 5818  C C    . ALA A 1 169 ? -16.190 -5.829  -14.858 1.00 0.00 ? 221 ALA A C    2  
ATOM 5819  O O    . ALA A 1 169 ? -15.428 -6.780  -15.034 1.00 0.00 ? 221 ALA A O    2  
ATOM 5820  C CB   . ALA A 1 169 ? -14.679 -3.981  -15.673 1.00 0.00 ? 221 ALA A CB   2  
ATOM 5821  H H    . ALA A 1 169 ? -14.307 -5.142  -13.092 1.00 0.00 ? 221 ALA A H    2  
ATOM 5822  H HA   . ALA A 1 169 ? -16.487 -3.737  -14.555 1.00 0.00 ? 221 ALA A HA   2  
ATOM 5823  H HB1  . ALA A 1 169 ? -13.834 -4.667  -15.726 1.00 0.00 ? 221 ALA A HB1  2  
ATOM 5824  H HB2  . ALA A 1 169 ? -15.193 -3.973  -16.634 1.00 0.00 ? 221 ALA A HB2  2  
ATOM 5825  H HB3  . ALA A 1 169 ? -14.316 -2.978  -15.451 1.00 0.00 ? 221 ALA A HB3  2  
ATOM 5826  N N    . PHE A 1 170 ? -17.521 -5.943  -14.895 1.00 0.00 ? 222 PHE A N    2  
ATOM 5827  C CA   . PHE A 1 170 ? -18.209 -7.193  -15.172 1.00 0.00 ? 222 PHE A CA   2  
ATOM 5828  C C    . PHE A 1 170 ? -19.636 -6.923  -15.655 1.00 0.00 ? 222 PHE A C    2  
ATOM 5829  O O    . PHE A 1 170 ? -20.531 -7.742  -15.457 1.00 0.00 ? 222 PHE A O    2  
ATOM 5830  C CB   . PHE A 1 170 ? -18.168 -8.115  -13.947 1.00 0.00 ? 222 PHE A CB   2  
ATOM 5831  C CG   . PHE A 1 170 ? -18.966 -7.681  -12.734 1.00 0.00 ? 222 PHE A CG   2  
ATOM 5832  C CD1  . PHE A 1 170 ? -18.723 -6.447  -12.111 1.00 0.00 ? 222 PHE A CD1  2  
ATOM 5833  C CD2  . PHE A 1 170 ? -19.956 -8.530  -12.218 1.00 0.00 ? 222 PHE A CD2  2  
ATOM 5834  C CE1  . PHE A 1 170 ? -19.465 -6.069  -10.982 1.00 0.00 ? 222 PHE A CE1  2  
ATOM 5835  C CE2  . PHE A 1 170 ? -20.699 -8.150  -11.098 1.00 0.00 ? 222 PHE A CE2  2  
ATOM 5836  C CZ   . PHE A 1 170 ? -20.456 -6.918  -10.476 1.00 0.00 ? 222 PHE A CZ   2  
ATOM 5837  H H    . PHE A 1 170 ? -18.088 -5.125  -14.723 1.00 0.00 ? 222 PHE A H    2  
ATOM 5838  H HA   . PHE A 1 170 ? -17.671 -7.689  -15.979 1.00 0.00 ? 222 PHE A HA   2  
ATOM 5839  H HB2  . PHE A 1 170 ? -18.525 -9.098  -14.254 1.00 0.00 ? 222 PHE A HB2  2  
ATOM 5840  H HB3  . PHE A 1 170 ? -17.126 -8.225  -13.646 1.00 0.00 ? 222 PHE A HB3  2  
ATOM 5841  H HD1  . PHE A 1 170 ? -17.963 -5.781  -12.493 1.00 0.00 ? 222 PHE A HD1  2  
ATOM 5842  H HD2  . PHE A 1 170 ? -20.154 -9.488  -12.678 1.00 0.00 ? 222 PHE A HD2  2  
ATOM 5843  H HE1  . PHE A 1 170 ? -19.271 -5.121  -10.502 1.00 0.00 ? 222 PHE A HE1  2  
ATOM 5844  H HE2  . PHE A 1 170 ? -21.458 -8.815  -10.714 1.00 0.00 ? 222 PHE A HE2  2  
ATOM 5845  H HZ   . PHE A 1 170 ? -21.030 -6.626  -9.610  1.00 0.00 ? 222 PHE A HZ   2  
ATOM 5846  N N    . SER A 1 171 ? -19.844 -5.764  -16.291 1.00 0.00 ? 223 SER A N    2  
ATOM 5847  C CA   . SER A 1 171 ? -21.145 -5.320  -16.769 1.00 0.00 ? 223 SER A CA   2  
ATOM 5848  C C    . SER A 1 171 ? -21.619 -6.134  -17.975 1.00 0.00 ? 223 SER A C    2  
ATOM 5849  O O    . SER A 1 171 ? -21.604 -5.641  -19.103 1.00 0.00 ? 223 SER A O    2  
ATOM 5850  C CB   . SER A 1 171 ? -21.077 -3.832  -17.120 1.00 0.00 ? 223 SER A CB   2  
ATOM 5851  O OG   . SER A 1 171 ? -20.625 -3.094  -16.004 1.00 0.00 ? 223 SER A OG   2  
ATOM 5852  H H    . SER A 1 171 ? -19.060 -5.148  -16.454 1.00 0.00 ? 223 SER A H    2  
ATOM 5853  H HA   . SER A 1 171 ? -21.863 -5.444  -15.959 1.00 0.00 ? 223 SER A HA   2  
ATOM 5854  H HB2  . SER A 1 171 ? -20.389 -3.687  -17.954 1.00 0.00 ? 223 SER A HB2  2  
ATOM 5855  H HB3  . SER A 1 171 ? -22.070 -3.486  -17.406 1.00 0.00 ? 223 SER A HB3  2  
ATOM 5856  H HG   . SER A 1 171 ? -20.660 -2.160  -16.220 1.00 0.00 ? 223 SER A HG   2  
ATOM 5857  N N    . ASN A 1 172 ? -22.042 -7.380  -17.744 1.00 0.00 ? 224 ASN A N    2  
ATOM 5858  C CA   . ASN A 1 172 ? -22.520 -8.253  -18.809 1.00 0.00 ? 224 ASN A CA   2  
ATOM 5859  C C    . ASN A 1 172 ? -23.617 -9.209  -18.336 1.00 0.00 ? 224 ASN A C    2  
ATOM 5860  O O    . ASN A 1 172 ? -24.161 -9.961  -19.143 1.00 0.00 ? 224 ASN A O    2  
ATOM 5861  C CB   . ASN A 1 172 ? -21.341 -9.066  -19.355 1.00 0.00 ? 224 ASN A CB   2  
ATOM 5862  C CG   . ASN A 1 172 ? -21.019 -10.258 -18.459 1.00 0.00 ? 224 ASN A CG   2  
ATOM 5863  O OD1  . ASN A 1 172 ? -21.129 -11.405 -18.884 1.00 0.00 ? 224 ASN A OD1  2  
ATOM 5864  N ND2  . ASN A 1 172 ? -20.619 -10.006 -17.216 1.00 0.00 ? 224 ASN A ND2  2  
ATOM 5865  H H    . ASN A 1 172 ? -22.030 -7.736  -16.800 1.00 0.00 ? 224 ASN A H    2  
ATOM 5866  H HA   . ASN A 1 172 ? -22.922 -7.633  -19.611 1.00 0.00 ? 224 ASN A HA   2  
ATOM 5867  H HB2  . ASN A 1 172 ? -21.605 -9.440  -20.344 1.00 0.00 ? 224 ASN A HB2  2  
ATOM 5868  H HB3  . ASN A 1 172 ? -20.468 -8.421  -19.447 1.00 0.00 ? 224 ASN A HB3  2  
ATOM 5869  H HD21 . ASN A 1 172 ? -20.498 -9.054  -16.903 1.00 0.00 ? 224 ASN A HD21 2  
ATOM 5870  H HD22 . ASN A 1 172 ? -20.439 -10.773 -16.583 1.00 0.00 ? 224 ASN A HD22 2  
ATOM 5871  N N    . GLN A 1 173 ? -23.948 -9.191  -17.041 1.00 0.00 ? 225 GLN A N    2  
ATOM 5872  C CA   . GLN A 1 173 ? -24.865 -10.158 -16.458 1.00 0.00 ? 225 GLN A CA   2  
ATOM 5873  C C    . GLN A 1 173 ? -25.705 -9.511  -15.358 1.00 0.00 ? 225 GLN A C    2  
ATOM 5874  O O    . GLN A 1 173 ? -25.377 -8.434  -14.859 1.00 0.00 ? 225 GLN A O    2  
ATOM 5875  C CB   . GLN A 1 173 ? -24.029 -11.324 -15.918 1.00 0.00 ? 225 GLN A CB   2  
ATOM 5876  C CG   . GLN A 1 173 ? -24.878 -12.515 -15.463 1.00 0.00 ? 225 GLN A CG   2  
ATOM 5877  C CD   . GLN A 1 173 ? -24.016 -13.708 -15.060 1.00 0.00 ? 225 GLN A CD   2  
ATOM 5878  O OE1  . GLN A 1 173 ? -22.790 -13.652 -15.097 1.00 0.00 ? 225 GLN A OE1  2  
ATOM 5879  N NE2  . GLN A 1 173 ? -24.657 -14.807 -14.670 1.00 0.00 ? 225 GLN A NE2  2  
ATOM 5880  H H    . GLN A 1 173 ? -23.551 -8.491  -16.429 1.00 0.00 ? 225 GLN A H    2  
ATOM 5881  H HA   . GLN A 1 173 ? -25.534 -10.533 -17.231 1.00 0.00 ? 225 GLN A HA   2  
ATOM 5882  H HB2  . GLN A 1 173 ? -23.363 -11.664 -16.712 1.00 0.00 ? 225 GLN A HB2  2  
ATOM 5883  H HB3  . GLN A 1 173 ? -23.422 -10.975 -15.083 1.00 0.00 ? 225 GLN A HB3  2  
ATOM 5884  H HG2  . GLN A 1 173 ? -25.488 -12.227 -14.606 1.00 0.00 ? 225 GLN A HG2  2  
ATOM 5885  H HG3  . GLN A 1 173 ? -25.538 -12.818 -16.275 1.00 0.00 ? 225 GLN A HG3  2  
ATOM 5886  H HE21 . GLN A 1 173 ? -25.667 -14.824 -14.648 1.00 0.00 ? 225 GLN A HE21 2  
ATOM 5887  H HE22 . GLN A 1 173 ? -24.130 -15.622 -14.393 1.00 0.00 ? 225 GLN A HE22 2  
ATOM 5888  N N    . GLN A 1 174 ? -26.800 -10.169 -14.971 1.00 0.00 ? 226 GLN A N    2  
ATOM 5889  C CA   . GLN A 1 174 ? -27.676 -9.661  -13.930 1.00 0.00 ? 226 GLN A CA   2  
ATOM 5890  C C    . GLN A 1 174 ? -26.920 -9.536  -12.603 1.00 0.00 ? 226 GLN A C    2  
ATOM 5891  O O    . GLN A 1 174 ? -27.431 -8.951  -11.652 1.00 0.00 ? 226 GLN A O    2  
ATOM 5892  C CB   . GLN A 1 174 ? -28.871 -10.602 -13.782 1.00 0.00 ? 226 GLN A CB   2  
ATOM 5893  C CG   . GLN A 1 174 ? -30.035 -9.910  -13.068 1.00 0.00 ? 226 GLN A CG   2  
ATOM 5894  C CD   . GLN A 1 174 ? -30.988 -10.937 -12.470 1.00 0.00 ? 226 GLN A CD   2  
ATOM 5895  O OE1  . GLN A 1 174 ? -32.054 -11.208 -13.018 1.00 0.00 ? 226 GLN A OE1  2  
ATOM 5896  N NE2  . GLN A 1 174 ? -30.602 -11.517 -11.336 1.00 0.00 ? 226 GLN A NE2  2  
ATOM 5897  H H    . GLN A 1 174 ? -27.040 -11.050 -15.404 1.00 0.00 ? 226 GLN A H    2  
ATOM 5898  H HA   . GLN A 1 174 ? -28.033 -8.677  -14.234 1.00 0.00 ? 226 GLN A HA   2  
ATOM 5899  H HB2  . GLN A 1 174 ? -29.209 -10.921 -14.769 1.00 0.00 ? 226 GLN A HB2  2  
ATOM 5900  H HB3  . GLN A 1 174 ? -28.557 -11.479 -13.217 1.00 0.00 ? 226 GLN A HB3  2  
ATOM 5901  H HG2  . GLN A 1 174 ? -29.657 -9.280  -12.264 1.00 0.00 ? 226 GLN A HG2  2  
ATOM 5902  H HG3  . GLN A 1 174 ? -30.570 -9.280  -13.779 1.00 0.00 ? 226 GLN A HG3  2  
ATOM 5903  H HE21 . GLN A 1 174 ? -29.720 -11.263 -10.914 1.00 0.00 ? 226 GLN A HE21 2  
ATOM 5904  H HE22 . GLN A 1 174 ? -31.192 -12.211 -10.899 1.00 0.00 ? 226 GLN A HE22 2  
ATOM 5905  N N    . SER A 1 175 ? -25.701 -10.080 -12.524 1.00 0.00 ? 227 SER A N    2  
ATOM 5906  C CA   . SER A 1 175 ? -24.903 -9.985  -11.316 1.00 0.00 ? 227 SER A CA   2  
ATOM 5907  C C    . SER A 1 175 ? -24.483 -8.535  -11.089 1.00 0.00 ? 227 SER A C    2  
ATOM 5908  O O    . SER A 1 175 ? -24.516 -8.049  -9.957  1.00 0.00 ? 227 SER A O    2  
ATOM 5909  C CB   . SER A 1 175 ? -23.674 -10.880 -11.461 1.00 0.00 ? 227 SER A CB   2  
ATOM 5910  O OG   . SER A 1 175 ? -24.070 -12.202 -11.754 1.00 0.00 ? 227 SER A OG   2  
ATOM 5911  H H    . SER A 1 175 ? -25.311 -10.572 -13.315 1.00 0.00 ? 227 SER A H    2  
ATOM 5912  H HA   . SER A 1 175 ? -25.493 -10.325 -10.466 1.00 0.00 ? 227 SER A HA   2  
ATOM 5913  H HB2  . SER A 1 175 ? -23.046 -10.506 -12.270 1.00 0.00 ? 227 SER A HB2  2  
ATOM 5914  H HB3  . SER A 1 175 ? -23.107 -10.866 -10.531 1.00 0.00 ? 227 SER A HB3  2  
ATOM 5915  H HG   . SER A 1 175 ? -24.537 -12.553 -10.993 1.00 0.00 ? 227 SER A HG   2  
ATOM 5916  N N    . TYR A 1 176 ? -24.087 -7.835  -12.159 1.00 0.00 ? 228 TYR A N    2  
ATOM 5917  C CA   . TYR A 1 176 ? -23.740 -6.427  -12.061 1.00 0.00 ? 228 TYR A CA   2  
ATOM 5918  C C    . TYR A 1 176 ? -25.008 -5.601  -11.887 1.00 0.00 ? 228 TYR A C    2  
ATOM 5919  O O    . TYR A 1 176 ? -24.978 -4.562  -11.233 1.00 0.00 ? 228 TYR A O    2  
ATOM 5920  C CB   . TYR A 1 176 ? -22.923 -5.991  -13.283 1.00 0.00 ? 228 TYR A CB   2  
ATOM 5921  C CG   . TYR A 1 176 ? -23.637 -5.063  -14.242 1.00 0.00 ? 228 TYR A CG   2  
ATOM 5922  C CD1  . TYR A 1 176 ? -23.715 -3.690  -13.960 1.00 0.00 ? 228 TYR A CD1  2  
ATOM 5923  C CD2  . TYR A 1 176 ? -24.216 -5.568  -15.416 1.00 0.00 ? 228 TYR A CD2  2  
ATOM 5924  C CE1  . TYR A 1 176 ? -24.360 -2.822  -14.852 1.00 0.00 ? 228 TYR A CE1  2  
ATOM 5925  C CE2  . TYR A 1 176 ? -24.863 -4.705  -16.313 1.00 0.00 ? 228 TYR A CE2  2  
ATOM 5926  C CZ   . TYR A 1 176 ? -24.935 -3.326  -16.035 1.00 0.00 ? 228 TYR A CZ   2  
ATOM 5927  O OH   . TYR A 1 176 ? -25.558 -2.485  -16.909 1.00 0.00 ? 228 TYR A OH   2  
ATOM 5928  H H    . TYR A 1 176 ? -24.022 -8.282  -13.062 1.00 0.00 ? 228 TYR A H    2  
ATOM 5929  H HA   . TYR A 1 176 ? -23.120 -6.291  -11.175 1.00 0.00 ? 228 TYR A HA   2  
ATOM 5930  H HB2  . TYR A 1 176 ? -22.034 -5.476  -12.924 1.00 0.00 ? 228 TYR A HB2  2  
ATOM 5931  H HB3  . TYR A 1 176 ? -22.591 -6.877  -13.825 1.00 0.00 ? 228 TYR A HB3  2  
ATOM 5932  H HD1  . TYR A 1 176 ? -23.278 -3.300  -13.053 1.00 0.00 ? 228 TYR A HD1  2  
ATOM 5933  H HD2  . TYR A 1 176 ? -24.161 -6.624  -15.634 1.00 0.00 ? 228 TYR A HD2  2  
ATOM 5934  H HE1  . TYR A 1 176 ? -24.414 -1.766  -14.634 1.00 0.00 ? 228 TYR A HE1  2  
ATOM 5935  H HE2  . TYR A 1 176 ? -25.308 -5.096  -17.216 1.00 0.00 ? 228 TYR A HE2  2  
ATOM 5936  H HH   . TYR A 1 176 ? -25.545 -1.570  -16.617 1.00 0.00 ? 228 TYR A HH   2  
ATOM 5937  N N    . ILE A 1 177 ? -26.125 -6.056  -12.467 1.00 0.00 ? 229 ILE A N    2  
ATOM 5938  C CA   . ILE A 1 177 ? -27.404 -5.379  -12.289 1.00 0.00 ? 229 ILE A CA   2  
ATOM 5939  C C    . ILE A 1 177 ? -27.816 -5.447  -10.818 1.00 0.00 ? 229 ILE A C    2  
ATOM 5940  O O    . ILE A 1 177 ? -28.446 -4.524  -10.309 1.00 0.00 ? 229 ILE A O    2  
ATOM 5941  C CB   . ILE A 1 177 ? -28.472 -6.039  -13.170 1.00 0.00 ? 229 ILE A CB   2  
ATOM 5942  C CG1  . ILE A 1 177 ? -28.091 -5.996  -14.657 1.00 0.00 ? 229 ILE A CG1  2  
ATOM 5943  C CG2  . ILE A 1 177 ? -29.832 -5.369  -12.957 1.00 0.00 ? 229 ILE A CG2  2  
ATOM 5944  C CD1  . ILE A 1 177 ? -28.038 -4.575  -15.217 1.00 0.00 ? 229 ILE A CD1  2  
ATOM 5945  H H    . ILE A 1 177 ? -26.098 -6.885  -13.043 1.00 0.00 ? 229 ILE A H    2  
ATOM 5946  H HA   . ILE A 1 177 ? -27.298 -4.332  -12.574 1.00 0.00 ? 229 ILE A HA   2  
ATOM 5947  H HB   . ILE A 1 177 ? -28.564 -7.084  -12.874 1.00 0.00 ? 229 ILE A HB   2  
ATOM 5948  H HG12 . ILE A 1 177 ? -27.117 -6.466  -14.793 1.00 0.00 ? 229 ILE A HG12 2  
ATOM 5949  H HG13 . ILE A 1 177 ? -28.826 -6.565  -15.227 1.00 0.00 ? 229 ILE A HG13 2  
ATOM 5950  H HG21 . ILE A 1 177 ? -29.751 -4.295  -13.125 1.00 0.00 ? 229 ILE A HG21 2  
ATOM 5951  H HG22 . ILE A 1 177 ? -30.558 -5.793  -13.650 1.00 0.00 ? 229 ILE A HG22 2  
ATOM 5952  H HG23 . ILE A 1 177 ? -30.176 -5.546  -11.938 1.00 0.00 ? 229 ILE A HG23 2  
ATOM 5953  H HD11 . ILE A 1 177 ? -27.737 -4.615  -16.263 1.00 0.00 ? 229 ILE A HD11 2  
ATOM 5954  H HD12 . ILE A 1 177 ? -29.023 -4.113  -15.149 1.00 0.00 ? 229 ILE A HD12 2  
ATOM 5955  H HD13 . ILE A 1 177 ? -27.315 -3.983  -14.657 1.00 0.00 ? 229 ILE A HD13 2  
ATOM 5956  N N    . ALA A 1 178 ? -27.464 -6.536  -10.130 1.00 0.00 ? 230 ALA A N    2  
ATOM 5957  C CA   . ALA A 1 178 ? -27.869 -6.740  -8.751  1.00 0.00 ? 230 ALA A CA   2  
ATOM 5958  C C    . ALA A 1 178 ? -26.974 -5.990  -7.764  1.00 0.00 ? 230 ALA A C    2  
ATOM 5959  O O    . ALA A 1 178 ? -27.409 -5.728  -6.645  1.00 0.00 ? 230 ALA A O    2  
ATOM 5960  C CB   . ALA A 1 178 ? -27.877 -8.239  -8.459  1.00 0.00 ? 230 ALA A CB   2  
ATOM 5961  H H    . ALA A 1 178 ? -26.904 -7.253  -10.572 1.00 0.00 ? 230 ALA A H    2  
ATOM 5962  H HA   . ALA A 1 178 ? -28.886 -6.366  -8.634  1.00 0.00 ? 230 ALA A HA   2  
ATOM 5963  H HB1  . ALA A 1 178 ? -26.868 -8.639  -8.562  1.00 0.00 ? 230 ALA A HB1  2  
ATOM 5964  H HB2  . ALA A 1 178 ? -28.237 -8.410  -7.444  1.00 0.00 ? 230 ALA A HB2  2  
ATOM 5965  H HB3  . ALA A 1 178 ? -28.540 -8.743  -9.164  1.00 0.00 ? 230 ALA A HB3  2  
ATOM 5966  N N    . ALA A 1 179 ? -25.742 -5.642  -8.153  1.00 0.00 ? 231 ALA A N    2  
ATOM 5967  C CA   . ALA A 1 179 ? -24.847 -4.884  -7.286  1.00 0.00 ? 231 ALA A CA   2  
ATOM 5968  C C    . ALA A 1 179 ? -24.779 -3.402  -7.661  1.00 0.00 ? 231 ALA A C    2  
ATOM 5969  O O    . ALA A 1 179 ? -24.083 -2.644  -6.989  1.00 0.00 ? 231 ALA A O    2  
ATOM 5970  C CB   . ALA A 1 179 ? -23.457 -5.528  -7.298  1.00 0.00 ? 231 ALA A CB   2  
ATOM 5971  H H    . ALA A 1 179 ? -25.406 -5.906  -9.069  1.00 0.00 ? 231 ALA A H    2  
ATOM 5972  H HA   . ALA A 1 179 ? -25.236 -4.927  -6.269  1.00 0.00 ? 231 ALA A HA   2  
ATOM 5973  H HB1  . ALA A 1 179 ? -23.026 -5.450  -8.297  1.00 0.00 ? 231 ALA A HB1  2  
ATOM 5974  H HB2  . ALA A 1 179 ? -22.806 -5.025  -6.585  1.00 0.00 ? 231 ALA A HB2  2  
ATOM 5975  H HB3  . ALA A 1 179 ? -23.536 -6.580  -7.024  1.00 0.00 ? 231 ALA A HB3  2  
ATOM 5976  N N    . ILE A 1 180 ? -25.485 -2.977  -8.716  1.00 0.00 ? 232 ILE A N    2  
ATOM 5977  C CA   . ILE A 1 180 ? -25.517 -1.570  -9.105  1.00 0.00 ? 232 ILE A CA   2  
ATOM 5978  C C    . ILE A 1 180 ? -26.914 -0.979  -8.904  1.00 0.00 ? 232 ILE A C    2  
ATOM 5979  O O    . ILE A 1 180 ? -27.057 0.238   -8.785  1.00 0.00 ? 232 ILE A O    2  
ATOM 5980  C CB   . ILE A 1 180 ? -24.989 -1.425  -10.538 1.00 0.00 ? 232 ILE A CB   2  
ATOM 5981  C CG1  . ILE A 1 180 ? -24.213 -0.113  -10.680 1.00 0.00 ? 232 ILE A CG1  2  
ATOM 5982  C CG2  . ILE A 1 180 ? -26.127 -1.492  -11.559 1.00 0.00 ? 232 ILE A CG2  2  
ATOM 5983  C CD1  . ILE A 1 180 ? -23.516 -0.044  -12.040 1.00 0.00 ? 232 ILE A CD1  2  
ATOM 5984  H H    . ILE A 1 180 ? -26.015 -3.635  -9.269  1.00 0.00 ? 232 ILE A H    2  
ATOM 5985  H HA   . ILE A 1 180 ? -24.837 -1.030  -8.447  1.00 0.00 ? 232 ILE A HA   2  
ATOM 5986  H HB   . ILE A 1 180 ? -24.293 -2.241  -10.726 1.00 0.00 ? 232 ILE A HB   2  
ATOM 5987  H HG12 . ILE A 1 180 ? -24.892 0.733   -10.572 1.00 0.00 ? 232 ILE A HG12 2  
ATOM 5988  H HG13 . ILE A 1 180 ? -23.455 -0.064  -9.898  1.00 0.00 ? 232 ILE A HG13 2  
ATOM 5989  H HG21 . ILE A 1 180 ? -26.755 -0.607  -11.466 1.00 0.00 ? 232 ILE A HG21 2  
ATOM 5990  H HG22 . ILE A 1 180 ? -25.713 -1.534  -12.567 1.00 0.00 ? 232 ILE A HG22 2  
ATOM 5991  H HG23 . ILE A 1 180 ? -26.723 -2.388  -11.386 1.00 0.00 ? 232 ILE A HG23 2  
ATOM 5992  H HD11 . ILE A 1 180 ? -24.254 0.045   -12.837 1.00 0.00 ? 232 ILE A HD11 2  
ATOM 5993  H HD12 . ILE A 1 180 ? -22.856 0.824   -12.063 1.00 0.00 ? 232 ILE A HD12 2  
ATOM 5994  H HD13 . ILE A 1 180 ? -22.923 -0.945  -12.196 1.00 0.00 ? 232 ILE A HD13 2  
ATOM 5995  N N    . SER A 1 181 ? -27.944 -1.832  -8.864  1.00 0.00 ? 233 SER A N    2  
ATOM 5996  C CA   . SER A 1 181 ? -29.289 -1.413  -8.479  1.00 0.00 ? 233 SER A CA   2  
ATOM 5997  C C    . SER A 1 181 ? -29.447 -1.538  -6.964  1.00 0.00 ? 233 SER A C    2  
ATOM 5998  O O    . SER A 1 181 ? -30.464 -1.134  -6.402  1.00 0.00 ? 233 SER A O    2  
ATOM 5999  C CB   . SER A 1 181 ? -30.341 -2.242  -9.218  1.00 0.00 ? 233 SER A CB   2  
ATOM 6000  O OG   . SER A 1 181 ? -30.222 -2.028  -10.609 1.00 0.00 ? 233 SER A OG   2  
ATOM 6001  H H    . SER A 1 181 ? -27.803 -2.804  -9.099  1.00 0.00 ? 233 SER A H    2  
ATOM 6002  H HA   . SER A 1 181 ? -29.423 -0.366  -8.750  1.00 0.00 ? 233 SER A HA   2  
ATOM 6003  H HB2  . SER A 1 181 ? -30.198 -3.299  -8.994  1.00 0.00 ? 233 SER A HB2  2  
ATOM 6004  H HB3  . SER A 1 181 ? -31.334 -1.937  -8.889  1.00 0.00 ? 233 SER A HB3  2  
ATOM 6005  H HG   . SER A 1 181 ? -30.873 -2.574  -11.056 1.00 0.00 ? 233 SER A HG   2  
ATOM 6006  N N    . ALA A 1 182 ? -28.427 -2.102  -6.311  1.00 0.00 ? 234 ALA A N    2  
ATOM 6007  C CA   . ALA A 1 182 ? -28.343 -2.154  -4.863  1.00 0.00 ? 234 ALA A CA   2  
ATOM 6008  C C    . ALA A 1 182 ? -27.049 -1.448  -4.477  1.00 0.00 ? 234 ALA A C    2  
ATOM 6009  O O    . ALA A 1 182 ? -26.092 -2.072  -4.020  1.00 0.00 ? 234 ALA A O    2  
ATOM 6010  C CB   . ALA A 1 182 ? -28.389 -3.607  -4.387  1.00 0.00 ? 234 ALA A CB   2  
ATOM 6011  H H    . ALA A 1 182 ? -27.666 -2.509  -6.837  1.00 0.00 ? 234 ALA A H    2  
ATOM 6012  H HA   . ALA A 1 182 ? -29.184 -1.612  -4.430  1.00 0.00 ? 234 ALA A HA   2  
ATOM 6013  H HB1  . ALA A 1 182 ? -27.527 -4.149  -4.775  1.00 0.00 ? 234 ALA A HB1  2  
ATOM 6014  H HB2  . ALA A 1 182 ? -28.366 -3.633  -3.298  1.00 0.00 ? 234 ALA A HB2  2  
ATOM 6015  H HB3  . ALA A 1 182 ? -29.304 -4.080  -4.741  1.00 0.00 ? 234 ALA A HB3  2  
ATOM 6016  N N    . ARG A 1 183 ? -27.033 -0.125  -4.669  1.00 0.00 ? 235 ARG A N    2  
ATOM 6017  C CA   . ARG A 1 183 ? -25.826 0.676   -4.504  1.00 0.00 ? 235 ARG A CA   2  
ATOM 6018  C C    . ARG A 1 183 ? -25.453 0.893   -3.039  1.00 0.00 ? 235 ARG A C    2  
ATOM 6019  O O    . ARG A 1 183 ? -24.487 1.599   -2.758  1.00 0.00 ? 235 ARG A O    2  
ATOM 6020  C CB   . ARG A 1 183 ? -25.926 1.997   -5.280  1.00 0.00 ? 235 ARG A CB   2  
ATOM 6021  C CG   . ARG A 1 183 ? -26.787 3.076   -4.613  1.00 0.00 ? 235 ARG A CG   2  
ATOM 6022  C CD   . ARG A 1 183 ? -28.264 2.698   -4.494  1.00 0.00 ? 235 ARG A CD   2  
ATOM 6023  N NE   . ARG A 1 183 ? -28.852 2.424   -5.810  1.00 0.00 ? 235 ARG A NE   2  
ATOM 6024  C CZ   . ARG A 1 183 ? -30.135 2.115   -6.013  1.00 0.00 ? 235 ARG A CZ   2  
ATOM 6025  N NH1  . ARG A 1 183 ? -30.981 2.016   -4.992  1.00 0.00 ? 235 ARG A NH1  2  
ATOM 6026  N NH2  . ARG A 1 183 ? -30.577 1.905   -7.251  1.00 0.00 ? 235 ARG A NH2  2  
ATOM 6027  H H    . ARG A 1 183 ? -27.883 0.349   -4.939  1.00 0.00 ? 235 ARG A H    2  
ATOM 6028  H HA   . ARG A 1 183 ? -25.011 0.104   -4.950  1.00 0.00 ? 235 ARG A HA   2  
ATOM 6029  H HB2  . ARG A 1 183 ? -24.919 2.404   -5.374  1.00 0.00 ? 235 ARG A HB2  2  
ATOM 6030  H HB3  . ARG A 1 183 ? -26.302 1.796   -6.283  1.00 0.00 ? 235 ARG A HB3  2  
ATOM 6031  H HG2  . ARG A 1 183 ? -26.394 3.286   -3.618  1.00 0.00 ? 235 ARG A HG2  2  
ATOM 6032  H HG3  . ARG A 1 183 ? -26.713 3.988   -5.205  1.00 0.00 ? 235 ARG A HG3  2  
ATOM 6033  H HD2  . ARG A 1 183 ? -28.361 1.826   -3.847  1.00 0.00 ? 235 ARG A HD2  2  
ATOM 6034  H HD3  . ARG A 1 183 ? -28.799 3.528   -4.034  1.00 0.00 ? 235 ARG A HD3  2  
ATOM 6035  H HE   . ARG A 1 183 ? -28.239 2.476   -6.612  1.00 0.00 ? 235 ARG A HE   2  
ATOM 6036  H HH11 . ARG A 1 183 ? -30.658 2.179   -4.049  1.00 0.00 ? 235 ARG A HH11 2  
ATOM 6037  H HH12 . ARG A 1 183 ? -31.948 1.776   -5.160  1.00 0.00 ? 235 ARG A HH12 2  
ATOM 6038  H HH21 . ARG A 1 183 ? -29.945 1.984   -8.034  1.00 0.00 ? 235 ARG A HH21 2  
ATOM 6039  H HH22 . ARG A 1 183 ? -31.546 1.666   -7.406  1.00 0.00 ? 235 ARG A HH22 2  
ATOM 6040  N N    . PHE A 1 184 ? -26.203 0.294   -2.110  1.00 0.00 ? 236 PHE A N    2  
ATOM 6041  C CA   . PHE A 1 184 ? -25.887 0.359   -0.693  1.00 0.00 ? 236 PHE A CA   2  
ATOM 6042  C C    . PHE A 1 184 ? -26.063 -1.020  -0.082  1.00 0.00 ? 236 PHE A C    2  
ATOM 6043  O O    . PHE A 1 184 ? -27.020 -1.732  -0.385  1.00 0.00 ? 236 PHE A O    2  
ATOM 6044  C CB   . PHE A 1 184 ? -26.783 1.373   0.021   1.00 0.00 ? 236 PHE A CB   2  
ATOM 6045  C CG   . PHE A 1 184 ? -26.612 2.797   -0.448  1.00 0.00 ? 236 PHE A CG   2  
ATOM 6046  C CD1  . PHE A 1 184 ? -25.418 3.484   -0.183  1.00 0.00 ? 236 PHE A CD1  2  
ATOM 6047  C CD2  . PHE A 1 184 ? -27.647 3.434   -1.147  1.00 0.00 ? 236 PHE A CD2  2  
ATOM 6048  C CE1  . PHE A 1 184 ? -25.258 4.804   -0.617  1.00 0.00 ? 236 PHE A CE1  2  
ATOM 6049  C CE2  . PHE A 1 184 ? -27.486 4.757   -1.584  1.00 0.00 ? 236 PHE A CE2  2  
ATOM 6050  C CZ   . PHE A 1 184 ? -26.290 5.439   -1.323  1.00 0.00 ? 236 PHE A CZ   2  
ATOM 6051  H H    . PHE A 1 184 ? -27.020 -0.234  -2.381  1.00 0.00 ? 236 PHE A H    2  
ATOM 6052  H HA   . PHE A 1 184 ? -24.841 0.632   -0.562  1.00 0.00 ? 236 PHE A HA   2  
ATOM 6053  H HB2  . PHE A 1 184 ? -27.823 1.079   -0.119  1.00 0.00 ? 236 PHE A HB2  2  
ATOM 6054  H HB3  . PHE A 1 184 ? -26.563 1.337   1.088   1.00 0.00 ? 236 PHE A HB3  2  
ATOM 6055  H HD1  . PHE A 1 184 ? -24.621 2.995   0.357   1.00 0.00 ? 236 PHE A HD1  2  
ATOM 6056  H HD2  . PHE A 1 184 ? -28.568 2.907   -1.350  1.00 0.00 ? 236 PHE A HD2  2  
ATOM 6057  H HE1  . PHE A 1 184 ? -24.340 5.332   -0.406  1.00 0.00 ? 236 PHE A HE1  2  
ATOM 6058  H HE2  . PHE A 1 184 ? -28.284 5.248   -2.122  1.00 0.00 ? 236 PHE A HE2  2  
ATOM 6059  H HZ   . PHE A 1 184 ? -26.167 6.454   -1.669  1.00 0.00 ? 236 PHE A HZ   2  
ATOM 6060  N N    . VAL A 1 185 ? -25.118 -1.380  0.785   1.00 0.00 ? 237 VAL A N    2  
ATOM 6061  C CA   . VAL A 1 185 ? -25.059 -2.678  1.423   1.00 0.00 ? 237 VAL A CA   2  
ATOM 6062  C C    . VAL A 1 185 ? -24.364 -2.482  2.762   1.00 0.00 ? 237 VAL A C    2  
ATOM 6063  O O    . VAL A 1 185 ? -23.686 -1.473  2.957   1.00 0.00 ? 237 VAL A O    2  
ATOM 6064  C CB   . VAL A 1 185 ? -24.274 -3.675  0.558   1.00 0.00 ? 237 VAL A CB   2  
ATOM 6065  C CG1  . VAL A 1 185 ? -24.758 -5.081  0.895   1.00 0.00 ? 237 VAL A CG1  2  
ATOM 6066  C CG2  . VAL A 1 185 ? -24.469 -3.480  -0.948  1.00 0.00 ? 237 VAL A CG2  2  
ATOM 6067  H H    . VAL A 1 185 ? -24.387 -0.727  1.027   1.00 0.00 ? 237 VAL A H    2  
ATOM 6068  H HA   . VAL A 1 185 ? -26.070 -3.051  1.584   1.00 0.00 ? 237 VAL A HA   2  
ATOM 6069  H HB   . VAL A 1 185 ? -23.210 -3.596  0.782   1.00 0.00 ? 237 VAL A HB   2  
ATOM 6070  H HG11 . VAL A 1 185 ? -25.820 -5.152  0.657   1.00 0.00 ? 237 VAL A HG11 2  
ATOM 6071  H HG12 . VAL A 1 185 ? -24.200 -5.802  0.298   1.00 0.00 ? 237 VAL A HG12 2  
ATOM 6072  H HG13 . VAL A 1 185 ? -24.609 -5.278  1.956   1.00 0.00 ? 237 VAL A HG13 2  
ATOM 6073  H HG21 . VAL A 1 185 ? -23.912 -4.247  -1.486  1.00 0.00 ? 237 VAL A HG21 2  
ATOM 6074  H HG22 . VAL A 1 185 ? -25.525 -3.568  -1.200  1.00 0.00 ? 237 VAL A HG22 2  
ATOM 6075  H HG23 . VAL A 1 185 ? -24.095 -2.501  -1.248  1.00 0.00 ? 237 VAL A HG23 2  
ATOM 6076  N N    . GLN A 1 186 ? -24.517 -3.426  3.687   1.00 0.00 ? 238 GLN A N    2  
ATOM 6077  C CA   . GLN A 1 186 ? -23.887 -3.301  4.986   1.00 0.00 ? 238 GLN A CA   2  
ATOM 6078  C C    . GLN A 1 186 ? -22.447 -3.800  4.926   1.00 0.00 ? 238 GLN A C    2  
ATOM 6079  O O    . GLN A 1 186 ? -21.528 -2.986  4.871   1.00 0.00 ? 238 GLN A O    2  
ATOM 6080  C CB   . GLN A 1 186 ? -24.741 -4.015  6.028   1.00 0.00 ? 238 GLN A CB   2  
ATOM 6081  C CG   . GLN A 1 186 ? -24.231 -3.690  7.431   1.00 0.00 ? 238 GLN A CG   2  
ATOM 6082  C CD   . GLN A 1 186 ? -25.013 -4.426  8.512   1.00 0.00 ? 238 GLN A CD   2  
ATOM 6083  O OE1  . GLN A 1 186 ? -25.998 -5.107  8.236   1.00 0.00 ? 238 GLN A OE1  2  
ATOM 6084  N NE2  . GLN A 1 186 ? -24.576 -4.291  9.759   1.00 0.00 ? 238 GLN A NE2  2  
ATOM 6085  H H    . GLN A 1 186 ? -25.076 -4.244  3.495   1.00 0.00 ? 238 GLN A H    2  
ATOM 6086  H HA   . GLN A 1 186 ? -23.856 -2.243  5.246   1.00 0.00 ? 238 GLN A HA   2  
ATOM 6087  H HB2  . GLN A 1 186 ? -25.767 -3.668  5.907   1.00 0.00 ? 238 GLN A HB2  2  
ATOM 6088  H HB3  . GLN A 1 186 ? -24.707 -5.093  5.870   1.00 0.00 ? 238 GLN A HB3  2  
ATOM 6089  H HG2  . GLN A 1 186 ? -23.183 -3.983  7.505   1.00 0.00 ? 238 GLN A HG2  2  
ATOM 6090  H HG3  . GLN A 1 186 ? -24.306 -2.617  7.605   1.00 0.00 ? 238 GLN A HG3  2  
ATOM 6091  H HE21 . GLN A 1 186 ? -23.765 -3.720  9.954   1.00 0.00 ? 238 GLN A HE21 2  
ATOM 6092  H HE22 . GLN A 1 186 ? -25.061 -4.766  10.507  1.00 0.00 ? 238 GLN A HE22 2  
ATOM 6093  N N    . LEU A 1 187 ? -22.267 -5.127  4.935   1.00 0.00 ? 239 LEU A N    2  
ATOM 6094  C CA   . LEU A 1 187 ? -20.965 -5.779  4.857   1.00 0.00 ? 239 LEU A CA   2  
ATOM 6095  C C    . LEU A 1 187 ? -20.035 -5.386  6.009   1.00 0.00 ? 239 LEU A C    2  
ATOM 6096  O O    . LEU A 1 187 ? -20.262 -4.402  6.709   1.00 0.00 ? 239 LEU A O    2  
ATOM 6097  C CB   . LEU A 1 187 ? -20.347 -5.503  3.481   1.00 0.00 ? 239 LEU A CB   2  
ATOM 6098  C CG   . LEU A 1 187 ? -21.311 -5.864  2.345   1.00 0.00 ? 239 LEU A CG   2  
ATOM 6099  C CD1  . LEU A 1 187 ? -20.673 -5.542  0.998   1.00 0.00 ? 239 LEU A CD1  2  
ATOM 6100  C CD2  . LEU A 1 187 ? -21.672 -7.347  2.369   1.00 0.00 ? 239 LEU A CD2  2  
ATOM 6101  H H    . LEU A 1 187 ? -23.077 -5.725  5.001   1.00 0.00 ? 239 LEU A H    2  
ATOM 6102  H HA   . LEU A 1 187 ? -21.122 -6.855  4.928   1.00 0.00 ? 239 LEU A HA   2  
ATOM 6103  H HB2  . LEU A 1 187 ? -20.101 -4.444  3.412   1.00 0.00 ? 239 LEU A HB2  2  
ATOM 6104  H HB3  . LEU A 1 187 ? -19.429 -6.084  3.375   1.00 0.00 ? 239 LEU A HB3  2  
ATOM 6105  H HG   . LEU A 1 187 ? -22.223 -5.274  2.441   1.00 0.00 ? 239 LEU A HG   2  
ATOM 6106  H HD11 . LEU A 1 187 ? -19.809 -6.188  0.845   1.00 0.00 ? 239 LEU A HD11 2  
ATOM 6107  H HD12 . LEU A 1 187 ? -21.397 -5.717  0.202   1.00 0.00 ? 239 LEU A HD12 2  
ATOM 6108  H HD13 . LEU A 1 187 ? -20.360 -4.499  0.981   1.00 0.00 ? 239 LEU A HD13 2  
ATOM 6109  H HD21 . LEU A 1 187 ? -20.764 -7.946  2.314   1.00 0.00 ? 239 LEU A HD21 2  
ATOM 6110  H HD22 . LEU A 1 187 ? -22.215 -7.585  3.284   1.00 0.00 ? 239 LEU A HD22 2  
ATOM 6111  H HD23 . LEU A 1 187 ? -22.306 -7.575  1.512   1.00 0.00 ? 239 LEU A HD23 2  
ATOM 6112  N N    . GLN A 1 188 ? -18.971 -6.169  6.208   1.00 0.00 ? 240 GLN A N    2  
ATOM 6113  C CA   . GLN A 1 188 ? -17.979 -5.884  7.235   1.00 0.00 ? 240 GLN A CA   2  
ATOM 6114  C C    . GLN A 1 188 ? -16.585 -6.148  6.681   1.00 0.00 ? 240 GLN A C    2  
ATOM 6115  O O    . GLN A 1 188 ? -16.309 -7.227  6.157   1.00 0.00 ? 240 GLN A O    2  
ATOM 6116  C CB   . GLN A 1 188 ? -18.222 -6.723  8.495   1.00 0.00 ? 240 GLN A CB   2  
ATOM 6117  C CG   . GLN A 1 188 ? -19.530 -6.354  9.205   1.00 0.00 ? 240 GLN A CG   2  
ATOM 6118  C CD   . GLN A 1 188 ? -20.767 -7.002  8.587   1.00 0.00 ? 240 GLN A CD   2  
ATOM 6119  O OE1  . GLN A 1 188 ? -20.677 -7.942  7.803   1.00 0.00 ? 240 GLN A OE1  2  
ATOM 6120  N NE2  . GLN A 1 188 ? -21.945 -6.496  8.943   1.00 0.00 ? 240 GLN A NE2  2  
ATOM 6121  H H    . GLN A 1 188 ? -18.834 -6.988  5.633   1.00 0.00 ? 240 GLN A H    2  
ATOM 6122  H HA   . GLN A 1 188 ? -18.041 -4.830  7.504   1.00 0.00 ? 240 GLN A HA   2  
ATOM 6123  H HB2  . GLN A 1 188 ? -18.215 -7.785  8.249   1.00 0.00 ? 240 GLN A HB2  2  
ATOM 6124  H HB3  . GLN A 1 188 ? -17.402 -6.529  9.186   1.00 0.00 ? 240 GLN A HB3  2  
ATOM 6125  H HG2  . GLN A 1 188 ? -19.465 -6.676  10.244  1.00 0.00 ? 240 GLN A HG2  2  
ATOM 6126  H HG3  . GLN A 1 188 ? -19.648 -5.270  9.200   1.00 0.00 ? 240 GLN A HG3  2  
ATOM 6127  H HE21 . GLN A 1 188 ? -21.984 -5.716  9.584   1.00 0.00 ? 240 GLN A HE21 2  
ATOM 6128  H HE22 . GLN A 1 188 ? -22.796 -6.893  8.570   1.00 0.00 ? 240 GLN A HE22 2  
ATOM 6129  N N    . HIS A 1 189 ? -15.708 -5.149  6.804   1.00 0.00 ? 241 HIS A N    2  
ATOM 6130  C CA   . HIS A 1 189 ? -14.336 -5.222  6.330   1.00 0.00 ? 241 HIS A CA   2  
ATOM 6131  C C    . HIS A 1 189 ? -13.525 -4.109  6.983   1.00 0.00 ? 241 HIS A C    2  
ATOM 6132  O O    . HIS A 1 189 ? -14.034 -3.007  7.182   1.00 0.00 ? 241 HIS A O    2  
ATOM 6133  C CB   . HIS A 1 189 ? -14.314 -5.069  4.807   1.00 0.00 ? 241 HIS A CB   2  
ATOM 6134  C CG   . HIS A 1 189 ? -14.991 -3.810  4.326   1.00 0.00 ? 241 HIS A CG   2  
ATOM 6135  N ND1  . HIS A 1 189 ? -16.373 -3.611  4.239   1.00 0.00 ? 241 HIS A ND1  2  
ATOM 6136  C CD2  . HIS A 1 189 ? -14.350 -2.682  3.907   1.00 0.00 ? 241 HIS A CD2  2  
ATOM 6137  C CE1  . HIS A 1 189 ? -16.522 -2.360  3.776   1.00 0.00 ? 241 HIS A CE1  2  
ATOM 6138  N NE2  . HIS A 1 189 ? -15.328 -1.778  3.568   1.00 0.00 ? 241 HIS A NE2  2  
ATOM 6139  H H    . HIS A 1 189 ? -15.999 -4.291  7.249   1.00 0.00 ? 241 HIS A H    2  
ATOM 6140  H HA   . HIS A 1 189 ? -13.905 -6.186  6.602   1.00 0.00 ? 241 HIS A HA   2  
ATOM 6141  H HB2  . HIS A 1 189 ? -13.278 -5.066  4.467   1.00 0.00 ? 241 HIS A HB2  2  
ATOM 6142  H HB3  . HIS A 1 189 ? -14.818 -5.924  4.358   1.00 0.00 ? 241 HIS A HB3  2  
ATOM 6143  H HD2  . HIS A 1 189 ? -13.280 -2.534  3.855   1.00 0.00 ? 241 HIS A HD2  2  
ATOM 6144  H HE1  . HIS A 1 189 ? -17.476 -1.885  3.596   1.00 0.00 ? 241 HIS A HE1  2  
ATOM 6145  H HE2  . HIS A 1 189 ? -15.180 -0.842  3.221   1.00 0.00 ? 241 HIS A HE2  2  
ATOM 6146  N N    . GLY A 1 190 ? -12.263 -4.384  7.323   1.00 0.00 ? 242 GLY A N    2  
ATOM 6147  C CA   . GLY A 1 190 ? -11.416 -3.390  7.965   1.00 0.00 ? 242 GLY A CA   2  
ATOM 6148  C C    . GLY A 1 190 ? -12.066 -2.881  9.250   1.00 0.00 ? 242 GLY A C    2  
ATOM 6149  O O    . GLY A 1 190 ? -12.542 -3.669  10.067  1.00 0.00 ? 242 GLY A O    2  
ATOM 6150  H H    . GLY A 1 190 ? -11.877 -5.299  7.137   1.00 0.00 ? 242 GLY A H    2  
ATOM 6151  H HA2  . GLY A 1 190 ? -10.447 -3.830  8.201   1.00 0.00 ? 242 GLY A HA2  2  
ATOM 6152  H HA3  . GLY A 1 190 ? -11.263 -2.553  7.284   1.00 0.00 ? 242 GLY A HA3  2  
ATOM 6153  N N    . GLU A 1 191 ? -12.083 -1.558  9.426   1.00 0.00 ? 243 GLU A N    2  
ATOM 6154  C CA   . GLU A 1 191 ? -12.689 -0.915  10.586  1.00 0.00 ? 243 GLU A CA   2  
ATOM 6155  C C    . GLU A 1 191 ? -14.126 -0.466  10.294  1.00 0.00 ? 243 GLU A C    2  
ATOM 6156  O O    . GLU A 1 191 ? -14.716 0.266   11.086  1.00 0.00 ? 243 GLU A O    2  
ATOM 6157  C CB   . GLU A 1 191 ? -11.818 0.258   11.038  1.00 0.00 ? 243 GLU A CB   2  
ATOM 6158  C CG   . GLU A 1 191 ? -10.432 -0.231  11.461  1.00 0.00 ? 243 GLU A CG   2  
ATOM 6159  C CD   . GLU A 1 191 ? -9.561  0.931   11.929  1.00 0.00 ? 243 GLU A CD   2  
ATOM 6160  O OE1  . GLU A 1 191 ? -9.745  1.365   13.089  1.00 0.00 ? 243 GLU A OE1  2  
ATOM 6161  O OE2  . GLU A 1 191 ? -8.715  1.379   11.123  1.00 0.00 ? 243 GLU A OE2  2  
ATOM 6162  H H    . GLU A 1 191 ? -11.659 -0.964  8.728   1.00 0.00 ? 243 GLU A H    2  
ATOM 6163  H HA   . GLU A 1 191 ? -12.731 -1.639  11.399  1.00 0.00 ? 243 GLU A HA   2  
ATOM 6164  H HB2  . GLU A 1 191 ? -11.717 0.972   10.220  1.00 0.00 ? 243 GLU A HB2  2  
ATOM 6165  H HB3  . GLU A 1 191 ? -12.292 0.755   11.884  1.00 0.00 ? 243 GLU A HB3  2  
ATOM 6166  H HG2  . GLU A 1 191 ? -10.539 -0.953  12.271  1.00 0.00 ? 243 GLU A HG2  2  
ATOM 6167  H HG3  . GLU A 1 191 ? -9.947  -0.723  10.616  1.00 0.00 ? 243 GLU A HG3  2  
ATOM 6168  N N    . ILE A 1 192 ? -14.692 -0.898  9.161   1.00 0.00 ? 244 ILE A N    2  
ATOM 6169  C CA   . ILE A 1 192 ? -16.038 -0.518  8.748   1.00 0.00 ? 244 ILE A CA   2  
ATOM 6170  C C    . ILE A 1 192 ? -17.032 -1.633  9.070   1.00 0.00 ? 244 ILE A C    2  
ATOM 6171  O O    . ILE A 1 192 ? -16.691 -2.815  9.025   1.00 0.00 ? 244 ILE A O    2  
ATOM 6172  C CB   . ILE A 1 192 ? -16.029 -0.137  7.260   1.00 0.00 ? 244 ILE A CB   2  
ATOM 6173  C CG1  . ILE A 1 192 ? -15.202 1.145   7.093   1.00 0.00 ? 244 ILE A CG1  2  
ATOM 6174  C CG2  . ILE A 1 192 ? -17.452 0.079   6.740   1.00 0.00 ? 244 ILE A CG2  2  
ATOM 6175  C CD1  . ILE A 1 192 ? -15.091 1.575   5.630   1.00 0.00 ? 244 ILE A CD1  2  
ATOM 6176  H H    . ILE A 1 192 ? -14.175 -1.518  8.555   1.00 0.00 ? 244 ILE A H    2  
ATOM 6177  H HA   . ILE A 1 192 ? -16.340 0.363   9.315   1.00 0.00 ? 244 ILE A HA   2  
ATOM 6178  H HB   . ILE A 1 192 ? -15.567 -0.942  6.688   1.00 0.00 ? 244 ILE A HB   2  
ATOM 6179  H HG12 . ILE A 1 192 ? -15.662 1.950   7.666   1.00 0.00 ? 244 ILE A HG12 2  
ATOM 6180  H HG13 . ILE A 1 192 ? -14.197 0.971   7.479   1.00 0.00 ? 244 ILE A HG13 2  
ATOM 6181  H HG21 . ILE A 1 192 ? -17.426 0.341   5.682   1.00 0.00 ? 244 ILE A HG21 2  
ATOM 6182  H HG22 . ILE A 1 192 ? -18.029 -0.841  6.844   1.00 0.00 ? 244 ILE A HG22 2  
ATOM 6183  H HG23 . ILE A 1 192 ? -17.933 0.883   7.298   1.00 0.00 ? 244 ILE A HG23 2  
ATOM 6184  H HD11 . ILE A 1 192 ? -14.422 2.434   5.555   1.00 0.00 ? 244 ILE A HD11 2  
ATOM 6185  H HD12 . ILE A 1 192 ? -14.687 0.752   5.040   1.00 0.00 ? 244 ILE A HD12 2  
ATOM 6186  H HD13 . ILE A 1 192 ? -16.071 1.859   5.246   1.00 0.00 ? 244 ILE A HD13 2  
ATOM 6187  N N    . ASP A 1 193 ? -18.269 -1.243  9.395   1.00 0.00 ? 245 ASP A N    2  
ATOM 6188  C CA   . ASP A 1 193 ? -19.309 -2.182  9.793   1.00 0.00 ? 245 ASP A CA   2  
ATOM 6189  C C    . ASP A 1 193 ? -20.569 -2.037  8.938   1.00 0.00 ? 245 ASP A C    2  
ATOM 6190  O O    . ASP A 1 193 ? -21.482 -2.855  9.040   1.00 0.00 ? 245 ASP A O    2  
ATOM 6191  C CB   . ASP A 1 193 ? -19.654 -1.906  11.255  1.00 0.00 ? 245 ASP A CB   2  
ATOM 6192  C CG   . ASP A 1 193 ? -20.576 -2.976  11.835  1.00 0.00 ? 245 ASP A CG   2  
ATOM 6193  O OD1  . ASP A 1 193 ? -20.129 -4.143  11.907  1.00 0.00 ? 245 ASP A OD1  2  
ATOM 6194  O OD2  . ASP A 1 193 ? -21.718 -2.618  12.201  1.00 0.00 ? 245 ASP A OD2  2  
ATOM 6195  H H    . ASP A 1 193 ? -18.504 -0.261  9.375   1.00 0.00 ? 245 ASP A H    2  
ATOM 6196  H HA   . ASP A 1 193 ? -18.932 -3.201  9.698   1.00 0.00 ? 245 ASP A HA   2  
ATOM 6197  H HB2  . ASP A 1 193 ? -18.737 -1.865  11.841  1.00 0.00 ? 245 ASP A HB2  2  
ATOM 6198  H HB3  . ASP A 1 193 ? -20.146 -0.935  11.319  1.00 0.00 ? 245 ASP A HB3  2  
ATOM 6199  N N    . LYS A 1 194 ? -20.623 -0.998  8.097   1.00 0.00 ? 246 LYS A N    2  
ATOM 6200  C CA   . LYS A 1 194 ? -21.803 -0.692  7.305   1.00 0.00 ? 246 LYS A CA   2  
ATOM 6201  C C    . LYS A 1 194 ? -21.478 0.250   6.148   1.00 0.00 ? 246 LYS A C    2  
ATOM 6202  O O    . LYS A 1 194 ? -20.395 0.832   6.104   1.00 0.00 ? 246 LYS A O    2  
ATOM 6203  C CB   . LYS A 1 194 ? -22.876 -0.073  8.211   1.00 0.00 ? 246 LYS A CB   2  
ATOM 6204  C CG   . LYS A 1 194 ? -22.632 1.403   8.543   1.00 0.00 ? 246 LYS A CG   2  
ATOM 6205  C CD   . LYS A 1 194 ? -21.314 1.677   9.269   1.00 0.00 ? 246 LYS A CD   2  
ATOM 6206  C CE   . LYS A 1 194 ? -21.176 3.191   9.400   1.00 0.00 ? 246 LYS A CE   2  
ATOM 6207  N NZ   . LYS A 1 194 ? -19.950 3.562   10.130  1.00 0.00 ? 246 LYS A NZ   2  
ATOM 6208  H H    . LYS A 1 194 ? -19.820 -0.392  8.000   1.00 0.00 ? 246 LYS A H    2  
ATOM 6209  H HA   . LYS A 1 194 ? -22.196 -1.622  6.896   1.00 0.00 ? 246 LYS A HA   2  
ATOM 6210  H HB2  . LYS A 1 194 ? -23.837 -0.149  7.703   1.00 0.00 ? 246 LYS A HB2  2  
ATOM 6211  H HB3  . LYS A 1 194 ? -22.940 -0.643  9.138   1.00 0.00 ? 246 LYS A HB3  2  
ATOM 6212  H HG2  . LYS A 1 194 ? -22.650 1.979   7.619   1.00 0.00 ? 246 LYS A HG2  2  
ATOM 6213  H HG3  . LYS A 1 194 ? -23.448 1.748   9.180   1.00 0.00 ? 246 LYS A HG3  2  
ATOM 6214  H HD2  . LYS A 1 194 ? -21.332 1.214   10.255  1.00 0.00 ? 246 LYS A HD2  2  
ATOM 6215  H HD3  . LYS A 1 194 ? -20.468 1.303   8.691   1.00 0.00 ? 246 LYS A HD3  2  
ATOM 6216  H HE2  . LYS A 1 194 ? -21.150 3.615   8.396   1.00 0.00 ? 246 LYS A HE2  2  
ATOM 6217  H HE3  . LYS A 1 194 ? -22.049 3.576   9.928   1.00 0.00 ? 246 LYS A HE3  2  
ATOM 6218  H HZ1  . LYS A 1 194 ? -19.883 4.567   10.201  1.00 0.00 ? 246 LYS A HZ1  2  
ATOM 6219  H HZ2  . LYS A 1 194 ? -19.970 3.169   11.060  1.00 0.00 ? 246 LYS A HZ2  2  
ATOM 6220  H HZ3  . LYS A 1 194 ? -19.137 3.214   9.641   1.00 0.00 ? 246 LYS A HZ3  2  
ATOM 6221  N N    . ARG A 1 195 ? -22.439 0.383   5.226   1.00 0.00 ? 247 ARG A N    2  
ATOM 6222  C CA   . ARG A 1 195 ? -22.414 1.265   4.062   1.00 0.00 ? 247 ARG A CA   2  
ATOM 6223  C C    . ARG A 1 195 ? -21.220 1.078   3.123   1.00 0.00 ? 247 ARG A C    2  
ATOM 6224  O O    . ARG A 1 195 ? -20.062 1.274   3.488   1.00 0.00 ? 247 ARG A O    2  
ATOM 6225  C CB   . ARG A 1 195 ? -22.579 2.723   4.507   1.00 0.00 ? 247 ARG A CB   2  
ATOM 6226  C CG   . ARG A 1 195 ? -22.460 3.671   3.314   1.00 0.00 ? 247 ARG A CG   2  
ATOM 6227  C CD   . ARG A 1 195 ? -22.813 5.100   3.722   1.00 0.00 ? 247 ARG A CD   2  
ATOM 6228  N NE   . ARG A 1 195 ? -22.674 6.019   2.585   1.00 0.00 ? 247 ARG A NE   2  
ATOM 6229  C CZ   . ARG A 1 195 ? -23.139 7.272   2.566   1.00 0.00 ? 247 ARG A CZ   2  
ATOM 6230  N NH1  . ARG A 1 195 ? -23.778 7.781   3.618   1.00 0.00 ? 247 ARG A NH1  2  
ATOM 6231  N NH2  . ARG A 1 195 ? -22.964 8.023   1.483   1.00 0.00 ? 247 ARG A NH2  2  
ATOM 6232  H H    . ARG A 1 195 ? -23.271 -0.177  5.338   1.00 0.00 ? 247 ARG A H    2  
ATOM 6233  H HA   . ARG A 1 195 ? -23.299 1.024   3.474   1.00 0.00 ? 247 ARG A HA   2  
ATOM 6234  H HB2  . ARG A 1 195 ? -23.564 2.845   4.960   1.00 0.00 ? 247 ARG A HB2  2  
ATOM 6235  H HB3  . ARG A 1 195 ? -21.812 2.972   5.240   1.00 0.00 ? 247 ARG A HB3  2  
ATOM 6236  H HG2  . ARG A 1 195 ? -21.433 3.653   2.949   1.00 0.00 ? 247 ARG A HG2  2  
ATOM 6237  H HG3  . ARG A 1 195 ? -23.136 3.349   2.523   1.00 0.00 ? 247 ARG A HG3  2  
ATOM 6238  H HD2  . ARG A 1 195 ? -23.842 5.122   4.082   1.00 0.00 ? 247 ARG A HD2  2  
ATOM 6239  H HD3  . ARG A 1 195 ? -22.147 5.417   4.525   1.00 0.00 ? 247 ARG A HD3  2  
ATOM 6240  H HE   . ARG A 1 195 ? -22.193 5.679   1.766   1.00 0.00 ? 247 ARG A HE   2  
ATOM 6241  H HH11 . ARG A 1 195 ? -23.916 7.219   4.447   1.00 0.00 ? 247 ARG A HH11 2  
ATOM 6242  H HH12 . ARG A 1 195 ? -24.125 8.729   3.589   1.00 0.00 ? 247 ARG A HH12 2  
ATOM 6243  H HH21 . ARG A 1 195 ? -22.480 7.640   0.684   1.00 0.00 ? 247 ARG A HH21 2  
ATOM 6244  H HH22 . ARG A 1 195 ? -23.312 8.971   1.459   1.00 0.00 ? 247 ARG A HH22 2  
ATOM 6245  N N    . VAL A 1 196 ? -21.550 0.691   1.889   1.00 0.00 ? 248 VAL A N    2  
ATOM 6246  C CA   . VAL A 1 196 ? -20.603 0.661   0.780   1.00 0.00 ? 248 VAL A CA   2  
ATOM 6247  C C    . VAL A 1 196 ? -21.282 1.300   -0.424  1.00 0.00 ? 248 VAL A C    2  
ATOM 6248  O O    . VAL A 1 196 ? -22.497 1.493   -0.411  1.00 0.00 ? 248 VAL A O    2  
ATOM 6249  C CB   . VAL A 1 196 ? -20.148 -0.768  0.464   1.00 0.00 ? 248 VAL A CB   2  
ATOM 6250  C CG1  . VAL A 1 196 ? -19.435 -1.389  1.665   1.00 0.00 ? 248 VAL A CG1  2  
ATOM 6251  C CG2  . VAL A 1 196 ? -21.332 -1.652  0.072   1.00 0.00 ? 248 VAL A CG2  2  
ATOM 6252  H H    . VAL A 1 196 ? -22.500 0.407   1.699   1.00 0.00 ? 248 VAL A H    2  
ATOM 6253  H HA   . VAL A 1 196 ? -19.729 1.266   1.022   1.00 0.00 ? 248 VAL A HA   2  
ATOM 6254  H HB   . VAL A 1 196 ? -19.447 -0.732  -0.372  1.00 0.00 ? 248 VAL A HB   2  
ATOM 6255  H HG11 . VAL A 1 196 ? -20.128 -1.481  2.501   1.00 0.00 ? 248 VAL A HG11 2  
ATOM 6256  H HG12 . VAL A 1 196 ? -19.064 -2.378  1.397   1.00 0.00 ? 248 VAL A HG12 2  
ATOM 6257  H HG13 . VAL A 1 196 ? -18.596 -0.755  1.955   1.00 0.00 ? 248 VAL A HG13 2  
ATOM 6258  H HG21 . VAL A 1 196 ? -21.840 -1.226  -0.793  1.00 0.00 ? 248 VAL A HG21 2  
ATOM 6259  H HG22 . VAL A 1 196 ? -20.972 -2.649  -0.185  1.00 0.00 ? 248 VAL A HG22 2  
ATOM 6260  H HG23 . VAL A 1 196 ? -22.027 -1.724  0.908   1.00 0.00 ? 248 VAL A HG23 2  
ATOM 6261  N N    . GLU A 1 197 ? -20.512 1.630   -1.463  1.00 0.00 ? 249 GLU A N    2  
ATOM 6262  C CA   . GLU A 1 197 ? -21.054 2.347   -2.605  1.00 0.00 ? 249 GLU A CA   2  
ATOM 6263  C C    . GLU A 1 197 ? -20.617 1.698   -3.915  1.00 0.00 ? 249 GLU A C    2  
ATOM 6264  O O    . GLU A 1 197 ? -19.460 1.306   -4.056  1.00 0.00 ? 249 GLU A O    2  
ATOM 6265  C CB   . GLU A 1 197 ? -20.603 3.808   -2.534  1.00 0.00 ? 249 GLU A CB   2  
ATOM 6266  C CG   . GLU A 1 197 ? -21.164 4.477   -1.275  1.00 0.00 ? 249 GLU A CG   2  
ATOM 6267  C CD   . GLU A 1 197 ? -20.846 5.971   -1.216  1.00 0.00 ? 249 GLU A CD   2  
ATOM 6268  O OE1  . GLU A 1 197 ? -19.861 6.391   -1.863  1.00 0.00 ? 249 GLU A OE1  2  
ATOM 6269  O OE2  . GLU A 1 197 ? -21.600 6.683   -0.517  1.00 0.00 ? 249 GLU A OE2  2  
ATOM 6270  H H    . GLU A 1 197 ? -19.532 1.387   -1.466  1.00 0.00 ? 249 GLU A H    2  
ATOM 6271  H HA   . GLU A 1 197 ? -22.142 2.322   -2.564  1.00 0.00 ? 249 GLU A HA   2  
ATOM 6272  H HB2  . GLU A 1 197 ? -19.514 3.852   -2.517  1.00 0.00 ? 249 GLU A HB2  2  
ATOM 6273  H HB3  . GLU A 1 197 ? -20.967 4.336   -3.415  1.00 0.00 ? 249 GLU A HB3  2  
ATOM 6274  H HG2  . GLU A 1 197 ? -22.247 4.345   -1.263  1.00 0.00 ? 249 GLU A HG2  2  
ATOM 6275  H HG3  . GLU A 1 197 ? -20.744 3.995   -0.393  1.00 0.00 ? 249 GLU A HG3  2  
ATOM 6276  N N    . VAL A 1 198 ? -21.545 1.589   -4.871  1.00 0.00 ? 250 VAL A N    2  
ATOM 6277  C CA   . VAL A 1 198 ? -21.273 1.007   -6.179  1.00 0.00 ? 250 VAL A CA   2  
ATOM 6278  C C    . VAL A 1 198 ? -22.087 1.740   -7.243  1.00 0.00 ? 250 VAL A C    2  
ATOM 6279  O O    . VAL A 1 198 ? -23.306 1.843   -7.126  1.00 0.00 ? 250 VAL A O    2  
ATOM 6280  C CB   . VAL A 1 198 ? -21.633 -0.484  -6.192  1.00 0.00 ? 250 VAL A CB   2  
ATOM 6281  C CG1  . VAL A 1 198 ? -21.157 -1.114  -7.501  1.00 0.00 ? 250 VAL A CG1  2  
ATOM 6282  C CG2  . VAL A 1 198 ? -20.982 -1.252  -5.043  1.00 0.00 ? 250 VAL A CG2  2  
ATOM 6283  H H    . VAL A 1 198 ? -22.483 1.920   -4.691  1.00 0.00 ? 250 VAL A H    2  
ATOM 6284  H HA   . VAL A 1 198 ? -20.210 1.116   -6.403  1.00 0.00 ? 250 VAL A HA   2  
ATOM 6285  H HB   . VAL A 1 198 ? -22.716 -0.590  -6.116  1.00 0.00 ? 250 VAL A HB   2  
ATOM 6286  H HG11 . VAL A 1 198 ? -20.076 -1.010  -7.580  1.00 0.00 ? 250 VAL A HG11 2  
ATOM 6287  H HG12 . VAL A 1 198 ? -21.419 -2.173  -7.510  1.00 0.00 ? 250 VAL A HG12 2  
ATOM 6288  H HG13 . VAL A 1 198 ? -21.636 -0.620  -8.346  1.00 0.00 ? 250 VAL A HG13 2  
ATOM 6289  H HG21 . VAL A 1 198 ? -21.341 -0.868  -4.088  1.00 0.00 ? 250 VAL A HG21 2  
ATOM 6290  H HG22 . VAL A 1 198 ? -21.243 -2.307  -5.120  1.00 0.00 ? 250 VAL A HG22 2  
ATOM 6291  H HG23 . VAL A 1 198 ? -19.899 -1.143  -5.101  1.00 0.00 ? 250 VAL A HG23 2  
ATOM 6292  N N    . LYS A 1 199 ? -21.415 2.249   -8.281  1.00 0.00 ? 251 LYS A N    2  
ATOM 6293  C CA   . LYS A 1 199 ? -22.076 2.972   -9.361  1.00 0.00 ? 251 LYS A CA   2  
ATOM 6294  C C    . LYS A 1 199 ? -21.194 2.943   -10.610 1.00 0.00 ? 251 LYS A C    2  
ATOM 6295  O O    . LYS A 1 199 ? -19.999 2.680   -10.491 1.00 0.00 ? 251 LYS A O    2  
ATOM 6296  C CB   . LYS A 1 199 ? -22.435 4.389   -8.882  1.00 0.00 ? 251 LYS A CB   2  
ATOM 6297  C CG   . LYS A 1 199 ? -21.331 5.161   -8.152  1.00 0.00 ? 251 LYS A CG   2  
ATOM 6298  C CD   . LYS A 1 199 ? -20.266 5.689   -9.114  1.00 0.00 ? 251 LYS A CD   2  
ATOM 6299  C CE   . LYS A 1 199 ? -19.339 6.653   -8.375  1.00 0.00 ? 251 LYS A CE   2  
ATOM 6300  N NZ   . LYS A 1 199 ? -18.302 7.191   -9.277  1.00 0.00 ? 251 LYS A NZ   2  
ATOM 6301  H H    . LYS A 1 199 ? -20.413 2.134   -8.333  1.00 0.00 ? 251 LYS A H    2  
ATOM 6302  H HA   . LYS A 1 199 ? -23.007 2.459   -9.607  1.00 0.00 ? 251 LYS A HA   2  
ATOM 6303  H HB2  . LYS A 1 199 ? -22.771 4.998   -9.721  1.00 0.00 ? 251 LYS A HB2  2  
ATOM 6304  H HB3  . LYS A 1 199 ? -23.279 4.280   -8.200  1.00 0.00 ? 251 LYS A HB3  2  
ATOM 6305  H HG2  . LYS A 1 199 ? -21.791 6.015   -7.657  1.00 0.00 ? 251 LYS A HG2  2  
ATOM 6306  H HG3  . LYS A 1 199 ? -20.867 4.532   -7.393  1.00 0.00 ? 251 LYS A HG3  2  
ATOM 6307  H HD2  . LYS A 1 199 ? -19.682 4.856   -9.508  1.00 0.00 ? 251 LYS A HD2  2  
ATOM 6308  H HD3  . LYS A 1 199 ? -20.751 6.216   -9.936  1.00 0.00 ? 251 LYS A HD3  2  
ATOM 6309  H HE2  . LYS A 1 199 ? -19.929 7.476   -7.973  1.00 0.00 ? 251 LYS A HE2  2  
ATOM 6310  H HE3  . LYS A 1 199 ? -18.864 6.130   -7.545  1.00 0.00 ? 251 LYS A HE3  2  
ATOM 6311  H HZ1  . LYS A 1 199 ? -17.743 6.436   -9.648  1.00 0.00 ? 251 LYS A HZ1  2  
ATOM 6312  H HZ2  . LYS A 1 199 ? -18.736 7.688   -10.042 1.00 0.00 ? 251 LYS A HZ2  2  
ATOM 6313  H HZ3  . LYS A 1 199 ? -17.704 7.826   -8.769  1.00 0.00 ? 251 LYS A HZ3  2  
ATOM 6314  N N    . PRO A 1 200 ? -21.740 3.202   -11.809 1.00 0.00 ? 252 PRO A N    2  
ATOM 6315  C CA   . PRO A 1 200 ? -20.996 3.076   -13.053 1.00 0.00 ? 252 PRO A CA   2  
ATOM 6316  C C    . PRO A 1 200 ? -19.793 4.015   -13.107 1.00 0.00 ? 252 PRO A C    2  
ATOM 6317  O O    . PRO A 1 200 ? -19.752 5.039   -12.427 1.00 0.00 ? 252 PRO A O    2  
ATOM 6318  C CB   . PRO A 1 200 ? -21.998 3.365   -14.170 1.00 0.00 ? 252 PRO A CB   2  
ATOM 6319  C CG   . PRO A 1 200 ? -23.063 4.216   -13.482 1.00 0.00 ? 252 PRO A CG   2  
ATOM 6320  C CD   . PRO A 1 200 ? -23.104 3.625   -12.076 1.00 0.00 ? 252 PRO A CD   2  
ATOM 6321  H HA   . PRO A 1 200 ? -20.639 2.052   -13.158 1.00 0.00 ? 252 PRO A HA   2  
ATOM 6322  H HB2  . PRO A 1 200 ? -21.539 3.891   -15.008 1.00 0.00 ? 252 PRO A HB2  2  
ATOM 6323  H HB3  . PRO A 1 200 ? -22.448 2.429   -14.502 1.00 0.00 ? 252 PRO A HB3  2  
ATOM 6324  H HG2  . PRO A 1 200 ? -22.728 5.253   -13.434 1.00 0.00 ? 252 PRO A HG2  2  
ATOM 6325  H HG3  . PRO A 1 200 ? -24.029 4.141   -13.982 1.00 0.00 ? 252 PRO A HG3  2  
ATOM 6326  H HD2  . PRO A 1 200 ? -23.456 4.376   -11.370 1.00 0.00 ? 252 PRO A HD2  2  
ATOM 6327  H HD3  . PRO A 1 200 ? -23.764 2.758   -12.065 1.00 0.00 ? 252 PRO A HD3  2  
ATOM 6328  N N    . TYR A 1 201 ? -18.810 3.646   -13.932 1.00 0.00 ? 253 TYR A N    2  
ATOM 6329  C CA   . TYR A 1 201 ? -17.560 4.369   -14.076 1.00 0.00 ? 253 TYR A CA   2  
ATOM 6330  C C    . TYR A 1 201 ? -17.746 5.667   -14.865 1.00 0.00 ? 253 TYR A C    2  
ATOM 6331  O O    . TYR A 1 201 ? -18.744 5.837   -15.565 1.00 0.00 ? 253 TYR A O    2  
ATOM 6332  C CB   . TYR A 1 201 ? -16.560 3.428   -14.747 1.00 0.00 ? 253 TYR A CB   2  
ATOM 6333  C CG   . TYR A 1 201 ? -15.140 3.933   -14.785 1.00 0.00 ? 253 TYR A CG   2  
ATOM 6334  C CD1  . TYR A 1 201 ? -14.463 4.205   -13.588 1.00 0.00 ? 253 TYR A CD1  2  
ATOM 6335  C CD2  . TYR A 1 201 ? -14.500 4.122   -16.017 1.00 0.00 ? 253 TYR A CD2  2  
ATOM 6336  C CE1  . TYR A 1 201 ? -13.140 4.662   -13.620 1.00 0.00 ? 253 TYR A CE1  2  
ATOM 6337  C CE2  . TYR A 1 201 ? -13.176 4.577   -16.056 1.00 0.00 ? 253 TYR A CE2  2  
ATOM 6338  C CZ   . TYR A 1 201 ? -12.490 4.851   -14.855 1.00 0.00 ? 253 TYR A CZ   2  
ATOM 6339  O OH   . TYR A 1 201 ? -11.201 5.295   -14.890 1.00 0.00 ? 253 TYR A OH   2  
ATOM 6340  H H    . TYR A 1 201 ? -18.921 2.815   -14.495 1.00 0.00 ? 253 TYR A H    2  
ATOM 6341  H HA   . TYR A 1 201 ? -17.186 4.616   -13.083 1.00 0.00 ? 253 TYR A HA   2  
ATOM 6342  H HB2  . TYR A 1 201 ? -16.562 2.486   -14.198 1.00 0.00 ? 253 TYR A HB2  2  
ATOM 6343  H HB3  . TYR A 1 201 ? -16.896 3.228   -15.764 1.00 0.00 ? 253 TYR A HB3  2  
ATOM 6344  H HD1  . TYR A 1 201 ? -14.961 4.062   -12.640 1.00 0.00 ? 253 TYR A HD1  2  
ATOM 6345  H HD2  . TYR A 1 201 ? -15.027 3.918   -16.938 1.00 0.00 ? 253 TYR A HD2  2  
ATOM 6346  H HE1  . TYR A 1 201 ? -12.622 4.870   -12.694 1.00 0.00 ? 253 TYR A HE1  2  
ATOM 6347  H HE2  . TYR A 1 201 ? -12.686 4.718   -17.008 1.00 0.00 ? 253 TYR A HE2  2  
ATOM 6348  H HH   . TYR A 1 201 ? -10.835 5.443   -14.015 1.00 0.00 ? 253 TYR A HH   2  
ATOM 6349  N N    . VAL A 1 202 ? -16.777 6.581   -14.747 1.00 0.00 ? 254 VAL A N    2  
ATOM 6350  C CA   . VAL A 1 202 ? -16.825 7.895   -15.377 1.00 0.00 ? 254 VAL A CA   2  
ATOM 6351  C C    . VAL A 1 202 ? -16.533 7.793   -16.871 1.00 0.00 ? 254 VAL A C    2  
ATOM 6352  O O    . VAL A 1 202 ? -15.488 7.201   -17.220 1.00 0.00 ? 254 VAL A O    2  
ATOM 6353  C CB   . VAL A 1 202 ? -15.838 8.840   -14.684 1.00 0.00 ? 254 VAL A CB   2  
ATOM 6354  C CG1  . VAL A 1 202 ? -15.923 10.236  -15.303 1.00 0.00 ? 254 VAL A CG1  2  
ATOM 6355  C CG2  . VAL A 1 202 ? -16.166 8.953   -13.195 1.00 0.00 ? 254 VAL A CG2  2  
ATOM 6356  H H    . VAL A 1 202 ? -15.962 6.361   -14.191 1.00 0.00 ? 254 VAL A H    2  
ATOM 6357  H HA   . VAL A 1 202 ? -17.830 8.300   -15.257 1.00 0.00 ? 254 VAL A HA   2  
ATOM 6358  H HB   . VAL A 1 202 ? -14.824 8.459   -14.800 1.00 0.00 ? 254 VAL A HB   2  
ATOM 6359  H HG11 . VAL A 1 202 ? -16.940 10.618  -15.207 1.00 0.00 ? 254 VAL A HG11 2  
ATOM 6360  H HG12 . VAL A 1 202 ? -15.235 10.905  -14.787 1.00 0.00 ? 254 VAL A HG12 2  
ATOM 6361  H HG13 . VAL A 1 202 ? -15.650 10.191  -16.357 1.00 0.00 ? 254 VAL A HG13 2  
ATOM 6362  H HG21 . VAL A 1 202 ? -16.064 7.979   -12.716 1.00 0.00 ? 254 VAL A HG21 2  
ATOM 6363  H HG22 . VAL A 1 202 ? -15.477 9.654   -12.723 1.00 0.00 ? 254 VAL A HG22 2  
ATOM 6364  H HG23 . VAL A 1 202 ? -17.187 9.314   -13.067 1.00 0.00 ? 254 VAL A HG23 2  
ATOM 6365  N N    . SER A 1 1   ? 20.322  -22.661 -13.924 1.00 0.00 ? 53  SER A N    3  
ATOM 6366  C CA   . SER A 1 1   ? 19.801  -21.560 -13.093 1.00 0.00 ? 53  SER A CA   3  
ATOM 6367  C C    . SER A 1 1   ? 19.294  -22.092 -11.757 1.00 0.00 ? 53  SER A C    3  
ATOM 6368  O O    . SER A 1 1   ? 19.102  -23.296 -11.598 1.00 0.00 ? 53  SER A O    3  
ATOM 6369  C CB   . SER A 1 1   ? 18.693  -20.804 -13.827 1.00 0.00 ? 53  SER A CB   3  
ATOM 6370  O OG   . SER A 1 1   ? 18.297  -19.677 -13.074 1.00 0.00 ? 53  SER A OG   3  
ATOM 6371  H H1   . SER A 1 1   ? 21.070  -23.131 -13.434 1.00 0.00 ? 53  SER A H1   3  
ATOM 6372  H H2   . SER A 1 1   ? 20.675  -22.291 -14.796 1.00 0.00 ? 53  SER A H2   3  
ATOM 6373  H H3   . SER A 1 1   ? 19.584  -23.324 -14.114 1.00 0.00 ? 53  SER A H3   3  
ATOM 6374  H HA   . SER A 1 1   ? 20.616  -20.865 -12.896 1.00 0.00 ? 53  SER A HA   3  
ATOM 6375  H HB2  . SER A 1 1   ? 19.063  -20.471 -14.798 1.00 0.00 ? 53  SER A HB2  3  
ATOM 6376  H HB3  . SER A 1 1   ? 17.837  -21.462 -13.976 1.00 0.00 ? 53  SER A HB3  3  
ATOM 6377  H HG   . SER A 1 1   ? 17.607  -19.217 -13.556 1.00 0.00 ? 53  SER A HG   3  
ATOM 6378  N N    . HIS A 1 2   ? 19.076  -21.190 -10.796 1.00 0.00 ? 54  HIS A N    3  
ATOM 6379  C CA   . HIS A 1 2   ? 18.612  -21.535 -9.458  1.00 0.00 ? 54  HIS A CA   3  
ATOM 6380  C C    . HIS A 1 2   ? 17.498  -20.592 -9.002  1.00 0.00 ? 54  HIS A C    3  
ATOM 6381  O O    . HIS A 1 2   ? 17.140  -20.581 -7.826  1.00 0.00 ? 54  HIS A O    3  
ATOM 6382  C CB   . HIS A 1 2   ? 19.795  -21.513 -8.487  1.00 0.00 ? 54  HIS A CB   3  
ATOM 6383  C CG   . HIS A 1 2   ? 20.893  -22.470 -8.871  1.00 0.00 ? 54  HIS A CG   3  
ATOM 6384  N ND1  . HIS A 1 2   ? 22.044  -22.135 -9.590  1.00 0.00 ? 54  HIS A ND1  3  
ATOM 6385  C CD2  . HIS A 1 2   ? 20.921  -23.802 -8.571  1.00 0.00 ? 54  HIS A CD2  3  
ATOM 6386  C CE1  . HIS A 1 2   ? 22.737  -23.280 -9.704  1.00 0.00 ? 54  HIS A CE1  3  
ATOM 6387  N NE2  . HIS A 1 2   ? 22.089  -24.295 -9.103  1.00 0.00 ? 54  HIS A NE2  3  
ATOM 6388  H H    . HIS A 1 2   ? 19.242  -20.214 -10.997 1.00 0.00 ? 54  HIS A H    3  
ATOM 6389  H HA   . HIS A 1 2   ? 18.203  -22.545 -9.481  1.00 0.00 ? 54  HIS A HA   3  
ATOM 6390  H HB2  . HIS A 1 2   ? 20.206  -20.503 -8.451  1.00 0.00 ? 54  HIS A HB2  3  
ATOM 6391  H HB3  . HIS A 1 2   ? 19.440  -21.775 -7.490  1.00 0.00 ? 54  HIS A HB3  3  
ATOM 6392  H HD2  . HIS A 1 2   ? 20.172  -24.356 -8.024  1.00 0.00 ? 54  HIS A HD2  3  
ATOM 6393  H HE1  . HIS A 1 2   ? 23.686  -23.374 -10.210 1.00 0.00 ? 54  HIS A HE1  3  
ATOM 6394  H HE2  . HIS A 1 2   ? 22.407  -25.252 -9.054  1.00 0.00 ? 54  HIS A HE2  3  
ATOM 6395  N N    . GLN A 1 3   ? 16.950  -19.798 -9.928  1.00 0.00 ? 55  GLN A N    3  
ATOM 6396  C CA   . GLN A 1 3   ? 15.900  -18.834 -9.632  1.00 0.00 ? 55  GLN A CA   3  
ATOM 6397  C C    . GLN A 1 3   ? 14.905  -18.773 -10.794 1.00 0.00 ? 55  GLN A C    3  
ATOM 6398  O O    . GLN A 1 3   ? 15.272  -19.011 -11.945 1.00 0.00 ? 55  GLN A O    3  
ATOM 6399  C CB   . GLN A 1 3   ? 16.549  -17.472 -9.358  1.00 0.00 ? 55  GLN A CB   3  
ATOM 6400  C CG   . GLN A 1 3   ? 15.532  -16.393 -8.975  1.00 0.00 ? 55  GLN A CG   3  
ATOM 6401  C CD   . GLN A 1 3   ? 14.710  -16.796 -7.757  1.00 0.00 ? 55  GLN A CD   3  
ATOM 6402  O OE1  . GLN A 1 3   ? 13.572  -17.237 -7.891  1.00 0.00 ? 55  GLN A OE1  3  
ATOM 6403  N NE2  . GLN A 1 3   ? 15.276  -16.648 -6.562  1.00 0.00 ? 55  GLN A NE2  3  
ATOM 6404  H H    . GLN A 1 3   ? 17.271  -19.859 -10.884 1.00 0.00 ? 55  GLN A H    3  
ATOM 6405  H HA   . GLN A 1 3   ? 15.366  -19.156 -8.738  1.00 0.00 ? 55  GLN A HA   3  
ATOM 6406  H HB2  . GLN A 1 3   ? 17.264  -17.582 -8.542  1.00 0.00 ? 55  GLN A HB2  3  
ATOM 6407  H HB3  . GLN A 1 3   ? 17.087  -17.148 -10.248 1.00 0.00 ? 55  GLN A HB3  3  
ATOM 6408  H HG2  . GLN A 1 3   ? 16.066  -15.470 -8.752  1.00 0.00 ? 55  GLN A HG2  3  
ATOM 6409  H HG3  . GLN A 1 3   ? 14.864  -16.207 -9.817  1.00 0.00 ? 55  GLN A HG3  3  
ATOM 6410  H HE21 . GLN A 1 3   ? 16.214  -16.281 -6.487  1.00 0.00 ? 55  GLN A HE21 3  
ATOM 6411  H HE22 . GLN A 1 3   ? 14.762  -16.906 -5.732  1.00 0.00 ? 55  GLN A HE22 3  
ATOM 6412  N N    . ASN A 1 4   ? 13.643  -18.451 -10.491 1.00 0.00 ? 56  ASN A N    3  
ATOM 6413  C CA   . ASN A 1 4   ? 12.578  -18.374 -11.482 1.00 0.00 ? 56  ASN A CA   3  
ATOM 6414  C C    . ASN A 1 4   ? 11.656  -17.176 -11.219 1.00 0.00 ? 56  ASN A C    3  
ATOM 6415  O O    . ASN A 1 4   ? 10.612  -17.039 -11.854 1.00 0.00 ? 56  ASN A O    3  
ATOM 6416  C CB   . ASN A 1 4   ? 11.797  -19.693 -11.456 1.00 0.00 ? 56  ASN A CB   3  
ATOM 6417  C CG   . ASN A 1 4   ? 10.842  -19.829 -12.636 1.00 0.00 ? 56  ASN A CG   3  
ATOM 6418  O OD1  . ASN A 1 4   ? 11.088  -19.300 -13.716 1.00 0.00 ? 56  ASN A OD1  3  
ATOM 6419  N ND2  . ASN A 1 4   ? 9.740   -20.544 -12.433 1.00 0.00 ? 56  ASN A ND2  3  
ATOM 6420  H H    . ASN A 1 4   ? 13.405  -18.252 -9.530  1.00 0.00 ? 56  ASN A H    3  
ATOM 6421  H HA   . ASN A 1 4   ? 13.028  -18.250 -12.466 1.00 0.00 ? 56  ASN A HA   3  
ATOM 6422  H HB2  . ASN A 1 4   ? 12.499  -20.527 -11.488 1.00 0.00 ? 56  ASN A HB2  3  
ATOM 6423  H HB3  . ASN A 1 4   ? 11.232  -19.757 -10.526 1.00 0.00 ? 56  ASN A HB3  3  
ATOM 6424  H HD21 . ASN A 1 4   ? 9.565   -20.953 -11.527 1.00 0.00 ? 56  ASN A HD21 3  
ATOM 6425  H HD22 . ASN A 1 4   ? 9.080   -20.674 -13.187 1.00 0.00 ? 56  ASN A HD22 3  
ATOM 6426  N N    . GLY A 1 5   ? 12.038  -16.304 -10.281 1.00 0.00 ? 57  GLY A N    3  
ATOM 6427  C CA   . GLY A 1 5   ? 11.246  -15.137 -9.916  1.00 0.00 ? 57  GLY A CA   3  
ATOM 6428  C C    . GLY A 1 5   ? 10.138  -15.489 -8.926  1.00 0.00 ? 57  GLY A C    3  
ATOM 6429  O O    . GLY A 1 5   ? 9.325   -14.634 -8.581  1.00 0.00 ? 57  GLY A O    3  
ATOM 6430  H H    . GLY A 1 5   ? 12.910  -16.447 -9.792  1.00 0.00 ? 57  GLY A H    3  
ATOM 6431  H HA2  . GLY A 1 5   ? 11.903  -14.396 -9.461  1.00 0.00 ? 57  GLY A HA2  3  
ATOM 6432  H HA3  . GLY A 1 5   ? 10.800  -14.712 -10.816 1.00 0.00 ? 57  GLY A HA3  3  
ATOM 6433  N N    . GLU A 1 6   ? 10.100  -16.743 -8.466  1.00 0.00 ? 58  GLU A N    3  
ATOM 6434  C CA   . GLU A 1 6   ? 9.102   -17.208 -7.514  1.00 0.00 ? 58  GLU A CA   3  
ATOM 6435  C C    . GLU A 1 6   ? 9.509   -16.844 -6.086  1.00 0.00 ? 58  GLU A C    3  
ATOM 6436  O O    . GLU A 1 6   ? 10.658  -16.483 -5.833  1.00 0.00 ? 58  GLU A O    3  
ATOM 6437  C CB   . GLU A 1 6   ? 8.918   -18.722 -7.654  1.00 0.00 ? 58  GLU A CB   3  
ATOM 6438  C CG   . GLU A 1 6   ? 8.370   -19.078 -9.035  1.00 0.00 ? 58  GLU A CG   3  
ATOM 6439  C CD   . GLU A 1 6   ? 8.151   -20.585 -9.166  1.00 0.00 ? 58  GLU A CD   3  
ATOM 6440  O OE1  . GLU A 1 6   ? 7.126   -21.069 -8.637  1.00 0.00 ? 58  GLU A OE1  3  
ATOM 6441  O OE2  . GLU A 1 6   ? 9.012   -21.240 -9.793  1.00 0.00 ? 58  GLU A OE2  3  
ATOM 6442  H H    . GLU A 1 6   ? 10.791  -17.407 -8.786  1.00 0.00 ? 58  GLU A H    3  
ATOM 6443  H HA   . GLU A 1 6   ? 8.149   -16.727 -7.731  1.00 0.00 ? 58  GLU A HA   3  
ATOM 6444  H HB2  . GLU A 1 6   ? 9.877   -19.219 -7.502  1.00 0.00 ? 58  GLU A HB2  3  
ATOM 6445  H HB3  . GLU A 1 6   ? 8.216   -19.067 -6.895  1.00 0.00 ? 58  GLU A HB3  3  
ATOM 6446  H HG2  . GLU A 1 6   ? 7.420   -18.564 -9.184  1.00 0.00 ? 58  GLU A HG2  3  
ATOM 6447  H HG3  . GLU A 1 6   ? 9.072   -18.747 -9.800  1.00 0.00 ? 58  GLU A HG3  3  
ATOM 6448  N N    . ARG A 1 7   ? 8.555   -16.939 -5.152  1.00 0.00 ? 59  ARG A N    3  
ATOM 6449  C CA   . ARG A 1 7   ? 8.758   -16.625 -3.739  1.00 0.00 ? 59  ARG A CA   3  
ATOM 6450  C C    . ARG A 1 7   ? 9.285   -15.206 -3.500  1.00 0.00 ? 59  ARG A C    3  
ATOM 6451  O O    . ARG A 1 7   ? 9.815   -14.921 -2.427  1.00 0.00 ? 59  ARG A O    3  
ATOM 6452  C CB   . ARG A 1 7   ? 9.631   -17.692 -3.069  1.00 0.00 ? 59  ARG A CB   3  
ATOM 6453  C CG   . ARG A 1 7   ? 9.017   -19.085 -3.222  1.00 0.00 ? 59  ARG A CG   3  
ATOM 6454  C CD   . ARG A 1 7   ? 9.893   -20.108 -2.501  1.00 0.00 ? 59  ARG A CD   3  
ATOM 6455  N NE   . ARG A 1 7   ? 9.339   -21.461 -2.623  1.00 0.00 ? 59  ARG A NE   3  
ATOM 6456  C CZ   . ARG A 1 7   ? 9.894   -22.548 -2.081  1.00 0.00 ? 59  ARG A CZ   3  
ATOM 6457  N NH1  . ARG A 1 7   ? 11.023  -22.457 -1.381  1.00 0.00 ? 59  ARG A NH1  3  
ATOM 6458  N NH2  . ARG A 1 7   ? 9.320   -23.738 -2.239  1.00 0.00 ? 59  ARG A NH2  3  
ATOM 6459  H H    . ARG A 1 7   ? 7.633   -17.245 -5.429  1.00 0.00 ? 59  ARG A H    3  
ATOM 6460  H HA   . ARG A 1 7   ? 7.777   -16.666 -3.266  1.00 0.00 ? 59  ARG A HA   3  
ATOM 6461  H HB2  . ARG A 1 7   ? 10.624  -17.683 -3.518  1.00 0.00 ? 59  ARG A HB2  3  
ATOM 6462  H HB3  . ARG A 1 7   ? 9.720   -17.462 -2.007  1.00 0.00 ? 59  ARG A HB3  3  
ATOM 6463  H HG2  . ARG A 1 7   ? 8.016   -19.094 -2.790  1.00 0.00 ? 59  ARG A HG2  3  
ATOM 6464  H HG3  . ARG A 1 7   ? 8.957   -19.347 -4.278  1.00 0.00 ? 59  ARG A HG3  3  
ATOM 6465  H HD2  . ARG A 1 7   ? 10.892  -20.087 -2.935  1.00 0.00 ? 59  ARG A HD2  3  
ATOM 6466  H HD3  . ARG A 1 7   ? 9.958   -19.840 -1.446  1.00 0.00 ? 59  ARG A HD3  3  
ATOM 6467  H HE   . ARG A 1 7   ? 8.484   -21.569 -3.152  1.00 0.00 ? 59  ARG A HE   3  
ATOM 6468  H HH11 . ARG A 1 7   ? 11.466  -21.558 -1.254  1.00 0.00 ? 59  ARG A HH11 3  
ATOM 6469  H HH12 . ARG A 1 7   ? 11.436  -23.285 -0.976  1.00 0.00 ? 59  ARG A HH12 3  
ATOM 6470  H HH21 . ARG A 1 7   ? 8.465   -23.819 -2.769  1.00 0.00 ? 59  ARG A HH21 3  
ATOM 6471  H HH22 . ARG A 1 7   ? 9.739   -24.560 -1.828  1.00 0.00 ? 59  ARG A HH22 3  
ATOM 6472  N N    . VAL A 1 8   ? 9.144   -14.315 -4.487  1.00 0.00 ? 60  VAL A N    3  
ATOM 6473  C CA   . VAL A 1 8   ? 9.551   -12.920 -4.366  1.00 0.00 ? 60  VAL A CA   3  
ATOM 6474  C C    . VAL A 1 8   ? 8.475   -12.017 -4.958  1.00 0.00 ? 60  VAL A C    3  
ATOM 6475  O O    . VAL A 1 8   ? 7.827   -12.372 -5.942  1.00 0.00 ? 60  VAL A O    3  
ATOM 6476  C CB   . VAL A 1 8   ? 10.903  -12.684 -5.052  1.00 0.00 ? 60  VAL A CB   3  
ATOM 6477  C CG1  . VAL A 1 8   ? 11.305  -11.210 -4.958  1.00 0.00 ? 60  VAL A CG1  3  
ATOM 6478  C CG2  . VAL A 1 8   ? 12.001  -13.515 -4.387  1.00 0.00 ? 60  VAL A CG2  3  
ATOM 6479  H H    . VAL A 1 8   ? 8.733   -14.610 -5.362  1.00 0.00 ? 60  VAL A H    3  
ATOM 6480  H HA   . VAL A 1 8   ? 9.656   -12.671 -3.309  1.00 0.00 ? 60  VAL A HA   3  
ATOM 6481  H HB   . VAL A 1 8   ? 10.830  -12.964 -6.102  1.00 0.00 ? 60  VAL A HB   3  
ATOM 6482  H HG11 . VAL A 1 8   ? 11.321  -10.898 -3.914  1.00 0.00 ? 60  VAL A HG11 3  
ATOM 6483  H HG12 . VAL A 1 8   ? 12.298  -11.074 -5.388  1.00 0.00 ? 60  VAL A HG12 3  
ATOM 6484  H HG13 . VAL A 1 8   ? 10.597  -10.592 -5.510  1.00 0.00 ? 60  VAL A HG13 3  
ATOM 6485  H HG21 . VAL A 1 8   ? 11.771  -14.577 -4.483  1.00 0.00 ? 60  VAL A HG21 3  
ATOM 6486  H HG22 . VAL A 1 8   ? 12.955  -13.315 -4.874  1.00 0.00 ? 60  VAL A HG22 3  
ATOM 6487  H HG23 . VAL A 1 8   ? 12.073  -13.251 -3.333  1.00 0.00 ? 60  VAL A HG23 3  
ATOM 6488  N N    . GLU A 1 9   ? 8.290   -10.843 -4.350  1.00 0.00 ? 61  GLU A N    3  
ATOM 6489  C CA   . GLU A 1 9   ? 7.307   -9.860  -4.777  1.00 0.00 ? 61  GLU A CA   3  
ATOM 6490  C C    . GLU A 1 9   ? 7.968   -8.487  -4.900  1.00 0.00 ? 61  GLU A C    3  
ATOM 6491  O O    . GLU A 1 9   ? 9.106   -8.298  -4.473  1.00 0.00 ? 61  GLU A O    3  
ATOM 6492  C CB   . GLU A 1 9   ? 6.143   -9.806  -3.780  1.00 0.00 ? 61  GLU A CB   3  
ATOM 6493  C CG   . GLU A 1 9   ? 5.313   -11.094 -3.745  1.00 0.00 ? 61  GLU A CG   3  
ATOM 6494  C CD   . GLU A 1 9   ? 6.027   -12.252 -3.044  1.00 0.00 ? 61  GLU A CD   3  
ATOM 6495  O OE1  . GLU A 1 9   ? 6.643   -12.006 -1.982  1.00 0.00 ? 61  GLU A OE1  3  
ATOM 6496  O OE2  . GLU A 1 9   ? 5.951   -13.382 -3.577  1.00 0.00 ? 61  GLU A OE2  3  
ATOM 6497  H H    . GLU A 1 9   ? 8.857   -10.611 -3.548  1.00 0.00 ? 61  GLU A H    3  
ATOM 6498  H HA   . GLU A 1 9   ? 6.914   -10.140 -5.755  1.00 0.00 ? 61  GLU A HA   3  
ATOM 6499  H HB2  . GLU A 1 9   ? 6.529   -9.594  -2.784  1.00 0.00 ? 61  GLU A HB2  3  
ATOM 6500  H HB3  . GLU A 1 9   ? 5.480   -8.992  -4.071  1.00 0.00 ? 61  GLU A HB3  3  
ATOM 6501  H HG2  . GLU A 1 9   ? 4.386   -10.891 -3.210  1.00 0.00 ? 61  GLU A HG2  3  
ATOM 6502  H HG3  . GLU A 1 9   ? 5.059   -11.382 -4.766  1.00 0.00 ? 61  GLU A HG3  3  
ATOM 6503  N N    . ARG A 1 10  ? 7.248   -7.526  -5.489  1.00 0.00 ? 62  ARG A N    3  
ATOM 6504  C CA   . ARG A 1 10  ? 7.740   -6.172  -5.711  1.00 0.00 ? 62  ARG A CA   3  
ATOM 6505  C C    . ARG A 1 10  ? 6.686   -5.153  -5.305  1.00 0.00 ? 62  ARG A C    3  
ATOM 6506  O O    . ARG A 1 10  ? 5.489   -5.397  -5.455  1.00 0.00 ? 62  ARG A O    3  
ATOM 6507  C CB   . ARG A 1 10  ? 8.206   -5.976  -7.155  1.00 0.00 ? 62  ARG A CB   3  
ATOM 6508  C CG   . ARG A 1 10  ? 7.111   -6.119  -8.219  1.00 0.00 ? 62  ARG A CG   3  
ATOM 6509  C CD   . ARG A 1 10  ? 6.476   -7.511  -8.224  1.00 0.00 ? 62  ARG A CD   3  
ATOM 6510  N NE   . ARG A 1 10  ? 5.724   -7.744  -9.461  1.00 0.00 ? 62  ARG A NE   3  
ATOM 6511  C CZ   . ARG A 1 10  ? 4.946   -8.809  -9.679  1.00 0.00 ? 62  ARG A CZ   3  
ATOM 6512  N NH1  . ARG A 1 10  ? 4.808   -9.757  -8.753  1.00 0.00 ? 62  ARG A NH1  3  
ATOM 6513  N NH2  . ARG A 1 10  ? 4.297   -8.930  -10.834 1.00 0.00 ? 62  ARG A NH2  3  
ATOM 6514  H H    . ARG A 1 10  ? 6.310   -7.738  -5.799  1.00 0.00 ? 62  ARG A H    3  
ATOM 6515  H HA   . ARG A 1 10  ? 8.605   -6.019  -5.065  1.00 0.00 ? 62  ARG A HA   3  
ATOM 6516  H HB2  . ARG A 1 10  ? 8.625   -4.973  -7.238  1.00 0.00 ? 62  ARG A HB2  3  
ATOM 6517  H HB3  . ARG A 1 10  ? 8.997   -6.696  -7.363  1.00 0.00 ? 62  ARG A HB3  3  
ATOM 6518  H HG2  . ARG A 1 10  ? 6.337   -5.369  -8.052  1.00 0.00 ? 62  ARG A HG2  3  
ATOM 6519  H HG3  . ARG A 1 10  ? 7.562   -5.938  -9.195  1.00 0.00 ? 62  ARG A HG3  3  
ATOM 6520  H HD2  . ARG A 1 10  ? 7.262   -8.261  -8.137  1.00 0.00 ? 62  ARG A HD2  3  
ATOM 6521  H HD3  . ARG A 1 10  ? 5.804   -7.599  -7.370  1.00 0.00 ? 62  ARG A HD3  3  
ATOM 6522  H HE   . ARG A 1 10  ? 5.805   -7.052  -10.192 1.00 0.00 ? 62  ARG A HE   3  
ATOM 6523  H HH11 . ARG A 1 10  ? 5.299   -9.679  -7.874  1.00 0.00 ? 62  ARG A HH11 3  
ATOM 6524  H HH12 . ARG A 1 10  ? 4.215   -10.554 -8.932  1.00 0.00 ? 62  ARG A HH12 3  
ATOM 6525  H HH21 . ARG A 1 10  ? 4.396   -8.222  -11.546 1.00 0.00 ? 62  ARG A HH21 3  
ATOM 6526  H HH22 . ARG A 1 10  ? 3.706   -9.733  -10.999 1.00 0.00 ? 62  ARG A HH22 3  
ATOM 6527  N N    . TYR A 1 11  ? 7.145   -4.013  -4.788  1.00 0.00 ? 63  TYR A N    3  
ATOM 6528  C CA   . TYR A 1 11  ? 6.266   -3.041  -4.161  1.00 0.00 ? 63  TYR A CA   3  
ATOM 6529  C C    . TYR A 1 11  ? 6.546   -1.613  -4.598  1.00 0.00 ? 63  TYR A C    3  
ATOM 6530  O O    . TYR A 1 11  ? 7.607   -1.310  -5.140  1.00 0.00 ? 63  TYR A O    3  
ATOM 6531  C CB   . TYR A 1 11  ? 6.461   -3.151  -2.648  1.00 0.00 ? 63  TYR A CB   3  
ATOM 6532  C CG   . TYR A 1 11  ? 6.175   -4.536  -2.121  1.00 0.00 ? 63  TYR A CG   3  
ATOM 6533  C CD1  . TYR A 1 11  ? 7.113   -5.562  -2.306  1.00 0.00 ? 63  TYR A CD1  3  
ATOM 6534  C CD2  . TYR A 1 11  ? 4.970   -4.796  -1.454  1.00 0.00 ? 63  TYR A CD2  3  
ATOM 6535  C CE1  . TYR A 1 11  ? 6.835   -6.859  -1.862  1.00 0.00 ? 63  TYR A CE1  3  
ATOM 6536  C CE2  . TYR A 1 11  ? 4.692   -6.088  -0.988  1.00 0.00 ? 63  TYR A CE2  3  
ATOM 6537  C CZ   . TYR A 1 11  ? 5.625   -7.127  -1.190  1.00 0.00 ? 63  TYR A CZ   3  
ATOM 6538  O OH   . TYR A 1 11  ? 5.356   -8.385  -0.739  1.00 0.00 ? 63  TYR A OH   3  
ATOM 6539  H H    . TYR A 1 11  ? 8.135   -3.814  -4.808  1.00 0.00 ? 63  TYR A H    3  
ATOM 6540  H HA   . TYR A 1 11  ? 5.230   -3.283  -4.398  1.00 0.00 ? 63  TYR A HA   3  
ATOM 6541  H HB2  . TYR A 1 11  ? 7.492   -2.892  -2.408  1.00 0.00 ? 63  TYR A HB2  3  
ATOM 6542  H HB3  . TYR A 1 11  ? 5.805   -2.435  -2.152  1.00 0.00 ? 63  TYR A HB3  3  
ATOM 6543  H HD1  . TYR A 1 11  ? 8.054   -5.356  -2.797  1.00 0.00 ? 63  TYR A HD1  3  
ATOM 6544  H HD2  . TYR A 1 11  ? 4.259   -3.998  -1.303  1.00 0.00 ? 63  TYR A HD2  3  
ATOM 6545  H HE1  . TYR A 1 11  ? 7.554   -7.646  -2.039  1.00 0.00 ? 63  TYR A HE1  3  
ATOM 6546  H HE2  . TYR A 1 11  ? 3.762   -6.286  -0.476  1.00 0.00 ? 63  TYR A HE2  3  
ATOM 6547  H HH   . TYR A 1 11  ? 4.509   -8.449  -0.295  1.00 0.00 ? 63  TYR A HH   3  
ATOM 6548  N N    . SER A 1 12  ? 5.571   -0.732  -4.353  1.00 0.00 ? 64  SER A N    3  
ATOM 6549  C CA   . SER A 1 12  ? 5.758   0.689   -4.548  1.00 0.00 ? 64  SER A CA   3  
ATOM 6550  C C    . SER A 1 12  ? 6.663   1.171   -3.436  1.00 0.00 ? 64  SER A C    3  
ATOM 6551  O O    . SER A 1 12  ? 6.411   0.888   -2.260  1.00 0.00 ? 64  SER A O    3  
ATOM 6552  C CB   . SER A 1 12  ? 4.440   1.458   -4.502  1.00 0.00 ? 64  SER A CB   3  
ATOM 6553  O OG   . SER A 1 12  ? 4.707   2.837   -4.642  1.00 0.00 ? 64  SER A OG   3  
ATOM 6554  H H    . SER A 1 12  ? 4.676   -1.053  -4.014  1.00 0.00 ? 64  SER A H    3  
ATOM 6555  H HA   . SER A 1 12  ? 6.238   0.862   -5.512  1.00 0.00 ? 64  SER A HA   3  
ATOM 6556  H HB2  . SER A 1 12  ? 3.781   1.134   -5.308  1.00 0.00 ? 64  SER A HB2  3  
ATOM 6557  H HB3  . SER A 1 12  ? 3.960   1.285   -3.539  1.00 0.00 ? 64  SER A HB3  3  
ATOM 6558  H HG   . SER A 1 12  ? 3.870   3.307   -4.677  1.00 0.00 ? 64  SER A HG   3  
ATOM 6559  N N    . ARG A 1 13  ? 7.702   1.894   -3.858  1.00 0.00 ? 65  ARG A N    3  
ATOM 6560  C CA   . ARG A 1 13  ? 8.699   2.451   -2.955  1.00 0.00 ? 65  ARG A CA   3  
ATOM 6561  C C    . ARG A 1 13  ? 8.118   3.520   -2.032  1.00 0.00 ? 65  ARG A C    3  
ATOM 6562  O O    . ARG A 1 13  ? 8.834   4.035   -1.177  1.00 0.00 ? 65  ARG A O    3  
ATOM 6563  C CB   . ARG A 1 13  ? 9.873   3.021   -3.757  1.00 0.00 ? 65  ARG A CB   3  
ATOM 6564  C CG   . ARG A 1 13  ? 9.444   4.224   -4.602  1.00 0.00 ? 65  ARG A CG   3  
ATOM 6565  C CD   . ARG A 1 13  ? 10.661  4.828   -5.297  1.00 0.00 ? 65  ARG A CD   3  
ATOM 6566  N NE   . ARG A 1 13  ? 10.270  5.965   -6.137  1.00 0.00 ? 65  ARG A NE   3  
ATOM 6567  C CZ   . ARG A 1 13  ? 10.952  7.112   -6.232  1.00 0.00 ? 65  ARG A CZ   3  
ATOM 6568  N NH1  . ARG A 1 13  ? 12.073  7.309   -5.541  1.00 0.00 ? 65  ARG A NH1  3  
ATOM 6569  N NH2  . ARG A 1 13  ? 10.508  8.078   -7.031  1.00 0.00 ? 65  ARG A NH2  3  
ATOM 6570  H H    . ARG A 1 13  ? 7.814   2.066   -4.846  1.00 0.00 ? 65  ARG A H    3  
ATOM 6571  H HA   . ARG A 1 13  ? 9.064   1.633   -2.333  1.00 0.00 ? 65  ARG A HA   3  
ATOM 6572  H HB2  . ARG A 1 13  ? 10.655  3.333   -3.066  1.00 0.00 ? 65  ARG A HB2  3  
ATOM 6573  H HB3  . ARG A 1 13  ? 10.273  2.248   -4.414  1.00 0.00 ? 65  ARG A HB3  3  
ATOM 6574  H HG2  . ARG A 1 13  ? 8.718   3.906   -5.350  1.00 0.00 ? 65  ARG A HG2  3  
ATOM 6575  H HG3  . ARG A 1 13  ? 8.991   4.981   -3.963  1.00 0.00 ? 65  ARG A HG3  3  
ATOM 6576  H HD2  . ARG A 1 13  ? 11.374  5.152   -4.538  1.00 0.00 ? 65  ARG A HD2  3  
ATOM 6577  H HD3  . ARG A 1 13  ? 11.132  4.068   -5.921  1.00 0.00 ? 65  ARG A HD3  3  
ATOM 6578  H HE   . ARG A 1 13  ? 9.426   5.867   -6.681  1.00 0.00 ? 65  ARG A HE   3  
ATOM 6579  H HH11 . ARG A 1 13  ? 12.424  6.589   -4.925  1.00 0.00 ? 65  ARG A HH11 3  
ATOM 6580  H HH12 . ARG A 1 13  ? 12.574  8.181   -5.631  1.00 0.00 ? 65  ARG A HH12 3  
ATOM 6581  H HH21 . ARG A 1 13  ? 9.659   7.946   -7.562  1.00 0.00 ? 65  ARG A HH21 3  
ATOM 6582  H HH22 . ARG A 1 13  ? 11.019  8.945   -7.107  1.00 0.00 ? 65  ARG A HH22 3  
ATOM 6583  N N    . LYS A 1 14  ? 6.834   3.858   -2.190  1.00 0.00 ? 66  LYS A N    3  
ATOM 6584  C CA   . LYS A 1 14  ? 6.167   4.730   -1.237  1.00 0.00 ? 66  LYS A CA   3  
ATOM 6585  C C    . LYS A 1 14  ? 5.837   3.887   -0.014  1.00 0.00 ? 66  LYS A C    3  
ATOM 6586  O O    . LYS A 1 14  ? 4.995   2.992   -0.077  1.00 0.00 ? 66  LYS A O    3  
ATOM 6587  C CB   . LYS A 1 14  ? 4.930   5.371   -1.867  1.00 0.00 ? 66  LYS A CB   3  
ATOM 6588  C CG   . LYS A 1 14  ? 4.285   6.324   -0.858  1.00 0.00 ? 66  LYS A CG   3  
ATOM 6589  C CD   . LYS A 1 14  ? 3.158   7.116   -1.518  1.00 0.00 ? 66  LYS A CD   3  
ATOM 6590  C CE   . LYS A 1 14  ? 2.499   8.019   -0.476  1.00 0.00 ? 66  LYS A CE   3  
ATOM 6591  N NZ   . LYS A 1 14  ? 1.417   8.821   -1.076  1.00 0.00 ? 66  LYS A NZ   3  
ATOM 6592  H H    . LYS A 1 14  ? 6.306   3.501   -2.974  1.00 0.00 ? 66  LYS A H    3  
ATOM 6593  H HA   . LYS A 1 14  ? 6.852   5.521   -0.934  1.00 0.00 ? 66  LYS A HA   3  
ATOM 6594  H HB2  . LYS A 1 14  ? 5.231   5.933   -2.751  1.00 0.00 ? 66  LYS A HB2  3  
ATOM 6595  H HB3  . LYS A 1 14  ? 4.218   4.599   -2.158  1.00 0.00 ? 66  LYS A HB3  3  
ATOM 6596  H HG2  . LYS A 1 14  ? 3.885   5.749   -0.023  1.00 0.00 ? 66  LYS A HG2  3  
ATOM 6597  H HG3  . LYS A 1 14  ? 5.038   7.019   -0.487  1.00 0.00 ? 66  LYS A HG3  3  
ATOM 6598  H HD2  . LYS A 1 14  ? 3.566   7.727   -2.323  1.00 0.00 ? 66  LYS A HD2  3  
ATOM 6599  H HD3  . LYS A 1 14  ? 2.417   6.428   -1.925  1.00 0.00 ? 66  LYS A HD3  3  
ATOM 6600  H HE2  . LYS A 1 14  ? 2.092   7.398   0.323   1.00 0.00 ? 66  LYS A HE2  3  
ATOM 6601  H HE3  . LYS A 1 14  ? 3.252   8.684   -0.053  1.00 0.00 ? 66  LYS A HE3  3  
ATOM 6602  H HZ1  . LYS A 1 14  ? 0.717   8.210   -1.473  1.00 0.00 ? 66  LYS A HZ1  3  
ATOM 6603  H HZ2  . LYS A 1 14  ? 0.986   9.400   -0.370  1.00 0.00 ? 66  LYS A HZ2  3  
ATOM 6604  H HZ3  . LYS A 1 14  ? 1.791   9.415   -1.802  1.00 0.00 ? 66  LYS A HZ3  3  
ATOM 6605  N N    . VAL A 1 15  ? 6.510   4.184   1.097   1.00 0.00 ? 67  VAL A N    3  
ATOM 6606  C CA   . VAL A 1 15  ? 6.431   3.383   2.305   1.00 0.00 ? 67  VAL A CA   3  
ATOM 6607  C C    . VAL A 1 15  ? 5.939   4.238   3.468   1.00 0.00 ? 67  VAL A C    3  
ATOM 6608  O O    . VAL A 1 15  ? 6.201   5.437   3.537   1.00 0.00 ? 67  VAL A O    3  
ATOM 6609  C CB   . VAL A 1 15  ? 7.799   2.736   2.577   1.00 0.00 ? 67  VAL A CB   3  
ATOM 6610  C CG1  . VAL A 1 15  ? 7.770   1.842   3.815   1.00 0.00 ? 67  VAL A CG1  3  
ATOM 6611  C CG2  . VAL A 1 15  ? 8.222   1.848   1.406   1.00 0.00 ? 67  VAL A CG2  3  
ATOM 6612  H H    . VAL A 1 15  ? 7.111   4.995   1.112   1.00 0.00 ? 67  VAL A H    3  
ATOM 6613  H HA   . VAL A 1 15  ? 5.706   2.585   2.149   1.00 0.00 ? 67  VAL A HA   3  
ATOM 6614  H HB   . VAL A 1 15  ? 8.547   3.517   2.718   1.00 0.00 ? 67  VAL A HB   3  
ATOM 6615  H HG11 . VAL A 1 15  ? 7.575   2.448   4.699   1.00 0.00 ? 67  VAL A HG11 3  
ATOM 6616  H HG12 . VAL A 1 15  ? 6.990   1.088   3.703   1.00 0.00 ? 67  VAL A HG12 3  
ATOM 6617  H HG13 . VAL A 1 15  ? 8.730   1.340   3.931   1.00 0.00 ? 67  VAL A HG13 3  
ATOM 6618  H HG21 . VAL A 1 15  ? 7.477   1.069   1.246   1.00 0.00 ? 67  VAL A HG21 3  
ATOM 6619  H HG22 . VAL A 1 15  ? 8.317   2.447   0.499   1.00 0.00 ? 67  VAL A HG22 3  
ATOM 6620  H HG23 . VAL A 1 15  ? 9.185   1.386   1.625   1.00 0.00 ? 67  VAL A HG23 3  
ATOM 6621  N N    . PHE A 1 16  ? 5.216   3.591   4.383   1.00 0.00 ? 68  PHE A N    3  
ATOM 6622  C CA   . PHE A 1 16  ? 4.671   4.243   5.562   1.00 0.00 ? 68  PHE A CA   3  
ATOM 6623  C C    . PHE A 1 16  ? 5.442   3.785   6.791   1.00 0.00 ? 68  PHE A C    3  
ATOM 6624  O O    . PHE A 1 16  ? 5.937   2.660   6.826   1.00 0.00 ? 68  PHE A O    3  
ATOM 6625  C CB   . PHE A 1 16  ? 3.188   3.884   5.683   1.00 0.00 ? 68  PHE A CB   3  
ATOM 6626  C CG   . PHE A 1 16  ? 2.630   4.007   7.084   1.00 0.00 ? 68  PHE A CG   3  
ATOM 6627  C CD1  . PHE A 1 16  ? 2.852   2.981   8.015   1.00 0.00 ? 68  PHE A CD1  3  
ATOM 6628  C CD2  . PHE A 1 16  ? 1.892   5.139   7.453   1.00 0.00 ? 68  PHE A CD2  3  
ATOM 6629  C CE1  . PHE A 1 16  ? 2.325   3.082   9.310   1.00 0.00 ? 68  PHE A CE1  3  
ATOM 6630  C CE2  . PHE A 1 16  ? 1.364   5.239   8.749   1.00 0.00 ? 68  PHE A CE2  3  
ATOM 6631  C CZ   . PHE A 1 16  ? 1.579   4.210   9.675   1.00 0.00 ? 68  PHE A CZ   3  
ATOM 6632  H H    . PHE A 1 16  ? 5.035   2.605   4.266   1.00 0.00 ? 68  PHE A H    3  
ATOM 6633  H HA   . PHE A 1 16  ? 4.767   5.325   5.474   1.00 0.00 ? 68  PHE A HA   3  
ATOM 6634  H HB2  . PHE A 1 16  ? 2.614   4.512   5.003   1.00 0.00 ? 68  PHE A HB2  3  
ATOM 6635  H HB3  . PHE A 1 16  ? 3.061   2.848   5.370   1.00 0.00 ? 68  PHE A HB3  3  
ATOM 6636  H HD1  . PHE A 1 16  ? 3.432   2.114   7.737   1.00 0.00 ? 68  PHE A HD1  3  
ATOM 6637  H HD2  . PHE A 1 16  ? 1.731   5.935   6.742   1.00 0.00 ? 68  PHE A HD2  3  
ATOM 6638  H HE1  . PHE A 1 16  ? 2.493   2.290   10.025  1.00 0.00 ? 68  PHE A HE1  3  
ATOM 6639  H HE2  . PHE A 1 16  ? 0.792   6.110   9.032   1.00 0.00 ? 68  PHE A HE2  3  
ATOM 6640  H HZ   . PHE A 1 16  ? 1.170   4.287   10.673  1.00 0.00 ? 68  PHE A HZ   3  
ATOM 6641  N N    . VAL A 1 17  ? 5.542   4.653   7.800   1.00 0.00 ? 69  VAL A N    3  
ATOM 6642  C CA   . VAL A 1 17  ? 6.173   4.306   9.060   1.00 0.00 ? 69  VAL A CA   3  
ATOM 6643  C C    . VAL A 1 17  ? 5.322   4.835   10.208  1.00 0.00 ? 69  VAL A C    3  
ATOM 6644  O O    . VAL A 1 17  ? 4.697   5.886   10.082  1.00 0.00 ? 69  VAL A O    3  
ATOM 6645  C CB   . VAL A 1 17  ? 7.586   4.893   9.114   1.00 0.00 ? 69  VAL A CB   3  
ATOM 6646  C CG1  . VAL A 1 17  ? 8.245   4.478   10.419  1.00 0.00 ? 69  VAL A CG1  3  
ATOM 6647  C CG2  . VAL A 1 17  ? 8.478   4.357   7.999   1.00 0.00 ? 69  VAL A CG2  3  
ATOM 6648  H H    . VAL A 1 17  ? 5.168   5.586   7.702   1.00 0.00 ? 69  VAL A H    3  
ATOM 6649  H HA   . VAL A 1 17  ? 6.240   3.221   9.143   1.00 0.00 ? 69  VAL A HA   3  
ATOM 6650  H HB   . VAL A 1 17  ? 7.539   5.981   9.052   1.00 0.00 ? 69  VAL A HB   3  
ATOM 6651  H HG11 . VAL A 1 17  ? 8.138   3.399   10.530  1.00 0.00 ? 69  VAL A HG11 3  
ATOM 6652  H HG12 . VAL A 1 17  ? 9.304   4.735   10.388  1.00 0.00 ? 69  VAL A HG12 3  
ATOM 6653  H HG13 . VAL A 1 17  ? 7.761   4.985   11.253  1.00 0.00 ? 69  VAL A HG13 3  
ATOM 6654  H HG21 . VAL A 1 17  ? 8.031   4.563   7.026   1.00 0.00 ? 69  VAL A HG21 3  
ATOM 6655  H HG22 . VAL A 1 17  ? 9.449   4.847   8.063   1.00 0.00 ? 69  VAL A HG22 3  
ATOM 6656  H HG23 . VAL A 1 17  ? 8.619   3.283   8.128   1.00 0.00 ? 69  VAL A HG23 3  
ATOM 6657  N N    . GLY A 1 18  ? 5.295   4.110   11.331  1.00 0.00 ? 70  GLY A N    3  
ATOM 6658  C CA   . GLY A 1 18  ? 4.553   4.539   12.509  1.00 0.00 ? 70  GLY A CA   3  
ATOM 6659  C C    . GLY A 1 18  ? 5.239   4.129   13.809  1.00 0.00 ? 70  GLY A C    3  
ATOM 6660  O O    . GLY A 1 18  ? 4.796   4.518   14.889  1.00 0.00 ? 70  GLY A O    3  
ATOM 6661  H H    . GLY A 1 18  ? 5.800   3.237   11.372  1.00 0.00 ? 70  GLY A H    3  
ATOM 6662  H HA2  . GLY A 1 18  ? 4.459   5.625   12.497  1.00 0.00 ? 70  GLY A HA2  3  
ATOM 6663  H HA3  . GLY A 1 18  ? 3.558   4.093   12.481  1.00 0.00 ? 70  GLY A HA3  3  
ATOM 6664  N N    . GLY A 1 19  ? 6.317   3.346   13.713  1.00 0.00 ? 71  GLY A N    3  
ATOM 6665  C CA   . GLY A 1 19  ? 7.060   2.890   14.879  1.00 0.00 ? 71  GLY A CA   3  
ATOM 6666  C C    . GLY A 1 19  ? 8.216   3.822   15.236  1.00 0.00 ? 71  GLY A C    3  
ATOM 6667  O O    . GLY A 1 19  ? 9.142   3.403   15.929  1.00 0.00 ? 71  GLY A O    3  
ATOM 6668  H H    . GLY A 1 19  ? 6.641   3.050   12.803  1.00 0.00 ? 71  GLY A H    3  
ATOM 6669  H HA2  . GLY A 1 19  ? 6.383   2.840   15.733  1.00 0.00 ? 71  GLY A HA2  3  
ATOM 6670  H HA3  . GLY A 1 19  ? 7.451   1.891   14.689  1.00 0.00 ? 71  GLY A HA3  3  
ATOM 6671  N N    . LEU A 1 20  ? 8.175   5.075   14.772  1.00 0.00 ? 72  LEU A N    3  
ATOM 6672  C CA   . LEU A 1 20  ? 9.250   6.029   15.005  1.00 0.00 ? 72  LEU A CA   3  
ATOM 6673  C C    . LEU A 1 20  ? 9.470   6.249   16.505  1.00 0.00 ? 72  LEU A C    3  
ATOM 6674  O O    . LEU A 1 20  ? 8.511   6.232   17.279  1.00 0.00 ? 72  LEU A O    3  
ATOM 6675  C CB   . LEU A 1 20  ? 8.926   7.357   14.313  1.00 0.00 ? 72  LEU A CB   3  
ATOM 6676  C CG   . LEU A 1 20  ? 8.726   7.198   12.803  1.00 0.00 ? 72  LEU A CG   3  
ATOM 6677  C CD1  . LEU A 1 20  ? 8.429   8.548   12.161  1.00 0.00 ? 72  LEU A CD1  3  
ATOM 6678  C CD2  . LEU A 1 20  ? 9.978   6.640   12.131  1.00 0.00 ? 72  LEU A CD2  3  
ATOM 6679  H H    . LEU A 1 20  ? 7.375   5.383   14.237  1.00 0.00 ? 72  LEU A H    3  
ATOM 6680  H HA   . LEU A 1 20  ? 10.166  5.622   14.576  1.00 0.00 ? 72  LEU A HA   3  
ATOM 6681  H HB2  . LEU A 1 20  ? 8.016   7.771   14.748  1.00 0.00 ? 72  LEU A HB2  3  
ATOM 6682  H HB3  . LEU A 1 20  ? 9.745   8.054   14.491  1.00 0.00 ? 72  LEU A HB3  3  
ATOM 6683  H HG   . LEU A 1 20  ? 7.881   6.533   12.622  1.00 0.00 ? 72  LEU A HG   3  
ATOM 6684  H HD11 . LEU A 1 20  ? 7.565   9.007   12.643  1.00 0.00 ? 72  LEU A HD11 3  
ATOM 6685  H HD12 . LEU A 1 20  ? 9.299   9.195   12.265  1.00 0.00 ? 72  LEU A HD12 3  
ATOM 6686  H HD13 . LEU A 1 20  ? 8.220   8.403   11.101  1.00 0.00 ? 72  LEU A HD13 3  
ATOM 6687  H HD21 . LEU A 1 20  ? 10.143  5.610   12.448  1.00 0.00 ? 72  LEU A HD21 3  
ATOM 6688  H HD22 . LEU A 1 20  ? 9.846   6.668   11.049  1.00 0.00 ? 72  LEU A HD22 3  
ATOM 6689  H HD23 . LEU A 1 20  ? 10.842  7.247   12.401  1.00 0.00 ? 72  LEU A HD23 3  
ATOM 6690  N N    . PRO A 1 21  ? 10.725  6.456   16.924  1.00 0.00 ? 73  PRO A N    3  
ATOM 6691  C CA   . PRO A 1 21  ? 11.092  6.672   18.314  1.00 0.00 ? 73  PRO A CA   3  
ATOM 6692  C C    . PRO A 1 21  ? 10.687  8.074   18.768  1.00 0.00 ? 73  PRO A C    3  
ATOM 6693  O O    . PRO A 1 21  ? 10.345  8.917   17.939  1.00 0.00 ? 73  PRO A O    3  
ATOM 6694  C CB   . PRO A 1 21  ? 12.611  6.498   18.347  1.00 0.00 ? 73  PRO A CB   3  
ATOM 6695  C CG   . PRO A 1 21  ? 13.033  6.993   16.964  1.00 0.00 ? 73  PRO A CG   3  
ATOM 6696  C CD   . PRO A 1 21  ? 11.898  6.496   16.072  1.00 0.00 ? 73  PRO A CD   3  
ATOM 6697  H HA   . PRO A 1 21  ? 10.619  5.925   18.951  1.00 0.00 ? 73  PRO A HA   3  
ATOM 6698  H HB2  . PRO A 1 21  ? 13.076  7.079   19.143  1.00 0.00 ? 73  PRO A HB2  3  
ATOM 6699  H HB3  . PRO A 1 21  ? 12.856  5.440   18.441  1.00 0.00 ? 73  PRO A HB3  3  
ATOM 6700  H HG2  . PRO A 1 21  ? 13.052  8.083   16.956  1.00 0.00 ? 73  PRO A HG2  3  
ATOM 6701  H HG3  . PRO A 1 21  ? 13.995  6.581   16.660  1.00 0.00 ? 73  PRO A HG3  3  
ATOM 6702  H HD2  . PRO A 1 21  ? 11.755  7.173   15.229  1.00 0.00 ? 73  PRO A HD2  3  
ATOM 6703  H HD3  . PRO A 1 21  ? 12.121  5.489   15.720  1.00 0.00 ? 73  PRO A HD3  3  
ATOM 6704  N N    . PRO A 1 22  ? 10.718  8.342   20.080  1.00 0.00 ? 74  PRO A N    3  
ATOM 6705  C CA   . PRO A 1 22  ? 10.457  9.659   20.635  1.00 0.00 ? 74  PRO A CA   3  
ATOM 6706  C C    . PRO A 1 22  ? 11.422  10.709  20.086  1.00 0.00 ? 74  PRO A C    3  
ATOM 6707  O O    . PRO A 1 22  ? 12.530  10.381  19.666  1.00 0.00 ? 74  PRO A O    3  
ATOM 6708  C CB   . PRO A 1 22  ? 10.622  9.507   22.148  1.00 0.00 ? 74  PRO A CB   3  
ATOM 6709  C CG   . PRO A 1 22  ? 10.396  8.015   22.388  1.00 0.00 ? 74  PRO A CG   3  
ATOM 6710  C CD   . PRO A 1 22  ? 10.999  7.391   21.135  1.00 0.00 ? 74  PRO A CD   3  
ATOM 6711  H HA   . PRO A 1 22  ? 9.429   9.942   20.408  1.00 0.00 ? 74  PRO A HA   3  
ATOM 6712  H HB2  . PRO A 1 22  ? 11.643  9.763   22.433  1.00 0.00 ? 74  PRO A HB2  3  
ATOM 6713  H HB3  . PRO A 1 22  ? 9.904   10.117  22.696  1.00 0.00 ? 74  PRO A HB3  3  
ATOM 6714  H HG2  . PRO A 1 22  ? 10.893  7.668   23.294  1.00 0.00 ? 74  PRO A HG2  3  
ATOM 6715  H HG3  . PRO A 1 22  ? 9.326   7.809   22.422  1.00 0.00 ? 74  PRO A HG3  3  
ATOM 6716  H HD2  . PRO A 1 22  ? 12.078  7.288   21.255  1.00 0.00 ? 74  PRO A HD2  3  
ATOM 6717  H HD3  . PRO A 1 22  ? 10.538  6.423   20.936  1.00 0.00 ? 74  PRO A HD3  3  
ATOM 6718  N N    . ASP A 1 23  ? 10.992  11.976  20.094  1.00 0.00 ? 75  ASP A N    3  
ATOM 6719  C CA   . ASP A 1 23  ? 11.785  13.112  19.638  1.00 0.00 ? 75  ASP A CA   3  
ATOM 6720  C C    . ASP A 1 23  ? 12.351  12.917  18.225  1.00 0.00 ? 75  ASP A C    3  
ATOM 6721  O O    . ASP A 1 23  ? 13.390  13.479  17.883  1.00 0.00 ? 75  ASP A O    3  
ATOM 6722  C CB   . ASP A 1 23  ? 12.855  13.443  20.683  1.00 0.00 ? 75  ASP A CB   3  
ATOM 6723  C CG   . ASP A 1 23  ? 13.523  14.793  20.420  1.00 0.00 ? 75  ASP A CG   3  
ATOM 6724  O OD1  . ASP A 1 23  ? 12.779  15.770  20.178  1.00 0.00 ? 75  ASP A OD1  3  
ATOM 6725  O OD2  . ASP A 1 23  ? 14.773  14.839  20.461  1.00 0.00 ? 75  ASP A OD2  3  
ATOM 6726  H H    . ASP A 1 23  ? 10.063  12.171  20.437  1.00 0.00 ? 75  ASP A H    3  
ATOM 6727  H HA   . ASP A 1 23  ? 11.105  13.961  19.587  1.00 0.00 ? 75  ASP A HA   3  
ATOM 6728  H HB2  . ASP A 1 23  ? 12.386  13.478  21.667  1.00 0.00 ? 75  ASP A HB2  3  
ATOM 6729  H HB3  . ASP A 1 23  ? 13.610  12.657  20.687  1.00 0.00 ? 75  ASP A HB3  3  
ATOM 6730  N N    . ILE A 1 24  ? 11.669  12.119  17.396  1.00 0.00 ? 76  ILE A N    3  
ATOM 6731  C CA   . ILE A 1 24  ? 12.091  11.861  16.026  1.00 0.00 ? 76  ILE A CA   3  
ATOM 6732  C C    . ILE A 1 24  ? 12.028  13.127  15.179  1.00 0.00 ? 76  ILE A C    3  
ATOM 6733  O O    . ILE A 1 24  ? 11.143  13.963  15.346  1.00 0.00 ? 76  ILE A O    3  
ATOM 6734  C CB   . ILE A 1 24  ? 11.245  10.730  15.411  1.00 0.00 ? 76  ILE A CB   3  
ATOM 6735  C CG1  . ILE A 1 24  ? 11.584  10.455  13.933  1.00 0.00 ? 76  ILE A CG1  3  
ATOM 6736  C CG2  . ILE A 1 24  ? 9.746   11.008  15.582  1.00 0.00 ? 76  ILE A CG2  3  
ATOM 6737  C CD1  . ILE A 1 24  ? 10.801  11.307  12.926  1.00 0.00 ? 76  ILE A CD1  3  
ATOM 6738  H H    . ILE A 1 24  ? 10.825  11.669  17.722  1.00 0.00 ? 76  ILE A H    3  
ATOM 6739  H HA   . ILE A 1 24  ? 13.128  11.527  16.050  1.00 0.00 ? 76  ILE A HA   3  
ATOM 6740  H HB   . ILE A 1 24  ? 11.482  9.820   15.964  1.00 0.00 ? 76  ILE A HB   3  
ATOM 6741  H HG12 . ILE A 1 24  ? 12.652  10.597  13.768  1.00 0.00 ? 76  ILE A HG12 3  
ATOM 6742  H HG13 . ILE A 1 24  ? 11.359  9.410   13.721  1.00 0.00 ? 76  ILE A HG13 3  
ATOM 6743  H HG21 . ILE A 1 24  ? 9.489   11.963  15.124  1.00 0.00 ? 76  ILE A HG21 3  
ATOM 6744  H HG22 . ILE A 1 24  ? 9.169   10.212  15.111  1.00 0.00 ? 76  ILE A HG22 3  
ATOM 6745  H HG23 . ILE A 1 24  ? 9.492   11.042  16.642  1.00 0.00 ? 76  ILE A HG23 3  
ATOM 6746  H HD11 . ILE A 1 24  ? 10.985  12.370  13.085  1.00 0.00 ? 76  ILE A HD11 3  
ATOM 6747  H HD12 . ILE A 1 24  ? 11.113  11.043  11.916  1.00 0.00 ? 76  ILE A HD12 3  
ATOM 6748  H HD13 . ILE A 1 24  ? 9.733   11.115  13.025  1.00 0.00 ? 76  ILE A HD13 3  
ATOM 6749  N N    . ASP A 1 25  ? 12.990  13.251  14.264  1.00 0.00 ? 77  ASP A N    3  
ATOM 6750  C CA   . ASP A 1 25  ? 12.996  14.265  13.226  1.00 0.00 ? 77  ASP A CA   3  
ATOM 6751  C C    . ASP A 1 25  ? 13.483  13.597  11.941  1.00 0.00 ? 77  ASP A C    3  
ATOM 6752  O O    . ASP A 1 25  ? 13.931  12.453  11.983  1.00 0.00 ? 77  ASP A O    3  
ATOM 6753  C CB   . ASP A 1 25  ? 13.866  15.454  13.639  1.00 0.00 ? 77  ASP A CB   3  
ATOM 6754  C CG   . ASP A 1 25  ? 15.347  15.095  13.659  1.00 0.00 ? 77  ASP A CG   3  
ATOM 6755  O OD1  . ASP A 1 25  ? 15.807  14.568  14.696  1.00 0.00 ? 77  ASP A OD1  3  
ATOM 6756  O OD2  . ASP A 1 25  ? 16.005  15.353  12.628  1.00 0.00 ? 77  ASP A OD2  3  
ATOM 6757  H H    . ASP A 1 25  ? 13.761  12.600  14.273  1.00 0.00 ? 77  ASP A H    3  
ATOM 6758  H HA   . ASP A 1 25  ? 11.975  14.617  13.076  1.00 0.00 ? 77  ASP A HA   3  
ATOM 6759  H HB2  . ASP A 1 25  ? 13.708  16.265  12.927  1.00 0.00 ? 77  ASP A HB2  3  
ATOM 6760  H HB3  . ASP A 1 25  ? 13.561  15.800  14.626  1.00 0.00 ? 77  ASP A HB3  3  
ATOM 6761  N N    . GLU A 1 26  ? 13.407  14.285  10.802  1.00 0.00 ? 78  GLU A N    3  
ATOM 6762  C CA   . GLU A 1 26  ? 13.735  13.687  9.515   1.00 0.00 ? 78  GLU A CA   3  
ATOM 6763  C C    . GLU A 1 26  ? 15.161  13.131  9.458   1.00 0.00 ? 78  GLU A C    3  
ATOM 6764  O O    . GLU A 1 26  ? 15.436  12.279  8.619   1.00 0.00 ? 78  GLU A O    3  
ATOM 6765  C CB   . GLU A 1 26  ? 13.498  14.711  8.401   1.00 0.00 ? 78  GLU A CB   3  
ATOM 6766  C CG   . GLU A 1 26  ? 14.243  16.019  8.663   1.00 0.00 ? 78  GLU A CG   3  
ATOM 6767  C CD   . GLU A 1 26  ? 14.097  16.977  7.482   1.00 0.00 ? 78  GLU A CD   3  
ATOM 6768  O OE1  . GLU A 1 26  ? 13.100  17.733  7.474   1.00 0.00 ? 78  GLU A OE1  3  
ATOM 6769  O OE2  . GLU A 1 26  ? 14.982  16.946  6.598   1.00 0.00 ? 78  GLU A OE2  3  
ATOM 6770  H H    . GLU A 1 26  ? 13.111  15.251  10.814  1.00 0.00 ? 78  GLU A H    3  
ATOM 6771  H HA   . GLU A 1 26  ? 13.055  12.851  9.351   1.00 0.00 ? 78  GLU A HA   3  
ATOM 6772  H HB2  . GLU A 1 26  ? 13.836  14.287  7.455   1.00 0.00 ? 78  GLU A HB2  3  
ATOM 6773  H HB3  . GLU A 1 26  ? 12.432  14.926  8.327   1.00 0.00 ? 78  GLU A HB3  3  
ATOM 6774  H HG2  . GLU A 1 26  ? 13.844  16.489  9.561   1.00 0.00 ? 78  GLU A HG2  3  
ATOM 6775  H HG3  . GLU A 1 26  ? 15.299  15.799  8.824   1.00 0.00 ? 78  GLU A HG3  3  
ATOM 6776  N N    . ASP A 1 27  ? 16.075  13.585  10.322  1.00 0.00 ? 79  ASP A N    3  
ATOM 6777  C CA   . ASP A 1 27  ? 17.443  13.081  10.313  1.00 0.00 ? 79  ASP A CA   3  
ATOM 6778  C C    . ASP A 1 27  ? 17.574  11.815  11.162  1.00 0.00 ? 79  ASP A C    3  
ATOM 6779  O O    . ASP A 1 27  ? 18.506  11.036  10.972  1.00 0.00 ? 79  ASP A O    3  
ATOM 6780  C CB   . ASP A 1 27  ? 18.393  14.175  10.803  1.00 0.00 ? 79  ASP A CB   3  
ATOM 6781  C CG   . ASP A 1 27  ? 19.853  13.758  10.648  1.00 0.00 ? 79  ASP A CG   3  
ATOM 6782  O OD1  . ASP A 1 27  ? 20.284  13.591  9.485   1.00 0.00 ? 79  ASP A OD1  3  
ATOM 6783  O OD2  . ASP A 1 27  ? 20.529  13.608  11.690  1.00 0.00 ? 79  ASP A OD2  3  
ATOM 6784  H H    . ASP A 1 27  ? 15.828  14.290  11.002  1.00 0.00 ? 79  ASP A H    3  
ATOM 6785  H HA   . ASP A 1 27  ? 17.713  12.834  9.286   1.00 0.00 ? 79  ASP A HA   3  
ATOM 6786  H HB2  . ASP A 1 27  ? 18.220  15.082  10.224  1.00 0.00 ? 79  ASP A HB2  3  
ATOM 6787  H HB3  . ASP A 1 27  ? 18.187  14.386  11.853  1.00 0.00 ? 79  ASP A HB3  3  
ATOM 6788  N N    . GLU A 1 28  ? 16.644  11.604  12.098  1.00 0.00 ? 80  GLU A N    3  
ATOM 6789  C CA   . GLU A 1 28  ? 16.645  10.426  12.953  1.00 0.00 ? 80  GLU A CA   3  
ATOM 6790  C C    . GLU A 1 28  ? 16.168  9.219   12.154  1.00 0.00 ? 80  GLU A C    3  
ATOM 6791  O O    . GLU A 1 28  ? 16.732  8.131   12.258  1.00 0.00 ? 80  GLU A O    3  
ATOM 6792  C CB   . GLU A 1 28  ? 15.700  10.678  14.129  1.00 0.00 ? 80  GLU A CB   3  
ATOM 6793  C CG   . GLU A 1 28  ? 15.597  9.463   15.051  1.00 0.00 ? 80  GLU A CG   3  
ATOM 6794  C CD   . GLU A 1 28  ? 16.855  9.300   15.904  1.00 0.00 ? 80  GLU A CD   3  
ATOM 6795  O OE1  . GLU A 1 28  ? 17.789  8.612   15.436  1.00 0.00 ? 80  GLU A OE1  3  
ATOM 6796  O OE2  . GLU A 1 28  ? 16.870  9.866   17.018  1.00 0.00 ? 80  GLU A OE2  3  
ATOM 6797  H H    . GLU A 1 28  ? 15.905  12.279  12.224  1.00 0.00 ? 80  GLU A H    3  
ATOM 6798  H HA   . GLU A 1 28  ? 17.652  10.240  13.325  1.00 0.00 ? 80  GLU A HA   3  
ATOM 6799  H HB2  . GLU A 1 28  ? 16.043  11.542  14.699  1.00 0.00 ? 80  GLU A HB2  3  
ATOM 6800  H HB3  . GLU A 1 28  ? 14.708  10.896  13.733  1.00 0.00 ? 80  GLU A HB3  3  
ATOM 6801  H HG2  . GLU A 1 28  ? 14.730  9.594   15.698  1.00 0.00 ? 80  GLU A HG2  3  
ATOM 6802  H HG3  . GLU A 1 28  ? 15.432  8.562   14.459  1.00 0.00 ? 80  GLU A HG3  3  
ATOM 6803  N N    . ILE A 1 29  ? 15.120  9.414   11.350  1.00 0.00 ? 81  ILE A N    3  
ATOM 6804  C CA   . ILE A 1 29  ? 14.581  8.347   10.522  1.00 0.00 ? 81  ILE A CA   3  
ATOM 6805  C C    . ILE A 1 29  ? 15.511  8.099   9.337   1.00 0.00 ? 81  ILE A C    3  
ATOM 6806  O O    . ILE A 1 29  ? 15.577  6.980   8.829   1.00 0.00 ? 81  ILE A O    3  
ATOM 6807  C CB   . ILE A 1 29  ? 13.131  8.681   10.134  1.00 0.00 ? 81  ILE A CB   3  
ATOM 6808  C CG1  . ILE A 1 29  ? 12.607  7.758   9.031   1.00 0.00 ? 81  ILE A CG1  3  
ATOM 6809  C CG2  . ILE A 1 29  ? 12.950  10.149  9.737   1.00 0.00 ? 81  ILE A CG2  3  
ATOM 6810  C CD1  . ILE A 1 29  ? 12.922  8.279   7.625   1.00 0.00 ? 81  ILE A CD1  3  
ATOM 6811  H H    . ILE A 1 29  ? 14.683  10.322  11.310  1.00 0.00 ? 81  ILE A H    3  
ATOM 6812  H HA   . ILE A 1 29  ? 14.560  7.432   11.112  1.00 0.00 ? 81  ILE A HA   3  
ATOM 6813  H HB   . ILE A 1 29  ? 12.520  8.500   11.017  1.00 0.00 ? 81  ILE A HB   3  
ATOM 6814  H HG12 . ILE A 1 29  ? 13.031  6.764   9.171   1.00 0.00 ? 81  ILE A HG12 3  
ATOM 6815  H HG13 . ILE A 1 29  ? 11.525  7.687   9.134   1.00 0.00 ? 81  ILE A HG13 3  
ATOM 6816  H HG21 . ILE A 1 29  ? 13.636  10.412  8.932   1.00 0.00 ? 81  ILE A HG21 3  
ATOM 6817  H HG22 . ILE A 1 29  ? 11.923  10.314  9.412   1.00 0.00 ? 81  ILE A HG22 3  
ATOM 6818  H HG23 . ILE A 1 29  ? 13.145  10.783  10.602  1.00 0.00 ? 81  ILE A HG23 3  
ATOM 6819  H HD11 . ILE A 1 29  ? 12.349  9.187   7.440   1.00 0.00 ? 81  ILE A HD11 3  
ATOM 6820  H HD12 . ILE A 1 29  ? 13.983  8.512   7.527   1.00 0.00 ? 81  ILE A HD12 3  
ATOM 6821  H HD13 . ILE A 1 29  ? 12.659  7.520   6.889   1.00 0.00 ? 81  ILE A HD13 3  
ATOM 6822  N N    . THR A 1 30  ? 16.237  9.128   8.887   1.00 0.00 ? 82  THR A N    3  
ATOM 6823  C CA   . THR A 1 30  ? 17.218  8.938   7.825   1.00 0.00 ? 82  THR A CA   3  
ATOM 6824  C C    . THR A 1 30  ? 18.376  8.091   8.349   1.00 0.00 ? 82  THR A C    3  
ATOM 6825  O O    . THR A 1 30  ? 19.030  7.389   7.581   1.00 0.00 ? 82  THR A O    3  
ATOM 6826  C CB   . THR A 1 30  ? 17.721  10.293  7.312   1.00 0.00 ? 82  THR A CB   3  
ATOM 6827  O OG1  . THR A 1 30  ? 16.658  10.998  6.716   1.00 0.00 ? 82  THR A OG1  3  
ATOM 6828  C CG2  . THR A 1 30  ? 18.813  10.120  6.257   1.00 0.00 ? 82  THR A CG2  3  
ATOM 6829  H H    . THR A 1 30  ? 16.109  10.047  9.287   1.00 0.00 ? 82  THR A H    3  
ATOM 6830  H HA   . THR A 1 30  ? 16.742  8.406   7.000   1.00 0.00 ? 82  THR A HA   3  
ATOM 6831  H HB   . THR A 1 30  ? 18.120  10.873  8.145   1.00 0.00 ? 82  THR A HB   3  
ATOM 6832  H HG1  . THR A 1 30  ? 16.105  11.357  7.416   1.00 0.00 ? 82  THR A HG1  3  
ATOM 6833  H HG21 . THR A 1 30  ? 18.454  9.472   5.458   1.00 0.00 ? 82  THR A HG21 3  
ATOM 6834  H HG22 . THR A 1 30  ? 19.071  11.094  5.842   1.00 0.00 ? 82  THR A HG22 3  
ATOM 6835  H HG23 . THR A 1 30  ? 19.701  9.683   6.712   1.00 0.00 ? 82  THR A HG23 3  
ATOM 6836  N N    . ALA A 1 31  ? 18.634  8.153   9.660   1.00 0.00 ? 83  ALA A N    3  
ATOM 6837  C CA   . ALA A 1 31  ? 19.673  7.358   10.293  1.00 0.00 ? 83  ALA A CA   3  
ATOM 6838  C C    . ALA A 1 31  ? 19.139  5.991   10.727  1.00 0.00 ? 83  ALA A C    3  
ATOM 6839  O O    . ALA A 1 31  ? 19.923  5.101   11.050  1.00 0.00 ? 83  ALA A O    3  
ATOM 6840  C CB   . ALA A 1 31  ? 20.234  8.133   11.484  1.00 0.00 ? 83  ALA A CB   3  
ATOM 6841  H H    . ALA A 1 31  ? 18.091  8.771   10.246  1.00 0.00 ? 83  ALA A H    3  
ATOM 6842  H HA   . ALA A 1 31  ? 20.480  7.198   9.577   1.00 0.00 ? 83  ALA A HA   3  
ATOM 6843  H HB1  . ALA A 1 31  ? 19.444  8.304   12.215  1.00 0.00 ? 83  ALA A HB1  3  
ATOM 6844  H HB2  . ALA A 1 31  ? 21.037  7.561   11.948  1.00 0.00 ? 83  ALA A HB2  3  
ATOM 6845  H HB3  . ALA A 1 31  ? 20.626  9.091   11.143  1.00 0.00 ? 83  ALA A HB3  3  
ATOM 6846  N N    . SER A 1 32  ? 17.814  5.815   10.737  1.00 0.00 ? 84  SER A N    3  
ATOM 6847  C CA   . SER A 1 32  ? 17.206  4.529   11.052  1.00 0.00 ? 84  SER A CA   3  
ATOM 6848  C C    . SER A 1 32  ? 17.243  3.601   9.842   1.00 0.00 ? 84  SER A C    3  
ATOM 6849  O O    . SER A 1 32  ? 17.327  2.385   9.996   1.00 0.00 ? 84  SER A O    3  
ATOM 6850  C CB   . SER A 1 32  ? 15.758  4.752   11.500  1.00 0.00 ? 84  SER A CB   3  
ATOM 6851  O OG   . SER A 1 32  ? 15.738  5.491   12.703  1.00 0.00 ? 84  SER A OG   3  
ATOM 6852  H H    . SER A 1 32  ? 17.200  6.590   10.526  1.00 0.00 ? 84  SER A H    3  
ATOM 6853  H HA   . SER A 1 32  ? 17.757  4.059   11.867  1.00 0.00 ? 84  SER A HA   3  
ATOM 6854  H HB2  . SER A 1 32  ? 15.219  5.297   10.726  1.00 0.00 ? 84  SER A HB2  3  
ATOM 6855  H HB3  . SER A 1 32  ? 15.267  3.793   11.659  1.00 0.00 ? 84  SER A HB3  3  
ATOM 6856  H HG   . SER A 1 32  ? 16.159  6.341   12.552  1.00 0.00 ? 84  SER A HG   3  
ATOM 6857  N N    . PHE A 1 33  ? 17.181  4.159   8.630   1.00 0.00 ? 85  PHE A N    3  
ATOM 6858  C CA   . PHE A 1 33  ? 17.167  3.359   7.415   1.00 0.00 ? 85  PHE A CA   3  
ATOM 6859  C C    . PHE A 1 33  ? 18.503  3.428   6.676   1.00 0.00 ? 85  PHE A C    3  
ATOM 6860  O O    . PHE A 1 33  ? 18.572  3.925   5.552   1.00 0.00 ? 85  PHE A O    3  
ATOM 6861  C CB   . PHE A 1 33  ? 16.009  3.789   6.518   1.00 0.00 ? 85  PHE A CB   3  
ATOM 6862  C CG   . PHE A 1 33  ? 14.623  3.726   7.126   1.00 0.00 ? 85  PHE A CG   3  
ATOM 6863  C CD1  . PHE A 1 33  ? 14.335  2.884   8.213   1.00 0.00 ? 85  PHE A CD1  3  
ATOM 6864  C CD2  . PHE A 1 33  ? 13.607  4.522   6.579   1.00 0.00 ? 85  PHE A CD2  3  
ATOM 6865  C CE1  . PHE A 1 33  ? 13.037  2.839   8.741   1.00 0.00 ? 85  PHE A CE1  3  
ATOM 6866  C CE2  . PHE A 1 33  ? 12.305  4.460   7.089   1.00 0.00 ? 85  PHE A CE2  3  
ATOM 6867  C CZ   . PHE A 1 33  ? 12.021  3.626   8.181   1.00 0.00 ? 85  PHE A CZ   3  
ATOM 6868  H H    . PHE A 1 33  ? 17.135  5.163   8.538   1.00 0.00 ? 85  PHE A H    3  
ATOM 6869  H HA   . PHE A 1 33  ? 17.005  2.316   7.688   1.00 0.00 ? 85  PHE A HA   3  
ATOM 6870  H HB2  . PHE A 1 33  ? 16.194  4.808   6.176   1.00 0.00 ? 85  PHE A HB2  3  
ATOM 6871  H HB3  . PHE A 1 33  ? 16.017  3.132   5.647   1.00 0.00 ? 85  PHE A HB3  3  
ATOM 6872  H HD1  . PHE A 1 33  ? 15.107  2.268   8.649   1.00 0.00 ? 85  PHE A HD1  3  
ATOM 6873  H HD2  . PHE A 1 33  ? 13.825  5.189   5.757   1.00 0.00 ? 85  PHE A HD2  3  
ATOM 6874  H HE1  . PHE A 1 33  ? 12.820  2.196   9.580   1.00 0.00 ? 85  PHE A HE1  3  
ATOM 6875  H HE2  . PHE A 1 33  ? 11.531  5.059   6.633   1.00 0.00 ? 85  PHE A HE2  3  
ATOM 6876  H HZ   . PHE A 1 33  ? 11.024  3.584   8.595   1.00 0.00 ? 85  PHE A HZ   3  
ATOM 6877  N N    . ARG A 1 34  ? 19.571  2.929   7.306   1.00 0.00 ? 86  ARG A N    3  
ATOM 6878  C CA   . ARG A 1 34  ? 20.899  2.905   6.702   1.00 0.00 ? 86  ARG A CA   3  
ATOM 6879  C C    . ARG A 1 34  ? 20.970  1.920   5.532   1.00 0.00 ? 86  ARG A C    3  
ATOM 6880  O O    . ARG A 1 34  ? 22.031  1.759   4.931   1.00 0.00 ? 86  ARG A O    3  
ATOM 6881  C CB   . ARG A 1 34  ? 21.945  2.559   7.765   1.00 0.00 ? 86  ARG A CB   3  
ATOM 6882  C CG   . ARG A 1 34  ? 21.942  3.605   8.882   1.00 0.00 ? 86  ARG A CG   3  
ATOM 6883  C CD   . ARG A 1 34  ? 23.006  3.279   9.931   1.00 0.00 ? 86  ARG A CD   3  
ATOM 6884  N NE   . ARG A 1 34  ? 24.359  3.357   9.370   1.00 0.00 ? 86  ARG A NE   3  
ATOM 6885  C CZ   . ARG A 1 34  ? 25.471  3.077   10.055  1.00 0.00 ? 86  ARG A CZ   3  
ATOM 6886  N NH1  . ARG A 1 34  ? 25.407  2.701   11.331  1.00 0.00 ? 86  ARG A NH1  3  
ATOM 6887  N NH2  . ARG A 1 34  ? 26.658  3.173   9.462   1.00 0.00 ? 86  ARG A NH2  3  
ATOM 6888  H H    . ARG A 1 34  ? 19.464  2.550   8.237   1.00 0.00 ? 86  ARG A H    3  
ATOM 6889  H HA   . ARG A 1 34  ? 21.117  3.899   6.312   1.00 0.00 ? 86  ARG A HA   3  
ATOM 6890  H HB2  . ARG A 1 34  ? 21.726  1.578   8.185   1.00 0.00 ? 86  ARG A HB2  3  
ATOM 6891  H HB3  . ARG A 1 34  ? 22.929  2.535   7.298   1.00 0.00 ? 86  ARG A HB3  3  
ATOM 6892  H HG2  . ARG A 1 34  ? 22.141  4.590   8.461   1.00 0.00 ? 86  ARG A HG2  3  
ATOM 6893  H HG3  . ARG A 1 34  ? 20.964  3.611   9.363   1.00 0.00 ? 86  ARG A HG3  3  
ATOM 6894  H HD2  . ARG A 1 34  ? 22.920  3.991   10.751  1.00 0.00 ? 86  ARG A HD2  3  
ATOM 6895  H HD3  . ARG A 1 34  ? 22.829  2.274   10.315  1.00 0.00 ? 86  ARG A HD3  3  
ATOM 6896  H HE   . ARG A 1 34  ? 24.447  3.642   8.404   1.00 0.00 ? 86  ARG A HE   3  
ATOM 6897  H HH11 . ARG A 1 34  ? 24.510  2.628   11.788  1.00 0.00 ? 86  ARG A HH11 3  
ATOM 6898  H HH12 . ARG A 1 34  ? 26.254  2.489   11.838  1.00 0.00 ? 86  ARG A HH12 3  
ATOM 6899  H HH21 . ARG A 1 34  ? 26.720  3.457   8.495   1.00 0.00 ? 86  ARG A HH21 3  
ATOM 6900  H HH22 . ARG A 1 34  ? 27.500  2.962   9.980   1.00 0.00 ? 86  ARG A HH22 3  
ATOM 6901  N N    . ARG A 1 35  ? 19.851  1.264   5.208   1.00 0.00 ? 87  ARG A N    3  
ATOM 6902  C CA   . ARG A 1 35  ? 19.765  0.299   4.118   1.00 0.00 ? 87  ARG A CA   3  
ATOM 6903  C C    . ARG A 1 35  ? 18.815  0.768   3.011   1.00 0.00 ? 87  ARG A C    3  
ATOM 6904  O O    . ARG A 1 35  ? 18.550  0.014   2.077   1.00 0.00 ? 87  ARG A O    3  
ATOM 6905  C CB   . ARG A 1 35  ? 19.371  -1.072  4.671   1.00 0.00 ? 87  ARG A CB   3  
ATOM 6906  C CG   . ARG A 1 35  ? 20.455  -1.592  5.620   1.00 0.00 ? 87  ARG A CG   3  
ATOM 6907  C CD   . ARG A 1 35  ? 20.132  -3.012  6.092   1.00 0.00 ? 87  ARG A CD   3  
ATOM 6908  N NE   . ARG A 1 35  ? 18.903  -3.056  6.892   1.00 0.00 ? 87  ARG A NE   3  
ATOM 6909  C CZ   . ARG A 1 35  ? 18.831  -2.745  8.190   1.00 0.00 ? 87  ARG A CZ   3  
ATOM 6910  N NH1  . ARG A 1 35  ? 19.914  -2.359  8.862   1.00 0.00 ? 87  ARG A NH1  3  
ATOM 6911  N NH2  . ARG A 1 35  ? 17.665  -2.818  8.828   1.00 0.00 ? 87  ARG A NH2  3  
ATOM 6912  H H    . ARG A 1 35  ? 19.012  1.436   5.744   1.00 0.00 ? 87  ARG A H    3  
ATOM 6913  H HA   . ARG A 1 35  ? 20.752  0.206   3.664   1.00 0.00 ? 87  ARG A HA   3  
ATOM 6914  H HB2  . ARG A 1 35  ? 18.423  -0.988  5.202   1.00 0.00 ? 87  ARG A HB2  3  
ATOM 6915  H HB3  . ARG A 1 35  ? 19.261  -1.772  3.844   1.00 0.00 ? 87  ARG A HB3  3  
ATOM 6916  H HG2  . ARG A 1 35  ? 21.409  -1.605  5.093   1.00 0.00 ? 87  ARG A HG2  3  
ATOM 6917  H HG3  . ARG A 1 35  ? 20.536  -0.933  6.484   1.00 0.00 ? 87  ARG A HG3  3  
ATOM 6918  H HD2  . ARG A 1 35  ? 20.016  -3.657  5.221   1.00 0.00 ? 87  ARG A HD2  3  
ATOM 6919  H HD3  . ARG A 1 35  ? 20.964  -3.386  6.688   1.00 0.00 ? 87  ARG A HD3  3  
ATOM 6920  H HE   . ARG A 1 35  ? 18.056  -3.343  6.422   1.00 0.00 ? 87  ARG A HE   3  
ATOM 6921  H HH11 . ARG A 1 35  ? 20.805  -2.299  8.391   1.00 0.00 ? 87  ARG A HH11 3  
ATOM 6922  H HH12 . ARG A 1 35  ? 19.845  -2.127  9.842   1.00 0.00 ? 87  ARG A HH12 3  
ATOM 6923  H HH21 . ARG A 1 35  ? 16.836  -3.112  8.332   1.00 0.00 ? 87  ARG A HH21 3  
ATOM 6924  H HH22 . ARG A 1 35  ? 17.610  -2.582  9.808   1.00 0.00 ? 87  ARG A HH22 3  
ATOM 6925  N N    . PHE A 1 36  ? 18.304  2.000   3.108   1.00 0.00 ? 88  PHE A N    3  
ATOM 6926  C CA   . PHE A 1 36  ? 17.483  2.598   2.061   1.00 0.00 ? 88  PHE A CA   3  
ATOM 6927  C C    . PHE A 1 36  ? 18.233  3.730   1.355   1.00 0.00 ? 88  PHE A C    3  
ATOM 6928  O O    . PHE A 1 36  ? 17.758  4.233   0.338   1.00 0.00 ? 88  PHE A O    3  
ATOM 6929  C CB   . PHE A 1 36  ? 16.159  3.110   2.646   1.00 0.00 ? 88  PHE A CB   3  
ATOM 6930  C CG   . PHE A 1 36  ? 15.033  2.101   2.780   1.00 0.00 ? 88  PHE A CG   3  
ATOM 6931  C CD1  . PHE A 1 36  ? 14.907  1.022   1.891   1.00 0.00 ? 88  PHE A CD1  3  
ATOM 6932  C CD2  . PHE A 1 36  ? 14.090  2.258   3.806   1.00 0.00 ? 88  PHE A CD2  3  
ATOM 6933  C CE1  . PHE A 1 36  ? 13.836  0.128   2.013   1.00 0.00 ? 88  PHE A CE1  3  
ATOM 6934  C CE2  . PHE A 1 36  ? 13.024  1.358   3.936   1.00 0.00 ? 88  PHE A CE2  3  
ATOM 6935  C CZ   . PHE A 1 36  ? 12.890  0.297   3.033   1.00 0.00 ? 88  PHE A CZ   3  
ATOM 6936  H H    . PHE A 1 36  ? 18.492  2.553   3.932   1.00 0.00 ? 88  PHE A H    3  
ATOM 6937  H HA   . PHE A 1 36  ? 17.266  1.844   1.304   1.00 0.00 ? 88  PHE A HA   3  
ATOM 6938  H HB2  . PHE A 1 36  ? 16.361  3.559   3.619   1.00 0.00 ? 88  PHE A HB2  3  
ATOM 6939  H HB3  . PHE A 1 36  ? 15.786  3.908   2.004   1.00 0.00 ? 88  PHE A HB3  3  
ATOM 6940  H HD1  . PHE A 1 36  ? 15.625  0.868   1.099   1.00 0.00 ? 88  PHE A HD1  3  
ATOM 6941  H HD2  . PHE A 1 36  ? 14.183  3.081   4.500   1.00 0.00 ? 88  PHE A HD2  3  
ATOM 6942  H HE1  . PHE A 1 36  ? 13.744  -0.692  1.317   1.00 0.00 ? 88  PHE A HE1  3  
ATOM 6943  H HE2  . PHE A 1 36  ? 12.304  1.485   4.731   1.00 0.00 ? 88  PHE A HE2  3  
ATOM 6944  H HZ   . PHE A 1 36  ? 12.061  -0.389  3.120   1.00 0.00 ? 88  PHE A HZ   3  
ATOM 6945  N N    . GLY A 1 37  ? 19.395  4.136   1.878   1.00 0.00 ? 89  GLY A N    3  
ATOM 6946  C CA   . GLY A 1 37  ? 20.183  5.209   1.284   1.00 0.00 ? 89  GLY A CA   3  
ATOM 6947  C C    . GLY A 1 37  ? 19.446  6.546   1.368   1.00 0.00 ? 89  GLY A C    3  
ATOM 6948  O O    . GLY A 1 37  ? 18.538  6.700   2.185   1.00 0.00 ? 89  GLY A O    3  
ATOM 6949  H H    . GLY A 1 37  ? 19.751  3.691   2.713   1.00 0.00 ? 89  GLY A H    3  
ATOM 6950  H HA2  . GLY A 1 37  ? 21.137  5.294   1.804   1.00 0.00 ? 89  GLY A HA2  3  
ATOM 6951  H HA3  . GLY A 1 37  ? 20.375  4.971   0.237   1.00 0.00 ? 89  GLY A HA3  3  
ATOM 6952  N N    . PRO A 1 38  ? 19.826  7.519   0.529   1.00 0.00 ? 90  PRO A N    3  
ATOM 6953  C CA   . PRO A 1 38  ? 19.176  8.814   0.448   1.00 0.00 ? 90  PRO A CA   3  
ATOM 6954  C C    . PRO A 1 38  ? 17.679  8.668   0.188   1.00 0.00 ? 90  PRO A C    3  
ATOM 6955  O O    . PRO A 1 38  ? 17.261  7.798   -0.576  1.00 0.00 ? 90  PRO A O    3  
ATOM 6956  C CB   . PRO A 1 38  ? 19.872  9.550   -0.699  1.00 0.00 ? 90  PRO A CB   3  
ATOM 6957  C CG   . PRO A 1 38  ? 21.249  8.887   -0.758  1.00 0.00 ? 90  PRO A CG   3  
ATOM 6958  C CD   . PRO A 1 38  ? 20.931  7.438   -0.406  1.00 0.00 ? 90  PRO A CD   3  
ATOM 6959  H HA   . PRO A 1 38  ? 19.341  9.355   1.380   1.00 0.00 ? 90  PRO A HA   3  
ATOM 6960  H HB2  . PRO A 1 38  ? 19.342  9.357   -1.632  1.00 0.00 ? 90  PRO A HB2  3  
ATOM 6961  H HB3  . PRO A 1 38  ? 19.944  10.619  -0.506  1.00 0.00 ? 90  PRO A HB3  3  
ATOM 6962  H HG2  . PRO A 1 38  ? 21.702  8.978   -1.745  1.00 0.00 ? 90  PRO A HG2  3  
ATOM 6963  H HG3  . PRO A 1 38  ? 21.893  9.317   0.009   1.00 0.00 ? 90  PRO A HG3  3  
ATOM 6964  H HD2  . PRO A 1 38  ? 20.611  6.902   -1.299  1.00 0.00 ? 90  PRO A HD2  3  
ATOM 6965  H HD3  . PRO A 1 38  ? 21.799  6.952   0.042   1.00 0.00 ? 90  PRO A HD3  3  
ATOM 6966  N N    . LEU A 1 39  ? 16.869  9.520   0.821   1.00 0.00 ? 91  LEU A N    3  
ATOM 6967  C CA   . LEU A 1 39  ? 15.422  9.439   0.700   1.00 0.00 ? 91  LEU A CA   3  
ATOM 6968  C C    . LEU A 1 39  ? 14.755  10.794  0.918   1.00 0.00 ? 91  LEU A C    3  
ATOM 6969  O O    . LEU A 1 39  ? 15.399  11.753  1.339   1.00 0.00 ? 91  LEU A O    3  
ATOM 6970  C CB   . LEU A 1 39  ? 14.886  8.394   1.690   1.00 0.00 ? 91  LEU A CB   3  
ATOM 6971  C CG   . LEU A 1 39  ? 14.727  8.892   3.130   1.00 0.00 ? 91  LEU A CG   3  
ATOM 6972  C CD1  . LEU A 1 39  ? 14.146  7.759   3.973   1.00 0.00 ? 91  LEU A CD1  3  
ATOM 6973  C CD2  . LEU A 1 39  ? 16.055  9.313   3.749   1.00 0.00 ? 91  LEU A CD2  3  
ATOM 6974  H H    . LEU A 1 39  ? 17.259  10.245  1.407   1.00 0.00 ? 91  LEU A H    3  
ATOM 6975  H HA   . LEU A 1 39  ? 15.186  9.105   -0.311  1.00 0.00 ? 91  LEU A HA   3  
ATOM 6976  H HB2  . LEU A 1 39  ? 13.905  8.064   1.347   1.00 0.00 ? 91  LEU A HB2  3  
ATOM 6977  H HB3  . LEU A 1 39  ? 15.552  7.531   1.686   1.00 0.00 ? 91  LEU A HB3  3  
ATOM 6978  H HG   . LEU A 1 39  ? 14.034  9.734   3.155   1.00 0.00 ? 91  LEU A HG   3  
ATOM 6979  H HD11 . LEU A 1 39  ? 14.010  8.101   4.999   1.00 0.00 ? 91  LEU A HD11 3  
ATOM 6980  H HD12 . LEU A 1 39  ? 13.183  7.458   3.561   1.00 0.00 ? 91  LEU A HD12 3  
ATOM 6981  H HD13 . LEU A 1 39  ? 14.828  6.908   3.960   1.00 0.00 ? 91  LEU A HD13 3  
ATOM 6982  H HD21 . LEU A 1 39  ? 16.435  10.198  3.238   1.00 0.00 ? 91  LEU A HD21 3  
ATOM 6983  H HD22 . LEU A 1 39  ? 15.898  9.548   4.801   1.00 0.00 ? 91  LEU A HD22 3  
ATOM 6984  H HD23 . LEU A 1 39  ? 16.773  8.498   3.663   1.00 0.00 ? 91  LEU A HD23 3  
ATOM 6985  N N    . ILE A 1 40  ? 13.453  10.858  0.626   1.00 0.00 ? 92  ILE A N    3  
ATOM 6986  C CA   . ILE A 1 40  ? 12.627  12.039  0.827   1.00 0.00 ? 92  ILE A CA   3  
ATOM 6987  C C    . ILE A 1 40  ? 11.500  11.673  1.788   1.00 0.00 ? 92  ILE A C    3  
ATOM 6988  O O    . ILE A 1 40  ? 10.987  10.555  1.748   1.00 0.00 ? 92  ILE A O    3  
ATOM 6989  C CB   . ILE A 1 40  ? 12.087  12.542  -0.519  1.00 0.00 ? 92  ILE A CB   3  
ATOM 6990  C CG1  . ILE A 1 40  ? 13.221  12.869  -1.503  1.00 0.00 ? 92  ILE A CG1  3  
ATOM 6991  C CG2  . ILE A 1 40  ? 11.202  13.774  -0.314  1.00 0.00 ? 92  ILE A CG2  3  
ATOM 6992  C CD1  . ILE A 1 40  ? 14.120  14.016  -1.035  1.00 0.00 ? 92  ILE A CD1  3  
ATOM 6993  H H    . ILE A 1 40  ? 12.999  10.039  0.246   1.00 0.00 ? 92  ILE A H    3  
ATOM 6994  H HA   . ILE A 1 40  ? 13.227  12.825  1.286   1.00 0.00 ? 92  ILE A HA   3  
ATOM 6995  H HB   . ILE A 1 40  ? 11.478  11.754  -0.961  1.00 0.00 ? 92  ILE A HB   3  
ATOM 6996  H HG12 . ILE A 1 40  ? 13.833  11.980  -1.653  1.00 0.00 ? 92  ILE A HG12 3  
ATOM 6997  H HG13 . ILE A 1 40  ? 12.782  13.143  -2.463  1.00 0.00 ? 92  ILE A HG13 3  
ATOM 6998  H HG21 . ILE A 1 40  ? 11.747  14.545  0.230   1.00 0.00 ? 92  ILE A HG21 3  
ATOM 6999  H HG22 . ILE A 1 40  ? 10.893  14.165  -1.283  1.00 0.00 ? 92  ILE A HG22 3  
ATOM 7000  H HG23 . ILE A 1 40  ? 10.311  13.498  0.251   1.00 0.00 ? 92  ILE A HG23 3  
ATOM 7001  H HD11 . ILE A 1 40  ? 14.570  13.770  -0.073  1.00 0.00 ? 92  ILE A HD11 3  
ATOM 7002  H HD12 . ILE A 1 40  ? 14.910  14.171  -1.769  1.00 0.00 ? 92  ILE A HD12 3  
ATOM 7003  H HD13 . ILE A 1 40  ? 13.538  14.933  -0.943  1.00 0.00 ? 92  ILE A HD13 3  
ATOM 7004  N N    . VAL A 1 41  ? 11.111  12.613  2.653   1.00 0.00 ? 93  VAL A N    3  
ATOM 7005  C CA   . VAL A 1 41  ? 10.107  12.367  3.679   1.00 0.00 ? 93  VAL A CA   3  
ATOM 7006  C C    . VAL A 1 41  ? 9.106   13.515  3.737   1.00 0.00 ? 93  VAL A C    3  
ATOM 7007  O O    . VAL A 1 41  ? 9.436   14.646  3.382   1.00 0.00 ? 93  VAL A O    3  
ATOM 7008  C CB   . VAL A 1 41  ? 10.783  12.171  5.043   1.00 0.00 ? 93  VAL A CB   3  
ATOM 7009  C CG1  . VAL A 1 41  ? 11.842  11.068  4.992   1.00 0.00 ? 93  VAL A CG1  3  
ATOM 7010  C CG2  . VAL A 1 41  ? 11.465  13.454  5.518   1.00 0.00 ? 93  VAL A CG2  3  
ATOM 7011  H H    . VAL A 1 41  ? 11.523  13.535  2.609   1.00 0.00 ? 93  VAL A H    3  
ATOM 7012  H HA   . VAL A 1 41  ? 9.563   11.454  3.433   1.00 0.00 ? 93  VAL A HA   3  
ATOM 7013  H HB   . VAL A 1 41  ? 10.022  11.887  5.768   1.00 0.00 ? 93  VAL A HB   3  
ATOM 7014  H HG11 . VAL A 1 41  ? 12.257  10.922  5.990   1.00 0.00 ? 93  VAL A HG11 3  
ATOM 7015  H HG12 . VAL A 1 41  ? 11.391  10.136  4.652   1.00 0.00 ? 93  VAL A HG12 3  
ATOM 7016  H HG13 . VAL A 1 41  ? 12.646  11.350  4.313   1.00 0.00 ? 93  VAL A HG13 3  
ATOM 7017  H HG21 . VAL A 1 41  ? 10.723  14.240  5.653   1.00 0.00 ? 93  VAL A HG21 3  
ATOM 7018  H HG22 . VAL A 1 41  ? 11.961  13.266  6.471   1.00 0.00 ? 93  VAL A HG22 3  
ATOM 7019  H HG23 . VAL A 1 41  ? 12.208  13.774  4.788   1.00 0.00 ? 93  VAL A HG23 3  
ATOM 7020  N N    . ASP A 1 42  ? 7.878   13.234  4.186   1.00 0.00 ? 94  ASP A N    3  
ATOM 7021  C CA   . ASP A 1 42  ? 6.861   14.262  4.332   1.00 0.00 ? 94  ASP A CA   3  
ATOM 7022  C C    . ASP A 1 42  ? 5.815   13.882  5.379   1.00 0.00 ? 94  ASP A C    3  
ATOM 7023  O O    . ASP A 1 42  ? 5.470   12.712  5.544   1.00 0.00 ? 94  ASP A O    3  
ATOM 7024  C CB   . ASP A 1 42  ? 6.182   14.500  2.981   1.00 0.00 ? 94  ASP A CB   3  
ATOM 7025  C CG   . ASP A 1 42  ? 5.150   15.623  3.065   1.00 0.00 ? 94  ASP A CG   3  
ATOM 7026  O OD1  . ASP A 1 42  ? 5.562   16.762  3.380   1.00 0.00 ? 94  ASP A OD1  3  
ATOM 7027  O OD2  . ASP A 1 42  ? 3.960   15.335  2.814   1.00 0.00 ? 94  ASP A OD2  3  
ATOM 7028  H H    . ASP A 1 42  ? 7.635   12.285  4.435   1.00 0.00 ? 94  ASP A H    3  
ATOM 7029  H HA   . ASP A 1 42  ? 7.343   15.188  4.645   1.00 0.00 ? 94  ASP A HA   3  
ATOM 7030  H HB2  . ASP A 1 42  ? 6.938   14.767  2.242   1.00 0.00 ? 94  ASP A HB2  3  
ATOM 7031  H HB3  . ASP A 1 42  ? 5.691   13.582  2.661   1.00 0.00 ? 94  ASP A HB3  3  
ATOM 7032  N N    . TRP A 1 43  ? 5.315   14.898  6.083   1.00 0.00 ? 95  TRP A N    3  
ATOM 7033  C CA   . TRP A 1 43  ? 4.217   14.784  7.029   1.00 0.00 ? 95  TRP A CA   3  
ATOM 7034  C C    . TRP A 1 43  ? 3.498   16.131  7.086   1.00 0.00 ? 95  TRP A C    3  
ATOM 7035  O O    . TRP A 1 43  ? 4.132   17.170  6.916   1.00 0.00 ? 95  TRP A O    3  
ATOM 7036  C CB   . TRP A 1 43  ? 4.726   14.337  8.404   1.00 0.00 ? 95  TRP A CB   3  
ATOM 7037  C CG   . TRP A 1 43  ? 6.130   14.713  8.770   1.00 0.00 ? 95  TRP A CG   3  
ATOM 7038  C CD1  . TRP A 1 43  ? 6.529   15.879  9.322   1.00 0.00 ? 95  TRP A CD1  3  
ATOM 7039  C CD2  . TRP A 1 43  ? 7.347   13.918  8.619   1.00 0.00 ? 95  TRP A CD2  3  
ATOM 7040  N NE1  . TRP A 1 43  ? 7.892   15.853  9.536   1.00 0.00 ? 95  TRP A NE1  3  
ATOM 7041  C CE2  . TRP A 1 43  ? 8.453   14.665  9.114   1.00 0.00 ? 95  TRP A CE2  3  
ATOM 7042  C CE3  . TRP A 1 43  ? 7.622   12.634  8.115   1.00 0.00 ? 95  TRP A CE3  3  
ATOM 7043  C CZ2  . TRP A 1 43  ? 9.760   14.162  9.111   1.00 0.00 ? 95  TRP A CZ2  3  
ATOM 7044  C CZ3  . TRP A 1 43  ? 8.927   12.117  8.112   1.00 0.00 ? 95  TRP A CZ3  3  
ATOM 7045  C CH2  . TRP A 1 43  ? 9.995   12.876  8.608   1.00 0.00 ? 95  TRP A CH2  3  
ATOM 7046  H H    . TRP A 1 43  ? 5.712   15.817  5.958   1.00 0.00 ? 95  TRP A H    3  
ATOM 7047  H HA   . TRP A 1 43  ? 3.512   14.038  6.662   1.00 0.00 ? 95  TRP A HA   3  
ATOM 7048  H HB2  . TRP A 1 43  ? 4.049   14.720  9.168   1.00 0.00 ? 95  TRP A HB2  3  
ATOM 7049  H HB3  . TRP A 1 43  ? 4.669   13.249  8.436   1.00 0.00 ? 95  TRP A HB3  3  
ATOM 7050  H HD1  . TRP A 1 43  ? 5.879   16.709  9.562   1.00 0.00 ? 95  TRP A HD1  3  
ATOM 7051  H HE1  . TRP A 1 43  ? 8.395   16.623  9.954   1.00 0.00 ? 95  TRP A HE1  3  
ATOM 7052  H HE3  . TRP A 1 43  ? 6.810   12.038  7.725   1.00 0.00 ? 95  TRP A HE3  3  
ATOM 7053  H HZ2  . TRP A 1 43  ? 10.582  14.753  9.490   1.00 0.00 ? 95  TRP A HZ2  3  
ATOM 7054  H HZ3  . TRP A 1 43  ? 9.109   11.127  7.722   1.00 0.00 ? 95  TRP A HZ3  3  
ATOM 7055  H HH2  . TRP A 1 43  ? 10.994  12.468  8.601   1.00 0.00 ? 95  TRP A HH2  3  
ATOM 7056  N N    . PRO A 1 44  ? 2.178   16.134  7.323   1.00 0.00 ? 96  PRO A N    3  
ATOM 7057  C CA   . PRO A 1 44  ? 1.326   17.309  7.205   1.00 0.00 ? 96  PRO A CA   3  
ATOM 7058  C C    . PRO A 1 44  ? 1.599   18.375  8.268   1.00 0.00 ? 96  PRO A C    3  
ATOM 7059  O O    . PRO A 1 44  ? 0.948   19.417  8.264   1.00 0.00 ? 96  PRO A O    3  
ATOM 7060  C CB   . PRO A 1 44  ? -0.103  16.771  7.311   1.00 0.00 ? 96  PRO A CB   3  
ATOM 7061  C CG   . PRO A 1 44  ? 0.060   15.532  8.187   1.00 0.00 ? 96  PRO A CG   3  
ATOM 7062  C CD   . PRO A 1 44  ? 1.400   14.974  7.715   1.00 0.00 ? 96  PRO A CD   3  
ATOM 7063  H HA   . PRO A 1 44  ? 1.465   17.761  6.224   1.00 0.00 ? 96  PRO A HA   3  
ATOM 7064  H HB2  . PRO A 1 44  ? -0.784  17.496  7.756   1.00 0.00 ? 96  PRO A HB2  3  
ATOM 7065  H HB3  . PRO A 1 44  ? -0.449  16.469  6.322   1.00 0.00 ? 96  PRO A HB3  3  
ATOM 7066  H HG2  . PRO A 1 44  ? 0.132   15.836  9.232   1.00 0.00 ? 96  PRO A HG2  3  
ATOM 7067  H HG3  . PRO A 1 44  ? -0.753  14.821  8.039   1.00 0.00 ? 96  PRO A HG3  3  
ATOM 7068  H HD2  . PRO A 1 44  ? 1.886   14.419  8.519   1.00 0.00 ? 96  PRO A HD2  3  
ATOM 7069  H HD3  . PRO A 1 44  ? 1.245   14.334  6.847   1.00 0.00 ? 96  PRO A HD3  3  
ATOM 7070  N N    . HIS A 1 45  ? 2.550   18.138  9.178   1.00 0.00 ? 97  HIS A N    3  
ATOM 7071  C CA   . HIS A 1 45  ? 2.880   19.108  10.214  1.00 0.00 ? 97  HIS A CA   3  
ATOM 7072  C C    . HIS A 1 45  ? 3.719   20.260  9.651   1.00 0.00 ? 97  HIS A C    3  
ATOM 7073  O O    . HIS A 1 45  ? 3.992   21.230  10.355  1.00 0.00 ? 97  HIS A O    3  
ATOM 7074  C CB   . HIS A 1 45  ? 3.589   18.391  11.364  1.00 0.00 ? 97  HIS A CB   3  
ATOM 7075  C CG   . HIS A 1 45  ? 3.745   19.256  12.588  1.00 0.00 ? 97  HIS A CG   3  
ATOM 7076  N ND1  . HIS A 1 45  ? 2.757   19.477  13.552  1.00 0.00 ? 97  HIS A ND1  3  
ATOM 7077  C CD2  . HIS A 1 45  ? 4.872   19.946  12.931  1.00 0.00 ? 97  HIS A CD2  3  
ATOM 7078  C CE1  . HIS A 1 45  ? 3.320   20.300  14.454  1.00 0.00 ? 97  HIS A CE1  3  
ATOM 7079  N NE2  . HIS A 1 45  ? 4.585   20.597  14.107  1.00 0.00 ? 97  HIS A NE2  3  
ATOM 7080  H H    . HIS A 1 45  ? 3.058   17.266  9.157   1.00 0.00 ? 97  HIS A H    3  
ATOM 7081  H HA   . HIS A 1 45  ? 1.950   19.526  10.599  1.00 0.00 ? 97  HIS A HA   3  
ATOM 7082  H HB2  . HIS A 1 45  ? 3.007   17.512  11.639  1.00 0.00 ? 97  HIS A HB2  3  
ATOM 7083  H HB3  . HIS A 1 45  ? 4.574   18.065  11.029  1.00 0.00 ? 97  HIS A HB3  3  
ATOM 7084  H HD2  . HIS A 1 45  ? 5.803   19.977  12.385  1.00 0.00 ? 97  HIS A HD2  3  
ATOM 7085  H HE1  . HIS A 1 45  ? 2.823   20.673  15.337  1.00 0.00 ? 97  HIS A HE1  3  
ATOM 7086  H HE2  . HIS A 1 45  ? 5.214   21.196  14.622  1.00 0.00 ? 97  HIS A HE2  3  
ATOM 7087  N N    . LYS A 1 46  ? 4.132   20.164  8.381   1.00 0.00 ? 98  LYS A N    3  
ATOM 7088  C CA   . LYS A 1 46  ? 4.922   21.197  7.717   1.00 0.00 ? 98  LYS A CA   3  
ATOM 7089  C C    . LYS A 1 46  ? 4.061   22.373  7.249   1.00 0.00 ? 98  LYS A C    3  
ATOM 7090  O O    . LYS A 1 46  ? 4.551   23.254  6.545   1.00 0.00 ? 98  LYS A O    3  
ATOM 7091  C CB   . LYS A 1 46  ? 5.754   20.573  6.589   1.00 0.00 ? 98  LYS A CB   3  
ATOM 7092  C CG   . LYS A 1 46  ? 4.928   19.885  5.493   1.00 0.00 ? 98  LYS A CG   3  
ATOM 7093  C CD   . LYS A 1 46  ? 4.348   20.863  4.469   1.00 0.00 ? 98  LYS A CD   3  
ATOM 7094  C CE   . LYS A 1 46  ? 3.625   20.099  3.358   1.00 0.00 ? 98  LYS A CE   3  
ATOM 7095  N NZ   . LYS A 1 46  ? 4.548   19.240  2.592   1.00 0.00 ? 98  LYS A NZ   3  
ATOM 7096  H H    . LYS A 1 46  ? 3.892   19.340  7.848   1.00 0.00 ? 98  LYS A H    3  
ATOM 7097  H HA   . LYS A 1 46  ? 5.622   21.595  8.453   1.00 0.00 ? 98  LYS A HA   3  
ATOM 7098  H HB2  . LYS A 1 46  ? 6.386   21.336  6.134   1.00 0.00 ? 98  LYS A HB2  3  
ATOM 7099  H HB3  . LYS A 1 46  ? 6.406   19.824  7.037   1.00 0.00 ? 98  LYS A HB3  3  
ATOM 7100  H HG2  . LYS A 1 46  ? 5.582   19.186  4.971   1.00 0.00 ? 98  LYS A HG2  3  
ATOM 7101  H HG3  . LYS A 1 46  ? 4.113   19.324  5.949   1.00 0.00 ? 98  LYS A HG3  3  
ATOM 7102  H HD2  . LYS A 1 46  ? 3.631   21.525  4.955   1.00 0.00 ? 98  LYS A HD2  3  
ATOM 7103  H HD3  . LYS A 1 46  ? 5.150   21.461  4.037   1.00 0.00 ? 98  LYS A HD3  3  
ATOM 7104  H HE2  . LYS A 1 46  ? 2.840   19.485  3.799   1.00 0.00 ? 98  LYS A HE2  3  
ATOM 7105  H HE3  . LYS A 1 46  ? 3.164   20.819  2.683   1.00 0.00 ? 98  LYS A HE3  3  
ATOM 7106  H HZ1  . LYS A 1 46  ? 4.049   18.791  1.837   1.00 0.00 ? 98  LYS A HZ1  3  
ATOM 7107  H HZ2  . LYS A 1 46  ? 5.296   19.797  2.205   1.00 0.00 ? 98  LYS A HZ2  3  
ATOM 7108  H HZ3  . LYS A 1 46  ? 4.940   18.525  3.187   1.00 0.00 ? 98  LYS A HZ3  3  
ATOM 7109  N N    . ALA A 1 47  ? 2.783   22.389  7.636   1.00 0.00 ? 99  ALA A N    3  
ATOM 7110  C CA   . ALA A 1 47  ? 1.843   23.429  7.243   1.00 0.00 ? 99  ALA A CA   3  
ATOM 7111  C C    . ALA A 1 47  ? 2.054   24.734  8.019   1.00 0.00 ? 99  ALA A C    3  
ATOM 7112  O O    . ALA A 1 47  ? 1.284   25.680  7.852   1.00 0.00 ? 99  ALA A O    3  
ATOM 7113  C CB   . ALA A 1 47  ? 0.419   22.902  7.422   1.00 0.00 ? 99  ALA A CB   3  
ATOM 7114  H H    . ALA A 1 47  ? 2.437   21.648  8.227   1.00 0.00 ? 99  ALA A H    3  
ATOM 7115  H HA   . ALA A 1 47  ? 1.998   23.641  6.185   1.00 0.00 ? 99  ALA A HA   3  
ATOM 7116  H HB1  . ALA A 1 47  ? 0.238   22.683  8.475   1.00 0.00 ? 99  ALA A HB1  3  
ATOM 7117  H HB2  . ALA A 1 47  ? -0.295  23.653  7.083   1.00 0.00 ? 99  ALA A HB2  3  
ATOM 7118  H HB3  . ALA A 1 47  ? 0.289   21.992  6.835   1.00 0.00 ? 99  ALA A HB3  3  
ATOM 7119  N N    . GLU A 1 48  ? 3.088   24.798  8.865   1.00 0.00 ? 100 GLU A N    3  
ATOM 7120  C CA   . GLU A 1 48  ? 3.412   25.992  9.635   1.00 0.00 ? 100 GLU A CA   3  
ATOM 7121  C C    . GLU A 1 48  ? 4.914   26.282  9.581   1.00 0.00 ? 100 GLU A C    3  
ATOM 7122  O O    . GLU A 1 48  ? 5.709   25.422  9.200   1.00 0.00 ? 100 GLU A O    3  
ATOM 7123  C CB   . GLU A 1 48  ? 2.890   25.854  11.067  1.00 0.00 ? 100 GLU A CB   3  
ATOM 7124  C CG   . GLU A 1 48  ? 3.519   24.669  11.800  1.00 0.00 ? 100 GLU A CG   3  
ATOM 7125  C CD   . GLU A 1 48  ? 2.919   24.522  13.197  1.00 0.00 ? 100 GLU A CD   3  
ATOM 7126  O OE1  . GLU A 1 48  ? 3.343   25.285  14.093  1.00 0.00 ? 100 GLU A OE1  3  
ATOM 7127  O OE2  . GLU A 1 48  ? 2.038   23.648  13.363  1.00 0.00 ? 100 GLU A OE2  3  
ATOM 7128  H H    . GLU A 1 48  ? 3.682   23.991  8.985   1.00 0.00 ? 100 GLU A H    3  
ATOM 7129  H HA   . GLU A 1 48  ? 2.902   26.843  9.182   1.00 0.00 ? 100 GLU A HA   3  
ATOM 7130  H HB2  . GLU A 1 48  ? 3.105   26.770  11.618  1.00 0.00 ? 100 GLU A HB2  3  
ATOM 7131  H HB3  . GLU A 1 48  ? 1.809   25.713  11.035  1.00 0.00 ? 100 GLU A HB3  3  
ATOM 7132  H HG2  . GLU A 1 48  ? 3.341   23.756  11.233  1.00 0.00 ? 100 GLU A HG2  3  
ATOM 7133  H HG3  . GLU A 1 48  ? 4.594   24.830  11.881  1.00 0.00 ? 100 GLU A HG3  3  
ATOM 7134  N N    . SER A 1 49  ? 5.300   27.503  9.965   1.00 0.00 ? 101 SER A N    3  
ATOM 7135  C CA   . SER A 1 49  ? 6.661   28.002  9.812   1.00 0.00 ? 101 SER A CA   3  
ATOM 7136  C C    . SER A 1 49  ? 7.603   27.604  10.951  1.00 0.00 ? 101 SER A C    3  
ATOM 7137  O O    . SER A 1 49  ? 8.721   28.116  11.018  1.00 0.00 ? 101 SER A O    3  
ATOM 7138  C CB   . SER A 1 49  ? 6.619   29.521  9.642   1.00 0.00 ? 101 SER A CB   3  
ATOM 7139  O OG   . SER A 1 49  ? 6.039   30.117  10.785  1.00 0.00 ? 101 SER A OG   3  
ATOM 7140  H H    . SER A 1 49  ? 4.622   28.127  10.377  1.00 0.00 ? 101 SER A H    3  
ATOM 7141  H HA   . SER A 1 49  ? 7.067   27.579  8.893   1.00 0.00 ? 101 SER A HA   3  
ATOM 7142  H HB2  . SER A 1 49  ? 7.630   29.902  9.501   1.00 0.00 ? 101 SER A HB2  3  
ATOM 7143  H HB3  . SER A 1 49  ? 6.020   29.768  8.764   1.00 0.00 ? 101 SER A HB3  3  
ATOM 7144  H HG   . SER A 1 49  ? 6.009   31.066  10.650  1.00 0.00 ? 101 SER A HG   3  
ATOM 7145  N N    . LYS A 1 50  ? 7.178   26.703  11.845  1.00 0.00 ? 102 LYS A N    3  
ATOM 7146  C CA   . LYS A 1 50  ? 8.006   26.276  12.967  1.00 0.00 ? 102 LYS A CA   3  
ATOM 7147  C C    . LYS A 1 50  ? 7.861   24.780  13.231  1.00 0.00 ? 102 LYS A C    3  
ATOM 7148  O O    . LYS A 1 50  ? 6.836   24.187  12.901  1.00 0.00 ? 102 LYS A O    3  
ATOM 7149  C CB   . LYS A 1 50  ? 7.659   27.099  14.213  1.00 0.00 ? 102 LYS A CB   3  
ATOM 7150  C CG   . LYS A 1 50  ? 6.205   26.887  14.642  1.00 0.00 ? 102 LYS A CG   3  
ATOM 7151  C CD   . LYS A 1 50  ? 5.891   27.740  15.871  1.00 0.00 ? 102 LYS A CD   3  
ATOM 7152  C CE   . LYS A 1 50  ? 4.440   27.514  16.288  1.00 0.00 ? 102 LYS A CE   3  
ATOM 7153  N NZ   . LYS A 1 50  ? 4.092   28.324  17.471  1.00 0.00 ? 102 LYS A NZ   3  
ATOM 7154  H H    . LYS A 1 50  ? 6.258   26.300  11.749  1.00 0.00 ? 102 LYS A H    3  
ATOM 7155  H HA   . LYS A 1 50  ? 9.050   26.466  12.720  1.00 0.00 ? 102 LYS A HA   3  
ATOM 7156  H HB2  . LYS A 1 50  ? 8.318   26.808  15.030  1.00 0.00 ? 102 LYS A HB2  3  
ATOM 7157  H HB3  . LYS A 1 50  ? 7.816   28.156  13.996  1.00 0.00 ? 102 LYS A HB3  3  
ATOM 7158  H HG2  . LYS A 1 50  ? 5.538   27.173  13.828  1.00 0.00 ? 102 LYS A HG2  3  
ATOM 7159  H HG3  . LYS A 1 50  ? 6.047   25.837  14.887  1.00 0.00 ? 102 LYS A HG3  3  
ATOM 7160  H HD2  . LYS A 1 50  ? 6.553   27.455  16.689  1.00 0.00 ? 102 LYS A HD2  3  
ATOM 7161  H HD3  . LYS A 1 50  ? 6.042   28.792  15.632  1.00 0.00 ? 102 LYS A HD3  3  
ATOM 7162  H HE2  . LYS A 1 50  ? 3.786   27.786  15.459  1.00 0.00 ? 102 LYS A HE2  3  
ATOM 7163  H HE3  . LYS A 1 50  ? 4.295   26.458  16.515  1.00 0.00 ? 102 LYS A HE3  3  
ATOM 7164  H HZ1  . LYS A 1 50  ? 4.217   29.305  17.264  1.00 0.00 ? 102 LYS A HZ1  3  
ATOM 7165  H HZ2  . LYS A 1 50  ? 3.130   28.162  17.729  1.00 0.00 ? 102 LYS A HZ2  3  
ATOM 7166  H HZ3  . LYS A 1 50  ? 4.689   28.073  18.247  1.00 0.00 ? 102 LYS A HZ3  3  
ATOM 7167  N N    . SER A 1 51  ? 8.904   24.194  13.829  1.00 0.00 ? 103 SER A N    3  
ATOM 7168  C CA   . SER A 1 51  ? 9.037   22.769  14.132  1.00 0.00 ? 103 SER A CA   3  
ATOM 7169  C C    . SER A 1 51  ? 8.893   21.865  12.904  1.00 0.00 ? 103 SER A C    3  
ATOM 7170  O O    . SER A 1 51  ? 8.438   22.292  11.843  1.00 0.00 ? 103 SER A O    3  
ATOM 7171  C CB   . SER A 1 51  ? 8.105   22.371  15.278  1.00 0.00 ? 103 SER A CB   3  
ATOM 7172  O OG   . SER A 1 51  ? 6.766   22.303  14.839  1.00 0.00 ? 103 SER A OG   3  
ATOM 7173  H H    . SER A 1 51  ? 9.679   24.783  14.099  1.00 0.00 ? 103 SER A H    3  
ATOM 7174  H HA   . SER A 1 51  ? 10.053  22.628  14.502  1.00 0.00 ? 103 SER A HA   3  
ATOM 7175  H HB2  . SER A 1 51  ? 8.400   21.394  15.659  1.00 0.00 ? 103 SER A HB2  3  
ATOM 7176  H HB3  . SER A 1 51  ? 8.189   23.103  16.082  1.00 0.00 ? 103 SER A HB3  3  
ATOM 7177  H HG   . SER A 1 51  ? 6.559   23.117  14.373  1.00 0.00 ? 103 SER A HG   3  
ATOM 7178  N N    . TYR A 1 52  ? 9.288   20.596  13.056  1.00 0.00 ? 104 TYR A N    3  
ATOM 7179  C CA   . TYR A 1 52  ? 9.245   19.617  11.976  1.00 0.00 ? 104 TYR A CA   3  
ATOM 7180  C C    . TYR A 1 52  ? 8.846   18.234  12.495  1.00 0.00 ? 104 TYR A C    3  
ATOM 7181  O O    . TYR A 1 52  ? 9.024   17.237  11.796  1.00 0.00 ? 104 TYR A O    3  
ATOM 7182  C CB   . TYR A 1 52  ? 10.609  19.558  11.282  1.00 0.00 ? 104 TYR A CB   3  
ATOM 7183  C CG   . TYR A 1 52  ? 11.071  20.887  10.725  1.00 0.00 ? 104 TYR A CG   3  
ATOM 7184  C CD1  . TYR A 1 52  ? 10.593  21.328  9.482   1.00 0.00 ? 104 TYR A CD1  3  
ATOM 7185  C CD2  . TYR A 1 52  ? 11.975  21.675  11.452  1.00 0.00 ? 104 TYR A CD2  3  
ATOM 7186  C CE1  . TYR A 1 52  ? 11.017  22.561  8.963   1.00 0.00 ? 104 TYR A CE1  3  
ATOM 7187  C CE2  . TYR A 1 52  ? 12.402  22.910  10.940  1.00 0.00 ? 104 TYR A CE2  3  
ATOM 7188  C CZ   . TYR A 1 52  ? 11.922  23.357  9.693   1.00 0.00 ? 104 TYR A CZ   3  
ATOM 7189  O OH   . TYR A 1 52  ? 12.336  24.558  9.195   1.00 0.00 ? 104 TYR A OH   3  
ATOM 7190  H H    . TYR A 1 52  ? 9.637   20.292  13.953  1.00 0.00 ? 104 TYR A H    3  
ATOM 7191  H HA   . TYR A 1 52  ? 8.497   19.931  11.249  1.00 0.00 ? 104 TYR A HA   3  
ATOM 7192  H HB2  . TYR A 1 52  ? 11.351  19.202  11.998  1.00 0.00 ? 104 TYR A HB2  3  
ATOM 7193  H HB3  . TYR A 1 52  ? 10.554  18.840  10.464  1.00 0.00 ? 104 TYR A HB3  3  
ATOM 7194  H HD1  . TYR A 1 52  ? 9.898   20.719  8.924   1.00 0.00 ? 104 TYR A HD1  3  
ATOM 7195  H HD2  . TYR A 1 52  ? 12.345  21.332  12.407  1.00 0.00 ? 104 TYR A HD2  3  
ATOM 7196  H HE1  . TYR A 1 52  ? 10.650  22.899  8.005   1.00 0.00 ? 104 TYR A HE1  3  
ATOM 7197  H HE2  . TYR A 1 52  ? 13.097  23.519  11.500  1.00 0.00 ? 104 TYR A HE2  3  
ATOM 7198  H HH   . TYR A 1 52  ? 11.945  24.760  8.341   1.00 0.00 ? 104 TYR A HH   3  
ATOM 7199  N N    . PHE A 1 53  ? 8.308   18.164  13.714  1.00 0.00 ? 105 PHE A N    3  
ATOM 7200  C CA   . PHE A 1 53  ? 7.942   16.902  14.342  1.00 0.00 ? 105 PHE A CA   3  
ATOM 7201  C C    . PHE A 1 53  ? 6.689   16.314  13.682  1.00 0.00 ? 105 PHE A C    3  
ATOM 7202  O O    . PHE A 1 53  ? 5.797   17.070  13.300  1.00 0.00 ? 105 PHE A O    3  
ATOM 7203  C CB   . PHE A 1 53  ? 7.725   17.149  15.837  1.00 0.00 ? 105 PHE A CB   3  
ATOM 7204  C CG   . PHE A 1 53  ? 7.555   15.888  16.650  1.00 0.00 ? 105 PHE A CG   3  
ATOM 7205  C CD1  . PHE A 1 53  ? 8.673   15.094  16.940  1.00 0.00 ? 105 PHE A CD1  3  
ATOM 7206  C CD2  . PHE A 1 53  ? 6.290   15.506  17.117  1.00 0.00 ? 105 PHE A CD2  3  
ATOM 7207  C CE1  . PHE A 1 53  ? 8.524   13.911  17.675  1.00 0.00 ? 105 PHE A CE1  3  
ATOM 7208  C CE2  . PHE A 1 53  ? 6.142   14.325  17.857  1.00 0.00 ? 105 PHE A CE2  3  
ATOM 7209  C CZ   . PHE A 1 53  ? 7.258   13.526  18.134  1.00 0.00 ? 105 PHE A CZ   3  
ATOM 7210  H H    . PHE A 1 53  ? 8.143   19.014  14.234  1.00 0.00 ? 105 PHE A H    3  
ATOM 7211  H HA   . PHE A 1 53  ? 8.776   16.210  14.224  1.00 0.00 ? 105 PHE A HA   3  
ATOM 7212  H HB2  . PHE A 1 53  ? 8.587   17.688  16.227  1.00 0.00 ? 105 PHE A HB2  3  
ATOM 7213  H HB3  . PHE A 1 53  ? 6.844   17.778  15.969  1.00 0.00 ? 105 PHE A HB3  3  
ATOM 7214  H HD1  . PHE A 1 53  ? 9.650   15.397  16.595  1.00 0.00 ? 105 PHE A HD1  3  
ATOM 7215  H HD2  . PHE A 1 53  ? 5.427   16.121  16.906  1.00 0.00 ? 105 PHE A HD2  3  
ATOM 7216  H HE1  . PHE A 1 53  ? 9.388   13.298  17.885  1.00 0.00 ? 105 PHE A HE1  3  
ATOM 7217  H HE2  . PHE A 1 53  ? 5.166   14.030  18.214  1.00 0.00 ? 105 PHE A HE2  3  
ATOM 7218  H HZ   . PHE A 1 53  ? 7.143   12.614  18.700  1.00 0.00 ? 105 PHE A HZ   3  
ATOM 7219  N N    . PRO A 1 54  ? 6.596   14.984  13.535  1.00 0.00 ? 106 PRO A N    3  
ATOM 7220  C CA   . PRO A 1 54  ? 5.419   14.317  12.996  1.00 0.00 ? 106 PRO A CA   3  
ATOM 7221  C C    . PRO A 1 54  ? 4.151   14.666  13.783  1.00 0.00 ? 106 PRO A C    3  
ATOM 7222  O O    . PRO A 1 54  ? 4.229   14.996  14.965  1.00 0.00 ? 106 PRO A O    3  
ATOM 7223  C CB   . PRO A 1 54  ? 5.724   12.821  13.077  1.00 0.00 ? 106 PRO A CB   3  
ATOM 7224  C CG   . PRO A 1 54  ? 7.249   12.766  13.067  1.00 0.00 ? 106 PRO A CG   3  
ATOM 7225  C CD   . PRO A 1 54  ? 7.622   14.014  13.863  1.00 0.00 ? 106 PRO A CD   3  
ATOM 7226  H HA   . PRO A 1 54  ? 5.303   14.606  11.951  1.00 0.00 ? 106 PRO A HA   3  
ATOM 7227  H HB2  . PRO A 1 54  ? 5.361   12.424  14.026  1.00 0.00 ? 106 PRO A HB2  3  
ATOM 7228  H HB3  . PRO A 1 54  ? 5.296   12.274  12.237  1.00 0.00 ? 106 PRO A HB3  3  
ATOM 7229  H HG2  . PRO A 1 54  ? 7.625   11.857  13.536  1.00 0.00 ? 106 PRO A HG2  3  
ATOM 7230  H HG3  . PRO A 1 54  ? 7.612   12.862  12.044  1.00 0.00 ? 106 PRO A HG3  3  
ATOM 7231  H HD2  . PRO A 1 54  ? 7.585   13.791  14.929  1.00 0.00 ? 106 PRO A HD2  3  
ATOM 7232  H HD3  . PRO A 1 54  ? 8.614   14.361  13.572  1.00 0.00 ? 106 PRO A HD3  3  
ATOM 7233  N N    . PRO A 1 55  ? 2.975   14.599  13.145  1.00 0.00 ? 107 PRO A N    3  
ATOM 7234  C CA   . PRO A 1 55  ? 1.711   14.975  13.756  1.00 0.00 ? 107 PRO A CA   3  
ATOM 7235  C C    . PRO A 1 55  ? 1.221   13.943  14.774  1.00 0.00 ? 107 PRO A C    3  
ATOM 7236  O O    . PRO A 1 55  ? 0.462   14.294  15.678  1.00 0.00 ? 107 PRO A O    3  
ATOM 7237  C CB   . PRO A 1 55  ? 0.736   15.074  12.582  1.00 0.00 ? 107 PRO A CB   3  
ATOM 7238  C CG   . PRO A 1 55  ? 1.272   14.023  11.611  1.00 0.00 ? 107 PRO A CG   3  
ATOM 7239  C CD   . PRO A 1 55  ? 2.783   14.163  11.776  1.00 0.00 ? 107 PRO A CD   3  
ATOM 7240  H HA   . PRO A 1 55  ? 1.798   15.946  14.244  1.00 0.00 ? 107 PRO A HA   3  
ATOM 7241  H HB2  . PRO A 1 55  ? -0.290  14.866  12.882  1.00 0.00 ? 107 PRO A HB2  3  
ATOM 7242  H HB3  . PRO A 1 55  ? 0.815   16.061  12.127  1.00 0.00 ? 107 PRO A HB3  3  
ATOM 7243  H HG2  . PRO A 1 55  ? 0.956   13.030  11.932  1.00 0.00 ? 107 PRO A HG2  3  
ATOM 7244  H HG3  . PRO A 1 55  ? 0.955   14.216  10.585  1.00 0.00 ? 107 PRO A HG3  3  
ATOM 7245  H HD2  . PRO A 1 55  ? 3.277   13.211  11.585  1.00 0.00 ? 107 PRO A HD2  3  
ATOM 7246  H HD3  . PRO A 1 55  ? 3.155   14.934  11.100  1.00 0.00 ? 107 PRO A HD3  3  
ATOM 7247  N N    . LYS A 1 56  ? 1.644   12.680  14.642  1.00 0.00 ? 108 LYS A N    3  
ATOM 7248  C CA   . LYS A 1 56  ? 1.229   11.617  15.553  1.00 0.00 ? 108 LYS A CA   3  
ATOM 7249  C C    . LYS A 1 56  ? 2.243   10.472  15.602  1.00 0.00 ? 108 LYS A C    3  
ATOM 7250  O O    . LYS A 1 56  ? 1.908   9.370   16.033  1.00 0.00 ? 108 LYS A O    3  
ATOM 7251  C CB   . LYS A 1 56  ? -0.163  11.109  15.159  1.00 0.00 ? 108 LYS A CB   3  
ATOM 7252  C CG   . LYS A 1 56  ? -0.155  10.416  13.793  1.00 0.00 ? 108 LYS A CG   3  
ATOM 7253  C CD   . LYS A 1 56  ? -1.564  9.972   13.392  1.00 0.00 ? 108 LYS A CD   3  
ATOM 7254  C CE   . LYS A 1 56  ? -2.209  9.069   14.448  1.00 0.00 ? 108 LYS A CE   3  
ATOM 7255  N NZ   . LYS A 1 56  ? -1.412  7.851   14.685  1.00 0.00 ? 108 LYS A NZ   3  
ATOM 7256  H H    . LYS A 1 56  ? 2.270   12.447  13.884  1.00 0.00 ? 108 LYS A H    3  
ATOM 7257  H HA   . LYS A 1 56  ? 1.167   12.041  16.555  1.00 0.00 ? 108 LYS A HA   3  
ATOM 7258  H HB2  . LYS A 1 56  ? -0.507  10.407  15.919  1.00 0.00 ? 108 LYS A HB2  3  
ATOM 7259  H HB3  . LYS A 1 56  ? -0.854  11.952  15.129  1.00 0.00 ? 108 LYS A HB3  3  
ATOM 7260  H HG2  . LYS A 1 56  ? 0.223   11.106  13.039  1.00 0.00 ? 108 LYS A HG2  3  
ATOM 7261  H HG3  . LYS A 1 56  ? 0.498   9.543   13.832  1.00 0.00 ? 108 LYS A HG3  3  
ATOM 7262  H HD2  . LYS A 1 56  ? -2.190  10.855  13.259  1.00 0.00 ? 108 LYS A HD2  3  
ATOM 7263  H HD3  . LYS A 1 56  ? -1.512  9.435   12.445  1.00 0.00 ? 108 LYS A HD3  3  
ATOM 7264  H HE2  . LYS A 1 56  ? -2.311  9.624   15.381  1.00 0.00 ? 108 LYS A HE2  3  
ATOM 7265  H HE3  . LYS A 1 56  ? -3.205  8.784   14.106  1.00 0.00 ? 108 LYS A HE3  3  
ATOM 7266  H HZ1  . LYS A 1 56  ? -0.495  8.096   15.031  1.00 0.00 ? 108 LYS A HZ1  3  
ATOM 7267  H HZ2  . LYS A 1 56  ? -1.875  7.269   15.369  1.00 0.00 ? 108 LYS A HZ2  3  
ATOM 7268  H HZ3  . LYS A 1 56  ? -1.315  7.331   13.825  1.00 0.00 ? 108 LYS A HZ3  3  
ATOM 7269  N N    . GLY A 1 57  ? 3.478   10.726  15.162  1.00 0.00 ? 109 GLY A N    3  
ATOM 7270  C CA   . GLY A 1 57  ? 4.525   9.713   15.108  1.00 0.00 ? 109 GLY A CA   3  
ATOM 7271  C C    . GLY A 1 57  ? 4.461   8.881   13.826  1.00 0.00 ? 109 GLY A C    3  
ATOM 7272  O O    . GLY A 1 57  ? 5.301   8.005   13.628  1.00 0.00 ? 109 GLY A O    3  
ATOM 7273  H H    . GLY A 1 57  ? 3.711   11.658  14.850  1.00 0.00 ? 109 GLY A H    3  
ATOM 7274  H HA2  . GLY A 1 57  ? 5.496   10.204  15.160  1.00 0.00 ? 109 GLY A HA2  3  
ATOM 7275  H HA3  . GLY A 1 57  ? 4.423   9.047   15.965  1.00 0.00 ? 109 GLY A HA3  3  
ATOM 7276  N N    . TYR A 1 58  ? 3.479   9.145   12.957  1.00 0.00 ? 110 TYR A N    3  
ATOM 7277  C CA   . TYR A 1 58  ? 3.370   8.463   11.676  1.00 0.00 ? 110 TYR A CA   3  
ATOM 7278  C C    . TYR A 1 58  ? 4.036   9.303   10.589  1.00 0.00 ? 110 TYR A C    3  
ATOM 7279  O O    . TYR A 1 58  ? 4.138   10.523  10.717  1.00 0.00 ? 110 TYR A O    3  
ATOM 7280  C CB   . TYR A 1 58  ? 1.901   8.197   11.332  1.00 0.00 ? 110 TYR A CB   3  
ATOM 7281  C CG   . TYR A 1 58  ? 1.211   7.102   12.123  1.00 0.00 ? 110 TYR A CG   3  
ATOM 7282  C CD1  . TYR A 1 58  ? 1.827   6.489   13.227  1.00 0.00 ? 110 TYR A CD1  3  
ATOM 7283  C CD2  . TYR A 1 58  ? -0.075  6.695   11.733  1.00 0.00 ? 110 TYR A CD2  3  
ATOM 7284  C CE1  . TYR A 1 58  ? 1.168   5.471   13.930  1.00 0.00 ? 110 TYR A CE1  3  
ATOM 7285  C CE2  . TYR A 1 58  ? -0.741  5.677   12.430  1.00 0.00 ? 110 TYR A CE2  3  
ATOM 7286  C CZ   . TYR A 1 58  ? -0.122  5.059   13.536  1.00 0.00 ? 110 TYR A CZ   3  
ATOM 7287  O OH   . TYR A 1 58  ? -0.768  4.070   14.216  1.00 0.00 ? 110 TYR A OH   3  
ATOM 7288  H H    . TYR A 1 58  ? 2.783   9.841   13.182  1.00 0.00 ? 110 TYR A H    3  
ATOM 7289  H HA   . TYR A 1 58  ? 3.891   7.506   11.724  1.00 0.00 ? 110 TYR A HA   3  
ATOM 7290  H HB2  . TYR A 1 58  ? 1.343   9.126   11.452  1.00 0.00 ? 110 TYR A HB2  3  
ATOM 7291  H HB3  . TYR A 1 58  ? 1.854   7.915   10.281  1.00 0.00 ? 110 TYR A HB3  3  
ATOM 7292  H HD1  . TYR A 1 58  ? 2.813   6.795   13.544  1.00 0.00 ? 110 TYR A HD1  3  
ATOM 7293  H HD2  . TYR A 1 58  ? -0.554  7.169   10.888  1.00 0.00 ? 110 TYR A HD2  3  
ATOM 7294  H HE1  . TYR A 1 58  ? 1.649   5.000   14.775  1.00 0.00 ? 110 TYR A HE1  3  
ATOM 7295  H HE2  . TYR A 1 58  ? -1.729  5.365   12.123  1.00 0.00 ? 110 TYR A HE2  3  
ATOM 7296  H HH   . TYR A 1 58  ? -0.248  3.719   14.943  1.00 0.00 ? 110 TYR A HH   3  
ATOM 7297  N N    . ALA A 1 59  ? 4.489   8.651   9.516   1.00 0.00 ? 111 ALA A N    3  
ATOM 7298  C CA   . ALA A 1 59  ? 5.188   9.321   8.432   1.00 0.00 ? 111 ALA A CA   3  
ATOM 7299  C C    . ALA A 1 59  ? 4.961   8.620   7.093   1.00 0.00 ? 111 ALA A C    3  
ATOM 7300  O O    . ALA A 1 59  ? 4.646   7.432   7.048   1.00 0.00 ? 111 ALA A O    3  
ATOM 7301  C CB   . ALA A 1 59  ? 6.682   9.340   8.753   1.00 0.00 ? 111 ALA A CB   3  
ATOM 7302  H H    . ALA A 1 59  ? 4.350   7.653   9.442   1.00 0.00 ? 111 ALA A H    3  
ATOM 7303  H HA   . ALA A 1 59  ? 4.835   10.350  8.355   1.00 0.00 ? 111 ALA A HA   3  
ATOM 7304  H HB1  . ALA A 1 59  ? 7.039   8.319   8.888   1.00 0.00 ? 111 ALA A HB1  3  
ATOM 7305  H HB2  . ALA A 1 59  ? 7.225   9.804   7.930   1.00 0.00 ? 111 ALA A HB2  3  
ATOM 7306  H HB3  . ALA A 1 59  ? 6.852   9.909   9.667   1.00 0.00 ? 111 ALA A HB3  3  
ATOM 7307  N N    . PHE A 1 60  ? 5.127   9.378   6.005   1.00 0.00 ? 112 PHE A N    3  
ATOM 7308  C CA   . PHE A 1 60  ? 5.081   8.834   4.655   1.00 0.00 ? 112 PHE A CA   3  
ATOM 7309  C C    . PHE A 1 60  ? 6.359   9.263   3.943   1.00 0.00 ? 112 PHE A C    3  
ATOM 7310  O O    . PHE A 1 60  ? 6.740   10.431  4.003   1.00 0.00 ? 112 PHE A O    3  
ATOM 7311  C CB   . PHE A 1 60  ? 3.835   9.330   3.918   1.00 0.00 ? 112 PHE A CB   3  
ATOM 7312  C CG   . PHE A 1 60  ? 2.534   8.829   4.504   1.00 0.00 ? 112 PHE A CG   3  
ATOM 7313  C CD1  . PHE A 1 60  ? 1.907   9.542   5.535   1.00 0.00 ? 112 PHE A CD1  3  
ATOM 7314  C CD2  . PHE A 1 60  ? 1.952   7.651   4.014   1.00 0.00 ? 112 PHE A CD2  3  
ATOM 7315  C CE1  . PHE A 1 60  ? 0.699   9.078   6.078   1.00 0.00 ? 112 PHE A CE1  3  
ATOM 7316  C CE2  . PHE A 1 60  ? 0.743   7.188   4.554   1.00 0.00 ? 112 PHE A CE2  3  
ATOM 7317  C CZ   . PHE A 1 60  ? 0.117   7.902   5.587   1.00 0.00 ? 112 PHE A CZ   3  
ATOM 7318  H H    . PHE A 1 60  ? 5.301   10.368  6.106   1.00 0.00 ? 112 PHE A H    3  
ATOM 7319  H HA   . PHE A 1 60  ? 5.053   7.745   4.697   1.00 0.00 ? 112 PHE A HA   3  
ATOM 7320  H HB2  . PHE A 1 60  ? 3.833   10.420  3.926   1.00 0.00 ? 112 PHE A HB2  3  
ATOM 7321  H HB3  . PHE A 1 60  ? 3.894   9.001   2.880   1.00 0.00 ? 112 PHE A HB3  3  
ATOM 7322  H HD1  . PHE A 1 60  ? 2.353   10.449  5.913   1.00 0.00 ? 112 PHE A HD1  3  
ATOM 7323  H HD2  . PHE A 1 60  ? 2.432   7.098   3.221   1.00 0.00 ? 112 PHE A HD2  3  
ATOM 7324  H HE1  . PHE A 1 60  ? 0.218   9.628   6.873   1.00 0.00 ? 112 PHE A HE1  3  
ATOM 7325  H HE2  . PHE A 1 60  ? 0.296   6.282   4.176   1.00 0.00 ? 112 PHE A HE2  3  
ATOM 7326  H HZ   . PHE A 1 60  ? -0.814  7.545   6.003   1.00 0.00 ? 112 PHE A HZ   3  
ATOM 7327  N N    . LEU A 1 61  ? 7.026   8.325   3.267   1.00 0.00 ? 113 LEU A N    3  
ATOM 7328  C CA   . LEU A 1 61  ? 8.334   8.587   2.693   1.00 0.00 ? 113 LEU A CA   3  
ATOM 7329  C C    . LEU A 1 61  ? 8.675   7.604   1.578   1.00 0.00 ? 113 LEU A C    3  
ATOM 7330  O O    . LEU A 1 61  ? 8.017   6.577   1.417   1.00 0.00 ? 113 LEU A O    3  
ATOM 7331  C CB   . LEU A 1 61  ? 9.370   8.543   3.821   1.00 0.00 ? 113 LEU A CB   3  
ATOM 7332  C CG   . LEU A 1 61  ? 9.285   7.302   4.724   1.00 0.00 ? 113 LEU A CG   3  
ATOM 7333  C CD1  . LEU A 1 61  ? 10.093  6.128   4.177   1.00 0.00 ? 113 LEU A CD1  3  
ATOM 7334  C CD2  . LEU A 1 61  ? 9.855   7.677   6.087   1.00 0.00 ? 113 LEU A CD2  3  
ATOM 7335  H H    . LEU A 1 61  ? 6.630   7.404   3.152   1.00 0.00 ? 113 LEU A H    3  
ATOM 7336  H HA   . LEU A 1 61  ? 8.341   9.589   2.265   1.00 0.00 ? 113 LEU A HA   3  
ATOM 7337  H HB2  . LEU A 1 61  ? 10.373  8.618   3.401   1.00 0.00 ? 113 LEU A HB2  3  
ATOM 7338  H HB3  . LEU A 1 61  ? 9.198   9.420   4.446   1.00 0.00 ? 113 LEU A HB3  3  
ATOM 7339  H HG   . LEU A 1 61  ? 8.247   6.997   4.860   1.00 0.00 ? 113 LEU A HG   3  
ATOM 7340  H HD11 . LEU A 1 61  ? 11.140  6.417   4.085   1.00 0.00 ? 113 LEU A HD11 3  
ATOM 7341  H HD12 . LEU A 1 61  ? 10.016  5.288   4.868   1.00 0.00 ? 113 LEU A HD12 3  
ATOM 7342  H HD13 . LEU A 1 61  ? 9.706   5.827   3.204   1.00 0.00 ? 113 LEU A HD13 3  
ATOM 7343  H HD21 . LEU A 1 61  ? 9.241   8.458   6.538   1.00 0.00 ? 113 LEU A HD21 3  
ATOM 7344  H HD22 . LEU A 1 61  ? 9.858   6.803   6.739   1.00 0.00 ? 113 LEU A HD22 3  
ATOM 7345  H HD23 . LEU A 1 61  ? 10.871  8.048   5.958   1.00 0.00 ? 113 LEU A HD23 3  
ATOM 7346  N N    . LEU A 1 62  ? 9.716   7.931   0.811   1.00 0.00 ? 114 LEU A N    3  
ATOM 7347  C CA   . LEU A 1 62  ? 10.211  7.084   -0.263  1.00 0.00 ? 114 LEU A CA   3  
ATOM 7348  C C    . LEU A 1 62  ? 11.690  7.372   -0.488  1.00 0.00 ? 114 LEU A C    3  
ATOM 7349  O O    . LEU A 1 62  ? 12.170  8.462   -0.188  1.00 0.00 ? 114 LEU A O    3  
ATOM 7350  C CB   . LEU A 1 62  ? 9.357   7.239   -1.530  1.00 0.00 ? 114 LEU A CB   3  
ATOM 7351  C CG   . LEU A 1 62  ? 8.987   8.670   -1.939  1.00 0.00 ? 114 LEU A CG   3  
ATOM 7352  C CD1  . LEU A 1 62  ? 10.173  9.446   -2.504  1.00 0.00 ? 114 LEU A CD1  3  
ATOM 7353  C CD2  . LEU A 1 62  ? 7.921   8.589   -3.032  1.00 0.00 ? 114 LEU A CD2  3  
ATOM 7354  H H    . LEU A 1 62  ? 10.199  8.803   0.975   1.00 0.00 ? 114 LEU A H    3  
ATOM 7355  H HA   . LEU A 1 62  ? 10.134  6.046   0.061   1.00 0.00 ? 114 LEU A HA   3  
ATOM 7356  H HB2  . LEU A 1 62  ? 9.863   6.747   -2.362  1.00 0.00 ? 114 LEU A HB2  3  
ATOM 7357  H HB3  . LEU A 1 62  ? 8.423   6.707   -1.352  1.00 0.00 ? 114 LEU A HB3  3  
ATOM 7358  H HG   . LEU A 1 62  ? 8.574   9.207   -1.085  1.00 0.00 ? 114 LEU A HG   3  
ATOM 7359  H HD11 . LEU A 1 62  ? 10.636  8.875   -3.308  1.00 0.00 ? 114 LEU A HD11 3  
ATOM 7360  H HD12 . LEU A 1 62  ? 9.821   10.399  -2.899  1.00 0.00 ? 114 LEU A HD12 3  
ATOM 7361  H HD13 . LEU A 1 62  ? 10.899  9.641   -1.714  1.00 0.00 ? 114 LEU A HD13 3  
ATOM 7362  H HD21 . LEU A 1 62  ? 7.046   8.063   -2.650  1.00 0.00 ? 114 LEU A HD21 3  
ATOM 7363  H HD22 . LEU A 1 62  ? 7.631   9.595   -3.334  1.00 0.00 ? 114 LEU A HD22 3  
ATOM 7364  H HD23 . LEU A 1 62  ? 8.318   8.052   -3.893  1.00 0.00 ? 114 LEU A HD23 3  
ATOM 7365  N N    . PHE A 1 63  ? 12.416  6.388   -1.019  1.00 0.00 ? 115 PHE A N    3  
ATOM 7366  C CA   . PHE A 1 63  ? 13.861  6.467   -1.160  1.00 0.00 ? 115 PHE A CA   3  
ATOM 7367  C C    . PHE A 1 63  ? 14.288  6.349   -2.621  1.00 0.00 ? 115 PHE A C    3  
ATOM 7368  O O    . PHE A 1 63  ? 13.495  5.981   -3.487  1.00 0.00 ? 115 PHE A O    3  
ATOM 7369  C CB   . PHE A 1 63  ? 14.509  5.438   -0.233  1.00 0.00 ? 115 PHE A CB   3  
ATOM 7370  C CG   . PHE A 1 63  ? 13.770  4.126   -0.182  1.00 0.00 ? 115 PHE A CG   3  
ATOM 7371  C CD1  . PHE A 1 63  ? 14.022  3.156   -1.157  1.00 0.00 ? 115 PHE A CD1  3  
ATOM 7372  C CD2  . PHE A 1 63  ? 12.835  3.883   0.837   1.00 0.00 ? 115 PHE A CD2  3  
ATOM 7373  C CE1  . PHE A 1 63  ? 13.330  1.939   -1.123  1.00 0.00 ? 115 PHE A CE1  3  
ATOM 7374  C CE2  . PHE A 1 63  ? 12.128  2.673   0.856   1.00 0.00 ? 115 PHE A CE2  3  
ATOM 7375  C CZ   . PHE A 1 63  ? 12.375  1.701   -0.124  1.00 0.00 ? 115 PHE A CZ   3  
ATOM 7376  H H    . PHE A 1 63  ? 11.957  5.545   -1.334  1.00 0.00 ? 115 PHE A H    3  
ATOM 7377  H HA   . PHE A 1 63  ? 14.190  7.451   -0.825  1.00 0.00 ? 115 PHE A HA   3  
ATOM 7378  H HB2  . PHE A 1 63  ? 15.539  5.266   -0.543  1.00 0.00 ? 115 PHE A HB2  3  
ATOM 7379  H HB3  . PHE A 1 63  ? 14.521  5.846   0.779   1.00 0.00 ? 115 PHE A HB3  3  
ATOM 7380  H HD1  . PHE A 1 63  ? 14.746  3.349   -1.935  1.00 0.00 ? 115 PHE A HD1  3  
ATOM 7381  H HD2  . PHE A 1 63  ? 12.652  4.617   1.608   1.00 0.00 ? 115 PHE A HD2  3  
ATOM 7382  H HE1  . PHE A 1 63  ? 13.537  1.186   -1.869  1.00 0.00 ? 115 PHE A HE1  3  
ATOM 7383  H HE2  . PHE A 1 63  ? 11.394  2.488   1.626   1.00 0.00 ? 115 PHE A HE2  3  
ATOM 7384  H HZ   . PHE A 1 63  ? 11.831  0.769   -0.108  1.00 0.00 ? 115 PHE A HZ   3  
ATOM 7385  N N    . GLN A 1 64  ? 15.558  6.667   -2.888  1.00 0.00 ? 116 GLN A N    3  
ATOM 7386  C CA   . GLN A 1 64  ? 16.073  6.849   -4.235  1.00 0.00 ? 116 GLN A CA   3  
ATOM 7387  C C    . GLN A 1 64  ? 16.285  5.563   -5.038  1.00 0.00 ? 116 GLN A C    3  
ATOM 7388  O O    . GLN A 1 64  ? 16.340  5.632   -6.265  1.00 0.00 ? 116 GLN A O    3  
ATOM 7389  C CB   . GLN A 1 64  ? 17.372  7.653   -4.118  1.00 0.00 ? 116 GLN A CB   3  
ATOM 7390  C CG   . GLN A 1 64  ? 17.902  8.104   -5.481  1.00 0.00 ? 116 GLN A CG   3  
ATOM 7391  C CD   . GLN A 1 64  ? 19.122  9.002   -5.322  1.00 0.00 ? 116 GLN A CD   3  
ATOM 7392  O OE1  . GLN A 1 64  ? 19.027  10.219  -5.458  1.00 0.00 ? 116 GLN A OE1  3  
ATOM 7393  N NE2  . GLN A 1 64  ? 20.281  8.414   -5.031  1.00 0.00 ? 116 GLN A NE2  3  
ATOM 7394  H H    . GLN A 1 64  ? 16.202  6.805   -2.122  1.00 0.00 ? 116 GLN A H    3  
ATOM 7395  H HA   . GLN A 1 64  ? 15.346  7.453   -4.779  1.00 0.00 ? 116 GLN A HA   3  
ATOM 7396  H HB2  . GLN A 1 64  ? 17.180  8.538   -3.511  1.00 0.00 ? 116 GLN A HB2  3  
ATOM 7397  H HB3  . GLN A 1 64  ? 18.129  7.046   -3.621  1.00 0.00 ? 116 GLN A HB3  3  
ATOM 7398  H HG2  . GLN A 1 64  ? 18.186  7.231   -6.069  1.00 0.00 ? 116 GLN A HG2  3  
ATOM 7399  H HG3  . GLN A 1 64  ? 17.121  8.652   -6.010  1.00 0.00 ? 116 GLN A HG3  3  
ATOM 7400  H HE21 . GLN A 1 64  ? 20.328  7.411   -4.927  1.00 0.00 ? 116 GLN A HE21 3  
ATOM 7401  H HE22 . GLN A 1 64  ? 21.111  8.976   -4.916  1.00 0.00 ? 116 GLN A HE22 3  
ATOM 7402  N N    . ASP A 1 65  ? 16.406  4.396   -4.396  1.00 0.00 ? 117 ASP A N    3  
ATOM 7403  C CA   . ASP A 1 65  ? 16.686  3.160   -5.116  1.00 0.00 ? 117 ASP A CA   3  
ATOM 7404  C C    . ASP A 1 65  ? 15.507  2.193   -5.072  1.00 0.00 ? 117 ASP A C    3  
ATOM 7405  O O    . ASP A 1 65  ? 14.926  1.960   -4.013  1.00 0.00 ? 117 ASP A O    3  
ATOM 7406  C CB   . ASP A 1 65  ? 17.960  2.528   -4.556  1.00 0.00 ? 117 ASP A CB   3  
ATOM 7407  C CG   . ASP A 1 65  ? 18.293  1.217   -5.265  1.00 0.00 ? 117 ASP A CG   3  
ATOM 7408  O OD1  . ASP A 1 65  ? 18.113  1.162   -6.501  1.00 0.00 ? 117 ASP A OD1  3  
ATOM 7409  O OD2  . ASP A 1 65  ? 18.723  0.280   -4.557  1.00 0.00 ? 117 ASP A OD2  3  
ATOM 7410  H H    . ASP A 1 65  ? 16.309  4.354   -3.392  1.00 0.00 ? 117 ASP A H    3  
ATOM 7411  H HA   . ASP A 1 65  ? 16.875  3.400   -6.163  1.00 0.00 ? 117 ASP A HA   3  
ATOM 7412  H HB2  . ASP A 1 65  ? 18.791  3.222   -4.685  1.00 0.00 ? 117 ASP A HB2  3  
ATOM 7413  H HB3  . ASP A 1 65  ? 17.824  2.337   -3.493  1.00 0.00 ? 117 ASP A HB3  3  
ATOM 7414  N N    . GLU A 1 66  ? 15.150  1.627   -6.229  1.00 0.00 ? 118 GLU A N    3  
ATOM 7415  C CA   . GLU A 1 66  ? 14.037  0.692   -6.328  1.00 0.00 ? 118 GLU A CA   3  
ATOM 7416  C C    . GLU A 1 66  ? 14.476  -0.743  -6.049  1.00 0.00 ? 118 GLU A C    3  
ATOM 7417  O O    . GLU A 1 66  ? 13.631  -1.605  -5.817  1.00 0.00 ? 118 GLU A O    3  
ATOM 7418  C CB   . GLU A 1 66  ? 13.392  0.805   -7.709  1.00 0.00 ? 118 GLU A CB   3  
ATOM 7419  C CG   . GLU A 1 66  ? 12.699  2.158   -7.862  1.00 0.00 ? 118 GLU A CG   3  
ATOM 7420  C CD   . GLU A 1 66  ? 12.032  2.279   -9.231  1.00 0.00 ? 118 GLU A CD   3  
ATOM 7421  O OE1  . GLU A 1 66  ? 12.739  2.675   -10.185 1.00 0.00 ? 118 GLU A OE1  3  
ATOM 7422  O OE2  . GLU A 1 66  ? 10.821  1.976   -9.314  1.00 0.00 ? 118 GLU A OE2  3  
ATOM 7423  H H    . GLU A 1 66  ? 15.659  1.846   -7.074  1.00 0.00 ? 118 GLU A H    3  
ATOM 7424  H HA   . GLU A 1 66  ? 13.288  0.965   -5.584  1.00 0.00 ? 118 GLU A HA   3  
ATOM 7425  H HB2  . GLU A 1 66  ? 14.154  0.689   -8.479  1.00 0.00 ? 118 GLU A HB2  3  
ATOM 7426  H HB3  . GLU A 1 66  ? 12.649  0.014   -7.821  1.00 0.00 ? 118 GLU A HB3  3  
ATOM 7427  H HG2  . GLU A 1 66  ? 11.943  2.255   -7.083  1.00 0.00 ? 118 GLU A HG2  3  
ATOM 7428  H HG3  . GLU A 1 66  ? 13.431  2.957   -7.743  1.00 0.00 ? 118 GLU A HG3  3  
ATOM 7429  N N    . SER A 1 67  ? 15.785  -1.016  -6.066  1.00 0.00 ? 119 SER A N    3  
ATOM 7430  C CA   . SER A 1 67  ? 16.299  -2.336  -5.723  1.00 0.00 ? 119 SER A CA   3  
ATOM 7431  C C    . SER A 1 67  ? 16.373  -2.474  -4.204  1.00 0.00 ? 119 SER A C    3  
ATOM 7432  O O    . SER A 1 67  ? 16.339  -3.579  -3.663  1.00 0.00 ? 119 SER A O    3  
ATOM 7433  C CB   . SER A 1 67  ? 17.672  -2.526  -6.371  1.00 0.00 ? 119 SER A CB   3  
ATOM 7434  O OG   . SER A 1 67  ? 18.144  -3.836  -6.132  1.00 0.00 ? 119 SER A OG   3  
ATOM 7435  H H    . SER A 1 67  ? 16.448  -0.297  -6.319  1.00 0.00 ? 119 SER A H    3  
ATOM 7436  H HA   . SER A 1 67  ? 15.619  -3.095  -6.112  1.00 0.00 ? 119 SER A HA   3  
ATOM 7437  H HB2  . SER A 1 67  ? 17.588  -2.368  -7.446  1.00 0.00 ? 119 SER A HB2  3  
ATOM 7438  H HB3  . SER A 1 67  ? 18.374  -1.803  -5.957  1.00 0.00 ? 119 SER A HB3  3  
ATOM 7439  H HG   . SER A 1 67  ? 19.003  -3.930  -6.549  1.00 0.00 ? 119 SER A HG   3  
ATOM 7440  N N    . SER A 1 68  ? 16.472  -1.336  -3.511  1.00 0.00 ? 120 SER A N    3  
ATOM 7441  C CA   . SER A 1 68  ? 16.493  -1.309  -2.057  1.00 0.00 ? 120 SER A CA   3  
ATOM 7442  C C    . SER A 1 68  ? 15.105  -1.612  -1.496  1.00 0.00 ? 120 SER A C    3  
ATOM 7443  O O    . SER A 1 68  ? 14.984  -1.953  -0.321  1.00 0.00 ? 120 SER A O    3  
ATOM 7444  C CB   . SER A 1 68  ? 16.976  0.066   -1.594  1.00 0.00 ? 120 SER A CB   3  
ATOM 7445  O OG   . SER A 1 68  ? 18.347  0.218   -1.895  1.00 0.00 ? 120 SER A OG   3  
ATOM 7446  H H    . SER A 1 68  ? 16.536  -0.455  -4.000  1.00 0.00 ? 120 SER A H    3  
ATOM 7447  H HA   . SER A 1 68  ? 17.185  -2.068  -1.691  1.00 0.00 ? 120 SER A HA   3  
ATOM 7448  H HB2  . SER A 1 68  ? 16.399  0.843   -2.095  1.00 0.00 ? 120 SER A HB2  3  
ATOM 7449  H HB3  . SER A 1 68  ? 16.837  0.162   -0.517  1.00 0.00 ? 120 SER A HB3  3  
ATOM 7450  H HG   . SER A 1 68  ? 18.459  0.168   -2.847  1.00 0.00 ? 120 SER A HG   3  
ATOM 7451  N N    . VAL A 1 69  ? 14.058  -1.492  -2.322  1.00 0.00 ? 121 VAL A N    3  
ATOM 7452  C CA   . VAL A 1 69  ? 12.696  -1.779  -1.895  1.00 0.00 ? 121 VAL A CA   3  
ATOM 7453  C C    . VAL A 1 69  ? 12.567  -3.260  -1.565  1.00 0.00 ? 121 VAL A C    3  
ATOM 7454  O O    . VAL A 1 69  ? 11.933  -3.628  -0.582  1.00 0.00 ? 121 VAL A O    3  
ATOM 7455  C CB   . VAL A 1 69  ? 11.710  -1.430  -3.017  1.00 0.00 ? 121 VAL A CB   3  
ATOM 7456  C CG1  . VAL A 1 69  ? 10.269  -1.709  -2.590  1.00 0.00 ? 121 VAL A CG1  3  
ATOM 7457  C CG2  . VAL A 1 69  ? 11.796  0.041   -3.409  1.00 0.00 ? 121 VAL A CG2  3  
ATOM 7458  H H    . VAL A 1 69  ? 14.206  -1.194  -3.275  1.00 0.00 ? 121 VAL A H    3  
ATOM 7459  H HA   . VAL A 1 69  ? 12.459  -1.192  -1.007  1.00 0.00 ? 121 VAL A HA   3  
ATOM 7460  H HB   . VAL A 1 69  ? 11.941  -2.040  -3.891  1.00 0.00 ? 121 VAL A HB   3  
ATOM 7461  H HG11 . VAL A 1 69  ? 10.031  -1.136  -1.694  1.00 0.00 ? 121 VAL A HG11 3  
ATOM 7462  H HG12 . VAL A 1 69  ? 9.593   -1.418  -3.395  1.00 0.00 ? 121 VAL A HG12 3  
ATOM 7463  H HG13 . VAL A 1 69  ? 10.141  -2.774  -2.387  1.00 0.00 ? 121 VAL A HG13 3  
ATOM 7464  H HG21 . VAL A 1 69  ? 12.821  0.291   -3.683  1.00 0.00 ? 121 VAL A HG21 3  
ATOM 7465  H HG22 . VAL A 1 69  ? 11.147  0.219   -4.268  1.00 0.00 ? 121 VAL A HG22 3  
ATOM 7466  H HG23 . VAL A 1 69  ? 11.471  0.664   -2.576  1.00 0.00 ? 121 VAL A HG23 3  
ATOM 7467  N N    . GLN A 1 70  ? 13.172  -4.116  -2.390  1.00 0.00 ? 122 GLN A N    3  
ATOM 7468  C CA   . GLN A 1 70  ? 12.986  -5.548  -2.267  1.00 0.00 ? 122 GLN A CA   3  
ATOM 7469  C C    . GLN A 1 70  ? 13.969  -6.129  -1.255  1.00 0.00 ? 122 GLN A C    3  
ATOM 7470  O O    . GLN A 1 70  ? 13.637  -7.075  -0.545  1.00 0.00 ? 122 GLN A O    3  
ATOM 7471  C CB   . GLN A 1 70  ? 13.142  -6.190  -3.650  1.00 0.00 ? 122 GLN A CB   3  
ATOM 7472  C CG   . GLN A 1 70  ? 12.133  -7.321  -3.861  1.00 0.00 ? 122 GLN A CG   3  
ATOM 7473  C CD   . GLN A 1 70  ? 12.294  -8.448  -2.849  1.00 0.00 ? 122 GLN A CD   3  
ATOM 7474  O OE1  . GLN A 1 70  ? 13.316  -9.130  -2.821  1.00 0.00 ? 122 GLN A OE1  3  
ATOM 7475  N NE2  . GLN A 1 70  ? 11.282  -8.654  -2.008  1.00 0.00 ? 122 GLN A NE2  3  
ATOM 7476  H H    . GLN A 1 70  ? 13.773  -3.773  -3.125  1.00 0.00 ? 122 GLN A H    3  
ATOM 7477  H HA   . GLN A 1 70  ? 11.972  -5.728  -1.911  1.00 0.00 ? 122 GLN A HA   3  
ATOM 7478  H HB2  . GLN A 1 70  ? 12.960  -5.433  -4.413  1.00 0.00 ? 122 GLN A HB2  3  
ATOM 7479  H HB3  . GLN A 1 70  ? 14.157  -6.567  -3.770  1.00 0.00 ? 122 GLN A HB3  3  
ATOM 7480  H HG2  . GLN A 1 70  ? 11.128  -6.908  -3.781  1.00 0.00 ? 122 GLN A HG2  3  
ATOM 7481  H HG3  . GLN A 1 70  ? 12.257  -7.727  -4.865  1.00 0.00 ? 122 GLN A HG3  3  
ATOM 7482  H HE21 . GLN A 1 70  ? 10.452  -8.080  -2.061  1.00 0.00 ? 122 GLN A HE21 3  
ATOM 7483  H HE22 . GLN A 1 70  ? 11.351  -9.388  -1.318  1.00 0.00 ? 122 GLN A HE22 3  
ATOM 7484  N N    . ALA A 1 71  ? 15.182  -5.573  -1.178  1.00 0.00 ? 123 ALA A N    3  
ATOM 7485  C CA   . ALA A 1 71  ? 16.208  -6.089  -0.290  1.00 0.00 ? 123 ALA A CA   3  
ATOM 7486  C C    . ALA A 1 71  ? 15.867  -5.842  1.179   1.00 0.00 ? 123 ALA A C    3  
ATOM 7487  O O    . ALA A 1 71  ? 16.115  -6.700  2.023   1.00 0.00 ? 123 ALA A O    3  
ATOM 7488  C CB   . ALA A 1 71  ? 17.524  -5.394  -0.638  1.00 0.00 ? 123 ALA A CB   3  
ATOM 7489  H H    . ALA A 1 71  ? 15.413  -4.773  -1.749  1.00 0.00 ? 123 ALA A H    3  
ATOM 7490  H HA   . ALA A 1 71  ? 16.318  -7.162  -0.453  1.00 0.00 ? 123 ALA A HA   3  
ATOM 7491  H HB1  . ALA A 1 71  ? 17.419  -4.322  -0.469  1.00 0.00 ? 123 ALA A HB1  3  
ATOM 7492  H HB2  . ALA A 1 71  ? 18.320  -5.783  -0.004  1.00 0.00 ? 123 ALA A HB2  3  
ATOM 7493  H HB3  . ALA A 1 71  ? 17.771  -5.575  -1.684  1.00 0.00 ? 123 ALA A HB3  3  
ATOM 7494  N N    . LEU A 1 72  ? 15.302  -4.673  1.489   1.00 0.00 ? 124 LEU A N    3  
ATOM 7495  C CA   . LEU A 1 72  ? 15.028  -4.291  2.864   1.00 0.00 ? 124 LEU A CA   3  
ATOM 7496  C C    . LEU A 1 72  ? 13.718  -4.915  3.338   1.00 0.00 ? 124 LEU A C    3  
ATOM 7497  O O    . LEU A 1 72  ? 13.656  -5.455  4.440   1.00 0.00 ? 124 LEU A O    3  
ATOM 7498  C CB   . LEU A 1 72  ? 15.003  -2.761  2.913   1.00 0.00 ? 124 LEU A CB   3  
ATOM 7499  C CG   . LEU A 1 72  ? 14.989  -2.124  4.308   1.00 0.00 ? 124 LEU A CG   3  
ATOM 7500  C CD1  . LEU A 1 72  ? 13.636  -2.270  5.000   1.00 0.00 ? 124 LEU A CD1  3  
ATOM 7501  C CD2  . LEU A 1 72  ? 16.064  -2.730  5.205   1.00 0.00 ? 124 LEU A CD2  3  
ATOM 7502  H H    . LEU A 1 72  ? 15.057  -4.023  0.755   1.00 0.00 ? 124 LEU A H    3  
ATOM 7503  H HA   . LEU A 1 72  ? 15.838  -4.652  3.497   1.00 0.00 ? 124 LEU A HA   3  
ATOM 7504  H HB2  . LEU A 1 72  ? 15.895  -2.399  2.401   1.00 0.00 ? 124 LEU A HB2  3  
ATOM 7505  H HB3  . LEU A 1 72  ? 14.129  -2.415  2.359   1.00 0.00 ? 124 LEU A HB3  3  
ATOM 7506  H HG   . LEU A 1 72  ? 15.194  -1.061  4.186   1.00 0.00 ? 124 LEU A HG   3  
ATOM 7507  H HD11 . LEU A 1 72  ? 12.836  -2.028  4.302   1.00 0.00 ? 124 LEU A HD11 3  
ATOM 7508  H HD12 . LEU A 1 72  ? 13.507  -3.289  5.366   1.00 0.00 ? 124 LEU A HD12 3  
ATOM 7509  H HD13 . LEU A 1 72  ? 13.594  -1.584  5.845   1.00 0.00 ? 124 LEU A HD13 3  
ATOM 7510  H HD21 . LEU A 1 72  ? 17.024  -2.700  4.688   1.00 0.00 ? 124 LEU A HD21 3  
ATOM 7511  H HD22 . LEU A 1 72  ? 16.126  -2.159  6.131   1.00 0.00 ? 124 LEU A HD22 3  
ATOM 7512  H HD23 . LEU A 1 72  ? 15.811  -3.764  5.438   1.00 0.00 ? 124 LEU A HD23 3  
ATOM 7513  N N    . ILE A 1 73  ? 12.672  -4.846  2.511   1.00 0.00 ? 125 ILE A N    3  
ATOM 7514  C CA   . ILE A 1 73  ? 11.366  -5.365  2.887   1.00 0.00 ? 125 ILE A CA   3  
ATOM 7515  C C    . ILE A 1 73  ? 11.409  -6.893  3.026   1.00 0.00 ? 125 ILE A C    3  
ATOM 7516  O O    . ILE A 1 73  ? 10.564  -7.471  3.709   1.00 0.00 ? 125 ILE A O    3  
ATOM 7517  C CB   . ILE A 1 73  ? 10.331  -4.890  1.859   1.00 0.00 ? 125 ILE A CB   3  
ATOM 7518  C CG1  . ILE A 1 73  ? 10.266  -3.355  1.920   1.00 0.00 ? 125 ILE A CG1  3  
ATOM 7519  C CG2  . ILE A 1 73  ? 8.944   -5.473  2.142   1.00 0.00 ? 125 ILE A CG2  3  
ATOM 7520  C CD1  . ILE A 1 73  ? 9.278   -2.788  0.901   1.00 0.00 ? 125 ILE A CD1  3  
ATOM 7521  H H    . ILE A 1 73  ? 12.774  -4.422  1.600   1.00 0.00 ? 125 ILE A H    3  
ATOM 7522  H HA   . ILE A 1 73  ? 11.092  -4.937  3.852   1.00 0.00 ? 125 ILE A HA   3  
ATOM 7523  H HB   . ILE A 1 73  ? 10.646  -5.203  0.864   1.00 0.00 ? 125 ILE A HB   3  
ATOM 7524  H HG12 . ILE A 1 73  ? 9.963   -3.048  2.921   1.00 0.00 ? 125 ILE A HG12 3  
ATOM 7525  H HG13 . ILE A 1 73  ? 11.253  -2.941  1.717   1.00 0.00 ? 125 ILE A HG13 3  
ATOM 7526  H HG21 . ILE A 1 73  ? 8.597   -5.136  3.118   1.00 0.00 ? 125 ILE A HG21 3  
ATOM 7527  H HG22 . ILE A 1 73  ? 8.241   -5.148  1.375   1.00 0.00 ? 125 ILE A HG22 3  
ATOM 7528  H HG23 . ILE A 1 73  ? 8.989   -6.562  2.118   1.00 0.00 ? 125 ILE A HG23 3  
ATOM 7529  H HD11 . ILE A 1 73  ? 8.263   -3.079  1.168   1.00 0.00 ? 125 ILE A HD11 3  
ATOM 7530  H HD12 . ILE A 1 73  ? 9.349   -1.701  0.894   1.00 0.00 ? 125 ILE A HD12 3  
ATOM 7531  H HD13 . ILE A 1 73  ? 9.510   -3.172  -0.093  1.00 0.00 ? 125 ILE A HD13 3  
ATOM 7532  N N    . ASP A 1 74  ? 12.379  -7.560  2.388   1.00 0.00 ? 126 ASP A N    3  
ATOM 7533  C CA   . ASP A 1 74  ? 12.502  -9.012  2.470   1.00 0.00 ? 126 ASP A CA   3  
ATOM 7534  C C    . ASP A 1 74  ? 13.495  -9.454  3.550   1.00 0.00 ? 126 ASP A C    3  
ATOM 7535  O O    . ASP A 1 74  ? 13.416  -10.585 4.025   1.00 0.00 ? 126 ASP A O    3  
ATOM 7536  C CB   . ASP A 1 74  ? 12.926  -9.552  1.104   1.00 0.00 ? 126 ASP A CB   3  
ATOM 7537  C CG   . ASP A 1 74  ? 12.950  -11.078 1.080   1.00 0.00 ? 126 ASP A CG   3  
ATOM 7538  O OD1  . ASP A 1 74  ? 11.849  -11.671 1.067   1.00 0.00 ? 126 ASP A OD1  3  
ATOM 7539  O OD2  . ASP A 1 74  ? 14.069  -11.638 1.072   1.00 0.00 ? 126 ASP A OD2  3  
ATOM 7540  H H    . ASP A 1 74  ? 13.052  -7.059  1.827   1.00 0.00 ? 126 ASP A H    3  
ATOM 7541  H HA   . ASP A 1 74  ? 11.525  -9.433  2.711   1.00 0.00 ? 126 ASP A HA   3  
ATOM 7542  H HB2  . ASP A 1 74  ? 12.222  -9.197  0.350   1.00 0.00 ? 126 ASP A HB2  3  
ATOM 7543  H HB3  . ASP A 1 74  ? 13.920  -9.174  0.866   1.00 0.00 ? 126 ASP A HB3  3  
ATOM 7544  N N    . ALA A 1 75  ? 14.426  -8.580  3.945   1.00 0.00 ? 127 ALA A N    3  
ATOM 7545  C CA   . ALA A 1 75  ? 15.425  -8.910  4.953   1.00 0.00 ? 127 ALA A CA   3  
ATOM 7546  C C    . ALA A 1 75  ? 14.927  -8.635  6.374   1.00 0.00 ? 127 ALA A C    3  
ATOM 7547  O O    . ALA A 1 75  ? 15.698  -8.753  7.327   1.00 0.00 ? 127 ALA A O    3  
ATOM 7548  C CB   . ALA A 1 75  ? 16.717  -8.148  4.660   1.00 0.00 ? 127 ALA A CB   3  
ATOM 7549  H H    . ALA A 1 75  ? 14.453  -7.656  3.536   1.00 0.00 ? 127 ALA A H    3  
ATOM 7550  H HA   . ALA A 1 75  ? 15.640  -9.977  4.878   1.00 0.00 ? 127 ALA A HA   3  
ATOM 7551  H HB1  . ALA A 1 75  ? 16.524  -7.076  4.706   1.00 0.00 ? 127 ALA A HB1  3  
ATOM 7552  H HB2  . ALA A 1 75  ? 17.473  -8.411  5.399   1.00 0.00 ? 127 ALA A HB2  3  
ATOM 7553  H HB3  . ALA A 1 75  ? 17.082  -8.413  3.668   1.00 0.00 ? 127 ALA A HB3  3  
ATOM 7554  N N    . CYS A 1 76  ? 13.652  -8.270  6.523   1.00 0.00 ? 128 CYS A N    3  
ATOM 7555  C CA   . CYS A 1 76  ? 13.072  -7.927  7.815   1.00 0.00 ? 128 CYS A CA   3  
ATOM 7556  C C    . CYS A 1 76  ? 11.809  -8.744  8.090   1.00 0.00 ? 128 CYS A C    3  
ATOM 7557  O O    . CYS A 1 76  ? 11.380  -9.538  7.252   1.00 0.00 ? 128 CYS A O    3  
ATOM 7558  C CB   . CYS A 1 76  ? 12.791  -6.426  7.842   1.00 0.00 ? 128 CYS A CB   3  
ATOM 7559  S SG   . CYS A 1 76  ? 14.328  -5.535  7.492   1.00 0.00 ? 128 CYS A SG   3  
ATOM 7560  H H    . CYS A 1 76  ? 13.053  -8.223  5.711   1.00 0.00 ? 128 CYS A H    3  
ATOM 7561  H HA   . CYS A 1 76  ? 13.794  -8.150  8.600   1.00 0.00 ? 128 CYS A HA   3  
ATOM 7562  H HB2  . CYS A 1 76  ? 12.043  -6.175  7.090   1.00 0.00 ? 128 CYS A HB2  3  
ATOM 7563  H HB3  . CYS A 1 76  ? 12.425  -6.142  8.829   1.00 0.00 ? 128 CYS A HB3  3  
ATOM 7564  H HG   . CYS A 1 76  ? 14.434  -5.937  6.223   1.00 0.00 ? 128 CYS A HG   3  
ATOM 7565  N N    . ILE A 1 77  ? 11.213  -8.550  9.270   1.00 0.00 ? 129 ILE A N    3  
ATOM 7566  C CA   . ILE A 1 77  ? 10.044  -9.306  9.701   1.00 0.00 ? 129 ILE A CA   3  
ATOM 7567  C C    . ILE A 1 77  ? 8.808   -8.805  8.957   1.00 0.00 ? 129 ILE A C    3  
ATOM 7568  O O    . ILE A 1 77  ? 8.716   -7.624  8.633   1.00 0.00 ? 129 ILE A O    3  
ATOM 7569  C CB   . ILE A 1 77  ? 9.894   -9.192  11.225  1.00 0.00 ? 129 ILE A CB   3  
ATOM 7570  C CG1  . ILE A 1 77  ? 11.134  -9.791  11.904  1.00 0.00 ? 129 ILE A CG1  3  
ATOM 7571  C CG2  . ILE A 1 77  ? 8.628   -9.908  11.702  1.00 0.00 ? 129 ILE A CG2  3  
ATOM 7572  C CD1  . ILE A 1 77  ? 11.092  -9.630  13.425  1.00 0.00 ? 129 ILE A CD1  3  
ATOM 7573  H H    . ILE A 1 77  ? 11.576  -7.851  9.903   1.00 0.00 ? 129 ILE A H    3  
ATOM 7574  H HA   . ILE A 1 77  ? 10.194  -10.356 9.448   1.00 0.00 ? 129 ILE A HA   3  
ATOM 7575  H HB   . ILE A 1 77  ? 9.824   -8.137  11.493  1.00 0.00 ? 129 ILE A HB   3  
ATOM 7576  H HG12 . ILE A 1 77  ? 11.206  -10.849 11.657  1.00 0.00 ? 129 ILE A HG12 3  
ATOM 7577  H HG13 . ILE A 1 77  ? 12.024  -9.285  11.532  1.00 0.00 ? 129 ILE A HG13 3  
ATOM 7578  H HG21 . ILE A 1 77  ? 8.680   -10.964 11.440  1.00 0.00 ? 129 ILE A HG21 3  
ATOM 7579  H HG22 . ILE A 1 77  ? 8.526   -9.810  12.783  1.00 0.00 ? 129 ILE A HG22 3  
ATOM 7580  H HG23 . ILE A 1 77  ? 7.750   -9.458  11.237  1.00 0.00 ? 129 ILE A HG23 3  
ATOM 7581  H HD11 . ILE A 1 77  ? 10.952  -8.579  13.680  1.00 0.00 ? 129 ILE A HD11 3  
ATOM 7582  H HD12 . ILE A 1 77  ? 10.279  -10.223 13.843  1.00 0.00 ? 129 ILE A HD12 3  
ATOM 7583  H HD13 . ILE A 1 77  ? 12.035  -9.978  13.848  1.00 0.00 ? 129 ILE A HD13 3  
ATOM 7584  N N    . GLU A 1 78  ? 7.854   -9.697  8.682   1.00 0.00 ? 130 GLU A N    3  
ATOM 7585  C CA   . GLU A 1 78  ? 6.672   -9.348  7.907   1.00 0.00 ? 130 GLU A CA   3  
ATOM 7586  C C    . GLU A 1 78  ? 5.418   -10.064 8.406   1.00 0.00 ? 130 GLU A C    3  
ATOM 7587  O O    . GLU A 1 78  ? 5.492   -11.040 9.151   1.00 0.00 ? 130 GLU A O    3  
ATOM 7588  C CB   . GLU A 1 78  ? 6.921   -9.671  6.431   1.00 0.00 ? 130 GLU A CB   3  
ATOM 7589  C CG   . GLU A 1 78  ? 7.106   -11.173 6.209   1.00 0.00 ? 130 GLU A CG   3  
ATOM 7590  C CD   . GLU A 1 78  ? 7.359   -11.481 4.736   1.00 0.00 ? 130 GLU A CD   3  
ATOM 7591  O OE1  . GLU A 1 78  ? 6.370   -11.491 3.968   1.00 0.00 ? 130 GLU A OE1  3  
ATOM 7592  O OE2  . GLU A 1 78  ? 8.539   -11.704 4.387   1.00 0.00 ? 130 GLU A OE2  3  
ATOM 7593  H H    . GLU A 1 78  ? 7.941   -10.648 9.012   1.00 0.00 ? 130 GLU A H    3  
ATOM 7594  H HA   . GLU A 1 78  ? 6.501   -8.276  7.996   1.00 0.00 ? 130 GLU A HA   3  
ATOM 7595  H HB2  . GLU A 1 78  ? 6.071   -9.325  5.844   1.00 0.00 ? 130 GLU A HB2  3  
ATOM 7596  H HB3  . GLU A 1 78  ? 7.816   -9.147  6.094   1.00 0.00 ? 130 GLU A HB3  3  
ATOM 7597  H HG2  . GLU A 1 78  ? 7.952   -11.525 6.801   1.00 0.00 ? 130 GLU A HG2  3  
ATOM 7598  H HG3  . GLU A 1 78  ? 6.209   -11.700 6.534   1.00 0.00 ? 130 GLU A HG3  3  
ATOM 7599  N N    . GLU A 1 79  ? 4.263   -9.553  7.976   1.00 0.00 ? 131 GLU A N    3  
ATOM 7600  C CA   . GLU A 1 79  ? 2.954   -10.123 8.250   1.00 0.00 ? 131 GLU A CA   3  
ATOM 7601  C C    . GLU A 1 79  ? 2.065   -9.891  7.031   1.00 0.00 ? 131 GLU A C    3  
ATOM 7602  O O    . GLU A 1 79  ? 2.345   -9.016  6.212   1.00 0.00 ? 131 GLU A O    3  
ATOM 7603  C CB   . GLU A 1 79  ? 2.350   -9.456  9.491   1.00 0.00 ? 131 GLU A CB   3  
ATOM 7604  C CG   . GLU A 1 79  ? 1.051   -10.128 9.948   1.00 0.00 ? 131 GLU A CG   3  
ATOM 7605  C CD   . GLU A 1 79  ? 1.238   -11.624 10.183  1.00 0.00 ? 131 GLU A CD   3  
ATOM 7606  O OE1  . GLU A 1 79  ? 1.680   -11.987 11.296  1.00 0.00 ? 131 GLU A OE1  3  
ATOM 7607  O OE2  . GLU A 1 79  ? 0.935   -12.394 9.245   1.00 0.00 ? 131 GLU A OE2  3  
ATOM 7608  H H    . GLU A 1 79  ? 4.280   -8.713  7.416   1.00 0.00 ? 131 GLU A H    3  
ATOM 7609  H HA   . GLU A 1 79  ? 3.057   -11.195 8.422   1.00 0.00 ? 131 GLU A HA   3  
ATOM 7610  H HB2  . GLU A 1 79  ? 3.069   -9.498  10.310  1.00 0.00 ? 131 GLU A HB2  3  
ATOM 7611  H HB3  . GLU A 1 79  ? 2.149   -8.407  9.269   1.00 0.00 ? 131 GLU A HB3  3  
ATOM 7612  H HG2  . GLU A 1 79  ? 0.720   -9.664  10.878  1.00 0.00 ? 131 GLU A HG2  3  
ATOM 7613  H HG3  . GLU A 1 79  ? 0.277   -9.968  9.198   1.00 0.00 ? 131 GLU A HG3  3  
ATOM 7614  N N    . ASP A 1 80  ? 0.988   -10.669 6.901   1.00 0.00 ? 132 ASP A N    3  
ATOM 7615  C CA   . ASP A 1 80  ? 0.064   -10.518 5.789   1.00 0.00 ? 132 ASP A CA   3  
ATOM 7616  C C    . ASP A 1 80  ? -0.614  -9.143  5.809   1.00 0.00 ? 132 ASP A C    3  
ATOM 7617  O O    . ASP A 1 80  ? -1.277  -8.774  4.839   1.00 0.00 ? 132 ASP A O    3  
ATOM 7618  C CB   . ASP A 1 80  ? -0.968  -11.645 5.857   1.00 0.00 ? 132 ASP A CB   3  
ATOM 7619  C CG   . ASP A 1 80  ? -1.906  -11.631 4.651   1.00 0.00 ? 132 ASP A CG   3  
ATOM 7620  O OD1  . ASP A 1 80  ? -1.399  -11.820 3.523   1.00 0.00 ? 132 ASP A OD1  3  
ATOM 7621  O OD2  . ASP A 1 80  ? -3.122  -11.432 4.867   1.00 0.00 ? 132 ASP A OD2  3  
ATOM 7622  H H    . ASP A 1 80  ? 0.802   -11.386 7.586   1.00 0.00 ? 132 ASP A H    3  
ATOM 7623  H HA   . ASP A 1 80  ? 0.624   -10.615 4.859   1.00 0.00 ? 132 ASP A HA   3  
ATOM 7624  H HB2  . ASP A 1 80  ? -0.447  -12.602 5.886   1.00 0.00 ? 132 ASP A HB2  3  
ATOM 7625  H HB3  . ASP A 1 80  ? -1.552  -11.538 6.772   1.00 0.00 ? 132 ASP A HB3  3  
ATOM 7626  N N    . GLY A 1 81  ? -0.456  -8.380  6.900   1.00 0.00 ? 133 GLY A N    3  
ATOM 7627  C CA   . GLY A 1 81  ? -1.072  -7.069  7.027   1.00 0.00 ? 133 GLY A CA   3  
ATOM 7628  C C    . GLY A 1 81  ? -0.067  -5.917  7.069   1.00 0.00 ? 133 GLY A C    3  
ATOM 7629  O O    . GLY A 1 81  ? -0.439  -4.782  6.776   1.00 0.00 ? 133 GLY A O    3  
ATOM 7630  H H    . GLY A 1 81  ? 0.103   -8.714  7.672   1.00 0.00 ? 133 GLY A H    3  
ATOM 7631  H HA2  . GLY A 1 81  ? -1.766  -6.905  6.203   1.00 0.00 ? 133 GLY A HA2  3  
ATOM 7632  H HA3  . GLY A 1 81  ? -1.628  -7.061  7.966   1.00 0.00 ? 133 GLY A HA3  3  
ATOM 7633  N N    . LYS A 1 82  ? 1.195   -6.186  7.426   1.00 0.00 ? 134 LYS A N    3  
ATOM 7634  C CA   . LYS A 1 82  ? 2.175   -5.126  7.635   1.00 0.00 ? 134 LYS A CA   3  
ATOM 7635  C C    . LYS A 1 82  ? 3.606   -5.662  7.619   1.00 0.00 ? 134 LYS A C    3  
ATOM 7636  O O    . LYS A 1 82  ? 3.838   -6.848  7.397   1.00 0.00 ? 134 LYS A O    3  
ATOM 7637  C CB   . LYS A 1 82  ? 1.896   -4.424  8.970   1.00 0.00 ? 134 LYS A CB   3  
ATOM 7638  C CG   . LYS A 1 82  ? 1.936   -5.374  10.172  1.00 0.00 ? 134 LYS A CG   3  
ATOM 7639  C CD   . LYS A 1 82  ? 0.573   -6.025  10.421  1.00 0.00 ? 134 LYS A CD   3  
ATOM 7640  C CE   . LYS A 1 82  ? 0.691   -6.976  11.604  1.00 0.00 ? 134 LYS A CE   3  
ATOM 7641  N NZ   . LYS A 1 82  ? -0.631  -7.475  12.029  1.00 0.00 ? 134 LYS A NZ   3  
ATOM 7642  H H    . LYS A 1 82  ? 1.491   -7.142  7.564   1.00 0.00 ? 134 LYS A H    3  
ATOM 7643  H HA   . LYS A 1 82  ? 2.081   -4.391  6.836   1.00 0.00 ? 134 LYS A HA   3  
ATOM 7644  H HB2  . LYS A 1 82  ? 2.648   -3.649  9.118   1.00 0.00 ? 134 LYS A HB2  3  
ATOM 7645  H HB3  . LYS A 1 82  ? 0.921   -3.939  8.930   1.00 0.00 ? 134 LYS A HB3  3  
ATOM 7646  H HG2  . LYS A 1 82  ? 2.695   -6.142  10.014  1.00 0.00 ? 134 LYS A HG2  3  
ATOM 7647  H HG3  . LYS A 1 82  ? 2.205   -4.798  11.057  1.00 0.00 ? 134 LYS A HG3  3  
ATOM 7648  H HD2  . LYS A 1 82  ? -0.159  -5.249  10.642  1.00 0.00 ? 134 LYS A HD2  3  
ATOM 7649  H HD3  . LYS A 1 82  ? 0.250   -6.592  9.548   1.00 0.00 ? 134 LYS A HD3  3  
ATOM 7650  H HE2  . LYS A 1 82  ? 1.336   -7.813  11.335  1.00 0.00 ? 134 LYS A HE2  3  
ATOM 7651  H HE3  . LYS A 1 82  ? 1.158   -6.432  12.426  1.00 0.00 ? 134 LYS A HE3  3  
ATOM 7652  H HZ1  . LYS A 1 82  ? -1.216  -6.701  12.309  1.00 0.00 ? 134 LYS A HZ1  3  
ATOM 7653  H HZ2  . LYS A 1 82  ? -1.078  -7.969  11.270  1.00 0.00 ? 134 LYS A HZ2  3  
ATOM 7654  H HZ3  . LYS A 1 82  ? -0.527  -8.103  12.814  1.00 0.00 ? 134 LYS A HZ3  3  
ATOM 7655  N N    . LEU A 1 83  ? 4.564   -4.765  7.860   1.00 0.00 ? 135 LEU A N    3  
ATOM 7656  C CA   . LEU A 1 83  ? 5.986   -5.062  7.903   1.00 0.00 ? 135 LEU A CA   3  
ATOM 7657  C C    . LEU A 1 83  ? 6.562   -4.583  9.237   1.00 0.00 ? 135 LEU A C    3  
ATOM 7658  O O    . LEU A 1 83  ? 6.011   -3.675  9.856   1.00 0.00 ? 135 LEU A O    3  
ATOM 7659  C CB   . LEU A 1 83  ? 6.662   -4.348  6.726   1.00 0.00 ? 135 LEU A CB   3  
ATOM 7660  C CG   . LEU A 1 83  ? 8.114   -4.772  6.510   1.00 0.00 ? 135 LEU A CG   3  
ATOM 7661  C CD1  . LEU A 1 83  ? 8.166   -6.160  5.873   1.00 0.00 ? 135 LEU A CD1  3  
ATOM 7662  C CD2  . LEU A 1 83  ? 8.798   -3.770  5.584   1.00 0.00 ? 135 LEU A CD2  3  
ATOM 7663  H H    . LEU A 1 83  ? 4.294   -3.806  8.026   1.00 0.00 ? 135 LEU A H    3  
ATOM 7664  H HA   . LEU A 1 83  ? 6.136   -6.137  7.812   1.00 0.00 ? 135 LEU A HA   3  
ATOM 7665  H HB2  . LEU A 1 83  ? 6.098   -4.547  5.815   1.00 0.00 ? 135 LEU A HB2  3  
ATOM 7666  H HB3  . LEU A 1 83  ? 6.634   -3.274  6.915   1.00 0.00 ? 135 LEU A HB3  3  
ATOM 7667  H HG   . LEU A 1 83  ? 8.649   -4.787  7.460   1.00 0.00 ? 135 LEU A HG   3  
ATOM 7668  H HD11 . LEU A 1 83  ? 9.203   -6.459  5.730   1.00 0.00 ? 135 LEU A HD11 3  
ATOM 7669  H HD12 . LEU A 1 83  ? 7.670   -6.881  6.522   1.00 0.00 ? 135 LEU A HD12 3  
ATOM 7670  H HD13 . LEU A 1 83  ? 7.659   -6.142  4.907   1.00 0.00 ? 135 LEU A HD13 3  
ATOM 7671  H HD21 . LEU A 1 83  ? 8.837   -2.796  6.073   1.00 0.00 ? 135 LEU A HD21 3  
ATOM 7672  H HD22 . LEU A 1 83  ? 9.814   -4.103  5.372   1.00 0.00 ? 135 LEU A HD22 3  
ATOM 7673  H HD23 . LEU A 1 83  ? 8.236   -3.683  4.655   1.00 0.00 ? 135 LEU A HD23 3  
ATOM 7674  N N    . TYR A 1 84  ? 7.666   -5.192  9.681   1.00 0.00 ? 136 TYR A N    3  
ATOM 7675  C CA   . TYR A 1 84  ? 8.346   -4.774  10.897  1.00 0.00 ? 136 TYR A CA   3  
ATOM 7676  C C    . TYR A 1 84  ? 9.856   -4.747  10.676  1.00 0.00 ? 136 TYR A C    3  
ATOM 7677  O O    . TYR A 1 84  ? 10.433  -5.683  10.124  1.00 0.00 ? 136 TYR A O    3  
ATOM 7678  C CB   . TYR A 1 84  ? 7.981   -5.702  12.055  1.00 0.00 ? 136 TYR A CB   3  
ATOM 7679  C CG   . TYR A 1 84  ? 6.544   -5.579  12.510  1.00 0.00 ? 136 TYR A CG   3  
ATOM 7680  C CD1  . TYR A 1 84  ? 6.148   -4.465  13.265  1.00 0.00 ? 136 TYR A CD1  3  
ATOM 7681  C CD2  . TYR A 1 84  ? 5.612   -6.574  12.182  1.00 0.00 ? 136 TYR A CD2  3  
ATOM 7682  C CE1  . TYR A 1 84  ? 4.821   -4.343  13.700  1.00 0.00 ? 136 TYR A CE1  3  
ATOM 7683  C CE2  . TYR A 1 84  ? 4.283   -6.462  12.614  1.00 0.00 ? 136 TYR A CE2  3  
ATOM 7684  C CZ   . TYR A 1 84  ? 3.882   -5.345  13.377  1.00 0.00 ? 136 TYR A CZ   3  
ATOM 7685  O OH   . TYR A 1 84  ? 2.592   -5.238  13.800  1.00 0.00 ? 136 TYR A OH   3  
ATOM 7686  H H    . TYR A 1 84  ? 8.057   -5.965  9.164   1.00 0.00 ? 136 TYR A H    3  
ATOM 7687  H HA   . TYR A 1 84  ? 8.024   -3.765  11.154  1.00 0.00 ? 136 TYR A HA   3  
ATOM 7688  H HB2  . TYR A 1 84  ? 8.171   -6.733  11.756  1.00 0.00 ? 136 TYR A HB2  3  
ATOM 7689  H HB3  . TYR A 1 84  ? 8.626   -5.470  12.901  1.00 0.00 ? 136 TYR A HB3  3  
ATOM 7690  H HD1  . TYR A 1 84  ? 6.866   -3.697  13.512  1.00 0.00 ? 136 TYR A HD1  3  
ATOM 7691  H HD2  . TYR A 1 84  ? 5.917   -7.430  11.596  1.00 0.00 ? 136 TYR A HD2  3  
ATOM 7692  H HE1  . TYR A 1 84  ? 4.517   -3.486  14.282  1.00 0.00 ? 136 TYR A HE1  3  
ATOM 7693  H HE2  . TYR A 1 84  ? 3.564   -7.228  12.363  1.00 0.00 ? 136 TYR A HE2  3  
ATOM 7694  H HH   . TYR A 1 84  ? 2.433   -4.444  14.317  1.00 0.00 ? 136 TYR A HH   3  
ATOM 7695  N N    . LEU A 1 85  ? 10.490  -3.655  11.116  1.00 0.00 ? 137 LEU A N    3  
ATOM 7696  C CA   . LEU A 1 85  ? 11.916  -3.429  10.941  1.00 0.00 ? 137 LEU A CA   3  
ATOM 7697  C C    . LEU A 1 85  ? 12.659  -3.647  12.256  1.00 0.00 ? 137 LEU A C    3  
ATOM 7698  O O    . LEU A 1 85  ? 12.156  -3.309  13.325  1.00 0.00 ? 137 LEU A O    3  
ATOM 7699  C CB   . LEU A 1 85  ? 12.127  -2.015  10.380  1.00 0.00 ? 137 LEU A CB   3  
ATOM 7700  C CG   . LEU A 1 85  ? 12.580  -2.000  8.916   1.00 0.00 ? 137 LEU A CG   3  
ATOM 7701  C CD1  . LEU A 1 85  ? 14.023  -2.495  8.824   1.00 0.00 ? 137 LEU A CD1  3  
ATOM 7702  C CD2  . LEU A 1 85  ? 11.669  -2.857  8.032   1.00 0.00 ? 137 LEU A CD2  3  
ATOM 7703  H H    . LEU A 1 85  ? 9.958   -2.943  11.593  1.00 0.00 ? 137 LEU A H    3  
ATOM 7704  H HA   . LEU A 1 85  ? 12.304  -4.154  10.226  1.00 0.00 ? 137 LEU A HA   3  
ATOM 7705  H HB2  . LEU A 1 85  ? 11.187  -1.467  10.451  1.00 0.00 ? 137 LEU A HB2  3  
ATOM 7706  H HB3  . LEU A 1 85  ? 12.872  -1.495  10.982  1.00 0.00 ? 137 LEU A HB3  3  
ATOM 7707  H HG   . LEU A 1 85  ? 12.546  -0.971  8.558   1.00 0.00 ? 137 LEU A HG   3  
ATOM 7708  H HD11 . LEU A 1 85  ? 14.671  -1.827  9.390   1.00 0.00 ? 137 LEU A HD11 3  
ATOM 7709  H HD12 . LEU A 1 85  ? 14.100  -3.502  9.235   1.00 0.00 ? 137 LEU A HD12 3  
ATOM 7710  H HD13 . LEU A 1 85  ? 14.338  -2.504  7.781   1.00 0.00 ? 137 LEU A HD13 3  
ATOM 7711  H HD21 . LEU A 1 85  ? 11.932  -2.709  6.983   1.00 0.00 ? 137 LEU A HD21 3  
ATOM 7712  H HD22 . LEU A 1 85  ? 11.784  -3.912  8.277   1.00 0.00 ? 137 LEU A HD22 3  
ATOM 7713  H HD23 . LEU A 1 85  ? 10.630  -2.565  8.184   1.00 0.00 ? 137 LEU A HD23 3  
ATOM 7714  N N    . CYS A 1 86  ? 13.864  -4.215  12.161  1.00 0.00 ? 138 CYS A N    3  
ATOM 7715  C CA   . CYS A 1 86  ? 14.671  -4.597  13.312  1.00 0.00 ? 138 CYS A CA   3  
ATOM 7716  C C    . CYS A 1 86  ? 15.731  -3.547  13.647  1.00 0.00 ? 138 CYS A C    3  
ATOM 7717  O O    . CYS A 1 86  ? 16.760  -3.873  14.238  1.00 0.00 ? 138 CYS A O    3  
ATOM 7718  C CB   . CYS A 1 86  ? 15.295  -5.971  13.063  1.00 0.00 ? 138 CYS A CB   3  
ATOM 7719  S SG   . CYS A 1 86  ? 13.981  -7.176  12.732  1.00 0.00 ? 138 CYS A SG   3  
ATOM 7720  H H    . CYS A 1 86  ? 14.247  -4.403  11.245  1.00 0.00 ? 138 CYS A H    3  
ATOM 7721  H HA   . CYS A 1 86  ? 14.009  -4.678  14.174  1.00 0.00 ? 138 CYS A HA   3  
ATOM 7722  H HB2  . CYS A 1 86  ? 15.969  -5.918  12.209  1.00 0.00 ? 138 CYS A HB2  3  
ATOM 7723  H HB3  . CYS A 1 86  ? 15.856  -6.281  13.945  1.00 0.00 ? 138 CYS A HB3  3  
ATOM 7724  H HG   . CYS A 1 86  ? 14.785  -8.229  12.564  1.00 0.00 ? 138 CYS A HG   3  
ATOM 7725  N N    . VAL A 1 87  ? 15.487  -2.286  13.272  1.00 0.00 ? 139 VAL A N    3  
ATOM 7726  C CA   . VAL A 1 87  ? 16.414  -1.187  13.516  1.00 0.00 ? 139 VAL A CA   3  
ATOM 7727  C C    . VAL A 1 87  ? 16.575  -0.915  15.016  1.00 0.00 ? 139 VAL A C    3  
ATOM 7728  O O    . VAL A 1 87  ? 17.472  -0.183  15.423  1.00 0.00 ? 139 VAL A O    3  
ATOM 7729  C CB   . VAL A 1 87  ? 15.919  0.050   12.756  1.00 0.00 ? 139 VAL A CB   3  
ATOM 7730  C CG1  . VAL A 1 87  ? 14.583  0.535   13.316  1.00 0.00 ? 139 VAL A CG1  3  
ATOM 7731  C CG2  . VAL A 1 87  ? 16.923  1.198   12.809  1.00 0.00 ? 139 VAL A CG2  3  
ATOM 7732  H H    . VAL A 1 87  ? 14.623  -2.075  12.795  1.00 0.00 ? 139 VAL A H    3  
ATOM 7733  H HA   . VAL A 1 87  ? 17.388  -1.468  13.118  1.00 0.00 ? 139 VAL A HA   3  
ATOM 7734  H HB   . VAL A 1 87  ? 15.775  -0.223  11.710  1.00 0.00 ? 139 VAL A HB   3  
ATOM 7735  H HG11 . VAL A 1 87  ? 14.702  0.843   14.355  1.00 0.00 ? 139 VAL A HG11 3  
ATOM 7736  H HG12 . VAL A 1 87  ? 14.234  1.385   12.730  1.00 0.00 ? 139 VAL A HG12 3  
ATOM 7737  H HG13 . VAL A 1 87  ? 13.846  -0.266  13.254  1.00 0.00 ? 139 VAL A HG13 3  
ATOM 7738  H HG21 . VAL A 1 87  ? 17.877  0.871   12.397  1.00 0.00 ? 139 VAL A HG21 3  
ATOM 7739  H HG22 . VAL A 1 87  ? 16.542  2.031   12.218  1.00 0.00 ? 139 VAL A HG22 3  
ATOM 7740  H HG23 . VAL A 1 87  ? 17.060  1.534   13.838  1.00 0.00 ? 139 VAL A HG23 3  
ATOM 7741  N N    . SER A 1 88  ? 15.707  -1.502  15.845  1.00 0.00 ? 140 SER A N    3  
ATOM 7742  C CA   . SER A 1 88  ? 15.754  -1.357  17.291  1.00 0.00 ? 140 SER A CA   3  
ATOM 7743  C C    . SER A 1 88  ? 16.684  -2.397  17.913  1.00 0.00 ? 140 SER A C    3  
ATOM 7744  O O    . SER A 1 88  ? 16.299  -3.095  18.850  1.00 0.00 ? 140 SER A O    3  
ATOM 7745  C CB   . SER A 1 88  ? 14.337  -1.431  17.859  1.00 0.00 ? 140 SER A CB   3  
ATOM 7746  O OG   . SER A 1 88  ? 13.744  -2.671  17.535  1.00 0.00 ? 140 SER A OG   3  
ATOM 7747  H H    . SER A 1 88  ? 14.973  -2.082  15.462  1.00 0.00 ? 140 SER A H    3  
ATOM 7748  H HA   . SER A 1 88  ? 16.157  -0.371  17.521  1.00 0.00 ? 140 SER A HA   3  
ATOM 7749  H HB2  . SER A 1 88  ? 14.364  -1.308  18.942  1.00 0.00 ? 140 SER A HB2  3  
ATOM 7750  H HB3  . SER A 1 88  ? 13.743  -0.626  17.426  1.00 0.00 ? 140 SER A HB3  3  
ATOM 7751  H HG   . SER A 1 88  ? 14.226  -3.366  17.989  1.00 0.00 ? 140 SER A HG   3  
ATOM 7752  N N    . SER A 1 89  ? 17.911  -2.505  17.391  1.00 0.00 ? 141 SER A N    3  
ATOM 7753  C CA   . SER A 1 89  ? 18.880  -3.484  17.873  1.00 0.00 ? 141 SER A CA   3  
ATOM 7754  C C    . SER A 1 89  ? 20.342  -3.130  17.558  1.00 0.00 ? 141 SER A C    3  
ATOM 7755  O O    . SER A 1 89  ? 21.179  -3.241  18.455  1.00 0.00 ? 141 SER A O    3  
ATOM 7756  C CB   . SER A 1 89  ? 18.543  -4.854  17.277  1.00 0.00 ? 141 SER A CB   3  
ATOM 7757  O OG   . SER A 1 89  ? 19.417  -5.834  17.797  1.00 0.00 ? 141 SER A OG   3  
ATOM 7758  H H    . SER A 1 89  ? 18.182  -1.881  16.643  1.00 0.00 ? 141 SER A H    3  
ATOM 7759  H HA   . SER A 1 89  ? 18.780  -3.551  18.956  1.00 0.00 ? 141 SER A HA   3  
ATOM 7760  H HB2  . SER A 1 89  ? 17.515  -5.115  17.527  1.00 0.00 ? 141 SER A HB2  3  
ATOM 7761  H HB3  . SER A 1 89  ? 18.647  -4.816  16.192  1.00 0.00 ? 141 SER A HB3  3  
ATOM 7762  H HG   . SER A 1 89  ? 19.237  -5.936  18.734  1.00 0.00 ? 141 SER A HG   3  
ATOM 7763  N N    . PRO A 1 90  ? 20.693  -2.708  16.330  1.00 0.00 ? 142 PRO A N    3  
ATOM 7764  C CA   . PRO A 1 90  ? 22.080  -2.515  15.923  1.00 0.00 ? 142 PRO A CA   3  
ATOM 7765  C C    . PRO A 1 90  ? 22.847  -1.462  16.724  1.00 0.00 ? 142 PRO A C    3  
ATOM 7766  O O    . PRO A 1 90  ? 23.998  -1.693  17.085  1.00 0.00 ? 142 PRO A O    3  
ATOM 7767  C CB   . PRO A 1 90  ? 22.020  -2.111  14.446  1.00 0.00 ? 142 PRO A CB   3  
ATOM 7768  C CG   . PRO A 1 90  ? 20.663  -2.626  13.979  1.00 0.00 ? 142 PRO A CG   3  
ATOM 7769  C CD   . PRO A 1 90  ? 19.808  -2.415  15.222  1.00 0.00 ? 142 PRO A CD   3  
ATOM 7770  H HA   . PRO A 1 90  ? 22.597  -3.472  16.005  1.00 0.00 ? 142 PRO A HA   3  
ATOM 7771  H HB2  . PRO A 1 90  ? 22.040  -1.025  14.360  1.00 0.00 ? 142 PRO A HB2  3  
ATOM 7772  H HB3  . PRO A 1 90  ? 22.835  -2.556  13.874  1.00 0.00 ? 142 PRO A HB3  3  
ATOM 7773  H HG2  . PRO A 1 90  ? 20.285  -2.065  13.124  1.00 0.00 ? 142 PRO A HG2  3  
ATOM 7774  H HG3  . PRO A 1 90  ? 20.731  -3.690  13.754  1.00 0.00 ? 142 PRO A HG3  3  
ATOM 7775  H HD2  . PRO A 1 90  ? 19.497  -1.371  15.279  1.00 0.00 ? 142 PRO A HD2  3  
ATOM 7776  H HD3  . PRO A 1 90  ? 18.943  -3.078  15.201  1.00 0.00 ? 142 PRO A HD3  3  
ATOM 7777  N N    . THR A 1 91  ? 22.224  -0.311  17.004  1.00 0.00 ? 143 THR A N    3  
ATOM 7778  C CA   . THR A 1 91  ? 22.870  0.785   17.727  1.00 0.00 ? 143 THR A CA   3  
ATOM 7779  C C    . THR A 1 91  ? 21.917  1.447   18.720  1.00 0.00 ? 143 THR A C    3  
ATOM 7780  O O    . THR A 1 91  ? 22.293  2.395   19.409  1.00 0.00 ? 143 THR A O    3  
ATOM 7781  C CB   . THR A 1 91  ? 23.393  1.833   16.738  1.00 0.00 ? 143 THR A CB   3  
ATOM 7782  O OG1  . THR A 1 91  ? 22.328  2.308   15.944  1.00 0.00 ? 143 THR A OG1  3  
ATOM 7783  C CG2  . THR A 1 91  ? 24.469  1.251   15.825  1.00 0.00 ? 143 THR A CG2  3  
ATOM 7784  H H    . THR A 1 91  ? 21.270  -0.181  16.702  1.00 0.00 ? 143 THR A H    3  
ATOM 7785  H HA   . THR A 1 91  ? 23.715  0.387   18.290  1.00 0.00 ? 143 THR A HA   3  
ATOM 7786  H HB   . THR A 1 91  ? 23.822  2.664   17.299  1.00 0.00 ? 143 THR A HB   3  
ATOM 7787  H HG1  . THR A 1 91  ? 22.665  3.003   15.373  1.00 0.00 ? 143 THR A HG1  3  
ATOM 7788  H HG21 . THR A 1 91  ? 24.868  2.039   15.188  1.00 0.00 ? 143 THR A HG21 3  
ATOM 7789  H HG22 . THR A 1 91  ? 25.276  0.835   16.428  1.00 0.00 ? 143 THR A HG22 3  
ATOM 7790  H HG23 . THR A 1 91  ? 24.042  0.466   15.200  1.00 0.00 ? 143 THR A HG23 3  
ATOM 7791  N N    . ILE A 1 92  ? 20.683  0.943   18.790  1.00 0.00 ? 144 ILE A N    3  
ATOM 7792  C CA   . ILE A 1 92  ? 19.628  1.443   19.657  1.00 0.00 ? 144 ILE A CA   3  
ATOM 7793  C C    . ILE A 1 92  ? 18.730  0.260   19.990  1.00 0.00 ? 144 ILE A C    3  
ATOM 7794  O O    . ILE A 1 92  ? 18.697  -0.706  19.234  1.00 0.00 ? 144 ILE A O    3  
ATOM 7795  C CB   . ILE A 1 92  ? 18.876  2.581   18.942  1.00 0.00 ? 144 ILE A CB   3  
ATOM 7796  C CG1  . ILE A 1 92  ? 17.656  3.075   19.736  1.00 0.00 ? 144 ILE A CG1  3  
ATOM 7797  C CG2  . ILE A 1 92  ? 18.475  2.184   17.517  1.00 0.00 ? 144 ILE A CG2  3  
ATOM 7798  C CD1  . ILE A 1 92  ? 16.347  2.345   19.407  1.00 0.00 ? 144 ILE A CD1  3  
ATOM 7799  H H    . ILE A 1 92  ? 20.446  0.156   18.206  1.00 0.00 ? 144 ILE A H    3  
ATOM 7800  H HA   . ILE A 1 92  ? 20.063  1.827   20.580  1.00 0.00 ? 144 ILE A HA   3  
ATOM 7801  H HB   . ILE A 1 92  ? 19.569  3.419   18.866  1.00 0.00 ? 144 ILE A HB   3  
ATOM 7802  H HG12 . ILE A 1 92  ? 17.865  2.987   20.802  1.00 0.00 ? 144 ILE A HG12 3  
ATOM 7803  H HG13 . ILE A 1 92  ? 17.509  4.131   19.510  1.00 0.00 ? 144 ILE A HG13 3  
ATOM 7804  H HG21 . ILE A 1 92  ? 17.848  1.292   17.537  1.00 0.00 ? 144 ILE A HG21 3  
ATOM 7805  H HG22 . ILE A 1 92  ? 17.925  3.003   17.053  1.00 0.00 ? 144 ILE A HG22 3  
ATOM 7806  H HG23 . ILE A 1 92  ? 19.366  1.984   16.922  1.00 0.00 ? 144 ILE A HG23 3  
ATOM 7807  H HD11 . ILE A 1 92  ? 15.566  2.688   20.088  1.00 0.00 ? 144 ILE A HD11 3  
ATOM 7808  H HD12 . ILE A 1 92  ? 16.044  2.571   18.386  1.00 0.00 ? 144 ILE A HD12 3  
ATOM 7809  H HD13 . ILE A 1 92  ? 16.464  1.266   19.514  1.00 0.00 ? 144 ILE A HD13 3  
ATOM 7810  N N    . LYS A 1 93  ? 18.002  0.316   21.107  1.00 0.00 ? 145 LYS A N    3  
ATOM 7811  C CA   . LYS A 1 93  ? 17.076  -0.746  21.469  1.00 0.00 ? 145 LYS A CA   3  
ATOM 7812  C C    . LYS A 1 93  ? 15.822  -0.166  22.117  1.00 0.00 ? 145 LYS A C    3  
ATOM 7813  O O    . LYS A 1 93  ? 15.897  0.490   23.154  1.00 0.00 ? 145 LYS A O    3  
ATOM 7814  C CB   . LYS A 1 93  ? 17.780  -1.744  22.396  1.00 0.00 ? 145 LYS A CB   3  
ATOM 7815  C CG   . LYS A 1 93  ? 17.383  -3.188  22.071  1.00 0.00 ? 145 LYS A CG   3  
ATOM 7816  C CD   . LYS A 1 93  ? 15.886  -3.476  22.216  1.00 0.00 ? 145 LYS A CD   3  
ATOM 7817  C CE   . LYS A 1 93  ? 15.394  -3.177  23.633  1.00 0.00 ? 145 LYS A CE   3  
ATOM 7818  N NZ   . LYS A 1 93  ? 13.965  -3.513  23.783  1.00 0.00 ? 145 LYS A NZ   3  
ATOM 7819  H H    . LYS A 1 93  ? 18.087  1.115   21.719  1.00 0.00 ? 145 LYS A H    3  
ATOM 7820  H HA   . LYS A 1 93  ? 16.785  -1.268  20.558  1.00 0.00 ? 145 LYS A HA   3  
ATOM 7821  H HB2  . LYS A 1 93  ? 18.857  -1.660  22.250  1.00 0.00 ? 145 LYS A HB2  3  
ATOM 7822  H HB3  . LYS A 1 93  ? 17.555  -1.514  23.437  1.00 0.00 ? 145 LYS A HB3  3  
ATOM 7823  H HG2  . LYS A 1 93  ? 17.677  -3.395  21.043  1.00 0.00 ? 145 LYS A HG2  3  
ATOM 7824  H HG3  . LYS A 1 93  ? 17.936  -3.858  22.730  1.00 0.00 ? 145 LYS A HG3  3  
ATOM 7825  H HD2  . LYS A 1 93  ? 15.327  -2.877  21.497  1.00 0.00 ? 145 LYS A HD2  3  
ATOM 7826  H HD3  . LYS A 1 93  ? 15.715  -4.528  21.994  1.00 0.00 ? 145 LYS A HD3  3  
ATOM 7827  H HE2  . LYS A 1 93  ? 15.978  -3.764  24.342  1.00 0.00 ? 145 LYS A HE2  3  
ATOM 7828  H HE3  . LYS A 1 93  ? 15.541  -2.119  23.850  1.00 0.00 ? 145 LYS A HE3  3  
ATOM 7829  H HZ1  . LYS A 1 93  ? 13.822  -4.496  23.599  1.00 0.00 ? 145 LYS A HZ1  3  
ATOM 7830  H HZ2  . LYS A 1 93  ? 13.662  -3.310  24.724  1.00 0.00 ? 145 LYS A HZ2  3  
ATOM 7831  H HZ3  . LYS A 1 93  ? 13.408  -2.975  23.136  1.00 0.00 ? 145 LYS A HZ3  3  
ATOM 7832  N N    . ASP A 1 94  ? 14.670  -0.416  21.494  1.00 0.00 ? 146 ASP A N    3  
ATOM 7833  C CA   . ASP A 1 94  ? 13.373  -0.018  22.015  1.00 0.00 ? 146 ASP A CA   3  
ATOM 7834  C C    . ASP A 1 94  ? 12.311  -0.993  21.507  1.00 0.00 ? 146 ASP A C    3  
ATOM 7835  O O    . ASP A 1 94  ? 12.083  -2.026  22.136  1.00 0.00 ? 146 ASP A O    3  
ATOM 7836  C CB   . ASP A 1 94  ? 13.060  1.432   21.628  1.00 0.00 ? 146 ASP A CB   3  
ATOM 7837  C CG   . ASP A 1 94  ? 11.698  1.876   22.162  1.00 0.00 ? 146 ASP A CG   3  
ATOM 7838  O OD1  . ASP A 1 94  ? 11.338  1.445   23.281  1.00 0.00 ? 146 ASP A OD1  3  
ATOM 7839  O OD2  . ASP A 1 94  ? 11.023  2.647   21.444  1.00 0.00 ? 146 ASP A OD2  3  
ATOM 7840  H H    . ASP A 1 94  ? 14.688  -0.914  20.615  1.00 0.00 ? 146 ASP A H    3  
ATOM 7841  H HA   . ASP A 1 94  ? 13.398  -0.086  23.102  1.00 0.00 ? 146 ASP A HA   3  
ATOM 7842  H HB2  . ASP A 1 94  ? 13.831  2.082   22.040  1.00 0.00 ? 146 ASP A HB2  3  
ATOM 7843  H HB3  . ASP A 1 94  ? 13.071  1.527   20.542  1.00 0.00 ? 146 ASP A HB3  3  
ATOM 7844  N N    . LYS A 1 95  ? 11.670  -0.671  20.379  1.00 0.00 ? 147 LYS A N    3  
ATOM 7845  C CA   . LYS A 1 95  ? 10.639  -1.505  19.774  1.00 0.00 ? 147 LYS A CA   3  
ATOM 7846  C C    . LYS A 1 95  ? 10.779  -1.463  18.252  1.00 0.00 ? 147 LYS A C    3  
ATOM 7847  O O    . LYS A 1 95  ? 11.237  -0.452  17.718  1.00 0.00 ? 147 LYS A O    3  
ATOM 7848  C CB   . LYS A 1 95  ? 9.251   -1.000  20.185  1.00 0.00 ? 147 LYS A CB   3  
ATOM 7849  C CG   . LYS A 1 95  ? 9.100   -0.958  21.706  1.00 0.00 ? 147 LYS A CG   3  
ATOM 7850  C CD   . LYS A 1 95  ? 7.721   -0.424  22.089  1.00 0.00 ? 147 LYS A CD   3  
ATOM 7851  C CE   . LYS A 1 95  ? 7.647   -0.216  23.602  1.00 0.00 ? 147 LYS A CE   3  
ATOM 7852  N NZ   . LYS A 1 95  ? 8.550   0.867   24.043  1.00 0.00 ? 147 LYS A NZ   3  
ATOM 7853  H H    . LYS A 1 95  ? 11.904  0.193   19.910  1.00 0.00 ? 147 LYS A H    3  
ATOM 7854  H HA   . LYS A 1 95  ? 10.763  -2.530  20.124  1.00 0.00 ? 147 LYS A HA   3  
ATOM 7855  H HB2  . LYS A 1 95  ? 9.107   0.005   19.788  1.00 0.00 ? 147 LYS A HB2  3  
ATOM 7856  H HB3  . LYS A 1 95  ? 8.490   -1.656  19.766  1.00 0.00 ? 147 LYS A HB3  3  
ATOM 7857  H HG2  . LYS A 1 95  ? 9.228   -1.960  22.116  1.00 0.00 ? 147 LYS A HG2  3  
ATOM 7858  H HG3  . LYS A 1 95  ? 9.861   -0.297  22.123  1.00 0.00 ? 147 LYS A HG3  3  
ATOM 7859  H HD2  . LYS A 1 95  ? 7.540   0.525   21.586  1.00 0.00 ? 147 LYS A HD2  3  
ATOM 7860  H HD3  . LYS A 1 95  ? 6.961   -1.144  21.783  1.00 0.00 ? 147 LYS A HD3  3  
ATOM 7861  H HE2  . LYS A 1 95  ? 6.623   0.041   23.874  1.00 0.00 ? 147 LYS A HE2  3  
ATOM 7862  H HE3  . LYS A 1 95  ? 7.917   -1.147  24.101  1.00 0.00 ? 147 LYS A HE3  3  
ATOM 7863  H HZ1  . LYS A 1 95  ? 9.505   0.658   23.784  1.00 0.00 ? 147 LYS A HZ1  3  
ATOM 7864  H HZ2  . LYS A 1 95  ? 8.281   1.739   23.611  1.00 0.00 ? 147 LYS A HZ2  3  
ATOM 7865  H HZ3  . LYS A 1 95  ? 8.498   0.971   25.046  1.00 0.00 ? 147 LYS A HZ3  3  
ATOM 7866  N N    . PRO A 1 96  ? 10.396  -2.535  17.545  1.00 0.00 ? 148 PRO A N    3  
ATOM 7867  C CA   . PRO A 1 96  ? 10.432  -2.596  16.093  1.00 0.00 ? 148 PRO A CA   3  
ATOM 7868  C C    . PRO A 1 96  ? 9.628   -1.468  15.450  1.00 0.00 ? 148 PRO A C    3  
ATOM 7869  O O    . PRO A 1 96  ? 8.722   -0.913  16.071  1.00 0.00 ? 148 PRO A O    3  
ATOM 7870  C CB   . PRO A 1 96  ? 9.842   -3.959  15.724  1.00 0.00 ? 148 PRO A CB   3  
ATOM 7871  C CG   . PRO A 1 96  ? 10.086  -4.803  16.974  1.00 0.00 ? 148 PRO A CG   3  
ATOM 7872  C CD   . PRO A 1 96  ? 9.904   -3.784  18.094  1.00 0.00 ? 148 PRO A CD   3  
ATOM 7873  H HA   . PRO A 1 96  ? 11.469  -2.548  15.760  1.00 0.00 ? 148 PRO A HA   3  
ATOM 7874  H HB2  . PRO A 1 96  ? 8.768   -3.859  15.564  1.00 0.00 ? 148 PRO A HB2  3  
ATOM 7875  H HB3  . PRO A 1 96  ? 10.327  -4.389  14.848  1.00 0.00 ? 148 PRO A HB3  3  
ATOM 7876  H HG2  . PRO A 1 96  ? 9.374   -5.625  17.052  1.00 0.00 ? 148 PRO A HG2  3  
ATOM 7877  H HG3  . PRO A 1 96  ? 11.113  -5.169  16.974  1.00 0.00 ? 148 PRO A HG3  3  
ATOM 7878  H HD2  . PRO A 1 96  ? 8.847   -3.682  18.337  1.00 0.00 ? 148 PRO A HD2  3  
ATOM 7879  H HD3  . PRO A 1 96  ? 10.473  -4.091  18.973  1.00 0.00 ? 148 PRO A HD3  3  
ATOM 7880  N N    . VAL A 1 97  ? 9.960   -1.126  14.202  1.00 0.00 ? 149 VAL A N    3  
ATOM 7881  C CA   . VAL A 1 97  ? 9.236   -0.097  13.467  1.00 0.00 ? 149 VAL A CA   3  
ATOM 7882  C C    . VAL A 1 97  ? 8.131   -0.752  12.651  1.00 0.00 ? 149 VAL A C    3  
ATOM 7883  O O    . VAL A 1 97  ? 8.404   -1.676  11.889  1.00 0.00 ? 149 VAL A O    3  
ATOM 7884  C CB   . VAL A 1 97  ? 10.179  0.674   12.538  1.00 0.00 ? 149 VAL A CB   3  
ATOM 7885  C CG1  . VAL A 1 97  ? 9.431   1.769   11.789  1.00 0.00 ? 149 VAL A CG1  3  
ATOM 7886  C CG2  . VAL A 1 97  ? 11.294  1.380   13.292  1.00 0.00 ? 149 VAL A CG2  3  
ATOM 7887  H H    . VAL A 1 97  ? 10.728  -1.591  13.739  1.00 0.00 ? 149 VAL A H    3  
ATOM 7888  H HA   . VAL A 1 97  ? 8.792   0.605   14.172  1.00 0.00 ? 149 VAL A HA   3  
ATOM 7889  H HB   . VAL A 1 97  ? 10.617  -0.016  11.817  1.00 0.00 ? 149 VAL A HB   3  
ATOM 7890  H HG11 . VAL A 1 97  ? 9.019   2.482   12.503  1.00 0.00 ? 149 VAL A HG11 3  
ATOM 7891  H HG12 . VAL A 1 97  ? 10.129  2.286   11.129  1.00 0.00 ? 149 VAL A HG12 3  
ATOM 7892  H HG13 . VAL A 1 97  ? 8.625   1.334   11.197  1.00 0.00 ? 149 VAL A HG13 3  
ATOM 7893  H HG21 . VAL A 1 97  ? 10.863  2.098   13.990  1.00 0.00 ? 149 VAL A HG21 3  
ATOM 7894  H HG22 . VAL A 1 97  ? 11.894  0.648   13.832  1.00 0.00 ? 149 VAL A HG22 3  
ATOM 7895  H HG23 . VAL A 1 97  ? 11.911  1.912   12.566  1.00 0.00 ? 149 VAL A HG23 3  
ATOM 7896  N N    . GLN A 1 98  ? 6.889   -0.284  12.800  1.00 0.00 ? 150 GLN A N    3  
ATOM 7897  C CA   . GLN A 1 98  ? 5.797   -0.769  11.972  1.00 0.00 ? 150 GLN A CA   3  
ATOM 7898  C C    . GLN A 1 98  ? 5.869   -0.058  10.625  1.00 0.00 ? 150 GLN A C    3  
ATOM 7899  O O    . GLN A 1 98  ? 6.007   1.164   10.580  1.00 0.00 ? 150 GLN A O    3  
ATOM 7900  C CB   . GLN A 1 98  ? 4.457   -0.534  12.669  1.00 0.00 ? 150 GLN A CB   3  
ATOM 7901  C CG   . GLN A 1 98  ? 3.320   -1.136  11.839  1.00 0.00 ? 150 GLN A CG   3  
ATOM 7902  C CD   . GLN A 1 98  ? 1.962   -0.975  12.515  1.00 0.00 ? 150 GLN A CD   3  
ATOM 7903  O OE1  . GLN A 1 98  ? 1.852   -0.414  13.601  1.00 0.00 ? 150 GLN A OE1  3  
ATOM 7904  N NE2  . GLN A 1 98  ? 0.911   -1.471  11.868  1.00 0.00 ? 150 GLN A NE2  3  
ATOM 7905  H H    . GLN A 1 98  ? 6.692   0.424   13.494  1.00 0.00 ? 150 GLN A H    3  
ATOM 7906  H HA   . GLN A 1 98  ? 5.923   -1.840  11.812  1.00 0.00 ? 150 GLN A HA   3  
ATOM 7907  H HB2  . GLN A 1 98  ? 4.476   -1.013  13.648  1.00 0.00 ? 150 GLN A HB2  3  
ATOM 7908  H HB3  . GLN A 1 98  ? 4.293   0.536   12.795  1.00 0.00 ? 150 GLN A HB3  3  
ATOM 7909  H HG2  . GLN A 1 98  ? 3.285   -0.647  10.864  1.00 0.00 ? 150 GLN A HG2  3  
ATOM 7910  H HG3  . GLN A 1 98  ? 3.512   -2.197  11.686  1.00 0.00 ? 150 GLN A HG3  3  
ATOM 7911  H HE21 . GLN A 1 98  ? 1.034   -1.926  10.974  1.00 0.00 ? 150 GLN A HE21 3  
ATOM 7912  H HE22 . GLN A 1 98  ? -0.010  -1.390  12.274  1.00 0.00 ? 150 GLN A HE22 3  
ATOM 7913  N N    . ILE A 1 99  ? 5.777   -0.822  9.532   1.00 0.00 ? 151 ILE A N    3  
ATOM 7914  C CA   . ILE A 1 99  ? 5.967   -0.296  8.187   1.00 0.00 ? 151 ILE A CA   3  
ATOM 7915  C C    . ILE A 1 99  ? 4.964   -0.905  7.213   1.00 0.00 ? 151 ILE A C    3  
ATOM 7916  O O    . ILE A 1 99  ? 4.498   -2.024  7.417   1.00 0.00 ? 151 ILE A O    3  
ATOM 7917  C CB   . ILE A 1 99  ? 7.420   -0.558  7.758   1.00 0.00 ? 151 ILE A CB   3  
ATOM 7918  C CG1  . ILE A 1 99  ? 8.313   0.346   8.619   1.00 0.00 ? 151 ILE A CG1  3  
ATOM 7919  C CG2  . ILE A 1 99  ? 7.627   -0.313  6.262   1.00 0.00 ? 151 ILE A CG2  3  
ATOM 7920  C CD1  . ILE A 1 99  ? 9.730   0.508   8.080   1.00 0.00 ? 151 ILE A CD1  3  
ATOM 7921  H H    . ILE A 1 99  ? 5.578   -1.807  9.629   1.00 0.00 ? 151 ILE A H    3  
ATOM 7922  H HA   . ILE A 1 99  ? 5.800   0.781   8.205   1.00 0.00 ? 151 ILE A HA   3  
ATOM 7923  H HB   . ILE A 1 99  ? 7.674   -1.599  7.965   1.00 0.00 ? 151 ILE A HB   3  
ATOM 7924  H HG12 . ILE A 1 99  ? 7.859   1.335   8.687   1.00 0.00 ? 151 ILE A HG12 3  
ATOM 7925  H HG13 . ILE A 1 99  ? 8.369   -0.082  9.619   1.00 0.00 ? 151 ILE A HG13 3  
ATOM 7926  H HG21 . ILE A 1 99  ? 7.340   0.712   6.024   1.00 0.00 ? 151 ILE A HG21 3  
ATOM 7927  H HG22 . ILE A 1 99  ? 8.670   -0.477  5.993   1.00 0.00 ? 151 ILE A HG22 3  
ATOM 7928  H HG23 . ILE A 1 99  ? 7.024   -1.010  5.680   1.00 0.00 ? 151 ILE A HG23 3  
ATOM 7929  H HD11 . ILE A 1 99  ? 9.704   1.071   7.147   1.00 0.00 ? 151 ILE A HD11 3  
ATOM 7930  H HD12 . ILE A 1 99  ? 10.325  1.059   8.810   1.00 0.00 ? 151 ILE A HD12 3  
ATOM 7931  H HD13 . ILE A 1 99  ? 10.174  -0.473  7.912   1.00 0.00 ? 151 ILE A HD13 3  
ATOM 7932  N N    . ARG A 1 100 ? 4.636   -0.160  6.150   1.00 0.00 ? 152 ARG A N    3  
ATOM 7933  C CA   . ARG A 1 100 ? 3.745   -0.627  5.097   1.00 0.00 ? 152 ARG A CA   3  
ATOM 7934  C C    . ARG A 1 100 ? 4.157   -0.028  3.748   1.00 0.00 ? 152 ARG A C    3  
ATOM 7935  O O    . ARG A 1 100 ? 4.002   1.175   3.547   1.00 0.00 ? 152 ARG A O    3  
ATOM 7936  C CB   . ARG A 1 100 ? 2.299   -0.224  5.414   1.00 0.00 ? 152 ARG A CB   3  
ATOM 7937  C CG   . ARG A 1 100 ? 1.778   -0.889  6.691   1.00 0.00 ? 152 ARG A CG   3  
ATOM 7938  C CD   . ARG A 1 100 ? 0.317   -0.512  6.936   1.00 0.00 ? 152 ARG A CD   3  
ATOM 7939  N NE   . ARG A 1 100 ? 0.170   0.931   7.172   1.00 0.00 ? 152 ARG A NE   3  
ATOM 7940  C CZ   . ARG A 1 100 ? -0.469  1.778   6.361   1.00 0.00 ? 152 ARG A CZ   3  
ATOM 7941  N NH1  . ARG A 1 100 ? -1.041  1.355   5.236   1.00 0.00 ? 152 ARG A NH1  3  
ATOM 7942  N NH2  . ARG A 1 100 ? -0.540  3.068   6.678   1.00 0.00 ? 152 ARG A NH2  3  
ATOM 7943  H H    . ARG A 1 100 ? 5.021   0.769   6.067   1.00 0.00 ? 152 ARG A H    3  
ATOM 7944  H HA   . ARG A 1 100 ? 3.794   -1.714  5.044   1.00 0.00 ? 152 ARG A HA   3  
ATOM 7945  H HB2  . ARG A 1 100 ? 2.245   0.859   5.526   1.00 0.00 ? 152 ARG A HB2  3  
ATOM 7946  H HB3  . ARG A 1 100 ? 1.662   -0.521  4.582   1.00 0.00 ? 152 ARG A HB3  3  
ATOM 7947  H HG2  . ARG A 1 100 ? 1.854   -1.972  6.588   1.00 0.00 ? 152 ARG A HG2  3  
ATOM 7948  H HG3  . ARG A 1 100 ? 2.371   -0.565  7.546   1.00 0.00 ? 152 ARG A HG3  3  
ATOM 7949  H HD2  . ARG A 1 100 ? -0.280  -0.816  6.076   1.00 0.00 ? 152 ARG A HD2  3  
ATOM 7950  H HD3  . ARG A 1 100 ? -0.042  -1.050  7.813   1.00 0.00 ? 152 ARG A HD3  3  
ATOM 7951  H HE   . ARG A 1 100 ? 0.586   1.303   8.014   1.00 0.00 ? 152 ARG A HE   3  
ATOM 7952  H HH11 . ARG A 1 100 ? -0.991  0.380   4.982   1.00 0.00 ? 152 ARG A HH11 3  
ATOM 7953  H HH12 . ARG A 1 100 ? -1.523  2.011   4.637   1.00 0.00 ? 152 ARG A HH12 3  
ATOM 7954  H HH21 . ARG A 1 100 ? -0.103  3.404   7.525   1.00 0.00 ? 152 ARG A HH21 3  
ATOM 7955  H HH22 . ARG A 1 100 ? -1.030  3.713   6.075   1.00 0.00 ? 152 ARG A HH22 3  
ATOM 7956  N N    . PRO A 1 101 ? 4.678   -0.844  2.820   1.00 0.00 ? 153 PRO A N    3  
ATOM 7957  C CA   . PRO A 1 101 ? 4.917   -0.466  1.432   1.00 0.00 ? 153 PRO A CA   3  
ATOM 7958  C C    . PRO A 1 101 ? 3.589   -0.593  0.683   1.00 0.00 ? 153 PRO A C    3  
ATOM 7959  O O    . PRO A 1 101 ? 2.548   -0.705  1.330   1.00 0.00 ? 153 PRO A O    3  
ATOM 7960  C CB   . PRO A 1 101 ? 5.932   -1.497  0.943   1.00 0.00 ? 153 PRO A CB   3  
ATOM 7961  C CG   . PRO A 1 101 ? 5.480   -2.759  1.675   1.00 0.00 ? 153 PRO A CG   3  
ATOM 7962  C CD   . PRO A 1 101 ? 5.076   -2.221  3.045   1.00 0.00 ? 153 PRO A CD   3  
ATOM 7963  H HA   . PRO A 1 101 ? 5.314   0.546   1.342   1.00 0.00 ? 153 PRO A HA   3  
ATOM 7964  H HB2  . PRO A 1 101 ? 5.910   -1.621  -0.139  1.00 0.00 ? 153 PRO A HB2  3  
ATOM 7965  H HB3  . PRO A 1 101 ? 6.929   -1.215  1.285   1.00 0.00 ? 153 PRO A HB3  3  
ATOM 7966  H HG2  . PRO A 1 101 ? 4.607   -3.178  1.174   1.00 0.00 ? 153 PRO A HG2  3  
ATOM 7967  H HG3  . PRO A 1 101 ? 6.275   -3.500  1.754   1.00 0.00 ? 153 PRO A HG3  3  
ATOM 7968  H HD2  . PRO A 1 101 ? 4.253   -2.812  3.448   1.00 0.00 ? 153 PRO A HD2  3  
ATOM 7969  H HD3  . PRO A 1 101 ? 5.932   -2.247  3.720   1.00 0.00 ? 153 PRO A HD3  3  
ATOM 7970  N N    . TRP A 1 102 ? 3.570   -0.582  -0.656  1.00 0.00 ? 154 TRP A N    3  
ATOM 7971  C CA   . TRP A 1 102 ? 2.342   -0.923  -1.371  1.00 0.00 ? 154 TRP A CA   3  
ATOM 7972  C C    . TRP A 1 102 ? 2.538   -2.010  -2.425  1.00 0.00 ? 154 TRP A C    3  
ATOM 7973  O O    . TRP A 1 102 ? 3.575   -2.089  -3.073  1.00 0.00 ? 154 TRP A O    3  
ATOM 7974  C CB   . TRP A 1 102 ? 1.644   0.296   -1.964  1.00 0.00 ? 154 TRP A CB   3  
ATOM 7975  C CG   . TRP A 1 102 ? 0.364   -0.101  -2.621  1.00 0.00 ? 154 TRP A CG   3  
ATOM 7976  C CD1  . TRP A 1 102 ? 0.152   -0.182  -3.951  1.00 0.00 ? 154 TRP A CD1  3  
ATOM 7977  C CD2  . TRP A 1 102 ? -0.898  -0.487  -1.995  1.00 0.00 ? 154 TRP A CD2  3  
ATOM 7978  N NE1  . TRP A 1 102 ? -1.123  -0.648  -4.193  1.00 0.00 ? 154 TRP A NE1  3  
ATOM 7979  C CE2  . TRP A 1 102 ? -1.826  -0.825  -3.019  1.00 0.00 ? 154 TRP A CE2  3  
ATOM 7980  C CE3  . TRP A 1 102 ? -1.342  -0.604  -0.665  1.00 0.00 ? 154 TRP A CE3  3  
ATOM 7981  C CZ2  . TRP A 1 102 ? -3.130  -1.244  -2.739  1.00 0.00 ? 154 TRP A CZ2  3  
ATOM 7982  C CZ3  . TRP A 1 102 ? -2.648  -1.026  -0.374  1.00 0.00 ? 154 TRP A CZ3  3  
ATOM 7983  C CH2  . TRP A 1 102 ? -3.543  -1.342  -1.405  1.00 0.00 ? 154 TRP A CH2  3  
ATOM 7984  H H    . TRP A 1 102 ? 4.397   -0.350  -1.189  1.00 0.00 ? 154 TRP A H    3  
ATOM 7985  H HA   . TRP A 1 102 ? 1.651   -1.342  -0.641  1.00 0.00 ? 154 TRP A HA   3  
ATOM 7986  H HB2  . TRP A 1 102 ? 1.432   1.012   -1.169  1.00 0.00 ? 154 TRP A HB2  3  
ATOM 7987  H HB3  . TRP A 1 102 ? 2.292   0.765   -2.704  1.00 0.00 ? 154 TRP A HB3  3  
ATOM 7988  H HD1  . TRP A 1 102 ? 0.876   0.069   -4.713  1.00 0.00 ? 154 TRP A HD1  3  
ATOM 7989  H HE1  . TRP A 1 102 ? -1.471  -0.834  -5.122  1.00 0.00 ? 154 TRP A HE1  3  
ATOM 7990  H HE3  . TRP A 1 102 ? -0.666  -0.363  0.143   1.00 0.00 ? 154 TRP A HE3  3  
ATOM 7991  H HZ2  . TRP A 1 102 ? -3.808  -1.490  -3.543  1.00 0.00 ? 154 TRP A HZ2  3  
ATOM 7992  H HZ3  . TRP A 1 102 ? -2.966  -1.106  0.655   1.00 0.00 ? 154 TRP A HZ3  3  
ATOM 7993  H HH2  . TRP A 1 102 ? -4.547  -1.661  -1.169  1.00 0.00 ? 154 TRP A HH2  3  
ATOM 7994  N N    . ASN A 1 103 ? 1.514   -2.854  -2.587  1.00 0.00 ? 155 ASN A N    3  
ATOM 7995  C CA   . ASN A 1 103 ? 1.511   -3.977  -3.512  1.00 0.00 ? 155 ASN A CA   3  
ATOM 7996  C C    . ASN A 1 103 ? 0.946   -3.573  -4.878  1.00 0.00 ? 155 ASN A C    3  
ATOM 7997  O O    . ASN A 1 103 ? -0.014  -4.168  -5.366  1.00 0.00 ? 155 ASN A O    3  
ATOM 7998  C CB   . ASN A 1 103 ? 0.770   -5.158  -2.874  1.00 0.00 ? 155 ASN A CB   3  
ATOM 7999  C CG   . ASN A 1 103 ? -0.554  -4.746  -2.241  1.00 0.00 ? 155 ASN A CG   3  
ATOM 8000  O OD1  . ASN A 1 103 ? -0.695  -4.768  -1.021  1.00 0.00 ? 155 ASN A OD1  3  
ATOM 8001  N ND2  . ASN A 1 103 ? -1.533  -4.367  -3.054  1.00 0.00 ? 155 ASN A ND2  3  
ATOM 8002  H H    . ASN A 1 103 ? 0.681   -2.712  -2.034  1.00 0.00 ? 155 ASN A H    3  
ATOM 8003  H HA   . ASN A 1 103 ? 2.544   -4.284  -3.676  1.00 0.00 ? 155 ASN A HA   3  
ATOM 8004  H HB2  . ASN A 1 103 ? 0.591   -5.924  -3.628  1.00 0.00 ? 155 ASN A HB2  3  
ATOM 8005  H HB3  . ASN A 1 103 ? 1.402   -5.583  -2.094  1.00 0.00 ? 155 ASN A HB3  3  
ATOM 8006  H HD21 . ASN A 1 103 ? -1.383  -4.355  -4.053  1.00 0.00 ? 155 ASN A HD21 3  
ATOM 8007  H HD22 . ASN A 1 103 ? -2.424  -4.091  -2.664  1.00 0.00 ? 155 ASN A HD22 3  
ATOM 8008  N N    . LEU A 1 104 ? 1.549   -2.550  -5.496  1.00 0.00 ? 156 LEU A N    3  
ATOM 8009  C CA   . LEU A 1 104 ? 1.147   -2.025  -6.798  1.00 0.00 ? 156 LEU A CA   3  
ATOM 8010  C C    . LEU A 1 104 ? 1.101   -3.071  -7.915  1.00 0.00 ? 156 LEU A C    3  
ATOM 8011  O O    . LEU A 1 104 ? 0.568   -2.786  -8.985  1.00 0.00 ? 156 LEU A O    3  
ATOM 8012  C CB   . LEU A 1 104 ? 2.097   -0.902  -7.231  1.00 0.00 ? 156 LEU A CB   3  
ATOM 8013  C CG   . LEU A 1 104 ? 3.570   -1.076  -6.843  1.00 0.00 ? 156 LEU A CG   3  
ATOM 8014  C CD1  . LEU A 1 104 ? 4.171   -2.461  -7.034  1.00 0.00 ? 156 LEU A CD1  3  
ATOM 8015  C CD2  . LEU A 1 104 ? 4.414   -0.147  -7.709  1.00 0.00 ? 156 LEU A CD2  3  
ATOM 8016  H H    . LEU A 1 104 ? 2.333   -2.107  -5.039  1.00 0.00 ? 156 LEU A H    3  
ATOM 8017  H HA   . LEU A 1 104 ? 0.144   -1.607  -6.706  1.00 0.00 ? 156 LEU A HA   3  
ATOM 8018  H HB2  . LEU A 1 104 ? 2.029   -0.794  -8.314  1.00 0.00 ? 156 LEU A HB2  3  
ATOM 8019  H HB3  . LEU A 1 104 ? 1.756   0.032   -6.784  1.00 0.00 ? 156 LEU A HB3  3  
ATOM 8020  H HG   . LEU A 1 104 ? 3.672   -0.805  -5.792  1.00 0.00 ? 156 LEU A HG   3  
ATOM 8021  H HD11 . LEU A 1 104 ? 4.037   -2.769  -8.071  1.00 0.00 ? 156 LEU A HD11 3  
ATOM 8022  H HD12 . LEU A 1 104 ? 5.236   -2.409  -6.807  1.00 0.00 ? 156 LEU A HD12 3  
ATOM 8023  H HD13 . LEU A 1 104 ? 3.705   -3.179  -6.358  1.00 0.00 ? 156 LEU A HD13 3  
ATOM 8024  H HD21 . LEU A 1 104 ? 4.066   0.880   -7.602  1.00 0.00 ? 156 LEU A HD21 3  
ATOM 8025  H HD22 . LEU A 1 104 ? 5.459   -0.220  -7.409  1.00 0.00 ? 156 LEU A HD22 3  
ATOM 8026  H HD23 . LEU A 1 104 ? 4.327   -0.459  -8.750  1.00 0.00 ? 156 LEU A HD23 3  
ATOM 8027  N N    . SER A 1 105 ? 1.646   -4.267  -7.689  1.00 0.00 ? 157 SER A N    3  
ATOM 8028  C CA   . SER A 1 105 ? 1.686   -5.300  -8.711  1.00 0.00 ? 157 SER A CA   3  
ATOM 8029  C C    . SER A 1 105 ? 0.726   -6.445  -8.396  1.00 0.00 ? 157 SER A C    3  
ATOM 8030  O O    . SER A 1 105 ? 0.787   -7.491  -9.041  1.00 0.00 ? 157 SER A O    3  
ATOM 8031  C CB   . SER A 1 105 ? 3.121   -5.780  -8.916  1.00 0.00 ? 157 SER A CB   3  
ATOM 8032  O OG   . SER A 1 105 ? 3.908   -4.717  -9.409  1.00 0.00 ? 157 SER A OG   3  
ATOM 8033  H H    . SER A 1 105 ? 2.052   -4.475  -6.787  1.00 0.00 ? 157 SER A H    3  
ATOM 8034  H HA   . SER A 1 105 ? 1.354   -4.862  -9.652  1.00 0.00 ? 157 SER A HA   3  
ATOM 8035  H HB2  . SER A 1 105 ? 3.531   -6.140  -7.971  1.00 0.00 ? 157 SER A HB2  3  
ATOM 8036  H HB3  . SER A 1 105 ? 3.132   -6.585  -9.650  1.00 0.00 ? 157 SER A HB3  3  
ATOM 8037  H HG   . SER A 1 105 ? 4.806   -5.032  -9.538  1.00 0.00 ? 157 SER A HG   3  
ATOM 8038  N N    . ASP A 1 106 ? -0.161  -6.262  -7.411  1.00 0.00 ? 158 ASP A N    3  
ATOM 8039  C CA   . ASP A 1 106 ? -1.190  -7.246  -7.103  1.00 0.00 ? 158 ASP A CA   3  
ATOM 8040  C C    . ASP A 1 106 ? -2.570  -6.590  -7.066  1.00 0.00 ? 158 ASP A C    3  
ATOM 8041  O O    . ASP A 1 106 ? -3.576  -7.264  -7.282  1.00 0.00 ? 158 ASP A O    3  
ATOM 8042  C CB   . ASP A 1 106 ? -0.854  -7.887  -5.758  1.00 0.00 ? 158 ASP A CB   3  
ATOM 8043  C CG   . ASP A 1 106 ? -1.898  -8.921  -5.352  1.00 0.00 ? 158 ASP A CG   3  
ATOM 8044  O OD1  . ASP A 1 106 ? -1.838  -10.050 -5.886  1.00 0.00 ? 158 ASP A OD1  3  
ATOM 8045  O OD2  . ASP A 1 106 ? -2.753  -8.576  -4.507  1.00 0.00 ? 158 ASP A OD2  3  
ATOM 8046  H H    . ASP A 1 106 ? -0.132  -5.421  -6.852  1.00 0.00 ? 158 ASP A H    3  
ATOM 8047  H HA   . ASP A 1 106 ? -1.197  -8.019  -7.871  1.00 0.00 ? 158 ASP A HA   3  
ATOM 8048  H HB2  . ASP A 1 106 ? 0.123   -8.367  -5.823  1.00 0.00 ? 158 ASP A HB2  3  
ATOM 8049  H HB3  . ASP A 1 106 ? -0.809  -7.111  -4.995  1.00 0.00 ? 158 ASP A HB3  3  
ATOM 8050  N N    . SER A 1 107 ? -2.620  -5.280  -6.795  1.00 0.00 ? 159 SER A N    3  
ATOM 8051  C CA   . SER A 1 107 ? -3.858  -4.511  -6.847  1.00 0.00 ? 159 SER A CA   3  
ATOM 8052  C C    . SER A 1 107 ? -4.636  -4.682  -8.148  1.00 0.00 ? 159 SER A C    3  
ATOM 8053  O O    . SER A 1 107 ? -5.822  -4.361  -8.184  1.00 0.00 ? 159 SER A O    3  
ATOM 8054  C CB   . SER A 1 107 ? -3.525  -3.031  -6.684  1.00 0.00 ? 159 SER A CB   3  
ATOM 8055  O OG   . SER A 1 107 ? -2.799  -2.823  -5.493  1.00 0.00 ? 159 SER A OG   3  
ATOM 8056  H H    . SER A 1 107 ? -1.778  -4.793  -6.526  1.00 0.00 ? 159 SER A H    3  
ATOM 8057  H HA   . SER A 1 107 ? -4.503  -4.823  -6.025  1.00 0.00 ? 159 SER A HA   3  
ATOM 8058  H HB2  . SER A 1 107 ? -2.925  -2.699  -7.532  1.00 0.00 ? 159 SER A HB2  3  
ATOM 8059  H HB3  . SER A 1 107 ? -4.451  -2.457  -6.661  1.00 0.00 ? 159 SER A HB3  3  
ATOM 8060  H HG   . SER A 1 107 ? -3.350  -3.090  -4.754  1.00 0.00 ? 159 SER A HG   3  
ATOM 8061  N N    . ASP A 1 108 ? -3.999  -5.178  -9.210  1.00 0.00 ? 160 ASP A N    3  
ATOM 8062  C CA   . ASP A 1 108 ? -4.678  -5.420  -10.469 1.00 0.00 ? 160 ASP A CA   3  
ATOM 8063  C C    . ASP A 1 108 ? -5.133  -6.876  -10.553 1.00 0.00 ? 160 ASP A C    3  
ATOM 8064  O O    . ASP A 1 108 ? -4.318  -7.796  -10.511 1.00 0.00 ? 160 ASP A O    3  
ATOM 8065  C CB   . ASP A 1 108 ? -3.772  -5.023  -11.638 1.00 0.00 ? 160 ASP A CB   3  
ATOM 8066  C CG   . ASP A 1 108 ? -2.461  -5.808  -11.664 1.00 0.00 ? 160 ASP A CG   3  
ATOM 8067  O OD1  . ASP A 1 108 ? -1.635  -5.589  -10.748 1.00 0.00 ? 160 ASP A OD1  3  
ATOM 8068  O OD2  . ASP A 1 108 ? -2.296  -6.620  -12.601 1.00 0.00 ? 160 ASP A OD2  3  
ATOM 8069  H H    . ASP A 1 108 ? -3.014  -5.398  -9.153  1.00 0.00 ? 160 ASP A H    3  
ATOM 8070  H HA   . ASP A 1 108 ? -5.564  -4.787  -10.509 1.00 0.00 ? 160 ASP A HA   3  
ATOM 8071  H HB2  . ASP A 1 108 ? -4.309  -5.191  -12.571 1.00 0.00 ? 160 ASP A HB2  3  
ATOM 8072  H HB3  . ASP A 1 108 ? -3.545  -3.960  -11.561 1.00 0.00 ? 160 ASP A HB3  3  
ATOM 8073  N N    . PHE A 1 109 ? -6.448  -7.074  -10.676 1.00 0.00 ? 161 PHE A N    3  
ATOM 8074  C CA   . PHE A 1 109 ? -7.024  -8.401  -10.843 1.00 0.00 ? 161 PHE A CA   3  
ATOM 8075  C C    . PHE A 1 109 ? -7.803  -8.479  -12.152 1.00 0.00 ? 161 PHE A C    3  
ATOM 8076  O O    . PHE A 1 109 ? -8.938  -8.012  -12.233 1.00 0.00 ? 161 PHE A O    3  
ATOM 8077  C CB   . PHE A 1 109 ? -7.940  -8.737  -9.661  1.00 0.00 ? 161 PHE A CB   3  
ATOM 8078  C CG   . PHE A 1 109 ? -7.227  -9.173  -8.399  1.00 0.00 ? 161 PHE A CG   3  
ATOM 8079  C CD1  . PHE A 1 109 ? -6.200  -10.127 -8.457  1.00 0.00 ? 161 PHE A CD1  3  
ATOM 8080  C CD2  . PHE A 1 109 ? -7.601  -8.628  -7.162  1.00 0.00 ? 161 PHE A CD2  3  
ATOM 8081  C CE1  . PHE A 1 109 ? -5.549  -10.535 -7.286  1.00 0.00 ? 161 PHE A CE1  3  
ATOM 8082  C CE2  . PHE A 1 109 ? -6.956  -9.044  -5.989  1.00 0.00 ? 161 PHE A CE2  3  
ATOM 8083  C CZ   . PHE A 1 109 ? -5.929  -9.995  -6.050  1.00 0.00 ? 161 PHE A CZ   3  
ATOM 8084  H H    . PHE A 1 109 ? -7.077  -6.284  -10.653 1.00 0.00 ? 161 PHE A H    3  
ATOM 8085  H HA   . PHE A 1 109 ? -6.225  -9.140  -10.890 1.00 0.00 ? 161 PHE A HA   3  
ATOM 8086  H HB2  . PHE A 1 109 ? -8.569  -7.875  -9.441  1.00 0.00 ? 161 PHE A HB2  3  
ATOM 8087  H HB3  . PHE A 1 109 ? -8.593  -9.557  -9.962  1.00 0.00 ? 161 PHE A HB3  3  
ATOM 8088  H HD1  . PHE A 1 109 ? -5.908  -10.551 -9.406  1.00 0.00 ? 161 PHE A HD1  3  
ATOM 8089  H HD2  . PHE A 1 109 ? -8.386  -7.888  -7.107  1.00 0.00 ? 161 PHE A HD2  3  
ATOM 8090  H HE1  . PHE A 1 109 ? -4.756  -11.267 -7.336  1.00 0.00 ? 161 PHE A HE1  3  
ATOM 8091  H HE2  . PHE A 1 109 ? -7.254  -8.628  -5.039  1.00 0.00 ? 161 PHE A HE2  3  
ATOM 8092  H HZ   . PHE A 1 109 ? -5.430  -10.311 -5.145  1.00 0.00 ? 161 PHE A HZ   3  
ATOM 8093  N N    . VAL A 1 110 ? -7.189  -9.074  -13.180 1.00 0.00 ? 162 VAL A N    3  
ATOM 8094  C CA   . VAL A 1 110 ? -7.857  -9.322  -14.451 1.00 0.00 ? 162 VAL A CA   3  
ATOM 8095  C C    . VAL A 1 110 ? -8.449  -10.731 -14.442 1.00 0.00 ? 162 VAL A C    3  
ATOM 8096  O O    . VAL A 1 110 ? -7.874  -11.640 -13.845 1.00 0.00 ? 162 VAL A O    3  
ATOM 8097  C CB   . VAL A 1 110 ? -6.865  -9.139  -15.604 1.00 0.00 ? 162 VAL A CB   3  
ATOM 8098  C CG1  . VAL A 1 110 ? -7.528  -9.414  -16.953 1.00 0.00 ? 162 VAL A CG1  3  
ATOM 8099  C CG2  . VAL A 1 110 ? -6.326  -7.709  -15.628 1.00 0.00 ? 162 VAL A CG2  3  
ATOM 8100  H H    . VAL A 1 110 ? -6.226  -9.366  -13.089 1.00 0.00 ? 162 VAL A H    3  
ATOM 8101  H HA   . VAL A 1 110 ? -8.667  -8.604  -14.579 1.00 0.00 ? 162 VAL A HA   3  
ATOM 8102  H HB   . VAL A 1 110 ? -6.031  -9.828  -15.473 1.00 0.00 ? 162 VAL A HB   3  
ATOM 8103  H HG11 . VAL A 1 110 ? -6.818  -9.213  -17.755 1.00 0.00 ? 162 VAL A HG11 3  
ATOM 8104  H HG12 . VAL A 1 110 ? -7.836  -10.458 -17.010 1.00 0.00 ? 162 VAL A HG12 3  
ATOM 8105  H HG13 . VAL A 1 110 ? -8.397  -8.766  -17.073 1.00 0.00 ? 162 VAL A HG13 3  
ATOM 8106  H HG21 . VAL A 1 110 ? -7.147  -7.011  -15.801 1.00 0.00 ? 162 VAL A HG21 3  
ATOM 8107  H HG22 . VAL A 1 110 ? -5.842  -7.478  -14.679 1.00 0.00 ? 162 VAL A HG22 3  
ATOM 8108  H HG23 . VAL A 1 110 ? -5.598  -7.608  -16.432 1.00 0.00 ? 162 VAL A HG23 3  
ATOM 8109  N N    . MET A 1 111 ? -9.595  -10.913 -15.105 1.00 0.00 ? 163 MET A N    3  
ATOM 8110  C CA   . MET A 1 111 ? -10.236 -12.219 -15.201 1.00 0.00 ? 163 MET A CA   3  
ATOM 8111  C C    . MET A 1 111 ? -10.780 -12.472 -16.612 1.00 0.00 ? 163 MET A C    3  
ATOM 8112  O O    . MET A 1 111 ? -11.295 -13.553 -16.892 1.00 0.00 ? 163 MET A O    3  
ATOM 8113  C CB   . MET A 1 111 ? -11.346 -12.300 -14.145 1.00 0.00 ? 163 MET A CB   3  
ATOM 8114  C CG   . MET A 1 111 ? -11.783 -13.751 -13.922 1.00 0.00 ? 163 MET A CG   3  
ATOM 8115  S SD   . MET A 1 111 ? -12.995 -13.988 -12.595 1.00 0.00 ? 163 MET A SD   3  
ATOM 8116  C CE   . MET A 1 111 ? -11.990 -13.510 -11.164 1.00 0.00 ? 163 MET A CE   3  
ATOM 8117  H H    . MET A 1 111 ? -10.043 -10.130 -15.558 1.00 0.00 ? 163 MET A H    3  
ATOM 8118  H HA   . MET A 1 111 ? -9.492  -12.985 -14.986 1.00 0.00 ? 163 MET A HA   3  
ATOM 8119  H HB2  . MET A 1 111 ? -10.971 -11.899 -13.204 1.00 0.00 ? 163 MET A HB2  3  
ATOM 8120  H HB3  . MET A 1 111 ? -12.200 -11.702 -14.465 1.00 0.00 ? 163 MET A HB3  3  
ATOM 8121  H HG2  . MET A 1 111 ? -12.220 -14.129 -14.847 1.00 0.00 ? 163 MET A HG2  3  
ATOM 8122  H HG3  . MET A 1 111 ? -10.901 -14.348 -13.693 1.00 0.00 ? 163 MET A HG3  3  
ATOM 8123  H HE1  . MET A 1 111 ? -12.575 -13.627 -10.252 1.00 0.00 ? 163 MET A HE1  3  
ATOM 8124  H HE2  . MET A 1 111 ? -11.106 -14.144 -11.109 1.00 0.00 ? 163 MET A HE2  3  
ATOM 8125  H HE3  . MET A 1 111 ? -11.688 -12.467 -11.259 1.00 0.00 ? 163 MET A HE3  3  
ATOM 8126  N N    . ASP A 1 112 ? -10.670 -11.486 -17.509 1.00 0.00 ? 164 ASP A N    3  
ATOM 8127  C CA   . ASP A 1 112 ? -11.172 -11.605 -18.870 1.00 0.00 ? 164 ASP A CA   3  
ATOM 8128  C C    . ASP A 1 112 ? -10.318 -10.777 -19.832 1.00 0.00 ? 164 ASP A C    3  
ATOM 8129  O O    . ASP A 1 112 ? -9.604  -9.870  -19.406 1.00 0.00 ? 164 ASP A O    3  
ATOM 8130  C CB   . ASP A 1 112 ? -12.629 -11.144 -18.897 1.00 0.00 ? 164 ASP A CB   3  
ATOM 8131  C CG   . ASP A 1 112 ? -13.248 -11.326 -20.279 1.00 0.00 ? 164 ASP A CG   3  
ATOM 8132  O OD1  . ASP A 1 112 ? -13.550 -12.487 -20.630 1.00 0.00 ? 164 ASP A OD1  3  
ATOM 8133  O OD2  . ASP A 1 112 ? -13.412 -10.299 -20.971 1.00 0.00 ? 164 ASP A OD2  3  
ATOM 8134  H H    . ASP A 1 112 ? -10.224 -10.617 -17.250 1.00 0.00 ? 164 ASP A H    3  
ATOM 8135  H HA   . ASP A 1 112 ? -11.129 -12.650 -19.177 1.00 0.00 ? 164 ASP A HA   3  
ATOM 8136  H HB2  . ASP A 1 112 ? -13.202 -11.721 -18.172 1.00 0.00 ? 164 ASP A HB2  3  
ATOM 8137  H HB3  . ASP A 1 112 ? -12.671 -10.091 -18.618 1.00 0.00 ? 164 ASP A HB3  3  
ATOM 8138  N N    . GLY A 1 113 ? -10.394 -11.088 -21.129 1.00 0.00 ? 165 GLY A N    3  
ATOM 8139  C CA   . GLY A 1 113 ? -9.622  -10.401 -22.156 1.00 0.00 ? 165 GLY A CA   3  
ATOM 8140  C C    . GLY A 1 113 ? -10.461 -10.073 -23.391 1.00 0.00 ? 165 GLY A C    3  
ATOM 8141  O O    . GLY A 1 113 ? -9.911  -9.679  -24.418 1.00 0.00 ? 165 GLY A O    3  
ATOM 8142  H H    . GLY A 1 113 ? -11.009 -11.834 -21.423 1.00 0.00 ? 165 GLY A H    3  
ATOM 8143  H HA2  . GLY A 1 113 ? -9.232  -9.470  -21.746 1.00 0.00 ? 165 GLY A HA2  3  
ATOM 8144  H HA3  . GLY A 1 113 ? -8.786  -11.034 -22.453 1.00 0.00 ? 165 GLY A HA3  3  
ATOM 8145  N N    . SER A 1 114 ? -11.786 -10.230 -23.304 1.00 0.00 ? 166 SER A N    3  
ATOM 8146  C CA   . SER A 1 114 ? -12.683 -9.992  -24.427 1.00 0.00 ? 166 SER A CA   3  
ATOM 8147  C C    . SER A 1 114 ? -13.109 -8.529  -24.510 1.00 0.00 ? 166 SER A C    3  
ATOM 8148  O O    . SER A 1 114 ? -13.693 -8.113  -25.509 1.00 0.00 ? 166 SER A O    3  
ATOM 8149  C CB   . SER A 1 114 ? -13.919 -10.876 -24.279 1.00 0.00 ? 166 SER A CB   3  
ATOM 8150  O OG   . SER A 1 114 ? -13.562 -12.234 -24.438 1.00 0.00 ? 166 SER A OG   3  
ATOM 8151  H H    . SER A 1 114 ? -12.199 -10.524 -22.430 1.00 0.00 ? 166 SER A H    3  
ATOM 8152  H HA   . SER A 1 114 ? -12.174 -10.254 -25.354 1.00 0.00 ? 166 SER A HA   3  
ATOM 8153  H HB2  . SER A 1 114 ? -14.360 -10.724 -23.294 1.00 0.00 ? 166 SER A HB2  3  
ATOM 8154  H HB3  . SER A 1 114 ? -14.653 -10.595 -25.035 1.00 0.00 ? 166 SER A HB3  3  
ATOM 8155  H HG   . SER A 1 114 ? -14.352 -12.769 -24.331 1.00 0.00 ? 166 SER A HG   3  
ATOM 8156  N N    . GLN A 1 115 ? -12.820 -7.745  -23.469 1.00 0.00 ? 167 GLN A N    3  
ATOM 8157  C CA   . GLN A 1 115 ? -13.190 -6.341  -23.423 1.00 0.00 ? 167 GLN A CA   3  
ATOM 8158  C C    . GLN A 1 115 ? -12.178 -5.577  -22.565 1.00 0.00 ? 167 GLN A C    3  
ATOM 8159  O O    . GLN A 1 115 ? -11.897 -5.990  -21.441 1.00 0.00 ? 167 GLN A O    3  
ATOM 8160  C CB   . GLN A 1 115 ? -14.609 -6.244  -22.854 1.00 0.00 ? 167 GLN A CB   3  
ATOM 8161  C CG   . GLN A 1 115 ? -15.029 -4.793  -22.616 1.00 0.00 ? 167 GLN A CG   3  
ATOM 8162  C CD   . GLN A 1 115 ? -16.461 -4.709  -22.102 1.00 0.00 ? 167 GLN A CD   3  
ATOM 8163  O OE1  . GLN A 1 115 ? -17.378 -4.364  -22.843 1.00 0.00 ? 167 GLN A OE1  3  
ATOM 8164  N NE2  . GLN A 1 115 ? -16.667 -5.023  -20.825 1.00 0.00 ? 167 GLN A NE2  3  
ATOM 8165  H H    . GLN A 1 115 ? -12.329 -8.131  -22.675 1.00 0.00 ? 167 GLN A H    3  
ATOM 8166  H HA   . GLN A 1 115 ? -13.190 -5.938  -24.436 1.00 0.00 ? 167 GLN A HA   3  
ATOM 8167  H HB2  . GLN A 1 115 ? -15.302 -6.700  -23.561 1.00 0.00 ? 167 GLN A HB2  3  
ATOM 8168  H HB3  . GLN A 1 115 ? -14.658 -6.799  -21.917 1.00 0.00 ? 167 GLN A HB3  3  
ATOM 8169  H HG2  . GLN A 1 115 ? -14.364 -4.344  -21.880 1.00 0.00 ? 167 GLN A HG2  3  
ATOM 8170  H HG3  . GLN A 1 115 ? -14.954 -4.239  -23.553 1.00 0.00 ? 167 GLN A HG3  3  
ATOM 8171  H HE21 . GLN A 1 115 ? -15.891 -5.302  -20.241 1.00 0.00 ? 167 GLN A HE21 3  
ATOM 8172  H HE22 . GLN A 1 115 ? -17.603 -4.983  -20.446 1.00 0.00 ? 167 GLN A HE22 3  
ATOM 8173  N N    . PRO A 1 116 ? -11.627 -4.468  -23.079 1.00 0.00 ? 168 PRO A N    3  
ATOM 8174  C CA   . PRO A 1 116 ? -10.657 -3.643  -22.380 1.00 0.00 ? 168 PRO A CA   3  
ATOM 8175  C C    . PRO A 1 116 ? -11.328 -2.733  -21.354 1.00 0.00 ? 168 PRO A C    3  
ATOM 8176  O O    . PRO A 1 116 ? -12.553 -2.611  -21.319 1.00 0.00 ? 168 PRO A O    3  
ATOM 8177  C CB   . PRO A 1 116 ? -9.986  -2.823  -23.482 1.00 0.00 ? 168 PRO A CB   3  
ATOM 8178  C CG   . PRO A 1 116 ? -11.134 -2.602  -24.465 1.00 0.00 ? 168 PRO A CG   3  
ATOM 8179  C CD   . PRO A 1 116 ? -11.895 -3.925  -24.400 1.00 0.00 ? 168 PRO A CD   3  
ATOM 8180  H HA   . PRO A 1 116 ? -9.916  -4.260  -21.873 1.00 0.00 ? 168 PRO A HA   3  
ATOM 8181  H HB2  . PRO A 1 116 ? -9.584  -1.882  -23.108 1.00 0.00 ? 168 PRO A HB2  3  
ATOM 8182  H HB3  . PRO A 1 116 ? -9.208  -3.419  -23.959 1.00 0.00 ? 168 PRO A HB3  3  
ATOM 8183  H HG2  . PRO A 1 116 ? -11.771 -1.796  -24.105 1.00 0.00 ? 168 PRO A HG2  3  
ATOM 8184  H HG3  . PRO A 1 116 ? -10.773 -2.392  -25.472 1.00 0.00 ? 168 PRO A HG3  3  
ATOM 8185  H HD2  . PRO A 1 116 ? -12.962 -3.757  -24.550 1.00 0.00 ? 168 PRO A HD2  3  
ATOM 8186  H HD3  . PRO A 1 116 ? -11.507 -4.608  -25.157 1.00 0.00 ? 168 PRO A HD3  3  
ATOM 8187  N N    . LEU A 1 117 ? -10.513 -2.088  -20.514 1.00 0.00 ? 169 LEU A N    3  
ATOM 8188  C CA   . LEU A 1 117 ? -11.006 -1.152  -19.517 1.00 0.00 ? 169 LEU A CA   3  
ATOM 8189  C C    . LEU A 1 117 ? -11.498 0.108   -20.225 1.00 0.00 ? 169 LEU A C    3  
ATOM 8190  O O    . LEU A 1 117 ? -10.824 0.629   -21.112 1.00 0.00 ? 169 LEU A O    3  
ATOM 8191  C CB   . LEU A 1 117 ? -9.896  -0.802  -18.519 1.00 0.00 ? 169 LEU A CB   3  
ATOM 8192  C CG   . LEU A 1 117 ? -9.599  -1.910  -17.500 1.00 0.00 ? 169 LEU A CG   3  
ATOM 8193  C CD1  . LEU A 1 117 ? -9.140  -3.218  -18.147 1.00 0.00 ? 169 LEU A CD1  3  
ATOM 8194  C CD2  . LEU A 1 117 ? -8.483  -1.423  -16.577 1.00 0.00 ? 169 LEU A CD2  3  
ATOM 8195  H H    . LEU A 1 117 ? -9.518  -2.245  -20.567 1.00 0.00 ? 169 LEU A H    3  
ATOM 8196  H HA   . LEU A 1 117 ? -11.841 -1.600  -18.979 1.00 0.00 ? 169 LEU A HA   3  
ATOM 8197  H HB2  . LEU A 1 117 ? -8.985  -0.560  -19.068 1.00 0.00 ? 169 LEU A HB2  3  
ATOM 8198  H HB3  . LEU A 1 117 ? -10.202 0.084   -17.963 1.00 0.00 ? 169 LEU A HB3  3  
ATOM 8199  H HG   . LEU A 1 117 ? -10.492 -2.103  -16.906 1.00 0.00 ? 169 LEU A HG   3  
ATOM 8200  H HD11 . LEU A 1 117 ? -8.301  -3.025  -18.815 1.00 0.00 ? 169 LEU A HD11 3  
ATOM 8201  H HD12 . LEU A 1 117 ? -8.828  -3.915  -17.369 1.00 0.00 ? 169 LEU A HD12 3  
ATOM 8202  H HD13 . LEU A 1 117 ? -9.964  -3.667  -18.703 1.00 0.00 ? 169 LEU A HD13 3  
ATOM 8203  H HD21 . LEU A 1 117 ? -8.805  -0.519  -16.059 1.00 0.00 ? 169 LEU A HD21 3  
ATOM 8204  H HD22 . LEU A 1 117 ? -8.251  -2.196  -15.844 1.00 0.00 ? 169 LEU A HD22 3  
ATOM 8205  H HD23 . LEU A 1 117 ? -7.592  -1.205  -17.164 1.00 0.00 ? 169 LEU A HD23 3  
ATOM 8206  N N    . ASP A 1 118 ? -12.677 0.595   -19.829 1.00 0.00 ? 170 ASP A N    3  
ATOM 8207  C CA   . ASP A 1 118 ? -13.273 1.786   -20.413 1.00 0.00 ? 170 ASP A CA   3  
ATOM 8208  C C    . ASP A 1 118 ? -14.205 2.453   -19.395 1.00 0.00 ? 170 ASP A C    3  
ATOM 8209  O O    . ASP A 1 118 ? -14.862 1.751   -18.626 1.00 0.00 ? 170 ASP A O    3  
ATOM 8210  C CB   . ASP A 1 118 ? -14.035 1.375   -21.677 1.00 0.00 ? 170 ASP A CB   3  
ATOM 8211  C CG   . ASP A 1 118 ? -14.639 2.578   -22.390 1.00 0.00 ? 170 ASP A CG   3  
ATOM 8212  O OD1  . ASP A 1 118 ? -15.764 2.959   -22.007 1.00 0.00 ? 170 ASP A OD1  3  
ATOM 8213  O OD2  . ASP A 1 118 ? -13.980 3.110   -23.311 1.00 0.00 ? 170 ASP A OD2  3  
ATOM 8214  H H    . ASP A 1 118 ? -13.183 0.123   -19.094 1.00 0.00 ? 170 ASP A H    3  
ATOM 8215  H HA   . ASP A 1 118 ? -12.477 2.478   -20.690 1.00 0.00 ? 170 ASP A HA   3  
ATOM 8216  H HB2  . ASP A 1 118 ? -13.352 0.866   -22.356 1.00 0.00 ? 170 ASP A HB2  3  
ATOM 8217  H HB3  . ASP A 1 118 ? -14.831 0.683   -21.405 1.00 0.00 ? 170 ASP A HB3  3  
ATOM 8218  N N    . PRO A 1 119 ? -14.285 3.792   -19.366 1.00 0.00 ? 171 PRO A N    3  
ATOM 8219  C CA   . PRO A 1 119 ? -15.124 4.530   -18.428 1.00 0.00 ? 171 PRO A CA   3  
ATOM 8220  C C    . PRO A 1 119 ? -16.609 4.162   -18.490 1.00 0.00 ? 171 PRO A C    3  
ATOM 8221  O O    . PRO A 1 119 ? -17.330 4.391   -17.520 1.00 0.00 ? 171 PRO A O    3  
ATOM 8222  C CB   . PRO A 1 119 ? -14.927 6.005   -18.788 1.00 0.00 ? 171 PRO A CB   3  
ATOM 8223  C CG   . PRO A 1 119 ? -13.562 6.037   -19.470 1.00 0.00 ? 171 PRO A CG   3  
ATOM 8224  C CD   . PRO A 1 119 ? -13.553 4.710   -20.222 1.00 0.00 ? 171 PRO A CD   3  
ATOM 8225  H HA   . PRO A 1 119 ? -14.749 4.354   -17.420 1.00 0.00 ? 171 PRO A HA   3  
ATOM 8226  H HB2  . PRO A 1 119 ? -15.691 6.312   -19.504 1.00 0.00 ? 171 PRO A HB2  3  
ATOM 8227  H HB3  . PRO A 1 119 ? -14.950 6.643   -17.904 1.00 0.00 ? 171 PRO A HB3  3  
ATOM 8228  H HG2  . PRO A 1 119 ? -13.462 6.887   -20.144 1.00 0.00 ? 171 PRO A HG2  3  
ATOM 8229  H HG3  . PRO A 1 119 ? -12.776 6.034   -18.715 1.00 0.00 ? 171 PRO A HG3  3  
ATOM 8230  H HD2  . PRO A 1 119 ? -14.076 4.821   -21.171 1.00 0.00 ? 171 PRO A HD2  3  
ATOM 8231  H HD3  . PRO A 1 119 ? -12.525 4.385   -20.381 1.00 0.00 ? 171 PRO A HD3  3  
ATOM 8232  N N    . ARG A 1 120 ? -17.077 3.596   -19.609 1.00 0.00 ? 172 ARG A N    3  
ATOM 8233  C CA   . ARG A 1 120 ? -18.471 3.191   -19.769 1.00 0.00 ? 172 ARG A CA   3  
ATOM 8234  C C    . ARG A 1 120 ? -18.665 1.736   -19.347 1.00 0.00 ? 172 ARG A C    3  
ATOM 8235  O O    . ARG A 1 120 ? -19.783 1.226   -19.390 1.00 0.00 ? 172 ARG A O    3  
ATOM 8236  C CB   . ARG A 1 120 ? -18.932 3.409   -21.216 1.00 0.00 ? 172 ARG A CB   3  
ATOM 8237  C CG   . ARG A 1 120 ? -19.243 4.873   -21.548 1.00 0.00 ? 172 ARG A CG   3  
ATOM 8238  C CD   . ARG A 1 120 ? -18.060 5.830   -21.380 1.00 0.00 ? 172 ARG A CD   3  
ATOM 8239  N NE   . ARG A 1 120 ? -16.909 5.416   -22.191 1.00 0.00 ? 172 ARG A NE   3  
ATOM 8240  C CZ   . ARG A 1 120 ? -16.140 6.238   -22.910 1.00 0.00 ? 172 ARG A CZ   3  
ATOM 8241  N NH1  . ARG A 1 120 ? -16.385 7.546   -22.958 1.00 0.00 ? 172 ARG A NH1  3  
ATOM 8242  N NH2  . ARG A 1 120 ? -15.110 5.745   -23.593 1.00 0.00 ? 172 ARG A NH2  3  
ATOM 8243  H H    . ARG A 1 120 ? -16.447 3.435   -20.383 1.00 0.00 ? 172 ARG A H    3  
ATOM 8244  H HA   . ARG A 1 120 ? -19.097 3.800   -19.118 1.00 0.00 ? 172 ARG A HA   3  
ATOM 8245  H HB2  . ARG A 1 120 ? -18.177 3.026   -21.903 1.00 0.00 ? 172 ARG A HB2  3  
ATOM 8246  H HB3  . ARG A 1 120 ? -19.848 2.838   -21.374 1.00 0.00 ? 172 ARG A HB3  3  
ATOM 8247  H HG2  . ARG A 1 120 ? -19.583 4.923   -22.582 1.00 0.00 ? 172 ARG A HG2  3  
ATOM 8248  H HG3  . ARG A 1 120 ? -20.056 5.213   -20.905 1.00 0.00 ? 172 ARG A HG3  3  
ATOM 8249  H HD2  . ARG A 1 120 ? -18.380 6.828   -21.677 1.00 0.00 ? 172 ARG A HD2  3  
ATOM 8250  H HD3  . ARG A 1 120 ? -17.773 5.862   -20.329 1.00 0.00 ? 172 ARG A HD3  3  
ATOM 8251  H HE   . ARG A 1 120 ? -16.682 4.432   -22.203 1.00 0.00 ? 172 ARG A HE   3  
ATOM 8252  H HH11 . ARG A 1 120 ? -17.167 7.930   -22.445 1.00 0.00 ? 172 ARG A HH11 3  
ATOM 8253  H HH12 . ARG A 1 120 ? -15.792 8.152   -23.504 1.00 0.00 ? 172 ARG A HH12 3  
ATOM 8254  H HH21 . ARG A 1 120 ? -14.906 4.756   -23.554 1.00 0.00 ? 172 ARG A HH21 3  
ATOM 8255  H HH22 . ARG A 1 120 ? -14.529 6.357   -24.148 1.00 0.00 ? 172 ARG A HH22 3  
ATOM 8256  N N    . LYS A 1 121 ? -17.579 1.071   -18.940 1.00 0.00 ? 173 LYS A N    3  
ATOM 8257  C CA   . LYS A 1 121 ? -17.597 -0.321  -18.504 1.00 0.00 ? 173 LYS A CA   3  
ATOM 8258  C C    . LYS A 1 121 ? -17.048 -0.461  -17.086 1.00 0.00 ? 173 LYS A C    3  
ATOM 8259  O O    . LYS A 1 121 ? -16.943 -1.576  -16.578 1.00 0.00 ? 173 LYS A O    3  
ATOM 8260  C CB   . LYS A 1 121 ? -16.801 -1.177  -19.493 1.00 0.00 ? 173 LYS A CB   3  
ATOM 8261  C CG   . LYS A 1 121 ? -17.348 -1.073  -20.920 1.00 0.00 ? 173 LYS A CG   3  
ATOM 8262  C CD   . LYS A 1 121 ? -18.763 -1.644  -21.021 1.00 0.00 ? 173 LYS A CD   3  
ATOM 8263  C CE   . LYS A 1 121 ? -19.309 -1.415  -22.427 1.00 0.00 ? 173 LYS A CE   3  
ATOM 8264  N NZ   . LYS A 1 121 ? -20.656 -2.000  -22.571 1.00 0.00 ? 173 LYS A NZ   3  
ATOM 8265  H H    . LYS A 1 121 ? -16.689 1.550   -18.932 1.00 0.00 ? 173 LYS A H    3  
ATOM 8266  H HA   . LYS A 1 121 ? -18.632 -0.665  -18.486 1.00 0.00 ? 173 LYS A HA   3  
ATOM 8267  H HB2  . LYS A 1 121 ? -15.764 -0.842  -19.491 1.00 0.00 ? 173 LYS A HB2  3  
ATOM 8268  H HB3  . LYS A 1 121 ? -16.832 -2.219  -19.175 1.00 0.00 ? 173 LYS A HB3  3  
ATOM 8269  H HG2  . LYS A 1 121 ? -17.356 -0.028  -21.234 1.00 0.00 ? 173 LYS A HG2  3  
ATOM 8270  H HG3  . LYS A 1 121 ? -16.694 -1.630  -21.591 1.00 0.00 ? 173 LYS A HG3  3  
ATOM 8271  H HD2  . LYS A 1 121 ? -18.736 -2.713  -20.805 1.00 0.00 ? 173 LYS A HD2  3  
ATOM 8272  H HD3  . LYS A 1 121 ? -19.419 -1.150  -20.304 1.00 0.00 ? 173 LYS A HD3  3  
ATOM 8273  H HE2  . LYS A 1 121 ? -19.354 -0.343  -22.613 1.00 0.00 ? 173 LYS A HE2  3  
ATOM 8274  H HE3  . LYS A 1 121 ? -18.635 -1.873  -23.151 1.00 0.00 ? 173 LYS A HE3  3  
ATOM 8275  H HZ1  . LYS A 1 121 ? -21.288 -1.577  -21.907 1.00 0.00 ? 173 LYS A HZ1  3  
ATOM 8276  H HZ2  . LYS A 1 121 ? -21.005 -1.837  -23.505 1.00 0.00 ? 173 LYS A HZ2  3  
ATOM 8277  H HZ3  . LYS A 1 121 ? -20.620 -2.994  -22.403 1.00 0.00 ? 173 LYS A HZ3  3  
ATOM 8278  N N    . THR A 1 122 ? -16.697 0.663   -16.453 1.00 0.00 ? 174 THR A N    3  
ATOM 8279  C CA   . THR A 1 122 ? -16.150 0.663   -15.103 1.00 0.00 ? 174 THR A CA   3  
ATOM 8280  C C    . THR A 1 122 ? -17.240 1.001   -14.091 1.00 0.00 ? 174 THR A C    3  
ATOM 8281  O O    . THR A 1 122 ? -18.228 1.656   -14.425 1.00 0.00 ? 174 THR A O    3  
ATOM 8282  C CB   . THR A 1 122 ? -14.978 1.650   -15.018 1.00 0.00 ? 174 THR A CB   3  
ATOM 8283  O OG1  . THR A 1 122 ? -14.030 1.339   -16.015 1.00 0.00 ? 174 THR A OG1  3  
ATOM 8284  C CG2  . THR A 1 122 ? -14.272 1.578   -13.666 1.00 0.00 ? 174 THR A CG2  3  
ATOM 8285  H H    . THR A 1 122 ? -16.812 1.554   -16.913 1.00 0.00 ? 174 THR A H    3  
ATOM 8286  H HA   . THR A 1 122 ? -15.767 -0.331  -14.873 1.00 0.00 ? 174 THR A HA   3  
ATOM 8287  H HB   . THR A 1 122 ? -15.346 2.664   -15.175 1.00 0.00 ? 174 THR A HB   3  
ATOM 8288  H HG1  . THR A 1 122 ? -14.443 1.448   -16.874 1.00 0.00 ? 174 THR A HG1  3  
ATOM 8289  H HG21 . THR A 1 122 ? -13.986 0.547   -13.454 1.00 0.00 ? 174 THR A HG21 3  
ATOM 8290  H HG22 . THR A 1 122 ? -13.380 2.204   -13.692 1.00 0.00 ? 174 THR A HG22 3  
ATOM 8291  H HG23 . THR A 1 122 ? -14.934 1.944   -12.881 1.00 0.00 ? 174 THR A HG23 3  
ATOM 8292  N N    . ILE A 1 123 ? -17.051 0.548   -12.850 1.00 0.00 ? 175 ILE A N    3  
ATOM 8293  C CA   . ILE A 1 123 ? -17.979 0.804   -11.759 1.00 0.00 ? 175 ILE A CA   3  
ATOM 8294  C C    . ILE A 1 123 ? -17.171 1.284   -10.552 1.00 0.00 ? 175 ILE A C    3  
ATOM 8295  O O    . ILE A 1 123 ? -16.014 0.902   -10.386 1.00 0.00 ? 175 ILE A O    3  
ATOM 8296  C CB   . ILE A 1 123 ? -18.760 -0.483  -11.446 1.00 0.00 ? 175 ILE A CB   3  
ATOM 8297  C CG1  . ILE A 1 123 ? -19.453 -1.008  -12.712 1.00 0.00 ? 175 ILE A CG1  3  
ATOM 8298  C CG2  . ILE A 1 123 ? -19.796 -0.243  -10.345 1.00 0.00 ? 175 ILE A CG2  3  
ATOM 8299  C CD1  . ILE A 1 123 ? -20.172 -2.332  -12.463 1.00 0.00 ? 175 ILE A CD1  3  
ATOM 8300  H H    . ILE A 1 123 ? -16.231 -0.004  -12.639 1.00 0.00 ? 175 ILE A H    3  
ATOM 8301  H HA   . ILE A 1 123 ? -18.681 1.585   -12.050 1.00 0.00 ? 175 ILE A HA   3  
ATOM 8302  H HB   . ILE A 1 123 ? -18.055 -1.237  -11.099 1.00 0.00 ? 175 ILE A HB   3  
ATOM 8303  H HG12 . ILE A 1 123 ? -20.173 -0.269  -13.067 1.00 0.00 ? 175 ILE A HG12 3  
ATOM 8304  H HG13 . ILE A 1 123 ? -18.708 -1.173  -13.489 1.00 0.00 ? 175 ILE A HG13 3  
ATOM 8305  H HG21 . ILE A 1 123 ? -20.536 0.479   -10.690 1.00 0.00 ? 175 ILE A HG21 3  
ATOM 8306  H HG22 . ILE A 1 123 ? -20.293 -1.179  -10.092 1.00 0.00 ? 175 ILE A HG22 3  
ATOM 8307  H HG23 . ILE A 1 123 ? -19.306 0.135   -9.448  1.00 0.00 ? 175 ILE A HG23 3  
ATOM 8308  H HD11 . ILE A 1 123 ? -21.018 -2.182  -11.792 1.00 0.00 ? 175 ILE A HD11 3  
ATOM 8309  H HD12 . ILE A 1 123 ? -20.537 -2.725  -13.412 1.00 0.00 ? 175 ILE A HD12 3  
ATOM 8310  H HD13 . ILE A 1 123 ? -19.476 -3.047  -12.025 1.00 0.00 ? 175 ILE A HD13 3  
ATOM 8311  N N    . PHE A 1 124 ? -17.785 2.120   -9.713  1.00 0.00 ? 176 PHE A N    3  
ATOM 8312  C CA   . PHE A 1 124 ? -17.130 2.682   -8.544  1.00 0.00 ? 176 PHE A CA   3  
ATOM 8313  C C    . PHE A 1 124 ? -17.535 1.888   -7.305  1.00 0.00 ? 176 PHE A C    3  
ATOM 8314  O O    . PHE A 1 124 ? -18.686 1.469   -7.193  1.00 0.00 ? 176 PHE A O    3  
ATOM 8315  C CB   . PHE A 1 124 ? -17.532 4.155   -8.434  1.00 0.00 ? 176 PHE A CB   3  
ATOM 8316  C CG   . PHE A 1 124 ? -17.133 4.834   -7.143  1.00 0.00 ? 176 PHE A CG   3  
ATOM 8317  C CD1  . PHE A 1 124 ? -17.939 4.700   -6.003  1.00 0.00 ? 176 PHE A CD1  3  
ATOM 8318  C CD2  . PHE A 1 124 ? -15.960 5.601   -7.083  1.00 0.00 ? 176 PHE A CD2  3  
ATOM 8319  C CE1  . PHE A 1 124 ? -17.578 5.336   -4.808  1.00 0.00 ? 176 PHE A CE1  3  
ATOM 8320  C CE2  . PHE A 1 124 ? -15.602 6.241   -5.889  1.00 0.00 ? 176 PHE A CE2  3  
ATOM 8321  C CZ   . PHE A 1 124 ? -16.410 6.110   -4.751  1.00 0.00 ? 176 PHE A CZ   3  
ATOM 8322  H H    . PHE A 1 124 ? -18.746 2.378   -9.880  1.00 0.00 ? 176 PHE A H    3  
ATOM 8323  H HA   . PHE A 1 124 ? -16.047 2.620   -8.660  1.00 0.00 ? 176 PHE A HA   3  
ATOM 8324  H HB2  . PHE A 1 124 ? -17.089 4.699   -9.268  1.00 0.00 ? 176 PHE A HB2  3  
ATOM 8325  H HB3  . PHE A 1 124 ? -18.615 4.225   -8.528  1.00 0.00 ? 176 PHE A HB3  3  
ATOM 8326  H HD1  . PHE A 1 124 ? -18.840 4.105   -6.043  1.00 0.00 ? 176 PHE A HD1  3  
ATOM 8327  H HD2  . PHE A 1 124 ? -15.334 5.701   -7.957  1.00 0.00 ? 176 PHE A HD2  3  
ATOM 8328  H HE1  . PHE A 1 124 ? -18.199 5.232   -3.930  1.00 0.00 ? 176 PHE A HE1  3  
ATOM 8329  H HE2  . PHE A 1 124 ? -14.703 6.838   -5.845  1.00 0.00 ? 176 PHE A HE2  3  
ATOM 8330  H HZ   . PHE A 1 124 ? -16.134 6.602   -3.830  1.00 0.00 ? 176 PHE A HZ   3  
ATOM 8331  N N    . VAL A 1 125 ? -16.595 1.679   -6.377  1.00 0.00 ? 177 VAL A N    3  
ATOM 8332  C CA   . VAL A 1 125 ? -16.858 0.927   -5.156  1.00 0.00 ? 177 VAL A CA   3  
ATOM 8333  C C    . VAL A 1 125 ? -16.268 1.670   -3.960  1.00 0.00 ? 177 VAL A C    3  
ATOM 8334  O O    . VAL A 1 125 ? -15.052 1.714   -3.785  1.00 0.00 ? 177 VAL A O    3  
ATOM 8335  C CB   . VAL A 1 125 ? -16.272 -0.486  -5.267  1.00 0.00 ? 177 VAL A CB   3  
ATOM 8336  C CG1  . VAL A 1 125 ? -16.699 -1.313  -4.054  1.00 0.00 ? 177 VAL A CG1  3  
ATOM 8337  C CG2  . VAL A 1 125 ? -16.771 -1.201  -6.523  1.00 0.00 ? 177 VAL A CG2  3  
ATOM 8338  H H    . VAL A 1 125 ? -15.665 2.049   -6.513  1.00 0.00 ? 177 VAL A H    3  
ATOM 8339  H HA   . VAL A 1 125 ? -17.935 0.844   -5.018  1.00 0.00 ? 177 VAL A HA   3  
ATOM 8340  H HB   . VAL A 1 125 ? -15.185 -0.429  -5.300  1.00 0.00 ? 177 VAL A HB   3  
ATOM 8341  H HG11 . VAL A 1 125 ? -16.333 -0.845  -3.141  1.00 0.00 ? 177 VAL A HG11 3  
ATOM 8342  H HG12 . VAL A 1 125 ? -17.786 -1.377  -4.020  1.00 0.00 ? 177 VAL A HG12 3  
ATOM 8343  H HG13 . VAL A 1 125 ? -16.279 -2.317  -4.134  1.00 0.00 ? 177 VAL A HG13 3  
ATOM 8344  H HG21 . VAL A 1 125 ? -16.430 -0.669  -7.412  1.00 0.00 ? 177 VAL A HG21 3  
ATOM 8345  H HG22 . VAL A 1 125 ? -16.370 -2.215  -6.546  1.00 0.00 ? 177 VAL A HG22 3  
ATOM 8346  H HG23 . VAL A 1 125 ? -17.860 -1.242  -6.516  1.00 0.00 ? 177 VAL A HG23 3  
ATOM 8347  N N    . GLY A 1 126 ? -17.138 2.255   -3.135  1.00 0.00 ? 178 GLY A N    3  
ATOM 8348  C CA   . GLY A 1 126 ? -16.715 3.040   -1.986  1.00 0.00 ? 178 GLY A CA   3  
ATOM 8349  C C    . GLY A 1 126 ? -16.782 2.245   -0.684  1.00 0.00 ? 178 GLY A C    3  
ATOM 8350  O O    . GLY A 1 126 ? -17.392 1.177   -0.620  1.00 0.00 ? 178 GLY A O    3  
ATOM 8351  H H    . GLY A 1 126 ? -18.130 2.160   -3.303  1.00 0.00 ? 178 GLY A H    3  
ATOM 8352  H HA2  . GLY A 1 126 ? -15.691 3.381   -2.135  1.00 0.00 ? 178 GLY A HA2  3  
ATOM 8353  H HA3  . GLY A 1 126 ? -17.354 3.918   -1.895  1.00 0.00 ? 178 GLY A HA3  3  
ATOM 8354  N N    . GLY A 1 127 ? -16.143 2.787   0.357   1.00 0.00 ? 179 GLY A N    3  
ATOM 8355  C CA   . GLY A 1 127 ? -16.138 2.206   1.690   1.00 0.00 ? 179 GLY A CA   3  
ATOM 8356  C C    . GLY A 1 127 ? -14.988 1.228   1.924   1.00 0.00 ? 179 GLY A C    3  
ATOM 8357  O O    . GLY A 1 127 ? -14.872 0.689   3.023   1.00 0.00 ? 179 GLY A O    3  
ATOM 8358  H H    . GLY A 1 127 ? -15.634 3.649   0.224   1.00 0.00 ? 179 GLY A H    3  
ATOM 8359  H HA2  . GLY A 1 127 ? -16.063 3.012   2.421   1.00 0.00 ? 179 GLY A HA2  3  
ATOM 8360  H HA3  . GLY A 1 127 ? -17.081 1.682   1.849   1.00 0.00 ? 179 GLY A HA3  3  
ATOM 8361  N N    . VAL A 1 128 ? -14.137 0.987   0.923   1.00 0.00 ? 180 VAL A N    3  
ATOM 8362  C CA   . VAL A 1 128 ? -13.032 0.045   1.069   1.00 0.00 ? 180 VAL A CA   3  
ATOM 8363  C C    . VAL A 1 128 ? -11.915 0.670   1.916   1.00 0.00 ? 180 VAL A C    3  
ATOM 8364  O O    . VAL A 1 128 ? -11.518 1.808   1.663   1.00 0.00 ? 180 VAL A O    3  
ATOM 8365  C CB   . VAL A 1 128 ? -12.519 -0.410  -0.303  1.00 0.00 ? 180 VAL A CB   3  
ATOM 8366  C CG1  . VAL A 1 128 ? -13.600 -1.220  -1.018  1.00 0.00 ? 180 VAL A CG1  3  
ATOM 8367  C CG2  . VAL A 1 128 ? -12.131 0.767   -1.196  1.00 0.00 ? 180 VAL A CG2  3  
ATOM 8368  H H    . VAL A 1 128 ? -14.247 1.463   0.038   1.00 0.00 ? 180 VAL A H    3  
ATOM 8369  H HA   . VAL A 1 128 ? -13.398 -0.849  1.573   1.00 0.00 ? 180 VAL A HA   3  
ATOM 8370  H HB   . VAL A 1 128 ? -11.648 -1.049  -0.154  1.00 0.00 ? 180 VAL A HB   3  
ATOM 8371  H HG11 . VAL A 1 128 ? -14.475 -0.594  -1.197  1.00 0.00 ? 180 VAL A HG11 3  
ATOM 8372  H HG12 . VAL A 1 128 ? -13.215 -1.582  -1.971  1.00 0.00 ? 180 VAL A HG12 3  
ATOM 8373  H HG13 . VAL A 1 128 ? -13.885 -2.071  -0.398  1.00 0.00 ? 180 VAL A HG13 3  
ATOM 8374  H HG21 . VAL A 1 128 ? -12.997 1.400   -1.382  1.00 0.00 ? 180 VAL A HG21 3  
ATOM 8375  H HG22 . VAL A 1 128 ? -11.347 1.354   -0.718  1.00 0.00 ? 180 VAL A HG22 3  
ATOM 8376  H HG23 . VAL A 1 128 ? -11.754 0.387   -2.147  1.00 0.00 ? 180 VAL A HG23 3  
ATOM 8377  N N    . PRO A 1 129 ? -11.402 -0.057  2.919   1.00 0.00 ? 181 PRO A N    3  
ATOM 8378  C CA   . PRO A 1 129 ? -10.231 0.326   3.698   1.00 0.00 ? 181 PRO A CA   3  
ATOM 8379  C C    . PRO A 1 129 ? -8.987  0.557   2.835   1.00 0.00 ? 181 PRO A C    3  
ATOM 8380  O O    . PRO A 1 129 ? -9.012  0.363   1.621   1.00 0.00 ? 181 PRO A O    3  
ATOM 8381  C CB   . PRO A 1 129 ? -9.991  -0.833  4.671   1.00 0.00 ? 181 PRO A CB   3  
ATOM 8382  C CG   . PRO A 1 129 ? -11.353 -1.514  4.780   1.00 0.00 ? 181 PRO A CG   3  
ATOM 8383  C CD   . PRO A 1 129 ? -11.942 -1.319  3.389   1.00 0.00 ? 181 PRO A CD   3  
ATOM 8384  H HA   . PRO A 1 129 ? -10.459 1.229   4.264   1.00 0.00 ? 181 PRO A HA   3  
ATOM 8385  H HB2  . PRO A 1 129 ? -9.276  -1.533  4.239   1.00 0.00 ? 181 PRO A HB2  3  
ATOM 8386  H HB3  . PRO A 1 129 ? -9.642  -0.479  5.641   1.00 0.00 ? 181 PRO A HB3  3  
ATOM 8387  H HG2  . PRO A 1 129 ? -11.256 -2.570  5.032   1.00 0.00 ? 181 PRO A HG2  3  
ATOM 8388  H HG3  . PRO A 1 129 ? -11.967 -0.987  5.510   1.00 0.00 ? 181 PRO A HG3  3  
ATOM 8389  H HD2  . PRO A 1 129 ? -11.627 -2.127  2.728   1.00 0.00 ? 181 PRO A HD2  3  
ATOM 8390  H HD3  . PRO A 1 129 ? -13.029 -1.283  3.455   1.00 0.00 ? 181 PRO A HD3  3  
ATOM 8391  N N    . ARG A 1 130 ? -7.887  0.975   3.473   1.00 0.00 ? 182 ARG A N    3  
ATOM 8392  C CA   . ARG A 1 130 ? -6.612  1.206   2.798   1.00 0.00 ? 182 ARG A CA   3  
ATOM 8393  C C    . ARG A 1 130 ? -5.562  0.123   3.081   1.00 0.00 ? 182 ARG A C    3  
ATOM 8394  O O    . ARG A 1 130 ? -4.848  -0.246  2.151   1.00 0.00 ? 182 ARG A O    3  
ATOM 8395  C CB   . ARG A 1 130 ? -6.079  2.591   3.172   1.00 0.00 ? 182 ARG A CB   3  
ATOM 8396  C CG   . ARG A 1 130 ? -7.001  3.686   2.633   1.00 0.00 ? 182 ARG A CG   3  
ATOM 8397  C CD   . ARG A 1 130 ? -6.488  5.074   3.024   1.00 0.00 ? 182 ARG A CD   3  
ATOM 8398  N NE   . ARG A 1 130 ? -5.146  5.334   2.484   1.00 0.00 ? 182 ARG A NE   3  
ATOM 8399  C CZ   . ARG A 1 130 ? -4.896  5.712   1.227   1.00 0.00 ? 182 ARG A CZ   3  
ATOM 8400  N NH1  . ARG A 1 130 ? -5.884  5.877   0.349   1.00 0.00 ? 182 ARG A NH1  3  
ATOM 8401  N NH2  . ARG A 1 130 ? -3.644  5.931   0.836   1.00 0.00 ? 182 ARG A NH2  3  
ATOM 8402  H H    . ARG A 1 130 ? -7.930  1.140   4.469   1.00 0.00 ? 182 ARG A H    3  
ATOM 8403  H HA   . ARG A 1 130 ? -6.787  1.200   1.723   1.00 0.00 ? 182 ARG A HA   3  
ATOM 8404  H HB2  . ARG A 1 130 ? -6.003  2.676   4.256   1.00 0.00 ? 182 ARG A HB2  3  
ATOM 8405  H HB3  . ARG A 1 130 ? -5.087  2.715   2.736   1.00 0.00 ? 182 ARG A HB3  3  
ATOM 8406  H HG2  . ARG A 1 130 ? -7.054  3.608   1.547   1.00 0.00 ? 182 ARG A HG2  3  
ATOM 8407  H HG3  . ARG A 1 130 ? -8.001  3.552   3.047   1.00 0.00 ? 182 ARG A HG3  3  
ATOM 8408  H HD2  . ARG A 1 130 ? -7.181  5.829   2.650   1.00 0.00 ? 182 ARG A HD2  3  
ATOM 8409  H HD3  . ARG A 1 130 ? -6.452  5.144   4.111   1.00 0.00 ? 182 ARG A HD3  3  
ATOM 8410  H HE   . ARG A 1 130 ? -4.365  5.216   3.113   1.00 0.00 ? 182 ARG A HE   3  
ATOM 8411  H HH11 . ARG A 1 130 ? -6.840  5.706   0.626   1.00 0.00 ? 182 ARG A HH11 3  
ATOM 8412  H HH12 . ARG A 1 130 ? -5.673  6.173   -0.593  1.00 0.00 ? 182 ARG A HH12 3  
ATOM 8413  H HH21 . ARG A 1 130 ? -2.881  5.822   1.489   1.00 0.00 ? 182 ARG A HH21 3  
ATOM 8414  H HH22 . ARG A 1 130 ? -3.457  6.206   -0.119  1.00 0.00 ? 182 ARG A HH22 3  
ATOM 8415  N N    . PRO A 1 131 ? -5.431  -0.404  4.311   1.00 0.00 ? 183 PRO A N    3  
ATOM 8416  C CA   . PRO A 1 131 ? -4.465  -1.447  4.626   1.00 0.00 ? 183 PRO A CA   3  
ATOM 8417  C C    . PRO A 1 131 ? -4.979  -2.819  4.180   1.00 0.00 ? 183 PRO A C    3  
ATOM 8418  O O    . PRO A 1 131 ? -5.138  -3.729  4.993   1.00 0.00 ? 183 PRO A O    3  
ATOM 8419  C CB   . PRO A 1 131 ? -4.272  -1.350  6.139   1.00 0.00 ? 183 PRO A CB   3  
ATOM 8420  C CG   . PRO A 1 131 ? -5.667  -0.962  6.619   1.00 0.00 ? 183 PRO A CG   3  
ATOM 8421  C CD   . PRO A 1 131 ? -6.179  -0.046  5.506   1.00 0.00 ? 183 PRO A CD   3  
ATOM 8422  H HA   . PRO A 1 131 ? -3.519  -1.244  4.124   1.00 0.00 ? 183 PRO A HA   3  
ATOM 8423  H HB2  . PRO A 1 131 ? -3.931  -2.287  6.578   1.00 0.00 ? 183 PRO A HB2  3  
ATOM 8424  H HB3  . PRO A 1 131 ? -3.575  -0.542  6.363   1.00 0.00 ? 183 PRO A HB3  3  
ATOM 8425  H HG2  . PRO A 1 131 ? -6.293  -1.853  6.671   1.00 0.00 ? 183 PRO A HG2  3  
ATOM 8426  H HG3  . PRO A 1 131 ? -5.636  -0.450  7.580   1.00 0.00 ? 183 PRO A HG3  3  
ATOM 8427  H HD2  . PRO A 1 131 ? -7.249  -0.209  5.373   1.00 0.00 ? 183 PRO A HD2  3  
ATOM 8428  H HD3  . PRO A 1 131 ? -5.979  0.994   5.765   1.00 0.00 ? 183 PRO A HD3  3  
ATOM 8429  N N    . LEU A 1 132 ? -5.241  -2.964  2.880   1.00 0.00 ? 184 LEU A N    3  
ATOM 8430  C CA   . LEU A 1 132 ? -5.821  -4.167  2.304   1.00 0.00 ? 184 LEU A CA   3  
ATOM 8431  C C    . LEU A 1 132 ? -5.323  -4.400  0.879   1.00 0.00 ? 184 LEU A C    3  
ATOM 8432  O O    . LEU A 1 132 ? -4.405  -3.733  0.405   1.00 0.00 ? 184 LEU A O    3  
ATOM 8433  C CB   . LEU A 1 132 ? -7.351  -4.042  2.335   1.00 0.00 ? 184 LEU A CB   3  
ATOM 8434  C CG   . LEU A 1 132 ? -7.908  -2.736  1.750   1.00 0.00 ? 184 LEU A CG   3  
ATOM 8435  C CD1  . LEU A 1 132 ? -7.369  -2.379  0.367   1.00 0.00 ? 184 LEU A CD1  3  
ATOM 8436  C CD2  . LEU A 1 132 ? -9.417  -2.903  1.625   1.00 0.00 ? 184 LEU A CD2  3  
ATOM 8437  H H    . LEU A 1 132 ? -5.033  -2.201  2.251   1.00 0.00 ? 184 LEU A H    3  
ATOM 8438  H HA   . LEU A 1 132 ? -5.546  -5.042  2.894   1.00 0.00 ? 184 LEU A HA   3  
ATOM 8439  H HB2  . LEU A 1 132 ? -7.788  -4.884  1.797   1.00 0.00 ? 184 LEU A HB2  3  
ATOM 8440  H HB3  . LEU A 1 132 ? -7.681  -4.111  3.372   1.00 0.00 ? 184 LEU A HB3  3  
ATOM 8441  H HG   . LEU A 1 132 ? -7.691  -1.915  2.433   1.00 0.00 ? 184 LEU A HG   3  
ATOM 8442  H HD11 . LEU A 1 132 ? -7.503  -3.223  -0.310  1.00 0.00 ? 184 LEU A HD11 3  
ATOM 8443  H HD12 . LEU A 1 132 ? -7.915  -1.518  -0.021  1.00 0.00 ? 184 LEU A HD12 3  
ATOM 8444  H HD13 . LEU A 1 132 ? -6.314  -2.118  0.435   1.00 0.00 ? 184 LEU A HD13 3  
ATOM 8445  H HD21 . LEU A 1 132 ? -9.863  -1.973  1.277   1.00 0.00 ? 184 LEU A HD21 3  
ATOM 8446  H HD22 . LEU A 1 132 ? -9.637  -3.695  0.909   1.00 0.00 ? 184 LEU A HD22 3  
ATOM 8447  H HD23 . LEU A 1 132 ? -9.831  -3.169  2.597   1.00 0.00 ? 184 LEU A HD23 3  
ATOM 8448  N N    . ARG A 1 133 ? -5.955  -5.364  0.207   1.00 0.00 ? 185 ARG A N    3  
ATOM 8449  C CA   . ARG A 1 133 ? -5.734  -5.695  -1.192  1.00 0.00 ? 185 ARG A CA   3  
ATOM 8450  C C    . ARG A 1 133 ? -7.095  -5.741  -1.881  1.00 0.00 ? 185 ARG A C    3  
ATOM 8451  O O    . ARG A 1 133 ? -8.127  -5.666  -1.213  1.00 0.00 ? 185 ARG A O    3  
ATOM 8452  C CB   . ARG A 1 133 ? -5.023  -7.050  -1.276  1.00 0.00 ? 185 ARG A CB   3  
ATOM 8453  C CG   . ARG A 1 133 ? -3.602  -6.972  -0.710  1.00 0.00 ? 185 ARG A CG   3  
ATOM 8454  C CD   . ARG A 1 133 ? -3.023  -8.377  -0.535  1.00 0.00 ? 185 ARG A CD   3  
ATOM 8455  N NE   . ARG A 1 133 ? -2.988  -9.115  -1.801  1.00 0.00 ? 185 ARG A NE   3  
ATOM 8456  C CZ   . ARG A 1 133 ? -2.985  -10.447 -1.899  1.00 0.00 ? 185 ARG A CZ   3  
ATOM 8457  N NH1  . ARG A 1 133 ? -3.007  -11.212 -0.810  1.00 0.00 ? 185 ARG A NH1  3  
ATOM 8458  N NH2  . ARG A 1 133 ? -2.962  -11.018 -3.099  1.00 0.00 ? 185 ARG A NH2  3  
ATOM 8459  H H    . ARG A 1 133 ? -6.651  -5.909  0.696   1.00 0.00 ? 185 ARG A H    3  
ATOM 8460  H HA   . ARG A 1 133 ? -5.120  -4.931  -1.670  1.00 0.00 ? 185 ARG A HA   3  
ATOM 8461  H HB2  . ARG A 1 133 ? -5.595  -7.779  -0.704  1.00 0.00 ? 185 ARG A HB2  3  
ATOM 8462  H HB3  . ARG A 1 133 ? -4.974  -7.369  -2.317  1.00 0.00 ? 185 ARG A HB3  3  
ATOM 8463  H HG2  . ARG A 1 133 ? -2.973  -6.396  -1.388  1.00 0.00 ? 185 ARG A HG2  3  
ATOM 8464  H HG3  . ARG A 1 133 ? -3.621  -6.481  0.263   1.00 0.00 ? 185 ARG A HG3  3  
ATOM 8465  H HD2  . ARG A 1 133 ? -2.009  -8.297  -0.142  1.00 0.00 ? 185 ARG A HD2  3  
ATOM 8466  H HD3  . ARG A 1 133 ? -3.637  -8.921  0.183   1.00 0.00 ? 185 ARG A HD3  3  
ATOM 8467  H HE   . ARG A 1 133 ? -2.964  -8.580  -2.658  1.00 0.00 ? 185 ARG A HE   3  
ATOM 8468  H HH11 . ARG A 1 133 ? -3.022  -10.786 0.106   1.00 0.00 ? 185 ARG A HH11 3  
ATOM 8469  H HH12 . ARG A 1 133 ? -3.007  -12.218 -0.899  1.00 0.00 ? 185 ARG A HH12 3  
ATOM 8470  H HH21 . ARG A 1 133 ? -2.938  -10.433 -3.922  1.00 0.00 ? 185 ARG A HH21 3  
ATOM 8471  H HH22 . ARG A 1 133 ? -2.967  -12.023 -3.187  1.00 0.00 ? 185 ARG A HH22 3  
ATOM 8472  N N    . ALA A 1 134 ? -7.116  -5.867  -3.209  1.00 0.00 ? 186 ALA A N    3  
ATOM 8473  C CA   . ALA A 1 134 ? -8.360  -5.986  -3.959  1.00 0.00 ? 186 ALA A CA   3  
ATOM 8474  C C    . ALA A 1 134 ? -9.057  -7.324  -3.671  1.00 0.00 ? 186 ALA A C    3  
ATOM 8475  O O    . ALA A 1 134 ? -10.032 -7.676  -4.333  1.00 0.00 ? 186 ALA A O    3  
ATOM 8476  C CB   . ALA A 1 134 ? -8.064  -5.812  -5.449  1.00 0.00 ? 186 ALA A CB   3  
ATOM 8477  H H    . ALA A 1 134 ? -6.245  -5.880  -3.721  1.00 0.00 ? 186 ALA A H    3  
ATOM 8478  H HA   . ALA A 1 134 ? -9.031  -5.188  -3.641  1.00 0.00 ? 186 ALA A HA   3  
ATOM 8479  H HB1  . ALA A 1 134 ? -8.979  -5.946  -6.025  1.00 0.00 ? 186 ALA A HB1  3  
ATOM 8480  H HB2  . ALA A 1 134 ? -7.665  -4.817  -5.644  1.00 0.00 ? 186 ALA A HB2  3  
ATOM 8481  H HB3  . ALA A 1 134 ? -7.317  -6.542  -5.761  1.00 0.00 ? 186 ALA A HB3  3  
ATOM 8482  N N    . VAL A 1 135 ? -8.551  -8.065  -2.681  1.00 0.00 ? 187 VAL A N    3  
ATOM 8483  C CA   . VAL A 1 135 ? -9.046  -9.391  -2.347  1.00 0.00 ? 187 VAL A CA   3  
ATOM 8484  C C    . VAL A 1 135 ? -10.492 -9.362  -1.878  1.00 0.00 ? 187 VAL A C    3  
ATOM 8485  O O    . VAL A 1 135 ? -11.299 -10.167 -2.334  1.00 0.00 ? 187 VAL A O    3  
ATOM 8486  C CB   . VAL A 1 135 ? -8.148  -9.972  -1.247  1.00 0.00 ? 187 VAL A CB   3  
ATOM 8487  C CG1  . VAL A 1 135 ? -8.710  -11.288 -0.711  1.00 0.00 ? 187 VAL A CG1  3  
ATOM 8488  C CG2  . VAL A 1 135 ? -6.751  -10.227 -1.811  1.00 0.00 ? 187 VAL A CG2  3  
ATOM 8489  H H    . VAL A 1 135 ? -7.784  -7.702  -2.132  1.00 0.00 ? 187 VAL A H    3  
ATOM 8490  H HA   . VAL A 1 135 ? -9.002  -10.027 -3.231  1.00 0.00 ? 187 VAL A HA   3  
ATOM 8491  H HB   . VAL A 1 135 ? -8.068  -9.258  -0.429  1.00 0.00 ? 187 VAL A HB   3  
ATOM 8492  H HG11 . VAL A 1 135 ? -8.017  -11.702 0.022   1.00 0.00 ? 187 VAL A HG11 3  
ATOM 8493  H HG12 . VAL A 1 135 ? -9.670  -11.108 -0.227  1.00 0.00 ? 187 VAL A HG12 3  
ATOM 8494  H HG13 . VAL A 1 135 ? -8.839  -11.996 -1.530  1.00 0.00 ? 187 VAL A HG13 3  
ATOM 8495  H HG21 . VAL A 1 135 ? -6.343  -9.298  -2.207  1.00 0.00 ? 187 VAL A HG21 3  
ATOM 8496  H HG22 . VAL A 1 135 ? -6.103  -10.595 -1.016  1.00 0.00 ? 187 VAL A HG22 3  
ATOM 8497  H HG23 . VAL A 1 135 ? -6.807  -10.968 -2.609  1.00 0.00 ? 187 VAL A HG23 3  
ATOM 8498  N N    . GLU A 1 136 ? -10.829 -8.444  -0.972  1.00 0.00 ? 188 GLU A N    3  
ATOM 8499  C CA   . GLU A 1 136 ? -12.161 -8.397  -0.398  1.00 0.00 ? 188 GLU A CA   3  
ATOM 8500  C C    . GLU A 1 136 ? -13.194 -7.927  -1.422  1.00 0.00 ? 188 GLU A C    3  
ATOM 8501  O O    . GLU A 1 136 ? -14.364 -8.272  -1.305  1.00 0.00 ? 188 GLU A O    3  
ATOM 8502  C CB   . GLU A 1 136 ? -12.152 -7.478  0.823   1.00 0.00 ? 188 GLU A CB   3  
ATOM 8503  C CG   . GLU A 1 136 ? -11.474 -6.146  0.504   1.00 0.00 ? 188 GLU A CG   3  
ATOM 8504  C CD   . GLU A 1 136 ? -11.851 -5.096  1.545   1.00 0.00 ? 188 GLU A CD   3  
ATOM 8505  O OE1  . GLU A 1 136 ? -11.447 -5.277  2.715   1.00 0.00 ? 188 GLU A OE1  3  
ATOM 8506  O OE2  . GLU A 1 136 ? -12.538 -4.124  1.160   1.00 0.00 ? 188 GLU A OE2  3  
ATOM 8507  H H    . GLU A 1 136 ? -10.150 -7.762  -0.663  1.00 0.00 ? 188 GLU A H    3  
ATOM 8508  H HA   . GLU A 1 136 ? -12.443 -9.398  -0.072  1.00 0.00 ? 188 GLU A HA   3  
ATOM 8509  H HB2  . GLU A 1 136 ? -13.180 -7.298  1.137   1.00 0.00 ? 188 GLU A HB2  3  
ATOM 8510  H HB3  . GLU A 1 136 ? -11.615 -7.962  1.638   1.00 0.00 ? 188 GLU A HB3  3  
ATOM 8511  H HG2  . GLU A 1 136 ? -10.392 -6.282  0.499   1.00 0.00 ? 188 GLU A HG2  3  
ATOM 8512  H HG3  . GLU A 1 136 ? -11.778 -5.818  -0.491  1.00 0.00 ? 188 GLU A HG3  3  
ATOM 8513  N N    . LEU A 1 137 ? -12.767 -7.148  -2.419  1.00 0.00 ? 189 LEU A N    3  
ATOM 8514  C CA   . LEU A 1 137 ? -13.645 -6.572  -3.422  1.00 0.00 ? 189 LEU A CA   3  
ATOM 8515  C C    . LEU A 1 137 ? -13.971 -7.607  -4.491  1.00 0.00 ? 189 LEU A C    3  
ATOM 8516  O O    . LEU A 1 137 ? -15.137 -7.810  -4.824  1.00 0.00 ? 189 LEU A O    3  
ATOM 8517  C CB   . LEU A 1 137 ? -12.940 -5.338  -4.001  1.00 0.00 ? 189 LEU A CB   3  
ATOM 8518  C CG   . LEU A 1 137 ? -13.680 -4.633  -5.145  1.00 0.00 ? 189 LEU A CG   3  
ATOM 8519  C CD1  . LEU A 1 137 ? -12.976 -3.309  -5.430  1.00 0.00 ? 189 LEU A CD1  3  
ATOM 8520  C CD2  . LEU A 1 137 ? -13.637 -5.432  -6.447  1.00 0.00 ? 189 LEU A CD2  3  
ATOM 8521  H H    . LEU A 1 137 ? -11.781 -6.939  -2.490  1.00 0.00 ? 189 LEU A H    3  
ATOM 8522  H HA   . LEU A 1 137 ? -14.574 -6.258  -2.947  1.00 0.00 ? 189 LEU A HA   3  
ATOM 8523  H HB2  . LEU A 1 137 ? -12.807 -4.623  -3.189  1.00 0.00 ? 189 LEU A HB2  3  
ATOM 8524  H HB3  . LEU A 1 137 ? -11.951 -5.627  -4.357  1.00 0.00 ? 189 LEU A HB3  3  
ATOM 8525  H HG   . LEU A 1 137 ? -14.713 -4.435  -4.860  1.00 0.00 ? 189 LEU A HG   3  
ATOM 8526  H HD11 . LEU A 1 137 ? -11.960 -3.506  -5.771  1.00 0.00 ? 189 LEU A HD11 3  
ATOM 8527  H HD12 . LEU A 1 137 ? -13.515 -2.769  -6.209  1.00 0.00 ? 189 LEU A HD12 3  
ATOM 8528  H HD13 . LEU A 1 137 ? -12.951 -2.701  -4.526  1.00 0.00 ? 189 LEU A HD13 3  
ATOM 8529  H HD21 . LEU A 1 137 ? -14.381 -6.230  -6.430  1.00 0.00 ? 189 LEU A HD21 3  
ATOM 8530  H HD22 . LEU A 1 137 ? -13.866 -4.771  -7.283  1.00 0.00 ? 189 LEU A HD22 3  
ATOM 8531  H HD23 . LEU A 1 137 ? -12.641 -5.854  -6.583  1.00 0.00 ? 189 LEU A HD23 3  
ATOM 8532  N N    . ALA A 1 138 ? -12.949 -8.269  -5.036  1.00 0.00 ? 190 ALA A N    3  
ATOM 8533  C CA   . ALA A 1 138 ? -13.162 -9.206  -6.122  1.00 0.00 ? 190 ALA A CA   3  
ATOM 8534  C C    . ALA A 1 138 ? -13.821 -10.486 -5.617  1.00 0.00 ? 190 ALA A C    3  
ATOM 8535  O O    . ALA A 1 138 ? -14.501 -11.168 -6.382  1.00 0.00 ? 190 ALA A O    3  
ATOM 8536  C CB   . ALA A 1 138 ? -11.816 -9.504  -6.781  1.00 0.00 ? 190 ALA A CB   3  
ATOM 8537  H H    . ALA A 1 138 ? -12.008 -8.121  -4.700  1.00 0.00 ? 190 ALA A H    3  
ATOM 8538  H HA   . ALA A 1 138 ? -13.818 -8.744  -6.859  1.00 0.00 ? 190 ALA A HA   3  
ATOM 8539  H HB1  . ALA A 1 138 ? -11.374 -8.577  -7.145  1.00 0.00 ? 190 ALA A HB1  3  
ATOM 8540  H HB2  . ALA A 1 138 ? -11.146 -9.963  -6.054  1.00 0.00 ? 190 ALA A HB2  3  
ATOM 8541  H HB3  . ALA A 1 138 ? -11.963 -10.187 -7.617  1.00 0.00 ? 190 ALA A HB3  3  
ATOM 8542  N N    . MET A 1 139 ? -13.633 -10.829 -4.338  1.00 0.00 ? 191 MET A N    3  
ATOM 8543  C CA   . MET A 1 139 ? -14.173 -12.065 -3.798  1.00 0.00 ? 191 MET A CA   3  
ATOM 8544  C C    . MET A 1 139 ? -15.653 -11.920 -3.450  1.00 0.00 ? 191 MET A C    3  
ATOM 8545  O O    . MET A 1 139 ? -16.416 -12.853 -3.682  1.00 0.00 ? 191 MET A O    3  
ATOM 8546  C CB   . MET A 1 139 ? -13.308 -12.553 -2.630  1.00 0.00 ? 191 MET A CB   3  
ATOM 8547  C CG   . MET A 1 139 ? -13.551 -11.790 -1.325  1.00 0.00 ? 191 MET A CG   3  
ATOM 8548  S SD   . MET A 1 139 ? -14.941 -12.394 -0.329  1.00 0.00 ? 191 MET A SD   3  
ATOM 8549  C CE   . MET A 1 139 ? -14.258 -13.981 0.216   1.00 0.00 ? 191 MET A CE   3  
ATOM 8550  H H    . MET A 1 139 ? -13.103 -10.228 -3.723  1.00 0.00 ? 191 MET A H    3  
ATOM 8551  H HA   . MET A 1 139 ? -14.098 -12.820 -4.581  1.00 0.00 ? 191 MET A HA   3  
ATOM 8552  H HB2  . MET A 1 139 ? -13.493 -13.613 -2.461  1.00 0.00 ? 191 MET A HB2  3  
ATOM 8553  H HB3  . MET A 1 139 ? -12.261 -12.443 -2.912  1.00 0.00 ? 191 MET A HB3  3  
ATOM 8554  H HG2  . MET A 1 139 ? -12.652 -11.864 -0.715  1.00 0.00 ? 191 MET A HG2  3  
ATOM 8555  H HG3  . MET A 1 139 ? -13.715 -10.738 -1.558  1.00 0.00 ? 191 MET A HG3  3  
ATOM 8556  H HE1  . MET A 1 139 ? -14.969 -14.474 0.879   1.00 0.00 ? 191 MET A HE1  3  
ATOM 8557  H HE2  . MET A 1 139 ? -14.069 -14.619 -0.648  1.00 0.00 ? 191 MET A HE2  3  
ATOM 8558  H HE3  . MET A 1 139 ? -13.323 -13.811 0.751   1.00 0.00 ? 191 MET A HE3  3  
ATOM 8559  N N    . ILE A 1 140 ? -16.088 -10.781 -2.899  1.00 0.00 ? 192 ILE A N    3  
ATOM 8560  C CA   . ILE A 1 140 ? -17.506 -10.631 -2.590  1.00 0.00 ? 192 ILE A CA   3  
ATOM 8561  C C    . ILE A 1 140 ? -18.325 -10.591 -3.878  1.00 0.00 ? 192 ILE A C    3  
ATOM 8562  O O    . ILE A 1 140 ? -19.399 -11.189 -3.946  1.00 0.00 ? 192 ILE A O    3  
ATOM 8563  C CB   . ILE A 1 140 ? -17.757 -9.392  -1.721  1.00 0.00 ? 192 ILE A CB   3  
ATOM 8564  C CG1  . ILE A 1 140 ? -17.204 -8.125  -2.387  1.00 0.00 ? 192 ILE A CG1  3  
ATOM 8565  C CG2  . ILE A 1 140 ? -17.147 -9.639  -0.338  1.00 0.00 ? 192 ILE A CG2  3  
ATOM 8566  C CD1  . ILE A 1 140 ? -17.318 -6.898  -1.482  1.00 0.00 ? 192 ILE A CD1  3  
ATOM 8567  H H    . ILE A 1 140 ? -15.455 -10.023 -2.689  1.00 0.00 ? 192 ILE A H    3  
ATOM 8568  H HA   . ILE A 1 140 ? -17.828 -11.507 -2.025  1.00 0.00 ? 192 ILE A HA   3  
ATOM 8569  H HB   . ILE A 1 140 ? -18.834 -9.273  -1.595  1.00 0.00 ? 192 ILE A HB   3  
ATOM 8570  H HG12 . ILE A 1 140 ? -16.159 -8.285  -2.651  1.00 0.00 ? 192 ILE A HG12 3  
ATOM 8571  H HG13 . ILE A 1 140 ? -17.748 -7.924  -3.309  1.00 0.00 ? 192 ILE A HG13 3  
ATOM 8572  H HG21 . ILE A 1 140 ? -17.558 -10.556 0.082   1.00 0.00 ? 192 ILE A HG21 3  
ATOM 8573  H HG22 . ILE A 1 140 ? -16.064 -9.737  -0.419  1.00 0.00 ? 192 ILE A HG22 3  
ATOM 8574  H HG23 . ILE A 1 140 ? -17.386 -8.810  0.329   1.00 0.00 ? 192 ILE A HG23 3  
ATOM 8575  H HD11 . ILE A 1 140 ? -16.701 -7.027  -0.593  1.00 0.00 ? 192 ILE A HD11 3  
ATOM 8576  H HD12 . ILE A 1 140 ? -16.979 -6.016  -2.026  1.00 0.00 ? 192 ILE A HD12 3  
ATOM 8577  H HD13 . ILE A 1 140 ? -18.360 -6.763  -1.188  1.00 0.00 ? 192 ILE A HD13 3  
ATOM 8578  N N    . MET A 1 141 ? -17.834 -9.895  -4.906  1.00 0.00 ? 193 MET A N    3  
ATOM 8579  C CA   . MET A 1 141 ? -18.579 -9.803  -6.150  1.00 0.00 ? 193 MET A CA   3  
ATOM 8580  C C    . MET A 1 141 ? -18.638 -11.166 -6.822  1.00 0.00 ? 193 MET A C    3  
ATOM 8581  O O    . MET A 1 141 ? -19.581 -11.457 -7.553  1.00 0.00 ? 193 MET A O    3  
ATOM 8582  C CB   . MET A 1 141 ? -17.939 -8.772  -7.077  1.00 0.00 ? 193 MET A CB   3  
ATOM 8583  C CG   . MET A 1 141 ? -17.942 -7.386  -6.435  1.00 0.00 ? 193 MET A CG   3  
ATOM 8584  S SD   . MET A 1 141 ? -19.595 -6.715  -6.113  1.00 0.00 ? 193 MET A SD   3  
ATOM 8585  C CE   . MET A 1 141 ? -19.120 -5.136  -5.363  1.00 0.00 ? 193 MET A CE   3  
ATOM 8586  H H    . MET A 1 141 ? -16.944 -9.423  -4.832  1.00 0.00 ? 193 MET A H    3  
ATOM 8587  H HA   . MET A 1 141 ? -19.600 -9.500  -5.919  1.00 0.00 ? 193 MET A HA   3  
ATOM 8588  H HB2  . MET A 1 141 ? -16.911 -9.068  -7.290  1.00 0.00 ? 193 MET A HB2  3  
ATOM 8589  H HB3  . MET A 1 141 ? -18.501 -8.735  -8.011  1.00 0.00 ? 193 MET A HB3  3  
ATOM 8590  H HG2  . MET A 1 141 ? -17.400 -7.449  -5.492  1.00 0.00 ? 193 MET A HG2  3  
ATOM 8591  H HG3  . MET A 1 141 ? -17.411 -6.699  -7.093  1.00 0.00 ? 193 MET A HG3  3  
ATOM 8592  H HE1  . MET A 1 141 ? -18.525 -5.322  -4.469  1.00 0.00 ? 193 MET A HE1  3  
ATOM 8593  H HE2  . MET A 1 141 ? -18.534 -4.556  -6.077  1.00 0.00 ? 193 MET A HE2  3  
ATOM 8594  H HE3  . MET A 1 141 ? -20.017 -4.580  -5.094  1.00 0.00 ? 193 MET A HE3  3  
ATOM 8595  N N    . ASP A 1 142 ? -17.634 -12.009 -6.579  1.00 0.00 ? 194 ASP A N    3  
ATOM 8596  C CA   . ASP A 1 142 ? -17.605 -13.346 -7.139  1.00 0.00 ? 194 ASP A CA   3  
ATOM 8597  C C    . ASP A 1 142 ? -18.444 -14.320 -6.311  1.00 0.00 ? 194 ASP A C    3  
ATOM 8598  O O    . ASP A 1 142 ? -18.687 -15.444 -6.751  1.00 0.00 ? 194 ASP A O    3  
ATOM 8599  C CB   . ASP A 1 142 ? -16.146 -13.782 -7.256  1.00 0.00 ? 194 ASP A CB   3  
ATOM 8600  C CG   . ASP A 1 142 ? -16.008 -15.187 -7.840  1.00 0.00 ? 194 ASP A CG   3  
ATOM 8601  O OD1  . ASP A 1 142 ? -16.376 -15.357 -9.024  1.00 0.00 ? 194 ASP A OD1  3  
ATOM 8602  O OD2  . ASP A 1 142 ? -15.537 -16.076 -7.097  1.00 0.00 ? 194 ASP A OD2  3  
ATOM 8603  H H    . ASP A 1 142 ? -16.863 -11.721 -5.992  1.00 0.00 ? 194 ASP A H    3  
ATOM 8604  H HA   . ASP A 1 142 ? -18.046 -13.302 -8.135  1.00 0.00 ? 194 ASP A HA   3  
ATOM 8605  H HB2  . ASP A 1 142 ? -15.623 -13.082 -7.909  1.00 0.00 ? 194 ASP A HB2  3  
ATOM 8606  H HB3  . ASP A 1 142 ? -15.687 -13.738 -6.269  1.00 0.00 ? 194 ASP A HB3  3  
ATOM 8607  N N    . ARG A 1 143 ? -18.894 -13.917 -5.115  1.00 0.00 ? 195 ARG A N    3  
ATOM 8608  C CA   . ARG A 1 143 ? -19.739 -14.769 -4.284  1.00 0.00 ? 195 ARG A CA   3  
ATOM 8609  C C    . ARG A 1 143 ? -21.226 -14.534 -4.527  1.00 0.00 ? 195 ARG A C    3  
ATOM 8610  O O    . ARG A 1 143 ? -22.025 -15.409 -4.197  1.00 0.00 ? 195 ARG A O    3  
ATOM 8611  C CB   . ARG A 1 143 ? -19.399 -14.533 -2.813  1.00 0.00 ? 195 ARG A CB   3  
ATOM 8612  C CG   . ARG A 1 143 ? -18.052 -15.172 -2.486  1.00 0.00 ? 195 ARG A CG   3  
ATOM 8613  C CD   . ARG A 1 143 ? -17.555 -14.694 -1.124  1.00 0.00 ? 195 ARG A CD   3  
ATOM 8614  N NE   . ARG A 1 143 ? -18.461 -15.099 -0.043  1.00 0.00 ? 195 ARG A NE   3  
ATOM 8615  C CZ   . ARG A 1 143 ? -18.491 -14.523 1.163   1.00 0.00 ? 195 ARG A CZ   3  
ATOM 8616  N NH1  . ARG A 1 143 ? -17.671 -13.519 1.461   1.00 0.00 ? 195 ARG A NH1  3  
ATOM 8617  N NH2  . ARG A 1 143 ? -19.351 -14.956 2.080   1.00 0.00 ? 195 ARG A NH2  3  
ATOM 8618  H H    . ARG A 1 143 ? -18.650 -13.004 -4.763  1.00 0.00 ? 195 ARG A H    3  
ATOM 8619  H HA   . ARG A 1 143 ? -19.532 -15.813 -4.522  1.00 0.00 ? 195 ARG A HA   3  
ATOM 8620  H HB2  . ARG A 1 143 ? -19.360 -13.461 -2.616  1.00 0.00 ? 195 ARG A HB2  3  
ATOM 8621  H HB3  . ARG A 1 143 ? -20.168 -14.985 -2.184  1.00 0.00 ? 195 ARG A HB3  3  
ATOM 8622  H HG2  . ARG A 1 143 ? -18.155 -16.257 -2.484  1.00 0.00 ? 195 ARG A HG2  3  
ATOM 8623  H HG3  . ARG A 1 143 ? -17.328 -14.888 -3.250  1.00 0.00 ? 195 ARG A HG3  3  
ATOM 8624  H HD2  . ARG A 1 143 ? -16.568 -15.118 -0.940  1.00 0.00 ? 195 ARG A HD2  3  
ATOM 8625  H HD3  . ARG A 1 143 ? -17.476 -13.607 -1.142  1.00 0.00 ? 195 ARG A HD3  3  
ATOM 8626  H HE   . ARG A 1 143 ? -19.097 -15.861 -0.229  1.00 0.00 ? 195 ARG A HE   3  
ATOM 8627  H HH11 . ARG A 1 143 ? -17.014 -13.180 0.773   1.00 0.00 ? 195 ARG A HH11 3  
ATOM 8628  H HH12 . ARG A 1 143 ? -17.704 -13.093 2.377   1.00 0.00 ? 195 ARG A HH12 3  
ATOM 8629  H HH21 . ARG A 1 143 ? -19.978 -15.718 1.863   1.00 0.00 ? 195 ARG A HH21 3  
ATOM 8630  H HH22 . ARG A 1 143 ? -19.377 -14.526 2.994   1.00 0.00 ? 195 ARG A HH22 3  
ATOM 8631  N N    . LEU A 1 144 ? -21.618 -13.385 -5.090  1.00 0.00 ? 196 LEU A N    3  
ATOM 8632  C CA   . LEU A 1 144 ? -23.030 -13.104 -5.344  1.00 0.00 ? 196 LEU A CA   3  
ATOM 8633  C C    . LEU A 1 144 ? -23.373 -12.741 -6.793  1.00 0.00 ? 196 LEU A C    3  
ATOM 8634  O O    . LEU A 1 144 ? -24.440 -13.129 -7.262  1.00 0.00 ? 196 LEU A O    3  
ATOM 8635  C CB   . LEU A 1 144 ? -23.541 -12.047 -4.357  1.00 0.00 ? 196 LEU A CB   3  
ATOM 8636  C CG   . LEU A 1 144 ? -22.528 -10.960 -3.977  1.00 0.00 ? 196 LEU A CG   3  
ATOM 8637  C CD1  . LEU A 1 144 ? -22.015 -10.161 -5.169  1.00 0.00 ? 196 LEU A CD1  3  
ATOM 8638  C CD2  . LEU A 1 144 ? -23.191 -9.976  -3.020  1.00 0.00 ? 196 LEU A CD2  3  
ATOM 8639  H H    . LEU A 1 144 ? -20.935 -12.683 -5.342  1.00 0.00 ? 196 LEU A H    3  
ATOM 8640  H HA   . LEU A 1 144 ? -23.592 -14.015 -5.137  1.00 0.00 ? 196 LEU A HA   3  
ATOM 8641  H HB2  . LEU A 1 144 ? -24.435 -11.580 -4.769  1.00 0.00 ? 196 LEU A HB2  3  
ATOM 8642  H HB3  . LEU A 1 144 ? -23.824 -12.562 -3.438  1.00 0.00 ? 196 LEU A HB3  3  
ATOM 8643  H HG   . LEU A 1 144 ? -21.677 -11.424 -3.478  1.00 0.00 ? 196 LEU A HG   3  
ATOM 8644  H HD11 . LEU A 1 144 ? -22.855 -9.819  -5.773  1.00 0.00 ? 196 LEU A HD11 3  
ATOM 8645  H HD12 . LEU A 1 144 ? -21.456 -9.297  -4.809  1.00 0.00 ? 196 LEU A HD12 3  
ATOM 8646  H HD13 . LEU A 1 144 ? -21.348 -10.784 -5.765  1.00 0.00 ? 196 LEU A HD13 3  
ATOM 8647  H HD21 . LEU A 1 144 ? -23.548 -10.511 -2.139  1.00 0.00 ? 196 LEU A HD21 3  
ATOM 8648  H HD22 . LEU A 1 144 ? -22.464 -9.221  -2.720  1.00 0.00 ? 196 LEU A HD22 3  
ATOM 8649  H HD23 . LEU A 1 144 ? -24.029 -9.491  -3.522  1.00 0.00 ? 196 LEU A HD23 3  
ATOM 8650  N N    . TYR A 1 145 ? -22.508 -12.014 -7.509  1.00 0.00 ? 197 TYR A N    3  
ATOM 8651  C CA   . TYR A 1 145 ? -22.784 -11.553 -8.864  1.00 0.00 ? 197 TYR A CA   3  
ATOM 8652  C C    . TYR A 1 145 ? -21.497 -11.570 -9.688  1.00 0.00 ? 197 TYR A C    3  
ATOM 8653  O O    . TYR A 1 145 ? -20.980 -10.523 -10.076 1.00 0.00 ? 197 TYR A O    3  
ATOM 8654  C CB   . TYR A 1 145 ? -23.408 -10.152 -8.819  1.00 0.00 ? 197 TYR A CB   3  
ATOM 8655  C CG   . TYR A 1 145 ? -24.749 -10.086 -8.115  1.00 0.00 ? 197 TYR A CG   3  
ATOM 8656  C CD1  . TYR A 1 145 ? -25.787 -10.952 -8.490  1.00 0.00 ? 197 TYR A CD1  3  
ATOM 8657  C CD2  . TYR A 1 145 ? -24.956 -9.158  -7.083  1.00 0.00 ? 197 TYR A CD2  3  
ATOM 8658  C CE1  . TYR A 1 145 ? -27.013 -10.922 -7.812  1.00 0.00 ? 197 TYR A CE1  3  
ATOM 8659  C CE2  . TYR A 1 145 ? -26.180 -9.119  -6.401  1.00 0.00 ? 197 TYR A CE2  3  
ATOM 8660  C CZ   . TYR A 1 145 ? -27.213 -10.007 -6.760  1.00 0.00 ? 197 TYR A CZ   3  
ATOM 8661  O OH   . TYR A 1 145 ? -28.403 -9.982  -6.094  1.00 0.00 ? 197 TYR A OH   3  
ATOM 8662  H H    . TYR A 1 145 ? -21.619 -11.759 -7.103  1.00 0.00 ? 197 TYR A H    3  
ATOM 8663  H HA   . TYR A 1 145 ? -23.492 -12.236 -9.333  1.00 0.00 ? 197 TYR A HA   3  
ATOM 8664  H HB2  . TYR A 1 145 ? -22.715 -9.475  -8.321  1.00 0.00 ? 197 TYR A HB2  3  
ATOM 8665  H HB3  . TYR A 1 145 ? -23.548 -9.802  -9.842  1.00 0.00 ? 197 TYR A HB3  3  
ATOM 8666  H HD1  . TYR A 1 145 ? -25.642 -11.648 -9.304  1.00 0.00 ? 197 TYR A HD1  3  
ATOM 8667  H HD2  . TYR A 1 145 ? -24.173 -8.467  -6.808  1.00 0.00 ? 197 TYR A HD2  3  
ATOM 8668  H HE1  . TYR A 1 145 ? -27.804 -11.601 -8.097  1.00 0.00 ? 197 TYR A HE1  3  
ATOM 8669  H HE2  . TYR A 1 145 ? -26.329 -8.408  -5.601  1.00 0.00 ? 197 TYR A HE2  3  
ATOM 8670  H HH   . TYR A 1 145 ? -28.427 -9.321  -5.398  1.00 0.00 ? 197 TYR A HH   3  
ATOM 8671  N N    . GLY A 1 146 ? -20.982 -12.777 -9.950  1.00 0.00 ? 198 GLY A N    3  
ATOM 8672  C CA   . GLY A 1 146 ? -19.726 -12.982 -10.657 1.00 0.00 ? 198 GLY A CA   3  
ATOM 8673  C C    . GLY A 1 146 ? -19.793 -12.571 -12.127 1.00 0.00 ? 198 GLY A C    3  
ATOM 8674  O O    . GLY A 1 146 ? -20.795 -12.030 -12.590 1.00 0.00 ? 198 GLY A O    3  
ATOM 8675  H H    . GLY A 1 146 ? -21.483 -13.598 -9.642  1.00 0.00 ? 198 GLY A H    3  
ATOM 8676  H HA2  . GLY A 1 146 ? -18.942 -12.403 -10.169 1.00 0.00 ? 198 GLY A HA2  3  
ATOM 8677  H HA3  . GLY A 1 146 ? -19.456 -14.036 -10.600 1.00 0.00 ? 198 GLY A HA3  3  
ATOM 8678  N N    . GLY A 1 147 ? -18.709 -12.837 -12.862 1.00 0.00 ? 199 GLY A N    3  
ATOM 8679  C CA   . GLY A 1 147 ? -18.589 -12.446 -14.260 1.00 0.00 ? 199 GLY A CA   3  
ATOM 8680  C C    . GLY A 1 147 ? -17.661 -11.244 -14.427 1.00 0.00 ? 199 GLY A C    3  
ATOM 8681  O O    . GLY A 1 147 ? -17.684 -10.589 -15.468 1.00 0.00 ? 199 GLY A O    3  
ATOM 8682  H H    . GLY A 1 147 ? -17.932 -13.327 -12.441 1.00 0.00 ? 199 GLY A H    3  
ATOM 8683  H HA2  . GLY A 1 147 ? -18.181 -13.285 -14.823 1.00 0.00 ? 199 GLY A HA2  3  
ATOM 8684  H HA3  . GLY A 1 147 ? -19.572 -12.198 -14.659 1.00 0.00 ? 199 GLY A HA3  3  
ATOM 8685  N N    . VAL A 1 148 ? -16.847 -10.954 -13.404 1.00 0.00 ? 200 VAL A N    3  
ATOM 8686  C CA   . VAL A 1 148 ? -15.923 -9.826  -13.412 1.00 0.00 ? 200 VAL A CA   3  
ATOM 8687  C C    . VAL A 1 148 ? -14.913 -9.940  -14.555 1.00 0.00 ? 200 VAL A C    3  
ATOM 8688  O O    . VAL A 1 148 ? -14.604 -11.044 -15.003 1.00 0.00 ? 200 VAL A O    3  
ATOM 8689  C CB   . VAL A 1 148 ? -15.222 -9.724  -12.050 1.00 0.00 ? 200 VAL A CB   3  
ATOM 8690  C CG1  . VAL A 1 148 ? -14.284 -10.907 -11.811 1.00 0.00 ? 200 VAL A CG1  3  
ATOM 8691  C CG2  . VAL A 1 148 ? -14.420 -8.427  -11.942 1.00 0.00 ? 200 VAL A CG2  3  
ATOM 8692  H H    . VAL A 1 148 ? -16.867 -11.539 -12.582 1.00 0.00 ? 200 VAL A H    3  
ATOM 8693  H HA   . VAL A 1 148 ? -16.507 -8.915  -13.550 1.00 0.00 ? 200 VAL A HA   3  
ATOM 8694  H HB   . VAL A 1 148 ? -15.982 -9.723  -11.269 1.00 0.00 ? 200 VAL A HB   3  
ATOM 8695  H HG11 . VAL A 1 148 ? -13.492 -10.907 -12.559 1.00 0.00 ? 200 VAL A HG11 3  
ATOM 8696  H HG12 . VAL A 1 148 ? -13.841 -10.823 -10.818 1.00 0.00 ? 200 VAL A HG12 3  
ATOM 8697  H HG13 . VAL A 1 148 ? -14.843 -11.841 -11.875 1.00 0.00 ? 200 VAL A HG13 3  
ATOM 8698  H HG21 . VAL A 1 148 ? -15.063 -7.580  -12.178 1.00 0.00 ? 200 VAL A HG21 3  
ATOM 8699  H HG22 . VAL A 1 148 ? -14.040 -8.323  -10.926 1.00 0.00 ? 200 VAL A HG22 3  
ATOM 8700  H HG23 . VAL A 1 148 ? -13.576 -8.450  -12.633 1.00 0.00 ? 200 VAL A HG23 3  
ATOM 8701  N N    . CYS A 1 149 ? -14.398 -8.798  -15.028 1.00 0.00 ? 201 CYS A N    3  
ATOM 8702  C CA   . CYS A 1 149 ? -13.371 -8.780  -16.060 1.00 0.00 ? 201 CYS A CA   3  
ATOM 8703  C C    . CYS A 1 149 ? -12.102 -8.105  -15.539 1.00 0.00 ? 201 CYS A C    3  
ATOM 8704  O O    . CYS A 1 149 ? -10.999 -8.536  -15.869 1.00 0.00 ? 201 CYS A O    3  
ATOM 8705  C CB   . CYS A 1 149 ? -13.910 -8.063  -17.299 1.00 0.00 ? 201 CYS A CB   3  
ATOM 8706  S SG   . CYS A 1 149 ? -15.377 -8.932  -17.913 1.00 0.00 ? 201 CYS A SG   3  
ATOM 8707  H H    . CYS A 1 149 ? -14.721 -7.913  -14.666 1.00 0.00 ? 201 CYS A H    3  
ATOM 8708  H HA   . CYS A 1 149 ? -13.118 -9.803  -16.339 1.00 0.00 ? 201 CYS A HA   3  
ATOM 8709  H HB2  . CYS A 1 149 ? -14.175 -7.036  -17.045 1.00 0.00 ? 201 CYS A HB2  3  
ATOM 8710  H HB3  . CYS A 1 149 ? -13.142 -8.049  -18.072 1.00 0.00 ? 201 CYS A HB3  3  
ATOM 8711  H HG   . CYS A 1 149 ? -16.089 -8.834  -16.787 1.00 0.00 ? 201 CYS A HG   3  
ATOM 8712  N N    . TYR A 1 150 ? -12.256 -7.052  -14.729 1.00 0.00 ? 202 TYR A N    3  
ATOM 8713  C CA   . TYR A 1 150 ? -11.133 -6.411  -14.059 1.00 0.00 ? 202 TYR A CA   3  
ATOM 8714  C C    . TYR A 1 150 ? -11.586 -5.810  -12.731 1.00 0.00 ? 202 TYR A C    3  
ATOM 8715  O O    . TYR A 1 150 ? -12.740 -5.411  -12.596 1.00 0.00 ? 202 TYR A O    3  
ATOM 8716  C CB   . TYR A 1 150 ? -10.553 -5.314  -14.952 1.00 0.00 ? 202 TYR A CB   3  
ATOM 8717  C CG   . TYR A 1 150 ? -9.577  -4.419  -14.223 1.00 0.00 ? 202 TYR A CG   3  
ATOM 8718  C CD1  . TYR A 1 150 ? -8.304  -4.898  -13.886 1.00 0.00 ? 202 TYR A CD1  3  
ATOM 8719  C CD2  . TYR A 1 150 ? -9.950  -3.111  -13.880 1.00 0.00 ? 202 TYR A CD2  3  
ATOM 8720  C CE1  . TYR A 1 150 ? -7.399  -4.073  -13.202 1.00 0.00 ? 202 TYR A CE1  3  
ATOM 8721  C CE2  . TYR A 1 150 ? -9.052  -2.281  -13.193 1.00 0.00 ? 202 TYR A CE2  3  
ATOM 8722  C CZ   . TYR A 1 150 ? -7.771  -2.761  -12.851 1.00 0.00 ? 202 TYR A CZ   3  
ATOM 8723  O OH   . TYR A 1 150 ? -6.896  -1.959  -12.181 1.00 0.00 ? 202 TYR A OH   3  
ATOM 8724  H H    . TYR A 1 150 ? -13.178 -6.673  -14.567 1.00 0.00 ? 202 TYR A H    3  
ATOM 8725  H HA   . TYR A 1 150 ? -10.359 -7.152  -13.861 1.00 0.00 ? 202 TYR A HA   3  
ATOM 8726  H HB2  . TYR A 1 150 ? -10.054 -5.775  -15.803 1.00 0.00 ? 202 TYR A HB2  3  
ATOM 8727  H HB3  . TYR A 1 150 ? -11.373 -4.700  -15.326 1.00 0.00 ? 202 TYR A HB3  3  
ATOM 8728  H HD1  . TYR A 1 150 ? -8.019  -5.905  -14.152 1.00 0.00 ? 202 TYR A HD1  3  
ATOM 8729  H HD2  . TYR A 1 150 ? -10.930 -2.741  -14.143 1.00 0.00 ? 202 TYR A HD2  3  
ATOM 8730  H HE1  . TYR A 1 150 ? -6.418  -4.443  -12.944 1.00 0.00 ? 202 TYR A HE1  3  
ATOM 8731  H HE2  . TYR A 1 150 ? -9.342  -1.274  -12.929 1.00 0.00 ? 202 TYR A HE2  3  
ATOM 8732  H HH   . TYR A 1 150 ? -7.250  -1.086  -11.998 1.00 0.00 ? 202 TYR A HH   3  
ATOM 8733  N N    . ALA A 1 151 ? -10.679 -5.744  -11.752 1.00 0.00 ? 203 ALA A N    3  
ATOM 8734  C CA   . ALA A 1 151 ? -10.957 -5.131  -10.462 1.00 0.00 ? 203 ALA A CA   3  
ATOM 8735  C C    . ALA A 1 151 ? -9.671  -4.655  -9.784  1.00 0.00 ? 203 ALA A C    3  
ATOM 8736  O O    . ALA A 1 151 ? -8.593  -5.194  -10.033 1.00 0.00 ? 203 ALA A O    3  
ATOM 8737  C CB   . ALA A 1 151 ? -11.666 -6.147  -9.568  1.00 0.00 ? 203 ALA A CB   3  
ATOM 8738  H H    . ALA A 1 151 ? -9.758  -6.129  -11.901 1.00 0.00 ? 203 ALA A H    3  
ATOM 8739  H HA   . ALA A 1 151 ? -11.610 -4.271  -10.605 1.00 0.00 ? 203 ALA A HA   3  
ATOM 8740  H HB1  . ALA A 1 151 ? -11.008 -6.996  -9.384  1.00 0.00 ? 203 ALA A HB1  3  
ATOM 8741  H HB2  . ALA A 1 151 ? -11.923 -5.674  -8.620  1.00 0.00 ? 203 ALA A HB2  3  
ATOM 8742  H HB3  . ALA A 1 151 ? -12.577 -6.496  -10.055 1.00 0.00 ? 203 ALA A HB3  3  
ATOM 8743  N N    . GLY A 1 152 ? -9.792  -3.640  -8.923  1.00 0.00 ? 204 GLY A N    3  
ATOM 8744  C CA   . GLY A 1 152 ? -8.674  -3.153  -8.127  1.00 0.00 ? 204 GLY A CA   3  
ATOM 8745  C C    . GLY A 1 152 ? -9.162  -2.170  -7.065  1.00 0.00 ? 204 GLY A C    3  
ATOM 8746  O O    . GLY A 1 152 ? -10.333 -1.789  -7.073  1.00 0.00 ? 204 GLY A O    3  
ATOM 8747  H H    . GLY A 1 152 ? -10.685 -3.183  -8.811  1.00 0.00 ? 204 GLY A H    3  
ATOM 8748  H HA2  . GLY A 1 152 ? -8.190  -3.995  -7.634  1.00 0.00 ? 204 GLY A HA2  3  
ATOM 8749  H HA3  . GLY A 1 152 ? -7.949  -2.657  -8.773  1.00 0.00 ? 204 GLY A HA3  3  
ATOM 8750  N N    . ILE A 1 153 ? -8.282  -1.752  -6.150  1.00 0.00 ? 205 ILE A N    3  
ATOM 8751  C CA   . ILE A 1 153 ? -8.679  -0.853  -5.072  1.00 0.00 ? 205 ILE A CA   3  
ATOM 8752  C C    . ILE A 1 153 ? -7.805  0.394   -4.960  1.00 0.00 ? 205 ILE A C    3  
ATOM 8753  O O    . ILE A 1 153 ? -6.582  0.326   -5.036  1.00 0.00 ? 205 ILE A O    3  
ATOM 8754  C CB   . ILE A 1 153 ? -8.803  -1.589  -3.728  1.00 0.00 ? 205 ILE A CB   3  
ATOM 8755  C CG1  . ILE A 1 153 ? -7.742  -2.664  -3.474  1.00 0.00 ? 205 ILE A CG1  3  
ATOM 8756  C CG2  . ILE A 1 153 ? -10.161 -2.287  -3.672  1.00 0.00 ? 205 ILE A CG2  3  
ATOM 8757  C CD1  . ILE A 1 153 ? -6.316  -2.124  -3.423  1.00 0.00 ? 205 ILE A CD1  3  
ATOM 8758  H H    . ILE A 1 153 ? -7.321  -2.059  -6.191  1.00 0.00 ? 205 ILE A H    3  
ATOM 8759  H HA   . ILE A 1 153 ? -9.679  -0.489  -5.310  1.00 0.00 ? 205 ILE A HA   3  
ATOM 8760  H HB   . ILE A 1 153 ? -8.766  -0.857  -2.922  1.00 0.00 ? 205 ILE A HB   3  
ATOM 8761  H HG12 . ILE A 1 153 ? -7.961  -3.139  -2.517  1.00 0.00 ? 205 ILE A HG12 3  
ATOM 8762  H HG13 . ILE A 1 153 ? -7.804  -3.424  -4.253  1.00 0.00 ? 205 ILE A HG13 3  
ATOM 8763  H HG21 . ILE A 1 153 ? -10.957 -1.554  -3.802  1.00 0.00 ? 205 ILE A HG21 3  
ATOM 8764  H HG22 . ILE A 1 153 ? -10.221 -3.034  -4.463  1.00 0.00 ? 205 ILE A HG22 3  
ATOM 8765  H HG23 . ILE A 1 153 ? -10.283 -2.774  -2.704  1.00 0.00 ? 205 ILE A HG23 3  
ATOM 8766  H HD11 . ILE A 1 153 ? -6.271  -1.262  -2.757  1.00 0.00 ? 205 ILE A HD11 3  
ATOM 8767  H HD12 . ILE A 1 153 ? -5.652  -2.904  -3.050  1.00 0.00 ? 205 ILE A HD12 3  
ATOM 8768  H HD13 . ILE A 1 153 ? -5.994  -1.841  -4.424  1.00 0.00 ? 205 ILE A HD13 3  
ATOM 8769  N N    . ASP A 1 154 ? -8.495  1.527   -4.778  1.00 0.00 ? 206 ASP A N    3  
ATOM 8770  C CA   . ASP A 1 154 ? -7.893  2.845   -4.587  1.00 0.00 ? 206 ASP A CA   3  
ATOM 8771  C C    . ASP A 1 154 ? -6.773  3.260   -5.551  1.00 0.00 ? 206 ASP A C    3  
ATOM 8772  O O    . ASP A 1 154 ? -6.259  4.368   -5.410  1.00 0.00 ? 206 ASP A O    3  
ATOM 8773  C CB   . ASP A 1 154 ? -7.418  2.977   -3.134  1.00 0.00 ? 206 ASP A CB   3  
ATOM 8774  C CG   . ASP A 1 154 ? -8.546  2.890   -2.105  1.00 0.00 ? 206 ASP A CG   3  
ATOM 8775  O OD1  . ASP A 1 154 ? -9.551  2.199   -2.376  1.00 0.00 ? 206 ASP A OD1  3  
ATOM 8776  O OD2  . ASP A 1 154 ? -8.384  3.530   -1.042  1.00 0.00 ? 206 ASP A OD2  3  
ATOM 8777  H H    . ASP A 1 154 ? -9.503  1.480   -4.746  1.00 0.00 ? 206 ASP A H    3  
ATOM 8778  H HA   . ASP A 1 154 ? -8.687  3.578   -4.722  1.00 0.00 ? 206 ASP A HA   3  
ATOM 8779  H HB2  . ASP A 1 154 ? -6.685  2.197   -2.926  1.00 0.00 ? 206 ASP A HB2  3  
ATOM 8780  H HB3  . ASP A 1 154 ? -6.935  3.947   -3.018  1.00 0.00 ? 206 ASP A HB3  3  
ATOM 8781  N N    . THR A 1 155 ? -6.370  2.434   -6.518  1.00 0.00 ? 207 THR A N    3  
ATOM 8782  C CA   . THR A 1 155 ? -5.168  2.708   -7.293  1.00 0.00 ? 207 THR A CA   3  
ATOM 8783  C C    . THR A 1 155 ? -5.257  3.940   -8.177  1.00 0.00 ? 207 THR A C    3  
ATOM 8784  O O    . THR A 1 155 ? -6.337  4.399   -8.547  1.00 0.00 ? 207 THR A O    3  
ATOM 8785  C CB   . THR A 1 155 ? -4.751  1.495   -8.122  1.00 0.00 ? 207 THR A CB   3  
ATOM 8786  O OG1  . THR A 1 155 ? -5.865  0.691   -8.446  1.00 0.00 ? 207 THR A OG1  3  
ATOM 8787  C CG2  . THR A 1 155 ? -3.733  0.703   -7.312  1.00 0.00 ? 207 THR A CG2  3  
ATOM 8788  H H    . THR A 1 155 ? -6.888  1.591   -6.721  1.00 0.00 ? 207 THR A H    3  
ATOM 8789  H HA   . THR A 1 155 ? -4.368  2.904   -6.581  1.00 0.00 ? 207 THR A HA   3  
ATOM 8790  H HB   . THR A 1 155 ? -4.271  1.839   -9.038  1.00 0.00 ? 207 THR A HB   3  
ATOM 8791  H HG1  . THR A 1 155 ? -5.563  -0.037  -8.994  1.00 0.00 ? 207 THR A HG1  3  
ATOM 8792  H HG21 . THR A 1 155 ? -4.194  0.348   -6.390  1.00 0.00 ? 207 THR A HG21 3  
ATOM 8793  H HG22 . THR A 1 155 ? -3.373  -0.142  -7.899  1.00 0.00 ? 207 THR A HG22 3  
ATOM 8794  H HG23 . THR A 1 155 ? -2.900  1.360   -7.066  1.00 0.00 ? 207 THR A HG23 3  
ATOM 8795  N N    . ASP A 1 156 ? -4.073  4.462   -8.503  1.00 0.00 ? 208 ASP A N    3  
ATOM 8796  C CA   . ASP A 1 156 ? -3.891  5.673   -9.278  1.00 0.00 ? 208 ASP A CA   3  
ATOM 8797  C C    . ASP A 1 156 ? -2.648  5.553   -10.143 1.00 0.00 ? 208 ASP A C    3  
ATOM 8798  O O    . ASP A 1 156 ? -1.641  5.046   -9.653  1.00 0.00 ? 208 ASP A O    3  
ATOM 8799  C CB   . ASP A 1 156 ? -3.661  6.801   -8.291  1.00 0.00 ? 208 ASP A CB   3  
ATOM 8800  C CG   . ASP A 1 156 ? -3.876  8.162   -8.946  1.00 0.00 ? 208 ASP A CG   3  
ATOM 8801  O OD1  . ASP A 1 156 ? -5.052  8.577   -9.048  1.00 0.00 ? 208 ASP A OD1  3  
ATOM 8802  O OD2  . ASP A 1 156 ? -2.859  8.771   -9.340  1.00 0.00 ? 208 ASP A OD2  3  
ATOM 8803  H H    . ASP A 1 156 ? -3.233  3.995   -8.191  1.00 0.00 ? 208 ASP A H    3  
ATOM 8804  H HA   . ASP A 1 156 ? -4.779  5.868   -9.880  1.00 0.00 ? 208 ASP A HA   3  
ATOM 8805  H HB2  . ASP A 1 156 ? -4.347  6.657   -7.456  1.00 0.00 ? 208 ASP A HB2  3  
ATOM 8806  H HB3  . ASP A 1 156 ? -2.647  6.724   -7.899  1.00 0.00 ? 208 ASP A HB3  3  
ATOM 8807  N N    . PRO A 1 157 ? -2.701  6.006   -11.403 1.00 0.00 ? 209 PRO A N    3  
ATOM 8808  C CA   . PRO A 1 157 ? -1.635  5.839   -12.377 1.00 0.00 ? 209 PRO A CA   3  
ATOM 8809  C C    . PRO A 1 157 ? -0.428  6.734   -12.091 1.00 0.00 ? 209 PRO A C    3  
ATOM 8810  O O    . PRO A 1 157 ? 0.570   6.655   -12.806 1.00 0.00 ? 209 PRO A O    3  
ATOM 8811  C CB   . PRO A 1 157 ? -2.277  6.193   -13.718 1.00 0.00 ? 209 PRO A CB   3  
ATOM 8812  C CG   . PRO A 1 157 ? -3.324  7.234   -13.331 1.00 0.00 ? 209 PRO A CG   3  
ATOM 8813  C CD   . PRO A 1 157 ? -3.823  6.720   -11.983 1.00 0.00 ? 209 PRO A CD   3  
ATOM 8814  H HA   . PRO A 1 157 ? -1.307  4.800   -12.392 1.00 0.00 ? 209 PRO A HA   3  
ATOM 8815  H HB2  . PRO A 1 157 ? -1.552  6.591   -14.428 1.00 0.00 ? 209 PRO A HB2  3  
ATOM 8816  H HB3  . PRO A 1 157 ? -2.775  5.312   -14.123 1.00 0.00 ? 209 PRO A HB3  3  
ATOM 8817  H HG2  . PRO A 1 157 ? -2.844  8.203   -13.195 1.00 0.00 ? 209 PRO A HG2  3  
ATOM 8818  H HG3  . PRO A 1 157 ? -4.129  7.295   -14.063 1.00 0.00 ? 209 PRO A HG3  3  
ATOM 8819  H HD2  . PRO A 1 157 ? -4.128  7.552   -11.350 1.00 0.00 ? 209 PRO A HD2  3  
ATOM 8820  H HD3  . PRO A 1 157 ? -4.652  6.026   -12.134 1.00 0.00 ? 209 PRO A HD3  3  
ATOM 8821  N N    . GLU A 1 158 ? -0.495  7.582   -11.059 1.00 0.00 ? 210 GLU A N    3  
ATOM 8822  C CA   . GLU A 1 158 ? 0.625   8.438   -10.694 1.00 0.00 ? 210 GLU A CA   3  
ATOM 8823  C C    . GLU A 1 158 ? 1.826   7.586   -10.304 1.00 0.00 ? 210 GLU A C    3  
ATOM 8824  O O    . GLU A 1 158 ? 2.942   7.823   -10.764 1.00 0.00 ? 210 GLU A O    3  
ATOM 8825  C CB   . GLU A 1 158 ? 0.206   9.318   -9.518  1.00 0.00 ? 210 GLU A CB   3  
ATOM 8826  C CG   . GLU A 1 158 ? 1.336   10.263  -9.105  1.00 0.00 ? 210 GLU A CG   3  
ATOM 8827  C CD   . GLU A 1 158 ? 0.862   11.248  -8.041  1.00 0.00 ? 210 GLU A CD   3  
ATOM 8828  O OE1  . GLU A 1 158 ? 0.811   10.842  -6.859  1.00 0.00 ? 210 GLU A OE1  3  
ATOM 8829  O OE2  . GLU A 1 158 ? 0.554   12.402  -8.416  1.00 0.00 ? 210 GLU A OE2  3  
ATOM 8830  H H    . GLU A 1 158 ? -1.339  7.640   -10.505 1.00 0.00 ? 210 GLU A H    3  
ATOM 8831  H HA   . GLU A 1 158 ? 0.891   9.071   -11.541 1.00 0.00 ? 210 GLU A HA   3  
ATOM 8832  H HB2  . GLU A 1 158 ? -0.667  9.897   -9.816  1.00 0.00 ? 210 GLU A HB2  3  
ATOM 8833  H HB3  . GLU A 1 158 ? -0.064  8.689   -8.669  1.00 0.00 ? 210 GLU A HB3  3  
ATOM 8834  H HG2  . GLU A 1 158 ? 2.170   9.681   -8.711  1.00 0.00 ? 210 GLU A HG2  3  
ATOM 8835  H HG3  . GLU A 1 158 ? 1.685   10.814  -9.979  1.00 0.00 ? 210 GLU A HG3  3  
ATOM 8836  N N    . LEU A 1 159 ? 1.580   6.590   -9.449  1.00 0.00 ? 211 LEU A N    3  
ATOM 8837  C CA   . LEU A 1 159 ? 2.592   5.632   -9.045  1.00 0.00 ? 211 LEU A CA   3  
ATOM 8838  C C    . LEU A 1 159 ? 1.954   4.314   -8.606  1.00 0.00 ? 211 LEU A C    3  
ATOM 8839  O O    . LEU A 1 159 ? 2.601   3.508   -7.940  1.00 0.00 ? 211 LEU A O    3  
ATOM 8840  C CB   . LEU A 1 159 ? 3.522   6.229   -7.980  1.00 0.00 ? 211 LEU A CB   3  
ATOM 8841  C CG   . LEU A 1 159 ? 2.919   6.399   -6.580  1.00 0.00 ? 211 LEU A CG   3  
ATOM 8842  C CD1  . LEU A 1 159 ? 3.970   7.061   -5.693  1.00 0.00 ? 211 LEU A CD1  3  
ATOM 8843  C CD2  . LEU A 1 159 ? 1.673   7.280   -6.563  1.00 0.00 ? 211 LEU A CD2  3  
ATOM 8844  H H    . LEU A 1 159 ? 0.652   6.491   -9.065  1.00 0.00 ? 211 LEU A H    3  
ATOM 8845  H HA   . LEU A 1 159 ? 3.197   5.416   -9.925  1.00 0.00 ? 211 LEU A HA   3  
ATOM 8846  H HB2  . LEU A 1 159 ? 4.393   5.581   -7.890  1.00 0.00 ? 211 LEU A HB2  3  
ATOM 8847  H HB3  . LEU A 1 159 ? 3.868   7.202   -8.330  1.00 0.00 ? 211 LEU A HB3  3  
ATOM 8848  H HG   . LEU A 1 159 ? 2.677   5.418   -6.170  1.00 0.00 ? 211 LEU A HG   3  
ATOM 8849  H HD11 . LEU A 1 159 ? 4.209   8.048   -6.087  1.00 0.00 ? 211 LEU A HD11 3  
ATOM 8850  H HD12 . LEU A 1 159 ? 3.578   7.161   -4.680  1.00 0.00 ? 211 LEU A HD12 3  
ATOM 8851  H HD13 . LEU A 1 159 ? 4.872   6.448   -5.670  1.00 0.00 ? 211 LEU A HD13 3  
ATOM 8852  H HD21 . LEU A 1 159 ? 0.851   6.777   -7.073  1.00 0.00 ? 211 LEU A HD21 3  
ATOM 8853  H HD22 . LEU A 1 159 ? 1.381   7.475   -5.532  1.00 0.00 ? 211 LEU A HD22 3  
ATOM 8854  H HD23 . LEU A 1 159 ? 1.889   8.228   -7.055  1.00 0.00 ? 211 LEU A HD23 3  
ATOM 8855  N N    . LYS A 1 160 ? 0.685   4.095   -8.983  1.00 0.00 ? 212 LYS A N    3  
ATOM 8856  C CA   . LYS A 1 160 ? -0.029  2.848   -8.714  1.00 0.00 ? 212 LYS A CA   3  
ATOM 8857  C C    . LYS A 1 160 ? -0.251  2.692   -7.219  1.00 0.00 ? 212 LYS A C    3  
ATOM 8858  O O    . LYS A 1 160 ? -0.055  1.619   -6.654  1.00 0.00 ? 212 LYS A O    3  
ATOM 8859  C CB   . LYS A 1 160 ? 0.659   1.643   -9.368  1.00 0.00 ? 212 LYS A CB   3  
ATOM 8860  C CG   . LYS A 1 160 ? 0.746   1.817   -10.887 1.00 0.00 ? 212 LYS A CG   3  
ATOM 8861  C CD   . LYS A 1 160 ? 1.428   0.613   -11.539 1.00 0.00 ? 212 LYS A CD   3  
ATOM 8862  C CE   . LYS A 1 160 ? 0.622   -0.666  -11.297 1.00 0.00 ? 212 LYS A CE   3  
ATOM 8863  N NZ   . LYS A 1 160 ? 1.279   -1.836  -11.909 1.00 0.00 ? 212 LYS A NZ   3  
ATOM 8864  H H    . LYS A 1 160 ? 0.173   4.820   -9.466  1.00 0.00 ? 212 LYS A H    3  
ATOM 8865  H HA   . LYS A 1 160 ? -1.017  2.929   -9.167  1.00 0.00 ? 212 LYS A HA   3  
ATOM 8866  H HB2  . LYS A 1 160 ? 1.662   1.522   -8.960  1.00 0.00 ? 212 LYS A HB2  3  
ATOM 8867  H HB3  . LYS A 1 160 ? 0.078   0.749   -9.143  1.00 0.00 ? 212 LYS A HB3  3  
ATOM 8868  H HG2  . LYS A 1 160 ? -0.258  1.927   -11.295 1.00 0.00 ? 212 LYS A HG2  3  
ATOM 8869  H HG3  . LYS A 1 160 ? 1.322   2.713   -11.117 1.00 0.00 ? 212 LYS A HG3  3  
ATOM 8870  H HD2  . LYS A 1 160 ? 1.510   0.786   -12.612 1.00 0.00 ? 212 LYS A HD2  3  
ATOM 8871  H HD3  . LYS A 1 160 ? 2.428   0.497   -11.120 1.00 0.00 ? 212 LYS A HD3  3  
ATOM 8872  H HE2  . LYS A 1 160 ? 0.526   -0.829  -10.224 1.00 0.00 ? 212 LYS A HE2  3  
ATOM 8873  H HE3  . LYS A 1 160 ? -0.373  -0.543  -11.723 1.00 0.00 ? 212 LYS A HE3  3  
ATOM 8874  H HZ1  . LYS A 1 160 ? 2.198   -1.964  -11.511 1.00 0.00 ? 212 LYS A HZ1  3  
ATOM 8875  H HZ2  . LYS A 1 160 ? 0.729   -2.664  -11.728 1.00 0.00 ? 212 LYS A HZ2  3  
ATOM 8876  H HZ3  . LYS A 1 160 ? 1.364   -1.704  -12.906 1.00 0.00 ? 212 LYS A HZ3  3  
ATOM 8877  N N    . TYR A 1 161 ? -0.665  3.792   -6.587  1.00 0.00 ? 213 TYR A N    3  
ATOM 8878  C CA   . TYR A 1 161 ? -0.798  3.845   -5.136  1.00 0.00 ? 213 TYR A CA   3  
ATOM 8879  C C    . TYR A 1 161 ? -2.213  4.258   -4.728  1.00 0.00 ? 213 TYR A C    3  
ATOM 8880  O O    . TYR A 1 161 ? -2.840  5.049   -5.429  1.00 0.00 ? 213 TYR A O    3  
ATOM 8881  C CB   . TYR A 1 161 ? 0.250   4.808   -4.578  1.00 0.00 ? 213 TYR A CB   3  
ATOM 8882  C CG   . TYR A 1 161 ? 0.301   4.884   -3.070  1.00 0.00 ? 213 TYR A CG   3  
ATOM 8883  C CD1  . TYR A 1 161 ? 1.120   3.999   -2.353  1.00 0.00 ? 213 TYR A CD1  3  
ATOM 8884  C CD2  . TYR A 1 161 ? -0.469  5.837   -2.388  1.00 0.00 ? 213 TYR A CD2  3  
ATOM 8885  C CE1  . TYR A 1 161 ? 1.172   4.064   -0.953  1.00 0.00 ? 213 TYR A CE1  3  
ATOM 8886  C CE2  . TYR A 1 161 ? -0.424  5.906   -0.988  1.00 0.00 ? 213 TYR A CE2  3  
ATOM 8887  C CZ   . TYR A 1 161 ? 0.398   5.020   -0.264  1.00 0.00 ? 213 TYR A CZ   3  
ATOM 8888  O OH   . TYR A 1 161 ? 0.442   5.088   1.097   1.00 0.00 ? 213 TYR A OH   3  
ATOM 8889  H H    . TYR A 1 161 ? -0.890  4.609   -7.137  1.00 0.00 ? 213 TYR A H    3  
ATOM 8890  H HA   . TYR A 1 161 ? -0.587  2.853   -4.737  1.00 0.00 ? 213 TYR A HA   3  
ATOM 8891  H HB2  . TYR A 1 161 ? 1.229   4.489   -4.936  1.00 0.00 ? 213 TYR A HB2  3  
ATOM 8892  H HB3  . TYR A 1 161 ? 0.047   5.805   -4.970  1.00 0.00 ? 213 TYR A HB3  3  
ATOM 8893  H HD1  . TYR A 1 161 ? 1.713   3.265   -2.878  1.00 0.00 ? 213 TYR A HD1  3  
ATOM 8894  H HD2  . TYR A 1 161 ? -1.099  6.519   -2.941  1.00 0.00 ? 213 TYR A HD2  3  
ATOM 8895  H HE1  . TYR A 1 161 ? 1.804   3.383   -0.404  1.00 0.00 ? 213 TYR A HE1  3  
ATOM 8896  H HE2  . TYR A 1 161 ? -1.021  6.636   -0.463  1.00 0.00 ? 213 TYR A HE2  3  
ATOM 8897  H HH   . TYR A 1 161 ? 1.030   4.435   1.484   1.00 0.00 ? 213 TYR A HH   3  
ATOM 8898  N N    . PRO A 1 162 ? -2.726  3.734   -3.604  1.00 0.00 ? 214 PRO A N    3  
ATOM 8899  C CA   . PRO A 1 162 ? -4.036  4.068   -3.072  1.00 0.00 ? 214 PRO A CA   3  
ATOM 8900  C C    . PRO A 1 162 ? -4.254  5.568   -2.880  1.00 0.00 ? 214 PRO A C    3  
ATOM 8901  O O    . PRO A 1 162 ? -3.628  6.191   -2.023  1.00 0.00 ? 214 PRO A O    3  
ATOM 8902  C CB   . PRO A 1 162 ? -4.126  3.329   -1.734  1.00 0.00 ? 214 PRO A CB   3  
ATOM 8903  C CG   . PRO A 1 162 ? -3.214  2.128   -1.948  1.00 0.00 ? 214 PRO A CG   3  
ATOM 8904  C CD   . PRO A 1 162 ? -2.081  2.746   -2.757  1.00 0.00 ? 214 PRO A CD   3  
ATOM 8905  H HA   . PRO A 1 162 ? -4.791  3.667   -3.748  1.00 0.00 ? 214 PRO A HA   3  
ATOM 8906  H HB2  . PRO A 1 162 ? -3.714  3.945   -0.935  1.00 0.00 ? 214 PRO A HB2  3  
ATOM 8907  H HB3  . PRO A 1 162 ? -5.147  3.026   -1.503  1.00 0.00 ? 214 PRO A HB3  3  
ATOM 8908  H HG2  . PRO A 1 162 ? -2.861  1.707   -1.007  1.00 0.00 ? 214 PRO A HG2  3  
ATOM 8909  H HG3  . PRO A 1 162 ? -3.733  1.381   -2.549  1.00 0.00 ? 214 PRO A HG3  3  
ATOM 8910  H HD2  . PRO A 1 162 ? -1.379  3.238   -2.084  1.00 0.00 ? 214 PRO A HD2  3  
ATOM 8911  H HD3  . PRO A 1 162 ? -1.581  1.974   -3.343  1.00 0.00 ? 214 PRO A HD3  3  
ATOM 8912  N N    . LYS A 1 163 ? -5.150  6.147   -3.685  1.00 0.00 ? 215 LYS A N    3  
ATOM 8913  C CA   . LYS A 1 163 ? -5.588  7.531   -3.549  1.00 0.00 ? 215 LYS A CA   3  
ATOM 8914  C C    . LYS A 1 163 ? -6.989  7.584   -2.932  1.00 0.00 ? 215 LYS A C    3  
ATOM 8915  O O    . LYS A 1 163 ? -7.360  8.596   -2.340  1.00 0.00 ? 215 LYS A O    3  
ATOM 8916  C CB   . LYS A 1 163 ? -5.595  8.192   -4.929  1.00 0.00 ? 215 LYS A CB   3  
ATOM 8917  C CG   . LYS A 1 163 ? -4.199  8.382   -5.523  1.00 0.00 ? 215 LYS A CG   3  
ATOM 8918  C CD   . LYS A 1 163 ? -3.342  9.390   -4.764  1.00 0.00 ? 215 LYS A CD   3  
ATOM 8919  C CE   . LYS A 1 163 ? -2.071  9.606   -5.586  1.00 0.00 ? 215 LYS A CE   3  
ATOM 8920  N NZ   . LYS A 1 163 ? -1.216  10.650  -4.993  1.00 0.00 ? 215 LYS A NZ   3  
ATOM 8921  H H    . LYS A 1 163 ? -5.553  5.598   -4.432  1.00 0.00 ? 215 LYS A H    3  
ATOM 8922  H HA   . LYS A 1 163 ? -4.905  8.071   -2.895  1.00 0.00 ? 215 LYS A HA   3  
ATOM 8923  H HB2  . LYS A 1 163 ? -6.173  7.567   -5.611  1.00 0.00 ? 215 LYS A HB2  3  
ATOM 8924  H HB3  . LYS A 1 163 ? -6.079  9.165   -4.856  1.00 0.00 ? 215 LYS A HB3  3  
ATOM 8925  H HG2  . LYS A 1 163 ? -3.675  7.428   -5.562  1.00 0.00 ? 215 LYS A HG2  3  
ATOM 8926  H HG3  . LYS A 1 163 ? -4.324  8.757   -6.539  1.00 0.00 ? 215 LYS A HG3  3  
ATOM 8927  H HD2  . LYS A 1 163 ? -3.882  10.333  -4.670  1.00 0.00 ? 215 LYS A HD2  3  
ATOM 8928  H HD3  . LYS A 1 163 ? -3.092  9.003   -3.777  1.00 0.00 ? 215 LYS A HD3  3  
ATOM 8929  H HE2  . LYS A 1 163 ? -1.517  8.668   -5.640  1.00 0.00 ? 215 LYS A HE2  3  
ATOM 8930  H HE3  . LYS A 1 163 ? -2.349  9.898   -6.598  1.00 0.00 ? 215 LYS A HE3  3  
ATOM 8931  H HZ1  . LYS A 1 163 ? -0.393  10.773  -5.566  1.00 0.00 ? 215 LYS A HZ1  3  
ATOM 8932  H HZ2  . LYS A 1 163 ? -1.718  11.525  -4.951  1.00 0.00 ? 215 LYS A HZ2  3  
ATOM 8933  H HZ3  . LYS A 1 163 ? -0.936  10.382  -4.061  1.00 0.00 ? 215 LYS A HZ3  3  
ATOM 8934  N N    . GLY A 1 164 ? -7.764  6.502   -3.068  1.00 0.00 ? 216 GLY A N    3  
ATOM 8935  C CA   . GLY A 1 164 ? -9.092  6.388   -2.479  1.00 0.00 ? 216 GLY A CA   3  
ATOM 8936  C C    . GLY A 1 164 ? -10.079 5.671   -3.404  1.00 0.00 ? 216 GLY A C    3  
ATOM 8937  O O    . GLY A 1 164 ? -9.974  5.783   -4.623  1.00 0.00 ? 216 GLY A O    3  
ATOM 8938  H H    . GLY A 1 164 ? -7.419  5.716   -3.600  1.00 0.00 ? 216 GLY A H    3  
ATOM 8939  H HA2  . GLY A 1 164 ? -9.018  5.834   -1.543  1.00 0.00 ? 216 GLY A HA2  3  
ATOM 8940  H HA3  . GLY A 1 164 ? -9.484  7.381   -2.257  1.00 0.00 ? 216 GLY A HA3  3  
ATOM 8941  N N    . ALA A 1 165 ? -11.026 4.942   -2.800  1.00 0.00 ? 217 ALA A N    3  
ATOM 8942  C CA   . ALA A 1 165 ? -12.120 4.220   -3.444  1.00 0.00 ? 217 ALA A CA   3  
ATOM 8943  C C    . ALA A 1 165 ? -11.709 3.159   -4.473  1.00 0.00 ? 217 ALA A C    3  
ATOM 8944  O O    . ALA A 1 165 ? -10.895 3.392   -5.366  1.00 0.00 ? 217 ALA A O    3  
ATOM 8945  C CB   . ALA A 1 165 ? -13.112 5.219   -4.034  1.00 0.00 ? 217 ALA A CB   3  
ATOM 8946  H H    . ALA A 1 165 ? -10.998 4.875   -1.792  1.00 0.00 ? 217 ALA A H    3  
ATOM 8947  H HA   . ALA A 1 165 ? -12.647 3.689   -2.651  1.00 0.00 ? 217 ALA A HA   3  
ATOM 8948  H HB1  . ALA A 1 165 ? -13.438 5.911   -3.257  1.00 0.00 ? 217 ALA A HB1  3  
ATOM 8949  H HB2  . ALA A 1 165 ? -12.635 5.772   -4.842  1.00 0.00 ? 217 ALA A HB2  3  
ATOM 8950  H HB3  . ALA A 1 165 ? -13.973 4.676   -4.426  1.00 0.00 ? 217 ALA A HB3  3  
ATOM 8951  N N    . GLY A 1 166 ? -12.293 1.966   -4.334  1.00 0.00 ? 218 GLY A N    3  
ATOM 8952  C CA   . GLY A 1 166 ? -12.042 0.864   -5.247  1.00 0.00 ? 218 GLY A CA   3  
ATOM 8953  C C    . GLY A 1 166 ? -12.863 0.962   -6.528  1.00 0.00 ? 218 GLY A C    3  
ATOM 8954  O O    . GLY A 1 166 ? -13.706 1.846   -6.678  1.00 0.00 ? 218 GLY A O    3  
ATOM 8955  H H    . GLY A 1 166 ? -12.933 1.810   -3.569  1.00 0.00 ? 218 GLY A H    3  
ATOM 8956  H HA2  . GLY A 1 166 ? -10.987 0.867   -5.519  1.00 0.00 ? 218 GLY A HA2  3  
ATOM 8957  H HA3  . GLY A 1 166 ? -12.277 -0.077  -4.751  1.00 0.00 ? 218 GLY A HA3  3  
ATOM 8958  N N    . ARG A 1 167 ? -12.603 0.038   -7.459  1.00 0.00 ? 219 ARG A N    3  
ATOM 8959  C CA   . ARG A 1 167 ? -13.304 -0.004  -8.733  1.00 0.00 ? 219 ARG A CA   3  
ATOM 8960  C C    . ARG A 1 167 ? -13.341 -1.425  -9.289  1.00 0.00 ? 219 ARG A C    3  
ATOM 8961  O O    . ARG A 1 167 ? -12.516 -2.266  -8.936  1.00 0.00 ? 219 ARG A O    3  
ATOM 8962  C CB   . ARG A 1 167 ? -12.624 0.944   -9.728  1.00 0.00 ? 219 ARG A CB   3  
ATOM 8963  C CG   . ARG A 1 167 ? -11.200 0.491   -10.057 1.00 0.00 ? 219 ARG A CG   3  
ATOM 8964  C CD   . ARG A 1 167 ? -10.546 1.459   -11.046 1.00 0.00 ? 219 ARG A CD   3  
ATOM 8965  N NE   . ARG A 1 167 ? -10.325 2.777   -10.444 1.00 0.00 ? 219 ARG A NE   3  
ATOM 8966  C CZ   . ARG A 1 167 ? -9.217  3.127   -9.781  1.00 0.00 ? 219 ARG A CZ   3  
ATOM 8967  N NH1  . ARG A 1 167 ? -8.217  2.264   -9.615  1.00 0.00 ? 219 ARG A NH1  3  
ATOM 8968  N NH2  . ARG A 1 167 ? -9.097  4.350   -9.276  1.00 0.00 ? 219 ARG A NH2  3  
ATOM 8969  H H    . ARG A 1 167 ? -11.898 -0.665  -7.285  1.00 0.00 ? 219 ARG A H    3  
ATOM 8970  H HA   . ARG A 1 167 ? -14.330 0.333   -8.582  1.00 0.00 ? 219 ARG A HA   3  
ATOM 8971  H HB2  . ARG A 1 167 ? -13.207 0.972   -10.648 1.00 0.00 ? 219 ARG A HB2  3  
ATOM 8972  H HB3  . ARG A 1 167 ? -12.597 1.947   -9.302  1.00 0.00 ? 219 ARG A HB3  3  
ATOM 8973  H HG2  . ARG A 1 167 ? -10.602 0.447   -9.147  1.00 0.00 ? 219 ARG A HG2  3  
ATOM 8974  H HG3  . ARG A 1 167 ? -11.232 -0.501  -10.509 1.00 0.00 ? 219 ARG A HG3  3  
ATOM 8975  H HD2  . ARG A 1 167 ? -9.592  1.043   -11.372 1.00 0.00 ? 219 ARG A HD2  3  
ATOM 8976  H HD3  . ARG A 1 167 ? -11.191 1.564   -11.919 1.00 0.00 ? 219 ARG A HD3  3  
ATOM 8977  H HE   . ARG A 1 167 ? -11.061 3.462   -10.540 1.00 0.00 ? 219 ARG A HE   3  
ATOM 8978  H HH11 . ARG A 1 167 ? -8.286  1.330   -9.994  1.00 0.00 ? 219 ARG A HH11 3  
ATOM 8979  H HH12 . ARG A 1 167 ? -7.388  2.545   -9.111  1.00 0.00 ? 219 ARG A HH12 3  
ATOM 8980  H HH21 . ARG A 1 167 ? -9.848  5.018   -9.375  1.00 0.00 ? 219 ARG A HH21 3  
ATOM 8981  H HH22 . ARG A 1 167 ? -8.249  4.609   -8.790  1.00 0.00 ? 219 ARG A HH22 3  
ATOM 8982  N N    . VAL A 1 168 ? -14.307 -1.685  -10.168 1.00 0.00 ? 220 VAL A N    3  
ATOM 8983  C CA   . VAL A 1 168 ? -14.447 -2.965  -10.848 1.00 0.00 ? 220 VAL A CA   3  
ATOM 8984  C C    . VAL A 1 168 ? -15.052 -2.711  -12.222 1.00 0.00 ? 220 VAL A C    3  
ATOM 8985  O O    . VAL A 1 168 ? -15.804 -1.756  -12.391 1.00 0.00 ? 220 VAL A O    3  
ATOM 8986  C CB   . VAL A 1 168 ? -15.289 -3.924  -9.995  1.00 0.00 ? 220 VAL A CB   3  
ATOM 8987  C CG1  . VAL A 1 168 ? -16.698 -3.396  -9.739  1.00 0.00 ? 220 VAL A CG1  3  
ATOM 8988  C CG2  . VAL A 1 168 ? -15.407 -5.299  -10.645 1.00 0.00 ? 220 VAL A CG2  3  
ATOM 8989  H H    . VAL A 1 168 ? -14.981 -0.965  -10.385 1.00 0.00 ? 220 VAL A H    3  
ATOM 8990  H HA   . VAL A 1 168 ? -13.458 -3.404  -10.982 1.00 0.00 ? 220 VAL A HA   3  
ATOM 8991  H HB   . VAL A 1 168 ? -14.793 -4.045  -9.032  1.00 0.00 ? 220 VAL A HB   3  
ATOM 8992  H HG11 . VAL A 1 168 ? -17.236 -3.312  -10.683 1.00 0.00 ? 220 VAL A HG11 3  
ATOM 8993  H HG12 . VAL A 1 168 ? -17.220 -4.095  -9.086  1.00 0.00 ? 220 VAL A HG12 3  
ATOM 8994  H HG13 . VAL A 1 168 ? -16.648 -2.421  -9.255  1.00 0.00 ? 220 VAL A HG13 3  
ATOM 8995  H HG21 . VAL A 1 168 ? -15.935 -5.220  -11.595 1.00 0.00 ? 220 VAL A HG21 3  
ATOM 8996  H HG22 . VAL A 1 168 ? -14.410 -5.706  -10.819 1.00 0.00 ? 220 VAL A HG22 3  
ATOM 8997  H HG23 . VAL A 1 168 ? -15.956 -5.969  -9.984  1.00 0.00 ? 220 VAL A HG23 3  
ATOM 8998  N N    . ALA A 1 169 ? -14.734 -3.550  -13.207 1.00 0.00 ? 221 ALA A N    3  
ATOM 8999  C CA   . ALA A 1 169 ? -15.220 -3.360  -14.563 1.00 0.00 ? 221 ALA A CA   3  
ATOM 9000  C C    . ALA A 1 169 ? -15.719 -4.679  -15.138 1.00 0.00 ? 221 ALA A C    3  
ATOM 9001  O O    . ALA A 1 169 ? -14.934 -5.600  -15.361 1.00 0.00 ? 221 ALA A O    3  
ATOM 9002  C CB   . ALA A 1 169 ? -14.100 -2.768  -15.418 1.00 0.00 ? 221 ALA A CB   3  
ATOM 9003  H H    . ALA A 1 169 ? -14.138 -4.344  -13.022 1.00 0.00 ? 221 ALA A H    3  
ATOM 9004  H HA   . ALA A 1 169 ? -16.052 -2.655  -14.548 1.00 0.00 ? 221 ALA A HA   3  
ATOM 9005  H HB1  . ALA A 1 169 ? -13.254 -3.456  -15.440 1.00 0.00 ? 221 ALA A HB1  3  
ATOM 9006  H HB2  . ALA A 1 169 ? -14.461 -2.609  -16.435 1.00 0.00 ? 221 ALA A HB2  3  
ATOM 9007  H HB3  . ALA A 1 169 ? -13.780 -1.816  -14.997 1.00 0.00 ? 221 ALA A HB3  3  
ATOM 9008  N N    . PHE A 1 170 ? -17.032 -4.757  -15.374 1.00 0.00 ? 222 PHE A N    3  
ATOM 9009  C CA   . PHE A 1 170 ? -17.663 -5.928  -15.963 1.00 0.00 ? 222 PHE A CA   3  
ATOM 9010  C C    . PHE A 1 170 ? -19.083 -5.610  -16.431 1.00 0.00 ? 222 PHE A C    3  
ATOM 9011  O O    . PHE A 1 170 ? -19.939 -6.492  -16.461 1.00 0.00 ? 222 PHE A O    3  
ATOM 9012  C CB   . PHE A 1 170 ? -17.647 -7.101  -14.979 1.00 0.00 ? 222 PHE A CB   3  
ATOM 9013  C CG   . PHE A 1 170 ? -18.554 -7.000  -13.766 1.00 0.00 ? 222 PHE A CG   3  
ATOM 9014  C CD1  . PHE A 1 170 ? -18.441 -5.931  -12.864 1.00 0.00 ? 222 PHE A CD1  3  
ATOM 9015  C CD2  . PHE A 1 170 ? -19.515 -7.998  -13.546 1.00 0.00 ? 222 PHE A CD2  3  
ATOM 9016  C CE1  . PHE A 1 170 ? -19.281 -5.866  -11.743 1.00 0.00 ? 222 PHE A CE1  3  
ATOM 9017  C CE2  . PHE A 1 170 ? -20.352 -7.933  -12.424 1.00 0.00 ? 222 PHE A CE2  3  
ATOM 9018  C CZ   . PHE A 1 170 ? -20.237 -6.867  -11.523 1.00 0.00 ? 222 PHE A CZ   3  
ATOM 9019  H H    . PHE A 1 170 ? -17.620 -3.972  -15.137 1.00 0.00 ? 222 PHE A H    3  
ATOM 9020  H HA   . PHE A 1 170 ? -17.080 -6.209  -16.840 1.00 0.00 ? 222 PHE A HA   3  
ATOM 9021  H HB2  . PHE A 1 170 ? -17.922 -8.001  -15.530 1.00 0.00 ? 222 PHE A HB2  3  
ATOM 9022  H HB3  . PHE A 1 170 ? -16.624 -7.232  -14.627 1.00 0.00 ? 222 PHE A HB3  3  
ATOM 9023  H HD1  . PHE A 1 170 ? -17.707 -5.157  -13.027 1.00 0.00 ? 222 PHE A HD1  3  
ATOM 9024  H HD2  . PHE A 1 170 ? -19.609 -8.819  -14.240 1.00 0.00 ? 222 PHE A HD2  3  
ATOM 9025  H HE1  . PHE A 1 170 ? -19.193 -5.046  -11.047 1.00 0.00 ? 222 PHE A HE1  3  
ATOM 9026  H HE2  . PHE A 1 170 ? -21.087 -8.705  -12.252 1.00 0.00 ? 222 PHE A HE2  3  
ATOM 9027  H HZ   . PHE A 1 170 ? -20.883 -6.817  -10.659 1.00 0.00 ? 222 PHE A HZ   3  
ATOM 9028  N N    . SER A 1 171 ? -19.339 -4.351  -16.800 1.00 0.00 ? 223 SER A N    3  
ATOM 9029  C CA   . SER A 1 171 ? -20.662 -3.907  -17.221 1.00 0.00 ? 223 SER A CA   3  
ATOM 9030  C C    . SER A 1 171 ? -21.038 -4.497  -18.579 1.00 0.00 ? 223 SER A C    3  
ATOM 9031  O O    . SER A 1 171 ? -20.912 -3.831  -19.605 1.00 0.00 ? 223 SER A O    3  
ATOM 9032  C CB   . SER A 1 171 ? -20.702 -2.379  -17.266 1.00 0.00 ? 223 SER A CB   3  
ATOM 9033  O OG   . SER A 1 171 ? -20.292 -1.851  -16.021 1.00 0.00 ? 223 SER A OG   3  
ATOM 9034  H H    . SER A 1 171 ? -18.596 -3.667  -16.787 1.00 0.00 ? 223 SER A H    3  
ATOM 9035  H HA   . SER A 1 171 ? -21.388 -4.245  -16.482 1.00 0.00 ? 223 SER A HA   3  
ATOM 9036  H HB2  . SER A 1 171 ? -20.031 -2.021  -18.046 1.00 0.00 ? 223 SER A HB2  3  
ATOM 9037  H HB3  . SER A 1 171 ? -21.718 -2.049  -17.485 1.00 0.00 ? 223 SER A HB3  3  
ATOM 9038  H HG   . SER A 1 171 ? -20.383 -0.895  -16.050 1.00 0.00 ? 223 SER A HG   3  
ATOM 9039  N N    . ASN A 1 172 ? -21.498 -5.754  -18.587 1.00 0.00 ? 224 ASN A N    3  
ATOM 9040  C CA   . ASN A 1 172 ? -21.883 -6.434  -19.815 1.00 0.00 ? 224 ASN A CA   3  
ATOM 9041  C C    . ASN A 1 172 ? -23.039 -7.420  -19.605 1.00 0.00 ? 224 ASN A C    3  
ATOM 9042  O O    . ASN A 1 172 ? -23.564 -7.954  -20.579 1.00 0.00 ? 224 ASN A O    3  
ATOM 9043  C CB   . ASN A 1 172 ? -20.658 -7.158  -20.391 1.00 0.00 ? 224 ASN A CB   3  
ATOM 9044  C CG   . ASN A 1 172 ? -20.405 -8.504  -19.720 1.00 0.00 ? 224 ASN A CG   3  
ATOM 9045  O OD1  . ASN A 1 172 ? -20.459 -9.542  -20.370 1.00 0.00 ? 224 ASN A OD1  3  
ATOM 9046  N ND2  . ASN A 1 172 ? -20.129 -8.505  -18.419 1.00 0.00 ? 224 ASN A ND2  3  
ATOM 9047  H H    . ASN A 1 172 ? -21.579 -6.254  -17.713 1.00 0.00 ? 224 ASN A H    3  
ATOM 9048  H HA   . ASN A 1 172 ? -22.209 -5.680  -20.532 1.00 0.00 ? 224 ASN A HA   3  
ATOM 9049  H HB2  . ASN A 1 172 ? -20.826 -7.334  -21.453 1.00 0.00 ? 224 ASN A HB2  3  
ATOM 9050  H HB3  . ASN A 1 172 ? -19.778 -6.524  -20.281 1.00 0.00 ? 224 ASN A HB3  3  
ATOM 9051  H HD21 . ASN A 1 172 ? -20.067 -7.635  -17.909 1.00 0.00 ? 224 ASN A HD21 3  
ATOM 9052  H HD22 . ASN A 1 172 ? -19.979 -9.381  -17.940 1.00 0.00 ? 224 ASN A HD22 3  
ATOM 9053  N N    . GLN A 1 173 ? -23.436 -7.662  -18.349 1.00 0.00 ? 225 GLN A N    3  
ATOM 9054  C CA   . GLN A 1 173 ? -24.487 -8.616  -18.021 1.00 0.00 ? 225 GLN A CA   3  
ATOM 9055  C C    . GLN A 1 173 ? -25.294 -8.172  -16.805 1.00 0.00 ? 225 GLN A C    3  
ATOM 9056  O O    . GLN A 1 173 ? -24.983 -7.179  -16.148 1.00 0.00 ? 225 GLN A O    3  
ATOM 9057  C CB   . GLN A 1 173 ? -23.876 -9.993  -17.745 1.00 0.00 ? 225 GLN A CB   3  
ATOM 9058  C CG   . GLN A 1 173 ? -23.518 -10.709 -19.045 1.00 0.00 ? 225 GLN A CG   3  
ATOM 9059  C CD   . GLN A 1 173 ? -23.110 -12.156 -18.789 1.00 0.00 ? 225 GLN A CD   3  
ATOM 9060  O OE1  . GLN A 1 173 ? -22.804 -12.544 -17.665 1.00 0.00 ? 225 GLN A OE1  3  
ATOM 9061  N NE2  . GLN A 1 173 ? -23.105 -12.973 -19.838 1.00 0.00 ? 225 GLN A NE2  3  
ATOM 9062  H H    . GLN A 1 173 ? -22.997 -7.172  -17.584 1.00 0.00 ? 225 GLN A H    3  
ATOM 9063  H HA   . GLN A 1 173 ? -25.175 -8.705  -18.863 1.00 0.00 ? 225 GLN A HA   3  
ATOM 9064  H HB2  . GLN A 1 173 ? -22.991 -9.887  -17.117 1.00 0.00 ? 225 GLN A HB2  3  
ATOM 9065  H HB3  . GLN A 1 173 ? -24.609 -10.605 -17.219 1.00 0.00 ? 225 GLN A HB3  3  
ATOM 9066  H HG2  . GLN A 1 173 ? -24.384 -10.705 -19.706 1.00 0.00 ? 225 GLN A HG2  3  
ATOM 9067  H HG3  . GLN A 1 173 ? -22.699 -10.189 -19.541 1.00 0.00 ? 225 GLN A HG3  3  
ATOM 9068  H HE21 . GLN A 1 173 ? -23.343 -12.624 -20.756 1.00 0.00 ? 225 GLN A HE21 3  
ATOM 9069  H HE22 . GLN A 1 173 ? -22.862 -13.944 -19.708 1.00 0.00 ? 225 GLN A HE22 3  
ATOM 9070  N N    . GLN A 1 174 ? -26.352 -8.932  -16.510 1.00 0.00 ? 226 GLN A N    3  
ATOM 9071  C CA   . GLN A 1 174 ? -27.246 -8.617  -15.409 1.00 0.00 ? 226 GLN A CA   3  
ATOM 9072  C C    . GLN A 1 174 ? -26.515 -8.710  -14.068 1.00 0.00 ? 226 GLN A C    3  
ATOM 9073  O O    . GLN A 1 174 ? -27.035 -8.255  -13.052 1.00 0.00 ? 226 GLN A O    3  
ATOM 9074  C CB   . GLN A 1 174 ? -28.433 -9.580  -15.440 1.00 0.00 ? 226 GLN A CB   3  
ATOM 9075  C CG   . GLN A 1 174 ? -29.613 -9.022  -14.641 1.00 0.00 ? 226 GLN A CG   3  
ATOM 9076  C CD   . GLN A 1 174 ? -30.584 -10.131 -14.261 1.00 0.00 ? 226 GLN A CD   3  
ATOM 9077  O OE1  . GLN A 1 174 ? -31.636 -10.293 -14.875 1.00 0.00 ? 226 GLN A OE1  3  
ATOM 9078  N NE2  . GLN A 1 174 ? -30.231 -10.907 -13.238 1.00 0.00 ? 226 GLN A NE2  3  
ATOM 9079  H H    . GLN A 1 174 ? -26.551 -9.755  -17.059 1.00 0.00 ? 226 GLN A H    3  
ATOM 9080  H HA   . GLN A 1 174 ? -27.612 -7.600  -15.546 1.00 0.00 ? 226 GLN A HA   3  
ATOM 9081  H HB2  . GLN A 1 174 ? -28.755 -9.732  -16.471 1.00 0.00 ? 226 GLN A HB2  3  
ATOM 9082  H HB3  . GLN A 1 174 ? -28.122 -10.537 -15.022 1.00 0.00 ? 226 GLN A HB3  3  
ATOM 9083  H HG2  . GLN A 1 174 ? -29.254 -8.551  -13.725 1.00 0.00 ? 226 GLN A HG2  3  
ATOM 9084  H HG3  . GLN A 1 174 ? -30.129 -8.266  -15.233 1.00 0.00 ? 226 GLN A HG3  3  
ATOM 9085  H HE21 . GLN A 1 174 ? -29.360 -10.737 -12.755 1.00 0.00 ? 226 GLN A HE21 3  
ATOM 9086  H HE22 . GLN A 1 174 ? -30.832 -11.664 -12.946 1.00 0.00 ? 226 GLN A HE22 3  
ATOM 9087  N N    . SER A 1 175 ? -25.312 -9.291  -14.039 1.00 0.00 ? 227 SER A N    3  
ATOM 9088  C CA   . SER A 1 175 ? -24.553 -9.379  -12.802 1.00 0.00 ? 227 SER A CA   3  
ATOM 9089  C C    . SER A 1 175 ? -24.083 -7.985  -12.393 1.00 0.00 ? 227 SER A C    3  
ATOM 9090  O O    . SER A 1 175 ? -24.049 -7.662  -11.207 1.00 0.00 ? 227 SER A O    3  
ATOM 9091  C CB   . SER A 1 175 ? -23.363 -10.316 -12.991 1.00 0.00 ? 227 SER A CB   3  
ATOM 9092  O OG   . SER A 1 175 ? -23.815 -11.600 -13.368 1.00 0.00 ? 227 SER A OG   3  
ATOM 9093  H H    . SER A 1 175 ? -24.911 -9.680  -14.881 1.00 0.00 ? 227 SER A H    3  
ATOM 9094  H HA   . SER A 1 175 ? -25.197 -9.781  -12.018 1.00 0.00 ? 227 SER A HA   3  
ATOM 9095  H HB2  . SER A 1 175 ? -22.708 -9.920  -13.767 1.00 0.00 ? 227 SER A HB2  3  
ATOM 9096  H HB3  . SER A 1 175 ? -22.808 -10.385 -12.056 1.00 0.00 ? 227 SER A HB3  3  
ATOM 9097  H HG   . SER A 1 175 ? -23.049 -12.172 -13.454 1.00 0.00 ? 227 SER A HG   3  
ATOM 9098  N N    . TYR A 1 176 ? -23.721 -7.151  -13.374 1.00 0.00 ? 228 TYR A N    3  
ATOM 9099  C CA   . TYR A 1 176 ? -23.351 -5.772  -13.109 1.00 0.00 ? 228 TYR A CA   3  
ATOM 9100  C C    . TYR A 1 176 ? -24.599 -4.978  -12.735 1.00 0.00 ? 228 TYR A C    3  
ATOM 9101  O O    . TYR A 1 176 ? -24.529 -4.081  -11.898 1.00 0.00 ? 228 TYR A O    3  
ATOM 9102  C CB   . TYR A 1 176 ? -22.620 -5.183  -14.319 1.00 0.00 ? 228 TYR A CB   3  
ATOM 9103  C CG   . TYR A 1 176 ? -23.300 -4.008  -14.993 1.00 0.00 ? 228 TYR A CG   3  
ATOM 9104  C CD1  . TYR A 1 176 ? -23.314 -2.751  -14.369 1.00 0.00 ? 228 TYR A CD1  3  
ATOM 9105  C CD2  . TYR A 1 176 ? -23.911 -4.171  -16.246 1.00 0.00 ? 228 TYR A CD2  3  
ATOM 9106  C CE1  . TYR A 1 176 ? -23.926 -1.656  -14.997 1.00 0.00 ? 228 TYR A CE1  3  
ATOM 9107  C CE2  . TYR A 1 176 ? -24.522 -3.080  -16.881 1.00 0.00 ? 228 TYR A CE2  3  
ATOM 9108  C CZ   . TYR A 1 176 ? -24.529 -1.817  -16.258 1.00 0.00 ? 228 TYR A CZ   3  
ATOM 9109  O OH   . TYR A 1 176 ? -25.119 -0.755  -16.877 1.00 0.00 ? 228 TYR A OH   3  
ATOM 9110  H H    . TYR A 1 176 ? -23.698 -7.475  -14.331 1.00 0.00 ? 228 TYR A H    3  
ATOM 9111  H HA   . TYR A 1 176 ? -22.672 -5.757  -12.256 1.00 0.00 ? 228 TYR A HA   3  
ATOM 9112  H HB2  . TYR A 1 176 ? -21.633 -4.858  -13.989 1.00 0.00 ? 228 TYR A HB2  3  
ATOM 9113  H HB3  . TYR A 1 176 ? -22.471 -5.970  -15.060 1.00 0.00 ? 228 TYR A HB3  3  
ATOM 9114  H HD1  . TYR A 1 176 ? -22.852 -2.625  -13.402 1.00 0.00 ? 228 TYR A HD1  3  
ATOM 9115  H HD2  . TYR A 1 176 ? -23.911 -5.139  -16.725 1.00 0.00 ? 228 TYR A HD2  3  
ATOM 9116  H HE1  . TYR A 1 176 ? -23.933 -0.690  -14.513 1.00 0.00 ? 228 TYR A HE1  3  
ATOM 9117  H HE2  . TYR A 1 176 ? -24.987 -3.207  -17.847 1.00 0.00 ? 228 TYR A HE2  3  
ATOM 9118  H HH   . TYR A 1 176 ? -25.063 0.054   -16.364 1.00 0.00 ? 228 TYR A HH   3  
ATOM 9119  N N    . ILE A 1 177 ? -25.742 -5.302  -13.349 1.00 0.00 ? 229 ILE A N    3  
ATOM 9120  C CA   . ILE A 1 177 ? -27.001 -4.652  -13.007 1.00 0.00 ? 229 ILE A CA   3  
ATOM 9121  C C    . ILE A 1 177 ? -27.378 -4.992  -11.566 1.00 0.00 ? 229 ILE A C    3  
ATOM 9122  O O    . ILE A 1 177 ? -27.941 -4.163  -10.851 1.00 0.00 ? 229 ILE A O    3  
ATOM 9123  C CB   . ILE A 1 177 ? -28.105 -5.128  -13.965 1.00 0.00 ? 229 ILE A CB   3  
ATOM 9124  C CG1  . ILE A 1 177 ? -27.744 -4.873  -15.435 1.00 0.00 ? 229 ILE A CG1  3  
ATOM 9125  C CG2  . ILE A 1 177 ? -29.430 -4.443  -13.625 1.00 0.00 ? 229 ILE A CG2  3  
ATOM 9126  C CD1  . ILE A 1 177 ? -27.618 -3.388  -15.766 1.00 0.00 ? 229 ILE A CD1  3  
ATOM 9127  H H    . ILE A 1 177 ? -25.749 -6.011  -14.067 1.00 0.00 ? 229 ILE A H    3  
ATOM 9128  H HA   . ILE A 1 177 ? -26.883 -3.572  -13.097 1.00 0.00 ? 229 ILE A HA   3  
ATOM 9129  H HB   . ILE A 1 177 ? -28.235 -6.202  -13.834 1.00 0.00 ? 229 ILE A HB   3  
ATOM 9130  H HG12 . ILE A 1 177 ? -26.798 -5.364  -15.664 1.00 0.00 ? 229 ILE A HG12 3  
ATOM 9131  H HG13 . ILE A 1 177 ? -28.519 -5.307  -16.067 1.00 0.00 ? 229 ILE A HG13 3  
ATOM 9132  H HG21 . ILE A 1 177 ? -29.304 -3.360  -13.629 1.00 0.00 ? 229 ILE A HG21 3  
ATOM 9133  H HG22 . ILE A 1 177 ? -30.186 -4.723  -14.358 1.00 0.00 ? 229 ILE A HG22 3  
ATOM 9134  H HG23 . ILE A 1 177 ? -29.766 -4.757  -12.637 1.00 0.00 ? 229 ILE A HG23 3  
ATOM 9135  H HD11 . ILE A 1 177 ? -28.576 -2.892  -15.607 1.00 0.00 ? 229 ILE A HD11 3  
ATOM 9136  H HD12 . ILE A 1 177 ? -26.857 -2.930  -15.137 1.00 0.00 ? 229 ILE A HD12 3  
ATOM 9137  H HD13 . ILE A 1 177 ? -27.335 -3.281  -16.814 1.00 0.00 ? 229 ILE A HD13 3  
ATOM 9138  N N    . ALA A 1 178 ? -27.068 -6.219  -11.137 1.00 0.00 ? 230 ALA A N    3  
ATOM 9139  C CA   . ALA A 1 178 ? -27.476 -6.710  -9.835  1.00 0.00 ? 230 ALA A CA   3  
ATOM 9140  C C    . ALA A 1 178 ? -26.608 -6.174  -8.701  1.00 0.00 ? 230 ALA A C    3  
ATOM 9141  O O    . ALA A 1 178 ? -27.069 -6.140  -7.562  1.00 0.00 ? 230 ALA A O    3  
ATOM 9142  C CB   . ALA A 1 178 ? -27.460 -8.235  -9.864  1.00 0.00 ? 230 ALA A CB   3  
ATOM 9143  H H    . ALA A 1 178 ? -26.538 -6.840  -11.732 1.00 0.00 ? 230 ALA A H    3  
ATOM 9144  H HA   . ALA A 1 178 ? -28.501 -6.390  -9.647  1.00 0.00 ? 230 ALA A HA   3  
ATOM 9145  H HB1  . ALA A 1 178 ? -26.443 -8.590  -10.021 1.00 0.00 ? 230 ALA A HB1  3  
ATOM 9146  H HB2  . ALA A 1 178 ? -27.841 -8.615  -8.915  1.00 0.00 ? 230 ALA A HB2  3  
ATOM 9147  H HB3  . ALA A 1 178 ? -28.099 -8.591  -10.673 1.00 0.00 ? 230 ALA A HB3  3  
ATOM 9148  N N    . ALA A 1 179 ? -25.368 -5.755  -8.976  1.00 0.00 ? 231 ALA A N    3  
ATOM 9149  C CA   . ALA A 1 179 ? -24.496 -5.212  -7.942  1.00 0.00 ? 231 ALA A CA   3  
ATOM 9150  C C    . ALA A 1 179 ? -24.451 -3.685  -7.961  1.00 0.00 ? 231 ALA A C    3  
ATOM 9151  O O    . ALA A 1 179 ? -24.002 -3.083  -6.989  1.00 0.00 ? 231 ALA A O    3  
ATOM 9152  C CB   . ALA A 1 179 ? -23.099 -5.806  -8.118  1.00 0.00 ? 231 ALA A CB   3  
ATOM 9153  H H    . ALA A 1 179 ? -25.008 -5.814  -9.918  1.00 0.00 ? 231 ALA A H    3  
ATOM 9154  H HA   . ALA A 1 179 ? -24.883 -5.509  -6.967  1.00 0.00 ? 231 ALA A HA   3  
ATOM 9155  H HB1  . ALA A 1 179 ? -22.687 -5.500  -9.079  1.00 0.00 ? 231 ALA A HB1  3  
ATOM 9156  H HB2  . ALA A 1 179 ? -22.449 -5.455  -7.316  1.00 0.00 ? 231 ALA A HB2  3  
ATOM 9157  H HB3  . ALA A 1 179 ? -23.156 -6.895  -8.084  1.00 0.00 ? 231 ALA A HB3  3  
ATOM 9158  N N    . ILE A 1 180 ? -24.905 -3.044  -9.044  1.00 0.00 ? 232 ILE A N    3  
ATOM 9159  C CA   . ILE A 1 180 ? -24.919 -1.589  -9.120  1.00 0.00 ? 232 ILE A CA   3  
ATOM 9160  C C    . ILE A 1 180 ? -26.255 -1.041  -8.619  1.00 0.00 ? 232 ILE A C    3  
ATOM 9161  O O    . ILE A 1 180 ? -26.351 0.139   -8.283  1.00 0.00 ? 232 ILE A O    3  
ATOM 9162  C CB   . ILE A 1 180 ? -24.570 -1.140  -10.545 1.00 0.00 ? 232 ILE A CB   3  
ATOM 9163  C CG1  . ILE A 1 180 ? -23.768 0.162   -10.499 1.00 0.00 ? 232 ILE A CG1  3  
ATOM 9164  C CG2  . ILE A 1 180 ? -25.829 -0.959  -11.398 1.00 0.00 ? 232 ILE A CG2  3  
ATOM 9165  C CD1  . ILE A 1 180 ? -23.249 0.515   -11.894 1.00 0.00 ? 232 ILE A CD1  3  
ATOM 9166  H H    . ILE A 1 180 ? -25.248 -3.568  -9.836  1.00 0.00 ? 232 ILE A H    3  
ATOM 9167  H HA   . ILE A 1 180 ? -24.138 -1.219  -8.456  1.00 0.00 ? 232 ILE A HA   3  
ATOM 9168  H HB   . ILE A 1 180 ? -23.937 -1.903  -10.998 1.00 0.00 ? 232 ILE A HB   3  
ATOM 9169  H HG12 . ILE A 1 180 ? -24.394 0.972   -10.125 1.00 0.00 ? 232 ILE A HG12 3  
ATOM 9170  H HG13 . ILE A 1 180 ? -22.917 0.031   -9.832  1.00 0.00 ? 232 ILE A HG13 3  
ATOM 9171  H HG21 . ILE A 1 180 ? -25.546 -0.798  -12.439 1.00 0.00 ? 232 ILE A HG21 3  
ATOM 9172  H HG22 . ILE A 1 180 ? -26.450 -1.852  -11.334 1.00 0.00 ? 232 ILE A HG22 3  
ATOM 9173  H HG23 . ILE A 1 180 ? -26.388 -0.094  -11.041 1.00 0.00 ? 232 ILE A HG23 3  
ATOM 9174  H HD11 . ILE A 1 180 ? -24.082 0.764   -12.551 1.00 0.00 ? 232 ILE A HD11 3  
ATOM 9175  H HD12 . ILE A 1 180 ? -22.582 1.374   -11.822 1.00 0.00 ? 232 ILE A HD12 3  
ATOM 9176  H HD13 . ILE A 1 180 ? -22.699 -0.330  -12.308 1.00 0.00 ? 232 ILE A HD13 3  
ATOM 9177  N N    . SER A 1 181 ? -27.285 -1.897  -8.569  1.00 0.00 ? 233 SER A N    3  
ATOM 9178  C CA   . SER A 1 181 ? -28.572 -1.537  -7.981  1.00 0.00 ? 233 SER A CA   3  
ATOM 9179  C C    . SER A 1 181 ? -28.687 -2.086  -6.558  1.00 0.00 ? 233 SER A C    3  
ATOM 9180  O O    . SER A 1 181 ? -29.631 -1.756  -5.841  1.00 0.00 ? 233 SER A O    3  
ATOM 9181  C CB   . SER A 1 181 ? -29.709 -2.054  -8.862  1.00 0.00 ? 233 SER A CB   3  
ATOM 9182  O OG   . SER A 1 181 ? -29.631 -1.466  -10.145 1.00 0.00 ? 233 SER A OG   3  
ATOM 9183  H H    . SER A 1 181 ? -27.184 -2.828  -8.947  1.00 0.00 ? 233 SER A H    3  
ATOM 9184  H HA   . SER A 1 181 ? -28.648 -0.451  -7.927  1.00 0.00 ? 233 SER A HA   3  
ATOM 9185  H HB2  . SER A 1 181 ? -29.634 -3.137  -8.953  1.00 0.00 ? 233 SER A HB2  3  
ATOM 9186  H HB3  . SER A 1 181 ? -30.665 -1.798  -8.406  1.00 0.00 ? 233 SER A HB3  3  
ATOM 9187  H HG   . SER A 1 181 ? -29.760 -0.518  -10.057 1.00 0.00 ? 233 SER A HG   3  
ATOM 9188  N N    . ALA A 1 182 ? -27.729 -2.924  -6.152  1.00 0.00 ? 234 ALA A N    3  
ATOM 9189  C CA   . ALA A 1 182 ? -27.658 -3.441  -4.794  1.00 0.00 ? 234 ALA A CA   3  
ATOM 9190  C C    . ALA A 1 182 ? -26.610 -2.633  -4.034  1.00 0.00 ? 234 ALA A C    3  
ATOM 9191  O O    . ALA A 1 182 ? -25.590 -3.161  -3.593  1.00 0.00 ? 234 ALA A O    3  
ATOM 9192  C CB   . ALA A 1 182 ? -27.355 -4.938  -4.809  1.00 0.00 ? 234 ALA A CB   3  
ATOM 9193  H H    . ALA A 1 182 ? -27.012 -3.213  -6.801  1.00 0.00 ? 234 ALA A H    3  
ATOM 9194  H HA   . ALA A 1 182 ? -28.624 -3.293  -4.309  1.00 0.00 ? 234 ALA A HA   3  
ATOM 9195  H HB1  . ALA A 1 182 ? -26.390 -5.111  -5.285  1.00 0.00 ? 234 ALA A HB1  3  
ATOM 9196  H HB2  . ALA A 1 182 ? -27.331 -5.317  -3.788  1.00 0.00 ? 234 ALA A HB2  3  
ATOM 9197  H HB3  . ALA A 1 182 ? -28.135 -5.460  -5.364  1.00 0.00 ? 234 ALA A HB3  3  
ATOM 9198  N N    . ARG A 1 183 ? -26.882 -1.334  -3.889  1.00 0.00 ? 235 ARG A N    3  
ATOM 9199  C CA   . ARG A 1 183 ? -25.948 -0.395  -3.281  1.00 0.00 ? 235 ARG A CA   3  
ATOM 9200  C C    . ARG A 1 183 ? -25.631 -0.720  -1.819  1.00 0.00 ? 235 ARG A C    3  
ATOM 9201  O O    . ARG A 1 183 ? -24.669 -0.179  -1.283  1.00 0.00 ? 235 ARG A O    3  
ATOM 9202  C CB   . ARG A 1 183 ? -26.497 1.024   -3.438  1.00 0.00 ? 235 ARG A CB   3  
ATOM 9203  C CG   . ARG A 1 183 ? -27.851 1.184   -2.743  1.00 0.00 ? 235 ARG A CG   3  
ATOM 9204  C CD   . ARG A 1 183 ? -28.345 2.623   -2.877  1.00 0.00 ? 235 ARG A CD   3  
ATOM 9205  N NE   . ARG A 1 183 ? -29.637 2.801   -2.207  1.00 0.00 ? 235 ARG A NE   3  
ATOM 9206  C CZ   . ARG A 1 183 ? -30.320 3.950   -2.189  1.00 0.00 ? 235 ARG A CZ   3  
ATOM 9207  N NH1  . ARG A 1 183 ? -29.848 5.035   -2.801  1.00 0.00 ? 235 ARG A NH1  3  
ATOM 9208  N NH2  . ARG A 1 183 ? -31.488 4.021   -1.552  1.00 0.00 ? 235 ARG A NH2  3  
ATOM 9209  H H    . ARG A 1 183 ? -27.767 -0.974  -4.214  1.00 0.00 ? 235 ARG A H    3  
ATOM 9210  H HA   . ARG A 1 183 ? -25.009 -0.453  -3.834  1.00 0.00 ? 235 ARG A HA   3  
ATOM 9211  H HB2  . ARG A 1 183 ? -25.788 1.733   -3.011  1.00 0.00 ? 235 ARG A HB2  3  
ATOM 9212  H HB3  . ARG A 1 183 ? -26.616 1.239   -4.500  1.00 0.00 ? 235 ARG A HB3  3  
ATOM 9213  H HG2  . ARG A 1 183 ? -28.580 0.512   -3.196  1.00 0.00 ? 235 ARG A HG2  3  
ATOM 9214  H HG3  . ARG A 1 183 ? -27.746 0.936   -1.687  1.00 0.00 ? 235 ARG A HG3  3  
ATOM 9215  H HD2  . ARG A 1 183 ? -27.612 3.293   -2.428  1.00 0.00 ? 235 ARG A HD2  3  
ATOM 9216  H HD3  . ARG A 1 183 ? -28.449 2.866   -3.935  1.00 0.00 ? 235 ARG A HD3  3  
ATOM 9217  H HE   . ARG A 1 183 ? -30.029 2.001   -1.732  1.00 0.00 ? 235 ARG A HE   3  
ATOM 9218  H HH11 . ARG A 1 183 ? -28.964 4.996   -3.288  1.00 0.00 ? 235 ARG A HH11 3  
ATOM 9219  H HH12 . ARG A 1 183 ? -30.372 5.898   -2.778  1.00 0.00 ? 235 ARG A HH12 3  
ATOM 9220  H HH21 . ARG A 1 183 ? -31.859 3.205   -1.087  1.00 0.00 ? 235 ARG A HH21 3  
ATOM 9221  H HH22 . ARG A 1 183 ? -32.003 4.889   -1.534  1.00 0.00 ? 235 ARG A HH22 3  
ATOM 9222  N N    . PHE A 1 184 ? -26.418 -1.588  -1.171  1.00 0.00 ? 236 PHE A N    3  
ATOM 9223  C CA   . PHE A 1 184 ? -26.105 -2.083  0.162   1.00 0.00 ? 236 PHE A CA   3  
ATOM 9224  C C    . PHE A 1 184 ? -26.419 -3.569  0.206   1.00 0.00 ? 236 PHE A C    3  
ATOM 9225  O O    . PHE A 1 184 ? -27.407 -4.018  -0.373  1.00 0.00 ? 236 PHE A O    3  
ATOM 9226  C CB   . PHE A 1 184 ? -26.901 -1.339  1.237   1.00 0.00 ? 236 PHE A CB   3  
ATOM 9227  C CG   . PHE A 1 184 ? -26.538 0.119   1.412   1.00 0.00 ? 236 PHE A CG   3  
ATOM 9228  C CD1  . PHE A 1 184 ? -25.349 0.478   2.065   1.00 0.00 ? 236 PHE A CD1  3  
ATOM 9229  C CD2  . PHE A 1 184 ? -27.394 1.117   0.925   1.00 0.00 ? 236 PHE A CD2  3  
ATOM 9230  C CE1  . PHE A 1 184 ? -25.011 1.830   2.218   1.00 0.00 ? 236 PHE A CE1  3  
ATOM 9231  C CE2  . PHE A 1 184 ? -27.056 2.469   1.078   1.00 0.00 ? 236 PHE A CE2  3  
ATOM 9232  C CZ   . PHE A 1 184 ? -25.865 2.826   1.724   1.00 0.00 ? 236 PHE A CZ   3  
ATOM 9233  H H    . PHE A 1 184 ? -27.261 -1.930  -1.610  1.00 0.00 ? 236 PHE A H    3  
ATOM 9234  H HA   . PHE A 1 184 ? -25.038 -1.977  0.354   1.00 0.00 ? 236 PHE A HA   3  
ATOM 9235  H HB2  . PHE A 1 184 ? -27.963 -1.412  1.000   1.00 0.00 ? 236 PHE A HB2  3  
ATOM 9236  H HB3  . PHE A 1 184 ? -26.740 -1.842  2.191   1.00 0.00 ? 236 PHE A HB3  3  
ATOM 9237  H HD1  . PHE A 1 184 ? -24.689 -0.285  2.451   1.00 0.00 ? 236 PHE A HD1  3  
ATOM 9238  H HD2  . PHE A 1 184 ? -28.316 0.846   0.434   1.00 0.00 ? 236 PHE A HD2  3  
ATOM 9239  H HE1  . PHE A 1 184 ? -24.094 2.106   2.715   1.00 0.00 ? 236 PHE A HE1  3  
ATOM 9240  H HE2  . PHE A 1 184 ? -27.714 3.237   0.698   1.00 0.00 ? 236 PHE A HE2  3  
ATOM 9241  H HZ   . PHE A 1 184 ? -25.605 3.868   1.841   1.00 0.00 ? 236 PHE A HZ   3  
ATOM 9242  N N    . VAL A 1 185 ? -25.567 -4.328  0.898   1.00 0.00 ? 237 VAL A N    3  
ATOM 9243  C CA   . VAL A 1 185 ? -25.613 -5.775  0.901   1.00 0.00 ? 237 VAL A CA   3  
ATOM 9244  C C    . VAL A 1 185 ? -24.990 -6.261  2.201   1.00 0.00 ? 237 VAL A C    3  
ATOM 9245  O O    . VAL A 1 185 ? -24.187 -5.555  2.810   1.00 0.00 ? 237 VAL A O    3  
ATOM 9246  C CB   . VAL A 1 185 ? -24.812 -6.330  -0.285  1.00 0.00 ? 237 VAL A CB   3  
ATOM 9247  C CG1  . VAL A 1 185 ? -25.216 -7.779  -0.517  1.00 0.00 ? 237 VAL A CG1  3  
ATOM 9248  C CG2  . VAL A 1 185 ? -25.064 -5.588  -1.598  1.00 0.00 ? 237 VAL A CG2  3  
ATOM 9249  H H    . VAL A 1 185 ? -24.840 -3.900  1.454   1.00 0.00 ? 237 VAL A H    3  
ATOM 9250  H HA   . VAL A 1 185 ? -26.648 -6.108  0.835   1.00 0.00 ? 237 VAL A HA   3  
ATOM 9251  H HB   . VAL A 1 185 ? -23.747 -6.280  -0.058  1.00 0.00 ? 237 VAL A HB   3  
ATOM 9252  H HG11 . VAL A 1 185 ? -24.676 -8.167  -1.380  1.00 0.00 ? 237 VAL A HG11 3  
ATOM 9253  H HG12 . VAL A 1 185 ? -24.976 -8.376  0.363   1.00 0.00 ? 237 VAL A HG12 3  
ATOM 9254  H HG13 . VAL A 1 185 ? -26.289 -7.815  -0.707  1.00 0.00 ? 237 VAL A HG13 3  
ATOM 9255  H HG21 . VAL A 1 185 ? -26.127 -5.606  -1.833  1.00 0.00 ? 237 VAL A HG21 3  
ATOM 9256  H HG22 . VAL A 1 185 ? -24.723 -4.557  -1.512  1.00 0.00 ? 237 VAL A HG22 3  
ATOM 9257  H HG23 . VAL A 1 185 ? -24.511 -6.075  -2.402  1.00 0.00 ? 237 VAL A HG23 3  
ATOM 9258  N N    . GLN A 1 186 ? -25.353 -7.468  2.633   1.00 0.00 ? 238 GLN A N    3  
ATOM 9259  C CA   . GLN A 1 186 ? -24.772 -8.049  3.827   1.00 0.00 ? 238 GLN A CA   3  
ATOM 9260  C C    . GLN A 1 186 ? -23.363 -8.536  3.510   1.00 0.00 ? 238 GLN A C    3  
ATOM 9261  O O    . GLN A 1 186 ? -23.181 -9.534  2.816   1.00 0.00 ? 238 GLN A O    3  
ATOM 9262  C CB   . GLN A 1 186 ? -25.691 -9.160  4.312   1.00 0.00 ? 238 GLN A CB   3  
ATOM 9263  C CG   . GLN A 1 186 ? -25.202 -9.737  5.638   1.00 0.00 ? 238 GLN A CG   3  
ATOM 9264  C CD   . GLN A 1 186 ? -25.261 -8.683  6.728   1.00 0.00 ? 238 GLN A CD   3  
ATOM 9265  O OE1  . GLN A 1 186 ? -24.235 -8.236  7.232   1.00 0.00 ? 238 GLN A OE1  3  
ATOM 9266  N NE2  . GLN A 1 186 ? -26.473 -8.281  7.096   1.00 0.00 ? 238 GLN A NE2  3  
ATOM 9267  H H    . GLN A 1 186 ? -26.043 -8.003  2.125   1.00 0.00 ? 238 GLN A H    3  
ATOM 9268  H HA   . GLN A 1 186 ? -24.716 -7.278  4.596   1.00 0.00 ? 238 GLN A HA   3  
ATOM 9269  H HB2  . GLN A 1 186 ? -26.688 -8.734  4.424   1.00 0.00 ? 238 GLN A HB2  3  
ATOM 9270  H HB3  . GLN A 1 186 ? -25.730 -9.960  3.574   1.00 0.00 ? 238 GLN A HB3  3  
ATOM 9271  H HG2  . GLN A 1 186 ? -25.843 -10.574 5.916   1.00 0.00 ? 238 GLN A HG2  3  
ATOM 9272  H HG3  . GLN A 1 186 ? -24.178 -10.095 5.529   1.00 0.00 ? 238 GLN A HG3  3  
ATOM 9273  H HE21 . GLN A 1 186 ? -27.294 -8.688  6.669   1.00 0.00 ? 238 GLN A HE21 3  
ATOM 9274  H HE22 . GLN A 1 186 ? -26.568 -7.565  7.801   1.00 0.00 ? 238 GLN A HE22 3  
ATOM 9275  N N    . LEU A 1 187 ? -22.373 -7.808  4.032   1.00 0.00 ? 239 LEU A N    3  
ATOM 9276  C CA   . LEU A 1 187 ? -20.963 -7.994  3.727   1.00 0.00 ? 239 LEU A CA   3  
ATOM 9277  C C    . LEU A 1 187 ? -20.119 -7.610  4.939   1.00 0.00 ? 239 LEU A C    3  
ATOM 9278  O O    . LEU A 1 187 ? -20.614 -6.971  5.866   1.00 0.00 ? 239 LEU A O    3  
ATOM 9279  C CB   . LEU A 1 187 ? -20.586 -7.089  2.548   1.00 0.00 ? 239 LEU A CB   3  
ATOM 9280  C CG   . LEU A 1 187 ? -21.280 -7.478  1.238   1.00 0.00 ? 239 LEU A CG   3  
ATOM 9281  C CD1  . LEU A 1 187 ? -20.990 -6.410  0.191   1.00 0.00 ? 239 LEU A CD1  3  
ATOM 9282  C CD2  . LEU A 1 187 ? -20.773 -8.825  0.726   1.00 0.00 ? 239 LEU A CD2  3  
ATOM 9283  H H    . LEU A 1 187 ? -22.611 -7.073  4.682   1.00 0.00 ? 239 LEU A H    3  
ATOM 9284  H HA   . LEU A 1 187 ? -20.761 -9.033  3.468   1.00 0.00 ? 239 LEU A HA   3  
ATOM 9285  H HB2  . LEU A 1 187 ? -20.855 -6.063  2.800   1.00 0.00 ? 239 LEU A HB2  3  
ATOM 9286  H HB3  . LEU A 1 187 ? -19.506 -7.135  2.395   1.00 0.00 ? 239 LEU A HB3  3  
ATOM 9287  H HG   . LEU A 1 187 ? -22.359 -7.524  1.387   1.00 0.00 ? 239 LEU A HG   3  
ATOM 9288  H HD11 . LEU A 1 187 ? -19.913 -6.282  0.087   1.00 0.00 ? 239 LEU A HD11 3  
ATOM 9289  H HD12 . LEU A 1 187 ? -21.421 -6.706  -0.765  1.00 0.00 ? 239 LEU A HD12 3  
ATOM 9290  H HD13 . LEU A 1 187 ? -21.434 -5.466  0.508   1.00 0.00 ? 239 LEU A HD13 3  
ATOM 9291  H HD21 . LEU A 1 187 ? -21.017 -9.611  1.440   1.00 0.00 ? 239 LEU A HD21 3  
ATOM 9292  H HD22 . LEU A 1 187 ? -21.252 -9.051  -0.227  1.00 0.00 ? 239 LEU A HD22 3  
ATOM 9293  H HD23 . LEU A 1 187 ? -19.692 -8.781  0.588   1.00 0.00 ? 239 LEU A HD23 3  
ATOM 9294  N N    . GLN A 1 188 ? -18.843 -8.000  4.932   1.00 0.00 ? 240 GLN A N    3  
ATOM 9295  C CA   . GLN A 1 188 ? -17.902 -7.630  5.979   1.00 0.00 ? 240 GLN A CA   3  
ATOM 9296  C C    . GLN A 1 188 ? -16.552 -7.304  5.348   1.00 0.00 ? 240 GLN A C    3  
ATOM 9297  O O    . GLN A 1 188 ? -16.047 -8.067  4.526   1.00 0.00 ? 240 GLN A O    3  
ATOM 9298  C CB   . GLN A 1 188 ? -17.764 -8.763  7.001   1.00 0.00 ? 240 GLN A CB   3  
ATOM 9299  C CG   . GLN A 1 188 ? -19.109 -9.103  7.643   1.00 0.00 ? 240 GLN A CG   3  
ATOM 9300  C CD   . GLN A 1 188 ? -18.933 -10.104 8.775   1.00 0.00 ? 240 GLN A CD   3  
ATOM 9301  O OE1  . GLN A 1 188 ? -19.076 -11.308 8.579   1.00 0.00 ? 240 GLN A OE1  3  
ATOM 9302  N NE2  . GLN A 1 188 ? -18.619 -9.612  9.971   1.00 0.00 ? 240 GLN A NE2  3  
ATOM 9303  H H    . GLN A 1 188 ? -18.501 -8.572  4.173   1.00 0.00 ? 240 GLN A H    3  
ATOM 9304  H HA   . GLN A 1 188 ? -18.270 -6.741  6.491   1.00 0.00 ? 240 GLN A HA   3  
ATOM 9305  H HB2  . GLN A 1 188 ? -17.366 -9.653  6.512   1.00 0.00 ? 240 GLN A HB2  3  
ATOM 9306  H HB3  . GLN A 1 188 ? -17.069 -8.445  7.779   1.00 0.00 ? 240 GLN A HB3  3  
ATOM 9307  H HG2  . GLN A 1 188 ? -19.559 -8.193  8.041   1.00 0.00 ? 240 GLN A HG2  3  
ATOM 9308  H HG3  . GLN A 1 188 ? -19.776 -9.529  6.893   1.00 0.00 ? 240 GLN A HG3  3  
ATOM 9309  H HE21 . GLN A 1 188 ? -18.520 -8.615  10.093  1.00 0.00 ? 240 GLN A HE21 3  
ATOM 9310  H HE22 . GLN A 1 188 ? -18.483 -10.239 10.752  1.00 0.00 ? 240 GLN A HE22 3  
ATOM 9311  N N    . HIS A 1 189 ? -15.968 -6.167  5.735   1.00 0.00 ? 241 HIS A N    3  
ATOM 9312  C CA   . HIS A 1 189 ? -14.688 -5.722  5.209   1.00 0.00 ? 241 HIS A CA   3  
ATOM 9313  C C    . HIS A 1 189 ? -14.046 -4.747  6.191   1.00 0.00 ? 241 HIS A C    3  
ATOM 9314  O O    . HIS A 1 189 ? -14.700 -3.818  6.659   1.00 0.00 ? 241 HIS A O    3  
ATOM 9315  C CB   . HIS A 1 189 ? -14.897 -5.059  3.843   1.00 0.00 ? 241 HIS A CB   3  
ATOM 9316  C CG   . HIS A 1 189 ? -15.840 -3.880  3.857   1.00 0.00 ? 241 HIS A CG   3  
ATOM 9317  N ND1  . HIS A 1 189 ? -15.474 -2.555  3.613   1.00 0.00 ? 241 HIS A ND1  3  
ATOM 9318  C CD2  . HIS A 1 189 ? -17.182 -3.932  4.103   1.00 0.00 ? 241 HIS A CD2  3  
ATOM 9319  C CE1  . HIS A 1 189 ? -16.609 -1.844  3.716   1.00 0.00 ? 241 HIS A CE1  3  
ATOM 9320  N NE2  . HIS A 1 189 ? -17.649 -2.643  4.007   1.00 0.00 ? 241 HIS A NE2  3  
ATOM 9321  H H    . HIS A 1 189 ? -16.424 -5.582  6.420   1.00 0.00 ? 241 HIS A H    3  
ATOM 9322  H HA   . HIS A 1 189 ? -14.030 -6.581  5.086   1.00 0.00 ? 241 HIS A HA   3  
ATOM 9323  H HB2  . HIS A 1 189 ? -13.929 -4.724  3.471   1.00 0.00 ? 241 HIS A HB2  3  
ATOM 9324  H HB3  . HIS A 1 189 ? -15.289 -5.805  3.150   1.00 0.00 ? 241 HIS A HB3  3  
ATOM 9325  H HD2  . HIS A 1 189 ? -17.765 -4.812  4.327   1.00 0.00 ? 241 HIS A HD2  3  
ATOM 9326  H HE1  . HIS A 1 189 ? -16.680 -0.774  3.582   1.00 0.00 ? 241 HIS A HE1  3  
ATOM 9327  H HE2  . HIS A 1 189 ? -18.606 -2.344  4.133   1.00 0.00 ? 241 HIS A HE2  3  
ATOM 9328  N N    . GLY A 1 190 ? -12.763 -4.951  6.507   1.00 0.00 ? 242 GLY A N    3  
ATOM 9329  C CA   . GLY A 1 190 ? -12.073 -4.102  7.467   1.00 0.00 ? 242 GLY A CA   3  
ATOM 9330  C C    . GLY A 1 190 ? -12.822 -4.083  8.797   1.00 0.00 ? 242 GLY A C    3  
ATOM 9331  O O    . GLY A 1 190 ? -13.263 -5.121  9.283   1.00 0.00 ? 242 GLY A O    3  
ATOM 9332  H H    . GLY A 1 190 ? -12.252 -5.711  6.080   1.00 0.00 ? 242 GLY A H    3  
ATOM 9333  H HA2  . GLY A 1 190 ? -11.061 -4.472  7.629   1.00 0.00 ? 242 GLY A HA2  3  
ATOM 9334  H HA3  . GLY A 1 190 ? -12.022 -3.087  7.075   1.00 0.00 ? 242 GLY A HA3  3  
ATOM 9335  N N    . GLU A 1 191 ? -12.962 -2.890  9.385   1.00 0.00 ? 243 GLU A N    3  
ATOM 9336  C CA   . GLU A 1 191 ? -13.702 -2.696  10.625  1.00 0.00 ? 243 GLU A CA   3  
ATOM 9337  C C    . GLU A 1 191 ? -15.161 -2.324  10.336  1.00 0.00 ? 243 GLU A C    3  
ATOM 9338  O O    . GLU A 1 191 ? -15.867 -1.848  11.225  1.00 0.00 ? 243 GLU A O    3  
ATOM 9339  C CB   . GLU A 1 191 ? -13.016 -1.634  11.492  1.00 0.00 ? 243 GLU A CB   3  
ATOM 9340  C CG   . GLU A 1 191 ? -11.641 -2.088  11.992  1.00 0.00 ? 243 GLU A CG   3  
ATOM 9341  C CD   . GLU A 1 191 ? -10.611 -2.201  10.867  1.00 0.00 ? 243 GLU A CD   3  
ATOM 9342  O OE1  . GLU A 1 191 ? -10.381 -1.176  10.188  1.00 0.00 ? 243 GLU A OE1  3  
ATOM 9343  O OE2  . GLU A 1 191 ? -10.062 -3.313  10.696  1.00 0.00 ? 243 GLU A OE2  3  
ATOM 9344  H H    . GLU A 1 191 ? -12.542 -2.078  8.957   1.00 0.00 ? 243 GLU A H    3  
ATOM 9345  H HA   . GLU A 1 191 ? -13.705 -3.636  11.176  1.00 0.00 ? 243 GLU A HA   3  
ATOM 9346  H HB2  . GLU A 1 191 ? -12.913 -0.710  10.925  1.00 0.00 ? 243 GLU A HB2  3  
ATOM 9347  H HB3  . GLU A 1 191 ? -13.641 -1.440  12.363  1.00 0.00 ? 243 GLU A HB3  3  
ATOM 9348  H HG2  . GLU A 1 191 ? -11.280 -1.361  12.719  1.00 0.00 ? 243 GLU A HG2  3  
ATOM 9349  H HG3  . GLU A 1 191 ? -11.744 -3.052  12.490  1.00 0.00 ? 243 GLU A HG3  3  
ATOM 9350  N N    . ILE A 1 192 ? -15.616 -2.540  9.096   1.00 0.00 ? 244 ILE A N    3  
ATOM 9351  C CA   . ILE A 1 192 ? -16.959 -2.190  8.654   1.00 0.00 ? 244 ILE A CA   3  
ATOM 9352  C C    . ILE A 1 192 ? -17.785 -3.456  8.432   1.00 0.00 ? 244 ILE A C    3  
ATOM 9353  O O    . ILE A 1 192 ? -17.250 -4.504  8.069   1.00 0.00 ? 244 ILE A O    3  
ATOM 9354  C CB   . ILE A 1 192 ? -16.881 -1.343  7.376   1.00 0.00 ? 244 ILE A CB   3  
ATOM 9355  C CG1  . ILE A 1 192 ? -15.993 -0.112  7.602   1.00 0.00 ? 244 ILE A CG1  3  
ATOM 9356  C CG2  . ILE A 1 192 ? -18.284 -0.909  6.934   1.00 0.00 ? 244 ILE A CG2  3  
ATOM 9357  C CD1  . ILE A 1 192 ? -15.769 0.658   6.300   1.00 0.00 ? 244 ILE A CD1  3  
ATOM 9358  H H    . ILE A 1 192 ? -15.004 -2.969  8.415   1.00 0.00 ? 244 ILE A H    3  
ATOM 9359  H HA   . ILE A 1 192 ? -17.445 -1.595  9.427   1.00 0.00 ? 244 ILE A HA   3  
ATOM 9360  H HB   . ILE A 1 192 ? -16.439 -1.949  6.585   1.00 0.00 ? 244 ILE A HB   3  
ATOM 9361  H HG12 . ILE A 1 192 ? -16.457 0.544   8.338   1.00 0.00 ? 244 ILE A HG12 3  
ATOM 9362  H HG13 . ILE A 1 192 ? -15.021 -0.433  7.976   1.00 0.00 ? 244 ILE A HG13 3  
ATOM 9363  H HG21 . ILE A 1 192 ? -18.749 -0.317  7.723   1.00 0.00 ? 244 ILE A HG21 3  
ATOM 9364  H HG22 . ILE A 1 192 ? -18.222 -0.313  6.023   1.00 0.00 ? 244 ILE A HG22 3  
ATOM 9365  H HG23 . ILE A 1 192 ? -18.899 -1.784  6.725   1.00 0.00 ? 244 ILE A HG23 3  
ATOM 9366  H HD11 . ILE A 1 192 ? -16.708 1.087   5.951   1.00 0.00 ? 244 ILE A HD11 3  
ATOM 9367  H HD12 . ILE A 1 192 ? -15.056 1.465   6.475   1.00 0.00 ? 244 ILE A HD12 3  
ATOM 9368  H HD13 . ILE A 1 192 ? -15.370 -0.018  5.544   1.00 0.00 ? 244 ILE A HD13 3  
ATOM 9369  N N    . ASP A 1 193 ? -19.098 -3.355  8.651   1.00 0.00 ? 245 ASP A N    3  
ATOM 9370  C CA   . ASP A 1 193 ? -20.007 -4.477  8.476   1.00 0.00 ? 245 ASP A CA   3  
ATOM 9371  C C    . ASP A 1 193 ? -21.320 -4.007  7.852   1.00 0.00 ? 245 ASP A C    3  
ATOM 9372  O O    . ASP A 1 193 ? -21.665 -2.831  7.942   1.00 0.00 ? 245 ASP A O    3  
ATOM 9373  C CB   . ASP A 1 193 ? -20.289 -5.133  9.831   1.00 0.00 ? 245 ASP A CB   3  
ATOM 9374  C CG   . ASP A 1 193 ? -19.022 -5.690  10.476  1.00 0.00 ? 245 ASP A CG   3  
ATOM 9375  O OD1  . ASP A 1 193 ? -18.620 -6.811  10.089  1.00 0.00 ? 245 ASP A OD1  3  
ATOM 9376  O OD2  . ASP A 1 193 ? -18.464 -4.993  11.351  1.00 0.00 ? 245 ASP A OD2  3  
ATOM 9377  H H    . ASP A 1 193 ? -19.491 -2.474  8.949   1.00 0.00 ? 245 ASP A H    3  
ATOM 9378  H HA   . ASP A 1 193 ? -19.550 -5.215  7.816   1.00 0.00 ? 245 ASP A HA   3  
ATOM 9379  H HB2  . ASP A 1 193 ? -20.736 -4.395  10.496  1.00 0.00 ? 245 ASP A HB2  3  
ATOM 9380  H HB3  . ASP A 1 193 ? -21.001 -5.946  9.686   1.00 0.00 ? 245 ASP A HB3  3  
ATOM 9381  N N    . LYS A 1 194 ? -22.036 -4.946  7.222   1.00 0.00 ? 246 LYS A N    3  
ATOM 9382  C CA   . LYS A 1 194 ? -23.375 -4.800  6.650   1.00 0.00 ? 246 LYS A CA   3  
ATOM 9383  C C    . LYS A 1 194 ? -23.607 -3.591  5.733   1.00 0.00 ? 246 LYS A C    3  
ATOM 9384  O O    . LYS A 1 194 ? -24.754 -3.341  5.364   1.00 0.00 ? 246 LYS A O    3  
ATOM 9385  C CB   . LYS A 1 194 ? -24.446 -4.923  7.737   1.00 0.00 ? 246 LYS A CB   3  
ATOM 9386  C CG   . LYS A 1 194 ? -24.367 -3.754  8.711   1.00 0.00 ? 246 LYS A CG   3  
ATOM 9387  C CD   . LYS A 1 194 ? -25.519 -3.800  9.704   1.00 0.00 ? 246 LYS A CD   3  
ATOM 9388  C CE   . LYS A 1 194 ? -25.301 -2.605  10.619  1.00 0.00 ? 246 LYS A CE   3  
ATOM 9389  N NZ   . LYS A 1 194 ? -26.350 -2.507  11.652  1.00 0.00 ? 246 LYS A NZ   3  
ATOM 9390  H H    . LYS A 1 194 ? -21.618 -5.861  7.132   1.00 0.00 ? 246 LYS A H    3  
ATOM 9391  H HA   . LYS A 1 194 ? -23.517 -5.672  6.012   1.00 0.00 ? 246 LYS A HA   3  
ATOM 9392  H HB2  . LYS A 1 194 ? -25.430 -4.935  7.270   1.00 0.00 ? 246 LYS A HB2  3  
ATOM 9393  H HB3  . LYS A 1 194 ? -24.303 -5.853  8.286   1.00 0.00 ? 246 LYS A HB3  3  
ATOM 9394  H HG2  . LYS A 1 194 ? -23.431 -3.813  9.268   1.00 0.00 ? 246 LYS A HG2  3  
ATOM 9395  H HG3  . LYS A 1 194 ? -24.405 -2.816  8.158   1.00 0.00 ? 246 LYS A HG3  3  
ATOM 9396  H HD2  . LYS A 1 194 ? -26.471 -3.710  9.184   1.00 0.00 ? 246 LYS A HD2  3  
ATOM 9397  H HD3  . LYS A 1 194 ? -25.484 -4.726  10.279  1.00 0.00 ? 246 LYS A HD3  3  
ATOM 9398  H HE2  . LYS A 1 194 ? -24.322 -2.712  11.086  1.00 0.00 ? 246 LYS A HE2  3  
ATOM 9399  H HE3  . LYS A 1 194 ? -25.293 -1.704  10.005  1.00 0.00 ? 246 LYS A HE3  3  
ATOM 9400  H HZ1  . LYS A 1 194 ? -26.351 -3.342  12.220  1.00 0.00 ? 246 LYS A HZ1  3  
ATOM 9401  H HZ2  . LYS A 1 194 ? -26.177 -1.708  12.245  1.00 0.00 ? 246 LYS A HZ2  3  
ATOM 9402  H HZ3  . LYS A 1 194 ? -27.255 -2.403  11.216  1.00 0.00 ? 246 LYS A HZ3  3  
ATOM 9403  N N    . ARG A 1 195 ? -22.567 -2.838  5.353   1.00 0.00 ? 247 ARG A N    3  
ATOM 9404  C CA   . ARG A 1 195 ? -22.735 -1.746  4.400   1.00 0.00 ? 247 ARG A CA   3  
ATOM 9405  C C    . ARG A 1 195 ? -21.538 -1.572  3.467   1.00 0.00 ? 247 ARG A C    3  
ATOM 9406  O O    . ARG A 1 195 ? -20.391 -1.796  3.849   1.00 0.00 ? 247 ARG A O    3  
ATOM 9407  C CB   . ARG A 1 195 ? -23.053 -0.435  5.130   1.00 0.00 ? 247 ARG A CB   3  
ATOM 9408  C CG   . ARG A 1 195 ? -21.872 0.058   5.968   1.00 0.00 ? 247 ARG A CG   3  
ATOM 9409  C CD   . ARG A 1 195 ? -22.214 1.380   6.657   1.00 0.00 ? 247 ARG A CD   3  
ATOM 9410  N NE   . ARG A 1 195 ? -23.326 1.225   7.601   1.00 0.00 ? 247 ARG A NE   3  
ATOM 9411  C CZ   . ARG A 1 195 ? -23.923 2.246   8.223   1.00 0.00 ? 247 ARG A CZ   3  
ATOM 9412  N NH1  . ARG A 1 195 ? -23.517 3.499   8.024   1.00 0.00 ? 247 ARG A NH1  3  
ATOM 9413  N NH2  . ARG A 1 195 ? -24.935 2.017   9.054   1.00 0.00 ? 247 ARG A NH2  3  
ATOM 9414  H H    . ARG A 1 195 ? -21.649 -3.025  5.730   1.00 0.00 ? 247 ARG A H    3  
ATOM 9415  H HA   . ARG A 1 195 ? -23.595 -1.985  3.775   1.00 0.00 ? 247 ARG A HA   3  
ATOM 9416  H HB2  . ARG A 1 195 ? -23.301 0.328   4.392   1.00 0.00 ? 247 ARG A HB2  3  
ATOM 9417  H HB3  . ARG A 1 195 ? -23.919 -0.590  5.775   1.00 0.00 ? 247 ARG A HB3  3  
ATOM 9418  H HG2  . ARG A 1 195 ? -21.624 -0.688  6.723   1.00 0.00 ? 247 ARG A HG2  3  
ATOM 9419  H HG3  . ARG A 1 195 ? -21.008 0.216   5.323   1.00 0.00 ? 247 ARG A HG3  3  
ATOM 9420  H HD2  . ARG A 1 195 ? -21.336 1.733   7.200   1.00 0.00 ? 247 ARG A HD2  3  
ATOM 9421  H HD3  . ARG A 1 195 ? -22.480 2.116   5.899   1.00 0.00 ? 247 ARG A HD3  3  
ATOM 9422  H HE   . ARG A 1 195 ? -23.656 0.288   7.785   1.00 0.00 ? 247 ARG A HE   3  
ATOM 9423  H HH11 . ARG A 1 195 ? -22.749 3.686   7.395   1.00 0.00 ? 247 ARG A HH11 3  
ATOM 9424  H HH12 . ARG A 1 195 ? -23.977 4.262   8.500   1.00 0.00 ? 247 ARG A HH12 3  
ATOM 9425  H HH21 . ARG A 1 195 ? -25.253 1.072   9.215   1.00 0.00 ? 247 ARG A HH21 3  
ATOM 9426  H HH22 . ARG A 1 195 ? -25.384 2.789   9.526   1.00 0.00 ? 247 ARG A HH22 3  
ATOM 9427  N N    . VAL A 1 196 ? -21.853 -1.164  2.235   1.00 0.00 ? 248 VAL A N    3  
ATOM 9428  C CA   . VAL A 1 196 ? -20.866 -0.853  1.206   1.00 0.00 ? 248 VAL A CA   3  
ATOM 9429  C C    . VAL A 1 196 ? -21.442 0.234   0.310   1.00 0.00 ? 248 VAL A C    3  
ATOM 9430  O O    . VAL A 1 196 ? -22.580 0.654   0.504   1.00 0.00 ? 248 VAL A O    3  
ATOM 9431  C CB   . VAL A 1 196 ? -20.533 -2.093  0.363   1.00 0.00 ? 248 VAL A CB   3  
ATOM 9432  C CG1  . VAL A 1 196 ? -19.835 -3.168  1.194   1.00 0.00 ? 248 VAL A CG1  3  
ATOM 9433  C CG2  . VAL A 1 196 ? -21.791 -2.692  -0.271  1.00 0.00 ? 248 VAL A CG2  3  
ATOM 9434  H H    . VAL A 1 196 ? -22.827 -1.055  1.990   1.00 0.00 ? 248 VAL A H    3  
ATOM 9435  H HA   . VAL A 1 196 ? -19.953 -0.458  1.652   1.00 0.00 ? 248 VAL A HA   3  
ATOM 9436  H HB   . VAL A 1 196 ? -19.855 -1.793  -0.435  1.00 0.00 ? 248 VAL A HB   3  
ATOM 9437  H HG11 . VAL A 1 196 ? -20.516 -3.559  1.950   1.00 0.00 ? 248 VAL A HG11 3  
ATOM 9438  H HG12 . VAL A 1 196 ? -19.523 -3.982  0.540   1.00 0.00 ? 248 VAL A HG12 3  
ATOM 9439  H HG13 . VAL A 1 196 ? -18.955 -2.741  1.675   1.00 0.00 ? 248 VAL A HG13 3  
ATOM 9440  H HG21 . VAL A 1 196 ? -22.290 -1.940  -0.882  1.00 0.00 ? 248 VAL A HG21 3  
ATOM 9441  H HG22 . VAL A 1 196 ? -21.510 -3.534  -0.903  1.00 0.00 ? 248 VAL A HG22 3  
ATOM 9442  H HG23 . VAL A 1 196 ? -22.472 -3.039  0.506   1.00 0.00 ? 248 VAL A HG23 3  
ATOM 9443  N N    . GLU A 1 197 ? -20.667 0.694   -0.673  1.00 0.00 ? 249 GLU A N    3  
ATOM 9444  C CA   . GLU A 1 197 ? -21.154 1.678   -1.624  1.00 0.00 ? 249 GLU A CA   3  
ATOM 9445  C C    . GLU A 1 197 ? -20.770 1.263   -3.043  1.00 0.00 ? 249 GLU A C    3  
ATOM 9446  O O    . GLU A 1 197 ? -19.612 0.943   -3.297  1.00 0.00 ? 249 GLU A O    3  
ATOM 9447  C CB   . GLU A 1 197 ? -20.575 3.049   -1.274  1.00 0.00 ? 249 GLU A CB   3  
ATOM 9448  C CG   . GLU A 1 197 ? -21.047 3.525   0.101   1.00 0.00 ? 249 GLU A CG   3  
ATOM 9449  C CD   . GLU A 1 197 ? -20.521 4.928   0.393   1.00 0.00 ? 249 GLU A CD   3  
ATOM 9450  O OE1  . GLU A 1 197 ? -19.371 5.023   0.878   1.00 0.00 ? 249 GLU A OE1  3  
ATOM 9451  O OE2  . GLU A 1 197 ? -21.269 5.895   0.129   1.00 0.00 ? 249 GLU A OE2  3  
ATOM 9452  H H    . GLU A 1 197 ? -19.719 0.362   -0.775  1.00 0.00 ? 249 GLU A H    3  
ATOM 9453  H HA   . GLU A 1 197 ? -22.241 1.733   -1.565  1.00 0.00 ? 249 GLU A HA   3  
ATOM 9454  H HB2  . GLU A 1 197 ? -19.488 3.000   -1.289  1.00 0.00 ? 249 GLU A HB2  3  
ATOM 9455  H HB3  . GLU A 1 197 ? -20.906 3.767   -2.025  1.00 0.00 ? 249 GLU A HB3  3  
ATOM 9456  H HG2  . GLU A 1 197 ? -22.137 3.536   0.120   1.00 0.00 ? 249 GLU A HG2  3  
ATOM 9457  H HG3  . GLU A 1 197 ? -20.688 2.840   0.868   1.00 0.00 ? 249 GLU A HG3  3  
ATOM 9458  N N    . VAL A 1 198 ? -21.736 1.269   -3.970  1.00 0.00 ? 250 VAL A N    3  
ATOM 9459  C CA   . VAL A 1 198 ? -21.487 0.896   -5.359  1.00 0.00 ? 250 VAL A CA   3  
ATOM 9460  C C    . VAL A 1 198 ? -22.334 1.760   -6.291  1.00 0.00 ? 250 VAL A C    3  
ATOM 9461  O O    . VAL A 1 198 ? -23.542 1.879   -6.097  1.00 0.00 ? 250 VAL A O    3  
ATOM 9462  C CB   . VAL A 1 198 ? -21.803 -0.588  -5.589  1.00 0.00 ? 250 VAL A CB   3  
ATOM 9463  C CG1  . VAL A 1 198 ? -21.298 -1.005  -6.969  1.00 0.00 ? 250 VAL A CG1  3  
ATOM 9464  C CG2  . VAL A 1 198 ? -21.125 -1.492  -4.558  1.00 0.00 ? 250 VAL A CG2  3  
ATOM 9465  H H    . VAL A 1 198 ? -22.674 1.540   -3.712  1.00 0.00 ? 250 VAL A H    3  
ATOM 9466  H HA   . VAL A 1 198 ? -20.434 1.065   -5.582  1.00 0.00 ? 250 VAL A HA   3  
ATOM 9467  H HB   . VAL A 1 198 ? -22.881 -0.741  -5.538  1.00 0.00 ? 250 VAL A HB   3  
ATOM 9468  H HG11 . VAL A 1 198 ? -21.515 -2.060  -7.134  1.00 0.00 ? 250 VAL A HG11 3  
ATOM 9469  H HG12 . VAL A 1 198 ? -21.794 -0.413  -7.740  1.00 0.00 ? 250 VAL A HG12 3  
ATOM 9470  H HG13 . VAL A 1 198 ? -20.221 -0.849  -7.026  1.00 0.00 ? 250 VAL A HG13 3  
ATOM 9471  H HG21 . VAL A 1 198 ? -21.342 -2.533  -4.792  1.00 0.00 ? 250 VAL A HG21 3  
ATOM 9472  H HG22 . VAL A 1 198 ? -20.047 -1.333  -4.583  1.00 0.00 ? 250 VAL A HG22 3  
ATOM 9473  H HG23 . VAL A 1 198 ? -21.510 -1.269  -3.561  1.00 0.00 ? 250 VAL A HG23 3  
ATOM 9474  N N    . LYS A 1 199 ? -21.691 2.357   -7.300  1.00 0.00 ? 251 LYS A N    3  
ATOM 9475  C CA   . LYS A 1 199 ? -22.364 3.226   -8.265  1.00 0.00 ? 251 LYS A CA   3  
ATOM 9476  C C    . LYS A 1 199 ? -21.607 3.214   -9.595  1.00 0.00 ? 251 LYS A C    3  
ATOM 9477  O O    . LYS A 1 199 ? -20.473 2.744   -9.636  1.00 0.00 ? 251 LYS A O    3  
ATOM 9478  C CB   . LYS A 1 199 ? -22.401 4.668   -7.748  1.00 0.00 ? 251 LYS A CB   3  
ATOM 9479  C CG   . LYS A 1 199 ? -23.000 4.802   -6.349  1.00 0.00 ? 251 LYS A CG   3  
ATOM 9480  C CD   . LYS A 1 199 ? -22.990 6.270   -5.924  1.00 0.00 ? 251 LYS A CD   3  
ATOM 9481  C CE   . LYS A 1 199 ? -23.468 6.405   -4.478  1.00 0.00 ? 251 LYS A CE   3  
ATOM 9482  N NZ   . LYS A 1 199 ? -24.885 6.025   -4.336  1.00 0.00 ? 251 LYS A NZ   3  
ATOM 9483  H H    . LYS A 1 199 ? -20.698 2.207   -7.412  1.00 0.00 ? 251 LYS A H    3  
ATOM 9484  H HA   . LYS A 1 199 ? -23.382 2.871   -8.423  1.00 0.00 ? 251 LYS A HA   3  
ATOM 9485  H HB2  . LYS A 1 199 ? -21.386 5.066   -7.735  1.00 0.00 ? 251 LYS A HB2  3  
ATOM 9486  H HB3  . LYS A 1 199 ? -23.003 5.256   -8.440  1.00 0.00 ? 251 LYS A HB3  3  
ATOM 9487  H HG2  . LYS A 1 199 ? -24.024 4.427   -6.351  1.00 0.00 ? 251 LYS A HG2  3  
ATOM 9488  H HG3  . LYS A 1 199 ? -22.400 4.232   -5.638  1.00 0.00 ? 251 LYS A HG3  3  
ATOM 9489  H HD2  . LYS A 1 199 ? -21.973 6.655   -5.994  1.00 0.00 ? 251 LYS A HD2  3  
ATOM 9490  H HD3  . LYS A 1 199 ? -23.638 6.850   -6.582  1.00 0.00 ? 251 LYS A HD3  3  
ATOM 9491  H HE2  . LYS A 1 199 ? -22.853 5.767   -3.843  1.00 0.00 ? 251 LYS A HE2  3  
ATOM 9492  H HE3  . LYS A 1 199 ? -23.338 7.439   -4.158  1.00 0.00 ? 251 LYS A HE3  3  
ATOM 9493  H HZ1  . LYS A 1 199 ? -25.169 6.124   -3.371  1.00 0.00 ? 251 LYS A HZ1  3  
ATOM 9494  H HZ2  . LYS A 1 199 ? -25.462 6.622   -4.911  1.00 0.00 ? 251 LYS A HZ2  3  
ATOM 9495  H HZ3  . LYS A 1 199 ? -25.015 5.065   -4.621  1.00 0.00 ? 251 LYS A HZ3  3  
ATOM 9496  N N    . PRO A 1 200 ? -22.200 3.719   -10.686 1.00 0.00 ? 252 PRO A N    3  
ATOM 9497  C CA   . PRO A 1 200 ? -21.517 3.877   -11.960 1.00 0.00 ? 252 PRO A CA   3  
ATOM 9498  C C    . PRO A 1 200 ? -20.250 4.718   -11.820 1.00 0.00 ? 252 PRO A C    3  
ATOM 9499  O O    . PRO A 1 200 ? -20.149 5.554   -10.924 1.00 0.00 ? 252 PRO A O    3  
ATOM 9500  C CB   . PRO A 1 200 ? -22.530 4.557   -12.887 1.00 0.00 ? 252 PRO A CB   3  
ATOM 9501  C CG   . PRO A 1 200 ? -23.878 4.178   -12.276 1.00 0.00 ? 252 PRO A CG   3  
ATOM 9502  C CD   . PRO A 1 200 ? -23.575 4.171   -10.781 1.00 0.00 ? 252 PRO A CD   3  
ATOM 9503  H HA   . PRO A 1 200 ? -21.263 2.895   -12.360 1.00 0.00 ? 252 PRO A HA   3  
ATOM 9504  H HB2  . PRO A 1 200 ? -22.405 5.639   -12.835 1.00 0.00 ? 252 PRO A HB2  3  
ATOM 9505  H HB3  . PRO A 1 200 ? -22.439 4.204   -13.915 1.00 0.00 ? 252 PRO A HB3  3  
ATOM 9506  H HG2  . PRO A 1 200 ? -24.654 4.902   -12.527 1.00 0.00 ? 252 PRO A HG2  3  
ATOM 9507  H HG3  . PRO A 1 200 ? -24.158 3.176   -12.600 1.00 0.00 ? 252 PRO A HG3  3  
ATOM 9508  H HD2  . PRO A 1 200 ? -23.655 5.185   -10.390 1.00 0.00 ? 252 PRO A HD2  3  
ATOM 9509  H HD3  . PRO A 1 200 ? -24.256 3.501   -10.258 1.00 0.00 ? 252 PRO A HD3  3  
ATOM 9510  N N    . TYR A 1 201 ? -19.278 4.498   -12.711 1.00 0.00 ? 253 TYR A N    3  
ATOM 9511  C CA   . TYR A 1 201 ? -18.024 5.228   -12.691 1.00 0.00 ? 253 TYR A CA   3  
ATOM 9512  C C    . TYR A 1 201 ? -18.196 6.624   -13.291 1.00 0.00 ? 253 TYR A C    3  
ATOM 9513  O O    . TYR A 1 201 ? -19.073 6.838   -14.129 1.00 0.00 ? 253 TYR A O    3  
ATOM 9514  C CB   . TYR A 1 201 ? -16.969 4.417   -13.437 1.00 0.00 ? 253 TYR A CB   3  
ATOM 9515  C CG   . TYR A 1 201 ? -15.579 4.991   -13.323 1.00 0.00 ? 253 TYR A CG   3  
ATOM 9516  C CD1  . TYR A 1 201 ? -14.921 4.961   -12.086 1.00 0.00 ? 253 TYR A CD1  3  
ATOM 9517  C CD2  . TYR A 1 201 ? -14.953 5.550   -14.446 1.00 0.00 ? 253 TYR A CD2  3  
ATOM 9518  C CE1  . TYR A 1 201 ? -13.632 5.496   -11.964 1.00 0.00 ? 253 TYR A CE1  3  
ATOM 9519  C CE2  . TYR A 1 201 ? -13.662 6.081   -14.333 1.00 0.00 ? 253 TYR A CE2  3  
ATOM 9520  C CZ   . TYR A 1 201 ? -12.995 6.058   -13.090 1.00 0.00 ? 253 TYR A CZ   3  
ATOM 9521  O OH   . TYR A 1 201 ? -11.739 6.578   -12.980 1.00 0.00 ? 253 TYR A OH   3  
ATOM 9522  H H    . TYR A 1 201 ? -19.398 3.803   -13.433 1.00 0.00 ? 253 TYR A H    3  
ATOM 9523  H HA   . TYR A 1 201 ? -17.697 5.332   -11.657 1.00 0.00 ? 253 TYR A HA   3  
ATOM 9524  H HB2  . TYR A 1 201 ? -16.952 3.411   -13.016 1.00 0.00 ? 253 TYR A HB2  3  
ATOM 9525  H HB3  . TYR A 1 201 ? -17.247 4.350   -14.488 1.00 0.00 ? 253 TYR A HB3  3  
ATOM 9526  H HD1  . TYR A 1 201 ? -15.407 4.526   -11.226 1.00 0.00 ? 253 TYR A HD1  3  
ATOM 9527  H HD2  . TYR A 1 201 ? -15.466 5.571   -15.397 1.00 0.00 ? 253 TYR A HD2  3  
ATOM 9528  H HE1  . TYR A 1 201 ? -13.134 5.476   -11.007 1.00 0.00 ? 253 TYR A HE1  3  
ATOM 9529  H HE2  . TYR A 1 201 ? -13.179 6.507   -15.200 1.00 0.00 ? 253 TYR A HE2  3  
ATOM 9530  H HH   . TYR A 1 201 ? -11.388 6.519   -12.088 1.00 0.00 ? 253 TYR A HH   3  
ATOM 9531  N N    . VAL A 1 202 ? -17.355 7.570   -12.856 1.00 0.00 ? 254 VAL A N    3  
ATOM 9532  C CA   . VAL A 1 202 ? -17.404 8.959   -13.301 1.00 0.00 ? 254 VAL A CA   3  
ATOM 9533  C C    . VAL A 1 202 ? -15.997 9.520   -13.481 1.00 0.00 ? 254 VAL A C    3  
ATOM 9534  O O    . VAL A 1 202 ? -15.847 10.392  -14.365 1.00 0.00 ? 254 VAL A O    3  
ATOM 9535  C CB   . VAL A 1 202 ? -18.205 9.821   -12.316 1.00 0.00 ? 254 VAL A CB   3  
ATOM 9536  C CG1  . VAL A 1 202 ? -19.669 9.382   -12.278 1.00 0.00 ? 254 VAL A CG1  3  
ATOM 9537  C CG2  . VAL A 1 202 ? -17.630 9.745   -10.900 1.00 0.00 ? 254 VAL A CG2  3  
ATOM 9538  H H    . VAL A 1 202 ? -16.642 7.325   -12.185 1.00 0.00 ? 254 VAL A H    3  
ATOM 9539  H HA   . VAL A 1 202 ? -17.901 8.998   -14.271 1.00 0.00 ? 254 VAL A HA   3  
ATOM 9540  H HB   . VAL A 1 202 ? -18.164 10.857  -12.653 1.00 0.00 ? 254 VAL A HB   3  
ATOM 9541  H HG11 . VAL A 1 202 ? -19.744 8.364   -11.894 1.00 0.00 ? 254 VAL A HG11 3  
ATOM 9542  H HG12 . VAL A 1 202 ? -20.233 10.052  -11.629 1.00 0.00 ? 254 VAL A HG12 3  
ATOM 9543  H HG13 . VAL A 1 202 ? -20.087 9.420   -13.284 1.00 0.00 ? 254 VAL A HG13 3  
ATOM 9544  H HG21 . VAL A 1 202 ? -17.673 8.719   -10.535 1.00 0.00 ? 254 VAL A HG21 3  
ATOM 9545  H HG22 . VAL A 1 202 ? -16.595 10.087  -10.901 1.00 0.00 ? 254 VAL A HG22 3  
ATOM 9546  H HG23 . VAL A 1 202 ? -18.215 10.384  -10.237 1.00 0.00 ? 254 VAL A HG23 3  
ATOM 9547  N N    . SER A 1 1   ? 28.288  -9.569  -12.210 1.00 0.00 ? 53  SER A N    4  
ATOM 9548  C CA   . SER A 1 1   ? 27.222  -8.551  -12.211 1.00 0.00 ? 53  SER A CA   4  
ATOM 9549  C C    . SER A 1 1   ? 25.848  -9.204  -12.102 1.00 0.00 ? 53  SER A C    4  
ATOM 9550  O O    . SER A 1 1   ? 25.721  -10.418 -12.260 1.00 0.00 ? 53  SER A O    4  
ATOM 9551  C CB   . SER A 1 1   ? 27.307  -7.685  -13.468 1.00 0.00 ? 53  SER A CB   4  
ATOM 9552  O OG   . SER A 1 1   ? 27.191  -8.498  -14.618 1.00 0.00 ? 53  SER A OG   4  
ATOM 9553  H H1   . SER A 1 1   ? 28.233  -10.124 -11.369 1.00 0.00 ? 53  SER A H1   4  
ATOM 9554  H H2   . SER A 1 1   ? 29.192  -9.118  -12.255 1.00 0.00 ? 53  SER A H2   4  
ATOM 9555  H H3   . SER A 1 1   ? 28.179  -10.171 -13.014 1.00 0.00 ? 53  SER A H3   4  
ATOM 9556  H HA   . SER A 1 1   ? 27.359  -7.906  -11.343 1.00 0.00 ? 53  SER A HA   4  
ATOM 9557  H HB2  . SER A 1 1   ? 26.504  -6.947  -13.461 1.00 0.00 ? 53  SER A HB2  4  
ATOM 9558  H HB3  . SER A 1 1   ? 28.267  -7.170  -13.487 1.00 0.00 ? 53  SER A HB3  4  
ATOM 9559  H HG   . SER A 1 1   ? 27.257  -7.937  -15.393 1.00 0.00 ? 53  SER A HG   4  
ATOM 9560  N N    . HIS A 1 2   ? 24.818  -8.393  -11.833 1.00 0.00 ? 54  HIS A N    4  
ATOM 9561  C CA   . HIS A 1 2   ? 23.438  -8.847  -11.700 1.00 0.00 ? 54  HIS A CA   4  
ATOM 9562  C C    . HIS A 1 2   ? 23.300  -10.012 -10.713 1.00 0.00 ? 54  HIS A C    4  
ATOM 9563  O O    . HIS A 1 2   ? 22.430  -10.868 -10.871 1.00 0.00 ? 54  HIS A O    4  
ATOM 9564  C CB   . HIS A 1 2   ? 22.851  -9.146  -13.082 1.00 0.00 ? 54  HIS A CB   4  
ATOM 9565  C CG   . HIS A 1 2   ? 21.359  -9.349  -13.063 1.00 0.00 ? 54  HIS A CG   4  
ATOM 9566  N ND1  . HIS A 1 2   ? 20.432  -8.478  -12.484 1.00 0.00 ? 54  HIS A ND1  4  
ATOM 9567  C CD2  . HIS A 1 2   ? 20.698  -10.413 -13.610 1.00 0.00 ? 54  HIS A CD2  4  
ATOM 9568  C CE1  . HIS A 1 2   ? 19.234  -9.046  -12.694 1.00 0.00 ? 54  HIS A CE1  4  
ATOM 9569  N NE2  . HIS A 1 2   ? 19.361  -10.203 -13.368 1.00 0.00 ? 54  HIS A NE2  4  
ATOM 9570  H H    . HIS A 1 2   ? 24.992  -7.404  -11.712 1.00 0.00 ? 54  HIS A H    4  
ATOM 9571  H HA   . HIS A 1 2   ? 22.873  -8.015  -11.279 1.00 0.00 ? 54  HIS A HA   4  
ATOM 9572  H HB2  . HIS A 1 2   ? 23.074  -8.309  -13.745 1.00 0.00 ? 54  HIS A HB2  4  
ATOM 9573  H HB3  . HIS A 1 2   ? 23.327  -10.039 -13.487 1.00 0.00 ? 54  HIS A HB3  4  
ATOM 9574  H HD2  . HIS A 1 2   ? 21.141  -11.249 -14.128 1.00 0.00 ? 54  HIS A HD2  4  
ATOM 9575  H HE1  . HIS A 1 2   ? 18.292  -8.630  -12.367 1.00 0.00 ? 54  HIS A HE1  4  
ATOM 9576  H HE2  . HIS A 1 2   ? 18.604  -10.812 -13.645 1.00 0.00 ? 54  HIS A HE2  4  
ATOM 9577  N N    . GLN A 1 3   ? 24.161  -10.049 -9.689  1.00 0.00 ? 55  GLN A N    4  
ATOM 9578  C CA   . GLN A 1 3   ? 24.154  -11.115 -8.697  1.00 0.00 ? 55  GLN A CA   4  
ATOM 9579  C C    . GLN A 1 3   ? 23.028  -10.918 -7.677  1.00 0.00 ? 55  GLN A C    4  
ATOM 9580  O O    . GLN A 1 3   ? 22.682  -11.848 -6.949  1.00 0.00 ? 55  GLN A O    4  
ATOM 9581  C CB   . GLN A 1 3   ? 25.533  -11.152 -8.028  1.00 0.00 ? 55  GLN A CB   4  
ATOM 9582  C CG   . GLN A 1 3   ? 25.692  -12.370 -7.114  1.00 0.00 ? 55  GLN A CG   4  
ATOM 9583  C CD   . GLN A 1 3   ? 27.101  -12.473 -6.539  1.00 0.00 ? 55  GLN A CD   4  
ATOM 9584  O OE1  . GLN A 1 3   ? 27.965  -11.640 -6.805  1.00 0.00 ? 55  GLN A OE1  4  
ATOM 9585  N NE2  . GLN A 1 3   ? 27.350  -13.506 -5.737  1.00 0.00 ? 55  GLN A NE2  4  
ATOM 9586  H H    . GLN A 1 3   ? 24.848  -9.316  -9.591  1.00 0.00 ? 55  GLN A H    4  
ATOM 9587  H HA   . GLN A 1 3   ? 23.992  -12.063 -9.211  1.00 0.00 ? 55  GLN A HA   4  
ATOM 9588  H HB2  . GLN A 1 3   ? 26.293  -11.200 -8.807  1.00 0.00 ? 55  GLN A HB2  4  
ATOM 9589  H HB3  . GLN A 1 3   ? 25.677  -10.240 -7.448  1.00 0.00 ? 55  GLN A HB3  4  
ATOM 9590  H HG2  . GLN A 1 3   ? 24.985  -12.301 -6.287  1.00 0.00 ? 55  GLN A HG2  4  
ATOM 9591  H HG3  . GLN A 1 3   ? 25.477  -13.275 -7.681  1.00 0.00 ? 55  GLN A HG3  4  
ATOM 9592  H HE21 . GLN A 1 3   ? 26.622  -14.177 -5.536  1.00 0.00 ? 55  GLN A HE21 4  
ATOM 9593  H HE22 . GLN A 1 3   ? 28.268  -13.614 -5.331  1.00 0.00 ? 55  GLN A HE22 4  
ATOM 9594  N N    . ASN A 1 4   ? 22.451  -9.713  -7.619  1.00 0.00 ? 56  ASN A N    4  
ATOM 9595  C CA   . ASN A 1 4   ? 21.372  -9.410  -6.692  1.00 0.00 ? 56  ASN A CA   4  
ATOM 9596  C C    . ASN A 1 4   ? 20.035  -9.853  -7.289  1.00 0.00 ? 56  ASN A C    4  
ATOM 9597  O O    . ASN A 1 4   ? 19.713  -9.508  -8.427  1.00 0.00 ? 56  ASN A O    4  
ATOM 9598  C CB   . ASN A 1 4   ? 21.394  -7.911  -6.375  1.00 0.00 ? 56  ASN A CB   4  
ATOM 9599  C CG   . ASN A 1 4   ? 20.365  -7.512  -5.324  1.00 0.00 ? 56  ASN A CG   4  
ATOM 9600  O OD1  . ASN A 1 4   ? 19.635  -8.344  -4.795  1.00 0.00 ? 56  ASN A OD1  4  
ATOM 9601  N ND2  . ASN A 1 4   ? 20.303  -6.220  -5.015  1.00 0.00 ? 56  ASN A ND2  4  
ATOM 9602  H H    . ASN A 1 4   ? 22.768  -8.979  -8.235  1.00 0.00 ? 56  ASN A H    4  
ATOM 9603  H HA   . ASN A 1 4   ? 21.539  -9.961  -5.767  1.00 0.00 ? 56  ASN A HA   4  
ATOM 9604  H HB2  . ASN A 1 4   ? 22.384  -7.639  -6.009  1.00 0.00 ? 56  ASN A HB2  4  
ATOM 9605  H HB3  . ASN A 1 4   ? 21.202  -7.347  -7.288  1.00 0.00 ? 56  ASN A HB3  4  
ATOM 9606  H HD21 . ASN A 1 4   ? 20.918  -5.561  -5.470  1.00 0.00 ? 56  ASN A HD21 4  
ATOM 9607  H HD22 . ASN A 1 4   ? 19.638  -5.904  -4.323  1.00 0.00 ? 56  ASN A HD22 4  
ATOM 9608  N N    . GLY A 1 5   ? 19.261  -10.618 -6.516  1.00 0.00 ? 57  GLY A N    4  
ATOM 9609  C CA   . GLY A 1 5   ? 17.964  -11.135 -6.935  1.00 0.00 ? 57  GLY A CA   4  
ATOM 9610  C C    . GLY A 1 5   ? 16.917  -10.966 -5.835  1.00 0.00 ? 57  GLY A C    4  
ATOM 9611  O O    . GLY A 1 5   ? 15.799  -11.460 -5.961  1.00 0.00 ? 57  GLY A O    4  
ATOM 9612  H H    . GLY A 1 5   ? 19.581  -10.859 -5.589  1.00 0.00 ? 57  GLY A H    4  
ATOM 9613  H HA2  . GLY A 1 5   ? 17.629  -10.600 -7.824  1.00 0.00 ? 57  GLY A HA2  4  
ATOM 9614  H HA3  . GLY A 1 5   ? 18.064  -12.195 -7.169  1.00 0.00 ? 57  GLY A HA3  4  
ATOM 9615  N N    . GLU A 1 6   ? 17.279  -10.268 -4.754  1.00 0.00 ? 58  GLU A N    4  
ATOM 9616  C CA   . GLU A 1 6   ? 16.405  -10.046 -3.611  1.00 0.00 ? 58  GLU A CA   4  
ATOM 9617  C C    . GLU A 1 6   ? 15.579  -8.769  -3.793  1.00 0.00 ? 58  GLU A C    4  
ATOM 9618  O O    . GLU A 1 6   ? 15.025  -8.240  -2.831  1.00 0.00 ? 58  GLU A O    4  
ATOM 9619  C CB   . GLU A 1 6   ? 17.228  -10.005 -2.317  1.00 0.00 ? 58  GLU A CB   4  
ATOM 9620  C CG   . GLU A 1 6   ? 17.811  -11.375 -1.958  1.00 0.00 ? 58  GLU A CG   4  
ATOM 9621  C CD   . GLU A 1 6   ? 18.839  -11.870 -2.978  1.00 0.00 ? 58  GLU A CD   4  
ATOM 9622  O OE1  . GLU A 1 6   ? 19.875  -11.189 -3.135  1.00 0.00 ? 58  GLU A OE1  4  
ATOM 9623  O OE2  . GLU A 1 6   ? 18.578  -12.928 -3.593  1.00 0.00 ? 58  GLU A OE2  4  
ATOM 9624  H H    . GLU A 1 6   ? 18.205  -9.867  -4.714  1.00 0.00 ? 58  GLU A H    4  
ATOM 9625  H HA   . GLU A 1 6   ? 15.708  -10.881 -3.543  1.00 0.00 ? 58  GLU A HA   4  
ATOM 9626  H HB2  . GLU A 1 6   ? 18.033  -9.277  -2.419  1.00 0.00 ? 58  GLU A HB2  4  
ATOM 9627  H HB3  . GLU A 1 6   ? 16.579  -9.692  -1.499  1.00 0.00 ? 58  GLU A HB3  4  
ATOM 9628  H HG2  . GLU A 1 6   ? 18.293  -11.304 -0.984  1.00 0.00 ? 58  GLU A HG2  4  
ATOM 9629  H HG3  . GLU A 1 6   ? 16.996  -12.096 -1.885  1.00 0.00 ? 58  GLU A HG3  4  
ATOM 9630  N N    . ARG A 1 7   ? 15.495  -8.269  -5.032  1.00 0.00 ? 59  ARG A N    4  
ATOM 9631  C CA   . ARG A 1 7   ? 14.788  -7.037  -5.355  1.00 0.00 ? 59  ARG A CA   4  
ATOM 9632  C C    . ARG A 1 7   ? 13.830  -7.229  -6.528  1.00 0.00 ? 59  ARG A C    4  
ATOM 9633  O O    . ARG A 1 7   ? 13.928  -8.206  -7.268  1.00 0.00 ? 59  ARG A O    4  
ATOM 9634  C CB   . ARG A 1 7   ? 15.795  -5.902  -5.599  1.00 0.00 ? 59  ARG A CB   4  
ATOM 9635  C CG   . ARG A 1 7   ? 17.039  -6.301  -6.404  1.00 0.00 ? 59  ARG A CG   4  
ATOM 9636  C CD   . ARG A 1 7   ? 16.716  -6.819  -7.806  1.00 0.00 ? 59  ARG A CD   4  
ATOM 9637  N NE   . ARG A 1 7   ? 17.941  -7.166  -8.535  1.00 0.00 ? 59  ARG A NE   4  
ATOM 9638  C CZ   . ARG A 1 7   ? 18.687  -6.305  -9.230  1.00 0.00 ? 59  ARG A CZ   4  
ATOM 9639  N NH1  . ARG A 1 7   ? 18.357  -5.018  -9.306  1.00 0.00 ? 59  ARG A NH1  4  
ATOM 9640  N NH2  . ARG A 1 7   ? 19.776  -6.740  -9.856  1.00 0.00 ? 59  ARG A NH2  4  
ATOM 9641  H H    . ARG A 1 7   ? 15.942  -8.766  -5.789  1.00 0.00 ? 59  ARG A H    4  
ATOM 9642  H HA   . ARG A 1 7   ? 14.179  -6.754  -4.496  1.00 0.00 ? 59  ARG A HA   4  
ATOM 9643  H HB2  . ARG A 1 7   ? 15.289  -5.078  -6.101  1.00 0.00 ? 59  ARG A HB2  4  
ATOM 9644  H HB3  . ARG A 1 7   ? 16.136  -5.544  -4.628  1.00 0.00 ? 59  ARG A HB3  4  
ATOM 9645  H HG2  . ARG A 1 7   ? 17.686  -5.430  -6.497  1.00 0.00 ? 59  ARG A HG2  4  
ATOM 9646  H HG3  . ARG A 1 7   ? 17.583  -7.074  -5.862  1.00 0.00 ? 59  ARG A HG3  4  
ATOM 9647  H HD2  . ARG A 1 7   ? 16.106  -7.719  -7.725  1.00 0.00 ? 59  ARG A HD2  4  
ATOM 9648  H HD3  . ARG A 1 7   ? 16.160  -6.060  -8.357  1.00 0.00 ? 59  ARG A HD3  4  
ATOM 9649  H HE   . ARG A 1 7   ? 18.237  -8.132  -8.506  1.00 0.00 ? 59  ARG A HE   4  
ATOM 9650  H HH11 . ARG A 1 7   ? 17.531  -4.681  -8.835  1.00 0.00 ? 59  ARG A HH11 4  
ATOM 9651  H HH12 . ARG A 1 7   ? 18.934  -4.378  -9.834  1.00 0.00 ? 59  ARG A HH12 4  
ATOM 9652  H HH21 . ARG A 1 7   ? 20.027  -7.718  -9.806  1.00 0.00 ? 59  ARG A HH21 4  
ATOM 9653  H HH22 . ARG A 1 7   ? 20.349  -6.096  -10.381 1.00 0.00 ? 59  ARG A HH22 4  
ATOM 9654  N N    . VAL A 1 8   ? 12.900  -6.285  -6.691  1.00 0.00 ? 60  VAL A N    4  
ATOM 9655  C CA   . VAL A 1 8   ? 11.902  -6.305  -7.756  1.00 0.00 ? 60  VAL A CA   4  
ATOM 9656  C C    . VAL A 1 8   ? 11.609  -4.879  -8.216  1.00 0.00 ? 60  VAL A C    4  
ATOM 9657  O O    . VAL A 1 8   ? 12.159  -3.922  -7.674  1.00 0.00 ? 60  VAL A O    4  
ATOM 9658  C CB   . VAL A 1 8   ? 10.603  -6.975  -7.281  1.00 0.00 ? 60  VAL A CB   4  
ATOM 9659  C CG1  . VAL A 1 8   ? 10.858  -8.387  -6.752  1.00 0.00 ? 60  VAL A CG1  4  
ATOM 9660  C CG2  . VAL A 1 8   ? 9.915   -6.141  -6.198  1.00 0.00 ? 60  VAL A CG2  4  
ATOM 9661  H H    . VAL A 1 8   ? 12.875  -5.505  -6.049  1.00 0.00 ? 60  VAL A H    4  
ATOM 9662  H HA   . VAL A 1 8   ? 12.292  -6.870  -8.603  1.00 0.00 ? 60  VAL A HA   4  
ATOM 9663  H HB   . VAL A 1 8   ? 9.925   -7.053  -8.131  1.00 0.00 ? 60  VAL A HB   4  
ATOM 9664  H HG11 . VAL A 1 8   ? 11.487  -8.349  -5.863  1.00 0.00 ? 60  VAL A HG11 4  
ATOM 9665  H HG12 . VAL A 1 8   ? 9.908   -8.857  -6.498  1.00 0.00 ? 60  VAL A HG12 4  
ATOM 9666  H HG13 . VAL A 1 8   ? 11.354  -8.979  -7.522  1.00 0.00 ? 60  VAL A HG13 4  
ATOM 9667  H HG21 . VAL A 1 8   ? 9.596   -5.185  -6.611  1.00 0.00 ? 60  VAL A HG21 4  
ATOM 9668  H HG22 . VAL A 1 8   ? 9.040   -6.673  -5.823  1.00 0.00 ? 60  VAL A HG22 4  
ATOM 9669  H HG23 . VAL A 1 8   ? 10.606  -5.961  -5.375  1.00 0.00 ? 60  VAL A HG23 4  
ATOM 9670  N N    . GLU A 1 9   ? 10.739  -4.741  -9.217  1.00 0.00 ? 61  GLU A N    4  
ATOM 9671  C CA   . GLU A 1 9   ? 10.319  -3.448  -9.740  1.00 0.00 ? 61  GLU A CA   4  
ATOM 9672  C C    . GLU A 1 9   ? 8.791   -3.333  -9.765  1.00 0.00 ? 61  GLU A C    4  
ATOM 9673  O O    . GLU A 1 9   ? 8.248   -2.470  -10.452 1.00 0.00 ? 61  GLU A O    4  
ATOM 9674  C CB   . GLU A 1 9   ? 10.939  -3.216  -11.120 1.00 0.00 ? 61  GLU A CB   4  
ATOM 9675  C CG   . GLU A 1 9   ? 10.476  -4.267  -12.130 1.00 0.00 ? 61  GLU A CG   4  
ATOM 9676  C CD   . GLU A 1 9   ? 11.097  -4.015  -13.503 1.00 0.00 ? 61  GLU A CD   4  
ATOM 9677  O OE1  . GLU A 1 9   ? 12.202  -4.549  -13.746 1.00 0.00 ? 61  GLU A OE1  4  
ATOM 9678  O OE2  . GLU A 1 9   ? 10.462  -3.288  -14.301 1.00 0.00 ? 61  GLU A OE2  4  
ATOM 9679  H H    . GLU A 1 9   ? 10.343  -5.566  -9.646  1.00 0.00 ? 61  GLU A H    4  
ATOM 9680  H HA   . GLU A 1 9   ? 10.691  -2.671  -9.071  1.00 0.00 ? 61  GLU A HA   4  
ATOM 9681  H HB2  . GLU A 1 9   ? 10.661  -2.226  -11.479 1.00 0.00 ? 61  GLU A HB2  4  
ATOM 9682  H HB3  . GLU A 1 9   ? 12.025  -3.262  -11.033 1.00 0.00 ? 61  GLU A HB3  4  
ATOM 9683  H HG2  . GLU A 1 9   ? 10.770  -5.257  -11.782 1.00 0.00 ? 61  GLU A HG2  4  
ATOM 9684  H HG3  . GLU A 1 9   ? 9.390   -4.239  -12.214 1.00 0.00 ? 61  GLU A HG3  4  
ATOM 9685  N N    . ARG A 1 10  ? 8.098   -4.201  -9.017  1.00 0.00 ? 62  ARG A N    4  
ATOM 9686  C CA   . ARG A 1 10  ? 6.641   -4.250  -9.009  1.00 0.00 ? 62  ARG A CA   4  
ATOM 9687  C C    . ARG A 1 10  ? 6.017   -3.806  -7.684  1.00 0.00 ? 62  ARG A C    4  
ATOM 9688  O O    . ARG A 1 10  ? 4.815   -3.973  -7.496  1.00 0.00 ? 62  ARG A O    4  
ATOM 9689  C CB   . ARG A 1 10  ? 6.142   -5.620  -9.495  1.00 0.00 ? 62  ARG A CB   4  
ATOM 9690  C CG   . ARG A 1 10  ? 6.733   -6.833  -8.771  1.00 0.00 ? 62  ARG A CG   4  
ATOM 9691  C CD   . ARG A 1 10  ? 6.378   -6.841  -7.286  1.00 0.00 ? 62  ARG A CD   4  
ATOM 9692  N NE   . ARG A 1 10  ? 6.728   -8.123  -6.661  1.00 0.00 ? 62  ARG A NE   4  
ATOM 9693  C CZ   . ARG A 1 10  ? 5.921   -9.189  -6.630  1.00 0.00 ? 62  ARG A CZ   4  
ATOM 9694  N NH1  . ARG A 1 10  ? 4.708   -9.145  -7.178  1.00 0.00 ? 62  ARG A NH1  4  
ATOM 9695  N NH2  . ARG A 1 10  ? 6.327   -10.312 -6.045  1.00 0.00 ? 62  ARG A NH2  4  
ATOM 9696  H H    . ARG A 1 10  ? 8.599   -4.857  -8.435  1.00 0.00 ? 62  ARG A H    4  
ATOM 9697  H HA   . ARG A 1 10  ? 6.293   -3.524  -9.742  1.00 0.00 ? 62  ARG A HA   4  
ATOM 9698  H HB2  . ARG A 1 10  ? 5.058   -5.651  -9.395  1.00 0.00 ? 62  ARG A HB2  4  
ATOM 9699  H HB3  . ARG A 1 10  ? 6.385   -5.712  -10.554 1.00 0.00 ? 62  ARG A HB3  4  
ATOM 9700  H HG2  . ARG A 1 10  ? 6.329   -7.735  -9.232  1.00 0.00 ? 62  ARG A HG2  4  
ATOM 9701  H HG3  . ARG A 1 10  ? 7.817   -6.841  -8.888  1.00 0.00 ? 62  ARG A HG3  4  
ATOM 9702  H HD2  . ARG A 1 10  ? 6.923   -6.041  -6.786  1.00 0.00 ? 62  ARG A HD2  4  
ATOM 9703  H HD3  . ARG A 1 10  ? 5.309   -6.666  -7.170  1.00 0.00 ? 62  ARG A HD3  4  
ATOM 9704  H HE   . ARG A 1 10  ? 7.639   -8.199  -6.230  1.00 0.00 ? 62  ARG A HE   4  
ATOM 9705  H HH11 . ARG A 1 10  ? 4.385   -8.298  -7.622  1.00 0.00 ? 62  ARG A HH11 4  
ATOM 9706  H HH12 . ARG A 1 10  ? 4.111   -9.959  -7.149  1.00 0.00 ? 62  ARG A HH12 4  
ATOM 9707  H HH21 . ARG A 1 10  ? 7.243   -10.361 -5.623  1.00 0.00 ? 62  ARG A HH21 4  
ATOM 9708  H HH22 . ARG A 1 10  ? 5.720   -11.119 -6.024  1.00 0.00 ? 62  ARG A HH22 4  
ATOM 9709  N N    . TYR A 1 11  ? 6.808   -3.244  -6.764  1.00 0.00 ? 63  TYR A N    4  
ATOM 9710  C CA   . TYR A 1 11  ? 6.272   -2.619  -5.560  1.00 0.00 ? 63  TYR A CA   4  
ATOM 9711  C C    . TYR A 1 11  ? 6.342   -1.101  -5.693  1.00 0.00 ? 63  TYR A C    4  
ATOM 9712  O O    . TYR A 1 11  ? 7.170   -0.583  -6.438  1.00 0.00 ? 63  TYR A O    4  
ATOM 9713  C CB   . TYR A 1 11  ? 7.060   -3.052  -4.319  1.00 0.00 ? 63  TYR A CB   4  
ATOM 9714  C CG   . TYR A 1 11  ? 6.637   -4.356  -3.677  1.00 0.00 ? 63  TYR A CG   4  
ATOM 9715  C CD1  . TYR A 1 11  ? 5.906   -5.315  -4.393  1.00 0.00 ? 63  TYR A CD1  4  
ATOM 9716  C CD2  . TYR A 1 11  ? 6.986   -4.598  -2.342  1.00 0.00 ? 63  TYR A CD2  4  
ATOM 9717  C CE1  . TYR A 1 11  ? 5.547   -6.526  -3.788  1.00 0.00 ? 63  TYR A CE1  4  
ATOM 9718  C CE2  . TYR A 1 11  ? 6.618   -5.801  -1.723  1.00 0.00 ? 63  TYR A CE2  4  
ATOM 9719  C CZ   . TYR A 1 11  ? 5.901   -6.773  -2.447  1.00 0.00 ? 63  TYR A CZ   4  
ATOM 9720  O OH   . TYR A 1 11  ? 5.549   -7.947  -1.850  1.00 0.00 ? 63  TYR A OH   4  
ATOM 9721  H H    . TYR A 1 11  ? 7.810   -3.238  -6.895  1.00 0.00 ? 63  TYR A H    4  
ATOM 9722  H HA   . TYR A 1 11  ? 5.227   -2.900  -5.431  1.00 0.00 ? 63  TYR A HA   4  
ATOM 9723  H HB2  . TYR A 1 11  ? 8.118   -3.108  -4.575  1.00 0.00 ? 63  TYR A HB2  4  
ATOM 9724  H HB3  . TYR A 1 11  ? 6.943   -2.275  -3.565  1.00 0.00 ? 63  TYR A HB3  4  
ATOM 9725  H HD1  . TYR A 1 11  ? 5.616   -5.127  -5.416  1.00 0.00 ? 63  TYR A HD1  4  
ATOM 9726  H HD2  . TYR A 1 11  ? 7.539   -3.856  -1.787  1.00 0.00 ? 63  TYR A HD2  4  
ATOM 9727  H HE1  . TYR A 1 11  ? 4.998   -7.265  -4.355  1.00 0.00 ? 63  TYR A HE1  4  
ATOM 9728  H HE2  . TYR A 1 11  ? 6.883   -5.980  -0.691  1.00 0.00 ? 63  TYR A HE2  4  
ATOM 9729  H HH   . TYR A 1 11  ? 5.074   -8.538  -2.437  1.00 0.00 ? 63  TYR A HH   4  
ATOM 9730  N N    . SER A 1 12  ? 5.473   -0.385  -4.971  1.00 0.00 ? 64  SER A N    4  
ATOM 9731  C CA   . SER A 1 12  ? 5.528   1.065   -4.917  1.00 0.00 ? 64  SER A CA   4  
ATOM 9732  C C    . SER A 1 12  ? 6.293   1.491   -3.680  1.00 0.00 ? 64  SER A C    4  
ATOM 9733  O O    . SER A 1 12  ? 6.184   0.868   -2.617  1.00 0.00 ? 64  SER A O    4  
ATOM 9734  C CB   . SER A 1 12  ? 4.146   1.710   -4.937  1.00 0.00 ? 64  SER A CB   4  
ATOM 9735  O OG   . SER A 1 12  ? 3.324   1.125   -3.958  1.00 0.00 ? 64  SER A OG   4  
ATOM 9736  H H    . SER A 1 12  ? 4.754   -0.852  -4.437  1.00 0.00 ? 64  SER A H    4  
ATOM 9737  H HA   . SER A 1 12  ? 6.073   1.425   -5.789  1.00 0.00 ? 64  SER A HA   4  
ATOM 9738  H HB2  . SER A 1 12  ? 4.250   2.774   -4.723  1.00 0.00 ? 64  SER A HB2  4  
ATOM 9739  H HB3  . SER A 1 12  ? 3.693   1.592   -5.921  1.00 0.00 ? 64  SER A HB3  4  
ATOM 9740  H HG   . SER A 1 12  ? 2.445   1.500   -4.044  1.00 0.00 ? 64  SER A HG   4  
ATOM 9741  N N    . ARG A 1 13  ? 7.061   2.569   -3.873  1.00 0.00 ? 65  ARG A N    4  
ATOM 9742  C CA   . ARG A 1 13  ? 8.037   3.033   -2.898  1.00 0.00 ? 65  ARG A CA   4  
ATOM 9743  C C    . ARG A 1 13  ? 7.432   3.889   -1.792  1.00 0.00 ? 65  ARG A C    4  
ATOM 9744  O O    . ARG A 1 13  ? 8.166   4.335   -0.915  1.00 0.00 ? 65  ARG A O    4  
ATOM 9745  C CB   . ARG A 1 13  ? 9.167   3.780   -3.612  1.00 0.00 ? 65  ARG A CB   4  
ATOM 9746  C CG   . ARG A 1 13  ? 8.655   5.023   -4.339  1.00 0.00 ? 65  ARG A CG   4  
ATOM 9747  C CD   . ARG A 1 13  ? 9.839   5.789   -4.926  1.00 0.00 ? 65  ARG A CD   4  
ATOM 9748  N NE   . ARG A 1 13  ? 9.397   6.995   -5.634  1.00 0.00 ? 65  ARG A NE   4  
ATOM 9749  C CZ   . ARG A 1 13  ? 10.163  8.073   -5.824  1.00 0.00 ? 65  ARG A CZ   4  
ATOM 9750  N NH1  . ARG A 1 13  ? 11.409  8.116   -5.361  1.00 0.00 ? 65  ARG A NH1  4  
ATOM 9751  N NH2  . ARG A 1 13  ? 9.677   9.121   -6.484  1.00 0.00 ? 65  ARG A NH2  4  
ATOM 9752  H H    . ARG A 1 13  ? 6.975   3.087   -4.735  1.00 0.00 ? 65  ARG A H    4  
ATOM 9753  H HA   . ARG A 1 13  ? 8.468   2.154   -2.420  1.00 0.00 ? 65  ARG A HA   4  
ATOM 9754  H HB2  . ARG A 1 13  ? 9.914   4.079   -2.876  1.00 0.00 ? 65  ARG A HB2  4  
ATOM 9755  H HB3  . ARG A 1 13  ? 9.637   3.113   -4.335  1.00 0.00 ? 65  ARG A HB3  4  
ATOM 9756  H HG2  . ARG A 1 13  ? 7.979   4.728   -5.142  1.00 0.00 ? 65  ARG A HG2  4  
ATOM 9757  H HG3  . ARG A 1 13  ? 8.123   5.665   -3.637  1.00 0.00 ? 65  ARG A HG3  4  
ATOM 9758  H HD2  . ARG A 1 13  ? 10.505  6.071   -4.111  1.00 0.00 ? 65  ARG A HD2  4  
ATOM 9759  H HD3  . ARG A 1 13  ? 10.377  5.141   -5.618  1.00 0.00 ? 65  ARG A HD3  4  
ATOM 9760  H HE   . ARG A 1 13  ? 8.456   7.005   -6.000  1.00 0.00 ? 65  ARG A HE   4  
ATOM 9761  H HH11 . ARG A 1 13  ? 11.787  7.331   -4.850  1.00 0.00 ? 65  ARG A HH11 4  
ATOM 9762  H HH12 . ARG A 1 13  ? 11.979  8.934   -5.521  1.00 0.00 ? 65  ARG A HH12 4  
ATOM 9763  H HH21 . ARG A 1 13  ? 8.734   9.098   -6.846  1.00 0.00 ? 65  ARG A HH21 4  
ATOM 9764  H HH22 . ARG A 1 13  ? 10.250  9.941   -6.625  1.00 0.00 ? 65  ARG A HH22 4  
ATOM 9765  N N    . LYS A 1 14  ? 6.119   4.128   -1.810  1.00 0.00 ? 66  LYS A N    4  
ATOM 9766  C CA   . LYS A 1 14  ? 5.476   4.813   -0.700  1.00 0.00 ? 66  LYS A CA   4  
ATOM 9767  C C    . LYS A 1 14  ? 5.408   3.823   0.455   1.00 0.00 ? 66  LYS A C    4  
ATOM 9768  O O    . LYS A 1 14  ? 4.688   2.829   0.378   1.00 0.00 ? 66  LYS A O    4  
ATOM 9769  C CB   . LYS A 1 14  ? 4.089   5.316   -1.118  1.00 0.00 ? 66  LYS A CB   4  
ATOM 9770  C CG   . LYS A 1 14  ? 3.303   5.887   0.071   1.00 0.00 ? 66  LYS A CG   4  
ATOM 9771  C CD   . LYS A 1 14  ? 4.043   7.016   0.799   1.00 0.00 ? 66  LYS A CD   4  
ATOM 9772  C CE   . LYS A 1 14  ? 4.280   8.226   -0.105  1.00 0.00 ? 66  LYS A CE   4  
ATOM 9773  N NZ   . LYS A 1 14  ? 3.013   8.915   -0.426  1.00 0.00 ? 66  LYS A NZ   4  
ATOM 9774  H H    . LYS A 1 14  ? 5.554   3.828   -2.592  1.00 0.00 ? 66  LYS A H    4  
ATOM 9775  H HA   . LYS A 1 14  ? 6.089   5.664   -0.401  1.00 0.00 ? 66  LYS A HA   4  
ATOM 9776  H HB2  . LYS A 1 14  ? 4.203   6.085   -1.881  1.00 0.00 ? 66  LYS A HB2  4  
ATOM 9777  H HB3  . LYS A 1 14  ? 3.524   4.486   -1.541  1.00 0.00 ? 66  LYS A HB3  4  
ATOM 9778  H HG2  . LYS A 1 14  ? 2.343   6.260   -0.286  1.00 0.00 ? 66  LYS A HG2  4  
ATOM 9779  H HG3  . LYS A 1 14  ? 3.108   5.085   0.785   1.00 0.00 ? 66  LYS A HG3  4  
ATOM 9780  H HD2  . LYS A 1 14  ? 3.454   7.328   1.661   1.00 0.00 ? 66  LYS A HD2  4  
ATOM 9781  H HD3  . LYS A 1 14  ? 5.004   6.647   1.156   1.00 0.00 ? 66  LYS A HD3  4  
ATOM 9782  H HE2  . LYS A 1 14  ? 4.941   8.925   0.409   1.00 0.00 ? 66  LYS A HE2  4  
ATOM 9783  H HE3  . LYS A 1 14  ? 4.768   7.900   -1.023  1.00 0.00 ? 66  LYS A HE3  4  
ATOM 9784  H HZ1  . LYS A 1 14  ? 3.198   9.709   -1.022  1.00 0.00 ? 66  LYS A HZ1  4  
ATOM 9785  H HZ2  . LYS A 1 14  ? 2.385   8.284   -0.902  1.00 0.00 ? 66  LYS A HZ2  4  
ATOM 9786  H HZ3  . LYS A 1 14  ? 2.574   9.240   0.422   1.00 0.00 ? 66  LYS A HZ3  4  
ATOM 9787  N N    . VAL A 1 15  ? 6.157   4.099   1.524   1.00 0.00 ? 67  VAL A N    4  
ATOM 9788  C CA   . VAL A 1 15  ? 6.221   3.218   2.676   1.00 0.00 ? 67  VAL A CA   4  
ATOM 9789  C C    . VAL A 1 15  ? 5.766   3.965   3.923   1.00 0.00 ? 67  VAL A C    4  
ATOM 9790  O O    . VAL A 1 15  ? 6.260   5.049   4.231   1.00 0.00 ? 67  VAL A O    4  
ATOM 9791  C CB   . VAL A 1 15  ? 7.638   2.650   2.840   1.00 0.00 ? 67  VAL A CB   4  
ATOM 9792  C CG1  . VAL A 1 15  ? 7.689   1.645   3.992   1.00 0.00 ? 67  VAL A CG1  4  
ATOM 9793  C CG2  . VAL A 1 15  ? 8.079   1.915   1.576   1.00 0.00 ? 67  VAL A CG2  4  
ATOM 9794  H H    . VAL A 1 15  ? 6.709   4.945   1.545   1.00 0.00 ? 67  VAL A H    4  
ATOM 9795  H HA   . VAL A 1 15  ? 5.541   2.382   2.513   1.00 0.00 ? 67  VAL A HA   4  
ATOM 9796  H HB   . VAL A 1 15  ? 8.334   3.462   3.042   1.00 0.00 ? 67  VAL A HB   4  
ATOM 9797  H HG11 . VAL A 1 15  ? 6.984   0.834   3.803   1.00 0.00 ? 67  VAL A HG11 4  
ATOM 9798  H HG12 . VAL A 1 15  ? 8.693   1.228   4.068   1.00 0.00 ? 67  VAL A HG12 4  
ATOM 9799  H HG13 . VAL A 1 15  ? 7.433   2.141   4.928   1.00 0.00 ? 67  VAL A HG13 4  
ATOM 9800  H HG21 . VAL A 1 15  ? 8.118   2.610   0.737   1.00 0.00 ? 67  VAL A HG21 4  
ATOM 9801  H HG22 . VAL A 1 15  ? 9.070   1.487   1.729   1.00 0.00 ? 67  VAL A HG22 4  
ATOM 9802  H HG23 . VAL A 1 15  ? 7.370   1.117   1.350   1.00 0.00 ? 67  VAL A HG23 4  
ATOM 9803  N N    . PHE A 1 16  ? 4.812   3.365   4.636   1.00 0.00 ? 68  PHE A N    4  
ATOM 9804  C CA   . PHE A 1 16  ? 4.325   3.900   5.896   1.00 0.00 ? 68  PHE A CA   4  
ATOM 9805  C C    . PHE A 1 16  ? 5.196   3.362   7.025   1.00 0.00 ? 68  PHE A C    4  
ATOM 9806  O O    . PHE A 1 16  ? 5.684   2.236   6.939   1.00 0.00 ? 68  PHE A O    4  
ATOM 9807  C CB   . PHE A 1 16  ? 2.864   3.488   6.065   1.00 0.00 ? 68  PHE A CB   4  
ATOM 9808  C CG   . PHE A 1 16  ? 2.376   3.481   7.497   1.00 0.00 ? 68  PHE A CG   4  
ATOM 9809  C CD1  . PHE A 1 16  ? 2.583   2.345   8.294   1.00 0.00 ? 68  PHE A CD1  4  
ATOM 9810  C CD2  . PHE A 1 16  ? 1.720   4.600   8.026   1.00 0.00 ? 68  PHE A CD2  4  
ATOM 9811  C CE1  . PHE A 1 16  ? 2.115   2.321   9.615   1.00 0.00 ? 68  PHE A CE1  4  
ATOM 9812  C CE2  . PHE A 1 16  ? 1.258   4.578   9.350   1.00 0.00 ? 68  PHE A CE2  4  
ATOM 9813  C CZ   . PHE A 1 16  ? 1.453   3.438   10.143  1.00 0.00 ? 68  PHE A CZ   4  
ATOM 9814  H H    . PHE A 1 16  ? 4.406   2.503   4.302   1.00 0.00 ? 68  PHE A H    4  
ATOM 9815  H HA   . PHE A 1 16  ? 4.389   4.989   5.893   1.00 0.00 ? 68  PHE A HA   4  
ATOM 9816  H HB2  . PHE A 1 16  ? 2.238   4.155   5.472   1.00 0.00 ? 68  PHE A HB2  4  
ATOM 9817  H HB3  . PHE A 1 16  ? 2.743   2.480   5.667   1.00 0.00 ? 68  PHE A HB3  4  
ATOM 9818  H HD1  . PHE A 1 16  ? 3.103   1.489   7.890   1.00 0.00 ? 68  PHE A HD1  4  
ATOM 9819  H HD2  . PHE A 1 16  ? 1.568   5.479   7.418   1.00 0.00 ? 68  PHE A HD2  4  
ATOM 9820  H HE1  . PHE A 1 16  ? 2.267   1.442   10.223  1.00 0.00 ? 68  PHE A HE1  4  
ATOM 9821  H HE2  . PHE A 1 16  ? 0.751   5.438   9.759   1.00 0.00 ? 68  PHE A HE2  4  
ATOM 9822  H HZ   . PHE A 1 16  ? 1.092   3.423   11.161  1.00 0.00 ? 68  PHE A HZ   4  
ATOM 9823  N N    . VAL A 1 17  ? 5.392   4.156   8.084   1.00 0.00 ? 69  VAL A N    4  
ATOM 9824  C CA   . VAL A 1 17  ? 6.167   3.727   9.235   1.00 0.00 ? 69  VAL A CA   4  
ATOM 9825  C C    . VAL A 1 17  ? 5.308   3.826   10.491  1.00 0.00 ? 69  VAL A C    4  
ATOM 9826  O O    . VAL A 1 17  ? 4.682   4.856   10.735  1.00 0.00 ? 69  VAL A O    4  
ATOM 9827  C CB   . VAL A 1 17  ? 7.438   4.572   9.344   1.00 0.00 ? 69  VAL A CB   4  
ATOM 9828  C CG1  . VAL A 1 17  ? 8.342   4.010   10.436  1.00 0.00 ? 69  VAL A CG1  4  
ATOM 9829  C CG2  . VAL A 1 17  ? 8.222   4.546   8.032   1.00 0.00 ? 69  VAL A CG2  4  
ATOM 9830  H H    . VAL A 1 17  ? 4.998   5.086   8.099   1.00 0.00 ? 69  VAL A H    4  
ATOM 9831  H HA   . VAL A 1 17  ? 6.461   2.687   9.096   1.00 0.00 ? 69  VAL A HA   4  
ATOM 9832  H HB   . VAL A 1 17  ? 7.176   5.603   9.581   1.00 0.00 ? 69  VAL A HB   4  
ATOM 9833  H HG11 . VAL A 1 17  ? 8.551   2.960   10.234  1.00 0.00 ? 69  VAL A HG11 4  
ATOM 9834  H HG12 . VAL A 1 17  ? 9.280   4.566   10.449  1.00 0.00 ? 69  VAL A HG12 4  
ATOM 9835  H HG13 . VAL A 1 17  ? 7.846   4.108   11.402  1.00 0.00 ? 69  VAL A HG13 4  
ATOM 9836  H HG21 . VAL A 1 17  ? 7.619   4.963   7.226   1.00 0.00 ? 69  VAL A HG21 4  
ATOM 9837  H HG22 . VAL A 1 17  ? 9.124   5.148   8.146   1.00 0.00 ? 69  VAL A HG22 4  
ATOM 9838  H HG23 . VAL A 1 17  ? 8.497   3.520   7.790   1.00 0.00 ? 69  VAL A HG23 4  
ATOM 9839  N N    . GLY A 1 18  ? 5.283   2.751   11.285  1.00 0.00 ? 70  GLY A N    4  
ATOM 9840  C CA   . GLY A 1 18  ? 4.482   2.676   12.503  1.00 0.00 ? 70  GLY A CA   4  
ATOM 9841  C C    . GLY A 1 18  ? 5.345   2.712   13.762  1.00 0.00 ? 70  GLY A C    4  
ATOM 9842  O O    . GLY A 1 18  ? 4.823   2.697   14.876  1.00 0.00 ? 70  GLY A O    4  
ATOM 9843  H H    . GLY A 1 18  ? 5.842   1.948   11.032  1.00 0.00 ? 70  GLY A H    4  
ATOM 9844  H HA2  . GLY A 1 18  ? 3.788   3.517   12.529  1.00 0.00 ? 70  GLY A HA2  4  
ATOM 9845  H HA3  . GLY A 1 18  ? 3.907   1.749   12.495  1.00 0.00 ? 70  GLY A HA3  4  
ATOM 9846  N N    . GLY A 1 19  ? 6.665   2.758   13.575  1.00 0.00 ? 71  GLY A N    4  
ATOM 9847  C CA   . GLY A 1 19  ? 7.601   2.869   14.681  1.00 0.00 ? 71  GLY A CA   4  
ATOM 9848  C C    . GLY A 1 19  ? 8.688   3.899   14.405  1.00 0.00 ? 71  GLY A C    4  
ATOM 9849  O O    . GLY A 1 19  ? 9.367   3.833   13.383  1.00 0.00 ? 71  GLY A O    4  
ATOM 9850  H H    . GLY A 1 19  ? 7.031   2.712   12.634  1.00 0.00 ? 71  GLY A H    4  
ATOM 9851  H HA2  . GLY A 1 19  ? 7.060   3.165   15.580  1.00 0.00 ? 71  GLY A HA2  4  
ATOM 9852  H HA3  . GLY A 1 19  ? 8.062   1.899   14.864  1.00 0.00 ? 71  GLY A HA3  4  
ATOM 9853  N N    . LEU A 1 20  ? 8.843   4.849   15.331  1.00 0.00 ? 72  LEU A N    4  
ATOM 9854  C CA   . LEU A 1 20  ? 9.849   5.899   15.274  1.00 0.00 ? 72  LEU A CA   4  
ATOM 9855  C C    . LEU A 1 20  ? 10.266  6.242   16.707  1.00 0.00 ? 72  LEU A C    4  
ATOM 9856  O O    . LEU A 1 20  ? 9.476   6.044   17.630  1.00 0.00 ? 72  LEU A O    4  
ATOM 9857  C CB   . LEU A 1 20  ? 9.275   7.145   14.586  1.00 0.00 ? 72  LEU A CB   4  
ATOM 9858  C CG   . LEU A 1 20  ? 8.923   6.927   13.110  1.00 0.00 ? 72  LEU A CG   4  
ATOM 9859  C CD1  . LEU A 1 20  ? 8.273   8.193   12.565  1.00 0.00 ? 72  LEU A CD1  4  
ATOM 9860  C CD2  . LEU A 1 20  ? 10.153  6.645   12.250  1.00 0.00 ? 72  LEU A CD2  4  
ATOM 9861  H H    . LEU A 1 20  ? 8.229   4.850   16.132  1.00 0.00 ? 72  LEU A H    4  
ATOM 9862  H HA   . LEU A 1 20  ? 10.716  5.541   14.720  1.00 0.00 ? 72  LEU A HA   4  
ATOM 9863  H HB2  . LEU A 1 20  ? 8.371   7.449   15.114  1.00 0.00 ? 72  LEU A HB2  4  
ATOM 9864  H HB3  . LEU A 1 20  ? 10.002  7.953   14.654  1.00 0.00 ? 72  LEU A HB3  4  
ATOM 9865  H HG   . LEU A 1 20  ? 8.215   6.102   13.019  1.00 0.00 ? 72  LEU A HG   4  
ATOM 9866  H HD11 . LEU A 1 20  ? 8.979   9.021   12.623  1.00 0.00 ? 72  LEU A HD11 4  
ATOM 9867  H HD12 . LEU A 1 20  ? 8.000   8.028   11.522  1.00 0.00 ? 72  LEU A HD12 4  
ATOM 9868  H HD13 . LEU A 1 20  ? 7.381   8.428   13.144  1.00 0.00 ? 72  LEU A HD13 4  
ATOM 9869  H HD21 . LEU A 1 20  ? 10.636  5.724   12.574  1.00 0.00 ? 72  LEU A HD21 4  
ATOM 9870  H HD22 . LEU A 1 20  ? 9.840   6.539   11.212  1.00 0.00 ? 72  LEU A HD22 4  
ATOM 9871  H HD23 . LEU A 1 20  ? 10.859  7.471   12.334  1.00 0.00 ? 72  LEU A HD23 4  
ATOM 9872  N N    . PRO A 1 21  ? 11.489  6.750   16.914  1.00 0.00 ? 73  PRO A N    4  
ATOM 9873  C CA   . PRO A 1 21  ? 11.975  7.157   18.224  1.00 0.00 ? 73  PRO A CA   4  
ATOM 9874  C C    . PRO A 1 21  ? 11.067  8.196   18.890  1.00 0.00 ? 73  PRO A C    4  
ATOM 9875  O O    . PRO A 1 21  ? 10.336  8.905   18.198  1.00 0.00 ? 73  PRO A O    4  
ATOM 9876  C CB   . PRO A 1 21  ? 13.373  7.731   17.980  1.00 0.00 ? 73  PRO A CB   4  
ATOM 9877  C CG   . PRO A 1 21  ? 13.815  7.056   16.682  1.00 0.00 ? 73  PRO A CG   4  
ATOM 9878  C CD   . PRO A 1 21  ? 12.507  6.958   15.902  1.00 0.00 ? 73  PRO A CD   4  
ATOM 9879  H HA   . PRO A 1 21  ? 12.056  6.269   18.850  1.00 0.00 ? 73  PRO A HA   4  
ATOM 9880  H HB2  . PRO A 1 21  ? 13.301  8.806   17.817  1.00 0.00 ? 73  PRO A HB2  4  
ATOM 9881  H HB3  . PRO A 1 21  ? 14.053  7.506   18.801  1.00 0.00 ? 73  PRO A HB3  4  
ATOM 9882  H HG2  . PRO A 1 21  ? 14.560  7.648   16.149  1.00 0.00 ? 73  PRO A HG2  4  
ATOM 9883  H HG3  . PRO A 1 21  ? 14.190  6.056   16.898  1.00 0.00 ? 73  PRO A HG3  4  
ATOM 9884  H HD2  . PRO A 1 21  ? 12.314  7.894   15.378  1.00 0.00 ? 73  PRO A HD2  4  
ATOM 9885  H HD3  . PRO A 1 21  ? 12.554  6.126   15.200  1.00 0.00 ? 73  PRO A HD3  4  
ATOM 9886  N N    . PRO A 1 22  ? 11.100  8.301   20.228  1.00 0.00 ? 74  PRO A N    4  
ATOM 9887  C CA   . PRO A 1 22  ? 10.320  9.273   20.987  1.00 0.00 ? 74  PRO A CA   4  
ATOM 9888  C C    . PRO A 1 22  ? 10.631  10.716  20.591  1.00 0.00 ? 74  PRO A C    4  
ATOM 9889  O O    . PRO A 1 22  ? 9.829   11.615  20.841  1.00 0.00 ? 74  PRO A O    4  
ATOM 9890  C CB   . PRO A 1 22  ? 10.688  9.028   22.453  1.00 0.00 ? 74  PRO A CB   4  
ATOM 9891  C CG   . PRO A 1 22  ? 11.191  7.587   22.470  1.00 0.00 ? 74  PRO A CG   4  
ATOM 9892  C CD   . PRO A 1 22  ? 11.888  7.471   21.120  1.00 0.00 ? 74  PRO A CD   4  
ATOM 9893  H HA   . PRO A 1 22  ? 9.260   9.074   20.829  1.00 0.00 ? 74  PRO A HA   4  
ATOM 9894  H HB2  . PRO A 1 22  ? 11.500  9.696   22.741  1.00 0.00 ? 74  PRO A HB2  4  
ATOM 9895  H HB3  . PRO A 1 22  ? 9.829   9.164   23.110  1.00 0.00 ? 74  PRO A HB3  4  
ATOM 9896  H HG2  . PRO A 1 22  ? 11.875  7.404   23.299  1.00 0.00 ? 74  PRO A HG2  4  
ATOM 9897  H HG3  . PRO A 1 22  ? 10.342  6.904   22.503  1.00 0.00 ? 74  PRO A HG3  4  
ATOM 9898  H HD2  . PRO A 1 22  ? 12.901  7.867   21.189  1.00 0.00 ? 74  PRO A HD2  4  
ATOM 9899  H HD3  . PRO A 1 22  ? 11.905  6.430   20.797  1.00 0.00 ? 74  PRO A HD3  4  
ATOM 9900  N N    . ASP A 1 23  ? 11.792  10.937  19.973  1.00 0.00 ? 75  ASP A N    4  
ATOM 9901  C CA   . ASP A 1 23  ? 12.179  12.226  19.426  1.00 0.00 ? 75  ASP A CA   4  
ATOM 9902  C C    . ASP A 1 23  ? 12.787  11.968  18.052  1.00 0.00 ? 75  ASP A C    4  
ATOM 9903  O O    . ASP A 1 23  ? 13.851  11.362  17.948  1.00 0.00 ? 75  ASP A O    4  
ATOM 9904  C CB   . ASP A 1 23  ? 13.166  12.916  20.369  1.00 0.00 ? 75  ASP A CB   4  
ATOM 9905  C CG   . ASP A 1 23  ? 13.571  14.287  19.833  1.00 0.00 ? 75  ASP A CG   4  
ATOM 9906  O OD1  . ASP A 1 23  ? 12.652  15.083  19.534  1.00 0.00 ? 75  ASP A OD1  4  
ATOM 9907  O OD2  . ASP A 1 23  ? 14.795  14.531  19.728  1.00 0.00 ? 75  ASP A OD2  4  
ATOM 9908  H H    . ASP A 1 23  ? 12.445  10.173  19.868  1.00 0.00 ? 75  ASP A H    4  
ATOM 9909  H HA   . ASP A 1 23  ? 11.294  12.853  19.310  1.00 0.00 ? 75  ASP A HA   4  
ATOM 9910  H HB2  . ASP A 1 23  ? 12.700  13.039  21.346  1.00 0.00 ? 75  ASP A HB2  4  
ATOM 9911  H HB3  . ASP A 1 23  ? 14.054  12.293  20.482  1.00 0.00 ? 75  ASP A HB3  4  
ATOM 9912  N N    . ILE A 1 24  ? 12.105  12.431  17.002  1.00 0.00 ? 76  ILE A N    4  
ATOM 9913  C CA   . ILE A 1 24  ? 12.478  12.104  15.636  1.00 0.00 ? 76  ILE A CA   4  
ATOM 9914  C C    . ILE A 1 24  ? 12.342  13.304  14.703  1.00 0.00 ? 76  ILE A C    4  
ATOM 9915  O O    . ILE A 1 24  ? 11.455  14.139  14.859  1.00 0.00 ? 76  ILE A O    4  
ATOM 9916  C CB   . ILE A 1 24  ? 11.640  10.899  15.177  1.00 0.00 ? 76  ILE A CB   4  
ATOM 9917  C CG1  . ILE A 1 24  ? 11.941  10.472  13.731  1.00 0.00 ? 76  ILE A CG1  4  
ATOM 9918  C CG2  . ILE A 1 24  ? 10.141  11.148  15.378  1.00 0.00 ? 76  ILE A CG2  4  
ATOM 9919  C CD1  . ILE A 1 24  ? 11.113  11.195  12.664  1.00 0.00 ? 76  ILE A CD1  4  
ATOM 9920  H H    . ILE A 1 24  ? 11.296  13.017  17.151  1.00 0.00 ? 76  ILE A H    4  
ATOM 9921  H HA   . ILE A 1 24  ? 13.526  11.806  15.626  1.00 0.00 ? 76  ILE A HA   4  
ATOM 9922  H HB   . ILE A 1 24  ? 11.919  10.063  15.818  1.00 0.00 ? 76  ILE A HB   4  
ATOM 9923  H HG12 . ILE A 1 24  ? 13.002  10.624  13.530  1.00 0.00 ? 76  ILE A HG12 4  
ATOM 9924  H HG13 . ILE A 1 24  ? 11.732  9.406   13.643  1.00 0.00 ? 76  ILE A HG13 4  
ATOM 9925  H HG21 . ILE A 1 24  ? 9.577   10.287  15.019  1.00 0.00 ? 76  ILE A HG21 4  
ATOM 9926  H HG22 . ILE A 1 24  ? 9.928   11.287  16.438  1.00 0.00 ? 76  ILE A HG22 4  
ATOM 9927  H HG23 . ILE A 1 24  ? 9.834   12.039  14.831  1.00 0.00 ? 76  ILE A HG23 4  
ATOM 9928  H HD11 . ILE A 1 24  ? 10.054  10.975  12.801  1.00 0.00 ? 76  ILE A HD11 4  
ATOM 9929  H HD12 . ILE A 1 24  ? 11.268  12.272  12.722  1.00 0.00 ? 76  ILE A HD12 4  
ATOM 9930  H HD13 . ILE A 1 24  ? 11.420  10.847  11.679  1.00 0.00 ? 76  ILE A HD13 4  
ATOM 9931  N N    . ASP A 1 25  ? 13.249  13.357  13.727  1.00 0.00 ? 77  ASP A N    4  
ATOM 9932  C CA   . ASP A 1 25  ? 13.254  14.305  12.622  1.00 0.00 ? 77  ASP A CA   4  
ATOM 9933  C C    . ASP A 1 25  ? 13.859  13.579  11.419  1.00 0.00 ? 77  ASP A C    4  
ATOM 9934  O O    . ASP A 1 25  ? 14.417  12.499  11.588  1.00 0.00 ? 77  ASP A O    4  
ATOM 9935  C CB   . ASP A 1 25  ? 14.067  15.542  13.006  1.00 0.00 ? 77  ASP A CB   4  
ATOM 9936  C CG   . ASP A 1 25  ? 14.019  16.606  11.913  1.00 0.00 ? 77  ASP A CG   4  
ATOM 9937  O OD1  . ASP A 1 25  ? 12.894  17.045  11.578  1.00 0.00 ? 77  ASP A OD1  4  
ATOM 9938  O OD2  . ASP A 1 25  ? 15.109  16.973  11.421  1.00 0.00 ? 77  ASP A OD2  4  
ATOM 9939  H H    . ASP A 1 25  ? 14.001  12.682  13.736  1.00 0.00 ? 77  ASP A H    4  
ATOM 9940  H HA   . ASP A 1 25  ? 12.233  14.605  12.390  1.00 0.00 ? 77  ASP A HA   4  
ATOM 9941  H HB2  . ASP A 1 25  ? 13.662  15.963  13.927  1.00 0.00 ? 77  ASP A HB2  4  
ATOM 9942  H HB3  . ASP A 1 25  ? 15.102  15.250  13.183  1.00 0.00 ? 77  ASP A HB3  4  
ATOM 9943  N N    . GLU A 1 26  ? 13.761  14.147  10.213  1.00 0.00 ? 78  GLU A N    4  
ATOM 9944  C CA   . GLU A 1 26  ? 14.232  13.495  8.995   1.00 0.00 ? 78  GLU A CA   4  
ATOM 9945  C C    . GLU A 1 26  ? 15.622  12.868  9.137   1.00 0.00 ? 78  GLU A C    4  
ATOM 9946  O O    . GLU A 1 26  ? 15.860  11.788  8.600   1.00 0.00 ? 78  GLU A O    4  
ATOM 9947  C CB   . GLU A 1 26  ? 14.252  14.539  7.874   1.00 0.00 ? 78  GLU A CB   4  
ATOM 9948  C CG   . GLU A 1 26  ? 14.772  13.939  6.567   1.00 0.00 ? 78  GLU A CG   4  
ATOM 9949  C CD   . GLU A 1 26  ? 14.713  14.956  5.427   1.00 0.00 ? 78  GLU A CD   4  
ATOM 9950  O OE1  . GLU A 1 26  ? 15.227  16.079  5.629   1.00 0.00 ? 78  GLU A OE1  4  
ATOM 9951  O OE2  . GLU A 1 26  ? 14.157  14.607  4.362   1.00 0.00 ? 78  GLU A OE2  4  
ATOM 9952  H H    . GLU A 1 26  ? 13.344  15.063  10.126  1.00 0.00 ? 78  GLU A H    4  
ATOM 9953  H HA   . GLU A 1 26  ? 13.528  12.708  8.724   1.00 0.00 ? 78  GLU A HA   4  
ATOM 9954  H HB2  . GLU A 1 26  ? 13.242  14.915  7.718   1.00 0.00 ? 78  GLU A HB2  4  
ATOM 9955  H HB3  . GLU A 1 26  ? 14.898  15.366  8.170   1.00 0.00 ? 78  GLU A HB3  4  
ATOM 9956  H HG2  . GLU A 1 26  ? 15.806  13.623  6.699   1.00 0.00 ? 78  GLU A HG2  4  
ATOM 9957  H HG3  . GLU A 1 26  ? 14.169  13.066  6.315   1.00 0.00 ? 78  GLU A HG3  4  
ATOM 9958  N N    . ASP A 1 27  ? 16.546  13.520  9.851   1.00 0.00 ? 79  ASP A N    4  
ATOM 9959  C CA   . ASP A 1 27  ? 17.905  13.008  9.980   1.00 0.00 ? 79  ASP A CA   4  
ATOM 9960  C C    . ASP A 1 27  ? 17.962  11.817  10.939  1.00 0.00 ? 79  ASP A C    4  
ATOM 9961  O O    . ASP A 1 27  ? 18.846  10.968  10.828  1.00 0.00 ? 79  ASP A O    4  
ATOM 9962  C CB   . ASP A 1 27  ? 18.812  14.140  10.461  1.00 0.00 ? 79  ASP A CB   4  
ATOM 9963  C CG   . ASP A 1 27  ? 20.270  13.695  10.535  1.00 0.00 ? 79  ASP A CG   4  
ATOM 9964  O OD1  . ASP A 1 27  ? 20.860  13.460  9.457   1.00 0.00 ? 79  ASP A OD1  4  
ATOM 9965  O OD2  . ASP A 1 27  ? 20.784  13.591  11.672  1.00 0.00 ? 79  ASP A OD2  4  
ATOM 9966  H H    . ASP A 1 27  ? 16.309  14.387  10.311  1.00 0.00 ? 79  ASP A H    4  
ATOM 9967  H HA   . ASP A 1 27  ? 18.249  12.677  9.000   1.00 0.00 ? 79  ASP A HA   4  
ATOM 9968  H HB2  . ASP A 1 27  ? 18.734  14.978  9.768   1.00 0.00 ? 79  ASP A HB2  4  
ATOM 9969  H HB3  . ASP A 1 27  ? 18.481  14.470  11.446  1.00 0.00 ? 79  ASP A HB3  4  
ATOM 9970  N N    . GLU A 1 28  ? 17.020  11.752  11.882  1.00 0.00 ? 80  GLU A N    4  
ATOM 9971  C CA   . GLU A 1 28  ? 16.990  10.699  12.885  1.00 0.00 ? 80  GLU A CA   4  
ATOM 9972  C C    . GLU A 1 28  ? 16.489  9.405   12.264  1.00 0.00 ? 80  GLU A C    4  
ATOM 9973  O O    . GLU A 1 28  ? 17.063  8.342   12.481  1.00 0.00 ? 80  GLU A O    4  
ATOM 9974  C CB   . GLU A 1 28  ? 16.052  11.115  14.018  1.00 0.00 ? 80  GLU A CB   4  
ATOM 9975  C CG   . GLU A 1 28  ? 16.006  10.058  15.123  1.00 0.00 ? 80  GLU A CG   4  
ATOM 9976  C CD   . GLU A 1 28  ? 17.327  9.992   15.890  1.00 0.00 ? 80  GLU A CD   4  
ATOM 9977  O OE1  . GLU A 1 28  ? 17.627  10.972  16.608  1.00 0.00 ? 80  GLU A OE1  4  
ATOM 9978  O OE2  . GLU A 1 28  ? 18.029  8.965   15.755  1.00 0.00 ? 80  GLU A OE2  4  
ATOM 9979  H H    . GLU A 1 28  ? 16.295  12.455  11.905  1.00 0.00 ? 80  GLU A H    4  
ATOM 9980  H HA   . GLU A 1 28  ? 17.994  10.544  13.281  1.00 0.00 ? 80  GLU A HA   4  
ATOM 9981  H HB2  . GLU A 1 28  ? 16.372  12.072  14.431  1.00 0.00 ? 80  GLU A HB2  4  
ATOM 9982  H HB3  . GLU A 1 28  ? 15.047  11.232  13.613  1.00 0.00 ? 80  GLU A HB3  4  
ATOM 9983  H HG2  . GLU A 1 28  ? 15.198  10.304  15.812  1.00 0.00 ? 80  GLU A HG2  4  
ATOM 9984  H HG3  . GLU A 1 28  ? 15.780  9.084   14.689  1.00 0.00 ? 80  GLU A HG3  4  
ATOM 9985  N N    . ILE A 1 29  ? 15.411  9.497   11.484  1.00 0.00 ? 81  ILE A N    4  
ATOM 9986  C CA   . ILE A 1 29  ? 14.800  8.327   10.879  1.00 0.00 ? 81  ILE A CA   4  
ATOM 9987  C C    . ILE A 1 29  ? 15.663  7.815   9.730   1.00 0.00 ? 81  ILE A C    4  
ATOM 9988  O O    . ILE A 1 29  ? 15.664  6.617   9.450   1.00 0.00 ? 81  ILE A O    4  
ATOM 9989  C CB   . ILE A 1 29  ? 13.354  8.658   10.477  1.00 0.00 ? 81  ILE A CB   4  
ATOM 9990  C CG1  . ILE A 1 29  ? 12.715  7.541   9.649   1.00 0.00 ? 81  ILE A CG1  4  
ATOM 9991  C CG2  . ILE A 1 29  ? 13.247  9.993   9.737   1.00 0.00 ? 81  ILE A CG2  4  
ATOM 9992  C CD1  . ILE A 1 29  ? 12.968  7.708   8.149   1.00 0.00 ? 81  ILE A CD1  4  
ATOM 9993  H H    . ILE A 1 29  ? 14.999  10.402  11.306  1.00 0.00 ? 81  ILE A H    4  
ATOM 9994  H HA   . ILE A 1 29  ? 14.760  7.537   11.628  1.00 0.00 ? 81  ILE A HA   4  
ATOM 9995  H HB   . ILE A 1 29  ? 12.782  8.740   11.402  1.00 0.00 ? 81  ILE A HB   4  
ATOM 9996  H HG12 . ILE A 1 29  ? 13.098  6.579   9.994   1.00 0.00 ? 81  ILE A HG12 4  
ATOM 9997  H HG13 . ILE A 1 29  ? 11.638  7.560   9.815   1.00 0.00 ? 81  ILE A HG13 4  
ATOM 9998  H HG21 . ILE A 1 29  ? 12.218  10.138  9.408   1.00 0.00 ? 81  ILE A HG21 4  
ATOM 9999  H HG22 . ILE A 1 29  ? 13.514  10.807  10.412  1.00 0.00 ? 81  ILE A HG22 4  
ATOM 10000 H HG23 . ILE A 1 29  ? 13.912  10.005  8.874   1.00 0.00 ? 81  ILE A HG23 4  
ATOM 10001 H HD11 . ILE A 1 29  ? 12.629  6.813   7.628   1.00 0.00 ? 81  ILE A HD11 4  
ATOM 10002 H HD12 . ILE A 1 29  ? 12.419  8.577   7.782   1.00 0.00 ? 81  ILE A HD12 4  
ATOM 10003 H HD13 . ILE A 1 29  ? 14.029  7.854   7.948   1.00 0.00 ? 81  ILE A HD13 4  
ATOM 10004 N N    . THR A 1 30  ? 16.401  8.705   9.059   1.00 0.00 ? 82  THR A N    4  
ATOM 10005 C CA   . THR A 1 30  ? 17.293  8.280   7.989   1.00 0.00 ? 82  THR A CA   4  
ATOM 10006 C C    . THR A 1 30  ? 18.481  7.526   8.581   1.00 0.00 ? 82  THR A C    4  
ATOM 10007 O O    . THR A 1 30  ? 19.055  6.661   7.922   1.00 0.00 ? 82  THR A O    4  
ATOM 10008 C CB   . THR A 1 30  ? 17.764  9.495   7.183   1.00 0.00 ? 82  THR A CB   4  
ATOM 10009 O OG1  . THR A 1 30  ? 16.653  10.165  6.635   1.00 0.00 ? 82  THR A OG1  4  
ATOM 10010 C CG2  . THR A 1 30  ? 18.673  9.075   6.030   1.00 0.00 ? 82  THR A CG2  4  
ATOM 10011 H H    . THR A 1 30  ? 16.348  9.687   9.289   1.00 0.00 ? 82  THR A H    4  
ATOM 10012 H HA   . THR A 1 30  ? 16.746  7.610   7.325   1.00 0.00 ? 82  THR A HA   4  
ATOM 10013 H HB   . THR A 1 30  ? 18.309  10.178  7.835   1.00 0.00 ? 82  THR A HB   4  
ATOM 10014 H HG1  . THR A 1 30  ? 16.235  10.672  7.336   1.00 0.00 ? 82  THR A HG1  4  
ATOM 10015 H HG21 . THR A 1 30  ? 18.903  9.946   5.416   1.00 0.00 ? 82  THR A HG21 4  
ATOM 10016 H HG22 . THR A 1 30  ? 19.603  8.663   6.423   1.00 0.00 ? 82  THR A HG22 4  
ATOM 10017 H HG23 . THR A 1 30  ? 18.170  8.323   5.422   1.00 0.00 ? 82  THR A HG23 4  
ATOM 10018 N N    . ALA A 1 31  ? 18.856  7.845   9.826   1.00 0.00 ? 83  ALA A N    4  
ATOM 10019 C CA   . ALA A 1 31  ? 19.937  7.153   10.510  1.00 0.00 ? 83  ALA A CA   4  
ATOM 10020 C C    . ALA A 1 31  ? 19.434  5.941   11.299  1.00 0.00 ? 83  ALA A C    4  
ATOM 10021 O O    . ALA A 1 31  ? 20.230  5.070   11.652  1.00 0.00 ? 83  ALA A O    4  
ATOM 10022 C CB   . ALA A 1 31  ? 20.649  8.147   11.426  1.00 0.00 ? 83  ALA A CB   4  
ATOM 10023 H H    . ALA A 1 31  ? 18.383  8.590   10.318  1.00 0.00 ? 83  ALA A H    4  
ATOM 10024 H HA   . ALA A 1 31  ? 20.653  6.801   9.767   1.00 0.00 ? 83  ALA A HA   4  
ATOM 10025 H HB1  . ALA A 1 31  ? 19.956  8.508   12.185  1.00 0.00 ? 83  ALA A HB1  4  
ATOM 10026 H HB2  . ALA A 1 31  ? 21.492  7.655   11.911  1.00 0.00 ? 83  ALA A HB2  4  
ATOM 10027 H HB3  . ALA A 1 31  ? 21.016  8.987   10.838  1.00 0.00 ? 83  ALA A HB3  4  
ATOM 10028 N N    . SER A 1 32  ? 18.128  5.870   11.581  1.00 0.00 ? 84  SER A N    4  
ATOM 10029 C CA   . SER A 1 32  ? 17.553  4.746   12.311  1.00 0.00 ? 84  SER A CA   4  
ATOM 10030 C C    . SER A 1 32  ? 17.368  3.526   11.414  1.00 0.00 ? 84  SER A C    4  
ATOM 10031 O O    . SER A 1 32  ? 17.465  2.395   11.887  1.00 0.00 ? 84  SER A O    4  
ATOM 10032 C CB   . SER A 1 32  ? 16.208  5.156   12.908  1.00 0.00 ? 84  SER A CB   4  
ATOM 10033 O OG   . SER A 1 32  ? 16.392  6.160   13.883  1.00 0.00 ? 84  SER A OG   4  
ATOM 10034 H H    . SER A 1 32  ? 17.509  6.615   11.294  1.00 0.00 ? 84  SER A H    4  
ATOM 10035 H HA   . SER A 1 32  ? 18.222  4.472   13.127  1.00 0.00 ? 84  SER A HA   4  
ATOM 10036 H HB2  . SER A 1 32  ? 15.554  5.527   12.119  1.00 0.00 ? 84  SER A HB2  4  
ATOM 10037 H HB3  . SER A 1 32  ? 15.742  4.288   13.374  1.00 0.00 ? 84  SER A HB3  4  
ATOM 10038 H HG   . SER A 1 32  ? 16.746  6.941   13.451  1.00 0.00 ? 84  SER A HG   4  
ATOM 10039 N N    . PHE A 1 33  ? 17.104  3.734   10.121  1.00 0.00 ? 85  PHE A N    4  
ATOM 10040 C CA   . PHE A 1 33  ? 16.956  2.632   9.183   1.00 0.00 ? 85  PHE A CA   4  
ATOM 10041 C C    . PHE A 1 33  ? 18.319  2.049   8.810   1.00 0.00 ? 85  PHE A C    4  
ATOM 10042 O O    . PHE A 1 33  ? 19.360  2.648   9.075   1.00 0.00 ? 85  PHE A O    4  
ATOM 10043 C CB   . PHE A 1 33  ? 16.225  3.100   7.925   1.00 0.00 ? 85  PHE A CB   4  
ATOM 10044 C CG   . PHE A 1 33  ? 14.739  3.361   8.043   1.00 0.00 ? 85  PHE A CG   4  
ATOM 10045 C CD1  . PHE A 1 33  ? 14.038  3.225   9.250   1.00 0.00 ? 85  PHE A CD1  4  
ATOM 10046 C CD2  . PHE A 1 33  ? 14.056  3.747   6.885   1.00 0.00 ? 85  PHE A CD2  4  
ATOM 10047 C CE1  . PHE A 1 33  ? 12.651  3.433   9.273   1.00 0.00 ? 85  PHE A CE1  4  
ATOM 10048 C CE2  . PHE A 1 33  ? 12.675  3.955   6.899   1.00 0.00 ? 85  PHE A CE2  4  
ATOM 10049 C CZ   . PHE A 1 33  ? 11.966  3.786   8.101   1.00 0.00 ? 85  PHE A CZ   4  
ATOM 10050 H H    . PHE A 1 33  ? 17.001  4.675   9.771   1.00 0.00 ? 85  PHE A H    4  
ATOM 10051 H HA   . PHE A 1 33  ? 16.367  1.838   9.643   1.00 0.00 ? 85  PHE A HA   4  
ATOM 10052 H HB2  . PHE A 1 33  ? 16.706  3.998   7.536   1.00 0.00 ? 85  PHE A HB2  4  
ATOM 10053 H HB3  . PHE A 1 33  ? 16.335  2.315   7.177   1.00 0.00 ? 85  PHE A HB3  4  
ATOM 10054 H HD1  . PHE A 1 33  ? 14.554  2.958   10.160  1.00 0.00 ? 85  PHE A HD1  4  
ATOM 10055 H HD2  . PHE A 1 33  ? 14.612  3.881   5.969   1.00 0.00 ? 85  PHE A HD2  4  
ATOM 10056 H HE1  . PHE A 1 33  ? 12.107  3.320   10.201  1.00 0.00 ? 85  PHE A HE1  4  
ATOM 10057 H HE2  . PHE A 1 33  ? 12.182  4.240   5.982   1.00 0.00 ? 85  PHE A HE2  4  
ATOM 10058 H HZ   . PHE A 1 33  ? 10.895  3.923   8.137   1.00 0.00 ? 85  PHE A HZ   4  
ATOM 10059 N N    . ARG A 1 34  ? 18.298  0.865   8.188   1.00 0.00 ? 86  ARG A N    4  
ATOM 10060 C CA   . ARG A 1 34  ? 19.489  0.166   7.722   1.00 0.00 ? 86  ARG A CA   4  
ATOM 10061 C C    . ARG A 1 34  ? 19.360  -0.075  6.220   1.00 0.00 ? 86  ARG A C    4  
ATOM 10062 O O    . ARG A 1 34  ? 18.248  -0.217  5.717   1.00 0.00 ? 86  ARG A O    4  
ATOM 10063 C CB   . ARG A 1 34  ? 19.649  -1.137  8.512   1.00 0.00 ? 86  ARG A CB   4  
ATOM 10064 C CG   . ARG A 1 34  ? 20.926  -1.885  8.127   1.00 0.00 ? 86  ARG A CG   4  
ATOM 10065 C CD   . ARG A 1 34  ? 21.086  -3.125  9.008   1.00 0.00 ? 86  ARG A CD   4  
ATOM 10066 N NE   . ARG A 1 34  ? 22.297  -3.873  8.651   1.00 0.00 ? 86  ARG A NE   4  
ATOM 10067 C CZ   . ARG A 1 34  ? 22.352  -4.827  7.717   1.00 0.00 ? 86  ARG A CZ   4  
ATOM 10068 N NH1  . ARG A 1 34  ? 21.266  -5.173  7.028   1.00 0.00 ? 86  ARG A NH1  4  
ATOM 10069 N NH2  . ARG A 1 34  ? 23.503  -5.444  7.464   1.00 0.00 ? 86  ARG A NH2  4  
ATOM 10070 H H    . ARG A 1 34  ? 17.408  0.419   8.021   1.00 0.00 ? 86  ARG A H    4  
ATOM 10071 H HA   . ARG A 1 34  ? 20.365  0.790   7.898   1.00 0.00 ? 86  ARG A HA   4  
ATOM 10072 H HB2  . ARG A 1 34  ? 19.688  -0.900  9.575   1.00 0.00 ? 86  ARG A HB2  4  
ATOM 10073 H HB3  . ARG A 1 34  ? 18.786  -1.777  8.326   1.00 0.00 ? 86  ARG A HB3  4  
ATOM 10074 H HG2  . ARG A 1 34  ? 20.870  -2.192  7.083   1.00 0.00 ? 86  ARG A HG2  4  
ATOM 10075 H HG3  . ARG A 1 34  ? 21.788  -1.233  8.264   1.00 0.00 ? 86  ARG A HG3  4  
ATOM 10076 H HD2  . ARG A 1 34  ? 21.154  -2.812  10.049  1.00 0.00 ? 86  ARG A HD2  4  
ATOM 10077 H HD3  . ARG A 1 34  ? 20.211  -3.766  8.893   1.00 0.00 ? 86  ARG A HD3  4  
ATOM 10078 H HE   . ARG A 1 34  ? 23.144  -3.645  9.151   1.00 0.00 ? 86  ARG A HE   4  
ATOM 10079 H HH11 . ARG A 1 34  ? 20.387  -4.709  7.209   1.00 0.00 ? 86  ARG A HH11 4  
ATOM 10080 H HH12 . ARG A 1 34  ? 21.321  -5.898  6.327   1.00 0.00 ? 86  ARG A HH12 4  
ATOM 10081 H HH21 . ARG A 1 34  ? 24.334  -5.192  7.980   1.00 0.00 ? 86  ARG A HH21 4  
ATOM 10082 H HH22 . ARG A 1 34  ? 23.546  -6.165  6.758   1.00 0.00 ? 86  ARG A HH22 4  
ATOM 10083 N N    . ARG A 1 35  ? 20.490  -0.122  5.507   1.00 0.00 ? 87  ARG A N    4  
ATOM 10084 C CA   . ARG A 1 35  ? 20.524  -0.262  4.050   1.00 0.00 ? 87  ARG A CA   4  
ATOM 10085 C C    . ARG A 1 35  ? 19.707  0.834   3.349   1.00 0.00 ? 87  ARG A C    4  
ATOM 10086 O O    . ARG A 1 35  ? 19.401  0.729   2.164   1.00 0.00 ? 87  ARG A O    4  
ATOM 10087 C CB   . ARG A 1 35  ? 20.104  -1.685  3.664   1.00 0.00 ? 87  ARG A CB   4  
ATOM 10088 C CG   . ARG A 1 35  ? 20.585  -2.076  2.265   1.00 0.00 ? 87  ARG A CG   4  
ATOM 10089 C CD   . ARG A 1 35  ? 20.204  -3.529  1.983   1.00 0.00 ? 87  ARG A CD   4  
ATOM 10090 N NE   . ARG A 1 35  ? 20.686  -3.955  0.666   1.00 0.00 ? 87  ARG A NE   4  
ATOM 10091 C CZ   . ARG A 1 35  ? 20.615  -5.209  0.213   1.00 0.00 ? 87  ARG A CZ   4  
ATOM 10092 N NH1  . ARG A 1 35  ? 20.073  -6.173  0.956   1.00 0.00 ? 87  ARG A NH1  4  
ATOM 10093 N NH2  . ARG A 1 35  ? 21.087  -5.508  -0.995  1.00 0.00 ? 87  ARG A NH2  4  
ATOM 10094 H H    . ARG A 1 35  ? 21.375  -0.053  5.989   1.00 0.00 ? 87  ARG A H    4  
ATOM 10095 H HA   . ARG A 1 35  ? 21.563  -0.130  3.746   1.00 0.00 ? 87  ARG A HA   4  
ATOM 10096 H HB2  . ARG A 1 35  ? 20.539  -2.383  4.381   1.00 0.00 ? 87  ARG A HB2  4  
ATOM 10097 H HB3  . ARG A 1 35  ? 19.019  -1.767  3.711   1.00 0.00 ? 87  ARG A HB3  4  
ATOM 10098 H HG2  . ARG A 1 35  ? 20.122  -1.435  1.514   1.00 0.00 ? 87  ARG A HG2  4  
ATOM 10099 H HG3  . ARG A 1 35  ? 21.669  -1.969  2.212   1.00 0.00 ? 87  ARG A HG3  4  
ATOM 10100 H HD2  . ARG A 1 35  ? 20.648  -4.166  2.750   1.00 0.00 ? 87  ARG A HD2  4  
ATOM 10101 H HD3  . ARG A 1 35  ? 19.119  -3.628  2.022   1.00 0.00 ? 87  ARG A HD3  4  
ATOM 10102 H HE   . ARG A 1 35  ? 21.097  -3.250  0.071   1.00 0.00 ? 87  ARG A HE   4  
ATOM 10103 H HH11 . ARG A 1 35  ? 19.711  -5.959  1.874   1.00 0.00 ? 87  ARG A HH11 4  
ATOM 10104 H HH12 . ARG A 1 35  ? 20.026  -7.118  0.603   1.00 0.00 ? 87  ARG A HH12 4  
ATOM 10105 H HH21 . ARG A 1 35  ? 21.498  -4.787  -1.570  1.00 0.00 ? 87  ARG A HH21 4  
ATOM 10106 H HH22 . ARG A 1 35  ? 21.035  -6.457  -1.336  1.00 0.00 ? 87  ARG A HH22 4  
ATOM 10107 N N    . PHE A 1 36  ? 19.356  1.888   4.091   1.00 0.00 ? 88  PHE A N    4  
ATOM 10108 C CA   . PHE A 1 36  ? 18.559  3.007   3.613   1.00 0.00 ? 88  PHE A CA   4  
ATOM 10109 C C    . PHE A 1 36  ? 19.371  4.289   3.780   1.00 0.00 ? 88  PHE A C    4  
ATOM 10110 O O    . PHE A 1 36  ? 19.376  4.906   4.843   1.00 0.00 ? 88  PHE A O    4  
ATOM 10111 C CB   . PHE A 1 36  ? 17.232  3.044   4.375   1.00 0.00 ? 88  PHE A CB   4  
ATOM 10112 C CG   . PHE A 1 36  ? 16.050  2.472   3.615   1.00 0.00 ? 88  PHE A CG   4  
ATOM 10113 C CD1  . PHE A 1 36  ? 16.120  1.224   2.976   1.00 0.00 ? 88  PHE A CD1  4  
ATOM 10114 C CD2  . PHE A 1 36  ? 14.861  3.208   3.548   1.00 0.00 ? 88  PHE A CD2  4  
ATOM 10115 C CE1  . PHE A 1 36  ? 15.017  0.739   2.260   1.00 0.00 ? 88  PHE A CE1  4  
ATOM 10116 C CE2  . PHE A 1 36  ? 13.749  2.711   2.860   1.00 0.00 ? 88  PHE A CE2  4  
ATOM 10117 C CZ   . PHE A 1 36  ? 13.828  1.475   2.207   1.00 0.00 ? 88  PHE A CZ   4  
ATOM 10118 H H    . PHE A 1 36  ? 19.659  1.920   5.054   1.00 0.00 ? 88  PHE A H    4  
ATOM 10119 H HA   . PHE A 1 36  ? 18.329  2.899   2.553   1.00 0.00 ? 88  PHE A HA   4  
ATOM 10120 H HB2  . PHE A 1 36  ? 17.348  2.501   5.313   1.00 0.00 ? 88  PHE A HB2  4  
ATOM 10121 H HB3  . PHE A 1 36  ? 17.003  4.082   4.614   1.00 0.00 ? 88  PHE A HB3  4  
ATOM 10122 H HD1  . PHE A 1 36  ? 17.020  0.628   3.027   1.00 0.00 ? 88  PHE A HD1  4  
ATOM 10123 H HD2  . PHE A 1 36  ? 14.800  4.173   4.032   1.00 0.00 ? 88  PHE A HD2  4  
ATOM 10124 H HE1  . PHE A 1 36  ? 15.083  -0.209  1.746   1.00 0.00 ? 88  PHE A HE1  4  
ATOM 10125 H HE2  . PHE A 1 36  ? 12.834  3.284   2.836   1.00 0.00 ? 88  PHE A HE2  4  
ATOM 10126 H HZ   . PHE A 1 36  ? 12.976  1.093   1.666   1.00 0.00 ? 88  PHE A HZ   4  
ATOM 10127 N N    . GLY A 1 37  ? 20.058  4.675   2.700   1.00 0.00 ? 89  GLY A N    4  
ATOM 10128 C CA   . GLY A 1 37  ? 20.822  5.909   2.617   1.00 0.00 ? 89  GLY A CA   4  
ATOM 10129 C C    . GLY A 1 37  ? 19.889  7.094   2.369   1.00 0.00 ? 89  GLY A C    4  
ATOM 10130 O O    . GLY A 1 37  ? 18.789  7.136   2.920   1.00 0.00 ? 89  GLY A O    4  
ATOM 10131 H H    . GLY A 1 37  ? 20.053  4.082   1.883   1.00 0.00 ? 89  GLY A H    4  
ATOM 10132 H HA2  . GLY A 1 37  ? 21.372  6.071   3.543   1.00 0.00 ? 89  GLY A HA2  4  
ATOM 10133 H HA3  . GLY A 1 37  ? 21.534  5.823   1.796   1.00 0.00 ? 89  GLY A HA3  4  
ATOM 10134 N N    . PRO A 1 38  ? 20.309  8.063   1.545   1.00 0.00 ? 90  PRO A N    4  
ATOM 10135 C CA   . PRO A 1 38  ? 19.505  9.225   1.208   1.00 0.00 ? 90  PRO A CA   4  
ATOM 10136 C C    . PRO A 1 38  ? 18.096  8.832   0.766   1.00 0.00 ? 90  PRO A C    4  
ATOM 10137 O O    . PRO A 1 38  ? 17.920  7.967   -0.092  1.00 0.00 ? 90  PRO A O    4  
ATOM 10138 C CB   . PRO A 1 38  ? 20.275  9.935   0.094   1.00 0.00 ? 90  PRO A CB   4  
ATOM 10139 C CG   . PRO A 1 38  ? 21.725  9.551   0.380   1.00 0.00 ? 90  PRO A CG   4  
ATOM 10140 C CD   . PRO A 1 38  ? 21.597  8.113   0.881   1.00 0.00 ? 90  PRO A CD   4  
ATOM 10141 H HA   . PRO A 1 38  ? 19.449  9.875   2.080   1.00 0.00 ? 90  PRO A HA   4  
ATOM 10142 H HB2  . PRO A 1 38  ? 19.981  9.527   -0.874  1.00 0.00 ? 90  PRO A HB2  4  
ATOM 10143 H HB3  . PRO A 1 38  ? 20.125  11.014  0.127   1.00 0.00 ? 90  PRO A HB3  4  
ATOM 10144 H HG2  . PRO A 1 38  ? 22.348  9.615   -0.512  1.00 0.00 ? 90  PRO A HG2  4  
ATOM 10145 H HG3  . PRO A 1 38  ? 22.117  10.181  1.178   1.00 0.00 ? 90  PRO A HG3  4  
ATOM 10146 H HD2  . PRO A 1 38  ? 21.596  7.425   0.036   1.00 0.00 ? 90  PRO A HD2  4  
ATOM 10147 H HD3  . PRO A 1 38  ? 22.409  7.875   1.568   1.00 0.00 ? 90  PRO A HD3  4  
ATOM 10148 N N    . LEU A 1 39  ? 17.096  9.480   1.368   1.00 0.00 ? 91  LEU A N    4  
ATOM 10149 C CA   . LEU A 1 39  ? 15.686  9.191   1.153   1.00 0.00 ? 91  LEU A CA   4  
ATOM 10150 C C    . LEU A 1 39  ? 14.866  10.440  1.468   1.00 0.00 ? 91  LEU A C    4  
ATOM 10151 O O    . LEU A 1 39  ? 15.400  11.407  2.009   1.00 0.00 ? 91  LEU A O    4  
ATOM 10152 C CB   . LEU A 1 39  ? 15.295  7.978   2.009   1.00 0.00 ? 91  LEU A CB   4  
ATOM 10153 C CG   . LEU A 1 39  ? 15.588  8.130   3.508   1.00 0.00 ? 91  LEU A CG   4  
ATOM 10154 C CD1  . LEU A 1 39  ? 14.471  8.876   4.227   1.00 0.00 ? 91  LEU A CD1  4  
ATOM 10155 C CD2  . LEU A 1 39  ? 15.654  6.746   4.144   1.00 0.00 ? 91  LEU A CD2  4  
ATOM 10156 H H    . LEU A 1 39  ? 17.318  10.218  2.021   1.00 0.00 ? 91  LEU A H    4  
ATOM 10157 H HA   . LEU A 1 39  ? 15.514  8.932   0.109   1.00 0.00 ? 91  LEU A HA   4  
ATOM 10158 H HB2  . LEU A 1 39  ? 14.238  7.755   1.869   1.00 0.00 ? 91  LEU A HB2  4  
ATOM 10159 H HB3  . LEU A 1 39  ? 15.869  7.128   1.640   1.00 0.00 ? 91  LEU A HB3  4  
ATOM 10160 H HG   . LEU A 1 39  ? 16.540  8.638   3.663   1.00 0.00 ? 91  LEU A HG   4  
ATOM 10161 H HD11 . LEU A 1 39  ? 13.525  8.371   4.033   1.00 0.00 ? 91  LEU A HD11 4  
ATOM 10162 H HD12 . LEU A 1 39  ? 14.674  8.863   5.298   1.00 0.00 ? 91  LEU A HD12 4  
ATOM 10163 H HD13 . LEU A 1 39  ? 14.421  9.907   3.879   1.00 0.00 ? 91  LEU A HD13 4  
ATOM 10164 H HD21 . LEU A 1 39  ? 16.443  6.165   3.667   1.00 0.00 ? 91  LEU A HD21 4  
ATOM 10165 H HD22 . LEU A 1 39  ? 15.876  6.844   5.207   1.00 0.00 ? 91  LEU A HD22 4  
ATOM 10166 H HD23 . LEU A 1 39  ? 14.694  6.246   4.016   1.00 0.00 ? 91  LEU A HD23 4  
ATOM 10167 N N    . ILE A 1 40  ? 13.573  10.426  1.131   1.00 0.00 ? 92  ILE A N    4  
ATOM 10168 C CA   . ILE A 1 40  ? 12.709  11.583  1.324   1.00 0.00 ? 92  ILE A CA   4  
ATOM 10169 C C    . ILE A 1 40  ? 11.512  11.191  2.187   1.00 0.00 ? 92  ILE A C    4  
ATOM 10170 O O    . ILE A 1 40  ? 11.014  10.071  2.099   1.00 0.00 ? 92  ILE A O    4  
ATOM 10171 C CB   . ILE A 1 40  ? 12.287  12.165  -0.032  1.00 0.00 ? 92  ILE A CB   4  
ATOM 10172 C CG1  . ILE A 1 40  ? 13.535  12.540  -0.847  1.00 0.00 ? 92  ILE A CG1  4  
ATOM 10173 C CG2  . ILE A 1 40  ? 11.392  13.391  0.168   1.00 0.00 ? 92  ILE A CG2  4  
ATOM 10174 C CD1  . ILE A 1 40  ? 13.180  13.077  -2.236  1.00 0.00 ? 92  ILE A CD1  4  
ATOM 10175 H H    . ILE A 1 40  ? 13.168  9.593   0.728   1.00 0.00 ? 92  ILE A H    4  
ATOM 10176 H HA   . ILE A 1 40  ? 13.266  12.354  1.857   1.00 0.00 ? 92  ILE A HA   4  
ATOM 10177 H HB   . ILE A 1 40  ? 11.725  11.407  -0.579  1.00 0.00 ? 92  ILE A HB   4  
ATOM 10178 H HG12 . ILE A 1 40  ? 14.105  13.297  -0.307  1.00 0.00 ? 92  ILE A HG12 4  
ATOM 10179 H HG13 . ILE A 1 40  ? 14.159  11.657  -0.976  1.00 0.00 ? 92  ILE A HG13 4  
ATOM 10180 H HG21 . ILE A 1 40  ? 11.940  14.162  0.711   1.00 0.00 ? 92  ILE A HG21 4  
ATOM 10181 H HG22 . ILE A 1 40  ? 11.075  13.783  -0.799  1.00 0.00 ? 92  ILE A HG22 4  
ATOM 10182 H HG23 . ILE A 1 40  ? 10.501  13.113  0.731   1.00 0.00 ? 92  ILE A HG23 4  
ATOM 10183 H HD11 . ILE A 1 40  ? 12.659  14.031  -2.148  1.00 0.00 ? 92  ILE A HD11 4  
ATOM 10184 H HD12 . ILE A 1 40  ? 14.095  13.228  -2.807  1.00 0.00 ? 92  ILE A HD12 4  
ATOM 10185 H HD13 . ILE A 1 40  ? 12.546  12.360  -2.757  1.00 0.00 ? 92  ILE A HD13 4  
ATOM 10186 N N    . VAL A 1 41  ? 11.056  12.128  3.021   1.00 0.00 ? 93  VAL A N    4  
ATOM 10187 C CA   . VAL A 1 41  ? 9.985   11.898  3.979   1.00 0.00 ? 93  VAL A CA   4  
ATOM 10188 C C    . VAL A 1 41  ? 8.863   12.911  3.783   1.00 0.00 ? 93  VAL A C    4  
ATOM 10189 O O    . VAL A 1 41  ? 9.071   13.961  3.174   1.00 0.00 ? 93  VAL A O    4  
ATOM 10190 C CB   . VAL A 1 41  ? 10.539  11.972  5.406   1.00 0.00 ? 93  VAL A CB   4  
ATOM 10191 C CG1  . VAL A 1 41  ? 11.658  10.950  5.616   1.00 0.00 ? 93  VAL A CG1  4  
ATOM 10192 C CG2  . VAL A 1 41  ? 11.097  13.367  5.693   1.00 0.00 ? 93  VAL A CG2  4  
ATOM 10193 H H    . VAL A 1 41  ? 11.471  13.048  3.002   1.00 0.00 ? 93  VAL A H    4  
ATOM 10194 H HA   . VAL A 1 41  ? 9.572   10.900  3.824   1.00 0.00 ? 93  VAL A HA   4  
ATOM 10195 H HB   . VAL A 1 41  ? 9.732   11.758  6.106   1.00 0.00 ? 93  VAL A HB   4  
ATOM 10196 H HG11 . VAL A 1 41  ? 12.502  11.179  4.966   1.00 0.00 ? 93  VAL A HG11 4  
ATOM 10197 H HG12 . VAL A 1 41  ? 11.990  10.983  6.654   1.00 0.00 ? 93  VAL A HG12 4  
ATOM 10198 H HG13 . VAL A 1 41  ? 11.288  9.949   5.390   1.00 0.00 ? 93  VAL A HG13 4  
ATOM 10199 H HG21 . VAL A 1 41  ? 10.292  14.101  5.657   1.00 0.00 ? 93  VAL A HG21 4  
ATOM 10200 H HG22 . VAL A 1 41  ? 11.551  13.382  6.684   1.00 0.00 ? 93  VAL A HG22 4  
ATOM 10201 H HG23 . VAL A 1 41  ? 11.854  13.622  4.952   1.00 0.00 ? 93  VAL A HG23 4  
ATOM 10202 N N    . ASP A 1 42  ? 7.670   12.601  4.298   1.00 0.00 ? 94  ASP A N    4  
ATOM 10203 C CA   . ASP A 1 42  ? 6.528   13.493  4.195   1.00 0.00 ? 94  ASP A CA   4  
ATOM 10204 C C    . ASP A 1 42  ? 5.660   13.431  5.451   1.00 0.00 ? 94  ASP A C    4  
ATOM 10205 O O    . ASP A 1 42  ? 5.312   12.353  5.938   1.00 0.00 ? 94  ASP A O    4  
ATOM 10206 C CB   . ASP A 1 42  ? 5.706   13.124  2.959   1.00 0.00 ? 94  ASP A CB   4  
ATOM 10207 C CG   . ASP A 1 42  ? 4.503   14.048  2.799   1.00 0.00 ? 94  ASP A CG   4  
ATOM 10208 O OD1  . ASP A 1 42  ? 4.731   15.271  2.655   1.00 0.00 ? 94  ASP A OD1  4  
ATOM 10209 O OD2  . ASP A 1 42  ? 3.366   13.525  2.822   1.00 0.00 ? 94  ASP A OD2  4  
ATOM 10210 H H    . ASP A 1 42  ? 7.540   11.722  4.777   1.00 0.00 ? 94  ASP A H    4  
ATOM 10211 H HA   . ASP A 1 42  ? 6.888   14.516  4.078   1.00 0.00 ? 94  ASP A HA   4  
ATOM 10212 H HB2  . ASP A 1 42  ? 6.335   13.202  2.072   1.00 0.00 ? 94  ASP A HB2  4  
ATOM 10213 H HB3  . ASP A 1 42  ? 5.361   12.095  3.054   1.00 0.00 ? 94  ASP A HB3  4  
ATOM 10214 N N    . TRP A 1 43  ? 5.319   14.617  5.964   1.00 0.00 ? 95  TRP A N    4  
ATOM 10215 C CA   . TRP A 1 43  ? 4.419   14.802  7.091   1.00 0.00 ? 95  TRP A CA   4  
ATOM 10216 C C    . TRP A 1 43  ? 3.997   16.275  7.160   1.00 0.00 ? 95  TRP A C    4  
ATOM 10217 O O    . TRP A 1 43  ? 4.700   17.139  6.636   1.00 0.00 ? 95  TRP A O    4  
ATOM 10218 C CB   . TRP A 1 43  ? 5.104   14.360  8.386   1.00 0.00 ? 95  TRP A CB   4  
ATOM 10219 C CG   . TRP A 1 43  ? 6.560   14.677  8.512   1.00 0.00 ? 95  TRP A CG   4  
ATOM 10220 C CD1  . TRP A 1 43  ? 7.104   15.909  8.614   1.00 0.00 ? 95  TRP A CD1  4  
ATOM 10221 C CD2  . TRP A 1 43  ? 7.689   13.747  8.552   1.00 0.00 ? 95  TRP A CD2  4  
ATOM 10222 N NE1  . TRP A 1 43  ? 8.473   15.803  8.740   1.00 0.00 ? 95  TRP A NE1  4  
ATOM 10223 C CE2  . TRP A 1 43  ? 8.888   14.490  8.731   1.00 0.00 ? 95  TRP A CE2  4  
ATOM 10224 C CE3  . TRP A 1 43  ? 7.814   12.350  8.472   1.00 0.00 ? 95  TRP A CE3  4  
ATOM 10225 C CZ2  . TRP A 1 43  ? 10.139  13.877  8.860   1.00 0.00 ? 95  TRP A CZ2  4  
ATOM 10226 C CZ3  . TRP A 1 43  ? 9.065   11.724  8.589   1.00 0.00 ? 95  TRP A CZ3  4  
ATOM 10227 C CH2  . TRP A 1 43  ? 10.224  12.483  8.793   1.00 0.00 ? 95  TRP A CH2  4  
ATOM 10228 H H    . TRP A 1 43  ? 5.700   15.454  5.546   1.00 0.00 ? 95  TRP A H    4  
ATOM 10229 H HA   . TRP A 1 43  ? 3.532   14.188  6.938   1.00 0.00 ? 95  TRP A HA   4  
ATOM 10230 H HB2  . TRP A 1 43  ? 4.576   14.798  9.234   1.00 0.00 ? 95  TRP A HB2  4  
ATOM 10231 H HB3  . TRP A 1 43  ? 5.000   13.278  8.462   1.00 0.00 ? 95  TRP A HB3  4  
ATOM 10232 H HD1  . TRP A 1 43  ? 6.551   16.837  8.603   1.00 0.00 ? 95  TRP A HD1  4  
ATOM 10233 H HE1  . TRP A 1 43  ? 9.077   16.608  8.827   1.00 0.00 ? 95  TRP A HE1  4  
ATOM 10234 H HE3  . TRP A 1 43  ? 6.925   11.755  8.319   1.00 0.00 ? 95  TRP A HE3  4  
ATOM 10235 H HZ2  . TRP A 1 43  ? 11.029  14.471  9.010   1.00 0.00 ? 95  TRP A HZ2  4  
ATOM 10236 H HZ3  . TRP A 1 43  ? 9.139   10.649  8.519   1.00 0.00 ? 95  TRP A HZ3  4  
ATOM 10237 H HH2  . TRP A 1 43  ? 11.182  11.994  8.898   1.00 0.00 ? 95  TRP A HH2  4  
ATOM 10238 N N    . PRO A 1 44  ? 2.857   16.578  7.799   1.00 0.00 ? 96  PRO A N    4  
ATOM 10239 C CA   . PRO A 1 44  ? 2.286   17.921  7.875   1.00 0.00 ? 96  PRO A CA   4  
ATOM 10240 C C    . PRO A 1 44  ? 3.176   18.960  8.566   1.00 0.00 ? 96  PRO A C    4  
ATOM 10241 O O    . PRO A 1 44  ? 2.834   20.141  8.572   1.00 0.00 ? 96  PRO A O    4  
ATOM 10242 C CB   . PRO A 1 44  ? 0.980   17.759  8.660   1.00 0.00 ? 96  PRO A CB   4  
ATOM 10243 C CG   . PRO A 1 44  ? 0.628   16.282  8.498   1.00 0.00 ? 96  PRO A CG   4  
ATOM 10244 C CD   . PRO A 1 44  ? 2.004   15.629  8.487   1.00 0.00 ? 96  PRO A CD   4  
ATOM 10245 H HA   . PRO A 1 44  ? 2.061   18.257  6.864   1.00 0.00 ? 96  PRO A HA   4  
ATOM 10246 H HB2  . PRO A 1 44  ? 1.159   17.969  9.714   1.00 0.00 ? 96  PRO A HB2  4  
ATOM 10247 H HB3  . PRO A 1 44  ? 0.194   18.405  8.268   1.00 0.00 ? 96  PRO A HB3  4  
ATOM 10248 H HG2  . PRO A 1 44  ? 0.012   15.921  9.321   1.00 0.00 ? 96  PRO A HG2  4  
ATOM 10249 H HG3  . PRO A 1 44  ? 0.138   16.125  7.537   1.00 0.00 ? 96  PRO A HG3  4  
ATOM 10250 H HD2  . PRO A 1 44  ? 2.357   15.494  9.510   1.00 0.00 ? 96  PRO A HD2  4  
ATOM 10251 H HD3  . PRO A 1 44  ? 1.958   14.672  7.967   1.00 0.00 ? 96  PRO A HD3  4  
ATOM 10252 N N    . HIS A 1 45  ? 4.306   18.544  9.145   1.00 0.00 ? 97  HIS A N    4  
ATOM 10253 C CA   . HIS A 1 45  ? 5.175   19.439  9.899   1.00 0.00 ? 97  HIS A CA   4  
ATOM 10254 C C    . HIS A 1 45  ? 6.389   19.912  9.097   1.00 0.00 ? 97  HIS A C    4  
ATOM 10255 O O    . HIS A 1 45  ? 7.274   20.558  9.655   1.00 0.00 ? 97  HIS A O    4  
ATOM 10256 C CB   . HIS A 1 45  ? 5.569   18.771  11.215  1.00 0.00 ? 97  HIS A CB   4  
ATOM 10257 C CG   . HIS A 1 45  ? 4.369   18.445  12.063  1.00 0.00 ? 97  HIS A CG   4  
ATOM 10258 N ND1  . HIS A 1 45  ? 3.674   17.232  12.053  1.00 0.00 ? 97  HIS A ND1  4  
ATOM 10259 C CD2  . HIS A 1 45  ? 3.787   19.290  12.964  1.00 0.00 ? 97  HIS A CD2  4  
ATOM 10260 C CE1  . HIS A 1 45  ? 2.687   17.381  12.952  1.00 0.00 ? 97  HIS A CE1  4  
ATOM 10261 N NE2  . HIS A 1 45  ? 2.730   18.602  13.513  1.00 0.00 ? 97  HIS A NE2  4  
ATOM 10262 H H    . HIS A 1 45  ? 4.573   17.573  9.071   1.00 0.00 ? 97  HIS A H    4  
ATOM 10263 H HA   . HIS A 1 45  ? 4.600   20.330  10.149  1.00 0.00 ? 97  HIS A HA   4  
ATOM 10264 H HB2  . HIS A 1 45  ? 6.119   17.854  11.001  1.00 0.00 ? 97  HIS A HB2  4  
ATOM 10265 H HB3  . HIS A 1 45  ? 6.219   19.444  11.774  1.00 0.00 ? 97  HIS A HB3  4  
ATOM 10266 H HD2  . HIS A 1 45  ? 4.094   20.299  13.197  1.00 0.00 ? 97  HIS A HD2  4  
ATOM 10267 H HE1  . HIS A 1 45  ? 1.956   16.623  13.192  1.00 0.00 ? 97  HIS A HE1  4  
ATOM 10268 H HE2  . HIS A 1 45  ? 2.095   18.951  14.217  1.00 0.00 ? 97  HIS A HE2  4  
ATOM 10269 N N    . LYS A 1 46  ? 6.440   19.600  7.797   1.00 0.00 ? 98  LYS A N    4  
ATOM 10270 C CA   . LYS A 1 46  ? 7.492   20.073  6.902   1.00 0.00 ? 98  LYS A CA   4  
ATOM 10271 C C    . LYS A 1 46  ? 6.905   20.580  5.583   1.00 0.00 ? 98  LYS A C    4  
ATOM 10272 O O    . LYS A 1 46  ? 7.655   20.945  4.679   1.00 0.00 ? 98  LYS A O    4  
ATOM 10273 C CB   . LYS A 1 46  ? 8.512   18.957  6.643   1.00 0.00 ? 98  LYS A CB   4  
ATOM 10274 C CG   . LYS A 1 46  ? 9.405   18.654  7.850   1.00 0.00 ? 98  LYS A CG   4  
ATOM 10275 C CD   . LYS A 1 46  ? 10.292  19.846  8.225   1.00 0.00 ? 98  LYS A CD   4  
ATOM 10276 C CE   . LYS A 1 46  ? 11.449  19.401  9.126   1.00 0.00 ? 98  LYS A CE   4  
ATOM 10277 N NZ   . LYS A 1 46  ? 10.977  18.766  10.372  1.00 0.00 ? 98  LYS A NZ   4  
ATOM 10278 H H    . LYS A 1 46  ? 5.719   19.011  7.406   1.00 0.00 ? 98  LYS A H    4  
ATOM 10279 H HA   . LYS A 1 46  ? 8.002   20.915  7.370   1.00 0.00 ? 98  LYS A HA   4  
ATOM 10280 H HB2  . LYS A 1 46  ? 7.979   18.051  6.355   1.00 0.00 ? 98  LYS A HB2  4  
ATOM 10281 H HB3  . LYS A 1 46  ? 9.155   19.252  5.814   1.00 0.00 ? 98  LYS A HB3  4  
ATOM 10282 H HG2  . LYS A 1 46  ? 8.788   18.381  8.706   1.00 0.00 ? 98  LYS A HG2  4  
ATOM 10283 H HG3  . LYS A 1 46  ? 10.049  17.814  7.592   1.00 0.00 ? 98  LYS A HG3  4  
ATOM 10284 H HD2  . LYS A 1 46  ? 10.712  20.282  7.317   1.00 0.00 ? 98  LYS A HD2  4  
ATOM 10285 H HD3  . LYS A 1 46  ? 9.698   20.602  8.738   1.00 0.00 ? 98  LYS A HD3  4  
ATOM 10286 H HE2  . LYS A 1 46  ? 12.069  18.692  8.578   1.00 0.00 ? 98  LYS A HE2  4  
ATOM 10287 H HE3  . LYS A 1 46  ? 12.058  20.270  9.375   1.00 0.00 ? 98  LYS A HE3  4  
ATOM 10288 H HZ1  . LYS A 1 46  ? 10.415  17.955  10.157  1.00 0.00 ? 98  LYS A HZ1  4  
ATOM 10289 H HZ2  . LYS A 1 46  ? 11.766  18.465  10.924  1.00 0.00 ? 98  LYS A HZ2  4  
ATOM 10290 H HZ3  . LYS A 1 46  ? 10.420  19.415  10.910  1.00 0.00 ? 98  LYS A HZ3  4  
ATOM 10291 N N    . ALA A 1 47  ? 5.574   20.606  5.465   1.00 0.00 ? 99  ALA A N    4  
ATOM 10292 C CA   . ALA A 1 47  ? 4.903   21.077  4.263   1.00 0.00 ? 99  ALA A CA   4  
ATOM 10293 C C    . ALA A 1 47  ? 3.571   21.735  4.616   1.00 0.00 ? 99  ALA A C    4  
ATOM 10294 O O    . ALA A 1 47  ? 2.932   21.360  5.597   1.00 0.00 ? 99  ALA A O    4  
ATOM 10295 C CB   . ALA A 1 47  ? 4.684   19.901  3.311   1.00 0.00 ? 99  ALA A CB   4  
ATOM 10296 H H    . ALA A 1 47  ? 4.997   20.292  6.232   1.00 0.00 ? 99  ALA A H    4  
ATOM 10297 H HA   . ALA A 1 47  ? 5.532   21.815  3.765   1.00 0.00 ? 99  ALA A HA   4  
ATOM 10298 H HB1  . ALA A 1 47  ? 4.056   19.151  3.793   1.00 0.00 ? 99  ALA A HB1  4  
ATOM 10299 H HB2  . ALA A 1 47  ? 4.189   20.253  2.405   1.00 0.00 ? 99  ALA A HB2  4  
ATOM 10300 H HB3  . ALA A 1 47  ? 5.643   19.457  3.047   1.00 0.00 ? 99  ALA A HB3  4  
ATOM 10301 N N    . GLU A 1 48  ? 3.161   22.719  3.808   1.00 0.00 ? 100 GLU A N    4  
ATOM 10302 C CA   . GLU A 1 48  ? 1.932   23.491  3.993   1.00 0.00 ? 100 GLU A CA   4  
ATOM 10303 C C    . GLU A 1 48  ? 1.813   24.123  5.386   1.00 0.00 ? 100 GLU A C    4  
ATOM 10304 O O    . GLU A 1 48  ? 0.742   24.599  5.757   1.00 0.00 ? 100 GLU A O    4  
ATOM 10305 C CB   . GLU A 1 48  ? 0.710   22.641  3.633   1.00 0.00 ? 100 GLU A CB   4  
ATOM 10306 C CG   . GLU A 1 48  ? 0.793   22.142  2.189   1.00 0.00 ? 100 GLU A CG   4  
ATOM 10307 C CD   . GLU A 1 48  ? -0.457  21.349  1.817   1.00 0.00 ? 100 GLU A CD   4  
ATOM 10308 O OE1  . GLU A 1 48  ? -1.423  21.985  1.337   1.00 0.00 ? 100 GLU A OE1  4  
ATOM 10309 O OE2  . GLU A 1 48  ? -0.440  20.113  2.016   1.00 0.00 ? 100 GLU A OE2  4  
ATOM 10310 H H    . GLU A 1 48  ? 3.734   22.957  3.011   1.00 0.00 ? 100 GLU A H    4  
ATOM 10311 H HA   . GLU A 1 48  ? 1.970   24.317  3.283   1.00 0.00 ? 100 GLU A HA   4  
ATOM 10312 H HB2  . GLU A 1 48  ? 0.646   21.787  4.307   1.00 0.00 ? 100 GLU A HB2  4  
ATOM 10313 H HB3  . GLU A 1 48  ? -0.189  23.246  3.743   1.00 0.00 ? 100 GLU A HB3  4  
ATOM 10314 H HG2  . GLU A 1 48  ? 0.892   22.997  1.520   1.00 0.00 ? 100 GLU A HG2  4  
ATOM 10315 H HG3  . GLU A 1 48  ? 1.671   21.506  2.074   1.00 0.00 ? 100 GLU A HG3  4  
ATOM 10316 N N    . SER A 1 49  ? 2.903   24.132  6.159   1.00 0.00 ? 101 SER A N    4  
ATOM 10317 C CA   . SER A 1 49  ? 2.931   24.691  7.504   1.00 0.00 ? 101 SER A CA   4  
ATOM 10318 C C    . SER A 1 49  ? 4.370   25.023  7.894   1.00 0.00 ? 101 SER A C    4  
ATOM 10319 O O    . SER A 1 49  ? 5.307   24.658  7.183   1.00 0.00 ? 101 SER A O    4  
ATOM 10320 C CB   . SER A 1 49  ? 2.343   23.669  8.478   1.00 0.00 ? 101 SER A CB   4  
ATOM 10321 O OG   . SER A 1 49  ? 2.187   24.248  9.756   1.00 0.00 ? 101 SER A OG   4  
ATOM 10322 H H    . SER A 1 49  ? 3.761   23.733  5.804   1.00 0.00 ? 101 SER A H    4  
ATOM 10323 H HA   . SER A 1 49  ? 2.330   25.599  7.533   1.00 0.00 ? 101 SER A HA   4  
ATOM 10324 H HB2  . SER A 1 49  ? 1.367   23.345  8.113   1.00 0.00 ? 101 SER A HB2  4  
ATOM 10325 H HB3  . SER A 1 49  ? 3.006   22.807  8.542   1.00 0.00 ? 101 SER A HB3  4  
ATOM 10326 H HG   . SER A 1 49  ? 1.813   23.590  10.345  1.00 0.00 ? 101 SER A HG   4  
ATOM 10327 N N    . LYS A 1 50  ? 4.552   25.713  9.023   1.00 0.00 ? 102 LYS A N    4  
ATOM 10328 C CA   . LYS A 1 50  ? 5.875   26.062  9.526   1.00 0.00 ? 102 LYS A CA   4  
ATOM 10329 C C    . LYS A 1 50  ? 6.628   24.790  9.911   1.00 0.00 ? 102 LYS A C    4  
ATOM 10330 O O    . LYS A 1 50  ? 6.015   23.805  10.321  1.00 0.00 ? 102 LYS A O    4  
ATOM 10331 C CB   . LYS A 1 50  ? 5.726   27.020  10.712  1.00 0.00 ? 102 LYS A CB   4  
ATOM 10332 C CG   . LYS A 1 50  ? 7.087   27.512  11.209  1.00 0.00 ? 102 LYS A CG   4  
ATOM 10333 C CD   . LYS A 1 50  ? 6.895   28.527  12.334  1.00 0.00 ? 102 LYS A CD   4  
ATOM 10334 C CE   . LYS A 1 50  ? 8.258   29.013  12.823  1.00 0.00 ? 102 LYS A CE   4  
ATOM 10335 N NZ   . LYS A 1 50  ? 8.111   30.001  13.909  1.00 0.00 ? 102 LYS A NZ   4  
ATOM 10336 H H    . LYS A 1 50  ? 3.747   26.007  9.558   1.00 0.00 ? 102 LYS A H    4  
ATOM 10337 H HA   . LYS A 1 50  ? 6.428   26.568  8.735   1.00 0.00 ? 102 LYS A HA   4  
ATOM 10338 H HB2  . LYS A 1 50  ? 5.135   27.880  10.398  1.00 0.00 ? 102 LYS A HB2  4  
ATOM 10339 H HB3  . LYS A 1 50  ? 5.207   26.513  11.525  1.00 0.00 ? 102 LYS A HB3  4  
ATOM 10340 H HG2  . LYS A 1 50  ? 7.668   26.670  11.584  1.00 0.00 ? 102 LYS A HG2  4  
ATOM 10341 H HG3  . LYS A 1 50  ? 7.623   27.984  10.385  1.00 0.00 ? 102 LYS A HG3  4  
ATOM 10342 H HD2  . LYS A 1 50  ? 6.318   29.375  11.963  1.00 0.00 ? 102 LYS A HD2  4  
ATOM 10343 H HD3  . LYS A 1 50  ? 6.358   28.058  13.158  1.00 0.00 ? 102 LYS A HD3  4  
ATOM 10344 H HE2  . LYS A 1 50  ? 8.833   28.160  13.185  1.00 0.00 ? 102 LYS A HE2  4  
ATOM 10345 H HE3  . LYS A 1 50  ? 8.795   29.469  11.991  1.00 0.00 ? 102 LYS A HE3  4  
ATOM 10346 H HZ1  . LYS A 1 50  ? 7.616   29.586  14.685  1.00 0.00 ? 102 LYS A HZ1  4  
ATOM 10347 H HZ2  . LYS A 1 50  ? 9.023   30.301  14.225  1.00 0.00 ? 102 LYS A HZ2  4  
ATOM 10348 H HZ3  . LYS A 1 50  ? 7.597   30.804  13.578  1.00 0.00 ? 102 LYS A HZ3  4  
ATOM 10349 N N    . SER A 1 51  ? 7.956   24.807  9.779   1.00 0.00 ? 103 SER A N    4  
ATOM 10350 C CA   . SER A 1 51  ? 8.776   23.639  10.063  1.00 0.00 ? 103 SER A CA   4  
ATOM 10351 C C    . SER A 1 51  ? 8.747   23.296  11.549  1.00 0.00 ? 103 SER A C    4  
ATOM 10352 O O    . SER A 1 51  ? 8.962   24.161  12.398  1.00 0.00 ? 103 SER A O    4  
ATOM 10353 C CB   . SER A 1 51  ? 10.212  23.885  9.602   1.00 0.00 ? 103 SER A CB   4  
ATOM 10354 O OG   . SER A 1 51  ? 10.227  24.159  8.218   1.00 0.00 ? 103 SER A OG   4  
ATOM 10355 H H    . SER A 1 51  ? 8.418   25.651  9.470   1.00 0.00 ? 103 SER A H    4  
ATOM 10356 H HA   . SER A 1 51  ? 8.380   22.791  9.504   1.00 0.00 ? 103 SER A HA   4  
ATOM 10357 H HB2  . SER A 1 51  ? 10.629  24.733  10.147  1.00 0.00 ? 103 SER A HB2  4  
ATOM 10358 H HB3  . SER A 1 51  ? 10.813  22.998  9.804   1.00 0.00 ? 103 SER A HB3  4  
ATOM 10359 H HG   . SER A 1 51  ? 11.134  24.322  7.949   1.00 0.00 ? 103 SER A HG   4  
ATOM 10360 N N    . TYR A 1 52  ? 8.479   22.024  11.856  1.00 0.00 ? 104 TYR A N    4  
ATOM 10361 C CA   . TYR A 1 52  ? 8.446   21.508  13.215  1.00 0.00 ? 104 TYR A CA   4  
ATOM 10362 C C    . TYR A 1 52  ? 8.694   19.998  13.181  1.00 0.00 ? 104 TYR A C    4  
ATOM 10363 O O    . TYR A 1 52  ? 8.870   19.423  12.108  1.00 0.00 ? 104 TYR A O    4  
ATOM 10364 C CB   . TYR A 1 52  ? 7.085   21.829  13.841  1.00 0.00 ? 104 TYR A CB   4  
ATOM 10365 C CG   . TYR A 1 52  ? 7.007   21.529  15.323  1.00 0.00 ? 104 TYR A CG   4  
ATOM 10366 C CD1  . TYR A 1 52  ? 7.785   22.269  16.225  1.00 0.00 ? 104 TYR A CD1  4  
ATOM 10367 C CD2  . TYR A 1 52  ? 6.161   20.514  15.794  1.00 0.00 ? 104 TYR A CD2  4  
ATOM 10368 C CE1  . TYR A 1 52  ? 7.724   21.994  17.599  1.00 0.00 ? 104 TYR A CE1  4  
ATOM 10369 C CE2  . TYR A 1 52  ? 6.092   20.235  17.167  1.00 0.00 ? 104 TYR A CE2  4  
ATOM 10370 C CZ   . TYR A 1 52  ? 6.876   20.973  18.075  1.00 0.00 ? 104 TYR A CZ   4  
ATOM 10371 O OH   . TYR A 1 52  ? 6.816   20.704  19.410  1.00 0.00 ? 104 TYR A OH   4  
ATOM 10372 H H    . TYR A 1 52  ? 8.285   21.371  11.110  1.00 0.00 ? 104 TYR A H    4  
ATOM 10373 H HA   . TYR A 1 52  ? 9.230   21.984  13.803  1.00 0.00 ? 104 TYR A HA   4  
ATOM 10374 H HB2  . TYR A 1 52  ? 6.881   22.891  13.702  1.00 0.00 ? 104 TYR A HB2  4  
ATOM 10375 H HB3  . TYR A 1 52  ? 6.312   21.265  13.320  1.00 0.00 ? 104 TYR A HB3  4  
ATOM 10376 H HD1  . TYR A 1 52  ? 8.434   23.052  15.863  1.00 0.00 ? 104 TYR A HD1  4  
ATOM 10377 H HD2  . TYR A 1 52  ? 5.560   19.945  15.100  1.00 0.00 ? 104 TYR A HD2  4  
ATOM 10378 H HE1  . TYR A 1 52  ? 8.324   22.562  18.294  1.00 0.00 ? 104 TYR A HE1  4  
ATOM 10379 H HE2  . TYR A 1 52  ? 5.439   19.453  17.527  1.00 0.00 ? 104 TYR A HE2  4  
ATOM 10380 H HH   . TYR A 1 52  ? 6.207   19.993  19.621  1.00 0.00 ? 104 TYR A HH   4  
ATOM 10381 N N    . PHE A 1 53  ? 8.711   19.347  14.347  1.00 0.00 ? 105 PHE A N    4  
ATOM 10382 C CA   . PHE A 1 53  ? 8.905   17.908  14.419  1.00 0.00 ? 105 PHE A CA   4  
ATOM 10383 C C    . PHE A 1 53  ? 7.637   17.173  13.972  1.00 0.00 ? 105 PHE A C    4  
ATOM 10384 O O    . PHE A 1 53  ? 6.529   17.655  14.204  1.00 0.00 ? 105 PHE A O    4  
ATOM 10385 C CB   . PHE A 1 53  ? 9.304   17.509  15.840  1.00 0.00 ? 105 PHE A CB   4  
ATOM 10386 C CG   . PHE A 1 53  ? 10.628  18.094  16.279  1.00 0.00 ? 105 PHE A CG   4  
ATOM 10387 C CD1  . PHE A 1 53  ? 11.827  17.455  15.927  1.00 0.00 ? 105 PHE A CD1  4  
ATOM 10388 C CD2  . PHE A 1 53  ? 10.660  19.274  17.037  1.00 0.00 ? 105 PHE A CD2  4  
ATOM 10389 C CE1  . PHE A 1 53  ? 13.055  18.000  16.328  1.00 0.00 ? 105 PHE A CE1  4  
ATOM 10390 C CE2  . PHE A 1 53  ? 11.889  19.818  17.437  1.00 0.00 ? 105 PHE A CE2  4  
ATOM 10391 C CZ   . PHE A 1 53  ? 13.087  19.181  17.082  1.00 0.00 ? 105 PHE A CZ   4  
ATOM 10392 H H    . PHE A 1 53  ? 8.583   19.856  15.210  1.00 0.00 ? 105 PHE A H    4  
ATOM 10393 H HA   . PHE A 1 53  ? 9.720   17.641  13.747  1.00 0.00 ? 105 PHE A HA   4  
ATOM 10394 H HB2  . PHE A 1 53  ? 8.525   17.833  16.530  1.00 0.00 ? 105 PHE A HB2  4  
ATOM 10395 H HB3  . PHE A 1 53  ? 9.371   16.423  15.894  1.00 0.00 ? 105 PHE A HB3  4  
ATOM 10396 H HD1  . PHE A 1 53  ? 11.806  16.544  15.347  1.00 0.00 ? 105 PHE A HD1  4  
ATOM 10397 H HD2  . PHE A 1 53  ? 9.739   19.764  17.313  1.00 0.00 ? 105 PHE A HD2  4  
ATOM 10398 H HE1  . PHE A 1 53  ? 13.977  17.509  16.056  1.00 0.00 ? 105 PHE A HE1  4  
ATOM 10399 H HE2  . PHE A 1 53  ? 11.913  20.728  18.019  1.00 0.00 ? 105 PHE A HE2  4  
ATOM 10400 H HZ   . PHE A 1 53  ? 14.033  19.600  17.390  1.00 0.00 ? 105 PHE A HZ   4  
ATOM 10401 N N    . PRO A 1 54  ? 7.791   16.009  13.329  1.00 0.00 ? 106 PRO A N    4  
ATOM 10402 C CA   . PRO A 1 54  ? 6.696   15.187  12.837  1.00 0.00 ? 106 PRO A CA   4  
ATOM 10403 C C    . PRO A 1 54  ? 5.929   14.524  13.982  1.00 0.00 ? 106 PRO A C    4  
ATOM 10404 O O    . PRO A 1 54  ? 6.354   14.595  15.136  1.00 0.00 ? 106 PRO A O    4  
ATOM 10405 C CB   . PRO A 1 54  ? 7.369   14.136  11.955  1.00 0.00 ? 106 PRO A CB   4  
ATOM 10406 C CG   . PRO A 1 54  ? 8.743   13.971  12.596  1.00 0.00 ? 106 PRO A CG   4  
ATOM 10407 C CD   . PRO A 1 54  ? 9.070   15.397  13.026  1.00 0.00 ? 106 PRO A CD   4  
ATOM 10408 H HA   . PRO A 1 54  ? 6.012   15.787  12.238  1.00 0.00 ? 106 PRO A HA   4  
ATOM 10409 H HB2  . PRO A 1 54  ? 6.820   13.195  11.930  1.00 0.00 ? 106 PRO A HB2  4  
ATOM 10410 H HB3  . PRO A 1 54  ? 7.490   14.545  10.951  1.00 0.00 ? 106 PRO A HB3  4  
ATOM 10411 H HG2  . PRO A 1 54  ? 8.658   13.331  13.475  1.00 0.00 ? 106 PRO A HG2  4  
ATOM 10412 H HG3  . PRO A 1 54  ? 9.476   13.581  11.892  1.00 0.00 ? 106 PRO A HG3  4  
ATOM 10413 H HD2  . PRO A 1 54  ? 9.723   15.394  13.899  1.00 0.00 ? 106 PRO A HD2  4  
ATOM 10414 H HD3  . PRO A 1 54  ? 9.540   15.932  12.201  1.00 0.00 ? 106 PRO A HD3  4  
ATOM 10415 N N    . PRO A 1 55  ? 4.797   13.873  13.672  1.00 0.00 ? 107 PRO A N    4  
ATOM 10416 C CA   . PRO A 1 55  ? 4.005   13.135  14.641  1.00 0.00 ? 107 PRO A CA   4  
ATOM 10417 C C    . PRO A 1 55  ? 4.838   12.053  15.325  1.00 0.00 ? 107 PRO A C    4  
ATOM 10418 O O    . PRO A 1 55  ? 5.835   11.586  14.774  1.00 0.00 ? 107 PRO A O    4  
ATOM 10419 C CB   . PRO A 1 55  ? 2.850   12.521  13.847  1.00 0.00 ? 107 PRO A CB   4  
ATOM 10420 C CG   . PRO A 1 55  ? 2.731   13.433  12.628  1.00 0.00 ? 107 PRO A CG   4  
ATOM 10421 C CD   . PRO A 1 55  ? 4.186   13.806  12.359  1.00 0.00 ? 107 PRO A CD   4  
ATOM 10422 H HA   . PRO A 1 55  ? 3.610   13.828  15.384  1.00 0.00 ? 107 PRO A HA   4  
ATOM 10423 H HB2  . PRO A 1 55  ? 3.123   11.519  13.517  1.00 0.00 ? 107 PRO A HB2  4  
ATOM 10424 H HB3  . PRO A 1 55  ? 1.928   12.499  14.429  1.00 0.00 ? 107 PRO A HB3  4  
ATOM 10425 H HG2  . PRO A 1 55  ? 2.279   12.921  11.778  1.00 0.00 ? 107 PRO A HG2  4  
ATOM 10426 H HG3  . PRO A 1 55  ? 2.166   14.327  12.893  1.00 0.00 ? 107 PRO A HG3  4  
ATOM 10427 H HD2  . PRO A 1 55  ? 4.662   13.020  11.773  1.00 0.00 ? 107 PRO A HD2  4  
ATOM 10428 H HD3  . PRO A 1 55  ? 4.242   14.761  11.837  1.00 0.00 ? 107 PRO A HD3  4  
ATOM 10429 N N    . LYS A 1 56  ? 4.430   11.650  16.530  1.00 0.00 ? 108 LYS A N    4  
ATOM 10430 C CA   . LYS A 1 56  ? 5.160   10.649  17.290  1.00 0.00 ? 108 LYS A CA   4  
ATOM 10431 C C    . LYS A 1 56  ? 4.823   9.248   16.791  1.00 0.00 ? 108 LYS A C    4  
ATOM 10432 O O    . LYS A 1 56  ? 3.652   8.898   16.664  1.00 0.00 ? 108 LYS A O    4  
ATOM 10433 C CB   . LYS A 1 56  ? 4.833   10.781  18.780  1.00 0.00 ? 108 LYS A CB   4  
ATOM 10434 C CG   . LYS A 1 56  ? 5.209   12.151  19.350  1.00 0.00 ? 108 LYS A CG   4  
ATOM 10435 C CD   . LYS A 1 56  ? 6.714   12.405  19.261  1.00 0.00 ? 108 LYS A CD   4  
ATOM 10436 C CE   . LYS A 1 56  ? 7.047   13.718  19.967  1.00 0.00 ? 108 LYS A CE   4  
ATOM 10437 N NZ   . LYS A 1 56  ? 8.498   13.984  19.939  1.00 0.00 ? 108 LYS A NZ   4  
ATOM 10438 H H    . LYS A 1 56  ? 3.594   12.047  16.936  1.00 0.00 ? 108 LYS A H    4  
ATOM 10439 H HA   . LYS A 1 56  ? 6.229   10.811  17.149  1.00 0.00 ? 108 LYS A HA   4  
ATOM 10440 H HB2  . LYS A 1 56  ? 3.765   10.622  18.925  1.00 0.00 ? 108 LYS A HB2  4  
ATOM 10441 H HB3  . LYS A 1 56  ? 5.374   10.011  19.333  1.00 0.00 ? 108 LYS A HB3  4  
ATOM 10442 H HG2  . LYS A 1 56  ? 4.677   12.935  18.809  1.00 0.00 ? 108 LYS A HG2  4  
ATOM 10443 H HG3  . LYS A 1 56  ? 4.910   12.187  20.398  1.00 0.00 ? 108 LYS A HG3  4  
ATOM 10444 H HD2  . LYS A 1 56  ? 7.249   11.588  19.745  1.00 0.00 ? 108 LYS A HD2  4  
ATOM 10445 H HD3  . LYS A 1 56  ? 7.018   12.470  18.216  1.00 0.00 ? 108 LYS A HD3  4  
ATOM 10446 H HE2  . LYS A 1 56  ? 6.519   14.533  19.474  1.00 0.00 ? 108 LYS A HE2  4  
ATOM 10447 H HE3  . LYS A 1 56  ? 6.714   13.658  21.003  1.00 0.00 ? 108 LYS A HE3  4  
ATOM 10448 H HZ1  . LYS A 1 56  ? 8.812   14.076  18.982  1.00 0.00 ? 108 LYS A HZ1  4  
ATOM 10449 H HZ2  . LYS A 1 56  ? 8.699   14.840  20.436  1.00 0.00 ? 108 LYS A HZ2  4  
ATOM 10450 H HZ3  . LYS A 1 56  ? 8.994   13.223  20.381  1.00 0.00 ? 108 LYS A HZ3  4  
ATOM 10451 N N    . GLY A 1 57  ? 5.858   8.454   16.511  1.00 0.00 ? 109 GLY A N    4  
ATOM 10452 C CA   . GLY A 1 57  ? 5.722   7.049   16.151  1.00 0.00 ? 109 GLY A CA   4  
ATOM 10453 C C    . GLY A 1 57  ? 5.178   6.784   14.747  1.00 0.00 ? 109 GLY A C    4  
ATOM 10454 O O    . GLY A 1 57  ? 5.127   5.624   14.345  1.00 0.00 ? 109 GLY A O    4  
ATOM 10455 H H    . GLY A 1 57  ? 6.793   8.834   16.555  1.00 0.00 ? 109 GLY A H    4  
ATOM 10456 H HA2  . GLY A 1 57  ? 6.698   6.573   16.241  1.00 0.00 ? 109 GLY A HA2  4  
ATOM 10457 H HA3  . GLY A 1 57  ? 5.046   6.579   16.866  1.00 0.00 ? 109 GLY A HA3  4  
ATOM 10458 N N    . TYR A 1 58  ? 4.774   7.811   13.988  1.00 0.00 ? 110 TYR A N    4  
ATOM 10459 C CA   . TYR A 1 58  ? 4.188   7.600   12.667  1.00 0.00 ? 110 TYR A CA   4  
ATOM 10460 C C    . TYR A 1 58  ? 4.681   8.618   11.642  1.00 0.00 ? 110 TYR A C    4  
ATOM 10461 O O    . TYR A 1 58  ? 4.913   9.780   11.968  1.00 0.00 ? 110 TYR A O    4  
ATOM 10462 C CB   . TYR A 1 58  ? 2.663   7.641   12.765  1.00 0.00 ? 110 TYR A CB   4  
ATOM 10463 C CG   . TYR A 1 58  ? 2.086   6.599   13.696  1.00 0.00 ? 110 TYR A CG   4  
ATOM 10464 C CD1  . TYR A 1 58  ? 1.958   5.274   13.262  1.00 0.00 ? 110 TYR A CD1  4  
ATOM 10465 C CD2  . TYR A 1 58  ? 1.681   6.957   14.990  1.00 0.00 ? 110 TYR A CD2  4  
ATOM 10466 C CE1  . TYR A 1 58  ? 1.422   4.301   14.119  1.00 0.00 ? 110 TYR A CE1  4  
ATOM 10467 C CE2  . TYR A 1 58  ? 1.146   5.992   15.855  1.00 0.00 ? 110 TYR A CE2  4  
ATOM 10468 C CZ   . TYR A 1 58  ? 1.013   4.658   15.420  1.00 0.00 ? 110 TYR A CZ   4  
ATOM 10469 O OH   . TYR A 1 58  ? 0.491   3.716   16.256  1.00 0.00 ? 110 TYR A OH   4  
ATOM 10470 H H    . TYR A 1 58  ? 4.867   8.758   14.325  1.00 0.00 ? 110 TYR A H    4  
ATOM 10471 H HA   . TYR A 1 58  ? 4.474   6.610   12.316  1.00 0.00 ? 110 TYR A HA   4  
ATOM 10472 H HB2  . TYR A 1 58  ? 2.357   8.630   13.109  1.00 0.00 ? 110 TYR A HB2  4  
ATOM 10473 H HB3  . TYR A 1 58  ? 2.246   7.485   11.770  1.00 0.00 ? 110 TYR A HB3  4  
ATOM 10474 H HD1  . TYR A 1 58  ? 2.274   5.006   12.265  1.00 0.00 ? 110 TYR A HD1  4  
ATOM 10475 H HD2  . TYR A 1 58  ? 1.783   7.980   15.321  1.00 0.00 ? 110 TYR A HD2  4  
ATOM 10476 H HE1  . TYR A 1 58  ? 1.322   3.279   13.783  1.00 0.00 ? 110 TYR A HE1  4  
ATOM 10477 H HE2  . TYR A 1 58  ? 0.837   6.267   16.852  1.00 0.00 ? 110 TYR A HE2  4  
ATOM 10478 H HH   . TYR A 1 58  ? 0.444   2.847   15.850  1.00 0.00 ? 110 TYR A HH   4  
ATOM 10479 N N    . ALA A 1 59  ? 4.839   8.162   10.394  1.00 0.00 ? 111 ALA A N    4  
ATOM 10480 C CA   . ALA A 1 59  ? 5.306   8.986   9.289   1.00 0.00 ? 111 ALA A CA   4  
ATOM 10481 C C    . ALA A 1 59  ? 5.026   8.314   7.944   1.00 0.00 ? 111 ALA A C    4  
ATOM 10482 O O    . ALA A 1 59  ? 4.643   7.146   7.893   1.00 0.00 ? 111 ALA A O    4  
ATOM 10483 C CB   . ALA A 1 59  ? 6.816   9.166   9.426   1.00 0.00 ? 111 ALA A CB   4  
ATOM 10484 H H    . ALA A 1 59  ? 4.628   7.194   10.194  1.00 0.00 ? 111 ALA A H    4  
ATOM 10485 H HA   . ALA A 1 59  ? 4.819   9.960   9.315   1.00 0.00 ? 111 ALA A HA   4  
ATOM 10486 H HB1  . ALA A 1 59  ? 7.292   8.188   9.478   1.00 0.00 ? 111 ALA A HB1  4  
ATOM 10487 H HB2  . ALA A 1 59  ? 7.198   9.692   8.552   1.00 0.00 ? 111 ALA A HB2  4  
ATOM 10488 H HB3  . ALA A 1 59  ? 7.042   9.741   10.324  1.00 0.00 ? 111 ALA A HB3  4  
ATOM 10489 N N    . PHE A 1 60  ? 5.223   9.065   6.853   1.00 0.00 ? 112 PHE A N    4  
ATOM 10490 C CA   . PHE A 1 60  ? 5.197   8.509   5.511   1.00 0.00 ? 112 PHE A CA   4  
ATOM 10491 C C    . PHE A 1 60  ? 6.496   8.900   4.816   1.00 0.00 ? 112 PHE A C    4  
ATOM 10492 O O    . PHE A 1 60  ? 6.986   10.013  5.003   1.00 0.00 ? 112 PHE A O    4  
ATOM 10493 C CB   . PHE A 1 60  ? 3.982   9.028   4.743   1.00 0.00 ? 112 PHE A CB   4  
ATOM 10494 C CG   . PHE A 1 60  ? 2.656   8.576   5.311   1.00 0.00 ? 112 PHE A CG   4  
ATOM 10495 C CD1  . PHE A 1 60  ? 2.033   9.320   6.324   1.00 0.00 ? 112 PHE A CD1  4  
ATOM 10496 C CD2  . PHE A 1 60  ? 2.047   7.411   4.823   1.00 0.00 ? 112 PHE A CD2  4  
ATOM 10497 C CE1  . PHE A 1 60  ? 0.801   8.900   6.846   1.00 0.00 ? 112 PHE A CE1  4  
ATOM 10498 C CE2  . PHE A 1 60  ? 0.814   6.992   5.345   1.00 0.00 ? 112 PHE A CE2  4  
ATOM 10499 C CZ   . PHE A 1 60  ? 0.192   7.737   6.356   1.00 0.00 ? 112 PHE A CZ   4  
ATOM 10500 H H    . PHE A 1 60  ? 5.409   10.053  6.949   1.00 0.00 ? 112 PHE A H    4  
ATOM 10501 H HA   . PHE A 1 60  ? 5.144   7.421   5.565   1.00 0.00 ? 112 PHE A HA   4  
ATOM 10502 H HB2  . PHE A 1 60  ? 4.009   10.117  4.733   1.00 0.00 ? 112 PHE A HB2  4  
ATOM 10503 H HB3  . PHE A 1 60  ? 4.050   8.681   3.710   1.00 0.00 ? 112 PHE A HB3  4  
ATOM 10504 H HD1  . PHE A 1 60  ? 2.501   10.216  6.703   1.00 0.00 ? 112 PHE A HD1  4  
ATOM 10505 H HD2  . PHE A 1 60  ? 2.526   6.834   4.046   1.00 0.00 ? 112 PHE A HD2  4  
ATOM 10506 H HE1  . PHE A 1 60  ? 0.321   9.473   7.627   1.00 0.00 ? 112 PHE A HE1  4  
ATOM 10507 H HE2  . PHE A 1 60  ? 0.345   6.096   4.967   1.00 0.00 ? 112 PHE A HE2  4  
ATOM 10508 H HZ   . PHE A 1 60  ? -0.758  7.415   6.758   1.00 0.00 ? 112 PHE A HZ   4  
ATOM 10509 N N    . LEU A 1 61  ? 7.067   7.999   4.014   1.00 0.00 ? 113 LEU A N    4  
ATOM 10510 C CA   . LEU A 1 61  ? 8.320   8.270   3.328   1.00 0.00 ? 113 LEU A CA   4  
ATOM 10511 C C    . LEU A 1 61  ? 8.489   7.371   2.109   1.00 0.00 ? 113 LEU A C    4  
ATOM 10512 O O    . LEU A 1 61  ? 7.694   6.459   1.886   1.00 0.00 ? 113 LEU A O    4  
ATOM 10513 C CB   . LEU A 1 61  ? 9.479   8.116   4.321   1.00 0.00 ? 113 LEU A CB   4  
ATOM 10514 C CG   . LEU A 1 61  ? 9.547   6.770   5.053   1.00 0.00 ? 113 LEU A CG   4  
ATOM 10515 C CD1  . LEU A 1 61  ? 10.203  5.667   4.221   1.00 0.00 ? 113 LEU A CD1  4  
ATOM 10516 C CD2  . LEU A 1 61  ? 10.418  6.976   6.286   1.00 0.00 ? 113 LEU A CD2  4  
ATOM 10517 H H    . LEU A 1 61  ? 6.629   7.100   3.870   1.00 0.00 ? 113 LEU A H    4  
ATOM 10518 H HA   . LEU A 1 61  ? 8.318   9.303   2.979   1.00 0.00 ? 113 LEU A HA   4  
ATOM 10519 H HB2  . LEU A 1 61  ? 10.426  8.289   3.811   1.00 0.00 ? 113 LEU A HB2  4  
ATOM 10520 H HB3  . LEU A 1 61  ? 9.357   8.896   5.073   1.00 0.00 ? 113 LEU A HB3  4  
ATOM 10521 H HG   . LEU A 1 61  ? 8.552   6.456   5.369   1.00 0.00 ? 113 LEU A HG   4  
ATOM 10522 H HD11 . LEU A 1 61  ? 11.209  5.973   3.933   1.00 0.00 ? 113 LEU A HD11 4  
ATOM 10523 H HD12 . LEU A 1 61  ? 10.271  4.761   4.823   1.00 0.00 ? 113 LEU A HD12 4  
ATOM 10524 H HD13 . LEU A 1 61  ? 9.607   5.459   3.332   1.00 0.00 ? 113 LEU A HD13 4  
ATOM 10525 H HD21 . LEU A 1 61  ? 9.943   7.693   6.956   1.00 0.00 ? 113 LEU A HD21 4  
ATOM 10526 H HD22 . LEU A 1 61  ? 10.551  6.026   6.802   1.00 0.00 ? 113 LEU A HD22 4  
ATOM 10527 H HD23 . LEU A 1 61  ? 11.390  7.360   5.974   1.00 0.00 ? 113 LEU A HD23 4  
ATOM 10528 N N    . LEU A 1 62  ? 9.535   7.635   1.322   1.00 0.00 ? 114 LEU A N    4  
ATOM 10529 C CA   . LEU A 1 62  ? 9.857   6.843   0.151   1.00 0.00 ? 114 LEU A CA   4  
ATOM 10530 C C    . LEU A 1 62  ? 11.363  6.870   -0.079  1.00 0.00 ? 114 LEU A C    4  
ATOM 10531 O O    . LEU A 1 62  ? 12.080  7.642   0.558   1.00 0.00 ? 114 LEU A O    4  
ATOM 10532 C CB   . LEU A 1 62  ? 9.043   7.322   -1.062  1.00 0.00 ? 114 LEU A CB   4  
ATOM 10533 C CG   . LEU A 1 62  ? 9.064   8.833   -1.323  1.00 0.00 ? 114 LEU A CG   4  
ATOM 10534 C CD1  . LEU A 1 62  ? 10.450  9.339   -1.706  1.00 0.00 ? 114 LEU A CD1  4  
ATOM 10535 C CD2  . LEU A 1 62  ? 8.109   9.134   -2.477  1.00 0.00 ? 114 LEU A CD2  4  
ATOM 10536 H H    . LEU A 1 62  ? 10.143  8.413   1.537   1.00 0.00 ? 114 LEU A H    4  
ATOM 10537 H HA   . LEU A 1 62  ? 9.579   5.809   0.351   1.00 0.00 ? 114 LEU A HA   4  
ATOM 10538 H HB2  . LEU A 1 62  ? 9.397   6.802   -1.951  1.00 0.00 ? 114 LEU A HB2  4  
ATOM 10539 H HB3  . LEU A 1 62  ? 8.005   7.033   -0.896  1.00 0.00 ? 114 LEU A HB3  4  
ATOM 10540 H HG   . LEU A 1 62  ? 8.719   9.363   -0.436  1.00 0.00 ? 114 LEU A HG   4  
ATOM 10541 H HD11 . LEU A 1 62  ? 10.857  8.729   -2.512  1.00 0.00 ? 114 LEU A HD11 4  
ATOM 10542 H HD12 . LEU A 1 62  ? 10.375  10.374  -2.037  1.00 0.00 ? 114 LEU A HD12 4  
ATOM 10543 H HD13 . LEU A 1 62  ? 11.107  9.296   -0.838  1.00 0.00 ? 114 LEU A HD13 4  
ATOM 10544 H HD21 . LEU A 1 62  ? 8.087   10.208  -2.660  1.00 0.00 ? 114 LEU A HD21 4  
ATOM 10545 H HD22 . LEU A 1 62  ? 8.446   8.620   -3.377  1.00 0.00 ? 114 LEU A HD22 4  
ATOM 10546 H HD23 . LEU A 1 62  ? 7.107   8.793   -2.219  1.00 0.00 ? 114 LEU A HD23 4  
ATOM 10547 N N    . PHE A 1 63  ? 11.849  6.026   -0.991  1.00 0.00 ? 115 PHE A N    4  
ATOM 10548 C CA   . PHE A 1 63  ? 13.276  5.890   -1.225  1.00 0.00 ? 115 PHE A CA   4  
ATOM 10549 C C    . PHE A 1 63  ? 13.646  6.342   -2.637  1.00 0.00 ? 115 PHE A C    4  
ATOM 10550 O O    . PHE A 1 63  ? 12.798  6.358   -3.528  1.00 0.00 ? 115 PHE A O    4  
ATOM 10551 C CB   . PHE A 1 63  ? 13.684  4.449   -0.920  1.00 0.00 ? 115 PHE A CB   4  
ATOM 10552 C CG   . PHE A 1 63  ? 15.135  4.328   -0.534  1.00 0.00 ? 115 PHE A CG   4  
ATOM 10553 C CD1  . PHE A 1 63  ? 15.536  4.632   0.776   1.00 0.00 ? 115 PHE A CD1  4  
ATOM 10554 C CD2  . PHE A 1 63  ? 16.081  3.916   -1.484  1.00 0.00 ? 115 PHE A CD2  4  
ATOM 10555 C CE1  . PHE A 1 63  ? 16.895  4.573   1.114   1.00 0.00 ? 115 PHE A CE1  4  
ATOM 10556 C CE2  . PHE A 1 63  ? 17.437  3.847   -1.141  1.00 0.00 ? 115 PHE A CE2  4  
ATOM 10557 C CZ   . PHE A 1 63  ? 17.844  4.184   0.156   1.00 0.00 ? 115 PHE A CZ   4  
ATOM 10558 H H    . PHE A 1 63  ? 11.219  5.456   -1.538  1.00 0.00 ? 115 PHE A H    4  
ATOM 10559 H HA   . PHE A 1 63  ? 13.800  6.536   -0.521  1.00 0.00 ? 115 PHE A HA   4  
ATOM 10560 H HB2  . PHE A 1 63  ? 13.084  4.086   -0.086  1.00 0.00 ? 115 PHE A HB2  4  
ATOM 10561 H HB3  . PHE A 1 63  ? 13.475  3.821   -1.786  1.00 0.00 ? 115 PHE A HB3  4  
ATOM 10562 H HD1  . PHE A 1 63  ? 14.806  4.913   1.522   1.00 0.00 ? 115 PHE A HD1  4  
ATOM 10563 H HD2  . PHE A 1 63  ? 15.766  3.654   -2.483  1.00 0.00 ? 115 PHE A HD2  4  
ATOM 10564 H HE1  . PHE A 1 63  ? 17.209  4.828   2.114   1.00 0.00 ? 115 PHE A HE1  4  
ATOM 10565 H HE2  . PHE A 1 63  ? 18.166  3.535   -1.874  1.00 0.00 ? 115 PHE A HE2  4  
ATOM 10566 H HZ   . PHE A 1 63  ? 18.892  4.142   0.418   1.00 0.00 ? 115 PHE A HZ   4  
ATOM 10567 N N    . GLN A 1 64  ? 14.914  6.713   -2.850  1.00 0.00 ? 116 GLN A N    4  
ATOM 10568 C CA   . GLN A 1 64  ? 15.360  7.243   -4.134  1.00 0.00 ? 116 GLN A CA   4  
ATOM 10569 C C    . GLN A 1 64  ? 15.453  6.147   -5.195  1.00 0.00 ? 116 GLN A C    4  
ATOM 10570 O O    . GLN A 1 64  ? 15.530  6.448   -6.386  1.00 0.00 ? 116 GLN A O    4  
ATOM 10571 C CB   . GLN A 1 64  ? 16.706  7.951   -3.958  1.00 0.00 ? 116 GLN A CB   4  
ATOM 10572 C CG   . GLN A 1 64  ? 16.547  9.173   -3.050  1.00 0.00 ? 116 GLN A CG   4  
ATOM 10573 C CD   . GLN A 1 64  ? 17.848  9.954   -2.901  1.00 0.00 ? 116 GLN A CD   4  
ATOM 10574 O OE1  . GLN A 1 64  ? 18.886  9.576   -3.440  1.00 0.00 ? 116 GLN A OE1  4  
ATOM 10575 N NE2  . GLN A 1 64  ? 17.805  11.060  -2.162  1.00 0.00 ? 116 GLN A NE2  4  
ATOM 10576 H H    . GLN A 1 64  ? 15.591  6.633   -2.106  1.00 0.00 ? 116 GLN A H    4  
ATOM 10577 H HA   . GLN A 1 64  ? 14.629  7.974   -4.479  1.00 0.00 ? 116 GLN A HA   4  
ATOM 10578 H HB2  . GLN A 1 64  ? 17.429  7.261   -3.521  1.00 0.00 ? 116 GLN A HB2  4  
ATOM 10579 H HB3  . GLN A 1 64  ? 17.065  8.278   -4.933  1.00 0.00 ? 116 GLN A HB3  4  
ATOM 10580 H HG2  . GLN A 1 64  ? 15.790  9.834   -3.471  1.00 0.00 ? 116 GLN A HG2  4  
ATOM 10581 H HG3  . GLN A 1 64  ? 16.214  8.852   -2.063  1.00 0.00 ? 116 GLN A HG3  4  
ATOM 10582 H HE21 . GLN A 1 64  ? 16.939  11.343  -1.726  1.00 0.00 ? 116 GLN A HE21 4  
ATOM 10583 H HE22 . GLN A 1 64  ? 18.640  11.614  -2.040  1.00 0.00 ? 116 GLN A HE22 4  
ATOM 10584 N N    . ASP A 1 65  ? 15.443  4.881   -4.768  1.00 0.00 ? 117 ASP A N    4  
ATOM 10585 C CA   . ASP A 1 65  ? 15.410  3.746   -5.678  1.00 0.00 ? 117 ASP A CA   4  
ATOM 10586 C C    . ASP A 1 65  ? 14.285  2.807   -5.254  1.00 0.00 ? 117 ASP A C    4  
ATOM 10587 O O    . ASP A 1 65  ? 14.098  2.554   -4.066  1.00 0.00 ? 117 ASP A O    4  
ATOM 10588 C CB   . ASP A 1 65  ? 16.759  3.025   -5.674  1.00 0.00 ? 117 ASP A CB   4  
ATOM 10589 C CG   . ASP A 1 65  ? 17.877  3.923   -6.200  1.00 0.00 ? 117 ASP A CG   4  
ATOM 10590 O OD1  . ASP A 1 65  ? 17.959  4.072   -7.439  1.00 0.00 ? 117 ASP A OD1  4  
ATOM 10591 O OD2  . ASP A 1 65  ? 18.638  4.450   -5.360  1.00 0.00 ? 117 ASP A OD2  4  
ATOM 10592 H H    . ASP A 1 65  ? 15.459  4.690   -3.776  1.00 0.00 ? 117 ASP A H    4  
ATOM 10593 H HA   . ASP A 1 65  ? 15.205  4.095   -6.689  1.00 0.00 ? 117 ASP A HA   4  
ATOM 10594 H HB2  . ASP A 1 65  ? 16.993  2.708   -4.658  1.00 0.00 ? 117 ASP A HB2  4  
ATOM 10595 H HB3  . ASP A 1 65  ? 16.689  2.140   -6.305  1.00 0.00 ? 117 ASP A HB3  4  
ATOM 10596 N N    . GLU A 1 66  ? 13.532  2.287   -6.226  1.00 0.00 ? 118 GLU A N    4  
ATOM 10597 C CA   . GLU A 1 66  ? 12.367  1.463   -5.941  1.00 0.00 ? 118 GLU A CA   4  
ATOM 10598 C C    . GLU A 1 66  ? 12.739  -0.014  -5.782  1.00 0.00 ? 118 GLU A C    4  
ATOM 10599 O O    . GLU A 1 66  ? 11.914  -0.816  -5.350  1.00 0.00 ? 118 GLU A O    4  
ATOM 10600 C CB   . GLU A 1 66  ? 11.331  1.702   -7.043  1.00 0.00 ? 118 GLU A CB   4  
ATOM 10601 C CG   . GLU A 1 66  ? 9.976   1.083   -6.705  1.00 0.00 ? 118 GLU A CG   4  
ATOM 10602 C CD   . GLU A 1 66  ? 8.893   1.654   -7.617  1.00 0.00 ? 118 GLU A CD   4  
ATOM 10603 O OE1  . GLU A 1 66  ? 8.833   1.219   -8.788  1.00 0.00 ? 118 GLU A OE1  4  
ATOM 10604 O OE2  . GLU A 1 66  ? 8.132   2.525   -7.135  1.00 0.00 ? 118 GLU A OE2  4  
ATOM 10605 H H    . GLU A 1 66  ? 13.761  2.467   -7.193  1.00 0.00 ? 118 GLU A H    4  
ATOM 10606 H HA   . GLU A 1 66  ? 11.938  1.799   -4.996  1.00 0.00 ? 118 GLU A HA   4  
ATOM 10607 H HB2  . GLU A 1 66  ? 11.197  2.778   -7.153  1.00 0.00 ? 118 GLU A HB2  4  
ATOM 10608 H HB3  . GLU A 1 66  ? 11.695  1.298   -7.987  1.00 0.00 ? 118 GLU A HB3  4  
ATOM 10609 H HG2  . GLU A 1 66  ? 10.027  0.002   -6.829  1.00 0.00 ? 118 GLU A HG2  4  
ATOM 10610 H HG3  . GLU A 1 66  ? 9.726   1.310   -5.668  1.00 0.00 ? 118 GLU A HG3  4  
ATOM 10611 N N    . SER A 1 67  ? 13.978  -0.382  -6.128  1.00 0.00 ? 119 SER A N    4  
ATOM 10612 C CA   . SER A 1 67  ? 14.456  -1.749  -5.965  1.00 0.00 ? 119 SER A CA   4  
ATOM 10613 C C    . SER A 1 67  ? 15.066  -1.951  -4.578  1.00 0.00 ? 119 SER A C    4  
ATOM 10614 O O    . SER A 1 67  ? 15.090  -3.070  -4.064  1.00 0.00 ? 119 SER A O    4  
ATOM 10615 C CB   . SER A 1 67  ? 15.476  -2.053  -7.061  1.00 0.00 ? 119 SER A CB   4  
ATOM 10616 O OG   . SER A 1 67  ? 16.540  -1.125  -6.992  1.00 0.00 ? 119 SER A OG   4  
ATOM 10617 H H    . SER A 1 67  ? 14.616  0.299   -6.514  1.00 0.00 ? 119 SER A H    4  
ATOM 10618 H HA   . SER A 1 67  ? 13.614  -2.433  -6.076  1.00 0.00 ? 119 SER A HA   4  
ATOM 10619 H HB2  . SER A 1 67  ? 15.862  -3.064  -6.930  1.00 0.00 ? 119 SER A HB2  4  
ATOM 10620 H HB3  . SER A 1 67  ? 14.989  -1.977  -8.033  1.00 0.00 ? 119 SER A HB3  4  
ATOM 10621 H HG   . SER A 1 67  ? 17.161  -1.322  -7.697  1.00 0.00 ? 119 SER A HG   4  
ATOM 10622 N N    . SER A 1 68  ? 15.560  -0.869  -3.965  1.00 0.00 ? 120 SER A N    4  
ATOM 10623 C CA   . SER A 1 68  ? 16.135  -0.933  -2.629  1.00 0.00 ? 120 SER A CA   4  
ATOM 10624 C C    . SER A 1 68  ? 15.021  -1.094  -1.597  1.00 0.00 ? 120 SER A C    4  
ATOM 10625 O O    . SER A 1 68  ? 15.255  -1.572  -0.487  1.00 0.00 ? 120 SER A O    4  
ATOM 10626 C CB   . SER A 1 68  ? 16.945  0.337   -2.371  1.00 0.00 ? 120 SER A CB   4  
ATOM 10627 O OG   . SER A 1 68  ? 17.596  0.245   -1.123  1.00 0.00 ? 120 SER A OG   4  
ATOM 10628 H H    . SER A 1 68  ? 15.538  0.027   -4.430  1.00 0.00 ? 120 SER A H    4  
ATOM 10629 H HA   . SER A 1 68  ? 16.801  -1.794  -2.571  1.00 0.00 ? 120 SER A HA   4  
ATOM 10630 H HB2  . SER A 1 68  ? 17.689  0.458   -3.157  1.00 0.00 ? 120 SER A HB2  4  
ATOM 10631 H HB3  . SER A 1 68  ? 16.276  1.197   -2.373  1.00 0.00 ? 120 SER A HB3  4  
ATOM 10632 H HG   . SER A 1 68  ? 18.079  1.061   -0.971  1.00 0.00 ? 120 SER A HG   4  
ATOM 10633 N N    . VAL A 1 69  ? 13.800  -0.690  -1.967  1.00 0.00 ? 121 VAL A N    4  
ATOM 10634 C CA   . VAL A 1 69  ? 12.631  -0.832  -1.115  1.00 0.00 ? 121 VAL A CA   4  
ATOM 10635 C C    . VAL A 1 69  ? 12.351  -2.311  -0.872  1.00 0.00 ? 121 VAL A C    4  
ATOM 10636 O O    . VAL A 1 69  ? 11.862  -2.676  0.190   1.00 0.00 ? 121 VAL A O    4  
ATOM 10637 C CB   . VAL A 1 69  ? 11.434  -0.149  -1.789  1.00 0.00 ? 121 VAL A CB   4  
ATOM 10638 C CG1  . VAL A 1 69  ? 10.122  -0.417  -1.049  1.00 0.00 ? 121 VAL A CG1  4  
ATOM 10639 C CG2  . VAL A 1 69  ? 11.664  1.362   -1.825  1.00 0.00 ? 121 VAL A CG2  4  
ATOM 10640 H H    . VAL A 1 69  ? 13.674  -0.271  -2.876  1.00 0.00 ? 121 VAL A H    4  
ATOM 10641 H HA   . VAL A 1 69  ? 12.821  -0.353  -0.154  1.00 0.00 ? 121 VAL A HA   4  
ATOM 10642 H HB   . VAL A 1 69  ? 11.340  -0.521  -2.810  1.00 0.00 ? 121 VAL A HB   4  
ATOM 10643 H HG11 . VAL A 1 69  ? 10.204  -0.071  -0.019  1.00 0.00 ? 121 VAL A HG11 4  
ATOM 10644 H HG12 . VAL A 1 69  ? 9.309   0.112   -1.547  1.00 0.00 ? 121 VAL A HG12 4  
ATOM 10645 H HG13 . VAL A 1 69  ? 9.899   -1.484  -1.061  1.00 0.00 ? 121 VAL A HG13 4  
ATOM 10646 H HG21 . VAL A 1 69  ? 10.830  1.845   -2.334  1.00 0.00 ? 121 VAL A HG21 4  
ATOM 10647 H HG22 . VAL A 1 69  ? 11.739  1.744   -0.808  1.00 0.00 ? 121 VAL A HG22 4  
ATOM 10648 H HG23 . VAL A 1 69  ? 12.584  1.582   -2.366  1.00 0.00 ? 121 VAL A HG23 4  
ATOM 10649 N N    . GLN A 1 70  ? 12.652  -3.177  -1.843  1.00 0.00 ? 122 GLN A N    4  
ATOM 10650 C CA   . GLN A 1 70  ? 12.343  -4.589  -1.716  1.00 0.00 ? 122 GLN A CA   4  
ATOM 10651 C C    . GLN A 1 70  ? 13.474  -5.334  -1.015  1.00 0.00 ? 122 GLN A C    4  
ATOM 10652 O O    . GLN A 1 70  ? 13.206  -6.244  -0.237  1.00 0.00 ? 122 GLN A O    4  
ATOM 10653 C CB   . GLN A 1 70  ? 12.070  -5.185  -3.098  1.00 0.00 ? 122 GLN A CB   4  
ATOM 10654 C CG   . GLN A 1 70  ? 11.769  -6.684  -2.999  1.00 0.00 ? 122 GLN A CG   4  
ATOM 10655 C CD   . GLN A 1 70  ? 10.478  -6.968  -2.243  1.00 0.00 ? 122 GLN A CD   4  
ATOM 10656 O OE1  . GLN A 1 70  ? 9.415   -7.095  -2.841  1.00 0.00 ? 122 GLN A OE1  4  
ATOM 10657 N NE2  . GLN A 1 70  ? 10.560  -7.069  -0.918  1.00 0.00 ? 122 GLN A NE2  4  
ATOM 10658 H H    . GLN A 1 70  ? 13.108  -2.857  -2.686  1.00 0.00 ? 122 GLN A H    4  
ATOM 10659 H HA   . GLN A 1 70  ? 11.440  -4.692  -1.115  1.00 0.00 ? 122 GLN A HA   4  
ATOM 10660 H HB2  . GLN A 1 70  ? 11.220  -4.670  -3.547  1.00 0.00 ? 122 GLN A HB2  4  
ATOM 10661 H HB3  . GLN A 1 70  ? 12.946  -5.037  -3.728  1.00 0.00 ? 122 GLN A HB3  4  
ATOM 10662 H HG2  . GLN A 1 70  ? 11.686  -7.103  -4.003  1.00 0.00 ? 122 GLN A HG2  4  
ATOM 10663 H HG3  . GLN A 1 70  ? 12.593  -7.188  -2.495  1.00 0.00 ? 122 GLN A HG3  4  
ATOM 10664 H HE21 . GLN A 1 70  ? 11.453  -6.960  -0.458  1.00 0.00 ? 122 GLN A HE21 4  
ATOM 10665 H HE22 . GLN A 1 70  ? 9.727   -7.256  -0.377  1.00 0.00 ? 122 GLN A HE22 4  
ATOM 10666 N N    . ALA A 1 71  ? 14.731  -4.966  -1.275  1.00 0.00 ? 123 ALA A N    4  
ATOM 10667 C CA   . ALA A 1 71  ? 15.861  -5.685  -0.713  1.00 0.00 ? 123 ALA A CA   4  
ATOM 10668 C C    . ALA A 1 71  ? 15.926  -5.531  0.807   1.00 0.00 ? 123 ALA A C    4  
ATOM 10669 O O    . ALA A 1 71  ? 16.356  -6.448  1.505   1.00 0.00 ? 123 ALA A O    4  
ATOM 10670 C CB   . ALA A 1 71  ? 17.144  -5.172  -1.369  1.00 0.00 ? 123 ALA A CB   4  
ATOM 10671 H H    . ALA A 1 71  ? 14.917  -4.178  -1.878  1.00 0.00 ? 123 ALA A H    4  
ATOM 10672 H HA   . ALA A 1 71  ? 15.746  -6.743  -0.945  1.00 0.00 ? 123 ALA A HA   4  
ATOM 10673 H HB1  . ALA A 1 71  ? 17.276  -4.115  -1.140  1.00 0.00 ? 123 ALA A HB1  4  
ATOM 10674 H HB2  . ALA A 1 71  ? 17.995  -5.738  -0.990  1.00 0.00 ? 123 ALA A HB2  4  
ATOM 10675 H HB3  . ALA A 1 71  ? 17.078  -5.303  -2.449  1.00 0.00 ? 123 ALA A HB3  4  
ATOM 10676 N N    . LEU A 1 72  ? 15.500  -4.378  1.329   1.00 0.00 ? 124 LEU A N    4  
ATOM 10677 C CA   . LEU A 1 72  ? 15.536  -4.125  2.760   1.00 0.00 ? 124 LEU A CA   4  
ATOM 10678 C C    . LEU A 1 72  ? 14.272  -4.664  3.425   1.00 0.00 ? 124 LEU A C    4  
ATOM 10679 O O    . LEU A 1 72  ? 14.349  -5.273  4.491   1.00 0.00 ? 124 LEU A O    4  
ATOM 10680 C CB   . LEU A 1 72  ? 15.727  -2.618  2.963   1.00 0.00 ? 124 LEU A CB   4  
ATOM 10681 C CG   . LEU A 1 72  ? 15.929  -2.162  4.413   1.00 0.00 ? 124 LEU A CG   4  
ATOM 10682 C CD1  . LEU A 1 72  ? 14.594  -1.998  5.136   1.00 0.00 ? 124 LEU A CD1  4  
ATOM 10683 C CD2  . LEU A 1 72  ? 16.827  -3.114  5.202   1.00 0.00 ? 124 LEU A CD2  4  
ATOM 10684 H H    . LEU A 1 72  ? 15.146  -3.652  0.722   1.00 0.00 ? 124 LEU A H    4  
ATOM 10685 H HA   . LEU A 1 72  ? 16.395  -4.647  3.182   1.00 0.00 ? 124 LEU A HA   4  
ATOM 10686 H HB2  . LEU A 1 72  ? 16.608  -2.316  2.397   1.00 0.00 ? 124 LEU A HB2  4  
ATOM 10687 H HB3  . LEU A 1 72  ? 14.863  -2.097  2.549   1.00 0.00 ? 124 LEU A HB3  4  
ATOM 10688 H HG   . LEU A 1 72  ? 16.407  -1.182  4.384   1.00 0.00 ? 124 LEU A HG   4  
ATOM 10689 H HD11 . LEU A 1 72  ? 14.104  -2.964  5.244   1.00 0.00 ? 124 LEU A HD11 4  
ATOM 10690 H HD12 . LEU A 1 72  ? 14.776  -1.575  6.124   1.00 0.00 ? 124 LEU A HD12 4  
ATOM 10691 H HD13 . LEU A 1 72  ? 13.953  -1.321  4.571   1.00 0.00 ? 124 LEU A HD13 4  
ATOM 10692 H HD21 . LEU A 1 72  ? 17.760  -3.272  4.662   1.00 0.00 ? 124 LEU A HD21 4  
ATOM 10693 H HD22 . LEU A 1 72  ? 17.045  -2.678  6.177   1.00 0.00 ? 124 LEU A HD22 4  
ATOM 10694 H HD23 . LEU A 1 72  ? 16.324  -4.070  5.347   1.00 0.00 ? 124 LEU A HD23 4  
ATOM 10695 N N    . ILE A 1 73  ? 13.107  -4.446  2.805   1.00 0.00 ? 125 ILE A N    4  
ATOM 10696 C CA   . ILE A 1 73  ? 11.851  -4.966  3.337   1.00 0.00 ? 125 ILE A CA   4  
ATOM 10697 C C    . ILE A 1 73  ? 11.827  -6.503  3.268   1.00 0.00 ? 125 ILE A C    4  
ATOM 10698 O O    . ILE A 1 73  ? 10.975  -7.137  3.890   1.00 0.00 ? 125 ILE A O    4  
ATOM 10699 C CB   . ILE A 1 73  ? 10.678  -4.316  2.592   1.00 0.00 ? 125 ILE A CB   4  
ATOM 10700 C CG1  . ILE A 1 73  ? 10.713  -2.808  2.879   1.00 0.00 ? 125 ILE A CG1  4  
ATOM 10701 C CG2  . ILE A 1 73  ? 9.335   -4.893  3.047   1.00 0.00 ? 125 ILE A CG2  4  
ATOM 10702 C CD1  . ILE A 1 73  ? 9.587   -2.066  2.159   1.00 0.00 ? 125 ILE A CD1  4  
ATOM 10703 H H    . ILE A 1 73  ? 13.084  -3.910  1.950   1.00 0.00 ? 125 ILE A H    4  
ATOM 10704 H HA   . ILE A 1 73  ? 11.772  -4.664  4.382   1.00 0.00 ? 125 ILE A HA   4  
ATOM 10705 H HB   . ILE A 1 73  ? 10.792  -4.489  1.522   1.00 0.00 ? 125 ILE A HB   4  
ATOM 10706 H HG12 . ILE A 1 73  ? 10.626  -2.643  3.952   1.00 0.00 ? 125 ILE A HG12 4  
ATOM 10707 H HG13 . ILE A 1 73  ? 11.668  -2.399  2.550   1.00 0.00 ? 125 ILE A HG13 4  
ATOM 10708 H HG21 . ILE A 1 73  ? 8.515   -4.388  2.538   1.00 0.00 ? 125 ILE A HG21 4  
ATOM 10709 H HG22 . ILE A 1 73  ? 9.283   -5.952  2.794   1.00 0.00 ? 125 ILE A HG22 4  
ATOM 10710 H HG23 . ILE A 1 73  ? 9.229   -4.764  4.123   1.00 0.00 ? 125 ILE A HG23 4  
ATOM 10711 H HD11 . ILE A 1 73  ? 9.560   -2.367  1.111   1.00 0.00 ? 125 ILE A HD11 4  
ATOM 10712 H HD12 . ILE A 1 73  ? 8.632   -2.299  2.629   1.00 0.00 ? 125 ILE A HD12 4  
ATOM 10713 H HD13 . ILE A 1 73  ? 9.762   -0.992  2.227   1.00 0.00 ? 125 ILE A HD13 4  
ATOM 10714 N N    . ASP A 1 74  ? 12.752  -7.120  2.522   1.00 0.00 ? 126 ASP A N    4  
ATOM 10715 C CA   . ASP A 1 74  ? 12.861  -8.573  2.460   1.00 0.00 ? 126 ASP A CA   4  
ATOM 10716 C C    . ASP A 1 74  ? 13.960  -9.088  3.394   1.00 0.00 ? 126 ASP A C    4  
ATOM 10717 O O    . ASP A 1 74  ? 13.919  -10.243 3.815   1.00 0.00 ? 126 ASP A O    4  
ATOM 10718 C CB   . ASP A 1 74  ? 13.136  -8.996  1.016   1.00 0.00 ? 126 ASP A CB   4  
ATOM 10719 C CG   . ASP A 1 74  ? 13.178  -10.516 0.877   1.00 0.00 ? 126 ASP A CG   4  
ATOM 10720 O OD1  . ASP A 1 74  ? 12.096  -11.137 0.980   1.00 0.00 ? 126 ASP A OD1  4  
ATOM 10721 O OD2  . ASP A 1 74  ? 14.291  -11.047 0.669   1.00 0.00 ? 126 ASP A OD2  4  
ATOM 10722 H H    . ASP A 1 74  ? 13.402  -6.570  1.979   1.00 0.00 ? 126 ASP A H    4  
ATOM 10723 H HA   . ASP A 1 74  ? 11.914  -9.012  2.771   1.00 0.00 ? 126 ASP A HA   4  
ATOM 10724 H HB2  . ASP A 1 74  ? 12.345  -8.607  0.373   1.00 0.00 ? 126 ASP A HB2  4  
ATOM 10725 H HB3  . ASP A 1 74  ? 14.089  -8.578  0.695   1.00 0.00 ? 126 ASP A HB3  4  
ATOM 10726 N N    . ALA A 1 75  ? 14.939  -8.240  3.723   1.00 0.00 ? 127 ALA A N    4  
ATOM 10727 C CA   . ALA A 1 75  ? 16.029  -8.591  4.622   1.00 0.00 ? 127 ALA A CA   4  
ATOM 10728 C C    . ALA A 1 75  ? 15.675  -8.294  6.083   1.00 0.00 ? 127 ALA A C    4  
ATOM 10729 O O    . ALA A 1 75  ? 16.564  -8.049  6.898   1.00 0.00 ? 127 ALA A O    4  
ATOM 10730 C CB   . ALA A 1 75  ? 17.305  -7.870  4.185   1.00 0.00 ? 127 ALA A CB   4  
ATOM 10731 H H    . ALA A 1 75  ? 14.940  -7.308  3.336   1.00 0.00 ? 127 ALA A H    4  
ATOM 10732 H HA   . ALA A 1 75  ? 16.204  -9.664  4.537   1.00 0.00 ? 127 ALA A HA   4  
ATOM 10733 H HB1  . ALA A 1 75  ? 17.163  -6.792  4.259   1.00 0.00 ? 127 ALA A HB1  4  
ATOM 10734 H HB2  . ALA A 1 75  ? 18.135  -8.171  4.824   1.00 0.00 ? 127 ALA A HB2  4  
ATOM 10735 H HB3  . ALA A 1 75  ? 17.537  -8.134  3.153   1.00 0.00 ? 127 ALA A HB3  4  
ATOM 10736 N N    . CYS A 1 76  ? 14.382  -8.315  6.419   1.00 0.00 ? 128 CYS A N    4  
ATOM 10737 C CA   . CYS A 1 76  ? 13.907  -7.972  7.752   1.00 0.00 ? 128 CYS A CA   4  
ATOM 10738 C C    . CYS A 1 76  ? 12.779  -8.905  8.208   1.00 0.00 ? 128 CYS A C    4  
ATOM 10739 O O    . CYS A 1 76  ? 12.448  -9.873  7.524   1.00 0.00 ? 128 CYS A O    4  
ATOM 10740 C CB   . CYS A 1 76  ? 13.444  -6.515  7.737   1.00 0.00 ? 128 CYS A CB   4  
ATOM 10741 S SG   . CYS A 1 76  ? 11.988  -6.363  6.669   1.00 0.00 ? 128 CYS A SG   4  
ATOM 10742 H H    . CYS A 1 76  ? 13.693  -8.575  5.728   1.00 0.00 ? 128 CYS A H    4  
ATOM 10743 H HA   . CYS A 1 76  ? 14.729  -8.061  8.462   1.00 0.00 ? 128 CYS A HA   4  
ATOM 10744 H HB2  . CYS A 1 76  ? 13.186  -6.206  8.750   1.00 0.00 ? 128 CYS A HB2  4  
ATOM 10745 H HB3  . CYS A 1 76  ? 14.243  -5.880  7.358   1.00 0.00 ? 128 CYS A HB3  4  
ATOM 10746 H HG   . CYS A 1 76  ? 12.602  -6.715  5.536   1.00 0.00 ? 128 CYS A HG   4  
ATOM 10747 N N    . ILE A 1 77  ? 12.193  -8.607  9.371   1.00 0.00 ? 129 ILE A N    4  
ATOM 10748 C CA   . ILE A 1 77  ? 11.142  -9.413  9.976   1.00 0.00 ? 129 ILE A CA   4  
ATOM 10749 C C    . ILE A 1 77  ? 9.841   -9.250  9.187   1.00 0.00 ? 129 ILE A C    4  
ATOM 10750 O O    . ILE A 1 77  ? 9.604   -8.212  8.571   1.00 0.00 ? 129 ILE A O    4  
ATOM 10751 C CB   . ILE A 1 77  ? 10.979  -9.006  11.449  1.00 0.00 ? 129 ILE A CB   4  
ATOM 10752 C CG1  . ILE A 1 77  ? 12.307  -9.231  12.188  1.00 0.00 ? 129 ILE A CG1  4  
ATOM 10753 C CG2  . ILE A 1 77  ? 9.857   -9.805  12.121  1.00 0.00 ? 129 ILE A CG2  4  
ATOM 10754 C CD1  . ILE A 1 77  ? 12.248  -8.756  13.641  1.00 0.00 ? 129 ILE A CD1  4  
ATOM 10755 H H    . ILE A 1 77  ? 12.484  -7.777  9.868   1.00 0.00 ? 129 ILE A H    4  
ATOM 10756 H HA   . ILE A 1 77  ? 11.436  -10.461 9.938   1.00 0.00 ? 129 ILE A HA   4  
ATOM 10757 H HB   . ILE A 1 77  ? 10.730  -7.946  11.492  1.00 0.00 ? 129 ILE A HB   4  
ATOM 10758 H HG12 . ILE A 1 77  ? 12.559  -10.291 12.168  1.00 0.00 ? 129 ILE A HG12 4  
ATOM 10759 H HG13 . ILE A 1 77  ? 13.097  -8.676  11.682  1.00 0.00 ? 129 ILE A HG13 4  
ATOM 10760 H HG21 . ILE A 1 77  ? 10.086  -10.868 12.078  1.00 0.00 ? 129 ILE A HG21 4  
ATOM 10761 H HG22 . ILE A 1 77  ? 9.752   -9.496  13.161  1.00 0.00 ? 129 ILE A HG22 4  
ATOM 10762 H HG23 . ILE A 1 77  ? 8.909   -9.613  11.617  1.00 0.00 ? 129 ILE A HG23 4  
ATOM 10763 H HD11 . ILE A 1 77  ? 11.554  -9.373  14.210  1.00 0.00 ? 129 ILE A HD11 4  
ATOM 10764 H HD12 . ILE A 1 77  ? 13.239  -8.840  14.086  1.00 0.00 ? 129 ILE A HD12 4  
ATOM 10765 H HD13 . ILE A 1 77  ? 11.926  -7.715  13.674  1.00 0.00 ? 129 ILE A HD13 4  
ATOM 10766 N N    . GLU A 1 78  ? 8.987   -10.279 9.201   1.00 0.00 ? 130 GLU A N    4  
ATOM 10767 C CA   . GLU A 1 78  ? 7.744   -10.269 8.446   1.00 0.00 ? 130 GLU A CA   4  
ATOM 10768 C C    . GLU A 1 78  ? 6.588   -10.886 9.233   1.00 0.00 ? 130 GLU A C    4  
ATOM 10769 O O    . GLU A 1 78  ? 6.791   -11.655 10.171  1.00 0.00 ? 130 GLU A O    4  
ATOM 10770 C CB   . GLU A 1 78  ? 7.945   -11.000 7.114   1.00 0.00 ? 130 GLU A CB   4  
ATOM 10771 C CG   . GLU A 1 78  ? 8.288   -12.476 7.324   1.00 0.00 ? 130 GLU A CG   4  
ATOM 10772 C CD   . GLU A 1 78  ? 8.492   -13.182 5.985   1.00 0.00 ? 130 GLU A CD   4  
ATOM 10773 O OE1  . GLU A 1 78  ? 7.473   -13.573 5.375   1.00 0.00 ? 130 GLU A OE1  4  
ATOM 10774 O OE2  . GLU A 1 78  ? 9.668   -13.325 5.582   1.00 0.00 ? 130 GLU A OE2  4  
ATOM 10775 H H    . GLU A 1 78  ? 9.202   -11.099 9.751   1.00 0.00 ? 130 GLU A H    4  
ATOM 10776 H HA   . GLU A 1 78  ? 7.479   -9.235  8.225   1.00 0.00 ? 130 GLU A HA   4  
ATOM 10777 H HB2  . GLU A 1 78  ? 7.030   -10.928 6.527   1.00 0.00 ? 130 GLU A HB2  4  
ATOM 10778 H HB3  . GLU A 1 78  ? 8.755   -10.519 6.563   1.00 0.00 ? 130 GLU A HB3  4  
ATOM 10779 H HG2  . GLU A 1 78  ? 9.198   -12.558 7.919   1.00 0.00 ? 130 GLU A HG2  4  
ATOM 10780 H HG3  . GLU A 1 78  ? 7.476   -12.963 7.862   1.00 0.00 ? 130 GLU A HG3  4  
ATOM 10781 N N    . GLU A 1 79  ? 5.366   -10.533 8.828   1.00 0.00 ? 131 GLU A N    4  
ATOM 10782 C CA   . GLU A 1 79  ? 4.127   -11.053 9.382   1.00 0.00 ? 131 GLU A CA   4  
ATOM 10783 C C    . GLU A 1 79  ? 3.106   -11.149 8.252   1.00 0.00 ? 131 GLU A C    4  
ATOM 10784 O O    . GLU A 1 79  ? 3.207   -10.424 7.263   1.00 0.00 ? 131 GLU A O    4  
ATOM 10785 C CB   . GLU A 1 79  ? 3.627   -10.110 10.484  1.00 0.00 ? 131 GLU A CB   4  
ATOM 10786 C CG   . GLU A 1 79  ? 2.384   -10.640 11.203  1.00 0.00 ? 131 GLU A CG   4  
ATOM 10787 C CD   . GLU A 1 79  ? 2.639   -12.005 11.839  1.00 0.00 ? 131 GLU A CD   4  
ATOM 10788 O OE1  . GLU A 1 79  ? 3.124   -12.025 12.993  1.00 0.00 ? 131 GLU A OE1  4  
ATOM 10789 O OE2  . GLU A 1 79  ? 2.345   -13.016 11.164  1.00 0.00 ? 131 GLU A OE2  4  
ATOM 10790 H H    . GLU A 1 79  ? 5.275   -9.858  8.083   1.00 0.00 ? 131 GLU A H    4  
ATOM 10791 H HA   . GLU A 1 79  ? 4.302   -12.045 9.797   1.00 0.00 ? 131 GLU A HA   4  
ATOM 10792 H HB2  . GLU A 1 79  ? 4.419   -9.965  11.220  1.00 0.00 ? 131 GLU A HB2  4  
ATOM 10793 H HB3  . GLU A 1 79  ? 3.389   -9.141  10.045  1.00 0.00 ? 131 GLU A HB3  4  
ATOM 10794 H HG2  . GLU A 1 79  ? 2.101   -9.930  11.981  1.00 0.00 ? 131 GLU A HG2  4  
ATOM 10795 H HG3  . GLU A 1 79  ? 1.558   -10.713 10.495  1.00 0.00 ? 131 GLU A HG3  4  
ATOM 10796 N N    . ASP A 1 80  ? 2.117   -12.038 8.383   1.00 0.00 ? 132 ASP A N    4  
ATOM 10797 C CA   . ASP A 1 80  ? 1.094   -12.197 7.358   1.00 0.00 ? 132 ASP A CA   4  
ATOM 10798 C C    . ASP A 1 80  ? 0.219   -10.945 7.247   1.00 0.00 ? 132 ASP A C    4  
ATOM 10799 O O    . ASP A 1 80  ? -0.638  -10.869 6.367   1.00 0.00 ? 132 ASP A O    4  
ATOM 10800 C CB   . ASP A 1 80  ? 0.241   -13.427 7.670   1.00 0.00 ? 132 ASP A CB   4  
ATOM 10801 C CG   . ASP A 1 80  ? 1.068   -14.710 7.624   1.00 0.00 ? 132 ASP A CG   4  
ATOM 10802 O OD1  . ASP A 1 80  ? 1.643   -14.987 6.547   1.00 0.00 ? 132 ASP A OD1  4  
ATOM 10803 O OD2  . ASP A 1 80  ? 1.120   -15.404 8.663   1.00 0.00 ? 132 ASP A OD2  4  
ATOM 10804 H H    . ASP A 1 80  ? 2.068   -12.619 9.207   1.00 0.00 ? 132 ASP A H    4  
ATOM 10805 H HA   . ASP A 1 80  ? 1.588   -12.350 6.398   1.00 0.00 ? 132 ASP A HA   4  
ATOM 10806 H HB2  . ASP A 1 80  ? -0.207  -13.313 8.657   1.00 0.00 ? 132 ASP A HB2  4  
ATOM 10807 H HB3  . ASP A 1 80  ? -0.558  -13.499 6.932   1.00 0.00 ? 132 ASP A HB3  4  
ATOM 10808 N N    . GLY A 1 81  ? 0.429   -9.963  8.133   1.00 0.00 ? 133 GLY A N    4  
ATOM 10809 C CA   . GLY A 1 81  ? -0.328  -8.722  8.131   1.00 0.00 ? 133 GLY A CA   4  
ATOM 10810 C C    . GLY A 1 81  ? 0.511   -7.504  7.745   1.00 0.00 ? 133 GLY A C    4  
ATOM 10811 O O    . GLY A 1 81  ? -0.042  -6.524  7.248   1.00 0.00 ? 133 GLY A O    4  
ATOM 10812 H H    . GLY A 1 81  ? 1.141   -10.084 8.838   1.00 0.00 ? 133 GLY A H    4  
ATOM 10813 H HA2  . GLY A 1 81  ? -1.172  -8.804  7.448   1.00 0.00 ? 133 GLY A HA2  4  
ATOM 10814 H HA3  . GLY A 1 81  ? -0.702  -8.563  9.142   1.00 0.00 ? 133 GLY A HA3  4  
ATOM 10815 N N    . LYS A 1 82  ? 1.832   -7.545  7.964   1.00 0.00 ? 134 LYS A N    4  
ATOM 10816 C CA   . LYS A 1 82  ? 2.701   -6.394  7.726   1.00 0.00 ? 134 LYS A CA   4  
ATOM 10817 C C    . LYS A 1 82  ? 4.170   -6.804  7.801   1.00 0.00 ? 134 LYS A C    4  
ATOM 10818 O O    . LYS A 1 82  ? 4.481   -7.961  8.071   1.00 0.00 ? 134 LYS A O    4  
ATOM 10819 C CB   . LYS A 1 82  ? 2.412   -5.321  8.784   1.00 0.00 ? 134 LYS A CB   4  
ATOM 10820 C CG   . LYS A 1 82  ? 2.920   -5.728  10.164  1.00 0.00 ? 134 LYS A CG   4  
ATOM 10821 C CD   . LYS A 1 82  ? 2.007   -5.150  11.245  1.00 0.00 ? 134 LYS A CD   4  
ATOM 10822 C CE   . LYS A 1 82  ? 0.656   -5.867  11.248  1.00 0.00 ? 134 LYS A CE   4  
ATOM 10823 N NZ   . LYS A 1 82  ? -0.207  -5.374  12.339  1.00 0.00 ? 134 LYS A NZ   4  
ATOM 10824 H H    . LYS A 1 82  ? 2.258   -8.395  8.305   1.00 0.00 ? 134 LYS A H    4  
ATOM 10825 H HA   . LYS A 1 82  ? 2.495   -5.984  6.738   1.00 0.00 ? 134 LYS A HA   4  
ATOM 10826 H HB2  . LYS A 1 82  ? 2.893   -4.386  8.496   1.00 0.00 ? 134 LYS A HB2  4  
ATOM 10827 H HB3  . LYS A 1 82  ? 1.337   -5.150  8.842   1.00 0.00 ? 134 LYS A HB3  4  
ATOM 10828 H HG2  . LYS A 1 82  ? 2.933   -6.815  10.255  1.00 0.00 ? 134 LYS A HG2  4  
ATOM 10829 H HG3  . LYS A 1 82  ? 3.932   -5.349  10.298  1.00 0.00 ? 134 LYS A HG3  4  
ATOM 10830 H HD2  . LYS A 1 82  ? 2.480   -5.299  12.216  1.00 0.00 ? 134 LYS A HD2  4  
ATOM 10831 H HD3  . LYS A 1 82  ? 1.862   -4.084  11.077  1.00 0.00 ? 134 LYS A HD3  4  
ATOM 10832 H HE2  . LYS A 1 82  ? 0.158   -5.705  10.292  1.00 0.00 ? 134 LYS A HE2  4  
ATOM 10833 H HE3  . LYS A 1 82  ? 0.827   -6.935  11.378  1.00 0.00 ? 134 LYS A HE3  4  
ATOM 10834 H HZ1  . LYS A 1 82  ? -0.379  -4.385  12.221  1.00 0.00 ? 134 LYS A HZ1  4  
ATOM 10835 H HZ2  . LYS A 1 82  ? -1.089  -5.866  12.332  1.00 0.00 ? 134 LYS A HZ2  4  
ATOM 10836 H HZ3  . LYS A 1 82  ? 0.244   -5.525  13.230  1.00 0.00 ? 134 LYS A HZ3  4  
ATOM 10837 N N    . LEU A 1 83  ? 5.078   -5.856  7.560   1.00 0.00 ? 135 LEU A N    4  
ATOM 10838 C CA   . LEU A 1 83  ? 6.508   -6.101  7.666   1.00 0.00 ? 135 LEU A CA   4  
ATOM 10839 C C    . LEU A 1 83  ? 7.076   -5.301  8.840   1.00 0.00 ? 135 LEU A C    4  
ATOM 10840 O O    . LEU A 1 83  ? 6.465   -4.332  9.288   1.00 0.00 ? 135 LEU A O    4  
ATOM 10841 C CB   . LEU A 1 83  ? 7.218   -5.737  6.355   1.00 0.00 ? 135 LEU A CB   4  
ATOM 10842 C CG   . LEU A 1 83  ? 6.904   -6.639  5.152   1.00 0.00 ? 135 LEU A CG   4  
ATOM 10843 C CD1  . LEU A 1 83  ? 7.098   -8.116  5.489   1.00 0.00 ? 135 LEU A CD1  4  
ATOM 10844 C CD2  . LEU A 1 83  ? 5.491   -6.429  4.610   1.00 0.00 ? 135 LEU A CD2  4  
ATOM 10845 H H    . LEU A 1 83  ? 4.775   -4.929  7.299   1.00 0.00 ? 135 LEU A H    4  
ATOM 10846 H HA   . LEU A 1 83  ? 6.683   -7.156  7.874   1.00 0.00 ? 135 LEU A HA   4  
ATOM 10847 H HB2  . LEU A 1 83  ? 6.969   -4.708  6.094   1.00 0.00 ? 135 LEU A HB2  4  
ATOM 10848 H HB3  . LEU A 1 83  ? 8.292   -5.790  6.533   1.00 0.00 ? 135 LEU A HB3  4  
ATOM 10849 H HG   . LEU A 1 83  ? 7.603   -6.380  4.357   1.00 0.00 ? 135 LEU A HG   4  
ATOM 10850 H HD11 . LEU A 1 83  ? 6.981   -8.708  4.582   1.00 0.00 ? 135 LEU A HD11 4  
ATOM 10851 H HD12 . LEU A 1 83  ? 8.100   -8.268  5.889   1.00 0.00 ? 135 LEU A HD12 4  
ATOM 10852 H HD13 . LEU A 1 83  ? 6.355   -8.432  6.222   1.00 0.00 ? 135 LEU A HD13 4  
ATOM 10853 H HD21 . LEU A 1 83  ? 5.314   -5.365  4.453   1.00 0.00 ? 135 LEU A HD21 4  
ATOM 10854 H HD22 . LEU A 1 83  ? 5.389   -6.953  3.660   1.00 0.00 ? 135 LEU A HD22 4  
ATOM 10855 H HD23 . LEU A 1 83  ? 4.753   -6.827  5.308   1.00 0.00 ? 135 LEU A HD23 4  
ATOM 10856 N N    . TYR A 1 84  ? 8.245   -5.708  9.339   1.00 0.00 ? 136 TYR A N    4  
ATOM 10857 C CA   . TYR A 1 84  ? 8.881   -5.043  10.467  1.00 0.00 ? 136 TYR A CA   4  
ATOM 10858 C C    . TYR A 1 84  ? 10.380  -4.897  10.236  1.00 0.00 ? 136 TYR A C    4  
ATOM 10859 O O    . TYR A 1 84  ? 11.038  -5.826  9.775   1.00 0.00 ? 136 TYR A O    4  
ATOM 10860 C CB   . TYR A 1 84  ? 8.644   -5.841  11.751  1.00 0.00 ? 136 TYR A CB   4  
ATOM 10861 C CG   . TYR A 1 84  ? 7.312   -5.605  12.428  1.00 0.00 ? 136 TYR A CG   4  
ATOM 10862 C CD1  . TYR A 1 84  ? 7.170   -4.519  13.304  1.00 0.00 ? 136 TYR A CD1  4  
ATOM 10863 C CD2  . TYR A 1 84  ? 6.230   -6.465  12.191  1.00 0.00 ? 136 TYR A CD2  4  
ATOM 10864 C CE1  . TYR A 1 84  ? 5.952   -4.297  13.960  1.00 0.00 ? 136 TYR A CE1  4  
ATOM 10865 C CE2  . TYR A 1 84  ? 5.009   -6.254  12.850  1.00 0.00 ? 136 TYR A CE2  4  
ATOM 10866 C CZ   . TYR A 1 84  ? 4.867   -5.170  13.739  1.00 0.00 ? 136 TYR A CZ   4  
ATOM 10867 O OH   . TYR A 1 84  ? 3.685   -4.963  14.386  1.00 0.00 ? 136 TYR A OH   4  
ATOM 10868 H H    . TYR A 1 84  ? 8.717   -6.502  8.932   1.00 0.00 ? 136 TYR A H    4  
ATOM 10869 H HA   . TYR A 1 84  ? 8.461   -4.044  10.587  1.00 0.00 ? 136 TYR A HA   4  
ATOM 10870 H HB2  . TYR A 1 84  ? 8.751   -6.903  11.530  1.00 0.00 ? 136 TYR A HB2  4  
ATOM 10871 H HB3  . TYR A 1 84  ? 9.424   -5.573  12.465  1.00 0.00 ? 136 TYR A HB3  4  
ATOM 10872 H HD1  . TYR A 1 84  ? 8.003   -3.853  13.475  1.00 0.00 ? 136 TYR A HD1  4  
ATOM 10873 H HD2  . TYR A 1 84  ? 6.333   -7.293  11.505  1.00 0.00 ? 136 TYR A HD2  4  
ATOM 10874 H HE1  . TYR A 1 84  ? 5.844   -3.460  14.633  1.00 0.00 ? 136 TYR A HE1  4  
ATOM 10875 H HE2  . TYR A 1 84  ? 4.179   -6.923  12.678  1.00 0.00 ? 136 TYR A HE2  4  
ATOM 10876 H HH   . TYR A 1 84  ? 3.706   -4.199  14.968  1.00 0.00 ? 136 TYR A HH   4  
ATOM 10877 N N    . LEU A 1 85  ? 10.912  -3.718  10.565  1.00 0.00 ? 137 LEU A N    4  
ATOM 10878 C CA   . LEU A 1 85  ? 12.333  -3.434  10.474  1.00 0.00 ? 137 LEU A CA   4  
ATOM 10879 C C    . LEU A 1 85  ? 12.958  -3.513  11.864  1.00 0.00 ? 137 LEU A C    4  
ATOM 10880 O O    . LEU A 1 85  ? 12.302  -3.215  12.861  1.00 0.00 ? 137 LEU A O    4  
ATOM 10881 C CB   . LEU A 1 85  ? 12.557  -2.051  9.854   1.00 0.00 ? 137 LEU A CB   4  
ATOM 10882 C CG   . LEU A 1 85  ? 12.045  -1.925  8.416   1.00 0.00 ? 137 LEU A CG   4  
ATOM 10883 C CD1  . LEU A 1 85  ? 12.530  -0.594  7.842   1.00 0.00 ? 137 LEU A CD1  4  
ATOM 10884 C CD2  . LEU A 1 85  ? 12.557  -3.057  7.535   1.00 0.00 ? 137 LEU A CD2  4  
ATOM 10885 H H    . LEU A 1 85  ? 10.306  -2.983  10.899  1.00 0.00 ? 137 LEU A H    4  
ATOM 10886 H HA   . LEU A 1 85  ? 12.813  -4.184  9.845   1.00 0.00 ? 137 LEU A HA   4  
ATOM 10887 H HB2  . LEU A 1 85  ? 12.057  -1.297  10.461  1.00 0.00 ? 137 LEU A HB2  4  
ATOM 10888 H HB3  . LEU A 1 85  ? 13.625  -1.831  9.871   1.00 0.00 ? 137 LEU A HB3  4  
ATOM 10889 H HG   . LEU A 1 85  ? 10.955  -1.944  8.416   1.00 0.00 ? 137 LEU A HG   4  
ATOM 10890 H HD11 . LEU A 1 85  ? 13.619  -0.566  7.858   1.00 0.00 ? 137 LEU A HD11 4  
ATOM 10891 H HD12 . LEU A 1 85  ? 12.183  -0.486  6.816   1.00 0.00 ? 137 LEU A HD12 4  
ATOM 10892 H HD13 . LEU A 1 85  ? 12.141  0.228   8.444   1.00 0.00 ? 137 LEU A HD13 4  
ATOM 10893 H HD21 . LEU A 1 85  ? 12.233  -2.890  6.508   1.00 0.00 ? 137 LEU A HD21 4  
ATOM 10894 H HD22 . LEU A 1 85  ? 13.646  -3.095  7.577   1.00 0.00 ? 137 LEU A HD22 4  
ATOM 10895 H HD23 . LEU A 1 85  ? 12.144  -4.003  7.885   1.00 0.00 ? 137 LEU A HD23 4  
ATOM 10896 N N    . CYS A 1 86  ? 14.230  -3.917  11.930  1.00 0.00 ? 138 CYS A N    4  
ATOM 10897 C CA   . CYS A 1 86  ? 14.934  -4.041  13.195  1.00 0.00 ? 138 CYS A CA   4  
ATOM 10898 C C    . CYS A 1 86  ? 15.774  -2.794  13.450  1.00 0.00 ? 138 CYS A C    4  
ATOM 10899 O O    . CYS A 1 86  ? 16.541  -2.366  12.589  1.00 0.00 ? 138 CYS A O    4  
ATOM 10900 C CB   . CYS A 1 86  ? 15.781  -5.313  13.181  1.00 0.00 ? 138 CYS A CB   4  
ATOM 10901 S SG   . CYS A 1 86  ? 16.555  -5.536  14.804  1.00 0.00 ? 138 CYS A SG   4  
ATOM 10902 H H    . CYS A 1 86  ? 14.729  -4.145  11.082  1.00 0.00 ? 138 CYS A H    4  
ATOM 10903 H HA   . CYS A 1 86  ? 14.200  -4.133  13.995  1.00 0.00 ? 138 CYS A HA   4  
ATOM 10904 H HB2  . CYS A 1 86  ? 15.143  -6.169  12.966  1.00 0.00 ? 138 CYS A HB2  4  
ATOM 10905 H HB3  . CYS A 1 86  ? 16.552  -5.234  12.414  1.00 0.00 ? 138 CYS A HB3  4  
ATOM 10906 H HG   . CYS A 1 86  ? 17.309  -4.433  14.765  1.00 0.00 ? 138 CYS A HG   4  
ATOM 10907 N N    . VAL A 1 87  ? 15.621  -2.215  14.643  1.00 0.00 ? 139 VAL A N    4  
ATOM 10908 C CA   . VAL A 1 87  ? 16.351  -1.022  15.055  1.00 0.00 ? 139 VAL A CA   4  
ATOM 10909 C C    . VAL A 1 87  ? 16.535  -1.012  16.576  1.00 0.00 ? 139 VAL A C    4  
ATOM 10910 O O    . VAL A 1 87  ? 17.046  -0.051  17.147  1.00 0.00 ? 139 VAL A O    4  
ATOM 10911 C CB   . VAL A 1 87  ? 15.600  0.215   14.544  1.00 0.00 ? 139 VAL A CB   4  
ATOM 10912 C CG1  . VAL A 1 87  ? 14.298  0.436   15.313  1.00 0.00 ? 139 VAL A CG1  4  
ATOM 10913 C CG2  . VAL A 1 87  ? 16.464  1.472   14.624  1.00 0.00 ? 139 VAL A CG2  4  
ATOM 10914 H H    . VAL A 1 87  ? 14.967  -2.615  15.301  1.00 0.00 ? 139 VAL A H    4  
ATOM 10915 H HA   . VAL A 1 87  ? 17.338  -1.049  14.593  1.00 0.00 ? 139 VAL A HA   4  
ATOM 10916 H HB   . VAL A 1 87  ? 15.354  0.051   13.496  1.00 0.00 ? 139 VAL A HB   4  
ATOM 10917 H HG11 . VAL A 1 87  ? 14.516  0.635   16.361  1.00 0.00 ? 139 VAL A HG11 4  
ATOM 10918 H HG12 . VAL A 1 87  ? 13.771  1.291   14.888  1.00 0.00 ? 139 VAL A HG12 4  
ATOM 10919 H HG13 . VAL A 1 87  ? 13.666  -0.448  15.230  1.00 0.00 ? 139 VAL A HG13 4  
ATOM 10920 H HG21 . VAL A 1 87  ? 17.420  1.289   14.133  1.00 0.00 ? 139 VAL A HG21 4  
ATOM 10921 H HG22 . VAL A 1 87  ? 15.952  2.286   14.110  1.00 0.00 ? 139 VAL A HG22 4  
ATOM 10922 H HG23 . VAL A 1 87  ? 16.633  1.756   15.663  1.00 0.00 ? 139 VAL A HG23 4  
ATOM 10923 N N    . SER A 1 88  ? 16.111  -2.095  17.236  1.00 0.00 ? 140 SER A N    4  
ATOM 10924 C CA   . SER A 1 88  ? 16.137  -2.232  18.684  1.00 0.00 ? 140 SER A CA   4  
ATOM 10925 C C    . SER A 1 88  ? 17.366  -3.013  19.141  1.00 0.00 ? 140 SER A C    4  
ATOM 10926 O O    . SER A 1 88  ? 17.260  -3.892  19.993  1.00 0.00 ? 140 SER A O    4  
ATOM 10927 C CB   . SER A 1 88  ? 14.830  -2.874  19.151  1.00 0.00 ? 140 SER A CB   4  
ATOM 10928 O OG   . SER A 1 88  ? 14.625  -4.107  18.493  1.00 0.00 ? 140 SER A OG   4  
ATOM 10929 H H    . SER A 1 88  ? 15.745  -2.876  16.712  1.00 0.00 ? 140 SER A H    4  
ATOM 10930 H HA   . SER A 1 88  ? 16.199  -1.234  19.119  1.00 0.00 ? 140 SER A HA   4  
ATOM 10931 H HB2  . SER A 1 88  ? 14.858  -3.033  20.228  1.00 0.00 ? 140 SER A HB2  4  
ATOM 10932 H HB3  . SER A 1 88  ? 14.005  -2.203  18.909  1.00 0.00 ? 140 SER A HB3  4  
ATOM 10933 H HG   . SER A 1 88  ? 15.296  -4.727  18.790  1.00 0.00 ? 140 SER A HG   4  
ATOM 10934 N N    . SER A 1 89  ? 18.532  -2.693  18.571  1.00 0.00 ? 141 SER A N    4  
ATOM 10935 C CA   . SER A 1 89  ? 19.757  -3.437  18.849  1.00 0.00 ? 141 SER A CA   4  
ATOM 10936 C C    . SER A 1 89  ? 21.057  -2.785  18.350  1.00 0.00 ? 141 SER A C    4  
ATOM 10937 O O    . SER A 1 89  ? 22.084  -2.986  18.997  1.00 0.00 ? 141 SER A O    4  
ATOM 10938 C CB   . SER A 1 89  ? 19.650  -4.825  18.212  1.00 0.00 ? 141 SER A CB   4  
ATOM 10939 O OG   . SER A 1 89  ? 19.503  -4.727  16.811  1.00 0.00 ? 141 SER A OG   4  
ATOM 10940 H H    . SER A 1 89  ? 18.567  -1.909  17.936  1.00 0.00 ? 141 SER A H    4  
ATOM 10941 H HA   . SER A 1 89  ? 19.841  -3.562  19.928  1.00 0.00 ? 141 SER A HA   4  
ATOM 10942 H HB2  . SER A 1 89  ? 20.550  -5.396  18.441  1.00 0.00 ? 141 SER A HB2  4  
ATOM 10943 H HB3  . SER A 1 89  ? 18.787  -5.349  18.625  1.00 0.00 ? 141 SER A HB3  4  
ATOM 10944 H HG   . SER A 1 89  ? 19.457  -5.615  16.449  1.00 0.00 ? 141 SER A HG   4  
ATOM 10945 N N    . PRO A 1 90  ? 21.087  -2.017  17.245  1.00 0.00 ? 142 PRO A N    4  
ATOM 10946 C CA   . PRO A 1 90  ? 22.342  -1.546  16.678  1.00 0.00 ? 142 PRO A CA   4  
ATOM 10947 C C    . PRO A 1 90  ? 22.897  -0.321  17.407  1.00 0.00 ? 142 PRO A C    4  
ATOM 10948 O O    . PRO A 1 90  ? 24.099  -0.071  17.354  1.00 0.00 ? 142 PRO A O    4  
ATOM 10949 C CB   . PRO A 1 90  ? 22.002  -1.211  15.227  1.00 0.00 ? 142 PRO A CB   4  
ATOM 10950 C CG   . PRO A 1 90  ? 20.568  -0.696  15.331  1.00 0.00 ? 142 PRO A CG   4  
ATOM 10951 C CD   . PRO A 1 90  ? 19.967  -1.557  16.442  1.00 0.00 ? 142 PRO A CD   4  
ATOM 10952 H HA   . PRO A 1 90  ? 23.089  -2.340  16.700  1.00 0.00 ? 142 PRO A HA   4  
ATOM 10953 H HB2  . PRO A 1 90  ? 22.677  -0.463  14.810  1.00 0.00 ? 142 PRO A HB2  4  
ATOM 10954 H HB3  . PRO A 1 90  ? 22.016  -2.124  14.632  1.00 0.00 ? 142 PRO A HB3  4  
ATOM 10955 H HG2  . PRO A 1 90  ? 20.577  0.348   15.645  1.00 0.00 ? 142 PRO A HG2  4  
ATOM 10956 H HG3  . PRO A 1 90  ? 20.027  -0.813  14.393  1.00 0.00 ? 142 PRO A HG3  4  
ATOM 10957 H HD2  . PRO A 1 90  ? 19.285  -0.951  17.038  1.00 0.00 ? 142 PRO A HD2  4  
ATOM 10958 H HD3  . PRO A 1 90  ? 19.449  -2.411  16.005  1.00 0.00 ? 142 PRO A HD3  4  
ATOM 10959 N N    . THR A 1 91  ? 22.030  0.439   18.086  1.00 0.00 ? 143 THR A N    4  
ATOM 10960 C CA   . THR A 1 91  ? 22.432  1.638   18.819  1.00 0.00 ? 143 THR A CA   4  
ATOM 10961 C C    . THR A 1 91  ? 21.569  1.829   20.065  1.00 0.00 ? 143 THR A C    4  
ATOM 10962 O O    . THR A 1 91  ? 22.028  2.405   21.050  1.00 0.00 ? 143 THR A O    4  
ATOM 10963 C CB   . THR A 1 91  ? 22.294  2.865   17.907  1.00 0.00 ? 143 THR A CB   4  
ATOM 10964 O OG1  . THR A 1 91  ? 23.041  2.685   16.724  1.00 0.00 ? 143 THR A OG1  4  
ATOM 10965 C CG2  . THR A 1 91  ? 22.806  4.131   18.595  1.00 0.00 ? 143 THR A CG2  4  
ATOM 10966 H H    . THR A 1 91  ? 21.055  0.177   18.092  1.00 0.00 ? 143 THR A H    4  
ATOM 10967 H HA   . THR A 1 91  ? 23.473  1.542   19.129  1.00 0.00 ? 143 THR A HA   4  
ATOM 10968 H HB   . THR A 1 91  ? 21.245  3.002   17.645  1.00 0.00 ? 143 THR A HB   4  
ATOM 10969 H HG1  . THR A 1 91  ? 22.681  1.930   16.253  1.00 0.00 ? 143 THR A HG1  4  
ATOM 10970 H HG21 . THR A 1 91  ? 22.764  4.965   17.895  1.00 0.00 ? 143 THR A HG21 4  
ATOM 10971 H HG22 . THR A 1 91  ? 22.184  4.362   19.459  1.00 0.00 ? 143 THR A HG22 4  
ATOM 10972 H HG23 . THR A 1 91  ? 23.836  3.980   18.918  1.00 0.00 ? 143 THR A HG23 4  
ATOM 10973 N N    . ILE A 1 92  ? 20.321  1.347   20.026  1.00 0.00 ? 144 ILE A N    4  
ATOM 10974 C CA   . ILE A 1 92  ? 19.379  1.460   21.131  1.00 0.00 ? 144 ILE A CA   4  
ATOM 10975 C C    . ILE A 1 92  ? 18.685  0.121   21.340  1.00 0.00 ? 144 ILE A C    4  
ATOM 10976 O O    . ILE A 1 92  ? 18.922  -0.820  20.586  1.00 0.00 ? 144 ILE A O    4  
ATOM 10977 C CB   . ILE A 1 92  ? 18.376  2.595   20.857  1.00 0.00 ? 144 ILE A CB   4  
ATOM 10978 C CG1  . ILE A 1 92  ? 17.490  2.379   19.622  1.00 0.00 ? 144 ILE A CG1  4  
ATOM 10979 C CG2  . ILE A 1 92  ? 19.149  3.896   20.650  1.00 0.00 ? 144 ILE A CG2  4  
ATOM 10980 C CD1  . ILE A 1 92  ? 16.284  1.482   19.908  1.00 0.00 ? 144 ILE A CD1  4  
ATOM 10981 H H    . ILE A 1 92  ? 19.996  0.876   19.195  1.00 0.00 ? 144 ILE A H    4  
ATOM 10982 H HA   . ILE A 1 92  ? 19.926  1.704   22.042  1.00 0.00 ? 144 ILE A HA   4  
ATOM 10983 H HB   . ILE A 1 92  ? 17.734  2.712   21.729  1.00 0.00 ? 144 ILE A HB   4  
ATOM 10984 H HG12 . ILE A 1 92  ? 17.108  3.346   19.297  1.00 0.00 ? 144 ILE A HG12 4  
ATOM 10985 H HG13 . ILE A 1 92  ? 18.081  1.953   18.811  1.00 0.00 ? 144 ILE A HG13 4  
ATOM 10986 H HG21 . ILE A 1 92  ? 19.731  3.838   19.730  1.00 0.00 ? 144 ILE A HG21 4  
ATOM 10987 H HG22 . ILE A 1 92  ? 18.449  4.729   20.577  1.00 0.00 ? 144 ILE A HG22 4  
ATOM 10988 H HG23 . ILE A 1 92  ? 19.817  4.063   21.496  1.00 0.00 ? 144 ILE A HG23 4  
ATOM 10989 H HD11 . ILE A 1 92  ? 16.609  0.470   20.147  1.00 0.00 ? 144 ILE A HD11 4  
ATOM 10990 H HD12 . ILE A 1 92  ? 15.717  1.889   20.745  1.00 0.00 ? 144 ILE A HD12 4  
ATOM 10991 H HD13 . ILE A 1 92  ? 15.645  1.449   19.026  1.00 0.00 ? 144 ILE A HD13 4  
ATOM 10992 N N    . LYS A 1 93  ? 17.827  0.028   22.359  1.00 0.00 ? 145 LYS A N    4  
ATOM 10993 C CA   . LYS A 1 93  ? 17.045  -1.175  22.605  1.00 0.00 ? 145 LYS A CA   4  
ATOM 10994 C C    . LYS A 1 93  ? 15.647  -0.783  23.074  1.00 0.00 ? 145 LYS A C    4  
ATOM 10995 O O    . LYS A 1 93  ? 15.488  -0.207  24.149  1.00 0.00 ? 145 LYS A O    4  
ATOM 10996 C CB   . LYS A 1 93  ? 17.763  -2.046  23.641  1.00 0.00 ? 145 LYS A CB   4  
ATOM 10997 C CG   . LYS A 1 93  ? 17.566  -3.542  23.365  1.00 0.00 ? 145 LYS A CG   4  
ATOM 10998 C CD   . LYS A 1 93  ? 16.103  -3.990  23.315  1.00 0.00 ? 145 LYS A CD   4  
ATOM 10999 C CE   . LYS A 1 93  ? 15.377  -3.694  24.628  1.00 0.00 ? 145 LYS A CE   4  
ATOM 11000 N NZ   . LYS A 1 93  ? 13.978  -4.162  24.578  1.00 0.00 ? 145 LYS A NZ   4  
ATOM 11001 H H    . LYS A 1 93  ? 17.708  0.813   22.981  1.00 0.00 ? 145 LYS A H    4  
ATOM 11002 H HA   . LYS A 1 93  ? 16.964  -1.733  21.672  1.00 0.00 ? 145 LYS A HA   4  
ATOM 11003 H HB2  . LYS A 1 93  ? 18.832  -1.839  23.596  1.00 0.00 ? 145 LYS A HB2  4  
ATOM 11004 H HB3  . LYS A 1 93  ? 17.411  -1.801  24.643  1.00 0.00 ? 145 LYS A HB3  4  
ATOM 11005 H HG2  . LYS A 1 93  ? 18.032  -3.773  22.407  1.00 0.00 ? 145 LYS A HG2  4  
ATOM 11006 H HG3  . LYS A 1 93  ? 18.080  -4.108  24.142  1.00 0.00 ? 145 LYS A HG3  4  
ATOM 11007 H HD2  . LYS A 1 93  ? 15.595  -3.488  22.490  1.00 0.00 ? 145 LYS A HD2  4  
ATOM 11008 H HD3  . LYS A 1 93  ? 16.074  -5.064  23.130  1.00 0.00 ? 145 LYS A HD3  4  
ATOM 11009 H HE2  . LYS A 1 93  ? 15.897  -4.200  25.442  1.00 0.00 ? 145 LYS A HE2  4  
ATOM 11010 H HE3  . LYS A 1 93  ? 15.394  -2.621  24.815  1.00 0.00 ? 145 LYS A HE3  4  
ATOM 11011 H HZ1  . LYS A 1 93  ? 13.955  -5.162  24.434  1.00 0.00 ? 145 LYS A HZ1  4  
ATOM 11012 H HZ2  . LYS A 1 93  ? 13.512  -3.948  25.447  1.00 0.00 ? 145 LYS A HZ2  4  
ATOM 11013 H HZ3  . LYS A 1 93  ? 13.485  -3.711  23.821  1.00 0.00 ? 145 LYS A HZ3  4  
ATOM 11014 N N    . ASP A 1 94  ? 14.636  -1.099  22.263  1.00 0.00 ? 146 ASP A N    4  
ATOM 11015 C CA   . ASP A 1 94  ? 13.244  -0.853  22.596  1.00 0.00 ? 146 ASP A CA   4  
ATOM 11016 C C    . ASP A 1 94  ? 12.363  -1.879  21.882  1.00 0.00 ? 146 ASP A C    4  
ATOM 11017 O O    . ASP A 1 94  ? 12.075  -2.933  22.445  1.00 0.00 ? 146 ASP A O    4  
ATOM 11018 C CB   . ASP A 1 94  ? 12.868  0.588   22.233  1.00 0.00 ? 146 ASP A CB   4  
ATOM 11019 C CG   . ASP A 1 94  ? 11.435  0.930   22.640  1.00 0.00 ? 146 ASP A CG   4  
ATOM 11020 O OD1  . ASP A 1 94  ? 10.940  0.316   23.611  1.00 0.00 ? 146 ASP A OD1  4  
ATOM 11021 O OD2  . ASP A 1 94  ? 10.846  1.806   21.970  1.00 0.00 ? 146 ASP A OD2  4  
ATOM 11022 H H    . ASP A 1 94  ? 14.838  -1.533  21.373  1.00 0.00 ? 146 ASP A H    4  
ATOM 11023 H HA   . ASP A 1 94  ? 13.112  -0.981  23.670  1.00 0.00 ? 146 ASP A HA   4  
ATOM 11024 H HB2  . ASP A 1 94  ? 13.546  1.270   22.745  1.00 0.00 ? 146 ASP A HB2  4  
ATOM 11025 H HB3  . ASP A 1 94  ? 12.986  0.733   21.159  1.00 0.00 ? 146 ASP A HB3  4  
ATOM 11026 N N    . LYS A 1 95  ? 11.941  -1.575  20.649  1.00 0.00 ? 147 LYS A N    4  
ATOM 11027 C CA   . LYS A 1 95  ? 11.109  -2.457  19.841  1.00 0.00 ? 147 LYS A CA   4  
ATOM 11028 C C    . LYS A 1 95  ? 11.341  -2.174  18.353  1.00 0.00 ? 147 LYS A C    4  
ATOM 11029 O O    . LYS A 1 95  ? 11.810  -1.090  18.006  1.00 0.00 ? 147 LYS A O    4  
ATOM 11030 C CB   . LYS A 1 95  ? 9.638   -2.248  20.225  1.00 0.00 ? 147 LYS A CB   4  
ATOM 11031 C CG   . LYS A 1 95  ? 9.166   -0.817  19.945  1.00 0.00 ? 147 LYS A CG   4  
ATOM 11032 C CD   . LYS A 1 95  ? 7.709   -0.664  20.384  1.00 0.00 ? 147 LYS A CD   4  
ATOM 11033 C CE   . LYS A 1 95  ? 7.216   0.763   20.139  1.00 0.00 ? 147 LYS A CE   4  
ATOM 11034 N NZ   . LYS A 1 95  ? 7.197   1.089   18.700  1.00 0.00 ? 147 LYS A NZ   4  
ATOM 11035 H H    . LYS A 1 95  ? 12.204  -0.688  20.245  1.00 0.00 ? 147 LYS A H    4  
ATOM 11036 H HA   . LYS A 1 95  ? 11.384  -3.491  20.048  1.00 0.00 ? 147 LYS A HA   4  
ATOM 11037 H HB2  . LYS A 1 95  ? 9.008   -2.939  19.664  1.00 0.00 ? 147 LYS A HB2  4  
ATOM 11038 H HB3  . LYS A 1 95  ? 9.517   -2.458  21.287  1.00 0.00 ? 147 LYS A HB3  4  
ATOM 11039 H HG2  . LYS A 1 95  ? 9.785   -0.112  20.501  1.00 0.00 ? 147 LYS A HG2  4  
ATOM 11040 H HG3  . LYS A 1 95  ? 9.250   -0.608  18.879  1.00 0.00 ? 147 LYS A HG3  4  
ATOM 11041 H HD2  . LYS A 1 95  ? 7.084   -1.365  19.831  1.00 0.00 ? 147 LYS A HD2  4  
ATOM 11042 H HD3  . LYS A 1 95  ? 7.632   -0.885  21.449  1.00 0.00 ? 147 LYS A HD3  4  
ATOM 11043 H HE2  . LYS A 1 95  ? 6.208   0.861   20.541  1.00 0.00 ? 147 LYS A HE2  4  
ATOM 11044 H HE3  . LYS A 1 95  ? 7.870   1.460   20.664  1.00 0.00 ? 147 LYS A HE3  4  
ATOM 11045 H HZ1  . LYS A 1 95  ? 8.128   1.011   18.316  1.00 0.00 ? 147 LYS A HZ1  4  
ATOM 11046 H HZ2  . LYS A 1 95  ? 6.585   0.450   18.214  1.00 0.00 ? 147 LYS A HZ2  4  
ATOM 11047 H HZ3  . LYS A 1 95  ? 6.862   2.031   18.568  1.00 0.00 ? 147 LYS A HZ3  4  
ATOM 11048 N N    . PRO A 1 96  ? 11.019  -3.129  17.467  1.00 0.00 ? 148 PRO A N    4  
ATOM 11049 C CA   . PRO A 1 96  ? 11.117  -2.957  16.024  1.00 0.00 ? 148 PRO A CA   4  
ATOM 11050 C C    . PRO A 1 96  ? 10.090  -1.939  15.528  1.00 0.00 ? 148 PRO A C    4  
ATOM 11051 O O    . PRO A 1 96  ? 9.309   -1.401  16.313  1.00 0.00 ? 148 PRO A O    4  
ATOM 11052 C CB   . PRO A 1 96  ? 10.863  -4.349  15.441  1.00 0.00 ? 148 PRO A CB   4  
ATOM 11053 C CG   . PRO A 1 96  ? 9.966   -5.005  16.487  1.00 0.00 ? 148 PRO A CG   4  
ATOM 11054 C CD   . PRO A 1 96  ? 10.530  -4.456  17.794  1.00 0.00 ? 148 PRO A CD   4  
ATOM 11055 H HA   . PRO A 1 96  ? 12.116  -2.622  15.747  1.00 0.00 ? 148 PRO A HA   4  
ATOM 11056 H HB2  . PRO A 1 96  ? 10.380  -4.304  14.466  1.00 0.00 ? 148 PRO A HB2  4  
ATOM 11057 H HB3  . PRO A 1 96  ? 11.805  -4.895  15.381  1.00 0.00 ? 148 PRO A HB3  4  
ATOM 11058 H HG2  . PRO A 1 96  ? 8.939   -4.662  16.357  1.00 0.00 ? 148 PRO A HG2  4  
ATOM 11059 H HG3  . PRO A 1 96  ? 10.022  -6.094  16.448  1.00 0.00 ? 148 PRO A HG3  4  
ATOM 11060 H HD2  . PRO A 1 96  ? 9.753   -4.430  18.556  1.00 0.00 ? 148 PRO A HD2  4  
ATOM 11061 H HD3  . PRO A 1 96  ? 11.364  -5.075  18.123  1.00 0.00 ? 148 PRO A HD3  4  
ATOM 11062 N N    . VAL A 1 97  ? 10.088  -1.671  14.217  1.00 0.00 ? 149 VAL A N    4  
ATOM 11063 C CA   . VAL A 1 97  ? 9.202   -0.672  13.628  1.00 0.00 ? 149 VAL A CA   4  
ATOM 11064 C C    . VAL A 1 97  ? 8.405   -1.281  12.478  1.00 0.00 ? 149 VAL A C    4  
ATOM 11065 O O    . VAL A 1 97  ? 8.934   -2.072  11.702  1.00 0.00 ? 149 VAL A O    4  
ATOM 11066 C CB   . VAL A 1 97  ? 9.995   0.563   13.177  1.00 0.00 ? 149 VAL A CB   4  
ATOM 11067 C CG1  . VAL A 1 97  ? 10.755  1.176   14.354  1.00 0.00 ? 149 VAL A CG1  4  
ATOM 11068 C CG2  . VAL A 1 97  ? 11.005  0.234   12.086  1.00 0.00 ? 149 VAL A CG2  4  
ATOM 11069 H H    . VAL A 1 97  ? 10.715  -2.169  13.602  1.00 0.00 ? 149 VAL A H    4  
ATOM 11070 H HA   . VAL A 1 97  ? 8.488   -0.347  14.386  1.00 0.00 ? 149 VAL A HA   4  
ATOM 11071 H HB   . VAL A 1 97  ? 9.299   1.298   12.774  1.00 0.00 ? 149 VAL A HB   4  
ATOM 11072 H HG11 . VAL A 1 97  ? 11.503  0.472   14.717  1.00 0.00 ? 149 VAL A HG11 4  
ATOM 11073 H HG12 . VAL A 1 97  ? 11.252  2.088   14.022  1.00 0.00 ? 149 VAL A HG12 4  
ATOM 11074 H HG13 . VAL A 1 97  ? 10.064  1.413   15.164  1.00 0.00 ? 149 VAL A HG13 4  
ATOM 11075 H HG21 . VAL A 1 97  ? 11.713  -0.512  12.447  1.00 0.00 ? 149 VAL A HG21 4  
ATOM 11076 H HG22 . VAL A 1 97  ? 10.478  -0.142  11.208  1.00 0.00 ? 149 VAL A HG22 4  
ATOM 11077 H HG23 . VAL A 1 97  ? 11.545  1.138   11.806  1.00 0.00 ? 149 VAL A HG23 4  
ATOM 11078 N N    . GLN A 1 98  ? 7.126   -0.912  12.372  1.00 0.00 ? 150 GLN A N    4  
ATOM 11079 C CA   . GLN A 1 98  ? 6.232   -1.433  11.347  1.00 0.00 ? 150 GLN A CA   4  
ATOM 11080 C C    . GLN A 1 98  ? 6.449   -0.700  10.027  1.00 0.00 ? 150 GLN A C    4  
ATOM 11081 O O    . GLN A 1 98  ? 6.593   0.520   10.027  1.00 0.00 ? 150 GLN A O    4  
ATOM 11082 C CB   . GLN A 1 98  ? 4.790   -1.268  11.835  1.00 0.00 ? 150 GLN A CB   4  
ATOM 11083 C CG   . GLN A 1 98  ? 3.769   -1.690  10.776  1.00 0.00 ? 150 GLN A CG   4  
ATOM 11084 C CD   . GLN A 1 98  ? 2.338   -1.431  11.238  1.00 0.00 ? 150 GLN A CD   4  
ATOM 11085 O OE1  . GLN A 1 98  ? 2.094   -1.069  12.385  1.00 0.00 ? 150 GLN A OE1  4  
ATOM 11086 N NE2  . GLN A 1 98  ? 1.375   -1.616  10.340  1.00 0.00 ? 150 GLN A NE2  4  
ATOM 11087 H H    . GLN A 1 98  ? 6.748   -0.243  13.027  1.00 0.00 ? 150 GLN A H    4  
ATOM 11088 H HA   . GLN A 1 98  ? 6.434   -2.494  11.199  1.00 0.00 ? 150 GLN A HA   4  
ATOM 11089 H HB2  . GLN A 1 98  ? 4.647   -1.864  12.736  1.00 0.00 ? 150 GLN A HB2  4  
ATOM 11090 H HB3  . GLN A 1 98  ? 4.624   -0.219  12.080  1.00 0.00 ? 150 GLN A HB3  4  
ATOM 11091 H HG2  . GLN A 1 98  ? 3.940   -1.124  9.860   1.00 0.00 ? 150 GLN A HG2  4  
ATOM 11092 H HG3  . GLN A 1 98  ? 3.889   -2.750  10.556  1.00 0.00 ? 150 GLN A HG3  4  
ATOM 11093 H HE21 . GLN A 1 98  ? 1.603   -1.916  9.403   1.00 0.00 ? 150 GLN A HE21 4  
ATOM 11094 H HE22 . GLN A 1 98  ? 0.412   -1.454  10.603  1.00 0.00 ? 150 GLN A HE22 4  
ATOM 11095 N N    . ILE A 1 99  ? 6.472   -1.443  8.916   1.00 0.00 ? 151 ILE A N    4  
ATOM 11096 C CA   . ILE A 1 99  ? 6.677   -0.902  7.574   1.00 0.00 ? 151 ILE A CA   4  
ATOM 11097 C C    . ILE A 1 99  ? 5.607   -1.465  6.636   1.00 0.00 ? 151 ILE A C    4  
ATOM 11098 O O    . ILE A 1 99  ? 5.181   -2.607  6.800   1.00 0.00 ? 151 ILE A O    4  
ATOM 11099 C CB   . ILE A 1 99  ? 8.099   -1.240  7.085   1.00 0.00 ? 151 ILE A CB   4  
ATOM 11100 C CG1  . ILE A 1 99  ? 9.019   -0.015  7.044   1.00 0.00 ? 151 ILE A CG1  4  
ATOM 11101 C CG2  . ILE A 1 99  ? 8.102   -1.810  5.664   1.00 0.00 ? 151 ILE A CG2  4  
ATOM 11102 C CD1  . ILE A 1 99  ? 9.290   0.579   8.422   1.00 0.00 ? 151 ILE A CD1  4  
ATOM 11103 H H    . ILE A 1 99  ? 6.338   -2.441  8.996   1.00 0.00 ? 151 ILE A H    4  
ATOM 11104 H HA   . ILE A 1 99  ? 6.567   0.182   7.605   1.00 0.00 ? 151 ILE A HA   4  
ATOM 11105 H HB   . ILE A 1 99  ? 8.534   -1.987  7.749   1.00 0.00 ? 151 ILE A HB   4  
ATOM 11106 H HG12 . ILE A 1 99  ? 9.971   -0.316  6.608   1.00 0.00 ? 151 ILE A HG12 4  
ATOM 11107 H HG13 . ILE A 1 99  ? 8.574   0.751   6.409   1.00 0.00 ? 151 ILE A HG13 4  
ATOM 11108 H HG21 . ILE A 1 99  ? 7.710   -1.070  4.967   1.00 0.00 ? 151 ILE A HG21 4  
ATOM 11109 H HG22 . ILE A 1 99  ? 9.124   -2.061  5.380   1.00 0.00 ? 151 ILE A HG22 4  
ATOM 11110 H HG23 . ILE A 1 99  ? 7.497   -2.715  5.619   1.00 0.00 ? 151 ILE A HG23 4  
ATOM 11111 H HD11 . ILE A 1 99  ? 9.574   -0.212  9.116   1.00 0.00 ? 151 ILE A HD11 4  
ATOM 11112 H HD12 . ILE A 1 99  ? 10.100  1.305   8.348   1.00 0.00 ? 151 ILE A HD12 4  
ATOM 11113 H HD13 . ILE A 1 99  ? 8.396   1.091   8.779   1.00 0.00 ? 151 ILE A HD13 4  
ATOM 11114 N N    . ARG A 1 100 ? 5.171   -0.666  5.652   1.00 0.00 ? 152 ARG A N    4  
ATOM 11115 C CA   . ARG A 1 100 ? 4.182   -1.101  4.667   1.00 0.00 ? 152 ARG A CA   4  
ATOM 11116 C C    . ARG A 1 100 ? 4.386   -0.427  3.303   1.00 0.00 ? 152 ARG A C    4  
ATOM 11117 O O    . ARG A 1 100 ? 3.983   0.722   3.132   1.00 0.00 ? 152 ARG A O    4  
ATOM 11118 C CB   . ARG A 1 100 ? 2.772   -0.770  5.174   1.00 0.00 ? 152 ARG A CB   4  
ATOM 11119 C CG   . ARG A 1 100 ? 2.361   -1.649  6.358   1.00 0.00 ? 152 ARG A CG   4  
ATOM 11120 C CD   . ARG A 1 100 ? 0.884   -1.429  6.691   1.00 0.00 ? 152 ARG A CD   4  
ATOM 11121 N NE   . ARG A 1 100 ? 0.633   -0.066  7.179   1.00 0.00 ? 152 ARG A NE   4  
ATOM 11122 C CZ   . ARG A 1 100 ? -0.585  0.435   7.406   1.00 0.00 ? 152 ARG A CZ   4  
ATOM 11123 N NH1  . ARG A 1 100 ? -1.675  -0.297  7.185   1.00 0.00 ? 152 ARG A NH1  4  
ATOM 11124 N NH2  . ARG A 1 100 ? -0.716  1.680   7.858   1.00 0.00 ? 152 ARG A NH2  4  
ATOM 11125 H H    . ARG A 1 100 ? 5.534   0.274   5.579   1.00 0.00 ? 152 ARG A H    4  
ATOM 11126 H HA   . ARG A 1 100 ? 4.252   -2.180  4.538   1.00 0.00 ? 152 ARG A HA   4  
ATOM 11127 H HB2  . ARG A 1 100 ? 2.727   0.279   5.466   1.00 0.00 ? 152 ARG A HB2  4  
ATOM 11128 H HB3  . ARG A 1 100 ? 2.061   -0.936  4.365   1.00 0.00 ? 152 ARG A HB3  4  
ATOM 11129 H HG2  . ARG A 1 100 ? 2.511   -2.696  6.096   1.00 0.00 ? 152 ARG A HG2  4  
ATOM 11130 H HG3  . ARG A 1 100 ? 2.967   -1.408  7.231   1.00 0.00 ? 152 ARG A HG3  4  
ATOM 11131 H HD2  . ARG A 1 100 ? 0.288   -1.605  5.796   1.00 0.00 ? 152 ARG A HD2  4  
ATOM 11132 H HD3  . ARG A 1 100 ? 0.584   -2.142  7.459   1.00 0.00 ? 152 ARG A HD3  4  
ATOM 11133 H HE   . ARG A 1 100 ? 1.434   0.525   7.352   1.00 0.00 ? 152 ARG A HE   4  
ATOM 11134 H HH11 . ARG A 1 100 ? -1.588  -1.240  6.834   1.00 0.00 ? 152 ARG A HH11 4  
ATOM 11135 H HH12 . ARG A 1 100 ? -2.590  0.090   7.368   1.00 0.00 ? 152 ARG A HH12 4  
ATOM 11136 H HH21 . ARG A 1 100 ? 0.103   2.244   8.033   1.00 0.00 ? 152 ARG A HH21 4  
ATOM 11137 H HH22 . ARG A 1 100 ? -1.635  2.062   8.028   1.00 0.00 ? 152 ARG A HH22 4  
ATOM 11138 N N    . PRO A 1 101 ? 5.004   -1.122  2.335   1.00 0.00 ? 153 PRO A N    4  
ATOM 11139 C CA   . PRO A 1 101 ? 5.073   -0.717  0.934   1.00 0.00 ? 153 PRO A CA   4  
ATOM 11140 C C    . PRO A 1 101 ? 3.782   -1.184  0.262   1.00 0.00 ? 153 PRO A C    4  
ATOM 11141 O O    . PRO A 1 101 ? 2.865   -1.607  0.968   1.00 0.00 ? 153 PRO A O    4  
ATOM 11142 C CB   . PRO A 1 101 ? 6.274   -1.481  0.381   1.00 0.00 ? 153 PRO A CB   4  
ATOM 11143 C CG   . PRO A 1 101 ? 6.164   -2.809  1.128   1.00 0.00 ? 153 PRO A CG   4  
ATOM 11144 C CD   . PRO A 1 101 ? 5.694   -2.387  2.522   1.00 0.00 ? 153 PRO A CD   4  
ATOM 11145 H HA   . PRO A 1 101 ? 5.206   0.358   0.822   1.00 0.00 ? 153 PRO A HA   4  
ATOM 11146 H HB2  . PRO A 1 101 ? 6.216   -1.615  -0.699  1.00 0.00 ? 153 PRO A HB2  4  
ATOM 11147 H HB3  . PRO A 1 101 ? 7.198   -0.978  0.664   1.00 0.00 ? 153 PRO A HB3  4  
ATOM 11148 H HG2  . PRO A 1 101 ? 5.401   -3.429  0.658   1.00 0.00 ? 153 PRO A HG2  4  
ATOM 11149 H HG3  . PRO A 1 101 ? 7.119   -3.334  1.160   1.00 0.00 ? 153 PRO A HG3  4  
ATOM 11150 H HD2  . PRO A 1 101 ? 5.027   -3.144  2.936   1.00 0.00 ? 153 PRO A HD2  4  
ATOM 11151 H HD3  . PRO A 1 101 ? 6.552   -2.235  3.176   1.00 0.00 ? 153 PRO A HD3  4  
ATOM 11152 N N    . TRP A 1 102 ? 3.648   -1.135  -1.073  1.00 0.00 ? 154 TRP A N    4  
ATOM 11153 C CA   . TRP A 1 102 ? 2.493   -1.763  -1.712  1.00 0.00 ? 154 TRP A CA   4  
ATOM 11154 C C    . TRP A 1 102 ? 2.857   -2.558  -2.959  1.00 0.00 ? 154 TRP A C    4  
ATOM 11155 O O    . TRP A 1 102 ? 3.845   -2.272  -3.631  1.00 0.00 ? 154 TRP A O    4  
ATOM 11156 C CB   . TRP A 1 102 ? 1.394   -0.737  -1.989  1.00 0.00 ? 154 TRP A CB   4  
ATOM 11157 C CG   . TRP A 1 102 ? 0.232   -1.288  -2.755  1.00 0.00 ? 154 TRP A CG   4  
ATOM 11158 C CD1  . TRP A 1 102 ? -0.101  -0.958  -4.021  1.00 0.00 ? 154 TRP A CD1  4  
ATOM 11159 C CD2  . TRP A 1 102 ? -0.760  -2.273  -2.331  1.00 0.00 ? 154 TRP A CD2  4  
ATOM 11160 N NE1  . TRP A 1 102 ? -1.209  -1.678  -4.416  1.00 0.00 ? 154 TRP A NE1  4  
ATOM 11161 C CE2  . TRP A 1 102 ? -1.655  -2.511  -3.414  1.00 0.00 ? 154 TRP A CE2  4  
ATOM 11162 C CE3  . TRP A 1 102 ? -0.979  -3.003  -1.150  1.00 0.00 ? 154 TRP A CE3  4  
ATOM 11163 C CZ2  . TRP A 1 102 ? -2.704  -3.434  -3.338  1.00 0.00 ? 154 TRP A CZ2  4  
ATOM 11164 C CZ3  . TRP A 1 102 ? -2.022  -3.937  -1.063  1.00 0.00 ? 154 TRP A CZ3  4  
ATOM 11165 C CH2  . TRP A 1 102 ? -2.873  -4.162  -2.155  1.00 0.00 ? 154 TRP A CH2  4  
ATOM 11166 H H    . TRP A 1 102 ? 4.334   -0.674  -1.653  1.00 0.00 ? 154 TRP A H    4  
ATOM 11167 H HA   . TRP A 1 102 ? 2.080   -2.490  -1.011  1.00 0.00 ? 154 TRP A HA   4  
ATOM 11168 H HB2  . TRP A 1 102 ? 1.030   -0.351  -1.037  1.00 0.00 ? 154 TRP A HB2  4  
ATOM 11169 H HB3  . TRP A 1 102 ? 1.815   0.093   -2.556  1.00 0.00 ? 154 TRP A HB3  4  
ATOM 11170 H HD1  . TRP A 1 102 ? 0.425   -0.239  -4.633  1.00 0.00 ? 154 TRP A HD1  4  
ATOM 11171 H HE1  . TRP A 1 102 ? -1.624  -1.597  -5.333  1.00 0.00 ? 154 TRP A HE1  4  
ATOM 11172 H HE3  . TRP A 1 102 ? -0.333  -2.844  -0.299  1.00 0.00 ? 154 TRP A HE3  4  
ATOM 11173 H HZ2  . TRP A 1 102 ? -3.368  -3.584  -4.176  1.00 0.00 ? 154 TRP A HZ2  4  
ATOM 11174 H HZ3  . TRP A 1 102 ? -2.169  -4.491  -0.148  1.00 0.00 ? 154 TRP A HZ3  4  
ATOM 11175 H HH2  . TRP A 1 102 ? -3.660  -4.897  -2.081  1.00 0.00 ? 154 TRP A HH2  4  
ATOM 11176 N N    . ASN A 1 103 ? 2.033   -3.570  -3.258  1.00 0.00 ? 155 ASN A N    4  
ATOM 11177 C CA   . ASN A 1 103 ? 2.195   -4.466  -4.390  1.00 0.00 ? 155 ASN A CA   4  
ATOM 11178 C C    . ASN A 1 103 ? 1.121   -4.185  -5.444  1.00 0.00 ? 155 ASN A C    4  
ATOM 11179 O O    . ASN A 1 103 ? 0.137   -4.913  -5.578  1.00 0.00 ? 155 ASN A O    4  
ATOM 11180 C CB   . ASN A 1 103 ? 2.209   -5.924  -3.910  1.00 0.00 ? 155 ASN A CB   4  
ATOM 11181 C CG   . ASN A 1 103 ? 0.970   -6.338  -3.121  1.00 0.00 ? 155 ASN A CG   4  
ATOM 11182 O OD1  . ASN A 1 103 ? 0.143   -5.517  -2.739  1.00 0.00 ? 155 ASN A OD1  4  
ATOM 11183 N ND2  . ASN A 1 103 ? 0.834   -7.636  -2.868  1.00 0.00 ? 155 ASN A ND2  4  
ATOM 11184 H H    . ASN A 1 103 ? 1.234   -3.735  -2.662  1.00 0.00 ? 155 ASN A H    4  
ATOM 11185 H HA   . ASN A 1 103 ? 3.163   -4.265  -4.852  1.00 0.00 ? 155 ASN A HA   4  
ATOM 11186 H HB2  . ASN A 1 103 ? 2.309   -6.578  -4.774  1.00 0.00 ? 155 ASN A HB2  4  
ATOM 11187 H HB3  . ASN A 1 103 ? 3.077   -6.072  -3.268  1.00 0.00 ? 155 ASN A HB3  4  
ATOM 11188 H HD21 . ASN A 1 103 ? 1.532   -8.291  -3.192  1.00 0.00 ? 155 ASN A HD21 4  
ATOM 11189 H HD22 . ASN A 1 103 ? 0.031   -7.960  -2.350  1.00 0.00 ? 155 ASN A HD22 4  
ATOM 11190 N N    . LEU A 1 104 ? 1.327   -3.104  -6.200  1.00 0.00 ? 156 LEU A N    4  
ATOM 11191 C CA   . LEU A 1 104 ? 0.430   -2.686  -7.265  1.00 0.00 ? 156 LEU A CA   4  
ATOM 11192 C C    . LEU A 1 104 ? 0.399   -3.669  -8.439  1.00 0.00 ? 156 LEU A C    4  
ATOM 11193 O O    . LEU A 1 104 ? -0.240  -3.395  -9.452  1.00 0.00 ? 156 LEU A O    4  
ATOM 11194 C CB   . LEU A 1 104 ? 0.712   -1.240  -7.698  1.00 0.00 ? 156 LEU A CB   4  
ATOM 11195 C CG   . LEU A 1 104 ? 2.169   -0.843  -7.980  1.00 0.00 ? 156 LEU A CG   4  
ATOM 11196 C CD1  . LEU A 1 104 ? 3.003   -0.715  -6.711  1.00 0.00 ? 156 LEU A CD1  4  
ATOM 11197 C CD2  . LEU A 1 104 ? 2.933   -1.805  -8.876  1.00 0.00 ? 156 LEU A CD2  4  
ATOM 11198 H H    . LEU A 1 104 ? 2.147   -2.540  -6.027  1.00 0.00 ? 156 LEU A H    4  
ATOM 11199 H HA   . LEU A 1 104 ? -0.575  -2.699  -6.845  1.00 0.00 ? 156 LEU A HA   4  
ATOM 11200 H HB2  . LEU A 1 104 ? 0.131   -1.041  -8.599  1.00 0.00 ? 156 LEU A HB2  4  
ATOM 11201 H HB3  . LEU A 1 104 ? 0.332   -0.576  -6.922  1.00 0.00 ? 156 LEU A HB3  4  
ATOM 11202 H HG   . LEU A 1 104 ? 2.153   0.133   -8.464  1.00 0.00 ? 156 LEU A HG   4  
ATOM 11203 H HD11 . LEU A 1 104 ? 3.900   -0.144  -6.951  1.00 0.00 ? 156 LEU A HD11 4  
ATOM 11204 H HD12 . LEU A 1 104 ? 2.428   -0.198  -5.942  1.00 0.00 ? 156 LEU A HD12 4  
ATOM 11205 H HD13 . LEU A 1 104 ? 3.319   -1.695  -6.350  1.00 0.00 ? 156 LEU A HD13 4  
ATOM 11206 H HD21 . LEU A 1 104 ? 3.951   -1.432  -8.983  1.00 0.00 ? 156 LEU A HD21 4  
ATOM 11207 H HD22 . LEU A 1 104 ? 2.966   -2.787  -8.402  1.00 0.00 ? 156 LEU A HD22 4  
ATOM 11208 H HD23 . LEU A 1 104 ? 2.449   -1.868  -9.851  1.00 0.00 ? 156 LEU A HD23 4  
ATOM 11209 N N    . SER A 1 105 ? 1.083   -4.810  -8.309  1.00 0.00 ? 157 SER A N    4  
ATOM 11210 C CA   . SER A 1 105 ? 0.982   -5.889  -9.279  1.00 0.00 ? 157 SER A CA   4  
ATOM 11211 C C    . SER A 1 105 ? -0.085  -6.892  -8.848  1.00 0.00 ? 157 SER A C    4  
ATOM 11212 O O    . SER A 1 105 ? -0.507  -7.722  -9.651  1.00 0.00 ? 157 SER A O    4  
ATOM 11213 C CB   . SER A 1 105 ? 2.343   -6.568  -9.433  1.00 0.00 ? 157 SER A CB   4  
ATOM 11214 O OG   . SER A 1 105 ? 2.793   -7.064  -8.189  1.00 0.00 ? 157 SER A OG   4  
ATOM 11215 H H    . SER A 1 105 ? 1.686   -4.947  -7.511  1.00 0.00 ? 157 SER A H    4  
ATOM 11216 H HA   . SER A 1 105 ? 0.695   -5.471  -10.245 1.00 0.00 ? 157 SER A HA   4  
ATOM 11217 H HB2  . SER A 1 105 ? 2.258   -7.390  -10.145 1.00 0.00 ? 157 SER A HB2  4  
ATOM 11218 H HB3  . SER A 1 105 ? 3.059   -5.840  -9.815  1.00 0.00 ? 157 SER A HB3  4  
ATOM 11219 H HG   . SER A 1 105 ? 2.178   -7.737  -7.888  1.00 0.00 ? 157 SER A HG   4  
ATOM 11220 N N    . ASP A 1 106 ? -0.525  -6.823  -7.585  1.00 0.00 ? 158 ASP A N    4  
ATOM 11221 C CA   . ASP A 1 106 ? -1.554  -7.712  -7.065  1.00 0.00 ? 158 ASP A CA   4  
ATOM 11222 C C    . ASP A 1 106 ? -2.901  -6.995  -6.972  1.00 0.00 ? 158 ASP A C    4  
ATOM 11223 O O    . ASP A 1 106 ? -3.939  -7.654  -6.921  1.00 0.00 ? 158 ASP A O    4  
ATOM 11224 C CB   . ASP A 1 106 ? -1.099  -8.216  -5.695  1.00 0.00 ? 158 ASP A CB   4  
ATOM 11225 C CG   . ASP A 1 106 ? -2.102  -9.186  -5.078  1.00 0.00 ? 158 ASP A CG   4  
ATOM 11226 O OD1  . ASP A 1 106 ? -2.044  -10.385 -5.432  1.00 0.00 ? 158 ASP A OD1  4  
ATOM 11227 O OD2  . ASP A 1 106 ? -2.920  -8.722  -4.257  1.00 0.00 ? 158 ASP A OD2  4  
ATOM 11228 H H    . ASP A 1 106 ? -0.138  -6.137  -6.954  1.00 0.00 ? 158 ASP A H    4  
ATOM 11229 H HA   . ASP A 1 106 ? -1.663  -8.568  -7.731  1.00 0.00 ? 158 ASP A HA   4  
ATOM 11230 H HB2  . ASP A 1 106 ? -0.138  -8.718  -5.802  1.00 0.00 ? 158 ASP A HB2  4  
ATOM 11231 H HB3  . ASP A 1 106 ? -0.972  -7.362  -5.028  1.00 0.00 ? 158 ASP A HB3  4  
ATOM 11232 N N    . SER A 1 107 ? -2.885  -5.655  -6.949  1.00 0.00 ? 159 SER A N    4  
ATOM 11233 C CA   . SER A 1 107 ? -4.101  -4.847  -7.038  1.00 0.00 ? 159 SER A CA   4  
ATOM 11234 C C    . SER A 1 107 ? -5.126  -5.373  -8.034  1.00 0.00 ? 159 SER A C    4  
ATOM 11235 O O    . SER A 1 107 ? -6.317  -5.136  -7.852  1.00 0.00 ? 159 SER A O    4  
ATOM 11236 C CB   . SER A 1 107 ? -3.739  -3.444  -7.515  1.00 0.00 ? 159 SER A CB   4  
ATOM 11237 O OG   . SER A 1 107 ? -2.893  -2.792  -6.595  1.00 0.00 ? 159 SER A OG   4  
ATOM 11238 H H    . SER A 1 107 ? -2.004  -5.171  -6.854  1.00 0.00 ? 159 SER A H    4  
ATOM 11239 H HA   . SER A 1 107 ? -4.580  -4.795  -6.061  1.00 0.00 ? 159 SER A HA   4  
ATOM 11240 H HB2  . SER A 1 107 ? -3.237  -3.511  -8.481  1.00 0.00 ? 159 SER A HB2  4  
ATOM 11241 H HB3  . SER A 1 107 ? -4.655  -2.865  -7.635  1.00 0.00 ? 159 SER A HB3  4  
ATOM 11242 H HG   . SER A 1 107 ? -2.728  -1.908  -6.929  1.00 0.00 ? 159 SER A HG   4  
ATOM 11243 N N    . ASP A 1 108 ? -4.684  -6.078  -9.074  1.00 0.00 ? 160 ASP A N    4  
ATOM 11244 C CA   . ASP A 1 108 ? -5.576  -6.593  -10.094 1.00 0.00 ? 160 ASP A CA   4  
ATOM 11245 C C    . ASP A 1 108 ? -5.917  -8.049  -9.790  1.00 0.00 ? 160 ASP A C    4  
ATOM 11246 O O    . ASP A 1 108 ? -5.031  -8.897  -9.701  1.00 0.00 ? 160 ASP A O    4  
ATOM 11247 C CB   . ASP A 1 108 ? -4.924  -6.423  -11.467 1.00 0.00 ? 160 ASP A CB   4  
ATOM 11248 C CG   . ASP A 1 108 ? -5.908  -6.740  -12.589 1.00 0.00 ? 160 ASP A CG   4  
ATOM 11249 O OD1  . ASP A 1 108 ? -6.626  -5.802  -12.998 1.00 0.00 ? 160 ASP A OD1  4  
ATOM 11250 O OD2  . ASP A 1 108 ? -5.931  -7.913  -13.026 1.00 0.00 ? 160 ASP A OD2  4  
ATOM 11251 H H    . ASP A 1 108 ? -3.696  -6.265  -9.160  1.00 0.00 ? 160 ASP A H    4  
ATOM 11252 H HA   . ASP A 1 108 ? -6.497  -6.011  -10.083 1.00 0.00 ? 160 ASP A HA   4  
ATOM 11253 H HB2  . ASP A 1 108 ? -4.592  -5.391  -11.573 1.00 0.00 ? 160 ASP A HB2  4  
ATOM 11254 H HB3  . ASP A 1 108 ? -4.057  -7.077  -11.540 1.00 0.00 ? 160 ASP A HB3  4  
ATOM 11255 N N    . PHE A 1 109 ? -7.212  -8.326  -9.632  1.00 0.00 ? 161 PHE A N    4  
ATOM 11256 C CA   . PHE A 1 109 ? -7.693  -9.669  -9.343  1.00 0.00 ? 161 PHE A CA   4  
ATOM 11257 C C    . PHE A 1 109 ? -8.650  -10.145 -10.435 1.00 0.00 ? 161 PHE A C    4  
ATOM 11258 O O    . PHE A 1 109 ? -9.768  -9.649  -10.568 1.00 0.00 ? 161 PHE A O    4  
ATOM 11259 C CB   . PHE A 1 109 ? -8.313  -9.723  -7.941  1.00 0.00 ? 161 PHE A CB   4  
ATOM 11260 C CG   . PHE A 1 109 ? -9.588  -8.930  -7.749  1.00 0.00 ? 161 PHE A CG   4  
ATOM 11261 C CD1  . PHE A 1 109 ? -9.543  -7.534  -7.632  1.00 0.00 ? 161 PHE A CD1  4  
ATOM 11262 C CD2  . PHE A 1 109 ? -10.818 -9.600  -7.681  1.00 0.00 ? 161 PHE A CD2  4  
ATOM 11263 C CE1  . PHE A 1 109 ? -10.730 -6.811  -7.449  1.00 0.00 ? 161 PHE A CE1  4  
ATOM 11264 C CE2  . PHE A 1 109 ? -12.003 -8.877  -7.492  1.00 0.00 ? 161 PHE A CE2  4  
ATOM 11265 C CZ   . PHE A 1 109 ? -11.958 -7.481  -7.369  1.00 0.00 ? 161 PHE A CZ   4  
ATOM 11266 H H    . PHE A 1 109 ? -7.895  -7.586  -9.716  1.00 0.00 ? 161 PHE A H    4  
ATOM 11267 H HA   . PHE A 1 109 ? -6.837  -10.345 -9.344  1.00 0.00 ? 161 PHE A HA   4  
ATOM 11268 H HB2  . PHE A 1 109 ? -8.538  -10.761 -7.698  1.00 0.00 ? 161 PHE A HB2  4  
ATOM 11269 H HB3  . PHE A 1 109 ? -7.575  -9.366  -7.222  1.00 0.00 ? 161 PHE A HB3  4  
ATOM 11270 H HD1  . PHE A 1 109 ? -8.596  -7.018  -7.681  1.00 0.00 ? 161 PHE A HD1  4  
ATOM 11271 H HD2  . PHE A 1 109 ? -10.856 -10.675 -7.775  1.00 0.00 ? 161 PHE A HD2  4  
ATOM 11272 H HE1  . PHE A 1 109 ? -10.698 -5.733  -7.367  1.00 0.00 ? 161 PHE A HE1  4  
ATOM 11273 H HE2  . PHE A 1 109 ? -12.948 -9.395  -7.440  1.00 0.00 ? 161 PHE A HE2  4  
ATOM 11274 H HZ   . PHE A 1 109 ? -12.870 -6.924  -7.215  1.00 0.00 ? 161 PHE A HZ   4  
ATOM 11275 N N    . VAL A 1 110 ? -8.197  -11.121 -11.226 1.00 0.00 ? 162 VAL A N    4  
ATOM 11276 C CA   . VAL A 1 110 ? -9.020  -11.741 -12.257 1.00 0.00 ? 162 VAL A CA   4  
ATOM 11277 C C    . VAL A 1 110 ? -9.752  -12.951 -11.684 1.00 0.00 ? 162 VAL A C    4  
ATOM 11278 O O    . VAL A 1 110 ? -9.264  -13.581 -10.746 1.00 0.00 ? 162 VAL A O    4  
ATOM 11279 C CB   . VAL A 1 110 ? -8.134  -12.141 -13.444 1.00 0.00 ? 162 VAL A CB   4  
ATOM 11280 C CG1  . VAL A 1 110 ? -8.981  -12.598 -14.633 1.00 0.00 ? 162 VAL A CG1  4  
ATOM 11281 C CG2  . VAL A 1 110 ? -7.274  -10.958 -13.894 1.00 0.00 ? 162 VAL A CG2  4  
ATOM 11282 H H    . VAL A 1 110 ? -7.247  -11.449 -11.123 1.00 0.00 ? 162 VAL A H    4  
ATOM 11283 H HA   . VAL A 1 110 ? -9.757  -11.018 -12.604 1.00 0.00 ? 162 VAL A HA   4  
ATOM 11284 H HB   . VAL A 1 110 ? -7.477  -12.957 -13.143 1.00 0.00 ? 162 VAL A HB   4  
ATOM 11285 H HG11 . VAL A 1 110 ? -9.683  -11.811 -14.911 1.00 0.00 ? 162 VAL A HG11 4  
ATOM 11286 H HG12 . VAL A 1 110 ? -8.332  -12.819 -15.480 1.00 0.00 ? 162 VAL A HG12 4  
ATOM 11287 H HG13 . VAL A 1 110 ? -9.532  -13.500 -14.370 1.00 0.00 ? 162 VAL A HG13 4  
ATOM 11288 H HG21 . VAL A 1 110 ? -6.568  -10.695 -13.107 1.00 0.00 ? 162 VAL A HG21 4  
ATOM 11289 H HG22 . VAL A 1 110 ? -6.718  -11.231 -14.790 1.00 0.00 ? 162 VAL A HG22 4  
ATOM 11290 H HG23 . VAL A 1 110 ? -7.910  -10.100 -14.107 1.00 0.00 ? 162 VAL A HG23 4  
ATOM 11291 N N    . MET A 1 111 ? -10.922 -13.279 -12.242 1.00 0.00 ? 163 MET A N    4  
ATOM 11292 C CA   . MET A 1 111 ? -11.695 -14.428 -11.796 1.00 0.00 ? 163 MET A CA   4  
ATOM 11293 C C    . MET A 1 111 ? -11.720 -15.523 -12.863 1.00 0.00 ? 163 MET A C    4  
ATOM 11294 O O    . MET A 1 111 ? -11.697 -16.706 -12.527 1.00 0.00 ? 163 MET A O    4  
ATOM 11295 C CB   . MET A 1 111 ? -13.106 -13.961 -11.435 1.00 0.00 ? 163 MET A CB   4  
ATOM 11296 C CG   . MET A 1 111 ? -13.933 -15.098 -10.836 1.00 0.00 ? 163 MET A CG   4  
ATOM 11297 S SD   . MET A 1 111 ? -13.262 -15.772 -9.292  1.00 0.00 ? 163 MET A SD   4  
ATOM 11298 C CE   . MET A 1 111 ? -14.522 -17.028 -8.960  1.00 0.00 ? 163 MET A CE   4  
ATOM 11299 H H    . MET A 1 111 ? -11.293 -12.719 -12.997 1.00 0.00 ? 163 MET A H    4  
ATOM 11300 H HA   . MET A 1 111 ? -11.230 -14.840 -10.900 1.00 0.00 ? 163 MET A HA   4  
ATOM 11301 H HB2  . MET A 1 111 ? -13.041 -13.150 -10.709 1.00 0.00 ? 163 MET A HB2  4  
ATOM 11302 H HB3  . MET A 1 111 ? -13.600 -13.594 -12.335 1.00 0.00 ? 163 MET A HB3  4  
ATOM 11303 H HG2  . MET A 1 111 ? -14.938 -14.725 -10.637 1.00 0.00 ? 163 MET A HG2  4  
ATOM 11304 H HG3  . MET A 1 111 ? -14.009 -15.903 -11.566 1.00 0.00 ? 163 MET A HG3  4  
ATOM 11305 H HE1  . MET A 1 111 ? -14.554 -17.738 -9.786  1.00 0.00 ? 163 MET A HE1  4  
ATOM 11306 H HE2  . MET A 1 111 ? -14.277 -17.556 -8.038  1.00 0.00 ? 163 MET A HE2  4  
ATOM 11307 H HE3  . MET A 1 111 ? -15.496 -16.551 -8.854  1.00 0.00 ? 163 MET A HE3  4  
ATOM 11308 N N    . ASP A 1 112 ? -11.763 -15.142 -14.144 1.00 0.00 ? 164 ASP A N    4  
ATOM 11309 C CA   . ASP A 1 112 ? -11.721 -16.093 -15.247 1.00 0.00 ? 164 ASP A CA   4  
ATOM 11310 C C    . ASP A 1 112 ? -11.296 -15.403 -16.544 1.00 0.00 ? 164 ASP A C    4  
ATOM 11311 O O    . ASP A 1 112 ? -11.278 -14.176 -16.628 1.00 0.00 ? 164 ASP A O    4  
ATOM 11312 C CB   . ASP A 1 112 ? -13.091 -16.754 -15.425 1.00 0.00 ? 164 ASP A CB   4  
ATOM 11313 C CG   . ASP A 1 112 ? -14.156 -15.765 -15.891 1.00 0.00 ? 164 ASP A CG   4  
ATOM 11314 O OD1  . ASP A 1 112 ? -14.251 -15.568 -17.122 1.00 0.00 ? 164 ASP A OD1  4  
ATOM 11315 O OD2  . ASP A 1 112 ? -14.861 -15.219 -15.014 1.00 0.00 ? 164 ASP A OD2  4  
ATOM 11316 H H    . ASP A 1 112 ? -11.823 -14.160 -14.373 1.00 0.00 ? 164 ASP A H    4  
ATOM 11317 H HA   . ASP A 1 112 ? -10.991 -16.868 -15.014 1.00 0.00 ? 164 ASP A HA   4  
ATOM 11318 H HB2  . ASP A 1 112 ? -13.003 -17.548 -16.167 1.00 0.00 ? 164 ASP A HB2  4  
ATOM 11319 H HB3  . ASP A 1 112 ? -13.404 -17.204 -14.483 1.00 0.00 ? 164 ASP A HB3  4  
ATOM 11320 N N    . GLY A 1 113 ? -10.952 -16.206 -17.556 1.00 0.00 ? 165 GLY A N    4  
ATOM 11321 C CA   . GLY A 1 113 ? -10.557 -15.728 -18.874 1.00 0.00 ? 165 GLY A CA   4  
ATOM 11322 C C    . GLY A 1 113 ? -11.567 -16.145 -19.943 1.00 0.00 ? 165 GLY A C    4  
ATOM 11323 O O    . GLY A 1 113 ? -11.255 -16.115 -21.133 1.00 0.00 ? 165 GLY A O    4  
ATOM 11324 H H    . GLY A 1 113 ? -10.964 -17.206 -17.412 1.00 0.00 ? 165 GLY A H    4  
ATOM 11325 H HA2  . GLY A 1 113 ? -10.489 -14.640 -18.862 1.00 0.00 ? 165 GLY A HA2  4  
ATOM 11326 H HA3  . GLY A 1 113 ? -9.582  -16.144 -19.126 1.00 0.00 ? 165 GLY A HA3  4  
ATOM 11327 N N    . SER A 1 114 ? -12.776 -16.534 -19.525 1.00 0.00 ? 166 SER A N    4  
ATOM 11328 C CA   . SER A 1 114 ? -13.795 -17.079 -20.411 1.00 0.00 ? 166 SER A CA   4  
ATOM 11329 C C    . SER A 1 114 ? -14.580 -15.995 -21.141 1.00 0.00 ? 166 SER A C    4  
ATOM 11330 O O    . SER A 1 114 ? -15.424 -16.312 -21.978 1.00 0.00 ? 166 SER A O    4  
ATOM 11331 C CB   . SER A 1 114 ? -14.764 -17.925 -19.585 1.00 0.00 ? 166 SER A CB   4  
ATOM 11332 O OG   . SER A 1 114 ? -14.110 -19.086 -19.113 1.00 0.00 ? 166 SER A OG   4  
ATOM 11333 H H    . SER A 1 114 ? -13.007 -16.454 -18.546 1.00 0.00 ? 166 SER A H    4  
ATOM 11334 H HA   . SER A 1 114 ? -13.318 -17.717 -21.155 1.00 0.00 ? 166 SER A HA   4  
ATOM 11335 H HB2  . SER A 1 114 ? -15.129 -17.341 -18.741 1.00 0.00 ? 166 SER A HB2  4  
ATOM 11336 H HB3  . SER A 1 114 ? -15.615 -18.202 -20.207 1.00 0.00 ? 166 SER A HB3  4  
ATOM 11337 H HG   . SER A 1 114 ? -14.737 -19.600 -18.599 1.00 0.00 ? 166 SER A HG   4  
ATOM 11338 N N    . GLN A 1 115 ? -14.318 -14.723 -20.837 1.00 0.00 ? 167 GLN A N    4  
ATOM 11339 C CA   . GLN A 1 115 ? -15.087 -13.625 -21.396 1.00 0.00 ? 167 GLN A CA   4  
ATOM 11340 C C    . GLN A 1 115 ? -14.202 -12.380 -21.533 1.00 0.00 ? 167 GLN A C    4  
ATOM 11341 O O    . GLN A 1 115 ? -13.478 -12.040 -20.596 1.00 0.00 ? 167 GLN A O    4  
ATOM 11342 C CB   . GLN A 1 115 ? -16.281 -13.401 -20.465 1.00 0.00 ? 167 GLN A CB   4  
ATOM 11343 C CG   . GLN A 1 115 ? -17.110 -12.176 -20.844 1.00 0.00 ? 167 GLN A CG   4  
ATOM 11344 C CD   . GLN A 1 115 ? -18.318 -12.037 -19.926 1.00 0.00 ? 167 GLN A CD   4  
ATOM 11345 O OE1  . GLN A 1 115 ? -18.353 -11.173 -19.054 1.00 0.00 ? 167 GLN A OE1  4  
ATOM 11346 N NE2  . GLN A 1 115 ? -19.324 -12.887 -20.116 1.00 0.00 ? 167 GLN A NE2  4  
ATOM 11347 H H    . GLN A 1 115 ? -13.568 -14.503 -20.197 1.00 0.00 ? 167 GLN A H    4  
ATOM 11348 H HA   . GLN A 1 115 ? -15.457 -13.914 -22.380 1.00 0.00 ? 167 GLN A HA   4  
ATOM 11349 H HB2  . GLN A 1 115 ? -16.921 -14.282 -20.507 1.00 0.00 ? 167 GLN A HB2  4  
ATOM 11350 H HB3  . GLN A 1 115 ? -15.920 -13.297 -19.442 1.00 0.00 ? 167 GLN A HB3  4  
ATOM 11351 H HG2  . GLN A 1 115 ? -16.492 -11.282 -20.765 1.00 0.00 ? 167 GLN A HG2  4  
ATOM 11352 H HG3  . GLN A 1 115 ? -17.457 -12.286 -21.872 1.00 0.00 ? 167 GLN A HG3  4  
ATOM 11353 H HE21 . GLN A 1 115 ? -19.267 -13.580 -20.850 1.00 0.00 ? 167 GLN A HE21 4  
ATOM 11354 H HE22 . GLN A 1 115 ? -20.141 -12.840 -19.524 1.00 0.00 ? 167 GLN A HE22 4  
ATOM 11355 N N    . PRO A 1 116 ? -14.250 -11.697 -22.686 1.00 0.00 ? 168 PRO A N    4  
ATOM 11356 C CA   . PRO A 1 116 ? -13.449 -10.519 -22.977 1.00 0.00 ? 168 PRO A CA   4  
ATOM 11357 C C    . PRO A 1 116 ? -13.900 -9.288  -22.207 1.00 0.00 ? 168 PRO A C    4  
ATOM 11358 O O    . PRO A 1 116 ? -14.914 -9.295  -21.510 1.00 0.00 ? 168 PRO A O    4  
ATOM 11359 C CB   . PRO A 1 116 ? -13.571 -10.312 -24.484 1.00 0.00 ? 168 PRO A CB   4  
ATOM 11360 C CG   . PRO A 1 116 ? -14.966 -10.852 -24.785 1.00 0.00 ? 168 PRO A CG   4  
ATOM 11361 C CD   . PRO A 1 116 ? -15.091 -12.031 -23.823 1.00 0.00 ? 168 PRO A CD   4  
ATOM 11362 H HA   . PRO A 1 116 ? -12.403 -10.692 -22.724 1.00 0.00 ? 168 PRO A HA   4  
ATOM 11363 H HB2  . PRO A 1 116 ? -13.470 -9.265  -24.769 1.00 0.00 ? 168 PRO A HB2  4  
ATOM 11364 H HB3  . PRO A 1 116 ? -12.815 -10.921 -24.980 1.00 0.00 ? 168 PRO A HB3  4  
ATOM 11365 H HG2  . PRO A 1 116 ? -15.710 -10.097 -24.532 1.00 0.00 ? 168 PRO A HG2  4  
ATOM 11366 H HG3  . PRO A 1 116 ? -15.067 -11.165 -25.825 1.00 0.00 ? 168 PRO A HG3  4  
ATOM 11367 H HD2  . PRO A 1 116 ? -16.130 -12.167 -23.525 1.00 0.00 ? 168 PRO A HD2  4  
ATOM 11368 H HD3  . PRO A 1 116 ? -14.708 -12.934 -24.299 1.00 0.00 ? 168 PRO A HD3  4  
ATOM 11369 N N    . LEU A 1 117 ? -13.108 -8.224  -22.354 1.00 0.00 ? 169 LEU A N    4  
ATOM 11370 C CA   . LEU A 1 117 ? -13.244 -7.006  -21.581 1.00 0.00 ? 169 LEU A CA   4  
ATOM 11371 C C    . LEU A 1 117 ? -13.272 -5.794  -22.503 1.00 0.00 ? 169 LEU A C    4  
ATOM 11372 O O    . LEU A 1 117 ? -12.622 -5.779  -23.548 1.00 0.00 ? 169 LEU A O    4  
ATOM 11373 C CB   . LEU A 1 117 ? -12.064 -6.925  -20.610 1.00 0.00 ? 169 LEU A CB   4  
ATOM 11374 C CG   . LEU A 1 117 ? -12.008 -8.151  -19.693 1.00 0.00 ? 169 LEU A CG   4  
ATOM 11375 C CD1  . LEU A 1 117 ? -10.640 -8.209  -19.026 1.00 0.00 ? 169 LEU A CD1  4  
ATOM 11376 C CD2  . LEU A 1 117 ? -13.110 -8.083  -18.638 1.00 0.00 ? 169 LEU A CD2  4  
ATOM 11377 H H    . LEU A 1 117 ? -12.363 -8.260  -23.035 1.00 0.00 ? 169 LEU A H    4  
ATOM 11378 H HA   . LEU A 1 117 ? -14.174 -7.036  -21.012 1.00 0.00 ? 169 LEU A HA   4  
ATOM 11379 H HB2  . LEU A 1 117 ? -11.144 -6.876  -21.192 1.00 0.00 ? 169 LEU A HB2  4  
ATOM 11380 H HB3  . LEU A 1 117 ? -12.145 -6.021  -20.008 1.00 0.00 ? 169 LEU A HB3  4  
ATOM 11381 H HG   . LEU A 1 117 ? -12.132 -9.062  -20.279 1.00 0.00 ? 169 LEU A HG   4  
ATOM 11382 H HD11 . LEU A 1 117 ? -9.877  -8.317  -19.797 1.00 0.00 ? 169 LEU A HD11 4  
ATOM 11383 H HD12 . LEU A 1 117 ? -10.465 -7.293  -18.462 1.00 0.00 ? 169 LEU A HD12 4  
ATOM 11384 H HD13 . LEU A 1 117 ? -10.599 -9.070  -18.360 1.00 0.00 ? 169 LEU A HD13 4  
ATOM 11385 H HD21 . LEU A 1 117 ? -14.086 -8.067  -19.122 1.00 0.00 ? 169 LEU A HD21 4  
ATOM 11386 H HD22 . LEU A 1 117 ? -13.050 -8.962  -17.996 1.00 0.00 ? 169 LEU A HD22 4  
ATOM 11387 H HD23 . LEU A 1 117 ? -12.985 -7.182  -18.037 1.00 0.00 ? 169 LEU A HD23 4  
ATOM 11388 N N    . ASP A 1 118 ? -14.036 -4.780  -22.100 1.00 0.00 ? 170 ASP A N    4  
ATOM 11389 C CA   . ASP A 1 118 ? -14.181 -3.540  -22.848 1.00 0.00 ? 170 ASP A CA   4  
ATOM 11390 C C    . ASP A 1 118 ? -14.534 -2.399  -21.886 1.00 0.00 ? 170 ASP A C    4  
ATOM 11391 O O    . ASP A 1 118 ? -15.219 -2.640  -20.893 1.00 0.00 ? 170 ASP A O    4  
ATOM 11392 C CB   . ASP A 1 118 ? -15.279 -3.734  -23.898 1.00 0.00 ? 170 ASP A CB   4  
ATOM 11393 C CG   . ASP A 1 118 ? -15.407 -2.529  -24.822 1.00 0.00 ? 170 ASP A CG   4  
ATOM 11394 O OD1  . ASP A 1 118 ? -16.184 -1.617  -24.468 1.00 0.00 ? 170 ASP A OD1  4  
ATOM 11395 O OD2  . ASP A 1 118 ? -14.727 -2.531  -25.872 1.00 0.00 ? 170 ASP A OD2  4  
ATOM 11396 H H    . ASP A 1 118 ? -14.541 -4.877  -21.231 1.00 0.00 ? 170 ASP A H    4  
ATOM 11397 H HA   . ASP A 1 118 ? -13.241 -3.319  -23.353 1.00 0.00 ? 170 ASP A HA   4  
ATOM 11398 H HB2  . ASP A 1 118 ? -15.042 -4.613  -24.499 1.00 0.00 ? 170 ASP A HB2  4  
ATOM 11399 H HB3  . ASP A 1 118 ? -16.230 -3.907  -23.395 1.00 0.00 ? 170 ASP A HB3  4  
ATOM 11400 N N    . PRO A 1 119 ? -14.091 -1.159  -22.149 1.00 0.00 ? 171 PRO A N    4  
ATOM 11401 C CA   . PRO A 1 119 ? -14.396 -0.004  -21.313 1.00 0.00 ? 171 PRO A CA   4  
ATOM 11402 C C    . PRO A 1 119 ? -15.894 0.238   -21.118 1.00 0.00 ? 171 PRO A C    4  
ATOM 11403 O O    . PRO A 1 119 ? -16.287 0.870   -20.139 1.00 0.00 ? 171 PRO A O    4  
ATOM 11404 C CB   . PRO A 1 119 ? -13.750 1.188   -22.023 1.00 0.00 ? 171 PRO A CB   4  
ATOM 11405 C CG   . PRO A 1 119 ? -12.622 0.555   -22.832 1.00 0.00 ? 171 PRO A CG   4  
ATOM 11406 C CD   . PRO A 1 119 ? -13.243 -0.770  -23.261 1.00 0.00 ? 171 PRO A CD   4  
ATOM 11407 H HA   . PRO A 1 119 ? -13.922 -0.145  -20.341 1.00 0.00 ? 171 PRO A HA   4  
ATOM 11408 H HB2  . PRO A 1 119 ? -14.471 1.641   -22.705 1.00 0.00 ? 171 PRO A HB2  4  
ATOM 11409 H HB3  . PRO A 1 119 ? -13.373 1.925   -21.313 1.00 0.00 ? 171 PRO A HB3  4  
ATOM 11410 H HG2  . PRO A 1 119 ? -12.340 1.168   -23.687 1.00 0.00 ? 171 PRO A HG2  4  
ATOM 11411 H HG3  . PRO A 1 119 ? -11.768 0.365   -22.181 1.00 0.00 ? 171 PRO A HG3  4  
ATOM 11412 H HD2  . PRO A 1 119 ? -13.850 -0.614  -24.151 1.00 0.00 ? 171 PRO A HD2  4  
ATOM 11413 H HD3  . PRO A 1 119 ? -12.461 -1.506  -23.450 1.00 0.00 ? 171 PRO A HD3  4  
ATOM 11414 N N    . ARG A 1 120 ? -16.738 -0.251  -22.035 1.00 0.00 ? 172 ARG A N    4  
ATOM 11415 C CA   . ARG A 1 120 ? -18.188 -0.100  -21.935 1.00 0.00 ? 172 ARG A CA   4  
ATOM 11416 C C    . ARG A 1 120 ? -18.807 -1.240  -21.127 1.00 0.00 ? 172 ARG A C    4  
ATOM 11417 O O    . ARG A 1 120 ? -20.022 -1.286  -20.952 1.00 0.00 ? 172 ARG A O    4  
ATOM 11418 C CB   . ARG A 1 120 ? -18.803 -0.007  -23.334 1.00 0.00 ? 172 ARG A CB   4  
ATOM 11419 C CG   . ARG A 1 120 ? -18.207 1.140   -24.160 1.00 0.00 ? 172 ARG A CG   4  
ATOM 11420 C CD   . ARG A 1 120 ? -18.400 2.487   -23.461 1.00 0.00 ? 172 ARG A CD   4  
ATOM 11421 N NE   . ARG A 1 120 ? -17.884 3.584   -24.285 1.00 0.00 ? 172 ARG A NE   4  
ATOM 11422 C CZ   . ARG A 1 120 ? -17.799 4.852   -23.875 1.00 0.00 ? 172 ARG A CZ   4  
ATOM 11423 N NH1  . ARG A 1 120 ? -18.194 5.202   -22.651 1.00 0.00 ? 172 ARG A NH1  4  
ATOM 11424 N NH2  . ARG A 1 120 ? -17.313 5.784   -24.692 1.00 0.00 ? 172 ARG A NH2  4  
ATOM 11425 H H    . ARG A 1 120 ? -16.372 -0.748  -22.834 1.00 0.00 ? 172 ARG A H    4  
ATOM 11426 H HA   . ARG A 1 120 ? -18.404 0.824   -21.400 1.00 0.00 ? 172 ARG A HA   4  
ATOM 11427 H HB2  . ARG A 1 120 ? -18.637 -0.947  -23.862 1.00 0.00 ? 172 ARG A HB2  4  
ATOM 11428 H HB3  . ARG A 1 120 ? -19.877 0.150   -23.239 1.00 0.00 ? 172 ARG A HB3  4  
ATOM 11429 H HG2  . ARG A 1 120 ? -17.142 0.965   -24.314 1.00 0.00 ? 172 ARG A HG2  4  
ATOM 11430 H HG3  . ARG A 1 120 ? -18.701 1.169   -25.131 1.00 0.00 ? 172 ARG A HG3  4  
ATOM 11431 H HD2  . ARG A 1 120 ? -19.463 2.644   -23.276 1.00 0.00 ? 172 ARG A HD2  4  
ATOM 11432 H HD3  . ARG A 1 120 ? -17.869 2.476   -22.509 1.00 0.00 ? 172 ARG A HD3  4  
ATOM 11433 H HE   . ARG A 1 120 ? -17.575 3.358   -25.219 1.00 0.00 ? 172 ARG A HE   4  
ATOM 11434 H HH11 . ARG A 1 120 ? -18.564 4.503   -22.022 1.00 0.00 ? 172 ARG A HH11 4  
ATOM 11435 H HH12 . ARG A 1 120 ? -18.124 6.165   -22.351 1.00 0.00 ? 172 ARG A HH12 4  
ATOM 11436 H HH21 . ARG A 1 120 ? -17.010 5.530   -25.622 1.00 0.00 ? 172 ARG A HH21 4  
ATOM 11437 H HH22 . ARG A 1 120 ? -17.250 6.743   -24.385 1.00 0.00 ? 172 ARG A HH22 4  
ATOM 11438 N N    . LYS A 1 121 ? -17.966 -2.158  -20.639 1.00 0.00 ? 173 LYS A N    4  
ATOM 11439 C CA   . LYS A 1 121 ? -18.363 -3.297  -19.822 1.00 0.00 ? 173 LYS A CA   4  
ATOM 11440 C C    . LYS A 1 121 ? -17.647 -3.247  -18.472 1.00 0.00 ? 173 LYS A C    4  
ATOM 11441 O O    . LYS A 1 121 ? -17.575 -4.249  -17.763 1.00 0.00 ? 173 LYS A O    4  
ATOM 11442 C CB   . LYS A 1 121 ? -18.072 -4.601  -20.575 1.00 0.00 ? 173 LYS A CB   4  
ATOM 11443 C CG   . LYS A 1 121 ? -18.741 -4.633  -21.954 1.00 0.00 ? 173 LYS A CG   4  
ATOM 11444 C CD   . LYS A 1 121 ? -20.266 -4.610  -21.849 1.00 0.00 ? 173 LYS A CD   4  
ATOM 11445 C CE   . LYS A 1 121 ? -20.870 -4.504  -23.248 1.00 0.00 ? 173 LYS A CE   4  
ATOM 11446 N NZ   . LYS A 1 121 ? -22.343 -4.506  -23.189 1.00 0.00 ? 173 LYS A NZ   4  
ATOM 11447 H H    . LYS A 1 121 ? -16.981 -2.065  -20.843 1.00 0.00 ? 173 LYS A H    4  
ATOM 11448 H HA   . LYS A 1 121 ? -19.433 -3.227  -19.626 1.00 0.00 ? 173 LYS A HA   4  
ATOM 11449 H HB2  . LYS A 1 121 ? -16.995 -4.696  -20.709 1.00 0.00 ? 173 LYS A HB2  4  
ATOM 11450 H HB3  . LYS A 1 121 ? -18.427 -5.446  -19.985 1.00 0.00 ? 173 LYS A HB3  4  
ATOM 11451 H HG2  . LYS A 1 121 ? -18.410 -3.774  -22.536 1.00 0.00 ? 173 LYS A HG2  4  
ATOM 11452 H HG3  . LYS A 1 121 ? -18.437 -5.542  -22.474 1.00 0.00 ? 173 LYS A HG3  4  
ATOM 11453 H HD2  . LYS A 1 121 ? -20.610 -5.526  -21.369 1.00 0.00 ? 173 LYS A HD2  4  
ATOM 11454 H HD3  . LYS A 1 121 ? -20.587 -3.751  -21.261 1.00 0.00 ? 173 LYS A HD3  4  
ATOM 11455 H HE2  . LYS A 1 121 ? -20.527 -3.577  -23.709 1.00 0.00 ? 173 LYS A HE2  4  
ATOM 11456 H HE3  . LYS A 1 121 ? -20.528 -5.346  -23.851 1.00 0.00 ? 173 LYS A HE3  4  
ATOM 11457 H HZ1  . LYS A 1 121 ? -22.668 -3.724  -22.640 1.00 0.00 ? 173 LYS A HZ1  4  
ATOM 11458 H HZ2  . LYS A 1 121 ? -22.724 -4.435  -24.122 1.00 0.00 ? 173 LYS A HZ2  4  
ATOM 11459 H HZ3  . LYS A 1 121 ? -22.669 -5.365  -22.768 1.00 0.00 ? 173 LYS A HZ3  4  
ATOM 11460 N N    . THR A 1 122 ? -17.117 -2.069  -18.127 1.00 0.00 ? 174 THR A N    4  
ATOM 11461 C CA   . THR A 1 122 ? -16.390 -1.868  -16.881 1.00 0.00 ? 174 THR A CA   4  
ATOM 11462 C C    . THR A 1 122 ? -17.249 -1.065  -15.910 1.00 0.00 ? 174 THR A C    4  
ATOM 11463 O O    . THR A 1 122 ? -18.127 -0.309  -16.324 1.00 0.00 ? 174 THR A O    4  
ATOM 11464 C CB   . THR A 1 122 ? -15.054 -1.175  -17.169 1.00 0.00 ? 174 THR A CB   4  
ATOM 11465 O OG1  . THR A 1 122 ? -14.323 -1.939  -18.104 1.00 0.00 ? 174 THR A OG1  4  
ATOM 11466 C CG2  . THR A 1 122 ? -14.197 -1.037  -15.911 1.00 0.00 ? 174 THR A CG2  4  
ATOM 11467 H H    . THR A 1 122 ? -17.221 -1.277  -18.745 1.00 0.00 ? 174 THR A H    4  
ATOM 11468 H HA   . THR A 1 122 ? -16.179 -2.838  -16.430 1.00 0.00 ? 174 THR A HA   4  
ATOM 11469 H HB   . THR A 1 122 ? -15.241 -0.183  -17.581 1.00 0.00 ? 174 THR A HB   4  
ATOM 11470 H HG1  . THR A 1 122 ? -14.848 -2.028  -18.904 1.00 0.00 ? 174 THR A HG1  4  
ATOM 11471 H HG21 . THR A 1 122 ? -14.671 -0.349  -15.212 1.00 0.00 ? 174 THR A HG21 4  
ATOM 11472 H HG22 . THR A 1 122 ? -14.076 -2.012  -15.439 1.00 0.00 ? 174 THR A HG22 4  
ATOM 11473 H HG23 . THR A 1 122 ? -13.218 -0.642  -16.183 1.00 0.00 ? 174 THR A HG23 4  
ATOM 11474 N N    . ILE A 1 123 ? -16.989 -1.233  -14.610 1.00 0.00 ? 175 ILE A N    4  
ATOM 11475 C CA   . ILE A 1 123 ? -17.734 -0.551  -13.563 1.00 0.00 ? 175 ILE A CA   4  
ATOM 11476 C C    . ILE A 1 123 ? -16.735 0.071   -12.584 1.00 0.00 ? 175 ILE A C    4  
ATOM 11477 O O    . ILE A 1 123 ? -15.589 -0.367  -12.491 1.00 0.00 ? 175 ILE A O    4  
ATOM 11478 C CB   . ILE A 1 123 ? -18.682 -1.544  -12.866 1.00 0.00 ? 175 ILE A CB   4  
ATOM 11479 C CG1  . ILE A 1 123 ? -19.444 -2.389  -13.900 1.00 0.00 ? 175 ILE A CG1  4  
ATOM 11480 C CG2  . ILE A 1 123 ? -19.681 -0.810  -11.969 1.00 0.00 ? 175 ILE A CG2  4  
ATOM 11481 C CD1  . ILE A 1 123 ? -20.361 -3.419  -13.235 1.00 0.00 ? 175 ILE A CD1  4  
ATOM 11482 H H    . ILE A 1 123 ? -16.249 -1.858  -14.325 1.00 0.00 ? 175 ILE A H    4  
ATOM 11483 H HA   . ILE A 1 123 ? -18.328 0.246   -14.009 1.00 0.00 ? 175 ILE A HA   4  
ATOM 11484 H HB   . ILE A 1 123 ? -18.090 -2.215  -12.244 1.00 0.00 ? 175 ILE A HB   4  
ATOM 11485 H HG12 . ILE A 1 123 ? -20.039 -1.737  -14.538 1.00 0.00 ? 175 ILE A HG12 4  
ATOM 11486 H HG13 . ILE A 1 123 ? -18.729 -2.932  -14.519 1.00 0.00 ? 175 ILE A HG13 4  
ATOM 11487 H HG21 . ILE A 1 123 ? -20.312 -0.161  -12.577 1.00 0.00 ? 175 ILE A HG21 4  
ATOM 11488 H HG22 . ILE A 1 123 ? -20.307 -1.529  -11.441 1.00 0.00 ? 175 ILE A HG22 4  
ATOM 11489 H HG23 . ILE A 1 123 ? -19.149 -0.215  -11.226 1.00 0.00 ? 175 ILE A HG23 4  
ATOM 11490 H HD11 . ILE A 1 123 ? -21.192 -2.918  -12.738 1.00 0.00 ? 175 ILE A HD11 4  
ATOM 11491 H HD12 . ILE A 1 123 ? -20.757 -4.091  -13.997 1.00 0.00 ? 175 ILE A HD12 4  
ATOM 11492 H HD13 . ILE A 1 123 ? -19.794 -3.999  -12.507 1.00 0.00 ? 175 ILE A HD13 4  
ATOM 11493 N N    . PHE A 1 124 ? -17.174 1.095   -11.853 1.00 0.00 ? 176 PHE A N    4  
ATOM 11494 C CA   . PHE A 1 124 ? -16.339 1.804   -10.898 1.00 0.00 ? 176 PHE A CA   4  
ATOM 11495 C C    . PHE A 1 124 ? -16.841 1.521   -9.486  1.00 0.00 ? 176 PHE A C    4  
ATOM 11496 O O    . PHE A 1 124 ? -18.030 1.271   -9.292  1.00 0.00 ? 176 PHE A O    4  
ATOM 11497 C CB   . PHE A 1 124 ? -16.384 3.302   -11.215 1.00 0.00 ? 176 PHE A CB   4  
ATOM 11498 C CG   . PHE A 1 124 ? -16.151 4.199   -10.018 1.00 0.00 ? 176 PHE A CG   4  
ATOM 11499 C CD1  . PHE A 1 124 ? -14.849 4.495   -9.592  1.00 0.00 ? 176 PHE A CD1  4  
ATOM 11500 C CD2  . PHE A 1 124 ? -17.250 4.734   -9.331  1.00 0.00 ? 176 PHE A CD2  4  
ATOM 11501 C CE1  . PHE A 1 124 ? -14.650 5.326   -8.479  1.00 0.00 ? 176 PHE A CE1  4  
ATOM 11502 C CE2  . PHE A 1 124 ? -17.052 5.568   -8.222  1.00 0.00 ? 176 PHE A CE2  4  
ATOM 11503 C CZ   . PHE A 1 124 ? -15.750 5.863   -7.796  1.00 0.00 ? 176 PHE A CZ   4  
ATOM 11504 H H    . PHE A 1 124 ? -18.131 1.402   -11.951 1.00 0.00 ? 176 PHE A H    4  
ATOM 11505 H HA   . PHE A 1 124 ? -15.307 1.460   -10.970 1.00 0.00 ? 176 PHE A HA   4  
ATOM 11506 H HB2  . PHE A 1 124 ? -15.644 3.526   -11.984 1.00 0.00 ? 176 PHE A HB2  4  
ATOM 11507 H HB3  . PHE A 1 124 ? -17.369 3.541   -11.618 1.00 0.00 ? 176 PHE A HB3  4  
ATOM 11508 H HD1  . PHE A 1 124 ? -14.000 4.083   -10.118 1.00 0.00 ? 176 PHE A HD1  4  
ATOM 11509 H HD2  . PHE A 1 124 ? -18.254 4.504   -9.655  1.00 0.00 ? 176 PHE A HD2  4  
ATOM 11510 H HE1  . PHE A 1 124 ? -13.648 5.554   -8.146  1.00 0.00 ? 176 PHE A HE1  4  
ATOM 11511 H HE2  . PHE A 1 124 ? -17.902 5.981   -7.700  1.00 0.00 ? 176 PHE A HE2  4  
ATOM 11512 H HZ   . PHE A 1 124 ? -15.592 6.503   -6.942  1.00 0.00 ? 176 PHE A HZ   4  
ATOM 11513 N N    . VAL A 1 125 ? -15.936 1.560   -8.504  1.00 0.00 ? 177 VAL A N    4  
ATOM 11514 C CA   . VAL A 1 125 ? -16.286 1.336   -7.110  1.00 0.00 ? 177 VAL A CA   4  
ATOM 11515 C C    . VAL A 1 125 ? -15.670 2.433   -6.250  1.00 0.00 ? 177 VAL A C    4  
ATOM 11516 O O    . VAL A 1 125 ? -14.451 2.598   -6.228  1.00 0.00 ? 177 VAL A O    4  
ATOM 11517 C CB   . VAL A 1 125 ? -15.812 -0.049  -6.653  1.00 0.00 ? 177 VAL A CB   4  
ATOM 11518 C CG1  . VAL A 1 125 ? -16.349 -0.337  -5.253  1.00 0.00 ? 177 VAL A CG1  4  
ATOM 11519 C CG2  . VAL A 1 125 ? -16.315 -1.144  -7.594  1.00 0.00 ? 177 VAL A CG2  4  
ATOM 11520 H H    . VAL A 1 125 ? -14.969 1.754