data_2MPF
# 
_entry.id   2MPF 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2MPF         
RCSB  RCSB103892   
BMRB  19977        
WWPDB D_1000103892 
# 
_pdbx_database_related.db_id          19977 
_pdbx_database_related.db_name        BMRB 
_pdbx_database_related.content_type   unspecified 
_pdbx_database_related.details        . 
# 
_pdbx_database_status.deposit_site                    BMRB 
_pdbx_database_status.entry_id                        2MPF 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2014-05-16 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  REL 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Saponaro, A.'     1 
'Pauleta, S.R.'    2 
'Cantini, F.'      3 
'Matzapetakis, M.' 4 
'Hammann, C.'      5 
'Banci, L.'        6 
'Thiel, G.'        7 
'Santoro, B.'      8 
'Moroni, A.'       9 
# 
_citation.id                        primary 
_citation.title                     
'Structural basis for the mutual antagonism of cAMP and TRIP8b in regulating HCN channel function.' 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.USA 
_citation.journal_volume            111 
_citation.page_first                14577 
_citation.page_last                 14582 
_citation.year                      2014 
_citation.journal_id_ASTM           PNASA6 
_citation.country                   US 
_citation.journal_id_ISSN           0027-8424 
_citation.journal_id_CSD            0040 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   25197093 
_citation.pdbx_database_id_DOI      10.1073/pnas.1410389111 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Saponaro, A.'     1  
primary 'Pauleta, S.R.'    2  
primary 'Cantini, F.'      3  
primary 'Matzapetakis, M.' 4  
primary 'Hammann, C.'      5  
primary 'Donadoni, C.'     6  
primary 'Hu, L.'           7  
primary 'Thiel, G.'        8  
primary 'Banci, L.'        9  
primary 'Santoro, B.'      10 
primary 'Moroni, A.'       11 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2' 
_entity.formula_weight             17987.891 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'cyclic nucleotide binding domain (UNP residues 521-672)' 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'HCN2, Brain cyclic nucleotide-gated channel 2, BCNG-2' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GPSSPMELNGPLREEIVNFNCRKLVASMPLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTK
GNKEMKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRIGKKNSILLH
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GPSSPMELNGPLREEIVNFNCRKLVASMPLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTK
GNKEMKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRIGKKNSILLH
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   PRO n 
1 3   SER n 
1 4   SER n 
1 5   PRO n 
1 6   MET n 
1 7   GLU n 
1 8   LEU n 
1 9   ASN n 
1 10  GLY n 
1 11  PRO n 
1 12  LEU n 
1 13  ARG n 
1 14  GLU n 
1 15  GLU n 
1 16  ILE n 
1 17  VAL n 
1 18  ASN n 
1 19  PHE n 
1 20  ASN n 
1 21  CYS n 
1 22  ARG n 
1 23  LYS n 
1 24  LEU n 
1 25  VAL n 
1 26  ALA n 
1 27  SER n 
1 28  MET n 
1 29  PRO n 
1 30  LEU n 
1 31  PHE n 
1 32  ALA n 
1 33  ASN n 
1 34  ALA n 
1 35  ASP n 
1 36  PRO n 
1 37  ASN n 
1 38  PHE n 
1 39  VAL n 
1 40  THR n 
1 41  ALA n 
1 42  MET n 
1 43  LEU n 
1 44  THR n 
1 45  LYS n 
1 46  LEU n 
1 47  LYS n 
1 48  PHE n 
1 49  GLU n 
1 50  VAL n 
1 51  PHE n 
1 52  GLN n 
1 53  PRO n 
1 54  GLY n 
1 55  ASP n 
1 56  TYR n 
1 57  ILE n 
1 58  ILE n 
1 59  ARG n 
1 60  GLU n 
1 61  GLY n 
1 62  THR n 
1 63  ILE n 
1 64  GLY n 
1 65  LYS n 
1 66  LYS n 
1 67  MET n 
1 68  TYR n 
1 69  PHE n 
1 70  ILE n 
1 71  GLN n 
1 72  HIS n 
1 73  GLY n 
1 74  VAL n 
1 75  VAL n 
1 76  SER n 
1 77  VAL n 
1 78  LEU n 
1 79  THR n 
1 80  LYS n 
1 81  GLY n 
1 82  ASN n 
1 83  LYS n 
1 84  GLU n 
1 85  MET n 
1 86  LYS n 
1 87  LEU n 
1 88  SER n 
1 89  ASP n 
1 90  GLY n 
1 91  SER n 
1 92  TYR n 
1 93  PHE n 
1 94  GLY n 
1 95  GLU n 
1 96  ILE n 
1 97  CYS n 
1 98  LEU n 
1 99  LEU n 
1 100 THR n 
1 101 ARG n 
1 102 GLY n 
1 103 ARG n 
1 104 ARG n 
1 105 THR n 
1 106 ALA n 
1 107 SER n 
1 108 VAL n 
1 109 ARG n 
1 110 ALA n 
1 111 ASP n 
1 112 THR n 
1 113 TYR n 
1 114 CYS n 
1 115 ARG n 
1 116 LEU n 
1 117 TYR n 
1 118 SER n 
1 119 LEU n 
1 120 SER n 
1 121 VAL n 
1 122 ASP n 
1 123 ASN n 
1 124 PHE n 
1 125 ASN n 
1 126 GLU n 
1 127 VAL n 
1 128 LEU n 
1 129 GLU n 
1 130 GLU n 
1 131 TYR n 
1 132 PRO n 
1 133 MET n 
1 134 MET n 
1 135 ARG n 
1 136 ARG n 
1 137 ALA n 
1 138 PHE n 
1 139 GLU n 
1 140 THR n 
1 141 VAL n 
1 142 ALA n 
1 143 ILE n 
1 144 ASP n 
1 145 ARG n 
1 146 LEU n 
1 147 ASP n 
1 148 ARG n 
1 149 ILE n 
1 150 GLY n 
1 151 LYS n 
1 152 LYS n 
1 153 ASN n 
1 154 SER n 
1 155 ILE n 
1 156 LEU n 
1 157 LEU n 
1 158 HIS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'HCN2, BCNG2' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     511693 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               Rosetta 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET24b 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    HCN2_HUMAN 
_struct_ref.pdbx_db_accession          Q9UL51 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;ELNGPLREEIVNFNCRKLVASMPLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKGNKEMK
LSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRIGKKNSILLH
;
_struct_ref.pdbx_align_begin           521 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2MPF 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 7 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 158 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q9UL51 
_struct_ref_seq.db_align_beg                  521 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  672 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       521 
_struct_ref_seq.pdbx_auth_seq_align_end       672 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2MPF GLY A 1 ? UNP Q9UL51 ? ? 'EXPRESSION TAG' 515 1 
1 2MPF PRO A 2 ? UNP Q9UL51 ? ? 'EXPRESSION TAG' 516 2 
1 2MPF SER A 3 ? UNP Q9UL51 ? ? 'EXPRESSION TAG' 517 3 
1 2MPF SER A 4 ? UNP Q9UL51 ? ? 'EXPRESSION TAG' 518 4 
1 2MPF PRO A 5 ? UNP Q9UL51 ? ? 'EXPRESSION TAG' 519 5 
1 2MPF MET A 6 ? UNP Q9UL51 ? ? 'EXPRESSION TAG' 520 6 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.type 
1 1  1 '2D 1H-15N HSQC'  
1 2  2 '2D 1H-13C HSQC'  
1 3  2 '3D CBCA(CO)NH'   
1 4  2 '3D HNCO'         
1 5  2 '3D HNCACB'       
1 6  1 '3D 1H-15N NOESY' 
1 7  2 '3D 1H-13C NOESY' 
1 8  2 '3D HCCH-TOCSY'   
1 9  3 '2D 1H-1H NOESY'  
1 10 3 '2D 1H-1H TOCSY'  
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      ? 
_pdbx_nmr_exptl_sample_conditions.pH                  7.0 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature         298 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
loop_
_pdbx_nmr_sample_details.contents 
_pdbx_nmr_sample_details.solution_id 
_pdbx_nmr_sample_details.solvent_system 
'1 mM [U-15N] HCN2 CNBD, 20 mM potassium phosphate, 150 mM potassium chloride, 90% H2O/10% D2O'        1 '90% H2O/10% D2O' 
'1 mM [U-13C; U-15N] HCN2 CNBD, 20 mM potassium phosphate, 150 mM potassium chloride, 90% H2O/10% D2O' 2 '90% H2O/10% D2O' 
'1 mM HCN2 CNBD, 20 mM potassium phosphate, 150 mM potassium chloride, 90% H2O/10% D2O'                3 '90% H2O/10% D2O' 
# 
loop_
_pdbx_nmr_spectrometer.field_strength 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.type 
600 Bruker Avance 1 'Bruker Avance' 
800 Bruker Avance 2 'Bruker Avance' 
900 Bruker Avance 3 'Bruker Avance' 
# 
_pdbx_nmr_refine.entry_id           2MPF 
_pdbx_nmr_refine.method             'torsion angle dynamics, molecular dynamics' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'target function' 
_pdbx_nmr_ensemble.conformers_calculated_total_number            500 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.entry_id                                      2MPF 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    14.91 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   0.38 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.entry_id             2MPF 
_pdbx_nmr_representative.selection_criteria   'closest to the average' 
# 
loop_
_pdbx_nmr_software.authors 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.ordinal 
'Bruker Biospin'                                                            collection                  TOPSPIN 2.1 1  
'Bruker Biospin'                                                            processing                  TOPSPIN 2.1 2  
'Keller and Wuthrich'                                                       'chemical shift assignment' CARA    1.8 3  
'Keller and Wuthrich'                                                       'data analysis'             CARA    1.8 4  
'Keller and Wuthrich'                                                       'peak picking'              CARA    1.8 5  
'Guntert, Mumenthaler and Wuthrich'                                         'structure solution'        CYANA   2.1 6  
'Case, Darden, Cheatham, III, Simmerling, Wang, Duke, Luo, ... and Kollman' refinement                  AMBER   12  7  
'Geerten Vuister, Jurgen F. Doreleijers and Alan Wilter Sousa da Silva'     'structure validation'      CING    ?   8  
'Bhattacharya and Montelione'                                               'structure validation'      PSVS    ?   9  
'Herrmann, Guntert and Wuthrich'                                            'structure solution'        CANDID  ?   10 
'Guntert, Mumenthaler and Wuthrich'                                         refinement                  CYANA   ?   11 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.entry_id                   2MPF 
_exptl.method                     'SOLUTION NMR' 
_exptl.method_details             ? 
# 
_struct.entry_id                  2MPF 
_struct.title                     'Solution structure human HCN2 CNBD in the cAMP-unbound state' 
_struct.pdbx_descriptor           'Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2' 
_struct.pdbx_model_details        'closest to the average, model1' 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2MPF 
_struct_keywords.pdbx_keywords   'TRANSPORT PROTEIN' 
_struct_keywords.text            'HCN channels, TRANSPORT PROTEIN' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 CYS A 21  ? ALA A 26  ? CYS A 535 ALA A 540 1 ? 6  
HELX_P HELX_P2 2 LEU A 30  ? ALA A 34  ? LEU A 544 ALA A 548 5 ? 5  
HELX_P HELX_P3 3 ASP A 35  ? MET A 42  ? ASP A 549 MET A 556 1 ? 8  
HELX_P HELX_P4 4 LEU A 43  ? LEU A 46  ? LEU A 557 LEU A 560 5 ? 4  
HELX_P HELX_P5 5 SER A 120 ? GLU A 129 ? SER A 634 GLU A 643 1 ? 10 
HELX_P HELX_P6 6 TYR A 131 ? ARG A 145 ? TYR A 645 ARG A 659 1 ? 15 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LYS A 47  ? PHE A 51  ? LYS A 561 PHE A 565 
A 2 CYS A 114 ? LEU A 119 ? CYS A 628 LEU A 633 
A 3 MET A 67  ? HIS A 72  ? MET A 581 HIS A 586 
A 4 TYR A 92  ? PHE A 93  ? TYR A 606 PHE A 607 
B 1 TYR A 56  ? ILE A 58  ? TYR A 570 ILE A 572 
B 2 SER A 107 ? ALA A 110 ? SER A 621 ALA A 624 
B 3 VAL A 74  ? LEU A 78  ? VAL A 588 LEU A 592 
B 4 GLU A 84  ? SER A 88  ? GLU A 598 SER A 602 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N LYS A 47  ? N LYS A 561 O SER A 118 ? O SER A 632 
A 2 3 O ARG A 115 ? O ARG A 629 N HIS A 72  ? N HIS A 586 
A 3 4 N TYR A 68  ? N TYR A 582 O PHE A 93  ? O PHE A 607 
B 1 2 N ILE A 57  ? N ILE A 571 O VAL A 108 ? O VAL A 622 
B 2 3 O ARG A 109 ? O ARG A 623 N SER A 76  ? N SER A 590 
B 3 4 N VAL A 77  ? N VAL A 591 O MET A 85  ? O MET A 599 
# 
_atom_sites.entry_id                    2MPF 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . ASN A 1 20  ? 6.488   16.139  1.353   1.00 5.13  ? 534 ASN A N    1  
ATOM 2     C CA   . ASN A 1 20  ? 6.088   14.834  0.809   1.00 4.94  ? 534 ASN A CA   1  
ATOM 3     C C    . ASN A 1 20  ? 6.099   13.684  1.840   1.00 3.70  ? 534 ASN A C    1  
ATOM 4     O O    . ASN A 1 20  ? 6.588   13.825  2.963   1.00 3.85  ? 534 ASN A O    1  
ATOM 5     C CB   . ASN A 1 20  ? 6.960   14.549  -0.440  1.00 6.35  ? 534 ASN A CB   1  
ATOM 6     C CG   . ASN A 1 20  ? 6.281   13.680  -1.494  1.00 7.44  ? 534 ASN A CG   1  
ATOM 7     O OD1  . ASN A 1 20  ? 5.171   13.195  -1.330  1.00 7.54  ? 534 ASN A OD1  1  
ATOM 8     N ND2  . ASN A 1 20  ? 6.914   13.465  -2.620  1.00 8.86  ? 534 ASN A ND2  1  
ATOM 9     H H    . ASN A 1 20  ? 7.434   16.435  1.176   1.00 5.72  ? 534 ASN A H    1  
ATOM 10    H HA   . ASN A 1 20  ? 5.053   14.930  0.472   1.00 5.37  ? 534 ASN A HA   1  
ATOM 11    H HB2  . ASN A 1 20  ? 7.212   15.488  -0.930  1.00 7.08  ? 534 ASN A HB2  1  
ATOM 12    H HB3  . ASN A 1 20  ? 7.896   14.076  -0.141  1.00 6.55  ? 534 ASN A HB3  1  
ATOM 13    H HD21 . ASN A 1 20  ? 7.849   13.837  -2.768  1.00 9.22  ? 534 ASN A HD21 1  
ATOM 14    H HD22 . ASN A 1 20  ? 6.459   12.893  -3.319  1.00 9.84  ? 534 ASN A HD22 1  
ATOM 15    N N    . CYS A 1 21  ? 5.579   12.522  1.437   1.00 3.04  ? 535 CYS A N    1  
ATOM 16    C CA   . CYS A 1 21  ? 5.286   11.336  2.257   1.00 2.25  ? 535 CYS A CA   1  
ATOM 17    C C    . CYS A 1 21  ? 6.515   10.509  2.722   1.00 1.76  ? 535 CYS A C    1  
ATOM 18    O O    . CYS A 1 21  ? 6.458   9.274   2.753   1.00 1.67  ? 535 CYS A O    1  
ATOM 19    C CB   . CYS A 1 21  ? 4.250   10.499  1.487   1.00 2.91  ? 535 CYS A CB   1  
ATOM 20    S SG   . CYS A 1 21  ? 2.699   11.439  1.372   1.00 3.82  ? 535 CYS A SG   1  
ATOM 21    H H    . CYS A 1 21  ? 5.187   12.515  0.501   1.00 3.63  ? 535 CYS A H    1  
ATOM 22    H HA   . CYS A 1 21  ? 4.803   11.683  3.171   1.00 2.40  ? 535 CYS A HA   1  
ATOM 23    H HB2  . CYS A 1 21  ? 4.627   10.270  0.489   1.00 3.59  ? 535 CYS A HB2  1  
ATOM 24    H HB3  . CYS A 1 21  ? 4.062   9.565   2.011   1.00 3.38  ? 535 CYS A HB3  1  
ATOM 25    H HG   . CYS A 1 21  ? 1.977   10.560  0.663   1.00 4.46  ? 535 CYS A HG   1  
ATOM 26    N N    . ARG A 1 22  ? 7.623   11.179  3.084   1.00 1.80  ? 536 ARG A N    1  
ATOM 27    C CA   . ARG A 1 22  ? 8.904   10.590  3.533   1.00 1.88  ? 536 ARG A CA   1  
ATOM 28    C C    . ARG A 1 22  ? 8.725   9.550   4.638   1.00 1.79  ? 536 ARG A C    1  
ATOM 29    O O    . ARG A 1 22  ? 9.181   8.417   4.485   1.00 1.80  ? 536 ARG A O    1  
ATOM 30    C CB   . ARG A 1 22  ? 9.852   11.696  4.042   1.00 2.48  ? 536 ARG A CB   1  
ATOM 31    C CG   . ARG A 1 22  ? 10.284  12.745  3.007   1.00 3.24  ? 536 ARG A CG   1  
ATOM 32    C CD   . ARG A 1 22  ? 11.243  13.731  3.691   1.00 3.58  ? 536 ARG A CD   1  
ATOM 33    N NE   . ARG A 1 22  ? 11.629  14.845  2.810   1.00 4.49  ? 536 ARG A NE   1  
ATOM 34    C CZ   . ARG A 1 22  ? 12.324  15.908  3.179   1.00 5.31  ? 536 ARG A CZ   1  
ATOM 35    N NH1  . ARG A 1 22  ? 12.777  16.075  4.387   1.00 5.54  ? 536 ARG A NH1  1  
ATOM 36    N NH2  . ARG A 1 22  ? 12.593  16.866  2.345   1.00 6.48  ? 536 ARG A NH2  1  
ATOM 37    H H    . ARG A 1 22  ? 7.548   12.191  3.078   1.00 2.06  ? 536 ARG A H    1  
ATOM 38    H HA   . ARG A 1 22  ? 9.382   10.051  2.715   1.00 1.99  ? 536 ARG A HA   1  
ATOM 39    H HB2  . ARG A 1 22  ? 9.372   12.214  4.873   1.00 3.96  ? 536 ARG A HB2  1  
ATOM 40    H HB3  . ARG A 1 22  ? 10.754  11.221  4.431   1.00 2.50  ? 536 ARG A HB3  1  
ATOM 41    H HG2  . ARG A 1 22  ? 10.791  12.256  2.173   1.00 3.47  ? 536 ARG A HG2  1  
ATOM 42    H HG3  . ARG A 1 22  ? 9.412   13.284  2.637   1.00 4.65  ? 536 ARG A HG3  1  
ATOM 43    H HD2  . ARG A 1 22  ? 10.755  14.136  4.581   1.00 4.61  ? 536 ARG A HD2  1  
ATOM 44    H HD3  . ARG A 1 22  ? 12.142  13.194  4.005   1.00 3.24  ? 536 ARG A HD3  1  
ATOM 45    H HE   . ARG A 1 22  ? 11.393  14.768  1.826   1.00 5.00  ? 536 ARG A HE   1  
ATOM 46    H HH11 . ARG A 1 22  ? 12.702  15.330  5.076   1.00 5.26  ? 536 ARG A HH11 1  
ATOM 47    H HH12 . ARG A 1 22  ? 13.383  16.869  4.558   1.00 6.30  ? 536 ARG A HH12 1  
ATOM 48    H HH21 . ARG A 1 22  ? 12.323  16.822  1.366   1.00 7.01  ? 536 ARG A HH21 1  
ATOM 49    H HH22 . ARG A 1 22  ? 13.110  17.668  2.682   1.00 7.11  ? 536 ARG A HH22 1  
ATOM 50    N N    . LYS A 1 23  ? 8.047   9.919   5.726   1.00 1.84  ? 537 LYS A N    1  
ATOM 51    C CA   . LYS A 1 23  ? 7.759   9.047   6.863   1.00 1.88  ? 537 LYS A CA   1  
ATOM 52    C C    . LYS A 1 23  ? 6.630   8.051   6.584   1.00 1.90  ? 537 LYS A C    1  
ATOM 53    O O    . LYS A 1 23  ? 6.607   6.988   7.194   1.00 1.97  ? 537 LYS A O    1  
ATOM 54    C CB   . LYS A 1 23  ? 7.484   9.958   8.061   1.00 2.03  ? 537 LYS A CB   1  
ATOM 55    C CG   . LYS A 1 23  ? 7.168   9.180   9.339   1.00 2.15  ? 537 LYS A CG   1  
ATOM 56    C CD   . LYS A 1 23  ? 7.123   10.166  10.501  1.00 2.92  ? 537 LYS A CD   1  
ATOM 57    C CE   . LYS A 1 23  ? 6.753   9.448   11.800  1.00 3.36  ? 537 LYS A CE   1  
ATOM 58    N NZ   . LYS A 1 23  ? 5.289   9.319   11.987  1.00 4.32  ? 537 LYS A NZ   1  
ATOM 59    H H    . LYS A 1 23  ? 7.711   10.871  5.792   1.00 1.95  ? 537 LYS A H    1  
ATOM 60    H HA   . LYS A 1 23  ? 8.648   8.465   7.107   1.00 1.89  ? 537 LYS A HA   1  
ATOM 61    H HB2  . LYS A 1 23  ? 8.373   10.570  8.231   1.00 2.20  ? 537 LYS A HB2  1  
ATOM 62    H HB3  . LYS A 1 23  ? 6.653   10.627  7.838   1.00 2.68  ? 537 LYS A HB3  1  
ATOM 63    H HG2  . LYS A 1 23  ? 6.205   8.684   9.242   1.00 2.93  ? 537 LYS A HG2  1  
ATOM 64    H HG3  . LYS A 1 23  ? 7.944   8.435   9.522   1.00 2.39  ? 537 LYS A HG3  1  
ATOM 65    H HD2  . LYS A 1 23  ? 8.119   10.601  10.598  1.00 3.37  ? 537 LYS A HD2  1  
ATOM 66    H HD3  . LYS A 1 23  ? 6.414   10.963  10.276  1.00 3.70  ? 537 LYS A HD3  1  
ATOM 67    H HE2  . LYS A 1 23  ? 7.222   8.460   11.800  1.00 3.27  ? 537 LYS A HE2  1  
ATOM 68    H HE3  . LYS A 1 23  ? 7.164   10.015  12.641  1.00 3.87  ? 537 LYS A HE3  1  
ATOM 69    H HZ1  . LYS A 1 23  ? 4.884   10.237  12.162  1.00 4.93  ? 537 LYS A HZ1  1  
ATOM 70    H HZ2  . LYS A 1 23  ? 5.102   8.757   12.811  1.00 4.73  ? 537 LYS A HZ2  1  
ATOM 71    H HZ3  . LYS A 1 23  ? 4.826   8.902   11.183  1.00 4.78  ? 537 LYS A HZ3  1  
ATOM 72    N N    . LEU A 1 24  ? 5.713   8.334   5.656   1.00 1.89  ? 538 LEU A N    1  
ATOM 73    C CA   . LEU A 1 24  ? 4.491   7.542   5.483   1.00 2.00  ? 538 LEU A CA   1  
ATOM 74    C C    . LEU A 1 24  ? 4.738   6.268   4.668   1.00 1.83  ? 538 LEU A C    1  
ATOM 75    O O    . LEU A 1 24  ? 4.253   5.202   5.041   1.00 1.99  ? 538 LEU A O    1  
ATOM 76    C CB   . LEU A 1 24  ? 3.377   8.410   4.869   1.00 2.15  ? 538 LEU A CB   1  
ATOM 77    C CG   . LEU A 1 24  ? 1.976   7.820   5.102   1.00 2.14  ? 538 LEU A CG   1  
ATOM 78    C CD1  . LEU A 1 24  ? 1.513   8.023   6.546   1.00 2.32  ? 538 LEU A CD1  1  
ATOM 79    C CD2  . LEU A 1 24  ? 0.963   8.475   4.166   1.00 3.78  ? 538 LEU A CD2  1  
ATOM 80    H H    . LEU A 1 24  ? 5.795   9.218   5.167   1.00 1.90  ? 538 LEU A H    1  
ATOM 81    H HA   . LEU A 1 24  ? 4.170   7.223   6.474   1.00 2.17  ? 538 LEU A HA   1  
ATOM 82    H HB2  . LEU A 1 24  ? 3.399   9.412   5.294   1.00 2.43  ? 538 LEU A HB2  1  
ATOM 83    H HB3  . LEU A 1 24  ? 3.561   8.496   3.801   1.00 2.78  ? 538 LEU A HB3  1  
ATOM 84    H HG   . LEU A 1 24  ? 1.993   6.754   4.892   1.00 2.45  ? 538 LEU A HG   1  
ATOM 85    H HD11 . LEU A 1 24  ? 0.556   7.531   6.690   1.00 3.11  ? 538 LEU A HD11 1  
ATOM 86    H HD12 . LEU A 1 24  ? 1.410   9.087   6.764   1.00 3.39  ? 538 LEU A HD12 1  
ATOM 87    H HD13 . LEU A 1 24  ? 2.220   7.584   7.245   1.00 2.28  ? 538 LEU A HD13 1  
ATOM 88    H HD21 . LEU A 1 24  ? 1.277   8.353   3.130   1.00 4.83  ? 538 LEU A HD21 1  
ATOM 89    H HD22 . LEU A 1 24  ? 0.880   9.539   4.390   1.00 4.30  ? 538 LEU A HD22 1  
ATOM 90    H HD23 . LEU A 1 24  ? -0.005  7.989   4.287   1.00 4.39  ? 538 LEU A HD23 1  
ATOM 91    N N    . VAL A 1 25  ? 5.554   6.347   3.611   1.00 1.55  ? 539 VAL A N    1  
ATOM 92    C CA   . VAL A 1 25  ? 6.060   5.145   2.922   1.00 1.33  ? 539 VAL A CA   1  
ATOM 93    C C    . VAL A 1 25  ? 7.058   4.398   3.823   1.00 1.46  ? 539 VAL A C    1  
ATOM 94    O O    . VAL A 1 25  ? 7.025   3.175   3.912   1.00 1.51  ? 539 VAL A O    1  
ATOM 95    C CB   . VAL A 1 25  ? 6.591   5.504   1.520   1.00 1.07  ? 539 VAL A CB   1  
ATOM 96    C CG1  . VAL A 1 25  ? 8.091   5.792   1.502   1.00 1.04  ? 539 VAL A CG1  1  
ATOM 97    C CG2  . VAL A 1 25  ? 6.243   4.392   0.530   1.00 0.97  ? 539 VAL A CG2  1  
ATOM 98    H H    . VAL A 1 25  ? 5.918   7.258   3.346   1.00 1.49  ? 539 VAL A H    1  
ATOM 99    H HA   . VAL A 1 25  ? 5.240   4.447   2.753   1.00 1.37  ? 539 VAL A HA   1  
ATOM 100   H HB   . VAL A 1 25  ? 6.079   6.402   1.170   1.00 1.13  ? 539 VAL A HB   1  
ATOM 101   H HG11 . VAL A 1 25  ? 8.292   6.642   2.159   1.00 2.32  ? 539 VAL A HG11 1  
ATOM 102   H HG12 . VAL A 1 25  ? 8.644   4.918   1.839   1.00 1.32  ? 539 VAL A HG12 1  
ATOM 103   H HG13 . VAL A 1 25  ? 8.408   6.018   0.483   1.00 1.99  ? 539 VAL A HG13 1  
ATOM 104   H HG21 . VAL A 1 25  ? 5.162   4.356   0.386   1.00 1.82  ? 539 VAL A HG21 1  
ATOM 105   H HG22 . VAL A 1 25  ? 6.717   4.577   -0.434  1.00 2.16  ? 539 VAL A HG22 1  
ATOM 106   H HG23 . VAL A 1 25  ? 6.570   3.433   0.925   1.00 1.51  ? 539 VAL A HG23 1  
ATOM 107   N N    . ALA A 1 26  ? 7.866   5.126   4.605   1.00 1.61  ? 540 ALA A N    1  
ATOM 108   C CA   . ALA A 1 26  ? 8.768   4.551   5.604   1.00 1.89  ? 540 ALA A CA   1  
ATOM 109   C C    . ALA A 1 26  ? 8.048   3.941   6.825   1.00 2.27  ? 540 ALA A C    1  
ATOM 110   O O    . ALA A 1 26  ? 8.686   3.263   7.635   1.00 2.50  ? 540 ALA A O    1  
ATOM 111   C CB   . ALA A 1 26  ? 9.747   5.638   6.050   1.00 1.98  ? 540 ALA A CB   1  
ATOM 112   H H    . ALA A 1 26  ? 7.874   6.130   4.492   1.00 1.59  ? 540 ALA A H    1  
ATOM 113   H HA   . ALA A 1 26  ? 9.338   3.752   5.131   1.00 1.85  ? 540 ALA A HA   1  
ATOM 114   H HB1  . ALA A 1 26  ? 10.512  5.197   6.689   1.00 1.98  ? 540 ALA A HB1  1  
ATOM 115   H HB2  . ALA A 1 26  ? 10.221  6.106   5.185   1.00 2.35  ? 540 ALA A HB2  1  
ATOM 116   H HB3  . ALA A 1 26  ? 9.211   6.388   6.629   1.00 3.07  ? 540 ALA A HB3  1  
ATOM 117   N N    . SER A 1 27  ? 6.735   4.150   6.987   1.00 2.40  ? 541 SER A N    1  
ATOM 118   C CA   . SER A 1 27  ? 5.948   3.585   8.080   1.00 2.75  ? 541 SER A CA   1  
ATOM 119   C C    . SER A 1 27  ? 5.567   2.121   7.809   1.00 2.68  ? 541 SER A C    1  
ATOM 120   O O    . SER A 1 27  ? 5.174   1.396   8.726   1.00 2.91  ? 541 SER A O    1  
ATOM 121   C CB   . SER A 1 27  ? 4.697   4.420   8.298   1.00 2.96  ? 541 SER A CB   1  
ATOM 122   O OG   . SER A 1 27  ? 4.962   5.714   8.812   1.00 3.85  ? 541 SER A OG   1  
ATOM 123   H H    . SER A 1 27  ? 6.223   4.699   6.315   1.00 2.34  ? 541 SER A H    1  
ATOM 124   H HA   . SER A 1 27  ? 6.523   3.650   8.990   1.00 2.99  ? 541 SER A HA   1  
ATOM 125   H HB2  . SER A 1 27  ? 4.192   4.496   7.353   1.00 3.06  ? 541 SER A HB2  1  
ATOM 126   H HB3  . SER A 1 27  ? 4.054   3.894   8.982   1.00 2.95  ? 541 SER A HB3  1  
ATOM 127   H HG   . SER A 1 27  ? 5.678   6.112   8.270   1.00 3.73  ? 541 SER A HG   1  
ATOM 128   N N    . MET A 1 28  ? 5.713   1.679   6.556   1.00 2.39  ? 542 MET A N    1  
ATOM 129   C CA   . MET A 1 28  ? 5.423   0.335   6.068   1.00 2.34  ? 542 MET A CA   1  
ATOM 130   C C    . MET A 1 28  ? 6.403   -0.682  6.692   1.00 2.48  ? 542 MET A C    1  
ATOM 131   O O    . MET A 1 28  ? 7.603   -0.388  6.775   1.00 2.49  ? 542 MET A O    1  
ATOM 132   C CB   . MET A 1 28  ? 5.532   0.392   4.532   1.00 2.03  ? 542 MET A CB   1  
ATOM 133   C CG   . MET A 1 28  ? 4.672   -0.601  3.761   1.00 1.55  ? 542 MET A CG   1  
ATOM 134   S SD   . MET A 1 28  ? 5.349   -2.271  3.649   1.00 2.26  ? 542 MET A SD   1  
ATOM 135   C CE   . MET A 1 28  ? 4.717   -2.709  2.013   1.00 1.52  ? 542 MET A CE   1  
ATOM 136   H H    . MET A 1 28  ? 6.025   2.341   5.859   1.00 2.25  ? 542 MET A H    1  
ATOM 137   H HA   . MET A 1 28  ? 4.395   0.110   6.348   1.00 2.59  ? 542 MET A HA   1  
ATOM 138   H HB2  . MET A 1 28  ? 5.205   1.378   4.198   1.00 2.47  ? 542 MET A HB2  1  
ATOM 139   H HB3  . MET A 1 28  ? 6.571   0.252   4.233   1.00 2.42  ? 542 MET A HB3  1  
ATOM 140   H HG2  . MET A 1 28  ? 3.676   -0.634  4.200   1.00 2.02  ? 542 MET A HG2  1  
ATOM 141   H HG3  . MET A 1 28  ? 4.574   -0.214  2.746   1.00 2.13  ? 542 MET A HG3  1  
ATOM 142   H HE1  . MET A 1 28  ? 5.318   -2.212  1.251   1.00 2.47  ? 542 MET A HE1  1  
ATOM 143   H HE2  . MET A 1 28  ? 4.780   -3.788  1.878   1.00 1.98  ? 542 MET A HE2  1  
ATOM 144   H HE3  . MET A 1 28  ? 3.679   -2.381  1.922   1.00 1.87  ? 542 MET A HE3  1  
ATOM 145   N N    . PRO A 1 29  ? 5.965   -1.877  7.137   1.00 2.72  ? 543 PRO A N    1  
ATOM 146   C CA   . PRO A 1 29  ? 6.833   -2.786  7.898   1.00 3.15  ? 543 PRO A CA   1  
ATOM 147   C C    . PRO A 1 29  ? 7.979   -3.393  7.070   1.00 3.01  ? 543 PRO A C    1  
ATOM 148   O O    . PRO A 1 29  ? 9.018   -3.734  7.631   1.00 3.47  ? 543 PRO A O    1  
ATOM 149   C CB   . PRO A 1 29  ? 5.891   -3.848  8.477   1.00 3.49  ? 543 PRO A CB   1  
ATOM 150   C CG   . PRO A 1 29  ? 4.703   -3.861  7.515   1.00 3.02  ? 543 PRO A CG   1  
ATOM 151   C CD   . PRO A 1 29  ? 4.610   -2.409  7.044   1.00 2.76  ? 543 PRO A CD   1  
ATOM 152   H HA   . PRO A 1 29  ? 7.299   -2.244  8.724   1.00 3.47  ? 543 PRO A HA   1  
ATOM 153   H HB2  . PRO A 1 29  ? 6.365   -4.828  8.547   1.00 3.67  ? 543 PRO A HB2  1  
ATOM 154   H HB3  . PRO A 1 29  ? 5.552   -3.524  9.462   1.00 4.01  ? 543 PRO A HB3  1  
ATOM 155   H HG2  . PRO A 1 29  ? 4.928   -4.506  6.664   1.00 2.73  ? 543 PRO A HG2  1  
ATOM 156   H HG3  . PRO A 1 29  ? 3.785   -4.185  8.008   1.00 3.31  ? 543 PRO A HG3  1  
ATOM 157   H HD2  . PRO A 1 29  ? 4.222   -2.378  6.030   1.00 2.44  ? 543 PRO A HD2  1  
ATOM 158   H HD3  . PRO A 1 29  ? 3.935   -1.843  7.680   1.00 3.06  ? 543 PRO A HD3  1  
ATOM 159   N N    . LEU A 1 30  ? 7.846   -3.455  5.741   1.00 2.53  ? 544 LEU A N    1  
ATOM 160   C CA   . LEU A 1 30  ? 8.914   -3.873  4.820   1.00 2.60  ? 544 LEU A CA   1  
ATOM 161   C C    . LEU A 1 30  ? 10.003  -2.798  4.655   1.00 2.63  ? 544 LEU A C    1  
ATOM 162   O O    . LEU A 1 30  ? 11.172  -3.114  4.433   1.00 3.16  ? 544 LEU A O    1  
ATOM 163   C CB   . LEU A 1 30  ? 8.237   -4.236  3.486   1.00 2.27  ? 544 LEU A CB   1  
ATOM 164   C CG   . LEU A 1 30  ? 9.151   -4.832  2.400   1.00 2.49  ? 544 LEU A CG   1  
ATOM 165   C CD1  . LEU A 1 30  ? 8.315   -5.763  1.525   1.00 2.74  ? 544 LEU A CD1  1  
ATOM 166   C CD2  . LEU A 1 30  ? 9.699   -3.741  1.470   1.00 3.04  ? 544 LEU A CD2  1  
ATOM 167   H H    . LEU A 1 30  ? 6.954   -3.195  5.342   1.00 2.23  ? 544 LEU A H    1  
ATOM 168   H HA   . LEU A 1 30  ? 9.394   -4.770  5.220   1.00 3.08  ? 544 LEU A HA   1  
ATOM 169   H HB2  . LEU A 1 30  ? 7.439   -4.939  3.717   1.00 2.79  ? 544 LEU A HB2  1  
ATOM 170   H HB3  . LEU A 1 30  ? 7.758   -3.362  3.057   1.00 2.54  ? 544 LEU A HB3  1  
ATOM 171   H HG   . LEU A 1 30  ? 9.969   -5.395  2.850   1.00 3.29  ? 544 LEU A HG   1  
ATOM 172   H HD11 . LEU A 1 30  ? 8.925   -6.162  0.714   1.00 3.46  ? 544 LEU A HD11 1  
ATOM 173   H HD12 . LEU A 1 30  ? 7.465   -5.212  1.122   1.00 2.41  ? 544 LEU A HD12 1  
ATOM 174   H HD13 . LEU A 1 30  ? 7.953   -6.597  2.126   1.00 3.64  ? 544 LEU A HD13 1  
ATOM 175   H HD21 . LEU A 1 30  ? 8.873   -3.196  1.008   1.00 3.28  ? 544 LEU A HD21 1  
ATOM 176   H HD22 . LEU A 1 30  ? 10.312  -4.204  0.698   1.00 3.50  ? 544 LEU A HD22 1  
ATOM 177   H HD23 . LEU A 1 30  ? 10.324  -3.042  2.018   1.00 3.90  ? 544 LEU A HD23 1  
ATOM 178   N N    . PHE A 1 31  ? 9.644   -1.518  4.793   1.00 2.22  ? 545 PHE A N    1  
ATOM 179   C CA   . PHE A 1 31  ? 10.544  -0.381  4.555   1.00 2.06  ? 545 PHE A CA   1  
ATOM 180   C C    . PHE A 1 31  ? 11.460  -0.087  5.758   1.00 2.21  ? 545 PHE A C    1  
ATOM 181   O O    . PHE A 1 31  ? 12.364  0.737   5.667   1.00 1.89  ? 545 PHE A O    1  
ATOM 182   C CB   . PHE A 1 31  ? 9.731   0.859   4.154   1.00 1.85  ? 545 PHE A CB   1  
ATOM 183   C CG   . PHE A 1 31  ? 9.246   0.937   2.711   1.00 1.51  ? 545 PHE A CG   1  
ATOM 184   C CD1  . PHE A 1 31  ? 8.402   -0.044  2.149   1.00 2.09  ? 545 PHE A CD1  1  
ATOM 185   C CD2  . PHE A 1 31  ? 9.564   2.080   1.951   1.00 2.39  ? 545 PHE A CD2  1  
ATOM 186   C CE1  . PHE A 1 31  ? 7.799   0.173   0.898   1.00 1.99  ? 545 PHE A CE1  1  
ATOM 187   C CE2  . PHE A 1 31  ? 8.991   2.282   0.686   1.00 2.28  ? 545 PHE A CE2  1  
ATOM 188   C CZ   . PHE A 1 31  ? 8.067   1.354   0.186   1.00 1.14  ? 545 PHE A CZ   1  
ATOM 189   H H    . PHE A 1 31  ? 8.717   -1.317  5.139   1.00 2.14  ? 545 PHE A H    1  
ATOM 190   H HA   . PHE A 1 31  ? 11.199  -0.630  3.722   1.00 2.01  ? 545 PHE A HA   1  
ATOM 191   H HB2  . PHE A 1 31  ? 8.872   0.958   4.817   1.00 1.88  ? 545 PHE A HB2  1  
ATOM 192   H HB3  . PHE A 1 31  ? 10.355  1.734   4.335   1.00 1.99  ? 545 PHE A HB3  1  
ATOM 193   H HD1  . PHE A 1 31  ? 8.165   -0.949  2.682   1.00 3.29  ? 545 PHE A HD1  1  
ATOM 194   H HD2  . PHE A 1 31  ? 10.211  2.837   2.361   1.00 3.64  ? 545 PHE A HD2  1  
ATOM 195   H HE1  . PHE A 1 31  ? 7.096   -0.547  0.506   1.00 3.19  ? 545 PHE A HE1  1  
ATOM 196   H HE2  . PHE A 1 31  ? 9.199   3.185   0.130   1.00 3.51  ? 545 PHE A HE2  1  
ATOM 197   H HZ   . PHE A 1 31  ? 7.529   1.581   -0.721  1.00 1.12  ? 545 PHE A HZ   1  
ATOM 198   N N    . ALA A 1 32  ? 11.286  -0.819  6.861   1.00 2.68  ? 546 ALA A N    1  
ATOM 199   C CA   . ALA A 1 32  ? 12.061  -0.749  8.102   1.00 2.84  ? 546 ALA A CA   1  
ATOM 200   C C    . ALA A 1 32  ? 13.584  -0.849  7.902   1.00 2.60  ? 546 ALA A C    1  
ATOM 201   O O    . ALA A 1 32  ? 14.387  -0.353  8.697   1.00 2.56  ? 546 ALA A O    1  
ATOM 202   C CB   . ALA A 1 32  ? 11.624  -1.999  8.860   1.00 3.26  ? 546 ALA A CB   1  
ATOM 203   H H    . ALA A 1 32  ? 10.607  -1.562  6.807   1.00 2.93  ? 546 ALA A H    1  
ATOM 204   H HA   . ALA A 1 32  ? 11.816  0.154   8.663   1.00 2.88  ? 546 ALA A HA   1  
ATOM 205   H HB1  . ALA A 1 32  ? 10.539  -1.996  8.992   1.00 4.08  ? 546 ALA A HB1  1  
ATOM 206   H HB2  . ALA A 1 32  ? 11.925  -2.867  8.262   1.00 2.76  ? 546 ALA A HB2  1  
ATOM 207   H HB3  . ALA A 1 32  ? 12.124  -2.039  9.825   1.00 3.89  ? 546 ALA A HB3  1  
ATOM 208   N N    . ASN A 1 33  ? 13.940  -1.570  6.844   1.00 2.53  ? 547 ASN A N    1  
ATOM 209   C CA   . ASN A 1 33  ? 15.262  -2.046  6.480   1.00 2.47  ? 547 ASN A CA   1  
ATOM 210   C C    . ASN A 1 33  ? 15.718  -1.466  5.118   1.00 2.16  ? 547 ASN A C    1  
ATOM 211   O O    . ASN A 1 33  ? 16.775  -1.844  4.607   1.00 2.27  ? 547 ASN A O    1  
ATOM 212   C CB   . ASN A 1 33  ? 15.150  -3.584  6.513   1.00 2.95  ? 547 ASN A CB   1  
ATOM 213   C CG   . ASN A 1 33  ? 15.761  -4.190  7.749   1.00 3.51  ? 547 ASN A CG   1  
ATOM 214   O OD1  . ASN A 1 33  ? 16.937  -4.522  7.799   1.00 3.89  ? 547 ASN A OD1  1  
ATOM 215   N ND2  . ASN A 1 33  ? 14.996  -4.354  8.791   1.00 3.97  ? 547 ASN A ND2  1  
ATOM 216   H H    . ASN A 1 33  ? 13.181  -1.922  6.280   1.00 2.65  ? 547 ASN A H    1  
ATOM 217   H HA   . ASN A 1 33  ? 15.995  -1.718  7.220   1.00 2.40  ? 547 ASN A HA   1  
ATOM 218   H HB2  . ASN A 1 33  ? 14.115  -3.918  6.424   1.00 3.63  ? 547 ASN A HB2  1  
ATOM 219   H HB3  . ASN A 1 33  ? 15.659  -4.013  5.676   1.00 2.76  ? 547 ASN A HB3  1  
ATOM 220   H HD21 . ASN A 1 33  ? 14.002  -4.220  8.746   1.00 3.88  ? 547 ASN A HD21 1  
ATOM 221   H HD22 . ASN A 1 33  ? 15.431  -4.783  9.596   1.00 4.57  ? 547 ASN A HD22 1  
ATOM 222   N N    . ALA A 1 34  ? 14.922  -0.555  4.540   1.00 1.87  ? 548 ALA A N    1  
ATOM 223   C CA   . ALA A 1 34  ? 15.131  0.016   3.202   1.00 1.62  ? 548 ALA A CA   1  
ATOM 224   C C    . ALA A 1 34  ? 16.313  1.001   3.095   1.00 1.44  ? 548 ALA A C    1  
ATOM 225   O O    . ALA A 1 34  ? 16.673  1.687   4.057   1.00 1.36  ? 548 ALA A O    1  
ATOM 226   C CB   . ALA A 1 34  ? 13.846  0.717   2.738   1.00 1.41  ? 548 ALA A CB   1  
ATOM 227   H H    . ALA A 1 34  ? 14.095  -0.274  5.062   1.00 1.93  ? 548 ALA A H    1  
ATOM 228   H HA   . ALA A 1 34  ? 15.331  -0.811  2.517   1.00 1.82  ? 548 ALA A HA   1  
ATOM 229   H HB1  . ALA A 1 34  ? 13.976  1.117   1.731   1.00 1.29  ? 548 ALA A HB1  1  
ATOM 230   H HB2  . ALA A 1 34  ? 13.013  0.019   2.725   1.00 2.07  ? 548 ALA A HB2  1  
ATOM 231   H HB3  . ALA A 1 34  ? 13.619  1.559   3.398   1.00 2.34  ? 548 ALA A HB3  1  
ATOM 232   N N    . ASP A 1 35  ? 16.848  1.134   1.877   1.00 1.43  ? 549 ASP A N    1  
ATOM 233   C CA   . ASP A 1 35  ? 17.799  2.184   1.487   1.00 1.31  ? 549 ASP A CA   1  
ATOM 234   C C    . ASP A 1 35  ? 17.081  3.556   1.379   1.00 1.10  ? 549 ASP A C    1  
ATOM 235   O O    . ASP A 1 35  ? 16.154  3.679   0.572   1.00 0.96  ? 549 ASP A O    1  
ATOM 236   C CB   . ASP A 1 35  ? 18.450  1.772   0.149   1.00 1.53  ? 549 ASP A CB   1  
ATOM 237   C CG   . ASP A 1 35  ? 19.655  2.630   -0.254  1.00 1.70  ? 549 ASP A CG   1  
ATOM 238   O OD1  . ASP A 1 35  ? 19.625  3.866   -0.072  1.00 1.81  ? 549 ASP A OD1  1  
ATOM 239   O OD2  . ASP A 1 35  ? 20.672  2.076   -0.741  1.00 2.90  ? 549 ASP A OD2  1  
ATOM 240   H H    . ASP A 1 35  ? 16.502  0.533   1.146   1.00 1.58  ? 549 ASP A H    1  
ATOM 241   H HA   . ASP A 1 35  ? 18.579  2.222   2.246   1.00 1.31  ? 549 ASP A HA   1  
ATOM 242   H HB2  . ASP A 1 35  ? 18.778  0.736   0.231   1.00 1.76  ? 549 ASP A HB2  1  
ATOM 243   H HB3  . ASP A 1 35  ? 17.708  1.813   -0.648  1.00 1.47  ? 549 ASP A HB3  1  
ATOM 244   N N    . PRO A 1 36  ? 17.491  4.608   2.119   1.00 1.09  ? 550 PRO A N    1  
ATOM 245   C CA   . PRO A 1 36  ? 16.805  5.911   2.192   1.00 0.98  ? 550 PRO A CA   1  
ATOM 246   C C    . PRO A 1 36  ? 16.661  6.648   0.849   1.00 1.00  ? 550 PRO A C    1  
ATOM 247   O O    . PRO A 1 36  ? 15.858  7.575   0.725   1.00 0.99  ? 550 PRO A O    1  
ATOM 248   C CB   . PRO A 1 36  ? 17.637  6.749   3.172   1.00 1.06  ? 550 PRO A CB   1  
ATOM 249   C CG   . PRO A 1 36  ? 19.025  6.128   3.051   1.00 1.20  ? 550 PRO A CG   1  
ATOM 250   C CD   . PRO A 1 36  ? 18.672  4.651   2.960   1.00 1.25  ? 550 PRO A CD   1  
ATOM 251   H HA   . PRO A 1 36  ? 15.812  5.770   2.614   1.00 0.94  ? 550 PRO A HA   1  
ATOM 252   H HB2  . PRO A 1 36  ? 17.645  7.810   2.919   1.00 1.13  ? 550 PRO A HB2  1  
ATOM 253   H HB3  . PRO A 1 36  ? 17.263  6.607   4.187   1.00 1.08  ? 550 PRO A HB3  1  
ATOM 254   H HG2  . PRO A 1 36  ? 19.493  6.444   2.116   1.00 1.32  ? 550 PRO A HG2  1  
ATOM 255   H HG3  . PRO A 1 36  ? 19.655  6.347   3.913   1.00 1.24  ? 550 PRO A HG3  1  
ATOM 256   H HD2  . PRO A 1 36  ? 19.502  4.097   2.530   1.00 1.49  ? 550 PRO A HD2  1  
ATOM 257   H HD3  . PRO A 1 36  ? 18.422  4.262   3.946   1.00 1.29  ? 550 PRO A HD3  1  
ATOM 258   N N    . ASN A 1 37  ? 17.405  6.238   -0.177  1.00 1.14  ? 551 ASN A N    1  
ATOM 259   C CA   . ASN A 1 37  ? 17.310  6.808   -1.523  1.00 1.24  ? 551 ASN A CA   1  
ATOM 260   C C    . ASN A 1 37  ? 16.200  6.118   -2.330  1.00 1.12  ? 551 ASN A C    1  
ATOM 261   O O    . ASN A 1 37  ? 15.409  6.791   -2.987  1.00 1.07  ? 551 ASN A O    1  
ATOM 262   C CB   . ASN A 1 37  ? 18.676  6.700   -2.222  1.00 1.58  ? 551 ASN A CB   1  
ATOM 263   C CG   . ASN A 1 37  ? 19.813  7.381   -1.482  1.00 1.73  ? 551 ASN A CG   1  
ATOM 264   O OD1  . ASN A 1 37  ? 20.819  6.773   -1.138  1.00 3.22  ? 551 ASN A OD1  1  
ATOM 265   N ND2  . ASN A 1 37  ? 19.736  8.665   -1.238  1.00 1.66  ? 551 ASN A ND2  1  
ATOM 266   H H    . ASN A 1 37  ? 17.937  5.388   -0.033  1.00 1.23  ? 551 ASN A H    1  
ATOM 267   H HA   . ASN A 1 37  ? 17.036  7.867   -1.454  1.00 1.25  ? 551 ASN A HA   1  
ATOM 268   H HB2  . ASN A 1 37  ? 18.934  5.649   -2.351  1.00 1.69  ? 551 ASN A HB2  1  
ATOM 269   H HB3  . ASN A 1 37  ? 18.598  7.158   -3.208  1.00 1.74  ? 551 ASN A HB3  1  
ATOM 270   H HD21 . ASN A 1 37  ? 18.929  9.207   -1.535  1.00 2.66  ? 551 ASN A HD21 1  
ATOM 271   H HD22 . ASN A 1 37  ? 20.527  9.112   -0.809  1.00 1.87  ? 551 ASN A HD22 1  
ATOM 272   N N    . PHE A 1 38  ? 16.075  4.794   -2.197  1.00 1.15  ? 552 PHE A N    1  
ATOM 273   C CA   . PHE A 1 38  ? 15.017  3.990   -2.825  1.00 1.13  ? 552 PHE A CA   1  
ATOM 274   C C    . PHE A 1 38  ? 13.631  4.439   -2.356  1.00 0.93  ? 552 PHE A C    1  
ATOM 275   O O    . PHE A 1 38  ? 12.755  4.732   -3.172  1.00 0.88  ? 552 PHE A O    1  
ATOM 276   C CB   . PHE A 1 38  ? 15.251  2.502   -2.505  1.00 1.30  ? 552 PHE A CB   1  
ATOM 277   C CG   . PHE A 1 38  ? 14.044  1.604   -2.706  1.00 1.32  ? 552 PHE A CG   1  
ATOM 278   C CD1  . PHE A 1 38  ? 13.484  1.435   -3.985  1.00 1.64  ? 552 PHE A CD1  1  
ATOM 279   C CD2  . PHE A 1 38  ? 13.449  0.972   -1.596  1.00 2.73  ? 552 PHE A CD2  1  
ATOM 280   C CE1  . PHE A 1 38  ? 12.338  0.639   -4.155  1.00 1.71  ? 552 PHE A CE1  1  
ATOM 281   C CE2  . PHE A 1 38  ? 12.309  0.168   -1.765  1.00 2.80  ? 552 PHE A CE2  1  
ATOM 282   C CZ   . PHE A 1 38  ? 11.759  0.000   -3.046  1.00 1.52  ? 552 PHE A CZ   1  
ATOM 283   H H    . PHE A 1 38  ? 16.679  4.342   -1.524  1.00 1.24  ? 552 PHE A H    1  
ATOM 284   H HA   . PHE A 1 38  ? 15.046  4.129   -3.904  1.00 1.20  ? 552 PHE A HA   1  
ATOM 285   H HB2  . PHE A 1 38  ? 16.074  2.129   -3.108  1.00 1.48  ? 552 PHE A HB2  1  
ATOM 286   H HB3  . PHE A 1 38  ? 15.558  2.408   -1.467  1.00 1.31  ? 552 PHE A HB3  1  
ATOM 287   H HD1  . PHE A 1 38  ? 13.920  1.932   -4.836  1.00 2.79  ? 552 PHE A HD1  1  
ATOM 288   H HD2  . PHE A 1 38  ? 13.863  1.110   -0.608  1.00 4.01  ? 552 PHE A HD2  1  
ATOM 289   H HE1  . PHE A 1 38  ? 11.902  0.518   -5.137  1.00 2.84  ? 552 PHE A HE1  1  
ATOM 290   H HE2  . PHE A 1 38  ? 11.848  -0.308  -0.910  1.00 4.10  ? 552 PHE A HE2  1  
ATOM 291   H HZ   . PHE A 1 38  ? 10.880  -0.611  -3.176  1.00 1.65  ? 552 PHE A HZ   1  
ATOM 292   N N    . VAL A 1 39  ? 13.458  4.563   -1.036  1.00 0.86  ? 553 VAL A N    1  
ATOM 293   C CA   . VAL A 1 39  ? 12.168  4.945   -0.430  1.00 0.81  ? 553 VAL A CA   1  
ATOM 294   C C    . VAL A 1 39  ? 11.719  6.342   -0.873  1.00 0.71  ? 553 VAL A C    1  
ATOM 295   O O    . VAL A 1 39  ? 10.534  6.606   -1.042  1.00 0.72  ? 553 VAL A O    1  
ATOM 296   C CB   . VAL A 1 39  ? 12.203  4.856   1.104   1.00 0.91  ? 553 VAL A CB   1  
ATOM 297   C CG1  . VAL A 1 39  ? 12.800  3.520   1.526   1.00 1.49  ? 553 VAL A CG1  1  
ATOM 298   C CG2  . VAL A 1 39  ? 13.044  5.907   1.822   1.00 1.41  ? 553 VAL A CG2  1  
ATOM 299   H H    . VAL A 1 39  ? 14.225  4.292   -0.428  1.00 0.91  ? 553 VAL A H    1  
ATOM 300   H HA   . VAL A 1 39  ? 11.429  4.215   -0.758  1.00 0.92  ? 553 VAL A HA   1  
ATOM 301   H HB   . VAL A 1 39  ? 11.182  4.928   1.469   1.00 1.49  ? 553 VAL A HB   1  
ATOM 302   H HG11 . VAL A 1 39  ? 13.879  3.532   1.344   1.00 2.06  ? 553 VAL A HG11 1  
ATOM 303   H HG12 . VAL A 1 39  ? 12.630  3.380   2.592   1.00 2.39  ? 553 VAL A HG12 1  
ATOM 304   H HG13 . VAL A 1 39  ? 12.336  2.708   0.968   1.00 2.29  ? 553 VAL A HG13 1  
ATOM 305   H HG21 . VAL A 1 39  ? 13.139  5.629   2.875   1.00 2.20  ? 553 VAL A HG21 1  
ATOM 306   H HG22 . VAL A 1 39  ? 14.033  5.922   1.380   1.00 2.13  ? 553 VAL A HG22 1  
ATOM 307   H HG23 . VAL A 1 39  ? 12.581  6.890   1.747   1.00 1.97  ? 553 VAL A HG23 1  
ATOM 308   N N    . THR A 1 40  ? 12.695  7.220   -1.105  1.00 0.72  ? 554 THR A N    1  
ATOM 309   C CA   . THR A 1 40  ? 12.525  8.619   -1.512  1.00 0.80  ? 554 THR A CA   1  
ATOM 310   C C    . THR A 1 40  ? 12.265  8.774   -3.010  1.00 0.82  ? 554 THR A C    1  
ATOM 311   O O    . THR A 1 40  ? 11.415  9.577   -3.403  1.00 0.88  ? 554 THR A O    1  
ATOM 312   C CB   . THR A 1 40  ? 13.762  9.436   -1.117  1.00 0.97  ? 554 THR A CB   1  
ATOM 313   O OG1  . THR A 1 40  ? 13.942  9.399   0.281   1.00 1.01  ? 554 THR A OG1  1  
ATOM 314   C CG2  . THR A 1 40  ? 13.613  10.899  -1.515  1.00 1.17  ? 554 THR A CG2  1  
ATOM 315   H H    . THR A 1 40  ? 13.629  6.882   -0.955  1.00 0.78  ? 554 THR A H    1  
ATOM 316   H HA   . THR A 1 40  ? 11.669  9.037   -0.984  1.00 0.84  ? 554 THR A HA   1  
ATOM 317   H HB   . THR A 1 40  ? 14.649  9.026   -1.602  1.00 1.00  ? 554 THR A HB   1  
ATOM 318   H HG1  . THR A 1 40  ? 14.603  8.702   0.471   1.00 1.13  ? 554 THR A HG1  1  
ATOM 319   H HG21 . THR A 1 40  ? 14.468  11.462  -1.145  1.00 2.43  ? 554 THR A HG21 1  
ATOM 320   H HG22 . THR A 1 40  ? 12.685  11.301  -1.106  1.00 1.34  ? 554 THR A HG22 1  
ATOM 321   H HG23 . THR A 1 40  ? 13.583  10.980  -2.601  1.00 2.01  ? 554 THR A HG23 1  
ATOM 322   N N    . ALA A 1 41  ? 12.952  8.004   -3.863  1.00 0.86  ? 555 ALA A N    1  
ATOM 323   C CA   . ALA A 1 41  ? 12.795  8.089   -5.316  1.00 0.95  ? 555 ALA A CA   1  
ATOM 324   C C    . ALA A 1 41  ? 11.391  7.645   -5.761  1.00 0.86  ? 555 ALA A C    1  
ATOM 325   O O    . ALA A 1 41  ? 10.919  7.999   -6.840  1.00 0.95  ? 555 ALA A O    1  
ATOM 326   C CB   . ALA A 1 41  ? 13.891  7.235   -5.962  1.00 1.10  ? 555 ALA A CB   1  
ATOM 327   H H    . ALA A 1 41  ? 13.600  7.304   -3.508  1.00 0.90  ? 555 ALA A H    1  
ATOM 328   H HA   . ALA A 1 41  ? 12.931  9.129   -5.621  1.00 1.04  ? 555 ALA A HA   1  
ATOM 329   H HB1  . ALA A 1 41  ? 13.807  6.201   -5.625  1.00 2.19  ? 555 ALA A HB1  1  
ATOM 330   H HB2  . ALA A 1 41  ? 13.789  7.268   -7.047  1.00 1.64  ? 555 ALA A HB2  1  
ATOM 331   H HB3  . ALA A 1 41  ? 14.872  7.623   -5.686  1.00 1.59  ? 555 ALA A HB3  1  
ATOM 332   N N    . MET A 1 42  ? 10.699  6.901   -4.897  1.00 0.75  ? 556 MET A N    1  
ATOM 333   C CA   . MET A 1 42  ? 9.323   6.452   -5.089  1.00 0.76  ? 556 MET A CA   1  
ATOM 334   C C    . MET A 1 42  ? 8.279   7.573   -4.927  1.00 0.72  ? 556 MET A C    1  
ATOM 335   O O    . MET A 1 42  ? 7.195   7.498   -5.501  1.00 0.76  ? 556 MET A O    1  
ATOM 336   C CB   . MET A 1 42  ? 9.108   5.336   -4.065  1.00 0.90  ? 556 MET A CB   1  
ATOM 337   C CG   . MET A 1 42  ? 7.851   4.514   -4.337  1.00 0.93  ? 556 MET A CG   1  
ATOM 338   S SD   . MET A 1 42  ? 7.630   3.091   -3.241  1.00 1.14  ? 556 MET A SD   1  
ATOM 339   C CE   . MET A 1 42  ? 9.273   2.325   -3.337  1.00 1.00  ? 556 MET A CE   1  
ATOM 340   H H    . MET A 1 42  ? 11.174  6.629   -4.041  1.00 0.73  ? 556 MET A H    1  
ATOM 341   H HA   . MET A 1 42  ? 9.221   6.039   -6.093  1.00 0.84  ? 556 MET A HA   1  
ATOM 342   H HB2  . MET A 1 42  ? 9.976   4.680   -4.113  1.00 1.20  ? 556 MET A HB2  1  
ATOM 343   H HB3  . MET A 1 42  ? 9.049   5.759   -3.062  1.00 1.28  ? 556 MET A HB3  1  
ATOM 344   H HG2  . MET A 1 42  ? 6.986   5.164   -4.218  1.00 1.25  ? 556 MET A HG2  1  
ATOM 345   H HG3  . MET A 1 42  ? 7.874   4.156   -5.365  1.00 1.11  ? 556 MET A HG3  1  
ATOM 346   H HE1  . MET A 1 42  ? 9.218   1.309   -2.950  1.00 2.13  ? 556 MET A HE1  1  
ATOM 347   H HE2  . MET A 1 42  ? 9.629   2.312   -4.373  1.00 1.36  ? 556 MET A HE2  1  
ATOM 348   H HE3  . MET A 1 42  ? 9.966   2.901   -2.719  1.00 1.56  ? 556 MET A HE3  1  
ATOM 349   N N    . LEU A 1 43  ? 8.591   8.624   -4.161  1.00 0.74  ? 557 LEU A N    1  
ATOM 350   C CA   . LEU A 1 43  ? 7.609   9.628   -3.734  1.00 0.81  ? 557 LEU A CA   1  
ATOM 351   C C    . LEU A 1 43  ? 7.195   10.615  -4.843  1.00 0.75  ? 557 LEU A C    1  
ATOM 352   O O    . LEU A 1 43  ? 6.169   11.286  -4.715  1.00 0.80  ? 557 LEU A O    1  
ATOM 353   C CB   . LEU A 1 43  ? 8.153   10.390  -2.510  1.00 0.95  ? 557 LEU A CB   1  
ATOM 354   C CG   . LEU A 1 43  ? 8.664   9.538   -1.337  1.00 1.03  ? 557 LEU A CG   1  
ATOM 355   C CD1  . LEU A 1 43  ? 9.250   10.435  -0.250  1.00 1.31  ? 557 LEU A CD1  1  
ATOM 356   C CD2  . LEU A 1 43  ? 7.542   8.708   -0.720  1.00 1.25  ? 557 LEU A CD2  1  
ATOM 357   H H    . LEU A 1 43  ? 9.514   8.659   -3.746  1.00 0.75  ? 557 LEU A H    1  
ATOM 358   H HA   . LEU A 1 43  ? 6.703   9.102   -3.433  1.00 0.91  ? 557 LEU A HA   1  
ATOM 359   H HB2  . LEU A 1 43  ? 8.960   11.043  -2.840  1.00 0.97  ? 557 LEU A HB2  1  
ATOM 360   H HB3  . LEU A 1 43  ? 7.349   11.011  -2.125  1.00 1.08  ? 557 LEU A HB3  1  
ATOM 361   H HG   . LEU A 1 43  ? 9.454   8.878   -1.684  1.00 0.85  ? 557 LEU A HG   1  
ATOM 362   H HD11 . LEU A 1 43  ? 10.039  11.059  -0.672  1.00 2.47  ? 557 LEU A HD11 1  
ATOM 363   H HD12 . LEU A 1 43  ? 9.684   9.804   0.525   1.00 1.95  ? 557 LEU A HD12 1  
ATOM 364   H HD13 . LEU A 1 43  ? 8.475   11.070  0.178   1.00 1.59  ? 557 LEU A HD13 1  
ATOM 365   H HD21 . LEU A 1 43  ? 7.907   8.234   0.189   1.00 2.19  ? 557 LEU A HD21 1  
ATOM 366   H HD22 . LEU A 1 43  ? 7.235   7.931   -1.419  1.00 1.40  ? 557 LEU A HD22 1  
ATOM 367   H HD23 . LEU A 1 43  ? 6.696   9.344   -0.466  1.00 2.20  ? 557 LEU A HD23 1  
ATOM 368   N N    . THR A 1 44  ? 7.978   10.720  -5.922  1.00 0.76  ? 558 THR A N    1  
ATOM 369   C CA   . THR A 1 44  ? 7.839   11.768  -6.958  1.00 0.88  ? 558 THR A CA   1  
ATOM 370   C C    . THR A 1 44  ? 6.505   11.806  -7.722  1.00 0.88  ? 558 THR A C    1  
ATOM 371   O O    . THR A 1 44  ? 6.128   12.878  -8.211  1.00 1.04  ? 558 THR A O    1  
ATOM 372   C CB   . THR A 1 44  ? 8.962   11.678  -8.004  1.00 1.08  ? 558 THR A CB   1  
ATOM 373   O OG1  . THR A 1 44  ? 8.881   10.482  -8.752  1.00 1.85  ? 558 THR A OG1  1  
ATOM 374   C CG2  . THR A 1 44  ? 10.364  11.752  -7.399  1.00 1.59  ? 558 THR A CG2  1  
ATOM 375   H H    . THR A 1 44  ? 8.834   10.179  -5.917  1.00 0.75  ? 558 THR A H    1  
ATOM 376   H HA   . THR A 1 44  ? 7.935   12.736  -6.464  1.00 1.00  ? 558 THR A HA   1  
ATOM 377   H HB   . THR A 1 44  ? 8.841   12.516  -8.687  1.00 1.51  ? 558 THR A HB   1  
ATOM 378   H HG1  . THR A 1 44  ? 9.238   10.703  -9.636  1.00 2.21  ? 558 THR A HG1  1  
ATOM 379   H HG21 . THR A 1 44  ? 11.102  11.810  -8.200  1.00 2.32  ? 558 THR A HG21 1  
ATOM 380   H HG22 . THR A 1 44  ? 10.569  10.869  -6.793  1.00 2.58  ? 558 THR A HG22 1  
ATOM 381   H HG23 . THR A 1 44  ? 10.450  12.643  -6.778  1.00 2.31  ? 558 THR A HG23 1  
ATOM 382   N N    . LYS A 1 45  ? 5.787   10.677  -7.855  1.00 0.85  ? 559 LYS A N    1  
ATOM 383   C CA   . LYS A 1 45  ? 4.507   10.571  -8.591  1.00 0.94  ? 559 LYS A CA   1  
ATOM 384   C C    . LYS A 1 45  ? 3.326   10.038  -7.767  1.00 0.96  ? 559 LYS A C    1  
ATOM 385   O O    . LYS A 1 45  ? 2.361   9.524   -8.332  1.00 1.22  ? 559 LYS A O    1  
ATOM 386   C CB   . LYS A 1 45  ? 4.705   9.838   -9.932  1.00 1.10  ? 559 LYS A CB   1  
ATOM 387   C CG   . LYS A 1 45  ? 5.212   8.387   -9.805  1.00 1.37  ? 559 LYS A CG   1  
ATOM 388   C CD   . LYS A 1 45  ? 4.483   7.432   -10.764 1.00 1.56  ? 559 LYS A CD   1  
ATOM 389   C CE   . LYS A 1 45  ? 3.152   6.984   -10.142 1.00 1.83  ? 559 LYS A CE   1  
ATOM 390   N NZ   . LYS A 1 45  ? 2.303   6.220   -11.091 1.00 2.61  ? 559 LYS A NZ   1  
ATOM 391   H H    . LYS A 1 45  ? 6.165   9.830   -7.449  1.00 0.86  ? 559 LYS A H    1  
ATOM 392   H HA   . LYS A 1 45  ? 4.188   11.579  -8.857  1.00 0.97  ? 559 LYS A HA   1  
ATOM 393   H HB2  . LYS A 1 45  ? 3.757   9.857   -10.473 1.00 1.14  ? 559 LYS A HB2  1  
ATOM 394   H HB3  . LYS A 1 45  ? 5.419   10.398  -10.538 1.00 1.17  ? 559 LYS A HB3  1  
ATOM 395   H HG2  . LYS A 1 45  ? 6.277   8.377   -10.038 1.00 1.59  ? 559 LYS A HG2  1  
ATOM 396   H HG3  . LYS A 1 45  ? 5.095   8.025   -8.782  1.00 1.99  ? 559 LYS A HG3  1  
ATOM 397   H HD2  . LYS A 1 45  ? 4.315   7.926   -11.723 1.00 1.95  ? 559 LYS A HD2  1  
ATOM 398   H HD3  . LYS A 1 45  ? 5.111   6.559   -10.935 1.00 2.10  ? 559 LYS A HD3  1  
ATOM 399   H HE2  . LYS A 1 45  ? 3.377   6.381   -9.261  1.00 2.03  ? 559 LYS A HE2  1  
ATOM 400   H HE3  . LYS A 1 45  ? 2.606   7.861   -9.779  1.00 1.74  ? 559 LYS A HE3  1  
ATOM 401   H HZ1  . LYS A 1 45  ? 2.093   6.774   -11.922 1.00 3.04  ? 559 LYS A HZ1  1  
ATOM 402   H HZ2  . LYS A 1 45  ? 1.431   5.954   -10.639 1.00 3.16  ? 559 LYS A HZ2  1  
ATOM 403   H HZ3  . LYS A 1 45  ? 2.735   5.363   -11.416 1.00 3.15  ? 559 LYS A HZ3  1  
ATOM 404   N N    . LEU A 1 46  ? 3.393   10.104  -6.437  1.00 0.78  ? 560 LEU A N    1  
ATOM 405   C CA   . LEU A 1 46  ? 2.315   9.638   -5.560  1.00 0.77  ? 560 LEU A CA   1  
ATOM 406   C C    . LEU A 1 46  ? 1.001   10.420  -5.767  1.00 0.75  ? 560 LEU A C    1  
ATOM 407   O O    . LEU A 1 46  ? 1.012   11.570  -6.220  1.00 1.04  ? 560 LEU A O    1  
ATOM 408   C CB   . LEU A 1 46  ? 2.762   9.796   -4.089  1.00 1.06  ? 560 LEU A CB   1  
ATOM 409   C CG   . LEU A 1 46  ? 3.575   8.633   -3.507  1.00 1.08  ? 560 LEU A CG   1  
ATOM 410   C CD1  . LEU A 1 46  ? 4.154   9.043   -2.152  1.00 2.71  ? 560 LEU A CD1  1  
ATOM 411   C CD2  . LEU A 1 46  ? 2.676   7.421   -3.264  1.00 1.30  ? 560 LEU A CD2  1  
ATOM 412   H H    . LEU A 1 46  ? 4.187   10.557  -6.013  1.00 0.73  ? 560 LEU A H    1  
ATOM 413   H HA   . LEU A 1 46  ? 2.122   8.590   -5.823  1.00 0.89  ? 560 LEU A HA   1  
ATOM 414   H HB2  . LEU A 1 46  ? 3.338   10.719  -3.998  1.00 2.15  ? 560 LEU A HB2  1  
ATOM 415   H HB3  . LEU A 1 46  ? 1.881   9.915   -3.462  1.00 1.93  ? 560 LEU A HB3  1  
ATOM 416   H HG   . LEU A 1 46  ? 4.387   8.367   -4.184  1.00 2.58  ? 560 LEU A HG   1  
ATOM 417   H HD11 . LEU A 1 46  ? 4.740   8.221   -1.740  1.00 3.46  ? 560 LEU A HD11 1  
ATOM 418   H HD12 . LEU A 1 46  ? 3.351   9.299   -1.461  1.00 3.26  ? 560 LEU A HD12 1  
ATOM 419   H HD13 . LEU A 1 46  ? 4.801   9.913   -2.277  1.00 3.70  ? 560 LEU A HD13 1  
ATOM 420   H HD21 . LEU A 1 46  ? 1.882   7.671   -2.560  1.00 1.85  ? 560 LEU A HD21 1  
ATOM 421   H HD22 . LEU A 1 46  ? 3.266   6.602   -2.853  1.00 2.20  ? 560 LEU A HD22 1  
ATOM 422   H HD23 . LEU A 1 46  ? 2.223   7.100   -4.198  1.00 2.50  ? 560 LEU A HD23 1  
ATOM 423   N N    . LYS A 1 47  ? -0.121  9.807   -5.367  1.00 0.76  ? 561 LYS A N    1  
ATOM 424   C CA   . LYS A 1 47  ? -1.468  10.407  -5.380  1.00 0.86  ? 561 LYS A CA   1  
ATOM 425   C C    . LYS A 1 47  ? -2.187  10.271  -4.031  1.00 0.90  ? 561 LYS A C    1  
ATOM 426   O O    . LYS A 1 47  ? -2.063  9.248   -3.362  1.00 0.90  ? 561 LYS A O    1  
ATOM 427   C CB   . LYS A 1 47  ? -2.306  9.762   -6.500  1.00 1.07  ? 561 LYS A CB   1  
ATOM 428   C CG   . LYS A 1 47  ? -3.189  10.764  -7.259  1.00 1.16  ? 561 LYS A CG   1  
ATOM 429   C CD   . LYS A 1 47  ? -2.592  11.266  -8.587  1.00 1.46  ? 561 LYS A CD   1  
ATOM 430   C CE   . LYS A 1 47  ? -1.152  11.780  -8.465  1.00 1.52  ? 561 LYS A CE   1  
ATOM 431   N NZ   . LYS A 1 47  ? -0.682  12.383  -9.733  1.00 1.83  ? 561 LYS A NZ   1  
ATOM 432   H H    . LYS A 1 47  ? -0.041  8.854   -5.028  1.00 0.89  ? 561 LYS A H    1  
ATOM 433   H HA   . LYS A 1 47  ? -1.367  11.474  -5.582  1.00 0.94  ? 561 LYS A HA   1  
ATOM 434   H HB2  . LYS A 1 47  ? -1.655  9.268   -7.212  1.00 1.40  ? 561 LYS A HB2  1  
ATOM 435   H HB3  . LYS A 1 47  ? -2.943  8.987   -6.068  1.00 1.44  ? 561 LYS A HB3  1  
ATOM 436   H HG2  . LYS A 1 47  ? -4.124  10.257  -7.487  1.00 1.37  ? 561 LYS A HG2  1  
ATOM 437   H HG3  . LYS A 1 47  ? -3.422  11.615  -6.619  1.00 1.36  ? 561 LYS A HG3  1  
ATOM 438   H HD2  . LYS A 1 47  ? -2.609  10.447  -9.309  1.00 1.67  ? 561 LYS A HD2  1  
ATOM 439   H HD3  . LYS A 1 47  ? -3.230  12.065  -8.968  1.00 1.93  ? 561 LYS A HD3  1  
ATOM 440   H HE2  . LYS A 1 47  ? -1.098  12.514  -7.659  1.00 1.66  ? 561 LYS A HE2  1  
ATOM 441   H HE3  . LYS A 1 47  ? -0.503  10.942  -8.198  1.00 1.51  ? 561 LYS A HE3  1  
ATOM 442   H HZ1  . LYS A 1 47  ? -0.840  11.751  -10.516 1.00 2.27  ? 561 LYS A HZ1  1  
ATOM 443   H HZ2  . LYS A 1 47  ? 0.318   12.575  -9.710  1.00 2.43  ? 561 LYS A HZ2  1  
ATOM 444   H HZ3  . LYS A 1 47  ? -1.150  13.263  -9.928  1.00 2.25  ? 561 LYS A HZ3  1  
ATOM 445   N N    . PHE A 1 48  ? -2.966  11.285  -3.671  1.00 1.08  ? 562 PHE A N    1  
ATOM 446   C CA   . PHE A 1 48  ? -3.766  11.384  -2.438  1.00 1.20  ? 562 PHE A CA   1  
ATOM 447   C C    . PHE A 1 48  ? -5.256  11.136  -2.720  1.00 0.98  ? 562 PHE A C    1  
ATOM 448   O O    . PHE A 1 48  ? -5.761  11.606  -3.742  1.00 0.95  ? 562 PHE A O    1  
ATOM 449   C CB   . PHE A 1 48  ? -3.544  12.790  -1.857  1.00 1.64  ? 562 PHE A CB   1  
ATOM 450   C CG   . PHE A 1 48  ? -4.581  13.293  -0.873  1.00 1.24  ? 562 PHE A CG   1  
ATOM 451   C CD1  . PHE A 1 48  ? -5.698  14.003  -1.351  1.00 2.05  ? 562 PHE A CD1  1  
ATOM 452   C CD2  . PHE A 1 48  ? -4.415  13.102  0.511   1.00 2.28  ? 562 PHE A CD2  1  
ATOM 453   C CE1  . PHE A 1 48  ? -6.619  14.562  -0.451  1.00 1.88  ? 562 PHE A CE1  1  
ATOM 454   C CE2  . PHE A 1 48  ? -5.339  13.659  1.412   1.00 2.85  ? 562 PHE A CE2  1  
ATOM 455   C CZ   . PHE A 1 48  ? -6.429  14.407  0.931   1.00 1.93  ? 562 PHE A CZ   1  
ATOM 456   H H    . PHE A 1 48  ? -3.024  12.060  -4.321  1.00 1.18  ? 562 PHE A H    1  
ATOM 457   H HA   . PHE A 1 48  ? -3.430  10.651  -1.704  1.00 1.41  ? 562 PHE A HA   1  
ATOM 458   H HB2  . PHE A 1 48  ? -2.564  12.826  -1.389  1.00 2.19  ? 562 PHE A HB2  1  
ATOM 459   H HB3  . PHE A 1 48  ? -3.522  13.507  -2.677  1.00 2.47  ? 562 PHE A HB3  1  
ATOM 460   H HD1  . PHE A 1 48  ? -5.846  14.123  -2.416  1.00 3.41  ? 562 PHE A HD1  1  
ATOM 461   H HD2  . PHE A 1 48  ? -3.574  12.535  0.883   1.00 3.31  ? 562 PHE A HD2  1  
ATOM 462   H HE1  . PHE A 1 48  ? -7.476  15.111  -0.820  1.00 2.82  ? 562 PHE A HE1  1  
ATOM 463   H HE2  . PHE A 1 48  ? -5.205  13.520  2.474   1.00 4.30  ? 562 PHE A HE2  1  
ATOM 464   H HZ   . PHE A 1 48  ? -7.130  14.857  1.619   1.00 2.42  ? 562 PHE A HZ   1  
ATOM 465   N N    . GLU A 1 49  ? -5.985  10.456  -1.827  1.00 0.94  ? 563 GLU A N    1  
ATOM 466   C CA   . GLU A 1 49  ? -7.442  10.329  -1.934  1.00 0.95  ? 563 GLU A CA   1  
ATOM 467   C C    . GLU A 1 49  ? -8.149  10.128  -0.579  1.00 0.78  ? 563 GLU A C    1  
ATOM 468   O O    . GLU A 1 49  ? -7.652  9.454   0.321   1.00 0.68  ? 563 GLU A O    1  
ATOM 469   C CB   . GLU A 1 49  ? -7.753  9.184   -2.916  1.00 1.05  ? 563 GLU A CB   1  
ATOM 470   C CG   . GLU A 1 49  ? -9.236  9.015   -3.241  1.00 1.72  ? 563 GLU A CG   1  
ATOM 471   C CD   . GLU A 1 49  ? -9.843  10.265  -3.893  1.00 3.36  ? 563 GLU A CD   1  
ATOM 472   O OE1  . GLU A 1 49  ? -10.187 11.222  -3.161  1.00 4.92  ? 563 GLU A OE1  1  
ATOM 473   O OE2  . GLU A 1 49  ? -9.963  10.333  -5.142  1.00 3.87  ? 563 GLU A OE2  1  
ATOM 474   H H    . GLU A 1 49  ? -5.547  10.034  -1.011  1.00 0.96  ? 563 GLU A H    1  
ATOM 475   H HA   . GLU A 1 49  ? -7.824  11.267  -2.338  1.00 1.09  ? 563 GLU A HA   1  
ATOM 476   H HB2  . GLU A 1 49  ? -7.224  9.359   -3.850  1.00 1.72  ? 563 GLU A HB2  1  
ATOM 477   H HB3  . GLU A 1 49  ? -7.383  8.248   -2.493  1.00 1.27  ? 563 GLU A HB3  1  
ATOM 478   H HG2  . GLU A 1 49  ? -9.341  8.160   -3.909  1.00 1.86  ? 563 GLU A HG2  1  
ATOM 479   H HG3  . GLU A 1 49  ? -9.753  8.783   -2.311  1.00 2.72  ? 563 GLU A HG3  1  
ATOM 480   N N    . VAL A 1 50  ? -9.350  10.695  -0.443  1.00 0.89  ? 564 VAL A N    1  
ATOM 481   C CA   . VAL A 1 50  ? -10.211 10.602  0.743   1.00 0.78  ? 564 VAL A CA   1  
ATOM 482   C C    . VAL A 1 50  ? -11.407 9.681   0.505   1.00 0.69  ? 564 VAL A C    1  
ATOM 483   O O    . VAL A 1 50  ? -12.008 9.667   -0.576  1.00 0.74  ? 564 VAL A O    1  
ATOM 484   C CB   . VAL A 1 50  ? -10.681 11.996  1.199   1.00 0.85  ? 564 VAL A CB   1  
ATOM 485   C CG1  . VAL A 1 50  ? -11.500 11.982  2.485   1.00 0.86  ? 564 VAL A CG1  1  
ATOM 486   C CG2  . VAL A 1 50  ? -9.489  12.931  1.423   1.00 0.99  ? 564 VAL A CG2  1  
ATOM 487   H H    . VAL A 1 50  ? -9.718  11.195  -1.241  1.00 1.06  ? 564 VAL A H    1  
ATOM 488   H HA   . VAL A 1 50  ? -9.624  10.177  1.553   1.00 0.76  ? 564 VAL A HA   1  
ATOM 489   H HB   . VAL A 1 50  ? -11.327 12.432  0.446   1.00 0.88  ? 564 VAL A HB   1  
ATOM 490   H HG11 . VAL A 1 50  ? -12.384 11.357  2.388   1.00 1.78  ? 564 VAL A HG11 1  
ATOM 491   H HG12 . VAL A 1 50  ? -10.897 11.654  3.332   1.00 1.62  ? 564 VAL A HG12 1  
ATOM 492   H HG13 . VAL A 1 50  ? -11.855 12.992  2.640   1.00 1.78  ? 564 VAL A HG13 1  
ATOM 493   H HG21 . VAL A 1 50  ? -9.028  13.169  0.463   1.00 1.50  ? 564 VAL A HG21 1  
ATOM 494   H HG22 . VAL A 1 50  ? -9.819  13.857  1.900   1.00 2.31  ? 564 VAL A HG22 1  
ATOM 495   H HG23 . VAL A 1 50  ? -8.754  12.431  2.051   1.00 1.72  ? 564 VAL A HG23 1  
ATOM 496   N N    . PHE A 1 51  ? -11.810 8.970   1.558   1.00 0.63  ? 565 PHE A N    1  
ATOM 497   C CA   . PHE A 1 51  ? -13.069 8.215   1.629   1.00 0.63  ? 565 PHE A CA   1  
ATOM 498   C C    . PHE A 1 51  ? -13.897 8.654   2.849   1.00 0.62  ? 565 PHE A C    1  
ATOM 499   O O    . PHE A 1 51  ? -13.367 9.251   3.784   1.00 0.68  ? 565 PHE A O    1  
ATOM 500   C CB   . PHE A 1 51  ? -12.799 6.707   1.589   1.00 0.65  ? 565 PHE A CB   1  
ATOM 501   C CG   . PHE A 1 51  ? -12.145 6.212   0.308   1.00 0.70  ? 565 PHE A CG   1  
ATOM 502   C CD1  . PHE A 1 51  ? -10.755 6.351   0.117   1.00 2.22  ? 565 PHE A CD1  1  
ATOM 503   C CD2  . PHE A 1 51  ? -12.913 5.549   -0.669  1.00 1.75  ? 565 PHE A CD2  1  
ATOM 504   C CE1  . PHE A 1 51  ? -10.141 5.826   -1.033  1.00 2.31  ? 565 PHE A CE1  1  
ATOM 505   C CE2  . PHE A 1 51  ? -12.297 5.009   -1.812  1.00 1.72  ? 565 PHE A CE2  1  
ATOM 506   C CZ   . PHE A 1 51  ? -10.908 5.140   -1.990  1.00 0.91  ? 565 PHE A CZ   1  
ATOM 507   H H    . PHE A 1 51  ? -11.290 9.097   2.422   1.00 0.65  ? 565 PHE A H    1  
ATOM 508   H HA   . PHE A 1 51  ? -13.669 8.434   0.752   1.00 0.67  ? 565 PHE A HA   1  
ATOM 509   H HB2  . PHE A 1 51  ? -12.169 6.434   2.429   1.00 0.62  ? 565 PHE A HB2  1  
ATOM 510   H HB3  . PHE A 1 51  ? -13.747 6.182   1.719   1.00 0.70  ? 565 PHE A HB3  1  
ATOM 511   H HD1  . PHE A 1 51  ? -10.152 6.847   0.865   1.00 3.58  ? 565 PHE A HD1  1  
ATOM 512   H HD2  . PHE A 1 51  ? -13.977 5.422   -0.526  1.00 3.13  ? 565 PHE A HD2  1  
ATOM 513   H HE1  . PHE A 1 51  ? -9.073  5.930   -1.173  1.00 3.71  ? 565 PHE A HE1  1  
ATOM 514   H HE2  . PHE A 1 51  ? -12.889 4.477   -2.545  1.00 3.05  ? 565 PHE A HE2  1  
ATOM 515   H HZ   . PHE A 1 51  ? -10.427 4.701   -2.855  1.00 1.01  ? 565 PHE A HZ   1  
ATOM 516   N N    . GLN A 1 52  ? -15.212 8.442   2.818   1.00 0.75  ? 566 GLN A N    1  
ATOM 517   C CA   . GLN A 1 52  ? -16.164 8.760   3.902   1.00 0.87  ? 566 GLN A CA   1  
ATOM 518   C C    . GLN A 1 52  ? -16.571 7.464   4.655   1.00 0.92  ? 566 GLN A C    1  
ATOM 519   O O    . GLN A 1 52  ? -16.369 6.371   4.119   1.00 0.90  ? 566 GLN A O    1  
ATOM 520   C CB   . GLN A 1 52  ? -17.406 9.452   3.295   1.00 1.04  ? 566 GLN A CB   1  
ATOM 521   C CG   . GLN A 1 52  ? -17.188 10.582  2.274   1.00 1.28  ? 566 GLN A CG   1  
ATOM 522   C CD   . GLN A 1 52  ? -16.546 11.823  2.866   1.00 1.56  ? 566 GLN A CD   1  
ATOM 523   O OE1  . GLN A 1 52  ? -17.163 12.874  3.007   1.00 2.78  ? 566 GLN A OE1  1  
ATOM 524   N NE2  . GLN A 1 52  ? -15.288 11.760  3.231   1.00 1.83  ? 566 GLN A NE2  1  
ATOM 525   H H    . GLN A 1 52  ? -15.584 7.960   2.005   1.00 0.86  ? 566 GLN A H    1  
ATOM 526   H HA   . GLN A 1 52  ? -15.696 9.442   4.631   1.00 0.91  ? 566 GLN A HA   1  
ATOM 527   H HB2  . GLN A 1 52  ? -17.978 8.691   2.777   1.00 1.26  ? 566 GLN A HB2  1  
ATOM 528   H HB3  . GLN A 1 52  ? -18.028 9.844   4.098   1.00 1.11  ? 566 GLN A HB3  1  
ATOM 529   H HG2  . GLN A 1 52  ? -16.584 10.225  1.441   1.00 2.07  ? 566 GLN A HG2  1  
ATOM 530   H HG3  . GLN A 1 52  ? -18.160 10.864  1.874   1.00 2.23  ? 566 GLN A HG3  1  
ATOM 531   H HE21 . GLN A 1 52  ? -14.771 10.896  3.186   1.00 2.20  ? 566 GLN A HE21 1  
ATOM 532   H HE22 . GLN A 1 52  ? -14.940 12.543  3.758   1.00 2.70  ? 566 GLN A HE22 1  
ATOM 533   N N    . PRO A 1 53  ? -17.162 7.532   5.868   1.00 1.09  ? 567 PRO A N    1  
ATOM 534   C CA   . PRO A 1 53  ? -17.400 6.341   6.689   1.00 1.21  ? 567 PRO A CA   1  
ATOM 535   C C    . PRO A 1 53  ? -18.302 5.281   6.026   1.00 1.33  ? 567 PRO A C    1  
ATOM 536   O O    . PRO A 1 53  ? -19.360 5.591   5.468   1.00 1.47  ? 567 PRO A O    1  
ATOM 537   C CB   . PRO A 1 53  ? -18.002 6.836   8.009   1.00 1.42  ? 567 PRO A CB   1  
ATOM 538   C CG   . PRO A 1 53  ? -17.728 8.339   8.045   1.00 1.38  ? 567 PRO A CG   1  
ATOM 539   C CD   . PRO A 1 53  ? -17.553 8.740   6.584   1.00 1.23  ? 567 PRO A CD   1  
ATOM 540   H HA   . PRO A 1 53  ? -16.430 5.890   6.904   1.00 1.13  ? 567 PRO A HA   1  
ATOM 541   H HB2  . PRO A 1 53  ? -19.080 6.669   8.022   1.00 1.61  ? 567 PRO A HB2  1  
ATOM 542   H HB3  . PRO A 1 53  ? -17.530 6.334   8.856   1.00 1.47  ? 567 PRO A HB3  1  
ATOM 543   H HG2  . PRO A 1 53  ? -18.550 8.884   8.509   1.00 1.56  ? 567 PRO A HG2  1  
ATOM 544   H HG3  . PRO A 1 53  ? -16.807 8.535   8.584   1.00 1.30  ? 567 PRO A HG3  1  
ATOM 545   H HD2  . PRO A 1 53  ? -18.506 9.100   6.199   1.00 1.34  ? 567 PRO A HD2  1  
ATOM 546   H HD3  . PRO A 1 53  ? -16.800 9.523   6.506   1.00 1.18  ? 567 PRO A HD3  1  
ATOM 547   N N    . GLY A 1 54  ? -17.896 4.014   6.115   1.00 1.34  ? 568 GLY A N    1  
ATOM 548   C CA   . GLY A 1 54  ? -18.613 2.839   5.623   1.00 1.52  ? 568 GLY A CA   1  
ATOM 549   C C    . GLY A 1 54  ? -18.215 2.446   4.203   1.00 1.47  ? 568 GLY A C    1  
ATOM 550   O O    . GLY A 1 54  ? -18.580 1.364   3.751   1.00 1.73  ? 568 GLY A O    1  
ATOM 551   H H    . GLY A 1 54  ? -16.950 3.837   6.425   1.00 1.25  ? 568 GLY A H    1  
ATOM 552   H HA2  . GLY A 1 54  ? -18.396 1.996   6.277   1.00 1.61  ? 568 GLY A HA2  1  
ATOM 553   H HA3  . GLY A 1 54  ? -19.687 3.024   5.641   1.00 1.65  ? 568 GLY A HA3  1  
ATOM 554   N N    . ASP A 1 55  ? -17.451 3.282   3.496   1.00 1.21  ? 569 ASP A N    1  
ATOM 555   C CA   . ASP A 1 55  ? -17.181 3.095   2.080   1.00 1.15  ? 569 ASP A CA   1  
ATOM 556   C C    . ASP A 1 55  ? -16.011 2.125   1.837   1.00 1.15  ? 569 ASP A C    1  
ATOM 557   O O    . ASP A 1 55  ? -14.907 2.321   2.352   1.00 1.16  ? 569 ASP A O    1  
ATOM 558   C CB   . ASP A 1 55  ? -16.990 4.472   1.423   1.00 1.03  ? 569 ASP A CB   1  
ATOM 559   C CG   . ASP A 1 55  ? -16.995 4.453   -0.107  1.00 1.18  ? 569 ASP A CG   1  
ATOM 560   O OD1  . ASP A 1 55  ? -17.495 3.483   -0.732  1.00 1.63  ? 569 ASP A OD1  1  
ATOM 561   O OD2  . ASP A 1 55  ? -16.499 5.434   -0.706  1.00 2.02  ? 569 ASP A OD2  1  
ATOM 562   H H    . ASP A 1 55  ? -17.134 4.142   3.914   1.00 1.07  ? 569 ASP A H    1  
ATOM 563   H HA   . ASP A 1 55  ? -18.085 2.655   1.678   1.00 1.24  ? 569 ASP A HA   1  
ATOM 564   H HB2  . ASP A 1 55  ? -17.798 5.131   1.747   1.00 1.12  ? 569 ASP A HB2  1  
ATOM 565   H HB3  . ASP A 1 55  ? -16.048 4.901   1.769   1.00 0.98  ? 569 ASP A HB3  1  
ATOM 566   N N    . TYR A 1 56  ? -16.246 1.067   1.056   1.00 1.21  ? 570 TYR A N    1  
ATOM 567   C CA   . TYR A 1 56  ? -15.225 0.071   0.697   1.00 1.25  ? 570 TYR A CA   1  
ATOM 568   C C    . TYR A 1 56  ? -14.115 0.691   -0.161  1.00 1.17  ? 570 TYR A C    1  
ATOM 569   O O    . TYR A 1 56  ? -14.342 1.134   -1.294  1.00 1.20  ? 570 TYR A O    1  
ATOM 570   C CB   . TYR A 1 56  ? -15.837 -1.154  0.003   1.00 1.44  ? 570 TYR A CB   1  
ATOM 571   C CG   . TYR A 1 56  ? -16.582 -2.091  0.937   1.00 1.65  ? 570 TYR A CG   1  
ATOM 572   C CD1  . TYR A 1 56  ? -15.893 -3.112  1.628   1.00 2.99  ? 570 TYR A CD1  1  
ATOM 573   C CD2  . TYR A 1 56  ? -17.970 -1.946  1.106   1.00 1.82  ? 570 TYR A CD2  1  
ATOM 574   C CE1  . TYR A 1 56  ? -16.591 -3.986  2.490   1.00 3.18  ? 570 TYR A CE1  1  
ATOM 575   C CE2  . TYR A 1 56  ? -18.665 -2.819  1.959   1.00 1.99  ? 570 TYR A CE2  1  
ATOM 576   C CZ   . TYR A 1 56  ? -17.986 -3.836  2.656   1.00 2.11  ? 570 TYR A CZ   1  
ATOM 577   O OH   . TYR A 1 56  ? -18.711 -4.661  3.457   1.00 2.34  ? 570 TYR A OH   1  
ATOM 578   H H    . TYR A 1 56  ? -17.190 0.949   0.713   1.00 1.28  ? 570 TYR A H    1  
ATOM 579   H HA   . TYR A 1 56  ? -14.767 -0.292  1.613   1.00 1.27  ? 570 TYR A HA   1  
ATOM 580   H HB2  . TYR A 1 56  ? -16.502 -0.824  -0.796  1.00 1.43  ? 570 TYR A HB2  1  
ATOM 581   H HB3  . TYR A 1 56  ? -15.033 -1.725  -0.464  1.00 1.52  ? 570 TYR A HB3  1  
ATOM 582   H HD1  . TYR A 1 56  ? -14.827 -3.234  1.491   1.00 4.15  ? 570 TYR A HD1  1  
ATOM 583   H HD2  . TYR A 1 56  ? -18.505 -1.164  0.586   1.00 2.74  ? 570 TYR A HD2  1  
ATOM 584   H HE1  . TYR A 1 56  ? -16.069 -4.780  3.007   1.00 4.42  ? 570 TYR A HE1  1  
ATOM 585   H HE2  . TYR A 1 56  ? -19.725 -2.702  2.107   1.00 2.89  ? 570 TYR A HE2  1  
ATOM 586   H HH   . TYR A 1 56  ? -18.177 -5.284  3.993   1.00 3.28  ? 570 TYR A HH   1  
ATOM 587   N N    . ILE A 1 57  ? -12.893 0.696   0.374   1.00 1.12  ? 571 ILE A N    1  
ATOM 588   C CA   . ILE A 1 57  ? -11.733 1.337   -0.253  1.00 1.12  ? 571 ILE A CA   1  
ATOM 589   C C    . ILE A 1 57  ? -11.013 0.407   -1.245  1.00 1.17  ? 571 ILE A C    1  
ATOM 590   O O    . ILE A 1 57  ? -10.382 0.889   -2.183  1.00 1.24  ? 571 ILE A O    1  
ATOM 591   C CB   . ILE A 1 57  ? -10.761 1.857   0.827   1.00 1.06  ? 571 ILE A CB   1  
ATOM 592   C CG1  . ILE A 1 57  ? -10.251 0.741   1.755   1.00 1.04  ? 571 ILE A CG1  1  
ATOM 593   C CG2  . ILE A 1 57  ? -11.383 2.939   1.717   1.00 1.07  ? 571 ILE A CG2  1  
ATOM 594   C CD1  . ILE A 1 57  ? -8.837  1.006   2.218   1.00 1.16  ? 571 ILE A CD1  1  
ATOM 595   H H    . ILE A 1 57  ? -12.758 0.264   1.281   1.00 1.13  ? 571 ILE A H    1  
ATOM 596   H HA   . ILE A 1 57  ? -12.073 2.202   -0.825  1.00 1.16  ? 571 ILE A HA   1  
ATOM 597   H HB   . ILE A 1 57  ? -9.915  2.304   0.302   1.00 1.11  ? 571 ILE A HB   1  
ATOM 598   H HG12 . ILE A 1 57  ? -10.911 0.600   2.612   1.00 1.08  ? 571 ILE A HG12 1  
ATOM 599   H HG13 . ILE A 1 57  ? -10.189 -0.183  1.216   1.00 1.36  ? 571 ILE A HG13 1  
ATOM 600   H HG21 . ILE A 1 57  ? -10.644 3.297   2.434   1.00 2.02  ? 571 ILE A HG21 1  
ATOM 601   H HG22 . ILE A 1 57  ? -11.710 3.765   1.097   1.00 2.02  ? 571 ILE A HG22 1  
ATOM 602   H HG23 . ILE A 1 57  ? -12.237 2.547   2.266   1.00 1.39  ? 571 ILE A HG23 1  
ATOM 603   H HD11 . ILE A 1 57  ? -8.496  0.151   2.800   1.00 1.73  ? 571 ILE A HD11 1  
ATOM 604   H HD12 . ILE A 1 57  ? -8.204  1.115   1.335   1.00 2.19  ? 571 ILE A HD12 1  
ATOM 605   H HD13 . ILE A 1 57  ? -8.812  1.908   2.822   1.00 1.84  ? 571 ILE A HD13 1  
ATOM 606   N N    . ILE A 1 58  ? -11.091 -0.914  -1.034  1.00 1.21  ? 572 ILE A N    1  
ATOM 607   C CA   . ILE A 1 58  ? -10.370 -1.950  -1.784  1.00 1.26  ? 572 ILE A CA   1  
ATOM 608   C C    . ILE A 1 58  ? -11.265 -3.184  -1.959  1.00 1.65  ? 572 ILE A C    1  
ATOM 609   O O    . ILE A 1 58  ? -11.619 -3.816  -0.962  1.00 2.51  ? 572 ILE A O    1  
ATOM 610   C CB   . ILE A 1 58  ? -9.067  -2.363  -1.057  1.00 1.70  ? 572 ILE A CB   1  
ATOM 611   C CG1  . ILE A 1 58  ? -8.118  -1.158  -0.939  1.00 1.91  ? 572 ILE A CG1  1  
ATOM 612   C CG2  . ILE A 1 58  ? -8.348  -3.508  -1.798  1.00 1.99  ? 572 ILE A CG2  1  
ATOM 613   C CD1  . ILE A 1 58  ? -6.857  -1.428  -0.125  1.00 1.79  ? 572 ILE A CD1  1  
ATOM 614   H H    . ILE A 1 58  ? -11.603 -1.227  -0.224  1.00 1.22  ? 572 ILE A H    1  
ATOM 615   H HA   . ILE A 1 58  ? -10.079 -1.542  -2.747  1.00 1.20  ? 572 ILE A HA   1  
ATOM 616   H HB   . ILE A 1 58  ? -9.320  -2.709  -0.054  1.00 2.02  ? 572 ILE A HB   1  
ATOM 617   H HG12 . ILE A 1 58  ? -7.858  -0.803  -1.933  1.00 2.46  ? 572 ILE A HG12 1  
ATOM 618   H HG13 . ILE A 1 58  ? -8.628  -0.351  -0.435  1.00 2.25  ? 572 ILE A HG13 1  
ATOM 619   H HG21 . ILE A 1 58  ? -8.985  -4.390  -1.869  1.00 1.63  ? 572 ILE A HG21 1  
ATOM 620   H HG22 . ILE A 1 58  ? -8.057  -3.180  -2.796  1.00 2.78  ? 572 ILE A HG22 1  
ATOM 621   H HG23 . ILE A 1 58  ? -7.460  -3.810  -1.247  1.00 3.15  ? 572 ILE A HG23 1  
ATOM 622   H HD11 . ILE A 1 58  ? -6.167  -2.059  -0.683  1.00 2.42  ? 572 ILE A HD11 1  
ATOM 623   H HD12 . ILE A 1 58  ? -6.382  -0.473  0.076   1.00 2.54  ? 572 ILE A HD12 1  
ATOM 624   H HD13 . ILE A 1 58  ? -7.124  -1.898  0.822   1.00 1.76  ? 572 ILE A HD13 1  
ATOM 625   N N    . ARG A 1 59  ? -11.552 -3.562  -3.211  1.00 1.44  ? 573 ARG A N    1  
ATOM 626   C CA   . ARG A 1 59  ? -12.040 -4.880  -3.648  1.00 2.05  ? 573 ARG A CA   1  
ATOM 627   C C    . ARG A 1 59  ? -11.496 -5.218  -5.042  1.00 1.38  ? 573 ARG A C    1  
ATOM 628   O O    . ARG A 1 59  ? -11.263 -4.326  -5.856  1.00 1.37  ? 573 ARG A O    1  
ATOM 629   C CB   . ARG A 1 59  ? -13.582 -4.887  -3.645  1.00 3.19  ? 573 ARG A CB   1  
ATOM 630   C CG   . ARG A 1 59  ? -14.185 -5.435  -2.340  1.00 4.70  ? 573 ARG A CG   1  
ATOM 631   C CD   . ARG A 1 59  ? -14.397 -6.951  -2.387  1.00 5.73  ? 573 ARG A CD   1  
ATOM 632   N NE   . ARG A 1 59  ? -13.151 -7.731  -2.537  1.00 7.08  ? 573 ARG A NE   1  
ATOM 633   C CZ   . ARG A 1 59  ? -13.035 -8.894  -3.150  1.00 8.19  ? 573 ARG A CZ   1  
ATOM 634   N NH1  . ARG A 1 59  ? -14.061 -9.558  -3.594  1.00 8.20  ? 573 ARG A NH1  1  
ATOM 635   N NH2  . ARG A 1 59  ? -11.866 -9.421  -3.349  1.00 9.79  ? 573 ARG A NH2  1  
ATOM 636   H H    . ARG A 1 59  ? -11.381 -2.901  -3.959  1.00 1.20  ? 573 ARG A H    1  
ATOM 637   H HA   . ARG A 1 59  ? -11.658 -5.638  -2.963  1.00 2.60  ? 573 ARG A HA   1  
ATOM 638   H HB2  . ARG A 1 59  ? -13.945 -3.870  -3.803  1.00 3.11  ? 573 ARG A HB2  1  
ATOM 639   H HB3  . ARG A 1 59  ? -13.953 -5.485  -4.480  1.00 3.68  ? 573 ARG A HB3  1  
ATOM 640   H HG2  . ARG A 1 59  ? -13.575 -5.180  -1.478  1.00 5.28  ? 573 ARG A HG2  1  
ATOM 641   H HG3  . ARG A 1 59  ? -15.163 -4.973  -2.200  1.00 5.19  ? 573 ARG A HG3  1  
ATOM 642   H HD2  . ARG A 1 59  ? -14.902 -7.255  -1.470  1.00 6.71  ? 573 ARG A HD2  1  
ATOM 643   H HD3  . ARG A 1 59  ? -15.051 -7.142  -3.236  1.00 5.27  ? 573 ARG A HD3  1  
ATOM 644   H HE   . ARG A 1 59  ? -12.329 -7.423  -2.022  1.00 7.76  ? 573 ARG A HE   1  
ATOM 645   H HH11 . ARG A 1 59  ? -14.995 -9.196  -3.435  1.00 7.48  ? 573 ARG A HH11 1  
ATOM 646   H HH12 . ARG A 1 59  ? -13.922 -10.511 -3.903  1.00 9.39  ? 573 ARG A HH12 1  
ATOM 647   H HH21 . ARG A 1 59  ? -11.029 -8.865  -3.155  1.00 10.19 ? 573 ARG A HH21 1  
ATOM 648   H HH22 . ARG A 1 59  ? -11.775 -10.260 -3.904  1.00 10.76 ? 573 ARG A HH22 1  
ATOM 649   N N    . GLU A 1 60  ? -11.253 -6.499  -5.305  1.00 1.79  ? 574 GLU A N    1  
ATOM 650   C CA   . GLU A 1 60  ? -10.676 -6.980  -6.566  1.00 1.50  ? 574 GLU A CA   1  
ATOM 651   C C    . GLU A 1 60  ? -11.684 -7.403  -7.650  1.00 2.09  ? 574 GLU A C    1  
ATOM 652   O O    . GLU A 1 60  ? -12.843 -7.748  -7.389  1.00 3.15  ? 574 GLU A O    1  
ATOM 653   C CB   . GLU A 1 60  ? -9.649  -8.093  -6.311  1.00 2.60  ? 574 GLU A CB   1  
ATOM 654   C CG   . GLU A 1 60  ? -8.412  -7.596  -5.545  1.00 3.09  ? 574 GLU A CG   1  
ATOM 655   C CD   . GLU A 1 60  ? -8.481  -7.823  -4.026  1.00 4.62  ? 574 GLU A CD   1  
ATOM 656   O OE1  . GLU A 1 60  ? -9.593  -7.956  -3.457  1.00 5.45  ? 574 GLU A OE1  1  
ATOM 657   O OE2  . GLU A 1 60  ? -7.397  -7.913  -3.407  1.00 5.86  ? 574 GLU A OE2  1  
ATOM 658   H H    . GLU A 1 60  ? -11.317 -7.160  -4.545  1.00 2.67  ? 574 GLU A H    1  
ATOM 659   H HA   . GLU A 1 60  ? -10.123 -6.149  -7.001  1.00 1.28  ? 574 GLU A HA   1  
ATOM 660   H HB2  . GLU A 1 60  ? -10.124 -8.926  -5.796  1.00 3.31  ? 574 GLU A HB2  1  
ATOM 661   H HB3  . GLU A 1 60  ? -9.300  -8.462  -7.276  1.00 3.54  ? 574 GLU A HB3  1  
ATOM 662   H HG2  . GLU A 1 60  ? -7.549  -8.135  -5.944  1.00 3.36  ? 574 GLU A HG2  1  
ATOM 663   H HG3  . GLU A 1 60  ? -8.247  -6.539  -5.763  1.00 3.64  ? 574 GLU A HG3  1  
ATOM 664   N N    . GLY A 1 61  ? -11.194 -7.403  -8.890  1.00 2.18  ? 575 GLY A N    1  
ATOM 665   C CA   . GLY A 1 61  ? -11.906 -7.824  -10.102 1.00 3.35  ? 575 GLY A CA   1  
ATOM 666   C C    . GLY A 1 61  ? -11.054 -7.818  -11.383 1.00 3.34  ? 575 GLY A C    1  
ATOM 667   O O    . GLY A 1 61  ? -11.499 -8.325  -12.415 1.00 4.23  ? 575 GLY A O    1  
ATOM 668   H H    . GLY A 1 61  ? -10.226 -7.112  -8.978  1.00 1.88  ? 575 GLY A H    1  
ATOM 669   H HA2  . GLY A 1 61  ? -12.288 -8.834  -9.954  1.00 3.94  ? 575 GLY A HA2  1  
ATOM 670   H HA3  . GLY A 1 61  ? -12.752 -7.156  -10.259 1.00 3.99  ? 575 GLY A HA3  1  
ATOM 671   N N    . THR A 1 62  ? -9.823  -7.293  -11.336 1.00 2.50  ? 576 THR A N    1  
ATOM 672   C CA   . THR A 1 62  ? -8.888  -7.223  -12.476 1.00 2.64  ? 576 THR A CA   1  
ATOM 673   C C    . THR A 1 62  ? -7.424  -7.299  -12.030 1.00 2.32  ? 576 THR A C    1  
ATOM 674   O O    . THR A 1 62  ? -7.114  -7.249  -10.838 1.00 2.20  ? 576 THR A O    1  
ATOM 675   C CB   . THR A 1 62  ? -9.145  -5.972  -13.335 1.00 3.02  ? 576 THR A CB   1  
ATOM 676   O OG1  . THR A 1 62  ? -8.521  -6.119  -14.587 1.00 3.28  ? 576 THR A OG1  1  
ATOM 677   C CG2  . THR A 1 62  ? -8.630  -4.677  -12.713 1.00 3.18  ? 576 THR A CG2  1  
ATOM 678   H H    . THR A 1 62  ? -9.482  -6.952  -10.443 1.00 1.98  ? 576 THR A H    1  
ATOM 679   H HA   . THR A 1 62  ? -9.066  -8.085  -13.117 1.00 2.99  ? 576 THR A HA   1  
ATOM 680   H HB   . THR A 1 62  ? -10.214 -5.885  -13.505 1.00 3.50  ? 576 THR A HB   1  
ATOM 681   H HG1  . THR A 1 62  ? -8.754  -5.316  -15.099 1.00 3.69  ? 576 THR A HG1  1  
ATOM 682   H HG21 . THR A 1 62  ? -9.025  -3.823  -13.262 1.00 4.08  ? 576 THR A HG21 1  
ATOM 683   H HG22 . THR A 1 62  ? -7.540  -4.641  -12.736 1.00 3.18  ? 576 THR A HG22 1  
ATOM 684   H HG23 . THR A 1 62  ? -8.970  -4.611  -11.685 1.00 3.39  ? 576 THR A HG23 1  
ATOM 685   N N    . ILE A 1 63  ? -6.514  -7.451  -12.987 1.00 2.47  ? 577 ILE A N    1  
ATOM 686   C CA   . ILE A 1 63  ? -5.118  -7.819  -12.742 1.00 2.27  ? 577 ILE A CA   1  
ATOM 687   C C    . ILE A 1 63  ? -4.234  -6.563  -12.609 1.00 2.04  ? 577 ILE A C    1  
ATOM 688   O O    . ILE A 1 63  ? -4.216  -5.712  -13.503 1.00 2.17  ? 577 ILE A O    1  
ATOM 689   C CB   . ILE A 1 63  ? -4.604  -8.772  -13.850 1.00 2.53  ? 577 ILE A CB   1  
ATOM 690   C CG1  . ILE A 1 63  ? -5.386  -10.105 -13.958 1.00 3.03  ? 577 ILE A CG1  1  
ATOM 691   C CG2  . ILE A 1 63  ? -3.136  -9.139  -13.568 1.00 2.31  ? 577 ILE A CG2  1  
ATOM 692   C CD1  . ILE A 1 63  ? -6.794  -10.050 -14.563 1.00 3.65  ? 577 ILE A CD1  1  
ATOM 693   H H    . ILE A 1 63  ? -6.835  -7.335  -13.942 1.00 2.83  ? 577 ILE A H    1  
ATOM 694   H HA   . ILE A 1 63  ? -5.088  -8.375  -11.802 1.00 2.26  ? 577 ILE A HA   1  
ATOM 695   H HB   . ILE A 1 63  ? -4.648  -8.261  -14.814 1.00 2.71  ? 577 ILE A HB   1  
ATOM 696   H HG12 . ILE A 1 63  ? -4.813  -10.793 -14.582 1.00 3.35  ? 577 ILE A HG12 1  
ATOM 697   H HG13 . ILE A 1 63  ? -5.470  -10.541 -12.966 1.00 2.93  ? 577 ILE A HG13 1  
ATOM 698   H HG21 . ILE A 1 63  ? -2.500  -8.256  -13.625 1.00 2.94  ? 577 ILE A HG21 1  
ATOM 699   H HG22 . ILE A 1 63  ? -3.034  -9.592  -12.582 1.00 2.36  ? 577 ILE A HG22 1  
ATOM 700   H HG23 . ILE A 1 63  ? -2.781  -9.837  -14.323 1.00 2.82  ? 577 ILE A HG23 1  
ATOM 701   H HD11 . ILE A 1 63  ? -6.806  -9.407  -15.442 1.00 4.64  ? 577 ILE A HD11 1  
ATOM 702   H HD12 . ILE A 1 63  ? -7.091  -11.058 -14.852 1.00 3.71  ? 577 ILE A HD12 1  
ATOM 703   H HD13 . ILE A 1 63  ? -7.509  -9.699  -13.822 1.00 3.89  ? 577 ILE A HD13 1  
ATOM 704   N N    . GLY A 1 64  ? -3.435  -6.478  -11.540 1.00 1.92  ? 578 GLY A N    1  
ATOM 705   C CA   . GLY A 1 64  ? -2.383  -5.463  -11.372 1.00 1.87  ? 578 GLY A CA   1  
ATOM 706   C C    . GLY A 1 64  ? -2.762  -4.257  -10.504 1.00 1.67  ? 578 GLY A C    1  
ATOM 707   O O    . GLY A 1 64  ? -2.209  -3.171  -10.691 1.00 1.79  ? 578 GLY A O    1  
ATOM 708   H H    . GLY A 1 64  ? -3.510  -7.192  -10.822 1.00 1.99  ? 578 GLY A H    1  
ATOM 709   H HA2  . GLY A 1 64  ? -1.519  -5.939  -10.909 1.00 1.97  ? 578 GLY A HA2  1  
ATOM 710   H HA3  . GLY A 1 64  ? -2.071  -5.092  -12.346 1.00 2.08  ? 578 GLY A HA3  1  
ATOM 711   N N    . LYS A 1 65  ? -3.710  -4.428  -9.570  1.00 1.65  ? 579 LYS A N    1  
ATOM 712   C CA   . LYS A 1 65  ? -4.186  -3.362  -8.665  1.00 1.56  ? 579 LYS A CA   1  
ATOM 713   C C    . LYS A 1 65  ? -3.038  -2.750  -7.828  1.00 1.31  ? 579 LYS A C    1  
ATOM 714   O O    . LYS A 1 65  ? -1.976  -3.343  -7.653  1.00 1.36  ? 579 LYS A O    1  
ATOM 715   C CB   . LYS A 1 65  ? -5.354  -3.891  -7.808  1.00 1.76  ? 579 LYS A CB   1  
ATOM 716   C CG   . LYS A 1 65  ? -6.342  -2.796  -7.349  1.00 2.67  ? 579 LYS A CG   1  
ATOM 717   C CD   . LYS A 1 65  ? -7.454  -3.432  -6.506  1.00 2.79  ? 579 LYS A CD   1  
ATOM 718   C CE   . LYS A 1 65  ? -8.508  -2.452  -5.962  1.00 4.12  ? 579 LYS A CE   1  
ATOM 719   N NZ   . LYS A 1 65  ? -9.521  -2.051  -6.968  1.00 4.47  ? 579 LYS A NZ   1  
ATOM 720   H H    . LYS A 1 65  ? -4.103  -5.352  -9.475  1.00 1.88  ? 579 LYS A H    1  
ATOM 721   H HA   . LYS A 1 65  ? -4.595  -2.573  -9.293  1.00 1.71  ? 579 LYS A HA   1  
ATOM 722   H HB2  . LYS A 1 65  ? -5.920  -4.616  -8.397  1.00 1.80  ? 579 LYS A HB2  1  
ATOM 723   H HB3  . LYS A 1 65  ? -4.952  -4.407  -6.936  1.00 1.95  ? 579 LYS A HB3  1  
ATOM 724   H HG2  . LYS A 1 65  ? -5.825  -2.053  -6.745  1.00 3.33  ? 579 LYS A HG2  1  
ATOM 725   H HG3  . LYS A 1 65  ? -6.779  -2.309  -8.221  1.00 3.16  ? 579 LYS A HG3  1  
ATOM 726   H HD2  . LYS A 1 65  ? -7.948  -4.203  -7.095  1.00 2.55  ? 579 LYS A HD2  1  
ATOM 727   H HD3  . LYS A 1 65  ? -6.981  -3.919  -5.653  1.00 2.87  ? 579 LYS A HD3  1  
ATOM 728   H HE2  . LYS A 1 65  ? -9.035  -2.964  -5.152  1.00 4.92  ? 579 LYS A HE2  1  
ATOM 729   H HE3  . LYS A 1 65  ? -8.018  -1.571  -5.539  1.00 4.75  ? 579 LYS A HE3  1  
ATOM 730   H HZ1  . LYS A 1 65  ? -9.239  -1.256  -7.537  1.00 4.98  ? 579 LYS A HZ1  1  
ATOM 731   H HZ2  . LYS A 1 65  ? -10.384 -1.783  -6.497  1.00 5.20  ? 579 LYS A HZ2  1  
ATOM 732   H HZ3  . LYS A 1 65  ? -9.744  -2.816  -7.600  1.00 4.37  ? 579 LYS A HZ3  1  
ATOM 733   N N    . LYS A 1 66  ? -3.270  -1.549  -7.299  1.00 1.25  ? 580 LYS A N    1  
ATOM 734   C CA   . LYS A 1 66  ? -2.281  -0.659  -6.663  1.00 1.14  ? 580 LYS A CA   1  
ATOM 735   C C    . LYS A 1 66  ? -1.992  -1.002  -5.194  1.00 0.94  ? 580 LYS A C    1  
ATOM 736   O O    . LYS A 1 66  ? -2.727  -1.772  -4.579  1.00 1.09  ? 580 LYS A O    1  
ATOM 737   C CB   . LYS A 1 66  ? -2.846  0.772   -6.684  1.00 1.52  ? 580 LYS A CB   1  
ATOM 738   C CG   . LYS A 1 66  ? -3.258  1.292   -8.068  1.00 1.58  ? 580 LYS A CG   1  
ATOM 739   C CD   . LYS A 1 66  ? -3.378  2.817   -8.034  1.00 2.56  ? 580 LYS A CD   1  
ATOM 740   C CE   . LYS A 1 66  ? -4.630  3.264   -7.270  1.00 3.48  ? 580 LYS A CE   1  
ATOM 741   N NZ   . LYS A 1 66  ? -4.769  4.736   -7.298  1.00 4.48  ? 580 LYS A NZ   1  
ATOM 742   H H    . LYS A 1 66  ? -4.158  -1.150  -7.534  1.00 1.37  ? 580 LYS A H    1  
ATOM 743   H HA   . LYS A 1 66  ? -1.341  -0.700  -7.212  1.00 1.30  ? 580 LYS A HA   1  
ATOM 744   H HB2  . LYS A 1 66  ? -3.715  0.820   -6.027  1.00 2.31  ? 580 LYS A HB2  1  
ATOM 745   H HB3  . LYS A 1 66  ? -2.096  1.440   -6.268  1.00 2.29  ? 580 LYS A HB3  1  
ATOM 746   H HG2  . LYS A 1 66  ? -2.506  1.014   -8.801  1.00 2.13  ? 580 LYS A HG2  1  
ATOM 747   H HG3  . LYS A 1 66  ? -4.209  0.852   -8.365  1.00 2.30  ? 580 LYS A HG3  1  
ATOM 748   H HD2  . LYS A 1 66  ? -2.480  3.211   -7.546  1.00 2.74  ? 580 LYS A HD2  1  
ATOM 749   H HD3  . LYS A 1 66  ? -3.431  3.193   -9.056  1.00 3.15  ? 580 LYS A HD3  1  
ATOM 750   H HE2  . LYS A 1 66  ? -5.515  2.799   -7.711  1.00 3.55  ? 580 LYS A HE2  1  
ATOM 751   H HE3  . LYS A 1 66  ? -4.548  2.924   -6.234  1.00 4.07  ? 580 LYS A HE3  1  
ATOM 752   H HZ1  . LYS A 1 66  ? -5.376  5.070   -6.552  1.00 5.55  ? 580 LYS A HZ1  1  
ATOM 753   H HZ2  . LYS A 1 66  ? -5.148  5.048   -8.185  1.00 4.49  ? 580 LYS A HZ2  1  
ATOM 754   H HZ3  . LYS A 1 66  ? -3.869  5.189   -7.146  1.00 4.93  ? 580 LYS A HZ3  1  
ATOM 755   N N    . MET A 1 67  ? -0.986  -0.333  -4.611  1.00 0.87  ? 581 MET A N    1  
ATOM 756   C CA   . MET A 1 67  ? -0.894  -0.221  -3.140  1.00 0.96  ? 581 MET A CA   1  
ATOM 757   C C    . MET A 1 67  ? -1.683  0.992   -2.621  1.00 0.87  ? 581 MET A C    1  
ATOM 758   O O    . MET A 1 67  ? -1.782  2.014   -3.307  1.00 0.79  ? 581 MET A O    1  
ATOM 759   C CB   . MET A 1 67  ? 0.559   -0.223  -2.618  1.00 1.13  ? 581 MET A CB   1  
ATOM 760   C CG   . MET A 1 67  ? 1.288   1.133   -2.677  1.00 2.59  ? 581 MET A CG   1  
ATOM 761   S SD   . MET A 1 67  ? 2.834   1.243   -1.724  1.00 3.24  ? 581 MET A SD   1  
ATOM 762   C CE   . MET A 1 67  ? 2.249   1.076   -0.004  1.00 2.60  ? 581 MET A CE   1  
ATOM 763   H H    . MET A 1 67  ? -0.443  0.305   -5.194  1.00 0.87  ? 581 MET A H    1  
ATOM 764   H HA   . MET A 1 67  ? -1.363  -1.108  -2.708  1.00 1.05  ? 581 MET A HA   1  
ATOM 765   H HB2  . MET A 1 67  ? 0.519   -0.533  -1.574  1.00 2.27  ? 581 MET A HB2  1  
ATOM 766   H HB3  . MET A 1 67  ? 1.141   -0.970  -3.158  1.00 1.49  ? 581 MET A HB3  1  
ATOM 767   H HG2  . MET A 1 67  ? 1.508   1.358   -3.721  1.00 3.66  ? 581 MET A HG2  1  
ATOM 768   H HG3  . MET A 1 67  ? 0.637   1.920   -2.299  1.00 3.51  ? 581 MET A HG3  1  
ATOM 769   H HE1  . MET A 1 67  ? 1.936   0.048   0.174   1.00 2.15  ? 581 MET A HE1  1  
ATOM 770   H HE2  . MET A 1 67  ? 3.062   1.305   0.685   1.00 3.31  ? 581 MET A HE2  1  
ATOM 771   H HE3  . MET A 1 67  ? 1.418   1.757   0.202   1.00 3.09  ? 581 MET A HE3  1  
ATOM 772   N N    . TYR A 1 68  ? -2.194  0.916   -1.391  1.00 0.98  ? 582 TYR A N    1  
ATOM 773   C CA   . TYR A 1 68  ? -2.932  2.003   -0.735  1.00 0.94  ? 582 TYR A CA   1  
ATOM 774   C C    . TYR A 1 68  ? -2.500  2.092   0.739   1.00 1.03  ? 582 TYR A C    1  
ATOM 775   O O    . TYR A 1 68  ? -2.235  1.066   1.368   1.00 1.12  ? 582 TYR A O    1  
ATOM 776   C CB   . TYR A 1 68  ? -4.449  1.776   -0.845  1.00 0.88  ? 582 TYR A CB   1  
ATOM 777   C CG   . TYR A 1 68  ? -5.030  1.486   -2.223  1.00 0.98  ? 582 TYR A CG   1  
ATOM 778   C CD1  . TYR A 1 68  ? -4.909  0.196   -2.779  1.00 2.04  ? 582 TYR A CD1  1  
ATOM 779   C CD2  . TYR A 1 68  ? -5.775  2.469   -2.907  1.00 2.04  ? 582 TYR A CD2  1  
ATOM 780   C CE1  . TYR A 1 68  ? -5.511  -0.107  -4.014  1.00 2.37  ? 582 TYR A CE1  1  
ATOM 781   C CE2  . TYR A 1 68  ? -6.404  2.161   -4.131  1.00 2.15  ? 582 TYR A CE2  1  
ATOM 782   C CZ   . TYR A 1 68  ? -6.273  0.869   -4.686  1.00 1.69  ? 582 TYR A CZ   1  
ATOM 783   O OH   . TYR A 1 68  ? -6.883  0.552   -5.859  1.00 2.15  ? 582 TYR A OH   1  
ATOM 784   H H    . TYR A 1 68  ? -2.065  0.066   -0.849  1.00 1.12  ? 582 TYR A H    1  
ATOM 785   H HA   . TYR A 1 68  ? -2.693  2.947   -1.221  1.00 0.89  ? 582 TYR A HA   1  
ATOM 786   H HB2  . TYR A 1 68  ? -4.698  0.931   -0.212  1.00 0.93  ? 582 TYR A HB2  1  
ATOM 787   H HB3  . TYR A 1 68  ? -4.953  2.649   -0.430  1.00 0.95  ? 582 TYR A HB3  1  
ATOM 788   H HD1  . TYR A 1 68  ? -4.360  -0.574  -2.252  1.00 3.15  ? 582 TYR A HD1  1  
ATOM 789   H HD2  . TYR A 1 68  ? -5.893  3.456   -2.481  1.00 3.26  ? 582 TYR A HD2  1  
ATOM 790   H HE1  . TYR A 1 68  ? -5.404  -1.093  -4.440  1.00 3.62  ? 582 TYR A HE1  1  
ATOM 791   H HE2  . TYR A 1 68  ? -6.997  2.909   -4.638  1.00 3.28  ? 582 TYR A HE2  1  
ATOM 792   H HH   . TYR A 1 68  ? -7.511  1.244   -6.137  1.00 2.59  ? 582 TYR A HH   1  
ATOM 793   N N    . PHE A 1 69  ? -2.375  3.295   1.305   1.00 1.02  ? 583 PHE A N    1  
ATOM 794   C CA   . PHE A 1 69  ? -1.765  3.462   2.629   1.00 1.12  ? 583 PHE A CA   1  
ATOM 795   C C    . PHE A 1 69  ? -2.316  4.682   3.389   1.00 1.09  ? 583 PHE A C    1  
ATOM 796   O O    . PHE A 1 69  ? -2.767  5.658   2.790   1.00 1.15  ? 583 PHE A O    1  
ATOM 797   C CB   . PHE A 1 69  ? -0.226  3.357   2.501   1.00 1.26  ? 583 PHE A CB   1  
ATOM 798   C CG   . PHE A 1 69  ? 0.544   4.412   1.719   1.00 1.50  ? 583 PHE A CG   1  
ATOM 799   C CD1  . PHE A 1 69  ? 0.445   4.491   0.315   1.00 2.51  ? 583 PHE A CD1  1  
ATOM 800   C CD2  . PHE A 1 69  ? 1.502   5.199   2.385   1.00 2.29  ? 583 PHE A CD2  1  
ATOM 801   C CE1  . PHE A 1 69  ? 1.285   5.356   -0.411  1.00 2.91  ? 583 PHE A CE1  1  
ATOM 802   C CE2  . PHE A 1 69  ? 2.340   6.067   1.661   1.00 2.52  ? 583 PHE A CE2  1  
ATOM 803   C CZ   . PHE A 1 69  ? 2.235   6.145   0.263   1.00 2.33  ? 583 PHE A CZ   1  
ATOM 804   H H    . PHE A 1 69  ? -2.615  4.136   0.779   1.00 1.00  ? 583 PHE A H    1  
ATOM 805   H HA   . PHE A 1 69  ? -2.074  2.608   3.232   1.00 1.17  ? 583 PHE A HA   1  
ATOM 806   H HB2  . PHE A 1 69  ? 0.214   3.266   3.490   1.00 1.39  ? 583 PHE A HB2  1  
ATOM 807   H HB3  . PHE A 1 69  ? -0.005  2.403   2.023   1.00 1.34  ? 583 PHE A HB3  1  
ATOM 808   H HD1  . PHE A 1 69  ? -0.251  3.862   -0.218  1.00 3.52  ? 583 PHE A HD1  1  
ATOM 809   H HD2  . PHE A 1 69  ? 1.626   5.100   3.453   1.00 3.32  ? 583 PHE A HD2  1  
ATOM 810   H HE1  . PHE A 1 69  ? 1.214   5.397   -1.489  1.00 4.10  ? 583 PHE A HE1  1  
ATOM 811   H HE2  . PHE A 1 69  ? 3.084   6.654   2.177   1.00 3.50  ? 583 PHE A HE2  1  
ATOM 812   H HZ   . PHE A 1 69  ? 2.901   6.792   -0.290  1.00 2.67  ? 583 PHE A HZ   1  
ATOM 813   N N    . ILE A 1 70  ? -2.399  4.570   4.718   1.00 0.98  ? 584 ILE A N    1  
ATOM 814   C CA   . ILE A 1 70  ? -3.273  5.414   5.567   1.00 0.88  ? 584 ILE A CA   1  
ATOM 815   C C    . ILE A 1 70  ? -2.541  6.663   6.078   1.00 0.93  ? 584 ILE A C    1  
ATOM 816   O O    . ILE A 1 70  ? -1.714  6.559   6.980   1.00 1.00  ? 584 ILE A O    1  
ATOM 817   C CB   . ILE A 1 70  ? -3.889  4.610   6.748   1.00 0.87  ? 584 ILE A CB   1  
ATOM 818   C CG1  . ILE A 1 70  ? -4.391  3.222   6.308   1.00 0.92  ? 584 ILE A CG1  1  
ATOM 819   C CG2  . ILE A 1 70  ? -5.048  5.421   7.390   1.00 0.75  ? 584 ILE A CG2  1  
ATOM 820   C CD1  . ILE A 1 70  ? -5.036  2.435   7.447   1.00 1.01  ? 584 ILE A CD1  1  
ATOM 821   H H    . ILE A 1 70  ? -1.963  3.743   5.131   1.00 0.97  ? 584 ILE A H    1  
ATOM 822   H HA   . ILE A 1 70  ? -4.102  5.756   4.949   1.00 0.81  ? 584 ILE A HA   1  
ATOM 823   H HB   . ILE A 1 70  ? -3.114  4.418   7.501   1.00 0.96  ? 584 ILE A HB   1  
ATOM 824   H HG12 . ILE A 1 70  ? -5.110  3.337   5.503   1.00 0.83  ? 584 ILE A HG12 1  
ATOM 825   H HG13 . ILE A 1 70  ? -3.557  2.628   5.940   1.00 1.02  ? 584 ILE A HG13 1  
ATOM 826   H HG21 . ILE A 1 70  ? -5.373  4.952   8.320   1.00 1.53  ? 584 ILE A HG21 1  
ATOM 827   H HG22 . ILE A 1 70  ? -4.734  6.436   7.629   1.00 1.95  ? 584 ILE A HG22 1  
ATOM 828   H HG23 . ILE A 1 70  ? -5.919  5.472   6.732   1.00 1.41  ? 584 ILE A HG23 1  
ATOM 829   H HD11 . ILE A 1 70  ? -4.987  1.372   7.215   1.00 1.64  ? 584 ILE A HD11 1  
ATOM 830   H HD12 . ILE A 1 70  ? -4.496  2.607   8.375   1.00 2.17  ? 584 ILE A HD12 1  
ATOM 831   H HD13 . ILE A 1 70  ? -6.074  2.757   7.548   1.00 1.43  ? 584 ILE A HD13 1  
ATOM 832   N N    . GLN A 1 71  ? -2.879  7.855   5.571   1.00 0.95  ? 585 GLN A N    1  
ATOM 833   C CA   . GLN A 1 71  ? -2.214  9.113   5.953   1.00 1.04  ? 585 GLN A CA   1  
ATOM 834   C C    . GLN A 1 71  ? -2.779  9.698   7.254   1.00 1.02  ? 585 GLN A C    1  
ATOM 835   O O    . GLN A 1 71  ? -2.011  10.174  8.094   1.00 1.19  ? 585 GLN A O    1  
ATOM 836   C CB   . GLN A 1 71  ? -2.280  10.093  4.767   1.00 1.11  ? 585 GLN A CB   1  
ATOM 837   C CG   . GLN A 1 71  ? -1.520  11.416  4.978   1.00 1.55  ? 585 GLN A CG   1  
ATOM 838   C CD   . GLN A 1 71  ? -2.446  12.574  5.345   1.00 1.96  ? 585 GLN A CD   1  
ATOM 839   O OE1  . GLN A 1 71  ? -2.992  13.248  4.483   1.00 2.95  ? 585 GLN A OE1  1  
ATOM 840   N NE2  . GLN A 1 71  ? -2.678  12.831  6.611   1.00 2.12  ? 585 GLN A NE2  1  
ATOM 841   H H    . GLN A 1 71  ? -3.665  7.918   4.931   1.00 0.93  ? 585 GLN A H    1  
ATOM 842   H HA   . GLN A 1 71  ? -1.162  8.904   6.141   1.00 1.14  ? 585 GLN A HA   1  
ATOM 843   H HB2  . GLN A 1 71  ? -1.838  9.589   3.907   1.00 1.21  ? 585 GLN A HB2  1  
ATOM 844   H HB3  . GLN A 1 71  ? -3.318  10.312  4.516   1.00 1.33  ? 585 GLN A HB3  1  
ATOM 845   H HG2  . GLN A 1 71  ? -0.750  11.295  5.741   1.00 2.16  ? 585 GLN A HG2  1  
ATOM 846   H HG3  . GLN A 1 71  ? -1.019  11.680  4.047   1.00 1.71  ? 585 GLN A HG3  1  
ATOM 847   H HE21 . GLN A 1 71  ? -2.229  12.291  7.335   1.00 2.44  ? 585 GLN A HE21 1  
ATOM 848   H HE22 . GLN A 1 71  ? -3.291  13.611  6.851   1.00 2.58  ? 585 GLN A HE22 1  
ATOM 849   N N    . HIS A 1 72  ? -4.103  9.643   7.427   1.00 0.89  ? 586 HIS A N    1  
ATOM 850   C CA   . HIS A 1 72  ? -4.803  9.975   8.670   1.00 0.87  ? 586 HIS A CA   1  
ATOM 851   C C    . HIS A 1 72  ? -6.221  9.382   8.664   1.00 0.77  ? 586 HIS A C    1  
ATOM 852   O O    . HIS A 1 72  ? -7.040  9.727   7.812   1.00 0.77  ? 586 HIS A O    1  
ATOM 853   C CB   . HIS A 1 72  ? -4.878  11.499  8.827   1.00 0.98  ? 586 HIS A CB   1  
ATOM 854   C CG   . HIS A 1 72  ? -5.594  11.934  10.073  1.00 1.38  ? 586 HIS A CG   1  
ATOM 855   N ND1  . HIS A 1 72  ? -5.105  11.874  11.356  1.00 2.22  ? 586 HIS A ND1  1  
ATOM 856   C CD2  . HIS A 1 72  ? -6.851  12.468  10.137  1.00 2.53  ? 586 HIS A CD2  1  
ATOM 857   C CE1  . HIS A 1 72  ? -6.037  12.379  12.180  1.00 2.49  ? 586 HIS A CE1  1  
ATOM 858   N NE2  . HIS A 1 72  ? -7.133  12.732  11.483  1.00 2.82  ? 586 HIS A NE2  1  
ATOM 859   H H    . HIS A 1 72  ? -4.664  9.308   6.650   1.00 0.82  ? 586 HIS A H    1  
ATOM 860   H HA   . HIS A 1 72  ? -4.251  9.569   9.518   1.00 0.91  ? 586 HIS A HA   1  
ATOM 861   H HB2  . HIS A 1 72  ? -3.873  11.907  8.860   1.00 1.33  ? 586 HIS A HB2  1  
ATOM 862   H HB3  . HIS A 1 72  ? -5.385  11.930  7.966   1.00 1.06  ? 586 HIS A HB3  1  
ATOM 863   H HD1  . HIS A 1 72  ? -4.182  11.540  11.633  1.00 3.22  ? 586 HIS A HD1  1  
ATOM 864   H HD2  . HIS A 1 72  ? -7.506  12.650  9.295   1.00 3.61  ? 586 HIS A HD2  1  
ATOM 865   H HE1  . HIS A 1 72  ? -5.927  12.484  13.253  1.00 3.22  ? 586 HIS A HE1  1  
ATOM 866   N N    . GLY A 1 73  ? -6.531  8.493   9.606   1.00 0.75  ? 587 GLY A N    1  
ATOM 867   C CA   . GLY A 1 73  ? -7.848  7.888   9.752   1.00 0.74  ? 587 GLY A CA   1  
ATOM 868   C C    . GLY A 1 73  ? -7.735  6.445   10.219  1.00 0.77  ? 587 GLY A C    1  
ATOM 869   O O    . GLY A 1 73  ? -6.654  5.969   10.570  1.00 0.88  ? 587 GLY A O    1  
ATOM 870   H H    . GLY A 1 73  ? -5.822  8.135   10.231  1.00 0.80  ? 587 GLY A H    1  
ATOM 871   H HA2  . GLY A 1 73  ? -8.428  8.447   10.485  1.00 0.89  ? 587 GLY A HA2  1  
ATOM 872   H HA3  . GLY A 1 73  ? -8.383  7.903   8.803   1.00 0.74  ? 587 GLY A HA3  1  
ATOM 873   N N    . VAL A 1 74  ? -8.868  5.749   10.186  1.00 0.79  ? 588 VAL A N    1  
ATOM 874   C CA   . VAL A 1 74  ? -9.015  4.361   10.614  1.00 0.91  ? 588 VAL A CA   1  
ATOM 875   C C    . VAL A 1 74  ? -9.832  3.619   9.549   1.00 0.94  ? 588 VAL A C    1  
ATOM 876   O O    . VAL A 1 74  ? -10.683 4.209   8.875   1.00 0.94  ? 588 VAL A O    1  
ATOM 877   C CB   . VAL A 1 74  ? -9.676  4.289   12.016  1.00 1.01  ? 588 VAL A CB   1  
ATOM 878   C CG1  . VAL A 1 74  ? -9.857  2.863   12.553  1.00 1.11  ? 588 VAL A CG1  1  
ATOM 879   C CG2  . VAL A 1 74  ? -8.859  5.050   13.070  1.00 1.05  ? 588 VAL A CG2  1  
ATOM 880   H H    . VAL A 1 74  ? -9.695  6.178   9.803   1.00 0.77  ? 588 VAL A H    1  
ATOM 881   H HA   . VAL A 1 74  ? -8.016  3.929   10.672  1.00 0.92  ? 588 VAL A HA   1  
ATOM 882   H HB   . VAL A 1 74  ? -10.660 4.754   11.959  1.00 1.02  ? 588 VAL A HB   1  
ATOM 883   H HG11 . VAL A 1 74  ? -10.336 2.899   13.533  1.00 1.41  ? 588 VAL A HG11 1  
ATOM 884   H HG12 . VAL A 1 74  ? -10.500 2.280   11.899  1.00 1.76  ? 588 VAL A HG12 1  
ATOM 885   H HG13 . VAL A 1 74  ? -8.891  2.370   12.652  1.00 2.19  ? 588 VAL A HG13 1  
ATOM 886   H HG21 . VAL A 1 74  ? -7.846  4.650   13.121  1.00 2.22  ? 588 VAL A HG21 1  
ATOM 887   H HG22 . VAL A 1 74  ? -8.816  6.110   12.828  1.00 1.45  ? 588 VAL A HG22 1  
ATOM 888   H HG23 . VAL A 1 74  ? -9.335  4.951   14.046  1.00 1.65  ? 588 VAL A HG23 1  
ATOM 889   N N    . VAL A 1 75  ? -9.591  2.323   9.394   1.00 1.00  ? 589 VAL A N    1  
ATOM 890   C CA   . VAL A 1 75  ? -10.403 1.397   8.592   1.00 0.99  ? 589 VAL A CA   1  
ATOM 891   C C    . VAL A 1 75  ? -10.947 0.268   9.461   1.00 0.95  ? 589 VAL A C    1  
ATOM 892   O O    . VAL A 1 75  ? -10.310 -0.129  10.434  1.00 0.92  ? 589 VAL A O    1  
ATOM 893   C CB   . VAL A 1 75  ? -9.629  0.814   7.398   1.00 1.04  ? 589 VAL A CB   1  
ATOM 894   C CG1  . VAL A 1 75  ? -9.373  1.867   6.313   1.00 1.07  ? 589 VAL A CG1  1  
ATOM 895   C CG2  . VAL A 1 75  ? -8.309  0.178   7.837   1.00 1.03  ? 589 VAL A CG2  1  
ATOM 896   H H    . VAL A 1 75  ? -8.867  1.911   9.979   1.00 1.01  ? 589 VAL A H    1  
ATOM 897   H HA   . VAL A 1 75  ? -11.263 1.922   8.185   1.00 1.03  ? 589 VAL A HA   1  
ATOM 898   H HB   . VAL A 1 75  ? -10.240 0.033   6.955   1.00 1.13  ? 589 VAL A HB   1  
ATOM 899   H HG11 . VAL A 1 75  ? -8.957  1.388   5.429   1.00 2.23  ? 589 VAL A HG11 1  
ATOM 900   H HG12 . VAL A 1 75  ? -10.311 2.331   6.019   1.00 1.51  ? 589 VAL A HG12 1  
ATOM 901   H HG13 . VAL A 1 75  ? -8.692  2.636   6.678   1.00 1.68  ? 589 VAL A HG13 1  
ATOM 902   H HG21 . VAL A 1 75  ? -7.616  0.951   8.177   1.00 1.87  ? 589 VAL A HG21 1  
ATOM 903   H HG22 . VAL A 1 75  ? -8.489  -0.522  8.651   1.00 1.61  ? 589 VAL A HG22 1  
ATOM 904   H HG23 . VAL A 1 75  ? -7.872  -0.387  7.017   1.00 1.97  ? 589 VAL A HG23 1  
ATOM 905   N N    . SER A 1 76  ? -12.086 -0.283  9.056   1.00 0.99  ? 590 SER A N    1  
ATOM 906   C CA   . SER A 1 76  ? -12.658 -1.533  9.574   1.00 1.06  ? 590 SER A CA   1  
ATOM 907   C C    . SER A 1 76  ? -12.656 -2.534  8.419   1.00 1.10  ? 590 SER A C    1  
ATOM 908   O O    . SER A 1 76  ? -13.062 -2.247  7.290   1.00 1.07  ? 590 SER A O    1  
ATOM 909   C CB   . SER A 1 76  ? -14.078 -1.309  10.105  1.00 1.15  ? 590 SER A CB   1  
ATOM 910   O OG   . SER A 1 76  ? -14.022 -0.756  11.402  1.00 1.40  ? 590 SER A OG   1  
ATOM 911   H H    . SER A 1 76  ? -12.457 0.052   8.171   1.00 1.07  ? 590 SER A H    1  
ATOM 912   H HA   . SER A 1 76  ? -12.026 -1.942  10.393  1.00 1.11  ? 590 SER A HA   1  
ATOM 913   H HB2  . SER A 1 76  ? -14.641 -0.658  9.433   1.00 1.18  ? 590 SER A HB2  1  
ATOM 914   H HB3  . SER A 1 76  ? -14.588 -2.270  10.173  1.00 1.28  ? 590 SER A HB3  1  
ATOM 915   H HG   . SER A 1 76  ? -14.212 0.205   11.391  1.00 1.49  ? 590 SER A HG   1  
ATOM 916   N N    . VAL A 1 77  ? -12.034 -3.669  8.678   1.00 1.24  ? 591 VAL A N    1  
ATOM 917   C CA   . VAL A 1 77  ? -11.189 -4.395  7.739   1.00 1.27  ? 591 VAL A CA   1  
ATOM 918   C C    . VAL A 1 77  ? -11.419 -5.884  7.963   1.00 1.52  ? 591 VAL A C    1  
ATOM 919   O O    . VAL A 1 77  ? -11.720 -6.288  9.087   1.00 1.57  ? 591 VAL A O    1  
ATOM 920   C CB   . VAL A 1 77  ? -9.740  -3.962  8.044   1.00 1.49  ? 591 VAL A CB   1  
ATOM 921   C CG1  . VAL A 1 77  ? -9.423  -4.074  9.517   1.00 2.50  ? 591 VAL A CG1  1  
ATOM 922   C CG2  . VAL A 1 77  ? -8.656  -4.845  7.516   1.00 1.42  ? 591 VAL A CG2  1  
ATOM 923   H H    . VAL A 1 77  ? -11.800 -3.885  9.643   1.00 1.34  ? 591 VAL A H    1  
ATOM 924   H HA   . VAL A 1 77  ? -11.416 -4.150  6.701   1.00 1.24  ? 591 VAL A HA   1  
ATOM 925   H HB   . VAL A 1 77  ? -9.573  -2.935  7.723   1.00 2.35  ? 591 VAL A HB   1  
ATOM 926   H HG11 . VAL A 1 77  ? -8.367  -3.933  9.739   1.00 3.36  ? 591 VAL A HG11 1  
ATOM 927   H HG12 . VAL A 1 77  ? -9.960  -3.285  10.006  1.00 3.28  ? 591 VAL A HG12 1  
ATOM 928   H HG13 . VAL A 1 77  ? -9.737  -5.089  9.816   1.00 2.85  ? 591 VAL A HG13 1  
ATOM 929   H HG21 . VAL A 1 77  ? -8.715  -5.780  8.079   1.00 2.01  ? 591 VAL A HG21 1  
ATOM 930   H HG22 . VAL A 1 77  ? -8.792  -4.977  6.452   1.00 2.28  ? 591 VAL A HG22 1  
ATOM 931   H HG23 . VAL A 1 77  ? -7.728  -4.330  7.757   1.00 2.19  ? 591 VAL A HG23 1  
ATOM 932   N N    . LEU A 1 78  ? -11.232 -6.715  6.945   1.00 1.80  ? 592 LEU A N    1  
ATOM 933   C CA   . LEU A 1 78  ? -11.196 -8.161  7.144   1.00 2.19  ? 592 LEU A CA   1  
ATOM 934   C C    . LEU A 1 78  ? -9.860  -8.701  6.643   1.00 2.44  ? 592 LEU A C    1  
ATOM 935   O O    . LEU A 1 78  ? -9.512  -8.422  5.492   1.00 2.37  ? 592 LEU A O    1  
ATOM 936   C CB   . LEU A 1 78  ? -12.340 -8.861  6.366   1.00 2.45  ? 592 LEU A CB   1  
ATOM 937   C CG   . LEU A 1 78  ? -13.820 -8.529  6.647   1.00 2.49  ? 592 LEU A CG   1  
ATOM 938   C CD1  . LEU A 1 78  ? -14.174 -8.648  8.123   1.00 2.46  ? 592 LEU A CD1  1  
ATOM 939   C CD2  . LEU A 1 78  ? -14.283 -7.160  6.145   1.00 2.47  ? 592 LEU A CD2  1  
ATOM 940   H H    . LEU A 1 78  ? -11.015 -6.354  6.016   1.00 1.76  ? 592 LEU A H    1  
ATOM 941   H HA   . LEU A 1 78  ? -11.258 -8.378  8.212   1.00 2.26  ? 592 LEU A HA   1  
ATOM 942   H HB2  . LEU A 1 78  ? -12.176 -8.701  5.299   1.00 2.51  ? 592 LEU A HB2  1  
ATOM 943   H HB3  . LEU A 1 78  ? -12.226 -9.933  6.534   1.00 2.73  ? 592 LEU A HB3  1  
ATOM 944   H HG   . LEU A 1 78  ? -14.408 -9.273  6.112   1.00 2.88  ? 592 LEU A HG   1  
ATOM 945   H HD11 . LEU A 1 78  ? -13.713 -7.834  8.674   1.00 2.82  ? 592 LEU A HD11 1  
ATOM 946   H HD12 . LEU A 1 78  ? -13.833 -9.609  8.509   1.00 3.15  ? 592 LEU A HD12 1  
ATOM 947   H HD13 . LEU A 1 78  ? -15.254 -8.582  8.243   1.00 2.35  ? 592 LEU A HD13 1  
ATOM 948   H HD21 . LEU A 1 78  ? -15.365 -7.090  6.244   1.00 2.40  ? 592 LEU A HD21 1  
ATOM 949   H HD22 . LEU A 1 78  ? -14.023 -7.046  5.094   1.00 3.40  ? 592 LEU A HD22 1  
ATOM 950   H HD23 . LEU A 1 78  ? -13.836 -6.357  6.724   1.00 2.71  ? 592 LEU A HD23 1  
ATOM 951   N N    . THR A 1 79  ? -9.160  -9.544  7.416   1.00 2.80  ? 593 THR A N    1  
ATOM 952   C CA   . THR A 1 79  ? -8.213  -10.485 6.766   1.00 3.03  ? 593 THR A CA   1  
ATOM 953   C C    . THR A 1 79  ? -8.848  -11.855 6.515   1.00 3.20  ? 593 THR A C    1  
ATOM 954   O O    . THR A 1 79  ? -9.414  -12.475 7.418   1.00 3.43  ? 593 THR A O    1  
ATOM 955   C CB   . THR A 1 79  ? -6.815  -10.529 7.409   1.00 3.33  ? 593 THR A CB   1  
ATOM 956   O OG1  . THR A 1 79  ? -6.816  -10.285 8.795   1.00 3.47  ? 593 THR A OG1  1  
ATOM 957   C CG2  . THR A 1 79  ? -5.945  -9.454  6.760   1.00 3.29  ? 593 THR A CG2  1  
ATOM 958   H H    . THR A 1 79  ? -9.382  -9.652  8.419   1.00 2.91  ? 593 THR A H    1  
ATOM 959   H HA   . THR A 1 79  ? -8.012  -10.120 5.761   1.00 2.92  ? 593 THR A HA   1  
ATOM 960   H HB   . THR A 1 79  ? -6.355  -11.497 7.231   1.00 3.57  ? 593 THR A HB   1  
ATOM 961   H HG1  . THR A 1 79  ? -5.874  -10.274 9.068   1.00 3.84  ? 593 THR A HG1  1  
ATOM 962   H HG21 . THR A 1 79  ? -5.759  -9.728  5.718   1.00 3.83  ? 593 THR A HG21 1  
ATOM 963   H HG22 . THR A 1 79  ? -4.986  -9.383  7.273   1.00 3.85  ? 593 THR A HG22 1  
ATOM 964   H HG23 . THR A 1 79  ? -6.461  -8.490  6.791   1.00 3.05  ? 593 THR A HG23 1  
ATOM 965   N N    . LYS A 1 80  ? -8.814  -12.320 5.256   1.00 3.16  ? 594 LYS A N    1  
ATOM 966   C CA   . LYS A 1 80  ? -9.547  -13.500 4.755   1.00 3.26  ? 594 LYS A CA   1  
ATOM 967   C C    . LYS A 1 80  ? -9.256  -14.803 5.511   1.00 3.70  ? 594 LYS A C    1  
ATOM 968   O O    . LYS A 1 80  ? -10.186 -15.558 5.782   1.00 3.53  ? 594 LYS A O    1  
ATOM 969   C CB   . LYS A 1 80  ? -9.380  -13.650 3.227   1.00 3.22  ? 594 LYS A CB   1  
ATOM 970   C CG   . LYS A 1 80  ? -7.949  -13.864 2.702   1.00 3.60  ? 594 LYS A CG   1  
ATOM 971   C CD   . LYS A 1 80  ? -7.187  -12.566 2.383   1.00 3.70  ? 594 LYS A CD   1  
ATOM 972   C CE   . LYS A 1 80  ? -5.776  -12.896 1.882   1.00 4.28  ? 594 LYS A CE   1  
ATOM 973   N NZ   . LYS A 1 80  ? -5.128  -11.729 1.242   1.00 5.35  ? 594 LYS A NZ   1  
ATOM 974   H H    . LYS A 1 80  ? -8.417  -11.705 4.555   1.00 3.01  ? 594 LYS A H    1  
ATOM 975   H HA   . LYS A 1 80  ? -10.605 -13.315 4.916   1.00 3.14  ? 594 LYS A HA   1  
ATOM 976   H HB2  . LYS A 1 80  ? -9.971  -14.514 2.921   1.00 3.34  ? 594 LYS A HB2  1  
ATOM 977   H HB3  . LYS A 1 80  ? -9.817  -12.784 2.728   1.00 2.91  ? 594 LYS A HB3  1  
ATOM 978   H HG2  . LYS A 1 80  ? -7.392  -14.458 3.420   1.00 3.96  ? 594 LYS A HG2  1  
ATOM 979   H HG3  . LYS A 1 80  ? -8.015  -14.441 1.778   1.00 3.69  ? 594 LYS A HG3  1  
ATOM 980   H HD2  . LYS A 1 80  ? -7.737  -12.025 1.612   1.00 3.59  ? 594 LYS A HD2  1  
ATOM 981   H HD3  . LYS A 1 80  ? -7.106  -11.935 3.266   1.00 3.73  ? 594 LYS A HD3  1  
ATOM 982   H HE2  . LYS A 1 80  ? -5.171  -13.242 2.728   1.00 4.15  ? 594 LYS A HE2  1  
ATOM 983   H HE3  . LYS A 1 80  ? -5.844  -13.710 1.154   1.00 4.88  ? 594 LYS A HE3  1  
ATOM 984   H HZ1  . LYS A 1 80  ? -4.375  -12.038 0.633   1.00 5.98  ? 594 LYS A HZ1  1  
ATOM 985   H HZ2  . LYS A 1 80  ? -4.699  -11.104 1.923   1.00 5.81  ? 594 LYS A HZ2  1  
ATOM 986   H HZ3  . LYS A 1 80  ? -5.788  -11.217 0.665   1.00 5.78  ? 594 LYS A HZ3  1  
ATOM 987   N N    . GLY A 1 81  ? -8.020  -15.014 5.959   1.00 4.94  ? 595 GLY A N    1  
ATOM 988   C CA   . GLY A 1 81  ? -7.613  -16.133 6.820   1.00 5.51  ? 595 GLY A CA   1  
ATOM 989   C C    . GLY A 1 81  ? -8.143  -16.070 8.251   1.00 5.34  ? 595 GLY A C    1  
ATOM 990   O O    . GLY A 1 81  ? -8.079  -17.049 8.998   1.00 5.78  ? 595 GLY A O    1  
ATOM 991   H H    . GLY A 1 81  ? -7.313  -14.329 5.711   1.00 5.81  ? 595 GLY A H    1  
ATOM 992   H HA2  . GLY A 1 81  ? -7.901  -17.080 6.370   1.00 5.93  ? 595 GLY A HA2  1  
ATOM 993   H HA3  . GLY A 1 81  ? -6.530  -16.080 6.934   1.00 5.76  ? 595 GLY A HA3  1  
ATOM 994   N N    . ASN A 1 82  ? -8.595  -14.891 8.657   1.00 4.72  ? 596 ASN A N    1  
ATOM 995   C CA   . ASN A 1 82  ? -8.487  -14.411 10.021  1.00 4.49  ? 596 ASN A CA   1  
ATOM 996   C C    . ASN A 1 82  ? -9.768  -13.658 10.425  1.00 4.09  ? 596 ASN A C    1  
ATOM 997   O O    . ASN A 1 82  ? -10.883 -14.098 10.120  1.00 4.22  ? 596 ASN A O    1  
ATOM 998   C CB   . ASN A 1 82  ? -7.235  -13.517 10.080  1.00 4.31  ? 596 ASN A CB   1  
ATOM 999   C CG   . ASN A 1 82  ? -5.898  -14.143 9.714   1.00 4.73  ? 596 ASN A CG   1  
ATOM 1000  O OD1  . ASN A 1 82  ? -5.714  -15.351 9.643   1.00 5.19  ? 596 ASN A OD1  1  
ATOM 1001  N ND2  . ASN A 1 82  ? -4.881  -13.336 9.547   1.00 4.68  ? 596 ASN A ND2  1  
ATOM 1002  H H    . ASN A 1 82  ? -8.734  -14.176 7.955   1.00 4.38  ? 596 ASN A H    1  
ATOM 1003  H HA   . ASN A 1 82  ? -8.355  -15.237 10.717  1.00 4.81  ? 596 ASN A HA   1  
ATOM 1004  H HB2  . ASN A 1 82  ? -7.434  -12.621 9.510   1.00 4.02  ? 596 ASN A HB2  1  
ATOM 1005  H HB3  . ASN A 1 82  ? -7.102  -13.168 11.080  1.00 4.19  ? 596 ASN A HB3  1  
ATOM 1006  H HD21 . ASN A 1 82  ? -4.977  -12.334 9.668   1.00 4.42  ? 596 ASN A HD21 1  
ATOM 1007  H HD22 . ASN A 1 82  ? -3.972  -13.749 9.415   1.00 4.99  ? 596 ASN A HD22 1  
ATOM 1008  N N    . LYS A 1 83  ? -9.606  -12.549 11.156  1.00 3.73  ? 597 LYS A N    1  
ATOM 1009  C CA   . LYS A 1 83  ? -10.669 -11.807 11.809  1.00 3.41  ? 597 LYS A CA   1  
ATOM 1010  C C    . LYS A 1 83  ? -11.078 -10.537 11.077  1.00 2.89  ? 597 LYS A C    1  
ATOM 1011  O O    . LYS A 1 83  ? -10.342 -9.987  10.254  1.00 2.80  ? 597 LYS A O    1  
ATOM 1012  C CB   . LYS A 1 83  ? -10.308 -11.533 13.289  1.00 3.45  ? 597 LYS A CB   1  
ATOM 1013  C CG   . LYS A 1 83  ? -10.101 -12.760 14.205  1.00 3.87  ? 597 LYS A CG   1  
ATOM 1014  C CD   . LYS A 1 83  ? -8.823  -13.606 14.036  1.00 4.27  ? 597 LYS A CD   1  
ATOM 1015  C CE   . LYS A 1 83  ? -7.502  -12.845 13.838  1.00 4.92  ? 597 LYS A CE   1  
ATOM 1016  N NZ   . LYS A 1 83  ? -7.058  -12.072 15.028  1.00 5.45  ? 597 LYS A NZ   1  
ATOM 1017  H H    . LYS A 1 83  ? -8.673  -12.156 11.237  1.00 3.75  ? 597 LYS A H    1  
ATOM 1018  H HA   . LYS A 1 83  ? -11.551 -12.414 11.745  1.00 3.64  ? 597 LYS A HA   1  
ATOM 1019  H HB2  . LYS A 1 83  ? -9.427  -10.892 13.333  1.00 3.53  ? 597 LYS A HB2  1  
ATOM 1020  H HB3  . LYS A 1 83  ? -11.127 -10.962 13.729  1.00 3.27  ? 597 LYS A HB3  1  
ATOM 1021  H HG2  . LYS A 1 83  ? -10.115 -12.404 15.233  1.00 3.95  ? 597 LYS A HG2  1  
ATOM 1022  H HG3  . LYS A 1 83  ? -10.962 -13.420 14.096  1.00 4.07  ? 597 LYS A HG3  1  
ATOM 1023  H HD2  . LYS A 1 83  ? -8.727  -14.264 14.902  1.00 4.50  ? 597 LYS A HD2  1  
ATOM 1024  H HD3  . LYS A 1 83  ? -8.959  -14.253 13.172  1.00 4.53  ? 597 LYS A HD3  1  
ATOM 1025  H HE2  . LYS A 1 83  ? -6.727  -13.574 13.584  1.00 5.81  ? 597 LYS A HE2  1  
ATOM 1026  H HE3  . LYS A 1 83  ? -7.605  -12.194 12.967  1.00 4.68  ? 597 LYS A HE3  1  
ATOM 1027  H HZ1  . LYS A 1 83  ? -7.735  -11.374 15.326  1.00 5.57  ? 597 LYS A HZ1  1  
ATOM 1028  H HZ2  . LYS A 1 83  ? -6.185  -11.591 14.825  1.00 6.33  ? 597 LYS A HZ2  1  
ATOM 1029  H HZ3  . LYS A 1 83  ? -6.844  -12.681 15.814  1.00 5.51  ? 597 LYS A HZ3  1  
ATOM 1030  N N    . GLU A 1 84  ? -12.253 -10.042 11.455  1.00 2.70  ? 598 GLU A N    1  
ATOM 1031  C CA   . GLU A 1 84  ? -12.535 -8.620  11.330  1.00 2.30  ? 598 GLU A CA   1  
ATOM 1032  C C    . GLU A 1 84  ? -11.626 -7.829  12.287  1.00 2.02  ? 598 GLU A C    1  
ATOM 1033  O O    . GLU A 1 84  ? -11.506 -8.152  13.471  1.00 2.07  ? 598 GLU A O    1  
ATOM 1034  C CB   . GLU A 1 84  ? -14.038 -8.325  11.499  1.00 2.51  ? 598 GLU A CB   1  
ATOM 1035  C CG   . GLU A 1 84  ? -14.588 -8.490  12.920  1.00 2.78  ? 598 GLU A CG   1  
ATOM 1036  C CD   . GLU A 1 84  ? -16.101 -8.253  12.950  1.00 3.00  ? 598 GLU A CD   1  
ATOM 1037  O OE1  . GLU A 1 84  ? -16.884 -9.173  12.605  1.00 4.11  ? 598 GLU A OE1  1  
ATOM 1038  O OE2  . GLU A 1 84  ? -16.530 -7.144  13.347  1.00 2.87  ? 598 GLU A OE2  1  
ATOM 1039  H H    . GLU A 1 84  ? -12.823 -10.583 12.091  1.00 2.92  ? 598 GLU A H    1  
ATOM 1040  H HA   . GLU A 1 84  ? -12.267 -8.345  10.315  1.00 2.20  ? 598 GLU A HA   1  
ATOM 1041  H HB2  . GLU A 1 84  ? -14.227 -7.304  11.170  1.00 2.47  ? 598 GLU A HB2  1  
ATOM 1042  H HB3  . GLU A 1 84  ? -14.596 -8.993  10.843  1.00 3.07  ? 598 GLU A HB3  1  
ATOM 1043  H HG2  . GLU A 1 84  ? -14.360 -9.494  13.279  1.00 3.43  ? 598 GLU A HG2  1  
ATOM 1044  H HG3  . GLU A 1 84  ? -14.103 -7.773  13.584  1.00 2.80  ? 598 GLU A HG3  1  
ATOM 1045  N N    . MET A 1 85  ? -10.950 -6.812  11.761  1.00 1.81  ? 599 MET A N    1  
ATOM 1046  C CA   . MET A 1 85  ? -10.050 -5.913  12.487  1.00 1.59  ? 599 MET A CA   1  
ATOM 1047  C C    . MET A 1 85  ? -10.497 -4.461  12.334  1.00 1.36  ? 599 MET A C    1  
ATOM 1048  O O    . MET A 1 85  ? -11.454 -4.157  11.611  1.00 1.50  ? 599 MET A O    1  
ATOM 1049  C CB   . MET A 1 85  ? -8.558  -6.130  12.150  1.00 1.71  ? 599 MET A CB   1  
ATOM 1050  C CG   . MET A 1 85  ? -8.092  -7.583  12.100  1.00 2.13  ? 599 MET A CG   1  
ATOM 1051  S SD   . MET A 1 85  ? -6.387  -7.742  11.492  1.00 2.62  ? 599 MET A SD   1  
ATOM 1052  C CE   . MET A 1 85  ? -6.606  -7.295  9.746   1.00 2.65  ? 599 MET A CE   1  
ATOM 1053  H H    . MET A 1 85  ? -11.115 -6.605  10.780  1.00 1.75  ? 599 MET A H    1  
ATOM 1054  H HA   . MET A 1 85  ? -10.128 -6.107  13.533  1.00 1.66  ? 599 MET A HA   1  
ATOM 1055  H HB2  . MET A 1 85  ? -8.314  -5.681  11.201  1.00 2.05  ? 599 MET A HB2  1  
ATOM 1056  H HB3  . MET A 1 85  ? -7.953  -5.616  12.896  1.00 1.95  ? 599 MET A HB3  1  
ATOM 1057  H HG2  . MET A 1 85  ? -8.157  -8.004  13.104  1.00 2.42  ? 599 MET A HG2  1  
ATOM 1058  H HG3  . MET A 1 85  ? -8.744  -8.157  11.442  1.00 2.59  ? 599 MET A HG3  1  
ATOM 1059  H HE1  . MET A 1 85  ? -5.713  -7.576  9.186   1.00 3.61  ? 599 MET A HE1  1  
ATOM 1060  H HE2  . MET A 1 85  ? -7.466  -7.825  9.335   1.00 2.41  ? 599 MET A HE2  1  
ATOM 1061  H HE3  . MET A 1 85  ? -6.764  -6.222  9.653   1.00 3.05  ? 599 MET A HE3  1  
ATOM 1062  N N    . LYS A 1 86  ? -9.791  -3.566  13.023  1.00 1.34  ? 600 LYS A N    1  
ATOM 1063  C CA   . LYS A 1 86  ? -9.408  -2.245  12.546  1.00 1.33  ? 600 LYS A CA   1  
ATOM 1064  C C    . LYS A 1 86  ? -7.932  -2.157  12.175  1.00 1.36  ? 600 LYS A C    1  
ATOM 1065  O O    . LYS A 1 86  ? -7.093  -2.874  12.720  1.00 1.52  ? 600 LYS A O    1  
ATOM 1066  C CB   . LYS A 1 86  ? -9.676  -1.182  13.642  1.00 1.40  ? 600 LYS A CB   1  
ATOM 1067  C CG   . LYS A 1 86  ? -11.092 -0.620  13.775  1.00 1.28  ? 600 LYS A CG   1  
ATOM 1068  C CD   . LYS A 1 86  ? -12.210 -1.654  13.747  1.00 1.69  ? 600 LYS A CD   1  
ATOM 1069  C CE   . LYS A 1 86  ? -12.183 -2.671  14.901  1.00 2.30  ? 600 LYS A CE   1  
ATOM 1070  N NZ   . LYS A 1 86  ? -12.854 -2.148  16.113  1.00 2.84  ? 600 LYS A NZ   1  
ATOM 1071  H H    . LYS A 1 86  ? -9.218  -3.912  13.763  1.00 1.55  ? 600 LYS A H    1  
ATOM 1072  H HA   . LYS A 1 86  ? -9.934  -2.098  11.604  1.00 1.37  ? 600 LYS A HA   1  
ATOM 1073  H HB2  . LYS A 1 86  ? -9.375  -1.596  14.607  1.00 1.76  ? 600 LYS A HB2  1  
ATOM 1074  H HB3  . LYS A 1 86  ? -9.031  -0.318  13.469  1.00 1.71  ? 600 LYS A HB3  1  
ATOM 1075  H HG2  . LYS A 1 86  ? -11.142 -0.062  14.704  1.00 1.37  ? 600 LYS A HG2  1  
ATOM 1076  H HG3  . LYS A 1 86  ? -11.258 0.065   12.948  1.00 1.28  ? 600 LYS A HG3  1  
ATOM 1077  H HD2  . LYS A 1 86  ? -13.169 -1.141  13.753  1.00 1.93  ? 600 LYS A HD2  1  
ATOM 1078  H HD3  . LYS A 1 86  ? -12.106 -2.147  12.784  1.00 1.60  ? 600 LYS A HD3  1  
ATOM 1079  H HE2  . LYS A 1 86  ? -12.706 -3.575  14.576  1.00 2.21  ? 600 LYS A HE2  1  
ATOM 1080  H HE3  . LYS A 1 86  ? -11.148 -2.943  15.127  1.00 3.21  ? 600 LYS A HE3  1  
ATOM 1081  H HZ1  . LYS A 1 86  ? -13.833 -1.961  15.907  1.00 2.57  ? 600 LYS A HZ1  1  
ATOM 1082  H HZ2  . LYS A 1 86  ? -12.440 -1.278  16.438  1.00 3.45  ? 600 LYS A HZ2  1  
ATOM 1083  H HZ3  . LYS A 1 86  ? -12.813 -2.826  16.872  1.00 3.93  ? 600 LYS A HZ3  1  
ATOM 1084  N N    . LEU A 1 87  ? -7.650  -1.188  11.310  1.00 1.22  ? 601 LEU A N    1  
ATOM 1085  C CA   . LEU A 1 87  ? -6.303  -0.670  10.991  1.00 1.18  ? 601 LEU A CA   1  
ATOM 1086  C C    . LEU A 1 87  ? -6.266  0.867   11.126  1.00 1.07  ? 601 LEU A C    1  
ATOM 1087  O O    . LEU A 1 87  ? -7.260  1.531   10.839  1.00 1.07  ? 601 LEU A O    1  
ATOM 1088  C CB   . LEU A 1 87  ? -5.852  -1.129  9.583   1.00 1.27  ? 601 LEU A CB   1  
ATOM 1089  C CG   . LEU A 1 87  ? -4.621  -2.048  9.545   1.00 1.43  ? 601 LEU A CG   1  
ATOM 1090  C CD1  . LEU A 1 87  ? -4.957  -3.418  10.125  1.00 1.57  ? 601 LEU A CD1  1  
ATOM 1091  C CD2  . LEU A 1 87  ? -4.185  -2.259  8.093   1.00 1.57  ? 601 LEU A CD2  1  
ATOM 1092  H H    . LEU A 1 87  ? -8.469  -0.658  11.012  1.00 1.11  ? 601 LEU A H    1  
ATOM 1093  H HA   . LEU A 1 87  ? -5.600  -1.069  11.723  1.00 1.21  ? 601 LEU A HA   1  
ATOM 1094  H HB2  . LEU A 1 87  ? -6.665  -1.656  9.088   1.00 1.34  ? 601 LEU A HB2  1  
ATOM 1095  H HB3  . LEU A 1 87  ? -5.624  -0.244  8.989   1.00 1.32  ? 601 LEU A HB3  1  
ATOM 1096  H HG   . LEU A 1 87  ? -3.801  -1.596  10.103  1.00 1.50  ? 601 LEU A HG   1  
ATOM 1097  H HD11 . LEU A 1 87  ? -5.853  -3.808  9.641   1.00 1.73  ? 601 LEU A HD11 1  
ATOM 1098  H HD12 . LEU A 1 87  ? -5.131  -3.332  11.195  1.00 1.86  ? 601 LEU A HD12 1  
ATOM 1099  H HD13 . LEU A 1 87  ? -4.126  -4.105  9.967   1.00 2.71  ? 601 LEU A HD13 1  
ATOM 1100  H HD21 . LEU A 1 87  ? -3.963  -1.302  7.623   1.00 2.27  ? 601 LEU A HD21 1  
ATOM 1101  H HD22 . LEU A 1 87  ? -4.973  -2.767  7.534   1.00 1.56  ? 601 LEU A HD22 1  
ATOM 1102  H HD23 . LEU A 1 87  ? -3.284  -2.872  8.067   1.00 2.51  ? 601 LEU A HD23 1  
ATOM 1103  N N    . SER A 1 88  ? -5.129  1.434   11.536  1.00 1.04  ? 602 SER A N    1  
ATOM 1104  C CA   . SER A 1 88  ? -4.970  2.855   11.919  1.00 1.00  ? 602 SER A CA   1  
ATOM 1105  C C    . SER A 1 88  ? -3.796  3.561   11.222  1.00 1.03  ? 602 SER A C    1  
ATOM 1106  O O    . SER A 1 88  ? -2.927  2.918   10.631  1.00 1.23  ? 602 SER A O    1  
ATOM 1107  C CB   . SER A 1 88  ? -4.849  2.973   13.446  1.00 1.09  ? 602 SER A CB   1  
ATOM 1108  O OG   . SER A 1 88  ? -3.846  2.113   13.960  1.00 1.83  ? 602 SER A OG   1  
ATOM 1109  H H    . SER A 1 88  ? -4.350  0.822   11.736  1.00 1.08  ? 602 SER A H    1  
ATOM 1110  H HA   . SER A 1 88  ? -5.867  3.405   11.631  1.00 1.00  ? 602 SER A HA   1  
ATOM 1111  H HB2  . SER A 1 88  ? -4.615  4.001   13.721  1.00 1.45  ? 602 SER A HB2  1  
ATOM 1112  H HB3  . SER A 1 88  ? -5.807  2.709   13.894  1.00 1.04  ? 602 SER A HB3  1  
ATOM 1113  H HG   . SER A 1 88  ? -3.828  2.227   14.933  1.00 2.16  ? 602 SER A HG   1  
ATOM 1114  N N    . ASP A 1 89  ? -3.777  4.898   11.257  1.00 0.91  ? 603 ASP A N    1  
ATOM 1115  C CA   . ASP A 1 89  ? -2.862  5.748   10.475  1.00 0.92  ? 603 ASP A CA   1  
ATOM 1116  C C    . ASP A 1 89  ? -1.367  5.359   10.545  1.00 1.06  ? 603 ASP A C    1  
ATOM 1117  O O    . ASP A 1 89  ? -0.863  4.893   11.570  1.00 1.16  ? 603 ASP A O    1  
ATOM 1118  C CB   . ASP A 1 89  ? -3.070  7.225   10.836  1.00 1.01  ? 603 ASP A CB   1  
ATOM 1119  C CG   . ASP A 1 89  ? -2.467  7.597   12.190  1.00 1.16  ? 603 ASP A CG   1  
ATOM 1120  O OD1  . ASP A 1 89  ? -3.105  7.328   13.234  1.00 1.83  ? 603 ASP A OD1  1  
ATOM 1121  O OD2  . ASP A 1 89  ? -1.367  8.200   12.209  1.00 1.65  ? 603 ASP A OD2  1  
ATOM 1122  H H    . ASP A 1 89  ? -4.539  5.357   11.746  1.00 0.84  ? 603 ASP A H    1  
ATOM 1123  H HA   . ASP A 1 89  ? -3.160  5.643   9.434   1.00 0.89  ? 603 ASP A HA   1  
ATOM 1124  H HB2  . ASP A 1 89  ? -2.604  7.837   10.061  1.00 1.11  ? 603 ASP A HB2  1  
ATOM 1125  H HB3  . ASP A 1 89  ? -4.137  7.452   10.839  1.00 1.05  ? 603 ASP A HB3  1  
ATOM 1126  N N    . GLY A 1 90  ? -0.659  5.533   9.427   1.00 1.18  ? 604 GLY A N    1  
ATOM 1127  C CA   . GLY A 1 90  ? 0.697   5.022   9.189   1.00 1.41  ? 604 GLY A CA   1  
ATOM 1128  C C    . GLY A 1 90  ? 0.735   3.604   8.601   1.00 1.54  ? 604 GLY A C    1  
ATOM 1129  O O    . GLY A 1 90  ? 1.715   3.244   7.947   1.00 1.95  ? 604 GLY A O    1  
ATOM 1130  H H    . GLY A 1 90  ? -1.117  5.966   8.629   1.00 1.14  ? 604 GLY A H    1  
ATOM 1131  H HA2  . GLY A 1 90  ? 1.212   5.690   8.500   1.00 1.57  ? 604 GLY A HA2  1  
ATOM 1132  H HA3  . GLY A 1 90  ? 1.245   5.009   10.130  1.00 1.41  ? 604 GLY A HA3  1  
ATOM 1133  N N    . SER A 1 91  ? -0.338  2.826   8.779   1.00 1.37  ? 605 SER A N    1  
ATOM 1134  C CA   . SER A 1 91  ? -0.508  1.484   8.201   1.00 1.46  ? 605 SER A CA   1  
ATOM 1135  C C    . SER A 1 91  ? -0.683  1.492   6.678   1.00 1.45  ? 605 SER A C    1  
ATOM 1136  O O    . SER A 1 91  ? -0.967  2.517   6.057   1.00 1.35  ? 605 SER A O    1  
ATOM 1137  C CB   . SER A 1 91  ? -1.739  0.804   8.804   1.00 1.39  ? 605 SER A CB   1  
ATOM 1138  O OG   . SER A 1 91  ? -1.580  0.606   10.197  1.00 1.46  ? 605 SER A OG   1  
ATOM 1139  H H    . SER A 1 91  ? -1.095  3.187   9.342   1.00 1.30  ? 605 SER A H    1  
ATOM 1140  H HA   . SER A 1 91  ? 0.370   0.880   8.436   1.00 1.61  ? 605 SER A HA   1  
ATOM 1141  H HB2  . SER A 1 91  ? -2.609  1.438   8.604   1.00 1.29  ? 605 SER A HB2  1  
ATOM 1142  H HB3  . SER A 1 91  ? -1.890  -0.169  8.334   1.00 1.48  ? 605 SER A HB3  1  
ATOM 1143  H HG   . SER A 1 91  ? -1.910  1.418   10.626  1.00 1.31  ? 605 SER A HG   1  
ATOM 1144  N N    . TYR A 1 92  ? -0.590  0.306   6.087   1.00 1.52  ? 606 TYR A N    1  
ATOM 1145  C CA   . TYR A 1 92  ? -0.702  0.034   4.657   1.00 1.45  ? 606 TYR A CA   1  
ATOM 1146  C C    . TYR A 1 92  ? -1.582  -1.214  4.405   1.00 1.40  ? 606 TYR A C    1  
ATOM 1147  O O    . TYR A 1 92  ? -1.650  -2.119  5.243   1.00 1.55  ? 606 TYR A O    1  
ATOM 1148  C CB   . TYR A 1 92  ? 0.729   -0.078  4.086   1.00 1.54  ? 606 TYR A CB   1  
ATOM 1149  C CG   . TYR A 1 92  ? 0.922   -1.257  3.166   1.00 1.91  ? 606 TYR A CG   1  
ATOM 1150  C CD1  . TYR A 1 92  ? 0.391   -1.206  1.867   1.00 3.68  ? 606 TYR A CD1  1  
ATOM 1151  C CD2  . TYR A 1 92  ? 1.455   -2.453  3.677   1.00 1.99  ? 606 TYR A CD2  1  
ATOM 1152  C CE1  . TYR A 1 92  ? 0.344   -2.379  1.087   1.00 5.02  ? 606 TYR A CE1  1  
ATOM 1153  C CE2  . TYR A 1 92  ? 1.434   -3.620  2.894   1.00 3.17  ? 606 TYR A CE2  1  
ATOM 1154  C CZ   . TYR A 1 92  ? 0.847   -3.591  1.610   1.00 4.63  ? 606 TYR A CZ   1  
ATOM 1155  O OH   . TYR A 1 92  ? 0.690   -4.753  0.923   1.00 6.15  ? 606 TYR A OH   1  
ATOM 1156  H H    . TYR A 1 92  ? -0.366  -0.494  6.673   1.00 1.63  ? 606 TYR A H    1  
ATOM 1157  H HA   . TYR A 1 92  ? -1.195  0.871   4.167   1.00 1.40  ? 606 TYR A HA   1  
ATOM 1158  H HB2  . TYR A 1 92  ? 0.973   0.839   3.551   1.00 2.60  ? 606 TYR A HB2  1  
ATOM 1159  H HB3  . TYR A 1 92  ? 1.450   -0.163  4.901   1.00 1.71  ? 606 TYR A HB3  1  
ATOM 1160  H HD1  . TYR A 1 92  ? -0.080  -0.286  1.532   1.00 4.33  ? 606 TYR A HD1  1  
ATOM 1161  H HD2  . TYR A 1 92  ? 1.815   -2.488  4.697   1.00 2.41  ? 606 TYR A HD2  1  
ATOM 1162  H HE1  . TYR A 1 92  ? -0.138  -2.373  0.120   1.00 6.59  ? 606 TYR A HE1  1  
ATOM 1163  H HE2  . TYR A 1 92  ? 1.806   -4.548  3.301   1.00 3.58  ? 606 TYR A HE2  1  
ATOM 1164  H HH   . TYR A 1 92  ? 0.106   -4.636  0.152   1.00 7.18  ? 606 TYR A HH   1  
ATOM 1165  N N    . PHE A 1 93  ? -2.258  -1.264  3.252   1.00 1.23  ? 607 PHE A N    1  
ATOM 1166  C CA   . PHE A 1 93  ? -3.070  -2.404  2.809   1.00 1.26  ? 607 PHE A CA   1  
ATOM 1167  C C    . PHE A 1 93  ? -3.189  -2.527  1.270   1.00 1.41  ? 607 PHE A C    1  
ATOM 1168  O O    . PHE A 1 93  ? -2.690  -1.703  0.498   1.00 1.76  ? 607 PHE A O    1  
ATOM 1169  C CB   . PHE A 1 93  ? -4.444  -2.340  3.511   1.00 1.53  ? 607 PHE A CB   1  
ATOM 1170  C CG   . PHE A 1 93  ? -5.091  -0.969  3.597   1.00 1.22  ? 607 PHE A CG   1  
ATOM 1171  C CD1  . PHE A 1 93  ? -5.073  -0.086  2.502   1.00 2.05  ? 607 PHE A CD1  1  
ATOM 1172  C CD2  . PHE A 1 93  ? -5.702  -0.564  4.797   1.00 2.14  ? 607 PHE A CD2  1  
ATOM 1173  C CE1  . PHE A 1 93  ? -5.644  1.190   2.602   1.00 2.30  ? 607 PHE A CE1  1  
ATOM 1174  C CE2  . PHE A 1 93  ? -6.276  0.712   4.889   1.00 2.06  ? 607 PHE A CE2  1  
ATOM 1175  C CZ   . PHE A 1 93  ? -6.241  1.592   3.803   1.00 1.51  ? 607 PHE A CZ   1  
ATOM 1176  H H    . PHE A 1 93  ? -2.167  -0.493  2.597   1.00 1.13  ? 607 PHE A H    1  
ATOM 1177  H HA   . PHE A 1 93  ? -2.578  -3.319  3.140   1.00 1.72  ? 607 PHE A HA   1  
ATOM 1178  H HB2  . PHE A 1 93  ? -5.147  -3.025  3.038   1.00 1.95  ? 607 PHE A HB2  1  
ATOM 1179  H HB3  . PHE A 1 93  ? -4.298  -2.705  4.529   1.00 2.48  ? 607 PHE A HB3  1  
ATOM 1180  H HD1  . PHE A 1 93  ? -4.611  -0.381  1.576   1.00 3.16  ? 607 PHE A HD1  1  
ATOM 1181  H HD2  . PHE A 1 93  ? -5.726  -1.231  5.646   1.00 3.41  ? 607 PHE A HD2  1  
ATOM 1182  H HE1  . PHE A 1 93  ? -5.655  1.842   1.746   1.00 3.57  ? 607 PHE A HE1  1  
ATOM 1183  H HE2  . PHE A 1 93  ? -6.746  1.029   5.800   1.00 3.17  ? 607 PHE A HE2  1  
ATOM 1184  H HZ   . PHE A 1 93  ? -6.711  2.560   3.885   1.00 1.80  ? 607 PHE A HZ   1  
ATOM 1185  N N    . GLY A 1 94  ? -3.867  -3.587  0.830   1.00 1.49  ? 608 GLY A N    1  
ATOM 1186  C CA   . GLY A 1 94  ? -3.827  -4.119  -0.535  1.00 1.77  ? 608 GLY A CA   1  
ATOM 1187  C C    . GLY A 1 94  ? -2.671  -5.111  -0.672  1.00 2.16  ? 608 GLY A C    1  
ATOM 1188  O O    . GLY A 1 94  ? -1.504  -4.719  -0.692  1.00 3.49  ? 608 GLY A O    1  
ATOM 1189  H H    . GLY A 1 94  ? -4.258  -4.185  1.549   1.00 1.48  ? 608 GLY A H    1  
ATOM 1190  H HA2  . GLY A 1 94  ? -4.767  -4.623  -0.759  1.00 1.91  ? 608 GLY A HA2  1  
ATOM 1191  H HA3  . GLY A 1 94  ? -3.682  -3.313  -1.255  1.00 1.92  ? 608 GLY A HA3  1  
ATOM 1192  N N    . GLU A 1 95  ? -2.980  -6.407  -0.749  1.00 1.85  ? 609 GLU A N    1  
ATOM 1193  C CA   . GLU A 1 95  ? -2.002  -7.499  -0.594  1.00 2.26  ? 609 GLU A CA   1  
ATOM 1194  C C    . GLU A 1 95  ? -1.433  -8.000  -1.937  1.00 1.92  ? 609 GLU A C    1  
ATOM 1195  O O    . GLU A 1 95  ? -0.941  -9.123  -2.048  1.00 2.70  ? 609 GLU A O    1  
ATOM 1196  C CB   . GLU A 1 95  ? -2.591  -8.606  0.308   1.00 3.58  ? 609 GLU A CB   1  
ATOM 1197  C CG   . GLU A 1 95  ? -1.503  -9.268  1.171   1.00 4.88  ? 609 GLU A CG   1  
ATOM 1198  C CD   . GLU A 1 95  ? -2.037  -10.340 2.132   1.00 5.71  ? 609 GLU A CD   1  
ATOM 1199  O OE1  . GLU A 1 95  ? -3.201  -10.258 2.600   1.00 6.17  ? 609 GLU A OE1  1  
ATOM 1200  O OE2  . GLU A 1 95  ? -1.269  -11.266 2.487   1.00 6.50  ? 609 GLU A OE2  1  
ATOM 1201  H H    . GLU A 1 95  ? -3.957  -6.676  -0.845  1.00 2.23  ? 609 GLU A H    1  
ATOM 1202  H HA   . GLU A 1 95  ? -1.144  -7.088  -0.062  1.00 3.05  ? 609 GLU A HA   1  
ATOM 1203  H HB2  . GLU A 1 95  ? -3.325  -8.159  0.981   1.00 4.34  ? 609 GLU A HB2  1  
ATOM 1204  H HB3  . GLU A 1 95  ? -3.100  -9.354  -0.302  1.00 3.80  ? 609 GLU A HB3  1  
ATOM 1205  H HG2  . GLU A 1 95  ? -0.752  -9.714  0.517   1.00 5.10  ? 609 GLU A HG2  1  
ATOM 1206  H HG3  . GLU A 1 95  ? -1.007  -8.497  1.763   1.00 5.79  ? 609 GLU A HG3  1  
ATOM 1207  N N    . ILE A 1 96  ? -1.503  -7.167  -2.980  1.00 2.55  ? 610 ILE A N    1  
ATOM 1208  C CA   . ILE A 1 96  ? -0.965  -7.447  -4.314  1.00 3.41  ? 610 ILE A CA   1  
ATOM 1209  C C    . ILE A 1 96  ? 0.567   -7.466  -4.226  1.00 2.34  ? 610 ILE A C    1  
ATOM 1210  O O    . ILE A 1 96  ? 1.198   -6.425  -4.041  1.00 3.21  ? 610 ILE A O    1  
ATOM 1211  C CB   . ILE A 1 96  ? -1.473  -6.402  -5.348  1.00 5.52  ? 610 ILE A CB   1  
ATOM 1212  C CG1  . ILE A 1 96  ? -2.989  -6.508  -5.652  1.00 7.16  ? 610 ILE A CG1  1  
ATOM 1213  C CG2  . ILE A 1 96  ? -0.748  -6.557  -6.701  1.00 6.49  ? 610 ILE A CG2  1  
ATOM 1214  C CD1  . ILE A 1 96  ? -3.932  -6.001  -4.552  1.00 7.84  ? 610 ILE A CD1  1  
ATOM 1215  H H    . ILE A 1 96  ? -1.883  -6.247  -2.807  1.00 3.22  ? 610 ILE A H    1  
ATOM 1216  H HA   . ILE A 1 96  ? -1.302  -8.434  -4.632  1.00 4.34  ? 610 ILE A HA   1  
ATOM 1217  H HB   . ILE A 1 96  ? -1.261  -5.398  -4.975  1.00 5.85  ? 610 ILE A HB   1  
ATOM 1218  H HG12 . ILE A 1 96  ? -3.204  -5.913  -6.540  1.00 8.59  ? 610 ILE A HG12 1  
ATOM 1219  H HG13 . ILE A 1 96  ? -3.239  -7.543  -5.884  1.00 7.11  ? 610 ILE A HG13 1  
ATOM 1220  H HG21 . ILE A 1 96  ? -1.110  -5.810  -7.408  1.00 7.73  ? 610 ILE A HG21 1  
ATOM 1221  H HG22 . ILE A 1 96  ? 0.323   -6.394  -6.591  1.00 6.36  ? 610 ILE A HG22 1  
ATOM 1222  H HG23 . ILE A 1 96  ? -0.922  -7.547  -7.113  1.00 6.58  ? 610 ILE A HG23 1  
ATOM 1223  H HD11 . ILE A 1 96  ? -4.950  -5.968  -4.940  1.00 8.90  ? 610 ILE A HD11 1  
ATOM 1224  H HD12 . ILE A 1 96  ? -3.922  -6.673  -3.698  1.00 7.33  ? 610 ILE A HD12 1  
ATOM 1225  H HD13 . ILE A 1 96  ? -3.637  -4.999  -4.240  1.00 8.36  ? 610 ILE A HD13 1  
ATOM 1226  N N    . CYS A 1 97  ? 1.187   -8.637  -4.403  1.00 2.05  ? 611 CYS A N    1  
ATOM 1227  C CA   . CYS A 1 97  ? 2.634   -8.697  -4.595  1.00 2.30  ? 611 CYS A CA   1  
ATOM 1228  C C    . CYS A 1 97  ? 3.001   -8.065  -5.948  1.00 1.81  ? 611 CYS A C    1  
ATOM 1229  O O    . CYS A 1 97  ? 2.412   -8.382  -6.977  1.00 2.50  ? 611 CYS A O    1  
ATOM 1230  C CB   . CYS A 1 97  ? 3.149   -10.138 -4.449  1.00 4.24  ? 611 CYS A CB   1  
ATOM 1231  S SG   . CYS A 1 97  ? 4.957   -10.152 -4.651  1.00 5.73  ? 611 CYS A SG   1  
ATOM 1232  H H    . CYS A 1 97  ? 0.642   -9.480  -4.497  1.00 2.88  ? 611 CYS A H    1  
ATOM 1233  H HA   . CYS A 1 97  ? 3.106   -8.102  -3.813  1.00 2.74  ? 611 CYS A HA   1  
ATOM 1234  H HB2  . CYS A 1 97  ? 2.887   -10.528 -3.463  1.00 4.97  ? 611 CYS A HB2  1  
ATOM 1235  H HB3  . CYS A 1 97  ? 2.701   -10.783 -5.202  1.00 4.70  ? 611 CYS A HB3  1  
ATOM 1236  H HG   . CYS A 1 97  ? 5.078   -11.455 -4.983  1.00 6.75  ? 611 CYS A HG   1  
ATOM 1237  N N    . LEU A 1 98  ? 4.026   -7.214  -5.965  1.00 1.67  ? 612 LEU A N    1  
ATOM 1238  C CA   . LEU A 1 98  ? 4.600   -6.587  -7.165  1.00 1.69  ? 612 LEU A CA   1  
ATOM 1239  C C    . LEU A 1 98  ? 4.952   -7.597  -8.272  1.00 2.09  ? 612 LEU A C    1  
ATOM 1240  O O    . LEU A 1 98  ? 4.851   -7.248  -9.449  1.00 2.43  ? 612 LEU A O    1  
ATOM 1241  C CB   . LEU A 1 98  ? 5.867   -5.854  -6.673  1.00 2.03  ? 612 LEU A CB   1  
ATOM 1242  C CG   . LEU A 1 98  ? 5.510   -4.538  -5.966  1.00 1.53  ? 612 LEU A CG   1  
ATOM 1243  C CD1  . LEU A 1 98  ? 6.338   -4.256  -4.724  1.00 1.86  ? 612 LEU A CD1  1  
ATOM 1244  C CD2  . LEU A 1 98  ? 5.682   -3.353  -6.905  1.00 1.18  ? 612 LEU A CD2  1  
ATOM 1245  H H    . LEU A 1 98  ? 4.442   -6.984  -5.076  1.00 2.26  ? 612 LEU A H    1  
ATOM 1246  H HA   . LEU A 1 98  ? 3.882   -5.880  -7.617  1.00 1.65  ? 612 LEU A HA   1  
ATOM 1247  H HB2  . LEU A 1 98  ? 6.415   -6.500  -5.985  1.00 2.70  ? 612 LEU A HB2  1  
ATOM 1248  H HB3  . LEU A 1 98  ? 6.533   -5.651  -7.508  1.00 2.76  ? 612 LEU A HB3  1  
ATOM 1249  H HG   . LEU A 1 98  ? 4.475   -4.583  -5.636  1.00 2.04  ? 612 LEU A HG   1  
ATOM 1250  H HD11 . LEU A 1 98  ? 7.398   -4.226  -4.971  1.00 2.47  ? 612 LEU A HD11 1  
ATOM 1251  H HD12 . LEU A 1 98  ? 6.153   -5.027  -3.979  1.00 2.58  ? 612 LEU A HD12 1  
ATOM 1252  H HD13 . LEU A 1 98  ? 6.024   -3.292  -4.318  1.00 2.46  ? 612 LEU A HD13 1  
ATOM 1253  H HD21 . LEU A 1 98  ? 6.719   -3.031  -6.947  1.00 1.83  ? 612 LEU A HD21 1  
ATOM 1254  H HD22 . LEU A 1 98  ? 5.038   -2.553  -6.544  1.00 1.54  ? 612 LEU A HD22 1  
ATOM 1255  H HD23 . LEU A 1 98  ? 5.358   -3.601  -7.915  1.00 2.32  ? 612 LEU A HD23 1  
ATOM 1256  N N    . LEU A 1 99  ? 5.318   -8.829  -7.901  1.00 2.29  ? 613 LEU A N    1  
ATOM 1257  C CA   . LEU A 1 99  ? 5.699   -9.927  -8.798  1.00 2.75  ? 613 LEU A CA   1  
ATOM 1258  C C    . LEU A 1 99  ? 4.562   -10.927 -9.065  1.00 2.83  ? 613 LEU A C    1  
ATOM 1259  O O    . LEU A 1 99  ? 4.740   -11.898 -9.803  1.00 3.28  ? 613 LEU A O    1  
ATOM 1260  C CB   . LEU A 1 99  ? 6.955   -10.632 -8.249  1.00 3.20  ? 613 LEU A CB   1  
ATOM 1261  C CG   . LEU A 1 99  ? 8.163   -9.687  -8.153  1.00 3.89  ? 613 LEU A CG   1  
ATOM 1262  C CD1  . LEU A 1 99  ? 8.323   -9.043  -6.772  1.00 3.76  ? 613 LEU A CD1  1  
ATOM 1263  C CD2  . LEU A 1 99  ? 9.462   -10.437 -8.445  1.00 4.82  ? 613 LEU A CD2  1  
ATOM 1264  H H    . LEU A 1 99  ? 5.348   -9.023  -6.910  1.00 2.22  ? 613 LEU A H    1  
ATOM 1265  H HA   . LEU A 1 99  ? 5.953   -9.504  -9.769  1.00 2.88  ? 613 LEU A HA   1  
ATOM 1266  H HB2  . LEU A 1 99  ? 6.748   -11.078 -7.276  1.00 2.95  ? 613 LEU A HB2  1  
ATOM 1267  H HB3  . LEU A 1 99  ? 7.199   -11.441 -8.938  1.00 4.23  ? 613 LEU A HB3  1  
ATOM 1268  H HG   . LEU A 1 99  ? 8.029   -8.896  -8.890  1.00 4.63  ? 613 LEU A HG   1  
ATOM 1269  H HD11 . LEU A 1 99  ? 9.095   -8.279  -6.832  1.00 4.60  ? 613 LEU A HD11 1  
ATOM 1270  H HD12 . LEU A 1 99  ? 8.610   -9.794  -6.036  1.00 3.84  ? 613 LEU A HD12 1  
ATOM 1271  H HD13 . LEU A 1 99  ? 7.399   -8.578  -6.449  1.00 3.87  ? 613 LEU A HD13 1  
ATOM 1272  H HD21 . LEU A 1 99  ? 9.565   -11.288 -7.773  1.00 4.76  ? 613 LEU A HD21 1  
ATOM 1273  H HD22 . LEU A 1 99  ? 10.310  -9.769  -8.318  1.00 5.07  ? 613 LEU A HD22 1  
ATOM 1274  H HD23 . LEU A 1 99  ? 9.453   -10.793 -9.473  1.00 5.98  ? 613 LEU A HD23 1  
ATOM 1275  N N    . THR A 1 100 ? 3.385   -10.677 -8.490  1.00 2.53  ? 614 THR A N    1  
ATOM 1276  C CA   . THR A 1 100 ? 2.208   -11.546 -8.638  1.00 2.64  ? 614 THR A CA   1  
ATOM 1277  C C    . THR A 1 100 ? 1.745   -11.658 -10.091 1.00 2.89  ? 614 THR A C    1  
ATOM 1278  O O    . THR A 1 100 ? 1.986   -10.770 -10.922 1.00 3.36  ? 614 THR A O    1  
ATOM 1279  C CB   . THR A 1 100 ? 1.041   -11.104 -7.734  1.00 3.32  ? 614 THR A CB   1  
ATOM 1280  O OG1  . THR A 1 100 ? 0.218   -12.201 -7.397  1.00 3.56  ? 614 THR A OG1  1  
ATOM 1281  C CG2  . THR A 1 100 ? 0.129   -10.034 -8.338  1.00 4.81  ? 614 THR A CG2  1  
ATOM 1282  H H    . THR A 1 100 ? 3.319   -9.832  -7.934  1.00 2.26  ? 614 THR A H    1  
ATOM 1283  H HA   . THR A 1 100 ? 2.506   -12.541 -8.310  1.00 2.44  ? 614 THR A HA   1  
ATOM 1284  H HB   . THR A 1 100 ? 1.451   -10.719 -6.808  1.00 3.34  ? 614 THR A HB   1  
ATOM 1285  H HG1  . THR A 1 100 ? 0.268   -12.286 -6.418  1.00 3.49  ? 614 THR A HG1  1  
ATOM 1286  H HG21 . THR A 1 100 ? -0.532  -9.664  -7.558  1.00 5.30  ? 614 THR A HG21 1  
ATOM 1287  H HG22 . THR A 1 100 ? -0.471  -10.447 -9.149  1.00 5.58  ? 614 THR A HG22 1  
ATOM 1288  H HG23 . THR A 1 100 ? 0.724   -9.205  -8.720  1.00 5.19  ? 614 THR A HG23 1  
ATOM 1289  N N    . ARG A 1 101 ? 1.002   -12.731 -10.364 1.00 2.86  ? 615 ARG A N    1  
ATOM 1290  C CA   . ARG A 1 101 ? 0.158   -12.909 -11.552 1.00 3.18  ? 615 ARG A CA   1  
ATOM 1291  C C    . ARG A 1 101 ? -1.307  -12.940 -11.116 1.00 2.94  ? 615 ARG A C    1  
ATOM 1292  O O    . ARG A 1 101 ? -1.616  -13.449 -10.036 1.00 2.82  ? 615 ARG A O    1  
ATOM 1293  C CB   . ARG A 1 101 ? 0.528   -14.197 -12.313 1.00 3.68  ? 615 ARG A CB   1  
ATOM 1294  C CG   . ARG A 1 101 ? 1.882   -14.182 -13.045 1.00 3.93  ? 615 ARG A CG   1  
ATOM 1295  C CD   . ARG A 1 101 ? 3.103   -14.128 -12.114 1.00 3.67  ? 615 ARG A CD   1  
ATOM 1296  N NE   . ARG A 1 101 ? 4.271   -14.775 -12.729 1.00 4.73  ? 615 ARG A NE   1  
ATOM 1297  C CZ   . ARG A 1 101 ? 5.546   -14.576 -12.464 1.00 5.70  ? 615 ARG A CZ   1  
ATOM 1298  N NH1  . ARG A 1 101 ? 5.976   -13.702 -11.602 1.00 6.14  ? 615 ARG A NH1  1  
ATOM 1299  N NH2  . ARG A 1 101 ? 6.430   -15.293 -13.087 1.00 6.89  ? 615 ARG A NH2  1  
ATOM 1300  H H    . ARG A 1 101 ? 0.844   -13.362 -9.589  1.00 2.71  ? 615 ARG A H    1  
ATOM 1301  H HA   . ARG A 1 101 ? 0.282   -12.062 -12.228 1.00 3.64  ? 615 ARG A HA   1  
ATOM 1302  H HB2  . ARG A 1 101 ? 0.502   -15.044 -11.625 1.00 3.73  ? 615 ARG A HB2  1  
ATOM 1303  H HB3  . ARG A 1 101 ? -0.239  -14.372 -13.069 1.00 4.67  ? 615 ARG A HB3  1  
ATOM 1304  H HG2  . ARG A 1 101 ? 1.934   -15.094 -13.641 1.00 4.99  ? 615 ARG A HG2  1  
ATOM 1305  H HG3  . ARG A 1 101 ? 1.920   -13.341 -13.736 1.00 4.50  ? 615 ARG A HG3  1  
ATOM 1306  H HD2  . ARG A 1 101 ? 3.326   -13.086 -11.878 1.00 3.85  ? 615 ARG A HD2  1  
ATOM 1307  H HD3  . ARG A 1 101 ? 2.867   -14.658 -11.192 1.00 3.89  ? 615 ARG A HD3  1  
ATOM 1308  H HE   . ARG A 1 101 ? 4.084   -15.542 -13.365 1.00 5.30  ? 615 ARG A HE   1  
ATOM 1309  H HH11 . ARG A 1 101 ? 5.328   -13.146 -11.052 1.00 5.73  ? 615 ARG A HH11 1  
ATOM 1310  H HH12 . ARG A 1 101 ? 6.969   -13.544 -11.500 1.00 7.27  ? 615 ARG A HH12 1  
ATOM 1311  H HH21 . ARG A 1 101 ? 6.126   -15.993 -13.741 1.00 7.17  ? 615 ARG A HH21 1  
ATOM 1312  H HH22 . ARG A 1 101 ? 7.410   -15.222 -12.824 1.00 7.81  ? 615 ARG A HH22 1  
ATOM 1313  N N    . GLY A 1 102 ? -2.208  -12.426 -11.946 1.00 3.31  ? 616 GLY A N    1  
ATOM 1314  C CA   . GLY A 1 102 ? -3.651  -12.476 -11.688 1.00 3.32  ? 616 GLY A CA   1  
ATOM 1315  C C    . GLY A 1 102 ? -4.161  -11.554 -10.568 1.00 2.76  ? 616 GLY A C    1  
ATOM 1316  O O    . GLY A 1 102 ? -3.390  -10.876 -9.881  1.00 2.81  ? 616 GLY A O    1  
ATOM 1317  H H    . GLY A 1 102 ? -1.880  -12.053 -12.830 1.00 3.88  ? 616 GLY A H    1  
ATOM 1318  H HA2  . GLY A 1 102 ? -4.184  -12.260 -12.611 1.00 3.74  ? 616 GLY A HA2  1  
ATOM 1319  H HA3  . GLY A 1 102 ? -3.907  -13.492 -11.397 1.00 3.64  ? 616 GLY A HA3  1  
ATOM 1320  N N    . ARG A 1 103 ? -5.485  -11.524 -10.379 1.00 2.61  ? 617 ARG A N    1  
ATOM 1321  C CA   . ARG A 1 103 ? -6.188  -10.813 -9.287  1.00 2.29  ? 617 ARG A CA   1  
ATOM 1322  C C    . ARG A 1 103 ? -6.002  -11.465 -7.900  1.00 2.15  ? 617 ARG A C    1  
ATOM 1323  O O    . ARG A 1 103 ? -5.614  -12.628 -7.789  1.00 2.60  ? 617 ARG A O    1  
ATOM 1324  C CB   . ARG A 1 103 ? -7.663  -10.625 -9.683  1.00 2.85  ? 617 ARG A CB   1  
ATOM 1325  C CG   . ARG A 1 103 ? -8.452  -11.941 -9.821  1.00 1.86  ? 617 ARG A CG   1  
ATOM 1326  C CD   . ARG A 1 103 ? -9.538  -11.788 -10.893 1.00 1.90  ? 617 ARG A CD   1  
ATOM 1327  N NE   . ARG A 1 103 ? -10.201 -13.073 -11.188 1.00 2.25  ? 617 ARG A NE   1  
ATOM 1328  C CZ   . ARG A 1 103 ? -11.233 -13.604 -10.554 1.00 2.78  ? 617 ARG A CZ   1  
ATOM 1329  N NH1  . ARG A 1 103 ? -11.773 -13.054 -9.506  1.00 3.54  ? 617 ARG A NH1  1  
ATOM 1330  N NH2  . ARG A 1 103 ? -11.754 -14.727 -10.947 1.00 3.62  ? 617 ARG A NH2  1  
ATOM 1331  H H    . ARG A 1 103 ? -6.051  -12.053 -11.043 1.00 3.01  ? 617 ARG A H    1  
ATOM 1332  H HA   . ARG A 1 103 ? -5.765  -9.809  -9.212  1.00 2.24  ? 617 ARG A HA   1  
ATOM 1333  H HB2  . ARG A 1 103 ? -8.165  -9.989  -8.952  1.00 4.03  ? 617 ARG A HB2  1  
ATOM 1334  H HB3  . ARG A 1 103 ? -7.676  -10.092 -10.636 1.00 3.87  ? 617 ARG A HB3  1  
ATOM 1335  H HG2  . ARG A 1 103 ? -7.790  -12.755 -10.114 1.00 2.05  ? 617 ARG A HG2  1  
ATOM 1336  H HG3  . ARG A 1 103 ? -8.902  -12.201 -8.862  1.00 2.49  ? 617 ARG A HG3  1  
ATOM 1337  H HD2  . ARG A 1 103 ? -10.267 -11.040 -10.572 1.00 2.46  ? 617 ARG A HD2  1  
ATOM 1338  H HD3  . ARG A 1 103 ? -9.062  -11.419 -11.807 1.00 2.18  ? 617 ARG A HD3  1  
ATOM 1339  H HE   . ARG A 1 103 ? -9.803  -13.625 -11.935 1.00 3.06  ? 617 ARG A HE   1  
ATOM 1340  H HH11 . ARG A 1 103 ? -11.384 -12.194 -9.134  1.00 3.68  ? 617 ARG A HH11 1  
ATOM 1341  H HH12 . ARG A 1 103 ? -12.590 -13.456 -9.078  1.00 4.51  ? 617 ARG A HH12 1  
ATOM 1342  H HH21 . ARG A 1 103 ? -11.421 -15.184 -11.788 1.00 4.08  ? 617 ARG A HH21 1  
ATOM 1343  H HH22 . ARG A 1 103 ? -12.485 -15.147 -10.387 1.00 4.30  ? 617 ARG A HH22 1  
ATOM 1344  N N    . ARG A 1 104 ? -6.280  -10.690 -6.847  1.00 1.84  ? 618 ARG A N    1  
ATOM 1345  C CA   . ARG A 1 104 ? -5.995  -10.953 -5.414  1.00 2.02  ? 618 ARG A CA   1  
ATOM 1346  C C    . ARG A 1 104 ? -7.297  -10.971 -4.586  1.00 1.98  ? 618 ARG A C    1  
ATOM 1347  O O    . ARG A 1 104 ? -8.381  -10.797 -5.148  1.00 2.27  ? 618 ARG A O    1  
ATOM 1348  C CB   . ARG A 1 104 ? -4.967  -9.895  -4.950  1.00 2.27  ? 618 ARG A CB   1  
ATOM 1349  C CG   . ARG A 1 104 ? -4.203  -10.121 -3.630  1.00 2.24  ? 618 ARG A CG   1  
ATOM 1350  C CD   . ARG A 1 104 ? -3.108  -11.197 -3.678  1.00 2.72  ? 618 ARG A CD   1  
ATOM 1351  N NE   . ARG A 1 104 ? -3.603  -12.568 -3.447  1.00 3.42  ? 618 ARG A NE   1  
ATOM 1352  C CZ   . ARG A 1 104 ? -3.525  -13.590 -4.281  1.00 4.65  ? 618 ARG A CZ   1  
ATOM 1353  N NH1  . ARG A 1 104 ? -3.256  -13.471 -5.544  1.00 5.63  ? 618 ARG A NH1  1  
ATOM 1354  N NH2  . ARG A 1 104 ? -3.717  -14.812 -3.894  1.00 5.52  ? 618 ARG A NH2  1  
ATOM 1355  H H    . ARG A 1 104 ? -6.701  -9.796  -7.058  1.00 1.73  ? 618 ARG A H    1  
ATOM 1356  H HA   . ARG A 1 104 ? -5.552  -11.943 -5.317  1.00 2.38  ? 618 ARG A HA   1  
ATOM 1357  H HB2  . ARG A 1 104 ? -4.215  -9.784  -5.733  1.00 2.95  ? 618 ARG A HB2  1  
ATOM 1358  H HB3  . ARG A 1 104 ? -5.480  -8.936  -4.877  1.00 2.75  ? 618 ARG A HB3  1  
ATOM 1359  H HG2  . ARG A 1 104 ? -3.702  -9.180  -3.401  1.00 3.11  ? 618 ARG A HG2  1  
ATOM 1360  H HG3  . ARG A 1 104 ? -4.881  -10.315 -2.801  1.00 2.68  ? 618 ARG A HG3  1  
ATOM 1361  H HD2  . ARG A 1 104 ? -2.557  -11.121 -4.617  1.00 3.34  ? 618 ARG A HD2  1  
ATOM 1362  H HD3  . ARG A 1 104 ? -2.402  -10.975 -2.876  1.00 2.94  ? 618 ARG A HD3  1  
ATOM 1363  H HE   . ARG A 1 104 ? -3.830  -12.807 -2.485  1.00 3.66  ? 618 ARG A HE   1  
ATOM 1364  H HH11 . ARG A 1 104 ? -3.092  -12.568 -5.976  1.00 5.54  ? 618 ARG A HH11 1  
ATOM 1365  H HH12 . ARG A 1 104 ? -3.226  -14.319 -6.092  1.00 6.83  ? 618 ARG A HH12 1  
ATOM 1366  H HH21 . ARG A 1 104 ? -3.886  -15.047 -2.922  1.00 5.51  ? 618 ARG A HH21 1  
ATOM 1367  H HH22 . ARG A 1 104 ? -3.565  -15.549 -4.571  1.00 6.57  ? 618 ARG A HH22 1  
ATOM 1368  N N    . THR A 1 105 ? -7.230  -11.250 -3.282  1.00 2.18  ? 619 THR A N    1  
ATOM 1369  C CA   . THR A 1 105 ? -8.357  -11.037 -2.351  1.00 2.28  ? 619 THR A CA   1  
ATOM 1370  C C    . THR A 1 105 ? -7.972  -10.149 -1.162  1.00 2.25  ? 619 THR A C    1  
ATOM 1371  O O    . THR A 1 105 ? -7.051  -10.471 -0.407  1.00 2.41  ? 619 THR A O    1  
ATOM 1372  C CB   . THR A 1 105 ? -8.926  -12.372 -1.838  1.00 2.95  ? 619 THR A CB   1  
ATOM 1373  O OG1  . THR A 1 105 ? -9.255  -13.208 -2.926  1.00 3.44  ? 619 THR A OG1  1  
ATOM 1374  C CG2  . THR A 1 105 ? -10.213 -12.208 -1.028  1.00 3.17  ? 619 THR A CG2  1  
ATOM 1375  H H    . THR A 1 105 ? -6.332  -11.484 -2.885  1.00 2.48  ? 619 THR A H    1  
ATOM 1376  H HA   . THR A 1 105 ? -9.164  -10.530 -2.878  1.00 2.21  ? 619 THR A HA   1  
ATOM 1377  H HB   . THR A 1 105 ? -8.183  -12.872 -1.218  1.00 4.18  ? 619 THR A HB   1  
ATOM 1378  H HG1  . THR A 1 105 ? -8.432  -13.358 -3.428  1.00 4.48  ? 619 THR A HG1  1  
ATOM 1379  H HG21 . THR A 1 105 ? -10.017 -11.644 -0.116  1.00 4.06  ? 619 THR A HG21 1  
ATOM 1380  H HG22 . THR A 1 105 ? -10.593 -13.190 -0.745  1.00 3.77  ? 619 THR A HG22 1  
ATOM 1381  H HG23 . THR A 1 105 ? -10.967 -11.688 -1.620  1.00 3.27  ? 619 THR A HG23 1  
ATOM 1382  N N    . ALA A 1 106 ? -8.728  -9.071  -0.954  1.00 2.17  ? 620 ALA A N    1  
ATOM 1383  C CA   . ALA A 1 106 ? -8.926  -8.367  0.312   1.00 1.98  ? 620 ALA A CA   1  
ATOM 1384  C C    . ALA A 1 106 ? -10.338 -7.743  0.367   1.00 1.90  ? 620 ALA A C    1  
ATOM 1385  O O    . ALA A 1 106 ? -11.000 -7.572  -0.661  1.00 2.12  ? 620 ALA A O    1  
ATOM 1386  C CB   . ALA A 1 106 ? -7.842  -7.296  0.492   1.00 2.13  ? 620 ALA A CB   1  
ATOM 1387  H H    . ALA A 1 106 ? -9.271  -8.721  -1.741  1.00 2.30  ? 620 ALA A H    1  
ATOM 1388  H HA   . ALA A 1 106 ? -8.843  -9.083  1.128   1.00 1.96  ? 620 ALA A HA   1  
ATOM 1389  H HB1  . ALA A 1 106 ? -8.033  -6.719  1.397   1.00 2.16  ? 620 ALA A HB1  1  
ATOM 1390  H HB2  . ALA A 1 106 ? -6.868  -7.773  0.595   1.00 3.03  ? 620 ALA A HB2  1  
ATOM 1391  H HB3  . ALA A 1 106 ? -7.837  -6.623  -0.367  1.00 2.57  ? 620 ALA A HB3  1  
ATOM 1392  N N    . SER A 1 107 ? -10.793 -7.379  1.570   1.00 1.80  ? 621 SER A N    1  
ATOM 1393  C CA   . SER A 1 107 ? -12.050 -6.651  1.784   1.00 1.80  ? 621 SER A CA   1  
ATOM 1394  C C    . SER A 1 107 ? -11.919 -5.704  2.981   1.00 1.65  ? 621 SER A C    1  
ATOM 1395  O O    . SER A 1 107 ? -11.672 -6.133  4.111   1.00 1.71  ? 621 SER A O    1  
ATOM 1396  C CB   . SER A 1 107 ? -13.192 -7.650  1.989   1.00 1.89  ? 621 SER A CB   1  
ATOM 1397  O OG   . SER A 1 107 ? -14.439 -6.994  1.888   1.00 2.11  ? 621 SER A OG   1  
ATOM 1398  H H    . SER A 1 107 ? -10.231 -7.586  2.384   1.00 1.87  ? 621 SER A H    1  
ATOM 1399  H HA   . SER A 1 107 ? -12.279 -6.059  0.897   1.00 1.97  ? 621 SER A HA   1  
ATOM 1400  H HB2  . SER A 1 107 ? -13.142 -8.416  1.213   1.00 2.73  ? 621 SER A HB2  1  
ATOM 1401  H HB3  . SER A 1 107 ? -13.100 -8.133  2.964   1.00 2.57  ? 621 SER A HB3  1  
ATOM 1402  H HG   . SER A 1 107 ? -15.122 -7.693  1.881   1.00 2.23  ? 621 SER A HG   1  
ATOM 1403  N N    . VAL A 1 108 ? -11.983 -4.392  2.732   1.00 1.51  ? 622 VAL A N    1  
ATOM 1404  C CA   . VAL A 1 108 ? -11.848 -3.363  3.779   1.00 1.34  ? 622 VAL A CA   1  
ATOM 1405  C C    . VAL A 1 108 ? -12.571 -2.058  3.421   1.00 1.25  ? 622 VAL A C    1  
ATOM 1406  O O    . VAL A 1 108 ? -12.580 -1.634  2.261   1.00 1.27  ? 622 VAL A O    1  
ATOM 1407  C CB   . VAL A 1 108 ? -10.358 -3.162  4.143   1.00 1.30  ? 622 VAL A CB   1  
ATOM 1408  C CG1  . VAL A 1 108 ? -9.432  -2.967  2.945   1.00 1.38  ? 622 VAL A CG1  1  
ATOM 1409  C CG2  . VAL A 1 108 ? -10.120 -2.009  5.115   1.00 1.13  ? 622 VAL A CG2  1  
ATOM 1410  H H    . VAL A 1 108 ? -12.099 -4.084  1.773   1.00 1.51  ? 622 VAL A H    1  
ATOM 1411  H HA   . VAL A 1 108 ? -12.342 -3.743  4.674   1.00 1.35  ? 622 VAL A HA   1  
ATOM 1412  H HB   . VAL A 1 108 ? -10.028 -4.069  4.648   1.00 1.39  ? 622 VAL A HB   1  
ATOM 1413  H HG11 . VAL A 1 108 ? -9.433  -3.867  2.331   1.00 1.78  ? 622 VAL A HG11 1  
ATOM 1414  H HG12 . VAL A 1 108 ? -9.765  -2.119  2.355   1.00 1.84  ? 622 VAL A HG12 1  
ATOM 1415  H HG13 . VAL A 1 108 ? -8.416  -2.797  3.299   1.00 2.49  ? 622 VAL A HG13 1  
ATOM 1416  H HG21 . VAL A 1 108 ? -9.096  -2.058  5.484   1.00 2.00  ? 622 VAL A HG21 1  
ATOM 1417  H HG22 . VAL A 1 108 ? -10.273 -1.048  4.623   1.00 1.77  ? 622 VAL A HG22 1  
ATOM 1418  H HG23 . VAL A 1 108 ? -10.801 -2.106  5.956   1.00 1.31  ? 622 VAL A HG23 1  
ATOM 1419  N N    . ARG A 1 109 ? -13.158 -1.403  4.433   1.00 1.18  ? 623 ARG A N    1  
ATOM 1420  C CA   . ARG A 1 109 ? -13.864 -0.117  4.324   1.00 1.14  ? 623 ARG A CA   1  
ATOM 1421  C C    . ARG A 1 109 ? -13.324 0.942   5.282   1.00 1.13  ? 623 ARG A C    1  
ATOM 1422  O O    . ARG A 1 109 ? -12.707 0.640   6.305   1.00 1.14  ? 623 ARG A O    1  
ATOM 1423  C CB   . ARG A 1 109 ? -15.390 -0.298  4.473   1.00 1.18  ? 623 ARG A CB   1  
ATOM 1424  C CG   . ARG A 1 109 ? -15.864 -0.858  5.824   1.00 1.33  ? 623 ARG A CG   1  
ATOM 1425  C CD   . ARG A 1 109 ? -16.031 -2.384  5.791   1.00 2.22  ? 623 ARG A CD   1  
ATOM 1426  N NE   . ARG A 1 109 ? -16.414 -2.916  7.108   1.00 3.31  ? 623 ARG A NE   1  
ATOM 1427  C CZ   . ARG A 1 109 ? -17.632 -2.999  7.606   1.00 3.25  ? 623 ARG A CZ   1  
ATOM 1428  N NH1  . ARG A 1 109 ? -18.712 -2.617  6.991   1.00 2.42  ? 623 ARG A NH1  1  
ATOM 1429  N NH2  . ARG A 1 109 ? -17.796 -3.501  8.786   1.00 4.87  ? 623 ARG A NH2  1  
ATOM 1430  H H    . ARG A 1 109 ? -13.066 -1.788  5.371   1.00 1.18  ? 623 ARG A H    1  
ATOM 1431  H HA   . ARG A 1 109 ? -13.689 0.291   3.331   1.00 1.12  ? 623 ARG A HA   1  
ATOM 1432  H HB2  . ARG A 1 109 ? -15.854 0.679   4.347   1.00 1.16  ? 623 ARG A HB2  1  
ATOM 1433  H HB3  . ARG A 1 109 ? -15.765 -0.930  3.667   1.00 1.21  ? 623 ARG A HB3  1  
ATOM 1434  H HG2  . ARG A 1 109 ? -15.172 -0.577  6.618   1.00 1.38  ? 623 ARG A HG2  1  
ATOM 1435  H HG3  . ARG A 1 109 ? -16.829 -0.408  6.054   1.00 1.48  ? 623 ARG A HG3  1  
ATOM 1436  H HD2  . ARG A 1 109 ? -16.787 -2.647  5.049   1.00 1.74  ? 623 ARG A HD2  1  
ATOM 1437  H HD3  . ARG A 1 109 ? -15.091 -2.847  5.491   1.00 3.44  ? 623 ARG A HD3  1  
ATOM 1438  H HE   . ARG A 1 109 ? -15.685 -3.323  7.681   1.00 4.75  ? 623 ARG A HE   1  
ATOM 1439  H HH11 . ARG A 1 109 ? -18.667 -2.163  6.081   1.00 2.35  ? 623 ARG A HH11 1  
ATOM 1440  H HH12 . ARG A 1 109 ? -19.605 -2.815  7.416   1.00 2.88  ? 623 ARG A HH12 1  
ATOM 1441  H HH21 . ARG A 1 109 ? -16.987 -3.869  9.273   1.00 6.20  ? 623 ARG A HH21 1  
ATOM 1442  H HH22 . ARG A 1 109 ? -18.734 -3.603  9.142   1.00 4.98  ? 623 ARG A HH22 1  
ATOM 1443  N N    . ALA A 1 110 ? -13.576 2.199   4.945   1.00 1.12  ? 624 ALA A N    1  
ATOM 1444  C CA   . ALA A 1 110 ? -13.257 3.345   5.782   1.00 1.04  ? 624 ALA A CA   1  
ATOM 1445  C C    . ALA A 1 110 ? -14.086 3.314   7.080   1.00 1.10  ? 624 ALA A C    1  
ATOM 1446  O O    . ALA A 1 110 ? -15.314 3.282   7.027   1.00 1.16  ? 624 ALA A O    1  
ATOM 1447  C CB   . ALA A 1 110 ? -13.515 4.597   4.942   1.00 0.92  ? 624 ALA A CB   1  
ATOM 1448  H H    . ALA A 1 110 ? -14.116 2.364   4.101   1.00 1.13  ? 624 ALA A H    1  
ATOM 1449  H HA   . ALA A 1 110 ? -12.201 3.324   6.045   1.00 1.06  ? 624 ALA A HA   1  
ATOM 1450  H HB1  . ALA A 1 110 ? -13.229 5.482   5.502   1.00 1.60  ? 624 ALA A HB1  1  
ATOM 1451  H HB2  . ALA A 1 110 ? -12.927 4.557   4.025   1.00 2.01  ? 624 ALA A HB2  1  
ATOM 1452  H HB3  . ALA A 1 110 ? -14.571 4.657   4.683   1.00 1.35  ? 624 ALA A HB3  1  
ATOM 1453  N N    . ASP A 1 111 ? -13.442 3.347   8.252   1.00 1.15  ? 625 ASP A N    1  
ATOM 1454  C CA   . ASP A 1 111 ? -14.161 3.448   9.537   1.00 1.25  ? 625 ASP A CA   1  
ATOM 1455  C C    . ASP A 1 111 ? -14.800 4.830   9.703   1.00 1.18  ? 625 ASP A C    1  
ATOM 1456  O O    . ASP A 1 111 ? -15.816 5.002   10.383  1.00 1.33  ? 625 ASP A O    1  
ATOM 1457  C CB   . ASP A 1 111 ? -13.185 3.260   10.708  1.00 1.28  ? 625 ASP A CB   1  
ATOM 1458  C CG   . ASP A 1 111 ? -13.919 2.853   11.984  1.00 1.47  ? 625 ASP A CG   1  
ATOM 1459  O OD1  . ASP A 1 111 ? -14.540 1.763   11.992  1.00 2.15  ? 625 ASP A OD1  1  
ATOM 1460  O OD2  . ASP A 1 111 ? -13.912 3.629   12.965  1.00 2.26  ? 625 ASP A OD2  1  
ATOM 1461  H H    . ASP A 1 111 ? -12.431 3.433   8.265   1.00 1.12  ? 625 ASP A H    1  
ATOM 1462  H HA   . ASP A 1 111 ? -14.938 2.683   9.576   1.00 1.44  ? 625 ASP A HA   1  
ATOM 1463  H HB2  . ASP A 1 111 ? -12.424 2.534   10.455  1.00 1.31  ? 625 ASP A HB2  1  
ATOM 1464  H HB3  . ASP A 1 111 ? -12.657 4.192   10.892  1.00 1.40  ? 625 ASP A HB3  1  
ATOM 1465  N N    . THR A 1 112 ? -14.140 5.811   9.091   1.00 1.01  ? 626 THR A N    1  
ATOM 1466  C CA   . THR A 1 112 ? -14.294 7.241   9.333   1.00 0.94  ? 626 THR A CA   1  
ATOM 1467  C C    . THR A 1 112 ? -14.061 7.986   8.014   1.00 0.77  ? 626 THR A C    1  
ATOM 1468  O O    . THR A 1 112 ? -13.752 7.371   6.994   1.00 0.70  ? 626 THR A O    1  
ATOM 1469  C CB   . THR A 1 112 ? -13.314 7.646   10.453  1.00 0.97  ? 626 THR A CB   1  
ATOM 1470  O OG1  . THR A 1 112 ? -13.299 9.036   10.655  1.00 1.00  ? 626 THR A OG1  1  
ATOM 1471  C CG2  . THR A 1 112 ? -11.870 7.194   10.207  1.00 0.93  ? 626 THR A CG2  1  
ATOM 1472  H H    . THR A 1 112 ? -13.345 5.548   8.501   1.00 0.96  ? 626 THR A H    1  
ATOM 1473  H HA   . THR A 1 112 ? -15.300 7.455   9.684   1.00 1.08  ? 626 THR A HA   1  
ATOM 1474  H HB   . THR A 1 112 ? -13.656 7.180   11.378  1.00 1.08  ? 626 THR A HB   1  
ATOM 1475  H HG1  . THR A 1 112 ? -12.959 9.164   11.569  1.00 1.13  ? 626 THR A HG1  1  
ATOM 1476  H HG21 . THR A 1 112 ? -11.523 7.569   9.245   1.00 1.82  ? 626 THR A HG21 1  
ATOM 1477  H HG22 . THR A 1 112 ? -11.820 6.101   10.225  1.00 1.95  ? 626 THR A HG22 1  
ATOM 1478  H HG23 . THR A 1 112 ? -11.232 7.579   11.003  1.00 1.57  ? 626 THR A HG23 1  
ATOM 1479  N N    . TYR A 1 113 ? -14.191 9.308   7.998   1.00 0.81  ? 627 TYR A N    1  
ATOM 1480  C CA   . TYR A 1 113 ? -13.690 10.141  6.909   1.00 0.78  ? 627 TYR A CA   1  
ATOM 1481  C C    . TYR A 1 113 ? -12.151 10.016  6.919   1.00 0.71  ? 627 TYR A C    1  
ATOM 1482  O O    . TYR A 1 113 ? -11.484 10.622  7.760   1.00 0.86  ? 627 TYR A O    1  
ATOM 1483  C CB   . TYR A 1 113 ? -14.255 11.543  7.174   1.00 1.06  ? 627 TYR A CB   1  
ATOM 1484  C CG   . TYR A 1 113 ? -14.110 12.651  6.142   1.00 1.58  ? 627 TYR A CG   1  
ATOM 1485  C CD1  . TYR A 1 113 ? -12.860 13.025  5.603   1.00 1.71  ? 627 TYR A CD1  1  
ATOM 1486  C CD2  . TYR A 1 113 ? -15.256 13.401  5.814   1.00 3.18  ? 627 TYR A CD2  1  
ATOM 1487  C CE1  . TYR A 1 113 ? -12.766 14.119  4.712   1.00 2.21  ? 627 TYR A CE1  1  
ATOM 1488  C CE2  . TYR A 1 113 ? -15.164 14.494  4.934   1.00 3.84  ? 627 TYR A CE2  1  
ATOM 1489  C CZ   . TYR A 1 113 ? -13.924 14.854  4.371   1.00 3.02  ? 627 TYR A CZ   1  
ATOM 1490  O OH   . TYR A 1 113 ? -13.889 15.888  3.492   1.00 3.80  ? 627 TYR A OH   1  
ATOM 1491  H H    . TYR A 1 113 ? -14.381 9.765   8.882   1.00 0.93  ? 627 TYR A H    1  
ATOM 1492  H HA   . TYR A 1 113 ? -14.082 9.773   5.968   1.00 0.74  ? 627 TYR A HA   1  
ATOM 1493  H HB2  . TYR A 1 113 ? -15.323 11.420  7.366   1.00 1.45  ? 627 TYR A HB2  1  
ATOM 1494  H HB3  . TYR A 1 113 ? -13.832 11.896  8.100   1.00 0.95  ? 627 TYR A HB3  1  
ATOM 1495  H HD1  . TYR A 1 113 ? -11.966 12.482  5.881   1.00 2.50  ? 627 TYR A HD1  1  
ATOM 1496  H HD2  . TYR A 1 113 ? -16.216 13.136  6.240   1.00 4.15  ? 627 TYR A HD2  1  
ATOM 1497  H HE1  . TYR A 1 113 ? -11.813 14.380  4.257   1.00 2.83  ? 627 TYR A HE1  1  
ATOM 1498  H HE2  . TYR A 1 113 ? -16.041 15.071  4.679   1.00 5.21  ? 627 TYR A HE2  1  
ATOM 1499  H HH   . TYR A 1 113 ? -13.006 16.136  3.170   1.00 3.34  ? 627 TYR A HH   1  
ATOM 1500  N N    . CYS A 1 114 ? -11.590 9.164   6.051   1.00 0.61  ? 628 CYS A N    1  
ATOM 1501  C CA   . CYS A 1 114 ? -10.188 8.728   6.095   1.00 0.60  ? 628 CYS A CA   1  
ATOM 1502  C C    . CYS A 1 114 ? -9.375  9.343   4.937   1.00 0.69  ? 628 CYS A C    1  
ATOM 1503  O O    . CYS A 1 114 ? -9.784  9.271   3.772   1.00 0.73  ? 628 CYS A O    1  
ATOM 1504  C CB   . CYS A 1 114 ? -10.094 7.178   6.160   1.00 0.58  ? 628 CYS A CB   1  
ATOM 1505  S SG   . CYS A 1 114 ? -10.493 6.380   4.585   1.00 1.96  ? 628 CYS A SG   1  
ATOM 1506  H H    . CYS A 1 114 ? -12.198 8.740   5.355   1.00 0.62  ? 628 CYS A H    1  
ATOM 1507  H HA   . CYS A 1 114 ? -9.747  9.103   7.021   1.00 0.67  ? 628 CYS A HA   1  
ATOM 1508  H HB2  . CYS A 1 114 ? -9.120  6.860   6.497   1.00 1.42  ? 628 CYS A HB2  1  
ATOM 1509  H HB3  . CYS A 1 114 ? -10.726 6.744   6.915   1.00 1.26  ? 628 CYS A HB3  1  
ATOM 1510  H HG   . CYS A 1 114 ? -9.949  7.313   3.788   1.00 2.84  ? 628 CYS A HG   1  
ATOM 1511  N N    . ARG A 1 115 ? -8.205  9.914   5.256   1.00 0.77  ? 629 ARG A N    1  
ATOM 1512  C CA   . ARG A 1 115 ? -7.208  10.456  4.318   1.00 0.89  ? 629 ARG A CA   1  
ATOM 1513  C C    . ARG A 1 115 ? -6.227  9.332   3.966   1.00 0.85  ? 629 ARG A C    1  
ATOM 1514  O O    . ARG A 1 115 ? -5.450  8.892   4.821   1.00 0.86  ? 629 ARG A O    1  
ATOM 1515  C CB   . ARG A 1 115 ? -6.461  11.634  4.994   1.00 1.06  ? 629 ARG A CB   1  
ATOM 1516  C CG   . ARG A 1 115 ? -7.341  12.802  5.487   1.00 1.90  ? 629 ARG A CG   1  
ATOM 1517  C CD   . ARG A 1 115 ? -7.514  13.907  4.438   1.00 1.65  ? 629 ARG A CD   1  
ATOM 1518  N NE   . ARG A 1 115 ? -6.522  14.990  4.594   1.00 1.82  ? 629 ARG A NE   1  
ATOM 1519  C CZ   . ARG A 1 115 ? -6.680  16.149  5.209   1.00 2.58  ? 629 ARG A CZ   1  
ATOM 1520  N NH1  . ARG A 1 115 ? -7.742  16.497  5.869   1.00 3.58  ? 629 ARG A NH1  1  
ATOM 1521  N NH2  . ARG A 1 115 ? -5.729  17.026  5.176   1.00 3.03  ? 629 ARG A NH2  1  
ATOM 1522  H H    . ARG A 1 115 ? -7.933  9.918   6.239   1.00 0.78  ? 629 ARG A H    1  
ATOM 1523  H HA   . ARG A 1 115 ? -7.693  10.796  3.394   1.00 0.98  ? 629 ARG A HA   1  
ATOM 1524  H HB2  . ARG A 1 115 ? -5.935  11.241  5.862   1.00 1.61  ? 629 ARG A HB2  1  
ATOM 1525  H HB3  . ARG A 1 115 ? -5.696  12.015  4.316   1.00 1.33  ? 629 ARG A HB3  1  
ATOM 1526  H HG2  . ARG A 1 115 ? -8.326  12.436  5.775   1.00 2.74  ? 629 ARG A HG2  1  
ATOM 1527  H HG3  . ARG A 1 115 ? -6.888  13.234  6.381   1.00 2.80  ? 629 ARG A HG3  1  
ATOM 1528  H HD2  . ARG A 1 115 ? -7.417  13.471  3.445   1.00 1.74  ? 629 ARG A HD2  1  
ATOM 1529  H HD3  . ARG A 1 115 ? -8.521  14.313  4.508   1.00 2.01  ? 629 ARG A HD3  1  
ATOM 1530  H HE   . ARG A 1 115 ? -5.626  14.892  4.134   1.00 2.16  ? 629 ARG A HE   1  
ATOM 1531  H HH11 . ARG A 1 115 ? -8.512  15.851  6.005   1.00 3.93  ? 629 ARG A HH11 1  
ATOM 1532  H HH12 . ARG A 1 115 ? -7.764  17.425  6.268   1.00 4.27  ? 629 ARG A HH12 1  
ATOM 1533  H HH21 . ARG A 1 115 ? -4.871  16.797  4.684   1.00 3.21  ? 629 ARG A HH21 1  
ATOM 1534  H HH22 . ARG A 1 115 ? -5.884  17.914  5.636   1.00 3.63  ? 629 ARG A HH22 1  
ATOM 1535  N N    . LEU A 1 116 ? -6.277  8.846   2.730   1.00 0.84  ? 630 LEU A N    1  
ATOM 1536  C CA   . LEU A 1 116 ? -5.424  7.764   2.223   1.00 0.87  ? 630 LEU A CA   1  
ATOM 1537  C C    . LEU A 1 116 ? -4.501  8.279   1.095   1.00 0.92  ? 630 LEU A C    1  
ATOM 1538  O O    . LEU A 1 116 ? -4.668  9.375   0.558   1.00 1.04  ? 630 LEU A O    1  
ATOM 1539  C CB   . LEU A 1 116 ? -6.279  6.545   1.781   1.00 0.83  ? 630 LEU A CB   1  
ATOM 1540  C CG   . LEU A 1 116 ? -7.347  6.010   2.766   1.00 0.83  ? 630 LEU A CG   1  
ATOM 1541  C CD1  . LEU A 1 116 ? -7.976  4.714   2.236   1.00 0.85  ? 630 LEU A CD1  1  
ATOM 1542  C CD2  . LEU A 1 116 ? -6.830  5.677   4.171   1.00 0.90  ? 630 LEU A CD2  1  
ATOM 1543  H H    . LEU A 1 116 ? -6.895  9.294   2.057   1.00 0.83  ? 630 LEU A H    1  
ATOM 1544  H HA   . LEU A 1 116 ? -4.770  7.417   3.023   1.00 0.92  ? 630 LEU A HA   1  
ATOM 1545  H HB2  . LEU A 1 116 ? -6.791  6.812   0.855   1.00 0.79  ? 630 LEU A HB2  1  
ATOM 1546  H HB3  . LEU A 1 116 ? -5.594  5.728   1.548   1.00 0.89  ? 630 LEU A HB3  1  
ATOM 1547  H HG   . LEU A 1 116 ? -8.132  6.759   2.862   1.00 0.81  ? 630 LEU A HG   1  
ATOM 1548  H HD11 . LEU A 1 116 ? -8.491  4.895   1.295   1.00 1.61  ? 630 LEU A HD11 1  
ATOM 1549  H HD12 . LEU A 1 116 ? -8.709  4.342   2.958   1.00 2.00  ? 630 LEU A HD12 1  
ATOM 1550  H HD13 . LEU A 1 116 ? -7.213  3.951   2.067   1.00 1.77  ? 630 LEU A HD13 1  
ATOM 1551  H HD21 . LEU A 1 116 ? -6.403  6.560   4.632   1.00 2.08  ? 630 LEU A HD21 1  
ATOM 1552  H HD22 . LEU A 1 116 ? -6.079  4.890   4.121   1.00 1.44  ? 630 LEU A HD22 1  
ATOM 1553  H HD23 . LEU A 1 116 ? -7.657  5.344   4.807   1.00 1.61  ? 630 LEU A HD23 1  
ATOM 1554  N N    . TYR A 1 117 ? -3.506  7.476   0.738   1.00 0.88  ? 631 TYR A N    1  
ATOM 1555  C CA   . TYR A 1 117 ? -2.548  7.712   -0.346  1.00 0.92  ? 631 TYR A CA   1  
ATOM 1556  C C    . TYR A 1 117 ? -2.390  6.435   -1.182  1.00 0.88  ? 631 TYR A C    1  
ATOM 1557  O O    . TYR A 1 117 ? -2.595  5.332   -0.669  1.00 1.05  ? 631 TYR A O    1  
ATOM 1558  C CB   . TYR A 1 117 ? -1.205  8.163   0.258   1.00 1.18  ? 631 TYR A CB   1  
ATOM 1559  C CG   . TYR A 1 117 ? -0.836  9.608   -0.010  1.00 2.89  ? 631 TYR A CG   1  
ATOM 1560  C CD1  . TYR A 1 117 ? -0.104  9.941   -1.163  1.00 3.99  ? 631 TYR A CD1  1  
ATOM 1561  C CD2  . TYR A 1 117 ? -1.209  10.615  0.899   1.00 4.34  ? 631 TYR A CD2  1  
ATOM 1562  C CE1  . TYR A 1 117 ? 0.247   11.281  -1.416  1.00 5.68  ? 631 TYR A CE1  1  
ATOM 1563  C CE2  . TYR A 1 117 ? -0.831  11.954  0.670   1.00 5.99  ? 631 TYR A CE2  1  
ATOM 1564  C CZ   . TYR A 1 117 ? -0.107  12.289  -0.496  1.00 6.47  ? 631 TYR A CZ   1  
ATOM 1565  O OH   . TYR A 1 117 ? 0.224   13.580  -0.761  1.00 8.24  ? 631 TYR A OH   1  
ATOM 1566  H H    . TYR A 1 117 ? -3.379  6.621   1.269   1.00 0.88  ? 631 TYR A H    1  
ATOM 1567  H HA   . TYR A 1 117 ? -2.920  8.496   -1.005  1.00 0.89  ? 631 TYR A HA   1  
ATOM 1568  H HB2  . TYR A 1 117 ? -1.225  8.008   1.336   1.00 1.71  ? 631 TYR A HB2  1  
ATOM 1569  H HB3  . TYR A 1 117 ? -0.405  7.535   -0.132  1.00 1.53  ? 631 TYR A HB3  1  
ATOM 1570  H HD1  . TYR A 1 117 ? 0.155   9.160   -1.864  1.00 4.14  ? 631 TYR A HD1  1  
ATOM 1571  H HD2  . TYR A 1 117 ? -1.792  10.350  1.768   1.00 4.65  ? 631 TYR A HD2  1  
ATOM 1572  H HE1  . TYR A 1 117 ? 0.788   11.558  -2.307  1.00 6.77  ? 631 TYR A HE1  1  
ATOM 1573  H HE2  . TYR A 1 117 ? -1.107  12.729  1.370   1.00 7.23  ? 631 TYR A HE2  1  
ATOM 1574  H HH   . TYR A 1 117 ? 0.011   14.169  -0.014  1.00 8.90  ? 631 TYR A HH   1  
ATOM 1575  N N    . SER A 1 118 ? -2.025  6.554   -2.461  1.00 0.80  ? 632 SER A N    1  
ATOM 1576  C CA   . SER A 1 118 ? -1.845  5.399   -3.351  1.00 0.89  ? 632 SER A CA   1  
ATOM 1577  C C    . SER A 1 118 ? -0.749  5.593   -4.408  1.00 0.88  ? 632 SER A C    1  
ATOM 1578  O O    . SER A 1 118 ? -0.470  6.707   -4.866  1.00 1.05  ? 632 SER A O    1  
ATOM 1579  C CB   . SER A 1 118 ? -3.184  5.052   -4.011  1.00 1.01  ? 632 SER A CB   1  
ATOM 1580  O OG   . SER A 1 118 ? -3.087  3.842   -4.734  1.00 2.07  ? 632 SER A OG   1  
ATOM 1581  H H    . SER A 1 118 ? -1.937  7.486   -2.862  1.00 0.77  ? 632 SER A H    1  
ATOM 1582  H HA   . SER A 1 118 ? -1.548  4.545   -2.742  1.00 1.11  ? 632 SER A HA   1  
ATOM 1583  H HB2  . SER A 1 118 ? -3.950  4.943   -3.242  1.00 2.09  ? 632 SER A HB2  1  
ATOM 1584  H HB3  . SER A 1 118 ? -3.476  5.859   -4.684  1.00 1.68  ? 632 SER A HB3  1  
ATOM 1585  H HG   . SER A 1 118 ? -2.779  3.134   -4.132  1.00 3.16  ? 632 SER A HG   1  
ATOM 1586  N N    . LEU A 1 119 ? -0.142  4.470   -4.803  1.00 0.85  ? 633 LEU A N    1  
ATOM 1587  C CA   . LEU A 1 119 ? 0.824   4.342   -5.894  1.00 1.04  ? 633 LEU A CA   1  
ATOM 1588  C C    . LEU A 1 119 ? 0.534   3.044   -6.652  1.00 0.99  ? 633 LEU A C    1  
ATOM 1589  O O    . LEU A 1 119 ? 0.346   1.985   -6.044  1.00 0.93  ? 633 LEU A O    1  
ATOM 1590  C CB   . LEU A 1 119 ? 2.259   4.345   -5.320  1.00 1.38  ? 633 LEU A CB   1  
ATOM 1591  C CG   . LEU A 1 119 ? 3.304   5.089   -6.174  1.00 1.91  ? 633 LEU A CG   1  
ATOM 1592  C CD1  . LEU A 1 119 ? 4.649   5.069   -5.455  1.00 2.33  ? 633 LEU A CD1  1  
ATOM 1593  C CD2  . LEU A 1 119 ? 3.545   4.474   -7.550  1.00 2.30  ? 633 LEU A CD2  1  
ATOM 1594  H H    . LEU A 1 119 ? -0.478  3.600   -4.406  1.00 0.84  ? 633 LEU A H    1  
ATOM 1595  H HA   . LEU A 1 119 ? 0.695   5.174   -6.590  1.00 1.22  ? 633 LEU A HA   1  
ATOM 1596  H HB2  . LEU A 1 119 ? 2.243   4.811   -4.336  1.00 1.34  ? 633 LEU A HB2  1  
ATOM 1597  H HB3  . LEU A 1 119 ? 2.590   3.316   -5.166  1.00 1.53  ? 633 LEU A HB3  1  
ATOM 1598  H HG   . LEU A 1 119 ? 2.992   6.126   -6.304  1.00 2.00  ? 633 LEU A HG   1  
ATOM 1599  H HD11 . LEU A 1 119 ? 4.558   5.527   -4.473  1.00 2.39  ? 633 LEU A HD11 1  
ATOM 1600  H HD12 . LEU A 1 119 ? 5.383   5.633   -6.030  1.00 3.47  ? 633 LEU A HD12 1  
ATOM 1601  H HD13 . LEU A 1 119 ? 4.996   4.042   -5.337  1.00 2.52  ? 633 LEU A HD13 1  
ATOM 1602  H HD21 . LEU A 1 119 ? 4.387   4.967   -8.034  1.00 2.92  ? 633 LEU A HD21 1  
ATOM 1603  H HD22 . LEU A 1 119 ? 2.664   4.592   -8.176  1.00 3.13  ? 633 LEU A HD22 1  
ATOM 1604  H HD23 . LEU A 1 119 ? 3.777   3.415   -7.441  1.00 2.17  ? 633 LEU A HD23 1  
ATOM 1605  N N    . SER A 1 120 ? 0.509   3.116   -7.979  1.00 1.18  ? 634 SER A N    1  
ATOM 1606  C CA   . SER A 1 120 ? 0.409   1.929   -8.829  1.00 1.21  ? 634 SER A CA   1  
ATOM 1607  C C    . SER A 1 120 ? 1.593   0.987   -8.650  1.00 1.24  ? 634 SER A C    1  
ATOM 1608  O O    . SER A 1 120 ? 2.754   1.404   -8.613  1.00 1.18  ? 634 SER A O    1  
ATOM 1609  C CB   . SER A 1 120 ? 0.204   2.310   -10.292 1.00 1.28  ? 634 SER A CB   1  
ATOM 1610  O OG   . SER A 1 120 ? 1.065   3.350   -10.705 1.00 2.03  ? 634 SER A OG   1  
ATOM 1611  H H    . SER A 1 120 ? 0.654   4.017   -8.428  1.00 1.33  ? 634 SER A H    1  
ATOM 1612  H HA   . SER A 1 120 ? -0.471  1.378   -8.517  1.00 1.30  ? 634 SER A HA   1  
ATOM 1613  H HB2  . SER A 1 120 ? 0.339   1.439   -10.934 1.00 1.52  ? 634 SER A HB2  1  
ATOM 1614  H HB3  . SER A 1 120 ? -0.817  2.657   -10.384 1.00 2.20  ? 634 SER A HB3  1  
ATOM 1615  H HG   . SER A 1 120 ? 0.746   3.640   -11.581 1.00 2.18  ? 634 SER A HG   1  
ATOM 1616  N N    . VAL A 1 121 ? 1.294   -0.312  -8.548  1.00 1.43  ? 635 VAL A N    1  
ATOM 1617  C CA   . VAL A 1 121 ? 2.298   -1.340  -8.249  1.00 1.67  ? 635 VAL A CA   1  
ATOM 1618  C C    . VAL A 1 121 ? 3.425   -1.315  -9.277  1.00 1.57  ? 635 VAL A C    1  
ATOM 1619  O O    . VAL A 1 121 ? 4.604   -1.420  -8.949  1.00 1.77  ? 635 VAL A O    1  
ATOM 1620  C CB   . VAL A 1 121 ? 1.636   -2.717  -8.088  1.00 1.98  ? 635 VAL A CB   1  
ATOM 1621  C CG1  . VAL A 1 121 ? 1.426   -3.477  -9.377  1.00 1.81  ? 635 VAL A CG1  1  
ATOM 1622  C CG2  . VAL A 1 121 ? 2.607   -3.627  -7.391  1.00 2.59  ? 635 VAL A CG2  1  
ATOM 1623  H H    . VAL A 1 121 ? 0.343   -0.606  -8.729  1.00 1.51  ? 635 VAL A H    1  
ATOM 1624  H HA   . VAL A 1 121 ? 2.763   -1.140  -7.296  1.00 1.85  ? 635 VAL A HA   1  
ATOM 1625  H HB   . VAL A 1 121 ? 0.713   -2.640  -7.513  1.00 3.38  ? 635 VAL A HB   1  
ATOM 1626  H HG11 . VAL A 1 121 ? 0.765   -2.903  -10.011 1.00 2.85  ? 635 VAL A HG11 1  
ATOM 1627  H HG12 . VAL A 1 121 ? 2.417   -3.650  -9.816  1.00 2.16  ? 635 VAL A HG12 1  
ATOM 1628  H HG13 . VAL A 1 121 ? 0.990   -4.443  -9.134  1.00 2.58  ? 635 VAL A HG13 1  
ATOM 1629  H HG21 . VAL A 1 121 ? 2.925   -3.164  -6.463  1.00 3.74  ? 635 VAL A HG21 1  
ATOM 1630  H HG22 . VAL A 1 121 ? 2.137   -4.584  -7.173  1.00 3.50  ? 635 VAL A HG22 1  
ATOM 1631  H HG23 . VAL A 1 121 ? 3.432   -3.758  -8.106  1.00 2.39  ? 635 VAL A HG23 1  
ATOM 1632  N N    . ASP A 1 122 ? 3.083   -1.097  -10.541 1.00 1.38  ? 636 ASP A N    1  
ATOM 1633  C CA   . ASP A 1 122 ? 4.068   -1.214  -11.603 1.00 1.60  ? 636 ASP A CA   1  
ATOM 1634  C C    . ASP A 1 122 ? 5.134   -0.093  -11.547 1.00 1.49  ? 636 ASP A C    1  
ATOM 1635  O O    . ASP A 1 122 ? 6.273   -0.278  -11.977 1.00 1.71  ? 636 ASP A O    1  
ATOM 1636  C CB   . ASP A 1 122 ? 3.376   -1.152  -12.972 1.00 1.75  ? 636 ASP A CB   1  
ATOM 1637  C CG   . ASP A 1 122 ? 2.152   -2.052  -13.081 1.00 2.05  ? 636 ASP A CG   1  
ATOM 1638  O OD1  . ASP A 1 122 ? 1.035   -1.578  -12.759 1.00 2.27  ? 636 ASP A OD1  1  
ATOM 1639  O OD2  . ASP A 1 122 ? 2.312   -3.230  -13.480 1.00 2.83  ? 636 ASP A OD2  1  
ATOM 1640  H H    . ASP A 1 122 ? 2.098   -1.056  -10.764 1.00 1.31  ? 636 ASP A H    1  
ATOM 1641  H HA   . ASP A 1 122 ? 4.517   -2.198  -11.407 1.00 2.03  ? 636 ASP A HA   1  
ATOM 1642  H HB2  . ASP A 1 122 ? 3.068   -0.122  -13.162 1.00 1.56  ? 636 ASP A HB2  1  
ATOM 1643  H HB3  . ASP A 1 122 ? 4.098   -1.432  -13.738 1.00 2.25  ? 636 ASP A HB3  1  
ATOM 1644  N N    . ASN A 1 123 ? 4.779   1.070   -10.986 1.00 1.24  ? 637 ASN A N    1  
ATOM 1645  C CA   . ASN A 1 123 ? 5.672   2.213   -10.796 1.00 1.16  ? 637 ASN A CA   1  
ATOM 1646  C C    . ASN A 1 123 ? 6.573   2.096   -9.553  1.00 1.10  ? 637 ASN A C    1  
ATOM 1647  O O    . ASN A 1 123 ? 7.614   2.744   -9.494  1.00 1.22  ? 637 ASN A O    1  
ATOM 1648  C CB   . ASN A 1 123 ? 4.839   3.500   -10.816 1.00 1.28  ? 637 ASN A CB   1  
ATOM 1649  C CG   . ASN A 1 123 ? 4.374   3.814   -12.222 1.00 1.80  ? 637 ASN A CG   1  
ATOM 1650  O OD1  . ASN A 1 123 ? 3.195   3.794   -12.530 1.00 2.81  ? 637 ASN A OD1  1  
ATOM 1651  N ND2  . ASN A 1 123 ? 5.260   4.131   -13.123 1.00 1.64  ? 637 ASN A ND2  1  
ATOM 1652  H H    . ASN A 1 123 ? 3.829   1.161   -10.649 1.00 1.18  ? 637 ASN A H    1  
ATOM 1653  H HA   . ASN A 1 123 ? 6.350   2.251   -11.648 1.00 1.27  ? 637 ASN A HA   1  
ATOM 1654  H HB2  . ASN A 1 123 ? 3.975   3.397   -10.161 1.00 1.37  ? 637 ASN A HB2  1  
ATOM 1655  H HB3  . ASN A 1 123 ? 5.450   4.327   -10.466 1.00 1.32  ? 637 ASN A HB3  1  
ATOM 1656  H HD21 . ASN A 1 123 ? 6.233   4.297   -12.869 1.00 1.77  ? 637 ASN A HD21 1  
ATOM 1657  H HD22 . ASN A 1 123 ? 4.940   4.168   -14.081 1.00 1.96  ? 637 ASN A HD22 1  
ATOM 1658  N N    . PHE A 1 124 ? 6.227   1.229   -8.600  1.00 1.07  ? 638 PHE A N    1  
ATOM 1659  C CA   . PHE A 1 124 ? 7.115   0.703   -7.557  1.00 1.13  ? 638 PHE A CA   1  
ATOM 1660  C C    . PHE A 1 124 ? 8.072   -0.345  -8.179  1.00 1.32  ? 638 PHE A C    1  
ATOM 1661  O O    . PHE A 1 124 ? 9.279   -0.291  -7.938  1.00 1.33  ? 638 PHE A O    1  
ATOM 1662  C CB   . PHE A 1 124 ? 6.209   0.202   -6.421  1.00 1.36  ? 638 PHE A CB   1  
ATOM 1663  C CG   . PHE A 1 124 ? 6.815   -0.288  -5.109  1.00 1.55  ? 638 PHE A CG   1  
ATOM 1664  C CD1  . PHE A 1 124 ? 7.922   -1.162  -5.052  1.00 1.66  ? 638 PHE A CD1  1  
ATOM 1665  C CD2  . PHE A 1 124 ? 6.174   0.070   -3.905  1.00 2.80  ? 638 PHE A CD2  1  
ATOM 1666  C CE1  . PHE A 1 124 ? 8.400   -1.633  -3.816  1.00 1.84  ? 638 PHE A CE1  1  
ATOM 1667  C CE2  . PHE A 1 124 ? 6.647   -0.405  -2.670  1.00 3.01  ? 638 PHE A CE2  1  
ATOM 1668  C CZ   . PHE A 1 124 ? 7.769   -1.248  -2.622  1.00 2.06  ? 638 PHE A CZ   1  
ATOM 1669  H H    . PHE A 1 124 ? 5.332   0.778   -8.696  1.00 1.06  ? 638 PHE A H    1  
ATOM 1670  H HA   . PHE A 1 124 ? 7.712   1.508   -7.131  1.00 0.96  ? 638 PHE A HA   1  
ATOM 1671  H HB2  . PHE A 1 124 ? 5.545   1.032   -6.172  1.00 1.31  ? 638 PHE A HB2  1  
ATOM 1672  H HB3  . PHE A 1 124 ? 5.566   -0.572  -6.811  1.00 1.66  ? 638 PHE A HB3  1  
ATOM 1673  H HD1  . PHE A 1 124 ? 8.400   -1.514  -5.949  1.00 2.47  ? 638 PHE A HD1  1  
ATOM 1674  H HD2  . PHE A 1 124 ? 5.304   0.712   -3.924  1.00 3.83  ? 638 PHE A HD2  1  
ATOM 1675  H HE1  . PHE A 1 124 ? 9.238   -2.315  -3.789  1.00 2.60  ? 638 PHE A HE1  1  
ATOM 1676  H HE2  . PHE A 1 124 ? 6.138   -0.119  -1.760  1.00 4.15  ? 638 PHE A HE2  1  
ATOM 1677  H HZ   . PHE A 1 124 ? 8.134   -1.611  -1.673  1.00 2.28  ? 638 PHE A HZ   1  
ATOM 1678  N N    . ASN A 1 125 ? 7.590   -1.223  -9.076  1.00 1.46  ? 639 ASN A N    1  
ATOM 1679  C CA   . ASN A 1 125 ? 8.457   -2.107  -9.885  1.00 1.57  ? 639 ASN A CA   1  
ATOM 1680  C C    . ASN A 1 125 ? 9.444   -1.328  -10.786 1.00 1.55  ? 639 ASN A C    1  
ATOM 1681  O O    . ASN A 1 125 ? 10.521  -1.842  -11.078 1.00 1.69  ? 639 ASN A O    1  
ATOM 1682  C CB   . ASN A 1 125 ? 7.612   -3.067  -10.754 1.00 1.57  ? 639 ASN A CB   1  
ATOM 1683  C CG   . ASN A 1 125 ? 7.162   -4.342  -10.067 1.00 1.79  ? 639 ASN A CG   1  
ATOM 1684  O OD1  . ASN A 1 125 ? 7.951   -5.089  -9.505  1.00 2.24  ? 639 ASN A OD1  1  
ATOM 1685  N ND2  . ASN A 1 125 ? 5.890   -4.667  -10.155 1.00 1.76  ? 639 ASN A ND2  1  
ATOM 1686  H H    . ASN A 1 125 ? 6.585   -1.266  -9.212  1.00 1.47  ? 639 ASN A H    1  
ATOM 1687  H HA   . ASN A 1 125 ? 9.072   -2.705  -9.210  1.00 1.66  ? 639 ASN A HA   1  
ATOM 1688  H HB2  . ASN A 1 125 ? 6.749   -2.548  -11.152 1.00 1.69  ? 639 ASN A HB2  1  
ATOM 1689  H HB3  . ASN A 1 125 ? 8.211   -3.390  -11.604 1.00 1.52  ? 639 ASN A HB3  1  
ATOM 1690  H HD21 . ASN A 1 125 ? 5.260   -4.136  -10.730 1.00 1.69  ? 639 ASN A HD21 1  
ATOM 1691  H HD22 . ASN A 1 125 ? 5.568   -5.521  -9.719  1.00 2.01  ? 639 ASN A HD22 1  
ATOM 1692  N N    . GLU A 1 126 ? 9.116   -0.106  -11.223 1.00 1.41  ? 640 GLU A N    1  
ATOM 1693  C CA   . GLU A 1 126 ? 10.015  0.765   -12.002 1.00 1.42  ? 640 GLU A CA   1  
ATOM 1694  C C    . GLU A 1 126 ? 11.197  1.276   -11.172 1.00 1.45  ? 640 GLU A C    1  
ATOM 1695  O O    . GLU A 1 126 ? 12.340  1.209   -11.622 1.00 1.69  ? 640 GLU A O    1  
ATOM 1696  C CB   . GLU A 1 126 ? 9.236   1.977   -12.543 1.00 1.28  ? 640 GLU A CB   1  
ATOM 1697  C CG   . GLU A 1 126 ? 8.580   1.778   -13.923 1.00 1.94  ? 640 GLU A CG   1  
ATOM 1698  C CD   . GLU A 1 126 ? 9.535   1.929   -15.120 1.00 2.32  ? 640 GLU A CD   1  
ATOM 1699  O OE1  . GLU A 1 126 ? 10.524  1.164   -15.235 1.00 3.51  ? 640 GLU A OE1  1  
ATOM 1700  O OE2  . GLU A 1 126 ? 9.279   2.782   -16.006 1.00 2.71  ? 640 GLU A OE2  1  
ATOM 1701  H H    . GLU A 1 126 ? 8.188   0.238   -11.015 1.00 1.33  ? 640 GLU A H    1  
ATOM 1702  H HA   . GLU A 1 126 ? 10.440  0.204   -12.831 1.00 1.56  ? 640 GLU A HA   1  
ATOM 1703  H HB2  . GLU A 1 126 ? 8.451   2.208   -11.833 1.00 1.79  ? 640 GLU A HB2  1  
ATOM 1704  H HB3  . GLU A 1 126 ? 9.881   2.856   -12.540 1.00 1.49  ? 640 GLU A HB3  1  
ATOM 1705  H HG2  . GLU A 1 126 ? 8.109   0.795   -13.956 1.00 2.78  ? 640 GLU A HG2  1  
ATOM 1706  H HG3  . GLU A 1 126 ? 7.783   2.519   -14.020 1.00 2.38  ? 640 GLU A HG3  1  
ATOM 1707  N N    . VAL A 1 127 ? 10.926  1.780   -9.967  1.00 1.28  ? 641 VAL A N    1  
ATOM 1708  C CA   . VAL A 1 127 ? 11.939  2.353   -9.064  1.00 1.27  ? 641 VAL A CA   1  
ATOM 1709  C C    . VAL A 1 127 ? 12.798  1.288   -8.395  1.00 1.43  ? 641 VAL A C    1  
ATOM 1710  O O    . VAL A 1 127 ? 13.972  1.537   -8.143  1.00 1.49  ? 641 VAL A O    1  
ATOM 1711  C CB   . VAL A 1 127 ? 11.285  3.317   -8.060  1.00 1.09  ? 641 VAL A CB   1  
ATOM 1712  C CG1  . VAL A 1 127 ? 10.125  2.712   -7.283  1.00 1.09  ? 641 VAL A CG1  1  
ATOM 1713  C CG2  . VAL A 1 127 ? 12.252  3.915   -7.037  1.00 1.08  ? 641 VAL A CG2  1  
ATOM 1714  H H    . VAL A 1 127 ? 9.956   1.818   -9.679  1.00 1.17  ? 641 VAL A H    1  
ATOM 1715  H HA   . VAL A 1 127 ? 12.623  2.951   -9.667  1.00 1.32  ? 641 VAL A HA   1  
ATOM 1716  H HB   . VAL A 1 127 ? 10.862  4.117   -8.655  1.00 1.04  ? 641 VAL A HB   1  
ATOM 1717  H HG11 . VAL A 1 127 ? 9.382   2.378   -8.000  1.00 1.74  ? 641 VAL A HG11 1  
ATOM 1718  H HG12 . VAL A 1 127 ? 10.461  1.872   -6.680  1.00 1.72  ? 641 VAL A HG12 1  
ATOM 1719  H HG13 . VAL A 1 127 ? 9.687   3.474   -6.640  1.00 1.72  ? 641 VAL A HG13 1  
ATOM 1720  H HG21 . VAL A 1 127 ? 11.762  4.729   -6.506  1.00 1.80  ? 641 VAL A HG21 1  
ATOM 1721  H HG22 . VAL A 1 127 ? 12.527  3.161   -6.297  1.00 2.01  ? 641 VAL A HG22 1  
ATOM 1722  H HG23 . VAL A 1 127 ? 13.141  4.288   -7.549  1.00 1.36  ? 641 VAL A HG23 1  
ATOM 1723  N N    . LEU A 1 128 ? 12.277  0.076   -8.191  1.00 1.52  ? 642 LEU A N    1  
ATOM 1724  C CA   . LEU A 1 128 ? 13.093  -1.066  -7.741  1.00 1.68  ? 642 LEU A CA   1  
ATOM 1725  C C    . LEU A 1 128 ? 14.344  -1.290  -8.615  1.00 1.80  ? 642 LEU A C    1  
ATOM 1726  O O    . LEU A 1 128 ? 15.415  -1.596  -8.097  1.00 1.85  ? 642 LEU A O    1  
ATOM 1727  C CB   . LEU A 1 128 ? 12.256  -2.361  -7.732  1.00 1.76  ? 642 LEU A CB   1  
ATOM 1728  C CG   . LEU A 1 128 ? 11.542  -2.679  -6.408  1.00 2.06  ? 642 LEU A CG   1  
ATOM 1729  C CD1  . LEU A 1 128 ? 10.834  -4.031  -6.532  1.00 2.26  ? 642 LEU A CD1  1  
ATOM 1730  C CD2  . LEU A 1 128 ? 12.524  -2.800  -5.242  1.00 2.61  ? 642 LEU A CD2  1  
ATOM 1731  H H    . LEU A 1 128 ? 11.283  -0.033  -8.361  1.00 1.47  ? 642 LEU A H    1  
ATOM 1732  H HA   . LEU A 1 128 ? 13.453  -0.840  -6.738  1.00 1.66  ? 642 LEU A HA   1  
ATOM 1733  H HB2  . LEU A 1 128 ? 11.523  -2.325  -8.538  1.00 1.64  ? 642 LEU A HB2  1  
ATOM 1734  H HB3  . LEU A 1 128 ? 12.925  -3.196  -7.947  1.00 2.09  ? 642 LEU A HB3  1  
ATOM 1735  H HG   . LEU A 1 128 ? 10.811  -1.903  -6.186  1.00 2.44  ? 642 LEU A HG   1  
ATOM 1736  H HD11 . LEU A 1 128 ? 11.567  -4.825  -6.694  1.00 2.43  ? 642 LEU A HD11 1  
ATOM 1737  H HD12 . LEU A 1 128 ? 10.136  -4.010  -7.368  1.00 2.73  ? 642 LEU A HD12 1  
ATOM 1738  H HD13 . LEU A 1 128 ? 10.280  -4.244  -5.619  1.00 3.09  ? 642 LEU A HD13 1  
ATOM 1739  H HD21 . LEU A 1 128 ? 13.305  -3.511  -5.496  1.00 2.71  ? 642 LEU A HD21 1  
ATOM 1740  H HD22 . LEU A 1 128 ? 11.998  -3.127  -4.349  1.00 3.65  ? 642 LEU A HD22 1  
ATOM 1741  H HD23 . LEU A 1 128 ? 12.985  -1.843  -5.025  1.00 2.89  ? 642 LEU A HD23 1  
ATOM 1742  N N    . GLU A 1 129 ? 14.229  -1.107  -9.932  1.00 1.89  ? 643 GLU A N    1  
ATOM 1743  C CA   . GLU A 1 129 ? 15.340  -1.300  -10.878 1.00 2.05  ? 643 GLU A CA   1  
ATOM 1744  C C    . GLU A 1 129 ? 16.484  -0.281  -10.724 1.00 1.97  ? 643 GLU A C    1  
ATOM 1745  O O    . GLU A 1 129 ? 17.604  -0.573  -11.147 1.00 2.14  ? 643 GLU A O    1  
ATOM 1746  C CB   . GLU A 1 129 ? 14.840  -1.280  -12.332 1.00 2.16  ? 643 GLU A CB   1  
ATOM 1747  C CG   . GLU A 1 129 ? 13.794  -2.329  -12.634 1.00 2.77  ? 643 GLU A CG   1  
ATOM 1748  C CD   . GLU A 1 129 ? 13.530  -2.563  -14.129 1.00 3.07  ? 643 GLU A CD   1  
ATOM 1749  O OE1  . GLU A 1 129 ? 14.492  -2.629  -14.936 1.00 2.95  ? 643 GLU A OE1  1  
ATOM 1750  O OE2  . GLU A 1 129 ? 12.353  -2.815  -14.488 1.00 4.32  ? 643 GLU A OE2  1  
ATOM 1751  H H    . GLU A 1 129 ? 13.314  -0.873  -10.289 1.00 1.89  ? 643 GLU A H    1  
ATOM 1752  H HA   . GLU A 1 129 ? 15.778  -2.281  -10.689 1.00 2.21  ? 643 GLU A HA   1  
ATOM 1753  H HB2  . GLU A 1 129 ? 14.354  -0.357  -12.525 1.00 2.24  ? 643 GLU A HB2  1  
ATOM 1754  H HB3  . GLU A 1 129 ? 15.692  -1.398  -13.001 1.00 2.27  ? 643 GLU A HB3  1  
ATOM 1755  H HG2  . GLU A 1 129 ? 14.183  -3.216  -12.188 1.00 3.04  ? 643 GLU A HG2  1  
ATOM 1756  H HG3  . GLU A 1 129 ? 12.866  -2.067  -12.127 1.00 3.44  ? 643 GLU A HG3  1  
ATOM 1757  N N    . GLU A 1 130 ? 16.249  0.882   -10.106 1.00 1.77  ? 644 GLU A N    1  
ATOM 1758  C CA   . GLU A 1 130 ? 17.292  1.865   -9.766  1.00 1.77  ? 644 GLU A CA   1  
ATOM 1759  C C    . GLU A 1 130 ? 18.156  1.440   -8.560  1.00 1.82  ? 644 GLU A C    1  
ATOM 1760  O O    . GLU A 1 130 ? 19.242  1.990   -8.336  1.00 1.89  ? 644 GLU A O    1  
ATOM 1761  C CB   . GLU A 1 130 ? 16.616  3.193   -9.439  1.00 1.63  ? 644 GLU A CB   1  
ATOM 1762  C CG   . GLU A 1 130 ? 15.940  3.842   -10.647 1.00 1.60  ? 644 GLU A CG   1  
ATOM 1763  C CD   . GLU A 1 130 ? 16.814  4.919   -11.301 1.00 1.73  ? 644 GLU A CD   1  
ATOM 1764  O OE1  . GLU A 1 130 ? 17.102  5.959   -10.657 1.00 2.32  ? 644 GLU A OE1  1  
ATOM 1765  O OE2  . GLU A 1 130 ? 17.221  4.741   -12.478 1.00 2.28  ? 644 GLU A OE2  1  
ATOM 1766  H H    . GLU A 1 130 ? 15.305  1.093   -9.792  1.00 1.68  ? 644 GLU A H    1  
ATOM 1767  H HA   . GLU A 1 130 ? 17.934  2.034   -10.626 1.00 1.88  ? 644 GLU A HA   1  
ATOM 1768  H HB2  . GLU A 1 130 ? 15.858  3.021   -8.684  1.00 1.54  ? 644 GLU A HB2  1  
ATOM 1769  H HB3  . GLU A 1 130 ? 17.349  3.869   -9.006  1.00 1.68  ? 644 GLU A HB3  1  
ATOM 1770  H HG2  . GLU A 1 130 ? 15.643  3.091   -11.378 1.00 1.59  ? 644 GLU A HG2  1  
ATOM 1771  H HG3  . GLU A 1 130 ? 15.018  4.274   -10.287 1.00 1.56  ? 644 GLU A HG3  1  
ATOM 1772  N N    . TYR A 1 131 ? 17.657  0.481   -7.775  1.00 1.81  ? 645 TYR A N    1  
ATOM 1773  C CA   . TYR A 1 131 ? 18.233  -0.007  -6.519  1.00 1.86  ? 645 TYR A CA   1  
ATOM 1774  C C    . TYR A 1 131 ? 18.271  -1.553  -6.502  1.00 2.03  ? 645 TYR A C    1  
ATOM 1775  O O    . TYR A 1 131 ? 17.536  -2.189  -5.739  1.00 2.04  ? 645 TYR A O    1  
ATOM 1776  C CB   . TYR A 1 131 ? 17.481  0.622   -5.330  1.00 1.67  ? 645 TYR A CB   1  
ATOM 1777  C CG   . TYR A 1 131 ? 17.408  2.141   -5.398  1.00 1.49  ? 645 TYR A CG   1  
ATOM 1778  C CD1  . TYR A 1 131 ? 18.456  2.947   -4.909  1.00 2.05  ? 645 TYR A CD1  1  
ATOM 1779  C CD2  . TYR A 1 131 ? 16.303  2.748   -6.019  1.00 2.51  ? 645 TYR A CD2  1  
ATOM 1780  C CE1  . TYR A 1 131 ? 18.407  4.346   -5.083  1.00 2.01  ? 645 TYR A CE1  1  
ATOM 1781  C CE2  . TYR A 1 131 ? 16.255  4.140   -6.206  1.00 2.45  ? 645 TYR A CE2  1  
ATOM 1782  C CZ   . TYR A 1 131 ? 17.318  4.945   -5.759  1.00 1.31  ? 645 TYR A CZ   1  
ATOM 1783  O OH   . TYR A 1 131 ? 17.305  6.275   -6.041  1.00 1.35  ? 645 TYR A OH   1  
ATOM 1784  H H    . TYR A 1 131 ? 16.753  0.109   -8.042  1.00 1.78  ? 645 TYR A H    1  
ATOM 1785  H HA   . TYR A 1 131 ? 19.258  0.340   -6.445  1.00 1.91  ? 645 TYR A HA   1  
ATOM 1786  H HB2  . TYR A 1 131 ? 16.465  0.224   -5.299  1.00 1.68  ? 645 TYR A HB2  1  
ATOM 1787  H HB3  . TYR A 1 131 ? 17.979  0.331   -4.404  1.00 1.70  ? 645 TYR A HB3  1  
ATOM 1788  H HD1  . TYR A 1 131 ? 19.310  2.489   -4.426  1.00 3.22  ? 645 TYR A HD1  1  
ATOM 1789  H HD2  . TYR A 1 131 ? 15.509  2.129   -6.406  1.00 3.76  ? 645 TYR A HD2  1  
ATOM 1790  H HE1  . TYR A 1 131 ? 19.217  4.959   -4.723  1.00 3.19  ? 645 TYR A HE1  1  
ATOM 1791  H HE2  . TYR A 1 131 ? 15.427  4.593   -6.729  1.00 3.68  ? 645 TYR A HE2  1  
ATOM 1792  H HH   . TYR A 1 131 ? 18.154  6.705   -5.806  1.00 1.55  ? 645 TYR A HH   1  
ATOM 1793  N N    . PRO A 1 132 ? 19.108  -2.189  -7.353  1.00 2.17  ? 646 PRO A N    1  
ATOM 1794  C CA   . PRO A 1 132 ? 19.137  -3.642  -7.566  1.00 2.33  ? 646 PRO A CA   1  
ATOM 1795  C C    . PRO A 1 132 ? 19.335  -4.494  -6.301  1.00 2.36  ? 646 PRO A C    1  
ATOM 1796  O O    . PRO A 1 132 ? 18.883  -5.643  -6.289  1.00 2.49  ? 646 PRO A O    1  
ATOM 1797  C CB   . PRO A 1 132 ? 20.256  -3.890  -8.589  1.00 2.48  ? 646 PRO A CB   1  
ATOM 1798  C CG   . PRO A 1 132 ? 21.122  -2.635  -8.503  1.00 2.43  ? 646 PRO A CG   1  
ATOM 1799  C CD   . PRO A 1 132 ? 20.085  -1.557  -8.227  1.00 2.22  ? 646 PRO A CD   1  
ATOM 1800  H HA   . PRO A 1 132 ? 18.192  -3.940  -8.016  1.00 2.34  ? 646 PRO A HA   1  
ATOM 1801  H HB2  . PRO A 1 132 ? 20.836  -4.787  -8.366  1.00 2.62  ? 646 PRO A HB2  1  
ATOM 1802  H HB3  . PRO A 1 132 ? 19.822  -3.965  -9.587  1.00 2.51  ? 646 PRO A HB3  1  
ATOM 1803  H HG2  . PRO A 1 132 ? 21.808  -2.711  -7.658  1.00 2.49  ? 646 PRO A HG2  1  
ATOM 1804  H HG3  . PRO A 1 132 ? 21.666  -2.439  -9.426  1.00 2.50  ? 646 PRO A HG3  1  
ATOM 1805  H HD2  . PRO A 1 132 ? 20.566  -0.700  -7.764  1.00 2.17  ? 646 PRO A HD2  1  
ATOM 1806  H HD3  . PRO A 1 132 ? 19.603  -1.259  -9.160  1.00 2.20  ? 646 PRO A HD3  1  
ATOM 1807  N N    . MET A 1 133 ? 19.921  -3.958  -5.222  1.00 2.26  ? 647 MET A N    1  
ATOM 1808  C CA   . MET A 1 133 ? 19.955  -4.623  -3.912  1.00 2.29  ? 647 MET A CA   1  
ATOM 1809  C C    . MET A 1 133 ? 18.534  -4.894  -3.388  1.00 2.24  ? 647 MET A C    1  
ATOM 1810  O O    . MET A 1 133 ? 18.210  -6.010  -2.983  1.00 2.31  ? 647 MET A O    1  
ATOM 1811  C CB   . MET A 1 133 ? 20.725  -3.724  -2.933  1.00 2.24  ? 647 MET A CB   1  
ATOM 1812  C CG   . MET A 1 133 ? 20.749  -4.280  -1.503  1.00 2.84  ? 647 MET A CG   1  
ATOM 1813  S SD   . MET A 1 133 ? 21.234  -3.067  -0.252  1.00 2.78  ? 647 MET A SD   1  
ATOM 1814  C CE   . MET A 1 133 ? 19.653  -2.189  -0.114  1.00 2.46  ? 647 MET A CE   1  
ATOM 1815  H H    . MET A 1 133 ? 20.293  -3.015  -5.285  1.00 2.15  ? 647 MET A H    1  
ATOM 1816  H HA   . MET A 1 133 ? 20.474  -5.578  -4.003  1.00 2.42  ? 647 MET A HA   1  
ATOM 1817  H HB2  . MET A 1 133 ? 21.751  -3.599  -3.281  1.00 1.76  ? 647 MET A HB2  1  
ATOM 1818  H HB3  . MET A 1 133 ? 20.251  -2.743  -2.918  1.00 2.95  ? 647 MET A HB3  1  
ATOM 1819  H HG2  . MET A 1 133 ? 19.752  -4.634  -1.233  1.00 3.83  ? 647 MET A HG2  1  
ATOM 1820  H HG3  . MET A 1 133 ? 21.439  -5.122  -1.468  1.00 2.94  ? 647 MET A HG3  1  
ATOM 1821  H HE1  . MET A 1 133 ? 19.391  -1.733  -1.070  1.00 2.04  ? 647 MET A HE1  1  
ATOM 1822  H HE2  . MET A 1 133 ? 18.871  -2.898  0.165   1.00 3.40  ? 647 MET A HE2  1  
ATOM 1823  H HE3  . MET A 1 133 ? 19.728  -1.416  0.651   1.00 2.72  ? 647 MET A HE3  1  
ATOM 1824  N N    . MET A 1 134 ? 17.663  -3.883  -3.436  1.00 2.15  ? 648 MET A N    1  
ATOM 1825  C CA   . MET A 1 134 ? 16.262  -4.014  -3.037  1.00 2.09  ? 648 MET A CA   1  
ATOM 1826  C C    . MET A 1 134 ? 15.477  -4.882  -4.032  1.00 2.05  ? 648 MET A C    1  
ATOM 1827  O O    . MET A 1 134 ? 14.567  -5.603  -3.629  1.00 2.07  ? 648 MET A O    1  
ATOM 1828  C CB   . MET A 1 134 ? 15.617  -2.625  -2.915  1.00 2.01  ? 648 MET A CB   1  
ATOM 1829  C CG   . MET A 1 134 ? 16.175  -1.735  -1.798  1.00 1.81  ? 648 MET A CG   1  
ATOM 1830  S SD   . MET A 1 134 ? 16.102  -2.371  -0.095  1.00 1.98  ? 648 MET A SD   1  
ATOM 1831  C CE   . MET A 1 134 ? 14.390  -2.961  0.035   1.00 2.51  ? 648 MET A CE   1  
ATOM 1832  H H    . MET A 1 134 ? 17.951  -3.022  -3.887  1.00 2.11  ? 648 MET A H    1  
ATOM 1833  H HA   . MET A 1 134 ? 16.212  -4.508  -2.065  1.00 2.17  ? 648 MET A HA   1  
ATOM 1834  H HB2  . MET A 1 134 ? 15.753  -2.096  -3.855  1.00 2.09  ? 648 MET A HB2  1  
ATOM 1835  H HB3  . MET A 1 134 ? 14.550  -2.752  -2.748  1.00 2.29  ? 648 MET A HB3  1  
ATOM 1836  H HG2  . MET A 1 134 ? 17.215  -1.503  -2.027  1.00 1.71  ? 648 MET A HG2  1  
ATOM 1837  H HG3  . MET A 1 134 ? 15.624  -0.795  -1.824  1.00 2.13  ? 648 MET A HG3  1  
ATOM 1838  H HE1  . MET A 1 134 ? 13.700  -2.168  -0.252  1.00 3.24  ? 648 MET A HE1  1  
ATOM 1839  H HE2  . MET A 1 134 ? 14.248  -3.830  -0.611  1.00 2.85  ? 648 MET A HE2  1  
ATOM 1840  H HE3  . MET A 1 134 ? 14.190  -3.258  1.066   1.00 3.25  ? 648 MET A HE3  1  
ATOM 1841  N N    . ARG A 1 135 ? 15.840  -4.878  -5.325  1.00 2.05  ? 649 ARG A N    1  
ATOM 1842  C CA   . ARG A 1 135 ? 15.154  -5.690  -6.348  1.00 2.09  ? 649 ARG A CA   1  
ATOM 1843  C C    . ARG A 1 135 ? 15.245  -7.189  -6.056  1.00 2.24  ? 649 ARG A C    1  
ATOM 1844  O O    . ARG A 1 135 ? 14.212  -7.859  -6.080  1.00 2.26  ? 649 ARG A O    1  
ATOM 1845  C CB   . ARG A 1 135 ? 15.654  -5.310  -7.753  1.00 2.11  ? 649 ARG A CB   1  
ATOM 1846  C CG   . ARG A 1 135 ? 14.672  -5.711  -8.868  1.00 2.44  ? 649 ARG A CG   1  
ATOM 1847  C CD   . ARG A 1 135 ? 14.899  -7.112  -9.468  1.00 2.28  ? 649 ARG A CD   1  
ATOM 1848  N NE   . ARG A 1 135 ? 16.050  -7.141  -10.389 1.00 2.28  ? 649 ARG A NE   1  
ATOM 1849  C CZ   . ARG A 1 135 ? 16.090  -6.615  -11.602 1.00 2.83  ? 649 ARG A CZ   1  
ATOM 1850  N NH1  . ARG A 1 135 ? 15.060  -6.068  -12.178 1.00 3.67  ? 649 ARG A NH1  1  
ATOM 1851  N NH2  . ARG A 1 135 ? 17.192  -6.591  -12.282 1.00 3.88  ? 649 ARG A NH2  1  
ATOM 1852  H H    . ARG A 1 135 ? 16.565  -4.228  -5.610  1.00 2.05  ? 649 ARG A H    1  
ATOM 1853  H HA   . ARG A 1 135 ? 14.091  -5.450  -6.292  1.00 2.05  ? 649 ARG A HA   1  
ATOM 1854  H HB2  . ARG A 1 135 ? 15.753  -4.224  -7.790  1.00 2.10  ? 649 ARG A HB2  1  
ATOM 1855  H HB3  . ARG A 1 135 ? 16.638  -5.741  -7.941  1.00 2.24  ? 649 ARG A HB3  1  
ATOM 1856  H HG2  . ARG A 1 135 ? 13.652  -5.648  -8.490  1.00 3.07  ? 649 ARG A HG2  1  
ATOM 1857  H HG3  . ARG A 1 135 ? 14.754  -4.973  -9.664  1.00 2.80  ? 649 ARG A HG3  1  
ATOM 1858  H HD2  . ARG A 1 135 ? 15.051  -7.841  -8.673  1.00 2.92  ? 649 ARG A HD2  1  
ATOM 1859  H HD3  . ARG A 1 135 ? 14.002  -7.410  -10.015 1.00 2.80  ? 649 ARG A HD3  1  
ATOM 1860  H HE   . ARG A 1 135 ? 16.877  -7.642  -10.084 1.00 3.16  ? 649 ARG A HE   1  
ATOM 1861  H HH11 . ARG A 1 135 ? 14.148  -6.074  -11.727 1.00 3.88  ? 649 ARG A HH11 1  
ATOM 1862  H HH12 . ARG A 1 135 ? 15.195  -5.603  -13.061 1.00 4.73  ? 649 ARG A HH12 1  
ATOM 1863  H HH21 . ARG A 1 135 ? 18.058  -6.892  -11.838 1.00 4.44  ? 649 ARG A HH21 1  
ATOM 1864  H HH22 . ARG A 1 135 ? 17.214  -6.104  -13.163 1.00 4.73  ? 649 ARG A HH22 1  
ATOM 1865  N N    . ARG A 1 136 ? 16.428  -7.706  -5.697  1.00 2.40  ? 650 ARG A N    1  
ATOM 1866  C CA   . ARG A 1 136 ? 16.599  -9.121  -5.284  1.00 2.62  ? 650 ARG A CA   1  
ATOM 1867  C C    . ARG A 1 136 ? 15.903  -9.459  -3.963  1.00 2.67  ? 650 ARG A C    1  
ATOM 1868  O O    . ARG A 1 136 ? 15.303  -10.524 -3.852  1.00 2.81  ? 650 ARG A O    1  
ATOM 1869  C CB   . ARG A 1 136 ? 18.072  -9.561  -5.247  1.00 2.84  ? 650 ARG A CB   1  
ATOM 1870  C CG   . ARG A 1 136 ? 18.977  -8.760  -4.303  1.00 2.76  ? 650 ARG A CG   1  
ATOM 1871  C CD   . ARG A 1 136 ? 20.327  -9.456  -4.119  1.00 2.59  ? 650 ARG A CD   1  
ATOM 1872  N NE   . ARG A 1 136 ? 21.214  -8.657  -3.260  1.00 3.03  ? 650 ARG A NE   1  
ATOM 1873  C CZ   . ARG A 1 136 ? 21.216  -8.604  -1.940  1.00 4.26  ? 650 ARG A CZ   1  
ATOM 1874  N NH1  . ARG A 1 136 ? 20.445  -9.324  -1.177  1.00 5.11  ? 650 ARG A NH1  1  
ATOM 1875  N NH2  . ARG A 1 136 ? 22.014  -7.802  -1.306  1.00 5.30  ? 650 ARG A NH2  1  
ATOM 1876  H H    . ARG A 1 136 ? 17.220  -7.075  -5.712  1.00 2.42  ? 650 ARG A H    1  
ATOM 1877  H HA   . ARG A 1 136 ? 16.110  -9.749  -6.032  1.00 2.68  ? 650 ARG A HA   1  
ATOM 1878  H HB2  . ARG A 1 136 ? 18.084  -10.602 -4.922  1.00 3.64  ? 650 ARG A HB2  1  
ATOM 1879  H HB3  . ARG A 1 136 ? 18.485  -9.514  -6.254  1.00 3.04  ? 650 ARG A HB3  1  
ATOM 1880  H HG2  . ARG A 1 136 ? 19.142  -7.767  -4.719  1.00 2.91  ? 650 ARG A HG2  1  
ATOM 1881  H HG3  . ARG A 1 136 ? 18.510  -8.669  -3.324  1.00 3.83  ? 650 ARG A HG3  1  
ATOM 1882  H HD2  . ARG A 1 136 ? 20.169  -10.445 -3.685  1.00 3.64  ? 650 ARG A HD2  1  
ATOM 1883  H HD3  . ARG A 1 136 ? 20.796  -9.582  -5.097  1.00 2.60  ? 650 ARG A HD3  1  
ATOM 1884  H HE   . ARG A 1 136 ? 21.859  -8.040  -3.744  1.00 3.18  ? 650 ARG A HE   1  
ATOM 1885  H HH11 . ARG A 1 136 ? 19.816  -10.020 -1.566  1.00 5.09  ? 650 ARG A HH11 1  
ATOM 1886  H HH12 . ARG A 1 136 ? 20.540  -9.210  -0.175  1.00 6.16  ? 650 ARG A HH12 1  
ATOM 1887  H HH21 . ARG A 1 136 ? 22.723  -7.255  -1.778  1.00 5.40  ? 650 ARG A HH21 1  
ATOM 1888  H HH22 . ARG A 1 136 ? 21.999  -7.850  -0.292  1.00 6.32  ? 650 ARG A HH22 1  
ATOM 1889  N N    . ALA A 1 137 ? 15.896  -8.527  -3.010  1.00 2.59  ? 651 ALA A N    1  
ATOM 1890  C CA   . ALA A 1 137 ? 15.155  -8.638  -1.751  1.00 2.66  ? 651 ALA A CA   1  
ATOM 1891  C C    . ALA A 1 137 ? 13.633  -8.833  -1.951  1.00 2.58  ? 651 ALA A C    1  
ATOM 1892  O O    . ALA A 1 137 ? 12.962  -9.352  -1.055  1.00 2.75  ? 651 ALA A O    1  
ATOM 1893  C CB   . ALA A 1 137 ? 15.447  -7.396  -0.896  1.00 2.58  ? 651 ALA A CB   1  
ATOM 1894  H H    . ALA A 1 137 ? 16.489  -7.725  -3.142  1.00 2.52  ? 651 ALA A H    1  
ATOM 1895  H HA   . ALA A 1 137 ? 15.533  -9.516  -1.225  1.00 2.88  ? 651 ALA A HA   1  
ATOM 1896  H HB1  . ALA A 1 137 ? 15.051  -7.544  0.109   1.00 3.44  ? 651 ALA A HB1  1  
ATOM 1897  H HB2  . ALA A 1 137 ? 16.522  -7.220  -0.828  1.00 2.19  ? 651 ALA A HB2  1  
ATOM 1898  H HB3  . ALA A 1 137 ? 14.964  -6.519  -1.327  1.00 2.85  ? 651 ALA A HB3  1  
ATOM 1899  N N    . PHE A 1 138 ? 13.107  -8.473  -3.130  1.00 2.35  ? 652 PHE A N    1  
ATOM 1900  C CA   . PHE A 1 138 ? 11.749  -8.784  -3.589  1.00 2.31  ? 652 PHE A CA   1  
ATOM 1901  C C    . PHE A 1 138 ? 11.633  -10.116 -4.367  1.00 2.50  ? 652 PHE A C    1  
ATOM 1902  O O    . PHE A 1 138 ? 10.651  -10.834 -4.193  1.00 2.68  ? 652 PHE A O    1  
ATOM 1903  C CB   . PHE A 1 138 ? 11.213  -7.591  -4.390  1.00 2.00  ? 652 PHE A CB   1  
ATOM 1904  C CG   . PHE A 1 138 ? 10.464  -6.591  -3.534  1.00 2.03  ? 652 PHE A CG   1  
ATOM 1905  C CD1  . PHE A 1 138 ? 9.114   -6.818  -3.207  1.00 3.54  ? 652 PHE A CD1  1  
ATOM 1906  C CD2  . PHE A 1 138 ? 11.120  -5.453  -3.037  1.00 1.70  ? 652 PHE A CD2  1  
ATOM 1907  C CE1  . PHE A 1 138 ? 8.426   -5.904  -2.387  1.00 3.63  ? 652 PHE A CE1  1  
ATOM 1908  C CE2  . PHE A 1 138 ? 10.430  -4.532  -2.229  1.00 1.73  ? 652 PHE A CE2  1  
ATOM 1909  C CZ   . PHE A 1 138 ? 9.081   -4.756  -1.905  1.00 2.20  ? 652 PHE A CZ   1  
ATOM 1910  H H    . PHE A 1 138 ? 13.701  -7.955  -3.763  1.00 2.23  ? 652 PHE A H    1  
ATOM 1911  H HA   . PHE A 1 138 ? 11.110  -8.882  -2.714  1.00 2.44  ? 652 PHE A HA   1  
ATOM 1912  H HB2  . PHE A 1 138 ? 12.037  -7.085  -4.894  1.00 1.91  ? 652 PHE A HB2  1  
ATOM 1913  H HB3  . PHE A 1 138 ? 10.533  -7.955  -5.156  1.00 1.93  ? 652 PHE A HB3  1  
ATOM 1914  H HD1  . PHE A 1 138 ? 8.615   -7.703  -3.577  1.00 4.83  ? 652 PHE A HD1  1  
ATOM 1915  H HD2  . PHE A 1 138 ? 12.160  -5.293  -3.278  1.00 2.59  ? 652 PHE A HD2  1  
ATOM 1916  H HE1  . PHE A 1 138 ? 7.394   -6.087  -2.122  1.00 5.00  ? 652 PHE A HE1  1  
ATOM 1917  H HE2  . PHE A 1 138 ? 10.942  -3.659  -1.847  1.00 2.56  ? 652 PHE A HE2  1  
ATOM 1918  H HZ   . PHE A 1 138 ? 8.551   -4.056  -1.270  1.00 2.31  ? 652 PHE A HZ   1  
ATOM 1919  N N    . GLU A 1 139 ? 12.637  -10.514 -5.159  1.00 2.52  ? 653 GLU A N    1  
ATOM 1920  C CA   . GLU A 1 139 ? 12.654  -11.802 -5.897  1.00 2.71  ? 653 GLU A CA   1  
ATOM 1921  C C    . GLU A 1 139 ? 12.700  -13.043 -4.975  1.00 3.08  ? 653 GLU A C    1  
ATOM 1922  O O    . GLU A 1 139 ? 12.483  -14.166 -5.438  1.00 3.04  ? 653 GLU A O    1  
ATOM 1923  C CB   . GLU A 1 139 ? 13.866  -11.876 -6.849  1.00 2.72  ? 653 GLU A CB   1  
ATOM 1924  C CG   . GLU A 1 139 ? 13.978  -10.768 -7.906  1.00 2.45  ? 653 GLU A CG   1  
ATOM 1925  C CD   . GLU A 1 139 ? 13.040  -10.890 -9.114  1.00 2.89  ? 653 GLU A CD   1  
ATOM 1926  O OE1  . GLU A 1 139 ? 12.738  -12.012 -9.596  1.00 3.69  ? 653 GLU A OE1  1  
ATOM 1927  O OE2  . GLU A 1 139 ? 12.651  -9.820  -9.645  1.00 3.35  ? 653 GLU A OE2  1  
ATOM 1928  H H    . GLU A 1 139 ? 13.440  -9.906  -5.249  1.00 2.43  ? 653 GLU A H    1  
ATOM 1929  H HA   . GLU A 1 139 ? 11.741  -11.881 -6.491  1.00 2.63  ? 653 GLU A HA   1  
ATOM 1930  H HB2  . GLU A 1 139 ? 14.770  -11.838 -6.239  1.00 2.99  ? 653 GLU A HB2  1  
ATOM 1931  H HB3  . GLU A 1 139 ? 13.867  -12.841 -7.358  1.00 3.17  ? 653 GLU A HB3  1  
ATOM 1932  H HG2  . GLU A 1 139 ? 13.799  -9.811  -7.422  1.00 2.40  ? 653 GLU A HG2  1  
ATOM 1933  H HG3  . GLU A 1 139 ? 15.006  -10.761 -8.273  1.00 2.35  ? 653 GLU A HG3  1  
ATOM 1934  N N    . THR A 1 140 ? 13.003  -12.870 -3.683  1.00 3.47  ? 654 THR A N    1  
ATOM 1935  C CA   . THR A 1 140 ? 13.003  -13.944 -2.669  1.00 4.00  ? 654 THR A CA   1  
ATOM 1936  C C    . THR A 1 140 ? 11.643  -14.109 -1.974  1.00 4.18  ? 654 THR A C    1  
ATOM 1937  O O    . THR A 1 140 ? 11.064  -15.190 -1.999  1.00 4.76  ? 654 THR A O    1  
ATOM 1938  C CB   . THR A 1 140 ? 14.182  -13.790 -1.697  1.00 4.17  ? 654 THR A CB   1  
ATOM 1939  O OG1  . THR A 1 140 ? 14.184  -14.840 -0.753  1.00 4.88  ? 654 THR A OG1  1  
ATOM 1940  C CG2  . THR A 1 140 ? 14.202  -12.449 -0.964  1.00 3.67  ? 654 THR A CG2  1  
ATOM 1941  H H    . THR A 1 140 ? 13.279  -11.938 -3.400  1.00 3.44  ? 654 THR A H    1  
ATOM 1942  H HA   . THR A 1 140 ? 13.188  -14.883 -3.178  1.00 4.24  ? 654 THR A HA   1  
ATOM 1943  H HB   . THR A 1 140 ? 15.103  -13.861 -2.275  1.00 4.18  ? 654 THR A HB   1  
ATOM 1944  H HG1  . THR A 1 140 ? 14.267  -15.675 -1.259  1.00 5.50  ? 654 THR A HG1  1  
ATOM 1945  H HG21 . THR A 1 140 ? 14.333  -11.645 -1.686  1.00 3.27  ? 654 THR A HG21 1  
ATOM 1946  H HG22 . THR A 1 140 ? 15.041  -12.429 -0.271  1.00 3.41  ? 654 THR A HG22 1  
ATOM 1947  H HG23 . THR A 1 140 ? 13.277  -12.282 -0.416  1.00 4.72  ? 654 THR A HG23 1  
ATOM 1948  N N    . VAL A 1 141 ? 11.059  -13.026 -1.448  1.00 3.82  ? 655 VAL A N    1  
ATOM 1949  C CA   . VAL A 1 141 ? 9.718   -12.974 -0.813  1.00 4.00  ? 655 VAL A CA   1  
ATOM 1950  C C    . VAL A 1 141 ? 8.594   -13.339 -1.787  1.00 4.03  ? 655 VAL A C    1  
ATOM 1951  O O    . VAL A 1 141 ? 7.573   -13.908 -1.393  1.00 4.47  ? 655 VAL A O    1  
ATOM 1952  C CB   . VAL A 1 141 ? 9.509   -11.584 -0.182  1.00 3.79  ? 655 VAL A CB   1  
ATOM 1953  C CG1  . VAL A 1 141 ? 9.700   -10.446 -1.174  1.00 3.24  ? 655 VAL A CG1  1  
ATOM 1954  C CG2  . VAL A 1 141 ? 8.191   -11.395 0.570   1.00 4.11  ? 655 VAL A CG2  1  
ATOM 1955  H H    . VAL A 1 141 ? 11.578  -12.163 -1.488  1.00 3.49  ? 655 VAL A H    1  
ATOM 1956  H HA   . VAL A 1 141 ? 9.689   -13.700 -0.003  1.00 4.36  ? 655 VAL A HA   1  
ATOM 1957  H HB   . VAL A 1 141 ? 10.307  -11.463 0.532   1.00 3.85  ? 655 VAL A HB   1  
ATOM 1958  H HG11 . VAL A 1 141 ? 9.587   -9.487  -0.668  1.00 3.64  ? 655 VAL A HG11 1  
ATOM 1959  H HG12 . VAL A 1 141 ? 10.722  -10.515 -1.541  1.00 2.76  ? 655 VAL A HG12 1  
ATOM 1960  H HG13 . VAL A 1 141 ? 8.987   -10.516 -1.994  1.00 3.68  ? 655 VAL A HG13 1  
ATOM 1961  H HG21 . VAL A 1 141 ? 8.162   -10.400 1.015   1.00 4.36  ? 655 VAL A HG21 1  
ATOM 1962  H HG22 . VAL A 1 141 ? 7.341   -11.510 -0.101  1.00 4.68  ? 655 VAL A HG22 1  
ATOM 1963  H HG23 . VAL A 1 141 ? 8.137   -12.120 1.380   1.00 4.14  ? 655 VAL A HG23 1  
ATOM 1964  N N    . ALA A 1 142 ? 8.841   -13.121 -3.078  1.00 3.63  ? 656 ALA A N    1  
ATOM 1965  C CA   . ALA A 1 142 ? 8.051   -13.639 -4.198  1.00 3.53  ? 656 ALA A CA   1  
ATOM 1966  C C    . ALA A 1 142 ? 7.819   -15.175 -4.177  1.00 3.95  ? 656 ALA A C    1  
ATOM 1967  O O    . ALA A 1 142 ? 6.905   -15.646 -4.854  1.00 4.04  ? 656 ALA A O    1  
ATOM 1968  C CB   . ALA A 1 142 ? 8.707   -13.166 -5.499  1.00 3.08  ? 656 ALA A CB   1  
ATOM 1969  H H    . ALA A 1 142 ? 9.659   -12.561 -3.287  1.00 3.35  ? 656 ALA A H    1  
ATOM 1970  H HA   . ALA A 1 142 ? 7.063   -13.179 -4.152  1.00 3.61  ? 656 ALA A HA   1  
ATOM 1971  H HB1  . ALA A 1 142 ? 8.167   -13.570 -6.355  1.00 3.70  ? 656 ALA A HB1  1  
ATOM 1972  H HB2  . ALA A 1 142 ? 8.673   -12.079 -5.548  1.00 3.28  ? 656 ALA A HB2  1  
ATOM 1973  H HB3  . ALA A 1 142 ? 9.744   -13.493 -5.542  1.00 2.82  ? 656 ALA A HB3  1  
ATOM 1974  N N    . ILE A 1 143 ? 8.526   -15.946 -3.334  1.00 4.42  ? 657 ILE A N    1  
ATOM 1975  C CA   . ILE A 1 143 ? 8.124   -17.315 -2.948  1.00 5.16  ? 657 ILE A CA   1  
ATOM 1976  C C    . ILE A 1 143 ? 8.334   -17.651 -1.455  1.00 5.03  ? 657 ILE A C    1  
ATOM 1977  O O    . ILE A 1 143 ? 7.591   -18.458 -0.899  1.00 5.80  ? 657 ILE A O    1  
ATOM 1978  C CB   . ILE A 1 143 ? 8.794   -18.340 -3.893  1.00 5.66  ? 657 ILE A CB   1  
ATOM 1979  C CG1  . ILE A 1 143 ? 8.051   -19.692 -3.844  1.00 7.03  ? 657 ILE A CG1  1  
ATOM 1980  C CG2  . ILE A 1 143 ? 10.302  -18.498 -3.616  1.00 5.30  ? 657 ILE A CG2  1  
ATOM 1981  C CD1  . ILE A 1 143 ? 8.379   -20.604 -5.031  1.00 7.43  ? 657 ILE A CD1  1  
ATOM 1982  H H    . ILE A 1 143 ? 9.336   -15.534 -2.886  1.00 4.39  ? 657 ILE A H    1  
ATOM 1983  H HA   . ILE A 1 143 ? 7.049   -17.396 -3.114  1.00 5.65  ? 657 ILE A HA   1  
ATOM 1984  H HB   . ILE A 1 143 ? 8.684   -17.957 -4.909  1.00 5.73  ? 657 ILE A HB   1  
ATOM 1985  H HG12 . ILE A 1 143 ? 8.293   -20.215 -2.920  1.00 7.43  ? 657 ILE A HG12 1  
ATOM 1986  H HG13 . ILE A 1 143 ? 6.975   -19.510 -3.861  1.00 7.75  ? 657 ILE A HG13 1  
ATOM 1987  H HG21 . ILE A 1 143 ? 10.764  -19.090 -4.404  1.00 5.36  ? 657 ILE A HG21 1  
ATOM 1988  H HG22 . ILE A 1 143 ? 10.784  -17.520 -3.609  1.00 4.94  ? 657 ILE A HG22 1  
ATOM 1989  H HG23 . ILE A 1 143 ? 10.469  -18.989 -2.657  1.00 6.04  ? 657 ILE A HG23 1  
ATOM 1990  H HD11 . ILE A 1 143 ? 8.143   -20.092 -5.964  1.00 7.64  ? 657 ILE A HD11 1  
ATOM 1991  H HD12 . ILE A 1 143 ? 9.433   -20.874 -5.019  1.00 6.94  ? 657 ILE A HD12 1  
ATOM 1992  H HD13 . ILE A 1 143 ? 7.780   -21.512 -4.963  1.00 8.55  ? 657 ILE A HD13 1  
ATOM 1993  N N    . ASP A 1 144 ? 9.293   -17.027 -0.764  1.00 4.20  ? 658 ASP A N    1  
ATOM 1994  C CA   . ASP A 1 144 ? 9.680   -17.345 0.626   1.00 4.12  ? 658 ASP A CA   1  
ATOM 1995  C C    . ASP A 1 144 ? 8.603   -17.026 1.687   1.00 4.26  ? 658 ASP A C    1  
ATOM 1996  O O    . ASP A 1 144 ? 8.653   -17.565 2.797   1.00 4.56  ? 658 ASP A O    1  
ATOM 1997  C CB   . ASP A 1 144 ? 10.993  -16.602 0.936   1.00 3.83  ? 658 ASP A CB   1  
ATOM 1998  C CG   . ASP A 1 144 ? 11.497  -16.830 2.363   1.00 4.23  ? 658 ASP A CG   1  
ATOM 1999  O OD1  . ASP A 1 144 ? 11.932  -17.962 2.679   1.00 4.23  ? 658 ASP A OD1  1  
ATOM 2000  O OD2  . ASP A 1 144 ? 11.470  -15.872 3.173   1.00 5.15  ? 658 ASP A OD2  1  
ATOM 2001  H H    . ASP A 1 144 ? 9.907   -16.399 -1.273  1.00 3.65  ? 658 ASP A H    1  
ATOM 2002  H HA   . ASP A 1 144 ? 9.880   -18.416 0.691   1.00 4.31  ? 658 ASP A HA   1  
ATOM 2003  H HB2  . ASP A 1 144 ? 11.762  -16.935 0.237   1.00 3.78  ? 658 ASP A HB2  1  
ATOM 2004  H HB3  . ASP A 1 144 ? 10.840  -15.533 0.784   1.00 3.72  ? 658 ASP A HB3  1  
ATOM 2005  N N    . ARG A 1 145 ? 7.615   -16.179 1.365   1.00 4.26  ? 659 ARG A N    1  
ATOM 2006  C CA   . ARG A 1 145 ? 6.623   -15.636 2.292   1.00 4.46  ? 659 ARG A CA   1  
ATOM 2007  C C    . ARG A 1 145 ? 5.551   -16.604 2.809   1.00 5.21  ? 659 ARG A C    1  
ATOM 2008  O O    . ARG A 1 145 ? 4.836   -16.234 3.740   1.00 5.57  ? 659 ARG A O    1  
ATOM 2009  C CB   . ARG A 1 145 ? 6.004   -14.418 1.600   1.00 4.33  ? 659 ARG A CB   1  
ATOM 2010  C CG   . ARG A 1 145 ? 4.972   -14.738 0.508   1.00 4.49  ? 659 ARG A CG   1  
ATOM 2011  C CD   . ARG A 1 145 ? 4.548   -13.446 -0.206  1.00 4.56  ? 659 ARG A CD   1  
ATOM 2012  N NE   . ARG A 1 145 ? 3.601   -13.713 -1.307  1.00 5.23  ? 659 ARG A NE   1  
ATOM 2013  C CZ   . ARG A 1 145 ? 3.886   -14.256 -2.478  1.00 5.84  ? 659 ARG A CZ   1  
ATOM 2014  N NH1  . ARG A 1 145 ? 5.092   -14.607 -2.811  1.00 5.98  ? 659 ARG A NH1  1  
ATOM 2015  N NH2  . ARG A 1 145 ? 2.956   -14.460 -3.356  1.00 7.08  ? 659 ARG A NH2  1  
ATOM 2016  H H    . ARG A 1 145 ? 7.636   -15.732 0.461   1.00 4.22  ? 659 ARG A H    1  
ATOM 2017  H HA   . ARG A 1 145 ? 7.154   -15.269 3.169   1.00 4.40  ? 659 ARG A HA   1  
ATOM 2018  H HB2  . ARG A 1 145 ? 5.541   -13.810 2.358   1.00 4.87  ? 659 ARG A HB2  1  
ATOM 2019  H HB3  . ARG A 1 145 ? 6.805   -13.828 1.162   1.00 4.14  ? 659 ARG A HB3  1  
ATOM 2020  H HG2  . ARG A 1 145 ? 5.411   -15.430 -0.211  1.00 4.58  ? 659 ARG A HG2  1  
ATOM 2021  H HG3  . ARG A 1 145 ? 4.091   -15.204 0.953   1.00 5.06  ? 659 ARG A HG3  1  
ATOM 2022  H HD2  . ARG A 1 145 ? 4.074   -12.784 0.521   1.00 5.29  ? 659 ARG A HD2  1  
ATOM 2023  H HD3  . ARG A 1 145 ? 5.435   -12.932 -0.588  1.00 4.00  ? 659 ARG A HD3  1  
ATOM 2024  H HE   . ARG A 1 145 ? 2.631   -13.483 -1.153  1.00 5.91  ? 659 ARG A HE   1  
ATOM 2025  H HH11 . ARG A 1 145 ? 5.862   -14.422 -2.184  1.00 5.29  ? 659 ARG A HH11 1  
ATOM 2026  H HH12 . ARG A 1 145 ? 5.235   -15.126 -3.672  1.00 7.20  ? 659 ARG A HH12 1  
ATOM 2027  H HH21 . ARG A 1 145 ? 1.983   -14.275 -3.158  1.00 7.42  ? 659 ARG A HH21 1  
ATOM 2028  H HH22 . ARG A 1 145 ? 3.196   -14.831 -4.270  1.00 8.03  ? 659 ARG A HH22 1  
ATOM 2029  N N    . LEU A 1 146 ? 5.415   -17.802 2.230   1.00 5.66  ? 660 LEU A N    1  
ATOM 2030  C CA   . LEU A 1 146 ? 4.222   -18.655 2.375   1.00 6.51  ? 660 LEU A CA   1  
ATOM 2031  C C    . LEU A 1 146 ? 3.816   -18.930 3.835   1.00 7.43  ? 660 LEU A C    1  
ATOM 2032  O O    . LEU A 1 146 ? 2.665   -18.701 4.195   1.00 8.10  ? 660 LEU A O    1  
ATOM 2033  C CB   . LEU A 1 146 ? 4.442   -19.964 1.591   1.00 7.05  ? 660 LEU A CB   1  
ATOM 2034  C CG   . LEU A 1 146 ? 3.253   -20.948 1.637   1.00 8.30  ? 660 LEU A CG   1  
ATOM 2035  C CD1  . LEU A 1 146 ? 1.976   -20.361 1.029   1.00 8.68  ? 660 LEU A CD1  1  
ATOM 2036  C CD2  . LEU A 1 146 ? 3.607   -22.212 0.858   1.00 8.44  ? 660 LEU A CD2  1  
ATOM 2037  H H    . LEU A 1 146 ? 6.079   -18.046 1.509   1.00 5.45  ? 660 LEU A H    1  
ATOM 2038  H HA   . LEU A 1 146 ? 3.387   -18.123 1.916   1.00 6.29  ? 660 LEU A HA   1  
ATOM 2039  H HB2  . LEU A 1 146 ? 4.652   -19.716 0.549   1.00 6.68  ? 660 LEU A HB2  1  
ATOM 2040  H HB3  . LEU A 1 146 ? 5.319   -20.470 1.997   1.00 7.30  ? 660 LEU A HB3  1  
ATOM 2041  H HG   . LEU A 1 146 ? 3.055   -21.234 2.669   1.00 9.31  ? 660 LEU A HG   1  
ATOM 2042  H HD11 . LEU A 1 146 ? 1.626   -19.520 1.624   1.00 9.13  ? 660 LEU A HD11 1  
ATOM 2043  H HD12 . LEU A 1 146 ? 1.192   -21.118 1.023   1.00 9.62  ? 660 LEU A HD12 1  
ATOM 2044  H HD13 . LEU A 1 146 ? 2.163   -20.030 0.007   1.00 7.98  ? 660 LEU A HD13 1  
ATOM 2045  H HD21 . LEU A 1 146 ? 4.508   -22.662 1.272   1.00 8.64  ? 660 LEU A HD21 1  
ATOM 2046  H HD22 . LEU A 1 146 ? 3.776   -21.968 -0.190  1.00 7.88  ? 660 LEU A HD22 1  
ATOM 2047  H HD23 . LEU A 1 146 ? 2.791   -22.931 0.934   1.00 9.46  ? 660 LEU A HD23 1  
ATOM 2048  N N    . ASP A 1 147 ? 4.749   -19.368 4.686   1.00 7.62  ? 661 ASP A N    1  
ATOM 2049  C CA   . ASP A 1 147 ? 4.472   -19.654 6.105   1.00 8.70  ? 661 ASP A CA   1  
ATOM 2050  C C    . ASP A 1 147 ? 4.894   -18.535 7.075   1.00 9.73  ? 661 ASP A C    1  
ATOM 2051  O O    . ASP A 1 147 ? 4.958   -18.729 8.291   1.00 10.70 ? 661 ASP A O    1  
ATOM 2052  C CB   . ASP A 1 147 ? 5.157   -20.933 6.555   1.00 8.64  ? 661 ASP A CB   1  
ATOM 2053  C CG   . ASP A 1 147 ? 4.797   -22.175 5.736   1.00 8.31  ? 661 ASP A CG   1  
ATOM 2054  O OD1  . ASP A 1 147 ? 3.653   -22.669 5.881   1.00 8.97  ? 661 ASP A OD1  1  
ATOM 2055  O OD2  . ASP A 1 147 ? 5.654   -22.679 4.969   1.00 7.89  ? 661 ASP A OD2  1  
ATOM 2056  H H    . ASP A 1 147 ? 5.667   -19.575 4.319   1.00 7.13  ? 661 ASP A H    1  
ATOM 2057  H HA   . ASP A 1 147 ? 3.401   -19.808 6.225   1.00 9.32  ? 661 ASP A HA   1  
ATOM 2058  H HB2  . ASP A 1 147 ? 6.228   -20.727 6.540   1.00 8.42  ? 661 ASP A HB2  1  
ATOM 2059  H HB3  . ASP A 1 147 ? 4.828   -21.085 7.585   1.00 9.55  ? 661 ASP A HB3  1  
ATOM 2060  N N    . ARG A 1 148 ? 5.246   -17.362 6.558   1.00 10.13 ? 662 ARG A N    1  
ATOM 2061  C CA   . ARG A 1 148 ? 5.793   -16.231 7.333   1.00 11.71 ? 662 ARG A CA   1  
ATOM 2062  C C    . ARG A 1 148 ? 4.710   -15.352 7.990   1.00 13.05 ? 662 ARG A C    1  
ATOM 2063  O O    . ARG A 1 148 ? 5.026   -14.280 8.510   1.00 14.35 ? 662 ARG A O    1  
ATOM 2064  C CB   . ARG A 1 148 ? 6.756   -15.423 6.452   1.00 12.30 ? 662 ARG A CB   1  
ATOM 2065  C CG   . ARG A 1 148 ? 7.796   -16.234 5.663   1.00 11.72 ? 662 ARG A CG   1  
ATOM 2066  C CD   . ARG A 1 148 ? 8.731   -17.106 6.503   1.00 12.19 ? 662 ARG A CD   1  
ATOM 2067  N NE   . ARG A 1 148 ? 9.691   -17.790 5.620   1.00 11.89 ? 662 ARG A NE   1  
ATOM 2068  C CZ   . ARG A 1 148 ? 10.458  -18.819 5.922   1.00 12.02 ? 662 ARG A CZ   1  
ATOM 2069  N NH1  . ARG A 1 148 ? 10.460  -19.397 7.085   1.00 12.36 ? 662 ARG A NH1  1  
ATOM 2070  N NH2  . ARG A 1 148 ? 11.264  -19.313 5.036   1.00 12.18 ? 662 ARG A NH2  1  
ATOM 2071  H H    . ARG A 1 148 ? 5.156   -17.265 5.553   1.00 9.69  ? 662 ARG A H    1  
ATOM 2072  H HA   . ARG A 1 148 ? 6.371   -16.632 8.168   1.00 12.00 ? 662 ARG A HA   1  
ATOM 2073  H HB2  . ARG A 1 148 ? 6.158   -14.871 5.730   1.00 12.57 ? 662 ARG A HB2  1  
ATOM 2074  H HB3  . ARG A 1 148 ? 7.289   -14.715 7.083   1.00 13.39 ? 662 ARG A HB3  1  
ATOM 2075  H HG2  . ARG A 1 148 ? 7.279   -16.882 4.957   1.00 11.13 ? 662 ARG A HG2  1  
ATOM 2076  H HG3  . ARG A 1 148 ? 8.400   -15.532 5.088   1.00 11.87 ? 662 ARG A HG3  1  
ATOM 2077  H HD2  . ARG A 1 148 ? 9.270   -16.475 7.212   1.00 12.96 ? 662 ARG A HD2  1  
ATOM 2078  H HD3  . ARG A 1 148 ? 8.142   -17.841 7.054   1.00 12.34 ? 662 ARG A HD3  1  
ATOM 2079  H HE   . ARG A 1 148 ? 9.737   -17.473 4.660   1.00 11.84 ? 662 ARG A HE   1  
ATOM 2080  H HH11 . ARG A 1 148 ? 9.829   -19.109 7.825   1.00 12.53 ? 662 ARG A HH11 1  
ATOM 2081  H HH12 . ARG A 1 148 ? 11.070  -20.190 7.234   1.00 12.67 ? 662 ARG A HH12 1  
ATOM 2082  H HH21 . ARG A 1 148 ? 11.394  -18.852 4.138   1.00 12.25 ? 662 ARG A HH21 1  
ATOM 2083  H HH22 . ARG A 1 148 ? 11.757  -20.164 5.258   1.00 12.47 ? 662 ARG A HH22 1  
ATOM 2084  N N    . ILE A 1 149 ? 3.445   -15.774 7.875   1.00 12.98 ? 663 ILE A N    1  
ATOM 2085  C CA   . ILE A 1 149 ? 2.187   -15.044 8.025   1.00 14.27 ? 663 ILE A CA   1  
ATOM 2086  C C    . ILE A 1 149 ? 2.150   -13.915 9.066   1.00 16.05 ? 663 ILE A C    1  
ATOM 2087  O O    . ILE A 1 149 ? 1.732   -14.076 10.212  1.00 16.94 ? 663 ILE A O    1  
ATOM 2088  C CB   . ILE A 1 149 ? 1.073   -16.068 8.293   1.00 14.12 ? 663 ILE A CB   1  
ATOM 2089  C CG1  . ILE A 1 149 ? 1.146   -17.331 7.420   1.00 12.59 ? 663 ILE A CG1  1  
ATOM 2090  C CG2  . ILE A 1 149 ? -0.262  -15.424 7.923   1.00 15.26 ? 663 ILE A CG2  1  
ATOM 2091  C CD1  . ILE A 1 149 ? 1.653   -18.550 8.196   1.00 12.38 ? 663 ILE A CD1  1  
ATOM 2092  H H    . ILE A 1 149 ? 3.297   -16.690 7.469   1.00 12.05 ? 663 ILE A H    1  
ATOM 2093  H HA   . ILE A 1 149 ? 1.979   -14.586 7.058   1.00 14.37 ? 663 ILE A HA   1  
ATOM 2094  H HB   . ILE A 1 149 ? 1.144   -16.364 9.335   1.00 14.71 ? 663 ILE A HB   1  
ATOM 2095  H HG12 . ILE A 1 149 ? 0.176   -17.601 7.056   1.00 12.59 ? 663 ILE A HG12 1  
ATOM 2096  H HG13 . ILE A 1 149 ? 1.690   -17.094 6.515   1.00 12.00 ? 663 ILE A HG13 1  
ATOM 2097  H HG21 . ILE A 1 149 ? -1.078  -16.088 8.203   1.00 15.47 ? 663 ILE A HG21 1  
ATOM 2098  H HG22 . ILE A 1 149 ? -0.399  -14.462 8.413   1.00 16.38 ? 663 ILE A HG22 1  
ATOM 2099  H HG23 . ILE A 1 149 ? -0.242  -15.321 6.835   1.00 14.97 ? 663 ILE A HG23 1  
ATOM 2100  H HD11 . ILE A 1 149 ? 2.587   -18.321 8.698   1.00 12.49 ? 663 ILE A HD11 1  
ATOM 2101  H HD12 . ILE A 1 149 ? 0.919   -18.821 8.955   1.00 13.19 ? 663 ILE A HD12 1  
ATOM 2102  H HD13 . ILE A 1 149 ? 1.771   -19.397 7.523   1.00 11.71 ? 663 ILE A HD13 1  
ATOM 2103  N N    . GLY A 1 150 ? 2.518   -12.728 8.603   1.00 16.81 ? 664 GLY A N    1  
ATOM 2104  C CA   . GLY A 1 150 ? 2.310   -11.432 9.258   1.00 18.67 ? 664 GLY A CA   1  
ATOM 2105  C C    . GLY A 1 150 ? 3.055   -11.253 10.581  1.00 19.77 ? 664 GLY A C    1  
ATOM 2106  O O    . GLY A 1 150 ? 2.656   -10.422 11.397  1.00 21.20 ? 664 GLY A O    1  
ATOM 2107  H H    . GLY A 1 150 ? 2.921   -12.750 7.681   1.00 16.15 ? 664 GLY A H    1  
ATOM 2108  H HA2  . GLY A 1 150 ? 2.639   -10.643 8.582   1.00 18.93 ? 664 GLY A HA2  1  
ATOM 2109  H HA3  . GLY A 1 150 ? 1.246   -11.295 9.448   1.00 19.30 ? 664 GLY A HA3  1  
ATOM 2110  N N    . LYS A 1 151 ? 4.095   -12.056 10.844  1.00 19.30 ? 665 LYS A N    1  
ATOM 2111  C CA   . LYS A 1 151 ? 4.767   -12.072 12.150  1.00 20.52 ? 665 LYS A CA   1  
ATOM 2112  C C    . LYS A 1 151 ? 5.644   -10.828 12.372  1.00 22.00 ? 665 LYS A C    1  
ATOM 2113  O O    . LYS A 1 151 ? 6.157   -10.247 11.413  1.00 22.10 ? 665 LYS A O    1  
ATOM 2114  C CB   . LYS A 1 151 ? 5.533   -13.380 12.375  1.00 19.64 ? 665 LYS A CB   1  
ATOM 2115  C CG   . LYS A 1 151 ? 4.749   -14.679 12.099  1.00 18.34 ? 665 LYS A CG   1  
ATOM 2116  C CD   . LYS A 1 151 ? 3.392   -14.844 12.805  1.00 18.52 ? 665 LYS A CD   1  
ATOM 2117  C CE   . LYS A 1 151 ? 3.530   -14.965 14.324  1.00 19.82 ? 665 LYS A CE   1  
ATOM 2118  N NZ   . LYS A 1 151 ? 2.220   -15.235 14.961  1.00 20.31 ? 665 LYS A NZ   1  
ATOM 2119  H H    . LYS A 1 151 ? 4.371   -12.727 10.138  1.00 18.17 ? 665 LYS A H    1  
ATOM 2120  H HA   . LYS A 1 151 ? 3.984   -12.049 12.889  1.00 21.30 ? 665 LYS A HA   1  
ATOM 2121  H HB2  . LYS A 1 151 ? 6.395   -13.358 11.721  1.00 19.35 ? 665 LYS A HB2  1  
ATOM 2122  H HB3  . LYS A 1 151 ? 5.898   -13.401 13.400  1.00 20.55 ? 665 LYS A HB3  1  
ATOM 2123  H HG2  . LYS A 1 151 ? 4.573   -14.754 11.027  1.00 17.67 ? 665 LYS A HG2  1  
ATOM 2124  H HG3  . LYS A 1 151 ? 5.386   -15.517 12.380  1.00 18.12 ? 665 LYS A HG3  1  
ATOM 2125  H HD2  . LYS A 1 151 ? 2.748   -13.997 12.570  1.00 18.75 ? 665 LYS A HD2  1  
ATOM 2126  H HD3  . LYS A 1 151 ? 2.914   -15.744 12.410  1.00 17.71 ? 665 LYS A HD3  1  
ATOM 2127  H HE2  . LYS A 1 151 ? 4.234   -15.768 14.562  1.00 19.81 ? 665 LYS A HE2  1  
ATOM 2128  H HE3  . LYS A 1 151 ? 3.941   -14.030 14.714  1.00 20.68 ? 665 LYS A HE3  1  
ATOM 2129  H HZ1  . LYS A 1 151 ? 1.867   -16.157 14.711  1.00 19.92 ? 665 LYS A HZ1  1  
ATOM 2130  H HZ2  . LYS A 1 151 ? 1.518   -14.560 14.670  1.00 20.64 ? 665 LYS A HZ2  1  
ATOM 2131  H HZ3  . LYS A 1 151 ? 2.304   -15.199 15.974  1.00 20.94 ? 665 LYS A HZ3  1  
ATOM 2132  N N    . LYS A 1 152 ? 5.805   -10.402 13.630  1.00 23.33 ? 666 LYS A N    1  
ATOM 2133  C CA   . LYS A 1 152 ? 6.595   -9.216  14.027  1.00 24.93 ? 666 LYS A CA   1  
ATOM 2134  C C    . LYS A 1 152 ? 7.950   -9.639  14.611  1.00 25.52 ? 666 LYS A C    1  
ATOM 2135  O O    . LYS A 1 152 ? 8.057   -10.704 15.220  1.00 25.46 ? 666 LYS A O    1  
ATOM 2136  C CB   . LYS A 1 152 ? 5.797   -8.341  15.017  1.00 26.29 ? 666 LYS A CB   1  
ATOM 2137  C CG   . LYS A 1 152 ? 4.643   -7.509  14.420  1.00 26.78 ? 666 LYS A CG   1  
ATOM 2138  C CD   . LYS A 1 152 ? 3.558   -8.310  13.681  1.00 26.18 ? 666 LYS A CD   1  
ATOM 2139  C CE   . LYS A 1 152 ? 2.267   -7.497  13.540  1.00 27.38 ? 666 LYS A CE   1  
ATOM 2140  N NZ   . LYS A 1 152 ? 1.250   -8.202  12.724  1.00 27.13 ? 666 LYS A NZ   1  
ATOM 2141  H H    . LYS A 1 152 ? 5.376   -10.945 14.369  1.00 23.31 ? 666 LYS A H    1  
ATOM 2142  H HA   . LYS A 1 152 ? 6.811   -8.613  13.143  1.00 24.93 ? 666 LYS A HA   1  
ATOM 2143  H HB2  . LYS A 1 152 ? 5.405   -8.970  15.816  1.00 26.39 ? 666 LYS A HB2  1  
ATOM 2144  H HB3  . LYS A 1 152 ? 6.487   -7.633  15.482  1.00 27.09 ? 666 LYS A HB3  1  
ATOM 2145  H HG2  . LYS A 1 152 ? 4.177   -6.968  15.244  1.00 27.71 ? 666 LYS A HG2  1  
ATOM 2146  H HG3  . LYS A 1 152 ? 5.057   -6.768  13.733  1.00 26.92 ? 666 LYS A HG3  1  
ATOM 2147  H HD2  . LYS A 1 152 ? 3.929   -8.564  12.688  1.00 25.38 ? 666 LYS A HD2  1  
ATOM 2148  H HD3  . LYS A 1 152 ? 3.334   -9.225  14.232  1.00 25.86 ? 666 LYS A HD3  1  
ATOM 2149  H HE2  . LYS A 1 152 ? 1.868   -7.306  14.540  1.00 28.21 ? 666 LYS A HE2  1  
ATOM 2150  H HE3  . LYS A 1 152 ? 2.502   -6.536  13.072  1.00 27.81 ? 666 LYS A HE3  1  
ATOM 2151  H HZ1  . LYS A 1 152 ? 0.372   -7.693  12.734  1.00 27.83 ? 666 LYS A HZ1  1  
ATOM 2152  H HZ2  . LYS A 1 152 ? 1.072   -9.147  13.057  1.00 27.01 ? 666 LYS A HZ2  1  
ATOM 2153  H HZ3  . LYS A 1 152 ? 1.559   -8.300  11.758  1.00 26.53 ? 666 LYS A HZ3  1  
ATOM 2154  N N    . ASN A 1 153 ? 8.971   -8.785  14.481  1.00 26.31 ? 667 ASN A N    1  
ATOM 2155  C CA   . ASN A 1 153 ? 10.341  -9.082  14.928  1.00 27.08 ? 667 ASN A CA   1  
ATOM 2156  C C    . ASN A 1 153 ? 10.408  -9.313  16.449  1.00 28.24 ? 667 ASN A C    1  
ATOM 2157  O O    . ASN A 1 153 ? 10.888  -10.355 16.902  1.00 28.18 ? 667 ASN A O    1  
ATOM 2158  C CB   . ASN A 1 153 ? 11.264  -7.940  14.463  1.00 27.81 ? 667 ASN A CB   1  
ATOM 2159  C CG   . ASN A 1 153 ? 12.707  -8.123  14.908  1.00 28.61 ? 667 ASN A CG   1  
ATOM 2160  O OD1  . ASN A 1 153 ? 13.159  -7.536  15.878  1.00 29.71 ? 667 ASN A OD1  1  
ATOM 2161  N ND2  . ASN A 1 153 ? 13.471  -8.936  14.223  1.00 28.25 ? 667 ASN A ND2  1  
ATOM 2162  H H    . ASN A 1 153 ? 8.795   -7.897  14.027  1.00 26.46 ? 667 ASN A H    1  
ATOM 2163  H HA   . ASN A 1 153 ? 10.674  -10.007 14.455  1.00 26.42 ? 667 ASN A HA   1  
ATOM 2164  H HB2  . ASN A 1 153 ? 11.244  -7.882  13.375  1.00 27.31 ? 667 ASN A HB2  1  
ATOM 2165  H HB3  . ASN A 1 153 ? 10.908  -6.990  14.862  1.00 28.44 ? 667 ASN A HB3  1  
ATOM 2166  H HD21 . ASN A 1 153 ? 13.098  -9.455  13.435  1.00 27.42 ? 667 ASN A HD21 1  
ATOM 2167  H HD22 . ASN A 1 153 ? 14.456  -8.974  14.457  1.00 28.93 ? 667 ASN A HD22 1  
ATOM 2168  N N    . SER A 1 154 ? 9.849   -8.378  17.219  1.00 29.42 ? 668 SER A N    1  
ATOM 2169  C CA   . SER A 1 154 ? 9.744   -8.418  18.682  1.00 30.75 ? 668 SER A CA   1  
ATOM 2170  C C    . SER A 1 154 ? 8.290   -8.240  19.131  1.00 31.42 ? 668 SER A C    1  
ATOM 2171  O O    . SER A 1 154 ? 7.649   -9.206  19.557  1.00 31.26 ? 668 SER A O    1  
ATOM 2172  C CB   . SER A 1 154 ? 10.690  -7.370  19.293  1.00 31.82 ? 668 SER A CB   1  
ATOM 2173  O OG   . SER A 1 154 ? 10.448  -6.084  18.746  1.00 31.83 ? 668 SER A OG   1  
ATOM 2174  H H    . SER A 1 154 ? 9.535   -7.531  16.769  1.00 29.53 ? 668 SER A H    1  
ATOM 2175  H HA   . SER A 1 154 ? 10.061  -9.392  19.055  1.00 30.66 ? 668 SER A HA   1  
ATOM 2176  H HB2  . SER A 1 154 ? 10.561  -7.343  20.377  1.00 32.65 ? 668 SER A HB2  1  
ATOM 2177  H HB3  . SER A 1 154 ? 11.719  -7.652  19.067  1.00 31.89 ? 668 SER A HB3  1  
ATOM 2178  H HG   . SER A 1 154 ? 11.150  -5.480  19.069  1.00 32.54 ? 668 SER A HG   1  
ATOM 2179  N N    . ILE A 1 155 ? 7.764   -7.021  18.999  1.00 32.28 ? 669 ILE A N    1  
ATOM 2180  C CA   . ILE A 1 155 ? 6.435   -6.565  19.436  1.00 33.28 ? 669 ILE A CA   1  
ATOM 2181  C C    . ILE A 1 155 ? 5.935   -5.415  18.542  1.00 33.37 ? 669 ILE A C    1  
ATOM 2182  O O    . ILE A 1 155 ? 6.725   -4.722  17.893  1.00 33.10 ? 669 ILE A O    1  
ATOM 2183  C CB   . ILE A 1 155 ? 6.467   -6.120  20.924  1.00 34.93 ? 669 ILE A CB   1  
ATOM 2184  C CG1  . ILE A 1 155 ? 7.485   -4.979  21.173  1.00 35.61 ? 669 ILE A CG1  1  
ATOM 2185  C CG2  . ILE A 1 155 ? 6.735   -7.321  21.848  1.00 35.05 ? 669 ILE A CG2  1  
ATOM 2186  C CD1  . ILE A 1 155 ? 7.583   -4.523  22.635  1.00 37.34 ? 669 ILE A CD1  1  
ATOM 2187  H H    . ILE A 1 155 ? 8.397   -6.301  18.663  1.00 32.45 ? 669 ILE A H    1  
ATOM 2188  H HA   . ILE A 1 155 ? 5.726   -7.388  19.339  1.00 32.95 ? 669 ILE A HA   1  
ATOM 2189  H HB   . ILE A 1 155 ? 5.475   -5.742  21.177  1.00 35.71 ? 669 ILE A HB   1  
ATOM 2190  H HG12 . ILE A 1 155 ? 8.475   -5.297  20.852  1.00 34.93 ? 669 ILE A HG12 1  
ATOM 2191  H HG13 . ILE A 1 155 ? 7.204   -4.116  20.571  1.00 35.65 ? 669 ILE A HG13 1  
ATOM 2192  H HG21 . ILE A 1 155 ? 6.082   -8.152  21.585  1.00 34.52 ? 669 ILE A HG21 1  
ATOM 2193  H HG22 . ILE A 1 155 ? 7.777   -7.638  21.774  1.00 34.88 ? 669 ILE A HG22 1  
ATOM 2194  H HG23 . ILE A 1 155 ? 6.528   -7.047  22.882  1.00 35.99 ? 669 ILE A HG23 1  
ATOM 2195  H HD11 . ILE A 1 155 ? 6.589   -4.305  23.026  1.00 37.71 ? 669 ILE A HD11 1  
ATOM 2196  H HD12 . ILE A 1 155 ? 8.051   -5.297  23.244  1.00 37.63 ? 669 ILE A HD12 1  
ATOM 2197  H HD13 . ILE A 1 155 ? 8.196   -3.623  22.693  1.00 38.03 ? 669 ILE A HD13 1  
ATOM 2198  N N    . LEU A 1 156 ? 4.624   -5.169  18.522  1.00 33.96 ? 670 LEU A N    1  
ATOM 2199  C CA   . LEU A 1 156 ? 3.977   -4.063  17.824  1.00 34.40 ? 670 LEU A CA   1  
ATOM 2200  C C    . LEU A 1 156 ? 3.833   -2.842  18.765  1.00 36.04 ? 670 LEU A C    1  
ATOM 2201  O O    . LEU A 1 156 ? 2.729   -2.367  19.035  1.00 36.79 ? 670 LEU A O    1  
ATOM 2202  C CB   . LEU A 1 156 ? 2.672   -4.627  17.224  1.00 34.05 ? 670 LEU A CB   1  
ATOM 2203  C CG   . LEU A 1 156 ? 1.874   -3.659  16.343  1.00 34.21 ? 670 LEU A CG   1  
ATOM 2204  C CD1  . LEU A 1 156 ? 2.687   -3.072  15.186  1.00 33.97 ? 670 LEU A CD1  1  
ATOM 2205  C CD2  . LEU A 1 156 ? 0.656   -4.371  15.755  1.00 33.64 ? 670 LEU A CD2  1  
ATOM 2206  H H    . LEU A 1 156 ? 3.994   -5.793  19.010  1.00 34.20 ? 670 LEU A H    1  
ATOM 2207  H HA   . LEU A 1 156 ? 4.619   -3.754  16.999  1.00 33.87 ? 670 LEU A HA   1  
ATOM 2208  H HB2  . LEU A 1 156 ? 2.920   -5.504  16.625  1.00 33.36 ? 670 LEU A HB2  1  
ATOM 2209  H HB3  . LEU A 1 156 ? 2.026   -4.955  18.041  1.00 34.50 ? 670 LEU A HB3  1  
ATOM 2210  H HG   . LEU A 1 156 ? 1.526   -2.859  16.981  1.00 35.09 ? 670 LEU A HG   1  
ATOM 2211  H HD11 . LEU A 1 156 ? 3.118   -3.873  14.585  1.00 33.27 ? 670 LEU A HD11 1  
ATOM 2212  H HD12 . LEU A 1 156 ? 3.485   -2.436  15.567  1.00 34.45 ? 670 LEU A HD12 1  
ATOM 2213  H HD13 . LEU A 1 156 ? 2.041   -2.462  14.555  1.00 34.17 ? 670 LEU A HD13 1  
ATOM 2214  H HD21 . LEU A 1 156 ? 0.978   -5.168  15.087  1.00 32.94 ? 670 LEU A HD21 1  
ATOM 2215  H HD22 . LEU A 1 156 ? 0.045   -3.658  15.201  1.00 33.83 ? 670 LEU A HD22 1  
ATOM 2216  H HD23 . LEU A 1 156 ? 0.055   -4.791  16.561  1.00 33.88 ? 670 LEU A HD23 1  
ATOM 2217  N N    . LEU A 1 157 ? 4.962   -2.360  19.299  1.00 36.68 ? 671 LEU A N    1  
ATOM 2218  C CA   . LEU A 1 157 ? 5.045   -1.209  20.211  1.00 38.30 ? 671 LEU A CA   1  
ATOM 2219  C C    . LEU A 1 157 ? 6.156   -0.237  19.787  1.00 38.82 ? 671 LEU A C    1  
ATOM 2220  O O    . LEU A 1 157 ? 7.278   -0.656  19.482  1.00 38.15 ? 671 LEU A O    1  
ATOM 2221  C CB   . LEU A 1 157 ? 5.226   -1.705  21.659  1.00 38.89 ? 671 LEU A CB   1  
ATOM 2222  C CG   . LEU A 1 157 ? 5.445   -0.614  22.730  1.00 40.54 ? 671 LEU A CG   1  
ATOM 2223  C CD1  . LEU A 1 157 ? 4.326   0.430   22.791  1.00 41.63 ? 671 LEU A CD1  1  
ATOM 2224  C CD2  . LEU A 1 157 ? 5.548   -1.273  24.105  1.00 40.94 ? 671 LEU A CD2  1  
ATOM 2225  H H    . LEU A 1 157 ? 5.832   -2.802  19.031  1.00 36.06 ? 671 LEU A H    1  
ATOM 2226  H HA   . LEU A 1 157 ? 4.100   -0.668  20.170  1.00 38.86 ? 671 LEU A HA   1  
ATOM 2227  H HB2  . LEU A 1 157 ? 4.349   -2.296  21.932  1.00 38.65 ? 671 LEU A HB2  1  
ATOM 2228  H HB3  . LEU A 1 157 ? 6.093   -2.360  21.682  1.00 38.40 ? 671 LEU A HB3  1  
ATOM 2229  H HG   . LEU A 1 157 ? 6.386   -0.102  22.529  1.00 40.81 ? 671 LEU A HG   1  
ATOM 2230  H HD11 . LEU A 1 157 ? 4.495   1.084   23.646  1.00 42.43 ? 671 LEU A HD11 1  
ATOM 2231  H HD12 . LEU A 1 157 ? 3.359   -0.061  22.904  1.00 41.78 ? 671 LEU A HD12 1  
ATOM 2232  H HD13 . LEU A 1 157 ? 4.326   1.057   21.901  1.00 41.60 ? 671 LEU A HD13 1  
ATOM 2233  H HD21 . LEU A 1 157 ? 5.746   -0.515  24.862  1.00 41.80 ? 671 LEU A HD21 1  
ATOM 2234  H HD22 . LEU A 1 157 ? 6.370   -1.988  24.113  1.00 40.63 ? 671 LEU A HD22 1  
ATOM 2235  H HD23 . LEU A 1 157 ? 4.617   -1.786  24.350  1.00 40.82 ? 671 LEU A HD23 1  
ATOM 2236  N N    . HIS A 1 158 ? 5.804   1.051   19.785  1.00 40.10 ? 672 HIS A N    1  
ATOM 2237  C CA   . HIS A 1 158 ? 6.582   2.234   19.397  1.00 40.99 ? 672 HIS A CA   1  
ATOM 2238  C C    . HIS A 1 158 ? 8.062   2.237   19.810  1.00 41.17 ? 672 HIS A C    1  
ATOM 2239  O O    . HIS A 1 158 ? 8.915   2.383   18.900  1.00 40.84 ? 672 HIS A O    1  
ATOM 2240  C CB   . HIS A 1 158 ? 5.849   3.456   19.973  1.00 42.52 ? 672 HIS A CB   1  
ATOM 2241  C CG   . HIS A 1 158 ? 6.358   4.756   19.410  1.00 43.52 ? 672 HIS A CG   1  
ATOM 2242  N ND1  . HIS A 1 158 ? 7.177   5.648   20.057  1.00 44.43 ? 672 HIS A ND1  1  
ATOM 2243  C CD2  . HIS A 1 158 ? 6.171   5.233   18.142  1.00 43.75 ? 672 HIS A CD2  1  
ATOM 2244  C CE1  . HIS A 1 158 ? 7.493   6.634   19.207  1.00 45.17 ? 672 HIS A CE1  1  
ATOM 2245  N NE2  . HIS A 1 158 ? 6.895   6.428   18.020  1.00 44.80 ? 672 HIS A NE2  1  
ATOM 2246  H H    . HIS A 1 158 ? 4.834   1.235   20.021  1.00 40.56 ? 672 HIS A H    1  
ATOM 2247  H HA   . HIS A 1 158 ? 6.558   2.304   18.310  1.00 40.55 ? 672 HIS A HA   1  
ATOM 2248  H HB2  . HIS A 1 158 ? 4.779   3.369   19.774  1.00 42.45 ? 672 HIS A HB2  1  
ATOM 2249  H HB3  . HIS A 1 158 ? 5.969   3.470   21.057  1.00 43.07 ? 672 HIS A HB3  1  
ATOM 2250  H HD1  . HIS A 1 158 ? 7.521   5.556   21.012  1.00 44.57 ? 672 HIS A HD1  1  
ATOM 2251  H HD2  . HIS A 1 158 ? 5.591   4.750   17.366  1.00 43.25 ? 672 HIS A HD2  1  
ATOM 2252  H HE1  . HIS A 1 158 ? 8.152   7.463   19.439  1.00 46.00 ? 672 HIS A HE1  1  
ATOM 2253  N N    . ASN A 1 20  ? 7.014   15.091  0.909   1.00 5.23  ? 534 ASN A N    2  
ATOM 2254  C CA   . ASN A 1 20  ? 5.988   14.052  0.781   1.00 4.75  ? 534 ASN A CA   2  
ATOM 2255  C C    . ASN A 1 20  ? 6.124   13.050  1.961   1.00 3.38  ? 534 ASN A C    2  
ATOM 2256  O O    . ASN A 1 20  ? 7.108   13.089  2.709   1.00 3.72  ? 534 ASN A O    2  
ATOM 2257  C CB   . ASN A 1 20  ? 6.090   13.387  -0.608  1.00 6.28  ? 534 ASN A CB   2  
ATOM 2258  C CG   . ASN A 1 20  ? 4.838   12.590  -0.932  1.00 7.12  ? 534 ASN A CG   2  
ATOM 2259  O OD1  . ASN A 1 20  ? 4.738   11.414  -0.627  1.00 7.25  ? 534 ASN A OD1  2  
ATOM 2260  N ND2  . ASN A 1 20  ? 3.819   13.225  -1.454  1.00 8.21  ? 534 ASN A ND2  2  
ATOM 2261  H H    . ASN A 1 20  ? 7.722   14.898  1.604   1.00 5.18  ? 534 ASN A H    2  
ATOM 2262  H HA   . ASN A 1 20  ? 5.006   14.525  0.868   1.00 4.96  ? 534 ASN A HA   2  
ATOM 2263  H HB2  . ASN A 1 20  ? 6.213   14.149  -1.377  1.00 7.11  ? 534 ASN A HB2  2  
ATOM 2264  H HB3  . ASN A 1 20  ? 6.958   12.730  -0.646  1.00 6.63  ? 534 ASN A HB3  2  
ATOM 2265  H HD21 . ASN A 1 20  ? 3.885   14.203  -1.701  1.00 8.39  ? 534 ASN A HD21 2  
ATOM 2266  H HD22 . ASN A 1 20  ? 2.942   12.728  -1.541  1.00 9.08  ? 534 ASN A HD22 2  
ATOM 2267  N N    . CYS A 1 21  ? 5.165   12.142  2.150   1.00 2.47  ? 535 CYS A N    2  
ATOM 2268  C CA   . CYS A 1 21  ? 5.029   11.265  3.324   1.00 1.84  ? 535 CYS A CA   2  
ATOM 2269  C C    . CYS A 1 21  ? 5.996   10.051  3.341   1.00 1.45  ? 535 CYS A C    2  
ATOM 2270  O O    . CYS A 1 21  ? 5.595   8.937   3.694   1.00 1.43  ? 535 CYS A O    2  
ATOM 2271  C CB   . CYS A 1 21  ? 3.553   10.849  3.453   1.00 2.90  ? 535 CYS A CB   2  
ATOM 2272  S SG   . CYS A 1 21  ? 2.455   12.300  3.527   1.00 4.08  ? 535 CYS A SG   2  
ATOM 2273  H H    . CYS A 1 21  ? 4.423   12.089  1.463   1.00 3.03  ? 535 CYS A H    2  
ATOM 2274  H HA   . CYS A 1 21  ? 5.270   11.856  4.209   1.00 2.29  ? 535 CYS A HA   2  
ATOM 2275  H HB2  . CYS A 1 21  ? 3.274   10.232  2.596   1.00 3.30  ? 535 CYS A HB2  2  
ATOM 2276  H HB3  . CYS A 1 21  ? 3.422   10.261  4.364   1.00 3.81  ? 535 CYS A HB3  2  
ATOM 2277  H HG   . CYS A 1 21  ? 2.835   12.773  4.728   1.00 4.53  ? 535 CYS A HG   2  
ATOM 2278  N N    . ARG A 1 22  ? 7.280   10.239  2.981   1.00 1.45  ? 536 ARG A N    2  
ATOM 2279  C CA   . ARG A 1 22  ? 8.309   9.172   2.905   1.00 1.36  ? 536 ARG A CA   2  
ATOM 2280  C C    . ARG A 1 22  ? 8.427   8.338   4.187   1.00 1.28  ? 536 ARG A C    2  
ATOM 2281  O O    . ARG A 1 22  ? 8.666   7.136   4.104   1.00 1.29  ? 536 ARG A O    2  
ATOM 2282  C CB   . ARG A 1 22  ? 9.672   9.756   2.465   1.00 1.67  ? 536 ARG A CB   2  
ATOM 2283  C CG   . ARG A 1 22  ? 10.464  10.485  3.560   1.00 1.72  ? 536 ARG A CG   2  
ATOM 2284  C CD   . ARG A 1 22  ? 11.772  11.078  3.024   1.00 2.08  ? 536 ARG A CD   2  
ATOM 2285  N NE   . ARG A 1 22  ? 12.527  11.702  4.125   1.00 2.30  ? 536 ARG A NE   2  
ATOM 2286  C CZ   . ARG A 1 22  ? 13.463  11.153  4.873   1.00 2.97  ? 536 ARG A CZ   2  
ATOM 2287  N NH1  . ARG A 1 22  ? 14.003  10.000  4.614   1.00 3.79  ? 536 ARG A NH1  2  
ATOM 2288  N NH2  . ARG A 1 22  ? 13.861  11.798  5.921   1.00 3.76  ? 536 ARG A NH2  2  
ATOM 2289  H H    . ARG A 1 22  ? 7.547   11.188  2.738   1.00 1.72  ? 536 ARG A H    2  
ATOM 2290  H HA   . ARG A 1 22  ? 7.996   8.464   2.137   1.00 1.38  ? 536 ARG A HA   2  
ATOM 2291  H HB2  . ARG A 1 22  ? 10.288  8.935   2.091   1.00 2.24  ? 536 ARG A HB2  2  
ATOM 2292  H HB3  . ARG A 1 22  ? 9.513   10.454  1.642   1.00 2.35  ? 536 ARG A HB3  2  
ATOM 2293  H HG2  . ARG A 1 22  ? 9.859   11.294  3.962   1.00 2.43  ? 536 ARG A HG2  2  
ATOM 2294  H HG3  . ARG A 1 22  ? 10.704  9.787   4.363   1.00 2.13  ? 536 ARG A HG3  2  
ATOM 2295  H HD2  . ARG A 1 22  ? 12.363  10.295  2.549   1.00 2.64  ? 536 ARG A HD2  2  
ATOM 2296  H HD3  . ARG A 1 22  ? 11.544  11.834  2.270   1.00 2.76  ? 536 ARG A HD3  2  
ATOM 2297  H HE   . ARG A 1 22  ? 12.237  12.624  4.437   1.00 2.89  ? 536 ARG A HE   2  
ATOM 2298  H HH11 . ARG A 1 22  ? 13.800  9.554   3.744   1.00 3.87  ? 536 ARG A HH11 2  
ATOM 2299  H HH12 . ARG A 1 22  ? 14.769  9.669   5.194   1.00 4.73  ? 536 ARG A HH12 2  
ATOM 2300  H HH21 . ARG A 1 22  ? 13.542  12.757  6.026   1.00 4.02  ? 536 ARG A HH21 2  
ATOM 2301  H HH22 . ARG A 1 22  ? 14.544  11.416  6.558   1.00 4.55  ? 536 ARG A HH22 2  
ATOM 2302  N N    . LYS A 1 23  ? 8.171   8.943   5.352   1.00 1.35  ? 537 LYS A N    2  
ATOM 2303  C CA   . LYS A 1 23  ? 8.130   8.281   6.667   1.00 1.36  ? 537 LYS A CA   2  
ATOM 2304  C C    . LYS A 1 23  ? 7.200   7.060   6.714   1.00 1.14  ? 537 LYS A C    2  
ATOM 2305  O O    . LYS A 1 23  ? 7.503   6.092   7.409   1.00 1.19  ? 537 LYS A O    2  
ATOM 2306  C CB   . LYS A 1 23  ? 7.705   9.339   7.694   1.00 1.69  ? 537 LYS A CB   2  
ATOM 2307  C CG   . LYS A 1 23  ? 7.838   8.872   9.151   1.00 1.86  ? 537 LYS A CG   2  
ATOM 2308  C CD   . LYS A 1 23  ? 7.737   10.086  10.079  1.00 2.70  ? 537 LYS A CD   2  
ATOM 2309  C CE   . LYS A 1 23  ? 7.980   9.693   11.540  1.00 3.08  ? 537 LYS A CE   2  
ATOM 2310  N NZ   . LYS A 1 23  ? 8.400   10.878  12.319  1.00 4.25  ? 537 LYS A NZ   2  
ATOM 2311  H H    . LYS A 1 23  ? 7.999   9.942   5.320   1.00 1.48  ? 537 LYS A H    2  
ATOM 2312  H HA   . LYS A 1 23  ? 9.133   7.936   6.926   1.00 1.45  ? 537 LYS A HA   2  
ATOM 2313  H HB2  . LYS A 1 23  ? 8.337   10.219  7.551   1.00 2.17  ? 537 LYS A HB2  2  
ATOM 2314  H HB3  . LYS A 1 23  ? 6.669   9.626   7.510   1.00 2.34  ? 537 LYS A HB3  2  
ATOM 2315  H HG2  . LYS A 1 23  ? 7.052   8.153   9.389   1.00 2.53  ? 537 LYS A HG2  2  
ATOM 2316  H HG3  . LYS A 1 23  ? 8.811   8.404   9.293   1.00 2.43  ? 537 LYS A HG3  2  
ATOM 2317  H HD2  . LYS A 1 23  ? 8.497   10.806  9.770   1.00 3.40  ? 537 LYS A HD2  2  
ATOM 2318  H HD3  . LYS A 1 23  ? 6.755   10.551  9.980   1.00 3.32  ? 537 LYS A HD3  2  
ATOM 2319  H HE2  . LYS A 1 23  ? 7.070   9.255   11.960  1.00 3.52  ? 537 LYS A HE2  2  
ATOM 2320  H HE3  . LYS A 1 23  ? 8.771   8.938   11.579  1.00 3.26  ? 537 LYS A HE3  2  
ATOM 2321  H HZ1  . LYS A 1 23  ? 9.286   11.224  11.958  1.00 4.82  ? 537 LYS A HZ1  2  
ATOM 2322  H HZ2  . LYS A 1 23  ? 8.550   10.656  13.300  1.00 4.63  ? 537 LYS A HZ2  2  
ATOM 2323  H HZ3  . LYS A 1 23  ? 7.718   11.631  12.261  1.00 4.97  ? 537 LYS A HZ3  2  
ATOM 2324  N N    . LEU A 1 24  ? 6.097   7.071   5.960   1.00 1.05  ? 538 LEU A N    2  
ATOM 2325  C CA   . LEU A 1 24  ? 5.108   5.985   5.950   1.00 1.02  ? 538 LEU A CA   2  
ATOM 2326  C C    . LEU A 1 24  ? 5.566   4.815   5.069   1.00 0.96  ? 538 LEU A C    2  
ATOM 2327  O O    . LEU A 1 24  ? 5.593   3.676   5.533   1.00 1.14  ? 538 LEU A O    2  
ATOM 2328  C CB   . LEU A 1 24  ? 3.729   6.532   5.531   1.00 1.20  ? 538 LEU A CB   2  
ATOM 2329  C CG   . LEU A 1 24  ? 3.152   7.619   6.464   1.00 1.15  ? 538 LEU A CG   2  
ATOM 2330  C CD1  . LEU A 1 24  ? 1.784   8.072   5.952   1.00 2.42  ? 538 LEU A CD1  2  
ATOM 2331  C CD2  . LEU A 1 24  ? 2.970   7.131   7.904   1.00 1.91  ? 538 LEU A CD2  2  
ATOM 2332  H H    . LEU A 1 24  ? 5.944   7.864   5.347   1.00 1.14  ? 538 LEU A H    2  
ATOM 2333  H HA   . LEU A 1 24  ? 5.019   5.582   6.960   1.00 1.10  ? 538 LEU A HA   2  
ATOM 2334  H HB2  . LEU A 1 24  ? 3.807   6.944   4.525   1.00 2.04  ? 538 LEU A HB2  2  
ATOM 2335  H HB3  . LEU A 1 24  ? 3.027   5.698   5.497   1.00 1.97  ? 538 LEU A HB3  2  
ATOM 2336  H HG   . LEU A 1 24  ? 3.818   8.482   6.465   1.00 2.38  ? 538 LEU A HG   2  
ATOM 2337  H HD11 . LEU A 1 24  ? 1.088   7.233   5.942   1.00 2.94  ? 538 LEU A HD11 2  
ATOM 2338  H HD12 . LEU A 1 24  ? 1.881   8.481   4.947   1.00 3.49  ? 538 LEU A HD12 2  
ATOM 2339  H HD13 . LEU A 1 24  ? 1.397   8.854   6.605   1.00 3.06  ? 538 LEU A HD13 2  
ATOM 2340  H HD21 . LEU A 1 24  ? 2.350   6.235   7.923   1.00 2.49  ? 538 LEU A HD21 2  
ATOM 2341  H HD22 . LEU A 1 24  ? 2.490   7.911   8.495   1.00 2.57  ? 538 LEU A HD22 2  
ATOM 2342  H HD23 . LEU A 1 24  ? 3.938   6.919   8.355   1.00 2.98  ? 538 LEU A HD23 2  
ATOM 2343  N N    . VAL A 1 25  ? 6.024   5.087   3.842   1.00 0.86  ? 539 VAL A N    2  
ATOM 2344  C CA   . VAL A 1 25  ? 6.577   4.050   2.945   1.00 0.85  ? 539 VAL A CA   2  
ATOM 2345  C C    . VAL A 1 25  ? 7.831   3.399   3.559   1.00 0.95  ? 539 VAL A C    2  
ATOM 2346  O O    . VAL A 1 25  ? 7.966   2.179   3.553   1.00 1.11  ? 539 VAL A O    2  
ATOM 2347  C CB   . VAL A 1 25  ? 6.768   4.615   1.518   1.00 0.75  ? 539 VAL A CB   2  
ATOM 2348  C CG1  . VAL A 1 25  ? 8.188   5.095   1.225   1.00 0.74  ? 539 VAL A CG1  2  
ATOM 2349  C CG2  . VAL A 1 25  ? 6.359   3.571   0.479   1.00 0.84  ? 539 VAL A CG2  2  
ATOM 2350  H H    . VAL A 1 25  ? 6.006   6.047   3.526   1.00 0.90  ? 539 VAL A H    2  
ATOM 2351  H HA   . VAL A 1 25  ? 5.847   3.247   2.846   1.00 0.96  ? 539 VAL A HA   2  
ATOM 2352  H HB   . VAL A 1 25  ? 6.098   5.466   1.386   1.00 0.74  ? 539 VAL A HB   2  
ATOM 2353  H HG11 . VAL A 1 25  ? 8.878   4.255   1.273   1.00 1.51  ? 539 VAL A HG11 2  
ATOM 2354  H HG12 . VAL A 1 25  ? 8.233   5.535   0.228   1.00 1.67  ? 539 VAL A HG12 2  
ATOM 2355  H HG13 . VAL A 1 25  ? 8.467   5.849   1.958   1.00 1.56  ? 539 VAL A HG13 2  
ATOM 2356  H HG21 . VAL A 1 25  ? 6.903   2.647   0.659   1.00 1.82  ? 539 VAL A HG21 2  
ATOM 2357  H HG22 . VAL A 1 25  ? 5.290   3.371   0.559   1.00 1.42  ? 539 VAL A HG22 2  
ATOM 2358  H HG23 . VAL A 1 25  ? 6.572   3.932   -0.528  1.00 1.72  ? 539 VAL A HG23 2  
ATOM 2359  N N    . ALA A 1 26  ? 8.688   4.189   4.218   1.00 0.98  ? 540 ALA A N    2  
ATOM 2360  C CA   . ALA A 1 26  ? 9.873   3.716   4.937   1.00 1.18  ? 540 ALA A CA   2  
ATOM 2361  C C    . ALA A 1 26  ? 9.556   2.883   6.199   1.00 1.31  ? 540 ALA A C    2  
ATOM 2362  O O    . ALA A 1 26  ? 10.442  2.187   6.716   1.00 1.43  ? 540 ALA A O    2  
ATOM 2363  C CB   . ALA A 1 26  ? 10.702  4.948   5.313   1.00 1.28  ? 540 ALA A CB   2  
ATOM 2364  H H    . ALA A 1 26  ? 8.534   5.192   4.191   1.00 0.94  ? 540 ALA A H    2  
ATOM 2365  H HA   . ALA A 1 26  ? 10.460  3.088   4.265   1.00 1.25  ? 540 ALA A HA   2  
ATOM 2366  H HB1  . ALA A 1 26  ? 10.145  5.559   6.025   1.00 1.95  ? 540 ALA A HB1  2  
ATOM 2367  H HB2  . ALA A 1 26  ? 11.637  4.635   5.778   1.00 1.71  ? 540 ALA A HB2  2  
ATOM 2368  H HB3  . ALA A 1 26  ? 10.925  5.539   4.422   1.00 2.08  ? 540 ALA A HB3  2  
ATOM 2369  N N    . SER A 1 27  ? 8.322   2.952   6.712   1.00 1.37  ? 541 SER A N    2  
ATOM 2370  C CA   . SER A 1 27  ? 7.858   2.252   7.911   1.00 1.53  ? 541 SER A CA   2  
ATOM 2371  C C    . SER A 1 27  ? 7.228   0.881   7.619   1.00 1.50  ? 541 SER A C    2  
ATOM 2372  O O    . SER A 1 27  ? 6.941   0.109   8.539   1.00 1.60  ? 541 SER A O    2  
ATOM 2373  C CB   . SER A 1 27  ? 6.877   3.144   8.646   1.00 1.77  ? 541 SER A CB   2  
ATOM 2374  O OG   . SER A 1 27  ? 7.557   4.211   9.279   1.00 2.79  ? 541 SER A OG   2  
ATOM 2375  H H    . SER A 1 27  ? 7.625   3.519   6.247   1.00 1.36  ? 541 SER A H    2  
ATOM 2376  H HA   . SER A 1 27  ? 8.691   2.114   8.580   1.00 1.59  ? 541 SER A HA   2  
ATOM 2377  H HB2  . SER A 1 27  ? 6.164   3.528   7.937   1.00 1.82  ? 541 SER A HB2  2  
ATOM 2378  H HB3  . SER A 1 27  ? 6.351   2.556   9.382   1.00 1.96  ? 541 SER A HB3  2  
ATOM 2379  H HG   . SER A 1 27  ? 7.626   4.942   8.627   1.00 3.23  ? 541 SER A HG   2  
ATOM 2380  N N    . MET A 1 28  ? 7.032   0.558   6.338   1.00 1.39  ? 542 MET A N    2  
ATOM 2381  C CA   . MET A 1 28  ? 6.598   -0.745  5.854   1.00 1.38  ? 542 MET A CA   2  
ATOM 2382  C C    . MET A 1 28  ? 7.718   -1.787  6.096   1.00 1.31  ? 542 MET A C    2  
ATOM 2383  O O    . MET A 1 28  ? 8.873   -1.516  5.745   1.00 1.23  ? 542 MET A O    2  
ATOM 2384  C CB   . MET A 1 28  ? 6.263   -0.574  4.361   1.00 1.36  ? 542 MET A CB   2  
ATOM 2385  C CG   . MET A 1 28  ? 5.224   -1.555  3.824   1.00 1.49  ? 542 MET A CG   2  
ATOM 2386  S SD   . MET A 1 28  ? 5.747   -3.285  3.751   1.00 2.85  ? 542 MET A SD   2  
ATOM 2387  C CE   . MET A 1 28  ? 4.566   -3.922  2.537   1.00 1.89  ? 542 MET A CE   2  
ATOM 2388  H H    . MET A 1 28  ? 7.236   1.251   5.631   1.00 1.33  ? 542 MET A H    2  
ATOM 2389  H HA   . MET A 1 28  ? 5.693   -1.012  6.397   1.00 1.53  ? 542 MET A HA   2  
ATOM 2390  H HB2  . MET A 1 28  ? 5.847   0.424   4.205   1.00 1.69  ? 542 MET A HB2  2  
ATOM 2391  H HB3  . MET A 1 28  ? 7.177   -0.647  3.770   1.00 1.87  ? 542 MET A HB3  2  
ATOM 2392  H HG2  . MET A 1 28  ? 4.330   -1.475  4.441   1.00 1.59  ? 542 MET A HG2  2  
ATOM 2393  H HG3  . MET A 1 28  ? 4.967   -1.238  2.813   1.00 2.25  ? 542 MET A HG3  2  
ATOM 2394  H HE1  . MET A 1 28  ? 4.696   -4.999  2.439   1.00 2.84  ? 542 MET A HE1  2  
ATOM 2395  H HE2  . MET A 1 28  ? 3.552   -3.709  2.869   1.00 2.17  ? 542 MET A HE2  2  
ATOM 2396  H HE3  . MET A 1 28  ? 4.746   -3.448  1.571   1.00 1.92  ? 542 MET A HE3  2  
ATOM 2397  N N    . PRO A 1 29  ? 7.451   -2.975  6.673   1.00 1.45  ? 543 PRO A N    2  
ATOM 2398  C CA   . PRO A 1 29  ? 8.491   -3.954  7.036   1.00 1.56  ? 543 PRO A CA   2  
ATOM 2399  C C    . PRO A 1 29  ? 9.292   -4.519  5.846   1.00 1.46  ? 543 PRO A C    2  
ATOM 2400  O O    . PRO A 1 29  ? 10.402  -5.014  6.025   1.00 1.57  ? 543 PRO A O    2  
ATOM 2401  C CB   . PRO A 1 29  ? 7.758   -5.057  7.809   1.00 1.87  ? 543 PRO A CB   2  
ATOM 2402  C CG   . PRO A 1 29  ? 6.308   -4.929  7.357   1.00 1.80  ? 543 PRO A CG   2  
ATOM 2403  C CD   . PRO A 1 29  ? 6.153   -3.429  7.140   1.00 1.66  ? 543 PRO A CD   2  
ATOM 2404  H HA   . PRO A 1 29  ? 9.207   -3.480  7.710   1.00 1.62  ? 543 PRO A HA   2  
ATOM 2405  H HB2  . PRO A 1 29  ? 8.156   -6.051  7.598   1.00 2.01  ? 543 PRO A HB2  2  
ATOM 2406  H HB3  . PRO A 1 29  ? 7.813   -4.849  8.878   1.00 2.13  ? 543 PRO A HB3  2  
ATOM 2407  H HG2  . PRO A 1 29  ? 6.166   -5.453  6.410   1.00 1.80  ? 543 PRO A HG2  2  
ATOM 2408  H HG3  . PRO A 1 29  ? 5.618   -5.301  8.114   1.00 1.98  ? 543 PRO A HG3  2  
ATOM 2409  H HD2  . PRO A 1 29  ? 5.361   -3.234  6.421   1.00 1.69  ? 543 PRO A HD2  2  
ATOM 2410  H HD3  . PRO A 1 29  ? 5.919   -2.934  8.078   1.00 1.77  ? 543 PRO A HD3  2  
ATOM 2411  N N    . LEU A 1 30  ? 8.783   -4.403  4.616   1.00 1.35  ? 544 LEU A N    2  
ATOM 2412  C CA   . LEU A 1 30  ? 9.487   -4.766  3.376   1.00 1.40  ? 544 LEU A CA   2  
ATOM 2413  C C    . LEU A 1 30  ? 10.579  -3.747  2.974   1.00 1.27  ? 544 LEU A C    2  
ATOM 2414  O O    . LEU A 1 30  ? 11.525  -4.101  2.269   1.00 1.46  ? 544 LEU A O    2  
ATOM 2415  C CB   . LEU A 1 30  ? 8.391   -4.984  2.322   1.00 1.49  ? 544 LEU A CB   2  
ATOM 2416  C CG   . LEU A 1 30  ? 8.834   -5.388  0.908   1.00 1.75  ? 544 LEU A CG   2  
ATOM 2417  C CD1  . LEU A 1 30  ? 7.733   -6.249  0.302   1.00 2.06  ? 544 LEU A CD1  2  
ATOM 2418  C CD2  . LEU A 1 30  ? 8.962   -4.159  0.008   1.00 2.41  ? 544 LEU A CD2  2  
ATOM 2419  H H    . LEU A 1 30  ? 7.847   -4.029  4.534   1.00 1.34  ? 544 LEU A H    2  
ATOM 2420  H HA   . LEU A 1 30  ? 9.990   -5.722  3.525   1.00 1.60  ? 544 LEU A HA   2  
ATOM 2421  H HB2  . LEU A 1 30  ? 7.734   -5.761  2.719   1.00 2.38  ? 544 LEU A HB2  2  
ATOM 2422  H HB3  . LEU A 1 30  ? 7.796   -4.081  2.226   1.00 1.91  ? 544 LEU A HB3  2  
ATOM 2423  H HG   . LEU A 1 30  ? 9.767   -5.951  0.935   1.00 2.70  ? 544 LEU A HG   2  
ATOM 2424  H HD11 . LEU A 1 30  ? 6.791   -5.700  0.344   1.00 2.02  ? 544 LEU A HD11 2  
ATOM 2425  H HD12 . LEU A 1 30  ? 7.639   -7.168  0.876   1.00 3.08  ? 544 LEU A HD12 2  
ATOM 2426  H HD13 . LEU A 1 30  ? 7.979   -6.497  -0.729  1.00 2.55  ? 544 LEU A HD13 2  
ATOM 2427  H HD21 . LEU A 1 30  ? 8.022   -3.606  -0.013  1.00 2.73  ? 544 LEU A HD21 2  
ATOM 2428  H HD22 . LEU A 1 30  ? 9.206   -4.479  -1.004  1.00 3.28  ? 544 LEU A HD22 2  
ATOM 2429  H HD23 . LEU A 1 30  ? 9.756   -3.510  0.371   1.00 3.11  ? 544 LEU A HD23 2  
ATOM 2430  N N    . PHE A 1 31  ? 10.486  -2.512  3.480   1.00 1.08  ? 545 PHE A N    2  
ATOM 2431  C CA   . PHE A 1 31  ? 11.390  -1.368  3.265   1.00 1.00  ? 545 PHE A CA   2  
ATOM 2432  C C    . PHE A 1 31  ? 12.428  -1.205  4.402   1.00 1.08  ? 545 PHE A C    2  
ATOM 2433  O O    . PHE A 1 31  ? 13.088  -0.169  4.525   1.00 1.05  ? 545 PHE A O    2  
ATOM 2434  C CB   . PHE A 1 31  ? 10.551  -0.083  3.095   1.00 0.98  ? 545 PHE A CB   2  
ATOM 2435  C CG   . PHE A 1 31  ? 9.798   0.104   1.785   1.00 0.92  ? 545 PHE A CG   2  
ATOM 2436  C CD1  . PHE A 1 31  ? 8.753   -0.762  1.402   1.00 2.09  ? 545 PHE A CD1  2  
ATOM 2437  C CD2  . PHE A 1 31  ? 10.082  1.234   0.993   1.00 1.90  ? 545 PHE A CD2  2  
ATOM 2438  C CE1  . PHE A 1 31  ? 7.981   -0.478  0.261   1.00 2.13  ? 545 PHE A CE1  2  
ATOM 2439  C CE2  . PHE A 1 31  ? 9.308   1.522   -0.142  1.00 1.91  ? 545 PHE A CE2  2  
ATOM 2440  C CZ   . PHE A 1 31  ? 8.236   0.684   -0.485  1.00 1.01  ? 545 PHE A CZ   2  
ATOM 2441  H H    . PHE A 1 31  ? 9.721   -2.350  4.118   1.00 1.08  ? 545 PHE A H    2  
ATOM 2442  H HA   . PHE A 1 31  ? 11.953  -1.528  2.345   1.00 0.97  ? 545 PHE A HA   2  
ATOM 2443  H HB2  . PHE A 1 31  ? 9.835   -0.010  3.912   1.00 1.04  ? 545 PHE A HB2  2  
ATOM 2444  H HB3  . PHE A 1 31  ? 11.214  0.775   3.205   1.00 1.05  ? 545 PHE A HB3  2  
ATOM 2445  H HD1  . PHE A 1 31  ? 8.508   -1.623  2.002   1.00 3.37  ? 545 PHE A HD1  2  
ATOM 2446  H HD2  . PHE A 1 31  ? 10.865  1.913   1.286   1.00 3.18  ? 545 PHE A HD2  2  
ATOM 2447  H HE1  . PHE A 1 31  ? 7.173   -1.133  -0.037  1.00 3.43  ? 545 PHE A HE1  2  
ATOM 2448  H HE2  . PHE A 1 31  ? 9.499   2.411   -0.726  1.00 3.17  ? 545 PHE A HE2  2  
ATOM 2449  H HZ   . PHE A 1 31  ? 7.585   0.960   -1.300  1.00 1.09  ? 545 PHE A HZ   2  
ATOM 2450  N N    . ALA A 1 32  ? 12.575  -2.210  5.265   1.00 1.24  ? 546 ALA A N    2  
ATOM 2451  C CA   . ALA A 1 32  ? 13.442  -2.200  6.448   1.00 1.43  ? 546 ALA A CA   2  
ATOM 2452  C C    . ALA A 1 32  ? 14.940  -1.960  6.172   1.00 1.40  ? 546 ALA A C    2  
ATOM 2453  O O    . ALA A 1 32  ? 15.651  -1.385  7.001   1.00 1.52  ? 546 ALA A O    2  
ATOM 2454  C CB   . ALA A 1 32  ? 13.246  -3.561  7.087   1.00 1.60  ? 546 ALA A CB   2  
ATOM 2455  H H    . ALA A 1 32  ? 12.002  -3.029  5.128   1.00 1.27  ? 546 ALA A H    2  
ATOM 2456  H HA   . ALA A 1 32  ? 13.107  -1.438  7.145   1.00 1.54  ? 546 ALA A HA   2  
ATOM 2457  H HB1  . ALA A 1 32  ? 12.194  -3.695  7.332   1.00 2.08  ? 546 ALA A HB1  2  
ATOM 2458  H HB2  . ALA A 1 32  ? 13.565  -4.321  6.371   1.00 2.04  ? 546 ALA A HB2  2  
ATOM 2459  H HB3  . ALA A 1 32  ? 13.849  -3.626  7.992   1.00 2.30  ? 546 ALA A HB3  2  
ATOM 2460  N N    . ASN A 1 33  ? 15.403  -2.369  4.993   1.00 1.31  ? 547 ASN A N    2  
ATOM 2461  C CA   . ASN A 1 33  ? 16.766  -2.215  4.475   1.00 1.35  ? 547 ASN A CA   2  
ATOM 2462  C C    . ASN A 1 33  ? 16.808  -1.364  3.198   1.00 1.15  ? 547 ASN A C    2  
ATOM 2463  O O    . ASN A 1 33  ? 17.772  -1.395  2.430   1.00 1.26  ? 547 ASN A O    2  
ATOM 2464  C CB   . ASN A 1 33  ? 17.428  -3.593  4.365   1.00 1.69  ? 547 ASN A CB   2  
ATOM 2465  C CG   . ASN A 1 33  ? 16.571  -4.640  3.680   1.00 2.46  ? 547 ASN A CG   2  
ATOM 2466  O OD1  . ASN A 1 33  ? 16.575  -4.790  2.466   1.00 3.76  ? 547 ASN A OD1  2  
ATOM 2467  N ND2  . ASN A 1 33  ? 15.771  -5.359  4.431   1.00 2.70  ? 547 ASN A ND2  2  
ATOM 2468  H H    . ASN A 1 33  ? 14.741  -2.826  4.373   1.00 1.27  ? 547 ASN A H    2  
ATOM 2469  H HA   . ASN A 1 33  ? 17.346  -1.652  5.200   1.00 1.44  ? 547 ASN A HA   2  
ATOM 2470  H HB2  . ASN A 1 33  ? 18.386  -3.522  3.853   1.00 2.91  ? 547 ASN A HB2  2  
ATOM 2471  H HB3  . ASN A 1 33  ? 17.611  -3.914  5.381   1.00 2.22  ? 547 ASN A HB3  2  
ATOM 2472  H HD21 . ASN A 1 33  ? 15.785  -5.220  5.445   1.00 2.18  ? 547 ASN A HD21 2  
ATOM 2473  H HD22 . ASN A 1 33  ? 15.252  -6.102  3.993   1.00 3.84  ? 547 ASN A HD22 2  
ATOM 2474  N N    . ALA A 1 34  ? 15.753  -0.575  3.002   1.00 0.98  ? 548 ALA A N    2  
ATOM 2475  C CA   . ALA A 1 34  ? 15.652  0.379   1.894   1.00 0.88  ? 548 ALA A CA   2  
ATOM 2476  C C    . ALA A 1 34  ? 16.757  1.460   1.918   1.00 0.86  ? 548 ALA A C    2  
ATOM 2477  O O    . ALA A 1 34  ? 17.290  1.829   2.972   1.00 0.97  ? 548 ALA A O    2  
ATOM 2478  C CB   . ALA A 1 34  ? 14.253  1.014   1.834   1.00 0.89  ? 548 ALA A CB   2  
ATOM 2479  H H    . ALA A 1 34  ? 14.993  -0.702  3.667   1.00 1.00  ? 548 ALA A H    2  
ATOM 2480  H HA   . ALA A 1 34  ? 15.784  -0.194  0.978   1.00 0.95  ? 548 ALA A HA   2  
ATOM 2481  H HB1  . ALA A 1 34  ? 13.478  0.248   1.884   1.00 1.43  ? 548 ALA A HB1  2  
ATOM 2482  H HB2  . ALA A 1 34  ? 14.117  1.734   2.646   1.00 1.92  ? 548 ALA A HB2  2  
ATOM 2483  H HB3  . ALA A 1 34  ? 14.147  1.552   0.891   1.00 1.61  ? 548 ALA A HB3  2  
ATOM 2484  N N    . ASP A 1 35  ? 17.076  2.008   0.746   1.00 0.88  ? 549 ASP A N    2  
ATOM 2485  C CA   . ASP A 1 35  ? 17.924  3.195   0.586   1.00 0.86  ? 549 ASP A CA   2  
ATOM 2486  C C    . ASP A 1 35  ? 17.069  4.486   0.659   1.00 0.83  ? 549 ASP A C    2  
ATOM 2487  O O    . ASP A 1 35  ? 16.062  4.577   -0.044  1.00 0.77  ? 549 ASP A O    2  
ATOM 2488  C CB   . ASP A 1 35  ? 18.690  3.061   -0.739  1.00 0.86  ? 549 ASP A CB   2  
ATOM 2489  C CG   . ASP A 1 35  ? 19.462  4.326   -1.099  1.00 1.09  ? 549 ASP A CG   2  
ATOM 2490  O OD1  . ASP A 1 35  ? 18.826  5.329   -1.477  1.00 2.26  ? 549 ASP A OD1  2  
ATOM 2491  O OD2  . ASP A 1 35  ? 20.707  4.334   -0.976  1.00 1.52  ? 549 ASP A OD2  2  
ATOM 2492  H H    . ASP A 1 35  ? 16.625  1.650   -0.082  1.00 1.01  ? 549 ASP A H    2  
ATOM 2493  H HA   . ASP A 1 35  ? 18.662  3.212   1.387   1.00 0.93  ? 549 ASP A HA   2  
ATOM 2494  H HB2  . ASP A 1 35  ? 19.383  2.223   -0.655  1.00 0.93  ? 549 ASP A HB2  2  
ATOM 2495  H HB3  . ASP A 1 35  ? 18.000  2.830   -1.548  1.00 0.77  ? 549 ASP A HB3  2  
ATOM 2496  N N    . PRO A 1 36  ? 17.438  5.512   1.450   1.00 0.91  ? 550 PRO A N    2  
ATOM 2497  C CA   . PRO A 1 36  ? 16.588  6.690   1.695   1.00 0.94  ? 550 PRO A CA   2  
ATOM 2498  C C    . PRO A 1 36  ? 16.297  7.546   0.445   1.00 0.89  ? 550 PRO A C    2  
ATOM 2499  O O    . PRO A 1 36  ? 15.349  8.334   0.426   1.00 0.92  ? 550 PRO A O    2  
ATOM 2500  C CB   . PRO A 1 36  ? 17.333  7.500   2.759   1.00 1.06  ? 550 PRO A CB   2  
ATOM 2501  C CG   . PRO A 1 36  ? 18.794  7.114   2.542   1.00 1.06  ? 550 PRO A CG   2  
ATOM 2502  C CD   . PRO A 1 36  ? 18.694  5.639   2.173   1.00 1.01  ? 550 PRO A CD   2  
ATOM 2503  H HA   . PRO A 1 36  ? 15.638  6.360   2.116   1.00 0.94  ? 550 PRO A HA   2  
ATOM 2504  H HB2  . PRO A 1 36  ? 17.177  8.575   2.647   1.00 1.10  ? 550 PRO A HB2  2  
ATOM 2505  H HB3  . PRO A 1 36  ? 17.015  7.175   3.751   1.00 1.13  ? 550 PRO A HB3  2  
ATOM 2506  H HG2  . PRO A 1 36  ? 19.201  7.674   1.698   1.00 1.04  ? 550 PRO A HG2  2  
ATOM 2507  H HG3  . PRO A 1 36  ? 19.397  7.264   3.438   1.00 1.13  ? 550 PRO A HG3  2  
ATOM 2508  H HD2  . PRO A 1 36  ? 19.547  5.351   1.558   1.00 1.02  ? 550 PRO A HD2  2  
ATOM 2509  H HD3  . PRO A 1 36  ? 18.659  5.032   3.080   1.00 1.07  ? 550 PRO A HD3  2  
ATOM 2510  N N    . ASN A 1 37  ? 17.070  7.366   -0.624  1.00 0.85  ? 551 ASN A N    2  
ATOM 2511  C CA   . ASN A 1 37  ? 16.935  8.076   -1.897  1.00 0.83  ? 551 ASN A CA   2  
ATOM 2512  C C    . ASN A 1 37  ? 16.000  7.293   -2.828  1.00 0.72  ? 551 ASN A C    2  
ATOM 2513  O O    . ASN A 1 37  ? 15.179  7.896   -3.518  1.00 0.74  ? 551 ASN A O    2  
ATOM 2514  C CB   . ASN A 1 37  ? 18.310  8.268   -2.568  1.00 0.90  ? 551 ASN A CB   2  
ATOM 2515  C CG   . ASN A 1 37  ? 19.443  8.716   -1.661  1.00 1.05  ? 551 ASN A CG   2  
ATOM 2516  O OD1  . ASN A 1 37  ? 19.742  9.894   -1.512  1.00 1.53  ? 551 ASN A OD1  2  
ATOM 2517  N ND2  . ASN A 1 37  ? 20.146  7.788   -1.064  1.00 1.80  ? 551 ASN A ND2  2  
ATOM 2518  H H    . ASN A 1 37  ? 17.649  6.533   -0.619  1.00 0.87  ? 551 ASN A H    2  
ATOM 2519  H HA   . ASN A 1 37  ? 16.494  9.061   -1.716  1.00 0.88  ? 551 ASN A HA   2  
ATOM 2520  H HB2  . ASN A 1 37  ? 18.614  7.332   -3.036  1.00 0.96  ? 551 ASN A HB2  2  
ATOM 2521  H HB3  . ASN A 1 37  ? 18.205  9.000   -3.362  1.00 0.94  ? 551 ASN A HB3  2  
ATOM 2522  H HD21 . ASN A 1 37  ? 19.879  6.813   -1.202  1.00 2.47  ? 551 ASN A HD21 2  
ATOM 2523  H HD22 . ASN A 1 37  ? 20.981  8.054   -0.554  1.00 2.07  ? 551 ASN A HD22 2  
ATOM 2524  N N    . PHE A 1 38  ? 16.082  5.958   -2.799  1.00 0.67  ? 552 PHE A N    2  
ATOM 2525  C CA   . PHE A 1 38  ? 15.177  5.032   -3.489  1.00 0.59  ? 552 PHE A CA   2  
ATOM 2526  C C    . PHE A 1 38  ? 13.729  5.184   -3.003  1.00 0.55  ? 552 PHE A C    2  
ATOM 2527  O O    . PHE A 1 38  ? 12.821  5.372   -3.814  1.00 0.54  ? 552 PHE A O    2  
ATOM 2528  C CB   . PHE A 1 38  ? 15.695  3.605   -3.251  1.00 0.62  ? 552 PHE A CB   2  
ATOM 2529  C CG   . PHE A 1 38  ? 14.715  2.477   -3.494  1.00 0.60  ? 552 PHE A CG   2  
ATOM 2530  C CD1  . PHE A 1 38  ? 14.357  2.112   -4.802  1.00 1.83  ? 552 PHE A CD1  2  
ATOM 2531  C CD2  . PHE A 1 38  ? 14.174  1.776   -2.400  1.00 1.77  ? 552 PHE A CD2  2  
ATOM 2532  C CE1  . PHE A 1 38  ? 13.462  1.051   -5.018  1.00 1.83  ? 552 PHE A CE1  2  
ATOM 2533  C CE2  . PHE A 1 38  ? 13.290  0.704   -2.611  1.00 1.83  ? 552 PHE A CE2  2  
ATOM 2534  C CZ   . PHE A 1 38  ? 12.942  0.338   -3.922  1.00 0.76  ? 552 PHE A CZ   2  
ATOM 2535  H H    . PHE A 1 38  ? 16.802  5.553   -2.204  1.00 0.71  ? 552 PHE A H    2  
ATOM 2536  H HA   . PHE A 1 38  ? 15.188  5.236   -4.560  1.00 0.58  ? 552 PHE A HA   2  
ATOM 2537  H HB2  . PHE A 1 38  ? 16.578  3.448   -3.864  1.00 0.66  ? 552 PHE A HB2  2  
ATOM 2538  H HB3  . PHE A 1 38  ? 16.022  3.521   -2.222  1.00 0.67  ? 552 PHE A HB3  2  
ATOM 2539  H HD1  . PHE A 1 38  ? 14.770  2.645   -5.642  1.00 3.09  ? 552 PHE A HD1  2  
ATOM 2540  H HD2  . PHE A 1 38  ? 14.449  2.051   -1.393  1.00 3.01  ? 552 PHE A HD2  2  
ATOM 2541  H HE1  . PHE A 1 38  ? 13.184  0.779   -6.025  1.00 3.08  ? 552 PHE A HE1  2  
ATOM 2542  H HE2  . PHE A 1 38  ? 12.892  0.153   -1.770  1.00 3.09  ? 552 PHE A HE2  2  
ATOM 2543  H HZ   . PHE A 1 38  ? 12.282  -0.498  -4.086  1.00 0.89  ? 552 PHE A HZ   2  
ATOM 2544  N N    . VAL A 1 39  ? 13.513  5.183   -1.680  1.00 0.58  ? 553 VAL A N    2  
ATOM 2545  C CA   . VAL A 1 39  ? 12.160  5.302   -1.088  1.00 0.60  ? 553 VAL A CA   2  
ATOM 2546  C C    . VAL A 1 39  ? 11.505  6.648   -1.399  1.00 0.62  ? 553 VAL A C    2  
ATOM 2547  O O    . VAL A 1 39  ? 10.289  6.752   -1.494  1.00 0.64  ? 553 VAL A O    2  
ATOM 2548  C CB   . VAL A 1 39  ? 12.150  5.072   0.431   1.00 0.72  ? 553 VAL A CB   2  
ATOM 2549  C CG1  . VAL A 1 39  ? 12.872  3.775   0.736   1.00 1.29  ? 553 VAL A CG1  2  
ATOM 2550  C CG2  . VAL A 1 39  ? 12.847  6.128   1.282   1.00 1.34  ? 553 VAL A CG2  2  
ATOM 2551  H H    . VAL A 1 39  ? 14.307  5.009   -1.068  1.00 0.62  ? 553 VAL A H    2  
ATOM 2552  H HA   . VAL A 1 39  ? 11.547  4.510   -1.516  1.00 0.58  ? 553 VAL A HA   2  
ATOM 2553  H HB   . VAL A 1 39  ? 11.117  4.992   0.759   1.00 1.33  ? 553 VAL A HB   2  
ATOM 2554  H HG11 . VAL A 1 39  ? 12.691  3.491   1.771   1.00 2.05  ? 553 VAL A HG11 2  
ATOM 2555  H HG12 . VAL A 1 39  ? 12.528  2.994   0.061   1.00 2.18  ? 553 VAL A HG12 2  
ATOM 2556  H HG13 . VAL A 1 39  ? 13.941  3.938   0.596   1.00 1.90  ? 553 VAL A HG13 2  
ATOM 2557  H HG21 . VAL A 1 39  ? 12.926  5.764   2.310   1.00 1.88  ? 553 VAL A HG21 2  
ATOM 2558  H HG22 . VAL A 1 39  ? 13.848  6.282   0.894   1.00 2.22  ? 553 VAL A HG22 2  
ATOM 2559  H HG23 . VAL A 1 39  ? 12.290  7.064   1.268   1.00 2.04  ? 553 VAL A HG23 2  
ATOM 2560  N N    . THR A 1 40  ? 12.343  7.667   -1.579  1.00 0.65  ? 554 THR A N    2  
ATOM 2561  C CA   . THR A 1 40  ? 11.961  9.035   -1.945  1.00 0.74  ? 554 THR A CA   2  
ATOM 2562  C C    . THR A 1 40  ? 11.688  9.196   -3.446  1.00 0.71  ? 554 THR A C    2  
ATOM 2563  O O    . THR A 1 40  ? 10.672  9.777   -3.826  1.00 0.78  ? 554 THR A O    2  
ATOM 2564  C CB   . THR A 1 40  ? 13.044  10.023  -1.482  1.00 0.85  ? 554 THR A CB   2  
ATOM 2565  O OG1  . THR A 1 40  ? 13.251  9.956   -0.082  1.00 0.92  ? 554 THR A OG1  2  
ATOM 2566  C CG2  . THR A 1 40  ? 12.626  11.443  -1.824  1.00 0.97  ? 554 THR A CG2  2  
ATOM 2567  H H    . THR A 1 40  ? 13.314  7.457   -1.418  1.00 0.66  ? 554 THR A H    2  
ATOM 2568  H HA   . THR A 1 40  ? 11.027  9.293   -1.442  1.00 0.79  ? 554 THR A HA   2  
ATOM 2569  H HB   . THR A 1 40  ? 13.986  9.802   -1.984  1.00 0.85  ? 554 THR A HB   2  
ATOM 2570  H HG1  . THR A 1 40  ? 13.984  9.330   0.078   1.00 0.98  ? 554 THR A HG1  2  
ATOM 2571  H HG21 . THR A 1 40  ? 11.615  11.620  -1.454  1.00 1.77  ? 554 THR A HG21 2  
ATOM 2572  H HG22 . THR A 1 40  ? 12.629  11.554  -2.909  1.00 1.77  ? 554 THR A HG22 2  
ATOM 2573  H HG23 . THR A 1 40  ? 13.328  12.151  -1.387  1.00 1.40  ? 554 THR A HG23 2  
ATOM 2574  N N    . ALA A 1 41  ? 12.533  8.643   -4.322  1.00 0.65  ? 555 ALA A N    2  
ATOM 2575  C CA   . ALA A 1 41  ? 12.343  8.723   -5.776  1.00 0.68  ? 555 ALA A CA   2  
ATOM 2576  C C    . ALA A 1 41  ? 11.045  8.030   -6.246  1.00 0.66  ? 555 ALA A C    2  
ATOM 2577  O O    . ALA A 1 41  ? 10.540  8.291   -7.336  1.00 0.81  ? 555 ALA A O    2  
ATOM 2578  C CB   . ALA A 1 41  ? 13.578  8.129   -6.465  1.00 0.68  ? 555 ALA A CB   2  
ATOM 2579  H H    . ALA A 1 41  ? 13.361  8.170   -3.979  1.00 0.64  ? 555 ALA A H    2  
ATOM 2580  H HA   . ALA A 1 41  ? 12.267  9.781   -6.039  1.00 0.79  ? 555 ALA A HA   2  
ATOM 2581  H HB1  . ALA A 1 41  ? 13.455  8.183   -7.547  1.00 1.71  ? 555 ALA A HB1  2  
ATOM 2582  H HB2  . ALA A 1 41  ? 14.468  8.692   -6.187  1.00 1.42  ? 555 ALA A HB2  2  
ATOM 2583  H HB3  . ALA A 1 41  ? 13.706  7.086   -6.171  1.00 1.50  ? 555 ALA A HB3  2  
ATOM 2584  N N    . MET A 1 42  ? 10.489  7.154   -5.406  1.00 0.57  ? 556 MET A N    2  
ATOM 2585  C CA   . MET A 1 42  ? 9.208   6.468   -5.589  1.00 0.62  ? 556 MET A CA   2  
ATOM 2586  C C    . MET A 1 42  ? 7.973   7.378   -5.443  1.00 0.67  ? 556 MET A C    2  
ATOM 2587  O O    . MET A 1 42  ? 6.874   6.983   -5.831  1.00 0.84  ? 556 MET A O    2  
ATOM 2588  C CB   . MET A 1 42  ? 9.192   5.359   -4.533  1.00 0.71  ? 556 MET A CB   2  
ATOM 2589  C CG   . MET A 1 42  ? 8.177   4.242   -4.774  1.00 0.67  ? 556 MET A CG   2  
ATOM 2590  S SD   . MET A 1 42  ? 8.318   2.880   -3.580  1.00 0.83  ? 556 MET A SD   2  
ATOM 2591  C CE   . MET A 1 42  ? 10.065  2.409   -3.767  1.00 0.62  ? 556 MET A CE   2  
ATOM 2592  H H    . MET A 1 42  ? 11.008  6.949   -4.559  1.00 0.54  ? 556 MET A H    2  
ATOM 2593  H HA   . MET A 1 42  ? 9.185   6.021   -6.584  1.00 0.73  ? 556 MET A HA   2  
ATOM 2594  H HB2  . MET A 1 42  ? 10.185  4.915   -4.520  1.00 1.08  ? 556 MET A HB2  2  
ATOM 2595  H HB3  . MET A 1 42  ? 9.005   5.796   -3.552  1.00 1.09  ? 556 MET A HB3  2  
ATOM 2596  H HG2  . MET A 1 42  ? 7.172   4.656   -4.710  1.00 0.98  ? 556 MET A HG2  2  
ATOM 2597  H HG3  . MET A 1 42  ? 8.310   3.840   -5.778  1.00 0.96  ? 556 MET A HG3  2  
ATOM 2598  H HE1  . MET A 1 42  ? 10.259  1.509   -3.186  1.00 1.68  ? 556 MET A HE1  2  
ATOM 2599  H HE2  . MET A 1 42  ? 10.292  2.225   -4.819  1.00 1.49  ? 556 MET A HE2  2  
ATOM 2600  H HE3  . MET A 1 42  ? 10.715  3.200   -3.394  1.00 1.40  ? 556 MET A HE3  2  
ATOM 2601  N N    . LEU A 1 43  ? 8.120   8.571   -4.852  1.00 0.71  ? 557 LEU A N    2  
ATOM 2602  C CA   . LEU A 1 43  ? 7.017   9.481   -4.493  1.00 0.81  ? 557 LEU A CA   2  
ATOM 2603  C C    . LEU A 1 43  ? 6.703   10.558  -5.555  1.00 0.91  ? 557 LEU A C    2  
ATOM 2604  O O    . LEU A 1 43  ? 5.727   11.302  -5.435  1.00 0.93  ? 557 LEU A O    2  
ATOM 2605  C CB   . LEU A 1 43  ? 7.335   10.137  -3.135  1.00 0.87  ? 557 LEU A CB   2  
ATOM 2606  C CG   . LEU A 1 43  ? 7.876   9.186   -2.051  1.00 0.83  ? 557 LEU A CG   2  
ATOM 2607  C CD1  . LEU A 1 43  ? 8.166   9.956   -0.776  1.00 0.94  ? 557 LEU A CD1  2  
ATOM 2608  C CD2  . LEU A 1 43  ? 6.917   8.045   -1.708  1.00 0.82  ? 557 LEU A CD2  2  
ATOM 2609  H H    . LEU A 1 43  ? 9.049   8.830   -4.535  1.00 0.76  ? 557 LEU A H    2  
ATOM 2610  H HA   . LEU A 1 43  ? 6.111   8.880   -4.371  1.00 0.82  ? 557 LEU A HA   2  
ATOM 2611  H HB2  . LEU A 1 43  ? 8.082   10.916  -3.300  1.00 0.90  ? 557 LEU A HB2  2  
ATOM 2612  H HB3  . LEU A 1 43  ? 6.429   10.618  -2.764  1.00 0.96  ? 557 LEU A HB3  2  
ATOM 2613  H HG   . LEU A 1 43  ? 8.824   8.767   -2.380  1.00 0.76  ? 557 LEU A HG   2  
ATOM 2614  H HD11 . LEU A 1 43  ? 7.239   10.340  -0.353  1.00 1.94  ? 557 LEU A HD11 2  
ATOM 2615  H HD12 . LEU A 1 43  ? 8.845   10.779  -1.004  1.00 1.95  ? 557 LEU A HD12 2  
ATOM 2616  H HD13 . LEU A 1 43  ? 8.641   9.271   -0.077  1.00 1.42  ? 557 LEU A HD13 2  
ATOM 2617  H HD21 . LEU A 1 43  ? 5.976   8.452   -1.339  1.00 1.60  ? 557 LEU A HD21 2  
ATOM 2618  H HD22 . LEU A 1 43  ? 7.365   7.415   -0.941  1.00 1.46  ? 557 LEU A HD22 2  
ATOM 2619  H HD23 . LEU A 1 43  ? 6.736   7.430   -2.587  1.00 1.85  ? 557 LEU A HD23 2  
ATOM 2620  N N    . THR A 1 44  ? 7.556   10.689  -6.572  1.00 1.00  ? 558 THR A N    2  
ATOM 2621  C CA   . THR A 1 44  ? 7.614   11.864  -7.473  1.00 1.06  ? 558 THR A CA   2  
ATOM 2622  C C    . THR A 1 44  ? 6.369   12.136  -8.336  1.00 1.02  ? 558 THR A C    2  
ATOM 2623  O O    . THR A 1 44  ? 6.190   13.279  -8.770  1.00 1.20  ? 558 THR A O    2  
ATOM 2624  C CB   . THR A 1 44  ? 8.861   11.808  -8.374  1.00 1.19  ? 558 THR A CB   2  
ATOM 2625  O OG1  . THR A 1 44  ? 8.914   10.604  -9.107  1.00 1.88  ? 558 THR A OG1  2  
ATOM 2626  C CG2  . THR A 1 44  ? 10.141  11.887  -7.545  1.00 1.52  ? 558 THR A CG2  2  
ATOM 2627  H H    . THR A 1 44  ? 8.354   10.065  -6.566  1.00 0.99  ? 558 THR A H    2  
ATOM 2628  H HA   . THR A 1 44  ? 7.722   12.745  -6.841  1.00 1.15  ? 558 THR A HA   2  
ATOM 2629  H HB   . THR A 1 44  ? 8.843   12.647  -9.070  1.00 1.71  ? 558 THR A HB   2  
ATOM 2630  H HG1  . THR A 1 44  ? 9.736   10.643  -9.635  1.00 2.21  ? 558 THR A HG1  2  
ATOM 2631  H HG21 . THR A 1 44  ? 10.128  12.798  -6.945  1.00 2.04  ? 558 THR A HG21 2  
ATOM 2632  H HG22 . THR A 1 44  ? 11.006  11.915  -8.206  1.00 2.37  ? 558 THR A HG22 2  
ATOM 2633  H HG23 . THR A 1 44  ? 10.220  11.025  -6.884  1.00 2.24  ? 558 THR A HG23 2  
ATOM 2634  N N    . LYS A 1 45  ? 5.496   11.142  -8.563  1.00 0.93  ? 559 LYS A N    2  
ATOM 2635  C CA   . LYS A 1 45  ? 4.153   11.295  -9.176  1.00 0.93  ? 559 LYS A CA   2  
ATOM 2636  C C    . LYS A 1 45  ? 2.992   10.760  -8.321  1.00 0.94  ? 559 LYS A C    2  
ATOM 2637  O O    . LYS A 1 45  ? 1.898   10.521  -8.837  1.00 1.14  ? 559 LYS A O    2  
ATOM 2638  C CB   . LYS A 1 45  ? 4.165   10.779  -10.631 1.00 1.22  ? 559 LYS A CB   2  
ATOM 2639  C CG   . LYS A 1 45  ? 4.448   9.277   -10.852 1.00 1.67  ? 559 LYS A CG   2  
ATOM 2640  C CD   . LYS A 1 45  ? 3.219   8.343   -10.902 1.00 2.01  ? 559 LYS A CD   2  
ATOM 2641  C CE   . LYS A 1 45  ? 2.876   7.651   -9.571  1.00 1.67  ? 559 LYS A CE   2  
ATOM 2642  N NZ   . LYS A 1 45  ? 1.791   6.654   -9.741  1.00 2.67  ? 559 LYS A NZ   2  
ATOM 2643  H H    . LYS A 1 45  ? 5.746   10.226  -8.201  1.00 0.94  ? 559 LYS A H    2  
ATOM 2644  H HA   . LYS A 1 45  ? 3.942   12.364  -9.238  1.00 0.88  ? 559 LYS A HA   2  
ATOM 2645  H HB2  . LYS A 1 45  ? 3.226   11.047  -11.117 1.00 1.35  ? 559 LYS A HB2  2  
ATOM 2646  H HB3  . LYS A 1 45  ? 4.946   11.333  -11.156 1.00 1.19  ? 559 LYS A HB3  2  
ATOM 2647  H HG2  . LYS A 1 45  ? 4.932   9.201   -11.827 1.00 2.09  ? 559 LYS A HG2  2  
ATOM 2648  H HG3  . LYS A 1 45  ? 5.176   8.920   -10.126 1.00 1.87  ? 559 LYS A HG3  2  
ATOM 2649  H HD2  . LYS A 1 45  ? 2.351   8.897   -11.263 1.00 2.84  ? 559 LYS A HD2  2  
ATOM 2650  H HD3  . LYS A 1 45  ? 3.434   7.569   -11.639 1.00 2.72  ? 559 LYS A HD3  2  
ATOM 2651  H HE2  . LYS A 1 45  ? 3.772   7.165   -9.175  1.00 1.74  ? 559 LYS A HE2  2  
ATOM 2652  H HE3  . LYS A 1 45  ? 2.564   8.404   -8.849  1.00 1.71  ? 559 LYS A HE3  2  
ATOM 2653  H HZ1  . LYS A 1 45  ? 1.453   6.297   -8.849  1.00 3.44  ? 559 LYS A HZ1  2  
ATOM 2654  H HZ2  . LYS A 1 45  ? 2.103   5.870   -10.307 1.00 2.92  ? 559 LYS A HZ2  2  
ATOM 2655  H HZ3  . LYS A 1 45  ? 0.971   7.063   -10.188 1.00 3.42  ? 559 LYS A HZ3  2  
ATOM 2656  N N    . LEU A 1 46  ? 3.246   10.488  -7.038  1.00 0.83  ? 560 LEU A N    2  
ATOM 2657  C CA   . LEU A 1 46  ? 2.385   9.703   -6.152  1.00 0.80  ? 560 LEU A CA   2  
ATOM 2658  C C    . LEU A 1 46  ? 0.996   10.338  -5.952  1.00 0.80  ? 560 LEU A C    2  
ATOM 2659  O O    . LEU A 1 46  ? 0.837   11.557  -6.028  1.00 0.99  ? 560 LEU A O    2  
ATOM 2660  C CB   . LEU A 1 46  ? 3.135   9.488   -4.826  1.00 0.95  ? 560 LEU A CB   2  
ATOM 2661  C CG   . LEU A 1 46  ? 2.524   8.409   -3.921  1.00 0.89  ? 560 LEU A CG   2  
ATOM 2662  C CD1  . LEU A 1 46  ? 2.340   7.114   -4.687  1.00 2.40  ? 560 LEU A CD1  2  
ATOM 2663  C CD2  . LEU A 1 46  ? 3.446   8.052   -2.761  1.00 1.19  ? 560 LEU A CD2  2  
ATOM 2664  H H    . LEU A 1 46  ? 4.144   10.760  -6.670  1.00 0.82  ? 560 LEU A H    2  
ATOM 2665  H HA   . LEU A 1 46  ? 2.271   8.718   -6.616  1.00 0.83  ? 560 LEU A HA   2  
ATOM 2666  H HB2  . LEU A 1 46  ? 4.145   9.170   -5.072  1.00 1.46  ? 560 LEU A HB2  2  
ATOM 2667  H HB3  . LEU A 1 46  ? 3.193   10.431  -4.279  1.00 1.36  ? 560 LEU A HB3  2  
ATOM 2668  H HG   . LEU A 1 46  ? 1.563   8.739   -3.545  1.00 1.90  ? 560 LEU A HG   2  
ATOM 2669  H HD11 . LEU A 1 46  ? 1.550   7.198   -5.422  1.00 3.27  ? 560 LEU A HD11 2  
ATOM 2670  H HD12 . LEU A 1 46  ? 2.051   6.330   -3.991  1.00 3.09  ? 560 LEU A HD12 2  
ATOM 2671  H HD13 . LEU A 1 46  ? 3.284   6.885   -5.189  1.00 3.19  ? 560 LEU A HD13 2  
ATOM 2672  H HD21 . LEU A 1 46  ? 3.762   8.960   -2.243  1.00 2.09  ? 560 LEU A HD21 2  
ATOM 2673  H HD22 . LEU A 1 46  ? 4.313   7.503   -3.140  1.00 2.33  ? 560 LEU A HD22 2  
ATOM 2674  H HD23 . LEU A 1 46  ? 2.915   7.409   -2.060  1.00 1.83  ? 560 LEU A HD23 2  
ATOM 2675  N N    . LYS A 1 47  ? -0.019  9.508   -5.688  1.00 0.71  ? 561 LYS A N    2  
ATOM 2676  C CA   . LYS A 1 47  ? -1.434  9.909   -5.589  1.00 0.80  ? 561 LYS A CA   2  
ATOM 2677  C C    . LYS A 1 47  ? -2.021  9.678   -4.197  1.00 0.70  ? 561 LYS A C    2  
ATOM 2678  O O    . LYS A 1 47  ? -1.703  8.682   -3.553  1.00 0.63  ? 561 LYS A O    2  
ATOM 2679  C CB   . LYS A 1 47  ? -2.260  9.151   -6.641  1.00 1.07  ? 561 LYS A CB   2  
ATOM 2680  C CG   . LYS A 1 47  ? -3.239  10.035  -7.426  1.00 1.05  ? 561 LYS A CG   2  
ATOM 2681  C CD   . LYS A 1 47  ? -2.659  10.576  -8.749  1.00 1.42  ? 561 LYS A CD   2  
ATOM 2682  C CE   . LYS A 1 47  ? -1.341  11.344  -8.574  1.00 1.50  ? 561 LYS A CE   2  
ATOM 2683  N NZ   . LYS A 1 47  ? -0.849  11.903  -9.854  1.00 1.83  ? 561 LYS A NZ   2  
ATOM 2684  H H    . LYS A 1 47  ? 0.197   8.529   -5.573  1.00 0.68  ? 561 LYS A H    2  
ATOM 2685  H HA   . LYS A 1 47  ? -1.505  10.977  -5.787  1.00 0.94  ? 561 LYS A HA   2  
ATOM 2686  H HB2  . LYS A 1 47  ? -1.595  8.668   -7.347  1.00 1.52  ? 561 LYS A HB2  2  
ATOM 2687  H HB3  . LYS A 1 47  ? -2.826  8.357   -6.149  1.00 1.43  ? 561 LYS A HB3  2  
ATOM 2688  H HG2  . LYS A 1 47  ? -4.110  9.421   -7.656  1.00 1.25  ? 561 LYS A HG2  2  
ATOM 2689  H HG3  . LYS A 1 47  ? -3.580  10.861  -6.804  1.00 1.15  ? 561 LYS A HG3  2  
ATOM 2690  H HD2  . LYS A 1 47  ? -2.493  9.738   -9.427  1.00 1.68  ? 561 LYS A HD2  2  
ATOM 2691  H HD3  . LYS A 1 47  ? -3.401  11.236  -9.203  1.00 1.80  ? 561 LYS A HD3  2  
ATOM 2692  H HE2  . LYS A 1 47  ? -1.497  12.156  -7.857  1.00 1.62  ? 561 LYS A HE2  2  
ATOM 2693  H HE3  . LYS A 1 47  ? -0.583  10.673  -8.160  1.00 1.51  ? 561 LYS A HE3  2  
ATOM 2694  H HZ1  . LYS A 1 47  ? 0.020   12.414  -9.710  1.00 2.31  ? 561 LYS A HZ1  2  
ATOM 2695  H HZ2  . LYS A 1 47  ? -1.518  12.563  -10.247 1.00 2.36  ? 561 LYS A HZ2  2  
ATOM 2696  H HZ3  . LYS A 1 47  ? -0.689  11.188  -10.557 1.00 2.53  ? 561 LYS A HZ3  2  
ATOM 2697  N N    . PHE A 1 48  ? -2.932  10.550  -3.778  1.00 0.84  ? 562 PHE A N    2  
ATOM 2698  C CA   . PHE A 1 48  ? -3.665  10.448  -2.509  1.00 0.81  ? 562 PHE A CA   2  
ATOM 2699  C C    . PHE A 1 48  ? -5.185  10.370  -2.713  1.00 0.77  ? 562 PHE A C    2  
ATOM 2700  O O    . PHE A 1 48  ? -5.728  10.939  -3.667  1.00 0.85  ? 562 PHE A O    2  
ATOM 2701  C CB   . PHE A 1 48  ? -3.218  11.560  -1.542  1.00 0.97  ? 562 PHE A CB   2  
ATOM 2702  C CG   . PHE A 1 48  ? -4.184  12.716  -1.331  1.00 0.90  ? 562 PHE A CG   2  
ATOM 2703  C CD1  . PHE A 1 48  ? -5.178  12.629  -0.338  1.00 2.08  ? 562 PHE A CD1  2  
ATOM 2704  C CD2  . PHE A 1 48  ? -4.074  13.890  -2.102  1.00 2.20  ? 562 PHE A CD2  2  
ATOM 2705  C CE1  . PHE A 1 48  ? -6.054  13.707  -0.115  1.00 2.16  ? 562 PHE A CE1  2  
ATOM 2706  C CE2  . PHE A 1 48  ? -4.951  14.969  -1.879  1.00 2.35  ? 562 PHE A CE2  2  
ATOM 2707  C CZ   . PHE A 1 48  ? -5.941  14.879  -0.883  1.00 1.34  ? 562 PHE A CZ   2  
ATOM 2708  H H    . PHE A 1 48  ? -3.129  11.333  -4.390  1.00 1.01  ? 562 PHE A H    2  
ATOM 2709  H HA   . PHE A 1 48  ? -3.384  9.509   -2.039  1.00 0.82  ? 562 PHE A HA   2  
ATOM 2710  H HB2  . PHE A 1 48  ? -3.046  11.092  -0.577  1.00 1.14  ? 562 PHE A HB2  2  
ATOM 2711  H HB3  . PHE A 1 48  ? -2.252  11.958  -1.857  1.00 1.35  ? 562 PHE A HB3  2  
ATOM 2712  H HD1  . PHE A 1 48  ? -5.265  11.729  0.260   1.00 3.47  ? 562 PHE A HD1  2  
ATOM 2713  H HD2  . PHE A 1 48  ? -3.310  13.965  -2.865  1.00 3.56  ? 562 PHE A HD2  2  
ATOM 2714  H HE1  . PHE A 1 48  ? -6.804  13.637  0.662   1.00 3.51  ? 562 PHE A HE1  2  
ATOM 2715  H HE2  . PHE A 1 48  ? -4.860  15.868  -2.475  1.00 3.75  ? 562 PHE A HE2  2  
ATOM 2716  H HZ   . PHE A 1 48  ? -6.613  15.711  -0.708  1.00 1.60  ? 562 PHE A HZ   2  
ATOM 2717  N N    . GLU A 1 49  ? -5.890  9.679   -1.814  1.00 0.73  ? 563 GLU A N    2  
ATOM 2718  C CA   . GLU A 1 49  ? -7.342  9.436   -1.905  1.00 0.77  ? 563 GLU A CA   2  
ATOM 2719  C C    . GLU A 1 49  ? -8.040  9.570   -0.539  1.00 0.69  ? 563 GLU A C    2  
ATOM 2720  O O    . GLU A 1 49  ? -7.413  9.469   0.511   1.00 0.74  ? 563 GLU A O    2  
ATOM 2721  C CB   . GLU A 1 49  ? -7.615  8.054   -2.535  1.00 0.93  ? 563 GLU A CB   2  
ATOM 2722  C CG   . GLU A 1 49  ? -7.276  8.035   -4.033  1.00 1.79  ? 563 GLU A CG   2  
ATOM 2723  C CD   . GLU A 1 49  ? -7.618  6.704   -4.709  1.00 2.24  ? 563 GLU A CD   2  
ATOM 2724  O OE1  . GLU A 1 49  ? -8.823  6.407   -4.909  1.00 2.55  ? 563 GLU A OE1  2  
ATOM 2725  O OE2  . GLU A 1 49  ? -6.677  5.987   -5.133  1.00 3.53  ? 563 GLU A OE2  2  
ATOM 2726  H H    . GLU A 1 49  ? -5.407  9.303   -0.999  1.00 0.72  ? 563 GLU A H    2  
ATOM 2727  H HA   . GLU A 1 49  ? -7.797  10.190  -2.551  1.00 0.84  ? 563 GLU A HA   2  
ATOM 2728  H HB2  . GLU A 1 49  ? -7.035  7.290   -2.015  1.00 2.05  ? 563 GLU A HB2  2  
ATOM 2729  H HB3  . GLU A 1 49  ? -8.674  7.816   -2.422  1.00 1.47  ? 563 GLU A HB3  2  
ATOM 2730  H HG2  . GLU A 1 49  ? -7.834  8.833   -4.529  1.00 2.34  ? 563 GLU A HG2  2  
ATOM 2731  H HG3  . GLU A 1 49  ? -6.212  8.235   -4.167  1.00 3.05  ? 563 GLU A HG3  2  
ATOM 2732  N N    . VAL A 1 50  ? -9.350  9.810   -0.541  1.00 0.71  ? 564 VAL A N    2  
ATOM 2733  C CA   . VAL A 1 50  ? -10.202 9.959   0.646   1.00 0.64  ? 564 VAL A CA   2  
ATOM 2734  C C    . VAL A 1 50  ? -11.499 9.171   0.508   1.00 0.64  ? 564 VAL A C    2  
ATOM 2735  O O    . VAL A 1 50  ? -12.145 9.176   -0.543  1.00 0.69  ? 564 VAL A O    2  
ATOM 2736  C CB   . VAL A 1 50  ? -10.549 11.434  0.906   1.00 0.64  ? 564 VAL A CB   2  
ATOM 2737  C CG1  . VAL A 1 50  ? -11.293 11.663  2.212   1.00 0.70  ? 564 VAL A CG1  2  
ATOM 2738  C CG2  . VAL A 1 50  ? -9.297  12.312  0.879   1.00 0.66  ? 564 VAL A CG2  2  
ATOM 2739  H H    . VAL A 1 50  ? -9.791  9.970   -1.430  1.00 0.83  ? 564 VAL A H    2  
ATOM 2740  H HA   . VAL A 1 50  ? -9.658  9.582   1.509   1.00 0.63  ? 564 VAL A HA   2  
ATOM 2741  H HB   . VAL A 1 50  ? -11.227 11.792  0.143   1.00 0.70  ? 564 VAL A HB   2  
ATOM 2742  H HG11 . VAL A 1 50  ? -10.661 11.428  3.067   1.00 1.71  ? 564 VAL A HG11 2  
ATOM 2743  H HG12 . VAL A 1 50  ? -11.595 12.704  2.212   1.00 1.53  ? 564 VAL A HG12 2  
ATOM 2744  H HG13 . VAL A 1 50  ? -12.208 11.077  2.262   1.00 1.56  ? 564 VAL A HG13 2  
ATOM 2745  H HG21 . VAL A 1 50  ? -8.517  11.850  1.483   1.00 1.64  ? 564 VAL A HG21 2  
ATOM 2746  H HG22 . VAL A 1 50  ? -8.949  12.379  -0.154  1.00 1.57  ? 564 VAL A HG22 2  
ATOM 2747  H HG23 . VAL A 1 50  ? -9.525  13.312  1.252   1.00 1.40  ? 564 VAL A HG23 2  
ATOM 2748  N N    . PHE A 1 51  ? -11.932 8.579   1.616   1.00 0.63  ? 565 PHE A N    2  
ATOM 2749  C CA   . PHE A 1 51  ? -13.231 7.918   1.764   1.00 0.68  ? 565 PHE A CA   2  
ATOM 2750  C C    . PHE A 1 51  ? -14.039 8.523   2.920   1.00 0.66  ? 565 PHE A C    2  
ATOM 2751  O O    . PHE A 1 51  ? -13.468 8.872   3.950   1.00 0.67  ? 565 PHE A O    2  
ATOM 2752  C CB   . PHE A 1 51  ? -13.011 6.412   1.911   1.00 0.73  ? 565 PHE A CB   2  
ATOM 2753  C CG   . PHE A 1 51  ? -12.499 5.772   0.633   1.00 0.73  ? 565 PHE A CG   2  
ATOM 2754  C CD1  . PHE A 1 51  ? -11.122 5.789   0.322   1.00 1.80  ? 565 PHE A CD1  2  
ATOM 2755  C CD2  . PHE A 1 51  ? -13.403 5.139   -0.239  1.00 1.80  ? 565 PHE A CD2  2  
ATOM 2756  C CE1  . PHE A 1 51  ? -10.659 5.153   -0.844  1.00 1.77  ? 565 PHE A CE1  2  
ATOM 2757  C CE2  . PHE A 1 51  ? -12.937 4.495   -1.397  1.00 1.85  ? 565 PHE A CE2  2  
ATOM 2758  C CZ   . PHE A 1 51  ? -11.561 4.481   -1.684  1.00 0.81  ? 565 PHE A CZ   2  
ATOM 2759  H H    . PHE A 1 51  ? -11.345 8.662   2.440   1.00 0.63  ? 565 PHE A H    2  
ATOM 2760  H HA   . PHE A 1 51  ? -13.813 8.057   0.856   1.00 0.75  ? 565 PHE A HA   2  
ATOM 2761  H HB2  . PHE A 1 51  ? -12.305 6.226   2.721   1.00 0.68  ? 565 PHE A HB2  2  
ATOM 2762  H HB3  . PHE A 1 51  ? -13.957 5.943   2.185   1.00 0.85  ? 565 PHE A HB3  2  
ATOM 2763  H HD1  . PHE A 1 51  ? -10.417 6.282   0.979   1.00 3.01  ? 565 PHE A HD1  2  
ATOM 2764  H HD2  . PHE A 1 51  ? -14.458 5.116   -0.006  1.00 2.98  ? 565 PHE A HD2  2  
ATOM 2765  H HE1  . PHE A 1 51  ? -9.607  5.155   -1.089  1.00 2.94  ? 565 PHE A HE1  2  
ATOM 2766  H HE2  . PHE A 1 51  ? -13.630 3.965   -2.035  1.00 3.06  ? 565 PHE A HE2  2  
ATOM 2767  H HZ   . PHE A 1 51  ? -11.189 3.930   -2.535  1.00 0.88  ? 565 PHE A HZ   2  
ATOM 2768  N N    . GLN A 1 52  ? -15.354 8.677   2.743   1.00 0.69  ? 566 GLN A N    2  
ATOM 2769  C CA   . GLN A 1 52  ? -16.299 9.156   3.768   1.00 0.73  ? 566 GLN A CA   2  
ATOM 2770  C C    . GLN A 1 52  ? -16.731 8.001   4.710   1.00 0.71  ? 566 GLN A C    2  
ATOM 2771  O O    . GLN A 1 52  ? -16.537 6.829   4.369   1.00 0.73  ? 566 GLN A O    2  
ATOM 2772  C CB   . GLN A 1 52  ? -17.549 9.735   3.057   1.00 0.92  ? 566 GLN A CB   2  
ATOM 2773  C CG   . GLN A 1 52  ? -17.359 10.893  2.068   1.00 1.23  ? 566 GLN A CG   2  
ATOM 2774  C CD   . GLN A 1 52  ? -16.604 12.055  2.679   1.00 1.51  ? 566 GLN A CD   2  
ATOM 2775  O OE1  . GLN A 1 52  ? -17.166 12.959  3.291   1.00 2.96  ? 566 GLN A OE1  2  
ATOM 2776  N NE2  . GLN A 1 52  ? -15.299 12.058  2.557   1.00 1.30  ? 566 GLN A NE2  2  
ATOM 2777  H H    . GLN A 1 52  ? -15.749 8.341   1.870   1.00 0.71  ? 566 GLN A H    2  
ATOM 2778  H HA   . GLN A 1 52  ? -15.813 9.929   4.386   1.00 0.78  ? 566 GLN A HA   2  
ATOM 2779  H HB2  . GLN A 1 52  ? -18.003 8.931   2.492   1.00 1.08  ? 566 GLN A HB2  2  
ATOM 2780  H HB3  . GLN A 1 52  ? -18.271 10.062  3.800   1.00 1.03  ? 566 GLN A HB3  2  
ATOM 2781  H HG2  . GLN A 1 52  ? -16.834 10.535  1.186   1.00 1.94  ? 566 GLN A HG2  2  
ATOM 2782  H HG3  . GLN A 1 52  ? -18.340 11.243  1.743   1.00 2.25  ? 566 GLN A HG3  2  
ATOM 2783  H HE21 . GLN A 1 52  ? -14.846 11.359  1.983   1.00 1.46  ? 566 GLN A HE21 2  
ATOM 2784  H HE22 . GLN A 1 52  ? -14.789 12.727  3.100   1.00 2.16  ? 566 GLN A HE22 2  
ATOM 2785  N N    . PRO A 1 53  ? -17.365 8.285   5.869   1.00 0.76  ? 567 PRO A N    2  
ATOM 2786  C CA   . PRO A 1 53  ? -17.809 7.246   6.799   1.00 0.78  ? 567 PRO A CA   2  
ATOM 2787  C C    . PRO A 1 53  ? -18.778 6.238   6.158   1.00 0.80  ? 567 PRO A C    2  
ATOM 2788  O O    . PRO A 1 53  ? -19.791 6.625   5.563   1.00 0.89  ? 567 PRO A O    2  
ATOM 2789  C CB   . PRO A 1 53  ? -18.470 7.979   7.975   1.00 0.89  ? 567 PRO A CB   2  
ATOM 2790  C CG   . PRO A 1 53  ? -17.930 9.406   7.896   1.00 0.88  ? 567 PRO A CG   2  
ATOM 2791  C CD   . PRO A 1 53  ? -17.680 9.604   6.405   1.00 0.84  ? 567 PRO A CD   2  
ATOM 2792  H HA   . PRO A 1 53  ? -16.927 6.715   7.162   1.00 0.77  ? 567 PRO A HA   2  
ATOM 2793  H HB2  . PRO A 1 53  ? -19.554 8.005   7.846   1.00 0.96  ? 567 PRO A HB2  2  
ATOM 2794  H HB3  . PRO A 1 53  ? -18.221 7.506   8.923   1.00 0.94  ? 567 PRO A HB3  2  
ATOM 2795  H HG2  . PRO A 1 53  ? -18.649 10.129  8.282   1.00 0.95  ? 567 PRO A HG2  2  
ATOM 2796  H HG3  . PRO A 1 53  ? -16.992 9.487   8.440   1.00 0.86  ? 567 PRO A HG3  2  
ATOM 2797  H HD2  . PRO A 1 53  ? -18.594 9.976   5.944   1.00 0.91  ? 567 PRO A HD2  2  
ATOM 2798  H HD3  . PRO A 1 53  ? -16.865 10.312  6.254   1.00 0.85  ? 567 PRO A HD3  2  
ATOM 2799  N N    . GLY A 1 54  ? -18.483 4.948   6.304   1.00 0.76  ? 568 GLY A N    2  
ATOM 2800  C CA   . GLY A 1 54  ? -19.285 3.815   5.846   1.00 0.82  ? 568 GLY A CA   2  
ATOM 2801  C C    . GLY A 1 54  ? -18.831 3.251   4.500   1.00 0.85  ? 568 GLY A C    2  
ATOM 2802  O O    . GLY A 1 54  ? -19.268 2.160   4.131   1.00 1.04  ? 568 GLY A O    2  
ATOM 2803  H H    . GLY A 1 54  ? -17.565 4.701   6.654   1.00 0.73  ? 568 GLY A H    2  
ATOM 2804  H HA2  . GLY A 1 54  ? -19.215 3.015   6.583   1.00 0.84  ? 568 GLY A HA2  2  
ATOM 2805  H HA3  . GLY A 1 54  ? -20.330 4.112   5.759   1.00 0.90  ? 568 GLY A HA3  2  
ATOM 2806  N N    . ASP A 1 55  ? -17.954 3.946   3.768   1.00 0.76  ? 569 ASP A N    2  
ATOM 2807  C CA   . ASP A 1 55  ? -17.661 3.616   2.380   1.00 0.79  ? 569 ASP A CA   2  
ATOM 2808  C C    . ASP A 1 55  ? -16.590 2.524   2.232   1.00 0.73  ? 569 ASP A C    2  
ATOM 2809  O O    . ASP A 1 55  ? -15.497 2.617   2.796   1.00 0.70  ? 569 ASP A O    2  
ATOM 2810  C CB   . ASP A 1 55  ? -17.320 4.890   1.586   1.00 0.83  ? 569 ASP A CB   2  
ATOM 2811  C CG   . ASP A 1 55  ? -17.394 4.704   0.064   1.00 0.94  ? 569 ASP A CG   2  
ATOM 2812  O OD1  . ASP A 1 55  ? -17.965 3.693   -0.420  1.00 1.46  ? 569 ASP A OD1  2  
ATOM 2813  O OD2  . ASP A 1 55  ? -16.926 5.607   -0.667  1.00 1.86  ? 569 ASP A OD2  2  
ATOM 2814  H H    . ASP A 1 55  ? -17.562 4.801   4.130   1.00 0.73  ? 569 ASP A H    2  
ATOM 2815  H HA   . ASP A 1 55  ? -18.594 3.231   1.988   1.00 0.86  ? 569 ASP A HA   2  
ATOM 2816  H HB2  . ASP A 1 55  ? -18.025 5.676   1.860   1.00 0.94  ? 569 ASP A HB2  2  
ATOM 2817  H HB3  . ASP A 1 55  ? -16.320 5.227   1.862   1.00 0.87  ? 569 ASP A HB3  2  
ATOM 2818  N N    . TYR A 1 56  ? -16.903 1.487   1.457   1.00 0.78  ? 570 TYR A N    2  
ATOM 2819  C CA   . TYR A 1 56  ? -15.959 0.430   1.070   1.00 0.77  ? 570 TYR A CA   2  
ATOM 2820  C C    . TYR A 1 56  ? -14.762 1.009   0.304   1.00 0.76  ? 570 TYR A C    2  
ATOM 2821  O O    . TYR A 1 56  ? -14.942 1.664   -0.726  1.00 0.87  ? 570 TYR A O    2  
ATOM 2822  C CB   . TYR A 1 56  ? -16.679 -0.646  0.247   1.00 0.90  ? 570 TYR A CB   2  
ATOM 2823  C CG   . TYR A 1 56  ? -17.504 -1.593  1.096   1.00 1.05  ? 570 TYR A CG   2  
ATOM 2824  C CD1  . TYR A 1 56  ? -16.846 -2.562  1.874   1.00 2.14  ? 570 TYR A CD1  2  
ATOM 2825  C CD2  . TYR A 1 56  ? -18.910 -1.511  1.116   1.00 2.05  ? 570 TYR A CD2  2  
ATOM 2826  C CE1  . TYR A 1 56  ? -17.588 -3.445  2.678   1.00 2.30  ? 570 TYR A CE1  2  
ATOM 2827  C CE2  . TYR A 1 56  ? -19.658 -2.409  1.905   1.00 2.18  ? 570 TYR A CE2  2  
ATOM 2828  C CZ   . TYR A 1 56  ? -18.998 -3.386  2.681   1.00 1.54  ? 570 TYR A CZ   2  
ATOM 2829  O OH   . TYR A 1 56  ? -19.716 -4.282  3.409   1.00 1.84  ? 570 TYR A OH   2  
ATOM 2830  H H    . TYR A 1 56  ? -17.835 1.474   1.068   1.00 0.89  ? 570 TYR A H    2  
ATOM 2831  H HA   . TYR A 1 56  ? -15.576 -0.046  1.968   1.00 0.74  ? 570 TYR A HA   2  
ATOM 2832  H HB2  . TYR A 1 56  ? -17.306 -0.174  -0.511  1.00 0.94  ? 570 TYR A HB2  2  
ATOM 2833  H HB3  . TYR A 1 56  ? -15.930 -1.243  -0.278  1.00 0.98  ? 570 TYR A HB3  2  
ATOM 2834  H HD1  . TYR A 1 56  ? -15.767 -2.633  1.854   1.00 3.33  ? 570 TYR A HD1  2  
ATOM 2835  H HD2  . TYR A 1 56  ? -19.419 -0.768  0.517   1.00 3.23  ? 570 TYR A HD2  2  
ATOM 2836  H HE1  . TYR A 1 56  ? -17.077 -4.176  3.284   1.00 3.52  ? 570 TYR A HE1  2  
ATOM 2837  H HE2  . TYR A 1 56  ? -20.737 -2.364  1.915   1.00 3.37  ? 570 TYR A HE2  2  
ATOM 2838  H HH   . TYR A 1 56  ? -19.139 -4.958  3.802   1.00 2.56  ? 570 TYR A HH   2  
ATOM 2839  N N    . ILE A 1 57  ? -13.540 0.764   0.797   1.00 0.71  ? 571 ILE A N    2  
ATOM 2840  C CA   . ILE A 1 57  ? -12.330 1.405   0.265   1.00 0.74  ? 571 ILE A CA   2  
ATOM 2841  C C    . ILE A 1 57  ? -11.668 0.617   -0.876  1.00 0.77  ? 571 ILE A C    2  
ATOM 2842  O O    . ILE A 1 57  ? -10.987 1.201   -1.718  1.00 0.87  ? 571 ILE A O    2  
ATOM 2843  C CB   . ILE A 1 57  ? -11.317 1.693   1.391   1.00 0.73  ? 571 ILE A CB   2  
ATOM 2844  C CG1  . ILE A 1 57  ? -10.882 0.416   2.128   1.00 0.72  ? 571 ILE A CG1  2  
ATOM 2845  C CG2  . ILE A 1 57  ? -11.848 2.679   2.440   1.00 0.78  ? 571 ILE A CG2  2  
ATOM 2846  C CD1  . ILE A 1 57  ? -9.478  0.557   2.677   1.00 0.85  ? 571 ILE A CD1  2  
ATOM 2847  H H    . ILE A 1 57  ? -13.438 0.171   1.613   1.00 0.74  ? 571 ILE A H    2  
ATOM 2848  H HA   . ILE A 1 57  ? -12.609 2.366   -0.154  1.00 0.79  ? 571 ILE A HA   2  
ATOM 2849  H HB   . ILE A 1 57  ? -10.446 2.149   0.918   1.00 0.79  ? 571 ILE A HB   2  
ATOM 2850  H HG12 . ILE A 1 57  ? -11.572 0.184   2.940   1.00 0.97  ? 571 ILE A HG12 2  
ATOM 2851  H HG13 . ILE A 1 57  ? -10.856 -0.423  1.449   1.00 1.01  ? 571 ILE A HG13 2  
ATOM 2852  H HG21 . ILE A 1 57  ? -12.171 3.589   1.950   1.00 1.38  ? 571 ILE A HG21 2  
ATOM 2853  H HG22 . ILE A 1 57  ? -12.696 2.254   2.972   1.00 1.68  ? 571 ILE A HG22 2  
ATOM 2854  H HG23 . ILE A 1 57  ? -11.059 2.923   3.154   1.00 1.84  ? 571 ILE A HG23 2  
ATOM 2855  H HD11 . ILE A 1 57  ? -8.804  0.783   1.849   1.00 1.57  ? 571 ILE A HD11 2  
ATOM 2856  H HD12 . ILE A 1 57  ? -9.445  1.352   3.416   1.00 1.89  ? 571 ILE A HD12 2  
ATOM 2857  H HD13 . ILE A 1 57  ? -9.190  -0.387  3.133   1.00 1.87  ? 571 ILE A HD13 2  
ATOM 2858  N N    . ILE A 1 58  ? -11.833 -0.711  -0.881  1.00 0.76  ? 572 ILE A N    2  
ATOM 2859  C CA   . ILE A 1 58  ? -11.153 -1.661  -1.765  1.00 0.80  ? 572 ILE A CA   2  
ATOM 2860  C C    . ILE A 1 58  ? -12.156 -2.659  -2.355  1.00 1.05  ? 572 ILE A C    2  
ATOM 2861  O O    . ILE A 1 58  ? -13.077 -3.114  -1.666  1.00 1.46  ? 572 ILE A O    2  
ATOM 2862  C CB   . ILE A 1 58  ? -10.011 -2.376  -0.998  1.00 1.09  ? 572 ILE A CB   2  
ATOM 2863  C CG1  . ILE A 1 58  ? -8.886  -1.361  -0.710  1.00 1.43  ? 572 ILE A CG1  2  
ATOM 2864  C CG2  . ILE A 1 58  ? -9.451  -3.565  -1.795  1.00 1.25  ? 572 ILE A CG2  2  
ATOM 2865  C CD1  . ILE A 1 58  ? -7.724  -1.871  0.150   1.00 1.16  ? 572 ILE A CD1  2  
ATOM 2866  H H    . ILE A 1 58  ? -12.370 -1.112  -0.131  1.00 0.76  ? 572 ILE A H    2  
ATOM 2867  H HA   . ILE A 1 58  ? -10.704 -1.111  -2.591  1.00 0.91  ? 572 ILE A HA   2  
ATOM 2868  H HB   . ILE A 1 58  ? -10.400 -2.755  -0.052  1.00 1.29  ? 572 ILE A HB   2  
ATOM 2869  H HG12 . ILE A 1 58  ? -8.509  -0.984  -1.656  1.00 2.06  ? 572 ILE A HG12 2  
ATOM 2870  H HG13 . ILE A 1 58  ? -9.302  -0.512  -0.185  1.00 1.95  ? 572 ILE A HG13 2  
ATOM 2871  H HG21 . ILE A 1 58  ? -8.607  -4.006  -1.279  1.00 1.89  ? 572 ILE A HG21 2  
ATOM 2872  H HG22 . ILE A 1 58  ? -10.213 -4.340  -1.888  1.00 1.61  ? 572 ILE A HG22 2  
ATOM 2873  H HG23 . ILE A 1 58  ? -9.132  -3.233  -2.783  1.00 2.26  ? 572 ILE A HG23 2  
ATOM 2874  H HD11 . ILE A 1 58  ? -8.108  -2.293  1.081   1.00 1.69  ? 572 ILE A HD11 2  
ATOM 2875  H HD12 . ILE A 1 58  ? -7.139  -2.618  -0.384  1.00 2.00  ? 572 ILE A HD12 2  
ATOM 2876  H HD13 . ILE A 1 58  ? -7.073  -1.031  0.385   1.00 1.97  ? 572 ILE A HD13 2  
ATOM 2877  N N    . ARG A 1 59  ? -11.927 -3.037  -3.618  1.00 1.12  ? 573 ARG A N    2  
ATOM 2878  C CA   . ARG A 1 59  ? -12.607 -4.137  -4.317  1.00 1.53  ? 573 ARG A CA   2  
ATOM 2879  C C    . ARG A 1 59  ? -11.630 -4.979  -5.143  1.00 1.28  ? 573 ARG A C    2  
ATOM 2880  O O    . ARG A 1 59  ? -10.510 -4.557  -5.436  1.00 1.42  ? 573 ARG A O    2  
ATOM 2881  C CB   . ARG A 1 59  ? -13.714 -3.582  -5.229  1.00 2.24  ? 573 ARG A CB   2  
ATOM 2882  C CG   . ARG A 1 59  ? -14.928 -3.031  -4.467  1.00 3.26  ? 573 ARG A CG   2  
ATOM 2883  C CD   . ARG A 1 59  ? -15.993 -2.647  -5.495  1.00 4.16  ? 573 ARG A CD   2  
ATOM 2884  N NE   . ARG A 1 59  ? -17.246 -2.194  -4.863  1.00 5.28  ? 573 ARG A NE   2  
ATOM 2885  C CZ   . ARG A 1 59  ? -18.453 -2.703  -5.021  1.00 6.25  ? 573 ARG A CZ   2  
ATOM 2886  N NH1  . ARG A 1 59  ? -18.691 -3.810  -5.658  1.00 6.52  ? 573 ARG A NH1  2  
ATOM 2887  N NH2  . ARG A 1 59  ? -19.475 -2.079  -4.524  1.00 7.42  ? 573 ARG A NH2  2  
ATOM 2888  H H    . ARG A 1 59  ? -11.131 -2.622  -4.093  1.00 1.10  ? 573 ARG A H    2  
ATOM 2889  H HA   . ARG A 1 59  ? -13.043 -4.811  -3.579  1.00 1.78  ? 573 ARG A HA   2  
ATOM 2890  H HB2  . ARG A 1 59  ? -13.298 -2.798  -5.866  1.00 2.68  ? 573 ARG A HB2  2  
ATOM 2891  H HB3  . ARG A 1 59  ? -14.069 -4.384  -5.877  1.00 2.75  ? 573 ARG A HB3  2  
ATOM 2892  H HG2  . ARG A 1 59  ? -15.323 -3.801  -3.801  1.00 3.81  ? 573 ARG A HG2  2  
ATOM 2893  H HG3  . ARG A 1 59  ? -14.644 -2.153  -3.886  1.00 4.02  ? 573 ARG A HG3  2  
ATOM 2894  H HD2  . ARG A 1 59  ? -15.599 -1.844  -6.120  1.00 4.77  ? 573 ARG A HD2  2  
ATOM 2895  H HD3  . ARG A 1 59  ? -16.168 -3.509  -6.139  1.00 4.26  ? 573 ARG A HD3  2  
ATOM 2896  H HE   . ARG A 1 59  ? -17.220 -1.319  -4.351  1.00 5.75  ? 573 ARG A HE   2  
ATOM 2897  H HH11 . ARG A 1 59  ? -17.919 -4.418  -5.902  1.00 5.99  ? 573 ARG A HH11 2  
ATOM 2898  H HH12 . ARG A 1 59  ? -19.648 -4.052  -5.904  1.00 7.54  ? 573 ARG A HH12 2  
ATOM 2899  H HH21 . ARG A 1 59  ? -19.307 -1.229  -3.996  1.00 7.69  ? 573 ARG A HH21 2  
ATOM 2900  H HH22 . ARG A 1 59  ? -20.399 -2.470  -4.621  1.00 8.25  ? 573 ARG A HH22 2  
ATOM 2901  N N    . GLU A 1 60  ? -12.101 -6.145  -5.567  1.00 1.75  ? 574 GLU A N    2  
ATOM 2902  C CA   . GLU A 1 60  ? -11.447 -7.013  -6.552  1.00 1.68  ? 574 GLU A CA   2  
ATOM 2903  C C    . GLU A 1 60  ? -11.885 -6.619  -7.981  1.00 2.23  ? 574 GLU A C    2  
ATOM 2904  O O    . GLU A 1 60  ? -12.862 -5.882  -8.174  1.00 3.23  ? 574 GLU A O    2  
ATOM 2905  C CB   . GLU A 1 60  ? -11.786 -8.482  -6.204  1.00 2.95  ? 574 GLU A CB   2  
ATOM 2906  C CG   . GLU A 1 60  ? -10.665 -9.499  -6.476  1.00 3.19  ? 574 GLU A CG   2  
ATOM 2907  C CD   . GLU A 1 60  ? -10.511 -9.860  -7.950  1.00 4.14  ? 574 GLU A CD   2  
ATOM 2908  O OE1  . GLU A 1 60  ? -11.325 -10.641 -8.500  1.00 5.34  ? 574 GLU A OE1  2  
ATOM 2909  O OE2  . GLU A 1 60  ? -9.598  -9.319  -8.611  1.00 4.41  ? 574 GLU A OE2  2  
ATOM 2910  H H    . GLU A 1 60  ? -13.045 -6.394  -5.288  1.00 2.45  ? 574 GLU A H    2  
ATOM 2911  H HA   . GLU A 1 60  ? -10.366 -6.882  -6.473  1.00 1.27  ? 574 GLU A HA   2  
ATOM 2912  H HB2  . GLU A 1 60  ? -11.992 -8.541  -5.134  1.00 3.39  ? 574 GLU A HB2  2  
ATOM 2913  H HB3  . GLU A 1 60  ? -12.698 -8.786  -6.719  1.00 3.82  ? 574 GLU A HB3  2  
ATOM 2914  H HG2  . GLU A 1 60  ? -9.724  -9.094  -6.107  1.00 3.14  ? 574 GLU A HG2  2  
ATOM 2915  H HG3  . GLU A 1 60  ? -10.882 -10.412 -5.919  1.00 3.67  ? 574 GLU A HG3  2  
ATOM 2916  N N    . GLY A 1 61  ? -11.196 -7.121  -9.005  1.00 2.26  ? 575 GLY A N    2  
ATOM 2917  C CA   . GLY A 1 61  ? -11.751 -7.212  -10.357 1.00 3.43  ? 575 GLY A CA   2  
ATOM 2918  C C    . GLY A 1 61  ? -10.755 -7.438  -11.495 1.00 3.31  ? 575 GLY A C    2  
ATOM 2919  O O    . GLY A 1 61  ? -11.204 -7.649  -12.626 1.00 4.29  ? 575 GLY A O    2  
ATOM 2920  H H    . GLY A 1 61  ? -10.410 -7.733  -8.793  1.00 1.81  ? 575 GLY A H    2  
ATOM 2921  H HA2  . GLY A 1 61  ? -12.461 -8.037  -10.378 1.00 4.15  ? 575 GLY A HA2  2  
ATOM 2922  H HA3  . GLY A 1 61  ? -12.289 -6.291  -10.582 1.00 4.06  ? 575 GLY A HA3  2  
ATOM 2923  N N    . THR A 1 62  ? -9.440  -7.354  -11.253 1.00 2.27  ? 576 THR A N    2  
ATOM 2924  C CA   . THR A 1 62  ? -8.439  -7.274  -12.338 1.00 2.36  ? 576 THR A CA   2  
ATOM 2925  C C    . THR A 1 62  ? -6.991  -7.517  -11.899 1.00 1.98  ? 576 THR A C    2  
ATOM 2926  O O    . THR A 1 62  ? -6.623  -7.353  -10.735 1.00 1.89  ? 576 THR A O    2  
ATOM 2927  C CB   . THR A 1 62  ? -8.540  -5.909  -13.051 1.00 2.71  ? 576 THR A CB   2  
ATOM 2928  O OG1  . THR A 1 62  ? -7.769  -5.833  -14.230 1.00 3.02  ? 576 THR A OG1  2  
ATOM 2929  C CG2  . THR A 1 62  ? -8.174  -4.722  -12.160 1.00 2.89  ? 576 THR A CG2  2  
ATOM 2930  H H    . THR A 1 62  ? -9.117  -7.312  -10.292 1.00 1.66  ? 576 THR A H    2  
ATOM 2931  H HA   . THR A 1 62  ? -8.683  -8.035  -13.073 1.00 2.85  ? 576 THR A HA   2  
ATOM 2932  H HB   . THR A 1 62  ? -9.569  -5.791  -13.372 1.00 3.23  ? 576 THR A HB   2  
ATOM 2933  H HG1  . THR A 1 62  ? -6.850  -5.631  -13.973 1.00 2.91  ? 576 THR A HG1  2  
ATOM 2934  H HG21 . THR A 1 62  ? -7.143  -4.800  -11.819 1.00 3.01  ? 576 THR A HG21 2  
ATOM 2935  H HG22 . THR A 1 62  ? -8.836  -4.692  -11.296 1.00 3.24  ? 576 THR A HG22 2  
ATOM 2936  H HG23 . THR A 1 62  ? -8.297  -3.800  -12.722 1.00 3.92  ? 576 THR A HG23 2  
ATOM 2937  N N    . ILE A 1 63  ? -6.159  -7.839  -12.887 1.00 2.09  ? 577 ILE A N    2  
ATOM 2938  C CA   . ILE A 1 63  ? -4.695  -7.692  -12.886 1.00 2.29  ? 577 ILE A CA   2  
ATOM 2939  C C    . ILE A 1 63  ? -4.318  -6.211  -13.119 1.00 2.52  ? 577 ILE A C    2  
ATOM 2940  O O    . ILE A 1 63  ? -5.137  -5.412  -13.587 1.00 2.78  ? 577 ILE A O    2  
ATOM 2941  C CB   . ILE A 1 63  ? -4.108  -8.688  -13.927 1.00 2.50  ? 577 ILE A CB   2  
ATOM 2942  C CG1  . ILE A 1 63  ? -3.919  -10.092 -13.307 1.00 2.44  ? 577 ILE A CG1  2  
ATOM 2943  C CG2  . ILE A 1 63  ? -2.760  -8.276  -14.541 1.00 3.20  ? 577 ILE A CG2  2  
ATOM 2944  C CD1  . ILE A 1 63  ? -5.188  -10.746 -12.767 1.00 2.19  ? 577 ILE A CD1  2  
ATOM 2945  H H    . ILE A 1 63  ? -6.599  -8.012  -13.790 1.00 2.33  ? 577 ILE A H    2  
ATOM 2946  H HA   . ILE A 1 63  ? -4.314  -7.963  -11.901 1.00 2.29  ? 577 ILE A HA   2  
ATOM 2947  H HB   . ILE A 1 63  ? -4.809  -8.772  -14.761 1.00 2.45  ? 577 ILE A HB   2  
ATOM 2948  H HG12 . ILE A 1 63  ? -3.535  -10.771 -14.061 1.00 2.85  ? 577 ILE A HG12 2  
ATOM 2949  H HG13 . ILE A 1 63  ? -3.185  -10.029 -12.505 1.00 2.80  ? 577 ILE A HG13 2  
ATOM 2950  H HG21 . ILE A 1 63  ? -2.437  -9.026  -15.264 1.00 3.37  ? 577 ILE A HG21 2  
ATOM 2951  H HG22 . ILE A 1 63  ? -2.857  -7.327  -15.074 1.00 4.30  ? 577 ILE A HG22 2  
ATOM 2952  H HG23 . ILE A 1 63  ? -1.994  -8.184  -13.772 1.00 3.19  ? 577 ILE A HG23 2  
ATOM 2953  H HD11 . ILE A 1 63  ? -4.984  -11.789 -12.530 1.00 2.31  ? 577 ILE A HD11 2  
ATOM 2954  H HD12 . ILE A 1 63  ? -5.499  -10.233 -11.860 1.00 2.81  ? 577 ILE A HD12 2  
ATOM 2955  H HD13 . ILE A 1 63  ? -5.978  -10.702 -13.515 1.00 2.79  ? 577 ILE A HD13 2  
ATOM 2956  N N    . GLY A 1 64  ? -3.087  -5.819  -12.770 1.00 2.75  ? 578 GLY A N    2  
ATOM 2957  C CA   . GLY A 1 64  ? -2.617  -4.436  -12.898 1.00 3.09  ? 578 GLY A CA   2  
ATOM 2958  C C    . GLY A 1 64  ? -3.075  -3.578  -11.717 1.00 2.47  ? 578 GLY A C    2  
ATOM 2959  O O    . GLY A 1 64  ? -3.676  -2.517  -11.914 1.00 2.87  ? 578 GLY A O    2  
ATOM 2960  H H    . GLY A 1 64  ? -2.441  -6.503  -12.413 1.00 2.92  ? 578 GLY A H    2  
ATOM 2961  H HA2  . GLY A 1 64  ? -1.530  -4.427  -12.940 1.00 3.56  ? 578 GLY A HA2  2  
ATOM 2962  H HA3  . GLY A 1 64  ? -2.992  -4.010  -13.828 1.00 3.52  ? 578 GLY A HA3  2  
ATOM 2963  N N    . LYS A 1 65  ? -2.867  -4.074  -10.489 1.00 1.89  ? 579 LYS A N    2  
ATOM 2964  C CA   . LYS A 1 65  ? -3.479  -3.557  -9.252  1.00 1.35  ? 579 LYS A CA   2  
ATOM 2965  C C    . LYS A 1 65  ? -2.466  -2.844  -8.335  1.00 1.20  ? 579 LYS A C    2  
ATOM 2966  O O    . LYS A 1 65  ? -1.276  -3.153  -8.364  1.00 1.57  ? 579 LYS A O    2  
ATOM 2967  C CB   . LYS A 1 65  ? -4.273  -4.683  -8.555  1.00 1.53  ? 579 LYS A CB   2  
ATOM 2968  C CG   . LYS A 1 65  ? -5.472  -4.077  -7.816  1.00 2.09  ? 579 LYS A CG   2  
ATOM 2969  C CD   . LYS A 1 65  ? -6.409  -5.084  -7.144  1.00 2.37  ? 579 LYS A CD   2  
ATOM 2970  C CE   . LYS A 1 65  ? -7.710  -4.422  -6.649  1.00 3.40  ? 579 LYS A CE   2  
ATOM 2971  N NZ   . LYS A 1 65  ? -7.473  -3.233  -5.790  1.00 4.24  ? 579 LYS A NZ   2  
ATOM 2972  H H    . LYS A 1 65  ? -2.252  -4.876  -10.412 1.00 2.27  ? 579 LYS A H    2  
ATOM 2973  H HA   . LYS A 1 65  ? -4.204  -2.804  -9.554  1.00 1.45  ? 579 LYS A HA   2  
ATOM 2974  H HB2  . LYS A 1 65  ? -4.655  -5.383  -9.303  1.00 1.81  ? 579 LYS A HB2  2  
ATOM 2975  H HB3  . LYS A 1 65  ? -3.630  -5.226  -7.860  1.00 2.08  ? 579 LYS A HB3  2  
ATOM 2976  H HG2  . LYS A 1 65  ? -5.090  -3.407  -7.050  1.00 2.76  ? 579 LYS A HG2  2  
ATOM 2977  H HG3  . LYS A 1 65  ? -6.057  -3.508  -8.538  1.00 2.54  ? 579 LYS A HG3  2  
ATOM 2978  H HD2  . LYS A 1 65  ? -6.668  -5.863  -7.861  1.00 2.42  ? 579 LYS A HD2  2  
ATOM 2979  H HD3  . LYS A 1 65  ? -5.893  -5.543  -6.301  1.00 2.79  ? 579 LYS A HD3  2  
ATOM 2980  H HE2  . LYS A 1 65  ? -8.305  -4.120  -7.516  1.00 3.95  ? 579 LYS A HE2  2  
ATOM 2981  H HE3  . LYS A 1 65  ? -8.288  -5.167  -6.093  1.00 4.27  ? 579 LYS A HE3  2  
ATOM 2982  H HZ1  . LYS A 1 65  ? -6.846  -3.458  -5.024  1.00 5.05  ? 579 LYS A HZ1  2  
ATOM 2983  H HZ2  . LYS A 1 65  ? -8.350  -2.853  -5.432  1.00 4.74  ? 579 LYS A HZ2  2  
ATOM 2984  H HZ3  . LYS A 1 65  ? -7.034  -2.490  -6.327  1.00 4.55  ? 579 LYS A HZ3  2  
ATOM 2985  N N    . LYS A 1 66  ? -2.938  -1.884  -7.527  1.00 0.98  ? 580 LYS A N    2  
ATOM 2986  C CA   . LYS A 1 66  ? -2.114  -1.006  -6.674  1.00 0.96  ? 580 LYS A CA   2  
ATOM 2987  C C    . LYS A 1 66  ? -1.980  -1.479  -5.219  1.00 0.88  ? 580 LYS A C    2  
ATOM 2988  O O    . LYS A 1 66  ? -2.808  -2.245  -4.719  1.00 1.05  ? 580 LYS A O    2  
ATOM 2989  C CB   . LYS A 1 66  ? -2.682  0.426   -6.699  1.00 1.35  ? 580 LYS A CB   2  
ATOM 2990  C CG   . LYS A 1 66  ? -2.713  1.063   -8.097  1.00 1.49  ? 580 LYS A CG   2  
ATOM 2991  C CD   . LYS A 1 66  ? -2.722  2.597   -7.994  1.00 2.39  ? 580 LYS A CD   2  
ATOM 2992  C CE   . LYS A 1 66  ? -4.068  3.170   -7.538  1.00 3.25  ? 580 LYS A CE   2  
ATOM 2993  N NZ   . LYS A 1 66  ? -5.036  3.288   -8.653  1.00 3.42  ? 580 LYS A NZ   2  
ATOM 2994  H H    . LYS A 1 66  ? -3.935  -1.718  -7.536  1.00 1.12  ? 580 LYS A H    2  
ATOM 2995  H HA   . LYS A 1 66  ? -1.102  -0.974  -7.081  1.00 1.11  ? 580 LYS A HA   2  
ATOM 2996  H HB2  . LYS A 1 66  ? -3.691  0.424   -6.290  1.00 2.19  ? 580 LYS A HB2  2  
ATOM 2997  H HB3  . LYS A 1 66  ? -2.061  1.042   -6.049  1.00 2.30  ? 580 LYS A HB3  2  
ATOM 2998  H HG2  . LYS A 1 66  ? -1.826  0.759   -8.650  1.00 2.38  ? 580 LYS A HG2  2  
ATOM 2999  H HG3  . LYS A 1 66  ? -3.587  0.714   -8.648  1.00 2.19  ? 580 LYS A HG3  2  
ATOM 3000  H HD2  . LYS A 1 66  ? -1.949  2.899   -7.284  1.00 2.62  ? 580 LYS A HD2  2  
ATOM 3001  H HD3  . LYS A 1 66  ? -2.464  3.028   -8.961  1.00 2.95  ? 580 LYS A HD3  2  
ATOM 3002  H HE2  . LYS A 1 66  ? -4.480  2.546   -6.741  1.00 3.68  ? 580 LYS A HE2  2  
ATOM 3003  H HE3  . LYS A 1 66  ? -3.897  4.168   -7.125  1.00 4.07  ? 580 LYS A HE3  2  
ATOM 3004  H HZ1  . LYS A 1 66  ? -4.661  3.863   -9.404  1.00 3.82  ? 580 LYS A HZ1  2  
ATOM 3005  H HZ2  . LYS A 1 66  ? -5.904  3.695   -8.314  1.00 4.11  ? 580 LYS A HZ2  2  
ATOM 3006  H HZ3  . LYS A 1 66  ? -5.274  2.378   -9.047  1.00 3.37  ? 580 LYS A HZ3  2  
ATOM 3007  N N    . MET A 1 67  ? -0.980  -0.927  -4.522  1.00 0.85  ? 581 MET A N    2  
ATOM 3008  C CA   . MET A 1 67  ? -0.920  -0.888  -3.054  1.00 0.88  ? 581 MET A CA   2  
ATOM 3009  C C    . MET A 1 67  ? -1.624  0.376   -2.526  1.00 0.78  ? 581 MET A C    2  
ATOM 3010  O O    . MET A 1 67  ? -1.607  1.419   -3.184  1.00 0.72  ? 581 MET A O    2  
ATOM 3011  C CB   . MET A 1 67  ? 0.547   -0.940  -2.582  1.00 1.01  ? 581 MET A CB   2  
ATOM 3012  C CG   . MET A 1 67  ? 0.631   -0.987  -1.049  1.00 1.44  ? 581 MET A CG   2  
ATOM 3013  S SD   . MET A 1 67  ? 2.274   -1.115  -0.306  1.00 1.96  ? 581 MET A SD   2  
ATOM 3014  C CE   . MET A 1 67  ? 1.729   -0.925  1.414   1.00 1.49  ? 581 MET A CE   2  
ATOM 3015  H H    . MET A 1 67  ? -0.372  -0.279  -5.018  1.00 0.80  ? 581 MET A H    2  
ATOM 3016  H HA   . MET A 1 67  ? -1.438  -1.761  -2.651  1.00 0.97  ? 581 MET A HA   2  
ATOM 3017  H HB2  . MET A 1 67  ? 1.030   -1.827  -2.993  1.00 1.37  ? 581 MET A HB2  2  
ATOM 3018  H HB3  . MET A 1 67  ? 1.079   -0.058  -2.942  1.00 1.28  ? 581 MET A HB3  2  
ATOM 3019  H HG2  . MET A 1 67  ? 0.198   -0.071  -0.651  1.00 2.30  ? 581 MET A HG2  2  
ATOM 3020  H HG3  . MET A 1 67  ? 0.033   -1.828  -0.695  1.00 2.48  ? 581 MET A HG3  2  
ATOM 3021  H HE1  . MET A 1 67  ? 2.561   -1.095  2.099   1.00 2.44  ? 581 MET A HE1  2  
ATOM 3022  H HE2  . MET A 1 67  ? 1.317   0.078   1.579   1.00 1.83  ? 581 MET A HE2  2  
ATOM 3023  H HE3  . MET A 1 67  ? 0.945   -1.656  1.616   1.00 2.02  ? 581 MET A HE3  2  
ATOM 3024  N N    . TYR A 1 68  ? -2.188  0.302   -1.316  1.00 0.83  ? 582 TYR A N    2  
ATOM 3025  C CA   . TYR A 1 68  ? -2.824  1.433   -0.633  1.00 0.77  ? 582 TYR A CA   2  
ATOM 3026  C C    . TYR A 1 68  ? -2.413  1.459   0.849   1.00 0.79  ? 582 TYR A C    2  
ATOM 3027  O O    . TYR A 1 68  ? -2.213  0.406   1.461   1.00 0.86  ? 582 TYR A O    2  
ATOM 3028  C CB   . TYR A 1 68  ? -4.351  1.345   -0.776  1.00 0.78  ? 582 TYR A CB   2  
ATOM 3029  C CG   . TYR A 1 68  ? -4.899  1.377   -2.190  1.00 0.99  ? 582 TYR A CG   2  
ATOM 3030  C CD1  . TYR A 1 68  ? -4.989  0.190   -2.943  1.00 2.03  ? 582 TYR A CD1  2  
ATOM 3031  C CD2  . TYR A 1 68  ? -5.378  2.586   -2.728  1.00 2.12  ? 582 TYR A CD2  2  
ATOM 3032  C CE1  . TYR A 1 68  ? -5.540  0.217   -4.238  1.00 2.24  ? 582 TYR A CE1  2  
ATOM 3033  C CE2  . TYR A 1 68  ? -5.947  2.611   -4.015  1.00 2.40  ? 582 TYR A CE2  2  
ATOM 3034  C CZ   . TYR A 1 68  ? -6.026  1.427   -4.778  1.00 1.78  ? 582 TYR A CZ   2  
ATOM 3035  O OH   . TYR A 1 68  ? -6.539  1.460   -6.039  1.00 2.25  ? 582 TYR A OH   2  
ATOM 3036  H H    . TYR A 1 68  ? -2.087  -0.552  -0.771  1.00 0.95  ? 582 TYR A H    2  
ATOM 3037  H HA   . TYR A 1 68  ? -2.495  2.365   -1.091  1.00 0.75  ? 582 TYR A HA   2  
ATOM 3038  H HB2  . TYR A 1 68  ? -4.694  0.422   -0.314  1.00 0.80  ? 582 TYR A HB2  2  
ATOM 3039  H HB3  . TYR A 1 68  ? -4.791  2.176   -0.224  1.00 0.87  ? 582 TYR A HB3  2  
ATOM 3040  H HD1  . TYR A 1 68  ? -4.637  -0.744  -2.530  1.00 3.18  ? 582 TYR A HD1  2  
ATOM 3041  H HD2  . TYR A 1 68  ? -5.319  3.499   -2.150  1.00 3.25  ? 582 TYR A HD2  2  
ATOM 3042  H HE1  . TYR A 1 68  ? -5.600  -0.689  -4.818  1.00 3.39  ? 582 TYR A HE1  2  
ATOM 3043  H HE2  . TYR A 1 68  ? -6.331  3.536   -4.409  1.00 3.62  ? 582 TYR A HE2  2  
ATOM 3044  H HH   . TYR A 1 68  ? -6.894  2.340   -6.259  1.00 2.98  ? 582 TYR A HH   2  
ATOM 3045  N N    . PHE A 1 69  ? -2.284  2.643   1.451   1.00 0.76  ? 583 PHE A N    2  
ATOM 3046  C CA   . PHE A 1 69  ? -1.879  2.763   2.858   1.00 0.77  ? 583 PHE A CA   2  
ATOM 3047  C C    . PHE A 1 69  ? -2.539  3.952   3.577   1.00 0.71  ? 583 PHE A C    2  
ATOM 3048  O O    . PHE A 1 69  ? -2.945  4.928   2.945   1.00 0.77  ? 583 PHE A O    2  
ATOM 3049  C CB   . PHE A 1 69  ? -0.341  2.708   2.948   1.00 0.86  ? 583 PHE A CB   2  
ATOM 3050  C CG   . PHE A 1 69  ? 0.446   3.860   2.347   1.00 1.07  ? 583 PHE A CG   2  
ATOM 3051  C CD1  . PHE A 1 69  ? 0.690   5.026   3.098   1.00 2.42  ? 583 PHE A CD1  2  
ATOM 3052  C CD2  . PHE A 1 69  ? 1.021   3.722   1.068   1.00 1.96  ? 583 PHE A CD2  2  
ATOM 3053  C CE1  . PHE A 1 69  ? 1.522   6.036   2.578   1.00 2.78  ? 583 PHE A CE1  2  
ATOM 3054  C CE2  . PHE A 1 69  ? 1.859   4.729   0.554   1.00 2.19  ? 583 PHE A CE2  2  
ATOM 3055  C CZ   . PHE A 1 69  ? 2.121   5.880   1.316   1.00 1.99  ? 583 PHE A CZ   2  
ATOM 3056  H H    . PHE A 1 69  ? -2.430  3.496   0.914   1.00 0.76  ? 583 PHE A H    2  
ATOM 3057  H HA   . PHE A 1 69  ? -2.249  1.884   3.382   1.00 0.81  ? 583 PHE A HA   2  
ATOM 3058  H HB2  . PHE A 1 69  ? -0.035  2.573   3.981   1.00 0.94  ? 583 PHE A HB2  2  
ATOM 3059  H HB3  . PHE A 1 69  ? -0.017  1.794   2.448   1.00 1.02  ? 583 PHE A HB3  2  
ATOM 3060  H HD1  . PHE A 1 69  ? 0.256   5.139   4.081   1.00 3.57  ? 583 PHE A HD1  2  
ATOM 3061  H HD2  . PHE A 1 69  ? 0.837   2.832   0.485   1.00 3.14  ? 583 PHE A HD2  2  
ATOM 3062  H HE1  . PHE A 1 69  ? 1.705   6.934   3.151   1.00 4.08  ? 583 PHE A HE1  2  
ATOM 3063  H HE2  . PHE A 1 69  ? 2.307   4.613   -0.422  1.00 3.31  ? 583 PHE A HE2  2  
ATOM 3064  H HZ   . PHE A 1 69  ? 2.778   6.648   0.928   1.00 2.36  ? 583 PHE A HZ   2  
ATOM 3065  N N    . ILE A 1 70  ? -2.727  3.833   4.898   1.00 0.66  ? 584 ILE A N    2  
ATOM 3066  C CA   . ILE A 1 70  ? -3.588  4.719   5.696   1.00 0.66  ? 584 ILE A CA   2  
ATOM 3067  C C    . ILE A 1 70  ? -2.772  5.879   6.268   1.00 0.76  ? 584 ILE A C    2  
ATOM 3068  O O    . ILE A 1 70  ? -1.928  5.674   7.140   1.00 0.81  ? 584 ILE A O    2  
ATOM 3069  C CB   . ILE A 1 70  ? -4.332  3.938   6.810   1.00 0.64  ? 584 ILE A CB   2  
ATOM 3070  C CG1  . ILE A 1 70  ? -4.950  2.634   6.252   1.00 0.59  ? 584 ILE A CG1  2  
ATOM 3071  C CG2  . ILE A 1 70  ? -5.445  4.842   7.389   1.00 0.63  ? 584 ILE A CG2  2  
ATOM 3072  C CD1  . ILE A 1 70  ? -5.767  1.844   7.270   1.00 0.60  ? 584 ILE A CD1  2  
ATOM 3073  H H    . ILE A 1 70  ? -2.350  3.018   5.373   1.00 0.66  ? 584 ILE A H    2  
ATOM 3074  H HA   . ILE A 1 70  ? -4.343  5.141   5.035   1.00 0.62  ? 584 ILE A HA   2  
ATOM 3075  H HB   . ILE A 1 70  ? -3.621  3.660   7.605   1.00 0.70  ? 584 ILE A HB   2  
ATOM 3076  H HG12 . ILE A 1 70  ? -5.588  2.865   5.402   1.00 0.55  ? 584 ILE A HG12 2  
ATOM 3077  H HG13 . ILE A 1 70  ? -4.158  1.972   5.906   1.00 0.64  ? 584 ILE A HG13 2  
ATOM 3078  H HG21 . ILE A 1 70  ? -5.046  5.805   7.708   1.00 1.34  ? 584 ILE A HG21 2  
ATOM 3079  H HG22 . ILE A 1 70  ? -6.220  5.021   6.638   1.00 1.44  ? 584 ILE A HG22 2  
ATOM 3080  H HG23 . ILE A 1 70  ? -5.907  4.374   8.259   1.00 1.65  ? 584 ILE A HG23 2  
ATOM 3081  H HD11 . ILE A 1 70  ? -6.764  2.273   7.353   1.00 1.55  ? 584 ILE A HD11 2  
ATOM 3082  H HD12 . ILE A 1 70  ? -5.828  0.809   6.931   1.00 1.73  ? 584 ILE A HD12 2  
ATOM 3083  H HD13 . ILE A 1 70  ? -5.283  1.883   8.241   1.00 1.58  ? 584 ILE A HD13 2  
ATOM 3084  N N    . GLN A 1 71  ? -3.043  7.101   5.807   1.00 0.84  ? 585 GLN A N    2  
ATOM 3085  C CA   . GLN A 1 71  ? -2.289  8.292   6.214   1.00 0.92  ? 585 GLN A CA   2  
ATOM 3086  C C    . GLN A 1 71  ? -2.902  8.941   7.463   1.00 0.92  ? 585 GLN A C    2  
ATOM 3087  O O    . GLN A 1 71  ? -2.182  9.229   8.419   1.00 1.02  ? 585 GLN A O    2  
ATOM 3088  C CB   . GLN A 1 71  ? -2.198  9.229   5.001   1.00 0.97  ? 585 GLN A CB   2  
ATOM 3089  C CG   . GLN A 1 71  ? -1.282  10.452  5.192   1.00 1.32  ? 585 GLN A CG   2  
ATOM 3090  C CD   . GLN A 1 71  ? -1.979  11.660  5.806   1.00 1.76  ? 585 GLN A CD   2  
ATOM 3091  O OE1  . GLN A 1 71  ? -1.649  12.109  6.896   1.00 3.24  ? 585 GLN A OE1  2  
ATOM 3092  N NE2  . GLN A 1 71  ? -2.935  12.237  5.113   1.00 1.92  ? 585 GLN A NE2  2  
ATOM 3093  H H    . GLN A 1 71  ? -3.812  7.227   5.152   1.00 0.86  ? 585 GLN A H    2  
ATOM 3094  H HA   . GLN A 1 71  ? -1.274  7.995   6.476   1.00 0.99  ? 585 GLN A HA   2  
ATOM 3095  H HB2  . GLN A 1 71  ? -1.795  8.651   4.168   1.00 1.17  ? 585 GLN A HB2  2  
ATOM 3096  H HB3  . GLN A 1 71  ? -3.199  9.554   4.719   1.00 1.21  ? 585 GLN A HB3  2  
ATOM 3097  H HG2  . GLN A 1 71  ? -0.421  10.180  5.800   1.00 1.92  ? 585 GLN A HG2  2  
ATOM 3098  H HG3  . GLN A 1 71  ? -0.912  10.756  4.213   1.00 1.45  ? 585 GLN A HG3  2  
ATOM 3099  H HE21 . GLN A 1 71  ? -3.188  11.858  4.204   1.00 2.76  ? 585 GLN A HE21 2  
ATOM 3100  H HE22 . GLN A 1 71  ? -3.292  13.130  5.438   1.00 2.30  ? 585 GLN A HE22 2  
ATOM 3101  N N    . HIS A 1 72  ? -4.232  9.097   7.490   1.00 0.84  ? 586 HIS A N    2  
ATOM 3102  C CA   . HIS A 1 72  ? -4.970  9.628   8.639   1.00 0.83  ? 586 HIS A CA   2  
ATOM 3103  C C    . HIS A 1 72  ? -6.441  9.181   8.624   1.00 0.74  ? 586 HIS A C    2  
ATOM 3104  O O    . HIS A 1 72  ? -7.228  9.636   7.793   1.00 0.76  ? 586 HIS A O    2  
ATOM 3105  C CB   . HIS A 1 72  ? -4.884  11.157  8.616   1.00 0.86  ? 586 HIS A CB   2  
ATOM 3106  C CG   . HIS A 1 72  ? -5.686  11.819  9.704   1.00 1.34  ? 586 HIS A CG   2  
ATOM 3107  N ND1  . HIS A 1 72  ? -5.346  11.900  11.036  1.00 2.09  ? 586 HIS A ND1  2  
ATOM 3108  C CD2  . HIS A 1 72  ? -6.894  12.445  9.553   1.00 2.66  ? 586 HIS A CD2  2  
ATOM 3109  C CE1  . HIS A 1 72  ? -6.317  12.570  11.672  1.00 2.48  ? 586 HIS A CE1  2  
ATOM 3110  N NE2  . HIS A 1 72  ? -7.282  12.937  10.806  1.00 2.99  ? 586 HIS A NE2  2  
ATOM 3111  H H    . HIS A 1 72  ? -4.760  8.836   6.664   1.00 0.81  ? 586 HIS A H    2  
ATOM 3112  H HA   . HIS A 1 72  ? -4.511  9.280   9.565   1.00 0.90  ? 586 HIS A HA   2  
ATOM 3113  H HB2  . HIS A 1 72  ? -3.842  11.467  8.708   1.00 1.21  ? 586 HIS A HB2  2  
ATOM 3114  H HB3  . HIS A 1 72  ? -5.261  11.503  7.656   1.00 1.05  ? 586 HIS A HB3  2  
ATOM 3115  H HD1  . HIS A 1 72  ? -4.520  11.497  11.483  1.00 3.08  ? 586 HIS A HD1  2  
ATOM 3116  H HD2  . HIS A 1 72  ? -7.445  12.542  8.625   1.00 3.76  ? 586 HIS A HD2  2  
ATOM 3117  H HE1  . HIS A 1 72  ? -6.317  12.783  12.733  1.00 3.15  ? 586 HIS A HE1  2  
ATOM 3118  N N    . GLY A 1 73  ? -6.821  8.314   9.559   1.00 0.74  ? 587 GLY A N    2  
ATOM 3119  C CA   . GLY A 1 73  ? -8.192  7.897   9.820   1.00 0.75  ? 587 GLY A CA   2  
ATOM 3120  C C    . GLY A 1 73  ? -8.235  6.462   10.339  1.00 0.68  ? 587 GLY A C    2  
ATOM 3121  O O    . GLY A 1 73  ? -7.222  5.918   10.788  1.00 0.75  ? 587 GLY A O    2  
ATOM 3122  H H    . GLY A 1 73  ? -6.130  7.911   10.175  1.00 0.78  ? 587 GLY A H    2  
ATOM 3123  H HA2  . GLY A 1 73  ? -8.630  8.547   10.577  1.00 0.90  ? 587 GLY A HA2  2  
ATOM 3124  H HA3  . GLY A 1 73  ? -8.795  7.978   8.919   1.00 0.79  ? 587 GLY A HA3  2  
ATOM 3125  N N    . VAL A 1 74  ? -9.417  5.849   10.272  1.00 0.63  ? 588 VAL A N    2  
ATOM 3126  C CA   . VAL A 1 74  ? -9.689  4.512   10.808  1.00 0.63  ? 588 VAL A CA   2  
ATOM 3127  C C    . VAL A 1 74  ? -10.590 3.751   9.830   1.00 0.59  ? 588 VAL A C    2  
ATOM 3128  O O    . VAL A 1 74  ? -11.490 4.328   9.210   1.00 0.62  ? 588 VAL A O    2  
ATOM 3129  C CB   . VAL A 1 74  ? -10.336 4.589   12.213  1.00 0.69  ? 588 VAL A CB   2  
ATOM 3130  C CG1  . VAL A 1 74  ? -10.480 3.207   12.863  1.00 0.71  ? 588 VAL A CG1  2  
ATOM 3131  C CG2  . VAL A 1 74  ? -9.532  5.467   13.182  1.00 0.76  ? 588 VAL A CG2  2  
ATOM 3132  H H    . VAL A 1 74  ? -10.185 6.312   9.813   1.00 0.63  ? 588 VAL A H    2  
ATOM 3133  H HA   . VAL A 1 74  ? -8.733  3.994   10.893  1.00 0.64  ? 588 VAL A HA   2  
ATOM 3134  H HB   . VAL A 1 74  ? -11.332 5.018   12.121  1.00 0.74  ? 588 VAL A HB   2  
ATOM 3135  H HG11 . VAL A 1 74  ? -11.142 2.577   12.270  1.00 1.53  ? 588 VAL A HG11 2  
ATOM 3136  H HG12 . VAL A 1 74  ? -9.505  2.730   12.958  1.00 1.65  ? 588 VAL A HG12 2  
ATOM 3137  H HG13 . VAL A 1 74  ? -10.918 3.310   13.857  1.00 1.52  ? 588 VAL A HG13 2  
ATOM 3138  H HG21 . VAL A 1 74  ? -9.526  6.503   12.846  1.00 1.63  ? 588 VAL A HG21 2  
ATOM 3139  H HG22 . VAL A 1 74  ? -9.995  5.448   14.167  1.00 1.68  ? 588 VAL A HG22 2  
ATOM 3140  H HG23 . VAL A 1 74  ? -8.507  5.103   13.259  1.00 1.58  ? 588 VAL A HG23 2  
ATOM 3141  N N    . VAL A 1 75  ? -10.356 2.451   9.682   1.00 0.57  ? 589 VAL A N    2  
ATOM 3142  C CA   . VAL A 1 75  ? -11.142 1.547   8.830   1.00 0.55  ? 589 VAL A CA   2  
ATOM 3143  C C    . VAL A 1 75  ? -11.658 0.363   9.646   1.00 0.59  ? 589 VAL A C    2  
ATOM 3144  O O    . VAL A 1 75  ? -10.965 -0.137  10.526  1.00 0.66  ? 589 VAL A O    2  
ATOM 3145  C CB   . VAL A 1 75  ? -10.348 1.073   7.596   1.00 0.55  ? 589 VAL A CB   2  
ATOM 3146  C CG1  . VAL A 1 75  ? -9.892  2.242   6.710   1.00 0.58  ? 589 VAL A CG1  2  
ATOM 3147  C CG2  . VAL A 1 75  ? -9.118  0.255   7.981   1.00 0.59  ? 589 VAL A CG2  2  
ATOM 3148  H H    . VAL A 1 75  ? -9.620  2.030   10.246  1.00 0.58  ? 589 VAL A H    2  
ATOM 3149  H HA   . VAL A 1 75  ? -12.019 2.075   8.461   1.00 0.56  ? 589 VAL A HA   2  
ATOM 3150  H HB   . VAL A 1 75  ? -10.989 0.433   6.996   1.00 0.57  ? 589 VAL A HB   2  
ATOM 3151  H HG11 . VAL A 1 75  ? -10.753 2.830   6.401   1.00 1.27  ? 589 VAL A HG11 2  
ATOM 3152  H HG12 . VAL A 1 75  ? -9.197  2.882   7.253   1.00 1.59  ? 589 VAL A HG12 2  
ATOM 3153  H HG13 . VAL A 1 75  ? -9.396  1.855   5.821   1.00 1.61  ? 589 VAL A HG13 2  
ATOM 3154  H HG21 . VAL A 1 75  ? -8.605  -0.093  7.093   1.00 1.49  ? 589 VAL A HG21 2  
ATOM 3155  H HG22 . VAL A 1 75  ? -8.441  0.869   8.576   1.00 1.39  ? 589 VAL A HG22 2  
ATOM 3156  H HG23 . VAL A 1 75  ? -9.418  -0.624  8.547   1.00 1.57  ? 589 VAL A HG23 2  
ATOM 3157  N N    . SER A 1 76  ? -12.851 -0.110  9.310   1.00 0.61  ? 590 SER A N    2  
ATOM 3158  C CA   . SER A 1 76  ? -13.489 -1.307  9.874   1.00 0.79  ? 590 SER A CA   2  
ATOM 3159  C C    . SER A 1 76  ? -13.513 -2.361  8.774   1.00 0.92  ? 590 SER A C    2  
ATOM 3160  O O    . SER A 1 76  ? -13.839 -2.108  7.614   1.00 0.80  ? 590 SER A O    2  
ATOM 3161  C CB   . SER A 1 76  ? -14.909 -1.006  10.364  1.00 0.96  ? 590 SER A CB   2  
ATOM 3162  O OG   . SER A 1 76  ? -14.843 -0.058  11.409  1.00 1.06  ? 590 SER A OG   2  
ATOM 3163  H H    . SER A 1 76  ? -13.254 0.263   8.460   1.00 0.56  ? 590 SER A H    2  
ATOM 3164  H HA   . SER A 1 76  ? -12.898 -1.693  10.727  1.00 0.82  ? 590 SER A HA   2  
ATOM 3165  H HB2  . SER A 1 76  ? -15.505 -0.606  9.541   1.00 0.97  ? 590 SER A HB2  2  
ATOM 3166  H HB3  . SER A 1 76  ? -15.371 -1.927  10.732  1.00 1.17  ? 590 SER A HB3  2  
ATOM 3167  H HG   . SER A 1 76  ? -15.650 0.485   11.409  1.00 1.11  ? 590 SER A HG   2  
ATOM 3168  N N    . VAL A 1 77  ? -13.016 -3.532  9.118   1.00 1.16  ? 591 VAL A N    2  
ATOM 3169  C CA   . VAL A 1 77  ? -12.228 -4.364  8.229   1.00 0.94  ? 591 VAL A CA   2  
ATOM 3170  C C    . VAL A 1 77  ? -12.618 -5.815  8.488   1.00 0.79  ? 591 VAL A C    2  
ATOM 3171  O O    . VAL A 1 77  ? -12.974 -6.179  9.613   1.00 0.82  ? 591 VAL A O    2  
ATOM 3172  C CB   . VAL A 1 77  ? -10.765 -4.049  8.576   1.00 1.22  ? 591 VAL A CB   2  
ATOM 3173  C CG1  . VAL A 1 77  ? -10.476 -4.252  10.043  1.00 2.57  ? 591 VAL A CG1  2  
ATOM 3174  C CG2  . VAL A 1 77  ? -9.749  -4.970  8.013   1.00 1.05  ? 591 VAL A CG2  2  
ATOM 3175  H H    . VAL A 1 77  ? -12.804 -3.705  10.093  1.00 1.33  ? 591 VAL A H    2  
ATOM 3176  H HA   . VAL A 1 77  ? -12.386 -4.126  7.172   1.00 0.96  ? 591 VAL A HA   2  
ATOM 3177  H HB   . VAL A 1 77  ? -10.523 -3.023  8.294   1.00 2.01  ? 591 VAL A HB   2  
ATOM 3178  H HG11 . VAL A 1 77  ? -9.414  -4.275  10.287  1.00 3.14  ? 591 VAL A HG11 2  
ATOM 3179  H HG12 . VAL A 1 77  ? -10.904 -3.402  10.533  1.00 3.53  ? 591 VAL A HG12 2  
ATOM 3180  H HG13 . VAL A 1 77  ? -10.924 -5.219  10.309  1.00 3.08  ? 591 VAL A HG13 2  
ATOM 3181  H HG21 . VAL A 1 77  ? -8.808  -4.485  8.259   1.00 1.55  ? 591 VAL A HG21 2  
ATOM 3182  H HG22 . VAL A 1 77  ? -9.850  -5.912  8.561   1.00 2.21  ? 591 VAL A HG22 2  
ATOM 3183  H HG23 . VAL A 1 77  ? -9.913  -5.050  6.950   1.00 2.08  ? 591 VAL A HG23 2  
ATOM 3184  N N    . LEU A 1 78  ? -12.520 -6.656  7.471   1.00 0.85  ? 592 LEU A N    2  
ATOM 3185  C CA   . LEU A 1 78  ? -12.764 -8.082  7.621   1.00 1.09  ? 592 LEU A CA   2  
ATOM 3186  C C    . LEU A 1 78  ? -11.598 -8.854  7.005   1.00 1.26  ? 592 LEU A C    2  
ATOM 3187  O O    . LEU A 1 78  ? -11.288 -8.634  5.832   1.00 1.21  ? 592 LEU A O    2  
ATOM 3188  C CB   . LEU A 1 78  ? -14.068 -8.499  6.892   1.00 1.27  ? 592 LEU A CB   2  
ATOM 3189  C CG   . LEU A 1 78  ? -15.443 -7.927  7.290   1.00 1.39  ? 592 LEU A CG   2  
ATOM 3190  C CD1  . LEU A 1 78  ? -15.770 -8.148  8.763   1.00 1.54  ? 592 LEU A CD1  2  
ATOM 3191  C CD2  . LEU A 1 78  ? -15.659 -6.453  6.938   1.00 1.51  ? 592 LEU A CD2  2  
ATOM 3192  H H    . LEU A 1 78  ? -12.263 -6.302  6.552   1.00 0.85  ? 592 LEU A H    2  
ATOM 3193  H HA   . LEU A 1 78  ? -12.810 -8.314  8.689   1.00 1.17  ? 592 LEU A HA   2  
ATOM 3194  H HB2  . LEU A 1 78  ? -13.942 -8.298  5.829   1.00 1.28  ? 592 LEU A HB2  2  
ATOM 3195  H HB3  . LEU A 1 78  ? -14.147 -9.582  6.984   1.00 1.51  ? 592 LEU A HB3  2  
ATOM 3196  H HG   . LEU A 1 78  ? -16.176 -8.487  6.712   1.00 1.71  ? 592 LEU A HG   2  
ATOM 3197  H HD11 . LEU A 1 78  ? -16.811 -7.886  8.951   1.00 2.05  ? 592 LEU A HD11 2  
ATOM 3198  H HD12 . LEU A 1 78  ? -15.132 -7.520  9.377   1.00 2.24  ? 592 LEU A HD12 2  
ATOM 3199  H HD13 . LEU A 1 78  ? -15.614 -9.196  9.019   1.00 2.41  ? 592 LEU A HD13 2  
ATOM 3200  H HD21 . LEU A 1 78  ? -15.337 -6.269  5.912   1.00 2.29  ? 592 LEU A HD21 2  
ATOM 3201  H HD22 . LEU A 1 78  ? -15.110 -5.806  7.616   1.00 2.15  ? 592 LEU A HD22 2  
ATOM 3202  H HD23 . LEU A 1 78  ? -16.717 -6.210  7.019   1.00 2.25  ? 592 LEU A HD23 2  
ATOM 3203  N N    . THR A 1 79  ? -10.978 -9.778  7.744   1.00 1.60  ? 593 THR A N    2  
ATOM 3204  C CA   . THR A 1 79  ? -10.103 -10.801 7.122   1.00 1.85  ? 593 THR A CA   2  
ATOM 3205  C C    . THR A 1 79  ? -10.817 -12.105 6.737   1.00 2.05  ? 593 THR A C    2  
ATOM 3206  O O    . THR A 1 79  ? -11.484 -12.738 7.566   1.00 2.18  ? 593 THR A O    2  
ATOM 3207  C CB   . THR A 1 79  ? -8.855  -11.095 7.960   1.00 2.04  ? 593 THR A CB   2  
ATOM 3208  O OG1  . THR A 1 79  ? -9.130  -11.050 9.345   1.00 1.99  ? 593 THR A OG1  2  
ATOM 3209  C CG2  . THR A 1 79  ? -7.772  -10.071 7.634   1.00 2.07  ? 593 THR A CG2  2  
ATOM 3210  H H    . THR A 1 79  ? -11.091 -9.766  8.760   1.00 1.73  ? 593 THR A H    2  
ATOM 3211  H HA   . THR A 1 79  ? -9.731  -10.392 6.187   1.00 1.85  ? 593 THR A HA   2  
ATOM 3212  H HB   . THR A 1 79  ? -8.470  -12.084 7.707   1.00 2.29  ? 593 THR A HB   2  
ATOM 3213  H HG1  . THR A 1 79  ? -8.292  -11.290 9.796   1.00 2.30  ? 593 THR A HG1  2  
ATOM 3214  H HG21 . THR A 1 79  ? -8.160  -9.061  7.787   1.00 2.39  ? 593 THR A HG21 2  
ATOM 3215  H HG22 . THR A 1 79  ? -7.471  -10.191 6.591   1.00 2.60  ? 593 THR A HG22 2  
ATOM 3216  H HG23 . THR A 1 79  ? -6.902  -10.240 8.264   1.00 2.64  ? 593 THR A HG23 2  
ATOM 3217  N N    . LYS A 1 80  ? -10.625 -12.563 5.489   1.00 2.20  ? 594 LYS A N    2  
ATOM 3218  C CA   . LYS A 1 80  ? -11.080 -13.885 5.009   1.00 2.49  ? 594 LYS A CA   2  
ATOM 3219  C C    . LYS A 1 80  ? -10.548 -15.020 5.888   1.00 2.96  ? 594 LYS A C    2  
ATOM 3220  O O    . LYS A 1 80  ? -9.444  -14.921 6.429   1.00 3.78  ? 594 LYS A O    2  
ATOM 3221  C CB   . LYS A 1 80  ? -10.778 -14.104 3.511   1.00 2.58  ? 594 LYS A CB   2  
ATOM 3222  C CG   . LYS A 1 80  ? -9.360  -14.570 3.128   1.00 2.90  ? 594 LYS A CG   2  
ATOM 3223  C CD   . LYS A 1 80  ? -8.277  -13.530 3.435   1.00 2.93  ? 594 LYS A CD   2  
ATOM 3224  C CE   . LYS A 1 80  ? -6.912  -13.824 2.814   1.00 3.46  ? 594 LYS A CE   2  
ATOM 3225  N NZ   . LYS A 1 80  ? -6.286  -15.080 3.299   1.00 4.00  ? 594 LYS A NZ   2  
ATOM 3226  H H    . LYS A 1 80  ? -10.151 -11.948 4.829   1.00 2.19  ? 594 LYS A H    2  
ATOM 3227  H HA   . LYS A 1 80  ? -12.165 -13.900 5.105   1.00 2.47  ? 594 LYS A HA   2  
ATOM 3228  H HB2  . LYS A 1 80  ? -11.462 -14.876 3.162   1.00 2.72  ? 594 LYS A HB2  2  
ATOM 3229  H HB3  . LYS A 1 80  ? -11.020 -13.194 2.958   1.00 2.42  ? 594 LYS A HB3  2  
ATOM 3230  H HG2  . LYS A 1 80  ? -9.137  -15.501 3.650   1.00 3.15  ? 594 LYS A HG2  2  
ATOM 3231  H HG3  . LYS A 1 80  ? -9.351  -14.774 2.056   1.00 3.10  ? 594 LYS A HG3  2  
ATOM 3232  H HD2  . LYS A 1 80  ? -8.601  -12.584 3.013   1.00 2.89  ? 594 LYS A HD2  2  
ATOM 3233  H HD3  . LYS A 1 80  ? -8.168  -13.408 4.513   1.00 2.93  ? 594 LYS A HD3  2  
ATOM 3234  H HE2  . LYS A 1 80  ? -7.018  -13.855 1.725   1.00 3.90  ? 594 LYS A HE2  2  
ATOM 3235  H HE3  . LYS A 1 80  ? -6.268  -12.977 3.065   1.00 4.03  ? 594 LYS A HE3  2  
ATOM 3236  H HZ1  . LYS A 1 80  ? -6.239  -15.103 4.315   1.00 4.43  ? 594 LYS A HZ1  2  
ATOM 3237  H HZ2  . LYS A 1 80  ? -5.342  -15.164 2.929   1.00 4.50  ? 594 LYS A HZ2  2  
ATOM 3238  H HZ3  . LYS A 1 80  ? -6.798  -15.910 3.003   1.00 4.36  ? 594 LYS A HZ3  2  
ATOM 3239  N N    . GLY A 1 81  ? -11.356 -16.059 6.094   1.00 3.11  ? 595 GLY A N    2  
ATOM 3240  C CA   . GLY A 1 81  ? -11.105 -17.094 7.106   1.00 3.46  ? 595 GLY A CA   2  
ATOM 3241  C C    . GLY A 1 81  ? -11.464 -16.695 8.535   1.00 3.34  ? 595 GLY A C    2  
ATOM 3242  O O    . GLY A 1 81  ? -11.719 -17.561 9.372   1.00 3.58  ? 595 GLY A O    2  
ATOM 3243  H H    . GLY A 1 81  ? -12.223 -16.109 5.572   1.00 3.46  ? 595 GLY A H    2  
ATOM 3244  H HA2  . GLY A 1 81  ? -11.622 -18.016 6.848   1.00 3.75  ? 595 GLY A HA2  2  
ATOM 3245  H HA3  . GLY A 1 81  ? -10.029 -17.276 7.151   1.00 3.62  ? 595 GLY A HA3  2  
ATOM 3246  N N    . ASN A 1 82  ? -11.440 -15.393 8.822   1.00 3.00  ? 596 ASN A N    2  
ATOM 3247  C CA   . ASN A 1 82  ? -11.022 -14.867 10.108  1.00 2.92  ? 596 ASN A CA   2  
ATOM 3248  C C    . ASN A 1 82  ? -12.032 -13.808 10.596  1.00 2.65  ? 596 ASN A C    2  
ATOM 3249  O O    . ASN A 1 82  ? -13.188 -14.135 10.875  1.00 2.88  ? 596 ASN A O    2  
ATOM 3250  C CB   . ASN A 1 82  ? -9.601  -14.302 9.949   1.00 2.86  ? 596 ASN A CB   2  
ATOM 3251  C CG   . ASN A 1 82  ? -8.457  -15.205 9.522   1.00 3.18  ? 596 ASN A CG   2  
ATOM 3252  O OD1  . ASN A 1 82  ? -8.562  -16.412 9.353   1.00 3.53  ? 596 ASN A OD1  2  
ATOM 3253  N ND2  . ASN A 1 82  ? -7.299  -14.604 9.380   1.00 3.17  ? 596 ASN A ND2  2  
ATOM 3254  H H    . ASN A 1 82  ? -11.379 -14.729 8.056   1.00 2.81  ? 596 ASN A H    2  
ATOM 3255  H HA   . ASN A 1 82  ? -10.963 -15.634 10.888  1.00 3.17  ? 596 ASN A HA   2  
ATOM 3256  H HB2  . ASN A 1 82  ? -9.669  -13.483 9.267   1.00 2.72  ? 596 ASN A HB2  2  
ATOM 3257  H HB3  . ASN A 1 82  ? -9.296  -13.870 10.876  1.00 2.80  ? 596 ASN A HB3  2  
ATOM 3258  H HD21 . ASN A 1 82  ? -7.199  -13.627 9.636   1.00 2.99  ? 596 ASN A HD21 2  
ATOM 3259  H HD22 . ASN A 1 82  ? -6.462  -15.137 9.172   1.00 3.42  ? 596 ASN A HD22 2  
ATOM 3260  N N    . LYS A 1 83  ? -11.556 -12.579 10.844  1.00 2.47  ? 597 LYS A N    2  
ATOM 3261  C CA   . LYS A 1 83  ? -12.095 -11.669 11.855  1.00 2.35  ? 597 LYS A CA   2  
ATOM 3262  C C    . LYS A 1 83  ? -12.961 -10.563 11.292  1.00 1.72  ? 597 LYS A C    2  
ATOM 3263  O O    . LYS A 1 83  ? -12.994 -10.306 10.090  1.00 1.83  ? 597 LYS A O    2  
ATOM 3264  C CB   . LYS A 1 83  ? -10.979 -11.071 12.748  1.00 3.01  ? 597 LYS A CB   2  
ATOM 3265  C CG   . LYS A 1 83  ? -9.679  -11.854 12.973  1.00 4.39  ? 597 LYS A CG   2  
ATOM 3266  C CD   . LYS A 1 83  ? -9.717  -13.161 13.785  1.00 3.59  ? 597 LYS A CD   2  
ATOM 3267  C CE   . LYS A 1 83  ? -10.830 -14.139 13.459  1.00 2.88  ? 597 LYS A CE   2  
ATOM 3268  N NZ   . LYS A 1 83  ? -10.799 -15.296 14.379  1.00 3.48  ? 597 LYS A NZ   2  
ATOM 3269  H H    . LYS A 1 83  ? -10.669 -12.321 10.425  1.00 2.67  ? 597 LYS A H    2  
ATOM 3270  H HA   . LYS A 1 83  ? -12.772 -12.226 12.488  1.00 2.73  ? 597 LYS A HA   2  
ATOM 3271  H HB2  . LYS A 1 83  ? -10.674 -10.134 12.284  1.00 3.03  ? 597 LYS A HB2  2  
ATOM 3272  H HB3  . LYS A 1 83  ? -11.400 -10.821 13.724  1.00 3.04  ? 597 LYS A HB3  2  
ATOM 3273  H HG2  . LYS A 1 83  ? -9.227  -12.037 12.006  1.00 5.59  ? 597 LYS A HG2  2  
ATOM 3274  H HG3  . LYS A 1 83  ? -9.007  -11.176 13.498  1.00 5.72  ? 597 LYS A HG3  2  
ATOM 3275  H HD2  . LYS A 1 83  ? -8.798  -13.705 13.568  1.00 4.48  ? 597 LYS A HD2  2  
ATOM 3276  H HD3  . LYS A 1 83  ? -9.763  -12.915 14.846  1.00 3.95  ? 597 LYS A HD3  2  
ATOM 3277  H HE2  . LYS A 1 83  ? -11.797 -13.639 13.528  1.00 3.15  ? 597 LYS A HE2  2  
ATOM 3278  H HE3  . LYS A 1 83  ? -10.661 -14.459 12.424  1.00 3.20  ? 597 LYS A HE3  2  
ATOM 3279  H HZ1  . LYS A 1 83  ? -11.013 -15.026 15.336  1.00 3.62  ? 597 LYS A HZ1  2  
ATOM 3280  H HZ2  . LYS A 1 83  ? -9.877  -15.730 14.385  1.00 4.07  ? 597 LYS A HZ2  2  
ATOM 3281  H HZ3  . LYS A 1 83  ? -11.469 -16.004 14.085  1.00 4.14  ? 597 LYS A HZ3  2  
ATOM 3282  N N    . GLU A 1 84  ? -13.543 -9.841  12.235  1.00 1.70  ? 598 GLU A N    2  
ATOM 3283  C CA   . GLU A 1 84  ? -13.943 -8.454  12.065  1.00 1.39  ? 598 GLU A CA   2  
ATOM 3284  C C    . GLU A 1 84  ? -13.101 -7.578  13.005  1.00 1.11  ? 598 GLU A C    2  
ATOM 3285  O O    . GLU A 1 84  ? -13.010 -7.824  14.212  1.00 1.15  ? 598 GLU A O    2  
ATOM 3286  C CB   . GLU A 1 84  ? -15.461 -8.288  12.214  1.00 1.95  ? 598 GLU A CB   2  
ATOM 3287  C CG   . GLU A 1 84  ? -15.983 -8.604  13.619  1.00 2.50  ? 598 GLU A CG   2  
ATOM 3288  C CD   . GLU A 1 84  ? -17.416 -9.136  13.568  1.00 3.38  ? 598 GLU A CD   2  
ATOM 3289  O OE1  . GLU A 1 84  ? -18.352 -8.372  13.214  1.00 3.19  ? 598 GLU A OE1  2  
ATOM 3290  O OE2  . GLU A 1 84  ? -17.622 -10.333 13.889  1.00 4.84  ? 598 GLU A OE2  2  
ATOM 3291  H H    . GLU A 1 84  ? -13.364 -10.146 13.178  1.00 2.29  ? 598 GLU A H    2  
ATOM 3292  H HA   . GLU A 1 84  ? -13.694 -8.178  11.044  1.00 1.23  ? 598 GLU A HA   2  
ATOM 3293  H HB2  . GLU A 1 84  ? -15.737 -7.263  11.952  1.00 1.93  ? 598 GLU A HB2  2  
ATOM 3294  H HB3  . GLU A 1 84  ? -15.942 -8.960  11.503  1.00 2.62  ? 598 GLU A HB3  2  
ATOM 3295  H HG2  . GLU A 1 84  ? -15.356 -9.360  14.093  1.00 3.13  ? 598 GLU A HG2  2  
ATOM 3296  H HG3  . GLU A 1 84  ? -15.923 -7.695  14.219  1.00 2.39  ? 598 GLU A HG3  2  
ATOM 3297  N N    . MET A 1 85  ? -12.416 -6.607  12.412  1.00 0.97  ? 599 MET A N    2  
ATOM 3298  C CA   . MET A 1 85  ? -11.377 -5.765  13.013  1.00 0.95  ? 599 MET A CA   2  
ATOM 3299  C C    . MET A 1 85  ? -11.652 -4.273  12.789  1.00 1.12  ? 599 MET A C    2  
ATOM 3300  O O    . MET A 1 85  ? -12.590 -3.893  12.076  1.00 1.63  ? 599 MET A O    2  
ATOM 3301  C CB   . MET A 1 85  ? -9.975  -6.253  12.596  1.00 0.98  ? 599 MET A CB   2  
ATOM 3302  C CG   . MET A 1 85  ? -9.534  -7.477  13.403  1.00 1.35  ? 599 MET A CG   2  
ATOM 3303  S SD   . MET A 1 85  ? -7.967  -8.218  12.857  1.00 1.68  ? 599 MET A SD   2  
ATOM 3304  C CE   . MET A 1 85  ? -8.293  -8.473  11.090  1.00 1.66  ? 599 MET A CE   2  
ATOM 3305  H H    . MET A 1 85  ? -12.589 -6.471  11.420  1.00 0.97  ? 599 MET A H    2  
ATOM 3306  H HA   . MET A 1 85  ? -11.381 -5.861  14.068  1.00 0.98  ? 599 MET A HA   2  
ATOM 3307  H HB2  . MET A 1 85  ? -9.983  -6.535  11.551  1.00 1.29  ? 599 MET A HB2  2  
ATOM 3308  H HB3  . MET A 1 85  ? -9.235  -5.469  12.745  1.00 1.42  ? 599 MET A HB3  2  
ATOM 3309  H HG2  . MET A 1 85  ? -9.429  -7.191  14.450  1.00 1.87  ? 599 MET A HG2  2  
ATOM 3310  H HG3  . MET A 1 85  ? -10.310 -8.236  13.342  1.00 1.75  ? 599 MET A HG3  2  
ATOM 3311  H HE1  . MET A 1 85  ? -9.299  -8.871  10.951  1.00 2.31  ? 599 MET A HE1  2  
ATOM 3312  H HE2  . MET A 1 85  ? -8.212  -7.524  10.560  1.00 1.93  ? 599 MET A HE2  2  
ATOM 3313  H HE3  . MET A 1 85  ? -7.562  -9.169  10.681  1.00 2.39  ? 599 MET A HE3  2  
ATOM 3314  N N    . LYS A 1 86  ? -10.827 -3.426  13.403  1.00 0.92  ? 600 LYS A N    2  
ATOM 3315  C CA   . LYS A 1 86  ? -10.314 -2.175  12.865  1.00 0.89  ? 600 LYS A CA   2  
ATOM 3316  C C    . LYS A 1 86  ? -8.858  -2.248  12.409  1.00 1.02  ? 600 LYS A C    2  
ATOM 3317  O O    . LYS A 1 86  ? -8.077  -3.080  12.867  1.00 1.30  ? 600 LYS A O    2  
ATOM 3318  C CB   . LYS A 1 86  ? -10.426 -1.080  13.950  1.00 0.94  ? 600 LYS A CB   2  
ATOM 3319  C CG   . LYS A 1 86  ? -11.643 -0.170  13.847  1.00 0.94  ? 600 LYS A CG   2  
ATOM 3320  C CD   . LYS A 1 86  ? -13.003 -0.854  13.908  1.00 1.04  ? 600 LYS A CD   2  
ATOM 3321  C CE   . LYS A 1 86  ? -13.229 -1.588  15.233  1.00 1.29  ? 600 LYS A CE   2  
ATOM 3322  N NZ   . LYS A 1 86  ? -14.658 -1.931  15.402  1.00 1.91  ? 600 LYS A NZ   2  
ATOM 3323  H H    . LYS A 1 86  ? -10.327 -3.752  14.198  1.00 0.85  ? 600 LYS A H    2  
ATOM 3324  H HA   . LYS A 1 86  ? -10.871 -1.979  11.952  1.00 0.88  ? 600 LYS A HA   2  
ATOM 3325  H HB2  . LYS A 1 86  ? -10.393 -1.534  14.942  1.00 1.05  ? 600 LYS A HB2  2  
ATOM 3326  H HB3  . LYS A 1 86  ? -9.556  -0.421  13.896  1.00 1.33  ? 600 LYS A HB3  2  
ATOM 3327  H HG2  . LYS A 1 86  ? -11.583 0.553   14.654  1.00 1.05  ? 600 LYS A HG2  2  
ATOM 3328  H HG3  . LYS A 1 86  ? -11.578 0.358   12.905  1.00 1.20  ? 600 LYS A HG3  2  
ATOM 3329  H HD2  . LYS A 1 86  ? -13.763 -0.081  13.796  1.00 1.27  ? 600 LYS A HD2  2  
ATOM 3330  H HD3  . LYS A 1 86  ? -13.069 -1.538  13.064  1.00 1.05  ? 600 LYS A HD3  2  
ATOM 3331  H HE2  . LYS A 1 86  ? -12.617 -2.493  15.251  1.00 1.70  ? 600 LYS A HE2  2  
ATOM 3332  H HE3  . LYS A 1 86  ? -12.910 -0.943  16.057  1.00 1.54  ? 600 LYS A HE3  2  
ATOM 3333  H HZ1  . LYS A 1 86  ? -15.218 -1.085  15.461  1.00 2.04  ? 600 LYS A HZ1  2  
ATOM 3334  H HZ2  . LYS A 1 86  ? -14.812 -2.474  16.253  1.00 2.87  ? 600 LYS A HZ2  2  
ATOM 3335  H HZ3  . LYS A 1 86  ? -14.987 -2.501  14.631  1.00 2.58  ? 600 LYS A HZ3  2  
ATOM 3336  N N    . LEU A 1 87  ? -8.516  -1.288  11.555  1.00 0.86  ? 601 LEU A N    2  
ATOM 3337  C CA   . LEU A 1 87  ? -7.157  -0.833  11.223  1.00 0.84  ? 601 LEU A CA   2  
ATOM 3338  C C    . LEU A 1 87  ? -7.098  0.702   11.370  1.00 0.78  ? 601 LEU A C    2  
ATOM 3339  O O    . LEU A 1 87  ? -8.090  1.387   11.114  1.00 0.74  ? 601 LEU A O    2  
ATOM 3340  C CB   . LEU A 1 87  ? -6.775  -1.269  9.788   1.00 0.83  ? 601 LEU A CB   2  
ATOM 3341  C CG   . LEU A 1 87  ? -5.665  -2.323  9.661   1.00 0.87  ? 601 LEU A CG   2  
ATOM 3342  C CD1  . LEU A 1 87  ? -6.122  -3.683  10.175  1.00 0.97  ? 601 LEU A CD1  2  
ATOM 3343  C CD2  . LEU A 1 87  ? -5.297  -2.485  8.185   1.00 0.91  ? 601 LEU A CD2  2  
ATOM 3344  H H    . LEU A 1 87  ? -9.288  -0.681  11.278  1.00 0.73  ? 601 LEU A H    2  
ATOM 3345  H HA   . LEU A 1 87  ? -6.447  -1.263  11.933  1.00 0.93  ? 601 LEU A HA   2  
ATOM 3346  H HB2  . LEU A 1 87  ? -7.652  -1.661  9.280   1.00 0.86  ? 601 LEU A HB2  2  
ATOM 3347  H HB3  . LEU A 1 87  ? -6.447  -0.385  9.240   1.00 1.00  ? 601 LEU A HB3  2  
ATOM 3348  H HG   . LEU A 1 87  ? -4.786  -1.999  10.217  1.00 1.02  ? 601 LEU A HG   2  
ATOM 3349  H HD11 . LEU A 1 87  ? -7.074  -3.949  9.719   1.00 1.73  ? 601 LEU A HD11 2  
ATOM 3350  H HD12 . LEU A 1 87  ? -6.233  -3.647  11.254  1.00 1.45  ? 601 LEU A HD12 2  
ATOM 3351  H HD13 . LEU A 1 87  ? -5.383  -4.443  9.929   1.00 1.96  ? 601 LEU A HD13 2  
ATOM 3352  H HD21 . LEU A 1 87  ? -5.011  -1.523  7.763   1.00 1.68  ? 601 LEU A HD21 2  
ATOM 3353  H HD22 . LEU A 1 87  ? -6.145  -2.884  7.629   1.00 1.68  ? 601 LEU A HD22 2  
ATOM 3354  H HD23 . LEU A 1 87  ? -4.454  -3.171  8.092   1.00 1.76  ? 601 LEU A HD23 2  
ATOM 3355  N N    . SER A 1 88  ? -5.942  1.251   11.742  1.00 0.84  ? 602 SER A N    2  
ATOM 3356  C CA   . SER A 1 88  ? -5.744  2.696   11.985  1.00 0.85  ? 602 SER A CA   2  
ATOM 3357  C C    . SER A 1 88  ? -4.594  3.286   11.167  1.00 0.85  ? 602 SER A C    2  
ATOM 3358  O O    . SER A 1 88  ? -3.831  2.561   10.526  1.00 0.90  ? 602 SER A O    2  
ATOM 3359  C CB   . SER A 1 88  ? -5.525  2.951   13.480  1.00 0.97  ? 602 SER A CB   2  
ATOM 3360  O OG   . SER A 1 88  ? -4.394  2.243   13.956  1.00 1.65  ? 602 SER A OG   2  
ATOM 3361  H H    . SER A 1 88  ? -5.158  0.642   11.927  1.00 0.91  ? 602 SER A H    2  
ATOM 3362  H HA   . SER A 1 88  ? -6.641  3.245   11.696  1.00 0.89  ? 602 SER A HA   2  
ATOM 3363  H HB2  . SER A 1 88  ? -5.391  4.018   13.662  1.00 1.19  ? 602 SER A HB2  2  
ATOM 3364  H HB3  . SER A 1 88  ? -6.414  2.629   14.018  1.00 1.17  ? 602 SER A HB3  2  
ATOM 3365  H HG   . SER A 1 88  ? -4.486  2.196   14.937  1.00 2.13  ? 602 SER A HG   2  
ATOM 3366  N N    . ASP A 1 89  ? -4.444  4.610   11.187  1.00 0.89  ? 603 ASP A N    2  
ATOM 3367  C CA   . ASP A 1 89  ? -3.370  5.310   10.472  1.00 0.94  ? 603 ASP A CA   2  
ATOM 3368  C C    . ASP A 1 89  ? -1.971  4.741   10.767  1.00 0.99  ? 603 ASP A C    2  
ATOM 3369  O O    . ASP A 1 89  ? -1.668  4.339   11.896  1.00 1.10  ? 603 ASP A O    2  
ATOM 3370  C CB   . ASP A 1 89  ? -3.433  6.819   10.716  1.00 1.06  ? 603 ASP A CB   2  
ATOM 3371  C CG   . ASP A 1 89  ? -3.059  7.248   12.135  1.00 1.22  ? 603 ASP A CG   2  
ATOM 3372  O OD1  . ASP A 1 89  ? -3.778  6.889   13.097  1.00 2.07  ? 603 ASP A OD1  2  
ATOM 3373  O OD2  . ASP A 1 89  ? -2.100  8.039   12.298  1.00 1.48  ? 603 ASP A OD2  2  
ATOM 3374  H H    . ASP A 1 89  ? -5.114  5.157   11.714  1.00 0.92  ? 603 ASP A H    2  
ATOM 3375  H HA   . ASP A 1 89  ? -3.550  5.161   9.408   1.00 0.93  ? 603 ASP A HA   2  
ATOM 3376  H HB2  . ASP A 1 89  ? -2.753  7.297   10.013  1.00 1.13  ? 603 ASP A HB2  2  
ATOM 3377  H HB3  . ASP A 1 89  ? -4.441  7.166   10.490  1.00 1.10  ? 603 ASP A HB3  2  
ATOM 3378  N N    . GLY A 1 90  ? -1.148  4.658   9.719   1.00 0.99  ? 604 GLY A N    2  
ATOM 3379  C CA   . GLY A 1 90  ? 0.109   3.907   9.696   1.00 1.09  ? 604 GLY A CA   2  
ATOM 3380  C C    . GLY A 1 90  ? -0.015  2.445   9.241   1.00 1.00  ? 604 GLY A C    2  
ATOM 3381  O O    . GLY A 1 90  ? 1.002   1.815   8.948   1.00 1.09  ? 604 GLY A O    2  
ATOM 3382  H H    . GLY A 1 90  ? -1.454  5.054   8.832   1.00 0.95  ? 604 GLY A H    2  
ATOM 3383  H HA2  . GLY A 1 90  ? 0.817   4.412   9.040   1.00 1.18  ? 604 GLY A HA2  2  
ATOM 3384  H HA3  . GLY A 1 90  ? 0.510   3.897   10.701  1.00 1.21  ? 604 GLY A HA3  2  
ATOM 3385  N N    . SER A 1 91  ? -1.233  1.901   9.153   1.00 0.91  ? 605 SER A N    2  
ATOM 3386  C CA   . SER A 1 91  ? -1.503  0.569   8.590   1.00 0.84  ? 605 SER A CA   2  
ATOM 3387  C C    . SER A 1 91  ? -1.536  0.593   7.055   1.00 0.80  ? 605 SER A C    2  
ATOM 3388  O O    . SER A 1 91  ? -1.656  1.655   6.439   1.00 0.80  ? 605 SER A O    2  
ATOM 3389  C CB   . SER A 1 91  ? -2.838  0.030   9.104   1.00 0.78  ? 605 SER A CB   2  
ATOM 3390  O OG   . SER A 1 91  ? -2.909  0.055   10.518  1.00 0.86  ? 605 SER A OG   2  
ATOM 3391  H H    . SER A 1 91  ? -2.028  2.459   9.430   1.00 0.95  ? 605 SER A H    2  
ATOM 3392  H HA   . SER A 1 91  ? -0.718  -0.122  8.902   1.00 0.91  ? 605 SER A HA   2  
ATOM 3393  H HB2  . SER A 1 91  ? -3.632  0.653   8.695   1.00 0.73  ? 605 SER A HB2  2  
ATOM 3394  H HB3  . SER A 1 91  ? -2.974  -0.993  8.757   1.00 0.79  ? 605 SER A HB3  2  
ATOM 3395  H HG   . SER A 1 91  ? -3.091  0.985   10.748  1.00 0.97  ? 605 SER A HG   2  
ATOM 3396  N N    . TYR A 1 92  ? -1.468  -0.577  6.419   1.00 0.81  ? 606 TYR A N    2  
ATOM 3397  C CA   . TYR A 1 92  ? -1.450  -0.710  4.957   1.00 0.83  ? 606 TYR A CA   2  
ATOM 3398  C C    . TYR A 1 92  ? -2.067  -2.024  4.457   1.00 0.90  ? 606 TYR A C    2  
ATOM 3399  O O    . TYR A 1 92  ? -2.143  -3.015  5.184   1.00 1.04  ? 606 TYR A O    2  
ATOM 3400  C CB   . TYR A 1 92  ? -0.008  -0.560  4.459   1.00 1.02  ? 606 TYR A CB   2  
ATOM 3401  C CG   . TYR A 1 92  ? 0.939   -1.610  5.002   1.00 1.19  ? 606 TYR A CG   2  
ATOM 3402  C CD1  . TYR A 1 92  ? 1.621   -1.370  6.211   1.00 2.66  ? 606 TYR A CD1  2  
ATOM 3403  C CD2  . TYR A 1 92  ? 1.069   -2.855  4.358   1.00 1.76  ? 606 TYR A CD2  2  
ATOM 3404  C CE1  . TYR A 1 92  ? 2.373   -2.395  6.809   1.00 3.28  ? 606 TYR A CE1  2  
ATOM 3405  C CE2  . TYR A 1 92  ? 1.834   -3.875  4.950   1.00 2.27  ? 606 TYR A CE2  2  
ATOM 3406  C CZ   . TYR A 1 92  ? 2.457   -3.664  6.197   1.00 2.68  ? 606 TYR A CZ   2  
ATOM 3407  O OH   . TYR A 1 92  ? 3.100   -4.691  6.816   1.00 3.55  ? 606 TYR A OH   2  
ATOM 3408  H H    . TYR A 1 92  ? -1.368  -1.426  6.973   1.00 0.83  ? 606 TYR A H    2  
ATOM 3409  H HA   . TYR A 1 92  ? -2.043  0.095   4.528   1.00 0.82  ? 606 TYR A HA   2  
ATOM 3410  H HB2  . TYR A 1 92  ? -0.022  -0.605  3.374   1.00 1.54  ? 606 TYR A HB2  2  
ATOM 3411  H HB3  . TYR A 1 92  ? 0.367   0.423   4.741   1.00 1.38  ? 606 TYR A HB3  2  
ATOM 3412  H HD1  . TYR A 1 92  ? 1.520   -0.416  6.713   1.00 3.68  ? 606 TYR A HD1  2  
ATOM 3413  H HD2  . TYR A 1 92  ? 0.536   -3.054  3.438   1.00 2.76  ? 606 TYR A HD2  2  
ATOM 3414  H HE1  . TYR A 1 92  ? 2.853   -2.214  7.755   1.00 4.59  ? 606 TYR A HE1  2  
ATOM 3415  H HE2  . TYR A 1 92  ? 1.912   -4.834  4.472   1.00 3.19  ? 606 TYR A HE2  2  
ATOM 3416  H HH   . TYR A 1 92  ? 3.372   -4.439  7.719   1.00 4.40  ? 606 TYR A HH   2  
ATOM 3417  N N    . PHE A 1 93  ? -2.513  -2.024  3.198   1.00 0.88  ? 607 PHE A N    2  
ATOM 3418  C CA   . PHE A 1 93  ? -3.258  -3.129  2.575   1.00 1.02  ? 607 PHE A CA   2  
ATOM 3419  C C    . PHE A 1 93  ? -3.186  -3.140  1.026   1.00 1.17  ? 607 PHE A C    2  
ATOM 3420  O O    . PHE A 1 93  ? -2.511  -2.330  0.386   1.00 1.46  ? 607 PHE A O    2  
ATOM 3421  C CB   . PHE A 1 93  ? -4.713  -3.096  3.107   1.00 1.32  ? 607 PHE A CB   2  
ATOM 3422  C CG   . PHE A 1 93  ? -5.369  -1.730  3.251   1.00 0.94  ? 607 PHE A CG   2  
ATOM 3423  C CD1  . PHE A 1 93  ? -5.132  -0.705  2.316   1.00 2.02  ? 607 PHE A CD1  2  
ATOM 3424  C CD2  . PHE A 1 93  ? -6.220  -1.479  4.343   1.00 1.93  ? 607 PHE A CD2  2  
ATOM 3425  C CE1  . PHE A 1 93  ? -5.698  0.566   2.493   1.00 2.30  ? 607 PHE A CE1  2  
ATOM 3426  C CE2  . PHE A 1 93  ? -6.803  -0.212  4.504   1.00 1.72  ? 607 PHE A CE2  2  
ATOM 3427  C CZ   . PHE A 1 93  ? -6.524  0.818   3.595   1.00 1.14  ? 607 PHE A CZ   2  
ATOM 3428  H H    . PHE A 1 93  ? -2.464  -1.152  2.680   1.00 0.79  ? 607 PHE A H    2  
ATOM 3429  H HA   . PHE A 1 93  ? -2.818  -4.071  2.902   1.00 1.57  ? 607 PHE A HA   2  
ATOM 3430  H HB2  . PHE A 1 93  ? -5.361  -3.728  2.498   1.00 1.97  ? 607 PHE A HB2  2  
ATOM 3431  H HB3  . PHE A 1 93  ? -4.693  -3.553  4.098   1.00 2.08  ? 607 PHE A HB3  2  
ATOM 3432  H HD1  . PHE A 1 93  ? -4.505  -0.886  1.459   1.00 3.23  ? 607 PHE A HD1  2  
ATOM 3433  H HD2  . PHE A 1 93  ? -6.430  -2.263  5.058   1.00 3.34  ? 607 PHE A HD2  2  
ATOM 3434  H HE1  . PHE A 1 93  ? -5.518  1.338   1.769   1.00 3.72  ? 607 PHE A HE1  2  
ATOM 3435  H HE2  . PHE A 1 93  ? -7.489  -0.025  5.309   1.00 2.88  ? 607 PHE A HE2  2  
ATOM 3436  H HZ   . PHE A 1 93  ? -6.985  1.787   3.719   1.00 1.44  ? 607 PHE A HZ   2  
ATOM 3437  N N    . GLY A 1 94  ? -3.886  -4.094  0.409   1.00 1.37  ? 608 GLY A N    2  
ATOM 3438  C CA   . GLY A 1 94  ? -4.107  -4.211  -1.039  1.00 1.77  ? 608 GLY A CA   2  
ATOM 3439  C C    . GLY A 1 94  ? -3.076  -5.045  -1.813  1.00 2.34  ? 608 GLY A C    2  
ATOM 3440  O O    . GLY A 1 94  ? -3.458  -5.711  -2.776  1.00 3.30  ? 608 GLY A O    2  
ATOM 3441  H H    . GLY A 1 94  ? -4.393  -4.733  1.010   1.00 1.36  ? 608 GLY A H    2  
ATOM 3442  H HA2  . GLY A 1 94  ? -5.090  -4.654  -1.204  1.00 1.92  ? 608 GLY A HA2  2  
ATOM 3443  H HA3  . GLY A 1 94  ? -4.116  -3.213  -1.476  1.00 1.98  ? 608 GLY A HA3  2  
ATOM 3444  N N    . GLU A 1 95  ? -1.807  -5.064  -1.396  1.00 2.83  ? 609 GLU A N    2  
ATOM 3445  C CA   . GLU A 1 95  ? -0.709  -5.811  -2.040  1.00 3.53  ? 609 GLU A CA   2  
ATOM 3446  C C    . GLU A 1 95  ? 0.254   -6.407  -0.990  1.00 2.87  ? 609 GLU A C    2  
ATOM 3447  O O    . GLU A 1 95  ? 0.364   -5.925  0.145   1.00 3.75  ? 609 GLU A O    2  
ATOM 3448  C CB   . GLU A 1 95  ? 0.002   -4.889  -3.055  1.00 5.66  ? 609 GLU A CB   2  
ATOM 3449  C CG   . GLU A 1 95  ? 1.224   -5.445  -3.815  1.00 7.15  ? 609 GLU A CG   2  
ATOM 3450  C CD   . GLU A 1 95  ? 0.937   -6.674  -4.689  1.00 7.60  ? 609 GLU A CD   2  
ATOM 3451  O OE1  . GLU A 1 95  ? 0.832   -7.788  -4.122  1.00 7.40  ? 609 GLU A OE1  2  
ATOM 3452  O OE2  . GLU A 1 95  ? 0.826   -6.508  -5.927  1.00 8.64  ? 609 GLU A OE2  2  
ATOM 3453  H H    . GLU A 1 95  ? -1.576  -4.515  -0.579  1.00 3.39  ? 609 GLU A H    2  
ATOM 3454  H HA   . GLU A 1 95  ? -1.128  -6.651  -2.597  1.00 3.87  ? 609 GLU A HA   2  
ATOM 3455  H HB2  . GLU A 1 95  ? -0.732  -4.565  -3.795  1.00 5.99  ? 609 GLU A HB2  2  
ATOM 3456  H HB3  . GLU A 1 95  ? 0.333   -4.001  -2.516  1.00 6.49  ? 609 GLU A HB3  2  
ATOM 3457  H HG2  . GLU A 1 95  ? 1.590   -4.650  -4.464  1.00 8.17  ? 609 GLU A HG2  2  
ATOM 3458  H HG3  . GLU A 1 95  ? 2.022   -5.673  -3.104  1.00 7.52  ? 609 GLU A HG3  2  
ATOM 3459  N N    . ILE A 1 96  ? 0.919   -7.501  -1.361  1.00 2.54  ? 610 ILE A N    2  
ATOM 3460  C CA   . ILE A 1 96  ? 1.783   -8.325  -0.509  1.00 2.97  ? 610 ILE A CA   2  
ATOM 3461  C C    . ILE A 1 96  ? 3.269   -8.106  -0.861  1.00 3.65  ? 610 ILE A C    2  
ATOM 3462  O O    . ILE A 1 96  ? 4.108   -7.990  0.040   1.00 5.00  ? 610 ILE A O    2  
ATOM 3463  C CB   . ILE A 1 96  ? 1.308   -9.797  -0.620  1.00 3.40  ? 610 ILE A CB   2  
ATOM 3464  C CG1  . ILE A 1 96  ? 0.077   -10.092 0.270   1.00 4.30  ? 610 ILE A CG1  2  
ATOM 3465  C CG2  . ILE A 1 96  ? 2.411   -10.806 -0.257  1.00 4.39  ? 610 ILE A CG2  2  
ATOM 3466  C CD1  . ILE A 1 96  ? -1.243  -9.430  -0.144  1.00 4.92  ? 610 ILE A CD1  2  
ATOM 3467  H H    . ILE A 1 96  ? 0.790   -7.814  -2.324  1.00 3.05  ? 610 ILE A H    2  
ATOM 3468  H HA   . ILE A 1 96  ? 1.668   -8.026  0.530   1.00 3.66  ? 610 ILE A HA   2  
ATOM 3469  H HB   . ILE A 1 96  ? 1.024   -10.001 -1.653  1.00 3.17  ? 610 ILE A HB   2  
ATOM 3470  H HG12 . ILE A 1 96  ? -0.105  -11.162 0.245   1.00 5.11  ? 610 ILE A HG12 2  
ATOM 3471  H HG13 . ILE A 1 96  ? 0.300   -9.813  1.300   1.00 4.68  ? 610 ILE A HG13 2  
ATOM 3472  H HG21 . ILE A 1 96  ? 3.207   -10.759 -1.000  1.00 4.50  ? 610 ILE A HG21 2  
ATOM 3473  H HG22 . ILE A 1 96  ? 2.804   -10.604 0.739   1.00 5.04  ? 610 ILE A HG22 2  
ATOM 3474  H HG23 . ILE A 1 96  ? 2.007   -11.819 -0.289  1.00 5.09  ? 610 ILE A HG23 2  
ATOM 3475  H HD11 . ILE A 1 96  ? -2.060  -9.885  0.414   1.00 5.68  ? 610 ILE A HD11 2  
ATOM 3476  H HD12 . ILE A 1 96  ? -1.227  -8.368  0.088   1.00 5.37  ? 610 ILE A HD12 2  
ATOM 3477  H HD13 . ILE A 1 96  ? -1.417  -9.577  -1.211  1.00 5.17  ? 610 ILE A HD13 2  
ATOM 3478  N N    . CYS A 1 97  ? 3.594   -8.030  -2.156  1.00 3.26  ? 611 CYS A N    2  
ATOM 3479  C CA   . CYS A 1 97  ? 4.931   -7.821  -2.715  1.00 3.99  ? 611 CYS A CA   2  
ATOM 3480  C C    . CYS A 1 97  ? 4.846   -7.462  -4.217  1.00 2.65  ? 611 CYS A C    2  
ATOM 3481  O O    . CYS A 1 97  ? 3.917   -7.872  -4.901  1.00 2.30  ? 611 CYS A O    2  
ATOM 3482  C CB   . CYS A 1 97  ? 5.730   -9.122  -2.515  1.00 5.75  ? 611 CYS A CB   2  
ATOM 3483  S SG   . CYS A 1 97  ? 7.477   -8.880  -2.943  1.00 7.26  ? 611 CYS A SG   2  
ATOM 3484  H H    . CYS A 1 97  ? 2.855   -8.205  -2.833  1.00 2.83  ? 611 CYS A H    2  
ATOM 3485  H HA   . CYS A 1 97  ? 5.423   -7.008  -2.186  1.00 4.88  ? 611 CYS A HA   2  
ATOM 3486  H HB2  . CYS A 1 97  ? 5.667   -9.422  -1.467  1.00 6.62  ? 611 CYS A HB2  2  
ATOM 3487  H HB3  . CYS A 1 97  ? 5.292   -9.915  -3.124  1.00 5.81  ? 611 CYS A HB3  2  
ATOM 3488  H HG   . CYS A 1 97  ? 7.914   -10.097 -2.592  1.00 8.23  ? 611 CYS A HG   2  
ATOM 3489  N N    . LEU A 1 98  ? 5.864   -6.808  -4.793  1.00 2.64  ? 612 LEU A N    2  
ATOM 3490  C CA   . LEU A 1 98  ? 5.972   -6.632  -6.259  1.00 1.82  ? 612 LEU A CA   2  
ATOM 3491  C C    . LEU A 1 98  ? 6.121   -7.971  -7.024  1.00 1.74  ? 612 LEU A C    2  
ATOM 3492  O O    . LEU A 1 98  ? 6.022   -7.999  -8.256  1.00 1.94  ? 612 LEU A O    2  
ATOM 3493  C CB   . LEU A 1 98  ? 7.191   -5.759  -6.588  1.00 2.49  ? 612 LEU A CB   2  
ATOM 3494  C CG   . LEU A 1 98  ? 7.183   -4.353  -5.978  1.00 2.11  ? 612 LEU A CG   2  
ATOM 3495  C CD1  . LEU A 1 98  ? 8.486   -3.666  -6.353  1.00 3.24  ? 612 LEU A CD1  2  
ATOM 3496  C CD2  . LEU A 1 98  ? 6.052   -3.466  -6.487  1.00 1.09  ? 612 LEU A CD2  2  
ATOM 3497  H H    . LEU A 1 98  ? 6.635   -6.511  -4.213  1.00 3.72  ? 612 LEU A H    2  
ATOM 3498  H HA   . LEU A 1 98  ? 5.073   -6.120  -6.624  1.00 1.64  ? 612 LEU A HA   2  
ATOM 3499  H HB2  . LEU A 1 98  ? 8.088   -6.280  -6.252  1.00 3.67  ? 612 LEU A HB2  2  
ATOM 3500  H HB3  . LEU A 1 98  ? 7.256   -5.655  -7.671  1.00 3.03  ? 612 LEU A HB3  2  
ATOM 3501  H HG   . LEU A 1 98  ? 7.128   -4.427  -4.891  1.00 2.74  ? 612 LEU A HG   2  
ATOM 3502  H HD11 . LEU A 1 98  ? 9.325   -4.311  -6.114  1.00 3.89  ? 612 LEU A HD11 2  
ATOM 3503  H HD12 . LEU A 1 98  ? 8.569   -2.754  -5.776  1.00 3.39  ? 612 LEU A HD12 2  
ATOM 3504  H HD13 . LEU A 1 98  ? 8.501   -3.444  -7.419  1.00 4.12  ? 612 LEU A HD13 2  
ATOM 3505  H HD21 . LEU A 1 98  ? 6.110   -2.511  -5.980  1.00 1.53  ? 612 LEU A HD21 2  
ATOM 3506  H HD22 . LEU A 1 98  ? 5.080   -3.910  -6.284  1.00 1.81  ? 612 LEU A HD22 2  
ATOM 3507  H HD23 . LEU A 1 98  ? 6.163   -3.281  -7.553  1.00 1.94  ? 612 LEU A HD23 2  
ATOM 3508  N N    . LEU A 1 99  ? 6.415   -9.062  -6.304  1.00 1.85  ? 613 LEU A N    2  
ATOM 3509  C CA   . LEU A 1 99  ? 6.603   -10.425 -6.819  1.00 2.08  ? 613 LEU A CA   2  
ATOM 3510  C C    . LEU A 1 99  ? 5.499   -11.396 -6.378  1.00 2.00  ? 613 LEU A C    2  
ATOM 3511  O O    . LEU A 1 99  ? 5.575   -12.590 -6.659  1.00 2.43  ? 613 LEU A O    2  
ATOM 3512  C CB   . LEU A 1 99  ? 7.999   -10.955 -6.454  1.00 2.56  ? 613 LEU A CB   2  
ATOM 3513  C CG   . LEU A 1 99  ? 9.135   -10.071 -6.988  1.00 3.38  ? 613 LEU A CG   2  
ATOM 3514  C CD1  . LEU A 1 99  ? 9.641   -9.099  -5.921  1.00 3.95  ? 613 LEU A CD1  2  
ATOM 3515  C CD2  . LEU A 1 99  ? 10.321  -10.926 -7.419  1.00 4.43  ? 613 LEU A CD2  2  
ATOM 3516  H H    . LEU A 1 99  ? 6.526   -8.929  -5.311  1.00 1.98  ? 613 LEU A H    2  
ATOM 3517  H HA   . LEU A 1 99  ? 6.543   -10.393 -7.906  1.00 2.33  ? 613 LEU A HA   2  
ATOM 3518  H HB2  . LEU A 1 99  ? 8.080   -11.055 -5.374  1.00 2.68  ? 613 LEU A HB2  2  
ATOM 3519  H HB3  . LEU A 1 99  ? 8.096   -11.951 -6.887  1.00 3.66  ? 613 LEU A HB3  2  
ATOM 3520  H HG   . LEU A 1 99  ? 8.768   -9.506  -7.842  1.00 3.99  ? 613 LEU A HG   2  
ATOM 3521  H HD11 . LEU A 1 99  ? 10.041  -9.660  -5.078  1.00 4.21  ? 613 LEU A HD11 2  
ATOM 3522  H HD12 . LEU A 1 99  ? 8.829   -8.466  -5.574  1.00 3.95  ? 613 LEU A HD12 2  
ATOM 3523  H HD13 . LEU A 1 99  ? 10.424  -8.469  -6.343  1.00 5.16  ? 613 LEU A HD13 2  
ATOM 3524  H HD21 . LEU A 1 99  ? 10.025  -11.573 -8.245  1.00 5.23  ? 613 LEU A HD21 2  
ATOM 3525  H HD22 . LEU A 1 99  ? 10.658  -11.546 -6.590  1.00 4.40  ? 613 LEU A HD22 2  
ATOM 3526  H HD23 . LEU A 1 99  ? 11.135  -10.284 -7.754  1.00 5.21  ? 613 LEU A HD23 2  
ATOM 3527  N N    . THR A 1 100 ? 4.469   -10.888 -5.703  1.00 1.79  ? 614 THR A N    2  
ATOM 3528  C CA   . THR A 1 100 ? 3.124   -11.487 -5.760  1.00 1.79  ? 614 THR A CA   2  
ATOM 3529  C C    . THR A 1 100 ? 2.361   -10.866 -6.926  1.00 1.76  ? 614 THR A C    2  
ATOM 3530  O O    . THR A 1 100 ? 2.541   -9.686  -7.237  1.00 2.08  ? 614 THR A O    2  
ATOM 3531  C CB   . THR A 1 100 ? 2.361   -11.390 -4.426  1.00 2.16  ? 614 THR A CB   2  
ATOM 3532  O OG1  . THR A 1 100 ? 2.483   -10.126 -3.819  1.00 3.55  ? 614 THR A OG1  2  
ATOM 3533  C CG2  . THR A 1 100 ? 2.933   -12.415 -3.448  1.00 2.98  ? 614 THR A CG2  2  
ATOM 3534  H H    . THR A 1 100 ? 4.510   -9.896  -5.486  1.00 1.67  ? 614 THR A H    2  
ATOM 3535  H HA   . THR A 1 100 ? 3.221   -12.549 -5.990  1.00 2.00  ? 614 THR A HA   2  
ATOM 3536  H HB   . THR A 1 100 ? 1.306   -11.616 -4.560  1.00 2.81  ? 614 THR A HB   2  
ATOM 3537  H HG1  . THR A 1 100 ? 1.928   -9.473  -4.286  1.00 4.03  ? 614 THR A HG1  2  
ATOM 3538  H HG21 . THR A 1 100 ? 2.921   -13.406 -3.900  1.00 3.47  ? 614 THR A HG21 2  
ATOM 3539  H HG22 . THR A 1 100 ? 2.313   -12.442 -2.554  1.00 3.72  ? 614 THR A HG22 2  
ATOM 3540  H HG23 . THR A 1 100 ? 3.957   -12.151 -3.183  1.00 3.74  ? 614 THR A HG23 2  
ATOM 3541  N N    . ARG A 1 101 ? 1.567   -11.674 -7.632  1.00 1.78  ? 615 ARG A N    2  
ATOM 3542  C CA   . ARG A 1 101 ? 0.929   -11.318 -8.912  1.00 2.06  ? 615 ARG A CA   2  
ATOM 3543  C C    . ARG A 1 101 ? -0.480  -11.895 -9.033  1.00 1.91  ? 615 ARG A C    2  
ATOM 3544  O O    . ARG A 1 101 ? -0.919  -12.640 -8.155  1.00 2.20  ? 615 ARG A O    2  
ATOM 3545  C CB   . ARG A 1 101 ? 1.855   -11.694 -10.089 1.00 2.80  ? 615 ARG A CB   2  
ATOM 3546  C CG   . ARG A 1 101 ? 2.077   -13.202 -10.297 1.00 2.81  ? 615 ARG A CG   2  
ATOM 3547  C CD   . ARG A 1 101 ? 3.037   -13.476 -11.465 1.00 3.52  ? 615 ARG A CD   2  
ATOM 3548  N NE   . ARG A 1 101 ? 2.451   -13.167 -12.787 1.00 4.30  ? 615 ARG A NE   2  
ATOM 3549  C CZ   . ARG A 1 101 ? 3.111   -13.014 -13.926 1.00 5.21  ? 615 ARG A CZ   2  
ATOM 3550  N NH1  . ARG A 1 101 ? 4.402   -13.160 -14.002 1.00 5.58  ? 615 ARG A NH1  2  
ATOM 3551  N NH2  . ARG A 1 101 ? 2.490   -12.717 -15.028 1.00 6.38  ? 615 ARG A NH2  2  
ATOM 3552  H H    . ARG A 1 101 ? 1.431   -12.618 -7.289  1.00 1.86  ? 615 ARG A H    2  
ATOM 3553  H HA   . ARG A 1 101 ? 0.805   -10.233 -8.940  1.00 2.39  ? 615 ARG A HA   2  
ATOM 3554  H HB2  . ARG A 1 101 ? 1.447   -11.268 -11.005 1.00 3.49  ? 615 ARG A HB2  2  
ATOM 3555  H HB3  . ARG A 1 101 ? 2.826   -11.225 -9.923  1.00 3.81  ? 615 ARG A HB3  2  
ATOM 3556  H HG2  . ARG A 1 101 ? 2.519   -13.616 -9.392  1.00 3.40  ? 615 ARG A HG2  2  
ATOM 3557  H HG3  . ARG A 1 101 ? 1.128   -13.706 -10.476 1.00 3.02  ? 615 ARG A HG3  2  
ATOM 3558  H HD2  . ARG A 1 101 ? 3.948   -12.890 -11.312 1.00 4.07  ? 615 ARG A HD2  2  
ATOM 3559  H HD3  . ARG A 1 101 ? 3.308   -14.531 -11.439 1.00 3.94  ? 615 ARG A HD3  2  
ATOM 3560  H HE   . ARG A 1 101 ? 1.440   -13.108 -12.838 1.00 4.72  ? 615 ARG A HE   2  
ATOM 3561  H HH11 . ARG A 1 101 ? 4.907   -13.516 -13.201 1.00 5.38  ? 615 ARG A HH11 2  
ATOM 3562  H HH12 . ARG A 1 101 ? 4.899   -12.973 -14.864 1.00 6.47  ? 615 ARG A HH12 2  
ATOM 3563  H HH21 . ARG A 1 101 ? 1.484   -12.579 -15.026 1.00 6.79  ? 615 ARG A HH21 2  
ATOM 3564  H HH22 . ARG A 1 101 ? 3.011   -12.690 -15.901 1.00 7.14  ? 615 ARG A HH22 2  
ATOM 3565  N N    . GLY A 1 102 ? -1.195  -11.517 -10.089 1.00 2.19  ? 616 GLY A N    2  
ATOM 3566  C CA   . GLY A 1 102 ? -2.565  -11.963 -10.339 1.00 2.41  ? 616 GLY A CA   2  
ATOM 3567  C C    . GLY A 1 102 ? -3.623  -11.092 -9.662  1.00 2.32  ? 616 GLY A C    2  
ATOM 3568  O O    . GLY A 1 102 ? -3.364  -9.941  -9.292  1.00 2.82  ? 616 GLY A O    2  
ATOM 3569  H H    . GLY A 1 102 ? -0.753  -10.936 -10.789 1.00 2.66  ? 616 GLY A H    2  
ATOM 3570  H HA2  . GLY A 1 102 ? -2.756  -11.990 -11.411 1.00 2.85  ? 616 GLY A HA2  2  
ATOM 3571  H HA3  . GLY A 1 102 ? -2.678  -12.981 -9.964  1.00 2.57  ? 616 GLY A HA3  2  
ATOM 3572  N N    . ARG A 1 103 ? -4.830  -11.637 -9.511  1.00 1.99  ? 617 ARG A N    2  
ATOM 3573  C CA   . ARG A 1 103 ? -5.957  -11.026 -8.776  1.00 1.91  ? 617 ARG A CA   2  
ATOM 3574  C C    . ARG A 1 103 ? -5.586  -10.748 -7.303  1.00 2.24  ? 617 ARG A C    2  
ATOM 3575  O O    . ARG A 1 103 ? -4.993  -11.603 -6.636  1.00 2.58  ? 617 ARG A O    2  
ATOM 3576  C CB   . ARG A 1 103 ? -7.200  -11.936 -8.884  1.00 1.80  ? 617 ARG A CB   2  
ATOM 3577  C CG   . ARG A 1 103 ? -7.625  -12.294 -10.325 1.00 1.78  ? 617 ARG A CG   2  
ATOM 3578  C CD   . ARG A 1 103 ? -8.100  -11.119 -11.189 1.00 2.04  ? 617 ARG A CD   2  
ATOM 3579  N NE   . ARG A 1 103 ? -9.509  -10.807 -10.937 1.00 2.64  ? 617 ARG A NE   2  
ATOM 3580  C CZ   . ARG A 1 103 ? -10.542 -10.969 -11.737 1.00 3.11  ? 617 ARG A CZ   2  
ATOM 3581  N NH1  . ARG A 1 103 ? -10.431 -11.347 -12.976 1.00 3.44  ? 617 ARG A NH1  2  
ATOM 3582  N NH2  . ARG A 1 103 ? -11.728 -10.744 -11.272 1.00 4.10  ? 617 ARG A NH2  2  
ATOM 3583  H H    . ARG A 1 103 ? -4.964  -12.541 -9.964  1.00 2.08  ? 617 ARG A H    2  
ATOM 3584  H HA   . ARG A 1 103 ? -6.191  -10.064 -9.233  1.00 2.07  ? 617 ARG A HA   2  
ATOM 3585  H HB2  . ARG A 1 103 ? -6.987  -12.870 -8.361  1.00 2.23  ? 617 ARG A HB2  2  
ATOM 3586  H HB3  . ARG A 1 103 ? -8.038  -11.461 -8.374  1.00 2.12  ? 617 ARG A HB3  2  
ATOM 3587  H HG2  . ARG A 1 103 ? -6.792  -12.760 -10.839 1.00 2.23  ? 617 ARG A HG2  2  
ATOM 3588  H HG3  . ARG A 1 103 ? -8.415  -13.042 -10.281 1.00 2.12  ? 617 ARG A HG3  2  
ATOM 3589  H HD2  . ARG A 1 103 ? -7.502  -10.235 -10.975 1.00 2.78  ? 617 ARG A HD2  2  
ATOM 3590  H HD3  . ARG A 1 103 ? -7.954  -11.381 -12.236 1.00 2.27  ? 617 ARG A HD3  2  
ATOM 3591  H HE   . ARG A 1 103 ? -9.717  -10.414 -10.019 1.00 3.45  ? 617 ARG A HE   2  
ATOM 3592  H HH11 . ARG A 1 103 ? -9.520  -11.528 -13.376 1.00 3.68  ? 617 ARG A HH11 2  
ATOM 3593  H HH12 . ARG A 1 103 ? -11.249 -11.369 -13.575 1.00 4.08  ? 617 ARG A HH12 2  
ATOM 3594  H HH21 . ARG A 1 103 ? -11.812 -10.582 -10.272 1.00 4.73  ? 617 ARG A HH21 2  
ATOM 3595  H HH22 . ARG A 1 103 ? -12.554 -10.954 -11.828 1.00 4.45  ? 617 ARG A HH22 2  
ATOM 3596  N N    . ARG A 1 104 ? -5.904  -9.544  -6.809  1.00 2.43  ? 618 ARG A N    2  
ATOM 3597  C CA   . ARG A 1 104 ? -5.581  -9.024  -5.457  1.00 2.99  ? 618 ARG A CA   2  
ATOM 3598  C C    . ARG A 1 104 ? -6.809  -8.379  -4.799  1.00 3.14  ? 618 ARG A C    2  
ATOM 3599  O O    . ARG A 1 104 ? -7.584  -7.709  -5.480  1.00 3.26  ? 618 ARG A O    2  
ATOM 3600  C CB   . ARG A 1 104 ? -4.388  -8.051  -5.543  1.00 3.55  ? 618 ARG A CB   2  
ATOM 3601  C CG   . ARG A 1 104 ? -3.029  -8.776  -5.428  1.00 3.85  ? 618 ARG A CG   2  
ATOM 3602  C CD   . ARG A 1 104 ? -1.894  -8.014  -6.123  1.00 5.33  ? 618 ARG A CD   2  
ATOM 3603  N NE   . ARG A 1 104 ? -2.072  -8.089  -7.580  1.00 7.00  ? 618 ARG A NE   2  
ATOM 3604  C CZ   . ARG A 1 104 ? -1.484  -7.377  -8.515  1.00 8.84  ? 618 ARG A CZ   2  
ATOM 3605  N NH1  . ARG A 1 104 ? -0.589  -6.468  -8.288  1.00 9.51  ? 618 ARG A NH1  2  
ATOM 3606  N NH2  . ARG A 1 104 ? -1.811  -7.612  -9.746  1.00 10.33 ? 618 ARG A NH2  2  
ATOM 3607  H H    . ARG A 1 104 ? -6.474  -8.949  -7.396  1.00 2.32  ? 618 ARG A H    2  
ATOM 3608  H HA   . ARG A 1 104 ? -5.299  -9.855  -4.809  1.00 3.08  ? 618 ARG A HA   2  
ATOM 3609  H HB2  . ARG A 1 104 ? -4.449  -7.503  -6.484  1.00 4.06  ? 618 ARG A HB2  2  
ATOM 3610  H HB3  . ARG A 1 104 ? -4.447  -7.319  -4.736  1.00 3.76  ? 618 ARG A HB3  2  
ATOM 3611  H HG2  . ARG A 1 104 ? -2.779  -8.901  -4.376  1.00 3.78  ? 618 ARG A HG2  2  
ATOM 3612  H HG3  . ARG A 1 104 ? -3.096  -9.768  -5.875  1.00 4.07  ? 618 ARG A HG3  2  
ATOM 3613  H HD2  . ARG A 1 104 ? -1.868  -6.976  -5.781  1.00 5.55  ? 618 ARG A HD2  2  
ATOM 3614  H HD3  . ARG A 1 104 ? -0.943  -8.483  -5.858  1.00 5.59  ? 618 ARG A HD3  2  
ATOM 3615  H HE   . ARG A 1 104 ? -2.706  -8.799  -7.925  1.00 7.01  ? 618 ARG A HE   2  
ATOM 3616  H HH11 . ARG A 1 104 ? -0.188  -6.383  -7.352  1.00 8.67  ? 618 ARG A HH11 2  
ATOM 3617  H HH12 . ARG A 1 104 ? -0.223  -5.925  -9.060  1.00 11.07 ? 618 ARG A HH12 2  
ATOM 3618  H HH21 . ARG A 1 104 ? -2.424  -8.398  -9.913  1.00 10.10 ? 618 ARG A HH21 2  
ATOM 3619  H HH22 . ARG A 1 104 ? -1.174  -7.298  -10.472 1.00 11.71 ? 618 ARG A HH22 2  
ATOM 3620  N N    . THR A 1 105 ? -6.961  -8.571  -3.488  1.00 3.33  ? 619 THR A N    2  
ATOM 3621  C CA   . THR A 1 105 ? -8.265  -8.547  -2.792  1.00 2.96  ? 619 THR A CA   2  
ATOM 3622  C C    . THR A 1 105 ? -8.130  -8.027  -1.352  1.00 2.82  ? 619 THR A C    2  
ATOM 3623  O O    . THR A 1 105 ? -7.161  -8.365  -0.669  1.00 3.10  ? 619 THR A O    2  
ATOM 3624  C CB   . THR A 1 105 ? -8.858  -9.977  -2.731  1.00 3.13  ? 619 THR A CB   2  
ATOM 3625  O OG1  . THR A 1 105 ? -8.634  -10.685 -3.936  1.00 4.01  ? 619 THR A OG1  2  
ATOM 3626  C CG2  . THR A 1 105 ? -10.364 -9.983  -2.478  1.00 3.32  ? 619 THR A CG2  2  
ATOM 3627  H H    . THR A 1 105 ? -6.179  -8.967  -2.982  1.00 3.63  ? 619 THR A H    2  
ATOM 3628  H HA   . THR A 1 105 ? -8.959  -7.905  -3.337  1.00 2.80  ? 619 THR A HA   2  
ATOM 3629  H HB   . THR A 1 105 ? -8.368  -10.531 -1.930  1.00 3.76  ? 619 THR A HB   2  
ATOM 3630  H HG1  . THR A 1 105 ? -9.278  -11.413 -3.988  1.00 3.98  ? 619 THR A HG1  2  
ATOM 3631  H HG21 . THR A 1 105 ? -10.583 -9.541  -1.506  1.00 4.10  ? 619 THR A HG21 2  
ATOM 3632  H HG22 . THR A 1 105 ? -10.736 -11.007 -2.476  1.00 3.19  ? 619 THR A HG22 2  
ATOM 3633  H HG23 . THR A 1 105 ? -10.875 -9.415  -3.253  1.00 4.09  ? 619 THR A HG23 2  
ATOM 3634  N N    . ALA A 1 106 ? -9.097  -7.244  -0.859  1.00 2.45  ? 620 ALA A N    2  
ATOM 3635  C CA   . ALA A 1 106 ? -9.297  -6.984  0.578   1.00 2.07  ? 620 ALA A CA   2  
ATOM 3636  C C    . ALA A 1 106 ? -10.741 -6.528  0.874   1.00 1.79  ? 620 ALA A C    2  
ATOM 3637  O O    . ALA A 1 106 ? -11.306 -5.711  0.144   1.00 2.18  ? 620 ALA A O    2  
ATOM 3638  C CB   . ALA A 1 106 ? -8.292  -5.943  1.099   1.00 2.31  ? 620 ALA A CB   2  
ATOM 3639  H H    . ALA A 1 106 ? -9.862  -6.994  -1.480  1.00 2.36  ? 620 ALA A H    2  
ATOM 3640  H HA   . ALA A 1 106 ? -9.124  -7.916  1.119   1.00 2.00  ? 620 ALA A HA   2  
ATOM 3641  H HB1  . ALA A 1 106 ? -8.367  -5.883  2.186   1.00 2.63  ? 620 ALA A HB1  2  
ATOM 3642  H HB2  . ALA A 1 106 ? -7.273  -6.227  0.840   1.00 2.84  ? 620 ALA A HB2  2  
ATOM 3643  H HB3  . ALA A 1 106 ? -8.515  -4.962  0.686   1.00 2.89  ? 620 ALA A HB3  2  
ATOM 3644  N N    . SER A 1 107 ? -11.336 -7.025  1.956   1.00 1.35  ? 621 SER A N    2  
ATOM 3645  C CA   . SER A 1 107 ? -12.728 -6.761  2.358   1.00 1.23  ? 621 SER A CA   2  
ATOM 3646  C C    . SER A 1 107 ? -12.784 -5.747  3.502   1.00 1.00  ? 621 SER A C    2  
ATOM 3647  O O    . SER A 1 107 ? -12.710 -6.115  4.676   1.00 0.99  ? 621 SER A O    2  
ATOM 3648  C CB   . SER A 1 107 ? -13.433 -8.081  2.719   1.00 1.64  ? 621 SER A CB   2  
ATOM 3649  O OG   . SER A 1 107 ? -12.566 -9.020  3.344   1.00 3.33  ? 621 SER A OG   2  
ATOM 3650  H H    . SER A 1 107 ? -10.790 -7.629  2.563   1.00 1.42  ? 621 SER A H    2  
ATOM 3651  H HA   . SER A 1 107 ? -13.273 -6.332  1.518   1.00 1.24  ? 621 SER A HA   2  
ATOM 3652  H HB2  . SER A 1 107 ? -14.293 -7.882  3.360   1.00 1.45  ? 621 SER A HB2  2  
ATOM 3653  H HB3  . SER A 1 107 ? -13.800 -8.530  1.796   1.00 2.57  ? 621 SER A HB3  2  
ATOM 3654  H HG   . SER A 1 107 ? -12.293 -8.676  4.215   1.00 4.22  ? 621 SER A HG   2  
ATOM 3655  N N    . VAL A 1 108 ? -12.820 -4.447  3.179   1.00 0.89  ? 622 VAL A N    2  
ATOM 3656  C CA   . VAL A 1 108 ? -12.697 -3.374  4.188   1.00 0.77  ? 622 VAL A CA   2  
ATOM 3657  C C    . VAL A 1 108 ? -13.361 -2.044  3.784   1.00 0.71  ? 622 VAL A C    2  
ATOM 3658  O O    . VAL A 1 108 ? -13.392 -1.681  2.604   1.00 0.71  ? 622 VAL A O    2  
ATOM 3659  C CB   . VAL A 1 108 ? -11.209 -3.232  4.591   1.00 0.79  ? 622 VAL A CB   2  
ATOM 3660  C CG1  . VAL A 1 108 ? -10.246 -3.155  3.409   1.00 0.86  ? 622 VAL A CG1  2  
ATOM 3661  C CG2  . VAL A 1 108 ? -10.925 -2.067  5.533   1.00 0.73  ? 622 VAL A CG2  2  
ATOM 3662  H H    . VAL A 1 108 ? -12.819 -4.193  2.197   1.00 0.94  ? 622 VAL A H    2  
ATOM 3663  H HA   . VAL A 1 108 ? -13.231 -3.701  5.081   1.00 0.79  ? 622 VAL A HA   2  
ATOM 3664  H HB   . VAL A 1 108 ? -10.942 -4.136  5.135   1.00 0.87  ? 622 VAL A HB   2  
ATOM 3665  H HG11 . VAL A 1 108 ? -10.245 -4.106  2.879   1.00 1.61  ? 622 VAL A HG11 2  
ATOM 3666  H HG12 . VAL A 1 108 ? -10.550 -2.364  2.731   1.00 1.57  ? 622 VAL A HG12 2  
ATOM 3667  H HG13 . VAL A 1 108 ? -9.238  -2.973  3.777   1.00 2.03  ? 622 VAL A HG13 2  
ATOM 3668  H HG21 . VAL A 1 108 ? -11.045 -1.117  5.011   1.00 1.45  ? 622 VAL A HG21 2  
ATOM 3669  H HG22 . VAL A 1 108 ? -11.606 -2.125  6.378   1.00 1.70  ? 622 VAL A HG22 2  
ATOM 3670  H HG23 . VAL A 1 108 ? -9.904  -2.147  5.906   1.00 1.65  ? 622 VAL A HG23 2  
ATOM 3671  N N    . ARG A 1 109 ? -13.873 -1.294  4.774   1.00 0.68  ? 623 ARG A N    2  
ATOM 3672  C CA   . ARG A 1 109 ? -14.544 0.015   4.626   1.00 0.65  ? 623 ARG A CA   2  
ATOM 3673  C C    . ARG A 1 109 ? -14.047 1.054   5.636   1.00 0.60  ? 623 ARG A C    2  
ATOM 3674  O O    . ARG A 1 109 ? -13.489 0.708   6.672   1.00 0.59  ? 623 ARG A O    2  
ATOM 3675  C CB   . ARG A 1 109 ? -16.071 -0.187  4.703   1.00 0.74  ? 623 ARG A CB   2  
ATOM 3676  C CG   . ARG A 1 109 ? -16.609 -0.430  6.123   1.00 0.83  ? 623 ARG A CG   2  
ATOM 3677  C CD   . ARG A 1 109 ? -17.955 -1.164  6.109   1.00 1.04  ? 623 ARG A CD   2  
ATOM 3678  N NE   . ARG A 1 109 ? -18.973 -0.447  5.323   1.00 2.13  ? 623 ARG A NE   2  
ATOM 3679  C CZ   . ARG A 1 109 ? -20.203 -0.855  5.097   1.00 2.96  ? 623 ARG A CZ   2  
ATOM 3680  N NH1  . ARG A 1 109 ? -20.680 -1.972  5.543   1.00 2.94  ? 623 ARG A NH1  2  
ATOM 3681  N NH2  . ARG A 1 109 ? -21.018 -0.126  4.409   1.00 4.20  ? 623 ARG A NH2  2  
ATOM 3682  H H    . ARG A 1 109 ? -13.787 -1.645  5.727   1.00 0.69  ? 623 ARG A H    2  
ATOM 3683  H HA   . ARG A 1 109 ? -14.310 0.419   3.642   1.00 0.64  ? 623 ARG A HA   2  
ATOM 3684  H HB2  . ARG A 1 109 ? -16.570 0.694   4.304   1.00 0.77  ? 623 ARG A HB2  2  
ATOM 3685  H HB3  . ARG A 1 109 ? -16.337 -1.032  4.069   1.00 0.81  ? 623 ARG A HB3  2  
ATOM 3686  H HG2  . ARG A 1 109 ? -15.903 -1.039  6.680   1.00 1.14  ? 623 ARG A HG2  2  
ATOM 3687  H HG3  . ARG A 1 109 ? -16.719 0.524   6.641   1.00 1.17  ? 623 ARG A HG3  2  
ATOM 3688  H HD2  . ARG A 1 109 ? -17.809 -2.161  5.688   1.00 0.96  ? 623 ARG A HD2  2  
ATOM 3689  H HD3  . ARG A 1 109 ? -18.302 -1.276  7.139   1.00 1.77  ? 623 ARG A HD3  2  
ATOM 3690  H HE   . ARG A 1 109 ? -18.739 0.450   4.919   1.00 2.68  ? 623 ARG A HE   2  
ATOM 3691  H HH11 . ARG A 1 109 ? -20.107 -2.605  6.094   1.00 2.42  ? 623 ARG A HH11 2  
ATOM 3692  H HH12 . ARG A 1 109 ? -21.642 -2.195  5.329   1.00 3.75  ? 623 ARG A HH12 2  
ATOM 3693  H HH21 . ARG A 1 109 ? -20.714 0.778   4.067   1.00 4.63  ? 623 ARG A HH21 2  
ATOM 3694  H HH22 . ARG A 1 109 ? -21.988 -0.409  4.372   1.00 4.81  ? 623 ARG A HH22 2  
ATOM 3695  N N    . ALA A 1 110 ? -14.246 2.334   5.353   1.00 0.62  ? 624 ALA A N    2  
ATOM 3696  C CA   . ALA A 1 110 ? -13.857 3.419   6.252   1.00 0.60  ? 624 ALA A CA   2  
ATOM 3697  C C    . ALA A 1 110 ? -14.885 3.592   7.386   1.00 0.60  ? 624 ALA A C    2  
ATOM 3698  O O    . ALA A 1 110 ? -16.080 3.707   7.123   1.00 0.73  ? 624 ALA A O    2  
ATOM 3699  C CB   . ALA A 1 110 ? -13.650 4.687   5.419   1.00 0.77  ? 624 ALA A CB   2  
ATOM 3700  H H    . ALA A 1 110 ? -14.750 2.565   4.503   1.00 0.65  ? 624 ALA A H    2  
ATOM 3701  H HA   . ALA A 1 110 ? -12.901 3.171   6.709   1.00 0.67  ? 624 ALA A HA   2  
ATOM 3702  H HB1  . ALA A 1 110 ? -12.960 4.486   4.598   1.00 1.84  ? 624 ALA A HB1  2  
ATOM 3703  H HB2  . ALA A 1 110 ? -14.602 5.028   5.010   1.00 1.29  ? 624 ALA A HB2  2  
ATOM 3704  H HB3  . ALA A 1 110 ? -13.223 5.468   6.044   1.00 1.86  ? 624 ALA A HB3  2  
ATOM 3705  N N    . ASP A 1 111 ? -14.447 3.646   8.650   1.00 0.64  ? 625 ASP A N    2  
ATOM 3706  C CA   . ASP A 1 111 ? -15.360 3.861   9.797   1.00 0.81  ? 625 ASP A CA   2  
ATOM 3707  C C    . ASP A 1 111 ? -15.754 5.336   9.980   1.00 0.86  ? 625 ASP A C    2  
ATOM 3708  O O    . ASP A 1 111 ? -16.614 5.695   10.787  1.00 0.93  ? 625 ASP A O    2  
ATOM 3709  C CB   . ASP A 1 111 ? -14.694 3.385   11.097  1.00 1.03  ? 625 ASP A CB   2  
ATOM 3710  C CG   . ASP A 1 111 ? -15.744 2.898   12.105  1.00 1.50  ? 625 ASP A CG   2  
ATOM 3711  O OD1  . ASP A 1 111 ? -16.610 2.057   11.740  1.00 2.73  ? 625 ASP A OD1  2  
ATOM 3712  O OD2  . ASP A 1 111 ? -15.754 3.393   13.255  1.00 1.98  ? 625 ASP A OD2  2  
ATOM 3713  H H    . ASP A 1 111 ? -13.449 3.611   8.832   1.00 0.69  ? 625 ASP A H    2  
ATOM 3714  H HA   . ASP A 1 111 ? -16.271 3.287   9.622   1.00 0.88  ? 625 ASP A HA   2  
ATOM 3715  H HB2  . ASP A 1 111 ? -13.954 2.620   10.884  1.00 1.08  ? 625 ASP A HB2  2  
ATOM 3716  H HB3  . ASP A 1 111 ? -14.128 4.209   11.533  1.00 1.08  ? 625 ASP A HB3  2  
ATOM 3717  N N    . THR A 1 112 ? -15.024 6.189   9.274   1.00 0.83  ? 626 THR A N    2  
ATOM 3718  C CA   . THR A 1 112 ? -14.893 7.638   9.462   1.00 0.80  ? 626 THR A CA   2  
ATOM 3719  C C    . THR A 1 112 ? -14.332 8.249   8.165   1.00 0.71  ? 626 THR A C    2  
ATOM 3720  O O    . THR A 1 112 ? -13.975 7.514   7.245   1.00 0.68  ? 626 THR A O    2  
ATOM 3721  C CB   . THR A 1 112 ? -13.999 7.911   10.692  1.00 0.87  ? 626 THR A CB   2  
ATOM 3722  O OG1  . THR A 1 112 ? -13.716 9.286   10.859  1.00 0.88  ? 626 THR A OG1  2  
ATOM 3723  C CG2  . THR A 1 112 ? -12.669 7.156   10.629  1.00 0.97  ? 626 THR A CG2  2  
ATOM 3724  H H    . THR A 1 112 ? -14.373 5.750   8.629   1.00 0.83  ? 626 THR A H    2  
ATOM 3725  H HA   . THR A 1 112 ? -15.872 8.068   9.655   1.00 0.83  ? 626 THR A HA   2  
ATOM 3726  H HB   . THR A 1 112 ? -14.528 7.572   11.583  1.00 0.94  ? 626 THR A HB   2  
ATOM 3727  H HG1  . THR A 1 112 ? -14.461 9.685   11.360  1.00 1.44  ? 626 THR A HG1  2  
ATOM 3728  H HG21 . THR A 1 112 ? -12.852 6.073   10.682  1.00 2.09  ? 626 THR A HG21 2  
ATOM 3729  H HG22 . THR A 1 112 ? -12.051 7.443   11.480  1.00 1.77  ? 626 THR A HG22 2  
ATOM 3730  H HG23 . THR A 1 112 ? -12.153 7.405   9.703   1.00 1.39  ? 626 THR A HG23 2  
ATOM 3731  N N    . TYR A 1 113 ? -14.247 9.575   8.052   1.00 0.73  ? 627 TYR A N    2  
ATOM 3732  C CA   . TYR A 1 113 ? -13.638 10.252  6.910   1.00 0.74  ? 627 TYR A CA   2  
ATOM 3733  C C    . TYR A 1 113 ? -12.117 10.008  6.974   1.00 0.71  ? 627 TYR A C    2  
ATOM 3734  O O    . TYR A 1 113 ? -11.423 10.587  7.812   1.00 0.84  ? 627 TYR A O    2  
ATOM 3735  C CB   . TYR A 1 113 ? -14.084 11.723  6.966   1.00 0.88  ? 627 TYR A CB   2  
ATOM 3736  C CG   . TYR A 1 113 ? -13.678 12.705  5.872   1.00 1.28  ? 627 TYR A CG   2  
ATOM 3737  C CD1  . TYR A 1 113 ? -12.359 12.790  5.384   1.00 1.77  ? 627 TYR A CD1  2  
ATOM 3738  C CD2  . TYR A 1 113 ? -14.637 13.632  5.417   1.00 2.70  ? 627 TYR A CD2  2  
ATOM 3739  C CE1  . TYR A 1 113 ? -12.014 13.768  4.431   1.00 2.13  ? 627 TYR A CE1  2  
ATOM 3740  C CE2  . TYR A 1 113 ? -14.294 14.621  4.473   1.00 3.17  ? 627 TYR A CE2  2  
ATOM 3741  C CZ   . TYR A 1 113 ? -12.976 14.691  3.979   1.00 2.40  ? 627 TYR A CZ   2  
ATOM 3742  O OH   . TYR A 1 113 ? -12.615 15.637  3.074   1.00 2.96  ? 627 TYR A OH   2  
ATOM 3743  H H    . TYR A 1 113 ? -14.402 10.133  8.878   1.00 0.78  ? 627 TYR A H    2  
ATOM 3744  H HA   . TYR A 1 113 ? -14.035 9.820   5.997   1.00 0.72  ? 627 TYR A HA   2  
ATOM 3745  H HB2  . TYR A 1 113 ? -15.173 11.719  7.013   1.00 1.11  ? 627 TYR A HB2  2  
ATOM 3746  H HB3  . TYR A 1 113 ? -13.755 12.133  7.907   1.00 0.85  ? 627 TYR A HB3  2  
ATOM 3747  H HD1  . TYR A 1 113 ? -11.599 12.119  5.746   1.00 2.75  ? 627 TYR A HD1  2  
ATOM 3748  H HD2  . TYR A 1 113 ? -15.642 13.595  5.822   1.00 3.73  ? 627 TYR A HD2  2  
ATOM 3749  H HE1  . TYR A 1 113 ? -11.025 13.792  3.990   1.00 3.03  ? 627 TYR A HE1  2  
ATOM 3750  H HE2  . TYR A 1 113 ? -15.035 15.332  4.139   1.00 4.45  ? 627 TYR A HE2  2  
ATOM 3751  H HH   . TYR A 1 113 ? -13.374 16.212  2.823   1.00 3.68  ? 627 TYR A HH   2  
ATOM 3752  N N    . CYS A 1 114 ? -11.606 9.132   6.107   1.00 0.63  ? 628 CYS A N    2  
ATOM 3753  C CA   . CYS A 1 114 ? -10.241 8.596   6.152   1.00 0.61  ? 628 CYS A CA   2  
ATOM 3754  C C    . CYS A 1 114 ? -9.421  9.022   4.924   1.00 0.61  ? 628 CYS A C    2  
ATOM 3755  O O    . CYS A 1 114 ? -9.880  8.886   3.787   1.00 0.63  ? 628 CYS A O    2  
ATOM 3756  C CB   . CYS A 1 114 ? -10.327 7.065   6.287   1.00 0.58  ? 628 CYS A CB   2  
ATOM 3757  S SG   . CYS A 1 114 ? -8.715  6.361   6.717   1.00 2.47  ? 628 CYS A SG   2  
ATOM 3758  H H    . CYS A 1 114 ? -12.240 8.746   5.413   1.00 0.65  ? 628 CYS A H    2  
ATOM 3759  H HA   . CYS A 1 114 ? -9.738  8.982   7.040   1.00 0.66  ? 628 CYS A HA   2  
ATOM 3760  H HB2  . CYS A 1 114 ? -11.056 6.804   7.056   1.00 1.45  ? 628 CYS A HB2  2  
ATOM 3761  H HB3  . CYS A 1 114 ? -10.633 6.625   5.338   1.00 1.12  ? 628 CYS A HB3  2  
ATOM 3762  H HG   . CYS A 1 114 ? -9.116  5.086   6.794   1.00 3.32  ? 628 CYS A HG   2  
ATOM 3763  N N    . ARG A 1 115 ? -8.197  9.508   5.159   1.00 0.62  ? 629 ARG A N    2  
ATOM 3764  C CA   . ARG A 1 115 ? -7.187  9.856   4.149   1.00 0.64  ? 629 ARG A CA   2  
ATOM 3765  C C    . ARG A 1 115 ? -6.265  8.656   3.899   1.00 0.65  ? 629 ARG A C    2  
ATOM 3766  O O    . ARG A 1 115 ? -5.568  8.184   4.806   1.00 0.71  ? 629 ARG A O    2  
ATOM 3767  C CB   . ARG A 1 115 ? -6.338  11.056  4.626   1.00 0.78  ? 629 ARG A CB   2  
ATOM 3768  C CG   . ARG A 1 115 ? -7.080  12.313  5.110   1.00 1.50  ? 629 ARG A CG   2  
ATOM 3769  C CD   . ARG A 1 115 ? -7.896  12.992  4.007   1.00 1.68  ? 629 ARG A CD   2  
ATOM 3770  N NE   . ARG A 1 115 ? -8.376  14.318  4.436   1.00 2.75  ? 629 ARG A NE   2  
ATOM 3771  C CZ   . ARG A 1 115 ? -8.122  15.503  3.909   1.00 3.06  ? 629 ARG A CZ   2  
ATOM 3772  N NH1  . ARG A 1 115 ? -7.281  15.711  2.938   1.00 2.95  ? 629 ARG A NH1  2  
ATOM 3773  N NH2  . ARG A 1 115 ? -8.743  16.526  4.400   1.00 4.40  ? 629 ARG A NH2  2  
ATOM 3774  H H    . ARG A 1 115 ? -7.901  9.551   6.131   1.00 0.65  ? 629 ARG A H    2  
ATOM 3775  H HA   . ARG A 1 115 ? -7.679  10.108  3.198   1.00 0.66  ? 629 ARG A HA   2  
ATOM 3776  H HB2  . ARG A 1 115 ? -5.706  10.725  5.450   1.00 1.59  ? 629 ARG A HB2  2  
ATOM 3777  H HB3  . ARG A 1 115 ? -5.678  11.348  3.812   1.00 1.16  ? 629 ARG A HB3  2  
ATOM 3778  H HG2  . ARG A 1 115 ? -7.732  12.064  5.947   1.00 2.56  ? 629 ARG A HG2  2  
ATOM 3779  H HG3  . ARG A 1 115 ? -6.331  13.021  5.470   1.00 2.18  ? 629 ARG A HG3  2  
ATOM 3780  H HD2  . ARG A 1 115 ? -7.294  13.075  3.105   1.00 1.60  ? 629 ARG A HD2  2  
ATOM 3781  H HD3  . ARG A 1 115 ? -8.751  12.361  3.770   1.00 2.23  ? 629 ARG A HD3  2  
ATOM 3782  H HE   . ARG A 1 115 ? -8.984  14.355  5.246   1.00 3.87  ? 629 ARG A HE   2  
ATOM 3783  H HH11 . ARG A 1 115 ? -6.581  14.999  2.749   1.00 2.78  ? 629 ARG A HH11 2  
ATOM 3784  H HH12 . ARG A 1 115 ? -7.186  16.640  2.531   1.00 3.74  ? 629 ARG A HH12 2  
ATOM 3785  H HH21 . ARG A 1 115 ? -9.322  16.373  5.217   1.00 5.24  ? 629 ARG A HH21 2  
ATOM 3786  H HH22 . ARG A 1 115 ? -8.462  17.464  4.141   1.00 4.67  ? 629 ARG A HH22 2  
ATOM 3787  N N    . LEU A 1 116 ? -6.249  8.187   2.659   1.00 0.63  ? 630 LEU A N    2  
ATOM 3788  C CA   . LEU A 1 116 ? -5.364  7.143   2.148   1.00 0.62  ? 630 LEU A CA   2  
ATOM 3789  C C    . LEU A 1 116 ? -4.327  7.720   1.166   1.00 0.70  ? 630 LEU A C    2  
ATOM 3790  O O    . LEU A 1 116 ? -4.433  8.851   0.678   1.00 0.86  ? 630 LEU A O    2  
ATOM 3791  C CB   . LEU A 1 116 ? -6.196  6.018   1.489   1.00 0.60  ? 630 LEU A CB   2  
ATOM 3792  C CG   . LEU A 1 116 ? -7.303  5.371   2.350   1.00 0.63  ? 630 LEU A CG   2  
ATOM 3793  C CD1  . LEU A 1 116 ? -7.912  4.176   1.608   1.00 0.67  ? 630 LEU A CD1  2  
ATOM 3794  C CD2  . LEU A 1 116 ? -6.777  4.849   3.685   1.00 0.76  ? 630 LEU A CD2  2  
ATOM 3795  H H    . LEU A 1 116 ? -6.823  8.670   1.973   1.00 0.62  ? 630 LEU A H    2  
ATOM 3796  H HA   . LEU A 1 116 ? -4.805  6.707   2.975   1.00 0.63  ? 630 LEU A HA   2  
ATOM 3797  H HB2  . LEU A 1 116 ? -6.660  6.417   0.585   1.00 0.60  ? 630 LEU A HB2  2  
ATOM 3798  H HB3  . LEU A 1 116 ? -5.503  5.231   1.187   1.00 0.66  ? 630 LEU A HB3  2  
ATOM 3799  H HG   . LEU A 1 116 ? -8.091  6.101   2.540   1.00 0.64  ? 630 LEU A HG   2  
ATOM 3800  H HD11 . LEU A 1 116 ? -8.741  3.754   2.178   1.00 1.25  ? 630 LEU A HD11 2  
ATOM 3801  H HD12 . LEU A 1 116 ? -7.157  3.407   1.441   1.00 1.66  ? 630 LEU A HD12 2  
ATOM 3802  H HD13 . LEU A 1 116 ? -8.295  4.507   0.646   1.00 1.42  ? 630 LEU A HD13 2  
ATOM 3803  H HD21 . LEU A 1 116 ? -6.470  5.688   4.305   1.00 1.50  ? 630 LEU A HD21 2  
ATOM 3804  H HD22 . LEU A 1 116 ? -5.930  4.188   3.510   1.00 1.90  ? 630 LEU A HD22 2  
ATOM 3805  H HD23 . LEU A 1 116 ? -7.566  4.311   4.210   1.00 1.55  ? 630 LEU A HD23 2  
ATOM 3806  N N    . TYR A 1 117 ? -3.328  6.905   0.848   1.00 0.64  ? 631 TYR A N    2  
ATOM 3807  C CA   . TYR A 1 117 ? -2.329  7.148   -0.191  1.00 0.68  ? 631 TYR A CA   2  
ATOM 3808  C C    . TYR A 1 117 ? -2.215  5.907   -1.089  1.00 0.76  ? 631 TYR A C    2  
ATOM 3809  O O    . TYR A 1 117 ? -2.284  4.779   -0.589  1.00 1.08  ? 631 TYR A O    2  
ATOM 3810  C CB   . TYR A 1 117 ? -0.998  7.534   0.472   1.00 0.88  ? 631 TYR A CB   2  
ATOM 3811  C CG   . TYR A 1 117 ? -0.499  8.919   0.112   1.00 2.32  ? 631 TYR A CG   2  
ATOM 3812  C CD1  . TYR A 1 117 ? 0.079   9.134   -1.149  1.00 3.35  ? 631 TYR A CD1  2  
ATOM 3813  C CD2  . TYR A 1 117 ? -0.613  9.986   1.024   1.00 3.86  ? 631 TYR A CD2  2  
ATOM 3814  C CE1  . TYR A 1 117 ? 0.541   10.419  -1.503  1.00 4.97  ? 631 TYR A CE1  2  
ATOM 3815  C CE2  . TYR A 1 117 ? -0.147  11.271  0.676   1.00 5.44  ? 631 TYR A CE2  2  
ATOM 3816  C CZ   . TYR A 1 117 ? 0.434   11.489  -0.593  1.00 5.80  ? 631 TYR A CZ   2  
ATOM 3817  O OH   . TYR A 1 117 ? 0.885   12.720  -0.959  1.00 7.52  ? 631 TYR A OH   2  
ATOM 3818  H H    . TYR A 1 117 ? -3.264  6.020   1.339   1.00 0.63  ? 631 TYR A H    2  
ATOM 3819  H HA   . TYR A 1 117 ? -2.656  7.980   -0.811  1.00 0.67  ? 631 TYR A HA   2  
ATOM 3820  H HB2  . TYR A 1 117 ? -1.107  7.479   1.554   1.00 1.80  ? 631 TYR A HB2  2  
ATOM 3821  H HB3  . TYR A 1 117 ? -0.236  6.809   0.187   1.00 1.53  ? 631 TYR A HB3  2  
ATOM 3822  H HD1  . TYR A 1 117 ? 0.140   8.305   -1.846  1.00 3.61  ? 631 TYR A HD1  2  
ATOM 3823  H HD2  . TYR A 1 117 ? -1.061  9.816   1.991   1.00 4.31  ? 631 TYR A HD2  2  
ATOM 3824  H HE1  . TYR A 1 117 ? 0.966   10.608  -2.475  1.00 6.02  ? 631 TYR A HE1  2  
ATOM 3825  H HE2  . TYR A 1 117 ? -0.230  12.089  1.377   1.00 6.74  ? 631 TYR A HE2  2  
ATOM 3826  H HH   . TYR A 1 117 ? 0.657   13.419  -0.323  1.00 8.23  ? 631 TYR A HH   2  
ATOM 3827  N N    . SER A 1 118 ? -2.057  6.106   -2.403  1.00 0.64  ? 632 SER A N    2  
ATOM 3828  C CA   . SER A 1 118 ? -2.211  5.060   -3.423  1.00 0.72  ? 632 SER A CA   2  
ATOM 3829  C C    . SER A 1 118 ? -0.963  4.947   -4.302  1.00 0.69  ? 632 SER A C    2  
ATOM 3830  O O    . SER A 1 118 ? -0.544  5.937   -4.904  1.00 0.80  ? 632 SER A O    2  
ATOM 3831  C CB   . SER A 1 118 ? -3.434  5.371   -4.302  1.00 0.99  ? 632 SER A CB   2  
ATOM 3832  O OG   . SER A 1 118 ? -4.588  5.635   -3.524  1.00 2.22  ? 632 SER A OG   2  
ATOM 3833  H H    . SER A 1 118 ? -2.005  7.060   -2.754  1.00 0.61  ? 632 SER A H    2  
ATOM 3834  H HA   . SER A 1 118 ? -2.376  4.103   -2.935  1.00 0.83  ? 632 SER A HA   2  
ATOM 3835  H HB2  . SER A 1 118 ? -3.221  6.248   -4.916  1.00 2.14  ? 632 SER A HB2  2  
ATOM 3836  H HB3  . SER A 1 118 ? -3.627  4.522   -4.958  1.00 1.57  ? 632 SER A HB3  2  
ATOM 3837  H HG   . SER A 1 118 ? -5.349  5.758   -4.132  1.00 2.37  ? 632 SER A HG   2  
ATOM 3838  N N    . LEU A 1 119 ? -0.363  3.754   -4.412  1.00 0.71  ? 633 LEU A N    2  
ATOM 3839  C CA   . LEU A 1 119 ? 0.934   3.540   -5.077  1.00 0.76  ? 633 LEU A CA   2  
ATOM 3840  C C    . LEU A 1 119 ? 0.872   2.340   -6.040  1.00 0.76  ? 633 LEU A C    2  
ATOM 3841  O O    . LEU A 1 119 ? 0.673   1.194   -5.633  1.00 0.77  ? 633 LEU A O    2  
ATOM 3842  C CB   . LEU A 1 119 ? 2.024   3.407   -3.986  1.00 0.86  ? 633 LEU A CB   2  
ATOM 3843  C CG   . LEU A 1 119 ? 3.462   3.807   -4.392  1.00 1.02  ? 633 LEU A CG   2  
ATOM 3844  C CD1  . LEU A 1 119 ? 4.360   3.712   -3.157  1.00 1.24  ? 633 LEU A CD1  2  
ATOM 3845  C CD2  . LEU A 1 119 ? 4.058   2.912   -5.478  1.00 1.50  ? 633 LEU A CD2  2  
ATOM 3846  H H    . LEU A 1 119 ? -0.782  2.960   -3.934  1.00 0.74  ? 633 LEU A H    2  
ATOM 3847  H HA   . LEU A 1 119 ? 1.176   4.416   -5.677  1.00 0.82  ? 633 LEU A HA   2  
ATOM 3848  H HB2  . LEU A 1 119 ? 1.744   4.054   -3.153  1.00 0.86  ? 633 LEU A HB2  2  
ATOM 3849  H HB3  . LEU A 1 119 ? 2.026   2.385   -3.605  1.00 1.02  ? 633 LEU A HB3  2  
ATOM 3850  H HG   . LEU A 1 119 ? 3.484   4.844   -4.745  1.00 0.99  ? 633 LEU A HG   2  
ATOM 3851  H HD11 . LEU A 1 119 ? 4.391   2.686   -2.789  1.00 2.25  ? 633 LEU A HD11 2  
ATOM 3852  H HD12 . LEU A 1 119 ? 3.984   4.369   -2.374  1.00 2.13  ? 633 LEU A HD12 2  
ATOM 3853  H HD13 . LEU A 1 119 ? 5.371   4.029   -3.410  1.00 1.69  ? 633 LEU A HD13 2  
ATOM 3854  H HD21 . LEU A 1 119 ? 3.564   3.102   -6.428  1.00 2.03  ? 633 LEU A HD21 2  
ATOM 3855  H HD22 . LEU A 1 119 ? 3.940   1.862   -5.206  1.00 2.57  ? 633 LEU A HD22 2  
ATOM 3856  H HD23 . LEU A 1 119 ? 5.117   3.135   -5.602  1.00 1.90  ? 633 LEU A HD23 2  
ATOM 3857  N N    . SER A 1 120 ? 1.036   2.611   -7.334  1.00 0.84  ? 634 SER A N    2  
ATOM 3858  C CA   . SER A 1 120 ? 1.037   1.612   -8.408  1.00 0.86  ? 634 SER A CA   2  
ATOM 3859  C C    . SER A 1 120 ? 2.374   0.873   -8.541  1.00 0.78  ? 634 SER A C    2  
ATOM 3860  O O    . SER A 1 120 ? 3.454   1.475   -8.562  1.00 0.75  ? 634 SER A O    2  
ATOM 3861  C CB   . SER A 1 120 ? 0.622   2.270   -9.729  1.00 1.01  ? 634 SER A CB   2  
ATOM 3862  O OG   . SER A 1 120 ? 1.244   3.529   -9.904  1.00 2.16  ? 634 SER A OG   2  
ATOM 3863  H H    . SER A 1 120 ? 1.172   3.571   -7.624  1.00 0.91  ? 634 SER A H    2  
ATOM 3864  H HA   . SER A 1 120 ? 0.287   0.858   -8.175  1.00 0.94  ? 634 SER A HA   2  
ATOM 3865  H HB2  . SER A 1 120 ? 0.864   1.616   -10.565 1.00 1.31  ? 634 SER A HB2  2  
ATOM 3866  H HB3  . SER A 1 120 ? -0.454  2.429   -9.715  1.00 1.97  ? 634 SER A HB3  2  
ATOM 3867  H HG   . SER A 1 120 ? 1.033   3.828   -10.812 1.00 2.25  ? 634 SER A HG   2  
ATOM 3868  N N    . VAL A 1 121 ? 2.316   -0.457  -8.679  1.00 0.87  ? 635 VAL A N    2  
ATOM 3869  C CA   . VAL A 1 121 ? 3.519   -1.292  -8.794  1.00 0.95  ? 635 VAL A CA   2  
ATOM 3870  C C    . VAL A 1 121 ? 4.284   -1.048  -10.094 1.00 0.95  ? 635 VAL A C    2  
ATOM 3871  O O    . VAL A 1 121 ? 5.493   -1.249  -10.123 1.00 1.08  ? 635 VAL A O    2  
ATOM 3872  C CB   . VAL A 1 121 ? 3.254   -2.796  -8.582  1.00 1.11  ? 635 VAL A CB   2  
ATOM 3873  C CG1  . VAL A 1 121 ? 2.555   -3.085  -7.253  1.00 1.72  ? 635 VAL A CG1  2  
ATOM 3874  C CG2  . VAL A 1 121 ? 2.472   -3.480  -9.694  1.00 1.86  ? 635 VAL A CG2  2  
ATOM 3875  H H    . VAL A 1 121 ? 1.411   -0.897  -8.805  1.00 0.96  ? 635 VAL A H    2  
ATOM 3876  H HA   . VAL A 1 121 ? 4.185   -0.989  -7.989  1.00 1.02  ? 635 VAL A HA   2  
ATOM 3877  H HB   . VAL A 1 121 ? 4.221   -3.285  -8.551  1.00 2.02  ? 635 VAL A HB   2  
ATOM 3878  H HG11 . VAL A 1 121 ? 1.496   -2.820  -7.320  1.00 2.13  ? 635 VAL A HG11 2  
ATOM 3879  H HG12 . VAL A 1 121 ? 2.661   -4.150  -7.025  1.00 2.47  ? 635 VAL A HG12 2  
ATOM 3880  H HG13 . VAL A 1 121 ? 3.025   -2.511  -6.457  1.00 2.90  ? 635 VAL A HG13 2  
ATOM 3881  H HG21 . VAL A 1 121 ? 1.467   -3.071  -9.756  1.00 2.88  ? 635 VAL A HG21 2  
ATOM 3882  H HG22 . VAL A 1 121 ? 2.996   -3.365  -10.643 1.00 2.59  ? 635 VAL A HG22 2  
ATOM 3883  H HG23 . VAL A 1 121 ? 2.406   -4.542  -9.462  1.00 2.30  ? 635 VAL A HG23 2  
ATOM 3884  N N    . ASP A 1 122 ? 3.634   -0.552  -11.150 1.00 0.91  ? 636 ASP A N    2  
ATOM 3885  C CA   . ASP A 1 122 ? 4.313   -0.155  -12.397 1.00 1.06  ? 636 ASP A CA   2  
ATOM 3886  C C    . ASP A 1 122 ? 5.375   0.937   -12.185 1.00 0.98  ? 636 ASP A C    2  
ATOM 3887  O O    . ASP A 1 122 ? 6.408   0.908   -12.859 1.00 1.17  ? 636 ASP A O    2  
ATOM 3888  C CB   . ASP A 1 122 ? 3.298   0.360   -13.428 1.00 1.20  ? 636 ASP A CB   2  
ATOM 3889  C CG   . ASP A 1 122 ? 2.758   -0.759  -14.324 1.00 1.64  ? 636 ASP A CG   2  
ATOM 3890  O OD1  . ASP A 1 122 ? 3.459   -1.119  -15.303 1.00 2.72  ? 636 ASP A OD1  2  
ATOM 3891  O OD2  . ASP A 1 122 ? 1.624   -1.247  -14.097 1.00 1.90  ? 636 ASP A OD2  2  
ATOM 3892  H H    . ASP A 1 122 ? 2.621   -0.487  -11.083 1.00 0.87  ? 636 ASP A H    2  
ATOM 3893  H HA   . ASP A 1 122 ? 4.822   -1.029  -12.809 1.00 1.29  ? 636 ASP A HA   2  
ATOM 3894  H HB2  . ASP A 1 122 ? 2.511   0.916   -12.914 1.00 1.32  ? 636 ASP A HB2  2  
ATOM 3895  H HB3  . ASP A 1 122 ? 3.795   1.074   -14.086 1.00 1.55  ? 636 ASP A HB3  2  
ATOM 3896  N N    . ASN A 1 123 ? 5.147   1.886   -11.265 1.00 0.82  ? 637 ASN A N    2  
ATOM 3897  C CA   . ASN A 1 123 ? 6.121   2.924   -10.895 1.00 0.78  ? 637 ASN A CA   2  
ATOM 3898  C C    . ASN A 1 123 ? 7.129   2.409   -9.851  1.00 0.74  ? 637 ASN A C    2  
ATOM 3899  O O    . ASN A 1 123 ? 8.304   2.753   -9.913  1.00 0.90  ? 637 ASN A O    2  
ATOM 3900  C CB   . ASN A 1 123 ? 5.382   4.186   -10.422 1.00 0.87  ? 637 ASN A CB   2  
ATOM 3901  C CG   . ASN A 1 123 ? 4.554   4.823   -11.523 1.00 1.28  ? 637 ASN A CG   2  
ATOM 3902  O OD1  . ASN A 1 123 ? 3.338   4.910   -11.443 1.00 2.22  ? 637 ASN A OD1  2  
ATOM 3903  N ND2  . ASN A 1 123 ? 5.160   5.305   -12.578 1.00 1.19  ? 637 ASN A ND2  2  
ATOM 3904  H H    . ASN A 1 123 ? 4.275   1.852   -10.751 1.00 0.81  ? 637 ASN A H    2  
ATOM 3905  H HA   . ASN A 1 123 ? 6.702   3.215   -11.772 1.00 0.80  ? 637 ASN A HA   2  
ATOM 3906  H HB2  . ASN A 1 123 ? 4.729   3.940   -9.584  1.00 0.98  ? 637 ASN A HB2  2  
ATOM 3907  H HB3  . ASN A 1 123 ? 6.115   4.920   -10.087 1.00 1.00  ? 637 ASN A HB3  2  
ATOM 3908  H HD21 . ASN A 1 123 ? 6.173   5.304   -12.680 1.00 1.61  ? 637 ASN A HD21 2  
ATOM 3909  H HD22 . ASN A 1 123 ? 4.583   5.747   -13.283 1.00 1.34  ? 637 ASN A HD22 2  
ATOM 3910  N N    . PHE A 1 124 ? 6.704   1.525   -8.944  1.00 0.71  ? 638 PHE A N    2  
ATOM 3911  C CA   . PHE A 1 124 ? 7.547   0.862   -7.937  1.00 0.76  ? 638 PHE A CA   2  
ATOM 3912  C C    . PHE A 1 124 ? 8.616   -0.049  -8.589  1.00 0.81  ? 638 PHE A C    2  
ATOM 3913  O O    . PHE A 1 124 ? 9.813   0.149   -8.391  1.00 0.79  ? 638 PHE A O    2  
ATOM 3914  C CB   . PHE A 1 124 ? 6.627   0.166   -6.927  1.00 0.94  ? 638 PHE A CB   2  
ATOM 3915  C CG   . PHE A 1 124 ? 7.205   -0.171  -5.558  1.00 1.17  ? 638 PHE A CG   2  
ATOM 3916  C CD1  . PHE A 1 124 ? 8.592   -0.253  -5.329  1.00 1.74  ? 638 PHE A CD1  2  
ATOM 3917  C CD2  . PHE A 1 124 ? 6.320   -0.511  -4.515  1.00 2.36  ? 638 PHE A CD2  2  
ATOM 3918  C CE1  . PHE A 1 124 ? 9.083   -0.764  -4.119  1.00 1.84  ? 638 PHE A CE1  2  
ATOM 3919  C CE2  . PHE A 1 124 ? 6.811   -1.049  -3.311  1.00 2.54  ? 638 PHE A CE2  2  
ATOM 3920  C CZ   . PHE A 1 124 ? 8.196   -1.209  -3.131  1.00 1.61  ? 638 PHE A CZ   2  
ATOM 3921  H H    . PHE A 1 124 ? 5.718   1.315   -8.945  1.00 0.74  ? 638 PHE A H    2  
ATOM 3922  H HA   . PHE A 1 124 ? 8.067   1.604   -7.347  1.00 0.71  ? 638 PHE A HA   2  
ATOM 3923  H HB2  . PHE A 1 124 ? 5.762   0.808   -6.756  1.00 0.98  ? 638 PHE A HB2  2  
ATOM 3924  H HB3  . PHE A 1 124 ? 6.264   -0.751  -7.385  1.00 1.02  ? 638 PHE A HB3  2  
ATOM 3925  H HD1  . PHE A 1 124 ? 9.296   0.019   -6.093  1.00 2.79  ? 638 PHE A HD1  2  
ATOM 3926  H HD2  . PHE A 1 124 ? 5.253   -0.434  -4.671  1.00 3.43  ? 638 PHE A HD2  2  
ATOM 3927  H HE1  . PHE A 1 124 ? 10.144  -0.854  -3.964  1.00 2.82  ? 638 PHE A HE1  2  
ATOM 3928  H HE2  . PHE A 1 124 ? 6.123   -1.360  -2.538  1.00 3.70  ? 638 PHE A HE2  2  
ATOM 3929  H HZ   . PHE A 1 124 ? 8.591   -1.668  -2.239  1.00 1.78  ? 638 PHE A HZ   2  
ATOM 3930  N N    . ASN A 1 125 ? 8.226   -0.980  -9.461  1.00 0.92  ? 639 ASN A N    2  
ATOM 3931  C CA   . ASN A 1 125 ? 9.157   -1.784  -10.277 1.00 1.00  ? 639 ASN A CA   2  
ATOM 3932  C C    . ASN A 1 125 ? 10.037  -0.924  -11.224 1.00 0.99  ? 639 ASN A C    2  
ATOM 3933  O O    . ASN A 1 125 ? 11.105  -1.367  -11.652 1.00 1.08  ? 639 ASN A O    2  
ATOM 3934  C CB   . ASN A 1 125 ? 8.357   -2.803  -11.114 1.00 1.05  ? 639 ASN A CB   2  
ATOM 3935  C CG   . ASN A 1 125 ? 7.728   -3.932  -10.330 1.00 1.36  ? 639 ASN A CG   2  
ATOM 3936  O OD1  . ASN A 1 125 ? 8.385   -4.863  -9.888  1.00 1.91  ? 639 ASN A OD1  2  
ATOM 3937  N ND2  . ASN A 1 125 ? 6.433   -3.899  -10.159 1.00 1.32  ? 639 ASN A ND2  2  
ATOM 3938  H H    . ASN A 1 125 ? 7.230   -1.119  -9.574  1.00 0.97  ? 639 ASN A H    2  
ATOM 3939  H HA   . ASN A 1 125 ? 9.827   -2.325  -9.600  1.00 1.05  ? 639 ASN A HA   2  
ATOM 3940  H HB2  . ASN A 1 125 ? 7.592   -2.283  -11.693 1.00 1.12  ? 639 ASN A HB2  2  
ATOM 3941  H HB3  . ASN A 1 125 ? 9.018   -3.289  -11.823 1.00 1.18  ? 639 ASN A HB3  2  
ATOM 3942  H HD21 . ASN A 1 125 ? 5.909   -3.098  -10.484 1.00 1.21  ? 639 ASN A HD21 2  
ATOM 3943  H HD22 . ASN A 1 125 ? 5.971   -4.707  -9.771  1.00 1.64  ? 639 ASN A HD22 2  
ATOM 3944  N N    . GLU A 1 126 ? 9.611   0.303   -11.541 1.00 0.94  ? 640 GLU A N    2  
ATOM 3945  C CA   . GLU A 1 126 ? 10.308  1.274   -12.401 1.00 0.98  ? 640 GLU A CA   2  
ATOM 3946  C C    . GLU A 1 126 ? 11.427  2.020   -11.663 1.00 0.92  ? 640 GLU A C    2  
ATOM 3947  O O    . GLU A 1 126 ? 12.511  2.208   -12.221 1.00 1.03  ? 640 GLU A O    2  
ATOM 3948  C CB   . GLU A 1 126 ? 9.241   2.209   -13.000 1.00 1.11  ? 640 GLU A CB   2  
ATOM 3949  C CG   . GLU A 1 126 ? 9.600   3.664   -13.307 1.00 1.63  ? 640 GLU A CG   2  
ATOM 3950  C CD   . GLU A 1 126 ? 8.387   4.432   -13.855 1.00 2.83  ? 640 GLU A CD   2  
ATOM 3951  O OE1  . GLU A 1 126 ? 7.862   4.072   -14.939 1.00 3.31  ? 640 GLU A OE1  2  
ATOM 3952  O OE2  . GLU A 1 126 ? 7.937   5.402   -13.200 1.00 4.44  ? 640 GLU A OE2  2  
ATOM 3953  H H    . GLU A 1 126 ? 8.722   0.593   -11.161 1.00 0.91  ? 640 GLU A H    2  
ATOM 3954  H HA   . GLU A 1 126 ? 10.783  0.742   -13.223 1.00 1.08  ? 640 GLU A HA   2  
ATOM 3955  H HB2  . GLU A 1 126 ? 8.859   1.741   -13.897 1.00 1.94  ? 640 GLU A HB2  2  
ATOM 3956  H HB3  . GLU A 1 126 ? 8.423   2.251   -12.302 1.00 2.23  ? 640 GLU A HB3  2  
ATOM 3957  H HG2  . GLU A 1 126 ? 9.905   4.125   -12.369 1.00 2.95  ? 640 GLU A HG2  2  
ATOM 3958  H HG3  . GLU A 1 126 ? 10.423  3.704   -14.020 1.00 1.99  ? 640 GLU A HG3  2  
ATOM 3959  N N    . VAL A 1 127 ? 11.201  2.394   -10.403 1.00 0.82  ? 641 VAL A N    2  
ATOM 3960  C CA   . VAL A 1 127 ? 12.248  2.905   -9.492  1.00 0.79  ? 641 VAL A CA   2  
ATOM 3961  C C    . VAL A 1 127 ? 13.198  1.797   -9.008  1.00 0.86  ? 641 VAL A C    2  
ATOM 3962  O O    . VAL A 1 127 ? 14.382  2.045   -8.781  1.00 0.92  ? 641 VAL A O    2  
ATOM 3963  C CB   . VAL A 1 127 ? 11.626  3.734   -8.351  1.00 0.70  ? 641 VAL A CB   2  
ATOM 3964  C CG1  . VAL A 1 127 ? 10.648  2.965   -7.467  1.00 0.72  ? 641 VAL A CG1  2  
ATOM 3965  C CG2  . VAL A 1 127 ? 12.679  4.356   -7.432  1.00 0.66  ? 641 VAL A CG2  2  
ATOM 3966  H H    . VAL A 1 127 ? 10.245  2.304   -10.067 1.00 0.81  ? 641 VAL A H    2  
ATOM 3967  H HA   . VAL A 1 127 ? 12.869  3.597   -10.054 1.00 0.84  ? 641 VAL A HA   2  
ATOM 3968  H HB   . VAL A 1 127 ? 11.072  4.545   -8.817  1.00 0.76  ? 641 VAL A HB   2  
ATOM 3969  H HG11 . VAL A 1 127 ? 11.121  2.078   -7.051  1.00 1.74  ? 641 VAL A HG11 2  
ATOM 3970  H HG12 . VAL A 1 127 ? 10.313  3.610   -6.660  1.00 1.67  ? 641 VAL A HG12 2  
ATOM 3971  H HG13 . VAL A 1 127 ? 9.775   2.680   -8.044  1.00 1.64  ? 641 VAL A HG13 2  
ATOM 3972  H HG21 . VAL A 1 127 ? 12.203  5.080   -6.769  1.00 1.49  ? 641 VAL A HG21 2  
ATOM 3973  H HG22 . VAL A 1 127 ? 13.122  3.583   -6.810  1.00 1.54  ? 641 VAL A HG22 2  
ATOM 3974  H HG23 . VAL A 1 127 ? 13.453  4.847   -8.027  1.00 1.54  ? 641 VAL A HG23 2  
ATOM 3975  N N    . LEU A 1 128 ? 12.717  0.549   -8.965  1.00 0.90  ? 642 LEU A N    2  
ATOM 3976  C CA   . LEU A 1 128 ? 13.523  -0.670  -8.760  1.00 1.04  ? 642 LEU A CA   2  
ATOM 3977  C C    . LEU A 1 128 ? 14.728  -0.802  -9.706  1.00 1.14  ? 642 LEU A C    2  
ATOM 3978  O O    . LEU A 1 128 ? 15.767  -1.341  -9.324  1.00 1.30  ? 642 LEU A O    2  
ATOM 3979  C CB   . LEU A 1 128 ? 12.636  -1.889  -8.828  1.00 1.09  ? 642 LEU A CB   2  
ATOM 3980  C CG   . LEU A 1 128 ? 13.048  -2.851  -7.699  1.00 1.21  ? 642 LEU A CG   2  
ATOM 3981  C CD1  . LEU A 1 128 ? 12.683  -2.373  -6.289  1.00 1.95  ? 642 LEU A CD1  2  
ATOM 3982  C CD2  . LEU A 1 128 ? 12.197  -4.048  -7.924  1.00 2.97  ? 642 LEU A CD2  2  
ATOM 3983  H H    . LEU A 1 128 ? 11.715  0.450   -9.091  1.00 0.87  ? 642 LEU A H    2  
ATOM 3984  H HA   . LEU A 1 128 ? 13.867  -0.761  -7.749  1.00 1.16  ? 642 LEU A HA   2  
ATOM 3985  H HB2  . LEU A 1 128 ? 11.602  -1.599  -8.674  1.00 1.31  ? 642 LEU A HB2  2  
ATOM 3986  H HB3  . LEU A 1 128 ? 12.736  -2.364  -9.807  1.00 1.62  ? 642 LEU A HB3  2  
ATOM 3987  H HG   . LEU A 1 128 ? 14.101  -3.124  -7.759  1.00 2.61  ? 642 LEU A HG   2  
ATOM 3988  H HD11 . LEU A 1 128 ? 12.783  -3.197  -5.581  1.00 2.66  ? 642 LEU A HD11 2  
ATOM 3989  H HD12 . LEU A 1 128 ? 11.654  -2.004  -6.296  1.00 2.64  ? 642 LEU A HD12 2  
ATOM 3990  H HD13 . LEU A 1 128 ? 13.363  -1.595  -5.959  1.00 3.18  ? 642 LEU A HD13 2  
ATOM 3991  H HD21 . LEU A 1 128 ? 12.448  -4.413  -8.910  1.00 3.84  ? 642 LEU A HD21 2  
ATOM 3992  H HD22 . LEU A 1 128 ? 11.177  -3.689  -7.868  1.00 3.84  ? 642 LEU A HD22 2  
ATOM 3993  H HD23 . LEU A 1 128 ? 12.411  -4.773  -7.150  1.00 3.51  ? 642 LEU A HD23 2  
ATOM 3994  N N    . GLU A 1 129 ? 14.615  -0.298  -10.936 1.00 1.13  ? 643 GLU A N    2  
ATOM 3995  C CA   . GLU A 1 129 ? 15.697  -0.317  -11.923 1.00 1.22  ? 643 GLU A CA   2  
ATOM 3996  C C    . GLU A 1 129 ? 16.891  0.582   -11.560 1.00 1.14  ? 643 GLU A C    2  
ATOM 3997  O O    . GLU A 1 129 ? 17.987  0.338   -12.068 1.00 1.23  ? 643 GLU A O    2  
ATOM 3998  C CB   . GLU A 1 129 ? 15.116  0.067   -13.289 1.00 1.36  ? 643 GLU A CB   2  
ATOM 3999  C CG   . GLU A 1 129 ? 14.118  -0.974  -13.813 1.00 1.84  ? 643 GLU A CG   2  
ATOM 4000  C CD   . GLU A 1 129 ? 14.781  -1.953  -14.789 1.00 2.30  ? 643 GLU A CD   2  
ATOM 4001  O OE1  . GLU A 1 129 ? 15.335  -2.986  -14.338 1.00 3.11  ? 643 GLU A OE1  2  
ATOM 4002  O OE2  . GLU A 1 129 ? 14.807  -1.682  -16.017 1.00 2.89  ? 643 GLU A OE2  2  
ATOM 4003  H H    . GLU A 1 129 ? 13.712  0.040   -11.250 1.00 1.13  ? 643 GLU A H    2  
ATOM 4004  H HA   . GLU A 1 129 ? 16.087  -1.331  -12.000 1.00 1.39  ? 643 GLU A HA   2  
ATOM 4005  H HB2  . GLU A 1 129 ? 14.597  1.017   -13.187 1.00 1.71  ? 643 GLU A HB2  2  
ATOM 4006  H HB3  . GLU A 1 129 ? 15.918  0.199   -14.014 1.00 1.60  ? 643 GLU A HB3  2  
ATOM 4007  H HG2  . GLU A 1 129 ? 13.675  -1.522  -12.984 1.00 2.02  ? 643 GLU A HG2  2  
ATOM 4008  H HG3  . GLU A 1 129 ? 13.299  -0.440  -14.287 1.00 2.18  ? 643 GLU A HG3  2  
ATOM 4009  N N    . GLU A 1 130 ? 16.746  1.587   -10.684 1.00 1.05  ? 644 GLU A N    2  
ATOM 4010  C CA   . GLU A 1 130 ? 17.837  2.493   -10.316 1.00 1.11  ? 644 GLU A CA   2  
ATOM 4011  C C    . GLU A 1 130 ? 18.720  1.955   -9.176  1.00 1.15  ? 644 GLU A C    2  
ATOM 4012  O O    . GLU A 1 130 ? 19.844  2.425   -8.990  1.00 1.27  ? 644 GLU A O    2  
ATOM 4013  C CB   . GLU A 1 130 ? 17.220  3.834   -9.937  1.00 1.04  ? 644 GLU A CB   2  
ATOM 4014  C CG   . GLU A 1 130 ? 16.514  4.519   -11.114 1.00 1.10  ? 644 GLU A CG   2  
ATOM 4015  C CD   . GLU A 1 130 ? 17.387  5.545   -11.847 1.00 1.36  ? 644 GLU A CD   2  
ATOM 4016  O OE1  . GLU A 1 130 ? 18.217  5.144   -12.702 1.00 2.70  ? 644 GLU A OE1  2  
ATOM 4017  O OE2  . GLU A 1 130 ? 17.227  6.763   -11.576 1.00 1.76  ? 644 GLU A OE2  2  
ATOM 4018  H H    . GLU A 1 130 ? 15.839  1.810   -10.275 1.00 0.99  ? 644 GLU A H    2  
ATOM 4019  H HA   . GLU A 1 130 ? 18.472  2.674   -11.175 1.00 1.23  ? 644 GLU A HA   2  
ATOM 4020  H HB2  . GLU A 1 130 ? 16.476  3.666   -9.162  1.00 0.92  ? 644 GLU A HB2  2  
ATOM 4021  H HB3  . GLU A 1 130 ? 17.991  4.476   -9.520  1.00 1.13  ? 644 GLU A HB3  2  
ATOM 4022  H HG2  . GLU A 1 130 ? 16.113  3.791   -11.817 1.00 1.08  ? 644 GLU A HG2  2  
ATOM 4023  H HG3  . GLU A 1 130 ? 15.649  5.004   -10.690 1.00 1.10  ? 644 GLU A HG3  2  
ATOM 4024  N N    . TYR A 1 131 ? 18.209  0.983   -8.416  1.00 1.10  ? 645 TYR A N    2  
ATOM 4025  C CA   . TYR A 1 131 ? 18.826  0.403   -7.210  1.00 1.14  ? 645 TYR A CA   2  
ATOM 4026  C C    . TYR A 1 131 ? 18.874  -1.134  -7.302  1.00 1.24  ? 645 TYR A C    2  
ATOM 4027  O O    . TYR A 1 131 ? 18.099  -1.816  -6.629  1.00 1.26  ? 645 TYR A O    2  
ATOM 4028  C CB   . TYR A 1 131 ? 18.087  0.898   -5.954  1.00 1.04  ? 645 TYR A CB   2  
ATOM 4029  C CG   . TYR A 1 131 ? 18.161  2.400   -5.787  1.00 0.97  ? 645 TYR A CG   2  
ATOM 4030  C CD1  . TYR A 1 131 ? 17.287  3.214   -6.528  1.00 1.88  ? 645 TYR A CD1  2  
ATOM 4031  C CD2  . TYR A 1 131 ? 19.135  2.986   -4.957  1.00 2.03  ? 645 TYR A CD2  2  
ATOM 4032  C CE1  . TYR A 1 131 ? 17.425  4.609   -6.513  1.00 1.81  ? 645 TYR A CE1  2  
ATOM 4033  C CE2  . TYR A 1 131 ? 19.248  4.390   -4.898  1.00 2.19  ? 645 TYR A CE2  2  
ATOM 4034  C CZ   . TYR A 1 131 ? 18.415  5.206   -5.697  1.00 1.15  ? 645 TYR A CZ   2  
ATOM 4035  O OH   . TYR A 1 131 ? 18.607  6.550   -5.715  1.00 1.39  ? 645 TYR A OH   2  
ATOM 4036  H H    . TYR A 1 131 ? 17.272  0.693   -8.655  1.00 1.04  ? 645 TYR A H    2  
ATOM 4037  H HA   . TYR A 1 131 ? 19.851  0.759   -7.121  1.00 1.21  ? 645 TYR A HA   2  
ATOM 4038  H HB2  . TYR A 1 131 ? 17.039  0.597   -6.005  1.00 0.96  ? 645 TYR A HB2  2  
ATOM 4039  H HB3  . TYR A 1 131 ? 18.531  0.425   -5.076  1.00 1.17  ? 645 TYR A HB3  2  
ATOM 4040  H HD1  . TYR A 1 131 ? 16.530  2.755   -7.150  1.00 3.12  ? 645 TYR A HD1  2  
ATOM 4041  H HD2  . TYR A 1 131 ? 19.801  2.363   -4.372  1.00 3.19  ? 645 TYR A HD2  2  
ATOM 4042  H HE1  . TYR A 1 131 ? 16.793  5.201   -7.162  1.00 2.96  ? 645 TYR A HE1  2  
ATOM 4043  H HE2  . TYR A 1 131 ? 19.986  4.843   -4.251  1.00 3.46  ? 645 TYR A HE2  2  
ATOM 4044  H HH   . TYR A 1 131 ? 19.420  6.795   -5.229  1.00 2.46  ? 645 TYR A HH   2  
ATOM 4045  N N    . PRO A 1 132 ? 19.757  -1.707  -8.143  1.00 1.35  ? 646 PRO A N    2  
ATOM 4046  C CA   . PRO A 1 132 ? 19.768  -3.134  -8.495  1.00 1.47  ? 646 PRO A CA   2  
ATOM 4047  C C    . PRO A 1 132 ? 19.865  -4.136  -7.332  1.00 1.57  ? 646 PRO A C    2  
ATOM 4048  O O    . PRO A 1 132 ? 19.392  -5.264  -7.502  1.00 1.66  ? 646 PRO A O    2  
ATOM 4049  C CB   . PRO A 1 132 ? 20.931  -3.292  -9.484  1.00 1.59  ? 646 PRO A CB   2  
ATOM 4050  C CG   . PRO A 1 132 ? 21.789  -2.043  -9.294  1.00 1.57  ? 646 PRO A CG   2  
ATOM 4051  C CD   . PRO A 1 132 ? 20.736  -0.999  -8.957  1.00 1.40  ? 646 PRO A CD   2  
ATOM 4052  H HA   . PRO A 1 132 ? 18.838  -3.371  -9.017  1.00 1.46  ? 646 PRO A HA   2  
ATOM 4053  H HB2  . PRO A 1 132 ? 21.507  -4.203  -9.315  1.00 1.72  ? 646 PRO A HB2  2  
ATOM 4054  H HB3  . PRO A 1 132 ? 20.526  -3.278  -10.493 1.00 1.60  ? 646 PRO A HB3  2  
ATOM 4055  H HG2  . PRO A 1 132 ? 22.468  -2.175  -8.452  1.00 1.63  ? 646 PRO A HG2  2  
ATOM 4056  H HG3  . PRO A 1 132 ? 22.334  -1.780  -10.199 1.00 1.64  ? 646 PRO A HG3  2  
ATOM 4057  H HD2  . PRO A 1 132 ? 21.190  -0.152  -8.445  1.00 1.37  ? 646 PRO A HD2  2  
ATOM 4058  H HD3  . PRO A 1 132 ? 20.256  -0.656  -9.874  1.00 1.39  ? 646 PRO A HD3  2  
ATOM 4059  N N    . MET A 1 133 ? 20.370  -3.755  -6.148  1.00 1.61  ? 647 MET A N    2  
ATOM 4060  C CA   . MET A 1 133 ? 20.292  -4.612  -4.953  1.00 1.76  ? 647 MET A CA   2  
ATOM 4061  C C    . MET A 1 133 ? 18.836  -4.854  -4.507  1.00 1.70  ? 647 MET A C    2  
ATOM 4062  O O    . MET A 1 133 ? 18.509  -5.938  -4.026  1.00 1.80  ? 647 MET A O    2  
ATOM 4063  C CB   . MET A 1 133 ? 21.133  -4.033  -3.796  1.00 1.89  ? 647 MET A CB   2  
ATOM 4064  C CG   . MET A 1 133 ? 20.429  -2.825  -3.179  1.00 1.87  ? 647 MET A CG   2  
ATOM 4065  S SD   . MET A 1 133 ? 21.295  -1.866  -1.923  1.00 1.73  ? 647 MET A SD   2  
ATOM 4066  C CE   . MET A 1 133 ? 19.908  -0.764  -1.550  1.00 1.40  ? 647 MET A CE   2  
ATOM 4067  H H    . MET A 1 133 ? 20.821  -2.849  -6.061  1.00 1.56  ? 647 MET A H    2  
ATOM 4068  H HA   . MET A 1 133 ? 20.727  -5.572  -5.203  1.00 1.89  ? 647 MET A HA   2  
ATOM 4069  H HB2  . MET A 1 133 ? 21.266  -4.792  -3.027  1.00 2.66  ? 647 MET A HB2  2  
ATOM 4070  H HB3  . MET A 1 133 ? 22.119  -3.747  -4.157  1.00 2.24  ? 647 MET A HB3  2  
ATOM 4071  H HG2  . MET A 1 133 ? 20.161  -2.162  -3.997  1.00 2.25  ? 647 MET A HG2  2  
ATOM 4072  H HG3  . MET A 1 133 ? 19.514  -3.175  -2.702  1.00 2.68  ? 647 MET A HG3  2  
ATOM 4073  H HE1  . MET A 1 133 ? 19.075  -1.354  -1.164  1.00 2.02  ? 647 MET A HE1  2  
ATOM 4074  H HE2  . MET A 1 133 ? 20.210  -0.023  -0.812  1.00 1.81  ? 647 MET A HE2  2  
ATOM 4075  H HE3  . MET A 1 133 ? 19.584  -0.270  -2.468  1.00 2.15  ? 647 MET A HE3  2  
ATOM 4076  N N    . MET A 1 134 ? 17.953  -3.856  -4.662  1.00 1.57  ? 648 MET A N    2  
ATOM 4077  C CA   . MET A 1 134 ? 16.604  -3.849  -4.084  1.00 1.45  ? 648 MET A CA   2  
ATOM 4078  C C    . MET A 1 134 ? 15.675  -4.833  -4.803  1.00 1.62  ? 648 MET A C    2  
ATOM 4079  O O    . MET A 1 134 ? 14.786  -5.404  -4.180  1.00 1.63  ? 648 MET A O    2  
ATOM 4080  C CB   . MET A 1 134 ? 16.012  -2.427  -4.089  1.00 1.33  ? 648 MET A CB   2  
ATOM 4081  C CG   . MET A 1 134 ? 16.768  -1.403  -3.233  1.00 1.08  ? 648 MET A CG   2  
ATOM 4082  S SD   . MET A 1 134 ? 16.218  -1.184  -1.512  1.00 1.36  ? 648 MET A SD   2  
ATOM 4083  C CE   . MET A 1 134 ? 16.544  -2.801  -0.756  1.00 1.50  ? 648 MET A CE   2  
ATOM 4084  H H    . MET A 1 134 ? 18.252  -3.028  -5.169  1.00 1.53  ? 648 MET A H    2  
ATOM 4085  H HA   . MET A 1 134 ? 16.677  -4.181  -3.053  1.00 1.39  ? 648 MET A HA   2  
ATOM 4086  H HB2  . MET A 1 134 ? 16.005  -2.057  -5.114  1.00 1.76  ? 648 MET A HB2  2  
ATOM 4087  H HB3  . MET A 1 134 ? 14.982  -2.460  -3.737  1.00 1.52  ? 648 MET A HB3  2  
ATOM 4088  H HG2  . MET A 1 134 ? 17.831  -1.629  -3.247  1.00 1.42  ? 648 MET A HG2  2  
ATOM 4089  H HG3  . MET A 1 134 ? 16.642  -0.433  -3.714  1.00 1.48  ? 648 MET A HG3  2  
ATOM 4090  H HE1  . MET A 1 134 ? 15.828  -3.532  -1.134  1.00 2.23  ? 648 MET A HE1  2  
ATOM 4091  H HE2  . MET A 1 134 ? 17.560  -3.126  -0.978  1.00 2.44  ? 648 MET A HE2  2  
ATOM 4092  H HE3  . MET A 1 134 ? 16.425  -2.726  0.326   1.00 2.19  ? 648 MET A HE3  2  
ATOM 4093  N N    . ARG A 1 135 ? 15.941  -5.118  -6.086  1.00 1.83  ? 649 ARG A N    2  
ATOM 4094  C CA   . ARG A 1 135 ? 15.295  -6.213  -6.822  1.00 2.07  ? 649 ARG A CA   2  
ATOM 4095  C C    . ARG A 1 135 ? 15.560  -7.555  -6.133  1.00 2.19  ? 649 ARG A C    2  
ATOM 4096  O O    . ARG A 1 135 ? 14.616  -8.234  -5.740  1.00 2.30  ? 649 ARG A O    2  
ATOM 4097  C CB   . ARG A 1 135 ? 15.718  -6.137  -8.306  1.00 2.30  ? 649 ARG A CB   2  
ATOM 4098  C CG   . ARG A 1 135 ? 15.090  -7.218  -9.207  1.00 2.78  ? 649 ARG A CG   2  
ATOM 4099  C CD   . ARG A 1 135 ? 15.958  -8.473  -9.336  1.00 2.68  ? 649 ARG A CD   2  
ATOM 4100  N NE   . ARG A 1 135 ? 15.223  -9.580  -9.969  1.00 3.87  ? 649 ARG A NE   2  
ATOM 4101  C CZ   . ARG A 1 135 ? 15.479  -10.195 -11.105 1.00 4.14  ? 649 ARG A CZ   2  
ATOM 4102  N NH1  . ARG A 1 135 ? 16.344  -9.774  -11.979 1.00 3.79  ? 649 ARG A NH1  2  
ATOM 4103  N NH2  . ARG A 1 135 ? 14.824  -11.282 -11.366 1.00 5.59  ? 649 ARG A NH2  2  
ATOM 4104  H H    . ARG A 1 135 ? 16.688  -4.604  -6.535  1.00 1.88  ? 649 ARG A H    2  
ATOM 4105  H HA   . ARG A 1 135 ? 14.214  -6.072  -6.768  1.00 2.06  ? 649 ARG A HA   2  
ATOM 4106  H HB2  . ARG A 1 135 ? 15.379  -5.171  -8.679  1.00 2.41  ? 649 ARG A HB2  2  
ATOM 4107  H HB3  . ARG A 1 135 ? 16.807  -6.149  -8.401  1.00 2.24  ? 649 ARG A HB3  2  
ATOM 4108  H HG2  . ARG A 1 135 ? 14.114  -7.496  -8.809  1.00 3.51  ? 649 ARG A HG2  2  
ATOM 4109  H HG3  . ARG A 1 135 ? 14.946  -6.802  -10.206 1.00 3.13  ? 649 ARG A HG3  2  
ATOM 4110  H HD2  . ARG A 1 135 ? 16.863  -8.231  -9.896  1.00 2.22  ? 649 ARG A HD2  2  
ATOM 4111  H HD3  . ARG A 1 135 ? 16.257  -8.804  -8.345  1.00 3.29  ? 649 ARG A HD3  2  
ATOM 4112  H HE   . ARG A 1 135 ? 14.506  -10.038 -9.414  1.00 5.13  ? 649 ARG A HE   2  
ATOM 4113  H HH11 . ARG A 1 135 ? 16.807  -8.877  -11.858 1.00 3.36  ? 649 ARG A HH11 2  
ATOM 4114  H HH12 . ARG A 1 135 ? 16.588  -10.350 -12.775 1.00 4.61  ? 649 ARG A HH12 2  
ATOM 4115  H HH21 . ARG A 1 135 ? 14.166  -11.609 -10.663 1.00 6.59  ? 649 ARG A HH21 2  
ATOM 4116  H HH22 . ARG A 1 135 ? 14.917  -11.752 -12.260 1.00 5.96  ? 649 ARG A HH22 2  
ATOM 4117  N N    . ARG A 1 136 ? 16.827  -7.898  -5.886  1.00 2.19  ? 650 ARG A N    2  
ATOM 4118  C CA   . ARG A 1 136 ? 17.234  -9.157  -5.227  1.00 2.29  ? 650 ARG A CA   2  
ATOM 4119  C C    . ARG A 1 136 ? 16.752  -9.252  -3.771  1.00 2.18  ? 650 ARG A C    2  
ATOM 4120  O O    . ARG A 1 136 ? 16.233  -10.278 -3.337  1.00 2.39  ? 650 ARG A O    2  
ATOM 4121  C CB   . ARG A 1 136 ? 18.761  -9.265  -5.314  1.00 2.29  ? 650 ARG A CB   2  
ATOM 4122  C CG   . ARG A 1 136 ? 19.253  -10.667 -4.943  1.00 3.35  ? 650 ARG A CG   2  
ATOM 4123  C CD   . ARG A 1 136 ? 20.772  -10.638 -4.793  1.00 3.02  ? 650 ARG A CD   2  
ATOM 4124  N NE   . ARG A 1 136 ? 21.313  -11.998 -4.643  1.00 4.28  ? 650 ARG A NE   2  
ATOM 4125  C CZ   . ARG A 1 136 ? 21.349  -12.735 -3.551  1.00 5.36  ? 650 ARG A CZ   2  
ATOM 4126  N NH1  . ARG A 1 136 ? 20.940  -12.320 -2.390  1.00 5.63  ? 650 ARG A NH1  2  
ATOM 4127  N NH2  . ARG A 1 136 ? 21.813  -13.941 -3.633  1.00 6.66  ? 650 ARG A NH2  2  
ATOM 4128  H H    . ARG A 1 136 ? 17.544  -7.256  -6.191  1.00 2.15  ? 650 ARG A H    2  
ATOM 4129  H HA   . ARG A 1 136 ? 16.799  -9.998  -5.772  1.00 2.49  ? 650 ARG A HA   2  
ATOM 4130  H HB2  . ARG A 1 136 ? 19.084  -9.047  -6.333  1.00 2.07  ? 650 ARG A HB2  2  
ATOM 4131  H HB3  . ARG A 1 136 ? 19.212  -8.530  -4.649  1.00 2.91  ? 650 ARG A HB3  2  
ATOM 4132  H HG2  . ARG A 1 136 ? 18.810  -10.995 -4.002  1.00 4.39  ? 650 ARG A HG2  2  
ATOM 4133  H HG3  . ARG A 1 136 ? 18.970  -11.368 -5.729  1.00 4.22  ? 650 ARG A HG3  2  
ATOM 4134  H HD2  . ARG A 1 136 ? 21.203  -10.179 -5.684  1.00 3.11  ? 650 ARG A HD2  2  
ATOM 4135  H HD3  . ARG A 1 136 ? 21.033  -10.015 -3.934  1.00 2.85  ? 650 ARG A HD3  2  
ATOM 4136  H HE   . ARG A 1 136 ? 21.679  -12.437 -5.475  1.00 4.78  ? 650 ARG A HE   2  
ATOM 4137  H HH11 . ARG A 1 136 ? 20.527  -11.398 -2.279  1.00 5.09  ? 650 ARG A HH11 2  
ATOM 4138  H HH12 . ARG A 1 136 ? 21.098  -12.882 -1.561  1.00 6.68  ? 650 ARG A HH12 2  
ATOM 4139  H HH21 . ARG A 1 136 ? 22.039  -14.313 -4.546  1.00 6.98  ? 650 ARG A HH21 2  
ATOM 4140  H HH22 . ARG A 1 136 ? 21.708  -14.558 -2.831  1.00 7.65  ? 650 ARG A HH22 2  
ATOM 4141  N N    . ALA A 1 137 ? 16.840  -8.135  -3.055  1.00 1.88  ? 651 ALA A N    2  
ATOM 4142  C CA   . ALA A 1 137 ? 16.333  -7.944  -1.694  1.00 1.79  ? 651 ALA A CA   2  
ATOM 4143  C C    . ALA A 1 137 ? 14.835  -8.254  -1.555  1.00 1.91  ? 651 ALA A C    2  
ATOM 4144  O O    . ALA A 1 137 ? 14.389  -8.604  -0.463  1.00 2.06  ? 651 ALA A O    2  
ATOM 4145  C CB   . ALA A 1 137 ? 16.564  -6.484  -1.297  1.00 1.50  ? 651 ALA A CB   2  
ATOM 4146  H H    . ALA A 1 137 ? 17.336  -7.377  -3.492  1.00 1.76  ? 651 ALA A H    2  
ATOM 4147  H HA   . ALA A 1 137 ? 16.882  -8.599  -1.015  1.00 1.93  ? 651 ALA A HA   2  
ATOM 4148  H HB1  . ALA A 1 137 ? 16.335  -6.352  -0.238  1.00 2.30  ? 651 ALA A HB1  2  
ATOM 4149  H HB2  . ALA A 1 137 ? 17.597  -6.190  -1.474  1.00 1.47  ? 651 ALA A HB2  2  
ATOM 4150  H HB3  . ALA A 1 137 ? 15.892  -5.851  -1.876  1.00 2.02  ? 651 ALA A HB3  2  
ATOM 4151  N N    . PHE A 1 138 ? 14.062  -8.112  -2.638  1.00 1.92  ? 652 PHE A N    2  
ATOM 4152  C CA   . PHE A 1 138 ? 12.655  -8.498  -2.721  1.00 2.09  ? 652 PHE A CA   2  
ATOM 4153  C C    . PHE A 1 138 ? 12.459  -9.942  -3.235  1.00 2.47  ? 652 PHE A C    2  
ATOM 4154  O O    . PHE A 1 138 ? 11.590  -10.651 -2.726  1.00 2.76  ? 652 PHE A O    2  
ATOM 4155  C CB   . PHE A 1 138 ? 11.926  -7.492  -3.615  1.00 1.88  ? 652 PHE A CB   2  
ATOM 4156  C CG   . PHE A 1 138 ? 11.754  -6.058  -3.139  1.00 1.37  ? 652 PHE A CG   2  
ATOM 4157  C CD1  . PHE A 1 138 ? 12.162  -5.595  -1.869  1.00 2.46  ? 652 PHE A CD1  2  
ATOM 4158  C CD2  . PHE A 1 138 ? 11.134  -5.167  -4.029  1.00 1.90  ? 652 PHE A CD2  2  
ATOM 4159  C CE1  . PHE A 1 138 ? 11.949  -4.250  -1.508  1.00 2.26  ? 652 PHE A CE1  2  
ATOM 4160  C CE2  . PHE A 1 138 ? 10.901  -3.834  -3.660  1.00 2.21  ? 652 PHE A CE2  2  
ATOM 4161  C CZ   . PHE A 1 138 ? 11.305  -3.372  -2.401  1.00 1.51  ? 652 PHE A CZ   2  
ATOM 4162  H H    . PHE A 1 138 ? 14.478  -7.710  -3.469  1.00 1.84  ? 652 PHE A H    2  
ATOM 4163  H HA   . PHE A 1 138 ? 12.210  -8.449  -1.727  1.00 2.14  ? 652 PHE A HA   2  
ATOM 4164  H HB2  . PHE A 1 138 ? 12.458  -7.450  -4.564  1.00 1.89  ? 652 PHE A HB2  2  
ATOM 4165  H HB3  . PHE A 1 138 ? 10.926  -7.880  -3.798  1.00 2.26  ? 652 PHE A HB3  2  
ATOM 4166  H HD1  . PHE A 1 138 ? 12.641  -6.257  -1.164  1.00 3.87  ? 652 PHE A HD1  2  
ATOM 4167  H HD2  . PHE A 1 138 ? 10.837  -5.517  -5.006  1.00 3.01  ? 652 PHE A HD2  2  
ATOM 4168  H HE1  . PHE A 1 138 ? 12.259  -3.898  -0.534  1.00 3.44  ? 652 PHE A HE1  2  
ATOM 4169  H HE2  . PHE A 1 138 ? 10.418  -3.162  -4.350  1.00 3.59  ? 652 PHE A HE2  2  
ATOM 4170  H HZ   . PHE A 1 138 ? 11.097  -2.349  -2.122  1.00 1.89  ? 652 PHE A HZ   2  
ATOM 4171  N N    . GLU A 1 139 ? 13.278  -10.421 -4.182  1.00 2.53  ? 653 GLU A N    2  
ATOM 4172  C CA   . GLU A 1 139 ? 13.263  -11.819 -4.672  1.00 2.88  ? 653 GLU A CA   2  
ATOM 4173  C C    . GLU A 1 139 ? 13.374  -12.850 -3.534  1.00 3.25  ? 653 GLU A C    2  
ATOM 4174  O O    . GLU A 1 139 ? 12.707  -13.884 -3.577  1.00 3.62  ? 653 GLU A O    2  
ATOM 4175  C CB   . GLU A 1 139 ? 14.445  -12.074 -5.629  1.00 3.10  ? 653 GLU A CB   2  
ATOM 4176  C CG   . GLU A 1 139 ? 14.380  -11.358 -6.986  1.00 2.76  ? 653 GLU A CG   2  
ATOM 4177  C CD   . GLU A 1 139 ? 13.467  -12.026 -8.022  1.00 3.31  ? 653 GLU A CD   2  
ATOM 4178  O OE1  . GLU A 1 139 ? 13.043  -13.190 -7.825  1.00 4.64  ? 653 GLU A OE1  2  
ATOM 4179  O OE2  . GLU A 1 139 ? 13.246  -11.403 -9.089  1.00 3.07  ? 653 GLU A OE2  2  
ATOM 4180  H H    . GLU A 1 139 ? 13.948  -9.781  -4.599  1.00 2.36  ? 653 GLU A H    2  
ATOM 4181  H HA   . GLU A 1 139 ? 12.330  -12.012 -5.198  1.00 2.80  ? 653 GLU A HA   2  
ATOM 4182  H HB2  . GLU A 1 139 ? 15.364  -11.768 -5.135  1.00 3.38  ? 653 GLU A HB2  2  
ATOM 4183  H HB3  . GLU A 1 139 ? 14.544  -13.146 -5.801  1.00 3.73  ? 653 GLU A HB3  2  
ATOM 4184  H HG2  . GLU A 1 139 ? 14.076  -10.324 -6.835  1.00 2.60  ? 653 GLU A HG2  2  
ATOM 4185  H HG3  . GLU A 1 139 ? 15.388  -11.339 -7.399  1.00 2.62  ? 653 GLU A HG3  2  
ATOM 4186  N N    . THR A 1 140 ? 14.197  -12.543 -2.526  1.00 3.15  ? 654 THR A N    2  
ATOM 4187  C CA   . THR A 1 140 ? 14.608  -13.438 -1.422  1.00 3.40  ? 654 THR A CA   2  
ATOM 4188  C C    . THR A 1 140 ? 13.643  -13.469 -0.228  1.00 3.56  ? 654 THR A C    2  
ATOM 4189  O O    . THR A 1 140 ? 13.714  -14.336 0.645   1.00 4.06  ? 654 THR A O    2  
ATOM 4190  C CB   . THR A 1 140 ? 16.016  -13.029 -0.983  1.00 3.12  ? 654 THR A CB   2  
ATOM 4191  O OG1  . THR A 1 140 ? 16.594  -14.040 -0.187  1.00 3.39  ? 654 THR A OG1  2  
ATOM 4192  C CG2  . THR A 1 140 ? 16.026  -11.702 -0.224  1.00 2.70  ? 654 THR A CG2  2  
ATOM 4193  H H    . THR A 1 140 ? 14.688  -11.658 -2.606  1.00 2.85  ? 654 THR A H    2  
ATOM 4194  H HA   . THR A 1 140 ? 14.672  -14.449 -1.808  1.00 3.76  ? 654 THR A HA   2  
ATOM 4195  H HB   . THR A 1 140 ? 16.613  -12.907 -1.883  1.00 3.10  ? 654 THR A HB   2  
ATOM 4196  H HG1  . THR A 1 140 ? 17.524  -13.764 -0.003  1.00 3.44  ? 654 THR A HG1  2  
ATOM 4197  H HG21 . THR A 1 140 ? 15.438  -10.961 -0.768  1.00 2.63  ? 654 THR A HG21 2  
ATOM 4198  H HG22 . THR A 1 140 ? 17.050  -11.340 -0.140  1.00 2.58  ? 654 THR A HG22 2  
ATOM 4199  H HG23 . THR A 1 140 ? 15.594  -11.832 0.766   1.00 3.65  ? 654 THR A HG23 2  
ATOM 4200  N N    . VAL A 1 141 ? 12.728  -12.501 -0.185  1.00 3.27  ? 655 VAL A N    2  
ATOM 4201  C CA   . VAL A 1 141 ? 11.655  -12.368 0.822   1.00 3.49  ? 655 VAL A CA   2  
ATOM 4202  C C    . VAL A 1 141 ? 10.305  -12.820 0.273   1.00 3.82  ? 655 VAL A C    2  
ATOM 4203  O O    . VAL A 1 141 ? 9.535   -13.466 0.980   1.00 4.19  ? 655 VAL A O    2  
ATOM 4204  C CB   . VAL A 1 141 ? 11.601  -10.932 1.377   1.00 3.23  ? 655 VAL A CB   2  
ATOM 4205  C CG1  . VAL A 1 141 ? 11.485  -9.870  0.297   1.00 2.88  ? 655 VAL A CG1  2  
ATOM 4206  C CG2  . VAL A 1 141 ? 10.512  -10.720 2.430   1.00 3.57  ? 655 VAL A CG2  2  
ATOM 4207  H H    . VAL A 1 141 ? 12.797  -11.811 -0.922  1.00 2.94  ? 655 VAL A H    2  
ATOM 4208  H HA   . VAL A 1 141 ? 11.878  -13.019 1.666   1.00 3.70  ? 655 VAL A HA   2  
ATOM 4209  H HB   . VAL A 1 141 ? 12.553  -10.733 1.839   1.00 3.11  ? 655 VAL A HB   2  
ATOM 4210  H HG11 . VAL A 1 141 ? 11.539  -8.879  0.748   1.00 3.58  ? 655 VAL A HG11 2  
ATOM 4211  H HG12 . VAL A 1 141 ? 12.351  -9.995  -0.353  1.00 2.68  ? 655 VAL A HG12 2  
ATOM 4212  H HG13 . VAL A 1 141 ? 10.558  -9.970  -0.264  1.00 2.97  ? 655 VAL A HG13 2  
ATOM 4213  H HG21 . VAL A 1 141 ? 10.646  -9.749  2.908   1.00 4.26  ? 655 VAL A HG21 2  
ATOM 4214  H HG22 . VAL A 1 141 ? 9.527   -10.754 1.967   1.00 3.73  ? 655 VAL A HG22 2  
ATOM 4215  H HG23 . VAL A 1 141 ? 10.582  -11.496 3.194   1.00 3.69  ? 655 VAL A HG23 2  
ATOM 4216  N N    . ALA A 1 142 ? 10.029  -12.536 -1.003  1.00 3.77  ? 656 ALA A N    2  
ATOM 4217  C CA   . ALA A 1 142 ? 8.775   -12.892 -1.674  1.00 4.15  ? 656 ALA A CA   2  
ATOM 4218  C C    . ALA A 1 142 ? 8.410   -14.381 -1.526  1.00 4.75  ? 656 ALA A C    2  
ATOM 4219  O O    . ALA A 1 142 ? 7.262   -14.705 -1.223  1.00 5.41  ? 656 ALA A O    2  
ATOM 4220  C CB   . ALA A 1 142 ? 8.898   -12.512 -3.153  1.00 3.91  ? 656 ALA A CB   2  
ATOM 4221  H H    . ALA A 1 142 ? 10.708  -11.973 -1.507  1.00 3.47  ? 656 ALA A H    2  
ATOM 4222  H HA   . ALA A 1 142 ? 7.963   -12.313 -1.231  1.00 4.22  ? 656 ALA A HA   2  
ATOM 4223  H HB1  . ALA A 1 142 ? 7.966   -12.750 -3.668  1.00 4.49  ? 656 ALA A HB1  2  
ATOM 4224  H HB2  . ALA A 1 142 ? 9.103   -11.447 -3.248  1.00 4.20  ? 656 ALA A HB2  2  
ATOM 4225  H HB3  . ALA A 1 142 ? 9.713   -13.070 -3.619  1.00 3.58  ? 656 ALA A HB3  2  
ATOM 4226  N N    . ILE A 1 143 ? 9.405   -15.267 -1.653  1.00 4.60  ? 657 ILE A N    2  
ATOM 4227  C CA   . ILE A 1 143 ? 9.258   -16.729 -1.566  1.00 5.03  ? 657 ILE A CA   2  
ATOM 4228  C C    . ILE A 1 143 ? 8.819   -17.258 -0.183  1.00 5.34  ? 657 ILE A C    2  
ATOM 4229  O O    . ILE A 1 143 ? 8.424   -18.418 -0.059  1.00 5.64  ? 657 ILE A O    2  
ATOM 4230  C CB   . ILE A 1 143 ? 10.532  -17.424 -2.103  1.00 5.14  ? 657 ILE A CB   2  
ATOM 4231  C CG1  . ILE A 1 143 ? 11.880  -17.003 -1.469  1.00 5.65  ? 657 ILE A CG1  2  
ATOM 4232  C CG2  . ILE A 1 143 ? 10.657  -17.184 -3.619  1.00 4.85  ? 657 ILE A CG2  2  
ATOM 4233  C CD1  . ILE A 1 143 ? 11.983  -17.196 0.045   1.00 7.43  ? 657 ILE A CD1  2  
ATOM 4234  H H    . ILE A 1 143 ? 10.320  -14.910 -1.895  1.00 4.16  ? 657 ILE A H    2  
ATOM 4235  H HA   . ILE A 1 143 ? 8.445   -17.008 -2.233  1.00 5.13  ? 657 ILE A HA   2  
ATOM 4236  H HB   . ILE A 1 143 ? 10.404  -18.495 -1.956  1.00 5.90  ? 657 ILE A HB   2  
ATOM 4237  H HG12 . ILE A 1 143 ? 12.669  -17.603 -1.926  1.00 5.09  ? 657 ILE A HG12 2  
ATOM 4238  H HG13 . ILE A 1 143 ? 12.091  -15.957 -1.697  1.00 5.98  ? 657 ILE A HG13 2  
ATOM 4239  H HG21 . ILE A 1 143 ? 10.861  -16.135 -3.829  1.00 5.02  ? 657 ILE A HG21 2  
ATOM 4240  H HG22 . ILE A 1 143 ? 11.475  -17.786 -4.016  1.00 4.41  ? 657 ILE A HG22 2  
ATOM 4241  H HG23 . ILE A 1 143 ? 9.739   -17.476 -4.128  1.00 5.88  ? 657 ILE A HG23 2  
ATOM 4242  H HD11 . ILE A 1 143 ? 11.607  -18.182 0.323   1.00 7.80  ? 657 ILE A HD11 2  
ATOM 4243  H HD12 . ILE A 1 143 ? 13.026  -17.112 0.346   1.00 7.71  ? 657 ILE A HD12 2  
ATOM 4244  H HD13 . ILE A 1 143 ? 11.420  -16.419 0.555   1.00 8.56  ? 657 ILE A HD13 2  
ATOM 4245  N N    . ASP A 1 144 ? 8.829   -16.409 0.847   1.00 5.35  ? 658 ASP A N    2  
ATOM 4246  C CA   . ASP A 1 144 ? 8.351   -16.705 2.202   1.00 5.81  ? 658 ASP A CA   2  
ATOM 4247  C C    . ASP A 1 144 ? 7.172   -15.803 2.610   1.00 5.85  ? 658 ASP A C    2  
ATOM 4248  O O    . ASP A 1 144 ? 6.240   -16.254 3.277   1.00 6.46  ? 658 ASP A O    2  
ATOM 4249  C CB   . ASP A 1 144 ? 9.535   -16.564 3.172   1.00 5.75  ? 658 ASP A CB   2  
ATOM 4250  C CG   . ASP A 1 144 ? 9.085   -16.702 4.624   1.00 6.72  ? 658 ASP A CG   2  
ATOM 4251  O OD1  . ASP A 1 144 ? 8.704   -17.826 5.032   1.00 7.22  ? 658 ASP A OD1  2  
ATOM 4252  O OD2  . ASP A 1 144 ? 9.032   -15.666 5.331   1.00 7.49  ? 658 ASP A OD2  2  
ATOM 4253  H H    . ASP A 1 144 ? 9.193   -15.481 0.672   1.00 5.12  ? 658 ASP A H    2  
ATOM 4254  H HA   . ASP A 1 144 ? 7.995   -17.733 2.255   1.00 6.33  ? 658 ASP A HA   2  
ATOM 4255  H HB2  . ASP A 1 144 ? 10.276  -17.333 2.949   1.00 5.88  ? 658 ASP A HB2  2  
ATOM 4256  H HB3  . ASP A 1 144 ? 10.002  -15.587 3.034   1.00 5.10  ? 658 ASP A HB3  2  
ATOM 4257  N N    . ARG A 1 145 ? 7.180   -14.531 2.193   1.00 5.34  ? 659 ARG A N    2  
ATOM 4258  C CA   . ARG A 1 145 ? 6.146   -13.526 2.500   1.00 5.50  ? 659 ARG A CA   2  
ATOM 4259  C C    . ARG A 1 145 ? 4.778   -13.839 1.872   1.00 5.97  ? 659 ARG A C    2  
ATOM 4260  O O    . ARG A 1 145 ? 3.767   -13.318 2.337   1.00 6.39  ? 659 ARG A O    2  
ATOM 4261  C CB   . ARG A 1 145 ? 6.697   -12.157 2.074   1.00 4.89  ? 659 ARG A CB   2  
ATOM 4262  C CG   . ARG A 1 145 ? 5.823   -10.991 2.546   1.00 5.82  ? 659 ARG A CG   2  
ATOM 4263  C CD   . ARG A 1 145 ? 6.465   -9.645  2.202   1.00 5.43  ? 659 ARG A CD   2  
ATOM 4264  N NE   . ARG A 1 145 ? 5.581   -8.540  2.628   1.00 6.27  ? 659 ARG A NE   2  
ATOM 4265  C CZ   . ARG A 1 145 ? 5.404   -8.133  3.876   1.00 7.18  ? 659 ARG A CZ   2  
ATOM 4266  N NH1  . ARG A 1 145 ? 6.160   -8.519  4.864   1.00 7.70  ? 659 ARG A NH1  2  
ATOM 4267  N NH2  . ARG A 1 145 ? 4.427   -7.338  4.200   1.00 7.99  ? 659 ARG A NH2  2  
ATOM 4268  H H    . ARG A 1 145 ? 7.997   -14.221 1.674   1.00 4.88  ? 659 ARG A H    2  
ATOM 4269  H HA   . ARG A 1 145 ? 5.989   -13.513 3.579   1.00 5.83  ? 659 ARG A HA   2  
ATOM 4270  H HB2  . ARG A 1 145 ? 7.686   -12.037 2.519   1.00 4.43  ? 659 ARG A HB2  2  
ATOM 4271  H HB3  . ARG A 1 145 ? 6.796   -12.123 0.987   1.00 4.63  ? 659 ARG A HB3  2  
ATOM 4272  H HG2  . ARG A 1 145 ? 4.850   -11.038 2.059   1.00 6.57  ? 659 ARG A HG2  2  
ATOM 4273  H HG3  . ARG A 1 145 ? 5.685   -11.065 3.626   1.00 6.41  ? 659 ARG A HG3  2  
ATOM 4274  H HD2  . ARG A 1 145 ? 7.449   -9.574  2.674   1.00 5.25  ? 659 ARG A HD2  2  
ATOM 4275  H HD3  . ARG A 1 145 ? 6.608   -9.605  1.120   1.00 5.01  ? 659 ARG A HD3  2  
ATOM 4276  H HE   . ARG A 1 145 ? 4.956   -8.158  1.925   1.00 6.46  ? 659 ARG A HE   2  
ATOM 4277  H HH11 . ARG A 1 145 ? 6.920   -9.184  4.738   1.00 7.35  ? 659 ARG A HH11 2  
ATOM 4278  H HH12 . ARG A 1 145 ? 5.902   -8.226  5.800   1.00 8.67  ? 659 ARG A HH12 2  
ATOM 4279  H HH21 . ARG A 1 145 ? 3.728   -7.056  3.515   1.00 8.02  ? 659 ARG A HH21 2  
ATOM 4280  H HH22 . ARG A 1 145 ? 4.271   -7.149  5.184   1.00 8.77  ? 659 ARG A HH22 2  
ATOM 4281  N N    . LEU A 1 146 ? 4.750   -14.709 0.864   1.00 5.99  ? 660 LEU A N    2  
ATOM 4282  C CA   . LEU A 1 146 ? 3.565   -15.290 0.214   1.00 6.39  ? 660 LEU A CA   2  
ATOM 4283  C C    . LEU A 1 146 ? 2.482   -15.839 1.176   1.00 7.49  ? 660 LEU A C    2  
ATOM 4284  O O    . LEU A 1 146 ? 1.299   -15.765 0.848   1.00 7.99  ? 660 LEU A O    2  
ATOM 4285  C CB   . LEU A 1 146 ? 4.100   -16.429 -0.674  1.00 6.07  ? 660 LEU A CB   2  
ATOM 4286  C CG   . LEU A 1 146 ? 3.052   -17.171 -1.527  1.00 6.31  ? 660 LEU A CG   2  
ATOM 4287  C CD1  . LEU A 1 146 ? 2.516   -16.302 -2.665  1.00 6.44  ? 660 LEU A CD1  2  
ATOM 4288  C CD2  . LEU A 1 146 ? 3.708   -18.415 -2.116  1.00 5.97  ? 660 LEU A CD2  2  
ATOM 4289  H H    . LEU A 1 146 ? 5.653   -14.969 0.493   1.00 5.72  ? 660 LEU A H    2  
ATOM 4290  H HA   . LEU A 1 146 ? 3.099   -14.529 -0.414  1.00 6.22  ? 660 LEU A HA   2  
ATOM 4291  H HB2  . LEU A 1 146 ? 4.864   -16.029 -1.343  1.00 5.72  ? 660 LEU A HB2  2  
ATOM 4292  H HB3  . LEU A 1 146 ? 4.585   -17.158 -0.021  1.00 6.39  ? 660 LEU A HB3  2  
ATOM 4293  H HG   . LEU A 1 146 ? 2.220   -17.499 -0.908  1.00 7.21  ? 660 LEU A HG   2  
ATOM 4294  H HD11 . LEU A 1 146 ? 1.864   -16.901 -3.298  1.00 6.51  ? 660 LEU A HD11 2  
ATOM 4295  H HD12 . LEU A 1 146 ? 3.344   -15.928 -3.270  1.00 6.28  ? 660 LEU A HD12 2  
ATOM 4296  H HD13 . LEU A 1 146 ? 1.954   -15.463 -2.258  1.00 7.21  ? 660 LEU A HD13 2  
ATOM 4297  H HD21 . LEU A 1 146 ? 2.979   -18.970 -2.708  1.00 6.24  ? 660 LEU A HD21 2  
ATOM 4298  H HD22 . LEU A 1 146 ? 4.053   -19.046 -1.296  1.00 6.46  ? 660 LEU A HD22 2  
ATOM 4299  H HD23 . LEU A 1 146 ? 4.553   -18.132 -2.744  1.00 5.74  ? 660 LEU A HD23 2  
ATOM 4300  N N    . ASP A 1 147 ? 2.871   -16.387 2.333   1.00 7.98  ? 661 ASP A N    2  
ATOM 4301  C CA   . ASP A 1 147 ? 1.990   -17.119 3.266   1.00 9.03  ? 661 ASP A CA   2  
ATOM 4302  C C    . ASP A 1 147 ? 0.674   -16.394 3.643   1.00 10.60 ? 661 ASP A C    2  
ATOM 4303  O O    . ASP A 1 147 ? 0.641   -15.181 3.851   1.00 11.33 ? 661 ASP A O    2  
ATOM 4304  C CB   . ASP A 1 147 ? 2.787   -17.491 4.533   1.00 9.25  ? 661 ASP A CB   2  
ATOM 4305  C CG   . ASP A 1 147 ? 2.252   -18.720 5.284   1.00 9.97  ? 661 ASP A CG   2  
ATOM 4306  O OD1  . ASP A 1 147 ? 1.181   -19.262 4.918   1.00 10.59 ? 661 ASP A OD1  2  
ATOM 4307  O OD2  . ASP A 1 147 ? 2.952   -19.198 6.213   1.00 10.16 ? 661 ASP A OD2  2  
ATOM 4308  H H    . ASP A 1 147 ? 3.867   -16.471 2.476   1.00 7.57  ? 661 ASP A H    2  
ATOM 4309  H HA   . ASP A 1 147 ? 1.720   -18.047 2.759   1.00 8.82  ? 661 ASP A HA   2  
ATOM 4310  H HB2  . ASP A 1 147 ? 3.819   -17.701 4.249   1.00 8.38  ? 661 ASP A HB2  2  
ATOM 4311  H HB3  . ASP A 1 147 ? 2.802   -16.635 5.211   1.00 10.10 ? 661 ASP A HB3  2  
ATOM 4312  N N    . ARG A 1 148 ? -0.415  -17.159 3.782   1.00 11.43 ? 662 ARG A N    2  
ATOM 4313  C CA   . ARG A 1 148 ? -1.835  -16.730 3.808   1.00 13.09 ? 662 ARG A CA   2  
ATOM 4314  C C    . ARG A 1 148 ? -2.267  -15.795 4.953   1.00 14.37 ? 662 ARG A C    2  
ATOM 4315  O O    . ARG A 1 148 ? -3.436  -15.412 5.002   1.00 15.65 ? 662 ARG A O    2  
ATOM 4316  C CB   . ARG A 1 148 ? -2.702  -18.007 3.856   1.00 13.69 ? 662 ARG A CB   2  
ATOM 4317  C CG   . ARG A 1 148 ? -2.720  -18.808 2.545   1.00 13.49 ? 662 ARG A CG   2  
ATOM 4318  C CD   . ARG A 1 148 ? -3.364  -20.182 2.797   1.00 13.94 ? 662 ARG A CD   2  
ATOM 4319  N NE   . ARG A 1 148 ? -3.679  -20.904 1.553   1.00 14.18 ? 662 ARG A NE   2  
ATOM 4320  C CZ   . ARG A 1 148 ? -2.835  -21.435 0.689   1.00 13.73 ? 662 ARG A CZ   2  
ATOM 4321  N NH1  . ARG A 1 148 ? -1.548  -21.456 0.851   1.00 12.92 ? 662 ARG A NH1  2  
ATOM 4322  N NH2  . ARG A 1 148 ? -3.267  -21.964 -0.412  1.00 14.44 ? 662 ARG A NH2  2  
ATOM 4323  H H    . ARG A 1 148 ? -0.241  -18.158 3.772   1.00 10.97 ? 662 ARG A H    2  
ATOM 4324  H HA   . ARG A 1 148 ? -2.059  -16.182 2.890   1.00 13.28 ? 662 ARG A HA   2  
ATOM 4325  H HB2  . ARG A 1 148 ? -2.337  -18.644 4.666   1.00 13.44 ? 662 ARG A HB2  2  
ATOM 4326  H HB3  . ARG A 1 148 ? -3.736  -17.746 4.087   1.00 14.84 ? 662 ARG A HB3  2  
ATOM 4327  H HG2  . ARG A 1 148 ? -3.300  -18.260 1.802   1.00 14.08 ? 662 ARG A HG2  2  
ATOM 4328  H HG3  . ARG A 1 148 ? -1.706  -18.945 2.169   1.00 12.74 ? 662 ARG A HG3  2  
ATOM 4329  H HD2  . ARG A 1 148 ? -2.703  -20.786 3.423   1.00 13.33 ? 662 ARG A HD2  2  
ATOM 4330  H HD3  . ARG A 1 148 ? -4.298  -20.030 3.339   1.00 15.06 ? 662 ARG A HD3  2  
ATOM 4331  H HE   . ARG A 1 148 ? -4.666  -21.053 1.364   1.00 15.02 ? 662 ARG A HE   2  
ATOM 4332  H HH11 . ARG A 1 148 ? -1.121  -21.055 1.678   1.00 12.54 ? 662 ARG A HH11 2  
ATOM 4333  H HH12 . ARG A 1 148 ? -0.973  -21.763 0.083   1.00 12.94 ? 662 ARG A HH12 2  
ATOM 4334  H HH21 . ARG A 1 148 ? -4.242  -21.887 -0.663  1.00 15.28 ? 662 ARG A HH21 2  
ATOM 4335  H HH22 . ARG A 1 148 ? -2.591  -22.301 -1.084  1.00 14.35 ? 662 ARG A HH22 2  
ATOM 4336  N N    . ILE A 1 149 ? -1.390  -15.458 5.901   1.00 14.31 ? 663 ILE A N    2  
ATOM 4337  C CA   . ILE A 1 149 ? -1.785  -15.003 7.248   1.00 15.66 ? 663 ILE A CA   2  
ATOM 4338  C C    . ILE A 1 149 ? -2.387  -13.601 7.263   1.00 17.28 ? 663 ILE A C    2  
ATOM 4339  O O    . ILE A 1 149 ? -1.714  -12.570 7.239   1.00 17.77 ? 663 ILE A O    2  
ATOM 4340  C CB   . ILE A 1 149 ? -0.642  -15.157 8.253   1.00 15.32 ? 663 ILE A CB   2  
ATOM 4341  C CG1  . ILE A 1 149 ? -0.124  -16.605 8.312   1.00 13.99 ? 663 ILE A CG1  2  
ATOM 4342  C CG2  . ILE A 1 149 ? -1.055  -14.714 9.672   1.00 16.83 ? 663 ILE A CG2  2  
ATOM 4343  C CD1  . ILE A 1 149 ? -1.170  -17.721 8.285   1.00 14.12 ? 663 ILE A CD1  2  
ATOM 4344  H H    . ILE A 1 149 ? -0.426  -15.708 5.739   1.00 13.37 ? 663 ILE A H    2  
ATOM 4345  H HA   . ILE A 1 149 ? -2.579  -15.671 7.586   1.00 16.08 ? 663 ILE A HA   2  
ATOM 4346  H HB   . ILE A 1 149 ? 0.175   -14.525 7.922   1.00 15.25 ? 663 ILE A HB   2  
ATOM 4347  H HG12 . ILE A 1 149 ? 0.592   -16.772 7.506   1.00 12.97 ? 663 ILE A HG12 2  
ATOM 4348  H HG13 . ILE A 1 149 ? 0.384   -16.691 9.255   1.00 14.31 ? 663 ILE A HG13 2  
ATOM 4349  H HG21 . ILE A 1 149 ? -1.876  -15.330 10.038  1.00 17.12 ? 663 ILE A HG21 2  
ATOM 4350  H HG22 . ILE A 1 149 ? -0.211  -14.812 10.355  1.00 17.08 ? 663 ILE A HG22 2  
ATOM 4351  H HG23 . ILE A 1 149 ? -1.362  -13.669 9.683   1.00 17.62 ? 663 ILE A HG23 2  
ATOM 4352  H HD11 . ILE A 1 149 ? -0.683  -18.673 8.491   1.00 13.76 ? 663 ILE A HD11 2  
ATOM 4353  H HD12 . ILE A 1 149 ? -1.926  -17.528 9.044   1.00 15.11 ? 663 ILE A HD12 2  
ATOM 4354  H HD13 . ILE A 1 149 ? -1.636  -17.772 7.304   1.00 13.89 ? 663 ILE A HD13 2  
ATOM 4355  N N    . GLY A 1 150 ? -3.707  -13.616 7.310   1.00 18.36 ? 664 GLY A N    2  
ATOM 4356  C CA   . GLY A 1 150 ? -4.609  -12.483 7.117   1.00 20.03 ? 664 GLY A CA   2  
ATOM 4357  C C    . GLY A 1 150 ? -4.462  -11.827 5.739   1.00 20.39 ? 664 GLY A C    2  
ATOM 4358  O O    . GLY A 1 150 ? -4.736  -10.631 5.620   1.00 21.65 ? 664 GLY A O    2  
ATOM 4359  H H    . GLY A 1 150 ? -4.081  -14.546 7.418   1.00 18.07 ? 664 GLY A H    2  
ATOM 4360  H HA2  . GLY A 1 150 ? -5.636  -12.833 7.221   1.00 20.56 ? 664 GLY A HA2  2  
ATOM 4361  H HA3  . GLY A 1 150 ? -4.417  -11.733 7.886   1.00 20.78 ? 664 GLY A HA3  2  
ATOM 4362  N N    . LYS A 1 151 ? -3.952  -12.557 4.731   1.00 19.44 ? 665 LYS A N    2  
ATOM 4363  C CA   . LYS A 1 151 ? -3.387  -12.009 3.481   1.00 19.73 ? 665 LYS A CA   2  
ATOM 4364  C C    . LYS A 1 151 ? -3.747  -12.825 2.224   1.00 19.97 ? 665 LYS A C    2  
ATOM 4365  O O    . LYS A 1 151 ? -3.850  -14.049 2.302   1.00 19.47 ? 665 LYS A O    2  
ATOM 4366  C CB   . LYS A 1 151 ? -1.859  -11.915 3.613   1.00 18.67 ? 665 LYS A CB   2  
ATOM 4367  C CG   . LYS A 1 151 ? -1.351  -10.771 4.511   1.00 18.84 ? 665 LYS A CG   2  
ATOM 4368  C CD   . LYS A 1 151 ? 0.086   -10.972 5.026   1.00 17.85 ? 665 LYS A CD   2  
ATOM 4369  C CE   . LYS A 1 151 ? 1.126   -11.215 3.924   1.00 17.27 ? 665 LYS A CE   2  
ATOM 4370  N NZ   . LYS A 1 151 ? 1.617   -12.611 3.931   1.00 15.94 ? 665 LYS A NZ   2  
ATOM 4371  H H    . LYS A 1 151 ? -3.801  -13.547 4.910   1.00 18.54 ? 665 LYS A H    2  
ATOM 4372  H HA   . LYS A 1 151 ? -3.765  -11.011 3.366   1.00 20.86 ? 665 LYS A HA   2  
ATOM 4373  H HB2  . LYS A 1 151 ? -1.517  -12.866 4.004   1.00 18.00 ? 665 LYS A HB2  2  
ATOM 4374  H HB3  . LYS A 1 151 ? -1.428  -11.772 2.623   1.00 18.70 ? 665 LYS A HB3  2  
ATOM 4375  H HG2  . LYS A 1 151 ? -1.403  -9.839  3.946   1.00 19.40 ? 665 LYS A HG2  2  
ATOM 4376  H HG3  . LYS A 1 151 ? -1.998  -10.665 5.379   1.00 19.44 ? 665 LYS A HG3  2  
ATOM 4377  H HD2  . LYS A 1 151 ? 0.371   -10.071 5.572   1.00 18.48 ? 665 LYS A HD2  2  
ATOM 4378  H HD3  . LYS A 1 151 ? 0.109   -11.801 5.738   1.00 17.23 ? 665 LYS A HD3  2  
ATOM 4379  H HE2  . LYS A 1 151 ? 0.688   -10.986 2.951   1.00 17.54 ? 665 LYS A HE2  2  
ATOM 4380  H HE3  . LYS A 1 151 ? 1.968   -10.538 4.091   1.00 17.90 ? 665 LYS A HE3  2  
ATOM 4381  H HZ1  . LYS A 1 151 ? 2.345   -12.758 3.238   1.00 15.52 ? 665 LYS A HZ1  2  
ATOM 4382  H HZ2  . LYS A 1 151 ? 0.893   -13.279 3.660   1.00 15.71 ? 665 LYS A HZ2  2  
ATOM 4383  H HZ3  . LYS A 1 151 ? 1.985   -12.885 4.838   1.00 15.84 ? 665 LYS A HZ3  2  
ATOM 4384  N N    . LYS A 1 152 ? -3.904  -12.170 1.063   1.00 20.94 ? 666 LYS A N    2  
ATOM 4385  C CA   . LYS A 1 152 ? -4.083  -12.820 -0.261  1.00 21.44 ? 666 LYS A CA   2  
ATOM 4386  C C    . LYS A 1 152 ? -2.794  -13.549 -0.683  1.00 20.87 ? 666 LYS A C    2  
ATOM 4387  O O    . LYS A 1 152 ? -1.704  -13.192 -0.241  1.00 20.84 ? 666 LYS A O    2  
ATOM 4388  C CB   . LYS A 1 152 ? -4.520  -11.764 -1.309  1.00 22.78 ? 666 LYS A CB   2  
ATOM 4389  C CG   . LYS A 1 152 ? -5.654  -12.144 -2.286  1.00 23.56 ? 666 LYS A CG   2  
ATOM 4390  C CD   . LYS A 1 152 ? -5.336  -13.217 -3.341  1.00 23.42 ? 666 LYS A CD   2  
ATOM 4391  C CE   . LYS A 1 152 ? -6.477  -13.320 -4.366  1.00 24.82 ? 666 LYS A CE   2  
ATOM 4392  N NZ   . LYS A 1 152 ? -6.241  -14.385 -5.375  1.00 24.95 ? 666 LYS A NZ   2  
ATOM 4393  H H    . LYS A 1 152 ? -3.830  -11.162 1.081   1.00 21.45 ? 666 LYS A H    2  
ATOM 4394  H HA   . LYS A 1 152 ? -4.874  -13.565 -0.167  1.00 21.51 ? 666 LYS A HA   2  
ATOM 4395  H HB2  . LYS A 1 152 ? -4.887  -10.891 -0.774  1.00 23.53 ? 666 LYS A HB2  2  
ATOM 4396  H HB3  . LYS A 1 152 ? -3.650  -11.432 -1.881  1.00 22.76 ? 666 LYS A HB3  2  
ATOM 4397  H HG2  . LYS A 1 152 ? -6.525  -12.457 -1.709  1.00 23.81 ? 666 LYS A HG2  2  
ATOM 4398  H HG3  . LYS A 1 152 ? -5.931  -11.234 -2.818  1.00 24.31 ? 666 LYS A HG3  2  
ATOM 4399  H HD2  . LYS A 1 152 ? -4.412  -12.954 -3.856  1.00 23.16 ? 666 LYS A HD2  2  
ATOM 4400  H HD3  . LYS A 1 152 ? -5.225  -14.182 -2.850  1.00 22.80 ? 666 LYS A HD3  2  
ATOM 4401  H HE2  . LYS A 1 152 ? -7.408  -13.528 -3.831  1.00 25.19 ? 666 LYS A HE2  2  
ATOM 4402  H HE3  . LYS A 1 152 ? -6.594  -12.354 -4.869  1.00 25.57 ? 666 LYS A HE3  2  
ATOM 4403  H HZ1  . LYS A 1 152 ? -7.037  -14.476 -6.001  1.00 25.78 ? 666 LYS A HZ1  2  
ATOM 4404  H HZ2  . LYS A 1 152 ? -6.112  -15.291 -4.926  1.00 24.61 ? 666 LYS A HZ2  2  
ATOM 4405  H HZ3  . LYS A 1 152 ? -5.423  -14.215 -5.952  1.00 24.72 ? 666 LYS A HZ3  2  
ATOM 4406  N N    . ASN A 1 153 ? -2.907  -14.555 -1.545  1.00 20.69 ? 667 ASN A N    2  
ATOM 4407  C CA   . ASN A 1 153 ? -1.803  -15.380 -2.050  1.00 20.41 ? 667 ASN A CA   2  
ATOM 4408  C C    . ASN A 1 153 ? -1.795  -15.487 -3.594  1.00 20.99 ? 667 ASN A C    2  
ATOM 4409  O O    . ASN A 1 153 ? -2.714  -15.005 -4.261  1.00 21.78 ? 667 ASN A O    2  
ATOM 4410  C CB   . ASN A 1 153 ? -1.839  -16.751 -1.340  1.00 19.94 ? 667 ASN A CB   2  
ATOM 4411  C CG   . ASN A 1 153 ? -3.099  -17.578 -1.572  1.00 20.72 ? 667 ASN A CG   2  
ATOM 4412  O OD1  . ASN A 1 153 ? -4.209  -17.078 -1.703  1.00 21.56 ? 667 ASN A OD1  2  
ATOM 4413  N ND2  . ASN A 1 153 ? -2.986  -18.881 -1.565  1.00 20.70 ? 667 ASN A ND2  2  
ATOM 4414  H H    . ASN A 1 153 ? -3.831  -14.808 -1.860  1.00 20.92 ? 667 ASN A H    2  
ATOM 4415  H HA   . ASN A 1 153 ? -0.857  -14.905 -1.782  1.00 20.41 ? 667 ASN A HA   2  
ATOM 4416  H HB2  . ASN A 1 153 ? -0.975  -17.328 -1.664  1.00 19.39 ? 667 ASN A HB2  2  
ATOM 4417  H HB3  . ASN A 1 153 ? -1.733  -16.600 -0.267  1.00 19.82 ? 667 ASN A HB3  2  
ATOM 4418  H HD21 . ASN A 1 153 ? -2.064  -19.302 -1.460  1.00 20.17 ? 667 ASN A HD21 2  
ATOM 4419  H HD22 . ASN A 1 153 ? -3.823  -19.436 -1.691  1.00 21.39 ? 667 ASN A HD22 2  
ATOM 4420  N N    . SER A 1 154 ? -0.742  -16.102 -4.149  1.00 20.83 ? 668 SER A N    2  
ATOM 4421  C CA   . SER A 1 154 ? -0.487  -16.236 -5.596  1.00 21.55 ? 668 SER A CA   2  
ATOM 4422  C C    . SER A 1 154 ? 0.227   -17.558 -5.951  1.00 21.26 ? 668 SER A C    2  
ATOM 4423  O O    . SER A 1 154 ? 0.443   -18.428 -5.098  1.00 20.79 ? 668 SER A O    2  
ATOM 4424  C CB   . SER A 1 154 ? 0.381   -15.063 -6.102  1.00 22.16 ? 668 SER A CB   2  
ATOM 4425  O OG   . SER A 1 154 ? -0.168  -13.790 -5.818  1.00 22.63 ? 668 SER A OG   2  
ATOM 4426  H H    . SER A 1 154 ? -0.055  -16.510 -3.535  1.00 20.31 ? 668 SER A H    2  
ATOM 4427  H HA   . SER A 1 154 ? -1.434  -16.219 -6.133  1.00 22.18 ? 668 SER A HA   2  
ATOM 4428  H HB2  . SER A 1 154 ? 1.364   -15.131 -5.634  1.00 22.14 ? 668 SER A HB2  2  
ATOM 4429  H HB3  . SER A 1 154 ? 0.503   -15.152 -7.185  1.00 22.47 ? 668 SER A HB3  2  
ATOM 4430  H HG   . SER A 1 154 ? -0.650  -13.484 -6.612  1.00 23.27 ? 668 SER A HG   2  
ATOM 4431  N N    . ILE A 1 155 ? 0.614   -17.697 -7.223  1.00 21.77 ? 669 ILE A N    2  
ATOM 4432  C CA   . ILE A 1 155 ? 1.449   -18.779 -7.777  1.00 21.88 ? 669 ILE A CA   2  
ATOM 4433  C C    . ILE A 1 155 ? 2.894   -18.761 -7.231  1.00 21.40 ? 669 ILE A C    2  
ATOM 4434  O O    . ILE A 1 155 ? 3.421   -17.695 -6.908  1.00 21.24 ? 669 ILE A O    2  
ATOM 4435  C CB   . ILE A 1 155 ? 1.417   -18.728 -9.325  1.00 23.06 ? 669 ILE A CB   2  
ATOM 4436  C CG1  . ILE A 1 155 ? 2.168   -17.508 -9.912  1.00 23.55 ? 669 ILE A CG1  2  
ATOM 4437  C CG2  . ILE A 1 155 ? -0.048  -18.756 -9.804  1.00 23.78 ? 669 ILE A CG2  2  
ATOM 4438  C CD1  . ILE A 1 155 ? 2.156   -17.459 -11.446 1.00 24.88 ? 669 ILE A CD1  2  
ATOM 4439  H H    . ILE A 1 155 ? 0.318   -16.981 -7.871  1.00 22.28 ? 669 ILE A H    2  
ATOM 4440  H HA   . ILE A 1 155 ? 1.004   -19.729 -7.474  1.00 21.73 ? 669 ILE A HA   2  
ATOM 4441  H HB   . ILE A 1 155 ? 1.910   -19.626 -9.697  1.00 23.28 ? 669 ILE A HB   2  
ATOM 4442  H HG12 . ILE A 1 155 ? 1.734   -16.583 -9.530  1.00 23.51 ? 669 ILE A HG12 2  
ATOM 4443  H HG13 . ILE A 1 155 ? 3.212   -17.548 -9.600  1.00 23.18 ? 669 ILE A HG13 2  
ATOM 4444  H HG21 . ILE A 1 155 ? -0.531  -17.796 -9.601  1.00 24.07 ? 669 ILE A HG21 2  
ATOM 4445  H HG22 . ILE A 1 155 ? -0.095  -18.961 -10.873 1.00 24.21 ? 669 ILE A HG22 2  
ATOM 4446  H HG23 . ILE A 1 155 ? -0.593  -19.546 -9.285  1.00 23.80 ? 669 ILE A HG23 2  
ATOM 4447  H HD11 . ILE A 1 155 ? 2.851   -16.694 -11.788 1.00 25.15 ? 669 ILE A HD11 2  
ATOM 4448  H HD12 . ILE A 1 155 ? 2.465   -18.422 -11.851 1.00 25.13 ? 669 ILE A HD12 2  
ATOM 4449  H HD13 . ILE A 1 155 ? 1.160   -17.210 -11.810 1.00 25.49 ? 669 ILE A HD13 2  
ATOM 4450  N N    . LEU A 1 156 ? 3.549   -19.927 -7.153  1.00 21.44 ? 670 LEU A N    2  
ATOM 4451  C CA   . LEU A 1 156 ? 4.871   -20.114 -6.516  1.00 21.35 ? 670 LEU A CA   2  
ATOM 4452  C C    . LEU A 1 156 ? 6.040   -20.309 -7.505  1.00 22.13 ? 670 LEU A C    2  
ATOM 4453  O O    . LEU A 1 156 ? 5.823   -20.570 -8.691  1.00 22.79 ? 670 LEU A O    2  
ATOM 4454  C CB   . LEU A 1 156 ? 4.781   -21.239 -5.464  1.00 21.05 ? 670 LEU A CB   2  
ATOM 4455  C CG   . LEU A 1 156 ? 4.912   -22.688 -5.982  1.00 21.25 ? 670 LEU A CG   2  
ATOM 4456  C CD1  . LEU A 1 156 ? 4.813   -23.645 -4.796  1.00 21.42 ? 670 LEU A CD1  2  
ATOM 4457  C CD2  . LEU A 1 156 ? 3.839   -23.083 -6.997  1.00 21.48 ? 670 LEU A CD2  2  
ATOM 4458  H H    . LEU A 1 156 ? 3.077   -20.749 -7.502  1.00 21.74 ? 670 LEU A H    2  
ATOM 4459  H HA   . LEU A 1 156 ? 5.100   -19.202 -5.961  1.00 21.17 ? 670 LEU A HA   2  
ATOM 4460  H HB2  . LEU A 1 156 ? 5.588   -21.078 -4.747  1.00 20.93 ? 670 LEU A HB2  2  
ATOM 4461  H HB3  . LEU A 1 156 ? 3.844   -21.136 -4.914  1.00 21.06 ? 670 LEU A HB3  2  
ATOM 4462  H HG   . LEU A 1 156 ? 5.893   -22.819 -6.440  1.00 21.44 ? 670 LEU A HG   2  
ATOM 4463  H HD11 . LEU A 1 156 ? 5.010   -24.661 -5.133  1.00 21.60 ? 670 LEU A HD11 2  
ATOM 4464  H HD12 . LEU A 1 156 ? 3.819   -23.600 -4.358  1.00 21.74 ? 670 LEU A HD12 2  
ATOM 4465  H HD13 . LEU A 1 156 ? 5.555   -23.385 -4.040  1.00 21.30 ? 670 LEU A HD13 2  
ATOM 4466  H HD21 . LEU A 1 156 ? 3.968   -22.522 -7.921  1.00 21.71 ? 670 LEU A HD21 2  
ATOM 4467  H HD22 . LEU A 1 156 ? 2.845   -22.903 -6.589  1.00 21.55 ? 670 LEU A HD22 2  
ATOM 4468  H HD23 . LEU A 1 156 ? 3.936   -24.143 -7.238  1.00 21.59 ? 670 LEU A HD23 2  
ATOM 4469  N N    . LEU A 1 157 ? 7.286   -20.198 -7.023  1.00 22.28 ? 671 LEU A N    2  
ATOM 4470  C CA   . LEU A 1 157 ? 8.514   -20.253 -7.836  1.00 23.24 ? 671 LEU A CA   2  
ATOM 4471  C C    . LEU A 1 157 ? 9.023   -21.681 -8.134  1.00 23.69 ? 671 LEU A C    2  
ATOM 4472  O O    . LEU A 1 157 ? 8.930   -22.596 -7.306  1.00 23.25 ? 671 LEU A O    2  
ATOM 4473  C CB   . LEU A 1 157 ? 9.604   -19.385 -7.167  1.00 23.35 ? 671 LEU A CB   2  
ATOM 4474  C CG   . LEU A 1 157 ? 10.937  -19.235 -7.931  1.00 24.37 ? 671 LEU A CG   2  
ATOM 4475  C CD1  . LEU A 1 157 ? 10.765  -18.545 -9.287  1.00 25.42 ? 671 LEU A CD1  2  
ATOM 4476  C CD2  . LEU A 1 157 ? 11.916  -18.401 -7.103  1.00 24.52 ? 671 LEU A CD2  2  
ATOM 4477  H H    . LEU A 1 157 ? 7.394   -19.979 -6.038  1.00 21.85 ? 671 LEU A H    2  
ATOM 4478  H HA   . LEU A 1 157 ? 8.281   -19.787 -8.794  1.00 23.83 ? 671 LEU A HA   2  
ATOM 4479  H HB2  . LEU A 1 157 ? 9.201   -18.388 -7.003  1.00 23.20 ? 671 LEU A HB2  2  
ATOM 4480  H HB3  . LEU A 1 157 ? 9.825   -19.812 -6.192  1.00 22.99 ? 671 LEU A HB3  2  
ATOM 4481  H HG   . LEU A 1 157 ? 11.384  -20.215 -8.085  1.00 24.46 ? 671 LEU A HG   2  
ATOM 4482  H HD11 . LEU A 1 157 ? 10.312  -17.563 -9.152  1.00 25.61 ? 671 LEU A HD11 2  
ATOM 4483  H HD12 . LEU A 1 157 ? 10.142  -19.142 -9.950  1.00 25.71 ? 671 LEU A HD12 2  
ATOM 4484  H HD13 . LEU A 1 157 ? 11.740  -18.422 -9.756  1.00 25.86 ? 671 LEU A HD13 2  
ATOM 4485  H HD21 . LEU A 1 157 ? 12.101  -18.897 -6.150  1.00 24.48 ? 671 LEU A HD21 2  
ATOM 4486  H HD22 . LEU A 1 157 ? 11.505  -17.407 -6.922  1.00 24.62 ? 671 LEU A HD22 2  
ATOM 4487  H HD23 . LEU A 1 157 ? 12.862  -18.311 -7.635  1.00 24.80 ? 671 LEU A HD23 2  
ATOM 4488  N N    . HIS A 1 158 ? 9.599   -21.820 -9.331  1.00 24.78 ? 672 HIS A N    2  
ATOM 4489  C CA   . HIS A 1 158 ? 10.382  -22.926 -9.903  1.00 25.66 ? 672 HIS A CA   2  
ATOM 4490  C C    . HIS A 1 158 ? 11.255  -23.710 -8.909  1.00 25.51 ? 672 HIS A C    2  
ATOM 4491  O O    . HIS A 1 158 ? 12.146  -23.108 -8.263  1.00 25.27 ? 672 HIS A O    2  
ATOM 4492  C CB   . HIS A 1 158 ? 11.239  -22.277 -11.006 1.00 26.77 ? 672 HIS A CB   2  
ATOM 4493  C CG   . HIS A 1 158 ? 12.114  -23.222 -11.783 1.00 27.92 ? 672 HIS A CG   2  
ATOM 4494  N ND1  . HIS A 1 158 ? 11.719  -24.393 -12.385 1.00 28.62 ? 672 HIS A ND1  2  
ATOM 4495  C CD2  . HIS A 1 158 ? 13.440  -23.042 -12.074 1.00 28.67 ? 672 HIS A CD2  2  
ATOM 4496  C CE1  . HIS A 1 158 ? 12.780  -24.916 -13.021 1.00 29.72 ? 672 HIS A CE1  2  
ATOM 4497  N NE2  . HIS A 1 158 ? 13.858  -24.123 -12.863 1.00 29.77 ? 672 HIS A NE2  2  
ATOM 4498  H H    . HIS A 1 158 ? 9.482   -21.031 -9.951  1.00 25.17 ? 672 HIS A H    2  
ATOM 4499  H HA   . HIS A 1 158 ? 9.699   -23.639 -10.363 1.00 25.87 ? 672 HIS A HA   2  
ATOM 4500  H HB2  . HIS A 1 158 ? 10.581  -21.772 -11.716 1.00 26.97 ? 672 HIS A HB2  2  
ATOM 4501  H HB3  . HIS A 1 158 ? 11.878  -21.518 -10.551 1.00 26.71 ? 672 HIS A HB3  2  
ATOM 4502  H HD1  . HIS A 1 158 ? 10.783  -24.793 -12.346 1.00 28.45 ? 672 HIS A HD1  2  
ATOM 4503  H HD2  . HIS A 1 158 ? 14.047  -22.201 -11.761 1.00 28.57 ? 672 HIS A HD2  2  
ATOM 4504  H HE1  . HIS A 1 158 ? 12.767  -25.842 -13.585 1.00 30.55 ? 672 HIS A HE1  2  
ATOM 4505  N N    . ASN A 1 20  ? 3.292   12.201  2.444   1.00 4.99  ? 534 ASN A N    3  
ATOM 4506  C CA   . ASN A 1 20  ? 3.417   11.065  3.360   1.00 4.50  ? 534 ASN A CA   3  
ATOM 4507  C C    . ASN A 1 20  ? 4.831   11.014  3.964   1.00 2.72  ? 534 ASN A C    3  
ATOM 4508  O O    . ASN A 1 20  ? 5.802   11.363  3.288   1.00 3.02  ? 534 ASN A O    3  
ATOM 4509  C CB   . ASN A 1 20  ? 2.980   9.759   2.658   1.00 6.32  ? 534 ASN A CB   3  
ATOM 4510  C CG   . ASN A 1 20  ? 4.081   8.995   1.934   1.00 7.05  ? 534 ASN A CG   3  
ATOM 4511  O OD1  . ASN A 1 20  ? 4.378   7.852   2.243   1.00 7.56  ? 534 ASN A OD1  3  
ATOM 4512  N ND2  . ASN A 1 20  ? 4.703   9.554   0.925   1.00 7.73  ? 534 ASN A ND2  3  
ATOM 4513  H H    . ASN A 1 20  ? 3.985   12.290  1.708   1.00 5.49  ? 534 ASN A H    3  
ATOM 4514  H HA   . ASN A 1 20  ? 2.729   11.221  4.194   1.00 4.88  ? 534 ASN A HA   3  
ATOM 4515  H HB2  . ASN A 1 20  ? 2.582   9.089   3.418   1.00 7.27  ? 534 ASN A HB2  3  
ATOM 4516  H HB3  . ASN A 1 20  ? 2.175   9.968   1.954   1.00 6.97  ? 534 ASN A HB3  3  
ATOM 4517  H HD21 . ASN A 1 20  ? 4.563   10.529  0.679   1.00 7.60  ? 534 ASN A HD21 3  
ATOM 4518  H HD22 . ASN A 1 20  ? 5.460   9.026   0.532   1.00 8.59  ? 534 ASN A HD22 3  
ATOM 4519  N N    . CYS A 1 21  ? 4.959   10.554  5.212   1.00 2.68  ? 535 CYS A N    3  
ATOM 4520  C CA   . CYS A 1 21  ? 6.273   10.276  5.797   1.00 2.84  ? 535 CYS A CA   3  
ATOM 4521  C C    . CYS A 1 21  ? 6.963   9.118   5.067   1.00 2.02  ? 535 CYS A C    3  
ATOM 4522  O O    . CYS A 1 21  ? 6.320   8.138   4.691   1.00 1.59  ? 535 CYS A O    3  
ATOM 4523  C CB   . CYS A 1 21  ? 6.150   9.990   7.299   1.00 5.26  ? 535 CYS A CB   3  
ATOM 4524  S SG   . CYS A 1 21  ? 6.228   11.550  8.213   1.00 6.81  ? 535 CYS A SG   3  
ATOM 4525  H H    . CYS A 1 21  ? 4.135   10.279  5.723   1.00 3.94  ? 535 CYS A H    3  
ATOM 4526  H HA   . CYS A 1 21  ? 6.906   11.154  5.672   1.00 3.09  ? 535 CYS A HA   3  
ATOM 4527  H HB2  . CYS A 1 21  ? 5.222   9.466   7.524   1.00 5.87  ? 535 CYS A HB2  3  
ATOM 4528  H HB3  . CYS A 1 21  ? 6.986   9.370   7.625   1.00 6.15  ? 535 CYS A HB3  3  
ATOM 4529  H HG   . CYS A 1 21  ? 5.078   12.067  7.759   1.00 6.39  ? 535 CYS A HG   3  
ATOM 4530  N N    . ARG A 1 22  ? 8.291   9.174   4.947   1.00 2.05  ? 536 ARG A N    3  
ATOM 4531  C CA   . ARG A 1 22  ? 9.103   8.091   4.371   1.00 1.68  ? 536 ARG A CA   3  
ATOM 4532  C C    . ARG A 1 22  ? 8.935   6.815   5.201   1.00 1.76  ? 536 ARG A C    3  
ATOM 4533  O O    . ARG A 1 22  ? 8.685   5.749   4.644   1.00 1.75  ? 536 ARG A O    3  
ATOM 4534  C CB   . ARG A 1 22  ? 10.581  8.512   4.285   1.00 2.14  ? 536 ARG A CB   3  
ATOM 4535  C CG   . ARG A 1 22  ? 10.875  9.680   3.326   1.00 1.79  ? 536 ARG A CG   3  
ATOM 4536  C CD   . ARG A 1 22  ? 10.467  11.081  3.826   1.00 2.49  ? 536 ARG A CD   3  
ATOM 4537  N NE   . ARG A 1 22  ? 9.204   11.566  3.234   1.00 4.18  ? 536 ARG A NE   3  
ATOM 4538  C CZ   . ARG A 1 22  ? 9.017   11.953  1.990   1.00 5.71  ? 536 ARG A CZ   3  
ATOM 4539  N NH1  . ARG A 1 22  ? 9.983   12.077  1.140   1.00 5.91  ? 536 ARG A NH1  3  
ATOM 4540  N NH2  . ARG A 1 22  ? 7.829   12.236  1.561   1.00 7.60  ? 536 ARG A NH2  3  
ATOM 4541  H H    . ARG A 1 22  ? 8.774   9.934   5.413   1.00 2.68  ? 536 ARG A H    3  
ATOM 4542  H HA   . ARG A 1 22  ? 8.740   7.860   3.368   1.00 1.35  ? 536 ARG A HA   3  
ATOM 4543  H HB2  . ARG A 1 22  ? 10.957  8.760   5.278   1.00 3.11  ? 536 ARG A HB2  3  
ATOM 4544  H HB3  . ARG A 1 22  ? 11.150  7.651   3.930   1.00 3.42  ? 536 ARG A HB3  3  
ATOM 4545  H HG2  . ARG A 1 22  ? 11.951  9.698   3.189   1.00 2.72  ? 536 ARG A HG2  3  
ATOM 4546  H HG3  . ARG A 1 22  ? 10.433  9.475   2.350   1.00 2.83  ? 536 ARG A HG3  3  
ATOM 4547  H HD2  . ARG A 1 22  ? 10.385  11.074  4.912   1.00 3.36  ? 536 ARG A HD2  3  
ATOM 4548  H HD3  . ARG A 1 22  ? 11.261  11.784  3.579   1.00 2.59  ? 536 ARG A HD3  3  
ATOM 4549  H HE   . ARG A 1 22  ? 8.449   11.807  3.869   1.00 4.80  ? 536 ARG A HE   3  
ATOM 4550  H HH11 . ARG A 1 22  ? 10.944  12.118  1.469   1.00 4.94  ? 536 ARG A HH11 3  
ATOM 4551  H HH12 . ARG A 1 22  ? 9.782   12.329  0.178   1.00 7.43  ? 536 ARG A HH12 3  
ATOM 4552  H HH21 . ARG A 1 22  ? 7.037   12.046  2.167   1.00 7.94  ? 536 ARG A HH21 3  
ATOM 4553  H HH22 . ARG A 1 22  ? 7.720   12.609  0.628   1.00 8.88  ? 536 ARG A HH22 3  
ATOM 4554  N N    . LYS A 1 23  ? 8.901   6.958   6.532   1.00 2.10  ? 537 LYS A N    3  
ATOM 4555  C CA   . LYS A 1 23  ? 8.515   5.924   7.506   1.00 2.23  ? 537 LYS A CA   3  
ATOM 4556  C C    . LYS A 1 23  ? 7.140   5.285   7.242   1.00 1.82  ? 537 LYS A C    3  
ATOM 4557  O O    . LYS A 1 23  ? 6.928   4.137   7.631   1.00 2.01  ? 537 LYS A O    3  
ATOM 4558  C CB   . LYS A 1 23  ? 8.555   6.576   8.903   1.00 2.60  ? 537 LYS A CB   3  
ATOM 4559  C CG   . LYS A 1 23  ? 8.157   5.659   10.072  1.00 3.56  ? 537 LYS A CG   3  
ATOM 4560  C CD   . LYS A 1 23  ? 9.108   4.472   10.262  1.00 5.03  ? 537 LYS A CD   3  
ATOM 4561  C CE   . LYS A 1 23  ? 8.460   3.404   11.150  1.00 5.92  ? 537 LYS A CE   3  
ATOM 4562  N NZ   . LYS A 1 23  ? 9.464   2.444   11.661  1.00 7.26  ? 537 LYS A NZ   3  
ATOM 4563  H H    . LYS A 1 23  ? 9.173   7.866   6.897   1.00 2.41  ? 537 LYS A H    3  
ATOM 4564  H HA   . LYS A 1 23  ? 9.255   5.127   7.464   1.00 2.47  ? 537 LYS A HA   3  
ATOM 4565  H HB2  . LYS A 1 23  ? 9.560   6.958   9.090   1.00 2.80  ? 537 LYS A HB2  3  
ATOM 4566  H HB3  . LYS A 1 23  ? 7.869   7.424   8.907   1.00 2.55  ? 537 LYS A HB3  3  
ATOM 4567  H HG2  . LYS A 1 23  ? 8.167   6.254   10.984  1.00 3.61  ? 537 LYS A HG2  3  
ATOM 4568  H HG3  . LYS A 1 23  ? 7.138   5.301   9.929   1.00 4.15  ? 537 LYS A HG3  3  
ATOM 4569  H HD2  . LYS A 1 23  ? 9.348   4.020   9.301   1.00 5.87  ? 537 LYS A HD2  3  
ATOM 4570  H HD3  . LYS A 1 23  ? 10.029  4.837   10.717  1.00 5.37  ? 537 LYS A HD3  3  
ATOM 4571  H HE2  . LYS A 1 23  ? 7.963   3.891   11.991  1.00 5.29  ? 537 LYS A HE2  3  
ATOM 4572  H HE3  . LYS A 1 23  ? 7.699   2.877   10.569  1.00 6.85  ? 537 LYS A HE3  3  
ATOM 4573  H HZ1  . LYS A 1 23  ? 10.033  2.892   12.371  1.00 7.36  ? 537 LYS A HZ1  3  
ATOM 4574  H HZ2  . LYS A 1 23  ? 10.063  2.106   10.909  1.00 7.89  ? 537 LYS A HZ2  3  
ATOM 4575  H HZ3  . LYS A 1 23  ? 9.007   1.647   12.102  1.00 8.01  ? 537 LYS A HZ3  3  
ATOM 4576  N N    . LEU A 1 24  ? 6.209   5.992   6.597   1.00 1.43  ? 538 LEU A N    3  
ATOM 4577  C CA   . LEU A 1 24  ? 4.831   5.532   6.401   1.00 1.20  ? 538 LEU A CA   3  
ATOM 4578  C C    . LEU A 1 24  ? 4.725   4.532   5.244   1.00 1.21  ? 538 LEU A C    3  
ATOM 4579  O O    . LEU A 1 24  ? 4.120   3.474   5.409   1.00 1.49  ? 538 LEU A O    3  
ATOM 4580  C CB   . LEU A 1 24  ? 3.906   6.748   6.206   1.00 1.13  ? 538 LEU A CB   3  
ATOM 4581  C CG   . LEU A 1 24  ? 2.443   6.453   6.572   1.00 1.35  ? 538 LEU A CG   3  
ATOM 4582  C CD1  . LEU A 1 24  ? 2.278   6.325   8.090   1.00 2.23  ? 538 LEU A CD1  3  
ATOM 4583  C CD2  . LEU A 1 24  ? 1.546   7.593   6.102   1.00 2.08  ? 538 LEU A CD2  3  
ATOM 4584  H H    . LEU A 1 24  ? 6.470   6.880   6.189   1.00 1.44  ? 538 LEU A H    3  
ATOM 4585  H HA   . LEU A 1 24  ? 4.531   5.003   7.306   1.00 1.37  ? 538 LEU A HA   3  
ATOM 4586  H HB2  . LEU A 1 24  ? 4.253   7.573   6.828   1.00 1.89  ? 538 LEU A HB2  3  
ATOM 4587  H HB3  . LEU A 1 24  ? 3.959   7.071   5.167   1.00 1.64  ? 538 LEU A HB3  3  
ATOM 4588  H HG   . LEU A 1 24  ? 2.115   5.535   6.087   1.00 2.53  ? 538 LEU A HG   3  
ATOM 4589  H HD11 . LEU A 1 24  ? 2.736   5.404   8.447   1.00 3.10  ? 538 LEU A HD11 3  
ATOM 4590  H HD12 . LEU A 1 24  ? 1.222   6.318   8.355   1.00 3.05  ? 538 LEU A HD12 3  
ATOM 4591  H HD13 . LEU A 1 24  ? 2.750   7.168   8.587   1.00 2.65  ? 538 LEU A HD13 3  
ATOM 4592  H HD21 . LEU A 1 24  ? 0.521   7.404   6.417   1.00 2.81  ? 538 LEU A HD21 3  
ATOM 4593  H HD22 . LEU A 1 24  ? 1.573   7.655   5.017   1.00 3.18  ? 538 LEU A HD22 3  
ATOM 4594  H HD23 . LEU A 1 24  ? 1.887   8.533   6.526   1.00 2.56  ? 538 LEU A HD23 3  
ATOM 4595  N N    . VAL A 1 25  ? 5.403   4.798   4.119   1.00 1.08  ? 539 VAL A N    3  
ATOM 4596  C CA   . VAL A 1 25  ? 5.634   3.776   3.080   1.00 1.15  ? 539 VAL A CA   3  
ATOM 4597  C C    . VAL A 1 25  ? 6.544   2.678   3.643   1.00 1.45  ? 539 VAL A C    3  
ATOM 4598  O O    . VAL A 1 25  ? 6.167   1.508   3.620   1.00 1.73  ? 539 VAL A O    3  
ATOM 4599  C CB   . VAL A 1 25  ? 6.096   4.407   1.744   1.00 0.93  ? 539 VAL A CB   3  
ATOM 4600  C CG1  . VAL A 1 25  ? 7.599   4.356   1.494   1.00 1.07  ? 539 VAL A CG1  3  
ATOM 4601  C CG2  . VAL A 1 25  ? 5.410   3.717   0.565   1.00 1.02  ? 539 VAL A CG2  3  
ATOM 4602  H H    . VAL A 1 25  ? 5.861   5.700   4.037   1.00 0.99  ? 539 VAL A H    3  
ATOM 4603  H HA   . VAL A 1 25  ? 4.694   3.274   2.854   1.00 1.25  ? 539 VAL A HA   3  
ATOM 4604  H HB   . VAL A 1 25  ? 5.788   5.452   1.724   1.00 0.75  ? 539 VAL A HB   3  
ATOM 4605  H HG11 . VAL A 1 25  ? 7.935   3.317   1.439   1.00 2.12  ? 539 VAL A HG11 3  
ATOM 4606  H HG12 . VAL A 1 25  ? 7.843   4.856   0.554   1.00 1.61  ? 539 VAL A HG12 3  
ATOM 4607  H HG13 . VAL A 1 25  ? 8.112   4.873   2.301   1.00 1.51  ? 539 VAL A HG13 3  
ATOM 4608  H HG21 . VAL A 1 25  ? 5.751   4.157   -0.373  1.00 1.71  ? 539 VAL A HG21 3  
ATOM 4609  H HG22 . VAL A 1 25  ? 5.637   2.652   0.565   1.00 1.54  ? 539 VAL A HG22 3  
ATOM 4610  H HG23 . VAL A 1 25  ? 4.334   3.866   0.647   1.00 1.98  ? 539 VAL A HG23 3  
ATOM 4611  N N    . ALA A 1 26  ? 7.654   3.043   4.295   1.00 1.51  ? 540 ALA A N    3  
ATOM 4612  C CA   . ALA A 1 26  ? 8.673   2.122   4.800   1.00 1.81  ? 540 ALA A CA   3  
ATOM 4613  C C    . ALA A 1 26  ? 8.256   1.257   6.007   1.00 1.93  ? 540 ALA A C    3  
ATOM 4614  O O    . ALA A 1 26  ? 9.090   0.528   6.536   1.00 2.01  ? 540 ALA A O    3  
ATOM 4615  C CB   . ALA A 1 26  ? 9.934   2.920   5.142   1.00 1.94  ? 540 ALA A CB   3  
ATOM 4616  H H    . ALA A 1 26  ? 7.879   4.032   4.335   1.00 1.38  ? 540 ALA A H    3  
ATOM 4617  H HA   . ALA A 1 26  ? 8.927   1.444   3.990   1.00 1.97  ? 540 ALA A HA   3  
ATOM 4618  H HB1  . ALA A 1 26  ? 10.212  3.574   4.316   1.00 2.43  ? 540 ALA A HB1  3  
ATOM 4619  H HB2  . ALA A 1 26  ? 9.750   3.513   6.036   1.00 2.17  ? 540 ALA A HB2  3  
ATOM 4620  H HB3  . ALA A 1 26  ? 10.760  2.236   5.344   1.00 2.83  ? 540 ALA A HB3  3  
ATOM 4621  N N    . SER A 1 27  ? 7.002   1.307   6.461   1.00 1.98  ? 541 SER A N    3  
ATOM 4622  C CA   . SER A 1 27  ? 6.536   0.565   7.638   1.00 2.09  ? 541 SER A CA   3  
ATOM 4623  C C    . SER A 1 27  ? 6.200   -0.892  7.311   1.00 2.06  ? 541 SER A C    3  
ATOM 4624  O O    . SER A 1 27  ? 5.998   -1.718  8.208   1.00 2.15  ? 541 SER A O    3  
ATOM 4625  C CB   . SER A 1 27  ? 5.351   1.282   8.266   1.00 2.29  ? 541 SER A CB   3  
ATOM 4626  O OG   . SER A 1 27  ? 5.809   2.239   9.201   1.00 2.45  ? 541 SER A OG   3  
ATOM 4627  H H    . SER A 1 27  ? 6.301   1.770   5.906   1.00 2.01  ? 541 SER A H    3  
ATOM 4628  H HA   . SER A 1 27  ? 7.330   0.568   8.375   1.00 2.10  ? 541 SER A HA   3  
ATOM 4629  H HB2  . SER A 1 27  ? 4.787   1.770   7.484   1.00 2.63  ? 541 SER A HB2  3  
ATOM 4630  H HB3  . SER A 1 27  ? 4.714   0.561   8.764   1.00 2.67  ? 541 SER A HB3  3  
ATOM 4631  H HG   . SER A 1 27  ? 6.189   2.979   8.684   1.00 2.62  ? 541 SER A HG   3  
ATOM 4632  N N    . MET A 1 28  ? 6.170   -1.226  6.020   1.00 1.98  ? 542 MET A N    3  
ATOM 4633  C CA   . MET A 1 28  ? 6.063   -2.594  5.537   1.00 1.95  ? 542 MET A CA   3  
ATOM 4634  C C    . MET A 1 28  ? 7.374   -3.383  5.742   1.00 1.75  ? 542 MET A C    3  
ATOM 4635  O O    . MET A 1 28  ? 8.459   -2.828  5.524   1.00 1.62  ? 542 MET A O    3  
ATOM 4636  C CB   . MET A 1 28  ? 5.703   -2.584  4.048   1.00 2.05  ? 542 MET A CB   3  
ATOM 4637  C CG   . MET A 1 28  ? 4.197   -2.733  3.830   1.00 2.18  ? 542 MET A CG   3  
ATOM 4638  S SD   . MET A 1 28  ? 3.699   -2.711  2.088   1.00 2.45  ? 542 MET A SD   3  
ATOM 4639  C CE   . MET A 1 28  ? 3.677   -4.488  1.720   1.00 2.26  ? 542 MET A CE   3  
ATOM 4640  H H    . MET A 1 28  ? 6.308   -0.492  5.336   1.00 1.94  ? 542 MET A H    3  
ATOM 4641  H HA   . MET A 1 28  ? 5.257   -3.062  6.092   1.00 2.10  ? 542 MET A HA   3  
ATOM 4642  H HB2  . MET A 1 28  ? 6.022   -1.651  3.589   1.00 2.12  ? 542 MET A HB2  3  
ATOM 4643  H HB3  . MET A 1 28  ? 6.249   -3.388  3.560   1.00 2.34  ? 542 MET A HB3  3  
ATOM 4644  H HG2  . MET A 1 28  ? 3.858   -3.661  4.289   1.00 2.65  ? 542 MET A HG2  3  
ATOM 4645  H HG3  . MET A 1 28  ? 3.694   -1.907  4.333   1.00 2.39  ? 542 MET A HG3  3  
ATOM 4646  H HE1  . MET A 1 28  ? 3.404   -4.635  0.675   1.00 2.78  ? 542 MET A HE1  3  
ATOM 4647  H HE2  . MET A 1 28  ? 4.657   -4.928  1.902   1.00 2.61  ? 542 MET A HE2  3  
ATOM 4648  H HE3  . MET A 1 28  ? 2.946   -4.986  2.353   1.00 2.80  ? 542 MET A HE3  3  
ATOM 4649  N N    . PRO A 1 29  ? 7.306   -4.692  6.054   1.00 1.79  ? 543 PRO A N    3  
ATOM 4650  C CA   . PRO A 1 29  ? 8.468   -5.583  6.051   1.00 1.76  ? 543 PRO A CA   3  
ATOM 4651  C C    . PRO A 1 29  ? 9.270   -5.572  4.744   1.00 1.52  ? 543 PRO A C    3  
ATOM 4652  O O    . PRO A 1 29  ? 10.493  -5.706  4.782   1.00 1.44  ? 543 PRO A O    3  
ATOM 4653  C CB   . PRO A 1 29  ? 7.932   -6.988  6.330   1.00 2.07  ? 543 PRO A CB   3  
ATOM 4654  C CG   . PRO A 1 29  ? 6.568   -6.769  6.975   1.00 1.98  ? 543 PRO A CG   3  
ATOM 4655  C CD   . PRO A 1 29  ? 6.115   -5.385  6.524   1.00 1.91  ? 543 PRO A CD   3  
ATOM 4656  H HA   . PRO A 1 29  ? 9.135   -5.293  6.859   1.00 1.82  ? 543 PRO A HA   3  
ATOM 4657  H HB2  . PRO A 1 29  ? 7.798   -7.532  5.397   1.00 2.21  ? 543 PRO A HB2  3  
ATOM 4658  H HB3  . PRO A 1 29  ? 8.600   -7.544  6.990   1.00 2.74  ? 543 PRO A HB3  3  
ATOM 4659  H HG2  . PRO A 1 29  ? 5.869   -7.530  6.634   1.00 2.45  ? 543 PRO A HG2  3  
ATOM 4660  H HG3  . PRO A 1 29  ? 6.669   -6.785  8.058   1.00 2.16  ? 543 PRO A HG3  3  
ATOM 4661  H HD2  . PRO A 1 29  ? 5.388   -5.471  5.718   1.00 2.14  ? 543 PRO A HD2  3  
ATOM 4662  H HD3  . PRO A 1 29  ? 5.666   -4.858  7.367   1.00 1.86  ? 543 PRO A HD3  3  
ATOM 4663  N N    . LEU A 1 30  ? 8.638   -5.370  3.582   1.00 1.51  ? 544 LEU A N    3  
ATOM 4664  C CA   . LEU A 1 30  ? 9.360   -5.391  2.303   1.00 1.45  ? 544 LEU A CA   3  
ATOM 4665  C C    . LEU A 1 30  ? 10.342  -4.210  2.096   1.00 1.33  ? 544 LEU A C    3  
ATOM 4666  O O    . LEU A 1 30  ? 11.213  -4.280  1.228   1.00 1.33  ? 544 LEU A O    3  
ATOM 4667  C CB   . LEU A 1 30  ? 8.392   -5.717  1.141   1.00 1.78  ? 544 LEU A CB   3  
ATOM 4668  C CG   . LEU A 1 30  ? 8.045   -4.578  0.172   1.00 1.40  ? 544 LEU A CG   3  
ATOM 4669  C CD1  . LEU A 1 30  ? 7.152   -5.095  -0.958  1.00 1.56  ? 544 LEU A CD1  3  
ATOM 4670  C CD2  . LEU A 1 30  ? 7.315   -3.446  0.876   1.00 2.41  ? 544 LEU A CD2  3  
ATOM 4671  H H    . LEU A 1 30  ? 7.622   -5.389  3.570   1.00 1.73  ? 544 LEU A H    3  
ATOM 4672  H HA   . LEU A 1 30  ? 10.005  -6.256  2.365   1.00 1.47  ? 544 LEU A HA   3  
ATOM 4673  H HB2  . LEU A 1 30  ? 8.851   -6.507  0.548   1.00 3.06  ? 544 LEU A HB2  3  
ATOM 4674  H HB3  . LEU A 1 30  ? 7.472   -6.139  1.552   1.00 2.66  ? 544 LEU A HB3  3  
ATOM 4675  H HG   . LEU A 1 30  ? 8.958   -4.185  -0.264  1.00 2.52  ? 544 LEU A HG   3  
ATOM 4676  H HD11 . LEU A 1 30  ? 6.922   -4.286  -1.650  1.00 2.30  ? 544 LEU A HD11 3  
ATOM 4677  H HD12 . LEU A 1 30  ? 6.223   -5.494  -0.550  1.00 1.69  ? 544 LEU A HD12 3  
ATOM 4678  H HD13 . LEU A 1 30  ? 7.670   -5.886  -1.500  1.00 2.36  ? 544 LEU A HD13 3  
ATOM 4679  H HD21 . LEU A 1 30  ? 6.370   -3.809  1.261   1.00 3.02  ? 544 LEU A HD21 3  
ATOM 4680  H HD22 . LEU A 1 30  ? 7.133   -2.633  0.176   1.00 3.40  ? 544 LEU A HD22 3  
ATOM 4681  H HD23 . LEU A 1 30  ? 7.915   -3.080  1.701   1.00 3.02  ? 544 LEU A HD23 3  
ATOM 4682  N N    . PHE A 1 31  ? 10.276  -3.176  2.949   1.00 1.29  ? 545 PHE A N    3  
ATOM 4683  C CA   . PHE A 1 31  ? 11.199  -2.035  2.996   1.00 1.24  ? 545 PHE A CA   3  
ATOM 4684  C C    . PHE A 1 31  ? 12.106  -2.048  4.245   1.00 1.35  ? 545 PHE A C    3  
ATOM 4685  O O    . PHE A 1 31  ? 12.765  -1.051  4.528   1.00 1.33  ? 545 PHE A O    3  
ATOM 4686  C CB   . PHE A 1 31  ? 10.424  -0.711  2.952   1.00 1.21  ? 545 PHE A CB   3  
ATOM 4687  C CG   . PHE A 1 31  ? 9.438   -0.487  1.822   1.00 1.15  ? 545 PHE A CG   3  
ATOM 4688  C CD1  . PHE A 1 31  ? 9.863   -0.323  0.488   1.00 1.85  ? 545 PHE A CD1  3  
ATOM 4689  C CD2  . PHE A 1 31  ? 8.082   -0.320  2.137   1.00 2.29  ? 545 PHE A CD2  3  
ATOM 4690  C CE1  . PHE A 1 31  ? 8.937   0.055   -0.505  1.00 1.76  ? 545 PHE A CE1  3  
ATOM 4691  C CE2  . PHE A 1 31  ? 7.158   0.061   1.153   1.00 2.37  ? 545 PHE A CE2  3  
ATOM 4692  C CZ   . PHE A 1 31  ? 7.591   0.290   -0.158  1.00 1.15  ? 545 PHE A CZ   3  
ATOM 4693  H H    . PHE A 1 31  ? 9.587   -3.223  3.686   1.00 1.37  ? 545 PHE A H    3  
ATOM 4694  H HA   . PHE A 1 31  ? 11.854  -2.070  2.126   1.00 1.19  ? 545 PHE A HA   3  
ATOM 4695  H HB2  . PHE A 1 31  ? 9.893   -0.618  3.902   1.00 1.26  ? 545 PHE A HB2  3  
ATOM 4696  H HB3  . PHE A 1 31  ? 11.138  0.112   2.914   1.00 1.28  ? 545 PHE A HB3  3  
ATOM 4697  H HD1  . PHE A 1 31  ? 10.904  -0.456  0.232   1.00 3.09  ? 545 PHE A HD1  3  
ATOM 4698  H HD2  . PHE A 1 31  ? 7.755   -0.441  3.158   1.00 3.49  ? 545 PHE A HD2  3  
ATOM 4699  H HE1  . PHE A 1 31  ? 9.254   0.180   -1.534  1.00 2.92  ? 545 PHE A HE1  3  
ATOM 4700  H HE2  . PHE A 1 31  ? 6.118   0.205   1.410   1.00 3.65  ? 545 PHE A HE2  3  
ATOM 4701  H HZ   . PHE A 1 31  ? 6.876   0.655   -0.883  1.00 1.18  ? 545 PHE A HZ   3  
ATOM 4702  N N    . ALA A 1 32  ? 12.161  -3.153  4.998   1.00 1.50  ? 546 ALA A N    3  
ATOM 4703  C CA   . ALA A 1 32  ? 12.925  -3.312  6.249   1.00 1.70  ? 546 ALA A CA   3  
ATOM 4704  C C    . ALA A 1 32  ? 14.382  -2.849  6.162   1.00 1.56  ? 546 ALA A C    3  
ATOM 4705  O O    . ALA A 1 32  ? 15.000  -2.399  7.131   1.00 1.71  ? 546 ALA A O    3  
ATOM 4706  C CB   . ALA A 1 32  ? 12.948  -4.809  6.527   1.00 1.94  ? 546 ALA A CB   3  
ATOM 4707  H H    . ALA A 1 32  ? 11.720  -3.985  4.627   1.00 1.56  ? 546 ALA A H    3  
ATOM 4708  H HA   . ALA A 1 32  ? 12.451  -2.795  7.077   1.00 1.87  ? 546 ALA A HA   3  
ATOM 4709  H HB1  . ALA A 1 32  ? 11.945  -5.153  6.771   1.00 2.41  ? 546 ALA A HB1  3  
ATOM 4710  H HB2  . ALA A 1 32  ? 13.321  -5.318  5.636   1.00 2.58  ? 546 ALA A HB2  3  
ATOM 4711  H HB3  . ALA A 1 32  ? 13.617  -5.019  7.361   1.00 2.29  ? 546 ALA A HB3  3  
ATOM 4712  N N    . ASN A 1 33  ? 14.935  -3.019  4.974   1.00 1.36  ? 547 ASN A N    3  
ATOM 4713  C CA   . ASN A 1 33  ? 16.334  -2.903  4.632   1.00 1.33  ? 547 ASN A CA   3  
ATOM 4714  C C    . ASN A 1 33  ? 16.548  -1.855  3.521   1.00 1.12  ? 547 ASN A C    3  
ATOM 4715  O O    . ASN A 1 33  ? 17.641  -1.746  2.965   1.00 1.15  ? 547 ASN A O    3  
ATOM 4716  C CB   . ASN A 1 33  ? 16.755  -4.337  4.281   1.00 1.57  ? 547 ASN A CB   3  
ATOM 4717  C CG   . ASN A 1 33  ? 17.492  -4.995  5.418   1.00 2.11  ? 547 ASN A CG   3  
ATOM 4718  O OD1  . ASN A 1 33  ? 18.646  -4.700  5.695   1.00 2.75  ? 547 ASN A OD1  3  
ATOM 4719  N ND2  . ASN A 1 33  ? 16.827  -5.841  6.160   1.00 2.46  ? 547 ASN A ND2  3  
ATOM 4720  H H    . ASN A 1 33  ? 14.332  -3.384  4.242   1.00 1.32  ? 547 ASN A H    3  
ATOM 4721  H HA   . ASN A 1 33  ? 16.907  -2.553  5.494   1.00 1.41  ? 547 ASN A HA   3  
ATOM 4722  H HB2  . ASN A 1 33  ? 15.894  -4.947  4.023   1.00 1.99  ? 547 ASN A HB2  3  
ATOM 4723  H HB3  . ASN A 1 33  ? 17.371  -4.350  3.411   1.00 2.00  ? 547 ASN A HB3  3  
ATOM 4724  H HD21 . ASN A 1 33  ? 15.887  -6.124  5.910   1.00 2.37  ? 547 ASN A HD21 3  
ATOM 4725  H HD22 . ASN A 1 33  ? 17.316  -6.276  6.919   1.00 3.13  ? 547 ASN A HD22 3  
ATOM 4726  N N    . ALA A 1 34  ? 15.498  -1.089  3.208   1.00 1.01  ? 548 ALA A N    3  
ATOM 4727  C CA   . ALA A 1 34  ? 15.486  -0.056  2.172   1.00 0.90  ? 548 ALA A CA   3  
ATOM 4728  C C    . ALA A 1 34  ? 16.492  1.088   2.424   1.00 0.94  ? 548 ALA A C    3  
ATOM 4729  O O    . ALA A 1 34  ? 16.716  1.505   3.564   1.00 1.06  ? 548 ALA A O    3  
ATOM 4730  C CB   . ALA A 1 34  ? 14.057  0.487   2.037   1.00 0.93  ? 548 ALA A CB   3  
ATOM 4731  H H    . ALA A 1 34  ? 14.639  -1.273  3.718   1.00 1.08  ? 548 ALA A H    3  
ATOM 4732  H HA   . ALA A 1 34  ? 15.749  -0.536  1.233   1.00 0.91  ? 548 ALA A HA   3  
ATOM 4733  H HB1  . ALA A 1 34  ? 13.375  -0.321  1.771   1.00 1.70  ? 548 ALA A HB1  3  
ATOM 4734  H HB2  . ALA A 1 34  ? 13.736  0.932   2.980   1.00 1.86  ? 548 ALA A HB2  3  
ATOM 4735  H HB3  . ALA A 1 34  ? 14.017  1.257   1.267   1.00 1.41  ? 548 ALA A HB3  3  
ATOM 4736  N N    . ASP A 1 35  ? 17.043  1.658   1.351   1.00 0.92  ? 549 ASP A N    3  
ATOM 4737  C CA   . ASP A 1 35  ? 17.789  2.921   1.380   1.00 1.04  ? 549 ASP A CA   3  
ATOM 4738  C C    . ASP A 1 35  ? 16.815  4.127   1.368   1.00 0.97  ? 549 ASP A C    3  
ATOM 4739  O O    . ASP A 1 35  ? 15.845  4.116   0.599   1.00 0.86  ? 549 ASP A O    3  
ATOM 4740  C CB   . ASP A 1 35  ? 18.786  2.943   0.207   1.00 1.13  ? 549 ASP A CB   3  
ATOM 4741  C CG   . ASP A 1 35  ? 19.666  4.195   0.163   1.00 1.37  ? 549 ASP A CG   3  
ATOM 4742  O OD1  . ASP A 1 35  ? 19.134  5.307   -0.023  1.00 2.22  ? 549 ASP A OD1  3  
ATOM 4743  O OD2  . ASP A 1 35  ? 20.906  4.070   0.298   1.00 1.98  ? 549 ASP A OD2  3  
ATOM 4744  H H    . ASP A 1 35  ? 16.861  1.247   0.446   1.00 0.89  ? 549 ASP A H    3  
ATOM 4745  H HA   . ASP A 1 35  ? 18.373  2.942   2.300   1.00 1.20  ? 549 ASP A HA   3  
ATOM 4746  H HB2  . ASP A 1 35  ? 19.429  2.069   0.297   1.00 1.26  ? 549 ASP A HB2  3  
ATOM 4747  H HB3  . ASP A 1 35  ? 18.249  2.858   -0.736  1.00 1.01  ? 549 ASP A HB3  3  
ATOM 4748  N N    . PRO A 1 36  ? 17.046  5.176   2.184   1.00 1.08  ? 550 PRO A N    3  
ATOM 4749  C CA   . PRO A 1 36  ? 16.157  6.337   2.283   1.00 1.05  ? 550 PRO A CA   3  
ATOM 4750  C C    . PRO A 1 36  ? 16.015  7.130   0.970   1.00 0.92  ? 550 PRO A C    3  
ATOM 4751  O O    . PRO A 1 36  ? 14.970  7.735   0.737   1.00 0.99  ? 550 PRO A O    3  
ATOM 4752  C CB   . PRO A 1 36  ? 16.740  7.203   3.406   1.00 1.24  ? 550 PRO A CB   3  
ATOM 4753  C CG   . PRO A 1 36  ? 18.213  6.813   3.436   1.00 1.35  ? 550 PRO A CG   3  
ATOM 4754  C CD   . PRO A 1 36  ? 18.163  5.328   3.104   1.00 1.31  ? 550 PRO A CD   3  
ATOM 4755  H HA   . PRO A 1 36  ? 15.168  6.001   2.597   1.00 1.05  ? 550 PRO A HA   3  
ATOM 4756  H HB2  . PRO A 1 36  ? 16.613  8.270   3.220   1.00 1.22  ? 550 PRO A HB2  3  
ATOM 4757  H HB3  . PRO A 1 36  ? 16.274  6.926   4.353   1.00 1.39  ? 550 PRO A HB3  3  
ATOM 4758  H HG2  . PRO A 1 36  ? 18.752  7.344   2.650   1.00 1.30  ? 550 PRO A HG2  3  
ATOM 4759  H HG3  . PRO A 1 36  ? 18.659  6.989   4.413   1.00 1.55  ? 550 PRO A HG3  3  
ATOM 4760  H HD2  . PRO A 1 36  ? 19.109  5.021   2.660   1.00 1.36  ? 550 PRO A HD2  3  
ATOM 4761  H HD3  . PRO A 1 36  ? 17.965  4.752   4.008   1.00 1.43  ? 550 PRO A HD3  3  
ATOM 4762  N N    . ASN A 1 37  ? 17.001  7.109   0.070   1.00 0.90  ? 551 ASN A N    3  
ATOM 4763  C CA   . ASN A 1 37  ? 16.937  7.786   -1.231  1.00 0.83  ? 551 ASN A CA   3  
ATOM 4764  C C    . ASN A 1 37  ? 16.064  6.998   -2.218  1.00 0.71  ? 551 ASN A C    3  
ATOM 4765  O O    . ASN A 1 37  ? 15.252  7.592   -2.925  1.00 0.67  ? 551 ASN A O    3  
ATOM 4766  C CB   . ASN A 1 37  ? 18.358  7.957   -1.800  1.00 0.94  ? 551 ASN A CB   3  
ATOM 4767  C CG   . ASN A 1 37  ? 19.297  8.693   -0.867  1.00 1.11  ? 551 ASN A CG   3  
ATOM 4768  O OD1  . ASN A 1 37  ? 19.480  9.899   -0.967  1.00 1.51  ? 551 ASN A OD1  3  
ATOM 4769  N ND2  . ASN A 1 37  ? 19.909  7.999   0.059   1.00 1.88  ? 551 ASN A ND2  3  
ATOM 4770  H H    . ASN A 1 37  ? 17.818  6.533   0.262   1.00 1.06  ? 551 ASN A H    3  
ATOM 4771  H HA   . ASN A 1 37  ? 16.481  8.773   -1.102  1.00 0.85  ? 551 ASN A HA   3  
ATOM 4772  H HB2  . ASN A 1 37  ? 18.787  6.978   -2.018  1.00 1.00  ? 551 ASN A HB2  3  
ATOM 4773  H HB3  . ASN A 1 37  ? 18.303  8.510   -2.737  1.00 0.93  ? 551 ASN A HB3  3  
ATOM 4774  H HD21 . ASN A 1 37  ? 19.775  6.984   0.077   1.00 2.60  ? 551 ASN A HD21 3  
ATOM 4775  H HD22 . ASN A 1 37  ? 20.541  8.460   0.694   1.00 2.03  ? 551 ASN A HD22 3  
ATOM 4776  N N    . PHE A 1 38  ? 16.187  5.666   -2.204  1.00 0.71  ? 552 PHE A N    3  
ATOM 4777  C CA   . PHE A 1 38  ? 15.387  4.723   -2.998  1.00 0.65  ? 552 PHE A CA   3  
ATOM 4778  C C    . PHE A 1 38  ? 13.898  4.835   -2.649  1.00 0.57  ? 552 PHE A C    3  
ATOM 4779  O O    . PHE A 1 38  ? 13.058  5.077   -3.516  1.00 0.55  ? 552 PHE A O    3  
ATOM 4780  C CB   . PHE A 1 38  ? 15.926  3.301   -2.740  1.00 0.73  ? 552 PHE A CB   3  
ATOM 4781  C CG   . PHE A 1 38  ? 14.922  2.169   -2.853  1.00 0.86  ? 552 PHE A CG   3  
ATOM 4782  C CD1  . PHE A 1 38  ? 14.444  1.758   -4.108  1.00 1.53  ? 552 PHE A CD1  3  
ATOM 4783  C CD2  . PHE A 1 38  ? 14.441  1.544   -1.688  1.00 2.43  ? 552 PHE A CD2  3  
ATOM 4784  C CE1  . PHE A 1 38  ? 13.460  0.757   -4.192  1.00 1.52  ? 552 PHE A CE1  3  
ATOM 4785  C CE2  . PHE A 1 38  ? 13.490  0.513   -1.773  1.00 2.59  ? 552 PHE A CE2  3  
ATOM 4786  C CZ   . PHE A 1 38  ? 12.994  0.122   -3.027  1.00 1.21  ? 552 PHE A CZ   3  
ATOM 4787  H H    . PHE A 1 38  ? 16.843  5.276   -1.538  1.00 0.80  ? 552 PHE A H    3  
ATOM 4788  H HA   . PHE A 1 38  ? 15.487  4.956   -4.057  1.00 0.67  ? 552 PHE A HA   3  
ATOM 4789  H HB2  . PHE A 1 38  ? 16.756  3.106   -3.412  1.00 0.73  ? 552 PHE A HB2  3  
ATOM 4790  H HB3  . PHE A 1 38  ? 16.330  3.264   -1.732  1.00 0.79  ? 552 PHE A HB3  3  
ATOM 4791  H HD1  . PHE A 1 38  ? 14.826  2.221   -5.004  1.00 2.83  ? 552 PHE A HD1  3  
ATOM 4792  H HD2  . PHE A 1 38  ? 14.810  1.861   -0.724  1.00 3.72  ? 552 PHE A HD2  3  
ATOM 4793  H HE1  . PHE A 1 38  ? 13.057  0.478   -5.152  1.00 2.72  ? 552 PHE A HE1  3  
ATOM 4794  H HE2  . PHE A 1 38  ? 13.134  0.027   -0.876  1.00 3.97  ? 552 PHE A HE2  3  
ATOM 4795  H HZ   . PHE A 1 38  ? 12.251  -0.660  -3.096  1.00 1.37  ? 552 PHE A HZ   3  
ATOM 4796  N N    . VAL A 1 39  ? 13.579  4.723   -1.359  1.00 0.59  ? 553 VAL A N    3  
ATOM 4797  C CA   . VAL A 1 39  ? 12.197  4.751   -0.859  1.00 0.63  ? 553 VAL A CA   3  
ATOM 4798  C C    . VAL A 1 39  ? 11.527  6.118   -1.060  1.00 0.67  ? 553 VAL A C    3  
ATOM 4799  O O    . VAL A 1 39  ? 10.316  6.205   -1.232  1.00 0.71  ? 553 VAL A O    3  
ATOM 4800  C CB   . VAL A 1 39  ? 12.200  4.292   0.606   1.00 0.81  ? 553 VAL A CB   3  
ATOM 4801  C CG1  . VAL A 1 39  ? 12.767  5.330   1.566   1.00 1.99  ? 553 VAL A CG1  3  
ATOM 4802  C CG2  . VAL A 1 39  ? 10.818  3.912   1.101   1.00 2.59  ? 553 VAL A CG2  3  
ATOM 4803  H H    . VAL A 1 39  ? 14.327  4.529   -0.699  1.00 0.63  ? 553 VAL A H    3  
ATOM 4804  H HA   . VAL A 1 39  ? 11.620  4.023   -1.427  1.00 0.61  ? 553 VAL A HA   3  
ATOM 4805  H HB   . VAL A 1 39  ? 12.833  3.410   0.664   1.00 2.05  ? 553 VAL A HB   3  
ATOM 4806  H HG11 . VAL A 1 39  ? 12.108  6.195   1.651   1.00 3.18  ? 553 VAL A HG11 3  
ATOM 4807  H HG12 . VAL A 1 39  ? 12.910  4.886   2.552   1.00 2.63  ? 553 VAL A HG12 3  
ATOM 4808  H HG13 . VAL A 1 39  ? 13.723  5.642   1.175   1.00 2.63  ? 553 VAL A HG13 3  
ATOM 4809  H HG21 . VAL A 1 39  ? 10.370  3.177   0.433   1.00 3.81  ? 553 VAL A HG21 3  
ATOM 4810  H HG22 . VAL A 1 39  ? 10.905  3.495   2.102   1.00 3.29  ? 553 VAL A HG22 3  
ATOM 4811  H HG23 . VAL A 1 39  ? 10.208  4.811   1.131   1.00 3.04  ? 553 VAL A HG23 3  
ATOM 4812  N N    . THR A 1 40  ? 12.331  7.184   -1.103  1.00 0.68  ? 554 THR A N    3  
ATOM 4813  C CA   . THR A 1 40  ? 11.891  8.562   -1.366  1.00 0.75  ? 554 THR A CA   3  
ATOM 4814  C C    . THR A 1 40  ? 11.691  8.854   -2.854  1.00 0.71  ? 554 THR A C    3  
ATOM 4815  O O    . THR A 1 40  ? 10.673  9.430   -3.235  1.00 0.80  ? 554 THR A O    3  
ATOM 4816  C CB   . THR A 1 40  ? 12.891  9.558   -0.767  1.00 0.85  ? 554 THR A CB   3  
ATOM 4817  O OG1  . THR A 1 40  ? 12.975  9.394   0.631   1.00 0.93  ? 554 THR A OG1  3  
ATOM 4818  C CG2  . THR A 1 40  ? 12.478  10.988  -1.044  1.00 0.95  ? 554 THR A CG2  3  
ATOM 4819  H H    . THR A 1 40  ? 13.310  7.015   -0.930  1.00 0.70  ? 554 THR A H    3  
ATOM 4820  H HA   . THR A 1 40  ? 10.924  8.726   -0.891  1.00 0.81  ? 554 THR A HA   3  
ATOM 4821  H HB   . THR A 1 40  ? 13.879  9.392   -1.196  1.00 0.82  ? 554 THR A HB   3  
ATOM 4822  H HG1  . THR A 1 40  ? 13.631  8.677   0.756   1.00 1.11  ? 554 THR A HG1  3  
ATOM 4823  H HG21 . THR A 1 40  ? 13.016  11.663  -0.381  1.00 1.80  ? 554 THR A HG21 3  
ATOM 4824  H HG22 . THR A 1 40  ? 11.402  11.075  -0.903  1.00 2.02  ? 554 THR A HG22 3  
ATOM 4825  H HG23 . THR A 1 40  ? 12.725  11.231  -2.077  1.00 1.54  ? 554 THR A HG23 3  
ATOM 4826  N N    . ALA A 1 41  ? 12.606  8.414   -3.723  1.00 0.63  ? 555 ALA A N    3  
ATOM 4827  C CA   . ALA A 1 41  ? 12.497  8.629   -5.171  1.00 0.64  ? 555 ALA A CA   3  
ATOM 4828  C C    . ALA A 1 41  ? 11.242  7.952   -5.774  1.00 0.65  ? 555 ALA A C    3  
ATOM 4829  O O    . ALA A 1 41  ? 10.776  8.324   -6.850  1.00 0.74  ? 555 ALA A O    3  
ATOM 4830  C CB   . ALA A 1 41  ? 13.799  8.164   -5.834  1.00 0.67  ? 555 ALA A CB   3  
ATOM 4831  H H    . ALA A 1 41  ? 13.414  7.906   -3.373  1.00 0.61  ? 555 ALA A H    3  
ATOM 4832  H HA   . ALA A 1 41  ? 12.396  9.702   -5.344  1.00 0.71  ? 555 ALA A HA   3  
ATOM 4833  H HB1  . ALA A 1 41  ? 13.710  8.228   -6.920  1.00 1.34  ? 555 ALA A HB1  3  
ATOM 4834  H HB2  . ALA A 1 41  ? 14.624  8.802   -5.516  1.00 1.73  ? 555 ALA A HB2  3  
ATOM 4835  H HB3  . ALA A 1 41  ? 14.027  7.138   -5.546  1.00 1.55  ? 555 ALA A HB3  3  
ATOM 4836  N N    . MET A 1 42  ? 10.666  6.992   -5.047  1.00 0.63  ? 556 MET A N    3  
ATOM 4837  C CA   . MET A 1 42  ? 9.387   6.318   -5.303  1.00 0.73  ? 556 MET A CA   3  
ATOM 4838  C C    . MET A 1 42  ? 8.149   7.240   -5.259  1.00 0.73  ? 556 MET A C    3  
ATOM 4839  O O    . MET A 1 42  ? 7.124   6.936   -5.870  1.00 0.88  ? 556 MET A O    3  
ATOM 4840  C CB   . MET A 1 42  ? 9.265   5.258   -4.195  1.00 0.85  ? 556 MET A CB   3  
ATOM 4841  C CG   . MET A 1 42  ? 8.613   3.942   -4.618  1.00 0.98  ? 556 MET A CG   3  
ATOM 4842  S SD   . MET A 1 42  ? 8.687   2.701   -3.304  1.00 1.15  ? 556 MET A SD   3  
ATOM 4843  C CE   . MET A 1 42  ? 10.452  2.272   -3.366  1.00 0.98  ? 556 MET A CE   3  
ATOM 4844  H H    . MET A 1 42  ? 11.160  6.722   -4.205  1.00 0.61  ? 556 MET A H    3  
ATOM 4845  H HA   . MET A 1 42  ? 9.426   5.839   -6.282  1.00 0.90  ? 556 MET A HA   3  
ATOM 4846  H HB2  . MET A 1 42  ? 10.260  5.021   -3.826  1.00 1.31  ? 556 MET A HB2  3  
ATOM 4847  H HB3  . MET A 1 42  ? 8.711   5.670   -3.351  1.00 1.14  ? 556 MET A HB3  3  
ATOM 4848  H HG2  . MET A 1 42  ? 7.577   4.123   -4.882  1.00 1.23  ? 556 MET A HG2  3  
ATOM 4849  H HG3  . MET A 1 42  ? 9.109   3.546   -5.495  1.00 1.38  ? 556 MET A HG3  3  
ATOM 4850  H HE1  . MET A 1 42  ? 10.636  1.613   -4.214  1.00 1.61  ? 556 MET A HE1  3  
ATOM 4851  H HE2  . MET A 1 42  ? 11.084  3.153   -3.484  1.00 1.62  ? 556 MET A HE2  3  
ATOM 4852  H HE3  . MET A 1 42  ? 10.719  1.774   -2.434  1.00 1.91  ? 556 MET A HE3  3  
ATOM 4853  N N    . LEU A 1 43  ? 8.215   8.342   -4.503  1.00 0.68  ? 557 LEU A N    3  
ATOM 4854  C CA   . LEU A 1 43  ? 7.077   9.198   -4.117  1.00 0.76  ? 557 LEU A CA   3  
ATOM 4855  C C    . LEU A 1 43  ? 6.831   10.388  -5.069  1.00 0.76  ? 557 LEU A C    3  
ATOM 4856  O O    . LEU A 1 43  ? 5.854   11.126  -4.918  1.00 0.76  ? 557 LEU A O    3  
ATOM 4857  C CB   . LEU A 1 43  ? 7.337   9.709   -2.681  1.00 0.84  ? 557 LEU A CB   3  
ATOM 4858  C CG   . LEU A 1 43  ? 7.794   8.651   -1.656  1.00 0.87  ? 557 LEU A CG   3  
ATOM 4859  C CD1  . LEU A 1 43  ? 8.064   9.289   -0.301  1.00 0.99  ? 557 LEU A CD1  3  
ATOM 4860  C CD2  . LEU A 1 43  ? 6.756   7.542   -1.479  1.00 0.94  ? 557 LEU A CD2  3  
ATOM 4861  H H    . LEU A 1 43  ? 9.102   8.542   -4.048  1.00 0.63  ? 557 LEU A H    3  
ATOM 4862  H HA   . LEU A 1 43  ? 6.159   8.598   -4.120  1.00 0.81  ? 557 LEU A HA   3  
ATOM 4863  H HB2  . LEU A 1 43  ? 8.112   10.475  -2.732  1.00 0.84  ? 557 LEU A HB2  3  
ATOM 4864  H HB3  . LEU A 1 43  ? 6.428   10.188  -2.313  1.00 0.92  ? 557 LEU A HB3  3  
ATOM 4865  H HG   . LEU A 1 43  ? 8.742   8.221   -1.977  1.00 0.82  ? 557 LEU A HG   3  
ATOM 4866  H HD11 . LEU A 1 43  ? 7.196   9.846   0.038   1.00 1.90  ? 557 LEU A HD11 3  
ATOM 4867  H HD12 . LEU A 1 43  ? 8.901   9.977   -0.414  1.00 1.53  ? 557 LEU A HD12 3  
ATOM 4868  H HD13 . LEU A 1 43  ? 8.331   8.513   0.421   1.00 1.97  ? 557 LEU A HD13 3  
ATOM 4869  H HD21 . LEU A 1 43  ? 7.109   6.828   -0.734  1.00 1.62  ? 557 LEU A HD21 3  
ATOM 4870  H HD22 . LEU A 1 43  ? 6.630   7.014   -2.420  1.00 1.96  ? 557 LEU A HD22 3  
ATOM 4871  H HD23 . LEU A 1 43  ? 5.801   7.960   -1.166  1.00 1.64  ? 557 LEU A HD23 3  
ATOM 4872  N N    . THR A 1 44  ? 7.739   10.617  -6.017  1.00 0.78  ? 558 THR A N    3  
ATOM 4873  C CA   . THR A 1 44  ? 7.928   11.933  -6.659  1.00 0.83  ? 558 THR A CA   3  
ATOM 4874  C C    . THR A 1 44  ? 6.806   12.419  -7.590  1.00 0.81  ? 558 THR A C    3  
ATOM 4875  O O    . THR A 1 44  ? 6.753   13.616  -7.869  1.00 1.12  ? 558 THR A O    3  
ATOM 4876  C CB   . THR A 1 44  ? 9.288   12.019  -7.369  1.00 1.02  ? 558 THR A CB   3  
ATOM 4877  O OG1  . THR A 1 44  ? 9.407   11.085  -8.420  1.00 1.55  ? 558 THR A OG1  3  
ATOM 4878  C CG2  . THR A 1 44  ? 10.435  11.763  -6.394  1.00 1.87  ? 558 THR A CG2  3  
ATOM 4879  H H    . THR A 1 44  ? 8.515   9.970   -6.047  1.00 0.82  ? 558 THR A H    3  
ATOM 4880  H HA   . THR A 1 44  ? 7.962   12.668  -5.857  1.00 1.03  ? 558 THR A HA   3  
ATOM 4881  H HB   . THR A 1 44  ? 9.404   13.014  -7.789  1.00 1.39  ? 558 THR A HB   3  
ATOM 4882  H HG1  . THR A 1 44  ? 10.328  11.166  -8.743  1.00 1.92  ? 558 THR A HG1  3  
ATOM 4883  H HG21 . THR A 1 44  ? 11.391  11.830  -6.911  1.00 2.23  ? 558 THR A HG21 3  
ATOM 4884  H HG22 . THR A 1 44  ? 10.344  10.775  -5.949  1.00 2.93  ? 558 THR A HG22 3  
ATOM 4885  H HG23 . THR A 1 44  ? 10.412  12.506  -5.599  1.00 2.74  ? 558 THR A HG23 3  
ATOM 4886  N N    . LYS A 1 45  ? 5.893   11.550  -8.050  1.00 0.75  ? 559 LYS A N    3  
ATOM 4887  C CA   . LYS A 1 45  ? 4.664   11.935  -8.796  1.00 1.06  ? 559 LYS A CA   3  
ATOM 4888  C C    . LYS A 1 45  ? 3.349   11.436  -8.183  1.00 1.17  ? 559 LYS A C    3  
ATOM 4889  O O    . LYS A 1 45  ? 2.321   11.402  -8.859  1.00 1.55  ? 559 LYS A O    3  
ATOM 4890  C CB   . LYS A 1 45  ? 4.827   11.627  -10.298 1.00 1.44  ? 559 LYS A CB   3  
ATOM 4891  C CG   . LYS A 1 45  ? 5.000   10.150  -10.697 1.00 1.71  ? 559 LYS A CG   3  
ATOM 4892  C CD   . LYS A 1 45  ? 3.712   9.343   -10.940 1.00 2.16  ? 559 LYS A CD   3  
ATOM 4893  C CE   . LYS A 1 45  ? 3.167   8.572   -9.724  1.00 1.80  ? 559 LYS A CE   3  
ATOM 4894  N NZ   . LYS A 1 45  ? 2.129   7.594   -10.127 1.00 2.54  ? 559 LYS A NZ   3  
ATOM 4895  H H    . LYS A 1 45  ? 6.030   10.572  -7.808  1.00 0.71  ? 559 LYS A H    3  
ATOM 4896  H HA   . LYS A 1 45  ? 4.573   13.020  -8.728  1.00 1.21  ? 559 LYS A HA   3  
ATOM 4897  H HB2  . LYS A 1 45  ? 3.989   12.055  -10.851 1.00 1.86  ? 559 LYS A HB2  3  
ATOM 4898  H HB3  . LYS A 1 45  ? 5.718   12.161  -10.635 1.00 1.44  ? 559 LYS A HB3  3  
ATOM 4899  H HG2  . LYS A 1 45  ? 5.546   10.153  -11.642 1.00 2.08  ? 559 LYS A HG2  3  
ATOM 4900  H HG3  . LYS A 1 45  ? 5.632   9.635   -9.978  1.00 1.81  ? 559 LYS A HG3  3  
ATOM 4901  H HD2  . LYS A 1 45  ? 2.936   9.996   -11.340 1.00 3.01  ? 559 LYS A HD2  3  
ATOM 4902  H HD3  . LYS A 1 45  ? 3.951   8.619   -11.716 1.00 2.82  ? 559 LYS A HD3  3  
ATOM 4903  H HE2  . LYS A 1 45  ? 3.986   8.053   -9.214  1.00 1.89  ? 559 LYS A HE2  3  
ATOM 4904  H HE3  . LYS A 1 45  ? 2.731   9.276   -9.021  1.00 1.83  ? 559 LYS A HE3  3  
ATOM 4905  H HZ1  . LYS A 1 45  ? 2.566   6.778   -10.550 1.00 2.59  ? 559 LYS A HZ1  3  
ATOM 4906  H HZ2  . LYS A 1 45  ? 1.478   7.980   -10.805 1.00 3.34  ? 559 LYS A HZ2  3  
ATOM 4907  H HZ3  . LYS A 1 45  ? 1.606   7.241   -9.329  1.00 3.32  ? 559 LYS A HZ3  3  
ATOM 4908  N N    . LEU A 1 46  ? 3.392   10.996  -6.928  1.00 0.95  ? 560 LEU A N    3  
ATOM 4909  C CA   . LEU A 1 46  ? 2.411   10.171  -6.215  1.00 0.97  ? 560 LEU A CA   3  
ATOM 4910  C C    . LEU A 1 46  ? 0.963   10.691  -6.256  1.00 1.02  ? 560 LEU A C    3  
ATOM 4911  O O    . LEU A 1 46  ? 0.705   11.894  -6.368  1.00 1.24  ? 560 LEU A O    3  
ATOM 4912  C CB   . LEU A 1 46  ? 2.952   10.025  -4.788  1.00 1.11  ? 560 LEU A CB   3  
ATOM 4913  C CG   . LEU A 1 46  ? 2.196   9.133   -3.798  1.00 1.15  ? 560 LEU A CG   3  
ATOM 4914  C CD1  . LEU A 1 46  ? 1.975   7.734   -4.360  1.00 2.17  ? 560 LEU A CD1  3  
ATOM 4915  C CD2  . LEU A 1 46  ? 3.093   8.953   -2.579  1.00 1.39  ? 560 LEU A CD2  3  
ATOM 4916  H H    . LEU A 1 46  ? 4.251   11.178  -6.439  1.00 0.80  ? 560 LEU A H    3  
ATOM 4917  H HA   . LEU A 1 46  ? 2.424   9.179   -6.666  1.00 0.97  ? 560 LEU A HA   3  
ATOM 4918  H HB2  . LEU A 1 46  ? 3.952   9.603   -4.879  1.00 1.43  ? 560 LEU A HB2  3  
ATOM 4919  H HB3  . LEU A 1 46  ? 3.035   11.020  -4.352  1.00 1.61  ? 560 LEU A HB3  3  
ATOM 4920  H HG   . LEU A 1 46  ? 1.250   9.587   -3.505  1.00 2.31  ? 560 LEU A HG   3  
ATOM 4921  H HD11 . LEU A 1 46  ? 2.891   7.424   -4.857  1.00 2.68  ? 560 LEU A HD11 3  
ATOM 4922  H HD12 . LEU A 1 46  ? 1.165   7.720   -5.076  1.00 3.31  ? 560 LEU A HD12 3  
ATOM 4923  H HD13 . LEU A 1 46  ? 1.724   7.041   -3.559  1.00 2.81  ? 560 LEU A HD13 3  
ATOM 4924  H HD21 . LEU A 1 46  ? 2.512   8.542   -1.764  1.00 1.83  ? 560 LEU A HD21 3  
ATOM 4925  H HD22 . LEU A 1 46  ? 3.491   9.915   -2.260  1.00 2.79  ? 560 LEU A HD22 3  
ATOM 4926  H HD23 . LEU A 1 46  ? 3.912   8.271   -2.832  1.00 2.02  ? 560 LEU A HD23 3  
ATOM 4927  N N    . LYS A 1 47  ? 0.021   9.744   -6.166  1.00 0.96  ? 561 LYS A N    3  
ATOM 4928  C CA   . LYS A 1 47  ? -1.425  9.940   -6.268  1.00 1.15  ? 561 LYS A CA   3  
ATOM 4929  C C    . LYS A 1 47  ? -2.169  9.664   -4.959  1.00 1.13  ? 561 LYS A C    3  
ATOM 4930  O O    . LYS A 1 47  ? -1.797  8.784   -4.174  1.00 0.93  ? 561 LYS A O    3  
ATOM 4931  C CB   . LYS A 1 47  ? -1.966  9.079   -7.426  1.00 1.39  ? 561 LYS A CB   3  
ATOM 4932  C CG   . LYS A 1 47  ? -3.066  9.795   -8.216  1.00 1.48  ? 561 LYS A CG   3  
ATOM 4933  C CD   . LYS A 1 47  ? -2.532  10.655  -9.373  1.00 1.71  ? 561 LYS A CD   3  
ATOM 4934  C CE   . LYS A 1 47  ? -1.493  11.715  -8.967  1.00 1.68  ? 561 LYS A CE   3  
ATOM 4935  N NZ   . LYS A 1 47  ? -1.341  12.728  -10.029 1.00 2.01  ? 561 LYS A NZ   3  
ATOM 4936  H H    . LYS A 1 47  ? 0.329   8.790   -6.053  1.00 0.90  ? 561 LYS A H    3  
ATOM 4937  H HA   . LYS A 1 47  ? -1.605  10.991  -6.489  1.00 1.36  ? 561 LYS A HA   3  
ATOM 4938  H HB2  . LYS A 1 47  ? -1.162  8.817   -8.116  1.00 1.76  ? 561 LYS A HB2  3  
ATOM 4939  H HB3  . LYS A 1 47  ? -2.364  8.146   -7.024  1.00 1.63  ? 561 LYS A HB3  3  
ATOM 4940  H HG2  . LYS A 1 47  ? -3.728  9.041   -8.630  1.00 1.80  ? 561 LYS A HG2  3  
ATOM 4941  H HG3  . LYS A 1 47  ? -3.672  10.402  -7.548  1.00 1.54  ? 561 LYS A HG3  3  
ATOM 4942  H HD2  . LYS A 1 47  ? -2.087  9.998   -10.123 1.00 1.97  ? 561 LYS A HD2  3  
ATOM 4943  H HD3  . LYS A 1 47  ? -3.391  11.145  -9.831  1.00 2.09  ? 561 LYS A HD3  3  
ATOM 4944  H HE2  . LYS A 1 47  ? -1.824  12.216  -8.055  1.00 1.75  ? 561 LYS A HE2  3  
ATOM 4945  H HE3  . LYS A 1 47  ? -0.522  11.241  -8.755  1.00 1.74  ? 561 LYS A HE3  3  
ATOM 4946  H HZ1  . LYS A 1 47  ? -1.156  12.298  -10.928 1.00 2.42  ? 561 LYS A HZ1  3  
ATOM 4947  H HZ2  . LYS A 1 47  ? -0.554  13.350  -9.851  1.00 2.41  ? 561 LYS A HZ2  3  
ATOM 4948  H HZ3  . LYS A 1 47  ? -2.192  13.277  -10.142 1.00 2.65  ? 561 LYS A HZ3  3  
ATOM 4949  N N    . PHE A 1 48  ? -3.226  10.436  -4.746  1.00 1.43  ? 562 PHE A N    3  
ATOM 4950  C CA   . PHE A 1 48  ? -3.919  10.611  -3.475  1.00 1.31  ? 562 PHE A CA   3  
ATOM 4951  C C    . PHE A 1 48  ? -5.445  10.518  -3.668  1.00 1.20  ? 562 PHE A C    3  
ATOM 4952  O O    . PHE A 1 48  ? -5.974  10.968  -4.687  1.00 1.32  ? 562 PHE A O    3  
ATOM 4953  C CB   . PHE A 1 48  ? -3.435  11.970  -2.936  1.00 1.79  ? 562 PHE A CB   3  
ATOM 4954  C CG   . PHE A 1 48  ? -4.391  12.716  -2.039  1.00 1.32  ? 562 PHE A CG   3  
ATOM 4955  C CD1  . PHE A 1 48  ? -4.850  12.128  -0.851  1.00 1.68  ? 562 PHE A CD1  3  
ATOM 4956  C CD2  . PHE A 1 48  ? -4.839  13.996  -2.409  1.00 2.32  ? 562 PHE A CD2  3  
ATOM 4957  C CE1  . PHE A 1 48  ? -5.779  12.802  -0.050  1.00 1.95  ? 562 PHE A CE1  3  
ATOM 4958  C CE2  . PHE A 1 48  ? -5.734  14.693  -1.580  1.00 2.14  ? 562 PHE A CE2  3  
ATOM 4959  C CZ   . PHE A 1 48  ? -6.211  14.093  -0.402  1.00 1.40  ? 562 PHE A CZ   3  
ATOM 4960  H H    . PHE A 1 48  ? -3.449  11.136  -5.451  1.00 1.67  ? 562 PHE A H    3  
ATOM 4961  H HA   . PHE A 1 48  ? -3.626  9.834   -2.769  1.00 1.14  ? 562 PHE A HA   3  
ATOM 4962  H HB2  . PHE A 1 48  ? -2.499  11.813  -2.402  1.00 2.20  ? 562 PHE A HB2  3  
ATOM 4963  H HB3  . PHE A 1 48  ? -3.204  12.627  -3.778  1.00 2.58  ? 562 PHE A HB3  3  
ATOM 4964  H HD1  . PHE A 1 48  ? -4.516  11.145  -0.568  1.00 2.66  ? 562 PHE A HD1  3  
ATOM 4965  H HD2  . PHE A 1 48  ? -4.499  14.437  -3.337  1.00 3.57  ? 562 PHE A HD2  3  
ATOM 4966  H HE1  . PHE A 1 48  ? -6.164  12.310  0.824   1.00 3.16  ? 562 PHE A HE1  3  
ATOM 4967  H HE2  . PHE A 1 48  ? -6.069  15.683  -1.853  1.00 3.20  ? 562 PHE A HE2  3  
ATOM 4968  H HZ   . PHE A 1 48  ? -6.921  14.619  0.218   1.00 1.74  ? 562 PHE A HZ   3  
ATOM 4969  N N    . GLU A 1 49  ? -6.157  9.905   -2.717  1.00 1.04  ? 563 GLU A N    3  
ATOM 4970  C CA   . GLU A 1 49  ? -7.626  9.784   -2.727  1.00 0.94  ? 563 GLU A CA   3  
ATOM 4971  C C    . GLU A 1 49  ? -8.228  9.797   -1.307  1.00 0.82  ? 563 GLU A C    3  
ATOM 4972  O O    . GLU A 1 49  ? -7.585  9.396   -0.343  1.00 0.87  ? 563 GLU A O    3  
ATOM 4973  C CB   . GLU A 1 49  ? -8.006  8.499   -3.484  1.00 0.99  ? 563 GLU A CB   3  
ATOM 4974  C CG   . GLU A 1 49  ? -9.505  8.365   -3.779  1.00 1.67  ? 563 GLU A CG   3  
ATOM 4975  C CD   . GLU A 1 49  ? -9.774  7.349   -4.891  1.00 1.98  ? 563 GLU A CD   3  
ATOM 4976  O OE1  . GLU A 1 49  ? -9.865  6.125   -4.619  1.00 2.63  ? 563 GLU A OE1  3  
ATOM 4977  O OE2  . GLU A 1 49  ? -9.958  7.769   -6.060  1.00 2.79  ? 563 GLU A OE2  3  
ATOM 4978  H H    . GLU A 1 49  ? -5.667  9.526   -1.908  1.00 1.02  ? 563 GLU A H    3  
ATOM 4979  H HA   . GLU A 1 49  ? -8.046  10.636  -3.263  1.00 0.99  ? 563 GLU A HA   3  
ATOM 4980  H HB2  . GLU A 1 49  ? -7.475  8.503   -4.434  1.00 1.66  ? 563 GLU A HB2  3  
ATOM 4981  H HB3  . GLU A 1 49  ? -7.677  7.630   -2.911  1.00 1.20  ? 563 GLU A HB3  3  
ATOM 4982  H HG2  . GLU A 1 49  ? -10.031 8.068   -2.870  1.00 2.26  ? 563 GLU A HG2  3  
ATOM 4983  H HG3  . GLU A 1 49  ? -9.891  9.335   -4.094  1.00 2.60  ? 563 GLU A HG3  3  
ATOM 4984  N N    . VAL A 1 50  ? -9.478  10.234  -1.160  1.00 0.73  ? 564 VAL A N    3  
ATOM 4985  C CA   . VAL A 1 50  ? -10.205 10.322  0.119   1.00 0.65  ? 564 VAL A CA   3  
ATOM 4986  C C    . VAL A 1 50  ? -11.494 9.507   0.080   1.00 0.61  ? 564 VAL A C    3  
ATOM 4987  O O    . VAL A 1 50  ? -12.157 9.403   -0.954  1.00 0.64  ? 564 VAL A O    3  
ATOM 4988  C CB   . VAL A 1 50  ? -10.508 11.790  0.474   1.00 0.71  ? 564 VAL A CB   3  
ATOM 4989  C CG1  . VAL A 1 50  ? -11.220 11.979  1.813   1.00 0.79  ? 564 VAL A CG1  3  
ATOM 4990  C CG2  . VAL A 1 50  ? -9.217  12.612  0.508   1.00 0.75  ? 564 VAL A CG2  3  
ATOM 4991  H H    . VAL A 1 50  ? -9.953  10.591  -1.979  1.00 0.78  ? 564 VAL A H    3  
ATOM 4992  H HA   . VAL A 1 50  ? -9.583  9.913   0.914   1.00 0.66  ? 564 VAL A HA   3  
ATOM 4993  H HB   . VAL A 1 50  ? -11.165 12.212  -0.275  1.00 0.75  ? 564 VAL A HB   3  
ATOM 4994  H HG11 . VAL A 1 50  ? -12.154 11.426  1.847   1.00 1.75  ? 564 VAL A HG11 3  
ATOM 4995  H HG12 . VAL A 1 50  ? -10.579 11.677  2.642   1.00 1.49  ? 564 VAL A HG12 3  
ATOM 4996  H HG13 . VAL A 1 50  ? -11.486 13.029  1.893   1.00 1.82  ? 564 VAL A HG13 3  
ATOM 4997  H HG21 . VAL A 1 50  ? -9.423  13.623  0.855   1.00 1.70  ? 564 VAL A HG21 3  
ATOM 4998  H HG22 . VAL A 1 50  ? -8.495  12.134  1.168   1.00 1.43  ? 564 VAL A HG22 3  
ATOM 4999  H HG23 . VAL A 1 50  ? -8.799  12.676  -0.497  1.00 1.82  ? 564 VAL A HG23 3  
ATOM 5000  N N    . PHE A 1 51  ? -11.874 8.969   1.238   1.00 0.60  ? 565 PHE A N    3  
ATOM 5001  C CA   . PHE A 1 51  ? -13.191 8.386   1.492   1.00 0.65  ? 565 PHE A CA   3  
ATOM 5002  C C    . PHE A 1 51  ? -13.817 8.980   2.760   1.00 0.70  ? 565 PHE A C    3  
ATOM 5003  O O    . PHE A 1 51  ? -13.131 9.250   3.747   1.00 0.68  ? 565 PHE A O    3  
ATOM 5004  C CB   . PHE A 1 51  ? -13.094 6.857   1.566   1.00 0.66  ? 565 PHE A CB   3  
ATOM 5005  C CG   . PHE A 1 51  ? -12.719 6.200   0.250   1.00 0.70  ? 565 PHE A CG   3  
ATOM 5006  C CD1  . PHE A 1 51  ? -11.376 6.174   -0.167  1.00 1.70  ? 565 PHE A CD1  3  
ATOM 5007  C CD2  . PHE A 1 51  ? -13.711 5.618   -0.566  1.00 2.26  ? 565 PHE A CD2  3  
ATOM 5008  C CE1  . PHE A 1 51  ? -11.025 5.573   -1.387  1.00 1.60  ? 565 PHE A CE1  3  
ATOM 5009  C CE2  . PHE A 1 51  ? -13.351 4.993   -1.775  1.00 2.43  ? 565 PHE A CE2  3  
ATOM 5010  C CZ   . PHE A 1 51  ? -12.007 4.955   -2.175  1.00 0.99  ? 565 PHE A CZ   3  
ATOM 5011  H H    . PHE A 1 51  ? -11.267 9.116   2.039   1.00 0.63  ? 565 PHE A H    3  
ATOM 5012  H HA   . PHE A 1 51  ? -13.851 8.634   0.661   1.00 0.70  ? 565 PHE A HA   3  
ATOM 5013  H HB2  . PHE A 1 51  ? -12.361 6.582   2.327   1.00 0.62  ? 565 PHE A HB2  3  
ATOM 5014  H HB3  . PHE A 1 51  ? -14.060 6.466   1.889   1.00 0.76  ? 565 PHE A HB3  3  
ATOM 5015  H HD1  . PHE A 1 51  ? -10.610 6.632   0.443   1.00 3.11  ? 565 PHE A HD1  3  
ATOM 5016  H HD2  . PHE A 1 51  ? -14.748 5.640   -0.260  1.00 3.59  ? 565 PHE A HD2  3  
ATOM 5017  H HE1  . PHE A 1 51  ? -10.001 5.591   -1.721  1.00 2.89  ? 565 PHE A HE1  3  
ATOM 5018  H HE2  . PHE A 1 51  ? -14.107 4.527   -2.392  1.00 3.86  ? 565 PHE A HE2  3  
ATOM 5019  H HZ   . PHE A 1 51  ? -11.724 4.451   -3.087  1.00 1.13  ? 565 PHE A HZ   3  
ATOM 5020  N N    . GLN A 1 52  ? -15.130 9.186   2.723   1.00 0.82  ? 566 GLN A N    3  
ATOM 5021  C CA   . GLN A 1 52  ? -15.943 9.684   3.831   1.00 0.87  ? 566 GLN A CA   3  
ATOM 5022  C C    . GLN A 1 52  ? -16.391 8.530   4.763   1.00 0.90  ? 566 GLN A C    3  
ATOM 5023  O O    . GLN A 1 52  ? -16.422 7.373   4.335   1.00 0.87  ? 566 GLN A O    3  
ATOM 5024  C CB   . GLN A 1 52  ? -17.150 10.452  3.248   1.00 0.97  ? 566 GLN A CB   3  
ATOM 5025  C CG   . GLN A 1 52  ? -16.867 11.597  2.271   1.00 1.17  ? 566 GLN A CG   3  
ATOM 5026  C CD   . GLN A 1 52  ? -15.661 12.416  2.666   1.00 1.55  ? 566 GLN A CD   3  
ATOM 5027  O OE1  . GLN A 1 52  ? -15.529 12.897  3.785   1.00 3.19  ? 566 GLN A OE1  3  
ATOM 5028  N NE2  . GLN A 1 52  ? -14.705 12.550  1.788   1.00 1.08  ? 566 GLN A NE2  3  
ATOM 5029  H H    . GLN A 1 52  ? -15.616 8.950   1.862   1.00 0.90  ? 566 GLN A H    3  
ATOM 5030  H HA   . GLN A 1 52  ? -15.338 10.373  4.422   1.00 0.92  ? 566 GLN A HA   3  
ATOM 5031  H HB2  . GLN A 1 52  ? -17.736 9.752   2.677   1.00 1.03  ? 566 GLN A HB2  3  
ATOM 5032  H HB3  . GLN A 1 52  ? -17.752 10.845  4.061   1.00 1.11  ? 566 GLN A HB3  3  
ATOM 5033  H HG2  . GLN A 1 52  ? -16.698 11.177  1.281   1.00 1.82  ? 566 GLN A HG2  3  
ATOM 5034  H HG3  . GLN A 1 52  ? -17.739 12.249  2.206   1.00 1.91  ? 566 GLN A HG3  3  
ATOM 5035  H HE21 . GLN A 1 52  ? -14.804 12.215  0.834   1.00 1.66  ? 566 GLN A HE21 3  
ATOM 5036  H HE22 . GLN A 1 52  ? -13.887 13.016  2.095   1.00 1.65  ? 566 GLN A HE22 3  
ATOM 5037  N N    . PRO A 1 53  ? -16.779 8.806   6.026   1.00 1.02  ? 567 PRO A N    3  
ATOM 5038  C CA   . PRO A 1 53  ? -17.227 7.782   6.974   1.00 1.04  ? 567 PRO A CA   3  
ATOM 5039  C C    . PRO A 1 53  ? -18.342 6.880   6.425   1.00 1.08  ? 567 PRO A C    3  
ATOM 5040  O O    . PRO A 1 53  ? -19.318 7.364   5.844   1.00 1.19  ? 567 PRO A O    3  
ATOM 5041  C CB   . PRO A 1 53  ? -17.750 8.547   8.193   1.00 1.14  ? 567 PRO A CB   3  
ATOM 5042  C CG   . PRO A 1 53  ? -17.067 9.904   8.133   1.00 1.19  ? 567 PRO A CG   3  
ATOM 5043  C CD   . PRO A 1 53  ? -16.812 10.122  6.646   1.00 1.18  ? 567 PRO A CD   3  
ATOM 5044  H HA   . PRO A 1 53  ? -16.368 7.175   7.265   1.00 0.98  ? 567 PRO A HA   3  
ATOM 5045  H HB2  . PRO A 1 53  ? -18.818 8.716   8.086   1.00 1.27  ? 567 PRO A HB2  3  
ATOM 5046  H HB3  . PRO A 1 53  ? -17.532 8.022   9.124   1.00 1.09  ? 567 PRO A HB3  3  
ATOM 5047  H HG2  . PRO A 1 53  ? -17.699 10.691  8.545   1.00 1.33  ? 567 PRO A HG2  3  
ATOM 5048  H HG3  . PRO A 1 53  ? -16.129 9.854   8.668   1.00 1.13  ? 567 PRO A HG3  3  
ATOM 5049  H HD2  . PRO A 1 53  ? -17.636 10.691  6.230   1.00 1.33  ? 567 PRO A HD2  3  
ATOM 5050  H HD3  . PRO A 1 53  ? -15.877 10.661  6.506   1.00 1.19  ? 567 PRO A HD3  3  
ATOM 5051  N N    . GLY A 1 54  ? -18.235 5.566   6.634   1.00 1.06  ? 568 GLY A N    3  
ATOM 5052  C CA   . GLY A 1 54  ? -19.254 4.586   6.254   1.00 1.16  ? 568 GLY A CA   3  
ATOM 5053  C C    . GLY A 1 54  ? -19.190 4.200   4.783   1.00 1.26  ? 568 GLY A C    3  
ATOM 5054  O O    . GLY A 1 54  ? -19.968 3.357   4.343   1.00 1.50  ? 568 GLY A O    3  
ATOM 5055  H H    . GLY A 1 54  ? -17.338 5.186   6.898   1.00 0.95  ? 568 GLY A H    3  
ATOM 5056  H HA2  . GLY A 1 54  ? -19.119 3.675   6.830   1.00 1.06  ? 568 GLY A HA2  3  
ATOM 5057  H HA3  . GLY A 1 54  ? -20.246 4.980   6.468   1.00 1.34  ? 568 GLY A HA3  3  
ATOM 5058  N N    . ASP A 1 55  ? -18.262 4.790   4.021   1.00 1.19  ? 569 ASP A N    3  
ATOM 5059  C CA   . ASP A 1 55  ? -18.123 4.488   2.614   1.00 1.25  ? 569 ASP A CA   3  
ATOM 5060  C C    . ASP A 1 55  ? -17.282 3.225   2.392   1.00 1.15  ? 569 ASP A C    3  
ATOM 5061  O O    . ASP A 1 55  ? -16.172 3.079   2.914   1.00 0.96  ? 569 ASP A O    3  
ATOM 5062  C CB   . ASP A 1 55  ? -17.609 5.710   1.837   1.00 1.22  ? 569 ASP A CB   3  
ATOM 5063  C CG   . ASP A 1 55  ? -17.892 5.632   0.335   1.00 1.30  ? 569 ASP A CG   3  
ATOM 5064  O OD1  . ASP A 1 55  ? -18.529 4.664   -0.145  1.00 1.49  ? 569 ASP A OD1  3  
ATOM 5065  O OD2  . ASP A 1 55  ? -17.496 6.563   -0.402  1.00 2.22  ? 569 ASP A OD2  3  
ATOM 5066  H H    . ASP A 1 55  ? -17.642 5.481   4.413   1.00 1.09  ? 569 ASP A H    3  
ATOM 5067  H HA   . ASP A 1 55  ? -19.133 4.289   2.285   1.00 1.47  ? 569 ASP A HA   3  
ATOM 5068  H HB2  . ASP A 1 55  ? -18.102 6.606   2.217   1.00 1.39  ? 569 ASP A HB2  3  
ATOM 5069  H HB3  . ASP A 1 55  ? -16.536 5.817   1.998   1.00 1.11  ? 569 ASP A HB3  3  
ATOM 5070  N N    . TYR A 1 56  ? -17.813 2.306   1.592   1.00 1.38  ? 570 TYR A N    3  
ATOM 5071  C CA   . TYR A 1 56  ? -17.110 1.102   1.162   1.00 1.45  ? 570 TYR A CA   3  
ATOM 5072  C C    . TYR A 1 56  ? -15.988 1.494   0.200   1.00 1.41  ? 570 TYR A C    3  
ATOM 5073  O O    . TYR A 1 56  ? -16.237 1.925   -0.928  1.00 1.47  ? 570 TYR A O    3  
ATOM 5074  C CB   . TYR A 1 56  ? -18.103 0.111   0.542   1.00 1.79  ? 570 TYR A CB   3  
ATOM 5075  C CG   . TYR A 1 56  ? -18.958 -0.594  1.579   1.00 1.92  ? 570 TYR A CG   3  
ATOM 5076  C CD1  . TYR A 1 56  ? -20.137 0.000   2.073   1.00 3.31  ? 570 TYR A CD1  3  
ATOM 5077  C CD2  . TYR A 1 56  ? -18.534 -1.834  2.088   1.00 1.74  ? 570 TYR A CD2  3  
ATOM 5078  C CE1  . TYR A 1 56  ? -20.880 -0.640  3.085   1.00 3.44  ? 570 TYR A CE1  3  
ATOM 5079  C CE2  . TYR A 1 56  ? -19.276 -2.479  3.094   1.00 1.88  ? 570 TYR A CE2  3  
ATOM 5080  C CZ   . TYR A 1 56  ? -20.445 -1.880  3.602   1.00 2.25  ? 570 TYR A CZ   3  
ATOM 5081  O OH   . TYR A 1 56  ? -21.149 -2.514  4.575   1.00 2.45  ? 570 TYR A OH   3  
ATOM 5082  H H    . TYR A 1 56  ? -18.717 2.510   1.196   1.00 1.56  ? 570 TYR A H    3  
ATOM 5083  H HA   . TYR A 1 56  ? -16.660 0.619   2.029   1.00 1.35  ? 570 TYR A HA   3  
ATOM 5084  H HB2  . TYR A 1 56  ? -18.741 0.631   -0.171  1.00 1.92  ? 570 TYR A HB2  3  
ATOM 5085  H HB3  . TYR A 1 56  ? -17.543 -0.644  -0.013  1.00 1.90  ? 570 TYR A HB3  3  
ATOM 5086  H HD1  . TYR A 1 56  ? -20.465 0.960   1.696   1.00 4.49  ? 570 TYR A HD1  3  
ATOM 5087  H HD2  . TYR A 1 56  ? -17.625 -2.286  1.718   1.00 2.51  ? 570 TYR A HD2  3  
ATOM 5088  H HE1  . TYR A 1 56  ? -21.773 -0.179  3.481   1.00 4.68  ? 570 TYR A HE1  3  
ATOM 5089  H HE2  . TYR A 1 56  ? -18.950 -3.428  3.492   1.00 2.64  ? 570 TYR A HE2  3  
ATOM 5090  H HH   . TYR A 1 56  ? -21.914 -1.982  4.884   1.00 3.19  ? 570 TYR A HH   3  
ATOM 5091  N N    . ILE A 1 57  ? -14.741 1.371   0.651   1.00 1.35  ? 571 ILE A N    3  
ATOM 5092  C CA   . ILE A 1 57  ? -13.568 1.841   -0.102  1.00 1.33  ? 571 ILE A CA   3  
ATOM 5093  C C    . ILE A 1 57  ? -13.092 0.828   -1.151  1.00 1.49  ? 571 ILE A C    3  
ATOM 5094  O O    . ILE A 1 57  ? -12.445 1.202   -2.132  1.00 1.57  ? 571 ILE A O    3  
ATOM 5095  C CB   . ILE A 1 57  ? -12.430 2.240   0.852   1.00 1.24  ? 571 ILE A CB   3  
ATOM 5096  C CG1  . ILE A 1 57  ? -11.773 0.988   1.450   1.00 1.17  ? 571 ILE A CG1  3  
ATOM 5097  C CG2  . ILE A 1 57  ? -12.906 3.195   1.962   1.00 1.13  ? 571 ILE A CG2  3  
ATOM 5098  C CD1  . ILE A 1 57  ? -10.704 1.327   2.460   1.00 1.42  ? 571 ILE A CD1  3  
ATOM 5099  H H    . ILE A 1 57  ? -14.604 1.046   1.596   1.00 1.38  ? 571 ILE A H    3  
ATOM 5100  H HA   . ILE A 1 57  ? -13.839 2.745   -0.632  1.00 1.33  ? 571 ILE A HA   3  
ATOM 5101  H HB   . ILE A 1 57  ? -11.681 2.769   0.261   1.00 1.39  ? 571 ILE A HB   3  
ATOM 5102  H HG12 . ILE A 1 57  ? -12.518 0.359   1.931   1.00 1.66  ? 571 ILE A HG12 3  
ATOM 5103  H HG13 . ILE A 1 57  ? -11.281 0.436   0.652   1.00 1.39  ? 571 ILE A HG13 3  
ATOM 5104  H HG21 . ILE A 1 57  ? -13.597 3.930   1.557   1.00 2.18  ? 571 ILE A HG21 3  
ATOM 5105  H HG22 . ILE A 1 57  ? -13.412 2.640   2.749   1.00 1.81  ? 571 ILE A HG22 3  
ATOM 5106  H HG23 . ILE A 1 57  ? -12.045 3.713   2.387   1.00 1.36  ? 571 ILE A HG23 3  
ATOM 5107  H HD11 . ILE A 1 57  ? -10.136 0.424   2.673   1.00 1.57  ? 571 ILE A HD11 3  
ATOM 5108  H HD12 . ILE A 1 57  ? -10.077 2.088   2.002   1.00 2.18  ? 571 ILE A HD12 3  
ATOM 5109  H HD13 . ILE A 1 57  ? -11.159 1.705   3.372   1.00 2.64  ? 571 ILE A HD13 3  
ATOM 5110  N N    . ILE A 1 58  ? -13.404 -0.453  -0.914  1.00 1.62  ? 572 ILE A N    3  
ATOM 5111  C CA   . ILE A 1 58  ? -12.895 -1.595  -1.668  1.00 1.82  ? 572 ILE A CA   3  
ATOM 5112  C C    . ILE A 1 58  ? -13.882 -2.048  -2.742  1.00 2.07  ? 572 ILE A C    3  
ATOM 5113  O O    . ILE A 1 58  ? -15.074 -2.250  -2.473  1.00 2.57  ? 572 ILE A O    3  
ATOM 5114  C CB   . ILE A 1 58  ? -12.593 -2.778  -0.717  1.00 2.46  ? 572 ILE A CB   3  
ATOM 5115  C CG1  . ILE A 1 58  ? -11.470 -2.497  0.274   1.00 2.80  ? 572 ILE A CG1  3  
ATOM 5116  C CG2  . ILE A 1 58  ? -12.303 -4.110  -1.436  1.00 2.68  ? 572 ILE A CG2  3  
ATOM 5117  C CD1  . ILE A 1 58  ? -10.116 -2.083  -0.288  1.00 2.30  ? 572 ILE A CD1  3  
ATOM 5118  H H    . ILE A 1 58  ? -13.903 -0.656  -0.058  1.00 1.62  ? 572 ILE A H    3  
ATOM 5119  H HA   . ILE A 1 58  ? -11.961 -1.300  -2.146  1.00 1.60  ? 572 ILE A HA   3  
ATOM 5120  H HB   . ILE A 1 58  ? -13.457 -2.930  -0.077  1.00 2.82  ? 572 ILE A HB   3  
ATOM 5121  H HG12 . ILE A 1 58  ? -11.817 -1.723  0.949   1.00 3.92  ? 572 ILE A HG12 3  
ATOM 5122  H HG13 . ILE A 1 58  ? -11.323 -3.406  0.848   1.00 3.51  ? 572 ILE A HG13 3  
ATOM 5123  H HG21 . ILE A 1 58  ? -13.190 -4.465  -1.960  1.00 3.85  ? 572 ILE A HG21 3  
ATOM 5124  H HG22 . ILE A 1 58  ? -11.476 -3.995  -2.138  1.00 2.32  ? 572 ILE A HG22 3  
ATOM 5125  H HG23 . ILE A 1 58  ? -12.043 -4.872  -0.704  1.00 3.09  ? 572 ILE A HG23 3  
ATOM 5126  H HD11 . ILE A 1 58  ? -10.203 -1.142  -0.826  1.00 3.15  ? 572 ILE A HD11 3  
ATOM 5127  H HD12 . ILE A 1 58  ? -9.427  -1.962  0.545   1.00 2.26  ? 572 ILE A HD12 3  
ATOM 5128  H HD13 . ILE A 1 58  ? -9.747  -2.862  -0.946  1.00 2.90  ? 572 ILE A HD13 3  
ATOM 5129  N N    . ARG A 1 59  ? -13.319 -2.371  -3.907  1.00 1.92  ? 573 ARG A N    3  
ATOM 5130  C CA   . ARG A 1 59  ? -13.790 -3.458  -4.772  1.00 2.09  ? 573 ARG A CA   3  
ATOM 5131  C C    . ARG A 1 59  ? -12.700 -4.515  -4.966  1.00 1.74  ? 573 ARG A C    3  
ATOM 5132  O O    . ARG A 1 59  ? -11.511 -4.210  -5.032  1.00 1.60  ? 573 ARG A O    3  
ATOM 5133  C CB   . ARG A 1 59  ? -14.402 -2.922  -6.076  1.00 2.62  ? 573 ARG A CB   3  
ATOM 5134  C CG   . ARG A 1 59  ? -13.579 -1.911  -6.886  1.00 3.76  ? 573 ARG A CG   3  
ATOM 5135  C CD   . ARG A 1 59  ? -12.282 -2.480  -7.485  1.00 4.87  ? 573 ARG A CD   3  
ATOM 5136  N NE   . ARG A 1 59  ? -11.783 -1.637  -8.578  1.00 6.56  ? 573 ARG A NE   3  
ATOM 5137  C CZ   . ARG A 1 59  ? -12.304 -1.523  -9.786  1.00 7.71  ? 573 ARG A CZ   3  
ATOM 5138  N NH1  . ARG A 1 59  ? -13.240 -2.316  -10.218 1.00 7.74  ? 573 ARG A NH1  3  
ATOM 5139  N NH2  . ARG A 1 59  ? -11.902 -0.569  -10.569 1.00 9.24  ? 573 ARG A NH2  3  
ATOM 5140  H H    . ARG A 1 59  ? -12.355 -2.070  -4.040  1.00 1.71  ? 573 ARG A H    3  
ATOM 5141  H HA   . ARG A 1 59  ? -14.605 -3.963  -4.257  1.00 2.53  ? 573 ARG A HA   3  
ATOM 5142  H HB2  . ARG A 1 59  ? -14.642 -3.768  -6.719  1.00 3.52  ? 573 ARG A HB2  3  
ATOM 5143  H HB3  . ARG A 1 59  ? -15.346 -2.437  -5.820  1.00 3.17  ? 573 ARG A HB3  3  
ATOM 5144  H HG2  . ARG A 1 59  ? -14.220 -1.563  -7.695  1.00 4.69  ? 573 ARG A HG2  3  
ATOM 5145  H HG3  . ARG A 1 59  ? -13.340 -1.050  -6.262  1.00 4.32  ? 573 ARG A HG3  3  
ATOM 5146  H HD2  . ARG A 1 59  ? -11.522 -2.513  -6.709  1.00 5.00  ? 573 ARG A HD2  3  
ATOM 5147  H HD3  . ARG A 1 59  ? -12.447 -3.496  -7.846  1.00 5.12  ? 573 ARG A HD3  3  
ATOM 5148  H HE   . ARG A 1 59  ? -10.991 -1.042  -8.370  1.00 7.19  ? 573 ARG A HE   3  
ATOM 5149  H HH11 . ARG A 1 59  ? -13.543 -3.108  -9.666  1.00 6.91  ? 573 ARG A HH11 3  
ATOM 5150  H HH12 . ARG A 1 59  ? -13.730 -2.056  -11.065 1.00 8.86  ? 573 ARG A HH12 3  
ATOM 5151  H HH21 . ARG A 1 59  ? -11.208 0.085   -10.231 1.00 9.60  ? 573 ARG A HH21 3  
ATOM 5152  H HH22 . ARG A 1 59  ? -12.303 -0.451  -11.493 1.00 10.20 ? 573 ARG A HH22 3  
ATOM 5153  N N    . GLU A 1 60  ? -13.091 -5.779  -4.972  1.00 2.35  ? 574 GLU A N    3  
ATOM 5154  C CA   . GLU A 1 60  ? -12.300 -6.911  -5.469  1.00 2.36  ? 574 GLU A CA   3  
ATOM 5155  C C    . GLU A 1 60  ? -12.725 -7.297  -6.897  1.00 2.68  ? 574 GLU A C    3  
ATOM 5156  O O    . GLU A 1 60  ? -13.827 -6.929  -7.321  1.00 3.53  ? 574 GLU A O    3  
ATOM 5157  C CB   . GLU A 1 60  ? -12.407 -8.036  -4.430  1.00 3.63  ? 574 GLU A CB   3  
ATOM 5158  C CG   . GLU A 1 60  ? -11.603 -9.303  -4.731  1.00 4.03  ? 574 GLU A CG   3  
ATOM 5159  C CD   . GLU A 1 60  ? -10.171 -9.048  -5.217  1.00 4.07  ? 574 GLU A CD   3  
ATOM 5160  O OE1  . GLU A 1 60  ? -9.515  -8.112  -4.714  1.00 4.69  ? 574 GLU A OE1  3  
ATOM 5161  O OE2  . GLU A 1 60  ? -9.789  -9.716  -6.209  1.00 4.51  ? 574 GLU A OE2  3  
ATOM 5162  H H    . GLU A 1 60  ? -14.088 -5.942  -4.888  1.00 3.04  ? 574 GLU A H    3  
ATOM 5163  H HA   . GLU A 1 60  ? -11.254 -6.613  -5.542  1.00 1.83  ? 574 GLU A HA   3  
ATOM 5164  H HB2  . GLU A 1 60  ? -12.068 -7.645  -3.472  1.00 3.79  ? 574 GLU A HB2  3  
ATOM 5165  H HB3  . GLU A 1 60  ? -13.456 -8.315  -4.317  1.00 4.66  ? 574 GLU A HB3  3  
ATOM 5166  H HG2  . GLU A 1 60  ? -11.582 -9.913  -3.829  1.00 5.03  ? 574 GLU A HG2  3  
ATOM 5167  H HG3  . GLU A 1 60  ? -12.145 -9.850  -5.500  1.00 4.16  ? 574 GLU A HG3  3  
ATOM 5168  N N    . GLY A 1 61  ? -11.905 -8.056  -7.641  1.00 2.56  ? 575 GLY A N    3  
ATOM 5169  C CA   . GLY A 1 61  ? -12.357 -8.642  -8.908  1.00 3.50  ? 575 GLY A CA   3  
ATOM 5170  C C    . GLY A 1 61  ? -11.282 -8.998  -9.934  1.00 3.29  ? 575 GLY A C    3  
ATOM 5171  O O    . GLY A 1 61  ? -11.613 -9.714  -10.882 1.00 4.13  ? 575 GLY A O    3  
ATOM 5172  H H    . GLY A 1 61  ? -11.011 -8.366  -7.261  1.00 2.23  ? 575 GLY A H    3  
ATOM 5173  H HA2  . GLY A 1 61  ? -12.926 -9.546  -8.689  1.00 4.29  ? 575 GLY A HA2  3  
ATOM 5174  H HA3  . GLY A 1 61  ? -13.030 -7.942  -9.404  1.00 3.97  ? 575 GLY A HA3  3  
ATOM 5175  N N    . THR A 1 62  ? -10.029 -8.546  -9.783  1.00 2.36  ? 576 THR A N    3  
ATOM 5176  C CA   . THR A 1 62  ? -8.988  -8.722  -10.820 1.00 2.26  ? 576 THR A CA   3  
ATOM 5177  C C    . THR A 1 62  ? -7.550  -8.833  -10.302 1.00 2.02  ? 576 THR A C    3  
ATOM 5178  O O    . THR A 1 62  ? -7.223  -8.417  -9.193  1.00 2.12  ? 576 THR A O    3  
ATOM 5179  C CB   . THR A 1 62  ? -9.078  -7.614  -11.882 1.00 2.39  ? 576 THR A CB   3  
ATOM 5180  O OG1  . THR A 1 62  ? -8.346  -7.985  -13.025 1.00 2.55  ? 576 THR A OG1  3  
ATOM 5181  C CG2  . THR A 1 62  ? -8.562  -6.251  -11.427 1.00 2.44  ? 576 THR A CG2  3  
ATOM 5182  H H    . THR A 1 62  ? -9.801  -8.003  -8.958  1.00 1.94  ? 576 THR A H    3  
ATOM 5183  H HA   . THR A 1 62  ? -9.193  -9.654  -11.342 1.00 2.60  ? 576 THR A HA   3  
ATOM 5184  H HB   . THR A 1 62  ? -10.117 -7.521  -12.175 1.00 2.98  ? 576 THR A HB   3  
ATOM 5185  H HG1  . THR A 1 62  ? -8.458  -7.270  -13.679 1.00 2.73  ? 576 THR A HG1  3  
ATOM 5186  H HG21 . THR A 1 62  ? -8.770  -5.506  -12.195 1.00 2.95  ? 576 THR A HG21 3  
ATOM 5187  H HG22 . THR A 1 62  ? -7.489  -6.288  -11.242 1.00 2.62  ? 576 THR A HG22 3  
ATOM 5188  H HG23 . THR A 1 62  ? -9.068  -5.955  -10.512 1.00 3.14  ? 576 THR A HG23 3  
ATOM 5189  N N    . ILE A 1 63  ? -6.700  -9.406  -11.152 1.00 1.99  ? 577 ILE A N    3  
ATOM 5190  C CA   . ILE A 1 63  ? -5.239  -9.468  -11.075 1.00 1.84  ? 577 ILE A CA   3  
ATOM 5191  C C    . ILE A 1 63  ? -4.592  -8.174  -11.597 1.00 1.80  ? 577 ILE A C    3  
ATOM 5192  O O    . ILE A 1 63  ? -5.179  -7.451  -12.409 1.00 2.16  ? 577 ILE A O    3  
ATOM 5193  C CB   . ILE A 1 63  ? -4.805  -10.709 -11.882 1.00 2.06  ? 577 ILE A CB   3  
ATOM 5194  C CG1  . ILE A 1 63  ? -4.999  -11.929 -10.970 1.00 2.24  ? 577 ILE A CG1  3  
ATOM 5195  C CG2  . ILE A 1 63  ? -3.360  -10.691 -12.401 1.00 2.07  ? 577 ILE A CG2  3  
ATOM 5196  C CD1  . ILE A 1 63  ? -5.325  -13.200 -11.737 1.00 2.49  ? 577 ILE A CD1  3  
ATOM 5197  H H    . ILE A 1 63  ? -7.094  -9.686  -12.038 1.00 2.17  ? 577 ILE A H    3  
ATOM 5198  H HA   . ILE A 1 63  ? -4.950  -9.614  -10.032 1.00 1.82  ? 577 ILE A HA   3  
ATOM 5199  H HB   . ILE A 1 63  ? -5.458  -10.800 -12.754 1.00 2.41  ? 577 ILE A HB   3  
ATOM 5200  H HG12 . ILE A 1 63  ? -4.094  -12.070 -10.399 1.00 2.91  ? 577 ILE A HG12 3  
ATOM 5201  H HG13 . ILE A 1 63  ? -5.800  -11.759 -10.256 1.00 2.59  ? 577 ILE A HG13 3  
ATOM 5202  H HG21 . ILE A 1 63  ? -3.159  -11.612 -12.945 1.00 2.71  ? 577 ILE A HG21 3  
ATOM 5203  H HG22 . ILE A 1 63  ? -3.213  -9.864  -13.095 1.00 2.44  ? 577 ILE A HG22 3  
ATOM 5204  H HG23 . ILE A 1 63  ? -2.654  -10.609 -11.576 1.00 2.43  ? 577 ILE A HG23 3  
ATOM 5205  H HD11 . ILE A 1 63  ? -6.281  -13.062 -12.243 1.00 2.63  ? 577 ILE A HD11 3  
ATOM 5206  H HD12 . ILE A 1 63  ? -4.546  -13.413 -12.466 1.00 2.95  ? 577 ILE A HD12 3  
ATOM 5207  H HD13 . ILE A 1 63  ? -5.397  -14.026 -11.032 1.00 3.57  ? 577 ILE A HD13 3  
ATOM 5208  N N    . GLY A 1 64  ? -3.353  -7.906  -11.176 1.00 1.65  ? 578 GLY A N    3  
ATOM 5209  C CA   . GLY A 1 64  ? -2.602  -6.698  -11.538 1.00 1.84  ? 578 GLY A CA   3  
ATOM 5210  C C    . GLY A 1 64  ? -2.921  -5.545  -10.590 1.00 1.61  ? 578 GLY A C    3  
ATOM 5211  O O    . GLY A 1 64  ? -3.040  -4.390  -11.002 1.00 1.88  ? 578 GLY A O    3  
ATOM 5212  H H    . GLY A 1 64  ? -2.957  -8.512  -10.464 1.00 1.61  ? 578 GLY A H    3  
ATOM 5213  H HA2  . GLY A 1 64  ? -1.535  -6.908  -11.472 1.00 2.05  ? 578 GLY A HA2  3  
ATOM 5214  H HA3  . GLY A 1 64  ? -2.836  -6.399  -12.559 1.00 2.18  ? 578 GLY A HA3  3  
ATOM 5215  N N    . LYS A 1 65  ? -3.170  -5.880  -9.323  1.00 1.50  ? 579 LYS A N    3  
ATOM 5216  C CA   . LYS A 1 65  ? -3.719  -4.980  -8.309  1.00 1.61  ? 579 LYS A CA   3  
ATOM 5217  C C    . LYS A 1 65  ? -2.597  -4.234  -7.577  1.00 1.45  ? 579 LYS A C    3  
ATOM 5218  O O    . LYS A 1 65  ? -1.537  -4.807  -7.320  1.00 1.56  ? 579 LYS A O    3  
ATOM 5219  C CB   . LYS A 1 65  ? -4.654  -5.830  -7.436  1.00 2.02  ? 579 LYS A CB   3  
ATOM 5220  C CG   . LYS A 1 65  ? -5.524  -5.012  -6.478  1.00 2.78  ? 579 LYS A CG   3  
ATOM 5221  C CD   . LYS A 1 65  ? -6.721  -5.850  -6.006  1.00 3.13  ? 579 LYS A CD   3  
ATOM 5222  C CE   . LYS A 1 65  ? -7.635  -4.968  -5.167  1.00 4.18  ? 579 LYS A CE   3  
ATOM 5223  N NZ   . LYS A 1 65  ? -9.016  -5.483  -5.185  1.00 4.83  ? 579 LYS A NZ   3  
ATOM 5224  H H    . LYS A 1 65  ? -3.032  -6.850  -9.059  1.00 1.63  ? 579 LYS A H    3  
ATOM 5225  H HA   . LYS A 1 65  ? -4.331  -4.232  -8.813  1.00 1.75  ? 579 LYS A HA   3  
ATOM 5226  H HB2  . LYS A 1 65  ? -5.320  -6.377  -8.110  1.00 1.91  ? 579 LYS A HB2  3  
ATOM 5227  H HB3  . LYS A 1 65  ? -4.075  -6.568  -6.883  1.00 2.68  ? 579 LYS A HB3  3  
ATOM 5228  H HG2  . LYS A 1 65  ? -4.930  -4.684  -5.624  1.00 3.55  ? 579 LYS A HG2  3  
ATOM 5229  H HG3  . LYS A 1 65  ? -5.900  -4.134  -7.003  1.00 2.95  ? 579 LYS A HG3  3  
ATOM 5230  H HD2  . LYS A 1 65  ? -7.282  -6.214  -6.870  1.00 2.78  ? 579 LYS A HD2  3  
ATOM 5231  H HD3  . LYS A 1 65  ? -6.392  -6.708  -5.416  1.00 3.67  ? 579 LYS A HD3  3  
ATOM 5232  H HE2  . LYS A 1 65  ? -7.256  -4.915  -4.144  1.00 5.18  ? 579 LYS A HE2  3  
ATOM 5233  H HE3  . LYS A 1 65  ? -7.627  -3.961  -5.590  1.00 4.15  ? 579 LYS A HE3  3  
ATOM 5234  H HZ1  . LYS A 1 65  ? -9.068  -6.435  -4.812  1.00 5.60  ? 579 LYS A HZ1  3  
ATOM 5235  H HZ2  . LYS A 1 65  ? -9.353  -5.526  -6.143  1.00 4.72  ? 579 LYS A HZ2  3  
ATOM 5236  H HZ3  . LYS A 1 65  ? -9.659  -4.872  -4.692  1.00 5.29  ? 579 LYS A HZ3  3  
ATOM 5237  N N    . LYS A 1 66  ? -2.791  -2.936  -7.329  1.00 1.28  ? 580 LYS A N    3  
ATOM 5238  C CA   . LYS A 1 66  ? -1.777  -2.003  -6.799  1.00 1.21  ? 580 LYS A CA   3  
ATOM 5239  C C    . LYS A 1 66  ? -1.912  -1.824  -5.278  1.00 1.00  ? 580 LYS A C    3  
ATOM 5240  O O    . LYS A 1 66  ? -2.818  -2.379  -4.651  1.00 1.11  ? 580 LYS A O    3  
ATOM 5241  C CB   . LYS A 1 66  ? -1.864  -0.656  -7.566  1.00 1.36  ? 580 LYS A CB   3  
ATOM 5242  C CG   . LYS A 1 66  ? -1.909  -0.767  -9.104  1.00 2.54  ? 580 LYS A CG   3  
ATOM 5243  C CD   . LYS A 1 66  ? -0.695  -1.504  -9.687  1.00 4.42  ? 580 LYS A CD   3  
ATOM 5244  C CE   . LYS A 1 66  ? -0.816  -1.716  -11.203 1.00 6.11  ? 580 LYS A CE   3  
ATOM 5245  N NZ   . LYS A 1 66  ? -0.769  -0.470  -12.000 1.00 6.12  ? 580 LYS A NZ   3  
ATOM 5246  H H    . LYS A 1 66  ? -3.690  -2.542  -7.584  1.00 1.31  ? 580 LYS A H    3  
ATOM 5247  H HA   . LYS A 1 66  ? -0.787  -2.432  -6.958  1.00 1.42  ? 580 LYS A HA   3  
ATOM 5248  H HB2  . LYS A 1 66  ? -2.762  -0.126  -7.246  1.00 1.75  ? 580 LYS A HB2  3  
ATOM 5249  H HB3  . LYS A 1 66  ? -1.006  -0.031  -7.306  1.00 1.74  ? 580 LYS A HB3  3  
ATOM 5250  H HG2  . LYS A 1 66  ? -2.818  -1.284  -9.411  1.00 2.71  ? 580 LYS A HG2  3  
ATOM 5251  H HG3  . LYS A 1 66  ? -1.945  0.241   -9.518  1.00 2.99  ? 580 LYS A HG3  3  
ATOM 5252  H HD2  . LYS A 1 66  ? 0.209   -0.954  -9.432  1.00 4.57  ? 580 LYS A HD2  3  
ATOM 5253  H HD3  . LYS A 1 66  ? -0.627  -2.494  -9.238  1.00 4.98  ? 580 LYS A HD3  3  
ATOM 5254  H HE2  . LYS A 1 66  ? -0.009  -2.377  -11.530 1.00 7.31  ? 580 LYS A HE2  3  
ATOM 5255  H HE3  . LYS A 1 66  ? -1.758  -2.239  -11.401 1.00 6.74  ? 580 LYS A HE3  3  
ATOM 5256  H HZ1  . LYS A 1 66  ? -0.989  -0.673  -12.968 1.00 6.68  ? 580 LYS A HZ1  3  
ATOM 5257  H HZ2  . LYS A 1 66  ? 0.147   -0.025  -12.006 1.00 6.79  ? 580 LYS A HZ2  3  
ATOM 5258  H HZ3  . LYS A 1 66  ? -1.444  0.226   -11.698 1.00 5.41  ? 580 LYS A HZ3  3  
ATOM 5259  N N    . MET A 1 67  ? -1.044  -0.996  -4.693  1.00 0.82  ? 581 MET A N    3  
ATOM 5260  C CA   . MET A 1 67  ? -1.129  -0.663  -3.262  1.00 0.79  ? 581 MET A CA   3  
ATOM 5261  C C    . MET A 1 67  ? -2.150  0.450   -3.018  1.00 0.86  ? 581 MET A C    3  
ATOM 5262  O O    . MET A 1 67  ? -2.147  1.470   -3.713  1.00 0.93  ? 581 MET A O    3  
ATOM 5263  C CB   . MET A 1 67  ? 0.229   -0.185  -2.711  1.00 1.12  ? 581 MET A CB   3  
ATOM 5264  C CG   . MET A 1 67  ? 1.186   -1.333  -2.392  1.00 1.63  ? 581 MET A CG   3  
ATOM 5265  S SD   . MET A 1 67  ? 0.646   -2.439  -1.055  1.00 2.37  ? 581 MET A SD   3  
ATOM 5266  C CE   . MET A 1 67  ? 0.966   -1.408  0.406   1.00 1.49  ? 581 MET A CE   3  
ATOM 5267  H H    . MET A 1 67  ? -0.314  -0.583  -5.260  1.00 0.88  ? 581 MET A H    3  
ATOM 5268  H HA   . MET A 1 67  ? -1.447  -1.543  -2.700  1.00 0.94  ? 581 MET A HA   3  
ATOM 5269  H HB2  . MET A 1 67  ? 0.698   0.487   -3.431  1.00 2.37  ? 581 MET A HB2  3  
ATOM 5270  H HB3  . MET A 1 67  ? 0.069   0.377   -1.789  1.00 2.10  ? 581 MET A HB3  3  
ATOM 5271  H HG2  . MET A 1 67  ? 1.325   -1.919  -3.298  1.00 2.93  ? 581 MET A HG2  3  
ATOM 5272  H HG3  . MET A 1 67  ? 2.155   -0.914  -2.122  1.00 2.59  ? 581 MET A HG3  3  
ATOM 5273  H HE1  . MET A 1 67  ? 0.216   -0.618  0.515   1.00 1.85  ? 581 MET A HE1  3  
ATOM 5274  H HE2  . MET A 1 67  ? 0.949   -2.044  1.293   1.00 2.10  ? 581 MET A HE2  3  
ATOM 5275  H HE3  . MET A 1 67  ? 1.956   -0.960  0.333   1.00 2.05  ? 581 MET A HE3  3  
ATOM 5276  N N    . TYR A 1 68  ? -2.962  0.280   -1.973  1.00 1.02  ? 582 TYR A N    3  
ATOM 5277  C CA   . TYR A 1 68  ? -3.743  1.353   -1.360  1.00 1.11  ? 582 TYR A CA   3  
ATOM 5278  C C    . TYR A 1 68  ? -3.429  1.352   0.130   1.00 1.18  ? 582 TYR A C    3  
ATOM 5279  O O    . TYR A 1 68  ? -3.548  0.330   0.805   1.00 1.40  ? 582 TYR A O    3  
ATOM 5280  C CB   . TYR A 1 68  ? -5.241  1.147   -1.620  1.00 1.19  ? 582 TYR A CB   3  
ATOM 5281  C CG   . TYR A 1 68  ? -5.578  1.084   -3.092  1.00 1.31  ? 582 TYR A CG   3  
ATOM 5282  C CD1  . TYR A 1 68  ? -5.532  -0.155  -3.758  1.00 2.37  ? 582 TYR A CD1  3  
ATOM 5283  C CD2  . TYR A 1 68  ? -5.837  2.264   -3.812  1.00 2.12  ? 582 TYR A CD2  3  
ATOM 5284  C CE1  . TYR A 1 68  ? -5.689  -0.214  -5.152  1.00 2.66  ? 582 TYR A CE1  3  
ATOM 5285  C CE2  . TYR A 1 68  ? -6.009  2.209   -5.206  1.00 2.40  ? 582 TYR A CE2  3  
ATOM 5286  C CZ   . TYR A 1 68  ? -5.901  0.973   -5.879  1.00 2.12  ? 582 TYR A CZ   3  
ATOM 5287  O OH   . TYR A 1 68  ? -5.947  0.931   -7.230  1.00 2.71  ? 582 TYR A OH   3  
ATOM 5288  H H    . TYR A 1 68  ? -2.938  -0.601  -1.469  1.00 1.04  ? 582 TYR A H    3  
ATOM 5289  H HA   . TYR A 1 68  ? -3.450  2.316   -1.782  1.00 1.09  ? 582 TYR A HA   3  
ATOM 5290  H HB2  . TYR A 1 68  ? -5.557  0.218   -1.148  1.00 1.25  ? 582 TYR A HB2  3  
ATOM 5291  H HB3  . TYR A 1 68  ? -5.798  1.964   -1.158  1.00 1.30  ? 582 TYR A HB3  3  
ATOM 5292  H HD1  . TYR A 1 68  ? -5.309  -1.053  -3.205  1.00 3.45  ? 582 TYR A HD1  3  
ATOM 5293  H HD2  . TYR A 1 68  ? -5.859  3.218   -3.301  1.00 3.19  ? 582 TYR A HD2  3  
ATOM 5294  H HE1  . TYR A 1 68  ? -5.601  -1.159  -5.668  1.00 3.84  ? 582 TYR A HE1  3  
ATOM 5295  H HE2  . TYR A 1 68  ? -6.178  3.113   -5.774  1.00 3.51  ? 582 TYR A HE2  3  
ATOM 5296  H HH   . TYR A 1 68  ? -5.845  0.017   -7.542  1.00 3.19  ? 582 TYR A HH   3  
ATOM 5297  N N    . PHE A 1 69  ? -3.002  2.491   0.660   1.00 1.03  ? 583 PHE A N    3  
ATOM 5298  C CA   . PHE A 1 69  ? -2.488  2.557   2.025   1.00 1.02  ? 583 PHE A CA   3  
ATOM 5299  C C    . PHE A 1 69  ? -2.802  3.901   2.680   1.00 0.94  ? 583 PHE A C    3  
ATOM 5300  O O    . PHE A 1 69  ? -3.145  4.873   2.006   1.00 0.96  ? 583 PHE A O    3  
ATOM 5301  C CB   . PHE A 1 69  ? -1.030  2.037   2.079   1.00 1.25  ? 583 PHE A CB   3  
ATOM 5302  C CG   . PHE A 1 69  ? 0.063   2.521   1.140   1.00 1.76  ? 583 PHE A CG   3  
ATOM 5303  C CD1  . PHE A 1 69  ? -0.090  3.591   0.238   1.00 2.62  ? 583 PHE A CD1  3  
ATOM 5304  C CD2  . PHE A 1 69  ? 1.265   1.787   1.139   1.00 2.77  ? 583 PHE A CD2  3  
ATOM 5305  C CE1  . PHE A 1 69  ? 0.904   3.838   -0.728  1.00 3.22  ? 583 PHE A CE1  3  
ATOM 5306  C CE2  . PHE A 1 69  ? 2.272   2.057   0.200   1.00 3.45  ? 583 PHE A CE2  3  
ATOM 5307  C CZ   . PHE A 1 69  ? 2.085   3.076   -0.744  1.00 3.28  ? 583 PHE A CZ   3  
ATOM 5308  H H    . PHE A 1 69  ? -2.946  3.321   0.079   1.00 0.98  ? 583 PHE A H    3  
ATOM 5309  H HA   . PHE A 1 69  ? -3.065  1.849   2.621   1.00 1.05  ? 583 PHE A HA   3  
ATOM 5310  H HB2  . PHE A 1 69  ? -0.637  2.045   3.087   1.00 1.22  ? 583 PHE A HB2  3  
ATOM 5311  H HB3  . PHE A 1 69  ? -1.122  0.980   1.839   1.00 1.45  ? 583 PHE A HB3  3  
ATOM 5312  H HD1  . PHE A 1 69  ? -0.955  4.235   0.286   1.00 3.42  ? 583 PHE A HD1  3  
ATOM 5313  H HD2  . PHE A 1 69  ? 1.409   0.995   1.859   1.00 3.54  ? 583 PHE A HD2  3  
ATOM 5314  H HE1  . PHE A 1 69  ? 0.770   4.638   -1.438  1.00 4.15  ? 583 PHE A HE1  3  
ATOM 5315  H HE2  . PHE A 1 69  ? 3.186   1.480   0.205   1.00 4.54  ? 583 PHE A HE2  3  
ATOM 5316  H HZ   . PHE A 1 69  ? 2.870   3.289   -1.453  1.00 3.86  ? 583 PHE A HZ   3  
ATOM 5317  N N    . ILE A 1 70  ? -2.865  3.906   4.010   1.00 0.92  ? 584 ILE A N    3  
ATOM 5318  C CA   . ILE A 1 70  ? -3.638  4.907   4.756   1.00 0.93  ? 584 ILE A CA   3  
ATOM 5319  C C    . ILE A 1 70  ? -2.727  6.076   5.145   1.00 1.03  ? 584 ILE A C    3  
ATOM 5320  O O    . ILE A 1 70  ? -1.936  5.939   6.076   1.00 1.02  ? 584 ILE A O    3  
ATOM 5321  C CB   . ILE A 1 70  ? -4.360  4.241   5.961   1.00 0.89  ? 584 ILE A CB   3  
ATOM 5322  C CG1  . ILE A 1 70  ? -5.175  3.003   5.518   1.00 0.88  ? 584 ILE A CG1  3  
ATOM 5323  C CG2  . ILE A 1 70  ? -5.295  5.276   6.621   1.00 0.85  ? 584 ILE A CG2  3  
ATOM 5324  C CD1  . ILE A 1 70  ? -5.932  2.313   6.655   1.00 0.84  ? 584 ILE A CD1  3  
ATOM 5325  H H    . ILE A 1 70  ? -2.559  3.068   4.502   1.00 0.94  ? 584 ILE A H    3  
ATOM 5326  H HA   . ILE A 1 70  ? -4.415  5.305   4.104   1.00 0.91  ? 584 ILE A HA   3  
ATOM 5327  H HB   . ILE A 1 70  ? -3.620  3.887   6.690   1.00 0.95  ? 584 ILE A HB   3  
ATOM 5328  H HG12 . ILE A 1 70  ? -5.890  3.285   4.748   1.00 0.84  ? 584 ILE A HG12 3  
ATOM 5329  H HG13 . ILE A 1 70  ? -4.505  2.260   5.091   1.00 0.97  ? 584 ILE A HG13 3  
ATOM 5330  H HG21 . ILE A 1 70  ? -5.778  4.848   7.502   1.00 1.30  ? 584 ILE A HG21 3  
ATOM 5331  H HG22 . ILE A 1 70  ? -4.739  6.154   6.942   1.00 1.77  ? 584 ILE A HG22 3  
ATOM 5332  H HG23 . ILE A 1 70  ? -6.068  5.584   5.916   1.00 2.02  ? 584 ILE A HG23 3  
ATOM 5333  H HD11 . ILE A 1 70  ? -6.105  1.270   6.390   1.00 1.73  ? 584 ILE A HD11 3  
ATOM 5334  H HD12 . ILE A 1 70  ? -5.352  2.338   7.570   1.00 1.37  ? 584 ILE A HD12 3  
ATOM 5335  H HD13 . ILE A 1 70  ? -6.882  2.817   6.825   1.00 1.83  ? 584 ILE A HD13 3  
ATOM 5336  N N    . GLN A 1 71  ? -2.819  7.225   4.457   1.00 1.19  ? 585 GLN A N    3  
ATOM 5337  C CA   . GLN A 1 71  ? -2.029  8.412   4.807   1.00 1.27  ? 585 GLN A CA   3  
ATOM 5338  C C    . GLN A 1 71  ? -2.467  8.963   6.170   1.00 1.24  ? 585 GLN A C    3  
ATOM 5339  O O    . GLN A 1 71  ? -1.654  9.067   7.090   1.00 1.35  ? 585 GLN A O    3  
ATOM 5340  C CB   . GLN A 1 71  ? -2.116  9.478   3.694   1.00 1.25  ? 585 GLN A CB   3  
ATOM 5341  C CG   . GLN A 1 71  ? -0.807  10.272  3.567   1.00 1.69  ? 585 GLN A CG   3  
ATOM 5342  C CD   . GLN A 1 71  ? -0.439  11.073  4.811   1.00 2.05  ? 585 GLN A CD   3  
ATOM 5343  O OE1  . GLN A 1 71  ? 0.513   10.773  5.517   1.00 3.50  ? 585 GLN A OE1  3  
ATOM 5344  N NE2  . GLN A 1 71  ? -1.198  12.091  5.132   1.00 1.92  ? 585 GLN A NE2  3  
ATOM 5345  H H    . GLN A 1 71  ? -3.508  7.330   3.715   1.00 1.25  ? 585 GLN A H    3  
ATOM 5346  H HA   . GLN A 1 71  ? -0.990  8.098   4.897   1.00 1.43  ? 585 GLN A HA   3  
ATOM 5347  H HB2  . GLN A 1 71  ? -2.299  8.995   2.736   1.00 1.60  ? 585 GLN A HB2  3  
ATOM 5348  H HB3  . GLN A 1 71  ? -2.947  10.160  3.879   1.00 1.32  ? 585 GLN A HB3  3  
ATOM 5349  H HG2  . GLN A 1 71  ? -0.012  9.562   3.359   1.00 2.58  ? 585 GLN A HG2  3  
ATOM 5350  H HG3  . GLN A 1 71  ? -0.887  10.959  2.727   1.00 1.89  ? 585 GLN A HG3  3  
ATOM 5351  H HE21 . GLN A 1 71  ? -1.937  12.389  4.501   1.00 2.38  ? 585 GLN A HE21 3  
ATOM 5352  H HE22 . GLN A 1 71  ? -1.002  12.609  5.980   1.00 2.41  ? 585 GLN A HE22 3  
ATOM 5353  N N    . HIS A 1 72  ? -3.761  9.259   6.334   1.00 1.15  ? 586 HIS A N    3  
ATOM 5354  C CA   . HIS A 1 72  ? -4.324  9.629   7.632   1.00 1.15  ? 586 HIS A CA   3  
ATOM 5355  C C    . HIS A 1 72  ? -5.799  9.224   7.779   1.00 1.01  ? 586 HIS A C    3  
ATOM 5356  O O    . HIS A 1 72  ? -6.645  9.673   7.010   1.00 0.93  ? 586 HIS A O    3  
ATOM 5357  C CB   . HIS A 1 72  ? -4.149  11.140  7.818   1.00 1.21  ? 586 HIS A CB   3  
ATOM 5358  C CG   . HIS A 1 72  ? -4.482  11.579  9.216   1.00 1.29  ? 586 HIS A CG   3  
ATOM 5359  N ND1  . HIS A 1 72  ? -5.738  11.852  9.701   1.00 2.11  ? 586 HIS A ND1  3  
ATOM 5360  C CD2  . HIS A 1 72  ? -3.609  11.690  10.261  1.00 2.27  ? 586 HIS A CD2  3  
ATOM 5361  C CE1  . HIS A 1 72  ? -5.629  12.122  11.010  1.00 2.23  ? 586 HIS A CE1  3  
ATOM 5362  N NE2  . HIS A 1 72  ? -4.344  12.032  11.406  1.00 2.20  ? 586 HIS A NE2  3  
ATOM 5363  H H    . HIS A 1 72  ? -4.373  9.241   5.520   1.00 1.13  ? 586 HIS A H    3  
ATOM 5364  H HA   . HIS A 1 72  ? -3.763  9.124   8.420   1.00 1.28  ? 586 HIS A HA   3  
ATOM 5365  H HB2  . HIS A 1 72  ? -3.118  11.419  7.603   1.00 1.40  ? 586 HIS A HB2  3  
ATOM 5366  H HB3  . HIS A 1 72  ? -4.791  11.664  7.109   1.00 1.44  ? 586 HIS A HB3  3  
ATOM 5367  H HD1  . HIS A 1 72  ? -6.602  11.875  9.158   1.00 3.18  ? 586 HIS A HD1  3  
ATOM 5368  H HD2  . HIS A 1 72  ? -2.543  11.509  10.212  1.00 3.52  ? 586 HIS A HD2  3  
ATOM 5369  H HE1  . HIS A 1 72  ? -6.464  12.357  11.654  1.00 3.14  ? 586 HIS A HE1  3  
ATOM 5370  N N    . GLY A 1 73  ? -6.122  8.405   8.782   1.00 1.05  ? 587 GLY A N    3  
ATOM 5371  C CA   . GLY A 1 73  ? -7.485  8.022   9.137   1.00 0.98  ? 587 GLY A CA   3  
ATOM 5372  C C    . GLY A 1 73  ? -7.533  6.581   9.637   1.00 1.05  ? 587 GLY A C    3  
ATOM 5373  O O    . GLY A 1 73  ? -6.502  6.006   9.988   1.00 1.20  ? 587 GLY A O    3  
ATOM 5374  H H    . GLY A 1 73  ? -5.399  7.946   9.321   1.00 1.19  ? 587 GLY A H    3  
ATOM 5375  H HA2  . GLY A 1 73  ? -7.856  8.676   9.925   1.00 1.08  ? 587 GLY A HA2  3  
ATOM 5376  H HA3  . GLY A 1 73  ? -8.144  8.119   8.276   1.00 0.90  ? 587 GLY A HA3  3  
ATOM 5377  N N    . VAL A 1 74  ? -8.734  6.001   9.661   1.00 1.00  ? 588 VAL A N    3  
ATOM 5378  C CA   . VAL A 1 74  ? -9.002  4.642   10.142  1.00 1.04  ? 588 VAL A CA   3  
ATOM 5379  C C    . VAL A 1 74  ? -10.022 3.961   9.218   1.00 0.91  ? 588 VAL A C    3  
ATOM 5380  O O    . VAL A 1 74  ? -10.894 4.610   8.629   1.00 0.85  ? 588 VAL A O    3  
ATOM 5381  C CB   . VAL A 1 74  ? -9.486  4.669   11.615  1.00 1.15  ? 588 VAL A CB   3  
ATOM 5382  C CG1  . VAL A 1 74  ? -9.801  3.287   12.196  1.00 1.15  ? 588 VAL A CG1  3  
ATOM 5383  C CG2  . VAL A 1 74  ? -8.439  5.290   12.548  1.00 1.38  ? 588 VAL A CG2  3  
ATOM 5384  H H    . VAL A 1 74  ? -9.523  6.505   9.291   1.00 0.93  ? 588 VAL A H    3  
ATOM 5385  H HA   . VAL A 1 74  ? -8.062  4.090   10.096  1.00 1.13  ? 588 VAL A HA   3  
ATOM 5386  H HB   . VAL A 1 74  ? -10.391 5.269   11.675  1.00 1.12  ? 588 VAL A HB   3  
ATOM 5387  H HG11 . VAL A 1 74  ? -10.603 2.814   11.637  1.00 1.81  ? 588 VAL A HG11 3  
ATOM 5388  H HG12 . VAL A 1 74  ? -8.914  2.656   12.177  1.00 2.17  ? 588 VAL A HG12 3  
ATOM 5389  H HG13 . VAL A 1 74  ? -10.139 3.390   13.228  1.00 1.29  ? 588 VAL A HG13 3  
ATOM 5390  H HG21 . VAL A 1 74  ? -8.283  6.338   12.297  1.00 1.98  ? 588 VAL A HG21 3  
ATOM 5391  H HG22 . VAL A 1 74  ? -8.788  5.244   13.579  1.00 1.43  ? 588 VAL A HG22 3  
ATOM 5392  H HG23 . VAL A 1 74  ? -7.495  4.754   12.458  1.00 2.53  ? 588 VAL A HG23 3  
ATOM 5393  N N    . VAL A 1 75  ? -9.929  2.642   9.077   1.00 0.90  ? 589 VAL A N    3  
ATOM 5394  C CA   . VAL A 1 75  ? -10.874 1.793   8.330   1.00 0.78  ? 589 VAL A CA   3  
ATOM 5395  C C    . VAL A 1 75  ? -11.326 0.620   9.201   1.00 0.79  ? 589 VAL A C    3  
ATOM 5396  O O    . VAL A 1 75  ? -10.527 0.091   9.966   1.00 0.95  ? 589 VAL A O    3  
ATOM 5397  C CB   . VAL A 1 75  ? -10.276 1.305   6.995   1.00 0.81  ? 589 VAL A CB   3  
ATOM 5398  C CG1  . VAL A 1 75  ? -9.948  2.473   6.055   1.00 0.84  ? 589 VAL A CG1  3  
ATOM 5399  C CG2  . VAL A 1 75  ? -9.012  0.460   7.188   1.00 0.94  ? 589 VAL A CG2  3  
ATOM 5400  H H    . VAL A 1 75  ? -9.186  2.169   9.587   1.00 0.97  ? 589 VAL A H    3  
ATOM 5401  H HA   . VAL A 1 75  ? -11.765 2.367   8.090   1.00 0.72  ? 589 VAL A HA   3  
ATOM 5402  H HB   . VAL A 1 75  ? -11.020 0.688   6.497   1.00 0.77  ? 589 VAL A HB   3  
ATOM 5403  H HG11 . VAL A 1 75  ? -9.197  3.122   6.503   1.00 1.40  ? 589 VAL A HG11 3  
ATOM 5404  H HG12 . VAL A 1 75  ? -9.561  2.089   5.112   1.00 2.09  ? 589 VAL A HG12 3  
ATOM 5405  H HG13 . VAL A 1 75  ? -10.847 3.051   5.853   1.00 1.79  ? 589 VAL A HG13 3  
ATOM 5406  H HG21 . VAL A 1 75  ? -9.252  -0.439  7.755   1.00 1.46  ? 589 VAL A HG21 3  
ATOM 5407  H HG22 . VAL A 1 75  ? -8.616  0.149   6.224   1.00 2.23  ? 589 VAL A HG22 3  
ATOM 5408  H HG23 . VAL A 1 75  ? -8.256  1.034   7.724   1.00 1.63  ? 589 VAL A HG23 3  
ATOM 5409  N N    . SER A 1 76  ? -12.577 0.191   9.062   1.00 0.69  ? 590 SER A N    3  
ATOM 5410  C CA   . SER A 1 76  ? -13.163 -0.965  9.761   1.00 0.83  ? 590 SER A CA   3  
ATOM 5411  C C    . SER A 1 76  ? -13.374 -2.066  8.744   1.00 0.90  ? 590 SER A C    3  
ATOM 5412  O O    . SER A 1 76  ? -13.880 -1.872  7.636   1.00 0.84  ? 590 SER A O    3  
ATOM 5413  C CB   . SER A 1 76  ? -14.524 -0.675  10.382  1.00 1.07  ? 590 SER A CB   3  
ATOM 5414  O OG   . SER A 1 76  ? -14.399 0.359   11.323  1.00 1.30  ? 590 SER A OG   3  
ATOM 5415  H H    . SER A 1 76  ? -13.095 0.554   8.272   1.00 0.63  ? 590 SER A H    3  
ATOM 5416  H HA   . SER A 1 76  ? -12.482 -1.320  10.561  1.00 0.87  ? 590 SER A HA   3  
ATOM 5417  H HB2  . SER A 1 76  ? -15.224 -0.376  9.600   1.00 1.05  ? 590 SER A HB2  3  
ATOM 5418  H HB3  . SER A 1 76  ? -14.893 -1.591  10.863  1.00 1.27  ? 590 SER A HB3  3  
ATOM 5419  H HG   . SER A 1 76  ? -15.299 0.684   11.515  1.00 1.09  ? 590 SER A HG   3  
ATOM 5420  N N    . VAL A 1 77  ? -12.847 -3.214  9.102   1.00 1.09  ? 591 VAL A N    3  
ATOM 5421  C CA   . VAL A 1 77  ? -12.154 -4.068  8.176   1.00 0.95  ? 591 VAL A CA   3  
ATOM 5422  C C    . VAL A 1 77  ? -12.428 -5.505  8.556   1.00 0.81  ? 591 VAL A C    3  
ATOM 5423  O O    . VAL A 1 77  ? -12.701 -5.831  9.716   1.00 0.83  ? 591 VAL A O    3  
ATOM 5424  C CB   . VAL A 1 77  ? -10.663 -3.686  8.225   1.00 1.33  ? 591 VAL A CB   3  
ATOM 5425  C CG1  . VAL A 1 77  ? -10.156 -3.620  9.644   1.00 2.60  ? 591 VAL A CG1  3  
ATOM 5426  C CG2  . VAL A 1 77  ? -9.711  -4.696  7.675   1.00 1.04  ? 591 VAL A CG2  3  
ATOM 5427  H H    . VAL A 1 77  ? -12.506 -3.319  10.054  1.00 1.20  ? 591 VAL A H    3  
ATOM 5428  H HA   . VAL A 1 77  ? -12.529 -3.913  7.166   1.00 1.02  ? 591 VAL A HA   3  
ATOM 5429  H HB   . VAL A 1 77  ? -10.502 -2.723  7.745   1.00 2.29  ? 591 VAL A HB   3  
ATOM 5430  H HG11 . VAL A 1 77  ? -9.077  -3.529  9.714   1.00 3.23  ? 591 VAL A HG11 3  
ATOM 5431  H HG12 . VAL A 1 77  ? -10.587 -2.737  10.071  1.00 3.63  ? 591 VAL A HG12 3  
ATOM 5432  H HG13 . VAL A 1 77  ? -10.484 -4.550  10.123  1.00 2.95  ? 591 VAL A HG13 3  
ATOM 5433  H HG21 . VAL A 1 77  ? -9.693  -5.529  8.386   1.00 1.84  ? 591 VAL A HG21 3  
ATOM 5434  H HG22 . VAL A 1 77  ? -10.031 -4.980  6.683   1.00 2.24  ? 591 VAL A HG22 3  
ATOM 5435  H HG23 . VAL A 1 77  ? -8.751  -4.196  7.660   1.00 1.68  ? 591 VAL A HG23 3  
ATOM 5436  N N    . LEU A 1 78  ? -12.324 -6.368  7.566   1.00 0.92  ? 592 LEU A N    3  
ATOM 5437  C CA   . LEU A 1 78  ? -12.122 -7.784  7.825   1.00 1.40  ? 592 LEU A CA   3  
ATOM 5438  C C    . LEU A 1 78  ? -10.752 -8.181  7.290   1.00 1.76  ? 592 LEU A C    3  
ATOM 5439  O O    . LEU A 1 78  ? -10.412 -7.815  6.160   1.00 1.74  ? 592 LEU A O    3  
ATOM 5440  C CB   . LEU A 1 78  ? -13.208 -8.623  7.122   1.00 1.72  ? 592 LEU A CB   3  
ATOM 5441  C CG   . LEU A 1 78  ? -14.681 -8.511  7.557   1.00 1.88  ? 592 LEU A CG   3  
ATOM 5442  C CD1  . LEU A 1 78  ? -14.858 -9.026  8.977   1.00 2.20  ? 592 LEU A CD1  3  
ATOM 5443  C CD2  . LEU A 1 78  ? -15.319 -7.125  7.448   1.00 1.78  ? 592 LEU A CD2  3  
ATOM 5444  H H    . LEU A 1 78  ? -12.142 -6.000  6.629   1.00 0.90  ? 592 LEU A H    3  
ATOM 5445  H HA   . LEU A 1 78  ? -12.116 -7.958  8.906   1.00 1.51  ? 592 LEU A HA   3  
ATOM 5446  H HB2  . LEU A 1 78  ? -13.158 -8.396  6.062   1.00 1.67  ? 592 LEU A HB2  3  
ATOM 5447  H HB3  . LEU A 1 78  ? -12.927 -9.672  7.217   1.00 2.14  ? 592 LEU A HB3  3  
ATOM 5448  H HG   . LEU A 1 78  ? -15.246 -9.165  6.896   1.00 2.28  ? 592 LEU A HG   3  
ATOM 5449  H HD11 . LEU A 1 78  ? -14.280 -8.409  9.658   1.00 2.54  ? 592 LEU A HD11 3  
ATOM 5450  H HD12 . LEU A 1 78  ? -14.513 -10.056 9.044   1.00 3.02  ? 592 LEU A HD12 3  
ATOM 5451  H HD13 . LEU A 1 78  ? -15.913 -8.994  9.251   1.00 2.30  ? 592 LEU A HD13 3  
ATOM 5452  H HD21 . LEU A 1 78  ? -16.399 -7.225  7.546   1.00 2.34  ? 592 LEU A HD21 3  
ATOM 5453  H HD22 . LEU A 1 78  ? -15.092 -6.693  6.474   1.00 2.20  ? 592 LEU A HD22 3  
ATOM 5454  H HD23 . LEU A 1 78  ? -14.953 -6.474  8.236   1.00 2.37  ? 592 LEU A HD23 3  
ATOM 5455  N N    . THR A 1 79  ? -9.999  -8.991  8.030   1.00 2.20  ? 593 THR A N    3  
ATOM 5456  C CA   . THR A 1 79  ? -8.995  -9.856  7.380   1.00 2.50  ? 593 THR A CA   3  
ATOM 5457  C C    . THR A 1 79  ? -9.598  -11.235 7.084   1.00 2.70  ? 593 THR A C    3  
ATOM 5458  O O    . THR A 1 79  ? -10.332 -11.801 7.898   1.00 2.78  ? 593 THR A O    3  
ATOM 5459  C CB   . THR A 1 79  ? -7.645  -9.843  8.107   1.00 2.80  ? 593 THR A CB   3  
ATOM 5460  O OG1  . THR A 1 79  ? -7.773  -9.805  9.507   1.00 2.77  ? 593 THR A OG1  3  
ATOM 5461  C CG2  . THR A 1 79  ? -6.894  -8.572  7.717   1.00 2.78  ? 593 THR A CG2  3  
ATOM 5462  H H    . THR A 1 79  ? -10.233 -9.164  9.010   1.00 2.29  ? 593 THR A H    3  
ATOM 5463  H HA   . THR A 1 79  ? -8.772  -9.451  6.394   1.00 2.42  ? 593 THR A HA   3  
ATOM 5464  H HB   . THR A 1 79  ? -7.052  -10.708 7.820   1.00 3.17  ? 593 THR A HB   3  
ATOM 5465  H HG1  . THR A 1 79  ? -6.849  -9.856  9.845   1.00 3.10  ? 593 THR A HG1  3  
ATOM 5466  H HG21 . THR A 1 79  ? -5.922  -8.545  8.208   1.00 3.49  ? 593 THR A HG21 3  
ATOM 5467  H HG22 . THR A 1 79  ? -7.480  -7.689  7.979   1.00 3.12  ? 593 THR A HG22 3  
ATOM 5468  H HG23 . THR A 1 79  ? -6.733  -8.567  6.644   1.00 2.93  ? 593 THR A HG23 3  
ATOM 5469  N N    . LYS A 1 80  ? -9.404  -11.727 5.854   1.00 2.79  ? 594 LYS A N    3  
ATOM 5470  C CA   . LYS A 1 80  ? -10.223 -12.783 5.229   1.00 2.89  ? 594 LYS A CA   3  
ATOM 5471  C C    . LYS A 1 80  ? -10.169 -14.148 5.926   1.00 3.15  ? 594 LYS A C    3  
ATOM 5472  O O    . LYS A 1 80  ? -11.192 -14.824 5.990   1.00 3.18  ? 594 LYS A O    3  
ATOM 5473  C CB   . LYS A 1 80  ? -9.892  -12.909 3.728   1.00 2.98  ? 594 LYS A CB   3  
ATOM 5474  C CG   . LYS A 1 80  ? -8.433  -13.275 3.392   1.00 3.34  ? 594 LYS A CG   3  
ATOM 5475  C CD   . LYS A 1 80  ? -7.591  -12.056 2.979   1.00 3.47  ? 594 LYS A CD   3  
ATOM 5476  C CE   . LYS A 1 80  ? -6.094  -12.362 2.846   1.00 4.01  ? 594 LYS A CE   3  
ATOM 5477  N NZ   . LYS A 1 80  ? -5.823  -13.482 1.919   1.00 4.23  ? 594 LYS A NZ   3  
ATOM 5478  H H    . LYS A 1 80  ? -8.705  -11.279 5.279   1.00 2.82  ? 594 LYS A H    3  
ATOM 5479  H HA   . LYS A 1 80  ? -11.268 -12.476 5.293   1.00 2.82  ? 594 LYS A HA   3  
ATOM 5480  H HB2  . LYS A 1 80  ? -10.533 -13.691 3.321   1.00 3.08  ? 594 LYS A HB2  3  
ATOM 5481  H HB3  . LYS A 1 80  ? -10.162 -11.983 3.217   1.00 2.81  ? 594 LYS A HB3  3  
ATOM 5482  H HG2  . LYS A 1 80  ? -7.964  -13.776 4.233   1.00 3.69  ? 594 LYS A HG2  3  
ATOM 5483  H HG3  . LYS A 1 80  ? -8.448  -13.986 2.567   1.00 3.41  ? 594 LYS A HG3  3  
ATOM 5484  H HD2  . LYS A 1 80  ? -7.958  -11.680 2.024   1.00 3.42  ? 594 LYS A HD2  3  
ATOM 5485  H HD3  . LYS A 1 80  ? -7.702  -11.262 3.716   1.00 3.55  ? 594 LYS A HD3  3  
ATOM 5486  H HE2  . LYS A 1 80  ? -5.593  -11.464 2.483   1.00 4.40  ? 594 LYS A HE2  3  
ATOM 5487  H HE3  . LYS A 1 80  ? -5.678  -12.589 3.832   1.00 4.30  ? 594 LYS A HE3  3  
ATOM 5488  H HZ1  . LYS A 1 80  ? -6.019  -14.381 2.350   1.00 4.18  ? 594 LYS A HZ1  3  
ATOM 5489  H HZ2  . LYS A 1 80  ? -4.845  -13.493 1.630   1.00 4.82  ? 594 LYS A HZ2  3  
ATOM 5490  H HZ3  . LYS A 1 80  ? -6.373  -13.412 1.066   1.00 4.53  ? 594 LYS A HZ3  3  
ATOM 5491  N N    . GLY A 1 81  ? -9.028  -14.542 6.489   1.00 4.21  ? 595 GLY A N    3  
ATOM 5492  C CA   . GLY A 1 81  ? -8.898  -15.764 7.298   1.00 4.54  ? 595 GLY A CA   3  
ATOM 5493  C C    . GLY A 1 81  ? -9.399  -15.614 8.736   1.00 4.35  ? 595 GLY A C    3  
ATOM 5494  O O    . GLY A 1 81  ? -9.351  -16.561 9.526   1.00 4.76  ? 595 GLY A O    3  
ATOM 5495  H H    . GLY A 1 81  ? -8.223  -13.926 6.410   1.00 5.15  ? 595 GLY A H    3  
ATOM 5496  H HA2  . GLY A 1 81  ? -9.417  -16.597 6.827   1.00 4.77  ? 595 GLY A HA2  3  
ATOM 5497  H HA3  . GLY A 1 81  ? -7.837  -15.992 7.387   1.00 4.76  ? 595 GLY A HA3  3  
ATOM 5498  N N    . ASN A 1 82  ? -9.749  -14.384 9.109   1.00 3.82  ? 596 ASN A N    3  
ATOM 5499  C CA   . ASN A 1 82  ? -9.485  -13.841 10.429  1.00 3.71  ? 596 ASN A CA   3  
ATOM 5500  C C    . ASN A 1 82  ? -10.680 -12.975 10.897  1.00 3.33  ? 596 ASN A C    3  
ATOM 5501  O O    . ASN A 1 82  ? -11.838 -13.293 10.604  1.00 3.38  ? 596 ASN A O    3  
ATOM 5502  C CB   . ASN A 1 82  ? -8.174  -13.028 10.356  1.00 3.63  ? 596 ASN A CB   3  
ATOM 5503  C CG   . ASN A 1 82  ? -6.917  -13.625 9.727   1.00 4.04  ? 596 ASN A CG   3  
ATOM 5504  O OD1  . ASN A 1 82  ? -6.800  -14.801 9.426   1.00 4.44  ? 596 ASN A OD1  3  
ATOM 5505  N ND2  . ASN A 1 82  ? -5.891  -12.831 9.554   1.00 4.06  ? 596 ASN A ND2  3  
ATOM 5506  H H    . ASN A 1 82  ? -9.886  -13.697 8.379   1.00 3.51  ? 596 ASN A H    3  
ATOM 5507  H HA   . ASN A 1 82  ? -9.358  -14.650 11.149  1.00 4.02  ? 596 ASN A HA   3  
ATOM 5508  H HB2  . ASN A 1 82  ? -8.430  -12.098 9.876   1.00 3.28  ? 596 ASN A HB2  3  
ATOM 5509  H HB3  . ASN A 1 82  ? -7.865  -12.785 11.351  1.00 3.66  ? 596 ASN A HB3  3  
ATOM 5510  H HD21 . ASN A 1 82  ? -5.918  -11.859 9.834   1.00 3.87  ? 596 ASN A HD21 3  
ATOM 5511  H HD22 . ASN A 1 82  ? -5.050  -13.204 9.141   1.00 4.36  ? 596 ASN A HD22 3  
ATOM 5512  N N    . LYS A 1 83  ? -10.415 -11.940 11.704  1.00 3.06  ? 597 LYS A N    3  
ATOM 5513  C CA   . LYS A 1 83  ? -11.394 -11.207 12.509  1.00 2.76  ? 597 LYS A CA   3  
ATOM 5514  C C    . LYS A 1 83  ? -11.794 -9.838  11.959  1.00 2.17  ? 597 LYS A C    3  
ATOM 5515  O O    . LYS A 1 83  ? -11.134 -9.253  11.098  1.00 2.07  ? 597 LYS A O    3  
ATOM 5516  C CB   . LYS A 1 83  ? -10.890 -11.094 13.969  1.00 2.99  ? 597 LYS A CB   3  
ATOM 5517  C CG   . LYS A 1 83  ? -10.869 -12.383 14.813  1.00 3.33  ? 597 LYS A CG   3  
ATOM 5518  C CD   . LYS A 1 83  ? -9.979  -13.546 14.341  1.00 3.43  ? 597 LYS A CD   3  
ATOM 5519  C CE   . LYS A 1 83  ? -8.502  -13.224 14.059  1.00 4.11  ? 597 LYS A CE   3  
ATOM 5520  N NZ   . LYS A 1 83  ? -7.768  -12.751 15.253  1.00 4.78  ? 597 LYS A NZ   3  
ATOM 5521  H H    . LYS A 1 83  ? -9.448  -11.646 11.805  1.00 3.14  ? 597 LYS A H    3  
ATOM 5522  H HA   . LYS A 1 83  ? -12.317 -11.765 12.471  1.00 2.94  ? 597 LYS A HA   3  
ATOM 5523  H HB2  . LYS A 1 83  ? -9.896  -10.652 13.969  1.00 3.16  ? 597 LYS A HB2  3  
ATOM 5524  H HB3  . LYS A 1 83  ? -11.534 -10.397 14.509  1.00 2.96  ? 597 LYS A HB3  3  
ATOM 5525  H HG2  . LYS A 1 83  ? -10.554 -12.110 15.820  1.00 3.72  ? 597 LYS A HG2  3  
ATOM 5526  H HG3  . LYS A 1 83  ? -11.893 -12.753 14.887  1.00 3.41  ? 597 LYS A HG3  3  
ATOM 5527  H HD2  . LYS A 1 83  ? -10.028 -14.333 15.092  1.00 3.68  ? 597 LYS A HD2  3  
ATOM 5528  H HD3  . LYS A 1 83  ? -10.411 -13.960 13.432  1.00 3.46  ? 597 LYS A HD3  3  
ATOM 5529  H HE2  . LYS A 1 83  ? -8.023  -14.135 13.689  1.00 4.77  ? 597 LYS A HE2  3  
ATOM 5530  H HE3  . LYS A 1 83  ? -8.437  -12.469 13.271  1.00 4.02  ? 597 LYS A HE3  3  
ATOM 5531  H HZ1  . LYS A 1 83  ? -7.992  -11.782 15.477  1.00 5.27  ? 597 LYS A HZ1  3  
ATOM 5532  H HZ2  . LYS A 1 83  ? -6.760  -12.798 15.097  1.00 5.55  ? 597 LYS A HZ2  3  
ATOM 5533  H HZ3  . LYS A 1 83  ? -7.970  -13.304 16.077  1.00 4.71  ? 597 LYS A HZ3  3  
ATOM 5534  N N    . GLU A 1 84  ? -12.867 -9.309  12.544  1.00 1.96  ? 598 GLU A N    3  
ATOM 5535  C CA   . GLU A 1 84  ? -13.216 -7.894  12.466  1.00 1.54  ? 598 GLU A CA   3  
ATOM 5536  C C    . GLU A 1 84  ? -12.189 -7.033  13.190  1.00 1.35  ? 598 GLU A C    3  
ATOM 5537  O O    . GLU A 1 84  ? -12.007 -7.099  14.409  1.00 1.49  ? 598 GLU A O    3  
ATOM 5538  C CB   . GLU A 1 84  ? -14.604 -7.617  13.053  1.00 1.99  ? 598 GLU A CB   3  
ATOM 5539  C CG   . GLU A 1 84  ? -15.675 -8.143  12.110  1.00 2.43  ? 598 GLU A CG   3  
ATOM 5540  C CD   . GLU A 1 84  ? -17.026 -8.272  12.814  1.00 2.82  ? 598 GLU A CD   3  
ATOM 5541  O OE1  . GLU A 1 84  ? -17.231 -9.253  13.570  1.00 4.03  ? 598 GLU A OE1  3  
ATOM 5542  O OE2  . GLU A 1 84  ? -17.879 -7.363  12.661  1.00 2.73  ? 598 GLU A OE2  3  
ATOM 5543  H H    . GLU A 1 84  ? -13.404 -9.891  13.174  1.00 2.21  ? 598 GLU A H    3  
ATOM 5544  H HA   . GLU A 1 84  ? -13.221 -7.614  11.417  1.00 1.29  ? 598 GLU A HA   3  
ATOM 5545  H HB2  . GLU A 1 84  ? -14.685 -8.099  14.027  1.00 3.24  ? 598 GLU A HB2  3  
ATOM 5546  H HB3  . GLU A 1 84  ? -14.747 -6.542  13.172  1.00 2.78  ? 598 GLU A HB3  3  
ATOM 5547  H HG2  . GLU A 1 84  ? -15.756 -7.465  11.263  1.00 3.10  ? 598 GLU A HG2  3  
ATOM 5548  H HG3  . GLU A 1 84  ? -15.337 -9.100  11.724  1.00 3.66  ? 598 GLU A HG3  3  
ATOM 5549  N N    . MET A 1 85  ? -11.530 -6.194  12.412  1.00 1.16  ? 599 MET A N    3  
ATOM 5550  C CA   . MET A 1 85  ? -10.530 -5.234  12.877  1.00 1.14  ? 599 MET A CA   3  
ATOM 5551  C C    . MET A 1 85  ? -10.919 -3.784  12.593  1.00 1.08  ? 599 MET A C    3  
ATOM 5552  O O    . MET A 1 85  ? -11.902 -3.503  11.907  1.00 1.38  ? 599 MET A O    3  
ATOM 5553  C CB   . MET A 1 85  ? -9.143  -5.631  12.366  1.00 1.33  ? 599 MET A CB   3  
ATOM 5554  C CG   . MET A 1 85  ? -8.686  -6.976  12.945  1.00 1.54  ? 599 MET A CG   3  
ATOM 5555  S SD   . MET A 1 85  ? -7.001  -7.448  12.486  1.00 2.11  ? 599 MET A SD   3  
ATOM 5556  C CE   . MET A 1 85  ? -7.050  -7.023  10.730  1.00 2.27  ? 599 MET A CE   3  
ATOM 5557  H H    . MET A 1 85  ? -11.739 -6.252  11.418  1.00 1.11  ? 599 MET A H    3  
ATOM 5558  H HA   . MET A 1 85  ? -10.448 -5.271  13.941  1.00 1.29  ? 599 MET A HA   3  
ATOM 5559  H HB2  . MET A 1 85  ? -9.176  -5.703  11.286  1.00 1.50  ? 599 MET A HB2  3  
ATOM 5560  H HB3  . MET A 1 85  ? -8.411  -4.876  12.647  1.00 1.85  ? 599 MET A HB3  3  
ATOM 5561  H HG2  . MET A 1 85  ? -8.744  -6.934  14.033  1.00 1.92  ? 599 MET A HG2  3  
ATOM 5562  H HG3  . MET A 1 85  ? -9.364  -7.756  12.598  1.00 1.76  ? 599 MET A HG3  3  
ATOM 5563  H HE1  . MET A 1 85  ? -6.988  -5.942  10.617  1.00 3.24  ? 599 MET A HE1  3  
ATOM 5564  H HE2  . MET A 1 85  ? -6.207  -7.483  10.220  1.00 3.04  ? 599 MET A HE2  3  
ATOM 5565  H HE3  . MET A 1 85  ? -8.001  -7.364  10.306  1.00 1.93  ? 599 MET A HE3  3  
ATOM 5566  N N    . LYS A 1 86  ? -10.105 -2.862  13.105  1.00 1.11  ? 600 LYS A N    3  
ATOM 5567  C CA   . LYS A 1 86  ? -9.664  -1.652  12.435  1.00 1.19  ? 600 LYS A CA   3  
ATOM 5568  C C    . LYS A 1 86  ? -8.245  -1.761  11.887  1.00 1.27  ? 600 LYS A C    3  
ATOM 5569  O O    . LYS A 1 86  ? -7.377  -2.421  12.460  1.00 1.42  ? 600 LYS A O    3  
ATOM 5570  C CB   . LYS A 1 86  ? -9.739  -0.459  13.406  1.00 1.52  ? 600 LYS A CB   3  
ATOM 5571  C CG   . LYS A 1 86  ? -11.073 0.278   13.386  1.00 1.26  ? 600 LYS A CG   3  
ATOM 5572  C CD   . LYS A 1 86  ? -12.315 -0.567  13.635  1.00 1.14  ? 600 LYS A CD   3  
ATOM 5573  C CE   . LYS A 1 86  ? -12.323 -1.262  15.002  1.00 1.65  ? 600 LYS A CE   3  
ATOM 5574  N NZ   . LYS A 1 86  ? -13.551 -2.066  15.174  1.00 2.19  ? 600 LYS A NZ   3  
ATOM 5575  H H    . LYS A 1 86  ? -9.485  -3.155  13.831  1.00 1.33  ? 600 LYS A H    3  
ATOM 5576  H HA   . LYS A 1 86  ? -10.300 -1.531  11.567  1.00 1.09  ? 600 LYS A HA   3  
ATOM 5577  H HB2  . LYS A 1 86  ? -9.513  -0.790  14.422  1.00 1.82  ? 600 LYS A HB2  3  
ATOM 5578  H HB3  . LYS A 1 86  ? -8.975  0.274   13.138  1.00 2.05  ? 600 LYS A HB3  3  
ATOM 5579  H HG2  . LYS A 1 86  ? -11.026 1.064   14.127  1.00 1.51  ? 600 LYS A HG2  3  
ATOM 5580  H HG3  . LYS A 1 86  ? -11.184 0.727   12.406  1.00 1.41  ? 600 LYS A HG3  3  
ATOM 5581  H HD2  . LYS A 1 86  ? -13.182 0.084   13.571  1.00 1.23  ? 600 LYS A HD2  3  
ATOM 5582  H HD3  . LYS A 1 86  ? -12.367 -1.284  12.820  1.00 1.07  ? 600 LYS A HD3  3  
ATOM 5583  H HE2  . LYS A 1 86  ? -11.443 -1.905  15.086  1.00 2.43  ? 600 LYS A HE2  3  
ATOM 5584  H HE3  . LYS A 1 86  ? -12.262 -0.500  15.784  1.00 1.79  ? 600 LYS A HE3  3  
ATOM 5585  H HZ1  . LYS A 1 86  ? -14.390 -1.502  15.067  1.00 2.09  ? 600 LYS A HZ1  3  
ATOM 5586  H HZ2  . LYS A 1 86  ? -13.600 -2.543  16.069  1.00 3.05  ? 600 LYS A HZ2  3  
ATOM 5587  H HZ3  . LYS A 1 86  ? -13.628 -2.778  14.448  1.00 3.06  ? 600 LYS A HZ3  3  
ATOM 5588  N N    . LEU A 1 87  ? -8.015  -1.003  10.824  1.00 1.26  ? 601 LEU A N    3  
ATOM 5589  C CA   . LEU A 1 87  ? -6.691  -0.615  10.302  1.00 1.36  ? 601 LEU A CA   3  
ATOM 5590  C C    . LEU A 1 87  ? -6.526  0.914   10.404  1.00 1.29  ? 601 LEU A C    3  
ATOM 5591  O O    . LEU A 1 87  ? -7.503  1.652   10.291  1.00 1.20  ? 601 LEU A O    3  
ATOM 5592  C CB   . LEU A 1 87  ? -6.497  -1.138  8.861   1.00 1.37  ? 601 LEU A CB   3  
ATOM 5593  C CG   . LEU A 1 87  ? -5.543  -2.334  8.704   1.00 1.46  ? 601 LEU A CG   3  
ATOM 5594  C CD1  . LEU A 1 87  ? -6.071  -3.585  9.392   1.00 1.41  ? 601 LEU A CD1  3  
ATOM 5595  C CD2  . LEU A 1 87  ? -5.389  -2.664  7.216   1.00 1.51  ? 601 LEU A CD2  3  
ATOM 5596  H H    . LEU A 1 87  ? -8.831  -0.479  10.510  1.00 1.15  ? 601 LEU A H    3  
ATOM 5597  H HA   . LEU A 1 87  ? -5.913  -1.052  10.933  1.00 1.49  ? 601 LEU A HA   3  
ATOM 5598  H HB2  . LEU A 1 87  ? -7.458  -1.427  8.446   1.00 1.31  ? 601 LEU A HB2  3  
ATOM 5599  H HB3  . LEU A 1 87  ? -6.104  -0.323  8.252   1.00 1.52  ? 601 LEU A HB3  3  
ATOM 5600  H HG   . LEU A 1 87  ? -4.572  -2.088  9.128   1.00 1.65  ? 601 LEU A HG   3  
ATOM 5601  H HD11 . LEU A 1 87  ? -7.055  -3.813  9.001   1.00 2.16  ? 601 LEU A HD11 3  
ATOM 5602  H HD12 . LEU A 1 87  ? -6.125  -3.423  10.465  1.00 1.40  ? 601 LEU A HD12 3  
ATOM 5603  H HD13 . LEU A 1 87  ? -5.402  -4.421  9.198   1.00 2.29  ? 601 LEU A HD13 3  
ATOM 5604  H HD21 . LEU A 1 87  ? -5.058  -1.785  6.663   1.00 2.08  ? 601 LEU A HD21 3  
ATOM 5605  H HD22 . LEU A 1 87  ? -6.337  -3.006  6.801   1.00 2.16  ? 601 LEU A HD22 3  
ATOM 5606  H HD23 . LEU A 1 87  ? -4.640  -3.447  7.089   1.00 2.06  ? 601 LEU A HD23 3  
ATOM 5607  N N    . SER A 1 88  ? -5.297  1.383   10.615  1.00 1.35  ? 602 SER A N    3  
ATOM 5608  C CA   . SER A 1 88  ? -4.964  2.753   11.049  1.00 1.25  ? 602 SER A CA   3  
ATOM 5609  C C    . SER A 1 88  ? -3.990  3.466   10.104  1.00 1.23  ? 602 SER A C    3  
ATOM 5610  O O    . SER A 1 88  ? -3.496  2.883   9.144   1.00 1.39  ? 602 SER A O    3  
ATOM 5611  C CB   . SER A 1 88  ? -4.382  2.683   12.470  1.00 1.67  ? 602 SER A CB   3  
ATOM 5612  O OG   . SER A 1 88  ? -3.257  1.823   12.559  1.00 2.47  ? 602 SER A OG   3  
ATOM 5613  H H    . SER A 1 88  ? -4.528  0.727   10.592  1.00 1.50  ? 602 SER A H    3  
ATOM 5614  H HA   . SER A 1 88  ? -5.868  3.364   11.086  1.00 1.07  ? 602 SER A HA   3  
ATOM 5615  H HB2  . SER A 1 88  ? -4.075  3.674   12.794  1.00 1.96  ? 602 SER A HB2  3  
ATOM 5616  H HB3  . SER A 1 88  ? -5.159  2.334   13.147  1.00 1.59  ? 602 SER A HB3  3  
ATOM 5617  H HG   . SER A 1 88  ? -2.962  1.840   13.493  1.00 2.69  ? 602 SER A HG   3  
ATOM 5618  N N    . ASP A 1 89  ? -3.667  4.732   10.356  1.00 1.18  ? 603 ASP A N    3  
ATOM 5619  C CA   . ASP A 1 89  ? -2.707  5.467   9.522   1.00 1.22  ? 603 ASP A CA   3  
ATOM 5620  C C    . ASP A 1 89  ? -1.329  4.766   9.459   1.00 1.39  ? 603 ASP A C    3  
ATOM 5621  O O    . ASP A 1 89  ? -0.749  4.389   10.480  1.00 1.54  ? 603 ASP A O    3  
ATOM 5622  C CB   . ASP A 1 89  ? -2.645  6.941   9.940   1.00 1.28  ? 603 ASP A CB   3  
ATOM 5623  C CG   . ASP A 1 89  ? -1.854  7.229   11.217  1.00 1.56  ? 603 ASP A CG   3  
ATOM 5624  O OD1  . ASP A 1 89  ? -2.253  6.792   12.322  1.00 1.67  ? 603 ASP A OD1  3  
ATOM 5625  O OD2  . ASP A 1 89  ? -0.863  7.992   11.124  1.00 3.11  ? 603 ASP A OD2  3  
ATOM 5626  H H    . ASP A 1 89  ? -4.126  5.200   11.128  1.00 1.18  ? 603 ASP A H    3  
ATOM 5627  H HA   . ASP A 1 89  ? -3.107  5.459   8.510   1.00 1.15  ? 603 ASP A HA   3  
ATOM 5628  H HB2  . ASP A 1 89  ? -2.184  7.491   9.120   1.00 1.36  ? 603 ASP A HB2  3  
ATOM 5629  H HB3  . ASP A 1 89  ? -3.660  7.324   10.058  1.00 1.18  ? 603 ASP A HB3  3  
ATOM 5630  N N    . GLY A 1 90  ? -0.819  4.523   8.249   1.00 1.44  ? 604 GLY A N    3  
ATOM 5631  C CA   . GLY A 1 90  ? 0.334   3.648   7.977   1.00 1.62  ? 604 GLY A CA   3  
ATOM 5632  C C    . GLY A 1 90  ? 0.010   2.164   7.760   1.00 1.50  ? 604 GLY A C    3  
ATOM 5633  O O    . GLY A 1 90  ? 0.926   1.356   7.600   1.00 1.60  ? 604 GLY A O    3  
ATOM 5634  H H    . GLY A 1 90  ? -1.294  4.923   7.444   1.00 1.39  ? 604 GLY A H    3  
ATOM 5635  H HA2  . GLY A 1 90  ? 0.825   4.001   7.072   1.00 1.78  ? 604 GLY A HA2  3  
ATOM 5636  H HA3  . GLY A 1 90  ? 1.044   3.716   8.800   1.00 1.76  ? 604 GLY A HA3  3  
ATOM 5637  N N    . SER A 1 91  ? -1.265  1.782   7.761   1.00 1.36  ? 605 SER A N    3  
ATOM 5638  C CA   . SER A 1 91  ? -1.742  0.448   7.367   1.00 1.31  ? 605 SER A CA   3  
ATOM 5639  C C    . SER A 1 91  ? -2.020  0.360   5.863   1.00 1.33  ? 605 SER A C    3  
ATOM 5640  O O    . SER A 1 91  ? -2.094  1.386   5.182   1.00 1.30  ? 605 SER A O    3  
ATOM 5641  C CB   . SER A 1 91  ? -3.028  0.122   8.111   1.00 1.14  ? 605 SER A CB   3  
ATOM 5642  O OG   . SER A 1 91  ? -2.806  0.028   9.507   1.00 1.18  ? 605 SER A OG   3  
ATOM 5643  H H    . SER A 1 91  ? -1.970  2.472   7.996   1.00 1.33  ? 605 SER A H    3  
ATOM 5644  H HA   . SER A 1 91  ? -0.996  -0.304  7.623   1.00 1.41  ? 605 SER A HA   3  
ATOM 5645  H HB2  . SER A 1 91  ? -3.761  0.898   7.881   1.00 1.00  ? 605 SER A HB2  3  
ATOM 5646  H HB3  . SER A 1 91  ? -3.405  -0.832  7.754   1.00 1.21  ? 605 SER A HB3  3  
ATOM 5647  H HG   . SER A 1 91  ? -2.272  0.803   9.772   1.00 1.36  ? 605 SER A HG   3  
ATOM 5648  N N    . TYR A 1 92  ? -2.204  -0.853  5.336   1.00 1.41  ? 606 TYR A N    3  
ATOM 5649  C CA   . TYR A 1 92  ? -2.332  -1.091  3.897   1.00 1.48  ? 606 TYR A CA   3  
ATOM 5650  C C    . TYR A 1 92  ? -3.293  -2.225  3.503   1.00 1.53  ? 606 TYR A C    3  
ATOM 5651  O O    . TYR A 1 92  ? -3.490  -3.202  4.226   1.00 1.64  ? 606 TYR A O    3  
ATOM 5652  C CB   . TYR A 1 92  ? -0.938  -1.320  3.301   1.00 1.68  ? 606 TYR A CB   3  
ATOM 5653  C CG   . TYR A 1 92  ? -0.186  -2.528  3.824   1.00 1.83  ? 606 TYR A CG   3  
ATOM 5654  C CD1  . TYR A 1 92  ? 0.486   -2.460  5.057   1.00 1.76  ? 606 TYR A CD1  3  
ATOM 5655  C CD2  . TYR A 1 92  ? -0.137  -3.709  3.062   1.00 3.42  ? 606 TYR A CD2  3  
ATOM 5656  C CE1  . TYR A 1 92  ? 1.159   -3.591  5.557   1.00 2.36  ? 606 TYR A CE1  3  
ATOM 5657  C CE2  . TYR A 1 92  ? 0.557   -4.831  3.545   1.00 3.93  ? 606 TYR A CE2  3  
ATOM 5658  C CZ   . TYR A 1 92  ? 1.184   -4.783  4.807   1.00 3.09  ? 606 TYR A CZ   3  
ATOM 5659  O OH   . TYR A 1 92  ? 1.797   -5.888  5.300   1.00 3.90  ? 606 TYR A OH   3  
ATOM 5660  H H    . TYR A 1 92  ? -2.124  -1.668  5.944   1.00 1.43  ? 606 TYR A H    3  
ATOM 5661  H HA   . TYR A 1 92  ? -2.732  -0.188  3.437   1.00 1.43  ? 606 TYR A HA   3  
ATOM 5662  H HB2  . TYR A 1 92  ? -1.059  -1.416  2.224   1.00 2.25  ? 606 TYR A HB2  3  
ATOM 5663  H HB3  . TYR A 1 92  ? -0.324  -0.439  3.487   1.00 1.68  ? 606 TYR A HB3  3  
ATOM 5664  H HD1  . TYR A 1 92  ? 0.470   -1.541  5.631   1.00 2.51  ? 606 TYR A HD1  3  
ATOM 5665  H HD2  . TYR A 1 92  ? -0.622  -3.751  2.099   1.00 4.53  ? 606 TYR A HD2  3  
ATOM 5666  H HE1  . TYR A 1 92  ? 1.658   -3.544  6.512   1.00 3.12  ? 606 TYR A HE1  3  
ATOM 5667  H HE2  . TYR A 1 92  ? 0.606   -5.730  2.950   1.00 5.29  ? 606 TYR A HE2  3  
ATOM 5668  H HH   . TYR A 1 92  ? 2.006   -5.786  6.248   1.00 4.23  ? 606 TYR A HH   3  
ATOM 5669  N N    . PHE A 1 93  ? -3.869  -2.072  2.312   1.00 1.51  ? 607 PHE A N    3  
ATOM 5670  C CA   . PHE A 1 93  ? -4.771  -2.991  1.612   1.00 1.63  ? 607 PHE A CA   3  
ATOM 5671  C C    . PHE A 1 93  ? -4.598  -2.853  0.081   1.00 1.97  ? 607 PHE A C    3  
ATOM 5672  O O    . PHE A 1 93  ? -3.624  -2.267  -0.404  1.00 2.00  ? 607 PHE A O    3  
ATOM 5673  C CB   . PHE A 1 93  ? -6.215  -2.795  2.109   1.00 1.67  ? 607 PHE A CB   3  
ATOM 5674  C CG   . PHE A 1 93  ? -6.679  -1.359  2.226   1.00 1.50  ? 607 PHE A CG   3  
ATOM 5675  C CD1  . PHE A 1 93  ? -7.100  -0.644  1.089   1.00 2.86  ? 607 PHE A CD1  3  
ATOM 5676  C CD2  . PHE A 1 93  ? -6.712  -0.749  3.494   1.00 1.60  ? 607 PHE A CD2  3  
ATOM 5677  C CE1  . PHE A 1 93  ? -7.554  0.680   1.221   1.00 3.13  ? 607 PHE A CE1  3  
ATOM 5678  C CE2  . PHE A 1 93  ? -7.168  0.571   3.621   1.00 1.52  ? 607 PHE A CE2  3  
ATOM 5679  C CZ   . PHE A 1 93  ? -7.570  1.284   2.488   1.00 1.89  ? 607 PHE A CZ   3  
ATOM 5680  H H    . PHE A 1 93  ? -3.674  -1.203  1.821   1.00 1.42  ? 607 PHE A H    3  
ATOM 5681  H HA   . PHE A 1 93  ? -4.487  -4.012  1.859   1.00 1.92  ? 607 PHE A HA   3  
ATOM 5682  H HB2  . PHE A 1 93  ? -6.911  -3.344  1.475   1.00 2.43  ? 607 PHE A HB2  3  
ATOM 5683  H HB3  . PHE A 1 93  ? -6.283  -3.255  3.096   1.00 1.88  ? 607 PHE A HB3  3  
ATOM 5684  H HD1  . PHE A 1 93  ? -7.097  -1.117  0.118   1.00 4.03  ? 607 PHE A HD1  3  
ATOM 5685  H HD2  . PHE A 1 93  ? -6.401  -1.300  4.371   1.00 2.75  ? 607 PHE A HD2  3  
ATOM 5686  H HE1  . PHE A 1 93  ? -7.925  1.223   0.361   1.00 4.48  ? 607 PHE A HE1  3  
ATOM 5687  H HE2  . PHE A 1 93  ? -7.241  1.037   4.586   1.00 2.42  ? 607 PHE A HE2  3  
ATOM 5688  H HZ   . PHE A 1 93  ? -7.957  2.280   2.613   1.00 2.18  ? 607 PHE A HZ   3  
ATOM 5689  N N    . GLY A 1 94  ? -5.454  -3.510  -0.704  1.00 2.38  ? 608 GLY A N    3  
ATOM 5690  C CA   . GLY A 1 94  ? -5.305  -3.646  -2.154  1.00 2.75  ? 608 GLY A CA   3  
ATOM 5691  C C    . GLY A 1 94  ? -4.935  -5.081  -2.491  1.00 3.00  ? 608 GLY A C    3  
ATOM 5692  O O    . GLY A 1 94  ? -5.814  -5.938  -2.576  1.00 4.02  ? 608 GLY A O    3  
ATOM 5693  H H    . GLY A 1 94  ? -6.221  -4.011  -0.273  1.00 2.47  ? 608 GLY A H    3  
ATOM 5694  H HA2  . GLY A 1 94  ? -6.246  -3.396  -2.636  1.00 3.27  ? 608 GLY A HA2  3  
ATOM 5695  H HA3  . GLY A 1 94  ? -4.530  -2.983  -2.537  1.00 2.57  ? 608 GLY A HA3  3  
ATOM 5696  N N    . GLU A 1 95  ? -3.639  -5.330  -2.632  1.00 2.90  ? 609 GLU A N    3  
ATOM 5697  C CA   . GLU A 1 95  ? -3.029  -6.661  -2.661  1.00 3.00  ? 609 GLU A CA   3  
ATOM 5698  C C    . GLU A 1 95  ? -1.582  -6.582  -2.150  1.00 2.39  ? 609 GLU A C    3  
ATOM 5699  O O    . GLU A 1 95  ? -0.962  -5.513  -2.208  1.00 3.56  ? 609 GLU A O    3  
ATOM 5700  C CB   . GLU A 1 95  ? -3.053  -7.211  -4.104  1.00 4.28  ? 609 GLU A CB   3  
ATOM 5701  C CG   . GLU A 1 95  ? -3.832  -8.522  -4.258  1.00 4.90  ? 609 GLU A CG   3  
ATOM 5702  C CD   . GLU A 1 95  ? -3.135  -9.709  -3.581  1.00 5.04  ? 609 GLU A CD   3  
ATOM 5703  O OE1  . GLU A 1 95  ? -2.993  -9.708  -2.339  1.00 5.09  ? 609 GLU A OE1  3  
ATOM 5704  O OE2  . GLU A 1 95  ? -2.749  -10.682 -4.273  1.00 5.77  ? 609 GLU A OE2  3  
ATOM 5705  H H    . GLU A 1 95  ? -2.995  -4.550  -2.598  1.00 3.39  ? 609 GLU A H    3  
ATOM 5706  H HA   . GLU A 1 95  ? -3.586  -7.320  -1.996  1.00 3.34  ? 609 GLU A HA   3  
ATOM 5707  H HB2  . GLU A 1 95  ? -3.515  -6.471  -4.754  1.00 5.14  ? 609 GLU A HB2  3  
ATOM 5708  H HB3  . GLU A 1 95  ? -2.037  -7.353  -4.472  1.00 4.60  ? 609 GLU A HB3  3  
ATOM 5709  H HG2  . GLU A 1 95  ? -4.831  -8.391  -3.844  1.00 4.98  ? 609 GLU A HG2  3  
ATOM 5710  H HG3  . GLU A 1 95  ? -3.948  -8.731  -5.324  1.00 5.99  ? 609 GLU A HG3  3  
ATOM 5711  N N    . ILE A 1 96  ? -1.003  -7.705  -1.715  1.00 1.89  ? 610 ILE A N    3  
ATOM 5712  C CA   . ILE A 1 96  ? 0.459   -7.842  -1.756  1.00 2.10  ? 610 ILE A CA   3  
ATOM 5713  C C    . ILE A 1 96  ? 0.821   -7.973  -3.240  1.00 1.85  ? 610 ILE A C    3  
ATOM 5714  O O    . ILE A 1 96  ? 0.188   -8.734  -3.983  1.00 2.93  ? 610 ILE A O    3  
ATOM 5715  C CB   . ILE A 1 96  ? 0.999   -8.991  -0.867  1.00 3.12  ? 610 ILE A CB   3  
ATOM 5716  C CG1  . ILE A 1 96  ? 0.986   -8.642  0.642   1.00 4.32  ? 610 ILE A CG1  3  
ATOM 5717  C CG2  . ILE A 1 96  ? 2.460   -9.349  -1.229  1.00 3.60  ? 610 ILE A CG2  3  
ATOM 5718  C CD1  . ILE A 1 96  ? -0.384  -8.307  1.243   1.00 5.33  ? 610 ILE A CD1  3  
ATOM 5719  H H    . ILE A 1 96  ? -1.564  -8.554  -1.694  1.00 2.57  ? 610 ILE A H    3  
ATOM 5720  H HA   . ILE A 1 96  ? 0.907   -6.919  -1.387  1.00 2.76  ? 610 ILE A HA   3  
ATOM 5721  H HB   . ILE A 1 96  ? 0.387   -9.876  -1.021  1.00 3.30  ? 610 ILE A HB   3  
ATOM 5722  H HG12 . ILE A 1 96  ? 1.374   -9.501  1.193   1.00 4.94  ? 610 ILE A HG12 3  
ATOM 5723  H HG13 . ILE A 1 96  ? 1.656   -7.802  0.825   1.00 4.65  ? 610 ILE A HG13 3  
ATOM 5724  H HG21 . ILE A 1 96  ? 3.079   -8.452  -1.266  1.00 4.14  ? 610 ILE A HG21 3  
ATOM 5725  H HG22 . ILE A 1 96  ? 2.875   -10.025 -0.484  1.00 4.20  ? 610 ILE A HG22 3  
ATOM 5726  H HG23 . ILE A 1 96  ? 2.519   -9.869  -2.189  1.00 3.66  ? 610 ILE A HG23 3  
ATOM 5727  H HD11 . ILE A 1 96  ? -0.307  -8.284  2.330   1.00 6.21  ? 610 ILE A HD11 3  
ATOM 5728  H HD12 . ILE A 1 96  ? -0.715  -7.326  0.904   1.00 5.84  ? 610 ILE A HD12 3  
ATOM 5729  H HD13 . ILE A 1 96  ? -1.112  -9.063  0.954   1.00 5.44  ? 610 ILE A HD13 3  
ATOM 5730  N N    . CYS A 1 97  ? 1.783   -7.169  -3.679  1.00 1.95  ? 611 CYS A N    3  
ATOM 5731  C CA   . CYS A 1 97  ? 2.096   -6.934  -5.086  1.00 2.26  ? 611 CYS A CA   3  
ATOM 5732  C C    . CYS A 1 97  ? 3.595   -6.620  -5.274  1.00 1.82  ? 611 CYS A C    3  
ATOM 5733  O O    . CYS A 1 97  ? 4.416   -6.903  -4.400  1.00 2.87  ? 611 CYS A O    3  
ATOM 5734  C CB   . CYS A 1 97  ? 1.154   -5.820  -5.585  1.00 3.91  ? 611 CYS A CB   3  
ATOM 5735  S SG   . CYS A 1 97  ? 1.244   -4.319  -4.567  1.00 5.47  ? 611 CYS A SG   3  
ATOM 5736  H H    . CYS A 1 97  ? 2.292   -6.617  -3.007  1.00 2.79  ? 611 CYS A H    3  
ATOM 5737  H HA   . CYS A 1 97  ? 1.884   -7.831  -5.664  1.00 2.69  ? 611 CYS A HA   3  
ATOM 5738  H HB2  . CYS A 1 97  ? 1.401   -5.562  -6.611  1.00 4.85  ? 611 CYS A HB2  3  
ATOM 5739  H HB3  . CYS A 1 97  ? 0.127   -6.191  -5.574  1.00 4.26  ? 611 CYS A HB3  3  
ATOM 5740  H HG   . CYS A 1 97  ? 0.502   -4.773  -3.539  1.00 6.11  ? 611 CYS A HG   3  
ATOM 5741  N N    . LEU A 1 98  ? 3.962   -6.024  -6.414  1.00 1.86  ? 612 LEU A N    3  
ATOM 5742  C CA   . LEU A 1 98  ? 5.304   -5.563  -6.804  1.00 1.60  ? 612 LEU A CA   3  
ATOM 5743  C C    . LEU A 1 98  ? 6.285   -6.698  -7.133  1.00 1.68  ? 612 LEU A C    3  
ATOM 5744  O O    . LEU A 1 98  ? 6.794   -6.750  -8.255  1.00 1.87  ? 612 LEU A O    3  
ATOM 5745  C CB   . LEU A 1 98  ? 5.820   -4.553  -5.752  1.00 1.68  ? 612 LEU A CB   3  
ATOM 5746  C CG   . LEU A 1 98  ? 6.874   -3.525  -6.187  1.00 2.03  ? 612 LEU A CG   3  
ATOM 5747  C CD1  . LEU A 1 98  ? 8.243   -4.076  -6.545  1.00 3.21  ? 612 LEU A CD1  3  
ATOM 5748  C CD2  . LEU A 1 98  ? 6.392   -2.677  -7.353  1.00 1.63  ? 612 LEU A CD2  3  
ATOM 5749  H H    . LEU A 1 98  ? 3.245   -5.923  -7.119  1.00 2.97  ? 612 LEU A H    3  
ATOM 5750  H HA   . LEU A 1 98  ? 5.155   -5.026  -7.738  1.00 1.79  ? 612 LEU A HA   3  
ATOM 5751  H HB2  . LEU A 1 98  ? 4.967   -3.978  -5.388  1.00 2.66  ? 612 LEU A HB2  3  
ATOM 5752  H HB3  . LEU A 1 98  ? 6.217   -5.097  -4.895  1.00 2.02  ? 612 LEU A HB3  3  
ATOM 5753  H HG   . LEU A 1 98  ? 7.017   -2.868  -5.339  1.00 2.82  ? 612 LEU A HG   3  
ATOM 5754  H HD11 . LEU A 1 98  ? 8.556   -4.793  -5.790  1.00 3.35  ? 612 LEU A HD11 3  
ATOM 5755  H HD12 . LEU A 1 98  ? 8.949   -3.243  -6.546  1.00 3.93  ? 612 LEU A HD12 3  
ATOM 5756  H HD13 . LEU A 1 98  ? 8.224   -4.547  -7.526  1.00 4.15  ? 612 LEU A HD13 3  
ATOM 5757  H HD21 . LEU A 1 98  ? 7.130   -1.912  -7.567  1.00 2.49  ? 612 LEU A HD21 3  
ATOM 5758  H HD22 . LEU A 1 98  ? 5.451   -2.218  -7.063  1.00 1.56  ? 612 LEU A HD22 3  
ATOM 5759  H HD23 . LEU A 1 98  ? 6.254   -3.277  -8.251  1.00 2.42  ? 612 LEU A HD23 3  
ATOM 5760  N N    . LEU A 1 99  ? 6.480   -7.640  -6.209  1.00 1.81  ? 613 LEU A N    3  
ATOM 5761  C CA   . LEU A 1 99  ? 7.135   -8.938  -6.444  1.00 2.06  ? 613 LEU A CA   3  
ATOM 5762  C C    . LEU A 1 99  ? 6.136   -10.094 -6.664  1.00 1.92  ? 613 LEU A C    3  
ATOM 5763  O O    . LEU A 1 99  ? 6.525   -11.219 -6.990  1.00 2.20  ? 613 LEU A O    3  
ATOM 5764  C CB   . LEU A 1 99  ? 8.202   -9.206  -5.364  1.00 2.49  ? 613 LEU A CB   3  
ATOM 5765  C CG   . LEU A 1 99  ? 7.857   -8.898  -3.893  1.00 2.90  ? 613 LEU A CG   3  
ATOM 5766  C CD1  . LEU A 1 99  ? 6.641   -9.666  -3.388  1.00 2.88  ? 613 LEU A CD1  3  
ATOM 5767  C CD2  . LEU A 1 99  ? 9.049   -9.268  -3.007  1.00 3.83  ? 613 LEU A CD2  3  
ATOM 5768  H H    . LEU A 1 99  ? 6.011   -7.499  -5.318  1.00 1.85  ? 613 LEU A H    3  
ATOM 5769  H HA   . LEU A 1 99  ? 7.682   -8.877  -7.385  1.00 2.28  ? 613 LEU A HA   3  
ATOM 5770  H HB2  . LEU A 1 99  ? 8.516   -10.246 -5.444  1.00 2.68  ? 613 LEU A HB2  3  
ATOM 5771  H HB3  . LEU A 1 99  ? 9.061   -8.591  -5.626  1.00 3.00  ? 613 LEU A HB3  3  
ATOM 5772  H HG   . LEU A 1 99  ? 7.669   -7.830  -3.781  1.00 3.34  ? 613 LEU A HG   3  
ATOM 5773  H HD11 . LEU A 1 99  ? 6.481   -9.450  -2.331  1.00 3.53  ? 613 LEU A HD11 3  
ATOM 5774  H HD12 . LEU A 1 99  ? 6.803   -10.735 -3.517  1.00 3.27  ? 613 LEU A HD12 3  
ATOM 5775  H HD13 . LEU A 1 99  ? 5.751   -9.352  -3.932  1.00 3.21  ? 613 LEU A HD13 3  
ATOM 5776  H HD21 . LEU A 1 99  ? 8.835   -9.007  -1.970  1.00 4.68  ? 613 LEU A HD21 3  
ATOM 5777  H HD22 . LEU A 1 99  ? 9.934   -8.718  -3.328  1.00 4.31  ? 613 LEU A HD22 3  
ATOM 5778  H HD23 . LEU A 1 99  ? 9.247   -10.337 -3.073  1.00 3.97  ? 613 LEU A HD23 3  
ATOM 5779  N N    . THR A 1 100 ? 4.838   -9.816  -6.538  1.00 1.68  ? 614 THR A N    3  
ATOM 5780  C CA   . THR A 1 100 ? 3.725   -10.763 -6.728  1.00 1.67  ? 614 THR A CA   3  
ATOM 5781  C C    . THR A 1 100 ? 2.605   -10.211 -7.615  1.00 1.88  ? 614 THR A C    3  
ATOM 5782  O O    . THR A 1 100 ? 2.472   -8.993  -7.774  1.00 2.24  ? 614 THR A O    3  
ATOM 5783  C CB   . THR A 1 100 ? 3.093   -11.152 -5.382  1.00 1.88  ? 614 THR A CB   3  
ATOM 5784  O OG1  . THR A 1 100 ? 2.763   -9.994  -4.682  1.00 3.34  ? 614 THR A OG1  3  
ATOM 5785  C CG2  . THR A 1 100 ? 3.964   -11.975 -4.447  1.00 2.91  ? 614 THR A CG2  3  
ATOM 5786  H H    . THR A 1 100 ? 4.595   -8.892  -6.218  1.00 1.64  ? 614 THR A H    3  
ATOM 5787  H HA   . THR A 1 100 ? 4.107   -11.654 -7.207  1.00 1.73  ? 614 THR A HA   3  
ATOM 5788  H HB   . THR A 1 100 ? 2.169   -11.704 -5.541  1.00 2.30  ? 614 THR A HB   3  
ATOM 5789  H HG1  . THR A 1 100 ? 2.098   -10.278 -4.035  1.00 3.55  ? 614 THR A HG1  3  
ATOM 5790  H HG21 . THR A 1 100 ? 4.995   -11.640 -4.497  1.00 3.76  ? 614 THR A HG21 3  
ATOM 5791  H HG22 . THR A 1 100 ? 3.916   -13.024 -4.734  1.00 3.63  ? 614 THR A HG22 3  
ATOM 5792  H HG23 . THR A 1 100 ? 3.597   -11.856 -3.422  1.00 3.40  ? 614 THR A HG23 3  
ATOM 5793  N N    . ARG A 1 101 ? 1.764   -11.118 -8.141  1.00 1.96  ? 615 ARG A N    3  
ATOM 5794  C CA   . ARG A 1 101 ? 0.415   -10.860 -8.687  1.00 2.32  ? 615 ARG A CA   3  
ATOM 5795  C C    . ARG A 1 101 ? -0.545  -12.026 -8.382  1.00 1.88  ? 615 ARG A C    3  
ATOM 5796  O O    . ARG A 1 101 ? -0.120  -13.181 -8.280  1.00 2.05  ? 615 ARG A O    3  
ATOM 5797  C CB   . ARG A 1 101 ? 0.468   -10.573 -10.202 1.00 3.34  ? 615 ARG A CB   3  
ATOM 5798  C CG   . ARG A 1 101 ? 1.124   -9.218  -10.515 1.00 4.90  ? 615 ARG A CG   3  
ATOM 5799  C CD   . ARG A 1 101 ? 0.866   -8.703  -11.935 1.00 6.17  ? 615 ARG A CD   3  
ATOM 5800  N NE   . ARG A 1 101 ? 1.580   -9.486  -12.958 1.00 6.14  ? 615 ARG A NE   3  
ATOM 5801  C CZ   . ARG A 1 101 ? 2.097   -9.059  -14.094 1.00 7.08  ? 615 ARG A CZ   3  
ATOM 5802  N NH1  . ARG A 1 101 ? 2.235   -7.797  -14.380 1.00 8.05  ? 615 ARG A NH1  3  
ATOM 5803  N NH2  . ARG A 1 101 ? 2.483   -9.926  -14.981 1.00 7.44  ? 615 ARG A NH2  3  
ATOM 5804  H H    . ARG A 1 101 ? 2.016   -12.092 -8.012  1.00 1.96  ? 615 ARG A H    3  
ATOM 5805  H HA   . ARG A 1 101 ? 0.008   -9.979  -8.191  1.00 2.73  ? 615 ARG A HA   3  
ATOM 5806  H HB2  . ARG A 1 101 ? 1.008   -11.372 -10.710 1.00 3.31  ? 615 ARG A HB2  3  
ATOM 5807  H HB3  . ARG A 1 101 ? -0.553  -10.551 -10.583 1.00 3.90  ? 615 ARG A HB3  3  
ATOM 5808  H HG2  . ARG A 1 101 ? 0.719   -8.476  -9.828  1.00 5.72  ? 615 ARG A HG2  3  
ATOM 5809  H HG3  . ARG A 1 101 ? 2.201   -9.287  -10.359 1.00 5.04  ? 615 ARG A HG3  3  
ATOM 5810  H HD2  . ARG A 1 101 ? -0.205  -8.735  -12.140 1.00 6.75  ? 615 ARG A HD2  3  
ATOM 5811  H HD3  . ARG A 1 101 ? 1.183   -7.665  -11.966 1.00 7.18  ? 615 ARG A HD3  3  
ATOM 5812  H HE   . ARG A 1 101 ? 1.609   -10.490 -12.825 1.00 5.73  ? 615 ARG A HE   3  
ATOM 5813  H HH11 . ARG A 1 101 ? 2.002   -7.109  -13.676 1.00 8.22  ? 615 ARG A HH11 3  
ATOM 5814  H HH12 . ARG A 1 101 ? 2.733   -7.496  -15.210 1.00 8.85  ? 615 ARG A HH12 3  
ATOM 5815  H HH21 . ARG A 1 101 ? 2.339   -10.914 -14.813 1.00 7.15  ? 615 ARG A HH21 3  
ATOM 5816  H HH22 . ARG A 1 101 ? 2.811   -9.613  -15.884 1.00 8.29  ? 615 ARG A HH22 3  
ATOM 5817  N N    . GLY A 1 102 ? -1.845  -11.748 -8.272  1.00 2.05  ? 616 GLY A N    3  
ATOM 5818  C CA   . GLY A 1 102 ? -2.885  -12.736 -7.941  1.00 2.10  ? 616 GLY A CA   3  
ATOM 5819  C C    . GLY A 1 102 ? -4.258  -12.114 -7.651  1.00 1.72  ? 616 GLY A C    3  
ATOM 5820  O O    . GLY A 1 102 ? -4.407  -10.888 -7.662  1.00 1.99  ? 616 GLY A O    3  
ATOM 5821  H H    . GLY A 1 102 ? -2.130  -10.782 -8.346  1.00 2.63  ? 616 GLY A H    3  
ATOM 5822  H HA2  . GLY A 1 102 ? -2.996  -13.435 -8.772  1.00 2.38  ? 616 GLY A HA2  3  
ATOM 5823  H HA3  . GLY A 1 102 ? -2.579  -13.303 -7.061  1.00 2.71  ? 616 GLY A HA3  3  
ATOM 5824  N N    . ARG A 1 103 ? -5.268  -12.961 -7.414  1.00 1.89  ? 617 ARG A N    3  
ATOM 5825  C CA   . ARG A 1 103 ? -6.602  -12.575 -6.912  1.00 1.83  ? 617 ARG A CA   3  
ATOM 5826  C C    . ARG A 1 103 ? -6.630  -12.552 -5.388  1.00 1.86  ? 617 ARG A C    3  
ATOM 5827  O O    . ARG A 1 103 ? -5.846  -13.247 -4.733  1.00 2.10  ? 617 ARG A O    3  
ATOM 5828  C CB   . ARG A 1 103 ? -7.668  -13.562 -7.426  1.00 2.19  ? 617 ARG A CB   3  
ATOM 5829  C CG   . ARG A 1 103 ? -8.017  -13.405 -8.912  1.00 1.84  ? 617 ARG A CG   3  
ATOM 5830  C CD   . ARG A 1 103 ? -8.510  -11.993 -9.278  1.00 1.75  ? 617 ARG A CD   3  
ATOM 5831  N NE   . ARG A 1 103 ? -9.582  -11.524 -8.387  1.00 3.10  ? 617 ARG A NE   3  
ATOM 5832  C CZ   . ARG A 1 103 ? -10.804 -11.999 -8.272  1.00 3.80  ? 617 ARG A CZ   3  
ATOM 5833  N NH1  . ARG A 1 103 ? -11.358 -12.867 -9.063  1.00 3.67  ? 617 ARG A NH1  3  
ATOM 5834  N NH2  . ARG A 1 103 ? -11.520 -11.578 -7.291  1.00 5.37  ? 617 ARG A NH2  3  
ATOM 5835  H H    . ARG A 1 103 ? -5.057  -13.956 -7.421  1.00 2.56  ? 617 ARG A H    3  
ATOM 5836  H HA   . ARG A 1 103 ? -6.852  -11.558 -7.234  1.00 1.84  ? 617 ARG A HA   3  
ATOM 5837  H HB2  . ARG A 1 103 ? -7.332  -14.584 -7.252  1.00 2.79  ? 617 ARG A HB2  3  
ATOM 5838  H HB3  . ARG A 1 103 ? -8.583  -13.438 -6.846  1.00 2.75  ? 617 ARG A HB3  3  
ATOM 5839  H HG2  . ARG A 1 103 ? -7.144  -13.645 -9.514  1.00 2.19  ? 617 ARG A HG2  3  
ATOM 5840  H HG3  . ARG A 1 103 ? -8.794  -14.131 -9.154  1.00 2.34  ? 617 ARG A HG3  3  
ATOM 5841  H HD2  . ARG A 1 103 ? -7.673  -11.302 -9.197  1.00 2.28  ? 617 ARG A HD2  3  
ATOM 5842  H HD3  . ARG A 1 103 ? -8.847  -11.975 -10.314 1.00 1.86  ? 617 ARG A HD3  3  
ATOM 5843  H HE   . ARG A 1 103 ? -9.354  -10.796 -7.709  1.00 4.13  ? 617 ARG A HE   3  
ATOM 5844  H HH11 . ARG A 1 103 ? -10.850 -13.236 -9.864  1.00 3.33  ? 617 ARG A HH11 3  
ATOM 5845  H HH12 . ARG A 1 103 ? -12.320 -13.122 -8.889  1.00 4.52  ? 617 ARG A HH12 3  
ATOM 5846  H HH21 . ARG A 1 103 ? -11.086 -10.942 -6.628  1.00 6.20  ? 617 ARG A HH21 3  
ATOM 5847  H HH22 . ARG A 1 103 ? -12.461 -11.945 -7.182  1.00 5.97  ? 617 ARG A HH22 3  
ATOM 5848  N N    . ARG A 1 104 ? -7.570  -11.791 -4.827  1.00 2.12  ? 618 ARG A N    3  
ATOM 5849  C CA   . ARG A 1 104 ? -7.819  -11.685 -3.380  1.00 2.30  ? 618 ARG A CA   3  
ATOM 5850  C C    . ARG A 1 104 ? -9.296  -11.944 -3.047  1.00 2.73  ? 618 ARG A C    3  
ATOM 5851  O O    . ARG A 1 104 ? -10.150 -12.007 -3.934  1.00 3.44  ? 618 ARG A O    3  
ATOM 5852  C CB   . ARG A 1 104 ? -7.327  -10.294 -2.920  1.00 2.64  ? 618 ARG A CB   3  
ATOM 5853  C CG   . ARG A 1 104 ? -6.823  -10.258 -1.469  1.00 3.56  ? 618 ARG A CG   3  
ATOM 5854  C CD   . ARG A 1 104 ? -6.346  -8.850  -1.084  1.00 4.26  ? 618 ARG A CD   3  
ATOM 5855  N NE   . ARG A 1 104 ? -5.983  -8.777  0.342   1.00 5.52  ? 618 ARG A NE   3  
ATOM 5856  C CZ   . ARG A 1 104 ? -4.892  -9.264  0.899   1.00 5.89  ? 618 ARG A CZ   3  
ATOM 5857  N NH1  . ARG A 1 104 ? -3.927  -9.823  0.238   1.00 5.30  ? 618 ARG A NH1  3  
ATOM 5858  N NH2  . ARG A 1 104 ? -4.737  -9.254  2.183   1.00 7.39  ? 618 ARG A NH2  3  
ATOM 5859  H H    . ARG A 1 104 ? -8.152  -11.231 -5.441  1.00 2.42  ? 618 ARG A H    3  
ATOM 5860  H HA   . ARG A 1 104 ? -7.238  -12.449 -2.855  1.00 2.20  ? 618 ARG A HA   3  
ATOM 5861  H HB2  . ARG A 1 104 ? -6.497  -9.984  -3.556  1.00 2.56  ? 618 ARG A HB2  3  
ATOM 5862  H HB3  . ARG A 1 104 ? -8.129  -9.566  -3.041  1.00 3.18  ? 618 ARG A HB3  3  
ATOM 5863  H HG2  . ARG A 1 104 ? -7.617  -10.555 -0.794  1.00 4.75  ? 618 ARG A HG2  3  
ATOM 5864  H HG3  . ARG A 1 104 ? -5.998  -10.960 -1.357  1.00 3.62  ? 618 ARG A HG3  3  
ATOM 5865  H HD2  . ARG A 1 104 ? -5.489  -8.573  -1.697  1.00 4.22  ? 618 ARG A HD2  3  
ATOM 5866  H HD3  . ARG A 1 104 ? -7.146  -8.134  -1.281  1.00 4.81  ? 618 ARG A HD3  3  
ATOM 5867  H HE   . ARG A 1 104 ? -6.692  -8.445  0.988   1.00 6.55  ? 618 ARG A HE   3  
ATOM 5868  H HH11 . ARG A 1 104 ? -3.884  -9.802  -0.776  1.00 4.51  ? 618 ARG A HH11 3  
ATOM 5869  H HH12 . ARG A 1 104 ? -3.162  -10.251 0.751   1.00 6.03  ? 618 ARG A HH12 3  
ATOM 5870  H HH21 . ARG A 1 104 ? -5.333  -8.706  2.790   1.00 8.31  ? 618 ARG A HH21 3  
ATOM 5871  H HH22 . ARG A 1 104 ? -3.873  -9.643  2.538   1.00 7.82  ? 618 ARG A HH22 3  
ATOM 5872  N N    . THR A 1 105 ? -9.601  -12.054 -1.760  1.00 2.58  ? 619 THR A N    3  
ATOM 5873  C CA   . THR A 1 105 ? -10.897 -11.685 -1.171  1.00 2.69  ? 619 THR A CA   3  
ATOM 5874  C C    . THR A 1 105 ? -10.688 -10.464 -0.279  1.00 1.99  ? 619 THR A C    3  
ATOM 5875  O O    . THR A 1 105 ? -9.744  -10.433 0.514   1.00 1.80  ? 619 THR A O    3  
ATOM 5876  C CB   . THR A 1 105 ? -11.561 -12.832 -0.390  1.00 3.30  ? 619 THR A CB   3  
ATOM 5877  O OG1  . THR A 1 105 ? -10.677 -13.465 0.511   1.00 4.07  ? 619 THR A OG1  3  
ATOM 5878  C CG2  . THR A 1 105 ? -12.083 -13.911 -1.331  1.00 3.76  ? 619 THR A CG2  3  
ATOM 5879  H H    . THR A 1 105 ? -8.831  -12.148 -1.109  1.00 2.41  ? 619 THR A H    3  
ATOM 5880  H HA   . THR A 1 105 ? -11.581 -11.397 -1.967  1.00 3.11  ? 619 THR A HA   3  
ATOM 5881  H HB   . THR A 1 105 ? -12.406 -12.429 0.169   1.00 3.91  ? 619 THR A HB   3  
ATOM 5882  H HG1  . THR A 1 105 ? -11.226 -14.083 1.028   1.00 4.95  ? 619 THR A HG1  3  
ATOM 5883  H HG21 . THR A 1 105 ? -11.263 -14.335 -1.913  1.00 4.04  ? 619 THR A HG21 3  
ATOM 5884  H HG22 . THR A 1 105 ? -12.816 -13.467 -2.002  1.00 3.76  ? 619 THR A HG22 3  
ATOM 5885  H HG23 . THR A 1 105 ? -12.567 -14.704 -0.763  1.00 4.85  ? 619 THR A HG23 3  
ATOM 5886  N N    . ALA A 1 106 ? -11.506 -9.421  -0.440  1.00 1.89  ? 620 ALA A N    3  
ATOM 5887  C CA   . ALA A 1 106 ? -11.282 -8.132  0.213   1.00 1.46  ? 620 ALA A CA   3  
ATOM 5888  C C    . ALA A 1 106 ? -12.588 -7.475  0.680   1.00 1.36  ? 620 ALA A C    3  
ATOM 5889  O O    . ALA A 1 106 ? -13.516 -7.267  -0.107  1.00 1.84  ? 620 ALA A O    3  
ATOM 5890  C CB   . ALA A 1 106 ? -10.466 -7.230  -0.718  1.00 2.35  ? 620 ALA A CB   3  
ATOM 5891  H H    . ALA A 1 106 ? -12.290 -9.504  -1.083  1.00 2.35  ? 620 ALA A H    3  
ATOM 5892  H HA   . ALA A 1 106 ? -10.676 -8.293  1.101   1.00 1.32  ? 620 ALA A HA   3  
ATOM 5893  H HB1  . ALA A 1 106 ? -9.553  -7.739  -1.029  1.00 2.77  ? 620 ALA A HB1  3  
ATOM 5894  H HB2  . ALA A 1 106 ? -11.047 -6.971  -1.601  1.00 3.64  ? 620 ALA A HB2  3  
ATOM 5895  H HB3  . ALA A 1 106 ? -10.189 -6.317  -0.192  1.00 2.44  ? 620 ALA A HB3  3  
ATOM 5896  N N    . SER A 1 107 ? -12.637 -7.131  1.971   1.00 1.04  ? 621 SER A N    3  
ATOM 5897  C CA   . SER A 1 107 ? -13.822 -6.607  2.661   1.00 1.12  ? 621 SER A CA   3  
ATOM 5898  C C    . SER A 1 107 ? -13.408 -5.552  3.698   1.00 0.97  ? 621 SER A C    3  
ATOM 5899  O O    . SER A 1 107 ? -12.994 -5.893  4.807   1.00 0.98  ? 621 SER A O    3  
ATOM 5900  C CB   . SER A 1 107 ? -14.575 -7.749  3.364   1.00 1.35  ? 621 SER A CB   3  
ATOM 5901  O OG   . SER A 1 107 ? -14.846 -8.842  2.503   1.00 1.97  ? 621 SER A OG   3  
ATOM 5902  H H    . SER A 1 107 ? -11.833 -7.360  2.543   1.00 1.11  ? 621 SER A H    3  
ATOM 5903  H HA   . SER A 1 107 ? -14.493 -6.146  1.938   1.00 1.41  ? 621 SER A HA   3  
ATOM 5904  H HB2  . SER A 1 107 ? -13.964 -8.125  4.180   1.00 1.86  ? 621 SER A HB2  3  
ATOM 5905  H HB3  . SER A 1 107 ? -15.507 -7.365  3.780   1.00 1.74  ? 621 SER A HB3  3  
ATOM 5906  H HG   . SER A 1 107 ? -15.277 -9.535  3.050   1.00 2.75  ? 621 SER A HG   3  
ATOM 5907  N N    . VAL A 1 108 ? -13.439 -4.268  3.331   1.00 0.88  ? 622 VAL A N    3  
ATOM 5908  C CA   . VAL A 1 108 ? -13.158 -3.155  4.254   1.00 0.81  ? 622 VAL A CA   3  
ATOM 5909  C C    . VAL A 1 108 ? -13.852 -1.844  3.830   1.00 0.76  ? 622 VAL A C    3  
ATOM 5910  O O    . VAL A 1 108 ? -13.991 -1.557  2.638   1.00 0.80  ? 622 VAL A O    3  
ATOM 5911  C CB   . VAL A 1 108 ? -11.635 -3.048  4.546   1.00 0.82  ? 622 VAL A CB   3  
ATOM 5912  C CG1  . VAL A 1 108 ? -10.644 -3.183  3.395   1.00 0.83  ? 622 VAL A CG1  3  
ATOM 5913  C CG2  . VAL A 1 108 ? -11.263 -1.763  5.258   1.00 0.79  ? 622 VAL A CG2  3  
ATOM 5914  H H    . VAL A 1 108 ? -13.825 -4.032  2.425   1.00 1.02  ? 622 VAL A H    3  
ATOM 5915  H HA   . VAL A 1 108 ? -13.624 -3.417  5.206   1.00 0.85  ? 622 VAL A HA   3  
ATOM 5916  H HB   . VAL A 1 108 ? -11.393 -3.865  5.216   1.00 0.97  ? 622 VAL A HB   3  
ATOM 5917  H HG11 . VAL A 1 108 ? -10.699 -2.303  2.763   1.00 1.52  ? 622 VAL A HG11 3  
ATOM 5918  H HG12 . VAL A 1 108 ? -9.629  -3.250  3.790   1.00 1.74  ? 622 VAL A HG12 3  
ATOM 5919  H HG13 . VAL A 1 108 ? -10.836 -4.097  2.838   1.00 1.80  ? 622 VAL A HG13 3  
ATOM 5920  H HG21 . VAL A 1 108 ? -10.214 -1.808  5.547   1.00 1.27  ? 622 VAL A HG21 3  
ATOM 5921  H HG22 . VAL A 1 108 ? -11.421 -0.914  4.587   1.00 1.66  ? 622 VAL A HG22 3  
ATOM 5922  H HG23 . VAL A 1 108 ? -11.870 -1.688  6.153   1.00 1.68  ? 622 VAL A HG23 3  
ATOM 5923  N N    . ARG A 1 109 ? -14.287 -1.039  4.816   1.00 0.73  ? 623 ARG A N    3  
ATOM 5924  C CA   . ARG A 1 109 ? -14.953 0.271   4.661   1.00 0.70  ? 623 ARG A CA   3  
ATOM 5925  C C    . ARG A 1 109 ? -14.361 1.341   5.592   1.00 0.65  ? 623 ARG A C    3  
ATOM 5926  O O    . ARG A 1 109 ? -13.665 1.025   6.555   1.00 0.62  ? 623 ARG A O    3  
ATOM 5927  C CB   . ARG A 1 109 ? -16.485 0.141   4.811   1.00 0.81  ? 623 ARG A CB   3  
ATOM 5928  C CG   . ARG A 1 109 ? -17.009 -0.221  6.211   1.00 0.89  ? 623 ARG A CG   3  
ATOM 5929  C CD   . ARG A 1 109 ? -17.059 -1.731  6.468   1.00 1.17  ? 623 ARG A CD   3  
ATOM 5930  N NE   . ARG A 1 109 ? -17.524 -2.009  7.835   1.00 2.53  ? 623 ARG A NE   3  
ATOM 5931  C CZ   . ARG A 1 109 ? -17.512 -3.178  8.444   1.00 3.73  ? 623 ARG A CZ   3  
ATOM 5932  N NH1  . ARG A 1 109 ? -17.072 -4.267  7.885   1.00 4.04  ? 623 ARG A NH1  3  
ATOM 5933  N NH2  . ARG A 1 109 ? -17.952 -3.299  9.657   1.00 5.16  ? 623 ARG A NH2  3  
ATOM 5934  H H    . ARG A 1 109 ? -14.104 -1.337  5.773   1.00 0.75  ? 623 ARG A H    3  
ATOM 5935  H HA   . ARG A 1 109 ? -14.771 0.627   3.650   1.00 0.67  ? 623 ARG A HA   3  
ATOM 5936  H HB2  . ARG A 1 109 ? -16.927 1.101   4.545   1.00 0.84  ? 623 ARG A HB2  3  
ATOM 5937  H HB3  . ARG A 1 109 ? -16.857 -0.588  4.091   1.00 0.91  ? 623 ARG A HB3  3  
ATOM 5938  H HG2  . ARG A 1 109 ? -16.403 0.264   6.977   1.00 1.49  ? 623 ARG A HG2  3  
ATOM 5939  H HG3  . ARG A 1 109 ? -18.025 0.165   6.295   1.00 1.50  ? 623 ARG A HG3  3  
ATOM 5940  H HD2  . ARG A 1 109 ? -17.746 -2.189  5.753   1.00 0.97  ? 623 ARG A HD2  3  
ATOM 5941  H HD3  . ARG A 1 109 ? -16.069 -2.161  6.329   1.00 2.24  ? 623 ARG A HD3  3  
ATOM 5942  H HE   . ARG A 1 109 ? -17.898 -1.227  8.362   1.00 3.13  ? 623 ARG A HE   3  
ATOM 5943  H HH11 . ARG A 1 109 ? -16.793 -4.249  6.909   1.00 3.55  ? 623 ARG A HH11 3  
ATOM 5944  H HH12 . ARG A 1 109 ? -17.133 -5.130  8.399   1.00 5.09  ? 623 ARG A HH12 3  
ATOM 5945  H HH21 . ARG A 1 109 ? -18.420 -2.524  10.111  1.00 5.50  ? 623 ARG A HH21 3  
ATOM 5946  H HH22 . ARG A 1 109 ? -17.906 -4.204  10.106  1.00 6.09  ? 623 ARG A HH22 3  
ATOM 5947  N N    . ALA A 1 110 ? -14.602 2.616   5.302   1.00 0.66  ? 624 ALA A N    3  
ATOM 5948  C CA   . ALA A 1 110 ? -14.065 3.734   6.078   1.00 0.60  ? 624 ALA A CA   3  
ATOM 5949  C C    . ALA A 1 110 ? -14.729 3.860   7.468   1.00 0.67  ? 624 ALA A C    3  
ATOM 5950  O O    . ALA A 1 110 ? -15.954 3.948   7.576   1.00 0.82  ? 624 ALA A O    3  
ATOM 5951  C CB   . ALA A 1 110 ? -14.225 5.004   5.238   1.00 0.65  ? 624 ALA A CB   3  
ATOM 5952  H H    . ALA A 1 110 ? -15.194 2.830   4.505   1.00 0.72  ? 624 ALA A H    3  
ATOM 5953  H HA   . ALA A 1 110 ? -13.000 3.570   6.233   1.00 0.62  ? 624 ALA A HA   3  
ATOM 5954  H HB1  . ALA A 1 110 ? -15.281 5.184   5.042   1.00 1.77  ? 624 ALA A HB1  3  
ATOM 5955  H HB2  . ALA A 1 110 ? -13.808 5.858   5.769   1.00 1.70  ? 624 ALA A HB2  3  
ATOM 5956  H HB3  . ALA A 1 110 ? -13.701 4.896   4.288   1.00 1.52  ? 624 ALA A HB3  3  
ATOM 5957  N N    . ASP A 1 111 ? -13.929 3.931   8.540   1.00 0.71  ? 625 ASP A N    3  
ATOM 5958  C CA   . ASP A 1 111 ? -14.427 4.145   9.916   1.00 0.89  ? 625 ASP A CA   3  
ATOM 5959  C C    . ASP A 1 111 ? -14.817 5.610   10.175  1.00 0.96  ? 625 ASP A C    3  
ATOM 5960  O O    . ASP A 1 111 ? -15.500 5.948   11.141  1.00 1.25  ? 625 ASP A O    3  
ATOM 5961  C CB   . ASP A 1 111 ? -13.322 3.773   10.919  1.00 1.08  ? 625 ASP A CB   3  
ATOM 5962  C CG   . ASP A 1 111 ? -13.859 3.491   12.328  1.00 1.53  ? 625 ASP A CG   3  
ATOM 5963  O OD1  . ASP A 1 111 ? -15.013 3.022   12.477  1.00 1.65  ? 625 ASP A OD1  3  
ATOM 5964  O OD2  . ASP A 1 111 ? -13.160 3.806   13.320  1.00 2.85  ? 625 ASP A OD2  3  
ATOM 5965  H H    . ASP A 1 111 ? -12.923 3.917   8.409   1.00 0.71  ? 625 ASP A H    3  
ATOM 5966  H HA   . ASP A 1 111 ? -15.299 3.508   10.080  1.00 0.95  ? 625 ASP A HA   3  
ATOM 5967  H HB2  . ASP A 1 111 ? -12.748 2.931   10.553  1.00 0.97  ? 625 ASP A HB2  3  
ATOM 5968  H HB3  . ASP A 1 111 ? -12.615 4.595   10.986  1.00 1.37  ? 625 ASP A HB3  3  
ATOM 5969  N N    . THR A 1 112 ? -14.281 6.486   9.333   1.00 0.80  ? 626 THR A N    3  
ATOM 5970  C CA   . THR A 1 112 ? -14.102 7.926   9.549   1.00 0.87  ? 626 THR A CA   3  
ATOM 5971  C C    . THR A 1 112 ? -13.667 8.566   8.218   1.00 0.81  ? 626 THR A C    3  
ATOM 5972  O O    . THR A 1 112 ? -13.372 7.842   7.266   1.00 0.77  ? 626 THR A O    3  
ATOM 5973  C CB   . THR A 1 112 ? -13.037 8.121   10.646  1.00 0.98  ? 626 THR A CB   3  
ATOM 5974  O OG1  . THR A 1 112 ? -12.839 9.483   10.933  1.00 1.11  ? 626 THR A OG1  3  
ATOM 5975  C CG2  . THR A 1 112 ? -11.685 7.502   10.282  1.00 0.94  ? 626 THR A CG2  3  
ATOM 5976  H H    . THR A 1 112 ? -13.769 6.084   8.557   1.00 0.70  ? 626 THR A H    3  
ATOM 5977  H HA   . THR A 1 112 ? -15.034 8.376   9.887   1.00 0.98  ? 626 THR A HA   3  
ATOM 5978  H HB   . THR A 1 112 ? -13.387 7.642   11.561  1.00 1.09  ? 626 THR A HB   3  
ATOM 5979  H HG1  . THR A 1 112 ? -13.575 9.751   11.526  1.00 0.93  ? 626 THR A HG1  3  
ATOM 5980  H HG21 . THR A 1 112 ? -10.972 7.696   11.081  1.00 1.73  ? 626 THR A HG21 3  
ATOM 5981  H HG22 . THR A 1 112 ? -11.310 7.926   9.351   1.00 1.84  ? 626 THR A HG22 3  
ATOM 5982  H HG23 . THR A 1 112 ? -11.796 6.419   10.180  1.00 1.57  ? 626 THR A HG23 3  
ATOM 5983  N N    . TYR A 1 113 ? -13.590 9.896   8.119   1.00 0.87  ? 627 TYR A N    3  
ATOM 5984  C CA   . TYR A 1 113 ? -12.992 10.576  6.964   1.00 0.84  ? 627 TYR A CA   3  
ATOM 5985  C C    . TYR A 1 113 ? -11.496 10.226  6.893   1.00 0.81  ? 627 TYR A C    3  
ATOM 5986  O O    . TYR A 1 113 ? -10.718 10.512  7.812   1.00 0.93  ? 627 TYR A O    3  
ATOM 5987  C CB   . TYR A 1 113 ? -13.292 12.084  7.012   1.00 0.95  ? 627 TYR A CB   3  
ATOM 5988  C CG   . TYR A 1 113 ? -12.225 12.994  6.434   1.00 1.36  ? 627 TYR A CG   3  
ATOM 5989  C CD1  . TYR A 1 113 ? -12.096 13.178  5.043   1.00 1.99  ? 627 TYR A CD1  3  
ATOM 5990  C CD2  . TYR A 1 113 ? -11.362 13.670  7.313   1.00 2.55  ? 627 TYR A CD2  3  
ATOM 5991  C CE1  . TYR A 1 113 ? -11.102 14.049  4.545   1.00 2.30  ? 627 TYR A CE1  3  
ATOM 5992  C CE2  . TYR A 1 113 ? -10.369 14.531  6.821   1.00 3.00  ? 627 TYR A CE2  3  
ATOM 5993  C CZ   . TYR A 1 113 ? -10.239 14.723  5.432   1.00 2.37  ? 627 TYR A CZ   3  
ATOM 5994  O OH   . TYR A 1 113 ? -9.276  15.547  4.950   1.00 2.91  ? 627 TYR A OH   3  
ATOM 5995  H H    . TYR A 1 113 ? -13.836 10.450  8.936   1.00 0.90  ? 627 TYR A H    3  
ATOM 5996  H HA   . TYR A 1 113 ? -13.460 10.188  6.060   1.00 0.80  ? 627 TYR A HA   3  
ATOM 5997  H HB2  . TYR A 1 113 ? -14.229 12.269  6.488   1.00 1.04  ? 627 TYR A HB2  3  
ATOM 5998  H HB3  . TYR A 1 113 ? -13.452 12.380  8.048   1.00 0.92  ? 627 TYR A HB3  3  
ATOM 5999  H HD1  . TYR A 1 113 ? -12.765 12.662  4.367   1.00 2.94  ? 627 TYR A HD1  3  
ATOM 6000  H HD2  . TYR A 1 113 ? -11.462 13.529  8.374   1.00 3.50  ? 627 TYR A HD2  3  
ATOM 6001  H HE1  . TYR A 1 113 ? -10.984 14.224  3.486   1.00 3.18  ? 627 TYR A HE1  3  
ATOM 6002  H HE2  . TYR A 1 113 ? -9.718  15.051  7.505   1.00 4.18  ? 627 TYR A HE2  3  
ATOM 6003  H HH   . TYR A 1 113 ? -8.709  15.879  5.666   1.00 3.65  ? 627 TYR A HH   3  
ATOM 6004  N N    . CYS A 1 114 ? -11.119 9.530   5.821   1.00 0.76  ? 628 CYS A N    3  
ATOM 6005  C CA   . CYS A 1 114 ? -9.870  8.787   5.713   1.00 0.67  ? 628 CYS A CA   3  
ATOM 6006  C C    . CYS A 1 114 ? -9.156  9.126   4.401   1.00 0.64  ? 628 CYS A C    3  
ATOM 6007  O O    . CYS A 1 114 ? -9.730  9.006   3.313   1.00 0.63  ? 628 CYS A O    3  
ATOM 6008  C CB   . CYS A 1 114 ? -10.203 7.291   5.836   1.00 0.60  ? 628 CYS A CB   3  
ATOM 6009  S SG   . CYS A 1 114 ? -8.725  6.322   6.210   1.00 2.21  ? 628 CYS A SG   3  
ATOM 6010  H H    . CYS A 1 114 ? -11.815 9.363   5.099   1.00 0.82  ? 628 CYS A H    3  
ATOM 6011  H HA   . CYS A 1 114 ? -9.214  9.062   6.539   1.00 0.76  ? 628 CYS A HA   3  
ATOM 6012  H HB2  . CYS A 1 114 ? -10.933 7.144   6.635   1.00 1.37  ? 628 CYS A HB2  3  
ATOM 6013  H HB3  . CYS A 1 114 ? -10.623 6.929   4.899   1.00 1.47  ? 628 CYS A HB3  3  
ATOM 6014  H HG   . CYS A 1 114 ? -9.366  5.182   6.500   1.00 3.05  ? 628 CYS A HG   3  
ATOM 6015  N N    . ARG A 1 115 ? -7.899  9.558   4.511   1.00 0.73  ? 629 ARG A N    3  
ATOM 6016  C CA   . ARG A 1 115 ? -7.042  9.967   3.395   1.00 0.79  ? 629 ARG A CA   3  
ATOM 6017  C C    . ARG A 1 115 ? -6.101  8.833   3.043   1.00 0.85  ? 629 ARG A C    3  
ATOM 6018  O O    . ARG A 1 115 ? -5.245  8.424   3.830   1.00 0.97  ? 629 ARG A O    3  
ATOM 6019  C CB   . ARG A 1 115 ? -6.311  11.275  3.730   1.00 0.99  ? 629 ARG A CB   3  
ATOM 6020  C CG   . ARG A 1 115 ? -7.354  12.366  4.016   1.00 1.39  ? 629 ARG A CG   3  
ATOM 6021  C CD   . ARG A 1 115 ? -7.043  13.724  3.381   1.00 1.27  ? 629 ARG A CD   3  
ATOM 6022  N NE   . ARG A 1 115 ? -6.144  14.537  4.206   1.00 1.58  ? 629 ARG A NE   3  
ATOM 6023  C CZ   . ARG A 1 115 ? -5.914  15.829  4.093   1.00 2.23  ? 629 ARG A CZ   3  
ATOM 6024  N NH1  . ARG A 1 115 ? -6.535  16.607  3.261   1.00 2.92  ? 629 ARG A NH1  3  
ATOM 6025  N NH2  . ARG A 1 115 ? -5.018  16.389  4.843   1.00 2.79  ? 629 ARG A NH2  3  
ATOM 6026  H H    . ARG A 1 115 ? -7.500  9.614   5.444   1.00 0.81  ? 629 ARG A H    3  
ATOM 6027  H HA   . ARG A 1 115 ? -7.666  10.153  2.512   1.00 0.76  ? 629 ARG A HA   3  
ATOM 6028  H HB2  . ARG A 1 115 ? -5.674  11.143  4.606   1.00 1.53  ? 629 ARG A HB2  3  
ATOM 6029  H HB3  . ARG A 1 115 ? -5.678  11.557  2.890   1.00 1.72  ? 629 ARG A HB3  3  
ATOM 6030  H HG2  . ARG A 1 115 ? -8.320  12.058  3.620   1.00 2.53  ? 629 ARG A HG2  3  
ATOM 6031  H HG3  . ARG A 1 115 ? -7.461  12.450  5.097   1.00 2.15  ? 629 ARG A HG3  3  
ATOM 6032  H HD2  . ARG A 1 115 ? -6.597  13.588  2.401   1.00 1.47  ? 629 ARG A HD2  3  
ATOM 6033  H HD3  . ARG A 1 115 ? -7.993  14.228  3.226   1.00 1.63  ? 629 ARG A HD3  3  
ATOM 6034  H HE   . ARG A 1 115 ? -5.688  14.077  4.983   1.00 1.96  ? 629 ARG A HE   3  
ATOM 6035  H HH11 . ARG A 1 115 ? -7.314  16.250  2.710   1.00 3.04  ? 629 ARG A HH11 3  
ATOM 6036  H HH12 . ARG A 1 115 ? -6.322  17.592  3.264   1.00 3.59  ? 629 ARG A HH12 3  
ATOM 6037  H HH21 . ARG A 1 115 ? -4.469  15.806  5.462   1.00 2.97  ? 629 ARG A HH21 3  
ATOM 6038  H HH22 . ARG A 1 115 ? -4.895  17.390  4.785   1.00 3.35  ? 629 ARG A HH22 3  
ATOM 6039  N N    . LEU A 1 116 ? -6.300  8.320   1.844   1.00 0.82  ? 630 LEU A N    3  
ATOM 6040  C CA   . LEU A 1 116 ? -5.574  7.196   1.278   1.00 0.91  ? 630 LEU A CA   3  
ATOM 6041  C C    . LEU A 1 116 ? -4.578  7.682   0.236   1.00 0.91  ? 630 LEU A C    3  
ATOM 6042  O O    . LEU A 1 116 ? -4.721  8.742   -0.376  1.00 1.00  ? 630 LEU A O    3  
ATOM 6043  C CB   . LEU A 1 116 ? -6.542  6.176   0.657   1.00 0.99  ? 630 LEU A CB   3  
ATOM 6044  C CG   . LEU A 1 116 ? -7.633  5.629   1.591   1.00 0.97  ? 630 LEU A CG   3  
ATOM 6045  C CD1  . LEU A 1 116 ? -8.340  4.486   0.868   1.00 1.13  ? 630 LEU A CD1  3  
ATOM 6046  C CD2  . LEU A 1 116 ? -7.082  5.083   2.908   1.00 1.07  ? 630 LEU A CD2  3  
ATOM 6047  H H    . LEU A 1 116 ? -6.936  8.828   1.232   1.00 0.78  ? 630 LEU A H    3  
ATOM 6048  H HA   . LEU A 1 116 ? -5.008  6.694   2.063   1.00 0.96  ? 630 LEU A HA   3  
ATOM 6049  H HB2  . LEU A 1 116 ? -7.030  6.639   -0.204  1.00 0.97  ? 630 LEU A HB2  3  
ATOM 6050  H HB3  . LEU A 1 116 ? -5.950  5.337   0.290   1.00 1.12  ? 630 LEU A HB3  3  
ATOM 6051  H HG   . LEU A 1 116 ? -8.359  6.414   1.807   1.00 0.87  ? 630 LEU A HG   3  
ATOM 6052  H HD11 . LEU A 1 116 ? -7.645  3.660   0.711   1.00 1.86  ? 630 LEU A HD11 3  
ATOM 6053  H HD12 . LEU A 1 116 ? -8.680  4.831   -0.104  1.00 2.40  ? 630 LEU A HD12 3  
ATOM 6054  H HD13 . LEU A 1 116 ? -9.198  4.158   1.450   1.00 1.34  ? 630 LEU A HD13 3  
ATOM 6055  H HD21 . LEU A 1 116 ? -6.299  4.352   2.704   1.00 2.21  ? 630 LEU A HD21 3  
ATOM 6056  H HD22 . LEU A 1 116 ? -7.884  4.616   3.481   1.00 1.79  ? 630 LEU A HD22 3  
ATOM 6057  H HD23 . LEU A 1 116 ? -6.677  5.899   3.504   1.00 1.60  ? 630 LEU A HD23 3  
ATOM 6058  N N    . TYR A 1 117 ? -3.568  6.866   -0.005  1.00 0.88  ? 631 TYR A N    3  
ATOM 6059  C CA   . TYR A 1 117 ? -2.628  7.088   -1.082  1.00 0.91  ? 631 TYR A CA   3  
ATOM 6060  C C    . TYR A 1 117 ? -2.414  5.809   -1.880  1.00 0.81  ? 631 TYR A C    3  
ATOM 6061  O O    . TYR A 1 117 ? -2.618  4.704   -1.370  1.00 0.92  ? 631 TYR A O    3  
ATOM 6062  C CB   . TYR A 1 117 ? -1.384  7.790   -0.528  1.00 1.20  ? 631 TYR A CB   3  
ATOM 6063  C CG   . TYR A 1 117 ? -0.401  7.074   0.378   1.00 1.70  ? 631 TYR A CG   3  
ATOM 6064  C CD1  . TYR A 1 117 ? -0.742  6.762   1.707   1.00 3.08  ? 631 TYR A CD1  3  
ATOM 6065  C CD2  . TYR A 1 117 ? 0.927   6.913   -0.049  1.00 2.71  ? 631 TYR A CD2  3  
ATOM 6066  C CE1  . TYR A 1 117 ? 0.237   6.300   2.607   1.00 4.45  ? 631 TYR A CE1  3  
ATOM 6067  C CE2  . TYR A 1 117 ? 1.922   6.494   0.853   1.00 3.87  ? 631 TYR A CE2  3  
ATOM 6068  C CZ   . TYR A 1 117 ? 1.578   6.199   2.188   1.00 4.56  ? 631 TYR A CZ   3  
ATOM 6069  O OH   . TYR A 1 117 ? 2.549   5.894   3.084   1.00 6.01  ? 631 TYR A OH   3  
ATOM 6070  H H    . TYR A 1 117 ? -3.483  6.006   0.529   1.00 0.88  ? 631 TYR A H    3  
ATOM 6071  H HA   . TYR A 1 117 ? -3.074  7.788   -1.788  1.00 1.08  ? 631 TYR A HA   3  
ATOM 6072  H HB2  . TYR A 1 117 ? -0.842  8.198   -1.367  1.00 2.25  ? 631 TYR A HB2  3  
ATOM 6073  H HB3  . TYR A 1 117 ? -1.733  8.643   0.043   1.00 2.12  ? 631 TYR A HB3  3  
ATOM 6074  H HD1  . TYR A 1 117 ? -1.753  6.905   2.043   1.00 3.64  ? 631 TYR A HD1  3  
ATOM 6075  H HD2  . TYR A 1 117 ? 1.181   7.123   -1.073  1.00 3.37  ? 631 TYR A HD2  3  
ATOM 6076  H HE1  . TYR A 1 117 ? -0.015  6.071   3.632   1.00 5.77  ? 631 TYR A HE1  3  
ATOM 6077  H HE2  . TYR A 1 117 ? 2.948   6.401   0.531   1.00 4.81  ? 631 TYR A HE2  3  
ATOM 6078  H HH   . TYR A 1 117 ? 3.410   6.175   2.745   1.00 6.20  ? 631 TYR A HH   3  
ATOM 6079  N N    . SER A 1 118 ? -2.069  5.960   -3.157  1.00 0.80  ? 632 SER A N    3  
ATOM 6080  C CA   . SER A 1 118 ? -1.809  4.811   -4.030  1.00 0.87  ? 632 SER A CA   3  
ATOM 6081  C C    . SER A 1 118 ? -0.539  5.042   -4.827  1.00 0.80  ? 632 SER A C    3  
ATOM 6082  O O    . SER A 1 118 ? -0.478  5.887   -5.723  1.00 1.01  ? 632 SER A O    3  
ATOM 6083  C CB   . SER A 1 118 ? -3.008  4.503   -4.932  1.00 1.19  ? 632 SER A CB   3  
ATOM 6084  O OG   . SER A 1 118 ? -2.814  3.264   -5.594  1.00 2.69  ? 632 SER A OG   3  
ATOM 6085  H H    . SER A 1 118 ? -1.962  6.905   -3.527  1.00 0.82  ? 632 SER A H    3  
ATOM 6086  H HA   . SER A 1 118 ? -1.649  3.929   -3.410  1.00 0.93  ? 632 SER A HA   3  
ATOM 6087  H HB2  . SER A 1 118 ? -3.906  4.435   -4.317  1.00 1.66  ? 632 SER A HB2  3  
ATOM 6088  H HB3  . SER A 1 118 ? -3.138  5.302   -5.664  1.00 1.93  ? 632 SER A HB3  3  
ATOM 6089  H HG   . SER A 1 118 ? -2.680  2.575   -4.909  1.00 3.54  ? 632 SER A HG   3  
ATOM 6090  N N    . LEU A 1 119 ? 0.496   4.286   -4.468  1.00 1.00  ? 633 LEU A N    3  
ATOM 6091  C CA   . LEU A 1 119 ? 1.777   4.245   -5.159  1.00 1.07  ? 633 LEU A CA   3  
ATOM 6092  C C    . LEU A 1 119 ? 1.734   3.013   -6.068  1.00 1.07  ? 633 LEU A C    3  
ATOM 6093  O O    . LEU A 1 119 ? 1.798   1.879   -5.590  1.00 1.34  ? 633 LEU A O    3  
ATOM 6094  C CB   . LEU A 1 119 ? 2.897   4.216   -4.099  1.00 1.14  ? 633 LEU A CB   3  
ATOM 6095  C CG   . LEU A 1 119 ? 4.264   4.767   -4.538  1.00 1.25  ? 633 LEU A CG   3  
ATOM 6096  C CD1  . LEU A 1 119 ? 5.247   4.569   -3.386  1.00 1.42  ? 633 LEU A CD1  3  
ATOM 6097  C CD2  . LEU A 1 119 ? 4.798   4.102   -5.802  1.00 1.48  ? 633 LEU A CD2  3  
ATOM 6098  H H    . LEU A 1 119 ? 0.342   3.593   -3.749  1.00 1.25  ? 633 LEU A H    3  
ATOM 6099  H HA   . LEU A 1 119 ? 1.897   5.140   -5.772  1.00 1.09  ? 633 LEU A HA   3  
ATOM 6100  H HB2  . LEU A 1 119 ? 2.578   4.818   -3.248  1.00 1.19  ? 633 LEU A HB2  3  
ATOM 6101  H HB3  . LEU A 1 119 ? 3.022   3.191   -3.749  1.00 1.21  ? 633 LEU A HB3  3  
ATOM 6102  H HG   . LEU A 1 119 ? 4.192   5.840   -4.713  1.00 1.31  ? 633 LEU A HG   3  
ATOM 6103  H HD11 . LEU A 1 119 ? 6.172   5.092   -3.611  1.00 2.35  ? 633 LEU A HD11 3  
ATOM 6104  H HD12 . LEU A 1 119 ? 5.455   3.509   -3.239  1.00 1.71  ? 633 LEU A HD12 3  
ATOM 6105  H HD13 . LEU A 1 119 ? 4.836   4.992   -2.470  1.00 2.09  ? 633 LEU A HD13 3  
ATOM 6106  H HD21 . LEU A 1 119 ? 4.845   3.022   -5.663  1.00 2.06  ? 633 LEU A HD21 3  
ATOM 6107  H HD22 . LEU A 1 119 ? 5.789   4.489   -6.033  1.00 2.59  ? 633 LEU A HD22 3  
ATOM 6108  H HD23 . LEU A 1 119 ? 4.153   4.327   -6.648  1.00 1.94  ? 633 LEU A HD23 3  
ATOM 6109  N N    . SER A 1 120 ? 1.547   3.225   -7.371  1.00 0.88  ? 634 SER A N    3  
ATOM 6110  C CA   . SER A 1 120 ? 1.489   2.109   -8.316  1.00 0.89  ? 634 SER A CA   3  
ATOM 6111  C C    . SER A 1 120 ? 2.848   1.411   -8.428  1.00 0.92  ? 634 SER A C    3  
ATOM 6112  O O    . SER A 1 120 ? 3.902   2.048   -8.336  1.00 0.95  ? 634 SER A O    3  
ATOM 6113  C CB   . SER A 1 120 ? 1.012   2.573   -9.691  1.00 0.89  ? 634 SER A CB   3  
ATOM 6114  O OG   . SER A 1 120 ? 0.899   1.435   -10.519 1.00 2.13  ? 634 SER A OG   3  
ATOM 6115  H H    . SER A 1 120 ? 1.482   4.171   -7.721  1.00 0.90  ? 634 SER A H    3  
ATOM 6116  H HA   . SER A 1 120 ? 0.765   1.388   -7.944  1.00 1.04  ? 634 SER A HA   3  
ATOM 6117  H HB2  . SER A 1 120 ? 0.042   3.067   -9.606  1.00 1.71  ? 634 SER A HB2  3  
ATOM 6118  H HB3  . SER A 1 120 ? 1.736   3.267   -10.110 1.00 1.45  ? 634 SER A HB3  3  
ATOM 6119  H HG   . SER A 1 120 ? 0.960   1.718   -11.458 1.00 2.08  ? 634 SER A HG   3  
ATOM 6120  N N    . VAL A 1 121 ? 2.827   0.102   -8.715  1.00 1.04  ? 635 VAL A N    3  
ATOM 6121  C CA   . VAL A 1 121 ? 4.041   -0.662  -9.049  1.00 1.26  ? 635 VAL A CA   3  
ATOM 6122  C C    . VAL A 1 121 ? 4.847   0.024   -10.149 1.00 1.48  ? 635 VAL A C    3  
ATOM 6123  O O    . VAL A 1 121 ? 6.071   0.030   -10.089 1.00 1.70  ? 635 VAL A O    3  
ATOM 6124  C CB   . VAL A 1 121 ? 3.746   -2.123  -9.451  1.00 1.60  ? 635 VAL A CB   3  
ATOM 6125  C CG1  . VAL A 1 121 ? 2.874   -2.862  -8.431  1.00 1.32  ? 635 VAL A CG1  3  
ATOM 6126  C CG2  . VAL A 1 121 ? 3.102   -2.296  -10.819 1.00 2.55  ? 635 VAL A CG2  3  
ATOM 6127  H H    . VAL A 1 121 ? 1.932   -0.348  -8.818  1.00 1.08  ? 635 VAL A H    3  
ATOM 6128  H HA   . VAL A 1 121 ? 4.675   -0.678  -8.167  1.00 1.22  ? 635 VAL A HA   3  
ATOM 6129  H HB   . VAL A 1 121 ? 4.694   -2.644  -9.515  1.00 2.59  ? 635 VAL A HB   3  
ATOM 6130  H HG11 . VAL A 1 121 ? 1.851   -2.493  -8.457  1.00 1.89  ? 635 VAL A HG11 3  
ATOM 6131  H HG12 . VAL A 1 121 ? 2.874   -3.921  -8.689  1.00 1.95  ? 635 VAL A HG12 3  
ATOM 6132  H HG13 . VAL A 1 121 ? 3.281   -2.744  -7.431  1.00 2.36  ? 635 VAL A HG13 3  
ATOM 6133  H HG21 . VAL A 1 121 ? 3.817   -2.002  -11.584 1.00 3.42  ? 635 VAL A HG21 3  
ATOM 6134  H HG22 . VAL A 1 121 ? 2.884   -3.351  -10.967 1.00 2.79  ? 635 VAL A HG22 3  
ATOM 6135  H HG23 . VAL A 1 121 ? 2.193   -1.707  -10.898 1.00 3.43  ? 635 VAL A HG23 3  
ATOM 6136  N N    . ASP A 1 122 ? 4.152   0.692   -11.076 1.00 1.57  ? 636 ASP A N    3  
ATOM 6137  C CA   . ASP A 1 122 ? 4.708   1.381   -12.238 1.00 1.95  ? 636 ASP A CA   3  
ATOM 6138  C C    . ASP A 1 122 ? 5.784   2.421   -11.910 1.00 1.87  ? 636 ASP A C    3  
ATOM 6139  O O    . ASP A 1 122 ? 6.629   2.703   -12.759 1.00 2.24  ? 636 ASP A O    3  
ATOM 6140  C CB   . ASP A 1 122 ? 3.565   2.076   -12.990 1.00 2.30  ? 636 ASP A CB   3  
ATOM 6141  C CG   . ASP A 1 122 ? 2.541   1.096   -13.557 1.00 2.44  ? 636 ASP A CG   3  
ATOM 6142  O OD1  . ASP A 1 122 ? 2.892   0.325   -14.479 1.00 2.81  ? 636 ASP A OD1  3  
ATOM 6143  O OD2  . ASP A 1 122 ? 1.385   1.065   -13.076 1.00 2.86  ? 636 ASP A OD2  3  
ATOM 6144  H H    . ASP A 1 122 ? 3.145   0.673   -10.991 1.00 1.43  ? 636 ASP A H    3  
ATOM 6145  H HA   . ASP A 1 122 ? 5.171   0.645   -12.885 1.00 2.22  ? 636 ASP A HA   3  
ATOM 6146  H HB2  . ASP A 1 122 ? 3.068   2.776   -12.316 1.00 2.32  ? 636 ASP A HB2  3  
ATOM 6147  H HB3  . ASP A 1 122 ? 3.986   2.646   -13.819 1.00 2.70  ? 636 ASP A HB3  3  
ATOM 6148  N N    . ASN A 1 123 ? 5.741   3.020   -10.718 1.00 1.60  ? 637 ASN A N    3  
ATOM 6149  C CA   . ASN A 1 123 ? 6.744   3.974   -10.232 1.00 1.58  ? 637 ASN A CA   3  
ATOM 6150  C C    . ASN A 1 123 ? 7.809   3.345   -9.322  1.00 1.39  ? 637 ASN A C    3  
ATOM 6151  O O    . ASN A 1 123 ? 8.880   3.919   -9.147  1.00 1.61  ? 637 ASN A O    3  
ATOM 6152  C CB   . ASN A 1 123 ? 6.009   5.137   -9.550  1.00 1.71  ? 637 ASN A CB   3  
ATOM 6153  C CG   . ASN A 1 123 ? 4.856   5.610   -10.405 1.00 1.85  ? 637 ASN A CG   3  
ATOM 6154  O OD1  . ASN A 1 123 ? 3.697   5.365   -10.110 1.00 2.52  ? 637 ASN A OD1  3  
ATOM 6155  N ND2  . ASN A 1 123 ? 5.128   6.238   -11.521 1.00 1.92  ? 637 ASN A ND2  3  
ATOM 6156  H H    . ASN A 1 123 ? 4.985   2.765   -10.090 1.00 1.54  ? 637 ASN A H    3  
ATOM 6157  H HA   . ASN A 1 123 ? 7.277   4.374   -11.098 1.00 1.68  ? 637 ASN A HA   3  
ATOM 6158  H HB2  . ASN A 1 123 ? 5.615   4.809   -8.591  1.00 2.01  ? 637 ASN A HB2  3  
ATOM 6159  H HB3  . ASN A 1 123 ? 6.700   5.964   -9.384  1.00 1.80  ? 637 ASN A HB3  3  
ATOM 6160  H HD21 . ASN A 1 123 ? 6.092   6.414   -11.786 1.00 2.23  ? 637 ASN A HD21 3  
ATOM 6161  H HD22 . ASN A 1 123 ? 4.381   6.343   -12.193 1.00 1.98  ? 637 ASN A HD22 3  
ATOM 6162  N N    . PHE A 1 124 ? 7.500   2.186   -8.736  1.00 1.14  ? 638 PHE A N    3  
ATOM 6163  C CA   . PHE A 1 124 ? 8.245   1.468   -7.696  1.00 1.07  ? 638 PHE A CA   3  
ATOM 6164  C C    . PHE A 1 124 ? 9.243   0.471   -8.321  1.00 1.04  ? 638 PHE A C    3  
ATOM 6165  O O    . PHE A 1 124 ? 10.430  0.481   -7.992  1.00 1.02  ? 638 PHE A O    3  
ATOM 6166  C CB   . PHE A 1 124 ? 7.166   0.858   -6.781  1.00 1.25  ? 638 PHE A CB   3  
ATOM 6167  C CG   . PHE A 1 124 ? 7.504   0.089   -5.509  1.00 1.19  ? 638 PHE A CG   3  
ATOM 6168  C CD1  . PHE A 1 124 ? 8.784   -0.429  -5.214  1.00 1.75  ? 638 PHE A CD1  3  
ATOM 6169  C CD2  . PHE A 1 124 ? 6.446   -0.160  -4.610  1.00 2.30  ? 638 PHE A CD2  3  
ATOM 6170  C CE1  . PHE A 1 124 ? 8.989   -1.206  -4.061  1.00 1.73  ? 638 PHE A CE1  3  
ATOM 6171  C CE2  . PHE A 1 124 ? 6.652   -0.928  -3.451  1.00 2.63  ? 638 PHE A CE2  3  
ATOM 6172  C CZ   . PHE A 1 124 ? 7.920   -1.464  -3.184  1.00 1.73  ? 638 PHE A CZ   3  
ATOM 6173  H H    . PHE A 1 124 ? 6.618   1.775   -9.007  1.00 1.09  ? 638 PHE A H    3  
ATOM 6174  H HA   . PHE A 1 124 ? 8.809   2.173   -7.092  1.00 1.05  ? 638 PHE A HA   3  
ATOM 6175  H HB2  . PHE A 1 124 ? 6.531   1.686   -6.467  1.00 1.47  ? 638 PHE A HB2  3  
ATOM 6176  H HB3  . PHE A 1 124 ? 6.535   0.217   -7.390  1.00 1.45  ? 638 PHE A HB3  3  
ATOM 6177  H HD1  . PHE A 1 124 ? 9.624   -0.251  -5.860  1.00 2.88  ? 638 PHE A HD1  3  
ATOM 6178  H HD2  . PHE A 1 124 ? 5.461   0.231   -4.819  1.00 3.33  ? 638 PHE A HD2  3  
ATOM 6179  H HE1  . PHE A 1 124 ? 9.968   -1.611  -3.855  1.00 2.63  ? 638 PHE A HE1  3  
ATOM 6180  H HE2  . PHE A 1 124 ? 5.830   -1.118  -2.773  1.00 3.87  ? 638 PHE A HE2  3  
ATOM 6181  H HZ   . PHE A 1 124 ? 8.075   -2.063  -2.298  1.00 2.08  ? 638 PHE A HZ   3  
ATOM 6182  N N    . ASN A 1 125 ? 8.824   -0.322  -9.309  1.00 1.10  ? 639 ASN A N    3  
ATOM 6183  C CA   . ASN A 1 125 ? 9.708   -1.227  -10.041 1.00 1.17  ? 639 ASN A CA   3  
ATOM 6184  C C    . ASN A 1 125 ? 10.698  -0.525  -10.981 1.00 1.15  ? 639 ASN A C    3  
ATOM 6185  O O    . ASN A 1 125 ? 11.708  -1.105  -11.377 1.00 1.21  ? 639 ASN A O    3  
ATOM 6186  C CB   . ASN A 1 125 ? 8.834   -2.247  -10.764 1.00 1.25  ? 639 ASN A CB   3  
ATOM 6187  C CG   . ASN A 1 125 ? 7.793   -1.727  -11.745 1.00 2.56  ? 639 ASN A CG   3  
ATOM 6188  O OD1  . ASN A 1 125 ? 7.961   -0.703  -12.395 1.00 4.63  ? 639 ASN A OD1  3  
ATOM 6189  N ND2  . ASN A 1 125 ? 6.702   -2.445  -11.888 1.00 2.37  ? 639 ASN A ND2  3  
ATOM 6190  H H    . ASN A 1 125 ? 7.853   -0.295  -9.601  1.00 1.13  ? 639 ASN A H    3  
ATOM 6191  H HA   . ASN A 1 125 ? 10.327  -1.768  -9.319  1.00 1.24  ? 639 ASN A HA   3  
ATOM 6192  H HB2  . ASN A 1 125 ? 9.502   -2.891  -11.311 1.00 2.28  ? 639 ASN A HB2  3  
ATOM 6193  H HB3  . ASN A 1 125 ? 8.323   -2.812  -9.996  1.00 2.53  ? 639 ASN A HB3  3  
ATOM 6194  H HD21 . ASN A 1 125 ? 6.606   -3.318  -11.380 1.00 1.36  ? 639 ASN A HD21 3  
ATOM 6195  H HD22 . ASN A 1 125 ? 5.979   -2.110  -12.514 1.00 3.87  ? 639 ASN A HD22 3  
ATOM 6196  N N    . GLU A 1 126 ? 10.438  0.737   -11.296 1.00 1.14  ? 640 GLU A N    3  
ATOM 6197  C CA   . GLU A 1 126 ? 11.424  1.664   -11.861 1.00 1.35  ? 640 GLU A CA   3  
ATOM 6198  C C    . GLU A 1 126 ? 12.594  1.930   -10.902 1.00 1.44  ? 640 GLU A C    3  
ATOM 6199  O O    . GLU A 1 126 ? 13.759  1.838   -11.285 1.00 1.69  ? 640 GLU A O    3  
ATOM 6200  C CB   . GLU A 1 126 ? 10.746  3.016   -12.131 1.00 1.70  ? 640 GLU A CB   3  
ATOM 6201  C CG   . GLU A 1 126 ? 9.839   3.064   -13.360 1.00 1.51  ? 640 GLU A CG   3  
ATOM 6202  C CD   . GLU A 1 126 ? 10.572  2.667   -14.637 1.00 2.26  ? 640 GLU A CD   3  
ATOM 6203  O OE1  . GLU A 1 126 ? 11.299  3.495   -15.236 1.00 3.13  ? 640 GLU A OE1  3  
ATOM 6204  O OE2  . GLU A 1 126 ? 10.444  1.491   -15.053 1.00 3.30  ? 640 GLU A OE2  3  
ATOM 6205  H H    . GLU A 1 126 ? 9.511   1.062   -11.064 1.00 1.06  ? 640 GLU A H    3  
ATOM 6206  H HA   . GLU A 1 126 ? 11.837  1.244   -12.777 1.00 1.37  ? 640 GLU A HA   3  
ATOM 6207  H HB2  . GLU A 1 126 ? 10.141  3.269   -11.266 1.00 2.39  ? 640 GLU A HB2  3  
ATOM 6208  H HB3  . GLU A 1 126 ? 11.510  3.784   -12.212 1.00 2.40  ? 640 GLU A HB3  3  
ATOM 6209  H HG2  . GLU A 1 126 ? 9.009   2.383   -13.190 1.00 1.97  ? 640 GLU A HG2  3  
ATOM 6210  H HG3  . GLU A 1 126 ? 9.437   4.074   -13.465 1.00 1.77  ? 640 GLU A HG3  3  
ATOM 6211  N N    . VAL A 1 127 ? 12.278  2.281   -9.655  1.00 1.33  ? 641 VAL A N    3  
ATOM 6212  C CA   . VAL A 1 127 ? 13.235  2.858   -8.689  1.00 1.34  ? 641 VAL A CA   3  
ATOM 6213  C C    . VAL A 1 127 ? 14.026  1.808   -7.922  1.00 1.43  ? 641 VAL A C    3  
ATOM 6214  O O    . VAL A 1 127 ? 15.164  2.065   -7.536  1.00 1.57  ? 641 VAL A O    3  
ATOM 6215  C CB   . VAL A 1 127 ? 12.535  3.877   -7.780  1.00 1.18  ? 641 VAL A CB   3  
ATOM 6216  C CG1  . VAL A 1 127 ? 11.338  3.297   -7.052  1.00 1.08  ? 641 VAL A CG1  3  
ATOM 6217  C CG2  . VAL A 1 127 ? 13.419  4.522   -6.719  1.00 1.16  ? 641 VAL A CG2  3  
ATOM 6218  H H    . VAL A 1 127 ? 11.298  2.237   -9.399  1.00 1.23  ? 641 VAL A H    3  
ATOM 6219  H HA   . VAL A 1 127 ? 13.975  3.419   -9.256  1.00 1.48  ? 641 VAL A HA   3  
ATOM 6220  H HB   . VAL A 1 127 ? 12.163  4.655   -8.435  1.00 1.24  ? 641 VAL A HB   3  
ATOM 6221  H HG11 . VAL A 1 127 ? 10.896  4.077   -6.442  1.00 2.15  ? 641 VAL A HG11 3  
ATOM 6222  H HG12 . VAL A 1 127 ? 10.616  2.988   -7.796  1.00 1.28  ? 641 VAL A HG12 3  
ATOM 6223  H HG13 . VAL A 1 127 ? 11.626  2.453   -6.429  1.00 2.07  ? 641 VAL A HG13 3  
ATOM 6224  H HG21 . VAL A 1 127 ? 12.879  5.359   -6.280  1.00 1.64  ? 641 VAL A HG21 3  
ATOM 6225  H HG22 . VAL A 1 127 ? 13.620  3.815   -5.916  1.00 1.91  ? 641 VAL A HG22 3  
ATOM 6226  H HG23 . VAL A 1 127 ? 14.346  4.876   -7.168  1.00 1.80  ? 641 VAL A HG23 3  
ATOM 6227  N N    . LEU A 1 128 ? 13.494  0.586   -7.834  1.00 1.38  ? 642 LEU A N    3  
ATOM 6228  C CA   . LEU A 1 128 ? 14.276  -0.630  -7.542  1.00 1.40  ? 642 LEU A CA   3  
ATOM 6229  C C    . LEU A 1 128 ? 15.620  -0.654  -8.289  1.00 1.58  ? 642 LEU A C    3  
ATOM 6230  O O    . LEU A 1 128 ? 16.651  -1.032  -7.738  1.00 1.69  ? 642 LEU A O    3  
ATOM 6231  C CB   . LEU A 1 128 ? 13.475  -1.867  -8.000  1.00 1.15  ? 642 LEU A CB   3  
ATOM 6232  C CG   . LEU A 1 128 ? 12.425  -2.447  -7.038  1.00 1.20  ? 642 LEU A CG   3  
ATOM 6233  C CD1  . LEU A 1 128 ? 11.955  -3.794  -7.591  1.00 1.38  ? 642 LEU A CD1  3  
ATOM 6234  C CD2  . LEU A 1 128 ? 12.966  -2.723  -5.639  1.00 2.20  ? 642 LEU A CD2  3  
ATOM 6235  H H    . LEU A 1 128 ? 12.524  0.505   -8.118  1.00 1.26  ? 642 LEU A H    3  
ATOM 6236  H HA   . LEU A 1 128 ? 14.514  -0.682  -6.482  1.00 1.49  ? 642 LEU A HA   3  
ATOM 6237  H HB2  . LEU A 1 128 ? 12.988  -1.644  -8.950  1.00 1.18  ? 642 LEU A HB2  3  
ATOM 6238  H HB3  . LEU A 1 128 ? 14.193  -2.654  -8.213  1.00 1.64  ? 642 LEU A HB3  3  
ATOM 6239  H HG   . LEU A 1 128 ? 11.578  -1.766  -6.966  1.00 1.73  ? 642 LEU A HG   3  
ATOM 6240  H HD11 . LEU A 1 128 ? 11.191  -4.218  -6.941  1.00 2.26  ? 642 LEU A HD11 3  
ATOM 6241  H HD12 . LEU A 1 128 ? 12.794  -4.495  -7.638  1.00 2.15  ? 642 LEU A HD12 3  
ATOM 6242  H HD13 . LEU A 1 128 ? 11.542  -3.672  -8.591  1.00 2.17  ? 642 LEU A HD13 3  
ATOM 6243  H HD21 . LEU A 1 128 ? 13.299  -1.807  -5.165  1.00 2.94  ? 642 LEU A HD21 3  
ATOM 6244  H HD22 . LEU A 1 128 ? 13.797  -3.421  -5.691  1.00 2.57  ? 642 LEU A HD22 3  
ATOM 6245  H HD23 . LEU A 1 128 ? 12.176  -3.154  -5.026  1.00 3.19  ? 642 LEU A HD23 3  
ATOM 6246  N N    . GLU A 1 129 ? 15.589  -0.251  -9.557  1.00 1.64  ? 643 GLU A N    3  
ATOM 6247  C CA   . GLU A 1 129 ? 16.727  -0.291  -10.473 1.00 1.77  ? 643 GLU A CA   3  
ATOM 6248  C C    . GLU A 1 129 ? 17.566  0.995   -10.451 1.00 1.48  ? 643 GLU A C    3  
ATOM 6249  O O    . GLU A 1 129 ? 18.680  0.978   -10.959 1.00 1.54  ? 643 GLU A O    3  
ATOM 6250  C CB   . GLU A 1 129 ? 16.204  -0.581  -11.886 1.00 1.99  ? 643 GLU A CB   3  
ATOM 6251  C CG   . GLU A 1 129 ? 15.400  -1.878  -12.004 1.00 2.73  ? 643 GLU A CG   3  
ATOM 6252  C CD   . GLU A 1 129 ? 16.133  -2.946  -12.808 1.00 3.36  ? 643 GLU A CD   3  
ATOM 6253  O OE1  . GLU A 1 129 ? 17.202  -3.445  -12.381 1.00 4.41  ? 643 GLU A OE1  3  
ATOM 6254  O OE2  . GLU A 1 129 ? 15.634  -3.317  -13.895 1.00 3.41  ? 643 GLU A OE2  3  
ATOM 6255  H H    . GLU A 1 129 ? 14.693  0.023   -9.938  1.00 1.62  ? 643 GLU A H    3  
ATOM 6256  H HA   . GLU A 1 129 ? 17.392  -1.107  -10.186 1.00 2.05  ? 643 GLU A HA   3  
ATOM 6257  H HB2  . GLU A 1 129 ? 15.525  0.214   -12.158 1.00 1.98  ? 643 GLU A HB2  3  
ATOM 6258  H HB3  . GLU A 1 129 ? 17.031  -0.585  -12.597 1.00 2.24  ? 643 GLU A HB3  3  
ATOM 6259  H HG2  . GLU A 1 129 ? 15.156  -2.261  -11.019 1.00 3.09  ? 643 GLU A HG2  3  
ATOM 6260  H HG3  . GLU A 1 129 ? 14.450  -1.644  -12.490 1.00 2.85  ? 643 GLU A HG3  3  
ATOM 6261  N N    . GLU A 1 130 ? 17.107  2.097   -9.845  1.00 1.27  ? 644 GLU A N    3  
ATOM 6262  C CA   . GLU A 1 130 ? 17.926  3.313   -9.684  1.00 1.17  ? 644 GLU A CA   3  
ATOM 6263  C C    . GLU A 1 130 ? 18.970  3.173   -8.565  1.00 1.25  ? 644 GLU A C    3  
ATOM 6264  O O    . GLU A 1 130 ? 19.949  3.924   -8.512  1.00 1.33  ? 644 GLU A O    3  
ATOM 6265  C CB   . GLU A 1 130 ? 16.999  4.498   -9.400  1.00 1.09  ? 644 GLU A CB   3  
ATOM 6266  C CG   . GLU A 1 130 ? 16.171  4.917   -10.615 1.00 1.11  ? 644 GLU A CG   3  
ATOM 6267  C CD   . GLU A 1 130 ? 16.593  6.296   -11.121 1.00 1.49  ? 644 GLU A CD   3  
ATOM 6268  O OE1  . GLU A 1 130 ? 16.066  7.318   -10.616 1.00 2.65  ? 644 GLU A OE1  3  
ATOM 6269  O OE2  . GLU A 1 130 ? 17.488  6.380   -11.999 1.00 1.57  ? 644 GLU A OE2  3  
ATOM 6270  H H    . GLU A 1 130 ? 16.207  2.073   -9.373  1.00 1.31  ? 644 GLU A H    3  
ATOM 6271  H HA   . GLU A 1 130 ? 18.481  3.508   -10.602 1.00 1.21  ? 644 GLU A HA   3  
ATOM 6272  H HB2  . GLU A 1 130 ? 16.322  4.230   -8.591  1.00 1.04  ? 644 GLU A HB2  3  
ATOM 6273  H HB3  . GLU A 1 130 ? 17.587  5.346   -9.063  1.00 1.16  ? 644 GLU A HB3  3  
ATOM 6274  H HG2  . GLU A 1 130 ? 16.247  4.180   -11.416 1.00 1.06  ? 644 GLU A HG2  3  
ATOM 6275  H HG3  . GLU A 1 130 ? 15.136  4.950   -10.297 1.00 1.19  ? 644 GLU A HG3  3  
ATOM 6276  N N    . TYR A 1 131 ? 18.756  2.186   -7.695  1.00 1.32  ? 645 TYR A N    3  
ATOM 6277  C CA   . TYR A 1 131 ? 19.590  1.796   -6.561  1.00 1.39  ? 645 TYR A CA   3  
ATOM 6278  C C    . TYR A 1 131 ? 19.735  0.268   -6.613  1.00 1.45  ? 645 TYR A C    3  
ATOM 6279  O O    . TYR A 1 131 ? 19.177  -0.414  -5.755  1.00 1.62  ? 645 TYR A O    3  
ATOM 6280  C CB   . TYR A 1 131 ? 18.943  2.287   -5.248  1.00 1.47  ? 645 TYR A CB   3  
ATOM 6281  C CG   . TYR A 1 131 ? 18.616  3.766   -5.242  1.00 1.33  ? 645 TYR A CG   3  
ATOM 6282  C CD1  . TYR A 1 131 ? 17.466  4.210   -5.915  1.00 1.58  ? 645 TYR A CD1  3  
ATOM 6283  C CD2  . TYR A 1 131 ? 19.477  4.693   -4.631  1.00 2.70  ? 645 TYR A CD2  3  
ATOM 6284  C CE1  . TYR A 1 131 ? 17.231  5.580   -6.089  1.00 1.64  ? 645 TYR A CE1  3  
ATOM 6285  C CE2  . TYR A 1 131 ? 19.223  6.073   -4.757  1.00 2.59  ? 645 TYR A CE2  3  
ATOM 6286  C CZ   . TYR A 1 131 ? 18.117  6.517   -5.517  1.00 1.18  ? 645 TYR A CZ   3  
ATOM 6287  O OH   . TYR A 1 131 ? 17.921  7.841   -5.735  1.00 1.20  ? 645 TYR A OH   3  
ATOM 6288  H H    . TYR A 1 131 ? 17.904  1.659   -7.831  1.00 1.33  ? 645 TYR A H    3  
ATOM 6289  H HA   . TYR A 1 131 ? 20.579  2.241   -6.654  1.00 1.34  ? 645 TYR A HA   3  
ATOM 6290  H HB2  . TYR A 1 131 ? 18.011  1.744   -5.085  1.00 1.55  ? 645 TYR A HB2  3  
ATOM 6291  H HB3  . TYR A 1 131 ? 19.611  2.058   -4.416  1.00 1.61  ? 645 TYR A HB3  3  
ATOM 6292  H HD1  . TYR A 1 131 ? 16.798  3.487   -6.358  1.00 2.71  ? 645 TYR A HD1  3  
ATOM 6293  H HD2  . TYR A 1 131 ? 20.341  4.334   -4.090  1.00 4.04  ? 645 TYR A HD2  3  
ATOM 6294  H HE1  . TYR A 1 131 ? 16.392  5.902   -6.687  1.00 2.89  ? 645 TYR A HE1  3  
ATOM 6295  H HE2  . TYR A 1 131 ? 19.893  6.796   -4.315  1.00 3.86  ? 645 TYR A HE2  3  
ATOM 6296  H HH   . TYR A 1 131 ? 17.257  7.965   -6.441  1.00 1.41  ? 645 TYR A HH   3  
ATOM 6297  N N    . PRO A 1 132 ? 20.374  -0.303  -7.656  1.00 1.35  ? 646 PRO A N    3  
ATOM 6298  C CA   . PRO A 1 132 ? 20.195  -1.699  -8.074  1.00 1.39  ? 646 PRO A CA   3  
ATOM 6299  C C    . PRO A 1 132 ? 20.535  -2.782  -7.039  1.00 1.28  ? 646 PRO A C    3  
ATOM 6300  O O    . PRO A 1 132 ? 20.181  -3.946  -7.262  1.00 1.32  ? 646 PRO A O    3  
ATOM 6301  C CB   . PRO A 1 132 ? 21.023  -1.857  -9.356  1.00 1.46  ? 646 PRO A CB   3  
ATOM 6302  C CG   . PRO A 1 132 ? 22.024  -0.707  -9.298  1.00 1.31  ? 646 PRO A CG   3  
ATOM 6303  C CD   . PRO A 1 132 ? 21.204  0.390   -8.630  1.00 1.31  ? 646 PRO A CD   3  
ATOM 6304  H HA   . PRO A 1 132 ? 19.145  -1.839  -8.333  1.00 1.60  ? 646 PRO A HA   3  
ATOM 6305  H HB2  . PRO A 1 132 ? 21.528  -2.821  -9.413  1.00 1.51  ? 646 PRO A HB2  3  
ATOM 6306  H HB3  . PRO A 1 132 ? 20.372  -1.721  -10.219 1.00 1.67  ? 646 PRO A HB3  3  
ATOM 6307  H HG2  . PRO A 1 132 ? 22.868  -0.979  -8.664  1.00 1.24  ? 646 PRO A HG2  3  
ATOM 6308  H HG3  . PRO A 1 132 ? 22.360  -0.417  -10.294 1.00 1.40  ? 646 PRO A HG3  3  
ATOM 6309  H HD2  . PRO A 1 132 ? 21.848  1.138   -8.169  1.00 1.26  ? 646 PRO A HD2  3  
ATOM 6310  H HD3  . PRO A 1 132 ? 20.573  0.872   -9.373  1.00 1.46  ? 646 PRO A HD3  3  
ATOM 6311  N N    . MET A 1 133 ? 21.132  -2.449  -5.887  1.00 1.20  ? 647 MET A N    3  
ATOM 6312  C CA   . MET A 1 133 ? 21.180  -3.381  -4.751  1.00 1.19  ? 647 MET A CA   3  
ATOM 6313  C C    . MET A 1 133 ? 19.759  -3.719  -4.243  1.00 1.14  ? 647 MET A C    3  
ATOM 6314  O O    . MET A 1 133 ? 19.483  -4.839  -3.828  1.00 1.21  ? 647 MET A O    3  
ATOM 6315  C CB   . MET A 1 133 ? 22.085  -2.809  -3.648  1.00 1.24  ? 647 MET A CB   3  
ATOM 6316  C CG   . MET A 1 133 ? 21.352  -1.699  -2.912  1.00 1.69  ? 647 MET A CG   3  
ATOM 6317  S SD   . MET A 1 133 ? 22.226  -0.821  -1.612  1.00 1.57  ? 647 MET A SD   3  
ATOM 6318  C CE   . MET A 1 133 ? 20.701  -0.194  -0.871  1.00 1.35  ? 647 MET A CE   3  
ATOM 6319  H H    . MET A 1 133 ? 21.362  -1.470  -5.712  1.00 1.23  ? 647 MET A H    3  
ATOM 6320  H HA   . MET A 1 133 ? 21.638  -4.304  -5.079  1.00 1.28  ? 647 MET A HA   3  
ATOM 6321  H HB2  . MET A 1 133 ? 22.331  -3.586  -2.931  1.00 1.70  ? 647 MET A HB2  3  
ATOM 6322  H HB3  . MET A 1 133 ? 23.011  -2.429  -4.080  1.00 1.82  ? 647 MET A HB3  3  
ATOM 6323  H HG2  . MET A 1 133 ? 21.003  -0.986  -3.653  1.00 2.47  ? 647 MET A HG2  3  
ATOM 6324  H HG3  . MET A 1 133 ? 20.485  -2.148  -2.432  1.00 2.30  ? 647 MET A HG3  3  
ATOM 6325  H HE1  . MET A 1 133 ? 20.078  -1.040  -0.568  1.00 1.68  ? 647 MET A HE1  3  
ATOM 6326  H HE2  . MET A 1 133 ? 20.932  0.424   -0.005  1.00 2.38  ? 647 MET A HE2  3  
ATOM 6327  H HE3  . MET A 1 133 ? 20.151  0.377   -1.623  1.00 1.80  ? 647 MET A HE3  3  
ATOM 6328  N N    . MET A 1 134 ? 18.832  -2.760  -4.339  1.00 1.06  ? 648 MET A N    3  
ATOM 6329  C CA   . MET A 1 134 ? 17.447  -2.847  -3.878  1.00 1.04  ? 648 MET A CA   3  
ATOM 6330  C C    . MET A 1 134 ? 16.603  -3.708  -4.815  1.00 1.08  ? 648 MET A C    3  
ATOM 6331  O O    . MET A 1 134 ? 15.790  -4.496  -4.338  1.00 1.10  ? 648 MET A O    3  
ATOM 6332  C CB   . MET A 1 134 ? 16.845  -1.436  -3.726  1.00 1.00  ? 648 MET A CB   3  
ATOM 6333  C CG   . MET A 1 134 ? 17.606  -0.503  -2.777  1.00 1.27  ? 648 MET A CG   3  
ATOM 6334  S SD   . MET A 1 134 ? 17.180  -0.580  -1.016  1.00 1.69  ? 648 MET A SD   3  
ATOM 6335  C CE   . MET A 1 134 ? 17.539  -2.298  -0.558  1.00 2.04  ? 648 MET A CE   3  
ATOM 6336  H H    . MET A 1 134 ? 19.122  -1.875  -4.742  1.00 1.06  ? 648 MET A H    3  
ATOM 6337  H HA   . MET A 1 134 ? 17.442  -3.340  -2.912  1.00 1.08  ? 648 MET A HA   3  
ATOM 6338  H HB2  . MET A 1 134 ? 16.835  -0.959  -4.704  1.00 1.15  ? 648 MET A HB2  3  
ATOM 6339  H HB3  . MET A 1 134 ? 15.819  -1.514  -3.373  1.00 1.30  ? 648 MET A HB3  3  
ATOM 6340  H HG2  . MET A 1 134 ? 18.676  -0.654  -2.895  1.00 1.46  ? 648 MET A HG2  3  
ATOM 6341  H HG3  . MET A 1 134 ? 17.397  0.518   -3.098  1.00 1.76  ? 648 MET A HG3  3  
ATOM 6342  H HE1  . MET A 1 134 ? 18.500  -2.606  -0.971  1.00 3.20  ? 648 MET A HE1  3  
ATOM 6343  H HE2  . MET A 1 134 ? 17.574  -2.387  0.526   1.00 2.79  ? 648 MET A HE2  3  
ATOM 6344  H HE3  . MET A 1 134 ? 16.750  -2.949  -0.931  1.00 2.04  ? 648 MET A HE3  3  
ATOM 6345  N N    . ARG A 1 135 ? 16.861  -3.667  -6.131  1.00 1.15  ? 649 ARG A N    3  
ATOM 6346  C CA   . ARG A 1 135 ? 16.355  -4.684  -7.064  1.00 1.24  ? 649 ARG A CA   3  
ATOM 6347  C C    . ARG A 1 135 ? 16.767  -6.078  -6.599  1.00 1.35  ? 649 ARG A C    3  
ATOM 6348  O O    . ARG A 1 135 ? 15.894  -6.894  -6.343  1.00 1.44  ? 649 ARG A O    3  
ATOM 6349  C CB   . ARG A 1 135 ? 16.797  -4.371  -8.501  1.00 1.31  ? 649 ARG A CB   3  
ATOM 6350  C CG   . ARG A 1 135 ? 16.266  -5.378  -9.544  1.00 1.51  ? 649 ARG A CG   3  
ATOM 6351  C CD   . ARG A 1 135 ? 17.345  -6.354  -10.037 1.00 1.97  ? 649 ARG A CD   3  
ATOM 6352  N NE   . ARG A 1 135 ? 18.414  -5.628  -10.743 1.00 3.35  ? 649 ARG A NE   3  
ATOM 6353  C CZ   . ARG A 1 135 ? 19.718  -5.787  -10.612 1.00 4.97  ? 649 ARG A CZ   3  
ATOM 6354  N NH1  . ARG A 1 135 ? 20.277  -6.722  -9.896  1.00 5.66  ? 649 ARG A NH1  3  
ATOM 6355  N NH2  . ARG A 1 135 ? 20.530  -4.971  -11.205 1.00 6.42  ? 649 ARG A NH2  3  
ATOM 6356  H H    . ARG A 1 135 ? 17.469  -2.933  -6.480  1.00 1.18  ? 649 ARG A H    3  
ATOM 6357  H HA   . ARG A 1 135 ? 15.264  -4.671  -7.030  1.00 1.22  ? 649 ARG A HA   3  
ATOM 6358  H HB2  . ARG A 1 135 ? 16.414  -3.390  -8.767  1.00 1.48  ? 649 ARG A HB2  3  
ATOM 6359  H HB3  . ARG A 1 135 ? 17.885  -4.309  -8.543  1.00 1.47  ? 649 ARG A HB3  3  
ATOM 6360  H HG2  . ARG A 1 135 ? 15.427  -5.940  -9.131  1.00 2.11  ? 649 ARG A HG2  3  
ATOM 6361  H HG3  . ARG A 1 135 ? 15.889  -4.825  -10.404 1.00 2.12  ? 649 ARG A HG3  3  
ATOM 6362  H HD2  . ARG A 1 135 ? 17.744  -6.909  -9.186  1.00 2.32  ? 649 ARG A HD2  3  
ATOM 6363  H HD3  . ARG A 1 135 ? 16.886  -7.066  -10.726 1.00 2.40  ? 649 ARG A HD3  3  
ATOM 6364  H HE   . ARG A 1 135 ? 18.117  -4.873  -11.355 1.00 3.66  ? 649 ARG A HE   3  
ATOM 6365  H HH11 . ARG A 1 135 ? 19.739  -7.461  -9.462  1.00 5.03  ? 649 ARG A HH11 3  
ATOM 6366  H HH12 . ARG A 1 135 ? 21.286  -6.727  -9.830  1.00 7.14  ? 649 ARG A HH12 3  
ATOM 6367  H HH21 . ARG A 1 135 ? 20.188  -4.203  -11.770 1.00 6.45  ? 649 ARG A HH21 3  
ATOM 6368  H HH22 . ARG A 1 135 ? 21.523  -5.129  -11.110 1.00 7.72  ? 649 ARG A HH22 3  
ATOM 6369  N N    . ARG A 1 136 ? 18.060  -6.346  -6.380  1.00 1.39  ? 650 ARG A N    3  
ATOM 6370  C CA   . ARG A 1 136 ? 18.554  -7.640  -5.881  1.00 1.51  ? 650 ARG A CA   3  
ATOM 6371  C C    . ARG A 1 136 ? 17.912  -8.036  -4.548  1.00 1.49  ? 650 ARG A C    3  
ATOM 6372  O O    . ARG A 1 136 ? 17.523  -9.188  -4.380  1.00 1.58  ? 650 ARG A O    3  
ATOM 6373  C CB   . ARG A 1 136 ? 20.090  -7.576  -5.822  1.00 1.68  ? 650 ARG A CB   3  
ATOM 6374  C CG   . ARG A 1 136 ? 20.745  -8.862  -5.302  1.00 1.85  ? 650 ARG A CG   3  
ATOM 6375  C CD   . ARG A 1 136 ? 20.912  -8.918  -3.776  1.00 2.31  ? 650 ARG A CD   3  
ATOM 6376  N NE   . ARG A 1 136 ? 21.877  -7.910  -3.312  1.00 2.96  ? 650 ARG A NE   3  
ATOM 6377  C CZ   . ARG A 1 136 ? 21.722  -7.013  -2.362  1.00 4.28  ? 650 ARG A CZ   3  
ATOM 6378  N NH1  . ARG A 1 136 ? 20.751  -7.015  -1.499  1.00 5.07  ? 650 ARG A NH1  3  
ATOM 6379  N NH2  . ARG A 1 136 ? 22.579  -6.050  -2.274  1.00 5.46  ? 650 ARG A NH2  3  
ATOM 6380  H H    . ARG A 1 136 ? 18.738  -5.614  -6.535  1.00 1.37  ? 650 ARG A H    3  
ATOM 6381  H HA   . ARG A 1 136 ? 18.274  -8.420  -6.589  1.00 1.57  ? 650 ARG A HA   3  
ATOM 6382  H HB2  . ARG A 1 136 ? 20.450  -7.410  -6.838  1.00 2.28  ? 650 ARG A HB2  3  
ATOM 6383  H HB3  . ARG A 1 136 ? 20.413  -6.729  -5.219  1.00 2.57  ? 650 ARG A HB3  3  
ATOM 6384  H HG2  . ARG A 1 136 ? 20.139  -9.704  -5.627  1.00 2.80  ? 650 ARG A HG2  3  
ATOM 6385  H HG3  . ARG A 1 136 ? 21.729  -8.948  -5.759  1.00 2.71  ? 650 ARG A HG3  3  
ATOM 6386  H HD2  . ARG A 1 136 ? 19.946  -8.756  -3.304  1.00 3.23  ? 650 ARG A HD2  3  
ATOM 6387  H HD3  . ARG A 1 136 ? 21.271  -9.910  -3.500  1.00 2.88  ? 650 ARG A HD3  3  
ATOM 6388  H HE   . ARG A 1 136 ? 22.707  -7.768  -3.878  1.00 3.20  ? 650 ARG A HE   3  
ATOM 6389  H HH11 . ARG A 1 136 ? 20.173  -7.830  -1.357  1.00 4.88  ? 650 ARG A HH11 3  
ATOM 6390  H HH12 . ARG A 1 136 ? 20.590  -6.161  -0.981  1.00 6.31  ? 650 ARG A HH12 3  
ATOM 6391  H HH21 . ARG A 1 136 ? 23.223  -5.933  -3.051  1.00 5.51  ? 650 ARG A HH21 3  
ATOM 6392  H HH22 . ARG A 1 136 ? 22.509  -5.365  -1.533  1.00 6.62  ? 650 ARG A HH22 3  
ATOM 6393  N N    . ALA A 1 137 ? 17.745  -7.080  -3.635  1.00 1.39  ? 651 ALA A N    3  
ATOM 6394  C CA   . ALA A 1 137 ? 17.076  -7.258  -2.343  1.00 1.40  ? 651 ALA A CA   3  
ATOM 6395  C C    . ALA A 1 137 ? 15.616  -7.749  -2.476  1.00 1.39  ? 651 ALA A C    3  
ATOM 6396  O O    . ALA A 1 137 ? 15.118  -8.421  -1.573  1.00 1.46  ? 651 ALA A O    3  
ATOM 6397  C CB   . ALA A 1 137 ? 17.146  -5.931  -1.571  1.00 1.34  ? 651 ALA A CB   3  
ATOM 6398  H H    . ALA A 1 137 ? 18.172  -6.185  -3.833  1.00 1.35  ? 651 ALA A H    3  
ATOM 6399  H HA   . ALA A 1 137 ? 17.626  -8.012  -1.780  1.00 1.50  ? 651 ALA A HA   3  
ATOM 6400  H HB1  . ALA A 1 137 ? 18.165  -5.536  -1.549  1.00 2.19  ? 651 ALA A HB1  3  
ATOM 6401  H HB2  . ALA A 1 137 ? 16.489  -5.196  -2.033  1.00 1.99  ? 651 ALA A HB2  3  
ATOM 6402  H HB3  . ALA A 1 137 ? 16.810  -6.087  -0.547  1.00 2.13  ? 651 ALA A HB3  3  
ATOM 6403  N N    . PHE A 1 138 ? 14.951  -7.466  -3.604  1.00 1.33  ? 652 PHE A N    3  
ATOM 6404  C CA   . PHE A 1 138 ? 13.641  -8.007  -3.989  1.00 1.38  ? 652 PHE A CA   3  
ATOM 6405  C C    . PHE A 1 138 ? 13.757  -9.307  -4.809  1.00 1.57  ? 652 PHE A C    3  
ATOM 6406  O O    . PHE A 1 138 ? 13.064  -10.282 -4.521  1.00 1.75  ? 652 PHE A O    3  
ATOM 6407  C CB   . PHE A 1 138 ? 12.862  -6.939  -4.773  1.00 1.26  ? 652 PHE A CB   3  
ATOM 6408  C CG   . PHE A 1 138 ? 12.089  -5.938  -3.931  1.00 1.12  ? 652 PHE A CG   3  
ATOM 6409  C CD1  . PHE A 1 138 ? 12.757  -5.090  -3.027  1.00 2.07  ? 652 PHE A CD1  3  
ATOM 6410  C CD2  . PHE A 1 138 ? 10.696  -5.822  -4.092  1.00 1.93  ? 652 PHE A CD2  3  
ATOM 6411  C CE1  . PHE A 1 138 ? 12.040  -4.123  -2.300  1.00 1.99  ? 652 PHE A CE1  3  
ATOM 6412  C CE2  . PHE A 1 138 ? 9.978   -4.856  -3.364  1.00 2.04  ? 652 PHE A CE2  3  
ATOM 6413  C CZ   . PHE A 1 138 ? 10.652  -3.998  -2.482  1.00 1.16  ? 652 PHE A CZ   3  
ATOM 6414  H H    . PHE A 1 138 ? 15.404  -6.855  -4.275  1.00 1.30  ? 652 PHE A H    3  
ATOM 6415  H HA   . PHE A 1 138 ? 13.074  -8.248  -3.087  1.00 1.41  ? 652 PHE A HA   3  
ATOM 6416  H HB2  . PHE A 1 138 ? 13.548  -6.382  -5.411  1.00 1.28  ? 652 PHE A HB2  3  
ATOM 6417  H HB3  . PHE A 1 138 ? 12.153  -7.446  -5.431  1.00 1.35  ? 652 PHE A HB3  3  
ATOM 6418  H HD1  . PHE A 1 138 ? 13.826  -5.163  -2.910  1.00 3.29  ? 652 PHE A HD1  3  
ATOM 6419  H HD2  . PHE A 1 138 ? 10.181  -6.466  -4.792  1.00 3.05  ? 652 PHE A HD2  3  
ATOM 6420  H HE1  . PHE A 1 138 ? 12.558  -3.471  -1.611  1.00 3.12  ? 652 PHE A HE1  3  
ATOM 6421  H HE2  . PHE A 1 138 ? 8.908   -4.763  -3.491  1.00 3.25  ? 652 PHE A HE2  3  
ATOM 6422  H HZ   . PHE A 1 138 ? 10.102  -3.237  -1.949  1.00 1.27  ? 652 PHE A HZ   3  
ATOM 6423  N N    . GLU A 1 139 ? 14.666  -9.386  -5.786  1.00 1.66  ? 653 GLU A N    3  
ATOM 6424  C CA   . GLU A 1 139 ? 14.840  -10.580 -6.631  1.00 1.89  ? 653 GLU A CA   3  
ATOM 6425  C C    . GLU A 1 139 ? 15.294  -11.827 -5.847  1.00 2.01  ? 653 GLU A C    3  
ATOM 6426  O O    . GLU A 1 139 ? 15.079  -12.951 -6.310  1.00 2.20  ? 653 GLU A O    3  
ATOM 6427  C CB   . GLU A 1 139 ? 15.846  -10.315 -7.768  1.00 2.09  ? 653 GLU A CB   3  
ATOM 6428  C CG   . GLU A 1 139 ? 15.491  -9.188  -8.750  1.00 1.97  ? 653 GLU A CG   3  
ATOM 6429  C CD   . GLU A 1 139 ? 14.069  -9.270  -9.308  1.00 2.55  ? 653 GLU A CD   3  
ATOM 6430  O OE1  . GLU A 1 139 ? 13.713  -10.268 -9.979  1.00 2.83  ? 653 GLU A OE1  3  
ATOM 6431  O OE2  . GLU A 1 139 ? 13.265  -8.343  -9.079  1.00 3.79  ? 653 GLU A OE2  3  
ATOM 6432  H H    . GLU A 1 139 ? 15.198  -8.550  -6.007  1.00 1.63  ? 653 GLU A H    3  
ATOM 6433  H HA   . GLU A 1 139 ? 13.874  -10.828 -7.073  1.00 1.93  ? 653 GLU A HA   3  
ATOM 6434  H HB2  . GLU A 1 139 ? 16.817  -10.090 -7.328  1.00 2.60  ? 653 GLU A HB2  3  
ATOM 6435  H HB3  . GLU A 1 139 ? 15.958  -11.233 -8.342  1.00 2.46  ? 653 GLU A HB3  3  
ATOM 6436  H HG2  . GLU A 1 139 ? 15.616  -8.235  -8.247  1.00 1.88  ? 653 GLU A HG2  3  
ATOM 6437  H HG3  . GLU A 1 139 ? 16.203  -9.211  -9.577  1.00 2.31  ? 653 GLU A HG3  3  
ATOM 6438  N N    . THR A 1 140 ? 15.901  -11.661 -4.666  1.00 1.95  ? 654 THR A N    3  
ATOM 6439  C CA   . THR A 1 140 ? 16.303  -12.772 -3.780  1.00 2.11  ? 654 THR A CA   3  
ATOM 6440  C C    . THR A 1 140 ? 15.119  -13.329 -2.990  1.00 2.20  ? 654 THR A C    3  
ATOM 6441  O O    . THR A 1 140 ? 14.905  -14.542 -2.927  1.00 2.54  ? 654 THR A O    3  
ATOM 6442  C CB   . THR A 1 140 ? 17.453  -12.364 -2.849  1.00 2.07  ? 654 THR A CB   3  
ATOM 6443  O OG1  . THR A 1 140 ? 17.819  -13.480 -2.078  1.00 2.36  ? 654 THR A OG1  3  
ATOM 6444  C CG2  . THR A 1 140 ? 17.099  -11.256 -1.861  1.00 1.83  ? 654 THR A CG2  3  
ATOM 6445  H H    . THR A 1 140 ? 16.064  -10.707 -4.353  1.00 1.83  ? 654 THR A H    3  
ATOM 6446  H HA   . THR A 1 140 ? 16.693  -13.581 -4.381  1.00 2.29  ? 654 THR A HA   3  
ATOM 6447  H HB   . THR A 1 140 ? 18.303  -12.045 -3.455  1.00 2.08  ? 654 THR A HB   3  
ATOM 6448  H HG1  . THR A 1 140 ? 18.533  -13.186 -1.473  1.00 2.68  ? 654 THR A HG1  3  
ATOM 6449  H HG21 . THR A 1 140 ? 16.488  -11.651 -1.051  1.00 2.14  ? 654 THR A HG21 3  
ATOM 6450  H HG22 . THR A 1 140 ? 16.543  -10.475 -2.371  1.00 2.18  ? 654 THR A HG22 3  
ATOM 6451  H HG23 . THR A 1 140 ? 18.015  -10.836 -1.450  1.00 2.44  ? 654 THR A HG23 3  
ATOM 6452  N N    . VAL A 1 141 ? 14.308  -12.431 -2.432  1.00 2.02  ? 655 VAL A N    3  
ATOM 6453  C CA   . VAL A 1 141 ? 13.193  -12.749 -1.537  1.00 2.14  ? 655 VAL A CA   3  
ATOM 6454  C C    . VAL A 1 141 ? 11.977  -13.218 -2.319  1.00 2.26  ? 655 VAL A C    3  
ATOM 6455  O O    . VAL A 1 141 ? 11.284  -14.115 -1.863  1.00 2.47  ? 655 VAL A O    3  
ATOM 6456  C CB   . VAL A 1 141 ? 12.888  -11.544 -0.632  1.00 2.06  ? 655 VAL A CB   3  
ATOM 6457  C CG1  . VAL A 1 141 ? 12.440  -10.326 -1.425  1.00 1.85  ? 655 VAL A CG1  3  
ATOM 6458  C CG2  . VAL A 1 141 ? 11.887  -11.860 0.482   1.00 2.30  ? 655 VAL A CG2  3  
ATOM 6459  H H    . VAL A 1 141 ? 14.505  -11.457 -2.604  1.00 1.90  ? 655 VAL A H    3  
ATOM 6460  H HA   . VAL A 1 141 ? 13.497  -13.568 -0.889  1.00 2.28  ? 655 VAL A HA   3  
ATOM 6461  H HB   . VAL A 1 141 ? 13.827  -11.246 -0.180  1.00 2.06  ? 655 VAL A HB   3  
ATOM 6462  H HG11 . VAL A 1 141 ? 13.263  -10.063 -2.085  1.00 2.34  ? 655 VAL A HG11 3  
ATOM 6463  H HG12 . VAL A 1 141 ? 11.536  -10.529 -1.994  1.00 2.32  ? 655 VAL A HG12 3  
ATOM 6464  H HG13 . VAL A 1 141 ? 12.250  -9.493  -0.755  1.00 2.39  ? 655 VAL A HG13 3  
ATOM 6465  H HG21 . VAL A 1 141 ? 11.836  -11.023 1.178   1.00 2.96  ? 655 VAL A HG21 3  
ATOM 6466  H HG22 . VAL A 1 141 ? 10.894  -12.028 0.072   1.00 2.54  ? 655 VAL A HG22 3  
ATOM 6467  H HG23 . VAL A 1 141 ? 12.201  -12.751 1.029   1.00 2.66  ? 655 VAL A HG23 3  
ATOM 6468  N N    . ALA A 1 142 ? 11.762  -12.702 -3.533  1.00 2.20  ? 656 ALA A N    3  
ATOM 6469  C CA   . ALA A 1 142 ? 10.644  -13.066 -4.406  1.00 2.38  ? 656 ALA A CA   3  
ATOM 6470  C C    . ALA A 1 142 ? 10.560  -14.575 -4.720  1.00 2.64  ? 656 ALA A C    3  
ATOM 6471  O O    . ALA A 1 142 ? 9.473   -15.063 -5.043  1.00 2.89  ? 656 ALA A O    3  
ATOM 6472  C CB   . ALA A 1 142 ? 10.759  -12.243 -5.693  1.00 2.35  ? 656 ALA A CB   3  
ATOM 6473  H H    . ALA A 1 142 ? 12.359  -11.933 -3.822  1.00 2.06  ? 656 ALA A H    3  
ATOM 6474  H HA   . ALA A 1 142 ? 9.715   -12.789 -3.908  1.00 2.45  ? 656 ALA A HA   3  
ATOM 6475  H HB1  . ALA A 1 142 ? 9.922   -12.470 -6.355  1.00 2.69  ? 656 ALA A HB1  3  
ATOM 6476  H HB2  . ALA A 1 142 ? 10.738  -11.178 -5.458  1.00 2.95  ? 656 ALA A HB2  3  
ATOM 6477  H HB3  . ALA A 1 142 ? 11.694  -12.475 -6.201  1.00 2.55  ? 656 ALA A HB3  3  
ATOM 6478  N N    . ILE A 1 143 ? 11.668  -15.318 -4.597  1.00 2.66  ? 657 ILE A N    3  
ATOM 6479  C CA   . ILE A 1 143 ? 11.686  -16.791 -4.607  1.00 2.94  ? 657 ILE A CA   3  
ATOM 6480  C C    . ILE A 1 143 ? 11.728  -17.380 -3.184  1.00 3.00  ? 657 ILE A C    3  
ATOM 6481  O O    . ILE A 1 143 ? 10.928  -18.260 -2.876  1.00 3.46  ? 657 ILE A O    3  
ATOM 6482  C CB   . ILE A 1 143 ? 12.783  -17.326 -5.555  1.00 3.07  ? 657 ILE A CB   3  
ATOM 6483  C CG1  . ILE A 1 143 ? 12.712  -18.866 -5.633  1.00 3.77  ? 657 ILE A CG1  3  
ATOM 6484  C CG2  . ILE A 1 143 ? 14.199  -16.850 -5.189  1.00 2.90  ? 657 ILE A CG2  3  
ATOM 6485  C CD1  . ILE A 1 143 ? 13.495  -19.447 -6.815  1.00 4.48  ? 657 ILE A CD1  3  
ATOM 6486  H H    . ILE A 1 143 ? 12.519  -14.837 -4.337  1.00 2.51  ? 657 ILE A H    3  
ATOM 6487  H HA   . ILE A 1 143 ? 10.748  -17.143 -5.038  1.00 3.17  ? 657 ILE A HA   3  
ATOM 6488  H HB   . ILE A 1 143 ? 12.555  -16.935 -6.548  1.00 3.47  ? 657 ILE A HB   3  
ATOM 6489  H HG12 . ILE A 1 143 ? 13.086  -19.307 -4.708  1.00 3.83  ? 657 ILE A HG12 3  
ATOM 6490  H HG13 . ILE A 1 143 ? 11.670  -19.164 -5.751  1.00 4.44  ? 657 ILE A HG13 3  
ATOM 6491  H HG21 . ILE A 1 143 ? 14.498  -17.264 -4.228  1.00 3.29  ? 657 ILE A HG21 3  
ATOM 6492  H HG22 . ILE A 1 143 ? 14.912  -17.177 -5.946  1.00 3.30  ? 657 ILE A HG22 3  
ATOM 6493  H HG23 . ILE A 1 143 ? 14.240  -15.762 -5.156  1.00 3.52  ? 657 ILE A HG23 3  
ATOM 6494  H HD11 . ILE A 1 143 ? 13.294  -20.513 -6.891  1.00 5.02  ? 657 ILE A HD11 3  
ATOM 6495  H HD12 . ILE A 1 143 ? 13.176  -18.960 -7.736  1.00 5.06  ? 657 ILE A HD12 3  
ATOM 6496  H HD13 . ILE A 1 143 ? 14.565  -19.301 -6.673  1.00 4.73  ? 657 ILE A HD13 3  
ATOM 6497  N N    . ASP A 1 144 ? 12.584  -16.875 -2.289  1.00 2.83  ? 658 ASP A N    3  
ATOM 6498  C CA   . ASP A 1 144 ? 12.793  -17.444 -0.944  1.00 3.10  ? 658 ASP A CA   3  
ATOM 6499  C C    . ASP A 1 144 ? 11.523  -17.414 -0.063  1.00 3.17  ? 658 ASP A C    3  
ATOM 6500  O O    . ASP A 1 144 ? 11.196  -18.399 0.604   1.00 3.50  ? 658 ASP A O    3  
ATOM 6501  C CB   . ASP A 1 144 ? 13.959  -16.691 -0.281  1.00 3.18  ? 658 ASP A CB   3  
ATOM 6502  C CG   . ASP A 1 144 ? 14.674  -17.513 0.792   1.00 3.65  ? 658 ASP A CG   3  
ATOM 6503  O OD1  . ASP A 1 144 ? 15.622  -18.253 0.434   1.00 4.41  ? 658 ASP A OD1  3  
ATOM 6504  O OD2  . ASP A 1 144 ? 14.343  -17.421 1.996   1.00 4.00  ? 658 ASP A OD2  3  
ATOM 6505  H H    . ASP A 1 144 ? 13.196  -16.123 -2.576  1.00 2.74  ? 658 ASP A H    3  
ATOM 6506  H HA   . ASP A 1 144 ? 13.084  -18.490 -1.063  1.00 3.36  ? 658 ASP A HA   3  
ATOM 6507  H HB2  . ASP A 1 144 ? 14.698  -16.447 -1.046  1.00 3.34  ? 658 ASP A HB2  3  
ATOM 6508  H HB3  . ASP A 1 144 ? 13.601  -15.751 0.139   1.00 3.06  ? 658 ASP A HB3  3  
ATOM 6509  N N    . ARG A 1 145 ? 10.745  -16.324 -0.131  1.00 2.97  ? 659 ARG A N    3  
ATOM 6510  C CA   . ARG A 1 145 ? 9.479   -16.112 0.576   1.00 3.13  ? 659 ARG A CA   3  
ATOM 6511  C C    . ARG A 1 145 ? 8.356   -17.053 0.138   1.00 3.41  ? 659 ARG A C    3  
ATOM 6512  O O    . ARG A 1 145 ? 7.424   -17.301 0.899   1.00 3.76  ? 659 ARG A O    3  
ATOM 6513  C CB   . ARG A 1 145 ? 9.098   -14.635 0.345   1.00 2.87  ? 659 ARG A CB   3  
ATOM 6514  C CG   . ARG A 1 145 ? 8.363   -14.367 -0.989  1.00 3.25  ? 659 ARG A CG   3  
ATOM 6515  C CD   . ARG A 1 145 ? 8.104   -12.879 -1.262  1.00 3.13  ? 659 ARG A CD   3  
ATOM 6516  N NE   . ARG A 1 145 ? 6.884   -12.408 -0.590  1.00 3.52  ? 659 ARG A NE   3  
ATOM 6517  C CZ   . ARG A 1 145 ? 5.644   -12.701 -0.938  1.00 4.29  ? 659 ARG A CZ   3  
ATOM 6518  N NH1  . ARG A 1 145 ? 5.370   -13.416 -1.992  1.00 5.17  ? 659 ARG A NH1  3  
ATOM 6519  N NH2  . ARG A 1 145 ? 4.645   -12.280 -0.226  1.00 4.91  ? 659 ARG A NH2  3  
ATOM 6520  H H    . ARG A 1 145 ? 11.061  -15.533 -0.681  1.00 2.74  ? 659 ARG A H    3  
ATOM 6521  H HA   . ARG A 1 145 ? 9.640   -16.277 1.641   1.00 3.36  ? 659 ARG A HA   3  
ATOM 6522  H HB2  . ARG A 1 145 ? 8.490   -14.297 1.165   1.00 2.92  ? 659 ARG A HB2  3  
ATOM 6523  H HB3  . ARG A 1 145 ? 10.000  -14.030 0.392   1.00 3.22  ? 659 ARG A HB3  3  
ATOM 6524  H HG2  . ARG A 1 145 ? 8.943   -14.772 -1.815  1.00 3.89  ? 659 ARG A HG2  3  
ATOM 6525  H HG3  . ARG A 1 145 ? 7.408   -14.891 -0.988  1.00 3.70  ? 659 ARG A HG3  3  
ATOM 6526  H HD2  . ARG A 1 145 ? 8.960   -12.290 -0.931  1.00 3.37  ? 659 ARG A HD2  3  
ATOM 6527  H HD3  . ARG A 1 145 ? 8.000   -12.724 -2.335  1.00 3.17  ? 659 ARG A HD3  3  
ATOM 6528  H HE   . ARG A 1 145 ? 7.020   -11.859 0.256   1.00 3.86  ? 659 ARG A HE   3  
ATOM 6529  H HH11 . ARG A 1 145 ? 6.107   -13.678 -2.639  1.00 5.24  ? 659 ARG A HH11 3  
ATOM 6530  H HH12 . ARG A 1 145 ? 4.421   -13.709 -2.181  1.00 6.18  ? 659 ARG A HH12 3  
ATOM 6531  H HH21 . ARG A 1 145 ? 4.837   -11.704 0.591   1.00 4.98  ? 659 ARG A HH21 3  
ATOM 6532  H HH22 . ARG A 1 145 ? 3.691   -12.456 -0.519  1.00 5.70  ? 659 ARG A HH22 3  
ATOM 6533  N N    . LEU A 1 146 ? 8.407   -17.507 -1.115  1.00 3.37  ? 660 LEU A N    3  
ATOM 6534  C CA   . LEU A 1 146 ? 7.354   -18.284 -1.777  1.00 3.67  ? 660 LEU A CA   3  
ATOM 6535  C C    . LEU A 1 146 ? 7.710   -19.779 -1.848  1.00 4.22  ? 660 LEU A C    3  
ATOM 6536  O O    . LEU A 1 146 ? 6.815   -20.623 -1.818  1.00 4.63  ? 660 LEU A O    3  
ATOM 6537  C CB   . LEU A 1 146 ? 7.072   -17.602 -3.131  1.00 3.80  ? 660 LEU A CB   3  
ATOM 6538  C CG   . LEU A 1 146 ? 5.766   -18.048 -3.820  1.00 4.15  ? 660 LEU A CG   3  
ATOM 6539  C CD1  . LEU A 1 146 ? 5.184   -16.913 -4.665  1.00 4.60  ? 660 LEU A CD1  3  
ATOM 6540  C CD2  . LEU A 1 146 ? 5.991   -19.222 -4.765  1.00 4.48  ? 660 LEU A CD2  3  
ATOM 6541  H H    . LEU A 1 146 ? 9.229   -17.274 -1.653  1.00 3.19  ? 660 LEU A H    3  
ATOM 6542  H HA   . LEU A 1 146 ? 6.442   -18.210 -1.182  1.00 3.90  ? 660 LEU A HA   3  
ATOM 6543  H HB2  . LEU A 1 146 ? 6.986   -16.534 -2.934  1.00 4.16  ? 660 LEU A HB2  3  
ATOM 6544  H HB3  . LEU A 1 146 ? 7.920   -17.742 -3.804  1.00 4.11  ? 660 LEU A HB3  3  
ATOM 6545  H HG   . LEU A 1 146 ? 5.033   -18.334 -3.069  1.00 4.78  ? 660 LEU A HG   3  
ATOM 6546  H HD11 . LEU A 1 146 ? 4.949   -16.063 -4.022  1.00 5.21  ? 660 LEU A HD11 3  
ATOM 6547  H HD12 . LEU A 1 146 ? 4.262   -17.240 -5.144  1.00 5.10  ? 660 LEU A HD12 3  
ATOM 6548  H HD13 . LEU A 1 146 ? 5.898   -16.601 -5.427  1.00 4.65  ? 660 LEU A HD13 3  
ATOM 6549  H HD21 . LEU A 1 146 ? 6.355   -20.080 -4.212  1.00 4.72  ? 660 LEU A HD21 3  
ATOM 6550  H HD22 . LEU A 1 146 ? 6.717   -18.947 -5.527  1.00 4.66  ? 660 LEU A HD22 3  
ATOM 6551  H HD23 . LEU A 1 146 ? 5.048   -19.492 -5.240  1.00 5.34  ? 660 LEU A HD23 3  
ATOM 6552  N N    . ASP A 1 147 ? 9.005   -20.101 -1.818  1.00 4.56  ? 661 ASP A N    3  
ATOM 6553  C CA   . ASP A 1 147 ? 9.620   -21.418 -1.993  1.00 5.56  ? 661 ASP A CA   3  
ATOM 6554  C C    . ASP A 1 147 ? 9.379   -22.050 -3.382  1.00 6.82  ? 661 ASP A C    3  
ATOM 6555  O O    . ASP A 1 147 ? 8.527   -21.605 -4.163  1.00 7.31  ? 661 ASP A O    3  
ATOM 6556  C CB   . ASP A 1 147 ? 9.265   -22.309 -0.790  1.00 5.37  ? 661 ASP A CB   3  
ATOM 6557  C CG   . ASP A 1 147 ? 10.418  -23.210 -0.353  1.00 6.24  ? 661 ASP A CG   3  
ATOM 6558  O OD1  . ASP A 1 147 ? 11.518  -22.682 -0.054  1.00 6.84  ? 661 ASP A OD1  3  
ATOM 6559  O OD2  . ASP A 1 147 ? 10.270  -24.454 -0.324  1.00 6.84  ? 661 ASP A OD2  3  
ATOM 6560  H H    . ASP A 1 147 ? 9.662   -19.337 -1.766  1.00 4.33  ? 661 ASP A H    3  
ATOM 6561  H HA   . ASP A 1 147 ? 10.694  -21.235 -1.942  1.00 6.30  ? 661 ASP A HA   3  
ATOM 6562  H HB2  . ASP A 1 147 ? 9.030   -21.655 0.048   1.00 5.03  ? 661 ASP A HB2  3  
ATOM 6563  H HB3  . ASP A 1 147 ? 8.378   -22.900 -1.020  1.00 5.66  ? 661 ASP A HB3  3  
ATOM 6564  N N    . ARG A 1 148 ? 10.189  -23.053 -3.744  1.00 7.96  ? 662 ARG A N    3  
ATOM 6565  C CA   . ARG A 1 148 ? 10.231  -23.616 -5.105  1.00 9.68  ? 662 ARG A CA   3  
ATOM 6566  C C    . ARG A 1 148 ? 9.024   -24.512 -5.382  1.00 10.22 ? 662 ARG A C    3  
ATOM 6567  O O    . ARG A 1 148 ? 8.218   -24.157 -6.238  1.00 11.30 ? 662 ARG A O    3  
ATOM 6568  C CB   . ARG A 1 148 ? 11.605  -24.270 -5.349  1.00 10.93 ? 662 ARG A CB   3  
ATOM 6569  C CG   . ARG A 1 148 ? 12.691  -23.183 -5.465  1.00 11.33 ? 662 ARG A CG   3  
ATOM 6570  C CD   . ARG A 1 148 ? 14.118  -23.719 -5.292  1.00 12.58 ? 662 ARG A CD   3  
ATOM 6571  N NE   . ARG A 1 148 ? 15.106  -22.622 -5.202  1.00 13.38 ? 662 ARG A NE   3  
ATOM 6572  C CZ   . ARG A 1 148 ? 15.278  -21.798 -4.185  1.00 13.51 ? 662 ARG A CZ   3  
ATOM 6573  N NH1  . ARG A 1 148 ? 14.568  -21.901 -3.104  1.00 12.82 ? 662 ARG A NH1  3  
ATOM 6574  N NH2  . ARG A 1 148 ? 16.152  -20.840 -4.213  1.00 14.63 ? 662 ARG A NH2  3  
ATOM 6575  H H    . ARG A 1 148 ? 10.900  -23.369 -3.089  1.00 7.94  ? 662 ARG A H    3  
ATOM 6576  H HA   . ARG A 1 148 ? 10.143  -22.804 -5.828  1.00 10.13 ? 662 ARG A HA   3  
ATOM 6577  H HB2  . ARG A 1 148 ? 11.834  -24.946 -4.527  1.00 10.90 ? 662 ARG A HB2  3  
ATOM 6578  H HB3  . ARG A 1 148 ? 11.590  -24.845 -6.274  1.00 12.01 ? 662 ARG A HB3  3  
ATOM 6579  H HG2  . ARG A 1 148 ? 12.612  -22.700 -6.437  1.00 11.80 ? 662 ARG A HG2  3  
ATOM 6580  H HG3  . ARG A 1 148 ? 12.516  -22.419 -4.709  1.00 10.65 ? 662 ARG A HG3  3  
ATOM 6581  H HD2  . ARG A 1 148 ? 14.173  -24.331 -4.390  1.00 12.40 ? 662 ARG A HD2  3  
ATOM 6582  H HD3  . ARG A 1 148 ? 14.362  -24.357 -6.140  1.00 13.40 ? 662 ARG A HD3  3  
ATOM 6583  H HE   . ARG A 1 148 ? 15.717  -22.488 -6.001  1.00 14.20 ? 662 ARG A HE   3  
ATOM 6584  H HH11 . ARG A 1 148 ? 13.888  -22.649 -3.024  1.00 12.12 ? 662 ARG A HH11 3  
ATOM 6585  H HH12 . ARG A 1 148 ? 14.652  -21.256 -2.330  1.00 13.18 ? 662 ARG A HH12 3  
ATOM 6586  H HH21 . ARG A 1 148 ? 16.785  -20.713 -5.002  1.00 15.36 ? 662 ARG A HH21 3  
ATOM 6587  H HH22 . ARG A 1 148 ? 16.238  -20.220 -3.418  1.00 14.95 ? 662 ARG A HH22 3  
ATOM 6588  N N    . ILE A 1 149 ? 8.814   -25.563 -4.586  1.00 9.80  ? 663 ILE A N    3  
ATOM 6589  C CA   . ILE A 1 149 ? 7.682   -26.513 -4.651  1.00 10.60 ? 663 ILE A CA   3  
ATOM 6590  C C    . ILE A 1 149 ? 7.568   -27.286 -5.981  1.00 12.37 ? 663 ILE A C    3  
ATOM 6591  O O    . ILE A 1 149 ? 7.668   -26.738 -7.079  1.00 13.13 ? 663 ILE A O    3  
ATOM 6592  C CB   . ILE A 1 149 ? 6.339   -25.843 -4.259  1.00 10.14 ? 663 ILE A CB   3  
ATOM 6593  C CG1  . ILE A 1 149 ? 6.403   -24.940 -3.013  1.00 8.63  ? 663 ILE A CG1  3  
ATOM 6594  C CG2  . ILE A 1 149 ? 5.222   -26.885 -4.077  1.00 11.13 ? 663 ILE A CG2  3  
ATOM 6595  C CD1  . ILE A 1 149 ? 6.867   -25.638 -1.735  1.00 8.50  ? 663 ILE A CD1  3  
ATOM 6596  H H    . ILE A 1 149 ? 9.504   -25.725 -3.859  1.00 9.15  ? 663 ILE A H    3  
ATOM 6597  H HA   . ILE A 1 149 ? 7.887   -27.262 -3.885  1.00 10.59 ? 663 ILE A HA   3  
ATOM 6598  H HB   . ILE A 1 149 ? 6.032   -25.197 -5.076  1.00 10.63 ? 663 ILE A HB   3  
ATOM 6599  H HG12 . ILE A 1 149 ? 7.056   -24.090 -3.208  1.00 8.18  ? 663 ILE A HG12 3  
ATOM 6600  H HG13 . ILE A 1 149 ? 5.403   -24.551 -2.841  1.00 8.61  ? 663 ILE A HG13 3  
ATOM 6601  H HG21 . ILE A 1 149 ? 5.016   -27.371 -5.025  1.00 12.00 ? 663 ILE A HG21 3  
ATOM 6602  H HG22 . ILE A 1 149 ? 5.514   -27.642 -3.347  1.00 11.22 ? 663 ILE A HG22 3  
ATOM 6603  H HG23 . ILE A 1 149 ? 4.304   -26.404 -3.739  1.00 11.26 ? 663 ILE A HG23 3  
ATOM 6604  H HD11 . ILE A 1 149 ? 7.850   -26.073 -1.888  1.00 8.93  ? 663 ILE A HD11 3  
ATOM 6605  H HD12 . ILE A 1 149 ? 6.924   -24.905 -0.932  1.00 8.22  ? 663 ILE A HD12 3  
ATOM 6606  H HD13 . ILE A 1 149 ? 6.160   -26.418 -1.461  1.00 8.86  ? 663 ILE A HD13 3  
ATOM 6607  N N    . GLY A 1 150 ? 7.284   -28.586 -5.900  1.00 13.35 ? 664 GLY A N    3  
ATOM 6608  C CA   . GLY A 1 150 ? 7.277   -29.490 -7.057  1.00 15.22 ? 664 GLY A CA   3  
ATOM 6609  C C    . GLY A 1 150 ? 6.170   -29.174 -8.068  1.00 15.93 ? 664 GLY A C    3  
ATOM 6610  O O    . GLY A 1 150 ? 6.391   -29.253 -9.280  1.00 17.29 ? 664 GLY A O    3  
ATOM 6611  H H    . GLY A 1 150 ? 7.070   -28.960 -4.982  1.00 12.95 ? 664 GLY A H    3  
ATOM 6612  H HA2  . GLY A 1 150 ? 8.241   -29.433 -7.567  1.00 15.81 ? 664 GLY A HA2  3  
ATOM 6613  H HA3  . GLY A 1 150 ? 7.135   -30.511 -6.703  1.00 15.85 ? 664 GLY A HA3  3  
ATOM 6614  N N    . LYS A 1 151 ? 4.993   -28.746 -7.591  1.00 15.25 ? 665 LYS A N    3  
ATOM 6615  C CA   . LYS A 1 151 ? 3.819   -28.426 -8.422  1.00 16.13 ? 665 LYS A CA   3  
ATOM 6616  C C    . LYS A 1 151 ? 3.835   -27.048 -9.105  1.00 16.74 ? 665 LYS A C    3  
ATOM 6617  O O    . LYS A 1 151 ? 2.827   -26.637 -9.681  1.00 17.20 ? 665 LYS A O    3  
ATOM 6618  C CB   . LYS A 1 151 ? 2.505   -28.758 -7.681  1.00 15.70 ? 665 LYS A CB   3  
ATOM 6619  C CG   . LYS A 1 151 ? 2.275   -28.075 -6.323  1.00 14.51 ? 665 LYS A CG   3  
ATOM 6620  C CD   . LYS A 1 151 ? 2.076   -26.554 -6.329  1.00 13.87 ? 665 LYS A CD   3  
ATOM 6621  C CE   . LYS A 1 151 ? 0.772   -26.172 -7.037  1.00 14.82 ? 665 LYS A CE   3  
ATOM 6622  N NZ   . LYS A 1 151 ? 0.442   -24.743 -6.851  1.00 14.42 ? 665 LYS A NZ   3  
ATOM 6623  H H    . LYS A 1 151 ? 4.872   -28.792 -6.582  1.00 14.32 ? 665 LYS A H    3  
ATOM 6624  H HA   . LYS A 1 151 ? 3.861   -29.124 -9.251  1.00 17.16 ? 665 LYS A HA   3  
ATOM 6625  H HB2  . LYS A 1 151 ? 1.661   -28.543 -8.336  1.00 16.18 ? 665 LYS A HB2  3  
ATOM 6626  H HB3  . LYS A 1 151 ? 2.498   -29.835 -7.504  1.00 16.14 ? 665 LYS A HB3  3  
ATOM 6627  H HG2  . LYS A 1 151 ? 1.395   -28.526 -5.864  1.00 14.71 ? 665 LYS A HG2  3  
ATOM 6628  H HG3  . LYS A 1 151 ? 3.114   -28.300 -5.674  1.00 14.21 ? 665 LYS A HG3  3  
ATOM 6629  H HD2  . LYS A 1 151 ? 2.026   -26.232 -5.290  1.00 13.33 ? 665 LYS A HD2  3  
ATOM 6630  H HD3  . LYS A 1 151 ? 2.926   -26.050 -6.789  1.00 13.56 ? 665 LYS A HD3  3  
ATOM 6631  H HE2  . LYS A 1 151 ? 0.858   -26.397 -8.104  1.00 15.49 ? 665 LYS A HE2  3  
ATOM 6632  H HE3  . LYS A 1 151 ? -0.038  -26.781 -6.626  1.00 15.48 ? 665 LYS A HE3  3  
ATOM 6633  H HZ1  . LYS A 1 151 ? -0.469  -24.529 -7.254  1.00 14.98 ? 665 LYS A HZ1  3  
ATOM 6634  H HZ2  . LYS A 1 151 ? 1.109   -24.146 -7.334  1.00 14.18 ? 665 LYS A HZ2  3  
ATOM 6635  H HZ3  . LYS A 1 151 ? 0.442   -24.497 -5.862  1.00 14.08 ? 665 LYS A HZ3  3  
ATOM 6636  N N    . LYS A 1 152 ? 4.960   -26.327 -9.057  1.00 17.04 ? 666 LYS A N    3  
ATOM 6637  C CA   . LYS A 1 152 ? 5.146   -25.007 -9.689  1.00 17.97 ? 666 LYS A CA   3  
ATOM 6638  C C    . LYS A 1 152 ? 4.948   -25.050 -11.213 1.00 19.21 ? 666 LYS A C    3  
ATOM 6639  O O    . LYS A 1 152 ? 5.273   -26.054 -11.854 1.00 19.90 ? 666 LYS A O    3  
ATOM 6640  C CB   . LYS A 1 152 ? 6.541   -24.493 -9.300  1.00 18.26 ? 666 LYS A CB   3  
ATOM 6641  C CG   . LYS A 1 152 ? 6.807   -23.022 -9.656  1.00 18.72 ? 666 LYS A CG   3  
ATOM 6642  C CD   . LYS A 1 152 ? 8.253   -22.660 -9.308  1.00 19.07 ? 666 LYS A CD   3  
ATOM 6643  C CE   . LYS A 1 152 ? 8.710   -21.305 -9.853  1.00 20.05 ? 666 LYS A CE   3  
ATOM 6644  N NZ   . LYS A 1 152 ? 10.021  -20.942 -9.265  1.00 20.33 ? 666 LYS A NZ   3  
ATOM 6645  H H    . LYS A 1 152 ? 5.746   -26.722 -8.556  1.00 16.78 ? 666 LYS A H    3  
ATOM 6646  H HA   . LYS A 1 152 ? 4.405   -24.323 -9.282  1.00 17.81 ? 666 LYS A HA   3  
ATOM 6647  H HB2  . LYS A 1 152 ? 6.648   -24.591 -8.221  1.00 17.74 ? 666 LYS A HB2  3  
ATOM 6648  H HB3  . LYS A 1 152 ? 7.293   -25.124 -9.778  1.00 18.90 ? 666 LYS A HB3  3  
ATOM 6649  H HG2  . LYS A 1 152 ? 6.656   -22.860 -10.715 1.00 19.47 ? 666 LYS A HG2  3  
ATOM 6650  H HG3  . LYS A 1 152 ? 6.119   -22.386 -9.102  1.00 18.35 ? 666 LYS A HG3  3  
ATOM 6651  H HD2  . LYS A 1 152 ? 8.363   -22.660 -8.226  1.00 18.42 ? 666 LYS A HD2  3  
ATOM 6652  H HD3  . LYS A 1 152 ? 8.906   -23.425 -9.729  1.00 19.51 ? 666 LYS A HD3  3  
ATOM 6653  H HE2  . LYS A 1 152 ? 8.793   -21.378 -10.941 1.00 20.79 ? 666 LYS A HE2  3  
ATOM 6654  H HE3  . LYS A 1 152 ? 7.967   -20.541 -9.615  1.00 20.06 ? 666 LYS A HE3  3  
ATOM 6655  H HZ1  . LYS A 1 152 ? 10.481  -20.190 -9.765  1.00 21.08 ? 666 LYS A HZ1  3  
ATOM 6656  H HZ2  . LYS A 1 152 ? 10.630  -21.757 -9.246  1.00 20.38 ? 666 LYS A HZ2  3  
ATOM 6657  H HZ3  . LYS A 1 152 ? 9.908   -20.679 -8.289  1.00 19.90 ? 666 LYS A HZ3  3  
ATOM 6658  N N    . ASN A 1 153 ? 4.451   -23.964 -11.800 1.00 19.69 ? 667 ASN A N    3  
ATOM 6659  C CA   . ASN A 1 153 ? 4.419   -23.760 -13.250 1.00 20.97 ? 667 ASN A CA   3  
ATOM 6660  C C    . ASN A 1 153 ? 5.827   -23.482 -13.816 1.00 21.66 ? 667 ASN A C    3  
ATOM 6661  O O    . ASN A 1 153 ? 6.713   -22.977 -13.122 1.00 21.32 ? 667 ASN A O    3  
ATOM 6662  C CB   . ASN A 1 153 ? 3.425   -22.630 -13.584 1.00 21.31 ? 667 ASN A CB   3  
ATOM 6663  C CG   . ASN A 1 153 ? 3.100   -22.575 -15.066 1.00 22.49 ? 667 ASN A CG   3  
ATOM 6664  O OD1  . ASN A 1 153 ? 3.556   -21.715 -15.810 1.00 23.00 ? 667 ASN A OD1  3  
ATOM 6665  N ND2  . ASN A 1 153 ? 2.350   -23.531 -15.546 1.00 23.16 ? 667 ASN A ND2  3  
ATOM 6666  H H    . ASN A 1 153 ? 4.168   -23.191 -11.209 1.00 19.26 ? 667 ASN A H    3  
ATOM 6667  H HA   . ASN A 1 153 ? 4.052   -24.680 -13.711 1.00 21.43 ? 667 ASN A HA   3  
ATOM 6668  H HB2  . ASN A 1 153 ? 2.491   -22.799 -13.045 1.00 21.12 ? 667 ASN A HB2  3  
ATOM 6669  H HB3  . ASN A 1 153 ? 3.834   -21.668 -13.273 1.00 21.09 ? 667 ASN A HB3  3  
ATOM 6670  H HD21 . ASN A 1 153 ? 1.988   -24.246 -14.921 1.00 22.91 ? 667 ASN A HD21 3  
ATOM 6671  H HD22 . ASN A 1 153 ? 2.139   -23.542 -16.539 1.00 24.03 ? 667 ASN A HD22 3  
ATOM 6672  N N    . SER A 1 154 ? 6.051   -23.790 -15.088 1.00 22.85 ? 668 SER A N    3  
ATOM 6673  C CA   . SER A 1 154 ? 7.331   -23.544 -15.768 1.00 23.82 ? 668 SER A CA   3  
ATOM 6674  C C    . SER A 1 154 ? 7.592   -22.045 -16.022 1.00 24.13 ? 668 SER A C    3  
ATOM 6675  O O    . SER A 1 154 ? 6.766   -21.199 -15.670 1.00 23.95 ? 668 SER A O    3  
ATOM 6676  C CB   . SER A 1 154 ? 7.385   -24.383 -17.044 1.00 25.14 ? 668 SER A CB   3  
ATOM 6677  O OG   . SER A 1 154 ? 7.161   -25.740 -16.690 1.00 25.01 ? 668 SER A OG   3  
ATOM 6678  H H    . SER A 1 154 ? 5.318   -24.254 -15.611 1.00 23.23 ? 668 SER A H    3  
ATOM 6679  H HA   . SER A 1 154 ? 8.137   -23.897 -15.127 1.00 23.59 ? 668 SER A HA   3  
ATOM 6680  H HB2  . SER A 1 154 ? 6.618   -24.051 -17.745 1.00 26.05 ? 668 SER A HB2  3  
ATOM 6681  H HB3  . SER A 1 154 ? 8.366   -24.280 -17.506 1.00 25.46 ? 668 SER A HB3  3  
ATOM 6682  H HG   . SER A 1 154 ? 7.334   -26.278 -17.499 1.00 25.79 ? 668 SER A HG   3  
ATOM 6683  N N    . ILE A 1 155 ? 8.745   -21.700 -16.608 1.00 24.76 ? 669 ILE A N    3  
ATOM 6684  C CA   . ILE A 1 155 ? 9.245   -20.313 -16.714 1.00 25.18 ? 669 ILE A CA   3  
ATOM 6685  C C    . ILE A 1 155 ? 8.284   -19.328 -17.410 1.00 25.53 ? 669 ILE A C    3  
ATOM 6686  O O    . ILE A 1 155 ? 7.356   -19.737 -18.112 1.00 25.80 ? 669 ILE A O    3  
ATOM 6687  C CB   . ILE A 1 155 ? 10.643  -20.278 -17.371 1.00 26.31 ? 669 ILE A CB   3  
ATOM 6688  C CG1  . ILE A 1 155 ? 10.621  -20.598 -18.883 1.00 27.46 ? 669 ILE A CG1  3  
ATOM 6689  C CG2  . ILE A 1 155 ? 11.607  -21.210 -16.614 1.00 26.20 ? 669 ILE A CG2  3  
ATOM 6690  C CD1  . ILE A 1 155 ? 11.956  -20.272 -19.563 1.00 28.70 ? 669 ILE A CD1  3  
ATOM 6691  H H    . ILE A 1 155 ? 9.384   -22.436 -16.871 1.00 25.02 ? 669 ILE A H    3  
ATOM 6692  H HA   . ILE A 1 155 ? 9.367   -19.945 -15.694 1.00 24.57 ? 669 ILE A HA   3  
ATOM 6693  H HB   . ILE A 1 155 ? 11.018  -19.261 -17.259 1.00 26.57 ? 669 ILE A HB   3  
ATOM 6694  H HG12 . ILE A 1 155 ? 10.377  -21.650 -19.041 1.00 27.41 ? 669 ILE A HG12 3  
ATOM 6695  H HG13 . ILE A 1 155 ? 9.858   -19.997 -19.375 1.00 27.64 ? 669 ILE A HG13 3  
ATOM 6696  H HG21 . ILE A 1 155 ? 11.359  -22.254 -16.799 1.00 26.30 ? 669 ILE A HG21 3  
ATOM 6697  H HG22 . ILE A 1 155 ? 12.626  -21.042 -16.949 1.00 26.68 ? 669 ILE A HG22 3  
ATOM 6698  H HG23 . ILE A 1 155 ? 11.560  -21.011 -15.543 1.00 25.73 ? 669 ILE A HG23 3  
ATOM 6699  H HD11 . ILE A 1 155 ? 12.260  -19.257 -19.309 1.00 28.80 ? 669 ILE A HD11 3  
ATOM 6700  H HD12 . ILE A 1 155 ? 12.726  -20.971 -19.247 1.00 28.87 ? 669 ILE A HD12 3  
ATOM 6701  H HD13 . ILE A 1 155 ? 11.845  -20.340 -20.643 1.00 29.48 ? 669 ILE A HD13 3  
ATOM 6702  N N    . LEU A 1 156 ? 8.511   -18.022 -17.226 1.00 25.76 ? 670 LEU A N    3  
ATOM 6703  C CA   . LEU A 1 156 ? 7.670   -16.918 -17.683 1.00 26.27 ? 670 LEU A CA   3  
ATOM 6704  C C    . LEU A 1 156 ? 8.304   -16.157 -18.871 1.00 27.59 ? 670 LEU A C    3  
ATOM 6705  O O    . LEU A 1 156 ? 9.522   -15.970 -18.910 1.00 28.00 ? 670 LEU A O    3  
ATOM 6706  C CB   . LEU A 1 156 ? 7.456   -16.033 -16.441 1.00 25.63 ? 670 LEU A CB   3  
ATOM 6707  C CG   . LEU A 1 156 ? 6.490   -14.866 -16.649 1.00 26.14 ? 670 LEU A CG   3  
ATOM 6708  C CD1  . LEU A 1 156 ? 5.091   -15.373 -17.006 1.00 26.34 ? 670 LEU A CD1  3  
ATOM 6709  C CD2  . LEU A 1 156 ? 6.400   -14.022 -15.378 1.00 25.71 ? 670 LEU A CD2  3  
ATOM 6710  H H    . LEU A 1 156 ? 9.277   -17.738 -16.627 1.00 25.67 ? 670 LEU A H    3  
ATOM 6711  H HA   . LEU A 1 156 ? 6.708   -17.315 -18.001 1.00 26.34 ? 670 LEU A HA   3  
ATOM 6712  H HB2  . LEU A 1 156 ? 7.082   -16.650 -15.623 1.00 25.04 ? 670 LEU A HB2  3  
ATOM 6713  H HB3  . LEU A 1 156 ? 8.422   -15.624 -16.137 1.00 25.58 ? 670 LEU A HB3  3  
ATOM 6714  H HG   . LEU A 1 156 ? 6.886   -14.253 -17.451 1.00 26.89 ? 670 LEU A HG   3  
ATOM 6715  H HD11 . LEU A 1 156 ? 5.085   -15.797 -18.007 1.00 26.81 ? 670 LEU A HD11 3  
ATOM 6716  H HD12 . LEU A 1 156 ? 4.382   -14.549 -16.990 1.00 26.73 ? 670 LEU A HD12 3  
ATOM 6717  H HD13 . LEU A 1 156 ? 4.773   -16.123 -16.285 1.00 25.83 ? 670 LEU A HD13 3  
ATOM 6718  H HD21 . LEU A 1 156 ? 7.391   -13.656 -15.109 1.00 25.76 ? 670 LEU A HD21 3  
ATOM 6719  H HD22 . LEU A 1 156 ? 6.004   -14.621 -14.557 1.00 25.11 ? 670 LEU A HD22 3  
ATOM 6720  H HD23 . LEU A 1 156 ? 5.747   -13.168 -15.548 1.00 26.17 ? 670 LEU A HD23 3  
ATOM 6721  N N    . LEU A 1 157 ? 7.496   -15.703 -19.837 1.00 28.41 ? 671 LEU A N    3  
ATOM 6722  C CA   . LEU A 1 157 ? 7.968   -15.049 -21.072 1.00 29.80 ? 671 LEU A CA   3  
ATOM 6723  C C    . LEU A 1 157 ? 8.503   -13.616 -20.853 1.00 30.17 ? 671 LEU A C    3  
ATOM 6724  O O    . LEU A 1 157 ? 8.126   -12.926 -19.902 1.00 29.54 ? 671 LEU A O    3  
ATOM 6725  C CB   . LEU A 1 157 ? 6.850   -15.126 -22.128 1.00 30.63 ? 671 LEU A CB   3  
ATOM 6726  C CG   . LEU A 1 157 ? 7.147   -14.537 -23.522 1.00 32.05 ? 671 LEU A CG   3  
ATOM 6727  C CD1  . LEU A 1 157 ? 8.359   -15.178 -24.211 1.00 32.82 ? 671 LEU A CD1  3  
ATOM 6728  C CD2  . LEU A 1 157 ? 5.923   -14.750 -24.411 1.00 32.80 ? 671 LEU A CD2  3  
ATOM 6729  H H    . LEU A 1 157 ? 6.500   -15.860 -19.751 1.00 28.19 ? 671 LEU A H    3  
ATOM 6730  H HA   . LEU A 1 157 ? 8.799   -15.643 -21.451 1.00 30.17 ? 671 LEU A HA   3  
ATOM 6731  H HB2  . LEU A 1 157 ? 6.598   -16.177 -22.260 1.00 30.48 ? 671 LEU A HB2  3  
ATOM 6732  H HB3  . LEU A 1 157 ? 5.971   -14.619 -21.730 1.00 30.48 ? 671 LEU A HB3  3  
ATOM 6733  H HG   . LEU A 1 157 ? 7.314   -13.465 -23.434 1.00 32.18 ? 671 LEU A HG   3  
ATOM 6734  H HD11 . LEU A 1 157 ? 9.276   -15.049 -23.638 1.00 32.71 ? 671 LEU A HD11 3  
ATOM 6735  H HD12 . LEU A 1 157 ? 8.511   -14.713 -25.183 1.00 33.68 ? 671 LEU A HD12 3  
ATOM 6736  H HD13 . LEU A 1 157 ? 8.185   -16.242 -24.358 1.00 32.84 ? 671 LEU A HD13 3  
ATOM 6737  H HD21 . LEU A 1 157 ? 5.742   -15.813 -24.556 1.00 32.87 ? 671 LEU A HD21 3  
ATOM 6738  H HD22 . LEU A 1 157 ? 6.088   -14.284 -25.378 1.00 33.60 ? 671 LEU A HD22 3  
ATOM 6739  H HD23 . LEU A 1 157 ? 5.044   -14.297 -23.952 1.00 32.64 ? 671 LEU A HD23 3  
ATOM 6740  N N    . HIS A 1 158 ? 9.378   -13.194 -21.766 1.00 31.36 ? 672 HIS A N    3  
ATOM 6741  C CA   . HIS A 1 158 ? 10.213  -11.994 -21.754 1.00 32.08 ? 672 HIS A CA   3  
ATOM 6742  C C    . HIS A 1 158 ? 9.481   -10.655 -21.886 1.00 32.50 ? 672 HIS A C    3  
ATOM 6743  O O    . HIS A 1 158 ? 9.755   -9.753  -21.063 1.00 32.27 ? 672 HIS A O    3  
ATOM 6744  C CB   . HIS A 1 158 ? 11.238  -12.173 -22.882 1.00 33.27 ? 672 HIS A CB   3  
ATOM 6745  C CG   . HIS A 1 158 ? 12.313  -11.119 -22.891 1.00 34.15 ? 672 HIS A CG   3  
ATOM 6746  N ND1  . HIS A 1 158 ? 13.157  -10.818 -21.849 1.00 33.99 ? 672 HIS A ND1  3  
ATOM 6747  C CD2  . HIS A 1 158 ? 12.588  -10.240 -23.903 1.00 35.37 ? 672 HIS A CD2  3  
ATOM 6748  C CE1  . HIS A 1 158 ? 13.939  -9.791  -22.220 1.00 35.09 ? 672 HIS A CE1  3  
ATOM 6749  N NE2  . HIS A 1 158 ? 13.607  -9.383  -23.461 1.00 35.95 ? 672 HIS A NE2  3  
ATOM 6750  H H    . HIS A 1 158 ? 9.570   -13.836 -22.517 1.00 31.89 ? 672 HIS A H    3  
ATOM 6751  H HA   . HIS A 1 158 ? 10.742  -11.971 -20.806 1.00 31.63 ? 672 HIS A HA   3  
ATOM 6752  H HB2  . HIS A 1 158 ? 11.696  -13.158 -22.788 1.00 33.09 ? 672 HIS A HB2  3  
ATOM 6753  H HB3  . HIS A 1 158 ? 10.716  -12.148 -23.840 1.00 33.84 ? 672 HIS A HB3  3  
ATOM 6754  H HD1  . HIS A 1 158 ? 13.161  -11.273 -20.936 1.00 33.25 ? 672 HIS A HD1  3  
ATOM 6755  H HD2  . HIS A 1 158 ? 12.081  -10.198 -24.859 1.00 35.89 ? 672 HIS A HD2  3  
ATOM 6756  H HE1  . HIS A 1 158 ? 14.695  -9.329  -21.592 1.00 35.35 ? 672 HIS A HE1  3  
ATOM 6757  N N    . ASN A 1 20  ? 7.419   13.386  7.058   1.00 4.60  ? 534 ASN A N    4  
ATOM 6758  C CA   . ASN A 1 20  ? 7.267   13.269  5.598   1.00 3.59  ? 534 ASN A CA   4  
ATOM 6759  C C    . ASN A 1 20  ? 6.870   11.862  5.092   1.00 2.59  ? 534 ASN A C    4  
ATOM 6760  O O    . ASN A 1 20  ? 7.167   10.840  5.713   1.00 3.04  ? 534 ASN A O    4  
ATOM 6761  C CB   . ASN A 1 20  ? 8.542   13.767  4.892   1.00 4.72  ? 534 ASN A CB   4  
ATOM 6762  C CG   . ASN A 1 20  ? 8.740   15.266  4.987   1.00 5.65  ? 534 ASN A CG   4  
ATOM 6763  O OD1  . ASN A 1 20  ? 9.650   15.745  5.650   1.00 6.61  ? 534 ASN A OD1  4  
ATOM 6764  N ND2  . ASN A 1 20  ? 7.912   16.047  4.340   1.00 6.16  ? 534 ASN A ND2  4  
ATOM 6765  H H    . ASN A 1 20  ? 8.301   13.705  7.431   1.00 5.34  ? 534 ASN A H    4  
ATOM 6766  H HA   . ASN A 1 20  ? 6.444   13.928  5.313   1.00 3.65  ? 534 ASN A HA   4  
ATOM 6767  H HB2  . ASN A 1 20  ? 9.415   13.260  5.302   1.00 5.65  ? 534 ASN A HB2  4  
ATOM 6768  H HB3  . ASN A 1 20  ? 8.480   13.527  3.832   1.00 4.98  ? 534 ASN A HB3  4  
ATOM 6769  H HD21 . ASN A 1 20  ? 7.165   15.645  3.777   1.00 5.91  ? 534 ASN A HD21 4  
ATOM 6770  H HD22 . ASN A 1 20  ? 8.051   17.053  4.397   1.00 7.19  ? 534 ASN A HD22 4  
ATOM 6771  N N    . CYS A 1 21  ? 6.251   11.819  3.905   1.00 1.92  ? 535 CYS A N    4  
ATOM 6772  C CA   . CYS A 1 21  ? 5.636   10.635  3.282   1.00 1.65  ? 535 CYS A CA   4  
ATOM 6773  C C    . CYS A 1 21  ? 6.549   9.389   3.209   1.00 1.30  ? 535 CYS A C    4  
ATOM 6774  O O    . CYS A 1 21  ? 6.061   8.264   3.355   1.00 1.23  ? 535 CYS A O    4  
ATOM 6775  C CB   . CYS A 1 21  ? 5.135   11.048  1.889   1.00 2.68  ? 535 CYS A CB   4  
ATOM 6776  S SG   . CYS A 1 21  ? 4.033   9.776   1.205   1.00 3.62  ? 535 CYS A SG   4  
ATOM 6777  H H    . CYS A 1 21  ? 6.101   12.711  3.441   1.00 2.41  ? 535 CYS A H    4  
ATOM 6778  H HA   . CYS A 1 21  ? 4.770   10.359  3.882   1.00 1.93  ? 535 CYS A HA   4  
ATOM 6779  H HB2  . CYS A 1 21  ? 4.587   11.991  1.951   1.00 3.19  ? 535 CYS A HB2  4  
ATOM 6780  H HB3  . CYS A 1 21  ? 5.986   11.188  1.221   1.00 3.62  ? 535 CYS A HB3  4  
ATOM 6781  H HG   . CYS A 1 21  ? 2.934   10.122  1.887   1.00 3.78  ? 535 CYS A HG   4  
ATOM 6782  N N    . ARG A 1 22  ? 7.877   9.557   3.097   1.00 1.33  ? 536 ARG A N    4  
ATOM 6783  C CA   . ARG A 1 22  ? 8.868   8.462   3.212   1.00 1.26  ? 536 ARG A CA   4  
ATOM 6784  C C    . ARG A 1 22  ? 8.720   7.595   4.474   1.00 1.22  ? 536 ARG A C    4  
ATOM 6785  O O    . ARG A 1 22  ? 9.028   6.405   4.418   1.00 1.26  ? 536 ARG A O    4  
ATOM 6786  C CB   . ARG A 1 22  ? 10.295  9.029   3.068   1.00 1.57  ? 536 ARG A CB   4  
ATOM 6787  C CG   . ARG A 1 22  ? 10.743  9.928   4.236   1.00 1.70  ? 536 ARG A CG   4  
ATOM 6788  C CD   . ARG A 1 22  ? 12.168  10.453  4.016   1.00 2.03  ? 536 ARG A CD   4  
ATOM 6789  N NE   . ARG A 1 22  ? 12.620  11.279  5.151   1.00 2.52  ? 536 ARG A NE   4  
ATOM 6790  C CZ   . ARG A 1 22  ? 13.697  12.048  5.175   1.00 3.02  ? 536 ARG A CZ   4  
ATOM 6791  N NH1  . ARG A 1 22  ? 14.553  12.122  4.198   1.00 3.49  ? 536 ARG A NH1  4  
ATOM 6792  N NH2  . ARG A 1 22  ? 13.974  12.793  6.200   1.00 3.90  ? 536 ARG A NH2  4  
ATOM 6793  H H    . ARG A 1 22  ? 8.205   10.494  2.874   1.00 1.63  ? 536 ARG A H    4  
ATOM 6794  H HA   . ARG A 1 22  ? 8.704   7.772   2.382   1.00 1.25  ? 536 ARG A HA   4  
ATOM 6795  H HB2  . ARG A 1 22  ? 10.991  8.191   2.989   1.00 2.41  ? 536 ARG A HB2  4  
ATOM 6796  H HB3  . ARG A 1 22  ? 10.355  9.597   2.139   1.00 2.10  ? 536 ARG A HB3  4  
ATOM 6797  H HG2  . ARG A 1 22  ? 10.061  10.775  4.330   1.00 2.25  ? 536 ARG A HG2  4  
ATOM 6798  H HG3  . ARG A 1 22  ? 10.727  9.355   5.164   1.00 2.44  ? 536 ARG A HG3  4  
ATOM 6799  H HD2  . ARG A 1 22  ? 12.844  9.605   3.896   1.00 2.70  ? 536 ARG A HD2  4  
ATOM 6800  H HD3  . ARG A 1 22  ? 12.184  11.046  3.099   1.00 2.43  ? 536 ARG A HD3  4  
ATOM 6801  H HE   . ARG A 1 22  ? 12.067  11.247  6.000   1.00 3.22  ? 536 ARG A HE   4  
ATOM 6802  H HH11 . ARG A 1 22  ? 14.473  11.523  3.384   1.00 3.60  ? 536 ARG A HH11 4  
ATOM 6803  H HH12 . ARG A 1 22  ? 15.360  12.726  4.318   1.00 4.22  ? 536 ARG A HH12 4  
ATOM 6804  H HH21 . ARG A 1 22  ? 13.404  12.776  7.035   1.00 4.45  ? 536 ARG A HH21 4  
ATOM 6805  H HH22 . ARG A 1 22  ? 14.826  13.342  6.156   1.00 4.41  ? 536 ARG A HH22 4  
ATOM 6806  N N    . LYS A 1 23  ? 8.209   8.139   5.589   1.00 1.30  ? 537 LYS A N    4  
ATOM 6807  C CA   . LYS A 1 23  ? 7.882   7.391   6.815   1.00 1.39  ? 537 LYS A CA   4  
ATOM 6808  C C    . LYS A 1 23  ? 6.639   6.510   6.664   1.00 1.37  ? 537 LYS A C    4  
ATOM 6809  O O    . LYS A 1 23  ? 6.554   5.462   7.304   1.00 1.54  ? 537 LYS A O    4  
ATOM 6810  C CB   . LYS A 1 23  ? 7.713   8.407   7.964   1.00 1.54  ? 537 LYS A CB   4  
ATOM 6811  C CG   . LYS A 1 23  ? 7.442   7.794   9.350   1.00 2.11  ? 537 LYS A CG   4  
ATOM 6812  C CD   . LYS A 1 23  ? 8.518   6.775   9.744   1.00 3.11  ? 537 LYS A CD   4  
ATOM 6813  C CE   . LYS A 1 23  ? 8.411   6.308   11.200  1.00 3.62  ? 537 LYS A CE   4  
ATOM 6814  N NZ   . LYS A 1 23  ? 7.140   5.607   11.501  1.00 4.58  ? 537 LYS A NZ   4  
ATOM 6815  H H    . LYS A 1 23  ? 7.993   9.130   5.583   1.00 1.40  ? 537 LYS A H    4  
ATOM 6816  H HA   . LYS A 1 23  ? 8.716   6.727   7.041   1.00 1.51  ? 537 LYS A HA   4  
ATOM 6817  H HB2  . LYS A 1 23  ? 8.622   9.006   8.031   1.00 1.62  ? 537 LYS A HB2  4  
ATOM 6818  H HB3  . LYS A 1 23  ? 6.889   9.083   7.728   1.00 2.14  ? 537 LYS A HB3  4  
ATOM 6819  H HG2  . LYS A 1 23  ? 7.426   8.600   10.084  1.00 2.47  ? 537 LYS A HG2  4  
ATOM 6820  H HG3  . LYS A 1 23  ? 6.463   7.313   9.350   1.00 3.16  ? 537 LYS A HG3  4  
ATOM 6821  H HD2  . LYS A 1 23  ? 8.465   5.906   9.089   1.00 4.23  ? 537 LYS A HD2  4  
ATOM 6822  H HD3  . LYS A 1 23  ? 9.494   7.241   9.601   1.00 3.53  ? 537 LYS A HD3  4  
ATOM 6823  H HE2  . LYS A 1 23  ? 9.246   5.629   11.400  1.00 4.00  ? 537 LYS A HE2  4  
ATOM 6824  H HE3  . LYS A 1 23  ? 8.523   7.172   11.860  1.00 3.64  ? 537 LYS A HE3  4  
ATOM 6825  H HZ1  . LYS A 1 23  ? 6.342   6.243   11.496  1.00 4.68  ? 537 LYS A HZ1  4  
ATOM 6826  H HZ2  . LYS A 1 23  ? 7.201   5.190   12.430  1.00 5.05  ? 537 LYS A HZ2  4  
ATOM 6827  H HZ3  . LYS A 1 23  ? 6.950   4.867   10.831  1.00 5.42  ? 537 LYS A HZ3  4  
ATOM 6828  N N    . LEU A 1 24  ? 5.688   6.910   5.821   1.00 1.28  ? 538 LEU A N    4  
ATOM 6829  C CA   . LEU A 1 24  ? 4.403   6.235   5.647   1.00 1.40  ? 538 LEU A CA   4  
ATOM 6830  C C    . LEU A 1 24  ? 4.551   4.984   4.768   1.00 1.36  ? 538 LEU A C    4  
ATOM 6831  O O    . LEU A 1 24  ? 4.182   3.893   5.199   1.00 1.46  ? 538 LEU A O    4  
ATOM 6832  C CB   . LEU A 1 24  ? 3.357   7.224   5.090   1.00 1.48  ? 538 LEU A CB   4  
ATOM 6833  C CG   . LEU A 1 24  ? 3.226   8.564   5.841   1.00 1.93  ? 538 LEU A CG   4  
ATOM 6834  C CD1  . LEU A 1 24  ? 2.120   9.403   5.201   1.00 3.55  ? 538 LEU A CD1  4  
ATOM 6835  C CD2  . LEU A 1 24  ? 2.887   8.365   7.317   1.00 1.88  ? 538 LEU A CD2  4  
ATOM 6836  H H    . LEU A 1 24  ? 5.869   7.732   5.260   1.00 1.24  ? 538 LEU A H    4  
ATOM 6837  H HA   . LEU A 1 24  ? 4.054   5.891   6.623   1.00 1.58  ? 538 LEU A HA   4  
ATOM 6838  H HB2  . LEU A 1 24  ? 3.592   7.440   4.047   1.00 2.30  ? 538 LEU A HB2  4  
ATOM 6839  H HB3  . LEU A 1 24  ? 2.386   6.733   5.115   1.00 2.00  ? 538 LEU A HB3  4  
ATOM 6840  H HG   . LEU A 1 24  ? 4.162   9.118   5.768   1.00 2.97  ? 538 LEU A HG   4  
ATOM 6841  H HD11 . LEU A 1 24  ? 1.161   8.892   5.292   1.00 3.81  ? 538 LEU A HD11 4  
ATOM 6842  H HD12 . LEU A 1 24  ? 2.340   9.564   4.146   1.00 4.58  ? 538 LEU A HD12 4  
ATOM 6843  H HD13 . LEU A 1 24  ? 2.059   10.372  5.698   1.00 4.33  ? 538 LEU A HD13 4  
ATOM 6844  H HD21 . LEU A 1 24  ? 1.979   7.772   7.414   1.00 1.99  ? 538 LEU A HD21 4  
ATOM 6845  H HD22 . LEU A 1 24  ? 2.731   9.334   7.792   1.00 2.90  ? 538 LEU A HD22 4  
ATOM 6846  H HD23 . LEU A 1 24  ? 3.707   7.863   7.829   1.00 2.61  ? 538 LEU A HD23 4  
ATOM 6847  N N    . VAL A 1 25  ? 5.168   5.111   3.585   1.00 1.29  ? 539 VAL A N    4  
ATOM 6848  C CA   . VAL A 1 25  ? 5.395   3.971   2.668   1.00 1.39  ? 539 VAL A CA   4  
ATOM 6849  C C    . VAL A 1 25  ? 6.260   2.878   3.322   1.00 1.66  ? 539 VAL A C    4  
ATOM 6850  O O    . VAL A 1 25  ? 6.006   1.686   3.163   1.00 1.90  ? 539 VAL A O    4  
ATOM 6851  C CB   . VAL A 1 25  ? 5.926   4.466   1.307   1.00 1.15  ? 539 VAL A CB   4  
ATOM 6852  C CG1  . VAL A 1 25  ? 7.447   4.477   1.190   1.00 1.14  ? 539 VAL A CG1  4  
ATOM 6853  C CG2  . VAL A 1 25  ? 5.349   3.601   0.191   1.00 1.21  ? 539 VAL A CG2  4  
ATOM 6854  H H    . VAL A 1 25  ? 5.440   6.042   3.289   1.00 1.27  ? 539 VAL A H    4  
ATOM 6855  H HA   . VAL A 1 25  ? 4.443   3.493   2.447   1.00 1.55  ? 539 VAL A HA   4  
ATOM 6856  H HB   . VAL A 1 25  ? 5.570   5.484   1.137   1.00 1.04  ? 539 VAL A HB   4  
ATOM 6857  H HG11 . VAL A 1 25  ? 7.730   4.824   0.198   1.00 1.83  ? 539 VAL A HG11 4  
ATOM 6858  H HG12 . VAL A 1 25  ? 7.868   5.136   1.945   1.00 1.41  ? 539 VAL A HG12 4  
ATOM 6859  H HG13 . VAL A 1 25  ? 7.825   3.466   1.313   1.00 2.16  ? 539 VAL A HG13 4  
ATOM 6860  H HG21 . VAL A 1 25  ? 4.280   3.784   0.125   1.00 2.33  ? 539 VAL A HG21 4  
ATOM 6861  H HG22 . VAL A 1 25  ? 5.813   3.854   -0.762  1.00 1.93  ? 539 VAL A HG22 4  
ATOM 6862  H HG23 . VAL A 1 25  ? 5.515   2.549   0.416   1.00 1.69  ? 539 VAL A HG23 4  
ATOM 6863  N N    . ALA A 1 26  ? 7.208   3.285   4.173   1.00 1.70  ? 540 ALA A N    4  
ATOM 6864  C CA   . ALA A 1 26  ? 8.080   2.418   4.964   1.00 2.01  ? 540 ALA A CA   4  
ATOM 6865  C C    . ALA A 1 26  ? 7.365   1.573   6.045   1.00 2.35  ? 540 ALA A C    4  
ATOM 6866  O O    . ALA A 1 26  ? 8.011   0.777   6.734   1.00 2.56  ? 540 ALA A O    4  
ATOM 6867  C CB   . ALA A 1 26  ? 9.134   3.323   5.600   1.00 2.08  ? 540 ALA A CB   4  
ATOM 6868  H H    . ALA A 1 26  ? 7.344   4.280   4.271   1.00 1.57  ? 540 ALA A H    4  
ATOM 6869  H HA   . ALA A 1 26  ? 8.580   1.727   4.290   1.00 2.00  ? 540 ALA A HA   4  
ATOM 6870  H HB1  . ALA A 1 26  ? 8.660   3.976   6.335   1.00 2.80  ? 540 ALA A HB1  4  
ATOM 6871  H HB2  . ALA A 1 26  ? 9.878   2.713   6.105   1.00 2.59  ? 540 ALA A HB2  4  
ATOM 6872  H HB3  . ALA A 1 26  ? 9.633   3.916   4.833   1.00 2.14  ? 540 ALA A HB3  4  
ATOM 6873  N N    . SER A 1 27  ? 6.047   1.733   6.210   1.00 2.46  ? 541 SER A N    4  
ATOM 6874  C CA   . SER A 1 27  ? 5.241   1.052   7.228   1.00 2.82  ? 541 SER A CA   4  
ATOM 6875  C C    . SER A 1 27  ? 5.018   -0.412  6.848   1.00 2.67  ? 541 SER A C    4  
ATOM 6876  O O    . SER A 1 27  ? 5.013   -1.305  7.698   1.00 2.62  ? 541 SER A O    4  
ATOM 6877  C CB   . SER A 1 27  ? 3.911   1.781   7.362   1.00 3.26  ? 541 SER A CB   4  
ATOM 6878  O OG   . SER A 1 27  ? 3.050   1.178   8.303   1.00 4.59  ? 541 SER A OG   4  
ATOM 6879  H H    . SER A 1 27  ? 5.541   2.250   5.502   1.00 2.37  ? 541 SER A H    4  
ATOM 6880  H HA   . SER A 1 27  ? 5.747   1.120   8.179   1.00 3.00  ? 541 SER A HA   4  
ATOM 6881  H HB2  . SER A 1 27  ? 4.095   2.816   7.650   1.00 2.70  ? 541 SER A HB2  4  
ATOM 6882  H HB3  . SER A 1 27  ? 3.435   1.763   6.393   1.00 3.82  ? 541 SER A HB3  4  
ATOM 6883  H HG   . SER A 1 27  ? 2.270   1.763   8.381   1.00 5.14  ? 541 SER A HG   4  
ATOM 6884  N N    . MET A 1 28  ? 4.952   -0.665  5.540   1.00 2.56  ? 542 MET A N    4  
ATOM 6885  C CA   . MET A 1 28  ? 4.865   -1.991  4.960   1.00 2.40  ? 542 MET A CA   4  
ATOM 6886  C C    . MET A 1 28  ? 6.098   -2.858  5.290   1.00 2.22  ? 542 MET A C    4  
ATOM 6887  O O    . MET A 1 28  ? 7.224   -2.401  5.084   1.00 2.16  ? 542 MET A O    4  
ATOM 6888  C CB   . MET A 1 28  ? 4.759   -1.843  3.441   1.00 2.22  ? 542 MET A CB   4  
ATOM 6889  C CG   . MET A 1 28  ? 3.379   -1.384  2.967   1.00 2.31  ? 542 MET A CG   4  
ATOM 6890  S SD   . MET A 1 28  ? 3.202   -1.408  1.162   1.00 2.97  ? 542 MET A SD   4  
ATOM 6891  C CE   . MET A 1 28  ? 2.986   -3.185  0.874   1.00 2.24  ? 542 MET A CE   4  
ATOM 6892  H H    . MET A 1 28  ? 5.052   0.113   4.904   1.00 2.56  ? 542 MET A H    4  
ATOM 6893  H HA   . MET A 1 28  ? 3.960   -2.447  5.346   1.00 2.62  ? 542 MET A HA   4  
ATOM 6894  H HB2  . MET A 1 28  ? 5.504   -1.125  3.098   1.00 2.14  ? 542 MET A HB2  4  
ATOM 6895  H HB3  . MET A 1 28  ? 4.988   -2.800  2.987   1.00 2.59  ? 542 MET A HB3  4  
ATOM 6896  H HG2  . MET A 1 28  ? 2.615   -2.028  3.402   1.00 2.66  ? 542 MET A HG2  4  
ATOM 6897  H HG3  . MET A 1 28  ? 3.211   -0.365  3.319   1.00 2.28  ? 542 MET A HG3  4  
ATOM 6898  H HE1  . MET A 1 28  ? 2.782   -3.359  -0.182  1.00 3.06  ? 542 MET A HE1  4  
ATOM 6899  H HE2  . MET A 1 28  ? 3.889   -3.725  1.155   1.00 2.04  ? 542 MET A HE2  4  
ATOM 6900  H HE3  . MET A 1 28  ? 2.147   -3.554  1.466   1.00 2.61  ? 542 MET A HE3  4  
ATOM 6901  N N    . PRO A 1 29  ? 5.935   -4.143  5.669   1.00 2.18  ? 543 PRO A N    4  
ATOM 6902  C CA   . PRO A 1 29  ? 7.055   -5.065  5.895   1.00 2.12  ? 543 PRO A CA   4  
ATOM 6903  C C    . PRO A 1 29  ? 7.845   -5.402  4.614   1.00 2.04  ? 543 PRO A C    4  
ATOM 6904  O O    . PRO A 1 29  ? 8.958   -5.916  4.687   1.00 2.12  ? 543 PRO A O    4  
ATOM 6905  C CB   . PRO A 1 29  ? 6.431   -6.307  6.539   1.00 2.17  ? 543 PRO A CB   4  
ATOM 6906  C CG   . PRO A 1 29  ? 4.995   -6.303  6.022   1.00 2.27  ? 543 PRO A CG   4  
ATOM 6907  C CD   . PRO A 1 29  ? 4.670   -4.814  5.916   1.00 2.27  ? 543 PRO A CD   4  
ATOM 6908  H HA   . PRO A 1 29  ? 7.752   -4.615  6.600   1.00 2.13  ? 543 PRO A HA   4  
ATOM 6909  H HB2  . PRO A 1 29  ? 6.959   -7.223  6.273   1.00 2.14  ? 543 PRO A HB2  4  
ATOM 6910  H HB3  . PRO A 1 29  ? 6.419   -6.188  7.622   1.00 2.33  ? 543 PRO A HB3  4  
ATOM 6911  H HG2  . PRO A 1 29  ? 4.961   -6.757  5.032   1.00 2.26  ? 543 PRO A HG2  4  
ATOM 6912  H HG3  . PRO A 1 29  ? 4.318   -6.813  6.706   1.00 2.46  ? 543 PRO A HG3  4  
ATOM 6913  H HD2  . PRO A 1 29  ? 3.961   -4.651  5.102   1.00 2.31  ? 543 PRO A HD2  4  
ATOM 6914  H HD3  . PRO A 1 29  ? 4.254   -4.447  6.855   1.00 2.34  ? 543 PRO A HD3  4  
ATOM 6915  N N    . LEU A 1 30  ? 7.316   -5.062  3.436   1.00 1.92  ? 544 LEU A N    4  
ATOM 6916  C CA   . LEU A 1 30  ? 8.014   -5.114  2.145   1.00 1.82  ? 544 LEU A CA   4  
ATOM 6917  C C    . LEU A 1 30  ? 9.087   -4.008  1.999   1.00 1.74  ? 544 LEU A C    4  
ATOM 6918  O O    . LEU A 1 30  ? 10.065  -4.182  1.274   1.00 1.68  ? 544 LEU A O    4  
ATOM 6919  C CB   . LEU A 1 30  ? 6.906   -5.095  1.072   1.00 1.87  ? 544 LEU A CB   4  
ATOM 6920  C CG   . LEU A 1 30  ? 7.364   -5.200  -0.395  1.00 1.80  ? 544 LEU A CG   4  
ATOM 6921  C CD1  . LEU A 1 30  ? 6.251   -5.869  -1.199  1.00 1.90  ? 544 LEU A CD1  4  
ATOM 6922  C CD2  . LEU A 1 30  ? 7.583   -3.825  -1.032  1.00 2.68  ? 544 LEU A CD2  4  
ATOM 6923  H H    . LEU A 1 30  ? 6.371   -4.711  3.442   1.00 1.92  ? 544 LEU A H    4  
ATOM 6924  H HA   . LEU A 1 30  ? 8.538   -6.069  2.071   1.00 1.86  ? 544 LEU A HA   4  
ATOM 6925  H HB2  . LEU A 1 30  ? 6.263   -5.950  1.286   1.00 2.69  ? 544 LEU A HB2  4  
ATOM 6926  H HB3  . LEU A 1 30  ? 6.290   -4.202  1.178   1.00 2.36  ? 544 LEU A HB3  4  
ATOM 6927  H HG   . LEU A 1 30  ? 8.269   -5.801  -0.468  1.00 2.53  ? 544 LEU A HG   4  
ATOM 6928  H HD11 . LEU A 1 30  ? 5.329   -5.301  -1.070  1.00 2.16  ? 544 LEU A HD11 4  
ATOM 6929  H HD12 . LEU A 1 30  ? 6.101   -6.885  -0.835  1.00 2.43  ? 544 LEU A HD12 4  
ATOM 6930  H HD13 . LEU A 1 30  ? 6.527   -5.908  -2.252  1.00 2.59  ? 544 LEU A HD13 4  
ATOM 6931  H HD21 . LEU A 1 30  ? 6.667   -3.238  -0.997  1.00 3.19  ? 544 LEU A HD21 4  
ATOM 6932  H HD22 . LEU A 1 30  ? 7.875   -3.953  -2.074  1.00 3.79  ? 544 LEU A HD22 4  
ATOM 6933  H HD23 . LEU A 1 30  ? 8.373   -3.281  -0.518  1.00 2.91  ? 544 LEU A HD23 4  
ATOM 6934  N N    . PHE A 1 31  ? 8.945   -2.902  2.739   1.00 1.79  ? 545 PHE A N    4  
ATOM 6935  C CA   . PHE A 1 31  ? 9.865   -1.760  2.824   1.00 1.73  ? 545 PHE A CA   4  
ATOM 6936  C C    . PHE A 1 31  ? 10.661  -1.741  4.156   1.00 1.89  ? 545 PHE A C    4  
ATOM 6937  O O    . PHE A 1 31  ? 11.284  -0.733  4.503   1.00 1.93  ? 545 PHE A O    4  
ATOM 6938  C CB   . PHE A 1 31  ? 9.070   -0.453  2.660   1.00 1.72  ? 545 PHE A CB   4  
ATOM 6939  C CG   . PHE A 1 31  ? 8.412   -0.153  1.320   1.00 1.56  ? 545 PHE A CG   4  
ATOM 6940  C CD1  . PHE A 1 31  ? 7.270   -0.859  0.898   1.00 2.86  ? 545 PHE A CD1  4  
ATOM 6941  C CD2  . PHE A 1 31  ? 8.845   0.960   0.574   1.00 1.65  ? 545 PHE A CD2  4  
ATOM 6942  C CE1  . PHE A 1 31  ? 6.519   -0.403  -0.199  1.00 2.77  ? 545 PHE A CE1  4  
ATOM 6943  C CE2  . PHE A 1 31  ? 8.106   1.408   -0.535  1.00 1.68  ? 545 PHE A CE2  4  
ATOM 6944  C CZ   . PHE A 1 31  ? 6.917   0.752   -0.890  1.00 1.43  ? 545 PHE A CZ   4  
ATOM 6945  H H    . PHE A 1 31  ? 8.151   -2.857  3.358   1.00 1.91  ? 545 PHE A H    4  
ATOM 6946  H HA   . PHE A 1 31  ? 10.589  -1.822  2.013   1.00 1.62  ? 545 PHE A HA   4  
ATOM 6947  H HB2  . PHE A 1 31  ? 8.293   -0.426  3.425   1.00 1.88  ? 545 PHE A HB2  4  
ATOM 6948  H HB3  . PHE A 1 31  ? 9.744   0.377   2.874   1.00 1.74  ? 545 PHE A HB3  4  
ATOM 6949  H HD1  . PHE A 1 31  ? 6.931   -1.720  1.448   1.00 4.16  ? 545 PHE A HD1  4  
ATOM 6950  H HD2  . PHE A 1 31  ? 9.710   1.518   0.893   1.00 2.70  ? 545 PHE A HD2  4  
ATOM 6951  H HE1  . PHE A 1 31  ? 5.606   -0.909  -0.480  1.00 4.00  ? 545 PHE A HE1  4  
ATOM 6952  H HE2  . PHE A 1 31  ? 8.410   2.298   -1.070  1.00 2.81  ? 545 PHE A HE2  4  
ATOM 6953  H HZ   . PHE A 1 31  ? 6.280   1.171   -1.654  1.00 1.43  ? 545 PHE A HZ   4  
ATOM 6954  N N    . ALA A 1 32  ? 10.649  -2.843  4.918   1.00 2.02  ? 546 ALA A N    4  
ATOM 6955  C CA   . ALA A 1 32  ? 11.236  -2.969  6.257   1.00 2.27  ? 546 ALA A CA   4  
ATOM 6956  C C    . ALA A 1 32  ? 12.729  -2.630  6.323   1.00 2.23  ? 546 ALA A C    4  
ATOM 6957  O O    . ALA A 1 32  ? 13.221  -2.134  7.340   1.00 2.46  ? 546 ALA A O    4  
ATOM 6958  C CB   . ALA A 1 32  ? 11.089  -4.434  6.653   1.00 2.40  ? 546 ALA A CB   4  
ATOM 6959  H H    . ALA A 1 32  ? 10.248  -3.679  4.520   1.00 2.00  ? 546 ALA A H    4  
ATOM 6960  H HA   . ALA A 1 32  ? 10.702  -2.345  6.971   1.00 2.46  ? 546 ALA A HA   4  
ATOM 6961  H HB1  . ALA A 1 32  ? 11.519  -4.589  7.641   1.00 2.45  ? 546 ALA A HB1  4  
ATOM 6962  H HB2  . ALA A 1 32  ? 10.041  -4.715  6.676   1.00 3.42  ? 546 ALA A HB2  4  
ATOM 6963  H HB3  . ALA A 1 32  ? 11.626  -5.052  5.927   1.00 2.70  ? 546 ALA A HB3  4  
ATOM 6964  N N    . ASN A 1 33  ? 13.422  -2.951  5.234   1.00 2.01  ? 547 ASN A N    4  
ATOM 6965  C CA   . ASN A 1 33  ? 14.870  -3.014  5.081   1.00 2.02  ? 547 ASN A CA   4  
ATOM 6966  C C    . ASN A 1 33  ? 15.382  -2.078  3.960   1.00 1.75  ? 547 ASN A C    4  
ATOM 6967  O O    . ASN A 1 33  ? 16.589  -1.979  3.721   1.00 1.79  ? 547 ASN A O    4  
ATOM 6968  C CB   . ASN A 1 33  ? 15.191  -4.503  4.836   1.00 2.19  ? 547 ASN A CB   4  
ATOM 6969  C CG   . ASN A 1 33  ? 15.827  -5.157  6.037   1.00 2.48  ? 547 ASN A CG   4  
ATOM 6970  O OD1  . ASN A 1 33  ? 17.023  -5.055  6.271   1.00 2.93  ? 547 ASN A OD1  4  
ATOM 6971  N ND2  . ASN A 1 33  ? 15.068  -5.824  6.864   1.00 2.78  ? 547 ASN A ND2  4  
ATOM 6972  H H    . ASN A 1 33  ? 12.885  -3.321  4.454   1.00 1.89  ? 547 ASN A H    4  
ATOM 6973  H HA   . ASN A 1 33  ? 15.346  -2.690  6.004   1.00 2.20  ? 547 ASN A HA   4  
ATOM 6974  H HB2  . ASN A 1 33  ? 14.299  -5.065  4.551   1.00 2.82  ? 547 ASN A HB2  4  
ATOM 6975  H HB3  . ASN A 1 33  ? 15.877  -4.608  4.012   1.00 2.24  ? 547 ASN A HB3  4  
ATOM 6976  H HD21 . ASN A 1 33  ? 14.069  -5.921  6.737   1.00 2.74  ? 547 ASN A HD21 4  
ATOM 6977  H HD22 . ASN A 1 33  ? 15.540  -6.331  7.597   1.00 3.30  ? 547 ASN A HD22 4  
ATOM 6978  N N    . ALA A 1 34  ? 14.449  -1.404  3.279   1.00 1.63  ? 548 ALA A N    4  
ATOM 6979  C CA   . ALA A 1 34  ? 14.656  -0.582  2.087   1.00 1.47  ? 548 ALA A CA   4  
ATOM 6980  C C    . ALA A 1 34  ? 15.635  0.597   2.287   1.00 1.49  ? 548 ALA A C    4  
ATOM 6981  O O    . ALA A 1 34  ? 15.622  1.249   3.333   1.00 1.69  ? 548 ALA A O    4  
ATOM 6982  C CB   . ALA A 1 34  ? 13.273  -0.069  1.649   1.00 1.49  ? 548 ALA A CB   4  
ATOM 6983  H H    . ALA A 1 34  ? 13.493  -1.582  3.560   1.00 1.77  ? 548 ALA A H    4  
ATOM 6984  H HA   . ALA A 1 34  ? 15.055  -1.227  1.301   1.00 1.42  ? 548 ALA A HA   4  
ATOM 6985  H HB1  . ALA A 1 34  ? 12.568  -0.895  1.540   1.00 2.42  ? 548 ALA A HB1  4  
ATOM 6986  H HB2  . ALA A 1 34  ? 12.884  0.636   2.391   1.00 1.83  ? 548 ALA A HB2  4  
ATOM 6987  H HB3  . ALA A 1 34  ? 13.352  0.456   0.699   1.00 1.84  ? 548 ALA A HB3  4  
ATOM 6988  N N    . ASP A 1 35  ? 16.428  0.934   1.259   1.00 1.35  ? 549 ASP A N    4  
ATOM 6989  C CA   . ASP A 1 35  ? 17.265  2.147   1.260   1.00 1.38  ? 549 ASP A CA   4  
ATOM 6990  C C    . ASP A 1 35  ? 16.377  3.410   1.241   1.00 1.33  ? 549 ASP A C    4  
ATOM 6991  O O    . ASP A 1 35  ? 15.509  3.519   0.366   1.00 1.14  ? 549 ASP A O    4  
ATOM 6992  C CB   . ASP A 1 35  ? 18.228  2.144   0.058   1.00 1.29  ? 549 ASP A CB   4  
ATOM 6993  C CG   . ASP A 1 35  ? 19.221  3.317   0.081   1.00 1.48  ? 549 ASP A CG   4  
ATOM 6994  O OD1  . ASP A 1 35  ? 18.831  4.465   -0.235  1.00 2.09  ? 549 ASP A OD1  4  
ATOM 6995  O OD2  . ASP A 1 35  ? 20.411  3.094   0.413   1.00 2.27  ? 549 ASP A OD2  4  
ATOM 6996  H H    . ASP A 1 35  ? 16.396  0.381   0.419   1.00 1.27  ? 549 ASP A H    4  
ATOM 6997  H HA   . ASP A 1 35  ? 17.864  2.132   2.171   1.00 1.55  ? 549 ASP A HA   4  
ATOM 6998  H HB2  . ASP A 1 35  ? 18.780  1.205   0.057   1.00 1.35  ? 549 ASP A HB2  4  
ATOM 6999  H HB3  . ASP A 1 35  ? 17.658  2.182   -0.869  1.00 1.13  ? 549 ASP A HB3  4  
ATOM 7000  N N    . PRO A 1 36  ? 16.581  4.392   2.139   1.00 1.50  ? 550 PRO A N    4  
ATOM 7001  C CA   . PRO A 1 36  ? 15.689  5.548   2.295   1.00 1.52  ? 550 PRO A CA   4  
ATOM 7002  C C    . PRO A 1 36  ? 15.565  6.428   1.040   1.00 1.39  ? 550 PRO A C    4  
ATOM 7003  O O    . PRO A 1 36  ? 14.631  7.224   0.931   1.00 1.41  ? 550 PRO A O    4  
ATOM 7004  C CB   . PRO A 1 36  ? 16.268  6.345   3.468   1.00 1.71  ? 550 PRO A CB   4  
ATOM 7005  C CG   . PRO A 1 36  ? 17.750  5.982   3.429   1.00 1.76  ? 550 PRO A CG   4  
ATOM 7006  C CD   . PRO A 1 36  ? 17.700  4.505   3.062   1.00 1.70  ? 550 PRO A CD   4  
ATOM 7007  H HA   . PRO A 1 36  ? 14.697  5.198   2.576   1.00 1.53  ? 550 PRO A HA   4  
ATOM 7008  H HB2  . PRO A 1 36  ? 16.109  7.419   3.360   1.00 1.71  ? 550 PRO A HB2  4  
ATOM 7009  H HB3  . PRO A 1 36  ? 15.832  5.988   4.400   1.00 1.82  ? 550 PRO A HB3  4  
ATOM 7010  H HG2  . PRO A 1 36  ? 18.239  6.536   2.627   1.00 1.70  ? 550 PRO A HG2  4  
ATOM 7011  H HG3  . PRO A 1 36  ? 18.240  6.151   4.388   1.00 1.92  ? 550 PRO A HG3  4  
ATOM 7012  H HD2  . PRO A 1 36  ? 18.641  4.209   2.599   1.00 1.71  ? 550 PRO A HD2  4  
ATOM 7013  H HD3  . PRO A 1 36  ? 17.506  3.902   3.950   1.00 1.82  ? 550 PRO A HD3  4  
ATOM 7014  N N    . ASN A 1 37  ? 16.468  6.283   0.070   1.00 1.32  ? 551 ASN A N    4  
ATOM 7015  C CA   . ASN A 1 37  ? 16.472  7.066   -1.164  1.00 1.20  ? 551 ASN A CA   4  
ATOM 7016  C C    . ASN A 1 37  ? 15.673  6.372   -2.265  1.00 0.98  ? 551 ASN A C    4  
ATOM 7017  O O    . ASN A 1 37  ? 14.919  7.027   -2.979  1.00 0.89  ? 551 ASN A O    4  
ATOM 7018  C CB   . ASN A 1 37  ? 17.909  7.340   -1.612  1.00 1.30  ? 551 ASN A CB   4  
ATOM 7019  C CG   . ASN A 1 37  ? 18.724  8.029   -0.541  1.00 1.55  ? 551 ASN A CG   4  
ATOM 7020  O OD1  . ASN A 1 37  ? 18.712  9.246   -0.409  1.00 1.82  ? 551 ASN A OD1  4  
ATOM 7021  N ND2  . ASN A 1 37  ? 19.434  7.274   0.259   1.00 2.28  ? 551 ASN A ND2  4  
ATOM 7022  H H    . ASN A 1 37  ? 17.103  5.495   0.145   1.00 1.37  ? 551 ASN A H    4  
ATOM 7023  H HA   . ASN A 1 37  ? 15.994  8.028   -0.972  1.00 1.23  ? 551 ASN A HA   4  
ATOM 7024  H HB2  . ASN A 1 37  ? 18.395  6.411   -1.900  1.00 1.30  ? 551 ASN A HB2  4  
ATOM 7025  H HB3  . ASN A 1 37  ? 17.889  7.987   -2.485  1.00 1.26  ? 551 ASN A HB3  4  
ATOM 7026  H HD21 . ASN A 1 37  ? 19.405  6.264   0.141   1.00 2.92  ? 551 ASN A HD21 4  
ATOM 7027  H HD22 . ASN A 1 37  ? 20.116  7.723   0.854   1.00 2.37  ? 551 ASN A HD22 4  
ATOM 7028  N N    . PHE A 1 38  ? 15.770  5.043   -2.332  1.00 0.95  ? 552 PHE A N    4  
ATOM 7029  C CA   . PHE A 1 38  ? 14.947  4.186   -3.193  1.00 0.83  ? 552 PHE A CA   4  
ATOM 7030  C C    . PHE A 1 38  ? 13.458  4.355   -2.865  1.00 0.83  ? 552 PHE A C    4  
ATOM 7031  O O    . PHE A 1 38  ? 12.644  4.584   -3.759  1.00 0.80  ? 552 PHE A O    4  
ATOM 7032  C CB   . PHE A 1 38  ? 15.424  2.731   -3.023  1.00 0.84  ? 552 PHE A CB   4  
ATOM 7033  C CG   . PHE A 1 38  ? 14.401  1.653   -3.327  1.00 0.85  ? 552 PHE A CG   4  
ATOM 7034  C CD1  . PHE A 1 38  ? 14.039  1.349   -4.652  1.00 1.75  ? 552 PHE A CD1  4  
ATOM 7035  C CD2  . PHE A 1 38  ? 13.805  0.952   -2.262  1.00 2.05  ? 552 PHE A CD2  4  
ATOM 7036  C CE1  . PHE A 1 38  ? 13.076  0.355   -4.903  1.00 1.79  ? 552 PHE A CE1  4  
ATOM 7037  C CE2  . PHE A 1 38  ? 12.851  -0.048  -2.514  1.00 2.08  ? 552 PHE A CE2  4  
ATOM 7038  C CZ   . PHE A 1 38  ? 12.488  -0.348  -3.837  1.00 0.99  ? 552 PHE A CZ   4  
ATOM 7039  H H    . PHE A 1 38  ? 16.377  4.598   -1.657  1.00 1.06  ? 552 PHE A H    4  
ATOM 7040  H HA   . PHE A 1 38  ? 15.077  4.479   -4.235  1.00 0.77  ? 552 PHE A HA   4  
ATOM 7041  H HB2  . PHE A 1 38  ? 16.303  2.570   -3.643  1.00 0.85  ? 552 PHE A HB2  4  
ATOM 7042  H HB3  . PHE A 1 38  ? 15.744  2.587   -1.995  1.00 0.87  ? 552 PHE A HB3  4  
ATOM 7043  H HD1  . PHE A 1 38  ? 14.498  1.878   -5.474  1.00 2.95  ? 552 PHE A HD1  4  
ATOM 7044  H HD2  . PHE A 1 38  ? 14.085  1.190   -1.248  1.00 3.27  ? 552 PHE A HD2  4  
ATOM 7045  H HE1  . PHE A 1 38  ? 12.784  0.124   -5.916  1.00 2.99  ? 552 PHE A HE1  4  
ATOM 7046  H HE2  . PHE A 1 38  ? 12.396  -0.587  -1.695  1.00 3.30  ? 552 PHE A HE2  4  
ATOM 7047  H HZ   . PHE A 1 38  ? 11.760  -1.121  -4.037  1.00 1.08  ? 552 PHE A HZ   4  
ATOM 7048  N N    . VAL A 1 39  ? 13.105  4.336   -1.573  1.00 0.90  ? 553 VAL A N    4  
ATOM 7049  C CA   . VAL A 1 39  ? 11.697  4.484   -1.144  1.00 0.96  ? 553 VAL A CA   4  
ATOM 7050  C C    . VAL A 1 39  ? 11.131  5.874   -1.437  1.00 0.93  ? 553 VAL A C    4  
ATOM 7051  O O    . VAL A 1 39  ? 9.950   6.022   -1.719  1.00 0.97  ? 553 VAL A O    4  
ATOM 7052  C CB   . VAL A 1 39  ? 11.474  4.133   0.332   1.00 1.20  ? 553 VAL A CB   4  
ATOM 7053  C CG1  . VAL A 1 39  ? 12.140  2.802   0.631   1.00 1.91  ? 553 VAL A CG1  4  
ATOM 7054  C CG2  . VAL A 1 39  ? 12.042  5.103   1.361   1.00 1.26  ? 553 VAL A CG2  4  
ATOM 7055  H H    . VAL A 1 39  ? 13.819  4.105   -0.886  1.00 0.97  ? 553 VAL A H    4  
ATOM 7056  H HA   . VAL A 1 39  ? 11.117  3.753   -1.704  1.00 0.94  ? 553 VAL A HA   4  
ATOM 7057  H HB   . VAL A 1 39  ? 10.405  4.050   0.499   1.00 1.74  ? 553 VAL A HB   4  
ATOM 7058  H HG11 . VAL A 1 39  ? 13.224  2.944   0.622   1.00 2.14  ? 553 VAL A HG11 4  
ATOM 7059  H HG12 . VAL A 1 39  ? 11.833  2.462   1.617   1.00 2.46  ? 553 VAL A HG12 4  
ATOM 7060  H HG13 . VAL A 1 39  ? 11.857  2.072   -0.125  1.00 3.02  ? 553 VAL A HG13 4  
ATOM 7061  H HG21 . VAL A 1 39  ? 11.940  4.666   2.358   1.00 2.05  ? 553 VAL A HG21 4  
ATOM 7062  H HG22 . VAL A 1 39  ? 13.093  5.244   1.152   1.00 1.75  ? 553 VAL A HG22 4  
ATOM 7063  H HG23 . VAL A 1 39  ? 11.515  6.056   1.328   1.00 1.94  ? 553 VAL A HG23 4  
ATOM 7064  N N    . THR A 1 40  ? 11.997  6.887   -1.387  1.00 0.91  ? 554 THR A N    4  
ATOM 7065  C CA   . THR A 1 40  ? 11.677  8.304   -1.617  1.00 0.91  ? 554 THR A CA   4  
ATOM 7066  C C    . THR A 1 40  ? 11.597  8.665   -3.106  1.00 0.78  ? 554 THR A C    4  
ATOM 7067  O O    . THR A 1 40  ? 10.682  9.384   -3.516  1.00 0.80  ? 554 THR A O    4  
ATOM 7068  C CB   . THR A 1 40  ? 12.707  9.212   -0.927  1.00 1.02  ? 554 THR A CB   4  
ATOM 7069  O OG1  . THR A 1 40  ? 12.733  9.008   0.471   1.00 1.14  ? 554 THR A OG1  4  
ATOM 7070  C CG2  . THR A 1 40  ? 12.361  10.678  -1.166  1.00 1.09  ? 554 THR A CG2  4  
ATOM 7071  H H    . THR A 1 40  ? 12.935  6.635   -1.138  1.00 0.95  ? 554 THR A H    4  
ATOM 7072  H HA   . THR A 1 40  ? 10.702  8.518   -1.178  1.00 0.98  ? 554 THR A HA   4  
ATOM 7073  H HB   . THR A 1 40  ? 13.699  9.005   -1.324  1.00 0.98  ? 554 THR A HB   4  
ATOM 7074  H HG1  . THR A 1 40  ? 13.325  8.247   0.638   1.00 1.43  ? 554 THR A HG1  4  
ATOM 7075  H HG21 . THR A 1 40  ? 11.305  10.837  -0.948  1.00 2.11  ? 554 THR A HG21 4  
ATOM 7076  H HG22 . THR A 1 40  ? 12.551  10.926  -2.212  1.00 1.49  ? 554 THR A HG22 4  
ATOM 7077  H HG23 . THR A 1 40  ? 12.982  11.311  -0.534  1.00 1.48  ? 554 THR A HG23 4  
ATOM 7078  N N    . ALA A 1 41  ? 12.519  8.155   -3.933  1.00 0.67  ? 555 ALA A N    4  
ATOM 7079  C CA   . ALA A 1 41  ? 12.567  8.413   -5.378  1.00 0.65  ? 555 ALA A CA   4  
ATOM 7080  C C    . ALA A 1 41  ? 11.309  7.902   -6.106  1.00 0.66  ? 555 ALA A C    4  
ATOM 7081  O O    . ALA A 1 41  ? 11.007  8.303   -7.228  1.00 0.81  ? 555 ALA A O    4  
ATOM 7082  C CB   . ALA A 1 41  ? 13.823  7.742   -5.953  1.00 0.70  ? 555 ALA A CB   4  
ATOM 7083  H H    . ALA A 1 41  ? 13.244  7.555   -3.548  1.00 0.68  ? 555 ALA A H    4  
ATOM 7084  H HA   . ALA A 1 41  ? 12.631  9.492   -5.528  1.00 0.70  ? 555 ALA A HA   4  
ATOM 7085  H HB1  . ALA A 1 41  ? 13.797  6.665   -5.770  1.00 1.76  ? 555 ALA A HB1  4  
ATOM 7086  H HB2  . ALA A 1 41  ? 13.872  7.907   -7.030  1.00 1.42  ? 555 ALA A HB2  4  
ATOM 7087  H HB3  . ALA A 1 41  ? 14.718  8.164   -5.495  1.00 1.58  ? 555 ALA A HB3  4  
ATOM 7088  N N    . MET A 1 42  ? 10.578  7.000   -5.453  1.00 0.64  ? 556 MET A N    4  
ATOM 7089  C CA   . MET A 1 42  ? 9.338   6.392   -5.925  1.00 0.78  ? 556 MET A CA   4  
ATOM 7090  C C    . MET A 1 42  ? 8.116   7.328   -5.846  1.00 0.88  ? 556 MET A C    4  
ATOM 7091  O O    . MET A 1 42  ? 7.232   7.254   -6.701  1.00 1.12  ? 556 MET A O    4  
ATOM 7092  C CB   . MET A 1 42  ? 9.156   5.167   -5.032  1.00 0.87  ? 556 MET A CB   4  
ATOM 7093  C CG   . MET A 1 42  ? 8.093   4.175   -5.488  1.00 0.87  ? 556 MET A CG   4  
ATOM 7094  S SD   . MET A 1 42  ? 7.927   2.778   -4.344  1.00 0.84  ? 556 MET A SD   4  
ATOM 7095  C CE   . MET A 1 42  ? 9.661   2.274   -4.084  1.00 0.69  ? 556 MET A CE   4  
ATOM 7096  H H    . MET A 1 42  ? 10.945  6.686   -4.560  1.00 0.62  ? 556 MET A H    4  
ATOM 7097  H HA   . MET A 1 42  ? 9.468   6.066   -6.957  1.00 0.86  ? 556 MET A HA   4  
ATOM 7098  H HB2  . MET A 1 42  ? 10.113  4.648   -5.003  1.00 1.20  ? 556 MET A HB2  4  
ATOM 7099  H HB3  . MET A 1 42  ? 8.910   5.494   -4.021  1.00 1.12  ? 556 MET A HB3  4  
ATOM 7100  H HG2  . MET A 1 42  ? 7.134   4.686   -5.554  1.00 1.12  ? 556 MET A HG2  4  
ATOM 7101  H HG3  . MET A 1 42  ? 8.348   3.799   -6.478  1.00 1.15  ? 556 MET A HG3  4  
ATOM 7102  H HE1  . MET A 1 42  ? 10.179  3.030   -3.496  1.00 1.50  ? 556 MET A HE1  4  
ATOM 7103  H HE2  . MET A 1 42  ? 9.697   1.330   -3.543  1.00 1.77  ? 556 MET A HE2  4  
ATOM 7104  H HE3  . MET A 1 42  ? 10.184  2.169   -5.037  1.00 1.78  ? 556 MET A HE3  4  
ATOM 7105  N N    . LEU A 1 43  ? 8.075   8.212   -4.841  1.00 0.86  ? 557 LEU A N    4  
ATOM 7106  C CA   . LEU A 1 43  ? 6.898   9.004   -4.428  1.00 1.01  ? 557 LEU A CA   4  
ATOM 7107  C C    . LEU A 1 43  ? 6.656   10.252  -5.298  1.00 0.91  ? 557 LEU A C    4  
ATOM 7108  O O    . LEU A 1 43  ? 5.663   10.956  -5.117  1.00 0.89  ? 557 LEU A O    4  
ATOM 7109  C CB   . LEU A 1 43  ? 7.077   9.453   -2.962  1.00 1.14  ? 557 LEU A CB   4  
ATOM 7110  C CG   . LEU A 1 43  ? 7.620   8.414   -1.969  1.00 1.15  ? 557 LEU A CG   4  
ATOM 7111  C CD1  . LEU A 1 43  ? 7.763   9.048   -0.590  1.00 1.31  ? 557 LEU A CD1  4  
ATOM 7112  C CD2  . LEU A 1 43  ? 6.716   7.187   -1.860  1.00 1.29  ? 557 LEU A CD2  4  
ATOM 7113  H H    . LEU A 1 43  ? 8.892   8.266   -4.243  1.00 0.85  ? 557 LEU A H    4  
ATOM 7114  H HA   . LEU A 1 43  ? 5.995   8.379   -4.497  1.00 1.13  ? 557 LEU A HA   4  
ATOM 7115  H HB2  . LEU A 1 43  ? 7.759   10.305  -2.949  1.00 1.10  ? 557 LEU A HB2  4  
ATOM 7116  H HB3  . LEU A 1 43  ? 6.110   9.799   -2.594  1.00 1.34  ? 557 LEU A HB3  4  
ATOM 7117  H HG   . LEU A 1 43  ? 8.615   8.112   -2.288  1.00 0.99  ? 557 LEU A HG   4  
ATOM 7118  H HD11 . LEU A 1 43  ? 8.194   8.324   0.100   1.00 2.12  ? 557 LEU A HD11 4  
ATOM 7119  H HD12 . LEU A 1 43  ? 6.787   9.366   -0.224  1.00 2.28  ? 557 LEU A HD12 4  
ATOM 7120  H HD13 . LEU A 1 43  ? 8.421   9.914   -0.656  1.00 1.38  ? 557 LEU A HD13 4  
ATOM 7121  H HD21 . LEU A 1 43  ? 7.180   6.467   -1.192  1.00 1.82  ? 557 LEU A HD21 4  
ATOM 7122  H HD22 . LEU A 1 43  ? 6.593   6.716   -2.834  1.00 2.36  ? 557 LEU A HD22 4  
ATOM 7123  H HD23 . LEU A 1 43  ? 5.744   7.472   -1.459  1.00 1.70  ? 557 LEU A HD23 4  
ATOM 7124  N N    . THR A 1 44  ? 7.560   10.556  -6.226  1.00 0.88  ? 558 THR A N    4  
ATOM 7125  C CA   . THR A 1 44  ? 7.510   11.732  -7.119  1.00 0.95  ? 558 THR A CA   4  
ATOM 7126  C C    . THR A 1 44  ? 6.163   11.942  -7.830  1.00 0.89  ? 558 THR A C    4  
ATOM 7127  O O    . THR A 1 44  ? 5.737   13.091  -7.978  1.00 0.98  ? 558 THR A O    4  
ATOM 7128  C CB   . THR A 1 44  ? 8.608   11.623  -8.189  1.00 1.22  ? 558 THR A CB   4  
ATOM 7129  O OG1  . THR A 1 44  ? 8.528   10.368  -8.827  1.00 2.00  ? 558 THR A OG1  4  
ATOM 7130  C CG2  . THR A 1 44  ? 9.998   11.742  -7.575  1.00 1.52  ? 558 THR A CG2  4  
ATOM 7131  H H    . THR A 1 44  ? 8.380   9.967   -6.275  1.00 0.88  ? 558 THR A H    4  
ATOM 7132  H HA   . THR A 1 44  ? 7.700   12.626  -6.526  1.00 1.04  ? 558 THR A HA   4  
ATOM 7133  H HB   . THR A 1 44  ? 8.481   12.417  -8.927  1.00 1.76  ? 558 THR A HB   4  
ATOM 7134  H HG1  . THR A 1 44  ? 9.314   10.282  -9.402  1.00 2.35  ? 558 THR A HG1  4  
ATOM 7135  H HG21 . THR A 1 44  ? 10.744  11.708  -8.366  1.00 2.29  ? 558 THR A HG21 4  
ATOM 7136  H HG22 . THR A 1 44  ? 10.185  10.928  -6.875  1.00 2.46  ? 558 THR A HG22 4  
ATOM 7137  H HG23 . THR A 1 44  ? 10.087  12.694  -7.053  1.00 2.25  ? 558 THR A HG23 4  
ATOM 7138  N N    . LYS A 1 45  ? 5.469   10.866  -8.226  1.00 0.86  ? 559 LYS A N    4  
ATOM 7139  C CA   . LYS A 1 45  ? 4.169   10.884  -8.932  1.00 0.89  ? 559 LYS A CA   4  
ATOM 7140  C C    . LYS A 1 45  ? 2.930   10.720  -8.031  1.00 0.90  ? 559 LYS A C    4  
ATOM 7141  O O    . LYS A 1 45  ? 1.833   10.487  -8.541  1.00 1.14  ? 559 LYS A O    4  
ATOM 7142  C CB   . LYS A 1 45  ? 4.189   9.800   -10.030 1.00 1.26  ? 559 LYS A CB   4  
ATOM 7143  C CG   . LYS A 1 45  ? 4.309   8.368   -9.460  1.00 1.79  ? 559 LYS A CG   4  
ATOM 7144  C CD   . LYS A 1 45  ? 3.404   7.346   -10.163 1.00 1.90  ? 559 LYS A CD   4  
ATOM 7145  C CE   . LYS A 1 45  ? 1.927   7.600   -9.847  1.00 2.28  ? 559 LYS A CE   4  
ATOM 7146  N NZ   . LYS A 1 45  ? 1.053   6.569   -10.458 1.00 3.08  ? 559 LYS A NZ   4  
ATOM 7147  H H    . LYS A 1 45  ? 5.916   9.968   -8.090  1.00 0.92  ? 559 LYS A H    4  
ATOM 7148  H HA   . LYS A 1 45  ? 4.051   11.851  -9.426  1.00 1.01  ? 559 LYS A HA   4  
ATOM 7149  H HB2  . LYS A 1 45  ? 3.280   9.894   -10.623 1.00 1.26  ? 559 LYS A HB2  4  
ATOM 7150  H HB3  . LYS A 1 45  ? 5.026   9.983   -10.707 1.00 1.53  ? 559 LYS A HB3  4  
ATOM 7151  H HG2  . LYS A 1 45  ? 5.348   8.050   -9.553  1.00 2.04  ? 559 LYS A HG2  4  
ATOM 7152  H HG3  . LYS A 1 45  ? 4.068   8.353   -8.397  1.00 2.49  ? 559 LYS A HG3  4  
ATOM 7153  H HD2  . LYS A 1 45  ? 3.572   7.386   -11.240 1.00 2.12  ? 559 LYS A HD2  4  
ATOM 7154  H HD3  . LYS A 1 45  ? 3.664   6.350   -9.800  1.00 2.38  ? 559 LYS A HD3  4  
ATOM 7155  H HE2  . LYS A 1 45  ? 1.810   7.594   -8.757  1.00 2.58  ? 559 LYS A HE2  4  
ATOM 7156  H HE3  . LYS A 1 45  ? 1.646   8.594   -10.205 1.00 2.24  ? 559 LYS A HE3  4  
ATOM 7157  H HZ1  . LYS A 1 45  ? 1.284   6.389   -11.429 1.00 3.21  ? 559 LYS A HZ1  4  
ATOM 7158  H HZ2  . LYS A 1 45  ? 0.073   6.844   -10.415 1.00 3.95  ? 559 LYS A HZ2  4  
ATOM 7159  H HZ3  . LYS A 1 45  ? 1.149   5.681   -9.974  1.00 3.51  ? 559 LYS A HZ3  4  
ATOM 7160  N N    . LEU A 1 46  ? 3.106   10.693  -6.709  1.00 0.84  ? 560 LEU A N    4  
ATOM 7161  C CA   . LEU A 1 46  ? 2.162   10.040  -5.799  1.00 0.88  ? 560 LEU A CA   4  
ATOM 7162  C C    . LEU A 1 46  ? 0.799   10.743  -5.696  1.00 0.92  ? 560 LEU A C    4  
ATOM 7163  O O    . LEU A 1 46  ? 0.704   11.973  -5.721  1.00 1.08  ? 560 LEU A O    4  
ATOM 7164  C CB   . LEU A 1 46  ? 2.847   9.835   -4.435  1.00 1.00  ? 560 LEU A CB   4  
ATOM 7165  C CG   . LEU A 1 46  ? 2.103   8.933   -3.439  1.00 1.09  ? 560 LEU A CG   4  
ATOM 7166  C CD1  . LEU A 1 46  ? 1.744   7.601   -4.083  1.00 2.18  ? 560 LEU A CD1  4  
ATOM 7167  C CD2  . LEU A 1 46  ? 3.032   8.557   -2.291  1.00 1.24  ? 560 LEU A CD2  4  
ATOM 7168  H H    . LEU A 1 46  ? 4.010   10.949  -6.337  1.00 0.75  ? 560 LEU A H    4  
ATOM 7169  H HA   . LEU A 1 46  ? 1.975   9.056   -6.233  1.00 0.91  ? 560 LEU A HA   4  
ATOM 7170  H HB2  . LEU A 1 46  ? 3.813   9.369   -4.621  1.00 1.36  ? 560 LEU A HB2  4  
ATOM 7171  H HB3  . LEU A 1 46  ? 3.019   10.808  -3.971  1.00 1.47  ? 560 LEU A HB3  4  
ATOM 7172  H HG   . LEU A 1 46  ? 1.211   9.430   -3.057  1.00 2.32  ? 560 LEU A HG   4  
ATOM 7173  H HD11 . LEU A 1 46  ? 2.624   7.260   -4.628  1.00 2.57  ? 560 LEU A HD11 4  
ATOM 7174  H HD12 . LEU A 1 46  ? 0.919   7.719   -4.772  1.00 3.28  ? 560 LEU A HD12 4  
ATOM 7175  H HD13 . LEU A 1 46  ? 1.443   6.882   -3.320  1.00 3.00  ? 560 LEU A HD13 4  
ATOM 7176  H HD21 . LEU A 1 46  ? 2.433   8.192   -1.462  1.00 1.91  ? 560 LEU A HD21 4  
ATOM 7177  H HD22 . LEU A 1 46  ? 3.582   9.435   -1.951  1.00 2.56  ? 560 LEU A HD22 4  
ATOM 7178  H HD23 . LEU A 1 46  ? 3.720   7.772   -2.624  1.00 1.88  ? 560 LEU A HD23 4  
ATOM 7179  N N    . LYS A 1 47  ? -0.259  9.934   -5.568  1.00 0.86  ? 561 LYS A N    4  
ATOM 7180  C CA   . LYS A 1 47  ? -1.663  10.356  -5.588  1.00 0.93  ? 561 LYS A CA   4  
ATOM 7181  C C    . LYS A 1 47  ? -2.364  10.137  -4.241  1.00 0.92  ? 561 LYS A C    4  
ATOM 7182  O O    . LYS A 1 47  ? -2.029  9.223   -3.481  1.00 0.87  ? 561 LYS A O    4  
ATOM 7183  C CB   . LYS A 1 47  ? -2.397  9.651   -6.746  1.00 1.09  ? 561 LYS A CB   4  
ATOM 7184  C CG   . LYS A 1 47  ? -3.421  10.562  -7.447  1.00 1.17  ? 561 LYS A CG   4  
ATOM 7185  C CD   . LYS A 1 47  ? -2.875  11.265  -8.705  1.00 1.54  ? 561 LYS A CD   4  
ATOM 7186  C CE   . LYS A 1 47  ? -1.661  12.175  -8.457  1.00 1.69  ? 561 LYS A CE   4  
ATOM 7187  N NZ   . LYS A 1 47  ? -1.120  12.692  -9.739  1.00 1.89  ? 561 LYS A NZ   4  
ATOM 7188  H H    . LYS A 1 47  ? -0.083  8.945   -5.468  1.00 0.83  ? 561 LYS A H    4  
ATOM 7189  H HA   . LYS A 1 47  ? -1.682  11.429  -5.773  1.00 1.06  ? 561 LYS A HA   4  
ATOM 7190  H HB2  . LYS A 1 47  ? -1.684  9.289   -7.490  1.00 1.44  ? 561 LYS A HB2  4  
ATOM 7191  H HB3  . LYS A 1 47  ? -2.914  8.775   -6.350  1.00 1.40  ? 561 LYS A HB3  4  
ATOM 7192  H HG2  . LYS A 1 47  ? -4.259  9.939   -7.753  1.00 1.34  ? 561 LYS A HG2  4  
ATOM 7193  H HG3  . LYS A 1 47  ? -3.813  11.304  -6.750  1.00 1.29  ? 561 LYS A HG3  4  
ATOM 7194  H HD2  . LYS A 1 47  ? -2.605  10.497  -9.429  1.00 1.72  ? 561 LYS A HD2  4  
ATOM 7195  H HD3  . LYS A 1 47  ? -3.681  11.862  -9.137  1.00 1.95  ? 561 LYS A HD3  4  
ATOM 7196  H HE2  . LYS A 1 47  ? -1.964  13.007  -7.813  1.00 1.94  ? 561 LYS A HE2  4  
ATOM 7197  H HE3  . LYS A 1 47  ? -0.884  11.607  -7.938  1.00 1.72  ? 561 LYS A HE3  4  
ATOM 7198  H HZ1  . LYS A 1 47  ? -1.825  13.220  -10.249 1.00 2.55  ? 561 LYS A HZ1  4  
ATOM 7199  H HZ2  . LYS A 1 47  ? -0.835  11.923  -10.340 1.00 2.27  ? 561 LYS A HZ2  4  
ATOM 7200  H HZ3  . LYS A 1 47  ? -0.314  13.296  -9.596  1.00 2.30  ? 561 LYS A HZ3  4  
ATOM 7201  N N    . PHE A 1 48  ? -3.342  10.994  -3.969  1.00 1.10  ? 562 PHE A N    4  
ATOM 7202  C CA   . PHE A 1 48  ? -4.057  11.125  -2.701  1.00 1.13  ? 562 PHE A CA   4  
ATOM 7203  C C    . PHE A 1 48  ? -5.580  10.993  -2.899  1.00 1.01  ? 562 PHE A C    4  
ATOM 7204  O O    . PHE A 1 48  ? -6.122  11.460  -3.903  1.00 1.06  ? 562 PHE A O    4  
ATOM 7205  C CB   . PHE A 1 48  ? -3.630  12.476  -2.107  1.00 1.52  ? 562 PHE A CB   4  
ATOM 7206  C CG   . PHE A 1 48  ? -4.577  13.077  -1.097  1.00 1.11  ? 562 PHE A CG   4  
ATOM 7207  C CD1  . PHE A 1 48  ? -4.627  12.568  0.210   1.00 2.22  ? 562 PHE A CD1  4  
ATOM 7208  C CD2  . PHE A 1 48  ? -5.409  14.146  -1.474  1.00 2.05  ? 562 PHE A CD2  4  
ATOM 7209  C CE1  . PHE A 1 48  ? -5.503  13.143  1.144   1.00 2.84  ? 562 PHE A CE1  4  
ATOM 7210  C CE2  . PHE A 1 48  ? -6.281  14.724  -0.537  1.00 1.78  ? 562 PHE A CE2  4  
ATOM 7211  C CZ   . PHE A 1 48  ? -6.324  14.225  0.775   1.00 1.83  ? 562 PHE A CZ   4  
ATOM 7212  H H    . PHE A 1 48  ? -3.514  11.724  -4.650  1.00 1.26  ? 562 PHE A H    4  
ATOM 7213  H HA   . PHE A 1 48  ? -3.749  10.337  -2.012  1.00 1.17  ? 562 PHE A HA   4  
ATOM 7214  H HB2  . PHE A 1 48  ? -2.648  12.360  -1.646  1.00 1.93  ? 562 PHE A HB2  4  
ATOM 7215  H HB3  . PHE A 1 48  ? -3.516  13.200  -2.914  1.00 2.40  ? 562 PHE A HB3  4  
ATOM 7216  H HD1  . PHE A 1 48  ? -4.002  11.733  0.494   1.00 3.27  ? 562 PHE A HD1  4  
ATOM 7217  H HD2  . PHE A 1 48  ? -5.382  14.519  -2.489  1.00 3.51  ? 562 PHE A HD2  4  
ATOM 7218  H HE1  . PHE A 1 48  ? -5.537  12.740  2.141   1.00 4.37  ? 562 PHE A HE1  4  
ATOM 7219  H HE2  . PHE A 1 48  ? -6.920  15.547  -0.828  1.00 2.76  ? 562 PHE A HE2  4  
ATOM 7220  H HZ   . PHE A 1 48  ? -6.996  14.677  1.490   1.00 2.35  ? 562 PHE A HZ   4  
ATOM 7221  N N    . GLU A 1 49  ? -6.270  10.344  -1.957  1.00 0.93  ? 563 GLU A N    4  
ATOM 7222  C CA   . GLU A 1 49  ? -7.714  10.056  -2.003  1.00 0.86  ? 563 GLU A CA   4  
ATOM 7223  C C    . GLU A 1 49  ? -8.382  10.193  -0.622  1.00 0.85  ? 563 GLU A C    4  
ATOM 7224  O O    . GLU A 1 49  ? -7.766  9.961   0.414   1.00 0.94  ? 563 GLU A O    4  
ATOM 7225  C CB   . GLU A 1 49  ? -7.955  8.632   -2.551  1.00 0.91  ? 563 GLU A CB   4  
ATOM 7226  C CG   . GLU A 1 49  ? -7.720  8.541   -4.065  1.00 1.51  ? 563 GLU A CG   4  
ATOM 7227  C CD   . GLU A 1 49  ? -7.749  7.108   -4.606  1.00 2.01  ? 563 GLU A CD   4  
ATOM 7228  O OE1  . GLU A 1 49  ? -8.771  6.400   -4.424  1.00 2.41  ? 563 GLU A OE1  4  
ATOM 7229  O OE2  . GLU A 1 49  ? -6.759  6.722   -5.281  1.00 3.15  ? 563 GLU A OE2  4  
ATOM 7230  H H    . GLU A 1 49  ? -5.770  10.004  -1.138  1.00 0.96  ? 563 GLU A H    4  
ATOM 7231  H HA   . GLU A 1 49  ? -8.201  10.772  -2.665  1.00 0.91  ? 563 GLU A HA   4  
ATOM 7232  H HB2  . GLU A 1 49  ? -7.297  7.931   -2.033  1.00 1.84  ? 563 GLU A HB2  4  
ATOM 7233  H HB3  . GLU A 1 49  ? -8.987  8.340   -2.352  1.00 1.79  ? 563 GLU A HB3  4  
ATOM 7234  H HG2  . GLU A 1 49  ? -8.484  9.133   -4.573  1.00 2.24  ? 563 GLU A HG2  4  
ATOM 7235  H HG3  . GLU A 1 49  ? -6.745  8.967   -4.305  1.00 2.66  ? 563 GLU A HG3  4  
ATOM 7236  N N    . VAL A 1 50  ? -9.673  10.531  -0.588  1.00 0.82  ? 564 VAL A N    4  
ATOM 7237  C CA   . VAL A 1 50  ? -10.482 10.642  0.639   1.00 0.82  ? 564 VAL A CA   4  
ATOM 7238  C C    . VAL A 1 50  ? -11.824 9.927   0.495   1.00 0.92  ? 564 VAL A C    4  
ATOM 7239  O O    . VAL A 1 50  ? -12.465 10.017  -0.557  1.00 1.04  ? 564 VAL A O    4  
ATOM 7240  C CB   . VAL A 1 50  ? -10.719 12.114  1.024   1.00 0.84  ? 564 VAL A CB   4  
ATOM 7241  C CG1  . VAL A 1 50  ? -11.317 12.269  2.413   1.00 0.91  ? 564 VAL A CG1  4  
ATOM 7242  C CG2  . VAL A 1 50  ? -9.430  12.934  0.969   1.00 0.80  ? 564 VAL A CG2  4  
ATOM 7243  H H    . VAL A 1 50  ? -10.102 10.803  -1.454  1.00 0.84  ? 564 VAL A H    4  
ATOM 7244  H HA   . VAL A 1 50  ? -9.939  10.169  1.454   1.00 0.79  ? 564 VAL A HA   4  
ATOM 7245  H HB   . VAL A 1 50  ? -11.440 12.569  0.357   1.00 0.93  ? 564 VAL A HB   4  
ATOM 7246  H HG11 . VAL A 1 50  ? -11.622 13.308  2.496   1.00 2.08  ? 564 VAL A HG11 4  
ATOM 7247  H HG12 . VAL A 1 50  ? -12.209 11.662  2.545   1.00 1.50  ? 564 VAL A HG12 4  
ATOM 7248  H HG13 . VAL A 1 50  ? -10.583 12.013  3.177   1.00 1.65  ? 564 VAL A HG13 4  
ATOM 7249  H HG21 . VAL A 1 50  ? -8.632  12.379  1.459   1.00 1.40  ? 564 VAL A HG21 4  
ATOM 7250  H HG22 . VAL A 1 50  ? -9.152  13.093  -0.075  1.00 1.62  ? 564 VAL A HG22 4  
ATOM 7251  H HG23 . VAL A 1 50  ? -9.573  13.901  1.455   1.00 1.78  ? 564 VAL A HG23 4  
ATOM 7252  N N    . PHE A 1 51  ? -12.273 9.282   1.573   1.00 0.89  ? 565 PHE A N    4  
ATOM 7253  C CA   . PHE A 1 51  ? -13.604 8.668   1.697   1.00 0.94  ? 565 PHE A CA   4  
ATOM 7254  C C    . PHE A 1 51  ? -14.255 9.030   3.041   1.00 0.86  ? 565 PHE A C    4  
ATOM 7255  O O    . PHE A 1 51  ? -13.558 9.159   4.045   1.00 0.76  ? 565 PHE A O    4  
ATOM 7256  C CB   . PHE A 1 51  ? -13.509 7.142   1.554   1.00 0.95  ? 565 PHE A CB   4  
ATOM 7257  C CG   . PHE A 1 51  ? -12.957 6.623   0.239   1.00 1.02  ? 565 PHE A CG   4  
ATOM 7258  C CD1  . PHE A 1 51  ? -11.563 6.572   0.021   1.00 1.72  ? 565 PHE A CD1  4  
ATOM 7259  C CD2  . PHE A 1 51  ? -13.835 6.111   -0.734  1.00 2.15  ? 565 PHE A CD2  4  
ATOM 7260  C CE1  . PHE A 1 51  ? -11.057 6.003   -1.162  1.00 1.76  ? 565 PHE A CE1  4  
ATOM 7261  C CE2  . PHE A 1 51  ? -13.325 5.527   -1.908  1.00 2.18  ? 565 PHE A CE2  4  
ATOM 7262  C CZ   . PHE A 1 51  ? -11.936 5.465   -2.117  1.00 1.15  ? 565 PHE A CZ   4  
ATOM 7263  H H    . PHE A 1 51  ? -11.688 9.305   2.405   1.00 0.84  ? 565 PHE A H    4  
ATOM 7264  H HA   . PHE A 1 51  ? -14.249 9.043   0.901   1.00 1.09  ? 565 PHE A HA   4  
ATOM 7265  H HB2  . PHE A 1 51  ? -12.894 6.753   2.360   1.00 0.88  ? 565 PHE A HB2  4  
ATOM 7266  H HB3  . PHE A 1 51  ? -14.508 6.725   1.697   1.00 1.02  ? 565 PHE A HB3  4  
ATOM 7267  H HD1  . PHE A 1 51  ? -10.880 6.956   0.766   1.00 2.84  ? 565 PHE A HD1  4  
ATOM 7268  H HD2  . PHE A 1 51  ? -14.903 6.144   -0.568  1.00 3.30  ? 565 PHE A HD2  4  
ATOM 7269  H HE1  . PHE A 1 51  ? -9.990  5.963   -1.336  1.00 2.86  ? 565 PHE A HE1  4  
ATOM 7270  H HE2  . PHE A 1 51  ? -13.999 5.112   -2.644  1.00 3.34  ? 565 PHE A HE2  4  
ATOM 7271  H HZ   . PHE A 1 51  ? -11.539 4.998   -3.008  1.00 1.22  ? 565 PHE A HZ   4  
ATOM 7272  N N    . GLN A 1 52  ? -15.579 9.188   3.069   1.00 0.99  ? 566 GLN A N    4  
ATOM 7273  C CA   . GLN A 1 52  ? -16.381 9.559   4.245   1.00 1.00  ? 566 GLN A CA   4  
ATOM 7274  C C    . GLN A 1 52  ? -16.830 8.323   5.073   1.00 0.92  ? 566 GLN A C    4  
ATOM 7275  O O    . GLN A 1 52  ? -16.727 7.188   4.597   1.00 0.89  ? 566 GLN A O    4  
ATOM 7276  C CB   . GLN A 1 52  ? -17.579 10.393  3.740   1.00 1.21  ? 566 GLN A CB   4  
ATOM 7277  C CG   . GLN A 1 52  ? -17.307 11.892  3.589   1.00 1.89  ? 566 GLN A CG   4  
ATOM 7278  C CD   . GLN A 1 52  ? -16.231 12.190  2.568   1.00 1.38  ? 566 GLN A CD   4  
ATOM 7279  O OE1  . GLN A 1 52  ? -16.444 12.162  1.362   1.00 2.10  ? 566 GLN A OE1  4  
ATOM 7280  N NE2  . GLN A 1 52  ? -15.021 12.459  2.995   1.00 1.62  ? 566 GLN A NE2  4  
ATOM 7281  H H    . GLN A 1 52  ? -16.087 9.011   2.207   1.00 1.11  ? 566 GLN A H    4  
ATOM 7282  H HA   . GLN A 1 52  ? -15.773 10.185  4.911   1.00 1.01  ? 566 GLN A HA   4  
ATOM 7283  H HB2  . GLN A 1 52  ? -17.950 9.985   2.798   1.00 1.18  ? 566 GLN A HB2  4  
ATOM 7284  H HB3  . GLN A 1 52  ? -18.384 10.329  4.451   1.00 1.28  ? 566 GLN A HB3  4  
ATOM 7285  H HG2  . GLN A 1 52  ? -18.224 12.385  3.273   1.00 2.77  ? 566 GLN A HG2  4  
ATOM 7286  H HG3  . GLN A 1 52  ? -17.017 12.299  4.557   1.00 2.73  ? 566 GLN A HG3  4  
ATOM 7287  H HE21 . GLN A 1 52  ? -14.823 12.589  3.974   1.00 2.56  ? 566 GLN A HE21 4  
ATOM 7288  H HE22 . GLN A 1 52  ? -14.327 12.599  2.296   1.00 1.57  ? 566 GLN A HE22 4  
ATOM 7289  N N    . PRO A 1 53  ? -17.333 8.503   6.316   1.00 0.96  ? 567 PRO A N    4  
ATOM 7290  C CA   . PRO A 1 53  ? -17.572 7.392   7.243   1.00 0.96  ? 567 PRO A CA   4  
ATOM 7291  C C    . PRO A 1 53  ? -18.563 6.331   6.736   1.00 1.04  ? 567 PRO A C    4  
ATOM 7292  O O    . PRO A 1 53  ? -19.698 6.647   6.366   1.00 1.20  ? 567 PRO A O    4  
ATOM 7293  C CB   . PRO A 1 53  ? -18.075 8.022   8.549   1.00 1.06  ? 567 PRO A CB   4  
ATOM 7294  C CG   . PRO A 1 53  ? -17.675 9.494   8.469   1.00 1.07  ? 567 PRO A CG   4  
ATOM 7295  C CD   . PRO A 1 53  ? -17.580 9.783   6.977   1.00 1.06  ? 567 PRO A CD   4  
ATOM 7296  H HA   . PRO A 1 53  ? -16.614 6.910   7.439   1.00 0.89  ? 567 PRO A HA   4  
ATOM 7297  H HB2  . PRO A 1 53  ? -19.161 7.952   8.613   1.00 1.18  ? 567 PRO A HB2  4  
ATOM 7298  H HB3  . PRO A 1 53  ? -17.619 7.534   9.410   1.00 1.06  ? 567 PRO A HB3  4  
ATOM 7299  H HG2  . PRO A 1 53  ? -18.409 10.138  8.954   1.00 1.18  ? 567 PRO A HG2  4  
ATOM 7300  H HG3  . PRO A 1 53  ? -16.702 9.641   8.922   1.00 1.02  ? 567 PRO A HG3  4  
ATOM 7301  H HD2  . PRO A 1 53  ? -18.528 10.196  6.638   1.00 1.17  ? 567 PRO A HD2  4  
ATOM 7302  H HD3  . PRO A 1 53  ? -16.779 10.499  6.796   1.00 1.06  ? 567 PRO A HD3  4  
ATOM 7303  N N    . GLY A 1 54  ? -18.156 5.060   6.777   1.00 0.99  ? 568 GLY A N    4  
ATOM 7304  C CA   . GLY A 1 54  ? -18.970 3.884   6.463   1.00 1.12  ? 568 GLY A CA   4  
ATOM 7305  C C    . GLY A 1 54  ? -18.786 3.380   5.032   1.00 1.07  ? 568 GLY A C    4  
ATOM 7306  O O    . GLY A 1 54  ? -19.261 2.291   4.710   1.00 1.24  ? 568 GLY A O    4  
ATOM 7307  H H    . GLY A 1 54  ? -17.181 4.868   6.950   1.00 0.91  ? 568 GLY A H    4  
ATOM 7308  H HA2  . GLY A 1 54  ? -18.703 3.077   7.143   1.00 1.16  ? 568 GLY A HA2  4  
ATOM 7309  H HA3  . GLY A 1 54  ? -20.025 4.116   6.608   1.00 1.27  ? 568 GLY A HA3  4  
ATOM 7310  N N    . ASP A 1 55  ? -18.093 4.135   4.175   1.00 0.94  ? 569 ASP A N    4  
ATOM 7311  C CA   . ASP A 1 55  ? -18.061 3.893   2.743   1.00 0.97  ? 569 ASP A CA   4  
ATOM 7312  C C    . ASP A 1 55  ? -17.014 2.834   2.356   1.00 0.83  ? 569 ASP A C    4  
ATOM 7313  O O    . ASP A 1 55  ? -15.854 2.905   2.765   1.00 0.74  ? 569 ASP A O    4  
ATOM 7314  C CB   . ASP A 1 55  ? -17.876 5.233   2.004   1.00 1.11  ? 569 ASP A CB   4  
ATOM 7315  C CG   . ASP A 1 55  ? -18.319 5.225   0.537   1.00 1.31  ? 569 ASP A CG   4  
ATOM 7316  O OD1  . ASP A 1 55  ? -18.843 4.205   0.029   1.00 2.32  ? 569 ASP A OD1  4  
ATOM 7317  O OD2  . ASP A 1 55  ? -18.186 6.277   -0.130  1.00 2.26  ? 569 ASP A OD2  4  
ATOM 7318  H H    . ASP A 1 55  ? -17.687 5.001   4.489   1.00 0.90  ? 569 ASP A H    4  
ATOM 7319  H HA   . ASP A 1 55  ? -19.046 3.515   2.508   1.00 1.13  ? 569 ASP A HA   4  
ATOM 7320  H HB2  . ASP A 1 55  ? -18.469 5.996   2.513   1.00 1.29  ? 569 ASP A HB2  4  
ATOM 7321  H HB3  . ASP A 1 55  ? -16.828 5.533   2.062   1.00 1.05  ? 569 ASP A HB3  4  
ATOM 7322  N N    . TYR A 1 56  ? -17.415 1.833   1.574   1.00 0.95  ? 570 TYR A N    4  
ATOM 7323  C CA   . TYR A 1 56  ? -16.520 0.770   1.096   1.00 0.93  ? 570 TYR A CA   4  
ATOM 7324  C C    . TYR A 1 56  ? -15.455 1.323   0.136   1.00 0.96  ? 570 TYR A C    4  
ATOM 7325  O O    . TYR A 1 56  ? -15.769 1.746   -0.979  1.00 1.07  ? 570 TYR A O    4  
ATOM 7326  C CB   . TYR A 1 56  ? -17.316 -0.384  0.475   1.00 1.08  ? 570 TYR A CB   4  
ATOM 7327  C CG   . TYR A 1 56  ? -17.899 -1.325  1.511   1.00 1.09  ? 570 TYR A CG   4  
ATOM 7328  C CD1  . TYR A 1 56  ? -17.112 -2.373  2.026   1.00 2.06  ? 570 TYR A CD1  4  
ATOM 7329  C CD2  . TYR A 1 56  ? -19.213 -1.138  1.978   1.00 2.14  ? 570 TYR A CD2  4  
ATOM 7330  C CE1  . TYR A 1 56  ? -17.637 -3.239  3.005   1.00 2.36  ? 570 TYR A CE1  4  
ATOM 7331  C CE2  . TYR A 1 56  ? -19.745 -2.005  2.950   1.00 2.09  ? 570 TYR A CE2  4  
ATOM 7332  C CZ   . TYR A 1 56  ? -18.960 -3.059  3.463   1.00 1.51  ? 570 TYR A CZ   4  
ATOM 7333  O OH   . TYR A 1 56  ? -19.479 -3.892  4.402   1.00 1.81  ? 570 TYR A OH   4  
ATOM 7334  H H    . TYR A 1 56  ? -18.394 1.821   1.318   1.00 1.15  ? 570 TYR A H    4  
ATOM 7335  H HA   . TYR A 1 56  ? -15.993 0.353   1.951   1.00 0.83  ? 570 TYR A HA   4  
ATOM 7336  H HB2  . TYR A 1 56  ? -18.112 0.013   -0.156  1.00 1.25  ? 570 TYR A HB2  4  
ATOM 7337  H HB3  . TYR A 1 56  ? -16.650 -0.968  -0.165  1.00 1.16  ? 570 TYR A HB3  4  
ATOM 7338  H HD1  . TYR A 1 56  ? -16.101 -2.516  1.669   1.00 3.16  ? 570 TYR A HD1  4  
ATOM 7339  H HD2  . TYR A 1 56  ? -19.817 -0.332  1.583   1.00 3.42  ? 570 TYR A HD2  4  
ATOM 7340  H HE1  . TYR A 1 56  ? -17.040 -4.052  3.390   1.00 3.66  ? 570 TYR A HE1  4  
ATOM 7341  H HE2  . TYR A 1 56  ? -20.755 -1.867  3.305   1.00 3.20  ? 570 TYR A HE2  4  
ATOM 7342  H HH   . TYR A 1 56  ? -18.829 -4.539  4.721   1.00 2.68  ? 570 TYR A HH   4  
ATOM 7343  N N    . ILE A 1 57  ? -14.192 1.309   0.568   1.00 0.94  ? 571 ILE A N    4  
ATOM 7344  C CA   . ILE A 1 57  ? -13.076 1.987   -0.117  1.00 1.03  ? 571 ILE A CA   4  
ATOM 7345  C C    . ILE A 1 57  ? -12.530 1.211   -1.327  1.00 1.19  ? 571 ILE A C    4  
ATOM 7346  O O    . ILE A 1 57  ? -11.943 1.809   -2.228  1.00 1.34  ? 571 ILE A O    4  
ATOM 7347  C CB   . ILE A 1 57  ? -11.935 2.289   0.876   1.00 0.92  ? 571 ILE A CB   4  
ATOM 7348  C CG1  . ILE A 1 57  ? -11.425 1.024   1.594   1.00 0.91  ? 571 ILE A CG1  4  
ATOM 7349  C CG2  . ILE A 1 57  ? -12.338 3.315   1.942   1.00 0.84  ? 571 ILE A CG2  4  
ATOM 7350  C CD1  . ILE A 1 57  ? -9.976  1.190   2.018   1.00 0.96  ? 571 ILE A CD1  4  
ATOM 7351  H H    . ILE A 1 57  ? -14.005 0.903   1.473   1.00 0.92  ? 571 ILE A H    4  
ATOM 7352  H HA   . ILE A 1 57  ? -13.425 2.946   -0.496  1.00 1.07  ? 571 ILE A HA   4  
ATOM 7353  H HB   . ILE A 1 57  ? -11.119 2.725   0.297   1.00 1.00  ? 571 ILE A HB   4  
ATOM 7354  H HG12 . ILE A 1 57  ? -12.042 0.796   2.463   1.00 1.12  ? 571 ILE A HG12 4  
ATOM 7355  H HG13 . ILE A 1 57  ? -11.450 0.176   0.926   1.00 1.17  ? 571 ILE A HG13 4  
ATOM 7356  H HG21 . ILE A 1 57  ? -12.648 4.236   1.456   1.00 1.92  ? 571 ILE A HG21 4  
ATOM 7357  H HG22 . ILE A 1 57  ? -13.160 2.938   2.545   1.00 1.57  ? 571 ILE A HG22 4  
ATOM 7358  H HG23 . ILE A 1 57  ? -11.489 3.529   2.593   1.00 1.46  ? 571 ILE A HG23 4  
ATOM 7359  H HD11 . ILE A 1 57  ? -9.891  1.970   2.770   1.00 1.91  ? 571 ILE A HD11 4  
ATOM 7360  H HD12 . ILE A 1 57  ? -9.613  0.250   2.426   1.00 1.53  ? 571 ILE A HD12 4  
ATOM 7361  H HD13 . ILE A 1 57  ? -9.390  1.453   1.135   1.00 1.87  ? 571 ILE A HD13 4  
ATOM 7362  N N    . ILE A 1 58  ? -12.687 -0.118  -1.333  1.00 1.19  ? 572 ILE A N    4  
ATOM 7363  C CA   . ILE A 1 58  ? -12.091 -1.046  -2.302  1.00 1.37  ? 572 ILE A CA   4  
ATOM 7364  C C    . ILE A 1 58  ? -13.150 -1.987  -2.890  1.00 1.54  ? 572 ILE A C    4  
ATOM 7365  O O    . ILE A 1 58  ? -14.022 -2.475  -2.164  1.00 1.73  ? 572 ILE A O    4  
ATOM 7366  C CB   . ILE A 1 58  ? -10.929 -1.822  -1.629  1.00 1.45  ? 572 ILE A CB   4  
ATOM 7367  C CG1  . ILE A 1 58  ? -9.750  -0.847  -1.422  1.00 1.83  ? 572 ILE A CG1  4  
ATOM 7368  C CG2  . ILE A 1 58  ? -10.462 -3.037  -2.452  1.00 1.61  ? 572 ILE A CG2  4  
ATOM 7369  C CD1  . ILE A 1 58  ? -8.553  -1.394  -0.639  1.00 1.46  ? 572 ILE A CD1  4  
ATOM 7370  H H    . ILE A 1 58  ? -13.123 -0.533  -0.527  1.00 1.09  ? 572 ILE A H    4  
ATOM 7371  H HA   . ILE A 1 58  ? -11.670 -0.467  -3.120  1.00 1.64  ? 572 ILE A HA   4  
ATOM 7372  H HB   . ILE A 1 58  ? -11.266 -2.187  -0.656  1.00 1.41  ? 572 ILE A HB   4  
ATOM 7373  H HG12 . ILE A 1 58  ? -9.419  -0.492  -2.394  1.00 2.44  ? 572 ILE A HG12 4  
ATOM 7374  H HG13 . ILE A 1 58  ? -10.099 0.022   -0.880  1.00 2.34  ? 572 ILE A HG13 4  
ATOM 7375  H HG21 . ILE A 1 58  ? -9.656  -3.551  -1.933  1.00 1.46  ? 572 ILE A HG21 4  
ATOM 7376  H HG22 . ILE A 1 58  ? -11.276 -3.754  -2.579  1.00 2.33  ? 572 ILE A HG22 4  
ATOM 7377  H HG23 . ILE A 1 58  ? -10.107 -2.704  -3.428  1.00 2.65  ? 572 ILE A HG23 4  
ATOM 7378  H HD11 . ILE A 1 58  ? -8.887  -1.781  0.323   1.00 1.81  ? 572 ILE A HD11 4  
ATOM 7379  H HD12 . ILE A 1 58  ? -8.044  -2.175  -1.202  1.00 2.15  ? 572 ILE A HD12 4  
ATOM 7380  H HD13 . ILE A 1 58  ? -7.852  -0.579  -0.465  1.00 2.20  ? 572 ILE A HD13 4  
ATOM 7381  N N    . ARG A 1 59  ? -13.000 -2.309  -4.183  1.00 1.75  ? 573 ARG A N    4  
ATOM 7382  C CA   . ARG A 1 59  ? -13.691 -3.404  -4.882  1.00 2.05  ? 573 ARG A CA   4  
ATOM 7383  C C    . ARG A 1 59  ? -12.661 -4.295  -5.578  1.00 1.72  ? 573 ARG A C    4  
ATOM 7384  O O    . ARG A 1 59  ? -12.126 -3.951  -6.634  1.00 2.05  ? 573 ARG A O    4  
ATOM 7385  C CB   . ARG A 1 59  ? -14.747 -2.805  -5.835  1.00 2.73  ? 573 ARG A CB   4  
ATOM 7386  C CG   . ARG A 1 59  ? -15.685 -3.805  -6.542  1.00 3.69  ? 573 ARG A CG   4  
ATOM 7387  C CD   . ARG A 1 59  ? -15.017 -4.615  -7.664  1.00 4.38  ? 573 ARG A CD   4  
ATOM 7388  N NE   . ARG A 1 59  ? -15.998 -5.266  -8.552  1.00 5.70  ? 573 ARG A NE   4  
ATOM 7389  C CZ   . ARG A 1 59  ? -15.836 -6.382  -9.241  1.00 6.92  ? 573 ARG A CZ   4  
ATOM 7390  N NH1  . ARG A 1 59  ? -14.718 -7.042  -9.297  1.00 7.35  ? 573 ARG A NH1  4  
ATOM 7391  N NH2  . ARG A 1 59  ? -16.807 -6.887  -9.936  1.00 8.17  ? 573 ARG A NH2  4  
ATOM 7392  H H    . ARG A 1 59  ? -12.256 -1.833  -4.689  1.00 1.83  ? 573 ARG A H    4  
ATOM 7393  H HA   . ARG A 1 59  ? -14.203 -4.016  -4.139  1.00 2.23  ? 573 ARG A HA   4  
ATOM 7394  H HB2  . ARG A 1 59  ? -15.381 -2.137  -5.246  1.00 3.29  ? 573 ARG A HB2  4  
ATOM 7395  H HB3  . ARG A 1 59  ? -14.248 -2.192  -6.587  1.00 2.73  ? 573 ARG A HB3  4  
ATOM 7396  H HG2  . ARG A 1 59  ? -16.108 -4.488  -5.806  1.00 4.18  ? 573 ARG A HG2  4  
ATOM 7397  H HG3  . ARG A 1 59  ? -16.500 -3.227  -6.978  1.00 4.41  ? 573 ARG A HG3  4  
ATOM 7398  H HD2  . ARG A 1 59  ? -14.404 -3.940  -8.261  1.00 4.70  ? 573 ARG A HD2  4  
ATOM 7399  H HD3  . ARG A 1 59  ? -14.380 -5.377  -7.214  1.00 4.46  ? 573 ARG A HD3  4  
ATOM 7400  H HE   . ARG A 1 59  ? -16.860 -4.767  -8.723  1.00 6.06  ? 573 ARG A HE   4  
ATOM 7401  H HH11 . ARG A 1 59  ? -13.868 -6.622  -8.940  1.00 6.77  ? 573 ARG A HH11 4  
ATOM 7402  H HH12 . ARG A 1 59  ? -14.705 -7.881  -9.863  1.00 8.58  ? 573 ARG A HH12 4  
ATOM 7403  H HH21 . ARG A 1 59  ? -17.714 -6.435  -9.990  1.00 8.31  ? 573 ARG A HH21 4  
ATOM 7404  H HH22 . ARG A 1 59  ? -16.626 -7.747  -10.441 1.00 9.20  ? 573 ARG A HH22 4  
ATOM 7405  N N    . GLU A 1 60  ? -12.367 -5.445  -4.983  1.00 1.89  ? 574 GLU A N    4  
ATOM 7406  C CA   . GLU A 1 60  ? -11.451 -6.450  -5.539  1.00 1.79  ? 574 GLU A CA   4  
ATOM 7407  C C    . GLU A 1 60  ? -12.168 -7.524  -6.388  1.00 2.49  ? 574 GLU A C    4  
ATOM 7408  O O    . GLU A 1 60  ? -13.366 -7.793  -6.233  1.00 3.59  ? 574 GLU A O    4  
ATOM 7409  C CB   . GLU A 1 60  ? -10.564 -6.998  -4.405  1.00 2.99  ? 574 GLU A CB   4  
ATOM 7410  C CG   . GLU A 1 60  ? -9.469  -7.994  -4.817  1.00 3.16  ? 574 GLU A CG   4  
ATOM 7411  C CD   . GLU A 1 60  ? -8.455  -7.436  -5.829  1.00 3.77  ? 574 GLU A CD   4  
ATOM 7412  O OE1  . GLU A 1 60  ? -8.811  -7.272  -7.019  1.00 4.03  ? 574 GLU A OE1  4  
ATOM 7413  O OE2  . GLU A 1 60  ? -7.294  -7.179  -5.441  1.00 4.89  ? 574 GLU A OE2  4  
ATOM 7414  H H    . GLU A 1 60  ? -12.838 -5.663  -4.109  1.00 2.54  ? 574 GLU A H    4  
ATOM 7415  H HA   . GLU A 1 60  ? -10.778 -5.938  -6.227  1.00 1.32  ? 574 GLU A HA   4  
ATOM 7416  H HB2  . GLU A 1 60  ? -10.076 -6.151  -3.921  1.00 3.45  ? 574 GLU A HB2  4  
ATOM 7417  H HB3  . GLU A 1 60  ? -11.204 -7.480  -3.666  1.00 4.10  ? 574 GLU A HB3  4  
ATOM 7418  H HG2  . GLU A 1 60  ? -8.936  -8.297  -3.913  1.00 3.93  ? 574 GLU A HG2  4  
ATOM 7419  H HG3  . GLU A 1 60  ? -9.945  -8.885  -5.225  1.00 3.07  ? 574 GLU A HG3  4  
ATOM 7420  N N    . GLY A 1 61  ? -11.412 -8.127  -7.304  1.00 2.35  ? 575 GLY A N    4  
ATOM 7421  C CA   . GLY A 1 61  ? -11.809 -9.146  -8.276  1.00 3.42  ? 575 GLY A CA   4  
ATOM 7422  C C    . GLY A 1 61  ? -11.037 -9.057  -9.602  1.00 3.18  ? 575 GLY A C    4  
ATOM 7423  O O    . GLY A 1 61  ? -11.516 -9.581  -10.609 1.00 4.03  ? 575 GLY A O    4  
ATOM 7424  H H    . GLY A 1 61  ? -10.438 -7.836  -7.327  1.00 1.70  ? 575 GLY A H    4  
ATOM 7425  H HA2  . GLY A 1 61  ? -11.627 -10.131 -7.845  1.00 4.04  ? 575 GLY A HA2  4  
ATOM 7426  H HA3  . GLY A 1 61  ? -12.873 -9.054  -8.493  1.00 4.20  ? 575 GLY A HA3  4  
ATOM 7427  N N    . THR A 1 62  ? -9.894  -8.356  -9.651  1.00 2.23  ? 576 THR A N    4  
ATOM 7428  C CA   . THR A 1 62  ? -9.243  -7.920  -10.905 1.00 2.32  ? 576 THR A CA   4  
ATOM 7429  C C    . THR A 1 62  ? -7.721  -8.125  -10.909 1.00 1.95  ? 576 THR A C    4  
ATOM 7430  O O    . THR A 1 62  ? -7.127  -8.532  -9.906  1.00 1.92  ? 576 THR A O    4  
ATOM 7431  C CB   . THR A 1 62  ? -9.651  -6.464  -11.212 1.00 2.92  ? 576 THR A CB   4  
ATOM 7432  O OG1  . THR A 1 62  ? -9.236  -6.023  -12.485 1.00 3.24  ? 576 THR A OG1  4  
ATOM 7433  C CG2  . THR A 1 62  ? -9.111  -5.455  -10.203 1.00 3.15  ? 576 THR A CG2  4  
ATOM 7434  H H    . THR A 1 62  ? -9.503  -7.993  -8.784  1.00 1.80  ? 576 THR A H    4  
ATOM 7435  H HA   . THR A 1 62  ? -9.631  -8.528  -11.718 1.00 2.76  ? 576 THR A HA   4  
ATOM 7436  H HB   . THR A 1 62  ? -10.737 -6.420  -11.202 1.00 3.60  ? 576 THR A HB   4  
ATOM 7437  H HG1  . THR A 1 62  ? -9.532  -6.694  -13.138 1.00 3.30  ? 576 THR A HG1  4  
ATOM 7438  H HG21 . THR A 1 62  ? -9.437  -5.731  -9.202  1.00 3.96  ? 576 THR A HG21 4  
ATOM 7439  H HG22 . THR A 1 62  ? -9.501  -4.465  -10.439 1.00 3.80  ? 576 THR A HG22 4  
ATOM 7440  H HG23 . THR A 1 62  ? -8.022  -5.431  -10.238 1.00 2.99  ? 576 THR A HG23 4  
ATOM 7441  N N    . ILE A 1 63  ? -7.088  -7.912  -12.068 1.00 2.23  ? 577 ILE A N    4  
ATOM 7442  C CA   . ILE A 1 63  ? -5.650  -8.062  -12.307 1.00 2.24  ? 577 ILE A CA   4  
ATOM 7443  C C    . ILE A 1 63  ? -4.953  -6.694  -12.474 1.00 2.29  ? 577 ILE A C    4  
ATOM 7444  O O    . ILE A 1 63  ? -5.347  -5.858  -13.301 1.00 2.55  ? 577 ILE A O    4  
ATOM 7445  C CB   . ILE A 1 63  ? -5.408  -8.981  -13.528 1.00 2.65  ? 577 ILE A CB   4  
ATOM 7446  C CG1  . ILE A 1 63  ? -5.961  -10.414 -13.338 1.00 2.84  ? 577 ILE A CG1  4  
ATOM 7447  C CG2  . ILE A 1 63  ? -3.897  -9.100  -13.818 1.00 2.77  ? 577 ILE A CG2  4  
ATOM 7448  C CD1  . ILE A 1 63  ? -7.470  -10.622 -13.524 1.00 3.22  ? 577 ILE A CD1  4  
ATOM 7449  H H    . ILE A 1 63  ? -7.664  -7.681  -12.867 1.00 2.68  ? 577 ILE A H    4  
ATOM 7450  H HA   . ILE A 1 63  ? -5.213  -8.558  -11.439 1.00 2.07  ? 577 ILE A HA   4  
ATOM 7451  H HB   . ILE A 1 63  ? -5.881  -8.538  -14.407 1.00 2.89  ? 577 ILE A HB   4  
ATOM 7452  H HG12 . ILE A 1 63  ? -5.502  -11.032 -14.096 1.00 3.25  ? 577 ILE A HG12 4  
ATOM 7453  H HG13 . ILE A 1 63  ? -5.662  -10.804 -12.366 1.00 2.59  ? 577 ILE A HG13 4  
ATOM 7454  H HG21 . ILE A 1 63  ? -3.475  -8.134  -14.094 1.00 3.47  ? 577 ILE A HG21 4  
ATOM 7455  H HG22 . ILE A 1 63  ? -3.367  -9.487  -12.946 1.00 2.54  ? 577 ILE A HG22 4  
ATOM 7456  H HG23 . ILE A 1 63  ? -3.727  -9.773  -14.659 1.00 3.42  ? 577 ILE A HG23 4  
ATOM 7457  H HD11 . ILE A 1 63  ? -8.030  -10.238 -12.675 1.00 3.70  ? 577 ILE A HD11 4  
ATOM 7458  H HD12 . ILE A 1 63  ? -7.800  -10.137 -14.442 1.00 4.07  ? 577 ILE A HD12 4  
ATOM 7459  H HD13 . ILE A 1 63  ? -7.672  -11.690 -13.603 1.00 3.20  ? 577 ILE A HD13 4  
ATOM 7460  N N    . GLY A 1 64  ? -3.858  -6.499  -11.732 1.00 2.17  ? 578 GLY A N    4  
ATOM 7461  C CA   . GLY A 1 64  ? -2.975  -5.331  -11.792 1.00 2.26  ? 578 GLY A CA   4  
ATOM 7462  C C    . GLY A 1 64  ? -3.378  -4.185  -10.858 1.00 1.99  ? 578 GLY A C    4  
ATOM 7463  O O    . GLY A 1 64  ? -3.131  -3.020  -11.188 1.00 2.13  ? 578 GLY A O    4  
ATOM 7464  H H    . GLY A 1 64  ? -3.643  -7.190  -11.018 1.00 2.09  ? 578 GLY A H    4  
ATOM 7465  H HA2  . GLY A 1 64  ? -1.977  -5.649  -11.499 1.00 2.36  ? 578 GLY A HA2  4  
ATOM 7466  H HA3  . GLY A 1 64  ? -2.919  -4.953  -12.812 1.00 2.55  ? 578 GLY A HA3  4  
ATOM 7467  N N    . LYS A 1 65  ? -4.036  -4.498  -9.732  1.00 1.79  ? 579 LYS A N    4  
ATOM 7468  C CA   . LYS A 1 65  ? -4.528  -3.513  -8.754  1.00 1.65  ? 579 LYS A CA   4  
ATOM 7469  C C    . LYS A 1 65  ? -3.372  -2.780  -8.046  1.00 1.43  ? 579 LYS A C    4  
ATOM 7470  O O    . LYS A 1 65  ? -2.320  -3.372  -7.796  1.00 1.49  ? 579 LYS A O    4  
ATOM 7471  C CB   . LYS A 1 65  ? -5.525  -4.174  -7.796  1.00 1.72  ? 579 LYS A CB   4  
ATOM 7472  C CG   . LYS A 1 65  ? -6.247  -3.116  -6.940  1.00 2.63  ? 579 LYS A CG   4  
ATOM 7473  C CD   . LYS A 1 65  ? -7.542  -3.656  -6.337  1.00 2.81  ? 579 LYS A CD   4  
ATOM 7474  C CE   . LYS A 1 65  ? -8.735  -3.668  -7.305  1.00 3.53  ? 579 LYS A CE   4  
ATOM 7475  N NZ   . LYS A 1 65  ? -9.375  -2.338  -7.443  1.00 4.23  ? 579 LYS A NZ   4  
ATOM 7476  H H    . LYS A 1 65  ? -4.131  -5.485  -9.509  1.00 1.84  ? 579 LYS A H    4  
ATOM 7477  H HA   . LYS A 1 65  ? -5.123  -2.772  -9.276  1.00 1.91  ? 579 LYS A HA   4  
ATOM 7478  H HB2  . LYS A 1 65  ? -6.263  -4.714  -8.392  1.00 1.94  ? 579 LYS A HB2  4  
ATOM 7479  H HB3  . LYS A 1 65  ? -5.011  -4.888  -7.150  1.00 1.87  ? 579 LYS A HB3  4  
ATOM 7480  H HG2  . LYS A 1 65  ? -5.584  -2.819  -6.126  1.00 3.22  ? 579 LYS A HG2  4  
ATOM 7481  H HG3  . LYS A 1 65  ? -6.477  -2.231  -7.530  1.00 3.23  ? 579 LYS A HG3  4  
ATOM 7482  H HD2  . LYS A 1 65  ? -7.336  -4.675  -6.030  1.00 2.84  ? 579 LYS A HD2  4  
ATOM 7483  H HD3  . LYS A 1 65  ? -7.791  -3.059  -5.463  1.00 3.43  ? 579 LYS A HD3  4  
ATOM 7484  H HE2  . LYS A 1 65  ? -8.381  -4.007  -8.281  1.00 4.05  ? 579 LYS A HE2  4  
ATOM 7485  H HE3  . LYS A 1 65  ? -9.472  -4.389  -6.944  1.00 4.30  ? 579 LYS A HE3  4  
ATOM 7486  H HZ1  . LYS A 1 65  ? -10.142 -2.346  -8.109  1.00 4.75  ? 579 LYS A HZ1  4  
ATOM 7487  H HZ2  . LYS A 1 65  ? -8.706  -1.635  -7.761  1.00 4.61  ? 579 LYS A HZ2  4  
ATOM 7488  H HZ3  . LYS A 1 65  ? -9.756  -1.987  -6.569  1.00 4.77  ? 579 LYS A HZ3  4  
ATOM 7489  N N    . LYS A 1 66  ? -3.585  -1.506  -7.699  1.00 1.34  ? 580 LYS A N    4  
ATOM 7490  C CA   . LYS A 1 66  ? -2.604  -0.639  -7.019  1.00 1.23  ? 580 LYS A CA   4  
ATOM 7491  C C    . LYS A 1 66  ? -2.611  -0.845  -5.496  1.00 1.11  ? 580 LYS A C    4  
ATOM 7492  O O    . LYS A 1 66  ? -3.475  -1.528  -4.948  1.00 1.20  ? 580 LYS A O    4  
ATOM 7493  C CB   . LYS A 1 66  ? -2.916  0.832   -7.350  1.00 1.39  ? 580 LYS A CB   4  
ATOM 7494  C CG   . LYS A 1 66  ? -2.653  1.216   -8.815  1.00 1.73  ? 580 LYS A CG   4  
ATOM 7495  C CD   . LYS A 1 66  ? -2.833  2.731   -9.001  1.00 2.49  ? 580 LYS A CD   4  
ATOM 7496  C CE   . LYS A 1 66  ? -4.315  3.147   -9.025  1.00 3.07  ? 580 LYS A CE   4  
ATOM 7497  N NZ   . LYS A 1 66  ? -4.839  3.288   -10.403 1.00 3.43  ? 580 LYS A NZ   4  
ATOM 7498  H H    . LYS A 1 66  ? -4.457  -1.088  -8.008  1.00 1.44  ? 580 LYS A H    4  
ATOM 7499  H HA   . LYS A 1 66  ? -1.600  -0.880  -7.371  1.00 1.31  ? 580 LYS A HA   4  
ATOM 7500  H HB2  . LYS A 1 66  ? -3.957  1.038   -7.102  1.00 2.31  ? 580 LYS A HB2  4  
ATOM 7501  H HB3  . LYS A 1 66  ? -2.295  1.470   -6.720  1.00 2.07  ? 580 LYS A HB3  4  
ATOM 7502  H HG2  . LYS A 1 66  ? -1.631  0.948   -9.074  1.00 2.62  ? 580 LYS A HG2  4  
ATOM 7503  H HG3  . LYS A 1 66  ? -3.323  0.674   -9.479  1.00 2.60  ? 580 LYS A HG3  4  
ATOM 7504  H HD2  . LYS A 1 66  ? -2.332  3.230   -8.168  1.00 2.71  ? 580 LYS A HD2  4  
ATOM 7505  H HD3  . LYS A 1 66  ? -2.347  3.049   -9.925  1.00 3.13  ? 580 LYS A HD3  4  
ATOM 7506  H HE2  . LYS A 1 66  ? -4.904  2.405   -8.479  1.00 3.12  ? 580 LYS A HE2  4  
ATOM 7507  H HE3  . LYS A 1 66  ? -4.420  4.101   -8.507  1.00 3.91  ? 580 LYS A HE3  4  
ATOM 7508  H HZ1  . LYS A 1 66  ? -4.358  4.025   -10.911 1.00 4.02  ? 580 LYS A HZ1  4  
ATOM 7509  H HZ2  . LYS A 1 66  ? -5.828  3.531   -10.407 1.00 3.93  ? 580 LYS A HZ2  4  
ATOM 7510  H HZ3  . LYS A 1 66  ? -4.736  2.421   -10.926 1.00 3.52  ? 580 LYS A HZ3  4  
ATOM 7511  N N    . MET A 1 67  ? -1.640  -0.238  -4.813  1.00 1.02  ? 581 MET A N    4  
ATOM 7512  C CA   . MET A 1 67  ? -1.514  -0.281  -3.351  1.00 0.99  ? 581 MET A CA   4  
ATOM 7513  C C    . MET A 1 67  ? -2.295  0.872   -2.709  1.00 0.95  ? 581 MET A C    4  
ATOM 7514  O O    . MET A 1 67  ? -2.163  2.007   -3.169  1.00 0.91  ? 581 MET A O    4  
ATOM 7515  C CB   . MET A 1 67  ? -0.025  -0.229  -2.964  1.00 1.14  ? 581 MET A CB   4  
ATOM 7516  C CG   . MET A 1 67  ? 0.196   -0.331  -1.451  1.00 1.47  ? 581 MET A CG   4  
ATOM 7517  S SD   . MET A 1 67  ? -0.456  -1.858  -0.732  1.00 2.55  ? 581 MET A SD   4  
ATOM 7518  C CE   . MET A 1 67  ? -0.513  -1.395  1.017   1.00 2.19  ? 581 MET A CE   4  
ATOM 7519  H H    . MET A 1 67  ? -1.029  0.396   -5.322  1.00 1.07  ? 581 MET A H    4  
ATOM 7520  H HA   . MET A 1 67  ? -1.934  -1.222  -2.992  1.00 1.01  ? 581 MET A HA   4  
ATOM 7521  H HB2  . MET A 1 67  ? 0.501   -1.053  -3.451  1.00 1.38  ? 581 MET A HB2  4  
ATOM 7522  H HB3  . MET A 1 67  ? 0.409   0.709   -3.313  1.00 1.58  ? 581 MET A HB3  4  
ATOM 7523  H HG2  . MET A 1 67  ? 1.266   -0.278  -1.245  1.00 2.07  ? 581 MET A HG2  4  
ATOM 7524  H HG3  . MET A 1 67  ? -0.278  0.522   -0.965  1.00 2.65  ? 581 MET A HG3  4  
ATOM 7525  H HE1  . MET A 1 67  ? -1.004  -2.193  1.576   1.00 3.03  ? 581 MET A HE1  4  
ATOM 7526  H HE2  . MET A 1 67  ? 0.492   -1.269  1.411   1.00 1.83  ? 581 MET A HE2  4  
ATOM 7527  H HE3  . MET A 1 67  ? -1.058  -0.456  1.159   1.00 2.79  ? 581 MET A HE3  4  
ATOM 7528  N N    . TYR A 1 68  ? -3.052  0.602   -1.636  1.00 1.01  ? 582 TYR A N    4  
ATOM 7529  C CA   . TYR A 1 68  ? -3.810  1.620   -0.894  1.00 1.03  ? 582 TYR A CA   4  
ATOM 7530  C C    . TYR A 1 68  ? -3.513  1.563   0.607   1.00 1.12  ? 582 TYR A C    4  
ATOM 7531  O O    . TYR A 1 68  ? -3.496  0.505   1.244   1.00 1.29  ? 582 TYR A O    4  
ATOM 7532  C CB   . TYR A 1 68  ? -5.321  1.539   -1.164  1.00 1.06  ? 582 TYR A CB   4  
ATOM 7533  C CG   . TYR A 1 68  ? -5.706  1.717   -2.620  1.00 1.24  ? 582 TYR A CG   4  
ATOM 7534  C CD1  . TYR A 1 68  ? -5.599  0.645   -3.531  1.00 1.96  ? 582 TYR A CD1  4  
ATOM 7535  C CD2  . TYR A 1 68  ? -6.143  2.976   -3.072  1.00 2.47  ? 582 TYR A CD2  4  
ATOM 7536  C CE1  . TYR A 1 68  ? -5.873  0.848   -4.896  1.00 2.24  ? 582 TYR A CE1  4  
ATOM 7537  C CE2  . TYR A 1 68  ? -6.422  3.180   -4.434  1.00 2.84  ? 582 TYR A CE2  4  
ATOM 7538  C CZ   . TYR A 1 68  ? -6.265  2.123   -5.354  1.00 2.17  ? 582 TYR A CZ   4  
ATOM 7539  O OH   . TYR A 1 68  ? -6.453  2.342   -6.682  1.00 2.77  ? 582 TYR A OH   4  
ATOM 7540  H H    . TYR A 1 68  ? -3.069  -0.342  -1.271  1.00 1.09  ? 582 TYR A H    4  
ATOM 7541  H HA   . TYR A 1 68  ? -3.489  2.602   -1.241  1.00 0.99  ? 582 TYR A HA   4  
ATOM 7542  H HB2  . TYR A 1 68  ? -5.724  0.601   -0.789  1.00 1.14  ? 582 TYR A HB2  4  
ATOM 7543  H HB3  . TYR A 1 68  ? -5.802  2.331   -0.590  1.00 1.12  ? 582 TYR A HB3  4  
ATOM 7544  H HD1  . TYR A 1 68  ? -5.269  -0.328  -3.190  1.00 3.03  ? 582 TYR A HD1  4  
ATOM 7545  H HD2  . TYR A 1 68  ? -6.248  3.798   -2.377  1.00 3.58  ? 582 TYR A HD2  4  
ATOM 7546  H HE1  . TYR A 1 68  ? -5.760  0.035   -5.598  1.00 3.28  ? 582 TYR A HE1  4  
ATOM 7547  H HE2  . TYR A 1 68  ? -6.754  4.148   -4.774  1.00 4.08  ? 582 TYR A HE2  4  
ATOM 7548  H HH   . TYR A 1 68  ? -6.593  3.291   -6.851  1.00 3.66  ? 582 TYR A HH   4  
ATOM 7549  N N    . PHE A 1 69  ? -3.249  2.730   1.186   1.00 1.00  ? 583 PHE A N    4  
ATOM 7550  C CA   . PHE A 1 69  ? -2.763  2.835   2.558   1.00 0.95  ? 583 PHE A CA   4  
ATOM 7551  C C    . PHE A 1 69  ? -3.093  4.191   3.201   1.00 0.80  ? 583 PHE A C    4  
ATOM 7552  O O    . PHE A 1 69  ? -3.569  5.104   2.528   1.00 0.83  ? 583 PHE A O    4  
ATOM 7553  C CB   . PHE A 1 69  ? -1.297  2.344   2.612   1.00 1.07  ? 583 PHE A CB   4  
ATOM 7554  C CG   . PHE A 1 69  ? -0.255  2.659   1.547   1.00 1.54  ? 583 PHE A CG   4  
ATOM 7555  C CD1  . PHE A 1 69  ? -0.409  3.657   0.567   1.00 2.53  ? 583 PHE A CD1  4  
ATOM 7556  C CD2  . PHE A 1 69  ? 0.909   1.862   1.535   1.00 2.58  ? 583 PHE A CD2  4  
ATOM 7557  C CE1  . PHE A 1 69  ? 0.549   3.793   -0.455  1.00 3.16  ? 583 PHE A CE1  4  
ATOM 7558  C CE2  . PHE A 1 69  ? 1.896   2.041   0.554   1.00 3.31  ? 583 PHE A CE2  4  
ATOM 7559  C CZ   . PHE A 1 69  ? 1.712   3.001   -0.450  1.00 3.19  ? 583 PHE A CZ   4  
ATOM 7560  H H    . PHE A 1 69  ? -3.280  3.575   0.623   1.00 0.87  ? 583 PHE A H    4  
ATOM 7561  H HA   . PHE A 1 69  ? -3.341  2.124   3.151   1.00 1.08  ? 583 PHE A HA   4  
ATOM 7562  H HB2  . PHE A 1 69  ? -0.860  2.485   3.589   1.00 1.02  ? 583 PHE A HB2  4  
ATOM 7563  H HB3  . PHE A 1 69  ? -1.402  1.270   2.523   1.00 1.42  ? 583 PHE A HB3  4  
ATOM 7564  H HD1  . PHE A 1 69  ? -1.228  4.362   0.617   1.00 3.38  ? 583 PHE A HD1  4  
ATOM 7565  H HD2  . PHE A 1 69  ? 1.057   1.108   2.292   1.00 3.38  ? 583 PHE A HD2  4  
ATOM 7566  H HE1  . PHE A 1 69  ? 0.414   4.557   -1.207  1.00 4.14  ? 583 PHE A HE1  4  
ATOM 7567  H HE2  . PHE A 1 69  ? 2.795   1.442   0.572   1.00 4.42  ? 583 PHE A HE2  4  
ATOM 7568  H HZ   . PHE A 1 69  ? 2.491   3.150   -1.182  1.00 3.82  ? 583 PHE A HZ   4  
ATOM 7569  N N    . ILE A 1 70  ? -2.997  4.290   4.532   1.00 0.75  ? 584 ILE A N    4  
ATOM 7570  C CA   . ILE A 1 70  ? -3.745  5.287   5.324   1.00 0.74  ? 584 ILE A CA   4  
ATOM 7571  C C    . ILE A 1 70  ? -2.866  6.491   5.698   1.00 0.82  ? 584 ILE A C    4  
ATOM 7572  O O    . ILE A 1 70  ? -2.057  6.393   6.621   1.00 0.88  ? 584 ILE A O    4  
ATOM 7573  C CB   . ILE A 1 70  ? -4.405  4.621   6.568   1.00 0.74  ? 584 ILE A CB   4  
ATOM 7574  C CG1  . ILE A 1 70  ? -5.115  3.303   6.185   1.00 0.72  ? 584 ILE A CG1  4  
ATOM 7575  C CG2  . ILE A 1 70  ? -5.419  5.602   7.209   1.00 0.74  ? 584 ILE A CG2  4  
ATOM 7576  C CD1  . ILE A 1 70  ? -5.826  2.628   7.354   1.00 0.78  ? 584 ILE A CD1  4  
ATOM 7577  H H    . ILE A 1 70  ? -2.569  3.515   5.041   1.00 0.76  ? 584 ILE A H    4  
ATOM 7578  H HA   . ILE A 1 70  ? -4.562  5.668   4.710   1.00 0.71  ? 584 ILE A HA   4  
ATOM 7579  H HB   . ILE A 1 70  ? -3.635  4.353   7.308   1.00 0.78  ? 584 ILE A HB   4  
ATOM 7580  H HG12 . ILE A 1 70  ? -5.840  3.490   5.396   1.00 0.70  ? 584 ILE A HG12 4  
ATOM 7581  H HG13 . ILE A 1 70  ? -4.383  2.588   5.811   1.00 0.74  ? 584 ILE A HG13 4  
ATOM 7582  H HG21 . ILE A 1 70  ? -4.955  6.570   7.393   1.00 1.73  ? 584 ILE A HG21 4  
ATOM 7583  H HG22 . ILE A 1 70  ? -6.290  5.747   6.563   1.00 1.52  ? 584 ILE A HG22 4  
ATOM 7584  H HG23 . ILE A 1 70  ? -5.768  5.216   8.167   1.00 1.36  ? 584 ILE A HG23 4  
ATOM 7585  H HD11 . ILE A 1 70  ? -6.765  3.140   7.555   1.00 1.98  ? 584 ILE A HD11 4  
ATOM 7586  H HD12 . ILE A 1 70  ? -6.012  1.586   7.104   1.00 1.29  ? 584 ILE A HD12 4  
ATOM 7587  H HD13 . ILE A 1 70  ? -5.195  2.656   8.233   1.00 1.77  ? 584 ILE A HD13 4  
ATOM 7588  N N    . GLN A 1 71  ? -3.043  7.642   5.032   1.00 0.87  ? 585 GLN A N    4  
ATOM 7589  C CA   . GLN A 1 71  ? -2.380  8.902   5.403   1.00 0.98  ? 585 GLN A CA   4  
ATOM 7590  C C    . GLN A 1 71  ? -2.853  9.389   6.786   1.00 0.88  ? 585 GLN A C    4  
ATOM 7591  O O    . GLN A 1 71  ? -2.024  9.686   7.649   1.00 0.97  ? 585 GLN A O    4  
ATOM 7592  C CB   . GLN A 1 71  ? -2.619  9.934   4.276   1.00 1.15  ? 585 GLN A CB   4  
ATOM 7593  C CG   . GLN A 1 71  ? -1.867  11.270  4.405   1.00 1.51  ? 585 GLN A CG   4  
ATOM 7594  C CD   . GLN A 1 71  ? -2.631  12.350  5.173   1.00 1.94  ? 585 GLN A CD   4  
ATOM 7595  O OE1  . GLN A 1 71  ? -3.589  12.947  4.694   1.00 3.19  ? 585 GLN A OE1  4  
ATOM 7596  N NE2  . GLN A 1 71  ? -2.254  12.644  6.394   1.00 1.89  ? 585 GLN A NE2  4  
ATOM 7597  H H    . GLN A 1 71  ? -3.744  7.698   4.292   1.00 0.88  ? 585 GLN A H    4  
ATOM 7598  H HA   . GLN A 1 71  ? -1.306  8.718   5.472   1.00 1.15  ? 585 GLN A HA   4  
ATOM 7599  H HB2  . GLN A 1 71  ? -2.294  9.474   3.341   1.00 1.34  ? 585 GLN A HB2  4  
ATOM 7600  H HB3  . GLN A 1 71  ? -3.683  10.143  4.178   1.00 1.43  ? 585 GLN A HB3  4  
ATOM 7601  H HG2  . GLN A 1 71  ? -0.890  11.102  4.860   1.00 1.93  ? 585 GLN A HG2  4  
ATOM 7602  H HG3  . GLN A 1 71  ? -1.693  11.657  3.400   1.00 1.87  ? 585 GLN A HG3  4  
ATOM 7603  H HE21 . GLN A 1 71  ? -1.500  12.146  6.839   1.00 2.21  ? 585 GLN A HE21 4  
ATOM 7604  H HE22 . GLN A 1 71  ? -2.710  13.431  6.845   1.00 2.36  ? 585 GLN A HE22 4  
ATOM 7605  N N    . HIS A 1 72  ? -4.174  9.404   7.016   1.00 0.75  ? 586 HIS A N    4  
ATOM 7606  C CA   . HIS A 1 72  ? -4.802  9.753   8.297   1.00 0.74  ? 586 HIS A CA   4  
ATOM 7607  C C    . HIS A 1 72  ? -6.216  9.154   8.433   1.00 0.68  ? 586 HIS A C    4  
ATOM 7608  O O    . HIS A 1 72  ? -7.002  9.200   7.489   1.00 0.75  ? 586 HIS A O    4  
ATOM 7609  C CB   . HIS A 1 72  ? -4.877  11.284  8.416   1.00 0.83  ? 586 HIS A CB   4  
ATOM 7610  C CG   . HIS A 1 72  ? -5.379  11.774  9.748   1.00 1.22  ? 586 HIS A CG   4  
ATOM 7611  N ND1  . HIS A 1 72  ? -4.610  12.139  10.829  1.00 2.02  ? 586 HIS A ND1  4  
ATOM 7612  C CD2  . HIS A 1 72  ? -6.688  11.965  10.099  1.00 2.42  ? 586 HIS A CD2  4  
ATOM 7613  C CE1  . HIS A 1 72  ? -5.434  12.531  11.813  1.00 2.22  ? 586 HIS A CE1  4  
ATOM 7614  N NE2  . HIS A 1 72  ? -6.719  12.436  11.417  1.00 2.56  ? 586 HIS A NE2  4  
ATOM 7615  H H    . HIS A 1 72  ? -4.786  9.148   6.248   1.00 0.71  ? 586 HIS A H    4  
ATOM 7616  H HA   . HIS A 1 72  ? -4.182  9.379   9.109   1.00 0.82  ? 586 HIS A HA   4  
ATOM 7617  H HB2  . HIS A 1 72  ? -3.886  11.696  8.259   1.00 1.01  ? 586 HIS A HB2  4  
ATOM 7618  H HB3  . HIS A 1 72  ? -5.523  11.686  7.636   1.00 1.03  ? 586 HIS A HB3  4  
ATOM 7619  H HD1  . HIS A 1 72  ? -3.590  12.188  10.861  1.00 3.09  ? 586 HIS A HD1  4  
ATOM 7620  H HD2  . HIS A 1 72  ? -7.547  11.787  9.463   1.00 3.61  ? 586 HIS A HD2  4  
ATOM 7621  H HE1  . HIS A 1 72  ? -5.110  12.891  12.784  1.00 2.95  ? 586 HIS A HE1  4  
ATOM 7622  N N    . GLY A 1 73  ? -6.589  8.642   9.610   1.00 0.77  ? 587 GLY A N    4  
ATOM 7623  C CA   . GLY A 1 73  ? -7.971  8.317   9.961   1.00 0.85  ? 587 GLY A CA   4  
ATOM 7624  C C    . GLY A 1 73  ? -8.053  6.933   10.585  1.00 0.80  ? 587 GLY A C    4  
ATOM 7625  O O    . GLY A 1 73  ? -7.114  6.495   11.258  1.00 0.98  ? 587 GLY A O    4  
ATOM 7626  H H    . GLY A 1 73  ? -5.903  8.417   10.313  1.00 0.88  ? 587 GLY A H    4  
ATOM 7627  H HA2  . GLY A 1 73  ? -8.347  9.044   10.682  1.00 1.01  ? 587 GLY A HA2  4  
ATOM 7628  H HA3  . GLY A 1 73  ? -8.613  8.350   9.081   1.00 0.92  ? 587 GLY A HA3  4  
ATOM 7629  N N    . VAL A 1 74  ? -9.171  6.251   10.342  1.00 0.65  ? 588 VAL A N    4  
ATOM 7630  C CA   . VAL A 1 74  ? -9.414  4.864   10.741  1.00 0.63  ? 588 VAL A CA   4  
ATOM 7631  C C    . VAL A 1 74  ? -10.233 4.162   9.635   1.00 0.64  ? 588 VAL A C    4  
ATOM 7632  O O    . VAL A 1 74  ? -11.056 4.790   8.961   1.00 0.66  ? 588 VAL A O    4  
ATOM 7633  C CB   . VAL A 1 74  ? -10.130 4.790   12.119  1.00 0.67  ? 588 VAL A CB   4  
ATOM 7634  C CG1  . VAL A 1 74  ? -10.303 3.358   12.643  1.00 0.72  ? 588 VAL A CG1  4  
ATOM 7635  C CG2  . VAL A 1 74  ? -9.400  5.556   13.232  1.00 0.75  ? 588 VAL A CG2  4  
ATOM 7636  H H    . VAL A 1 74  ? -9.884  6.675   9.768   1.00 0.63  ? 588 VAL A H    4  
ATOM 7637  H HA   . VAL A 1 74  ? -8.432  4.400   10.822  1.00 0.66  ? 588 VAL A HA   4  
ATOM 7638  H HB   . VAL A 1 74  ? -11.118 5.233   12.021  1.00 0.68  ? 588 VAL A HB   4  
ATOM 7639  H HG11 . VAL A 1 74  ? -10.872 2.755   11.942  1.00 1.62  ? 588 VAL A HG11 4  
ATOM 7640  H HG12 . VAL A 1 74  ? -9.329  2.898   12.811  1.00 1.73  ? 588 VAL A HG12 4  
ATOM 7641  H HG13 . VAL A 1 74  ? -10.851 3.372   13.586  1.00 1.39  ? 588 VAL A HG13 4  
ATOM 7642  H HG21 . VAL A 1 74  ? -8.381  5.183   13.341  1.00 1.67  ? 588 VAL A HG21 4  
ATOM 7643  H HG22 . VAL A 1 74  ? -9.380  6.623   13.011  1.00 1.52  ? 588 VAL A HG22 4  
ATOM 7644  H HG23 . VAL A 1 74  ? -9.925  5.430   14.179  1.00 1.74  ? 588 VAL A HG23 4  
ATOM 7645  N N    . VAL A 1 75  ? -10.039 2.858   9.444   1.00 0.68  ? 589 VAL A N    4  
ATOM 7646  C CA   . VAL A 1 75  ? -10.868 1.976   8.594   1.00 0.67  ? 589 VAL A CA   4  
ATOM 7647  C C    . VAL A 1 75  ? -11.442 0.821   9.410   1.00 0.69  ? 589 VAL A C    4  
ATOM 7648  O O    . VAL A 1 75  ? -10.832 0.404   10.389  1.00 0.72  ? 589 VAL A O    4  
ATOM 7649  C CB   . VAL A 1 75  ? -10.106 1.434   7.370   1.00 0.64  ? 589 VAL A CB   4  
ATOM 7650  C CG1  . VAL A 1 75  ? -9.754  2.561   6.393   1.00 0.67  ? 589 VAL A CG1  4  
ATOM 7651  C CG2  . VAL A 1 75  ? -8.851  0.654   7.776   1.00 0.65  ? 589 VAL A CG2  4  
ATOM 7652  H H    . VAL A 1 75  ? -9.337  2.410   10.029  1.00 0.68  ? 589 VAL A H    4  
ATOM 7653  H HA   . VAL A 1 75  ? -11.714 2.535   8.209   1.00 0.72  ? 589 VAL A HA   4  
ATOM 7654  H HB   . VAL A 1 75  ? -10.756 0.742   6.841   1.00 0.65  ? 589 VAL A HB   4  
ATOM 7655  H HG11 . VAL A 1 75  ? -10.648 3.130   6.142   1.00 1.30  ? 589 VAL A HG11 4  
ATOM 7656  H HG12 . VAL A 1 75  ? -9.019  3.234   6.831   1.00 1.60  ? 589 VAL A HG12 4  
ATOM 7657  H HG13 . VAL A 1 75  ? -9.364  2.138   5.469   1.00 1.69  ? 589 VAL A HG13 4  
ATOM 7658  H HG21 . VAL A 1 75  ? -8.160  1.309   8.305   1.00 1.78  ? 589 VAL A HG21 4  
ATOM 7659  H HG22 . VAL A 1 75  ? -9.117  -0.176  8.428   1.00 1.41  ? 589 VAL A HG22 4  
ATOM 7660  H HG23 . VAL A 1 75  ? -8.364  0.238   6.897   1.00 1.76  ? 589 VAL A HG23 4  
ATOM 7661  N N    . SER A 1 76  ? -12.570 0.261   8.977   1.00 0.74  ? 590 SER A N    4  
ATOM 7662  C CA   . SER A 1 76  ? -13.165 -0.979  9.496   1.00 0.86  ? 590 SER A CA   4  
ATOM 7663  C C    . SER A 1 76  ? -13.037 -2.020  8.393   1.00 0.95  ? 590 SER A C    4  
ATOM 7664  O O    . SER A 1 76  ? -13.394 -1.819  7.236   1.00 0.95  ? 590 SER A O    4  
ATOM 7665  C CB   . SER A 1 76  ? -14.653 -0.847  9.873   1.00 1.03  ? 590 SER A CB   4  
ATOM 7666  O OG   . SER A 1 76  ? -15.050 0.478   10.210  1.00 1.69  ? 590 SER A OG   4  
ATOM 7667  H H    . SER A 1 76  ? -12.906 0.563   8.070   1.00 0.78  ? 590 SER A H    4  
ATOM 7668  H HA   . SER A 1 76  ? -12.584 -1.337  10.369  1.00 0.87  ? 590 SER A HA   4  
ATOM 7669  H HB2  . SER A 1 76  ? -15.257 -1.136  9.012   1.00 1.10  ? 590 SER A HB2  4  
ATOM 7670  H HB3  . SER A 1 76  ? -14.882 -1.569  10.668  1.00 1.23  ? 590 SER A HB3  4  
ATOM 7671  H HG   . SER A 1 76  ? -14.653 0.768   11.053  1.00 1.27  ? 590 SER A HG   4  
ATOM 7672  N N    . VAL A 1 77  ? -12.397 -3.110  8.741   1.00 1.09  ? 591 VAL A N    4  
ATOM 7673  C CA   . VAL A 1 77  ? -11.497 -3.835  7.867   1.00 1.15  ? 591 VAL A CA   4  
ATOM 7674  C C    . VAL A 1 77  ? -11.703 -5.310  8.150   1.00 1.27  ? 591 VAL A C    4  
ATOM 7675  O O    . VAL A 1 77  ? -12.038 -5.688  9.279   1.00 1.24  ? 591 VAL A O    4  
ATOM 7676  C CB   . VAL A 1 77  ? -10.070 -3.347  8.191   1.00 1.60  ? 591 VAL A CB   4  
ATOM 7677  C CG1  . VAL A 1 77  ? -9.810  -3.292  9.682   1.00 2.79  ? 591 VAL A CG1  4  
ATOM 7678  C CG2  . VAL A 1 77  ? -8.960  -4.274  7.810   1.00 1.13  ? 591 VAL A CG2  4  
ATOM 7679  H H    . VAL A 1 77  ? -12.192 -3.256  9.723   1.00 1.17  ? 591 VAL A H    4  
ATOM 7680  H HA   . VAL A 1 77  ? -11.693 -3.641  6.808   1.00 1.15  ? 591 VAL A HA   4  
ATOM 7681  H HB   . VAL A 1 77  ? -9.904  -2.364  7.749   1.00 2.55  ? 591 VAL A HB   4  
ATOM 7682  H HG11 . VAL A 1 77  ? -8.771  -3.086  9.928   1.00 3.59  ? 591 VAL A HG11 4  
ATOM 7683  H HG12 . VAL A 1 77  ? -10.407 -2.490  10.072  1.00 3.74  ? 591 VAL A HG12 4  
ATOM 7684  H HG13 . VAL A 1 77  ? -10.090 -4.281  10.072  1.00 2.98  ? 591 VAL A HG13 4  
ATOM 7685  H HG21 . VAL A 1 77  ? -8.050  -3.722  8.020   1.00 2.11  ? 591 VAL A HG21 4  
ATOM 7686  H HG22 . VAL A 1 77  ? -9.023  -5.137  8.480   1.00 1.66  ? 591 VAL A HG22 4  
ATOM 7687  H HG23 . VAL A 1 77  ? -9.058  -4.527  6.763   1.00 2.04  ? 591 VAL A HG23 4  
ATOM 7688  N N    . LEU A 1 78  ? -11.465 -6.144  7.151   1.00 1.57  ? 592 LEU A N    4  
ATOM 7689  C CA   . LEU A 1 78  ? -11.230 -7.555  7.380   1.00 2.13  ? 592 LEU A CA   4  
ATOM 7690  C C    . LEU A 1 78  ? -9.859  -7.874  6.784   1.00 2.55  ? 592 LEU A C    4  
ATOM 7691  O O    . LEU A 1 78  ? -9.624  -7.542  5.619   1.00 2.44  ? 592 LEU A O    4  
ATOM 7692  C CB   . LEU A 1 78  ? -12.318 -8.410  6.691   1.00 2.37  ? 592 LEU A CB   4  
ATOM 7693  C CG   . LEU A 1 78  ? -13.825 -8.177  6.942   1.00 2.36  ? 592 LEU A CG   4  
ATOM 7694  C CD1  . LEU A 1 78  ? -14.198 -8.367  8.400   1.00 2.37  ? 592 LEU A CD1  4  
ATOM 7695  C CD2  . LEU A 1 78  ? -14.418 -6.841  6.484   1.00 2.19  ? 592 LEU A CD2  4  
ATOM 7696  H H    . LEU A 1 78  ? -11.281 -5.787  6.212   1.00 1.53  ? 592 LEU A H    4  
ATOM 7697  H HA   . LEU A 1 78  ? -11.190 -7.738  8.457   1.00 2.28  ? 592 LEU A HA   4  
ATOM 7698  H HB2  . LEU A 1 78  ? -12.165 -8.328  5.618   1.00 2.42  ? 592 LEU A HB2  4  
ATOM 7699  H HB3  . LEU A 1 78  ? -12.112 -9.450  6.948   1.00 2.74  ? 592 LEU A HB3  4  
ATOM 7700  H HG   . LEU A 1 78  ? -14.337 -8.950  6.374   1.00 2.80  ? 592 LEU A HG   4  
ATOM 7701  H HD11 . LEU A 1 78  ? -13.749 -9.285  8.780   1.00 3.21  ? 592 LEU A HD11 4  
ATOM 7702  H HD12 . LEU A 1 78  ? -15.281 -8.437  8.492   1.00 2.08  ? 592 LEU A HD12 4  
ATOM 7703  H HD13 . LEU A 1 78  ? -13.850 -7.511  8.971   1.00 3.12  ? 592 LEU A HD13 4  
ATOM 7704  H HD21 . LEU A 1 78  ? -14.094 -6.023  7.121   1.00 2.57  ? 592 LEU A HD21 4  
ATOM 7705  H HD22 . LEU A 1 78  ? -15.504 -6.892  6.530   1.00 2.18  ? 592 LEU A HD22 4  
ATOM 7706  H HD23 . LEU A 1 78  ? -14.130 -6.642  5.459   1.00 3.11  ? 592 LEU A HD23 4  
ATOM 7707  N N    . THR A 1 79  ? -8.947  -8.505  7.524   1.00 3.17  ? 593 THR A N    4  
ATOM 7708  C CA   . THR A 1 79  ? -7.721  -9.028  6.885   1.00 3.77  ? 593 THR A CA   4  
ATOM 7709  C C    . THR A 1 79  ? -7.939  -10.416 6.289   1.00 4.25  ? 593 THR A C    4  
ATOM 7710  O O    . THR A 1 79  ? -8.566  -11.287 6.903   1.00 4.34  ? 593 THR A O    4  
ATOM 7711  C CB   . THR A 1 79  ? -6.487  -8.961  7.796   1.00 4.01  ? 593 THR A CB   4  
ATOM 7712  O OG1  . THR A 1 79  ? -6.837  -9.073  9.152   1.00 3.75  ? 593 THR A OG1  4  
ATOM 7713  C CG2  . THR A 1 79  ? -5.807  -7.604  7.613   1.00 3.96  ? 593 THR A CG2  4  
ATOM 7714  H H    . THR A 1 79  ? -9.100  -8.691  8.521   1.00 3.30  ? 593 THR A H    4  
ATOM 7715  H HA   . THR A 1 79  ? -7.479  -8.390  6.037   1.00 3.79  ? 593 THR A HA   4  
ATOM 7716  H HB   . THR A 1 79  ? -5.782  -9.749  7.530   1.00 4.49  ? 593 THR A HB   4  
ATOM 7717  H HG1  . THR A 1 79  ? -5.999  -9.081  9.661   1.00 4.00  ? 593 THR A HG1  4  
ATOM 7718  H HG21 . THR A 1 79  ? -5.429  -7.527  6.592   1.00 4.29  ? 593 THR A HG21 4  
ATOM 7719  H HG22 . THR A 1 79  ? -4.964  -7.516  8.296   1.00 4.51  ? 593 THR A HG22 4  
ATOM 7720  H HG23 . THR A 1 79  ? -6.526  -6.801  7.791   1.00 3.86  ? 593 THR A HG23 4  
ATOM 7721  N N    . LYS A 1 80  ? -7.426  -10.644 5.071   1.00 4.65  ? 594 LYS A N    4  
ATOM 7722  C CA   . LYS A 1 80  ? -7.418  -11.979 4.453   1.00 5.27  ? 594 LYS A CA   4  
ATOM 7723  C C    . LYS A 1 80  ? -6.589  -12.952 5.300   1.00 6.15  ? 594 LYS A C    4  
ATOM 7724  O O    . LYS A 1 80  ? -5.643  -12.547 5.978   1.00 7.19  ? 594 LYS A O    4  
ATOM 7725  C CB   . LYS A 1 80  ? -7.029  -11.951 2.961   1.00 5.41  ? 594 LYS A CB   4  
ATOM 7726  C CG   . LYS A 1 80  ? -5.607  -11.472 2.631   1.00 6.05  ? 594 LYS A CG   4  
ATOM 7727  C CD   . LYS A 1 80  ? -5.510  -9.959  2.397   1.00 5.83  ? 594 LYS A CD   4  
ATOM 7728  C CE   . LYS A 1 80  ? -4.074  -9.569  2.037   1.00 6.73  ? 594 LYS A CE   4  
ATOM 7729  N NZ   . LYS A 1 80  ? -4.029  -8.234  1.400   1.00 8.12  ? 594 LYS A NZ   4  
ATOM 7730  H H    . LYS A 1 80  ? -6.968  -9.884  4.589   1.00 4.61  ? 594 LYS A H    4  
ATOM 7731  H HA   . LYS A 1 80  ? -8.441  -12.350 4.484   1.00 5.05  ? 594 LYS A HA   4  
ATOM 7732  H HB2  . LYS A 1 80  ? -7.124  -12.969 2.580   1.00 5.85  ? 594 LYS A HB2  4  
ATOM 7733  H HB3  . LYS A 1 80  ? -7.751  -11.344 2.412   1.00 4.76  ? 594 LYS A HB3  4  
ATOM 7734  H HG2  . LYS A 1 80  ? -4.929  -11.781 3.423   1.00 6.66  ? 594 LYS A HG2  4  
ATOM 7735  H HG3  . LYS A 1 80  ? -5.290  -11.964 1.711   1.00 6.32  ? 594 LYS A HG3  4  
ATOM 7736  H HD2  . LYS A 1 80  ? -6.179  -9.689  1.579   1.00 5.39  ? 594 LYS A HD2  4  
ATOM 7737  H HD3  . LYS A 1 80  ? -5.801  -9.416  3.294   1.00 5.68  ? 594 LYS A HD3  4  
ATOM 7738  H HE2  . LYS A 1 80  ? -3.471  -9.579  2.952   1.00 6.48  ? 594 LYS A HE2  4  
ATOM 7739  H HE3  . LYS A 1 80  ? -3.663  -10.317 1.354   1.00 7.04  ? 594 LYS A HE3  4  
ATOM 7740  H HZ1  . LYS A 1 80  ? -4.589  -8.221  0.550   1.00 8.33  ? 594 LYS A HZ1  4  
ATOM 7741  H HZ2  . LYS A 1 80  ? -3.078  -7.988  1.138   1.00 8.81  ? 594 LYS A HZ2  4  
ATOM 7742  H HZ3  . LYS A 1 80  ? -4.402  -7.517  2.018   1.00 8.70  ? 594 LYS A HZ3  4  
ATOM 7743  N N    . GLY A 1 81  ? -7.030  -14.206 5.352   1.00 5.99  ? 595 GLY A N    4  
ATOM 7744  C CA   . GLY A 1 81  ? -6.615  -15.187 6.361   1.00 6.56  ? 595 GLY A CA   4  
ATOM 7745  C C    . GLY A 1 81  ? -7.291  -15.044 7.723   1.00 6.22  ? 595 GLY A C    4  
ATOM 7746  O O    . GLY A 1 81  ? -7.253  -15.986 8.519   1.00 6.62  ? 595 GLY A O    4  
ATOM 7747  H H    . GLY A 1 81  ? -7.789  -14.460 4.732   1.00 5.62  ? 595 GLY A H    4  
ATOM 7748  H HA2  . GLY A 1 81  ? -6.777  -16.198 5.996   1.00 7.03  ? 595 GLY A HA2  4  
ATOM 7749  H HA3  . GLY A 1 81  ? -5.556  -15.036 6.575   1.00 6.83  ? 595 GLY A HA3  4  
ATOM 7750  N N    . ASN A 1 82  ? -7.823  -13.862 8.045   1.00 5.54  ? 596 ASN A N    4  
ATOM 7751  C CA   . ASN A 1 82  ? -7.914  -13.406 9.427   1.00 5.12  ? 596 ASN A CA   4  
ATOM 7752  C C    . ASN A 1 82  ? -9.268  -12.735 9.745   1.00 4.61  ? 596 ASN A C    4  
ATOM 7753  O O    . ASN A 1 82  ? -10.311 -13.101 9.187   1.00 4.75  ? 596 ASN A O    4  
ATOM 7754  C CB   . ASN A 1 82  ? -6.725  -12.474 9.731   1.00 4.95  ? 596 ASN A CB   4  
ATOM 7755  C CG   . ASN A 1 82  ? -5.303  -12.858 9.334   1.00 5.52  ? 596 ASN A CG   4  
ATOM 7756  O OD1  . ASN A 1 82  ? -4.960  -13.985 8.999   1.00 6.08  ? 596 ASN A OD1  4  
ATOM 7757  N ND2  . ASN A 1 82  ? -4.388  -11.925 9.443   1.00 5.49  ? 596 ASN A ND2  4  
ATOM 7758  H H    . ASN A 1 82  ? -7.902  -13.141 7.336   1.00 5.27  ? 596 ASN A H    4  
ATOM 7759  H HA   . ASN A 1 82  ? -7.842  -14.256 10.097  1.00 5.38  ? 596 ASN A HA   4  
ATOM 7760  H HB2  . ASN A 1 82  ? -6.984  -11.496 9.365   1.00 4.61  ? 596 ASN A HB2  4  
ATOM 7761  H HB3  . ASN A 1 82  ? -6.671  -12.355 10.790  1.00 4.74  ? 596 ASN A HB3  4  
ATOM 7762  H HD21 . ASN A 1 82  ? -4.638  -10.998 9.768   1.00 5.12  ? 596 ASN A HD21 4  
ATOM 7763  H HD22 . ASN A 1 82  ? -3.423  -12.156 9.275   1.00 5.92  ? 596 ASN A HD22 4  
ATOM 7764  N N    . LYS A 1 83  ? -9.267  -11.837 10.743  1.00 4.10  ? 597 LYS A N    4  
ATOM 7765  C CA   . LYS A 1 83  ? -10.450 -11.367 11.467  1.00 3.63  ? 597 LYS A CA   4  
ATOM 7766  C C    . LYS A 1 83  ? -10.936 -9.982  11.049  1.00 2.96  ? 597 LYS A C    4  
ATOM 7767  O O    . LYS A 1 83  ? -10.237 -9.232  10.368  1.00 2.86  ? 597 LYS A O    4  
ATOM 7768  C CB   . LYS A 1 83  ? -10.210 -11.462 12.991  1.00 3.62  ? 597 LYS A CB   4  
ATOM 7769  C CG   . LYS A 1 83  ? -10.234 -12.884 13.587  1.00 3.92  ? 597 LYS A CG   4  
ATOM 7770  C CD   . LYS A 1 83  ? -9.114  -13.852 13.163  1.00 4.25  ? 597 LYS A CD   4  
ATOM 7771  C CE   . LYS A 1 83  ? -7.687  -13.303 13.321  1.00 4.80  ? 597 LYS A CE   4  
ATOM 7772  N NZ   . LYS A 1 83  ? -7.404  -12.892 14.720  1.00 4.99  ? 597 LYS A NZ   4  
ATOM 7773  H H    . LYS A 1 83  ? -8.372  -11.475 11.054  1.00 4.10  ? 597 LYS A H    4  
ATOM 7774  H HA   . LYS A 1 83  ? -11.260 -12.023 11.200  1.00 3.93  ? 597 LYS A HA   4  
ATOM 7775  H HB2  . LYS A 1 83  ? -9.273  -10.968 13.241  1.00 3.72  ? 597 LYS A HB2  4  
ATOM 7776  H HB3  . LYS A 1 83  ? -10.997 -10.907 13.504  1.00 3.45  ? 597 LYS A HB3  4  
ATOM 7777  H HG2  . LYS A 1 83  ? -10.198 -12.784 14.672  1.00 4.04  ? 597 LYS A HG2  4  
ATOM 7778  H HG3  . LYS A 1 83  ? -11.192 -13.345 13.343  1.00 4.07  ? 597 LYS A HG3  4  
ATOM 7779  H HD2  . LYS A 1 83  ? -9.205  -14.763 13.756  1.00 4.37  ? 597 LYS A HD2  4  
ATOM 7780  H HD3  . LYS A 1 83  ? -9.266  -14.148 12.127  1.00 4.65  ? 597 LYS A HD3  4  
ATOM 7781  H HE2  . LYS A 1 83  ? -6.989  -14.092 13.030  1.00 5.65  ? 597 LYS A HE2  4  
ATOM 7782  H HE3  . LYS A 1 83  ? -7.538  -12.466 12.627  1.00 4.77  ? 597 LYS A HE3  4  
ATOM 7783  H HZ1  . LYS A 1 83  ? -7.707  -13.614 15.374  1.00 4.91  ? 597 LYS A HZ1  4  
ATOM 7784  H HZ2  . LYS A 1 83  ? -7.873  -12.020 14.966  1.00 5.04  ? 597 LYS A HZ2  4  
ATOM 7785  H HZ3  . LYS A 1 83  ? -6.409  -12.738 14.866  1.00 5.80  ? 597 LYS A HZ3  4  
ATOM 7786  N N    . GLU A 1 84  ? -12.138 -9.628  11.510  1.00 2.68  ? 598 GLU A N    4  
ATOM 7787  C CA   . GLU A 1 84  ? -12.559 -8.228  11.510  1.00 2.12  ? 598 GLU A CA   4  
ATOM 7788  C C    . GLU A 1 84  ? -11.727 -7.386  12.482  1.00 1.78  ? 598 GLU A C    4  
ATOM 7789  O O    . GLU A 1 84  ? -11.497 -7.763  13.634  1.00 1.95  ? 598 GLU A O    4  
ATOM 7790  C CB   . GLU A 1 84  ? -14.071 -8.044  11.734  1.00 2.33  ? 598 GLU A CB   4  
ATOM 7791  C CG   . GLU A 1 84  ? -14.624 -8.449  13.103  1.00 2.79  ? 598 GLU A CG   4  
ATOM 7792  C CD   . GLU A 1 84  ? -16.132 -8.185  13.130  1.00 2.99  ? 598 GLU A CD   4  
ATOM 7793  O OE1  . GLU A 1 84  ? -16.539 -7.009  13.287  1.00 3.12  ? 598 GLU A OE1  4  
ATOM 7794  O OE2  . GLU A 1 84  ? -16.932 -9.131  12.939  1.00 3.83  ? 598 GLU A OE2  4  
ATOM 7795  H H    . GLU A 1 84  ? -12.673 -10.300 12.038  1.00 2.98  ? 598 GLU A H    4  
ATOM 7796  H HA   . GLU A 1 84  ? -12.346 -7.855  10.512  1.00 1.97  ? 598 GLU A HA   4  
ATOM 7797  H HB2  . GLU A 1 84  ? -14.306 -6.988  11.565  1.00 2.20  ? 598 GLU A HB2  4  
ATOM 7798  H HB3  . GLU A 1 84  ? -14.607 -8.623  10.986  1.00 2.85  ? 598 GLU A HB3  4  
ATOM 7799  H HG2  . GLU A 1 84  ? -14.425 -9.509  13.280  1.00 3.46  ? 598 GLU A HG2  4  
ATOM 7800  H HG3  . GLU A 1 84  ? -14.143 -7.864  13.888  1.00 2.88  ? 598 GLU A HG3  4  
ATOM 7801  N N    . MET A 1 85  ? -11.268 -6.235  12.000  1.00 1.40  ? 599 MET A N    4  
ATOM 7802  C CA   . MET A 1 85  ? -10.533 -5.230  12.762  1.00 1.16  ? 599 MET A CA   4  
ATOM 7803  C C    . MET A 1 85  ? -11.048 -3.819  12.476  1.00 1.04  ? 599 MET A C    4  
ATOM 7804  O O    . MET A 1 85  ? -11.930 -3.610  11.638  1.00 1.36  ? 599 MET A O    4  
ATOM 7805  C CB   . MET A 1 85  ? -9.018  -5.377  12.554  1.00 1.51  ? 599 MET A CB   4  
ATOM 7806  C CG   . MET A 1 85  ? -8.482  -6.763  12.933  1.00 1.71  ? 599 MET A CG   4  
ATOM 7807  S SD   . MET A 1 85  ? -6.704  -6.972  12.662  1.00 2.49  ? 599 MET A SD   4  
ATOM 7808  C CE   . MET A 1 85  ? -6.633  -6.506  10.914  1.00 2.80  ? 599 MET A CE   4  
ATOM 7809  H H    . MET A 1 85  ? -11.394 -6.053  11.010  1.00 1.38  ? 599 MET A H    4  
ATOM 7810  H HA   . MET A 1 85  ? -10.711 -5.376  13.804  1.00 1.13  ? 599 MET A HA   4  
ATOM 7811  H HB2  . MET A 1 85  ? -8.788  -5.179  11.513  1.00 1.88  ? 599 MET A HB2  4  
ATOM 7812  H HB3  . MET A 1 85  ? -8.493  -4.642  13.165  1.00 1.95  ? 599 MET A HB3  4  
ATOM 7813  H HG2  . MET A 1 85  ? -8.697  -6.951  13.986  1.00 1.94  ? 599 MET A HG2  4  
ATOM 7814  H HG3  . MET A 1 85  ? -8.994  -7.521  12.340  1.00 2.02  ? 599 MET A HG3  4  
ATOM 7815  H HE1  . MET A 1 85  ? -7.489  -6.939  10.389  1.00 2.41  ? 599 MET A HE1  4  
ATOM 7816  H HE2  . MET A 1 85  ? -6.683  -5.424  10.824  1.00 3.65  ? 599 MET A HE2  4  
ATOM 7817  H HE3  . MET A 1 85  ? -5.699  -6.856  10.477  1.00 3.45  ? 599 MET A HE3  4  
ATOM 7818  N N    . LYS A 1 86  ? -10.488 -2.843  13.182  1.00 0.96  ? 600 LYS A N    4  
ATOM 7819  C CA   . LYS A 1 86  ? -10.120 -1.534  12.676  1.00 0.94  ? 600 LYS A CA   4  
ATOM 7820  C C    . LYS A 1 86  ? -8.621  -1.417  12.402  1.00 0.94  ? 600 LYS A C    4  
ATOM 7821  O O    . LYS A 1 86  ? -7.804  -2.018  13.098  1.00 1.07  ? 600 LYS A O    4  
ATOM 7822  C CB   . LYS A 1 86  ? -10.551 -0.449  13.687  1.00 1.11  ? 600 LYS A CB   4  
ATOM 7823  C CG   . LYS A 1 86  ? -11.966 0.122   13.543  1.00 1.08  ? 600 LYS A CG   4  
ATOM 7824  C CD   . LYS A 1 86  ? -13.093 -0.882  13.312  1.00 1.14  ? 600 LYS A CD   4  
ATOM 7825  C CE   . LYS A 1 86  ? -13.397 -1.774  14.521  1.00 1.35  ? 600 LYS A CE   4  
ATOM 7826  N NZ   . LYS A 1 86  ? -14.392 -1.143  15.417  1.00 1.71  ? 600 LYS A NZ   4  
ATOM 7827  H H    . LYS A 1 86  ? -10.013 -3.110  14.010  1.00 1.01  ? 600 LYS A H    4  
ATOM 7828  H HA   . LYS A 1 86  ? -10.589 -1.452  11.704  1.00 0.93  ? 600 LYS A HA   4  
ATOM 7829  H HB2  . LYS A 1 86  ? -10.434 -0.842  14.699  1.00 1.21  ? 600 LYS A HB2  4  
ATOM 7830  H HB3  . LYS A 1 86  ? -9.868  0.400   13.609  1.00 1.64  ? 600 LYS A HB3  4  
ATOM 7831  H HG2  . LYS A 1 86  ? -12.174 0.695   14.443  1.00 1.23  ? 600 LYS A HG2  4  
ATOM 7832  H HG3  . LYS A 1 86  ? -11.961 0.802   12.697  1.00 1.38  ? 600 LYS A HG3  4  
ATOM 7833  H HD2  . LYS A 1 86  ? -13.996 -0.345  13.023  1.00 1.52  ? 600 LYS A HD2  4  
ATOM 7834  H HD3  . LYS A 1 86  ? -12.810 -1.496  12.468  1.00 1.09  ? 600 LYS A HD3  4  
ATOM 7835  H HE2  . LYS A 1 86  ? -13.814 -2.715  14.154  1.00 1.72  ? 600 LYS A HE2  4  
ATOM 7836  H HE3  . LYS A 1 86  ? -12.473 -1.997  15.061  1.00 1.98  ? 600 LYS A HE3  4  
ATOM 7837  H HZ1  . LYS A 1 86  ? -14.047 -0.287  15.848  1.00 2.35  ? 600 LYS A HZ1  4  
ATOM 7838  H HZ2  . LYS A 1 86  ? -14.709 -1.788  16.131  1.00 2.56  ? 600 LYS A HZ2  4  
ATOM 7839  H HZ3  . LYS A 1 86  ? -15.219 -0.894  14.876  1.00 2.08  ? 600 LYS A HZ3  4  
ATOM 7840  N N    . LEU A 1 87  ? -8.288  -0.588  11.415  1.00 0.87  ? 601 LEU A N    4  
ATOM 7841  C CA   . LEU A 1 87  ? -6.920  -0.154  11.084  1.00 0.85  ? 601 LEU A CA   4  
ATOM 7842  C C    . LEU A 1 87  ? -6.796  1.372   11.198  1.00 0.78  ? 601 LEU A C    4  
ATOM 7843  O O    . LEU A 1 87  ? -7.751  2.094   10.924  1.00 0.79  ? 601 LEU A O    4  
ATOM 7844  C CB   . LEU A 1 87  ? -6.499  -0.648  9.682   1.00 0.93  ? 601 LEU A CB   4  
ATOM 7845  C CG   . LEU A 1 87  ? -5.271  -1.567  9.663   1.00 1.09  ? 601 LEU A CG   4  
ATOM 7846  C CD1  . LEU A 1 87  ? -5.625  -2.924  10.260  1.00 1.13  ? 601 LEU A CD1  4  
ATOM 7847  C CD2  . LEU A 1 87  ? -4.821  -1.792  8.217   1.00 1.24  ? 601 LEU A CD2  4  
ATOM 7848  H H    . LEU A 1 87  ? -9.068  -0.107  10.975  1.00 0.83  ? 601 LEU A H    4  
ATOM 7849  H HA   . LEU A 1 87  ? -6.237  -0.578  11.821  1.00 0.88  ? 601 LEU A HA   4  
ATOM 7850  H HB2  . LEU A 1 87  ? -7.321  -1.181  9.210   1.00 0.91  ? 601 LEU A HB2  4  
ATOM 7851  H HB3  . LEU A 1 87  ? -6.267  0.219   9.065   1.00 1.11  ? 601 LEU A HB3  4  
ATOM 7852  H HG   . LEU A 1 87  ? -4.456  -1.113  10.222  1.00 1.25  ? 601 LEU A HG   4  
ATOM 7853  H HD11 . LEU A 1 87  ? -5.908  -2.808  11.304  1.00 1.76  ? 601 LEU A HD11 4  
ATOM 7854  H HD12 . LEU A 1 87  ? -4.765  -3.590  10.198  1.00 2.14  ? 601 LEU A HD12 4  
ATOM 7855  H HD13 . LEU A 1 87  ? -6.460  -3.348  9.704   1.00 1.70  ? 601 LEU A HD13 4  
ATOM 7856  H HD21 . LEU A 1 87  ? -3.924  -2.414  8.210   1.00 1.95  ? 601 LEU A HD21 4  
ATOM 7857  H HD22 . LEU A 1 87  ? -4.587  -0.841  7.742   1.00 2.31  ? 601 LEU A HD22 4  
ATOM 7858  H HD23 . LEU A 1 87  ? -5.601  -2.297  7.649   1.00 1.49  ? 601 LEU A HD23 4  
ATOM 7859  N N    . SER A 1 88  ? -5.619  1.858   11.577  1.00 0.78  ? 602 SER A N    4  
ATOM 7860  C CA   . SER A 1 88  ? -5.355  3.243   12.006  1.00 0.82  ? 602 SER A CA   4  
ATOM 7861  C C    . SER A 1 88  ? -4.436  4.015   11.051  1.00 0.85  ? 602 SER A C    4  
ATOM 7862  O O    . SER A 1 88  ? -3.844  3.451   10.134  1.00 0.98  ? 602 SER A O    4  
ATOM 7863  C CB   . SER A 1 88  ? -4.744  3.201   13.413  1.00 1.09  ? 602 SER A CB   4  
ATOM 7864  O OG   . SER A 1 88  ? -3.623  2.328   13.423  1.00 1.81  ? 602 SER A OG   4  
ATOM 7865  H H    . SER A 1 88  ? -4.875  1.190   11.732  1.00 0.82  ? 602 SER A H    4  
ATOM 7866  H HA   . SER A 1 88  ? -6.292  3.804   12.060  1.00 1.00  ? 602 SER A HA   4  
ATOM 7867  H HB2  . SER A 1 88  ? -4.437  4.203   13.718  1.00 1.55  ? 602 SER A HB2  4  
ATOM 7868  H HB3  . SER A 1 88  ? -5.494  2.838   14.116  1.00 1.14  ? 602 SER A HB3  4  
ATOM 7869  H HG   . SER A 1 88  ? -3.021  2.602   14.148  1.00 2.25  ? 602 SER A HG   4  
ATOM 7870  N N    . ASP A 1 89  ? -4.268  5.318   11.270  1.00 0.91  ? 603 ASP A N    4  
ATOM 7871  C CA   . ASP A 1 89  ? -3.327  6.154   10.515  1.00 1.06  ? 603 ASP A CA   4  
ATOM 7872  C C    . ASP A 1 89  ? -1.902  5.563   10.472  1.00 1.10  ? 603 ASP A C    4  
ATOM 7873  O O    . ASP A 1 89  ? -1.414  4.986   11.449  1.00 1.08  ? 603 ASP A O    4  
ATOM 7874  C CB   . ASP A 1 89  ? -3.331  7.571   11.097  1.00 1.23  ? 603 ASP A CB   4  
ATOM 7875  C CG   . ASP A 1 89  ? -2.862  7.608   12.550  1.00 1.30  ? 603 ASP A CG   4  
ATOM 7876  O OD1  . ASP A 1 89  ? -3.692  7.340   13.457  1.00 2.51  ? 603 ASP A OD1  4  
ATOM 7877  O OD2  . ASP A 1 89  ? -1.680  7.952   12.783  1.00 2.13  ? 603 ASP A OD2  4  
ATOM 7878  H H    . ASP A 1 89  ? -4.750  5.738   12.051  1.00 0.94  ? 603 ASP A H    4  
ATOM 7879  H HA   . ASP A 1 89  ? -3.685  6.215   9.487   1.00 1.15  ? 603 ASP A HA   4  
ATOM 7880  H HB2  . ASP A 1 89  ? -2.682  8.204   10.489  1.00 1.40  ? 603 ASP A HB2  4  
ATOM 7881  H HB3  . ASP A 1 89  ? -4.341  7.977   11.045  1.00 1.27  ? 603 ASP A HB3  4  
ATOM 7882  N N    . GLY A 1 90  ? -1.243  5.667   9.316   1.00 1.23  ? 604 GLY A N    4  
ATOM 7883  C CA   . GLY A 1 90  ? 0.069   5.065   9.073   1.00 1.38  ? 604 GLY A CA   4  
ATOM 7884  C C    . GLY A 1 90  ? 0.054   3.566   8.754   1.00 1.34  ? 604 GLY A C    4  
ATOM 7885  O O    . GLY A 1 90  ? 1.126   2.986   8.577   1.00 1.50  ? 604 GLY A O    4  
ATOM 7886  H H    . GLY A 1 90  ? -1.668  6.162   8.537   1.00 1.28  ? 604 GLY A H    4  
ATOM 7887  H HA2  . GLY A 1 90  ? 0.547   5.589   8.245   1.00 1.50  ? 604 GLY A HA2  4  
ATOM 7888  H HA3  . GLY A 1 90  ? 0.672   5.194   9.966   1.00 1.47  ? 604 GLY A HA3  4  
ATOM 7889  N N    . SER A 1 91  ? -1.127  2.947   8.690   1.00 1.20  ? 605 SER A N    4  
ATOM 7890  C CA   . SER A 1 91  ? -1.356  1.537   8.329   1.00 1.13  ? 605 SER A CA   4  
ATOM 7891  C C    . SER A 1 91  ? -1.641  1.352   6.836   1.00 1.03  ? 605 SER A C    4  
ATOM 7892  O O    . SER A 1 91  ? -1.759  2.327   6.098   1.00 0.97  ? 605 SER A O    4  
ATOM 7893  C CB   . SER A 1 91  ? -2.527  0.974   9.124   1.00 1.06  ? 605 SER A CB   4  
ATOM 7894  O OG   . SER A 1 91  ? -2.354  1.213   10.506  1.00 1.30  ? 605 SER A OG   4  
ATOM 7895  H H    . SER A 1 91  ? -1.946  3.501   8.899   1.00 1.16  ? 605 SER A H    4  
ATOM 7896  H HA   . SER A 1 91  ? -0.467  0.957   8.571   1.00 1.27  ? 605 SER A HA   4  
ATOM 7897  H HB2  . SER A 1 91  ? -3.434  1.472   8.767   1.00 0.89  ? 605 SER A HB2  4  
ATOM 7898  H HB3  . SER A 1 91  ? -2.602  -0.101  8.954   1.00 1.11  ? 605 SER A HB3  4  
ATOM 7899  H HG   . SER A 1 91  ? -2.766  2.079   10.675  1.00 1.38  ? 605 SER A HG   4  
ATOM 7900  N N    . TYR A 1 92  ? -1.745  0.108   6.365   1.00 1.04  ? 606 TYR A N    4  
ATOM 7901  C CA   . TYR A 1 92  ? -1.853  -0.210  4.937   1.00 1.03  ? 606 TYR A CA   4  
ATOM 7902  C C    . TYR A 1 92  ? -2.729  -1.447  4.648   1.00 1.09  ? 606 TYR A C    4  
ATOM 7903  O O    . TYR A 1 92  ? -2.884  -2.292  5.533   1.00 1.27  ? 606 TYR A O    4  
ATOM 7904  C CB   . TYR A 1 92  ? -0.416  -0.389  4.426   1.00 1.11  ? 606 TYR A CB   4  
ATOM 7905  C CG   . TYR A 1 92  ? 0.267   -1.618  4.969   1.00 1.23  ? 606 TYR A CG   4  
ATOM 7906  C CD1  . TYR A 1 92  ? 0.038   -2.853  4.343   1.00 2.49  ? 606 TYR A CD1  4  
ATOM 7907  C CD2  . TYR A 1 92  ? 1.043   -1.545  6.139   1.00 2.23  ? 606 TYR A CD2  4  
ATOM 7908  C CE1  . TYR A 1 92  ? 0.528   -4.034  4.908   1.00 3.23  ? 606 TYR A CE1  4  
ATOM 7909  C CE2  . TYR A 1 92  ? 1.553   -2.731  6.705   1.00 2.73  ? 606 TYR A CE2  4  
ATOM 7910  C CZ   . TYR A 1 92  ? 1.259   -3.983  6.115   1.00 2.88  ? 606 TYR A CZ   4  
ATOM 7911  O OH   . TYR A 1 92  ? 1.627   -5.136  6.730   1.00 3.86  ? 606 TYR A OH   4  
ATOM 7912  H H    . TYR A 1 92  ? -1.642  -0.675  6.997   1.00 1.09  ? 606 TYR A H    4  
ATOM 7913  H HA   . TYR A 1 92  ? -2.317  0.626   4.422   1.00 1.02  ? 606 TYR A HA   4  
ATOM 7914  H HB2  . TYR A 1 92  ? -0.433  -0.468  3.352   1.00 1.60  ? 606 TYR A HB2  4  
ATOM 7915  H HB3  . TYR A 1 92  ? 0.176   0.493   4.676   1.00 1.41  ? 606 TYR A HB3  4  
ATOM 7916  H HD1  . TYR A 1 92  ? -0.578  -2.913  3.462   1.00 3.48  ? 606 TYR A HD1  4  
ATOM 7917  H HD2  . TYR A 1 92  ? 1.194   -0.587  6.624   1.00 3.34  ? 606 TYR A HD2  4  
ATOM 7918  H HE1  . TYR A 1 92  ? 0.303   -4.967  4.415   1.00 4.56  ? 606 TYR A HE1  4  
ATOM 7919  H HE2  . TYR A 1 92  ? 2.113   -2.696  7.627   1.00 3.78  ? 606 TYR A HE2  4  
ATOM 7920  H HH   . TYR A 1 92  ? 1.025   -5.855  6.470   1.00 4.64  ? 606 TYR A HH   4  
ATOM 7921  N N    . PHE A 1 93  ? -3.288  -1.581  3.432   1.00 0.98  ? 607 PHE A N    4  
ATOM 7922  C CA   . PHE A 1 93  ? -4.104  -2.754  3.053   1.00 1.05  ? 607 PHE A CA   4  
ATOM 7923  C C    . PHE A 1 93  ? -4.110  -3.058  1.538   1.00 1.25  ? 607 PHE A C    4  
ATOM 7924  O O    . PHE A 1 93  ? -3.559  -2.316  0.730   1.00 1.63  ? 607 PHE A O    4  
ATOM 7925  C CB   . PHE A 1 93  ? -5.530  -2.587  3.617   1.00 1.53  ? 607 PHE A CB   4  
ATOM 7926  C CG   . PHE A 1 93  ? -6.124  -1.201  3.463   1.00 0.95  ? 607 PHE A CG   4  
ATOM 7927  C CD1  . PHE A 1 93  ? -6.317  -0.646  2.184   1.00 1.85  ? 607 PHE A CD1  4  
ATOM 7928  C CD2  . PHE A 1 93  ? -6.450  -0.447  4.606   1.00 2.02  ? 607 PHE A CD2  4  
ATOM 7929  C CE1  . PHE A 1 93  ? -6.794  0.667   2.053   1.00 2.24  ? 607 PHE A CE1  4  
ATOM 7930  C CE2  . PHE A 1 93  ? -6.946  0.860   4.463   1.00 1.84  ? 607 PHE A CE2  4  
ATOM 7931  C CZ   . PHE A 1 93  ? -7.086  1.427   3.194   1.00 1.36  ? 607 PHE A CZ   4  
ATOM 7932  H H    . PHE A 1 93  ? -3.195  -0.846  2.730   1.00 0.91  ? 607 PHE A H    4  
ATOM 7933  H HA   . PHE A 1 93  ? -3.673  -3.637  3.522   1.00 1.29  ? 607 PHE A HA   4  
ATOM 7934  H HB2  . PHE A 1 93  ? -6.206  -3.312  3.162   1.00 2.29  ? 607 PHE A HB2  4  
ATOM 7935  H HB3  . PHE A 1 93  ? -5.493  -2.831  4.680   1.00 2.35  ? 607 PHE A HB3  4  
ATOM 7936  H HD1  . PHE A 1 93  ? -6.077  -1.213  1.296   1.00 3.01  ? 607 PHE A HD1  4  
ATOM 7937  H HD2  . PHE A 1 93  ? -6.317  -0.868  5.591   1.00 3.43  ? 607 PHE A HD2  4  
ATOM 7938  H HE1  . PHE A 1 93  ? -6.963  1.082   1.074   1.00 3.64  ? 607 PHE A HE1  4  
ATOM 7939  H HE2  . PHE A 1 93  ? -7.229  1.437   5.321   1.00 2.99  ? 607 PHE A HE2  4  
ATOM 7940  H HZ   . PHE A 1 93  ? -7.464  2.432   3.098   1.00 1.85  ? 607 PHE A HZ   4  
ATOM 7941  N N    . GLY A 1 94  ? -4.730  -4.176  1.145   1.00 1.32  ? 608 GLY A N    4  
ATOM 7942  C CA   . GLY A 1 94  ? -4.691  -4.711  -0.224  1.00 1.61  ? 608 GLY A CA   4  
ATOM 7943  C C    . GLY A 1 94  ? -3.353  -5.373  -0.591  1.00 1.88  ? 608 GLY A C    4  
ATOM 7944  O O    . GLY A 1 94  ? -2.346  -5.169  0.088   1.00 3.07  ? 608 GLY A O    4  
ATOM 7945  H H    . GLY A 1 94  ? -5.205  -4.726  1.851   1.00 1.27  ? 608 GLY A H    4  
ATOM 7946  H HA2  . GLY A 1 94  ? -5.485  -5.449  -0.335  1.00 1.93  ? 608 GLY A HA2  4  
ATOM 7947  H HA3  . GLY A 1 94  ? -4.878  -3.907  -0.936  1.00 1.92  ? 608 GLY A HA3  4  
ATOM 7948  N N    . GLU A 1 95  ? -3.352  -6.186  -1.653  1.00 2.04  ? 609 GLU A N    4  
ATOM 7949  C CA   . GLU A 1 95  ? -2.208  -6.941  -2.208  1.00 2.62  ? 609 GLU A CA   4  
ATOM 7950  C C    . GLU A 1 95  ? -1.454  -7.881  -1.236  1.00 1.80  ? 609 GLU A C    4  
ATOM 7951  O O    . GLU A 1 95  ? -1.647  -7.884  -0.017  1.00 2.70  ? 609 GLU A O    4  
ATOM 7952  C CB   . GLU A 1 95  ? -1.268  -5.994  -2.998  1.00 4.46  ? 609 GLU A CB   4  
ATOM 7953  C CG   . GLU A 1 95  ? -1.467  -6.080  -4.527  1.00 5.95  ? 609 GLU A CG   4  
ATOM 7954  C CD   . GLU A 1 95  ? -0.695  -7.226  -5.204  1.00 6.93  ? 609 GLU A CD   4  
ATOM 7955  O OE1  . GLU A 1 95  ? -0.416  -8.244  -4.526  1.00 6.83  ? 609 GLU A OE1  4  
ATOM 7956  O OE2  . GLU A 1 95  ? -0.417  -7.110  -6.426  1.00 8.26  ? 609 GLU A OE2  4  
ATOM 7957  H H    . GLU A 1 95  ? -4.244  -6.334  -2.110  1.00 2.66  ? 609 GLU A H    4  
ATOM 7958  H HA   . GLU A 1 95  ? -2.632  -7.627  -2.939  1.00 3.67  ? 609 GLU A HA   4  
ATOM 7959  H HB2  . GLU A 1 95  ? -1.454  -4.963  -2.691  1.00 5.11  ? 609 GLU A HB2  4  
ATOM 7960  H HB3  . GLU A 1 95  ? -0.222  -6.202  -2.763  1.00 4.91  ? 609 GLU A HB3  4  
ATOM 7961  H HG2  . GLU A 1 95  ? -2.532  -6.198  -4.742  1.00 5.91  ? 609 GLU A HG2  4  
ATOM 7962  H HG3  . GLU A 1 95  ? -1.137  -5.136  -4.962  1.00 6.98  ? 609 GLU A HG3  4  
ATOM 7963  N N    . ILE A 1 96  ? -0.596  -8.726  -1.809  1.00 2.03  ? 610 ILE A N    4  
ATOM 7964  C CA   . ILE A 1 96  ? 0.333   -9.631  -1.119  1.00 2.74  ? 610 ILE A CA   4  
ATOM 7965  C C    . ILE A 1 96  ? 1.779   -9.253  -1.465  1.00 2.82  ? 610 ILE A C    4  
ATOM 7966  O O    . ILE A 1 96  ? 2.621   -9.174  -0.575  1.00 3.99  ? 610 ILE A O    4  
ATOM 7967  C CB   . ILE A 1 96  ? 0.001   -11.099 -1.488  1.00 3.77  ? 610 ILE A CB   4  
ATOM 7968  C CG1  . ILE A 1 96  ? -1.309  -11.532 -0.801  1.00 4.98  ? 610 ILE A CG1  4  
ATOM 7969  C CG2  . ILE A 1 96  ? 1.145   -12.072 -1.146  1.00 4.68  ? 610 ILE A CG2  4  
ATOM 7970  C CD1  . ILE A 1 96  ? -1.845  -12.893 -1.260  1.00 6.21  ? 610 ILE A CD1  4  
ATOM 7971  H H    . ILE A 1 96  ? -0.513  -8.665  -2.824  1.00 2.83  ? 610 ILE A H    4  
ATOM 7972  H HA   . ILE A 1 96  ? 0.233   -9.520  -0.038  1.00 3.60  ? 610 ILE A HA   4  
ATOM 7973  H HB   . ILE A 1 96  ? -0.172  -11.151 -2.557  1.00 3.62  ? 610 ILE A HB   4  
ATOM 7974  H HG12 . ILE A 1 96  ? -1.133  -11.565 0.269   1.00 5.54  ? 610 ILE A HG12 4  
ATOM 7975  H HG13 . ILE A 1 96  ? -2.086  -10.792 -0.997  1.00 4.91  ? 610 ILE A HG13 4  
ATOM 7976  H HG21 . ILE A 1 96  ? 2.051   -11.820 -1.698  1.00 4.67  ? 610 ILE A HG21 4  
ATOM 7977  H HG22 . ILE A 1 96  ? 1.354   -12.040 -0.076  1.00 5.14  ? 610 ILE A HG22 4  
ATOM 7978  H HG23 . ILE A 1 96  ? 0.877   -13.085 -1.434  1.00 5.59  ? 610 ILE A HG23 4  
ATOM 7979  H HD11 . ILE A 1 96  ? -2.827  -13.058 -0.819  1.00 6.90  ? 610 ILE A HD11 4  
ATOM 7980  H HD12 . ILE A 1 96  ? -1.927  -12.911 -2.345  1.00 6.53  ? 610 ILE A HD12 4  
ATOM 7981  H HD13 . ILE A 1 96  ? -1.191  -13.699 -0.937  1.00 6.67  ? 610 ILE A HD13 4  
ATOM 7982  N N    . CYS A 1 97  ? 2.080   -9.019  -2.747  1.00 2.45  ? 611 CYS A N    4  
ATOM 7983  C CA   . CYS A 1 97  ? 3.439   -8.738  -3.209  1.00 3.00  ? 611 CYS A CA   4  
ATOM 7984  C C    . CYS A 1 97  ? 3.417   -8.065  -4.582  1.00 1.93  ? 611 CYS A C    4  
ATOM 7985  O O    . CYS A 1 97  ? 2.794   -8.578  -5.503  1.00 2.19  ? 611 CYS A O    4  
ATOM 7986  C CB   . CYS A 1 97  ? 4.221   -10.060 -3.246  1.00 4.92  ? 611 CYS A CB   4  
ATOM 7987  S SG   . CYS A 1 97  ? 5.901   -9.822  -3.891  1.00 6.22  ? 611 CYS A SG   4  
ATOM 7988  H H    . CYS A 1 97  ? 1.336   -9.016  -3.440  1.00 2.46  ? 611 CYS A H    4  
ATOM 7989  H HA   . CYS A 1 97  ? 3.932   -8.067  -2.512  1.00 3.71  ? 611 CYS A HA   4  
ATOM 7990  H HB2  . CYS A 1 97  ? 4.282   -10.463 -2.232  1.00 5.89  ? 611 CYS A HB2  4  
ATOM 7991  H HB3  . CYS A 1 97  ? 3.691   -10.781 -3.867  1.00 5.19  ? 611 CYS A HB3  4  
ATOM 7992  H HG   . CYS A 1 97  ? 6.318   -11.076 -3.668  1.00 7.31  ? 611 CYS A HG   4  
ATOM 7993  N N    . LEU A 1 98  ? 4.192   -6.989  -4.755  1.00 1.77  ? 612 LEU A N    4  
ATOM 7994  C CA   . LEU A 1 98  ? 4.337   -6.219  -6.004  1.00 1.43  ? 612 LEU A CA   4  
ATOM 7995  C C    . LEU A 1 98  ? 4.877   -7.002  -7.223  1.00 1.61  ? 612 LEU A C    4  
ATOM 7996  O O    . LEU A 1 98  ? 5.000   -6.436  -8.314  1.00 1.95  ? 612 LEU A O    4  
ATOM 7997  C CB   . LEU A 1 98  ? 5.199   -4.987  -5.700  1.00 1.59  ? 612 LEU A CB   4  
ATOM 7998  C CG   . LEU A 1 98  ? 4.329   -3.841  -5.150  1.00 1.87  ? 612 LEU A CG   4  
ATOM 7999  C CD1  . LEU A 1 98  ? 4.277   -3.788  -3.624  1.00 3.06  ? 612 LEU A CD1  4  
ATOM 8000  C CD2  . LEU A 1 98  ? 4.896   -2.534  -5.663  1.00 1.56  ? 612 LEU A CD2  4  
ATOM 8001  H H    . LEU A 1 98  ? 4.708   -6.660  -3.955  1.00 2.62  ? 612 LEU A H    4  
ATOM 8002  H HA   . LEU A 1 98  ? 3.362   -5.846  -6.321  1.00 1.86  ? 612 LEU A HA   4  
ATOM 8003  H HB2  . LEU A 1 98  ? 6.007   -5.231  -5.008  1.00 2.09  ? 612 LEU A HB2  4  
ATOM 8004  H HB3  . LEU A 1 98  ? 5.669   -4.670  -6.630  1.00 2.39  ? 612 LEU A HB3  4  
ATOM 8005  H HG   . LEU A 1 98  ? 3.311   -3.920  -5.525  1.00 2.49  ? 612 LEU A HG   4  
ATOM 8006  H HD11 . LEU A 1 98  ? 3.684   -2.925  -3.319  1.00 4.20  ? 612 LEU A HD11 4  
ATOM 8007  H HD12 . LEU A 1 98  ? 5.284   -3.691  -3.220  1.00 2.74  ? 612 LEU A HD12 4  
ATOM 8008  H HD13 . LEU A 1 98  ? 3.802   -4.689  -3.237  1.00 4.10  ? 612 LEU A HD13 4  
ATOM 8009  H HD21 . LEU A 1 98  ? 4.204   -1.721  -5.457  1.00 2.51  ? 612 LEU A HD21 4  
ATOM 8010  H HD22 . LEU A 1 98  ? 5.032   -2.616  -6.740  1.00 1.52  ? 612 LEU A HD22 4  
ATOM 8011  H HD23 . LEU A 1 98  ? 5.852   -2.359  -5.180  1.00 2.06  ? 612 LEU A HD23 4  
ATOM 8012  N N    . LEU A 1 99  ? 5.195   -8.287  -7.037  1.00 1.76  ? 613 LEU A N    4  
ATOM 8013  C CA   . LEU A 1 99  ? 5.644   -9.229  -8.062  1.00 2.24  ? 613 LEU A CA   4  
ATOM 8014  C C    . LEU A 1 99  ? 4.752   -10.484 -8.170  1.00 2.15  ? 613 LEU A C    4  
ATOM 8015  O O    . LEU A 1 99  ? 4.947   -11.278 -9.092  1.00 2.71  ? 613 LEU A O    4  
ATOM 8016  C CB   . LEU A 1 99  ? 7.120   -9.596  -7.800  1.00 2.74  ? 613 LEU A CB   4  
ATOM 8017  C CG   . LEU A 1 99  ? 8.052   -8.369  -7.772  1.00 3.79  ? 613 LEU A CG   4  
ATOM 8018  C CD1  . LEU A 1 99  ? 8.381   -7.918  -6.343  1.00 3.91  ? 613 LEU A CD1  4  
ATOM 8019  C CD2  . LEU A 1 99  ? 9.380   -8.670  -8.466  1.00 5.06  ? 613 LEU A CD2  4  
ATOM 8020  H H    . LEU A 1 99  ? 5.073   -8.645  -6.103  1.00 1.73  ? 613 LEU A H    4  
ATOM 8021  H HA   . LEU A 1 99  ? 5.591   -8.738  -9.035  1.00 2.57  ? 613 LEU A HA   4  
ATOM 8022  H HB2  . LEU A 1 99  ? 7.205   -10.139 -6.859  1.00 2.59  ? 613 LEU A HB2  4  
ATOM 8023  H HB3  . LEU A 1 99  ? 7.439   -10.268 -8.599  1.00 3.51  ? 613 LEU A HB3  4  
ATOM 8024  H HG   . LEU A 1 99  ? 7.556   -7.551  -8.290  1.00 4.39  ? 613 LEU A HG   4  
ATOM 8025  H HD11 . LEU A 1 99  ? 9.016   -7.033  -6.378  1.00 4.90  ? 613 LEU A HD11 4  
ATOM 8026  H HD12 . LEU A 1 99  ? 8.906   -8.713  -5.814  1.00 4.03  ? 613 LEU A HD12 4  
ATOM 8027  H HD13 . LEU A 1 99  ? 7.470   -7.670  -5.803  1.00 3.93  ? 613 LEU A HD13 4  
ATOM 8028  H HD21 . LEU A 1 99  ? 10.019  -7.786  -8.452  1.00 5.76  ? 613 LEU A HD21 4  
ATOM 8029  H HD22 . LEU A 1 99  ? 9.199   -8.950  -9.503  1.00 5.91  ? 613 LEU A HD22 4  
ATOM 8030  H HD23 . LEU A 1 99  ? 9.886   -9.490  -7.958  1.00 5.01  ? 613 LEU A HD23 4  
ATOM 8031  N N    . THR A 1 100 ? 3.781   -10.672 -7.263  1.00 1.64  ? 614 THR A N    4  
ATOM 8032  C CA   . THR A 1 100 ? 2.817   -11.796 -7.341  1.00 1.65  ? 614 THR A CA   4  
ATOM 8033  C C    . THR A 1 100 ? 1.592   -11.470 -8.198  1.00 1.71  ? 614 THR A C    4  
ATOM 8034  O O    . THR A 1 100 ? 1.152   -10.320 -8.288  1.00 1.97  ? 614 THR A O    4  
ATOM 8035  C CB   . THR A 1 100 ? 2.432   -12.395 -5.976  1.00 1.91  ? 614 THR A CB   4  
ATOM 8036  O OG1  . THR A 1 100 ? 2.035   -13.736 -6.151  1.00 2.86  ? 614 THR A OG1  4  
ATOM 8037  C CG2  . THR A 1 100 ? 1.285   -11.714 -5.231  1.00 2.46  ? 614 THR A CG2  4  
ATOM 8038  H H    . THR A 1 100 ? 3.612   -9.916  -6.602  1.00 1.47  ? 614 THR A H    4  
ATOM 8039  H HA   . THR A 1 100 ? 3.332   -12.607 -7.851  1.00 1.86  ? 614 THR A HA   4  
ATOM 8040  H HB   . THR A 1 100 ? 3.317   -12.398 -5.347  1.00 2.21  ? 614 THR A HB   4  
ATOM 8041  H HG1  . THR A 1 100 ? 1.749   -14.066 -5.284  1.00 3.19  ? 614 THR A HG1  4  
ATOM 8042  H HG21 . THR A 1 100 ? 0.342   -11.872 -5.757  1.00 3.59  ? 614 THR A HG21 4  
ATOM 8043  H HG22 . THR A 1 100 ? 1.462   -10.644 -5.160  1.00 2.76  ? 614 THR A HG22 4  
ATOM 8044  H HG23 . THR A 1 100 ? 1.210   -12.128 -4.226  1.00 3.15  ? 614 THR A HG23 4  
ATOM 8045  N N    . ARG A 1 101 ? 1.046   -12.508 -8.837  1.00 1.82  ? 615 ARG A N    4  
ATOM 8046  C CA   . ARG A 1 101 ? -0.028  -12.423 -9.843  1.00 2.03  ? 615 ARG A CA   4  
ATOM 8047  C C    . ARG A 1 101 ? -1.364  -11.928 -9.274  1.00 2.06  ? 615 ARG A C    4  
ATOM 8048  O O    . ARG A 1 101 ? -1.602  -11.980 -8.063  1.00 2.72  ? 615 ARG A O    4  
ATOM 8049  C CB   . ARG A 1 101 ? -0.175  -13.780 -10.557 1.00 2.94  ? 615 ARG A CB   4  
ATOM 8050  C CG   . ARG A 1 101 ? 0.996   -14.029 -11.523 1.00 3.19  ? 615 ARG A CG   4  
ATOM 8051  C CD   . ARG A 1 101 ? 0.848   -15.341 -12.302 1.00 4.26  ? 615 ARG A CD   4  
ATOM 8052  N NE   . ARG A 1 101 ? 0.972   -16.525 -11.432 1.00 5.24  ? 615 ARG A NE   4  
ATOM 8053  C CZ   . ARG A 1 101 ? 0.062   -17.441 -11.164 1.00 6.82  ? 615 ARG A CZ   4  
ATOM 8054  N NH1  . ARG A 1 101 ? -1.175  -17.367 -11.568 1.00 7.70  ? 615 ARG A NH1  4  
ATOM 8055  N NH2  . ARG A 1 101 ? 0.418   -18.480 -10.470 1.00 8.04  ? 615 ARG A NH2  4  
ATOM 8056  H H    . ARG A 1 101 ? 1.433   -13.416 -8.614  1.00 1.96  ? 615 ARG A H    4  
ATOM 8057  H HA   . ARG A 1 101 ? 0.261   -11.678 -10.588 1.00 2.38  ? 615 ARG A HA   4  
ATOM 8058  H HB2  . ARG A 1 101 ? -0.226  -14.578 -9.815  1.00 3.35  ? 615 ARG A HB2  4  
ATOM 8059  H HB3  . ARG A 1 101 ? -1.101  -13.792 -11.134 1.00 3.94  ? 615 ARG A HB3  4  
ATOM 8060  H HG2  . ARG A 1 101 ? 1.038   -13.209 -12.242 1.00 3.75  ? 615 ARG A HG2  4  
ATOM 8061  H HG3  . ARG A 1 101 ? 1.933   -14.048 -10.971 1.00 3.07  ? 615 ARG A HG3  4  
ATOM 8062  H HD2  . ARG A 1 101 ? -0.106  -15.333 -12.824 1.00 4.99  ? 615 ARG A HD2  4  
ATOM 8063  H HD3  . ARG A 1 101 ? 1.637   -15.383 -13.056 1.00 4.50  ? 615 ARG A HD3  4  
ATOM 8064  H HE   . ARG A 1 101 ? 1.848   -16.634 -10.934 1.00 5.24  ? 615 ARG A HE   4  
ATOM 8065  H HH11 . ARG A 1 101 ? -1.488  -16.597 -12.144 1.00 7.26  ? 615 ARG A HH11 4  
ATOM 8066  H HH12 . ARG A 1 101 ? -1.850  -18.059 -11.262 1.00 9.14  ? 615 ARG A HH12 4  
ATOM 8067  H HH21 . ARG A 1 101 ? 1.408   -18.631 -10.317 1.00 7.87  ? 615 ARG A HH21 4  
ATOM 8068  H HH22 . ARG A 1 101 ? -0.236  -19.233 -10.283 1.00 9.38  ? 615 ARG A HH22 4  
ATOM 8069  N N    . GLY A 1 102 ? -2.227  -11.445 -10.171 1.00 2.26  ? 616 GLY A N    4  
ATOM 8070  C CA   . GLY A 1 102 ? -3.543  -10.872 -9.873  1.00 2.88  ? 616 GLY A CA   4  
ATOM 8071  C C    . GLY A 1 102 ? -4.549  -11.867 -9.289  1.00 1.87  ? 616 GLY A C    4  
ATOM 8072  O O    . GLY A 1 102 ? -4.183  -12.969 -8.882  1.00 2.57  ? 616 GLY A O    4  
ATOM 8073  H H    . GLY A 1 102 ? -1.939  -11.474 -11.145 1.00 2.59  ? 616 GLY A H    4  
ATOM 8074  H HA2  . GLY A 1 102 ? -3.425  -10.060 -9.159  1.00 3.71  ? 616 GLY A HA2  4  
ATOM 8075  H HA3  . GLY A 1 102 ? -3.957  -10.461 -10.793 1.00 4.52  ? 616 GLY A HA3  4  
ATOM 8076  N N    . ARG A 1 103 ? -5.831  -11.473 -9.234  1.00 2.01  ? 617 ARG A N    4  
ATOM 8077  C CA   . ARG A 1 103 ? -6.888  -12.209 -8.506  1.00 1.63  ? 617 ARG A CA   4  
ATOM 8078  C C    . ARG A 1 103 ? -6.571  -12.374 -7.012  1.00 1.56  ? 617 ARG A C    4  
ATOM 8079  O O    . ARG A 1 103 ? -6.723  -13.455 -6.438  1.00 1.89  ? 617 ARG A O    4  
ATOM 8080  C CB   . ARG A 1 103 ? -7.235  -13.553 -9.188  1.00 2.09  ? 617 ARG A CB   4  
ATOM 8081  C CG   . ARG A 1 103 ? -7.764  -13.459 -10.624 1.00 2.02  ? 617 ARG A CG   4  
ATOM 8082  C CD   . ARG A 1 103 ? -9.105  -12.713 -10.683 1.00 1.72  ? 617 ARG A CD   4  
ATOM 8083  N NE   . ARG A 1 103 ? -9.861  -13.040 -11.906 1.00 2.44  ? 617 ARG A NE   4  
ATOM 8084  C CZ   . ARG A 1 103 ? -10.548 -14.145 -12.143 1.00 3.01  ? 617 ARG A CZ   4  
ATOM 8085  N NH1  . ARG A 1 103 ? -10.639 -15.157 -11.331 1.00 3.81  ? 617 ARG A NH1  4  
ATOM 8086  N NH2  . ARG A 1 103 ? -11.179 -14.274 -13.265 1.00 3.90  ? 617 ARG A NH2  4  
ATOM 8087  H H    . ARG A 1 103 ? -6.054  -10.543 -9.574  1.00 3.23  ? 617 ARG A H    4  
ATOM 8088  H HA   . ARG A 1 103 ? -7.791  -11.597 -8.516  1.00 2.19  ? 617 ARG A HA   4  
ATOM 8089  H HB2  . ARG A 1 103 ? -6.361  -14.205 -9.186  1.00 2.86  ? 617 ARG A HB2  4  
ATOM 8090  H HB3  . ARG A 1 103 ? -7.999  -14.048 -8.590  1.00 2.72  ? 617 ARG A HB3  4  
ATOM 8091  H HG2  . ARG A 1 103 ? -7.036  -12.961 -11.266 1.00 2.42  ? 617 ARG A HG2  4  
ATOM 8092  H HG3  . ARG A 1 103 ? -7.897  -14.477 -10.992 1.00 2.74  ? 617 ARG A HG3  4  
ATOM 8093  H HD2  . ARG A 1 103 ? -9.708  -12.975 -9.810  1.00 2.51  ? 617 ARG A HD2  4  
ATOM 8094  H HD3  . ARG A 1 103 ? -8.907  -11.638 -10.649 1.00 1.80  ? 617 ARG A HD3  4  
ATOM 8095  H HE   . ARG A 1 103 ? -9.881  -12.351 -12.642 1.00 3.39  ? 617 ARG A HE   4  
ATOM 8096  H HH11 . ARG A 1 103 ? -10.141 -15.186 -10.447 1.00 4.16  ? 617 ARG A HH11 4  
ATOM 8097  H HH12 . ARG A 1 103 ? -11.181 -15.957 -11.634 1.00 4.68  ? 617 ARG A HH12 4  
ATOM 8098  H HH21 . ARG A 1 103 ? -11.062 -13.572 -13.984 1.00 4.59  ? 617 ARG A HH21 4  
ATOM 8099  H HH22 . ARG A 1 103 ? -11.652 -15.152 -13.449 1.00 4.43  ? 617 ARG A HH22 4  
ATOM 8100  N N    . ARG A 1 104 ? -6.148  -11.282 -6.366  1.00 1.58  ? 618 ARG A N    4  
ATOM 8101  C CA   . ARG A 1 104 ? -6.154  -11.165 -4.898  1.00 1.75  ? 618 ARG A CA   4  
ATOM 8102  C C    . ARG A 1 104 ? -7.597  -11.114 -4.362  1.00 1.87  ? 618 ARG A C    4  
ATOM 8103  O O    . ARG A 1 104 ? -8.550  -11.047 -5.142  1.00 2.39  ? 618 ARG A O    4  
ATOM 8104  C CB   . ARG A 1 104 ? -5.333  -9.940  -4.445  1.00 1.95  ? 618 ARG A CB   4  
ATOM 8105  C CG   . ARG A 1 104 ? -3.903  -9.791  -4.998  1.00 2.91  ? 618 ARG A CG   4  
ATOM 8106  C CD   . ARG A 1 104 ? -2.907  -10.853 -4.513  1.00 3.12  ? 618 ARG A CD   4  
ATOM 8107  N NE   . ARG A 1 104 ? -2.789  -11.977 -5.460  1.00 4.38  ? 618 ARG A NE   4  
ATOM 8108  C CZ   . ARG A 1 104 ? -3.169  -13.232 -5.313  1.00 5.07  ? 618 ARG A CZ   4  
ATOM 8109  N NH1  . ARG A 1 104 ? -3.743  -13.713 -4.253  1.00 5.09  ? 618 ARG A NH1  4  
ATOM 8110  N NH2  . ARG A 1 104 ? -2.979  -14.073 -6.275  1.00 6.44  ? 618 ARG A NH2  4  
ATOM 8111  H H    . ARG A 1 104 ? -6.042  -10.428 -6.902  1.00 1.69  ? 618 ARG A H    4  
ATOM 8112  H HA   . ARG A 1 104 ? -5.707  -12.062 -4.483  1.00 1.95  ? 618 ARG A HA   4  
ATOM 8113  H HB2  . ARG A 1 104 ? -5.882  -9.051  -4.735  1.00 2.41  ? 618 ARG A HB2  4  
ATOM 8114  H HB3  . ARG A 1 104 ? -5.276  -9.936  -3.355  1.00 2.14  ? 618 ARG A HB3  4  
ATOM 8115  H HG2  . ARG A 1 104 ? -3.914  -9.762  -6.088  1.00 3.89  ? 618 ARG A HG2  4  
ATOM 8116  H HG3  . ARG A 1 104 ? -3.534  -8.821  -4.664  1.00 3.54  ? 618 ARG A HG3  4  
ATOM 8117  H HD2  . ARG A 1 104 ? -1.930  -10.369 -4.442  1.00 3.44  ? 618 ARG A HD2  4  
ATOM 8118  H HD3  . ARG A 1 104 ? -3.185  -11.191 -3.515  1.00 2.90  ? 618 ARG A HD3  4  
ATOM 8119  H HE   . ARG A 1 104 ? -2.340  -11.779 -6.350  1.00 5.32  ? 618 ARG A HE   4  
ATOM 8120  H HH11 . ARG A 1 104 ? -4.008  -13.112 -3.481  1.00 4.56  ? 618 ARG A HH11 4  
ATOM 8121  H HH12 . ARG A 1 104 ? -4.062  -14.675 -4.294  1.00 6.15  ? 618 ARG A HH12 4  
ATOM 8122  H HH21 . ARG A 1 104 ? -2.614  -13.754 -7.162  1.00 7.08  ? 618 ARG A HH21 4  
ATOM 8123  H HH22 . ARG A 1 104 ? -3.353  -15.010 -6.187  1.00 7.16  ? 618 ARG A HH22 4  
ATOM 8124  N N    . THR A 1 105 ? -7.764  -11.142 -3.039  1.00 1.86  ? 619 THR A N    4  
ATOM 8125  C CA   . THR A 1 105 ? -9.049  -10.879 -2.358  1.00 1.90  ? 619 THR A CA   4  
ATOM 8126  C C    . THR A 1 105 ? -8.924  -9.750  -1.326  1.00 1.66  ? 619 THR A C    4  
ATOM 8127  O O    . THR A 1 105 ? -7.849  -9.563  -0.749  1.00 2.06  ? 619 THR A O    4  
ATOM 8128  C CB   . THR A 1 105 ? -9.634  -12.170 -1.757  1.00 2.53  ? 619 THR A CB   4  
ATOM 8129  O OG1  . THR A 1 105 ? -10.993 -11.955 -1.455  1.00 2.49  ? 619 THR A OG1  4  
ATOM 8130  C CG2  . THR A 1 105 ? -8.940  -12.648 -0.480  1.00 4.09  ? 619 THR A CG2  4  
ATOM 8131  H H    . THR A 1 105 ? -6.939  -11.260 -2.464  1.00 2.06  ? 619 THR A H    4  
ATOM 8132  H HA   . THR A 1 105 ? -9.761  -10.536 -3.106  1.00 2.07  ? 619 THR A HA   4  
ATOM 8133  H HB   . THR A 1 105 ? -9.572  -12.961 -2.505  1.00 3.26  ? 619 THR A HB   4  
ATOM 8134  H HG1  . THR A 1 105 ? -11.333 -12.783 -1.055  1.00 3.23  ? 619 THR A HG1  4  
ATOM 8135  H HG21 . THR A 1 105 ? -9.332  -13.625 -0.198  1.00 4.62  ? 619 THR A HG21 4  
ATOM 8136  H HG22 . THR A 1 105 ? -9.113  -11.945 0.335   1.00 4.74  ? 619 THR A HG22 4  
ATOM 8137  H HG23 . THR A 1 105 ? -7.869  -12.743 -0.655  1.00 5.03  ? 619 THR A HG23 4  
ATOM 8138  N N    . ALA A 1 106 ? -9.985  -8.962  -1.109  1.00 1.49  ? 620 ALA A N    4  
ATOM 8139  C CA   . ALA A 1 106 ? -10.010 -7.873  -0.119  1.00 1.49  ? 620 ALA A CA   4  
ATOM 8140  C C    . ALA A 1 106 ? -11.436 -7.496  0.335   1.00 1.25  ? 620 ALA A C    4  
ATOM 8141  O O    . ALA A 1 106 ? -12.378 -7.532  -0.466  1.00 1.56  ? 620 ALA A O    4  
ATOM 8142  C CB   . ALA A 1 106 ? -9.314  -6.636  -0.707  1.00 2.17  ? 620 ALA A CB   4  
ATOM 8143  H H    . ALA A 1 106 ? -10.838 -9.155  -1.621  1.00 1.73  ? 620 ALA A H    4  
ATOM 8144  H HA   . ALA A 1 106 ? -9.450  -8.194  0.761   1.00 1.74  ? 620 ALA A HA   4  
ATOM 8145  H HB1  . ALA A 1 106 ? -8.302  -6.884  -1.025  1.00 2.77  ? 620 ALA A HB1  4  
ATOM 8146  H HB2  . ALA A 1 106 ? -9.878  -6.265  -1.563  1.00 3.26  ? 620 ALA A HB2  4  
ATOM 8147  H HB3  . ALA A 1 106 ? -9.260  -5.849  0.047   1.00 2.31  ? 620 ALA A HB3  4  
ATOM 8148  N N    . SER A 1 107 ? -11.577 -7.071  1.598   1.00 1.25  ? 621 SER A N    4  
ATOM 8149  C CA   . SER A 1 107 ? -12.827 -6.566  2.194   1.00 1.19  ? 621 SER A CA   4  
ATOM 8150  C C    . SER A 1 107 ? -12.540 -5.461  3.231   1.00 1.16  ? 621 SER A C    4  
ATOM 8151  O O    . SER A 1 107 ? -12.064 -5.747  4.331   1.00 1.39  ? 621 SER A O    4  
ATOM 8152  C CB   . SER A 1 107 ? -13.590 -7.718  2.870   1.00 1.50  ? 621 SER A CB   4  
ATOM 8153  O OG   . SER A 1 107 ? -13.892 -8.764  1.968   1.00 2.18  ? 621 SER A OG   4  
ATOM 8154  H H    . SER A 1 107 ? -10.775 -7.138  2.210   1.00 1.61  ? 621 SER A H    4  
ATOM 8155  H HA   . SER A 1 107 ? -13.467 -6.154  1.416   1.00 1.17  ? 621 SER A HA   4  
ATOM 8156  H HB2  . SER A 1 107 ? -12.977 -8.128  3.669   1.00 2.13  ? 621 SER A HB2  4  
ATOM 8157  H HB3  . SER A 1 107 ? -14.519 -7.338  3.296   1.00 1.60  ? 621 SER A HB3  4  
ATOM 8158  H HG   . SER A 1 107 ? -14.629 -8.456  1.393   1.00 2.36  ? 621 SER A HG   4  
ATOM 8159  N N    . VAL A 1 108 ? -12.763 -4.183  2.892   1.00 0.96  ? 622 VAL A N    4  
ATOM 8160  C CA   . VAL A 1 108 ? -12.582 -3.051  3.837   1.00 0.89  ? 622 VAL A CA   4  
ATOM 8161  C C    . VAL A 1 108 ? -13.419 -1.804  3.486   1.00 0.76  ? 622 VAL A C    4  
ATOM 8162  O O    . VAL A 1 108 ? -13.623 -1.476  2.315   1.00 0.75  ? 622 VAL A O    4  
ATOM 8163  C CB   . VAL A 1 108 ? -11.075 -2.742  4.037   1.00 0.99  ? 622 VAL A CB   4  
ATOM 8164  C CG1  . VAL A 1 108 ? -10.298 -2.617  2.730   1.00 1.05  ? 622 VAL A CG1  4  
ATOM 8165  C CG2  . VAL A 1 108 ? -10.786 -1.502  4.885   1.00 0.97  ? 622 VAL A CG2  4  
ATOM 8166  H H    . VAL A 1 108 ? -13.113 -3.977  1.959   1.00 0.87  ? 622 VAL A H    4  
ATOM 8167  H HA   . VAL A 1 108 ? -12.953 -3.384  4.807   1.00 0.93  ? 622 VAL A HA   4  
ATOM 8168  H HB   . VAL A 1 108 ? -10.638 -3.581  4.577   1.00 1.13  ? 622 VAL A HB   4  
ATOM 8169  H HG11 . VAL A 1 108 ? -10.291 -3.579  2.221   1.00 1.49  ? 622 VAL A HG11 4  
ATOM 8170  H HG12 . VAL A 1 108 ? -10.762 -1.868  2.094   1.00 2.04  ? 622 VAL A HG12 4  
ATOM 8171  H HG13 . VAL A 1 108 ? -9.268  -2.339  2.948   1.00 1.96  ? 622 VAL A HG13 4  
ATOM 8172  H HG21 . VAL A 1 108 ? -9.717  -1.440  5.086   1.00 1.57  ? 622 VAL A HG21 4  
ATOM 8173  H HG22 . VAL A 1 108 ? -11.101 -0.599  4.362   1.00 1.90  ? 622 VAL A HG22 4  
ATOM 8174  H HG23 . VAL A 1 108 ? -11.308 -1.581  5.834   1.00 1.38  ? 622 VAL A HG23 4  
ATOM 8175  N N    . ARG A 1 109 ? -13.870 -1.073  4.518   1.00 0.75  ? 623 ARG A N    4  
ATOM 8176  C CA   . ARG A 1 109 ? -14.603 0.203   4.443   1.00 0.68  ? 623 ARG A CA   4  
ATOM 8177  C C    . ARG A 1 109 ? -13.993 1.273   5.354   1.00 0.69  ? 623 ARG A C    4  
ATOM 8178  O O    . ARG A 1 109 ? -13.260 0.973   6.294   1.00 0.77  ? 623 ARG A O    4  
ATOM 8179  C CB   . ARG A 1 109 ? -16.101 -0.039  4.732   1.00 0.74  ? 623 ARG A CB   4  
ATOM 8180  C CG   . ARG A 1 109 ? -16.423 -0.264  6.218   1.00 0.88  ? 623 ARG A CG   4  
ATOM 8181  C CD   . ARG A 1 109 ? -17.750 -0.997  6.454   1.00 1.00  ? 623 ARG A CD   4  
ATOM 8182  N NE   . ARG A 1 109 ? -18.912 -0.280  5.902   1.00 1.89  ? 623 ARG A NE   4  
ATOM 8183  C CZ   . ARG A 1 109 ? -20.179 -0.617  6.051   1.00 2.56  ? 623 ARG A CZ   4  
ATOM 8184  N NH1  . ARG A 1 109 ? -20.560 -1.669  6.712   1.00 2.50  ? 623 ARG A NH1  4  
ATOM 8185  N NH2  . ARG A 1 109 ? -21.101 0.124   5.518   1.00 3.71  ? 623 ARG A NH2  4  
ATOM 8186  H H    . ARG A 1 109 ? -13.635 -1.394  5.455   1.00 0.81  ? 623 ARG A H    4  
ATOM 8187  H HA   . ARG A 1 109 ? -14.517 0.593   3.432   1.00 0.66  ? 623 ARG A HA   4  
ATOM 8188  H HB2  . ARG A 1 109 ? -16.679 0.817   4.384   1.00 0.74  ? 623 ARG A HB2  4  
ATOM 8189  H HB3  . ARG A 1 109 ? -16.423 -0.909  4.164   1.00 0.79  ? 623 ARG A HB3  4  
ATOM 8190  H HG2  . ARG A 1 109 ? -15.639 -0.866  6.665   1.00 1.17  ? 623 ARG A HG2  4  
ATOM 8191  H HG3  . ARG A 1 109 ? -16.445 0.698   6.728   1.00 1.31  ? 623 ARG A HG3  4  
ATOM 8192  H HD2  . ARG A 1 109 ? -17.690 -1.990  6.002   1.00 0.98  ? 623 ARG A HD2  4  
ATOM 8193  H HD3  . ARG A 1 109 ? -17.883 -1.117  7.531   1.00 1.75  ? 623 ARG A HD3  4  
ATOM 8194  H HE   . ARG A 1 109 ? -18.752 0.567   5.371   1.00 2.49  ? 623 ARG A HE   4  
ATOM 8195  H HH11 . ARG A 1 109 ? -19.863 -2.287  7.114   1.00 2.13  ? 623 ARG A HH11 4  
ATOM 8196  H HH12 . ARG A 1 109 ? -21.541 -1.920  6.738   1.00 3.17  ? 623 ARG A HH12 4  
ATOM 8197  H HH21 . ARG A 1 109 ? -20.837 0.903   4.926   1.00 4.22  ? 623 ARG A HH21 4  
ATOM 8198  H HH22 . ARG A 1 109 ? -22.078 -0.067  5.705   1.00 4.27  ? 623 ARG A HH22 4  
ATOM 8199  N N    . ALA A 1 110 ? -14.299 2.536   5.095   1.00 0.65  ? 624 ALA A N    4  
ATOM 8200  C CA   . ALA A 1 110 ? -13.897 3.646   5.948   1.00 0.61  ? 624 ALA A CA   4  
ATOM 8201  C C    . ALA A 1 110 ? -14.626 3.580   7.305   1.00 0.67  ? 624 ALA A C    4  
ATOM 8202  O O    . ALA A 1 110 ? -15.839 3.369   7.346   1.00 0.81  ? 624 ALA A O    4  
ATOM 8203  C CB   . ALA A 1 110 ? -14.182 4.943   5.187   1.00 0.62  ? 624 ALA A CB   4  
ATOM 8204  H H    . ALA A 1 110 ? -14.915 2.734   4.313   1.00 0.65  ? 624 ALA A H    4  
ATOM 8205  H HA   . ALA A 1 110 ? -12.825 3.587   6.128   1.00 0.67  ? 624 ALA A HA   4  
ATOM 8206  H HB1  . ALA A 1 110 ? -13.804 5.791   5.750   1.00 1.58  ? 624 ALA A HB1  4  
ATOM 8207  H HB2  . ALA A 1 110 ? -13.689 4.923   4.215   1.00 1.49  ? 624 ALA A HB2  4  
ATOM 8208  H HB3  . ALA A 1 110 ? -15.256 5.058   5.036   1.00 1.59  ? 624 ALA A HB3  4  
ATOM 8209  N N    . ASP A 1 111 ? -13.925 3.781   8.425   1.00 0.70  ? 625 ASP A N    4  
ATOM 8210  C CA   . ASP A 1 111 ? -14.586 3.947   9.734   1.00 0.80  ? 625 ASP A CA   4  
ATOM 8211  C C    . ASP A 1 111 ? -15.198 5.345   9.841   1.00 0.79  ? 625 ASP A C    4  
ATOM 8212  O O    . ASP A 1 111 ? -16.279 5.535   10.394  1.00 0.97  ? 625 ASP A O    4  
ATOM 8213  C CB   . ASP A 1 111 ? -13.575 3.776   10.876  1.00 0.91  ? 625 ASP A CB   4  
ATOM 8214  C CG   . ASP A 1 111 ? -14.261 3.375   12.186  1.00 1.27  ? 625 ASP A CG   4  
ATOM 8215  O OD1  . ASP A 1 111 ? -14.610 2.182   12.338  1.00 2.08  ? 625 ASP A OD1  4  
ATOM 8216  O OD2  . ASP A 1 111 ? -14.468 4.243   13.070  1.00 2.32  ? 625 ASP A OD2  4  
ATOM 8217  H H    . ASP A 1 111 ? -12.932 3.975   8.368   1.00 0.71  ? 625 ASP A H    4  
ATOM 8218  H HA   . ASP A 1 111 ? -15.373 3.206   9.853   1.00 0.92  ? 625 ASP A HA   4  
ATOM 8219  H HB2  . ASP A 1 111 ? -12.819 3.049   10.606  1.00 0.91  ? 625 ASP A HB2  4  
ATOM 8220  H HB3  . ASP A 1 111 ? -13.043 4.708   11.024  1.00 1.09  ? 625 ASP A HB3  4  
ATOM 8221  N N    . THR A 1 112 ? -14.465 6.305   9.279   1.00 0.72  ? 626 THR A N    4  
ATOM 8222  C CA   . THR A 1 112 ? -14.542 7.744   9.513   1.00 0.73  ? 626 THR A CA   4  
ATOM 8223  C C    . THR A 1 112 ? -14.215 8.453   8.192   1.00 0.68  ? 626 THR A C    4  
ATOM 8224  O O    . THR A 1 112 ? -14.006 7.786   7.180   1.00 0.68  ? 626 THR A O    4  
ATOM 8225  C CB   . THR A 1 112 ? -13.570 8.107   10.652  1.00 0.77  ? 626 THR A CB   4  
ATOM 8226  O OG1  . THR A 1 112 ? -13.608 9.486   10.930  1.00 0.86  ? 626 THR A OG1  4  
ATOM 8227  C CG2  . THR A 1 112 ? -12.127 7.678   10.376  1.00 0.74  ? 626 THR A CG2  4  
ATOM 8228  H H    . THR A 1 112 ? -13.670 6.016   8.708   1.00 0.70  ? 626 THR A H    4  
ATOM 8229  H HA   . THR A 1 112 ? -15.541 8.019   9.835   1.00 0.83  ? 626 THR A HA   4  
ATOM 8230  H HB   . THR A 1 112 ? -13.894 7.586   11.549  1.00 0.86  ? 626 THR A HB   4  
ATOM 8231  H HG1  . THR A 1 112 ? -12.998 9.621   11.692  1.00 0.99  ? 626 THR A HG1  4  
ATOM 8232  H HG21 . THR A 1 112 ? -11.775 8.095   9.433   1.00 1.77  ? 626 THR A HG21 4  
ATOM 8233  H HG22 . THR A 1 112 ? -12.088 6.587   10.341  1.00 1.66  ? 626 THR A HG22 4  
ATOM 8234  H HG23 . THR A 1 112 ? -11.483 8.013   11.186  1.00 1.66  ? 626 THR A HG23 4  
ATOM 8235  N N    . TYR A 1 113 ? -14.154 9.782   8.156   1.00 0.74  ? 627 TYR A N    4  
ATOM 8236  C CA   . TYR A 1 113 ? -13.521 10.503  7.057   1.00 0.76  ? 627 TYR A CA   4  
ATOM 8237  C C    . TYR A 1 113 ? -12.031 10.105  7.038   1.00 0.72  ? 627 TYR A C    4  
ATOM 8238  O O    . TYR A 1 113 ? -11.221 10.603  7.828   1.00 0.81  ? 627 TYR A O    4  
ATOM 8239  C CB   . TYR A 1 113 ? -13.811 11.987  7.299   1.00 0.94  ? 627 TYR A CB   4  
ATOM 8240  C CG   . TYR A 1 113 ? -13.419 13.031  6.265   1.00 1.21  ? 627 TYR A CG   4  
ATOM 8241  C CD1  . TYR A 1 113 ? -12.121 13.097  5.720   1.00 1.91  ? 627 TYR A CD1  4  
ATOM 8242  C CD2  . TYR A 1 113 ? -14.358 14.028  5.937   1.00 2.62  ? 627 TYR A CD2  4  
ATOM 8243  C CE1  . TYR A 1 113 ? -11.773 14.142  4.840   1.00 2.09  ? 627 TYR A CE1  4  
ATOM 8244  C CE2  . TYR A 1 113 ? -14.007 15.080  5.070   1.00 3.11  ? 627 TYR A CE2  4  
ATOM 8245  C CZ   . TYR A 1 113 ? -12.711 15.142  4.516   1.00 2.23  ? 627 TYR A CZ   4  
ATOM 8246  O OH   . TYR A 1 113 ? -12.359 16.138  3.659   1.00 2.78  ? 627 TYR A OH   4  
ATOM 8247  H H    . TYR A 1 113 ? -14.283 10.291  9.021   1.00 0.81  ? 627 TYR A H    4  
ATOM 8248  H HA   . TYR A 1 113 ? -13.984 10.211  6.121   1.00 0.76  ? 627 TYR A HA   4  
ATOM 8249  H HB2  . TYR A 1 113 ? -14.890 12.068  7.436   1.00 1.27  ? 627 TYR A HB2  4  
ATOM 8250  H HB3  . TYR A 1 113 ? -13.358 12.261  8.241   1.00 1.00  ? 627 TYR A HB3  4  
ATOM 8251  H HD1  . TYR A 1 113 ? -11.375 12.365  5.984   1.00 3.10  ? 627 TYR A HD1  4  
ATOM 8252  H HD2  . TYR A 1 113 ? -15.350 14.006  6.375   1.00 3.70  ? 627 TYR A HD2  4  
ATOM 8253  H HE1  . TYR A 1 113 ? -10.803 14.161  4.356   1.00 3.05  ? 627 TYR A HE1  4  
ATOM 8254  H HE2  . TYR A 1 113 ? -14.728 15.850  4.837   1.00 4.48  ? 627 TYR A HE2  4  
ATOM 8255  H HH   . TYR A 1 113 ? -13.109 16.742  3.478   1.00 3.50  ? 627 TYR A HH   4  
ATOM 8256  N N    . CYS A 1 114 ? -11.690 9.153   6.164   1.00 0.69  ? 628 CYS A N    4  
ATOM 8257  C CA   . CYS A 1 114 ? -10.366 8.558   6.022   1.00 0.61  ? 628 CYS A CA   4  
ATOM 8258  C C    . CYS A 1 114 ? -9.630  9.199   4.834   1.00 0.66  ? 628 CYS A C    4  
ATOM 8259  O O    . CYS A 1 114 ? -10.199 9.408   3.757   1.00 0.88  ? 628 CYS A O    4  
ATOM 8260  C CB   . CYS A 1 114 ? -10.453 7.011   5.953   1.00 0.54  ? 628 CYS A CB   4  
ATOM 8261  S SG   . CYS A 1 114 ? -10.944 6.391   4.324   1.00 2.27  ? 628 CYS A SG   4  
ATOM 8262  H H    . CYS A 1 114 ? -12.419 8.830   5.535   1.00 0.75  ? 628 CYS A H    4  
ATOM 8263  H HA   . CYS A 1 114 ? -9.796  8.800   6.920   1.00 0.65  ? 628 CYS A HA   4  
ATOM 8264  H HB2  . CYS A 1 114 ? -9.523  6.560   6.267   1.00 1.20  ? 628 CYS A HB2  4  
ATOM 8265  H HB3  . CYS A 1 114 ? -11.142 6.604   6.669   1.00 1.14  ? 628 CYS A HB3  4  
ATOM 8266  H HG   . CYS A 1 114 ? -12.024 7.174   4.177   1.00 3.15  ? 628 CYS A HG   4  
ATOM 8267  N N    . ARG A 1 115 ? -8.353  9.516   5.050   1.00 0.62  ? 629 ARG A N    4  
ATOM 8268  C CA   . ARG A 1 115 ? -7.424  10.093  4.079   1.00 0.67  ? 629 ARG A CA   4  
ATOM 8269  C C    . ARG A 1 115 ? -6.439  9.004   3.692   1.00 0.64  ? 629 ARG A C    4  
ATOM 8270  O O    . ARG A 1 115 ? -5.630  8.542   4.504   1.00 0.65  ? 629 ARG A O    4  
ATOM 8271  C CB   . ARG A 1 115 ? -6.694  11.259  4.754   1.00 0.86  ? 629 ARG A CB   4  
ATOM 8272  C CG   . ARG A 1 115 ? -7.620  12.430  5.129   1.00 1.76  ? 629 ARG A CG   4  
ATOM 8273  C CD   . ARG A 1 115 ? -7.477  13.570  4.128   1.00 1.44  ? 629 ARG A CD   4  
ATOM 8274  N NE   . ARG A 1 115 ? -6.153  14.200  4.261   1.00 1.54  ? 629 ARG A NE   4  
ATOM 8275  C CZ   . ARG A 1 115 ? -5.853  15.479  4.274   1.00 2.12  ? 629 ARG A CZ   4  
ATOM 8276  N NH1  . ARG A 1 115 ? -6.730  16.415  4.055   1.00 2.75  ? 629 ARG A NH1  4  
ATOM 8277  N NH2  . ARG A 1 115 ? -4.625  15.806  4.526   1.00 2.81  ? 629 ARG A NH2  4  
ATOM 8278  H H    . ARG A 1 115 ? -7.968  9.345   5.976   1.00 0.67  ? 629 ARG A H    4  
ATOM 8279  H HA   . ARG A 1 115 ? -7.951  10.434  3.170   1.00 0.74  ? 629 ARG A HA   4  
ATOM 8280  H HB2  . ARG A 1 115 ? -6.223  10.895  5.663   1.00 1.48  ? 629 ARG A HB2  4  
ATOM 8281  H HB3  . ARG A 1 115 ? -5.889  11.593  4.100   1.00 1.14  ? 629 ARG A HB3  4  
ATOM 8282  H HG2  . ARG A 1 115 ? -8.662  12.113  5.157   1.00 2.69  ? 629 ARG A HG2  4  
ATOM 8283  H HG3  . ARG A 1 115 ? -7.354  12.798  6.122   1.00 2.64  ? 629 ARG A HG3  4  
ATOM 8284  H HD2  . ARG A 1 115 ? -7.594  13.173  3.124   1.00 1.79  ? 629 ARG A HD2  4  
ATOM 8285  H HD3  . ARG A 1 115 ? -8.278  14.281  4.302   1.00 1.82  ? 629 ARG A HD3  4  
ATOM 8286  H HE   . ARG A 1 115 ? -5.361  13.593  4.447   1.00 2.00  ? 629 ARG A HE   4  
ATOM 8287  H HH11 . ARG A 1 115 ? -7.690  16.159  3.876   1.00 2.92  ? 629 ARG A HH11 4  
ATOM 8288  H HH12 . ARG A 1 115 ? -6.495  17.380  4.253   1.00 3.39  ? 629 ARG A HH12 4  
ATOM 8289  H HH21 . ARG A 1 115 ? -3.955  15.070  4.696   1.00 3.14  ? 629 ARG A HH21 4  
ATOM 8290  H HH22 . ARG A 1 115 ? -4.348  16.778  4.571   1.00 3.36  ? 629 ARG A HH22 4  
ATOM 8291  N N    . LEU A 1 116 ? -6.545  8.567   2.453   1.00 0.69  ? 630 LEU A N    4  
ATOM 8292  C CA   . LEU A 1 116 ? -5.782  7.457   1.899   1.00 0.71  ? 630 LEU A CA   4  
ATOM 8293  C C    . LEU A 1 116 ? -4.782  7.973   0.854   1.00 0.77  ? 630 LEU A C    4  
ATOM 8294  O O    . LEU A 1 116 ? -4.929  9.055   0.285   1.00 0.87  ? 630 LEU A O    4  
ATOM 8295  C CB   . LEU A 1 116 ? -6.737  6.361   1.372   1.00 0.73  ? 630 LEU A CB   4  
ATOM 8296  C CG   . LEU A 1 116 ? -7.852  5.903   2.346   1.00 0.72  ? 630 LEU A CG   4  
ATOM 8297  C CD1  . LEU A 1 116 ? -8.609  4.705   1.764   1.00 0.82  ? 630 LEU A CD1  4  
ATOM 8298  C CD2  . LEU A 1 116 ? -7.365  5.476   3.738   1.00 0.74  ? 630 LEU A CD2  4  
ATOM 8299  H H    . LEU A 1 116 ? -7.153  9.095   1.829   1.00 0.72  ? 630 LEU A H    4  
ATOM 8300  H HA   . LEU A 1 116 ? -5.191  7.004   2.692   1.00 0.71  ? 630 LEU A HA   4  
ATOM 8301  H HB2  . LEU A 1 116 ? -7.215  6.731   0.463   1.00 0.75  ? 630 LEU A HB2  4  
ATOM 8302  H HB3  . LEU A 1 116 ? -6.133  5.495   1.099   1.00 0.77  ? 630 LEU A HB3  4  
ATOM 8303  H HG   . LEU A 1 116 ? -8.560  6.721   2.473   1.00 0.72  ? 630 LEU A HG   4  
ATOM 8304  H HD11 . LEU A 1 116 ? -9.352  4.370   2.493   1.00 1.66  ? 630 LEU A HD11 4  
ATOM 8305  H HD12 . LEU A 1 116 ? -7.922  3.892   1.510   1.00 1.26  ? 630 LEU A HD12 4  
ATOM 8306  H HD13 . LEU A 1 116 ? -9.131  5.006   0.859   1.00 1.65  ? 630 LEU A HD13 4  
ATOM 8307  H HD21 . LEU A 1 116 ? -6.664  4.650   3.647   1.00 1.50  ? 630 LEU A HD21 4  
ATOM 8308  H HD22 . LEU A 1 116 ? -8.218  5.182   4.360   1.00 1.84  ? 630 LEU A HD22 4  
ATOM 8309  H HD23 . LEU A 1 116 ? -6.883  6.309   4.239   1.00 1.74  ? 630 LEU A HD23 4  
ATOM 8310  N N    . TYR A 1 117 ? -3.738  7.194   0.612   1.00 0.74  ? 631 TYR A N    4  
ATOM 8311  C CA   . TYR A 1 117 ? -2.768  7.425   -0.453  1.00 0.78  ? 631 TYR A CA   4  
ATOM 8312  C C    . TYR A 1 117 ? -2.680  6.180   -1.338  1.00 0.71  ? 631 TYR A C    4  
ATOM 8313  O O    . TYR A 1 117 ? -2.950  5.071   -0.867  1.00 0.83  ? 631 TYR A O    4  
ATOM 8314  C CB   . TYR A 1 117 ? -1.434  7.948   0.118   1.00 1.07  ? 631 TYR A CB   4  
ATOM 8315  C CG   . TYR A 1 117 ? -0.577  7.085   1.026   1.00 1.89  ? 631 TYR A CG   4  
ATOM 8316  C CD1  . TYR A 1 117 ? -1.008  6.761   2.326   1.00 3.49  ? 631 TYR A CD1  4  
ATOM 8317  C CD2  . TYR A 1 117 ? 0.718   6.720   0.617   1.00 2.71  ? 631 TYR A CD2  4  
ATOM 8318  C CE1  . TYR A 1 117 ? -0.194  5.988   3.177   1.00 4.92  ? 631 TYR A CE1  4  
ATOM 8319  C CE2  . TYR A 1 117 ? 1.554   5.980   1.473   1.00 4.10  ? 631 TYR A CE2  4  
ATOM 8320  C CZ   . TYR A 1 117 ? 1.077   5.570   2.734   1.00 5.01  ? 631 TYR A CZ   4  
ATOM 8321  O OH   . TYR A 1 117 ? 1.833   4.747   3.499   1.00 6.60  ? 631 TYR A OH   4  
ATOM 8322  H H    . TYR A 1 117 ? -3.683  6.305   1.101   1.00 0.73  ? 631 TYR A H    4  
ATOM 8323  H HA   . TYR A 1 117 ? -3.147  8.216   -1.101  1.00 0.83  ? 631 TYR A HA   4  
ATOM 8324  H HB2  . TYR A 1 117 ? -0.830  8.275   -0.711  1.00 1.80  ? 631 TYR A HB2  4  
ATOM 8325  H HB3  . TYR A 1 117 ? -1.636  8.847   0.676   1.00 2.19  ? 631 TYR A HB3  4  
ATOM 8326  H HD1  . TYR A 1 117 ? -1.977  7.091   2.657   1.00 4.07  ? 631 TYR A HD1  4  
ATOM 8327  H HD2  . TYR A 1 117 ? 1.057   6.977   -0.373  1.00 3.12  ? 631 TYR A HD2  4  
ATOM 8328  H HE1  . TYR A 1 117 ? -0.541  5.709   4.159   1.00 6.29  ? 631 TYR A HE1  4  
ATOM 8329  H HE2  . TYR A 1 117 ? 2.532   5.660   1.149   1.00 4.99  ? 631 TYR A HE2  4  
ATOM 8330  H HH   . TYR A 1 117 ? 1.390   4.477   4.304   1.00 7.41  ? 631 TYR A HH   4  
ATOM 8331  N N    . SER A 1 118 ? -2.388  6.361   -2.629  1.00 0.71  ? 632 SER A N    4  
ATOM 8332  C CA   . SER A 1 118 ? -2.455  5.271   -3.611  1.00 0.82  ? 632 SER A CA   4  
ATOM 8333  C C    . SER A 1 118 ? -1.230  5.221   -4.531  1.00 0.77  ? 632 SER A C    4  
ATOM 8334  O O    . SER A 1 118 ? -0.938  6.168   -5.263  1.00 0.87  ? 632 SER A O    4  
ATOM 8335  C CB   . SER A 1 118 ? -3.799  5.300   -4.357  1.00 1.05  ? 632 SER A CB   4  
ATOM 8336  O OG   . SER A 1 118 ? -4.118  6.559   -4.930  1.00 2.14  ? 632 SER A OG   4  
ATOM 8337  H H    . SER A 1 118 ? -2.264  7.307   -2.983  1.00 0.76  ? 632 SER A H    4  
ATOM 8338  H HA   . SER A 1 118 ? -2.449  4.337   -3.058  1.00 0.90  ? 632 SER A HA   4  
ATOM 8339  H HB2  . SER A 1 118 ? -3.807  4.528   -5.129  1.00 1.69  ? 632 SER A HB2  4  
ATOM 8340  H HB3  . SER A 1 118 ? -4.577  5.067   -3.632  1.00 1.93  ? 632 SER A HB3  4  
ATOM 8341  H HG   . SER A 1 118 ? -5.101  6.631   -4.975  1.00 2.65  ? 632 SER A HG   4  
ATOM 8342  N N    . LEU A 1 119 ? -0.482  4.111   -4.473  1.00 0.74  ? 633 LEU A N    4  
ATOM 8343  C CA   . LEU A 1 119 ? 0.832   3.929   -5.118  1.00 0.75  ? 633 LEU A CA   4  
ATOM 8344  C C    . LEU A 1 119 ? 0.771   2.786   -6.151  1.00 0.74  ? 633 LEU A C    4  
ATOM 8345  O O    . LEU A 1 119 ? 0.351   1.671   -5.833  1.00 0.79  ? 633 LEU A O    4  
ATOM 8346  C CB   . LEU A 1 119 ? 1.916   3.735   -4.032  1.00 0.83  ? 633 LEU A CB   4  
ATOM 8347  C CG   . LEU A 1 119 ? 3.337   4.246   -4.371  1.00 0.95  ? 633 LEU A CG   4  
ATOM 8348  C CD1  . LEU A 1 119 ? 4.276   3.994   -3.194  1.00 1.19  ? 633 LEU A CD1  4  
ATOM 8349  C CD2  . LEU A 1 119 ? 3.953   3.590   -5.604  1.00 1.27  ? 633 LEU A CD2  4  
ATOM 8350  H H    . LEU A 1 119 ? -0.841  3.337   -3.919  1.00 0.79  ? 633 LEU A H    4  
ATOM 8351  H HA   . LEU A 1 119 ? 1.095   4.843   -5.639  1.00 0.81  ? 633 LEU A HA   4  
ATOM 8352  H HB2  . LEU A 1 119 ? 1.602   4.289   -3.149  1.00 0.90  ? 633 LEU A HB2  4  
ATOM 8353  H HB3  . LEU A 1 119 ? 1.963   2.680   -3.759  1.00 0.93  ? 633 LEU A HB3  4  
ATOM 8354  H HG   . LEU A 1 119 ? 3.313   5.327   -4.524  1.00 1.00  ? 633 LEU A HG   4  
ATOM 8355  H HD11 . LEU A 1 119 ? 4.323   2.928   -2.970  1.00 2.05  ? 633 LEU A HD11 4  
ATOM 8356  H HD12 . LEU A 1 119 ? 3.918   4.543   -2.323  1.00 2.24  ? 633 LEU A HD12 4  
ATOM 8357  H HD13 . LEU A 1 119 ? 5.277   4.354   -3.431  1.00 1.70  ? 633 LEU A HD13 4  
ATOM 8358  H HD21 . LEU A 1 119 ? 3.865   2.504   -5.540  1.00 2.28  ? 633 LEU A HD21 4  
ATOM 8359  H HD22 . LEU A 1 119 ? 5.006   3.853   -5.685  1.00 2.00  ? 633 LEU A HD22 4  
ATOM 8360  H HD23 . LEU A 1 119 ? 3.460   3.947   -6.504  1.00 1.96  ? 633 LEU A HD23 4  
ATOM 8361  N N    . SER A 1 120 ? 1.171   3.058   -7.395  1.00 0.79  ? 634 SER A N    4  
ATOM 8362  C CA   . SER A 1 120 ? 1.204   2.078   -8.488  1.00 0.83  ? 634 SER A CA   4  
ATOM 8363  C C    . SER A 1 120 ? 2.467   1.199   -8.494  1.00 0.80  ? 634 SER A C    4  
ATOM 8364  O O    . SER A 1 120 ? 3.568   1.648   -8.171  1.00 0.81  ? 634 SER A O    4  
ATOM 8365  C CB   . SER A 1 120 ? 0.970   2.786   -9.822  1.00 0.93  ? 634 SER A CB   4  
ATOM 8366  O OG   . SER A 1 120 ? 1.964   3.754   -10.104 1.00 2.23  ? 634 SER A OG   4  
ATOM 8367  H H    . SER A 1 120 ? 1.457   4.004   -7.613  1.00 0.87  ? 634 SER A H    4  
ATOM 8368  H HA   . SER A 1 120 ? 0.365   1.399   -8.346  1.00 0.88  ? 634 SER A HA   4  
ATOM 8369  H HB2  . SER A 1 120 ? 0.949   2.046   -10.613 1.00 1.17  ? 634 SER A HB2  4  
ATOM 8370  H HB3  . SER A 1 120 ? -0.002  3.273   -9.800  1.00 1.60  ? 634 SER A HB3  4  
ATOM 8371  H HG   . SER A 1 120 ? 2.429   3.420   -10.905 1.00 2.15  ? 634 SER A HG   4  
ATOM 8372  N N    . VAL A 1 121 ? 2.326   -0.079  -8.868  1.00 0.91  ? 635 VAL A N    4  
ATOM 8373  C CA   . VAL A 1 121 ? 3.412   -1.077  -8.760  1.00 0.97  ? 635 VAL A CA   4  
ATOM 8374  C C    . VAL A 1 121 ? 4.354   -0.996  -9.946  1.00 0.94  ? 635 VAL A C    4  
ATOM 8375  O O    . VAL A 1 121 ? 5.523   -1.361  -9.833  1.00 1.06  ? 635 VAL A O    4  
ATOM 8376  C CB   . VAL A 1 121 ? 2.921   -2.525  -8.555  1.00 1.14  ? 635 VAL A CB   4  
ATOM 8377  C CG1  . VAL A 1 121 ? 1.798   -2.627  -7.532  1.00 1.71  ? 635 VAL A CG1  4  
ATOM 8378  C CG2  . VAL A 1 121 ? 2.546   -3.287  -9.805  1.00 1.87  ? 635 VAL A CG2  4  
ATOM 8379  H H    . VAL A 1 121 ? 1.532   -0.311  -9.460  1.00 1.16  ? 635 VAL A H    4  
ATOM 8380  H HA   . VAL A 1 121 ? 3.997   -0.829  -7.873  1.00 1.05  ? 635 VAL A HA   4  
ATOM 8381  H HB   . VAL A 1 121 ? 3.749   -3.106  -8.177  1.00 1.83  ? 635 VAL A HB   4  
ATOM 8382  H HG11 . VAL A 1 121 ? 1.655   -3.678  -7.285  1.00 2.12  ? 635 VAL A HG11 4  
ATOM 8383  H HG12 . VAL A 1 121 ? 2.083   -2.079  -6.638  1.00 2.79  ? 635 VAL A HG12 4  
ATOM 8384  H HG13 . VAL A 1 121 ? 0.877   -2.223  -7.946  1.00 2.62  ? 635 VAL A HG13 4  
ATOM 8385  H HG21 . VAL A 1 121 ? 2.207   -4.273  -9.497  1.00 2.47  ? 635 VAL A HG21 4  
ATOM 8386  H HG22 . VAL A 1 121 ? 1.767   -2.767  -10.358 1.00 3.07  ? 635 VAL A HG22 4  
ATOM 8387  H HG23 . VAL A 1 121 ? 3.447   -3.420  -10.400 1.00 2.26  ? 635 VAL A HG23 4  
ATOM 8388  N N    . ASP A 1 122 ? 3.855   -0.479  -11.069 1.00 0.88  ? 636 ASP A N    4  
ATOM 8389  C CA   . ASP A 1 122 ? 4.659   -0.131  -12.236 1.00 1.02  ? 636 ASP A CA   4  
ATOM 8390  C C    . ASP A 1 122 ? 5.863   0.736   -11.846 1.00 0.99  ? 636 ASP A C    4  
ATOM 8391  O O    . ASP A 1 122 ? 7.013   0.391   -12.131 1.00 1.31  ? 636 ASP A O    4  
ATOM 8392  C CB   . ASP A 1 122 ? 3.799   0.607   -13.272 1.00 1.25  ? 636 ASP A CB   4  
ATOM 8393  C CG   . ASP A 1 122 ? 2.746   1.586   -12.741 1.00 3.00  ? 636 ASP A CG   4  
ATOM 8394  O OD1  . ASP A 1 122 ? 3.104   2.670   -12.215 1.00 4.54  ? 636 ASP A OD1  4  
ATOM 8395  O OD2  . ASP A 1 122 ? 1.542   1.255   -12.840 1.00 3.74  ? 636 ASP A OD2  4  
ATOM 8396  H H    . ASP A 1 122 ? 2.862   -0.273  -11.085 1.00 0.85  ? 636 ASP A H    4  
ATOM 8397  H HA   . ASP A 1 122 ? 5.046   -1.042  -12.693 1.00 1.24  ? 636 ASP A HA   4  
ATOM 8398  H HB2  . ASP A 1 122 ? 4.487   1.187   -13.857 1.00 1.98  ? 636 ASP A HB2  4  
ATOM 8399  H HB3  . ASP A 1 122 ? 3.319   -0.132  -13.915 1.00 1.61  ? 636 ASP A HB3  4  
ATOM 8400  N N    . ASN A 1 123 ? 5.594   1.821   -11.123 1.00 0.84  ? 637 ASN A N    4  
ATOM 8401  C CA   . ASN A 1 123 ? 6.594   2.776   -10.674 1.00 0.84  ? 637 ASN A CA   4  
ATOM 8402  C C    . ASN A 1 123 ? 7.584   2.171   -9.671  1.00 0.83  ? 637 ASN A C    4  
ATOM 8403  O O    . ASN A 1 123 ? 8.733   2.605   -9.670  1.00 1.00  ? 637 ASN A O    4  
ATOM 8404  C CB   . ASN A 1 123 ? 5.869   4.007   -10.105 1.00 0.99  ? 637 ASN A CB   4  
ATOM 8405  C CG   . ASN A 1 123 ? 5.724   5.080   -11.162 1.00 1.52  ? 637 ASN A CG   4  
ATOM 8406  O OD1  . ASN A 1 123 ? 6.356   6.124   -11.092 1.00 3.14  ? 637 ASN A OD1  4  
ATOM 8407  N ND2  . ASN A 1 123 ? 4.919   4.870   -12.176 1.00 1.26  ? 637 ASN A ND2  4  
ATOM 8408  H H    . ASN A 1 123 ? 4.618   2.043   -10.962 1.00 0.87  ? 637 ASN A H    4  
ATOM 8409  H HA   . ASN A 1 123 ? 7.184   3.083   -11.541 1.00 0.87  ? 637 ASN A HA   4  
ATOM 8410  H HB2  . ASN A 1 123 ? 4.889   3.741   -9.708  1.00 0.97  ? 637 ASN A HB2  4  
ATOM 8411  H HB3  . ASN A 1 123 ? 6.457   4.429   -9.289  1.00 1.27  ? 637 ASN A HB3  4  
ATOM 8412  H HD21 . ASN A 1 123 ? 4.371   4.014   -12.238 1.00 2.34  ? 637 ASN A HD21 4  
ATOM 8413  H HD22 . ASN A 1 123 ? 4.904   5.559   -12.914 1.00 1.34  ? 637 ASN A HD22 4  
ATOM 8414  N N    . PHE A 1 124 ? 7.173   1.161   -8.892  1.00 0.76  ? 638 PHE A N    4  
ATOM 8415  C CA   . PHE A 1 124 ? 8.022   0.409   -7.951  1.00 0.79  ? 638 PHE A CA   4  
ATOM 8416  C C    . PHE A 1 124 ? 8.987   -0.529  -8.691  1.00 0.88  ? 638 PHE A C    4  
ATOM 8417  O O    . PHE A 1 124 ? 10.197  -0.528  -8.460  1.00 0.95  ? 638 PHE A O    4  
ATOM 8418  C CB   . PHE A 1 124 ? 7.143   -0.393  -6.982  1.00 0.88  ? 638 PHE A CB   4  
ATOM 8419  C CG   . PHE A 1 124 ? 7.922   -1.107  -5.887  1.00 1.06  ? 638 PHE A CG   4  
ATOM 8420  C CD1  . PHE A 1 124 ? 8.670   -2.268  -6.169  1.00 2.26  ? 638 PHE A CD1  4  
ATOM 8421  C CD2  . PHE A 1 124 ? 7.848   -0.643  -4.562  1.00 1.65  ? 638 PHE A CD2  4  
ATOM 8422  C CE1  . PHE A 1 124 ? 9.406   -2.902  -5.153  1.00 2.49  ? 638 PHE A CE1  4  
ATOM 8423  C CE2  . PHE A 1 124 ? 8.578   -1.276  -3.542  1.00 1.71  ? 638 PHE A CE2  4  
ATOM 8424  C CZ   . PHE A 1 124 ? 9.373   -2.392  -3.845  1.00 1.57  ? 638 PHE A CZ   4  
ATOM 8425  H H    . PHE A 1 124 ? 6.224   0.842   -9.034  1.00 0.76  ? 638 PHE A H    4  
ATOM 8426  H HA   . PHE A 1 124 ? 8.596   1.097   -7.338  1.00 0.79  ? 638 PHE A HA   4  
ATOM 8427  H HB2  . PHE A 1 124 ? 6.422   0.286   -6.523  1.00 0.90  ? 638 PHE A HB2  4  
ATOM 8428  H HB3  . PHE A 1 124 ? 6.582   -1.136  -7.541  1.00 0.95  ? 638 PHE A HB3  4  
ATOM 8429  H HD1  . PHE A 1 124 ? 8.685   -2.677  -7.168  1.00 3.30  ? 638 PHE A HD1  4  
ATOM 8430  H HD2  . PHE A 1 124 ? 7.213   0.196   -4.324  1.00 2.71  ? 638 PHE A HD2  4  
ATOM 8431  H HE1  . PHE A 1 124 ? 10.002  -3.777  -5.377  1.00 3.67  ? 638 PHE A HE1  4  
ATOM 8432  H HE2  . PHE A 1 124 ? 8.529   -0.906  -2.527  1.00 2.66  ? 638 PHE A HE2  4  
ATOM 8433  H HZ   . PHE A 1 124 ? 9.952   -2.862  -3.068  1.00 1.78  ? 638 PHE A HZ   4  
ATOM 8434  N N    . ASN A 1 125 ? 8.448   -1.320  -9.619  1.00 0.96  ? 639 ASN A N    4  
ATOM 8435  C CA   . ASN A 1 125 ? 9.205   -2.247  -10.457 1.00 1.12  ? 639 ASN A CA   4  
ATOM 8436  C C    . ASN A 1 125 ? 10.200  -1.499  -11.380 1.00 1.18  ? 639 ASN A C    4  
ATOM 8437  O O    . ASN A 1 125 ? 11.197  -2.074  -11.818 1.00 1.34  ? 639 ASN A O    4  
ATOM 8438  C CB   . ASN A 1 125 ? 8.171   -3.092  -11.231 1.00 1.16  ? 639 ASN A CB   4  
ATOM 8439  C CG   . ASN A 1 125 ? 7.567   -4.242  -10.442 1.00 1.45  ? 639 ASN A CG   4  
ATOM 8440  O OD1  . ASN A 1 125 ? 8.094   -5.348  -10.457 1.00 2.06  ? 639 ASN A OD1  4  
ATOM 8441  N ND2  . ASN A 1 125 ? 6.462   -4.076  -9.752  1.00 1.48  ? 639 ASN A ND2  4  
ATOM 8442  H H    . ASN A 1 125 ? 7.446   -1.259  -9.765  1.00 0.93  ? 639 ASN A H    4  
ATOM 8443  H HA   . ASN A 1 125 ? 9.812   -2.903  -9.825  1.00 1.21  ? 639 ASN A HA   4  
ATOM 8444  H HB2  . ASN A 1 125 ? 7.390   -2.446  -11.627 1.00 1.20  ? 639 ASN A HB2  4  
ATOM 8445  H HB3  . ASN A 1 125 ? 8.648   -3.572  -12.074 1.00 1.29  ? 639 ASN A HB3  4  
ATOM 8446  H HD21 . ASN A 1 125 ? 5.951   -3.199  -9.718  1.00 1.54  ? 639 ASN A HD21 4  
ATOM 8447  H HD22 . ASN A 1 125 ? 6.091   -4.920  -9.351  1.00 1.77  ? 639 ASN A HD22 4  
ATOM 8448  N N    . GLU A 1 126 ? 9.975   -0.207  -11.635 1.00 1.11  ? 640 GLU A N    4  
ATOM 8449  C CA   . GLU A 1 126 ? 10.889  0.694   -12.349 1.00 1.23  ? 640 GLU A CA   4  
ATOM 8450  C C    . GLU A 1 126 ? 12.049  1.254   -11.504 1.00 1.26  ? 640 GLU A C    4  
ATOM 8451  O O    . GLU A 1 126 ? 13.212  1.184   -11.903 1.00 1.56  ? 640 GLU A O    4  
ATOM 8452  C CB   . GLU A 1 126 ? 10.081  1.889   -12.886 1.00 1.23  ? 640 GLU A CB   4  
ATOM 8453  C CG   . GLU A 1 126 ? 9.430   1.740   -14.278 1.00 1.86  ? 640 GLU A CG   4  
ATOM 8454  C CD   . GLU A 1 126 ? 10.156  0.800   -15.251 1.00 3.14  ? 640 GLU A CD   4  
ATOM 8455  O OE1  . GLU A 1 126 ? 9.892   -0.426  -15.195 1.00 4.62  ? 640 GLU A OE1  4  
ATOM 8456  O OE2  . GLU A 1 126 ? 10.961  1.270   -16.093 1.00 3.51  ? 640 GLU A OE2  4  
ATOM 8457  H H    . GLU A 1 126 ? 9.092   0.178   -11.322 1.00 1.02  ? 640 GLU A H    4  
ATOM 8458  H HA   . GLU A 1 126 ? 11.352  0.148   -13.166 1.00 1.36  ? 640 GLU A HA   4  
ATOM 8459  H HB2  . GLU A 1 126 ? 9.282   2.114   -12.182 1.00 1.52  ? 640 GLU A HB2  4  
ATOM 8460  H HB3  . GLU A 1 126 ? 10.721  2.768   -12.839 1.00 1.77  ? 640 GLU A HB3  4  
ATOM 8461  H HG2  . GLU A 1 126 ? 8.414   1.368   -14.139 1.00 2.40  ? 640 GLU A HG2  4  
ATOM 8462  H HG3  . GLU A 1 126 ? 9.339   2.731   -14.725 1.00 1.87  ? 640 GLU A HG3  4  
ATOM 8463  N N    . VAL A 1 127 ? 11.751  1.873   -10.360 1.00 0.97  ? 641 VAL A N    4  
ATOM 8464  C CA   . VAL A 1 127 ? 12.732  2.544   -9.473  1.00 0.91  ? 641 VAL A CA   4  
ATOM 8465  C C    . VAL A 1 127 ? 13.739  1.563   -8.865  1.00 0.92  ? 641 VAL A C    4  
ATOM 8466  O O    . VAL A 1 127 ? 14.866  1.945   -8.562  1.00 0.93  ? 641 VAL A O    4  
ATOM 8467  C CB   . VAL A 1 127 ? 11.980  3.355   -8.401  1.00 0.84  ? 641 VAL A CB   4  
ATOM 8468  C CG1  . VAL A 1 127 ? 11.038  2.481   -7.592  1.00 0.94  ? 641 VAL A CG1  4  
ATOM 8469  C CG2  . VAL A 1 127 ? 12.846  4.124   -7.399  1.00 0.73  ? 641 VAL A CG2  4  
ATOM 8470  H H    . VAL A 1 127 ? 10.774  1.912   -10.091 1.00 0.84  ? 641 VAL A H    4  
ATOM 8471  H HA   . VAL A 1 127 ? 13.310  3.265   -10.050 1.00 0.93  ? 641 VAL A HA   4  
ATOM 8472  H HB   . VAL A 1 127 ? 11.363  4.074   -8.934  1.00 0.92  ? 641 VAL A HB   4  
ATOM 8473  H HG11 . VAL A 1 127 ? 10.370  3.118   -7.022  1.00 1.40  ? 641 VAL A HG11 4  
ATOM 8474  H HG12 . VAL A 1 127 ? 10.446  1.891   -8.277  1.00 1.77  ? 641 VAL A HG12 4  
ATOM 8475  H HG13 . VAL A 1 127 ? 11.591  1.818   -6.933  1.00 2.16  ? 641 VAL A HG13 4  
ATOM 8476  H HG21 . VAL A 1 127 ? 13.453  3.434   -6.817  1.00 1.96  ? 641 VAL A HG21 4  
ATOM 8477  H HG22 . VAL A 1 127 ? 13.489  4.825   -7.930  1.00 1.55  ? 641 VAL A HG22 4  
ATOM 8478  H HG23 . VAL A 1 127 ? 12.199  4.658   -6.700  1.00 1.66  ? 641 VAL A HG23 4  
ATOM 8479  N N    . LEU A 1 128 ? 13.382  0.280   -8.759  1.00 0.96  ? 642 LEU A N    4  
ATOM 8480  C CA   . LEU A 1 128 ? 14.284  -0.768  -8.263  1.00 1.02  ? 642 LEU A CA   4  
ATOM 8481  C C    . LEU A 1 128 ? 15.576  -0.925  -9.104  1.00 1.16  ? 642 LEU A C    4  
ATOM 8482  O O    . LEU A 1 128 ? 16.621  -1.278  -8.562  1.00 1.23  ? 642 LEU A O    4  
ATOM 8483  C CB   . LEU A 1 128 ? 13.508  -2.103  -8.135  1.00 1.15  ? 642 LEU A CB   4  
ATOM 8484  C CG   . LEU A 1 128 ? 13.638  -2.814  -6.769  1.00 1.52  ? 642 LEU A CG   4  
ATOM 8485  C CD1  . LEU A 1 128 ? 13.132  -4.253  -6.881  1.00 1.81  ? 642 LEU A CD1  4  
ATOM 8486  C CD2  . LEU A 1 128 ? 15.056  -2.871  -6.203  1.00 2.34  ? 642 LEU A CD2  4  
ATOM 8487  H H    . LEU A 1 128 ? 12.420  0.050   -8.976  1.00 0.98  ? 642 LEU A H    4  
ATOM 8488  H HA   . LEU A 1 128 ? 14.606  -0.448  -7.274  1.00 0.96  ? 642 LEU A HA   4  
ATOM 8489  H HB2  . LEU A 1 128 ? 12.445  -1.926  -8.297  1.00 1.32  ? 642 LEU A HB2  4  
ATOM 8490  H HB3  . LEU A 1 128 ? 13.825  -2.779  -8.931  1.00 1.27  ? 642 LEU A HB3  4  
ATOM 8491  H HG   . LEU A 1 128 ? 13.008  -2.294  -6.049  1.00 1.90  ? 642 LEU A HG   4  
ATOM 8492  H HD11 . LEU A 1 128 ? 13.129  -4.720  -5.896  1.00 2.74  ? 642 LEU A HD11 4  
ATOM 8493  H HD12 . LEU A 1 128 ? 13.780  -4.832  -7.539  1.00 2.78  ? 642 LEU A HD12 4  
ATOM 8494  H HD13 . LEU A 1 128 ? 12.117  -4.261  -7.276  1.00 1.72  ? 642 LEU A HD13 4  
ATOM 8495  H HD21 . LEU A 1 128 ? 15.080  -3.520  -5.329  1.00 2.88  ? 642 LEU A HD21 4  
ATOM 8496  H HD22 . LEU A 1 128 ? 15.384  -1.881  -5.890  1.00 3.10  ? 642 LEU A HD22 4  
ATOM 8497  H HD23 . LEU A 1 128 ? 15.739  -3.244  -6.962  1.00 3.05  ? 642 LEU A HD23 4  
ATOM 8498  N N    . GLU A 1 129 ? 15.551  -0.604  -10.405 1.00 1.25  ? 643 GLU A N    4  
ATOM 8499  C CA   . GLU A 1 129 ? 16.743  -0.660  -11.277 1.00 1.42  ? 643 GLU A CA   4  
ATOM 8500  C C    . GLU A 1 129 ? 17.722  0.522   -11.066 1.00 1.26  ? 643 GLU A C    4  
ATOM 8501  O O    . GLU A 1 129 ? 18.853  0.482   -11.558 1.00 1.29  ? 643 GLU A O    4  
ATOM 8502  C CB   . GLU A 1 129 ? 16.317  -0.797  -12.757 1.00 1.74  ? 643 GLU A CB   4  
ATOM 8503  C CG   . GLU A 1 129 ? 15.647  -2.131  -13.110 1.00 2.53  ? 643 GLU A CG   4  
ATOM 8504  C CD   . GLU A 1 129 ? 16.286  -2.864  -14.304 1.00 2.86  ? 643 GLU A CD   4  
ATOM 8505  O OE1  . GLU A 1 129 ? 17.515  -3.120  -14.310 1.00 3.80  ? 643 GLU A OE1  4  
ATOM 8506  O OE2  . GLU A 1 129 ? 15.584  -3.181  -15.295 1.00 3.06  ? 643 GLU A OE2  4  
ATOM 8507  H H    . GLU A 1 129 ? 14.682  -0.275  -10.805 1.00 1.23  ? 643 GLU A H    4  
ATOM 8508  H HA   . GLU A 1 129 ? 17.314  -1.555  -11.021 1.00 1.58  ? 643 GLU A HA   4  
ATOM 8509  H HB2  . GLU A 1 129 ? 15.576  -0.042  -12.964 1.00 1.78  ? 643 GLU A HB2  4  
ATOM 8510  H HB3  . GLU A 1 129 ? 17.180  -0.632  -13.403 1.00 2.05  ? 643 GLU A HB3  4  
ATOM 8511  H HG2  . GLU A 1 129 ? 15.683  -2.746  -12.226 1.00 3.03  ? 643 GLU A HG2  4  
ATOM 8512  H HG3  . GLU A 1 129 ? 14.591  -1.947  -13.322 1.00 2.81  ? 643 GLU A HG3  4  
ATOM 8513  N N    . GLU A 1 130 ? 17.353  1.563   -10.309 1.00 1.14  ? 644 GLU A N    4  
ATOM 8514  C CA   . GLU A 1 130 ? 18.266  2.656   -9.933  1.00 1.12  ? 644 GLU A CA   4  
ATOM 8515  C C    . GLU A 1 130 ? 19.244  2.269   -8.804  1.00 1.09  ? 644 GLU A C    4  
ATOM 8516  O O    . GLU A 1 130 ? 20.338  2.830   -8.710  1.00 1.13  ? 644 GLU A O    4  
ATOM 8517  C CB   . GLU A 1 130 ? 17.438  3.871   -9.516  1.00 1.10  ? 644 GLU A CB   4  
ATOM 8518  C CG   . GLU A 1 130 ? 16.638  4.484   -10.670 1.00 1.16  ? 644 GLU A CG   4  
ATOM 8519  C CD   . GLU A 1 130 ? 17.295  5.766   -11.185 1.00 1.37  ? 644 GLU A CD   4  
ATOM 8520  O OE1  . GLU A 1 130 ? 18.223  5.662   -12.024 1.00 1.84  ? 644 GLU A OE1  4  
ATOM 8521  O OE2  . GLU A 1 130 ? 16.942  6.880   -10.728 1.00 2.23  ? 644 GLU A OE2  4  
ATOM 8522  H H    . GLU A 1 130 ? 16.414  1.594   -9.922  1.00 1.15  ? 644 GLU A H    4  
ATOM 8523  H HA   . GLU A 1 130 ? 18.856  2.957   -10.795 1.00 1.18  ? 644 GLU A HA   4  
ATOM 8524  H HB2  . GLU A 1 130 ? 16.742  3.572   -8.742  1.00 1.03  ? 644 GLU A HB2  4  
ATOM 8525  H HB3  . GLU A 1 130 ? 18.100  4.621   -9.088  1.00 1.12  ? 644 GLU A HB3  4  
ATOM 8526  H HG2  . GLU A 1 130 ? 16.522  3.773   -11.490 1.00 1.17  ? 644 GLU A HG2  4  
ATOM 8527  H HG3  . GLU A 1 130 ? 15.642  4.689   -10.299 1.00 1.22  ? 644 GLU A HG3  4  
ATOM 8528  N N    . TYR A 1 131 ? 18.869  1.291   -7.973  1.00 1.07  ? 645 TYR A N    4  
ATOM 8529  C CA   . TYR A 1 131 ? 19.584  0.890   -6.753  1.00 1.07  ? 645 TYR A CA   4  
ATOM 8530  C C    . TYR A 1 131 ? 19.878  -0.628  -6.779  1.00 1.22  ? 645 TYR A C    4  
ATOM 8531  O O    . TYR A 1 131 ? 19.319  -1.383  -5.977  1.00 1.34  ? 645 TYR A O    4  
ATOM 8532  C CB   . TYR A 1 131 ? 18.773  1.332   -5.514  1.00 1.00  ? 645 TYR A CB   4  
ATOM 8533  C CG   . TYR A 1 131 ? 18.387  2.806   -5.481  1.00 0.86  ? 645 TYR A CG   4  
ATOM 8534  C CD1  . TYR A 1 131 ? 17.211  3.230   -6.129  1.00 1.72  ? 645 TYR A CD1  4  
ATOM 8535  C CD2  . TYR A 1 131 ? 19.192  3.753   -4.813  1.00 2.23  ? 645 TYR A CD2  4  
ATOM 8536  C CE1  . TYR A 1 131 ? 16.873  4.595   -6.169  1.00 1.86  ? 645 TYR A CE1  4  
ATOM 8537  C CE2  . TYR A 1 131 ? 18.843  5.120   -4.826  1.00 2.14  ? 645 TYR A CE2  4  
ATOM 8538  C CZ   . TYR A 1 131 ? 17.696  5.546   -5.532  1.00 0.91  ? 645 TYR A CZ   4  
ATOM 8539  O OH   . TYR A 1 131 ? 17.382  6.865   -5.647  1.00 1.06  ? 645 TYR A OH   4  
ATOM 8540  H H    . TYR A 1 131 ? 17.985  0.838   -8.160  1.00 1.10  ? 645 TYR A H    4  
ATOM 8541  H HA   . TYR A 1 131 ? 20.544  1.405   -6.706  1.00 1.07  ? 645 TYR A HA   4  
ATOM 8542  H HB2  . TYR A 1 131 ? 17.855  0.744   -5.466  1.00 1.08  ? 645 TYR A HB2  4  
ATOM 8543  H HB3  . TYR A 1 131 ? 19.354  1.101   -4.621  1.00 1.06  ? 645 TYR A HB3  4  
ATOM 8544  H HD1  . TYR A 1 131 ? 16.585  2.507   -6.634  1.00 2.97  ? 645 TYR A HD1  4  
ATOM 8545  H HD2  . TYR A 1 131 ? 20.093  3.433   -4.307  1.00 3.60  ? 645 TYR A HD2  4  
ATOM 8546  H HE1  . TYR A 1 131 ? 15.994  4.923   -6.703  1.00 3.21  ? 645 TYR A HE1  4  
ATOM 8547  H HE2  . TYR A 1 131 ? 19.465  5.841   -4.316  1.00 3.43  ? 645 TYR A HE2  4  
ATOM 8548  H HH   . TYR A 1 131 ? 18.025  7.460   -5.210  1.00 1.57  ? 645 TYR A HH   4  
ATOM 8549  N N    . PRO A 1 132 ? 20.699  -1.133  -7.723  1.00 1.25  ? 646 PRO A N    4  
ATOM 8550  C CA   . PRO A 1 132 ? 20.817  -2.565  -8.007  1.00 1.37  ? 646 PRO A CA   4  
ATOM 8551  C C    . PRO A 1 132 ? 21.279  -3.450  -6.837  1.00 1.46  ? 646 PRO A C    4  
ATOM 8552  O O    . PRO A 1 132 ? 20.922  -4.632  -6.827  1.00 1.57  ? 646 PRO A O    4  
ATOM 8553  C CB   . PRO A 1 132 ? 21.758  -2.674  -9.211  1.00 1.39  ? 646 PRO A CB   4  
ATOM 8554  C CG   . PRO A 1 132 ? 22.545  -1.365  -9.185  1.00 1.31  ? 646 PRO A CG   4  
ATOM 8555  C CD   . PRO A 1 132 ? 21.505  -0.375  -8.669  1.00 1.23  ? 646 PRO A CD   4  
ATOM 8556  H HA   . PRO A 1 132 ? 19.838  -2.932  -8.315  1.00 1.45  ? 646 PRO A HA   4  
ATOM 8557  H HB2  . PRO A 1 132 ? 22.408  -3.545  -9.146  1.00 1.46  ? 646 PRO A HB2  4  
ATOM 8558  H HB3  . PRO A 1 132 ? 21.166  -2.726  -10.124 1.00 1.44  ? 646 PRO A HB3  4  
ATOM 8559  H HG2  . PRO A 1 132 ? 23.369  -1.439  -8.472  1.00 1.34  ? 646 PRO A HG2  4  
ATOM 8560  H HG3  . PRO A 1 132 ? 22.910  -1.090  -10.176 1.00 1.36  ? 646 PRO A HG3  4  
ATOM 8561  H HD2  . PRO A 1 132 ? 21.989  0.478   -8.197  1.00 1.20  ? 646 PRO A HD2  4  
ATOM 8562  H HD3  . PRO A 1 132 ? 20.877  -0.041  -9.496  1.00 1.24  ? 646 PRO A HD3  4  
ATOM 8563  N N    . MET A 1 133 ? 21.953  -2.927  -5.796  1.00 1.47  ? 647 MET A N    4  
ATOM 8564  C CA   . MET A 1 133 ? 22.255  -3.737  -4.604  1.00 1.66  ? 647 MET A CA   4  
ATOM 8565  C C    . MET A 1 133 ? 20.953  -4.198  -3.917  1.00 1.76  ? 647 MET A C    4  
ATOM 8566  O O    . MET A 1 133 ? 20.894  -5.267  -3.309  1.00 1.99  ? 647 MET A O    4  
ATOM 8567  C CB   . MET A 1 133 ? 23.170  -2.961  -3.633  1.00 1.74  ? 647 MET A CB   4  
ATOM 8568  C CG   . MET A 1 133 ? 22.326  -2.134  -2.663  1.00 1.69  ? 647 MET A CG   4  
ATOM 8569  S SD   . MET A 1 133 ? 23.127  -0.931  -1.596  1.00 1.78  ? 647 MET A SD   4  
ATOM 8570  C CE   . MET A 1 133 ? 21.542  -0.389  -0.912  1.00 1.53  ? 647 MET A CE   4  
ATOM 8571  H H    . MET A 1 133 ? 22.142  -1.924  -5.753  1.00 1.37  ? 647 MET A H    4  
ATOM 8572  H HA   . MET A 1 133 ? 22.797  -4.621  -4.921  1.00 1.74  ? 647 MET A HA   4  
ATOM 8573  H HB2  . MET A 1 133 ? 23.769  -3.668  -3.056  1.00 2.01  ? 647 MET A HB2  4  
ATOM 8574  H HB3  . MET A 1 133 ? 23.847  -2.312  -4.189  1.00 2.32  ? 647 MET A HB3  4  
ATOM 8575  H HG2  . MET A 1 133 ? 21.563  -1.613  -3.245  1.00 2.21  ? 647 MET A HG2  4  
ATOM 8576  H HG3  . MET A 1 133 ? 21.814  -2.827  -1.996  1.00 1.94  ? 647 MET A HG3  4  
ATOM 8577  H HE1  . MET A 1 133 ? 20.950  0.032   -1.727  1.00 1.74  ? 647 MET A HE1  4  
ATOM 8578  H HE2  . MET A 1 133 ? 21.008  -1.256  -0.509  1.00 1.89  ? 647 MET A HE2  4  
ATOM 8579  H HE3  . MET A 1 133 ? 21.701  0.356   -0.134  1.00 2.38  ? 647 MET A HE3  4  
ATOM 8580  N N    . MET A 1 134 ? 19.908  -3.371  -4.016  1.00 1.63  ? 648 MET A N    4  
ATOM 8581  C CA   . MET A 1 134 ? 18.599  -3.564  -3.413  1.00 1.71  ? 648 MET A CA   4  
ATOM 8582  C C    . MET A 1 134 ? 17.712  -4.443  -4.306  1.00 1.69  ? 648 MET A C    4  
ATOM 8583  O O    . MET A 1 134 ? 16.802  -5.097  -3.806  1.00 1.65  ? 648 MET A O    4  
ATOM 8584  C CB   . MET A 1 134 ? 18.013  -2.175  -3.110  1.00 1.79  ? 648 MET A CB   4  
ATOM 8585  C CG   . MET A 1 134 ? 16.734  -2.156  -2.274  1.00 1.52  ? 648 MET A CG   4  
ATOM 8586  S SD   . MET A 1 134 ? 16.684  -3.111  -0.724  1.00 1.97  ? 648 MET A SD   4  
ATOM 8587  C CE   . MET A 1 134 ? 18.170  -2.527  0.138   1.00 2.69  ? 648 MET A CE   4  
ATOM 8588  H H    . MET A 1 134 ? 20.029  -2.533  -4.579  1.00 1.50  ? 648 MET A H    4  
ATOM 8589  H HA   . MET A 1 134 ? 18.743  -4.075  -2.468  1.00 1.81  ? 648 MET A HA   4  
ATOM 8590  H HB2  . MET A 1 134 ? 18.767  -1.591  -2.579  1.00 3.02  ? 648 MET A HB2  4  
ATOM 8591  H HB3  . MET A 1 134 ? 17.794  -1.663  -4.045  1.00 2.28  ? 648 MET A HB3  4  
ATOM 8592  H HG2  . MET A 1 134 ? 16.550  -1.110  -2.030  1.00 2.00  ? 648 MET A HG2  4  
ATOM 8593  H HG3  . MET A 1 134 ? 15.919  -2.502  -2.906  1.00 2.61  ? 648 MET A HG3  4  
ATOM 8594  H HE1  . MET A 1 134 ? 18.205  -2.963  1.137   1.00 3.58  ? 648 MET A HE1  4  
ATOM 8595  H HE2  . MET A 1 134 ? 19.059  -2.841  -0.409  1.00 3.58  ? 648 MET A HE2  4  
ATOM 8596  H HE3  . MET A 1 134 ? 18.155  -1.440  0.224   1.00 3.31  ? 648 MET A HE3  4  
ATOM 8597  N N    . ARG A 1 135 ? 18.037  -4.559  -5.605  1.00 1.77  ? 649 ARG A N    4  
ATOM 8598  C CA   . ARG A 1 135 ? 17.409  -5.516  -6.530  1.00 1.82  ? 649 ARG A CA   4  
ATOM 8599  C C    . ARG A 1 135 ? 17.739  -6.948  -6.117  1.00 1.91  ? 649 ARG A C    4  
ATOM 8600  O O    . ARG A 1 135 ? 16.815  -7.712  -5.856  1.00 2.01  ? 649 ARG A O    4  
ATOM 8601  C CB   . ARG A 1 135 ? 17.779  -5.167  -7.988  1.00 1.81  ? 649 ARG A CB   4  
ATOM 8602  C CG   . ARG A 1 135 ? 16.740  -5.628  -9.027  1.00 1.76  ? 649 ARG A CG   4  
ATOM 8603  C CD   . ARG A 1 135 ? 16.777  -7.119  -9.390  1.00 1.94  ? 649 ARG A CD   4  
ATOM 8604  N NE   . ARG A 1 135 ? 17.913  -7.439  -10.275 1.00 2.96  ? 649 ARG A NE   4  
ATOM 8605  C CZ   . ARG A 1 135 ? 17.969  -8.423  -11.155 1.00 3.59  ? 649 ARG A CZ   4  
ATOM 8606  N NH1  . ARG A 1 135 ? 17.066  -9.360  -11.234 1.00 3.67  ? 649 ARG A NH1  4  
ATOM 8607  N NH2  . ARG A 1 135 ? 18.961  -8.456  -11.992 1.00 4.84  ? 649 ARG A NH2  4  
ATOM 8608  H H    . ARG A 1 135 ? 18.795  -3.983  -5.950  1.00 1.85  ? 649 ARG A H    4  
ATOM 8609  H HA   . ARG A 1 135 ? 16.328  -5.419  -6.417  1.00 1.87  ? 649 ARG A HA   4  
ATOM 8610  H HB2  . ARG A 1 135 ? 17.832  -4.079  -8.070  1.00 2.05  ? 649 ARG A HB2  4  
ATOM 8611  H HB3  . ARG A 1 135 ? 18.765  -5.561  -8.240  1.00 1.93  ? 649 ARG A HB3  4  
ATOM 8612  H HG2  . ARG A 1 135 ? 15.744  -5.387  -8.655  1.00 2.19  ? 649 ARG A HG2  4  
ATOM 8613  H HG3  . ARG A 1 135 ? 16.885  -5.050  -9.942  1.00 2.05  ? 649 ARG A HG3  4  
ATOM 8614  H HD2  . ARG A 1 135 ? 16.820  -7.726  -8.489  1.00 2.51  ? 649 ARG A HD2  4  
ATOM 8615  H HD3  . ARG A 1 135 ? 15.844  -7.355  -9.908  1.00 2.04  ? 649 ARG A HD3  4  
ATOM 8616  H HE   . ARG A 1 135 ? 18.685  -6.786  -10.316 1.00 3.76  ? 649 ARG A HE   4  
ATOM 8617  H HH11 . ARG A 1 135 ? 16.305  -9.405  -10.561 1.00 3.41  ? 649 ARG A HH11 4  
ATOM 8618  H HH12 . ARG A 1 135 ? 17.125  -10.087 -11.935 1.00 4.50  ? 649 ARG A HH12 4  
ATOM 8619  H HH21 . ARG A 1 135 ? 19.680  -7.746  -11.944 1.00 5.45  ? 649 ARG A HH21 4  
ATOM 8620  H HH22 . ARG A 1 135 ? 18.991  -9.173  -12.707 1.00 5.43  ? 649 ARG A HH22 4  
ATOM 8621  N N    . ARG A 1 136 ? 19.018  -7.302  -5.924  1.00 1.91  ? 650 ARG A N    4  
ATOM 8622  C CA   . ARG A 1 136 ? 19.389  -8.629  -5.367  1.00 2.00  ? 650 ARG A CA   4  
ATOM 8623  C C    . ARG A 1 136 ? 18.855  -8.857  -3.947  1.00 2.04  ? 650 ARG A C    4  
ATOM 8624  O O    . ARG A 1 136 ? 18.359  -9.940  -3.645  1.00 2.13  ? 650 ARG A O    4  
ATOM 8625  C CB   . ARG A 1 136 ? 20.900  -8.906  -5.451  1.00 2.06  ? 650 ARG A CB   4  
ATOM 8626  C CG   . ARG A 1 136 ? 21.808  -7.930  -4.689  1.00 2.34  ? 650 ARG A CG   4  
ATOM 8627  C CD   . ARG A 1 136 ? 23.276  -8.367  -4.728  1.00 2.53  ? 650 ARG A CD   4  
ATOM 8628  N NE   . ARG A 1 136 ? 23.874  -8.157  -6.056  1.00 3.33  ? 650 ARG A NE   4  
ATOM 8629  C CZ   . ARG A 1 136 ? 24.664  -8.967  -6.733  1.00 4.55  ? 650 ARG A CZ   4  
ATOM 8630  N NH1  . ARG A 1 136 ? 24.865  -10.212 -6.420  1.00 5.16  ? 650 ARG A NH1  4  
ATOM 8631  N NH2  . ARG A 1 136 ? 25.278  -8.493  -7.777  1.00 5.91  ? 650 ARG A NH2  4  
ATOM 8632  H H    . ARG A 1 136 ? 19.731  -6.624  -6.162  1.00 1.87  ? 650 ARG A H    4  
ATOM 8633  H HA   . ARG A 1 136 ? 18.902  -9.393  -5.975  1.00 2.04  ? 650 ARG A HA   4  
ATOM 8634  H HB2  . ARG A 1 136 ? 21.059  -9.899  -5.031  1.00 2.71  ? 650 ARG A HB2  4  
ATOM 8635  H HB3  . ARG A 1 136 ? 21.193  -8.920  -6.500  1.00 2.38  ? 650 ARG A HB3  4  
ATOM 8636  H HG2  . ARG A 1 136 ? 21.720  -6.934  -5.121  1.00 2.95  ? 650 ARG A HG2  4  
ATOM 8637  H HG3  . ARG A 1 136 ? 21.503  -7.898  -3.644  1.00 3.19  ? 650 ARG A HG3  4  
ATOM 8638  H HD2  . ARG A 1 136 ? 23.832  -7.765  -4.006  1.00 3.12  ? 650 ARG A HD2  4  
ATOM 8639  H HD3  . ARG A 1 136 ? 23.355  -9.408  -4.413  1.00 2.97  ? 650 ARG A HD3  4  
ATOM 8640  H HE   . ARG A 1 136 ? 23.781  -7.232  -6.458  1.00 3.89  ? 650 ARG A HE   4  
ATOM 8641  H HH11 . ARG A 1 136 ? 24.335  -10.640 -5.665  1.00 4.78  ? 650 ARG A HH11 4  
ATOM 8642  H HH12 . ARG A 1 136 ? 25.500  -10.772 -6.972  1.00 6.42  ? 650 ARG A HH12 4  
ATOM 8643  H HH21 . ARG A 1 136 ? 25.101  -7.527  -8.020  1.00 6.16  ? 650 ARG A HH21 4  
ATOM 8644  H HH22 . ARG A 1 136 ? 25.985  -9.032  -8.262  1.00 7.02  ? 650 ARG A HH22 4  
ATOM 8645  N N    . ALA A 1 137 ? 18.848  -7.804  -3.129  1.00 1.99  ? 651 ALA A N    4  
ATOM 8646  C CA   . ALA A 1 137 ? 18.252  -7.799  -1.793  1.00 2.02  ? 651 ALA A CA   4  
ATOM 8647  C C    . ALA A 1 137 ? 16.727  -8.065  -1.811  1.00 2.01  ? 651 ALA A C    4  
ATOM 8648  O O    . ALA A 1 137 ? 16.169  -8.450  -0.781  1.00 2.09  ? 651 ALA A O    4  
ATOM 8649  C CB   . ALA A 1 137 ? 18.579  -6.475  -1.078  1.00 2.09  ? 651 ALA A CB   4  
ATOM 8650  H H    . ALA A 1 137 ? 19.316  -6.975  -3.446  1.00 1.93  ? 651 ALA A H    4  
ATOM 8651  H HA   . ALA A 1 137 ? 18.722  -8.615  -1.242  1.00 2.04  ? 651 ALA A HA   4  
ATOM 8652  H HB1  . ALA A 1 137 ? 17.941  -5.681  -1.455  1.00 2.04  ? 651 ALA A HB1  4  
ATOM 8653  H HB2  . ALA A 1 137 ? 18.382  -6.571  -0.012  1.00 2.45  ? 651 ALA A HB2  4  
ATOM 8654  H HB3  . ALA A 1 137 ? 19.625  -6.188  -1.205  1.00 3.07  ? 651 ALA A HB3  4  
ATOM 8655  N N    . PHE A 1 138 ? 16.065  -7.883  -2.963  1.00 1.97  ? 652 PHE A N    4  
ATOM 8656  C CA   . PHE A 1 138 ? 14.690  -8.305  -3.246  1.00 1.98  ? 652 PHE A CA   4  
ATOM 8657  C C    . PHE A 1 138 ? 14.597  -9.719  -3.850  1.00 2.14  ? 652 PHE A C    4  
ATOM 8658  O O    . PHE A 1 138 ? 13.764  -10.506 -3.409  1.00 2.38  ? 652 PHE A O    4  
ATOM 8659  C CB   . PHE A 1 138 ? 13.997  -7.271  -4.153  1.00 1.90  ? 652 PHE A CB   4  
ATOM 8660  C CG   . PHE A 1 138 ? 12.948  -6.462  -3.424  1.00 1.47  ? 652 PHE A CG   4  
ATOM 8661  C CD1  . PHE A 1 138 ? 11.622  -6.932  -3.366  1.00 2.16  ? 652 PHE A CD1  4  
ATOM 8662  C CD2  . PHE A 1 138 ? 13.299  -5.266  -2.773  1.00 2.41  ? 652 PHE A CD2  4  
ATOM 8663  C CE1  . PHE A 1 138 ? 10.650  -6.209  -2.652  1.00 2.37  ? 652 PHE A CE1  4  
ATOM 8664  C CE2  . PHE A 1 138 ? 12.326  -4.541  -2.062  1.00 2.07  ? 652 PHE A CE2  4  
ATOM 8665  C CZ   . PHE A 1 138 ? 11.004  -5.018  -1.994  1.00 1.25  ? 652 PHE A CZ   4  
ATOM 8666  H H    . PHE A 1 138 ? 16.564  -7.444  -3.725  1.00 1.96  ? 652 PHE A H    4  
ATOM 8667  H HA   . PHE A 1 138 ? 14.145  -8.335  -2.301  1.00 2.00  ? 652 PHE A HA   4  
ATOM 8668  H HB2  . PHE A 1 138 ? 14.729  -6.592  -4.591  1.00 2.08  ? 652 PHE A HB2  4  
ATOM 8669  H HB3  . PHE A 1 138 ? 13.513  -7.783  -4.987  1.00 2.11  ? 652 PHE A HB3  4  
ATOM 8670  H HD1  . PHE A 1 138 ? 11.360  -7.852  -3.871  1.00 3.32  ? 652 PHE A HD1  4  
ATOM 8671  H HD2  . PHE A 1 138 ? 14.321  -4.913  -2.816  1.00 3.84  ? 652 PHE A HD2  4  
ATOM 8672  H HE1  . PHE A 1 138 ? 9.633   -6.571  -2.607  1.00 3.80  ? 652 PHE A HE1  4  
ATOM 8673  H HE2  . PHE A 1 138 ? 12.596  -3.620  -1.563  1.00 3.22  ? 652 PHE A HE2  4  
ATOM 8674  H HZ   . PHE A 1 138 ? 10.256  -4.462  -1.446  1.00 1.40  ? 652 PHE A HZ   4  
ATOM 8675  N N    . GLU A 1 139 ? 15.459  -10.100 -4.798  1.00 2.09  ? 653 GLU A N    4  
ATOM 8676  C CA   . GLU A 1 139 ? 15.428  -11.431 -5.449  1.00 2.23  ? 653 GLU A CA   4  
ATOM 8677  C C    . GLU A 1 139 ? 15.553  -12.612 -4.468  1.00 2.28  ? 653 GLU A C    4  
ATOM 8678  O O    . GLU A 1 139 ? 15.071  -13.714 -4.757  1.00 2.35  ? 653 GLU A O    4  
ATOM 8679  C CB   . GLU A 1 139 ? 16.577  -11.560 -6.466  1.00 2.52  ? 653 GLU A CB   4  
ATOM 8680  C CG   . GLU A 1 139 ? 16.468  -10.616 -7.669  1.00 2.00  ? 653 GLU A CG   4  
ATOM 8681  C CD   . GLU A 1 139 ? 15.284  -10.905 -8.596  1.00 2.22  ? 653 GLU A CD   4  
ATOM 8682  O OE1  . GLU A 1 139 ? 14.605  -11.955 -8.464  1.00 3.08  ? 653 GLU A OE1  4  
ATOM 8683  O OE2  . GLU A 1 139 ? 15.004  -10.043 -9.464  1.00 2.65  ? 653 GLU A OE2  4  
ATOM 8684  H H    . GLU A 1 139 ? 16.108  -9.404  -5.153  1.00 1.94  ? 653 GLU A H    4  
ATOM 8685  H HA   . GLU A 1 139 ? 14.473  -11.545 -5.965  1.00 2.20  ? 653 GLU A HA   4  
ATOM 8686  H HB2  . GLU A 1 139 ? 17.519  -11.362 -5.955  1.00 3.06  ? 653 GLU A HB2  4  
ATOM 8687  H HB3  . GLU A 1 139 ? 16.619  -12.585 -6.837  1.00 3.08  ? 653 GLU A HB3  4  
ATOM 8688  H HG2  . GLU A 1 139 ? 16.384  -9.596  -7.299  1.00 1.94  ? 653 GLU A HG2  4  
ATOM 8689  H HG3  . GLU A 1 139 ? 17.391  -10.687 -8.247  1.00 2.06  ? 653 GLU A HG3  4  
ATOM 8690  N N    . THR A 1 140 ? 16.189  -12.364 -3.320  1.00 2.30  ? 654 THR A N    4  
ATOM 8691  C CA   . THR A 1 140 ? 16.490  -13.323 -2.242  1.00 2.50  ? 654 THR A CA   4  
ATOM 8692  C C    . THR A 1 140 ? 15.356  -13.479 -1.212  1.00 2.61  ? 654 THR A C    4  
ATOM 8693  O O    . THR A 1 140 ? 15.234  -14.491 -0.521  1.00 3.02  ? 654 THR A O    4  
ATOM 8694  C CB   . THR A 1 140 ? 17.815  -12.890 -1.602  1.00 2.46  ? 654 THR A CB   4  
ATOM 8695  O OG1  . THR A 1 140 ? 18.307  -13.913 -0.788  1.00 2.75  ? 654 THR A OG1  4  
ATOM 8696  C CG2  . THR A 1 140 ? 17.703  -11.615 -0.770  1.00 2.26  ? 654 THR A CG2  4  
ATOM 8697  H H    . THR A 1 140 ? 16.555  -11.424 -3.213  1.00 2.23  ? 654 THR A H    4  
ATOM 8698  H HA   . THR A 1 140 ? 16.664  -14.301 -2.676  1.00 2.69  ? 654 THR A HA   4  
ATOM 8699  H HB   . THR A 1 140 ? 18.527  -12.711 -2.404  1.00 2.44  ? 654 THR A HB   4  
ATOM 8700  H HG1  . THR A 1 140 ? 19.243  -13.732 -0.595  1.00 3.08  ? 654 THR A HG1  4  
ATOM 8701  H HG21 . THR A 1 140 ? 17.251  -10.828 -1.370  1.00 2.11  ? 654 THR A HG21 4  
ATOM 8702  H HG22 . THR A 1 140 ? 18.697  -11.290 -0.469  1.00 2.99  ? 654 THR A HG22 4  
ATOM 8703  H HG23 . THR A 1 140 ? 17.088  -11.799 0.109   1.00 2.85  ? 654 THR A HG23 4  
ATOM 8704  N N    . VAL A 1 141 ? 14.470  -12.483 -1.146  1.00 2.36  ? 655 VAL A N    4  
ATOM 8705  C CA   . VAL A 1 141 ? 13.289  -12.439 -0.259  1.00 2.54  ? 655 VAL A CA   4  
ATOM 8706  C C    . VAL A 1 141 ? 11.980  -12.701 -1.008  1.00 2.73  ? 655 VAL A C    4  
ATOM 8707  O O    . VAL A 1 141 ? 11.049  -13.293 -0.461  1.00 3.04  ? 655 VAL A O    4  
ATOM 8708  C CB   . VAL A 1 141 ? 13.269  -11.109 0.511   1.00 2.58  ? 655 VAL A CB   4  
ATOM 8709  C CG1  . VAL A 1 141 ? 13.195  -9.885  -0.383  1.00 2.51  ? 655 VAL A CG1  4  
ATOM 8710  C CG2  . VAL A 1 141 ? 12.155  -11.056 1.556   1.00 2.89  ? 655 VAL A CG2  4  
ATOM 8711  H H    . VAL A 1 141 ? 14.634  -11.701 -1.767  1.00 2.10  ? 655 VAL A H    4  
ATOM 8712  H HA   . VAL A 1 141 ? 13.381  -13.228 0.483   1.00 2.64  ? 655 VAL A HA   4  
ATOM 8713  H HB   . VAL A 1 141 ? 14.228  -11.021 1.002   1.00 2.53  ? 655 VAL A HB   4  
ATOM 8714  H HG11 . VAL A 1 141 ? 12.305  -9.902  -1.009  1.00 2.20  ? 655 VAL A HG11 4  
ATOM 8715  H HG12 . VAL A 1 141 ? 13.200  -8.980  0.223   1.00 3.49  ? 655 VAL A HG12 4  
ATOM 8716  H HG13 . VAL A 1 141 ? 14.097  -9.897  -0.989  1.00 2.97  ? 655 VAL A HG13 4  
ATOM 8717  H HG21 . VAL A 1 141 ? 11.187  -10.975 1.059   1.00 2.87  ? 655 VAL A HG21 4  
ATOM 8718  H HG22 . VAL A 1 141 ? 12.174  -11.955 2.171   1.00 3.33  ? 655 VAL A HG22 4  
ATOM 8719  H HG23 . VAL A 1 141 ? 12.295  -10.185 2.198   1.00 3.64  ? 655 VAL A HG23 4  
ATOM 8720  N N    . ALA A 1 142 ? 11.932  -12.343 -2.290  1.00 2.63  ? 656 ALA A N    4  
ATOM 8721  C CA   . ALA A 1 142 ? 10.809  -12.613 -3.188  1.00 2.83  ? 656 ALA A CA   4  
ATOM 8722  C C    . ALA A 1 142 ? 10.442  -14.106 -3.230  1.00 3.13  ? 656 ALA A C    4  
ATOM 8723  O O    . ALA A 1 142 ? 9.261   -14.436 -3.214  1.00 3.57  ? 656 ALA A O    4  
ATOM 8724  C CB   . ALA A 1 142 ? 11.155  -12.081 -4.583  1.00 2.67  ? 656 ALA A CB   4  
ATOM 8725  H H    . ALA A 1 142 ? 12.708  -11.789 -2.638  1.00 2.46  ? 656 ALA A H    4  
ATOM 8726  H HA   . ALA A 1 142 ? 9.934   -12.074 -2.819  1.00 3.01  ? 656 ALA A HA   4  
ATOM 8727  H HB1  . ALA A 1 142 ? 12.056  -12.567 -4.962  1.00 3.03  ? 656 ALA A HB1  4  
ATOM 8728  H HB2  . ALA A 1 142 ? 10.331  -12.283 -5.270  1.00 2.61  ? 656 ALA A HB2  4  
ATOM 8729  H HB3  . ALA A 1 142 ? 11.320  -11.003 -4.544  1.00 3.33  ? 656 ALA A HB3  4  
ATOM 8730  N N    . ILE A 1 143 ? 11.426  -15.014 -3.158  1.00 3.03  ? 657 ILE A N    4  
ATOM 8731  C CA   . ILE A 1 143 ? 11.185  -16.468 -3.117  1.00 3.38  ? 657 ILE A CA   4  
ATOM 8732  C C    . ILE A 1 143 ? 10.471  -16.968 -1.842  1.00 3.68  ? 657 ILE A C    4  
ATOM 8733  O O    . ILE A 1 143 ? 10.035  -18.118 -1.808  1.00 4.00  ? 657 ILE A O    4  
ATOM 8734  C CB   . ILE A 1 143 ? 12.469  -17.263 -3.464  1.00 3.55  ? 657 ILE A CB   4  
ATOM 8735  C CG1  . ILE A 1 143 ? 13.719  -16.956 -2.610  1.00 4.63  ? 657 ILE A CG1  4  
ATOM 8736  C CG2  . ILE A 1 143 ? 12.840  -17.019 -4.938  1.00 3.16  ? 657 ILE A CG2  4  
ATOM 8737  C CD1  . ILE A 1 143 ? 13.559  -17.280 -1.125  1.00 6.24  ? 657 ILE A CD1  4  
ATOM 8738  H H    . ILE A 1 143 ? 12.380  -14.687 -3.168  1.00 2.75  ? 657 ILE A H    4  
ATOM 8739  H HA   . ILE A 1 143 ? 10.474  -16.686 -3.914  1.00 3.51  ? 657 ILE A HA   4  
ATOM 8740  H HB   . ILE A 1 143 ? 12.245  -18.326 -3.363  1.00 4.25  ? 657 ILE A HB   4  
ATOM 8741  H HG12 . ILE A 1 143 ? 14.546  -17.559 -2.987  1.00 4.31  ? 657 ILE A HG12 4  
ATOM 8742  H HG13 . ILE A 1 143 ? 14.000  -15.908 -2.716  1.00 5.42  ? 657 ILE A HG13 4  
ATOM 8743  H HG21 . ILE A 1 143 ? 13.120  -15.979 -5.097  1.00 3.43  ? 657 ILE A HG21 4  
ATOM 8744  H HG22 . ILE A 1 143 ? 13.680  -17.656 -5.219  1.00 3.20  ? 657 ILE A HG22 4  
ATOM 8745  H HG23 . ILE A 1 143 ? 11.995  -17.266 -5.581  1.00 4.04  ? 657 ILE A HG23 4  
ATOM 8746  H HD11 . ILE A 1 143 ? 14.542  -17.275 -0.659  1.00 6.82  ? 657 ILE A HD11 4  
ATOM 8747  H HD12 . ILE A 1 143 ? 12.940  -16.527 -0.639  1.00 7.17  ? 657 ILE A HD12 4  
ATOM 8748  H HD13 . ILE A 1 143 ? 13.114  -18.267 -1.000  1.00 6.60  ? 657 ILE A HD13 4  
ATOM 8749  N N    . ASP A 1 144 ? 10.287  -16.114 -0.826  1.00 3.74  ? 658 ASP A N    4  
ATOM 8750  C CA   . ASP A 1 144 ? 9.356   -16.326 0.293   1.00 4.42  ? 658 ASP A CA   4  
ATOM 8751  C C    . ASP A 1 144 ? 8.074   -15.482 0.160   1.00 4.61  ? 658 ASP A C    4  
ATOM 8752  O O    . ASP A 1 144 ? 6.998   -15.969 0.498   1.00 5.34  ? 658 ASP A O    4  
ATOM 8753  C CB   . ASP A 1 144 ? 10.052  -16.004 1.625   1.00 4.74  ? 658 ASP A CB   4  
ATOM 8754  C CG   . ASP A 1 144 ? 9.070   -16.101 2.795   1.00 6.03  ? 658 ASP A CG   4  
ATOM 8755  O OD1  . ASP A 1 144 ? 8.806   -17.208 3.317   1.00 6.32  ? 658 ASP A OD1  4  
ATOM 8756  O OD2  . ASP A 1 144 ? 8.517   -15.059 3.204   1.00 7.22  ? 658 ASP A OD2  4  
ATOM 8757  H H    . ASP A 1 144 ? 10.718  -15.202 -0.900  1.00 3.52  ? 658 ASP A H    4  
ATOM 8758  H HA   . ASP A 1 144 ? 9.052   -17.374 0.325   1.00 4.88  ? 658 ASP A HA   4  
ATOM 8759  H HB2  . ASP A 1 144 ? 10.881  -16.691 1.783   1.00 4.85  ? 658 ASP A HB2  4  
ATOM 8760  H HB3  . ASP A 1 144 ? 10.459  -14.993 1.588   1.00 4.29  ? 658 ASP A HB3  4  
ATOM 8761  N N    . ARG A 1 145 ? 8.174   -14.232 -0.315  1.00 4.18  ? 659 ARG A N    4  
ATOM 8762  C CA   . ARG A 1 145 ? 7.068   -13.250 -0.390  1.00 4.64  ? 659 ARG A CA   4  
ATOM 8763  C C    . ARG A 1 145 ? 6.125   -13.437 -1.596  1.00 5.25  ? 659 ARG A C    4  
ATOM 8764  O O    . ARG A 1 145 ? 5.061   -12.827 -1.631  1.00 6.00  ? 659 ARG A O    4  
ATOM 8765  C CB   . ARG A 1 145 ? 7.658   -11.819 -0.344  1.00 4.24  ? 659 ARG A CB   4  
ATOM 8766  C CG   . ARG A 1 145 ? 7.848   -11.206 1.059   1.00 4.62  ? 659 ARG A CG   4  
ATOM 8767  C CD   . ARG A 1 145 ? 8.653   -12.079 2.030   1.00 4.07  ? 659 ARG A CD   4  
ATOM 8768  N NE   . ARG A 1 145 ? 9.254   -11.292 3.129   1.00 5.51  ? 659 ARG A NE   4  
ATOM 8769  C CZ   . ARG A 1 145 ? 9.923   -11.774 4.160   1.00 6.82  ? 659 ARG A CZ   4  
ATOM 8770  N NH1  . ARG A 1 145 ? 9.975   -13.043 4.431   1.00 7.11  ? 659 ARG A NH1  4  
ATOM 8771  N NH2  . ARG A 1 145 ? 10.596  -10.990 4.949   1.00 8.40  ? 659 ARG A NH2  4  
ATOM 8772  H H    . ARG A 1 145 ? 9.107   -13.915 -0.560  1.00 3.64  ? 659 ARG A H    4  
ATOM 8773  H HA   . ARG A 1 145 ? 6.420   -13.381 0.480   1.00 5.09  ? 659 ARG A HA   4  
ATOM 8774  H HB2  . ARG A 1 145 ? 8.624   -11.806 -0.853  1.00 4.04  ? 659 ARG A HB2  4  
ATOM 8775  H HB3  . ARG A 1 145 ? 6.998   -11.145 -0.892  1.00 4.87  ? 659 ARG A HB3  4  
ATOM 8776  H HG2  . ARG A 1 145 ? 8.360   -10.251 0.934   1.00 5.87  ? 659 ARG A HG2  4  
ATOM 8777  H HG3  . ARG A 1 145 ? 6.870   -11.007 1.499   1.00 5.27  ? 659 ARG A HG3  4  
ATOM 8778  H HD2  . ARG A 1 145 ? 7.983   -12.834 2.437   1.00 3.98  ? 659 ARG A HD2  4  
ATOM 8779  H HD3  . ARG A 1 145 ? 9.454   -12.577 1.482   1.00 4.09  ? 659 ARG A HD3  4  
ATOM 8780  H HE   . ARG A 1 145 ? 9.203   -10.281 3.077   1.00 6.01  ? 659 ARG A HE   4  
ATOM 8781  H HH11 . ARG A 1 145 ? 9.347   -13.673 3.927   1.00 6.28  ? 659 ARG A HH11 4  
ATOM 8782  H HH12 . ARG A 1 145 ? 10.358  -13.339 5.313   1.00 8.44  ? 659 ARG A HH12 4  
ATOM 8783  H HH21 . ARG A 1 145 ? 10.629  -9.983  4.814   1.00 8.69  ? 659 ARG A HH21 4  
ATOM 8784  H HH22 . ARG A 1 145 ? 11.193  -11.405 5.658   1.00 9.59  ? 659 ARG A HH22 4  
ATOM 8785  N N    . LEU A 1 146 ? 6.497   -14.241 -2.594  1.00 5.09  ? 660 LEU A N    4  
ATOM 8786  C CA   . LEU A 1 146 ? 5.728   -14.485 -3.830  1.00 5.75  ? 660 LEU A CA   4  
ATOM 8787  C C    . LEU A 1 146 ? 4.956   -15.821 -3.832  1.00 6.22  ? 660 LEU A C    4  
ATOM 8788  O O    . LEU A 1 146 ? 3.976   -15.971 -4.561  1.00 6.89  ? 660 LEU A O    4  
ATOM 8789  C CB   . LEU A 1 146 ? 6.721   -14.343 -5.002  1.00 5.91  ? 660 LEU A CB   4  
ATOM 8790  C CG   . LEU A 1 146 ? 6.109   -14.353 -6.416  1.00 6.37  ? 660 LEU A CG   4  
ATOM 8791  C CD1  . LEU A 1 146 ? 6.920   -13.433 -7.327  1.00 7.11  ? 660 LEU A CD1  4  
ATOM 8792  C CD2  . LEU A 1 146 ? 6.143   -15.743 -7.048  1.00 6.03  ? 660 LEU A CD2  4  
ATOM 8793  H H    . LEU A 1 146 ? 7.440   -14.612 -2.554  1.00 4.58  ? 660 LEU A H    4  
ATOM 8794  H HA   . LEU A 1 146 ? 4.977   -13.700 -3.938  1.00 6.04  ? 660 LEU A HA   4  
ATOM 8795  H HB2  . LEU A 1 146 ? 7.241   -13.394 -4.863  1.00 6.22  ? 660 LEU A HB2  4  
ATOM 8796  H HB3  . LEU A 1 146 ? 7.470   -15.133 -4.938  1.00 5.78  ? 660 LEU A HB3  4  
ATOM 8797  H HG   . LEU A 1 146 ? 5.083   -13.988 -6.379  1.00 7.10  ? 660 LEU A HG   4  
ATOM 8798  H HD11 . LEU A 1 146 ? 6.863   -12.411 -6.961  1.00 7.91  ? 660 LEU A HD11 4  
ATOM 8799  H HD12 . LEU A 1 146 ? 6.526   -13.462 -8.341  1.00 7.60  ? 660 LEU A HD12 4  
ATOM 8800  H HD13 . LEU A 1 146 ? 7.963   -13.748 -7.347  1.00 6.98  ? 660 LEU A HD13 4  
ATOM 8801  H HD21 . LEU A 1 146 ? 5.665   -15.698 -8.023  1.00 6.74  ? 660 LEU A HD21 4  
ATOM 8802  H HD22 . LEU A 1 146 ? 5.610   -16.462 -6.433  1.00 5.73  ? 660 LEU A HD22 4  
ATOM 8803  H HD23 . LEU A 1 146 ? 7.174   -16.078 -7.172  1.00 6.19  ? 660 LEU A HD23 4  
ATOM 8804  N N    . ASP A 1 147 ? 5.371   -16.784 -3.006  1.00 6.07  ? 661 ASP A N    4  
ATOM 8805  C CA   . ASP A 1 147 ? 4.824   -18.149 -2.936  1.00 6.68  ? 661 ASP A CA   4  
ATOM 8806  C C    . ASP A 1 147 ? 4.702   -18.612 -1.459  1.00 6.73  ? 661 ASP A C    4  
ATOM 8807  O O    . ASP A 1 147 ? 5.029   -17.856 -0.540  1.00 6.97  ? 661 ASP A O    4  
ATOM 8808  C CB   . ASP A 1 147 ? 5.685   -19.060 -3.839  1.00 7.04  ? 661 ASP A CB   4  
ATOM 8809  C CG   . ASP A 1 147 ? 4.909   -20.222 -4.476  1.00 8.04  ? 661 ASP A CG   4  
ATOM 8810  O OD1  . ASP A 1 147 ? 4.207   -20.961 -3.748  1.00 8.12  ? 661 ASP A OD1  4  
ATOM 8811  O OD2  . ASP A 1 147 ? 4.973   -20.387 -5.720  1.00 9.15  ? 661 ASP A OD2  4  
ATOM 8812  H H    . ASP A 1 147 ? 6.122   -16.566 -2.367  1.00 5.64  ? 661 ASP A H    4  
ATOM 8813  H HA   . ASP A 1 147 ? 3.817   -18.141 -3.351  1.00 7.54  ? 661 ASP A HA   4  
ATOM 8814  H HB2  . ASP A 1 147 ? 6.087   -18.458 -4.656  1.00 7.40  ? 661 ASP A HB2  4  
ATOM 8815  H HB3  . ASP A 1 147 ? 6.533   -19.434 -3.272  1.00 6.83  ? 661 ASP A HB3  4  
ATOM 8816  N N    . ARG A 1 148 ? 4.142   -19.802 -1.203  1.00 7.15  ? 662 ARG A N    4  
ATOM 8817  C CA   . ARG A 1 148 ? 3.547   -20.189 0.094   1.00 8.04  ? 662 ARG A CA   4  
ATOM 8818  C C    . ARG A 1 148 ? 4.445   -20.903 1.124   1.00 8.08  ? 662 ARG A C    4  
ATOM 8819  O O    . ARG A 1 148 ? 4.001   -21.127 2.247   1.00 9.04  ? 662 ARG A O    4  
ATOM 8820  C CB   . ARG A 1 148 ? 2.251   -20.968 -0.204  1.00 9.11  ? 662 ARG A CB   4  
ATOM 8821  C CG   . ARG A 1 148 ? 2.472   -22.371 -0.805  1.00 9.07  ? 662 ARG A CG   4  
ATOM 8822  C CD   . ARG A 1 148 ? 1.169   -22.999 -1.322  1.00 10.29 ? 662 ARG A CD   4  
ATOM 8823  N NE   . ARG A 1 148 ? 0.175   -23.177 -0.247  1.00 11.03 ? 662 ARG A NE   4  
ATOM 8824  C CZ   . ARG A 1 148 ? -0.305  -24.301 0.252   1.00 11.62 ? 662 ARG A CZ   4  
ATOM 8825  N NH1  . ARG A 1 148 ? 0.007   -25.475 -0.210  1.00 11.64 ? 662 ARG A NH1  4  
ATOM 8826  N NH2  . ARG A 1 148 ? -1.131  -24.262 1.259   1.00 12.58 ? 662 ARG A NH2  4  
ATOM 8827  H H    . ARG A 1 148 ? 3.925   -20.393 -2.002  1.00 7.28  ? 662 ARG A H    4  
ATOM 8828  H HA   . ARG A 1 148 ? 3.246   -19.271 0.602   1.00 8.54  ? 662 ARG A HA   4  
ATOM 8829  H HB2  . ARG A 1 148 ? 1.695   -21.068 0.724   1.00 9.42  ? 662 ARG A HB2  4  
ATOM 8830  H HB3  . ARG A 1 148 ? 1.638   -20.377 -0.889  1.00 10.10 ? 662 ARG A HB3  4  
ATOM 8831  H HG2  . ARG A 1 148 ? 3.166   -22.305 -1.643  1.00 8.98  ? 662 ARG A HG2  4  
ATOM 8832  H HG3  . ARG A 1 148 ? 2.910   -23.026 -0.051  1.00 8.79  ? 662 ARG A HG3  4  
ATOM 8833  H HD2  . ARG A 1 148 ? 0.744   -22.353 -2.094  1.00 10.83 ? 662 ARG A HD2  4  
ATOM 8834  H HD3  . ARG A 1 148 ? 1.411   -23.953 -1.788  1.00 10.52 ? 662 ARG A HD3  4  
ATOM 8835  H HE   . ARG A 1 148 ? -0.206  -22.327 0.161   1.00 11.44 ? 662 ARG A HE   4  
ATOM 8836  H HH11 . ARG A 1 148 ? 0.574   -25.579 -1.048  1.00 11.28 ? 662 ARG A HH11 4  
ATOM 8837  H HH12 . ARG A 1 148 ? -0.297  -26.300 0.288   1.00 12.29 ? 662 ARG A HH12 4  
ATOM 8838  H HH21 . ARG A 1 148 ? -1.401  -23.373 1.658   1.00 12.91 ? 662 ARG A HH21 4  
ATOM 8839  H HH22 . ARG A 1 148 ? -1.549  -25.108 1.626   1.00 13.24 ? 662 ARG A HH22 4  
ATOM 8840  N N    . ILE A 1 149 ? 5.661   -21.321 0.763   1.00 7.59  ? 663 ILE A N    4  
ATOM 8841  C CA   . ILE A 1 149 ? 6.406   -22.390 1.446   1.00 8.20  ? 663 ILE A CA   4  
ATOM 8842  C C    . ILE A 1 149 ? 6.907   -22.088 2.881   1.00 9.43  ? 663 ILE A C    4  
ATOM 8843  O O    . ILE A 1 149 ? 6.889   -22.986 3.729   1.00 9.93  ? 663 ILE A O    4  
ATOM 8844  C CB   . ILE A 1 149 ? 7.568   -22.855 0.530   1.00 8.22  ? 663 ILE A CB   4  
ATOM 8845  C CG1  . ILE A 1 149 ? 7.234   -22.793 -0.975  1.00 7.57  ? 663 ILE A CG1  4  
ATOM 8846  C CG2  . ILE A 1 149 ? 7.854   -24.332 0.817   1.00 9.15  ? 663 ILE A CG2  4  
ATOM 8847  C CD1  . ILE A 1 149 ? 7.580   -21.481 -1.694  1.00 7.98  ? 663 ILE A CD1  4  
ATOM 8848  H H    . ILE A 1 149 ? 5.937   -21.181 -0.201  1.00 7.08  ? 663 ILE A H    4  
ATOM 8849  H HA   . ILE A 1 149 ? 5.715   -23.230 1.532   1.00 8.39  ? 663 ILE A HA   4  
ATOM 8850  H HB   . ILE A 1 149 ? 8.463   -22.266 0.720   1.00 8.68  ? 663 ILE A HB   4  
ATOM 8851  H HG12 . ILE A 1 149 ? 7.792   -23.546 -1.496  1.00 7.53  ? 663 ILE A HG12 4  
ATOM 8852  H HG13 . ILE A 1 149 ? 6.193   -23.075 -1.103  1.00 7.63  ? 663 ILE A HG13 4  
ATOM 8853  H HG21 . ILE A 1 149 ? 8.086   -24.485 1.870   1.00 9.50  ? 663 ILE A HG21 4  
ATOM 8854  H HG22 . ILE A 1 149 ? 6.974   -24.912 0.531   1.00 9.38  ? 663 ILE A HG22 4  
ATOM 8855  H HG23 . ILE A 1 149 ? 8.700   -24.676 0.221   1.00 9.71  ? 663 ILE A HG23 4  
ATOM 8856  H HD11 . ILE A 1 149 ? 8.658   -21.328 -1.665  1.00 8.34  ? 663 ILE A HD11 4  
ATOM 8857  H HD12 . ILE A 1 149 ? 7.274   -21.565 -2.737  1.00 8.52  ? 663 ILE A HD12 4  
ATOM 8858  H HD13 . ILE A 1 149 ? 7.094   -20.619 -1.244  1.00 8.01  ? 663 ILE A HD13 4  
ATOM 8859  N N    . GLY A 1 150 ? 7.336   -20.854 3.176   1.00 10.36 ? 664 GLY A N    4  
ATOM 8860  C CA   . GLY A 1 150 ? 7.931   -20.447 4.469   1.00 11.91 ? 664 GLY A CA   4  
ATOM 8861  C C    . GLY A 1 150 ? 9.468   -20.552 4.571   1.00 12.86 ? 664 GLY A C    4  
ATOM 8862  O O    . GLY A 1 150 ? 10.014  -20.593 5.681   1.00 14.03 ? 664 GLY A O    4  
ATOM 8863  H H    . GLY A 1 150 ? 7.171   -20.122 2.491   1.00 10.22 ? 664 GLY A H    4  
ATOM 8864  H HA2  . GLY A 1 150 ? 7.666   -19.404 4.647   1.00 12.43 ? 664 GLY A HA2  4  
ATOM 8865  H HA3  . GLY A 1 150 ? 7.498   -21.038 5.275   1.00 12.29 ? 664 GLY A HA3  4  
ATOM 8866  N N    . LYS A 1 151 ? 10.166  -20.624 3.428   1.00 12.67 ? 665 LYS A N    4  
ATOM 8867  C CA   . LYS A 1 151 ? 11.630  -20.802 3.288   1.00 13.80 ? 665 LYS A CA   4  
ATOM 8868  C C    . LYS A 1 151 ? 12.257  -19.580 2.595   1.00 15.02 ? 665 LYS A C    4  
ATOM 8869  O O    . LYS A 1 151 ? 11.695  -19.107 1.607   1.00 15.14 ? 665 LYS A O    4  
ATOM 8870  C CB   . LYS A 1 151 ? 11.921  -22.084 2.494   1.00 13.24 ? 665 LYS A CB   4  
ATOM 8871  C CG   . LYS A 1 151 ? 11.393  -23.390 3.121   1.00 12.53 ? 665 LYS A CG   4  
ATOM 8872  C CD   . LYS A 1 151 ? 11.336  -24.544 2.103   1.00 12.09 ? 665 LYS A CD   4  
ATOM 8873  C CE   . LYS A 1 151 ? 12.714  -25.024 1.632   1.00 13.24 ? 665 LYS A CE   4  
ATOM 8874  N NZ   . LYS A 1 151 ? 12.596  -26.020 0.539   1.00 13.33 ? 665 LYS A NZ   4  
ATOM 8875  H H    . LYS A 1 151 ? 9.639   -20.516 2.574   1.00 11.88 ? 665 LYS A H    4  
ATOM 8876  H HA   . LYS A 1 151 ? 12.089  -20.919 4.260   1.00 14.56 ? 665 LYS A HA   4  
ATOM 8877  H HB2  . LYS A 1 151 ? 11.452  -21.948 1.531   1.00 13.10 ? 665 LYS A HB2  4  
ATOM 8878  H HB3  . LYS A 1 151 ? 12.998  -22.175 2.339   1.00 13.94 ? 665 LYS A HB3  4  
ATOM 8879  H HG2  . LYS A 1 151 ? 12.023  -23.671 3.965   1.00 13.00 ? 665 LYS A HG2  4  
ATOM 8880  H HG3  . LYS A 1 151 ? 10.379  -23.236 3.489   1.00 12.32 ? 665 LYS A HG3  4  
ATOM 8881  H HD2  . LYS A 1 151 ? 10.813  -25.384 2.561   1.00 12.00 ? 665 LYS A HD2  4  
ATOM 8882  H HD3  . LYS A 1 151 ? 10.757  -24.217 1.240   1.00 11.45 ? 665 LYS A HD3  4  
ATOM 8883  H HE2  . LYS A 1 151 ? 13.300  -24.170 1.282   1.00 13.56 ? 665 LYS A HE2  4  
ATOM 8884  H HE3  . LYS A 1 151 ? 13.231  -25.472 2.485   1.00 14.09 ? 665 LYS A HE3  4  
ATOM 8885  H HZ1  . LYS A 1 151 ? 11.792  -26.635 0.664   1.00 13.29 ? 665 LYS A HZ1  4  
ATOM 8886  H HZ2  . LYS A 1 151 ? 13.415  -26.621 0.508   1.00 13.86 ? 665 LYS A HZ2  4  
ATOM 8887  H HZ3  . LYS A 1 151 ? 12.474  -25.575 -0.369  1.00 13.27 ? 665 LYS A HZ3  4  
ATOM 8888  N N    . LYS A 1 152 ? 13.412  -19.086 3.066   1.00 16.14 ? 666 LYS A N    4  
ATOM 8889  C CA   . LYS A 1 152 ? 14.031  -17.815 2.609   1.00 17.57 ? 666 LYS A CA   4  
ATOM 8890  C C    . LYS A 1 152 ? 15.551  -17.926 2.360   1.00 18.64 ? 666 LYS A C    4  
ATOM 8891  O O    . LYS A 1 152 ? 16.218  -18.780 2.949   1.00 18.97 ? 666 LYS A O    4  
ATOM 8892  C CB   . LYS A 1 152 ? 13.658  -16.706 3.621   1.00 18.37 ? 666 LYS A CB   4  
ATOM 8893  C CG   . LYS A 1 152 ? 14.195  -15.321 3.225   1.00 19.35 ? 666 LYS A CG   4  
ATOM 8894  C CD   . LYS A 1 152 ? 13.809  -14.188 4.181   1.00 20.12 ? 666 LYS A CD   4  
ATOM 8895  C CE   . LYS A 1 152 ? 14.591  -12.905 3.841   1.00 21.52 ? 666 LYS A CE   4  
ATOM 8896  N NZ   . LYS A 1 152 ? 16.027  -13.003 4.207   1.00 22.37 ? 666 LYS A NZ   4  
ATOM 8897  H H    . LYS A 1 152 ? 13.855  -19.587 3.830   1.00 16.13 ? 666 LYS A H    4  
ATOM 8898  H HA   . LYS A 1 152 ? 13.585  -17.542 1.652   1.00 17.53 ? 666 LYS A HA   4  
ATOM 8899  H HB2  . LYS A 1 152 ? 12.572  -16.647 3.697   1.00 17.99 ? 666 LYS A HB2  4  
ATOM 8900  H HB3  . LYS A 1 152 ? 14.054  -16.970 4.604   1.00 18.92 ? 666 LYS A HB3  4  
ATOM 8901  H HG2  . LYS A 1 152 ? 15.273  -15.380 3.235   1.00 20.05 ? 666 LYS A HG2  4  
ATOM 8902  H HG3  . LYS A 1 152 ? 13.858  -15.072 2.217   1.00 19.11 ? 666 LYS A HG3  4  
ATOM 8903  H HD2  . LYS A 1 152 ? 12.741  -13.995 4.085   1.00 19.65 ? 666 LYS A HD2  4  
ATOM 8904  H HD3  . LYS A 1 152 ? 14.020  -14.483 5.210   1.00 20.36 ? 666 LYS A HD3  4  
ATOM 8905  H HE2  . LYS A 1 152 ? 14.493  -12.703 2.772   1.00 21.72 ? 666 LYS A HE2  4  
ATOM 8906  H HE3  . LYS A 1 152 ? 14.141  -12.069 4.387   1.00 21.92 ? 666 LYS A HE3  4  
ATOM 8907  H HZ1  . LYS A 1 152 ? 16.130  -13.063 5.217   1.00 22.85 ? 666 LYS A HZ1  4  
ATOM 8908  H HZ2  . LYS A 1 152 ? 16.541  -12.172 3.924   1.00 23.04 ? 666 LYS A HZ2  4  
ATOM 8909  H HZ3  . LYS A 1 152 ? 16.479  -13.806 3.771   1.00 22.06 ? 666 LYS A HZ3  4  
ATOM 8910  N N    . ASN A 1 153 ? 16.100  -17.050 1.511   1.00 19.39 ? 667 ASN A N    4  
ATOM 8911  C CA   . ASN A 1 153 ? 17.530  -16.907 1.201   1.00 20.63 ? 667 ASN A CA   4  
ATOM 8912  C C    . ASN A 1 153 ? 18.150  -15.620 1.807   1.00 21.94 ? 667 ASN A C    4  
ATOM 8913  O O    . ASN A 1 153 ? 17.466  -14.788 2.412   1.00 22.14 ? 667 ASN A O    4  
ATOM 8914  C CB   . ASN A 1 153 ? 17.689  -16.972 -0.334  1.00 20.83 ? 667 ASN A CB   4  
ATOM 8915  C CG   . ASN A 1 153 ? 17.584  -18.363 -0.925  1.00 20.68 ? 667 ASN A CG   4  
ATOM 8916  O OD1  . ASN A 1 153 ? 17.489  -19.378 -0.246  1.00 20.54 ? 667 ASN A OD1  4  
ATOM 8917  N ND2  . ASN A 1 153 ? 17.649  -18.457 -2.228  1.00 20.97 ? 667 ASN A ND2  4  
ATOM 8918  H H    . ASN A 1 153 ? 15.493  -16.362 1.086   1.00 19.23 ? 667 ASN A H    4  
ATOM 8919  H HA   . ASN A 1 153 ? 18.087  -17.740 1.632   1.00 20.68 ? 667 ASN A HA   4  
ATOM 8920  H HB2  . ASN A 1 153 ? 16.945  -16.337 -0.810  1.00 20.67 ? 667 ASN A HB2  4  
ATOM 8921  H HB3  . ASN A 1 153 ? 18.661  -16.581 -0.624  1.00 21.54 ? 667 ASN A HB3  4  
ATOM 8922  H HD21 . ASN A 1 153 ? 17.810  -17.623 -2.788  1.00 21.30 ? 667 ASN A HD21 4  
ATOM 8923  H HD22 . ASN A 1 153 ? 17.584  -19.359 -2.674  1.00 21.05 ? 667 ASN A HD22 4  
ATOM 8924  N N    . SER A 1 154 ? 19.472  -15.469 1.670   1.00 23.03 ? 668 SER A N    4  
ATOM 8925  C CA   . SER A 1 154 ? 20.245  -14.325 2.183   1.00 24.47 ? 668 SER A CA   4  
ATOM 8926  C C    . SER A 1 154 ? 21.239  -13.778 1.137   1.00 25.42 ? 668 SER A C    4  
ATOM 8927  O O    . SER A 1 154 ? 20.928  -13.728 -0.058  1.00 25.23 ? 668 SER A O    4  
ATOM 8928  C CB   . SER A 1 154 ? 20.889  -14.718 3.523   1.00 25.07 ? 668 SER A CB   4  
ATOM 8929  O OG   . SER A 1 154 ? 21.848  -15.745 3.347   1.00 25.05 ? 668 SER A OG   4  
ATOM 8930  H H    . SER A 1 154 ? 19.979  -16.178 1.148   1.00 22.96 ? 668 SER A H    4  
ATOM 8931  H HA   . SER A 1 154 ? 19.568  -13.497 2.396   1.00 24.65 ? 668 SER A HA   4  
ATOM 8932  H HB2  . SER A 1 154 ? 21.368  -13.848 3.971   1.00 25.96 ? 668 SER A HB2  4  
ATOM 8933  H HB3  . SER A 1 154 ? 20.112  -15.065 4.206   1.00 24.82 ? 668 SER A HB3  4  
ATOM 8934  H HG   . SER A 1 154 ? 21.509  -16.538 3.824   1.00 24.84 ? 668 SER A HG   4  
ATOM 8935  N N    . ILE A 1 155 ? 22.407  -13.294 1.566   1.00 26.59 ? 669 ILE A N    4  
ATOM 8936  C CA   . ILE A 1 155 ? 23.421  -12.651 0.714   1.00 27.74 ? 669 ILE A CA   4  
ATOM 8937  C C    . ILE A 1 155 ? 24.351  -13.663 0.023   1.00 27.82 ? 669 ILE A C    4  
ATOM 8938  O O    . ILE A 1 155 ? 24.422  -14.836 0.413   1.00 27.31 ? 669 ILE A O    4  
ATOM 8939  C CB   . ILE A 1 155 ? 24.214  -11.597 1.525   1.00 29.18 ? 669 ILE A CB   4  
ATOM 8940  C CG1  . ILE A 1 155 ? 25.044  -12.226 2.669   1.00 29.61 ? 669 ILE A CG1  4  
ATOM 8941  C CG2  . ILE A 1 155 ? 23.245  -10.518 2.047   1.00 29.33 ? 669 ILE A CG2  4  
ATOM 8942  C CD1  . ILE A 1 155 ? 25.974  -11.226 3.369   1.00 31.20 ? 669 ILE A CD1  4  
ATOM 8943  H H    . ILE A 1 155 ? 22.620  -13.393 2.546   1.00 26.82 ? 669 ILE A H    4  
ATOM 8944  H HA   . ILE A 1 155 ? 22.908  -12.112 -0.082  1.00 27.69 ? 669 ILE A HA   4  
ATOM 8945  H HB   . ILE A 1 155 ? 24.909  -11.106 0.844   1.00 30.03 ? 669 ILE A HB   4  
ATOM 8946  H HG12 . ILE A 1 155 ? 24.379  -12.666 3.412   1.00 28.90 ? 669 ILE A HG12 4  
ATOM 8947  H HG13 . ILE A 1 155 ? 25.670  -13.021 2.262   1.00 29.60 ? 669 ILE A HG13 4  
ATOM 8948  H HG21 . ILE A 1 155 ? 23.803  -9.663  2.430   1.00 30.10 ? 669 ILE A HG21 4  
ATOM 8949  H HG22 . ILE A 1 155 ? 22.611  -10.165 1.233   1.00 29.10 ? 669 ILE A HG22 4  
ATOM 8950  H HG23 . ILE A 1 155 ? 22.613  -10.918 2.840   1.00 29.10 ? 669 ILE A HG23 4  
ATOM 8951  H HD11 . ILE A 1 155 ? 25.394  -10.471 3.898   1.00 31.26 ? 669 ILE A HD11 4  
ATOM 8952  H HD12 . ILE A 1 155 ? 26.593  -11.757 4.092   1.00 31.80 ? 669 ILE A HD12 4  
ATOM 8953  H HD13 . ILE A 1 155 ? 26.620  -10.744 2.634   1.00 31.80 ? 669 ILE A HD13 4  
ATOM 8954  N N    . LEU A 1 156 ? 25.113  -13.192 -0.966  1.00 28.69 ? 670 LEU A N    4  
ATOM 8955  C CA   . LEU A 1 156 ? 26.365  -13.818 -1.410  1.00 29.39 ? 670 LEU A CA   4  
ATOM 8956  C C    . LEU A 1 156 ? 27.550  -13.139 -0.702  1.00 30.88 ? 670 LEU A C    4  
ATOM 8957  O O    . LEU A 1 156 ? 27.462  -11.961 -0.347  1.00 31.60 ? 670 LEU A O    4  
ATOM 8958  C CB   . LEU A 1 156 ? 26.479  -13.735 -2.942  1.00 29.45 ? 670 LEU A CB   4  
ATOM 8959  C CG   . LEU A 1 156 ? 25.378  -14.481 -3.722  1.00 28.75 ? 670 LEU A CG   4  
ATOM 8960  C CD1  . LEU A 1 156 ? 25.583  -14.281 -5.222  1.00 29.08 ? 670 LEU A CD1  4  
ATOM 8961  C CD2  . LEU A 1 156 ? 25.386  -15.988 -3.449  1.00 28.35 ? 670 LEU A CD2  4  
ATOM 8962  H H    . LEU A 1 156 ? 24.982  -12.220 -1.236  1.00 29.17 ? 670 LEU A H    4  
ATOM 8963  H HA   . LEU A 1 156 ? 26.379  -14.867 -1.116  1.00 28.94 ? 670 LEU A HA   4  
ATOM 8964  H HB2  . LEU A 1 156 ? 26.458  -12.684 -3.232  1.00 29.72 ? 670 LEU A HB2  4  
ATOM 8965  H HB3  . LEU A 1 156 ? 27.446  -14.142 -3.237  1.00 29.96 ? 670 LEU A HB3  4  
ATOM 8966  H HG   . LEU A 1 156 ? 24.401  -14.080 -3.449  1.00 28.47 ? 670 LEU A HG   4  
ATOM 8967  H HD11 . LEU A 1 156 ? 24.767  -14.751 -5.770  1.00 28.49 ? 670 LEU A HD11 4  
ATOM 8968  H HD12 . LEU A 1 156 ? 26.526  -14.729 -5.528  1.00 29.66 ? 670 LEU A HD12 4  
ATOM 8969  H HD13 . LEU A 1 156 ? 25.593  -13.216 -5.452  1.00 29.50 ? 670 LEU A HD13 4  
ATOM 8970  H HD21 . LEU A 1 156 ? 26.360  -16.409 -3.697  1.00 28.86 ? 670 LEU A HD21 4  
ATOM 8971  H HD22 . LEU A 1 156 ? 24.623  -16.472 -4.058  1.00 27.83 ? 670 LEU A HD22 4  
ATOM 8972  H HD23 . LEU A 1 156 ? 25.162  -16.182 -2.404  1.00 28.21 ? 670 LEU A HD23 4  
ATOM 8973  N N    . LEU A 1 157 ? 28.640  -13.870 -0.443  1.00 31.47 ? 671 LEU A N    4  
ATOM 8974  C CA   . LEU A 1 157 ? 29.705  -13.410 0.460   1.00 32.90 ? 671 LEU A CA   4  
ATOM 8975  C C    . LEU A 1 157 ? 31.127  -13.826 0.025   1.00 33.85 ? 671 LEU A C    4  
ATOM 8976  O O    . LEU A 1 157 ? 31.338  -14.649 -0.873  1.00 33.42 ? 671 LEU A O    4  
ATOM 8977  C CB   . LEU A 1 157 ? 29.326  -13.890 1.886   1.00 32.69 ? 671 LEU A CB   4  
ATOM 8978  C CG   . LEU A 1 157 ? 30.115  -13.309 3.080   1.00 34.08 ? 671 LEU A CG   4  
ATOM 8979  C CD1  . LEU A 1 157 ? 30.142  -11.777 3.100   1.00 35.08 ? 671 LEU A CD1  4  
ATOM 8980  C CD2  . LEU A 1 157 ? 29.483  -13.781 4.388   1.00 33.89 ? 671 LEU A CD2  4  
ATOM 8981  H H    . LEU A 1 157 ? 28.660  -14.842 -0.730  1.00 30.94 ? 671 LEU A H    4  
ATOM 8982  H HA   . LEU A 1 157 ? 29.699  -12.319 0.459   1.00 33.59 ? 671 LEU A HA   4  
ATOM 8983  H HB2  . LEU A 1 157 ? 28.275  -13.644 2.051   1.00 31.98 ? 671 LEU A HB2  4  
ATOM 8984  H HB3  . LEU A 1 157 ? 29.412  -14.977 1.917   1.00 32.26 ? 671 LEU A HB3  4  
ATOM 8985  H HG   . LEU A 1 157 ? 31.139  -13.679 3.057   1.00 34.68 ? 671 LEU A HG   4  
ATOM 8986  H HD11 . LEU A 1 157 ? 30.643  -11.430 4.005   1.00 35.74 ? 671 LEU A HD11 4  
ATOM 8987  H HD12 . LEU A 1 157 ? 29.125  -11.385 3.087   1.00 34.87 ? 671 LEU A HD12 4  
ATOM 8988  H HD13 . LEU A 1 157 ? 30.687  -11.376 2.248   1.00 35.49 ? 671 LEU A HD13 4  
ATOM 8989  H HD21 . LEU A 1 157 ? 28.471  -13.390 4.485   1.00 33.43 ? 671 LEU A HD21 4  
ATOM 8990  H HD22 . LEU A 1 157 ? 30.082  -13.438 5.232   1.00 34.64 ? 671 LEU A HD22 4  
ATOM 8991  H HD23 . LEU A 1 157 ? 29.446  -14.869 4.412   1.00 33.61 ? 671 LEU A HD23 4  
ATOM 8992  N N    . HIS A 1 158 ? 32.102  -13.214 0.696   1.00 35.28 ? 672 HIS A N    4  
ATOM 8993  C CA   . HIS A 1 158 ? 33.540  -13.488 0.716   1.00 36.55 ? 672 HIS A CA   4  
ATOM 8994  C C    . HIS A 1 158 ? 33.857  -14.925 1.163   1.00 36.32 ? 672 HIS A C    4  
ATOM 8995  O O    . HIS A 1 158 ? 34.596  -15.637 0.444   1.00 36.49 ? 672 HIS A O    4  
ATOM 8996  C CB   . HIS A 1 158 ? 34.117  -12.422 1.667   1.00 37.89 ? 672 HIS A CB   4  
ATOM 8997  C CG   . HIS A 1 158 ? 35.613  -12.305 1.777   1.00 39.43 ? 672 HIS A CG   4  
ATOM 8998  N ND1  . HIS A 1 158 ? 36.578  -13.025 1.114   1.00 40.07 ? 672 HIS A ND1  4  
ATOM 8999  C CD2  . HIS A 1 158 ? 36.264  -11.401 2.570   1.00 40.57 ? 672 HIS A CD2  4  
ATOM 9000  C CE1  . HIS A 1 158 ? 37.781  -12.570 1.502   1.00 41.50 ? 672 HIS A CE1  4  
ATOM 9001  N NE2  . HIS A 1 158 ? 37.642  -11.581 2.401   1.00 41.85 ? 672 HIS A NE2  4  
ATOM 9002  H H    . HIS A 1 158 ? 31.798  -12.527 1.369   1.00 35.60 ? 672 HIS A H    4  
ATOM 9003  H HA   . HIS A 1 158 ? 33.953  -13.340 -0.281  1.00 36.87 ? 672 HIS A HA   4  
ATOM 9004  H HB2  . HIS A 1 158 ? 33.748  -11.443 1.351   1.00 38.01 ? 672 HIS A HB2  4  
ATOM 9005  H HB3  . HIS A 1 158 ? 33.723  -12.600 2.670   1.00 37.71 ? 672 HIS A HB3  4  
ATOM 9006  H HD1  . HIS A 1 158 ? 36.418  -13.757 0.429   1.00 39.63 ? 672 HIS A HD1  4  
ATOM 9007  H HD2  . HIS A 1 158 ? 35.785  -10.668 3.204   1.00 40.56 ? 672 HIS A HD2  4  
ATOM 9008  H HE1  . HIS A 1 158 ? 38.731  -12.944 1.141   1.00 42.33 ? 672 HIS A HE1  4  
ATOM 9009  N N    . ASN A 1 20  ? 6.093   14.948  1.537   1.00 4.58  ? 534 ASN A N    5  
ATOM 9010  C CA   . ASN A 1 20  ? 5.446   14.309  2.691   1.00 3.59  ? 534 ASN A CA   5  
ATOM 9011  C C    . ASN A 1 20  ? 5.553   12.767  2.608   1.00 2.88  ? 534 ASN A C    5  
ATOM 9012  O O    . ASN A 1 20  ? 5.818   12.209  1.540   1.00 4.19  ? 534 ASN A O    5  
ATOM 9013  C CB   . ASN A 1 20  ? 3.968   14.768  2.748   1.00 4.79  ? 534 ASN A CB   5  
ATOM 9014  C CG   . ASN A 1 20  ? 3.270   14.443  4.063   1.00 5.44  ? 534 ASN A CG   5  
ATOM 9015  O OD1  . ASN A 1 20  ? 3.888   14.250  5.102   1.00 5.47  ? 534 ASN A OD1  5  
ATOM 9016  N ND2  . ASN A 1 20  ? 1.966   14.384  4.088   1.00 6.75  ? 534 ASN A ND2  5  
ATOM 9017  H H    . ASN A 1 20  ? 6.195   14.383  0.702   1.00 5.40  ? 534 ASN A H    5  
ATOM 9018  H HA   . ASN A 1 20  ? 5.954   14.628  3.603   1.00 3.67  ? 534 ASN A HA   5  
ATOM 9019  H HB2  . ASN A 1 20  ? 3.913   15.849  2.617   1.00 5.35  ? 534 ASN A HB2  5  
ATOM 9020  H HB3  . ASN A 1 20  ? 3.416   14.303  1.930   1.00 5.61  ? 534 ASN A HB3  5  
ATOM 9021  H HD21 . ASN A 1 20  ? 1.426   14.542  3.248   1.00 7.17  ? 534 ASN A HD21 5  
ATOM 9022  H HD22 . ASN A 1 20  ? 1.521   14.164  4.974   1.00 7.63  ? 534 ASN A HD22 5  
ATOM 9023  N N    . CYS A 1 21  ? 5.257   12.082  3.715   1.00 1.88  ? 535 CYS A N    5  
ATOM 9024  C CA   . CYS A 1 21  ? 5.116   10.624  3.836   1.00 1.69  ? 535 CYS A CA   5  
ATOM 9025  C C    . CYS A 1 21  ? 6.407   9.784   3.711   1.00 1.26  ? 535 CYS A C    5  
ATOM 9026  O O    . CYS A 1 21  ? 6.309   8.556   3.626   1.00 1.15  ? 535 CYS A O    5  
ATOM 9027  C CB   . CYS A 1 21  ? 3.965   10.116  2.945   1.00 2.69  ? 535 CYS A CB   5  
ATOM 9028  S SG   . CYS A 1 21  ? 2.407   10.932  3.397   1.00 3.78  ? 535 CYS A SG   5  
ATOM 9029  H H    . CYS A 1 21  ? 5.048   12.627  4.543   1.00 2.61  ? 535 CYS A H    5  
ATOM 9030  H HA   . CYS A 1 21  ? 4.788   10.442  4.858   1.00 2.04  ? 535 CYS A HA   5  
ATOM 9031  H HB2  . CYS A 1 21  ? 4.196   10.312  1.897   1.00 3.03  ? 535 CYS A HB2  5  
ATOM 9032  H HB3  . CYS A 1 21  ? 3.852   9.038   3.074   1.00 3.55  ? 535 CYS A HB3  5  
ATOM 9033  H HG   . CYS A 1 21  ? 1.661   10.436  2.400   1.00 4.24  ? 535 CYS A HG   5  
ATOM 9034  N N    . ARG A 1 22  ? 7.610   10.381  3.761   1.00 1.30  ? 536 ARG A N    5  
ATOM 9035  C CA   . ARG A 1 22  ? 8.879   9.626   3.694   1.00 1.22  ? 536 ARG A CA   5  
ATOM 9036  C C    . ARG A 1 22  ? 9.029   8.643   4.860   1.00 1.18  ? 536 ARG A C    5  
ATOM 9037  O O    . ARG A 1 22  ? 9.285   7.465   4.620   1.00 1.19  ? 536 ARG A O    5  
ATOM 9038  C CB   . ARG A 1 22  ? 10.078  10.588  3.618   1.00 1.59  ? 536 ARG A CB   5  
ATOM 9039  C CG   . ARG A 1 22  ? 11.361  9.878   3.149   1.00 1.85  ? 536 ARG A CG   5  
ATOM 9040  C CD   . ARG A 1 22  ? 12.571  10.810  3.279   1.00 2.10  ? 536 ARG A CD   5  
ATOM 9041  N NE   . ARG A 1 22  ? 13.711  10.350  2.465   1.00 3.26  ? 536 ARG A NE   5  
ATOM 9042  C CZ   . ARG A 1 22  ? 14.765  11.074  2.143   1.00 4.05  ? 536 ARG A CZ   5  
ATOM 9043  N NH1  . ARG A 1 22  ? 15.018  12.232  2.673   1.00 4.04  ? 536 ARG A NH1  5  
ATOM 9044  N NH2  . ARG A 1 22  ? 15.590  10.645  1.241   1.00 5.63  ? 536 ARG A NH2  5  
ATOM 9045  H H    . ARG A 1 22  ? 7.648   11.394  3.863   1.00 1.60  ? 536 ARG A H    5  
ATOM 9046  H HA   . ARG A 1 22  ? 8.862   9.023   2.785   1.00 1.15  ? 536 ARG A HA   5  
ATOM 9047  H HB2  . ARG A 1 22  ? 9.852   11.384  2.907   1.00 2.73  ? 536 ARG A HB2  5  
ATOM 9048  H HB3  . ARG A 1 22  ? 10.244  11.041  4.597   1.00 2.46  ? 536 ARG A HB3  5  
ATOM 9049  H HG2  . ARG A 1 22  ? 11.545  8.984   3.744   1.00 2.69  ? 536 ARG A HG2  5  
ATOM 9050  H HG3  . ARG A 1 22  ? 11.235  9.589   2.105   1.00 2.90  ? 536 ARG A HG3  5  
ATOM 9051  H HD2  . ARG A 1 22  ? 12.282  11.807  2.941   1.00 2.72  ? 536 ARG A HD2  5  
ATOM 9052  H HD3  . ARG A 1 22  ? 12.866  10.868  4.328   1.00 2.75  ? 536 ARG A HD3  5  
ATOM 9053  H HE   . ARG A 1 22  ? 13.611  9.486   1.958   1.00 4.19  ? 536 ARG A HE   5  
ATOM 9054  H HH11 . ARG A 1 22  ? 14.414  12.596  3.405   1.00 3.76  ? 536 ARG A HH11 5  
ATOM 9055  H HH12 . ARG A 1 22  ? 15.770  12.798  2.294   1.00 4.95  ? 536 ARG A HH12 5  
ATOM 9056  H HH21 . ARG A 1 22  ? 15.347  9.825   0.686   1.00 6.44  ? 536 ARG A HH21 5  
ATOM 9057  H HH22 . ARG A 1 22  ? 16.341  11.233  0.912   1.00 6.34  ? 536 ARG A HH22 5  
ATOM 9058  N N    . LYS A 1 23  ? 8.790   9.082   6.104   1.00 1.26  ? 537 LYS A N    5  
ATOM 9059  C CA   . LYS A 1 23  ? 8.831   8.203   7.292   1.00 1.29  ? 537 LYS A CA   5  
ATOM 9060  C C    . LYS A 1 23  ? 7.688   7.186   7.295   1.00 1.20  ? 537 LYS A C    5  
ATOM 9061  O O    . LYS A 1 23  ? 7.851   6.078   7.804   1.00 1.22  ? 537 LYS A O    5  
ATOM 9062  C CB   . LYS A 1 23  ? 8.781   9.007   8.600   1.00 1.47  ? 537 LYS A CB   5  
ATOM 9063  C CG   . LYS A 1 23  ? 9.891   10.055  8.761   1.00 3.00  ? 537 LYS A CG   5  
ATOM 9064  C CD   . LYS A 1 23  ? 9.953   10.497  10.226  1.00 3.50  ? 537 LYS A CD   5  
ATOM 9065  C CE   . LYS A 1 23  ? 11.002  11.584  10.468  1.00 5.13  ? 537 LYS A CE   5  
ATOM 9066  N NZ   . LYS A 1 23  ? 11.124  11.880  11.913  1.00 5.92  ? 537 LYS A NZ   5  
ATOM 9067  H H    . LYS A 1 23  ? 8.470   10.036  6.214   1.00 1.35  ? 537 LYS A H    5  
ATOM 9068  H HA   . LYS A 1 23  ? 9.763   7.635   7.284   1.00 1.34  ? 537 LYS A HA   5  
ATOM 9069  H HB2  . LYS A 1 23  ? 7.813   9.500   8.694   1.00 1.87  ? 537 LYS A HB2  5  
ATOM 9070  H HB3  . LYS A 1 23  ? 8.864   8.290   9.419   1.00 2.50  ? 537 LYS A HB3  5  
ATOM 9071  H HG2  . LYS A 1 23  ? 10.848  9.619   8.489   1.00 4.03  ? 537 LYS A HG2  5  
ATOM 9072  H HG3  . LYS A 1 23  ? 9.689   10.913  8.118   1.00 3.89  ? 537 LYS A HG3  5  
ATOM 9073  H HD2  . LYS A 1 23  ? 8.975   10.871  10.529  1.00 3.59  ? 537 LYS A HD2  5  
ATOM 9074  H HD3  . LYS A 1 23  ? 10.203  9.627   10.834  1.00 3.72  ? 537 LYS A HD3  5  
ATOM 9075  H HE2  . LYS A 1 23  ? 11.966  11.248  10.074  1.00 5.77  ? 537 LYS A HE2  5  
ATOM 9076  H HE3  . LYS A 1 23  ? 10.707  12.485  9.928   1.00 5.70  ? 537 LYS A HE3  5  
ATOM 9077  H HZ1  . LYS A 1 23  ? 10.221  12.092  12.338  1.00 5.73  ? 537 LYS A HZ1  5  
ATOM 9078  H HZ2  . LYS A 1 23  ? 11.733  12.672  12.095  1.00 6.98  ? 537 LYS A HZ2  5  
ATOM 9079  H HZ3  . LYS A 1 23  ? 11.470  11.070  12.420  1.00 6.13  ? 537 LYS A HZ3  5  
ATOM 9080  N N    . LEU A 1 24  ? 6.542   7.549   6.712   1.00 1.21  ? 538 LEU A N    5  
ATOM 9081  C CA   . LEU A 1 24  ? 5.337   6.717   6.670   1.00 1.23  ? 538 LEU A CA   5  
ATOM 9082  C C    . LEU A 1 24  ? 5.527   5.516   5.734   1.00 1.16  ? 538 LEU A C    5  
ATOM 9083  O O    . LEU A 1 24  ? 5.261   4.384   6.142   1.00 1.25  ? 538 LEU A O    5  
ATOM 9084  C CB   . LEU A 1 24  ? 4.135   7.607   6.297   1.00 1.34  ? 538 LEU A CB   5  
ATOM 9085  C CG   . LEU A 1 24  ? 2.783   6.878   6.168   1.00 1.12  ? 538 LEU A CG   5  
ATOM 9086  C CD1  . LEU A 1 24  ? 2.377   6.126   7.434   1.00 2.05  ? 538 LEU A CD1  5  
ATOM 9087  C CD2  . LEU A 1 24  ? 1.680   7.892   5.861   1.00 2.16  ? 538 LEU A CD2  5  
ATOM 9088  H H    . LEU A 1 24  ? 6.512   8.468   6.292   1.00 1.30  ? 538 LEU A H    5  
ATOM 9089  H HA   . LEU A 1 24  ? 5.169   6.320   7.674   1.00 1.32  ? 538 LEU A HA   5  
ATOM 9090  H HB2  . LEU A 1 24  ? 4.039   8.388   7.054   1.00 2.16  ? 538 LEU A HB2  5  
ATOM 9091  H HB3  . LEU A 1 24  ? 4.342   8.090   5.344   1.00 2.22  ? 538 LEU A HB3  5  
ATOM 9092  H HG   . LEU A 1 24  ? 2.837   6.169   5.342   1.00 2.21  ? 538 LEU A HG   5  
ATOM 9093  H HD11 . LEU A 1 24  ? 3.077   5.315   7.633   1.00 2.94  ? 538 LEU A HD11 5  
ATOM 9094  H HD12 . LEU A 1 24  ? 1.387   5.695   7.290   1.00 2.83  ? 538 LEU A HD12 5  
ATOM 9095  H HD13 . LEU A 1 24  ? 2.355   6.807   8.286   1.00 2.48  ? 538 LEU A HD13 5  
ATOM 9096  H HD21 . LEU A 1 24  ? 1.573   8.592   6.693   1.00 2.37  ? 538 LEU A HD21 5  
ATOM 9097  H HD22 . LEU A 1 24  ? 0.735   7.374   5.703   1.00 3.05  ? 538 LEU A HD22 5  
ATOM 9098  H HD23 . LEU A 1 24  ? 1.930   8.453   4.963   1.00 3.19  ? 538 LEU A HD23 5  
ATOM 9099  N N    . VAL A 1 25  ? 6.062   5.737   4.527   1.00 1.05  ? 539 VAL A N    5  
ATOM 9100  C CA   . VAL A 1 25  ? 6.433   4.653   3.600   1.00 1.01  ? 539 VAL A CA   5  
ATOM 9101  C C    . VAL A 1 25  ? 7.631   3.855   4.134   1.00 1.08  ? 539 VAL A C    5  
ATOM 9102  O O    . VAL A 1 25  ? 7.593   2.627   4.160   1.00 1.17  ? 539 VAL A O    5  
ATOM 9103  C CB   . VAL A 1 25  ? 6.599   5.186   2.160   1.00 0.89  ? 539 VAL A CB   5  
ATOM 9104  C CG1  . VAL A 1 25  ? 8.027   5.610   1.814   1.00 0.96  ? 539 VAL A CG1  5  
ATOM 9105  C CG2  . VAL A 1 25  ? 6.109   4.139   1.158   1.00 0.90  ? 539 VAL A CG2  5  
ATOM 9106  H H    . VAL A 1 25  ? 6.251   6.698   4.249   1.00 1.03  ? 539 VAL A H    5  
ATOM 9107  H HA   . VAL A 1 25  ? 5.615   3.942   3.548   1.00 1.08  ? 539 VAL A HA   5  
ATOM 9108  H HB   . VAL A 1 25  ? 5.957   6.059   2.036   1.00 0.85  ? 539 VAL A HB   5  
ATOM 9109  H HG11 . VAL A 1 25  ? 8.058   6.008   0.800   1.00 1.77  ? 539 VAL A HG11 5  
ATOM 9110  H HG12 . VAL A 1 25  ? 8.335   6.382   2.517   1.00 1.98  ? 539 VAL A HG12 5  
ATOM 9111  H HG13 . VAL A 1 25  ? 8.702   4.756   1.869   1.00 1.35  ? 539 VAL A HG13 5  
ATOM 9112  H HG21 . VAL A 1 25  ? 5.032   4.004   1.267   1.00 1.97  ? 539 VAL A HG21 5  
ATOM 9113  H HG22 . VAL A 1 25  ? 6.319   4.462   0.137   1.00 1.74  ? 539 VAL A HG22 5  
ATOM 9114  H HG23 . VAL A 1 25  ? 6.600   3.190   1.355   1.00 1.77  ? 539 VAL A HG23 5  
ATOM 9115  N N    . ALA A 1 26  ? 8.647   4.524   4.692   1.00 1.10  ? 540 ALA A N    5  
ATOM 9116  C CA   . ALA A 1 26  ? 9.841   3.873   5.234   1.00 1.23  ? 540 ALA A CA   5  
ATOM 9117  C C    . ALA A 1 26  ? 9.609   3.063   6.525   1.00 1.41  ? 540 ALA A C    5  
ATOM 9118  O O    . ALA A 1 26  ? 10.552  2.440   7.020   1.00 1.56  ? 540 ALA A O    5  
ATOM 9119  C CB   . ALA A 1 26  ? 10.917  4.935   5.462   1.00 1.31  ? 540 ALA A CB   5  
ATOM 9120  H H    . ALA A 1 26  ? 8.644   5.538   4.659   1.00 1.08  ? 540 ALA A H    5  
ATOM 9121  H HA   . ALA A 1 26  ? 10.210  3.178   4.481   1.00 1.21  ? 540 ALA A HA   5  
ATOM 9122  H HB1  . ALA A 1 26  ? 11.839  4.457   5.789   1.00 1.96  ? 540 ALA A HB1  5  
ATOM 9123  H HB2  . ALA A 1 26  ? 11.108  5.488   4.541   1.00 2.14  ? 540 ALA A HB2  5  
ATOM 9124  H HB3  . ALA A 1 26  ? 10.585  5.619   6.245   1.00 1.98  ? 540 ALA A HB3  5  
ATOM 9125  N N    . SER A 1 27  ? 8.404   3.077   7.103   1.00 1.48  ? 541 SER A N    5  
ATOM 9126  C CA   . SER A 1 27  ? 8.076   2.371   8.344   1.00 1.70  ? 541 SER A CA   5  
ATOM 9127  C C    . SER A 1 27  ? 7.510   0.956   8.105   1.00 1.67  ? 541 SER A C    5  
ATOM 9128  O O    . SER A 1 27  ? 7.335   0.168   9.041   1.00 1.80  ? 541 SER A O    5  
ATOM 9129  C CB   . SER A 1 27  ? 7.094   3.216   9.143   1.00 1.96  ? 541 SER A CB   5  
ATOM 9130  O OG   . SER A 1 27  ? 7.719   4.289   9.822   1.00 2.95  ? 541 SER A OG   5  
ATOM 9131  H H    . SER A 1 27  ? 7.654   3.592   6.666   1.00 1.46  ? 541 SER A H    5  
ATOM 9132  H HA   . SER A 1 27  ? 8.971   2.301   8.942   1.00 1.78  ? 541 SER A HA   5  
ATOM 9133  H HB2  . SER A 1 27  ? 6.365   3.613   8.456   1.00 1.86  ? 541 SER A HB2  5  
ATOM 9134  H HB3  . SER A 1 27  ? 6.595   2.581   9.857   1.00 2.25  ? 541 SER A HB3  5  
ATOM 9135  H HG   . SER A 1 27  ? 7.936   4.964   9.146   1.00 3.37  ? 541 SER A HG   5  
ATOM 9136  N N    . MET A 1 28  ? 7.212   0.619   6.846   1.00 1.54  ? 542 MET A N    5  
ATOM 9137  C CA   . MET A 1 28  ? 6.680   -0.664  6.403   1.00 1.53  ? 542 MET A CA   5  
ATOM 9138  C C    . MET A 1 28  ? 7.703   -1.812  6.512   1.00 1.41  ? 542 MET A C    5  
ATOM 9139  O O    . MET A 1 28  ? 8.913   -1.585  6.413   1.00 1.43  ? 542 MET A O    5  
ATOM 9140  C CB   . MET A 1 28  ? 6.222   -0.521  4.943   1.00 1.49  ? 542 MET A CB   5  
ATOM 9141  C CG   . MET A 1 28  ? 4.731   -0.191  4.826   1.00 1.89  ? 542 MET A CG   5  
ATOM 9142  S SD   . MET A 1 28  ? 4.098   -0.124  3.128   1.00 2.64  ? 542 MET A SD   5  
ATOM 9143  C CE   . MET A 1 28  ? 4.424   -1.816  2.559   1.00 1.85  ? 542 MET A CE   5  
ATOM 9144  H H    . MET A 1 28  ? 7.356   1.307   6.126   1.00 1.45  ? 542 MET A H    5  
ATOM 9145  H HA   . MET A 1 28  ? 5.819   -0.906  7.028   1.00 1.71  ? 542 MET A HA   5  
ATOM 9146  H HB2  . MET A 1 28  ? 6.797   0.253   4.440   1.00 1.69  ? 542 MET A HB2  5  
ATOM 9147  H HB3  . MET A 1 28  ? 6.428   -1.450  4.419   1.00 1.58  ? 542 MET A HB3  5  
ATOM 9148  H HG2  . MET A 1 28  ? 4.156   -0.937  5.375   1.00 1.87  ? 542 MET A HG2  5  
ATOM 9149  H HG3  . MET A 1 28  ? 4.555   0.779   5.293   1.00 2.48  ? 542 MET A HG3  5  
ATOM 9150  H HE1  . MET A 1 28  ? 5.487   -1.928  2.352   1.00 2.67  ? 542 MET A HE1  5  
ATOM 9151  H HE2  . MET A 1 28  ? 4.133   -2.541  3.318   1.00 2.27  ? 542 MET A HE2  5  
ATOM 9152  H HE3  . MET A 1 28  ? 3.864   -2.015  1.646   1.00 2.04  ? 542 MET A HE3  5  
ATOM 9153  N N    . PRO A 1 29  ? 7.239   -3.074  6.610   1.00 1.41  ? 543 PRO A N    5  
ATOM 9154  C CA   . PRO A 1 29  ? 8.110   -4.252  6.680   1.00 1.43  ? 543 PRO A CA   5  
ATOM 9155  C C    . PRO A 1 29  ? 8.898   -4.478  5.381   1.00 1.33  ? 543 PRO A C    5  
ATOM 9156  O O    . PRO A 1 29  ? 10.004  -5.012  5.424   1.00 1.36  ? 543 PRO A O    5  
ATOM 9157  C CB   . PRO A 1 29  ? 7.175   -5.419  7.019   1.00 1.67  ? 543 PRO A CB   5  
ATOM 9158  C CG   . PRO A 1 29  ? 5.818   -4.982  6.466   1.00 1.72  ? 543 PRO A CG   5  
ATOM 9159  C CD   . PRO A 1 29  ? 5.838   -3.461  6.628   1.00 1.56  ? 543 PRO A CD   5  
ATOM 9160  H HA   . PRO A 1 29  ? 8.834   -4.141  7.487   1.00 1.47  ? 543 PRO A HA   5  
ATOM 9161  H HB2  . PRO A 1 29  ? 7.508   -6.359  6.576   1.00 1.76  ? 543 PRO A HB2  5  
ATOM 9162  H HB3  . PRO A 1 29  ? 7.105   -5.520  8.103   1.00 1.89  ? 543 PRO A HB3  5  
ATOM 9163  H HG2  . PRO A 1 29  ? 5.760   -5.233  5.405   1.00 1.81  ? 543 PRO A HG2  5  
ATOM 9164  H HG3  . PRO A 1 29  ? 4.990   -5.437  7.012   1.00 1.97  ? 543 PRO A HG3  5  
ATOM 9165  H HD2  . PRO A 1 29  ? 5.281   -3.009  5.809   1.00 1.66  ? 543 PRO A HD2  5  
ATOM 9166  H HD3  . PRO A 1 29  ? 5.408   -3.144  7.578   1.00 1.61  ? 543 PRO A HD3  5  
ATOM 9167  N N    . LEU A 1 30  ? 8.386   -3.998  4.240   1.00 1.31  ? 544 LEU A N    5  
ATOM 9168  C CA   . LEU A 1 30  ? 9.065   -4.045  2.934   1.00 1.27  ? 544 LEU A CA   5  
ATOM 9169  C C    . LEU A 1 30  ? 10.180  -2.984  2.789   1.00 1.21  ? 544 LEU A C    5  
ATOM 9170  O O    . LEU A 1 30  ? 10.936  -3.004  1.819   1.00 1.29  ? 544 LEU A O    5  
ATOM 9171  C CB   . LEU A 1 30  ? 8.046   -3.892  1.784   1.00 1.35  ? 544 LEU A CB   5  
ATOM 9172  C CG   . LEU A 1 30  ? 6.651   -4.522  1.952   1.00 2.08  ? 544 LEU A CG   5  
ATOM 9173  C CD1  . LEU A 1 30  ? 5.852   -4.305  0.666   1.00 1.91  ? 544 LEU A CD1  5  
ATOM 9174  C CD2  . LEU A 1 30  ? 6.656   -6.012  2.260   1.00 3.39  ? 544 LEU A CD2  5  
ATOM 9175  H H    . LEU A 1 30  ? 7.456   -3.611  4.275   1.00 1.40  ? 544 LEU A H    5  
ATOM 9176  H HA   . LEU A 1 30  ? 9.541   -5.024  2.834   1.00 1.34  ? 544 LEU A HA   5  
ATOM 9177  H HB2  . LEU A 1 30  ? 7.898   -2.827  1.601   1.00 2.59  ? 544 LEU A HB2  5  
ATOM 9178  H HB3  . LEU A 1 30  ? 8.503   -4.312  0.888   1.00 1.89  ? 544 LEU A HB3  5  
ATOM 9179  H HG   . LEU A 1 30  ? 6.137   -4.018  2.770   1.00 3.46  ? 544 LEU A HG   5  
ATOM 9180  H HD11 . LEU A 1 30  ? 5.839   -3.248  0.407   1.00 2.64  ? 544 LEU A HD11 5  
ATOM 9181  H HD12 . LEU A 1 30  ? 4.827   -4.648  0.808   1.00 2.60  ? 544 LEU A HD12 5  
ATOM 9182  H HD13 . LEU A 1 30  ? 6.306   -4.864  -0.153  1.00 1.73  ? 544 LEU A HD13 5  
ATOM 9183  H HD21 . LEU A 1 30  ? 5.624   -6.346  2.371   1.00 4.23  ? 544 LEU A HD21 5  
ATOM 9184  H HD22 . LEU A 1 30  ? 7.176   -6.204  3.197   1.00 4.35  ? 544 LEU A HD22 5  
ATOM 9185  H HD23 . LEU A 1 30  ? 7.140   -6.565  1.455   1.00 3.69  ? 544 LEU A HD23 5  
ATOM 9186  N N    . PHE A 1 31  ? 10.273  -2.044  3.738   1.00 1.20  ? 545 PHE A N    5  
ATOM 9187  C CA   . PHE A 1 31  ? 11.226  -0.928  3.787   1.00 1.22  ? 545 PHE A CA   5  
ATOM 9188  C C    . PHE A 1 31  ? 12.217  -1.053  4.967   1.00 1.23  ? 545 PHE A C    5  
ATOM 9189  O O    . PHE A 1 31  ? 12.927  -0.104  5.307   1.00 1.32  ? 545 PHE A O    5  
ATOM 9190  C CB   . PHE A 1 31  ? 10.453  0.400   3.811   1.00 1.31  ? 545 PHE A CB   5  
ATOM 9191  C CG   . PHE A 1 31  ? 9.718   0.755   2.527   1.00 1.28  ? 545 PHE A CG   5  
ATOM 9192  C CD1  . PHE A 1 31  ? 8.525   0.095   2.172   1.00 2.02  ? 545 PHE A CD1  5  
ATOM 9193  C CD2  . PHE A 1 31  ? 10.193  1.801   1.715   1.00 2.34  ? 545 PHE A CD2  5  
ATOM 9194  C CE1  . PHE A 1 31  ? 7.796   0.503   1.043   1.00 1.97  ? 545 PHE A CE1  5  
ATOM 9195  C CE2  . PHE A 1 31  ? 9.475   2.203   0.576   1.00 2.41  ? 545 PHE A CE2  5  
ATOM 9196  C CZ   . PHE A 1 31  ? 8.268   1.562   0.250   1.00 1.31  ? 545 PHE A CZ   5  
ATOM 9197  H H    . PHE A 1 31  ? 9.613   -2.081  4.497   1.00 1.24  ? 545 PHE A H    5  
ATOM 9198  H HA   . PHE A 1 31  ? 11.827  -0.941  2.878   1.00 1.19  ? 545 PHE A HA   5  
ATOM 9199  H HB2  . PHE A 1 31  ? 9.738   0.386   4.634   1.00 1.33  ? 545 PHE A HB2  5  
ATOM 9200  H HB3  . PHE A 1 31  ? 11.162  1.201   4.020   1.00 1.45  ? 545 PHE A HB3  5  
ATOM 9201  H HD1  . PHE A 1 31  ? 8.148   -0.706  2.783   1.00 3.24  ? 545 PHE A HD1  5  
ATOM 9202  H HD2  . PHE A 1 31  ? 11.100  2.316   1.987   1.00 3.54  ? 545 PHE A HD2  5  
ATOM 9203  H HE1  . PHE A 1 31  ? 6.855   0.027   0.805   1.00 3.12  ? 545 PHE A HE1  5  
ATOM 9204  H HE2  . PHE A 1 31  ? 9.827   3.026   -0.028  1.00 3.68  ? 545 PHE A HE2  5  
ATOM 9205  H HZ   . PHE A 1 31  ? 7.673   1.920   -0.579  1.00 1.36  ? 545 PHE A HZ   5  
ATOM 9206  N N    . ALA A 1 32  ? 12.288  -2.236  5.582   1.00 1.25  ? 546 ALA A N    5  
ATOM 9207  C CA   . ALA A 1 32  ? 13.194  -2.600  6.678   1.00 1.44  ? 546 ALA A CA   5  
ATOM 9208  C C    . ALA A 1 32  ? 14.680  -2.319  6.407   1.00 1.40  ? 546 ALA A C    5  
ATOM 9209  O O    . ALA A 1 32  ? 15.466  -2.129  7.337   1.00 1.67  ? 546 ALA A O    5  
ATOM 9210  C CB   . ALA A 1 32  ? 13.067  -4.115  6.819   1.00 1.61  ? 546 ALA A CB   5  
ATOM 9211  H H    . ALA A 1 32  ? 11.721  -2.980  5.200   1.00 1.24  ? 546 ALA A H    5  
ATOM 9212  H HA   . ALA A 1 32  ? 12.896  -2.103  7.602   1.00 1.66  ? 546 ALA A HA   5  
ATOM 9213  H HB1  . ALA A 1 32  ? 13.357  -4.564  5.864   1.00 2.48  ? 546 ALA A HB1  5  
ATOM 9214  H HB2  . ALA A 1 32  ? 13.750  -4.474  7.589   1.00 2.21  ? 546 ALA A HB2  5  
ATOM 9215  H HB3  . ALA A 1 32  ? 12.041  -4.385  7.071   1.00 2.03  ? 546 ALA A HB3  5  
ATOM 9216  N N    . ASN A 1 33  ? 15.052  -2.398  5.131   1.00 1.22  ? 547 ASN A N    5  
ATOM 9217  C CA   . ASN A 1 33  ? 16.405  -2.382  4.593   1.00 1.24  ? 547 ASN A CA   5  
ATOM 9218  C C    . ASN A 1 33  ? 16.602  -1.265  3.552   1.00 1.10  ? 547 ASN A C    5  
ATOM 9219  O O    . ASN A 1 33  ? 17.654  -1.190  2.916   1.00 1.20  ? 547 ASN A O    5  
ATOM 9220  C CB   . ASN A 1 33  ? 16.660  -3.789  4.013   1.00 1.55  ? 547 ASN A CB   5  
ATOM 9221  C CG   . ASN A 1 33  ? 17.781  -4.491  4.714   1.00 2.18  ? 547 ASN A CG   5  
ATOM 9222  O OD1  . ASN A 1 33  ? 18.879  -4.666  4.197   1.00 2.85  ? 547 ASN A OD1  5  
ATOM 9223  N ND2  . ASN A 1 33  ? 17.530  -4.892  5.928   1.00 2.62  ? 547 ASN A ND2  5  
ATOM 9224  H H    . ASN A 1 33  ? 14.320  -2.594  4.454   1.00 1.20  ? 547 ASN A H    5  
ATOM 9225  H HA   . ASN A 1 33  ? 17.113  -2.180  5.401   1.00 1.34  ? 547 ASN A HA   5  
ATOM 9226  H HB2  . ASN A 1 33  ? 15.772  -4.419  4.077   1.00 1.90  ? 547 ASN A HB2  5  
ATOM 9227  H HB3  . ASN A 1 33  ? 16.927  -3.736  2.972   1.00 2.20  ? 547 ASN A HB3  5  
ATOM 9228  H HD21 . ASN A 1 33  ? 16.626  -4.748  6.338   1.00 2.42  ? 547 ASN A HD21 5  
ATOM 9229  H HD22 . ASN A 1 33  ? 18.267  -5.364  6.414   1.00 3.42  ? 547 ASN A HD22 5  
ATOM 9230  N N    . ALA A 1 34  ? 15.587  -0.419  3.350   1.00 1.02  ? 548 ALA A N    5  
ATOM 9231  C CA   . ALA A 1 34  ? 15.552  0.534   2.233   1.00 0.98  ? 548 ALA A CA   5  
ATOM 9232  C C    . ALA A 1 34  ? 16.709  1.562   2.231   1.00 0.90  ? 548 ALA A C    5  
ATOM 9233  O O    . ALA A 1 34  ? 17.104  2.083   3.280   1.00 0.96  ? 548 ALA A O    5  
ATOM 9234  C CB   . ALA A 1 34  ? 14.189  1.239   2.189   1.00 1.10  ? 548 ALA A CB   5  
ATOM 9235  H H    . ALA A 1 34  ? 14.750  -0.584  3.901   1.00 1.01  ? 548 ALA A H    5  
ATOM 9236  H HA   . ALA A 1 34  ? 15.642  -0.056  1.320   1.00 1.03  ? 548 ALA A HA   5  
ATOM 9237  H HB1  . ALA A 1 34  ? 14.069  1.686   1.204   1.00 1.57  ? 548 ALA A HB1  5  
ATOM 9238  H HB2  . ALA A 1 34  ? 13.376  0.531   2.350   1.00 1.63  ? 548 ALA A HB2  5  
ATOM 9239  H HB3  . ALA A 1 34  ? 14.133  2.043   2.929   1.00 2.14  ? 548 ALA A HB3  5  
ATOM 9240  N N    . ASP A 1 35  ? 17.203  1.898   1.034   1.00 0.83  ? 549 ASP A N    5  
ATOM 9241  C CA   . ASP A 1 35  ? 18.110  3.028   0.776   1.00 0.80  ? 549 ASP A CA   5  
ATOM 9242  C C    . ASP A 1 35  ? 17.317  4.345   0.632   1.00 0.80  ? 549 ASP A C    5  
ATOM 9243  O O    . ASP A 1 35  ? 16.313  4.364   -0.086  1.00 0.71  ? 549 ASP A O    5  
ATOM 9244  C CB   . ASP A 1 35  ? 18.914  2.743   -0.501  1.00 0.81  ? 549 ASP A CB   5  
ATOM 9245  C CG   . ASP A 1 35  ? 19.901  3.867   -0.824  1.00 0.95  ? 549 ASP A CG   5  
ATOM 9246  O OD1  . ASP A 1 35  ? 19.457  4.907   -1.354  1.00 1.80  ? 549 ASP A OD1  5  
ATOM 9247  O OD2  . ASP A 1 35  ? 21.104  3.742   -0.484  1.00 1.85  ? 549 ASP A OD2  5  
ATOM 9248  H H    . ASP A 1 35  ? 16.865  1.395   0.226   1.00 0.85  ? 549 ASP A H    5  
ATOM 9249  H HA   . ASP A 1 35  ? 18.810  3.112   1.608   1.00 0.88  ? 549 ASP A HA   5  
ATOM 9250  H HB2  . ASP A 1 35  ? 19.451  1.810   -0.367  1.00 0.89  ? 549 ASP A HB2  5  
ATOM 9251  H HB3  . ASP A 1 35  ? 18.233  2.617   -1.343  1.00 0.77  ? 549 ASP A HB3  5  
ATOM 9252  N N    . PRO A 1 36  ? 17.751  5.467   1.243   1.00 0.99  ? 550 PRO A N    5  
ATOM 9253  C CA   . PRO A 1 36  ? 16.964  6.702   1.300   1.00 1.15  ? 550 PRO A CA   5  
ATOM 9254  C C    . PRO A 1 36  ? 16.686  7.347   -0.064  1.00 1.13  ? 550 PRO A C    5  
ATOM 9255  O O    . PRO A 1 36  ? 15.825  8.217   -0.151  1.00 1.24  ? 550 PRO A O    5  
ATOM 9256  C CB   . PRO A 1 36  ? 17.780  7.655   2.180   1.00 1.43  ? 550 PRO A CB   5  
ATOM 9257  C CG   . PRO A 1 36  ? 19.215  7.188   1.954   1.00 1.39  ? 550 PRO A CG   5  
ATOM 9258  C CD   . PRO A 1 36  ? 19.036  5.675   1.898   1.00 1.16  ? 550 PRO A CD   5  
ATOM 9259  H HA   . PRO A 1 36  ? 16.007  6.494   1.782   1.00 1.16  ? 550 PRO A HA   5  
ATOM 9260  H HB2  . PRO A 1 36  ? 17.649  8.703   1.905   1.00 1.58  ? 550 PRO A HB2  5  
ATOM 9261  H HB3  . PRO A 1 36  ? 17.503  7.503   3.222   1.00 1.55  ? 550 PRO A HB3  5  
ATOM 9262  H HG2  . PRO A 1 36  ? 19.577  7.548   0.989   1.00 1.39  ? 550 PRO A HG2  5  
ATOM 9263  H HG3  . PRO A 1 36  ? 19.878  7.490   2.764   1.00 1.56  ? 550 PRO A HG3  5  
ATOM 9264  H HD2  . PRO A 1 36  ? 19.864  5.227   1.355   1.00 1.09  ? 550 PRO A HD2  5  
ATOM 9265  H HD3  . PRO A 1 36  ? 18.997  5.278   2.908   1.00 1.27  ? 550 PRO A HD3  5  
ATOM 9266  N N    . ASN A 1 37  ? 17.392  6.957   -1.125  1.00 1.07  ? 551 ASN A N    5  
ATOM 9267  C CA   . ASN A 1 37  ? 17.205  7.498   -2.474  1.00 1.15  ? 551 ASN A CA   5  
ATOM 9268  C C    . ASN A 1 37  ? 16.216  6.649   -3.281  1.00 1.00  ? 551 ASN A C    5  
ATOM 9269  O O    . ASN A 1 37  ? 15.375  7.194   -3.990  1.00 1.09  ? 551 ASN A O    5  
ATOM 9270  C CB   . ASN A 1 37  ? 18.567  7.637   -3.172  1.00 1.28  ? 551 ASN A CB   5  
ATOM 9271  C CG   . ASN A 1 37  ? 19.584  8.435   -2.376  1.00 1.48  ? 551 ASN A CG   5  
ATOM 9272  O OD1  . ASN A 1 37  ? 20.686  7.976   -2.119  1.00 2.48  ? 551 ASN A OD1  5  
ATOM 9273  N ND2  . ASN A 1 37  ? 19.291  9.659   -1.992  1.00 2.37  ? 551 ASN A ND2  5  
ATOM 9274  H H    . ASN A 1 37  ? 17.964  6.125   -1.014  1.00 1.02  ? 551 ASN A H    5  
ATOM 9275  H HA   . ASN A 1 37  ? 16.768  8.495   -2.401  1.00 1.27  ? 551 ASN A HA   5  
ATOM 9276  H HB2  . ASN A 1 37  ? 18.980  6.643   -3.349  1.00 1.21  ? 551 ASN A HB2  5  
ATOM 9277  H HB3  . ASN A 1 37  ? 18.417  8.124   -4.130  1.00 1.41  ? 551 ASN A HB3  5  
ATOM 9278  H HD21 . ASN A 1 37  ? 18.389  10.062  -2.236  1.00 3.51  ? 551 ASN A HD21 5  
ATOM 9279  H HD22 . ASN A 1 37  ? 19.847  10.062  -1.251  1.00 2.43  ? 551 ASN A HD22 5  
ATOM 9280  N N    . PHE A 1 38  ? 16.252  5.326   -3.098  1.00 0.82  ? 552 PHE A N    5  
ATOM 9281  C CA   . PHE A 1 38  ? 15.271  4.381   -3.646  1.00 0.72  ? 552 PHE A CA   5  
ATOM 9282  C C    . PHE A 1 38  ? 13.858  4.706   -3.148  1.00 0.62  ? 552 PHE A C    5  
ATOM 9283  O O    . PHE A 1 38  ? 12.931  4.829   -3.949  1.00 0.66  ? 552 PHE A O    5  
ATOM 9284  C CB   . PHE A 1 38  ? 15.686  2.946   -3.268  1.00 0.68  ? 552 PHE A CB   5  
ATOM 9285  C CG   . PHE A 1 38  ? 14.566  1.922   -3.310  1.00 0.69  ? 552 PHE A CG   5  
ATOM 9286  C CD1  . PHE A 1 38  ? 14.024  1.498   -4.538  1.00 1.76  ? 552 PHE A CD1  5  
ATOM 9287  C CD2  . PHE A 1 38  ? 14.030  1.425   -2.104  1.00 2.12  ? 552 PHE A CD2  5  
ATOM 9288  C CE1  . PHE A 1 38  ? 12.945  0.595   -4.556  1.00 1.67  ? 552 PHE A CE1  5  
ATOM 9289  C CE2  . PHE A 1 38  ? 12.961  0.513   -2.123  1.00 2.30  ? 552 PHE A CE2  5  
ATOM 9290  C CZ   . PHE A 1 38  ? 12.418  0.096   -3.350  1.00 0.99  ? 552 PHE A CZ   5  
ATOM 9291  H H    . PHE A 1 38  ? 16.944  4.974   -2.455  1.00 0.80  ? 552 PHE A H    5  
ATOM 9292  H HA   . PHE A 1 38  ? 15.252  4.468   -4.732  1.00 0.84  ? 552 PHE A HA   5  
ATOM 9293  H HB2  . PHE A 1 38  ? 16.489  2.622   -3.928  1.00 0.81  ? 552 PHE A HB2  5  
ATOM 9294  H HB3  . PHE A 1 38  ? 16.092  2.952   -2.258  1.00 0.65  ? 552 PHE A HB3  5  
ATOM 9295  H HD1  . PHE A 1 38  ? 14.426  1.874   -5.467  1.00 3.13  ? 552 PHE A HD1  5  
ATOM 9296  H HD2  . PHE A 1 38  ? 14.441  1.749   -1.160  1.00 3.39  ? 552 PHE A HD2  5  
ATOM 9297  H HE1  . PHE A 1 38  ? 12.517  0.283   -5.497  1.00 2.92  ? 552 PHE A HE1  5  
ATOM 9298  H HE2  . PHE A 1 38  ? 12.552  0.134   -1.197  1.00 3.70  ? 552 PHE A HE2  5  
ATOM 9299  H HZ   . PHE A 1 38  ? 11.596  -0.607  -3.364  1.00 1.17  ? 552 PHE A HZ   5  
ATOM 9300  N N    . VAL A 1 39  ? 13.698  4.918   -1.834  1.00 0.59  ? 553 VAL A N    5  
ATOM 9301  C CA   . VAL A 1 39  ? 12.372  5.233   -1.258  1.00 0.64  ? 553 VAL A CA   5  
ATOM 9302  C C    . VAL A 1 39  ? 11.823  6.562   -1.771  1.00 0.80  ? 553 VAL A C    5  
ATOM 9303  O O    . VAL A 1 39  ? 10.625  6.704   -1.990  1.00 0.87  ? 553 VAL A O    5  
ATOM 9304  C CB   . VAL A 1 39  ? 12.351  5.215   0.280   1.00 0.83  ? 553 VAL A CB   5  
ATOM 9305  C CG1  . VAL A 1 39  ? 13.018  3.945   0.771   1.00 1.26  ? 553 VAL A CG1  5  
ATOM 9306  C CG2  . VAL A 1 39  ? 13.090  6.336   1.004   1.00 1.57  ? 553 VAL A CG2  5  
ATOM 9307  H H    . VAL A 1 39  ? 14.497  4.768   -1.221  1.00 0.62  ? 553 VAL A H    5  
ATOM 9308  H HA   . VAL A 1 39  ? 11.691  4.444   -1.577  1.00 0.58  ? 553 VAL A HA   5  
ATOM 9309  H HB   . VAL A 1 39  ? 11.314  5.220   0.607   1.00 1.38  ? 553 VAL A HB   5  
ATOM 9310  H HG11 . VAL A 1 39  ? 14.097  4.028   0.609   1.00 2.18  ? 553 VAL A HG11 5  
ATOM 9311  H HG12 . VAL A 1 39  ? 12.829  3.831   1.837   1.00 1.93  ? 553 VAL A HG12 5  
ATOM 9312  H HG13 . VAL A 1 39  ? 12.615  3.093   0.226   1.00 2.11  ? 553 VAL A HG13 5  
ATOM 9313  H HG21 . VAL A 1 39  ? 12.575  7.284   0.860   1.00 2.59  ? 553 VAL A HG21 5  
ATOM 9314  H HG22 . VAL A 1 39  ? 13.130  6.097   2.070   1.00 1.87  ? 553 VAL A HG22 5  
ATOM 9315  H HG23 . VAL A 1 39  ? 14.106  6.391   0.626   1.00 2.52  ? 553 VAL A HG23 5  
ATOM 9316  N N    . THR A 1 40  ? 12.718  7.520   -2.002  1.00 0.91  ? 554 THR A N    5  
ATOM 9317  C CA   . THR A 1 40  ? 12.408  8.893   -2.416  1.00 1.07  ? 554 THR A CA   5  
ATOM 9318  C C    . THR A 1 40  ? 12.130  9.020   -3.906  1.00 1.07  ? 554 THR A C    5  
ATOM 9319  O O    . THR A 1 40  ? 11.175  9.697   -4.286  1.00 1.13  ? 554 THR A O    5  
ATOM 9320  C CB   . THR A 1 40  ? 13.530  9.834   -1.984  1.00 1.20  ? 554 THR A CB   5  
ATOM 9321  O OG1  . THR A 1 40  ? 13.483  9.892   -0.582  1.00 1.21  ? 554 THR A OG1  5  
ATOM 9322  C CG2  . THR A 1 40  ? 13.368  11.247  -2.536  1.00 1.54  ? 554 THR A CG2  5  
ATOM 9323  H H    . THR A 1 40  ? 13.674  7.293   -1.784  1.00 0.85  ? 554 THR A H    5  
ATOM 9324  H HA   . THR A 1 40  ? 11.510  9.216   -1.896  1.00 1.12  ? 554 THR A HA   5  
ATOM 9325  H HB   . THR A 1 40  ? 14.495  9.435   -2.300  1.00 1.08  ? 554 THR A HB   5  
ATOM 9326  H HG1  . THR A 1 40  ? 13.020  10.721  -0.337  1.00 2.26  ? 554 THR A HG1  5  
ATOM 9327  H HG21 . THR A 1 40  ? 13.600  11.245  -3.602  1.00 2.97  ? 554 THR A HG21 5  
ATOM 9328  H HG22 . THR A 1 40  ? 14.057  11.924  -2.032  1.00 1.88  ? 554 THR A HG22 5  
ATOM 9329  H HG23 . THR A 1 40  ? 12.339  11.581  -2.394  1.00 1.75  ? 554 THR A HG23 5  
ATOM 9330  N N    . ALA A 1 41  ? 12.881  8.322   -4.762  1.00 1.02  ? 555 ALA A N    5  
ATOM 9331  C CA   . ALA A 1 41  ? 12.630  8.302   -6.206  1.00 1.09  ? 555 ALA A CA   5  
ATOM 9332  C C    . ALA A 1 41  ? 11.225  7.751   -6.560  1.00 0.95  ? 555 ALA A C    5  
ATOM 9333  O O    . ALA A 1 41  ? 10.711  7.977   -7.662  1.00 1.13  ? 555 ALA A O    5  
ATOM 9334  C CB   . ALA A 1 41  ? 13.763  7.514   -6.871  1.00 1.13  ? 555 ALA A CB   5  
ATOM 9335  H H    . ALA A 1 41  ? 13.672  7.784   -4.407  1.00 0.97  ? 555 ALA A H    5  
ATOM 9336  H HA   . ALA A 1 41  ? 12.677  9.335   -6.558  1.00 1.26  ? 555 ALA A HA   5  
ATOM 9337  H HB1  . ALA A 1 41  ? 13.813  6.509   -6.450  1.00 1.80  ? 555 ALA A HB1  5  
ATOM 9338  H HB2  . ALA A 1 41  ? 13.594  7.452   -7.947  1.00 2.17  ? 555 ALA A HB2  5  
ATOM 9339  H HB3  . ALA A 1 41  ? 14.713  8.019   -6.691  1.00 1.52  ? 555 ALA A HB3  5  
ATOM 9340  N N    . MET A 1 42  ? 10.586  7.055   -5.611  1.00 0.70  ? 556 MET A N    5  
ATOM 9341  C CA   . MET A 1 42  ? 9.199   6.580   -5.680  1.00 0.61  ? 556 MET A CA   5  
ATOM 9342  C C    . MET A 1 42  ? 8.148   7.686   -5.438  1.00 0.59  ? 556 MET A C    5  
ATOM 9343  O O    . MET A 1 42  ? 7.033   7.595   -5.954  1.00 0.65  ? 556 MET A O    5  
ATOM 9344  C CB   . MET A 1 42  ? 9.061   5.460   -4.638  1.00 0.68  ? 556 MET A CB   5  
ATOM 9345  C CG   . MET A 1 42  ? 7.965   4.442   -4.967  1.00 0.63  ? 556 MET A CG   5  
ATOM 9346  S SD   . MET A 1 42  ? 7.848   3.033   -3.820  1.00 0.76  ? 556 MET A SD   5  
ATOM 9347  C CE   . MET A 1 42  ? 9.586   2.641   -3.443  1.00 0.74  ? 556 MET A CE   5  
ATOM 9348  H H    . MET A 1 42  ? 11.101  6.875   -4.753  1.00 0.65  ? 556 MET A H    5  
ATOM 9349  H HA   . MET A 1 42  ? 9.026   6.158   -6.671  1.00 0.70  ? 556 MET A HA   5  
ATOM 9350  H HB2  . MET A 1 42  ? 10.012  4.931   -4.589  1.00 1.04  ? 556 MET A HB2  5  
ATOM 9351  H HB3  . MET A 1 42  ? 8.858   5.891   -3.657  1.00 1.07  ? 556 MET A HB3  5  
ATOM 9352  H HG2  . MET A 1 42  ? 7.001   4.952   -4.979  1.00 0.95  ? 556 MET A HG2  5  
ATOM 9353  H HG3  . MET A 1 42  ? 8.140   4.050   -5.968  1.00 0.91  ? 556 MET A HG3  5  
ATOM 9354  H HE1  . MET A 1 42  ? 10.186  2.609   -4.357  1.00 1.42  ? 556 MET A HE1  5  
ATOM 9355  H HE2  . MET A 1 42  ? 9.986   3.405   -2.774  1.00 1.84  ? 556 MET A HE2  5  
ATOM 9356  H HE3  . MET A 1 42  ? 9.638   1.674   -2.942  1.00 1.72  ? 556 MET A HE3  5  
ATOM 9357  N N    . LEU A 1 43  ? 8.486   8.742   -4.686  1.00 0.67  ? 557 LEU A N    5  
ATOM 9358  C CA   . LEU A 1 43  ? 7.553   9.769   -4.184  1.00 0.78  ? 557 LEU A CA   5  
ATOM 9359  C C    . LEU A 1 43  ? 7.198   10.848  -5.225  1.00 0.79  ? 557 LEU A C    5  
ATOM 9360  O O    . LEU A 1 43  ? 6.196   11.552  -5.081  1.00 0.86  ? 557 LEU A O    5  
ATOM 9361  C CB   . LEU A 1 43  ? 8.145   10.429  -2.915  1.00 1.00  ? 557 LEU A CB   5  
ATOM 9362  C CG   . LEU A 1 43  ? 8.582   9.457   -1.801  1.00 0.94  ? 557 LEU A CG   5  
ATOM 9363  C CD1  . LEU A 1 43  ? 9.113   10.198  -0.576  1.00 1.16  ? 557 LEU A CD1  5  
ATOM 9364  C CD2  . LEU A 1 43  ? 7.453   8.539   -1.338  1.00 0.96  ? 557 LEU A CD2  5  
ATOM 9365  H H    . LEU A 1 43  ? 9.445   8.793   -4.354  1.00 0.72  ? 557 LEU A H    5  
ATOM 9366  H HA   . LEU A 1 43  ? 6.619   9.283   -3.897  1.00 0.79  ? 557 LEU A HA   5  
ATOM 9367  H HB2  . LEU A 1 43  ? 9.013   11.021  -3.205  1.00 1.11  ? 557 LEU A HB2  5  
ATOM 9368  H HB3  . LEU A 1 43  ? 7.401   11.114  -2.505  1.00 1.20  ? 557 LEU A HB3  5  
ATOM 9369  H HG   . LEU A 1 43  ? 9.395   8.852   -2.187  1.00 0.81  ? 557 LEU A HG   5  
ATOM 9370  H HD11 . LEU A 1 43  ? 10.008  10.752  -0.853  1.00 2.39  ? 557 LEU A HD11 5  
ATOM 9371  H HD12 . LEU A 1 43  ? 9.388   9.478   0.194   1.00 1.77  ? 557 LEU A HD12 5  
ATOM 9372  H HD13 . LEU A 1 43  ? 8.353   10.875  -0.185  1.00 1.48  ? 557 LEU A HD13 5  
ATOM 9373  H HD21 . LEU A 1 43  ? 6.588   9.130   -1.037  1.00 1.82  ? 557 LEU A HD21 5  
ATOM 9374  H HD22 . LEU A 1 43  ? 7.790   7.941   -0.494  1.00 1.79  ? 557 LEU A HD22 5  
ATOM 9375  H HD23 . LEU A 1 43  ? 7.187   7.856   -2.140  1.00 1.58  ? 557 LEU A HD23 5  
ATOM 9376  N N    . THR A 1 44  ? 7.988   10.980  -6.296  1.00 0.81  ? 558 THR A N    5  
ATOM 9377  C CA   . THR A 1 44  ? 7.977   12.143  -7.213  1.00 0.91  ? 558 THR A CA   5  
ATOM 9378  C C    . THR A 1 44  ? 6.657   12.395  -7.969  1.00 0.83  ? 558 THR A C    5  
ATOM 9379  O O    . THR A 1 44  ? 6.410   13.511  -8.434  1.00 1.05  ? 558 THR A O    5  
ATOM 9380  C CB   . THR A 1 44  ? 9.158   12.021  -8.190  1.00 1.07  ? 558 THR A CB   5  
ATOM 9381  O OG1  . THR A 1 44  ? 9.562   13.295  -8.628  1.00 2.23  ? 558 THR A OG1  5  
ATOM 9382  C CG2  . THR A 1 44  ? 8.872   11.148  -9.415  1.00 2.87  ? 558 THR A CG2  5  
ATOM 9383  H H    . THR A 1 44  ? 8.787   10.363  -6.331  1.00 0.79  ? 558 THR A H    5  
ATOM 9384  H HA   . THR A 1 44  ? 8.158   13.028  -6.605  1.00 1.09  ? 558 THR A HA   5  
ATOM 9385  H HB   . THR A 1 44  ? 9.998   11.584  -7.651  1.00 2.10  ? 558 THR A HB   5  
ATOM 9386  H HG1  . THR A 1 44  ? 10.434  13.153  -9.039  1.00 2.40  ? 558 THR A HG1  5  
ATOM 9387  H HG21 . THR A 1 44  ? 9.776   11.055  -10.014 1.00 3.58  ? 558 THR A HG21 5  
ATOM 9388  H HG22 . THR A 1 44  ? 8.102   11.598  -10.042 1.00 3.91  ? 558 THR A HG22 5  
ATOM 9389  H HG23 . THR A 1 44  ? 8.558   10.153  -9.101  1.00 3.57  ? 558 THR A HG23 5  
ATOM 9390  N N    . LYS A 1 45  ? 5.793   11.376  -8.091  1.00 0.67  ? 559 LYS A N    5  
ATOM 9391  C CA   . LYS A 1 45  ? 4.428   11.448  -8.665  1.00 0.76  ? 559 LYS A CA   5  
ATOM 9392  C C    . LYS A 1 45  ? 3.308   10.984  -7.719  1.00 0.88  ? 559 LYS A C    5  
ATOM 9393  O O    . LYS A 1 45  ? 2.152   10.924  -8.138  1.00 1.25  ? 559 LYS A O    5  
ATOM 9394  C CB   . LYS A 1 45  ? 4.390   10.673  -9.998  1.00 0.93  ? 559 LYS A CB   5  
ATOM 9395  C CG   . LYS A 1 45  ? 4.762   9.181   -9.872  1.00 1.23  ? 559 LYS A CG   5  
ATOM 9396  C CD   . LYS A 1 45  ? 3.715   8.211   -10.446 1.00 1.56  ? 559 LYS A CD   5  
ATOM 9397  C CE   . LYS A 1 45  ? 2.556   7.944   -9.472  1.00 1.84  ? 559 LYS A CE   5  
ATOM 9398  N NZ   . LYS A 1 45  ? 1.551   7.022   -10.056 1.00 2.74  ? 559 LYS A NZ   5  
ATOM 9399  H H    . LYS A 1 45  ? 6.098   10.486  -7.726  1.00 0.65  ? 559 LYS A H    5  
ATOM 9400  H HA   . LYS A 1 45  ? 4.195   12.491  -8.890  1.00 0.83  ? 559 LYS A HA   5  
ATOM 9401  H HB2  . LYS A 1 45  ? 3.396   10.769  -10.434 1.00 1.07  ? 559 LYS A HB2  5  
ATOM 9402  H HB3  . LYS A 1 45  ? 5.086   11.144  -10.693 1.00 0.98  ? 559 LYS A HB3  5  
ATOM 9403  H HG2  . LYS A 1 45  ? 5.698   9.026   -10.411 1.00 1.33  ? 559 LYS A HG2  5  
ATOM 9404  H HG3  . LYS A 1 45  ? 4.948   8.922   -8.831  1.00 1.72  ? 559 LYS A HG3  5  
ATOM 9405  H HD2  . LYS A 1 45  ? 3.336   8.594   -11.395 1.00 2.16  ? 559 LYS A HD2  5  
ATOM 9406  H HD3  . LYS A 1 45  ? 4.218   7.262   -10.639 1.00 1.89  ? 559 LYS A HD3  5  
ATOM 9407  H HE2  . LYS A 1 45  ? 2.970   7.498   -8.562  1.00 1.86  ? 559 LYS A HE2  5  
ATOM 9408  H HE3  . LYS A 1 45  ? 2.073   8.884   -9.193  1.00 1.87  ? 559 LYS A HE3  5  
ATOM 9409  H HZ1  . LYS A 1 45  ? 0.930   7.488   -10.712 1.00 3.31  ? 559 LYS A HZ1  5  
ATOM 9410  H HZ2  . LYS A 1 45  ? 0.959   6.608   -9.340  1.00 3.51  ? 559 LYS A HZ2  5  
ATOM 9411  H HZ3  . LYS A 1 45  ? 2.002   6.265   -10.566 1.00 2.91  ? 559 LYS A HZ3  5  
ATOM 9412  N N    . LEU A 1 46  ? 3.662   10.594  -6.492  1.00 0.75  ? 560 LEU A N    5  
ATOM 9413  C CA   . LEU A 1 46  ? 2.864   9.742   -5.602  1.00 0.82  ? 560 LEU A CA   5  
ATOM 9414  C C    . LEU A 1 46  ? 1.685   10.527  -4.990  1.00 1.17  ? 560 LEU A C    5  
ATOM 9415  O O    . LEU A 1 46  ? 1.890   11.614  -4.438  1.00 1.80  ? 560 LEU A O    5  
ATOM 9416  C CB   . LEU A 1 46  ? 3.840   9.133   -4.574  1.00 1.18  ? 560 LEU A CB   5  
ATOM 9417  C CG   . LEU A 1 46  ? 3.432   7.769   -3.992  1.00 1.37  ? 560 LEU A CG   5  
ATOM 9418  C CD1  . LEU A 1 46  ? 4.590   7.198   -3.178  1.00 2.67  ? 560 LEU A CD1  5  
ATOM 9419  C CD2  . LEU A 1 46  ? 2.245   7.852   -3.045  1.00 1.21  ? 560 LEU A CD2  5  
ATOM 9420  H H    . LEU A 1 46  ? 4.600   10.813  -6.188  1.00 0.75  ? 560 LEU A H    5  
ATOM 9421  H HA   . LEU A 1 46  ? 2.466   8.913   -6.192  1.00 0.76  ? 560 LEU A HA   5  
ATOM 9422  H HB2  . LEU A 1 46  ? 4.783   8.961   -5.090  1.00 1.71  ? 560 LEU A HB2  5  
ATOM 9423  H HB3  . LEU A 1 46  ? 4.023   9.846   -3.769  1.00 1.63  ? 560 LEU A HB3  5  
ATOM 9424  H HG   . LEU A 1 46  ? 3.196   7.091   -4.809  1.00 2.71  ? 560 LEU A HG   5  
ATOM 9425  H HD11 . LEU A 1 46  ? 4.309   6.240   -2.748  1.00 3.16  ? 560 LEU A HD11 5  
ATOM 9426  H HD12 . LEU A 1 46  ? 4.842   7.882   -2.368  1.00 3.38  ? 560 LEU A HD12 5  
ATOM 9427  H HD13 . LEU A 1 46  ? 5.457   7.046   -3.821  1.00 3.57  ? 560 LEU A HD13 5  
ATOM 9428  H HD21 . LEU A 1 46  ? 1.346   8.100   -3.600  1.00 2.47  ? 560 LEU A HD21 5  
ATOM 9429  H HD22 . LEU A 1 46  ? 2.445   8.600   -2.279  1.00 1.98  ? 560 LEU A HD22 5  
ATOM 9430  H HD23 . LEU A 1 46  ? 2.080   6.884   -2.573  1.00 2.09  ? 560 LEU A HD23 5  
ATOM 9431  N N    . LYS A 1 47  ? 0.462   9.999   -5.129  1.00 0.97  ? 561 LYS A N    5  
ATOM 9432  C CA   . LYS A 1 47  ? -0.821  10.722  -5.002  1.00 1.21  ? 561 LYS A CA   5  
ATOM 9433  C C    . LYS A 1 47  ? -1.657  10.324  -3.774  1.00 1.01  ? 561 LYS A C    5  
ATOM 9434  O O    . LYS A 1 47  ? -1.726  9.144   -3.425  1.00 0.75  ? 561 LYS A O    5  
ATOM 9435  C CB   . LYS A 1 47  ? -1.622  10.464  -6.291  1.00 1.50  ? 561 LYS A CB   5  
ATOM 9436  C CG   . LYS A 1 47  ? -2.642  11.561  -6.634  1.00 1.86  ? 561 LYS A CG   5  
ATOM 9437  C CD   . LYS A 1 47  ? -2.150  12.521  -7.735  1.00 2.37  ? 561 LYS A CD   5  
ATOM 9438  C CE   . LYS A 1 47  ? -0.791  13.170  -7.421  1.00 2.48  ? 561 LYS A CE   5  
ATOM 9439  N NZ   . LYS A 1 47  ? -0.344  14.054  -8.521  1.00 2.86  ? 561 LYS A NZ   5  
ATOM 9440  H H    . LYS A 1 47  ? 0.421   9.081   -5.565  1.00 0.83  ? 561 LYS A H    5  
ATOM 9441  H HA   . LYS A 1 47  ? -0.611  11.789  -4.922  1.00 1.44  ? 561 LYS A HA   5  
ATOM 9442  H HB2  . LYS A 1 47  ? -0.936  10.360  -7.130  1.00 1.89  ? 561 LYS A HB2  5  
ATOM 9443  H HB3  . LYS A 1 47  ? -2.149  9.512   -6.193  1.00 1.56  ? 561 LYS A HB3  5  
ATOM 9444  H HG2  . LYS A 1 47  ? -3.547  11.068  -6.983  1.00 1.96  ? 561 LYS A HG2  5  
ATOM 9445  H HG3  . LYS A 1 47  ? -2.909  12.126  -5.744  1.00 2.04  ? 561 LYS A HG3  5  
ATOM 9446  H HD2  . LYS A 1 47  ? -2.070  11.962  -8.669  1.00 2.48  ? 561 LYS A HD2  5  
ATOM 9447  H HD3  . LYS A 1 47  ? -2.902  13.300  -7.870  1.00 2.86  ? 561 LYS A HD3  5  
ATOM 9448  H HE2  . LYS A 1 47  ? -0.878  13.746  -6.497  1.00 2.58  ? 561 LYS A HE2  5  
ATOM 9449  H HE3  . LYS A 1 47  ? -0.047  12.383  -7.264  1.00 2.36  ? 561 LYS A HE3  5  
ATOM 9450  H HZ1  . LYS A 1 47  ? -0.265  13.542  -9.397  1.00 2.60  ? 561 LYS A HZ1  5  
ATOM 9451  H HZ2  . LYS A 1 47  ? 0.577   14.447  -8.345  1.00 3.64  ? 561 LYS A HZ2  5  
ATOM 9452  H HZ3  . LYS A 1 47  ? -0.998  14.821  -8.661  1.00 3.39  ? 561 LYS A HZ3  5  
ATOM 9453  N N    . PHE A 1 48  ? -2.334  11.301  -3.165  1.00 1.32  ? 562 PHE A N    5  
ATOM 9454  C CA   . PHE A 1 48  ? -3.188  11.118  -1.976  1.00 1.24  ? 562 PHE A CA   5  
ATOM 9455  C C    . PHE A 1 48  ? -4.695  11.103  -2.313  1.00 1.17  ? 562 PHE A C    5  
ATOM 9456  O O    . PHE A 1 48  ? -5.135  11.779  -3.245  1.00 1.25  ? 562 PHE A O    5  
ATOM 9457  C CB   . PHE A 1 48  ? -2.812  12.144  -0.887  1.00 1.38  ? 562 PHE A CB   5  
ATOM 9458  C CG   . PHE A 1 48  ? -3.864  13.189  -0.567  1.00 1.22  ? 562 PHE A CG   5  
ATOM 9459  C CD1  . PHE A 1 48  ? -3.903  14.411  -1.264  1.00 2.04  ? 562 PHE A CD1  5  
ATOM 9460  C CD2  . PHE A 1 48  ? -4.822  12.920  0.427   1.00 1.91  ? 562 PHE A CD2  5  
ATOM 9461  C CE1  . PHE A 1 48  ? -4.907  15.355  -0.975  1.00 2.13  ? 562 PHE A CE1  5  
ATOM 9462  C CE2  . PHE A 1 48  ? -5.821  13.864  0.718   1.00 1.90  ? 562 PHE A CE2  5  
ATOM 9463  C CZ   . PHE A 1 48  ? -5.870  15.079  0.012   1.00 1.35  ? 562 PHE A CZ   5  
ATOM 9464  H H    . PHE A 1 48  ? -2.281  12.227  -3.577  1.00 1.63  ? 562 PHE A H    5  
ATOM 9465  H HA   . PHE A 1 48  ? -2.963  10.140  -1.554  1.00 1.22  ? 562 PHE A HA   5  
ATOM 9466  H HB2  . PHE A 1 48  ? -2.616  11.588  0.029   1.00 1.48  ? 562 PHE A HB2  5  
ATOM 9467  H HB3  . PHE A 1 48  ? -1.881  12.648  -1.152  1.00 1.76  ? 562 PHE A HB3  5  
ATOM 9468  H HD1  . PHE A 1 48  ? -3.166  14.621  -2.027  1.00 3.08  ? 562 PHE A HD1  5  
ATOM 9469  H HD2  . PHE A 1 48  ? -4.794  11.975  0.956   1.00 2.97  ? 562 PHE A HD2  5  
ATOM 9470  H HE1  . PHE A 1 48  ? -4.938  16.294  -1.512  1.00 3.23  ? 562 PHE A HE1  5  
ATOM 9471  H HE2  . PHE A 1 48  ? -6.549  13.655  1.490   1.00 2.92  ? 562 PHE A HE2  5  
ATOM 9472  H HZ   . PHE A 1 48  ? -6.644  15.801  0.233   1.00 1.54  ? 562 PHE A HZ   5  
ATOM 9473  N N    . GLU A 1 49  ? -5.500  10.359  -1.545  1.00 1.07  ? 563 GLU A N    5  
ATOM 9474  C CA   . GLU A 1 49  ? -6.947  10.168  -1.762  1.00 1.00  ? 563 GLU A CA   5  
ATOM 9475  C C    . GLU A 1 49  ? -7.739  10.154  -0.436  1.00 0.91  ? 563 GLU A C    5  
ATOM 9476  O O    . GLU A 1 49  ? -7.172  9.979   0.640   1.00 1.07  ? 563 GLU A O    5  
ATOM 9477  C CB   . GLU A 1 49  ? -7.184  8.871   -2.566  1.00 1.04  ? 563 GLU A CB   5  
ATOM 9478  C CG   . GLU A 1 49  ? -6.792  9.043   -4.045  1.00 2.26  ? 563 GLU A CG   5  
ATOM 9479  C CD   . GLU A 1 49  ? -6.904  7.761   -4.872  1.00 2.52  ? 563 GLU A CD   5  
ATOM 9480  O OE1  . GLU A 1 49  ? -7.836  6.949   -4.691  1.00 2.51  ? 563 GLU A OE1  5  
ATOM 9481  O OE2  . GLU A 1 49  ? -6.031  7.536   -5.751  1.00 3.65  ? 563 GLU A OE2  5  
ATOM 9482  H H    . GLU A 1 49  ? -5.106  9.902   -0.724  1.00 1.06  ? 563 GLU A H    5  
ATOM 9483  H HA   . GLU A 1 49  ? -7.341  11.002  -2.346  1.00 1.02  ? 563 GLU A HA   5  
ATOM 9484  H HB2  . GLU A 1 49  ? -6.607  8.057   -2.125  1.00 1.82  ? 563 GLU A HB2  5  
ATOM 9485  H HB3  . GLU A 1 49  ? -8.240  8.605   -2.520  1.00 1.47  ? 563 GLU A HB3  5  
ATOM 9486  H HG2  . GLU A 1 49  ? -7.424  9.813   -4.496  1.00 2.95  ? 563 GLU A HG2  5  
ATOM 9487  H HG3  . GLU A 1 49  ? -5.757  9.378   -4.104  1.00 3.42  ? 563 GLU A HG3  5  
ATOM 9488  N N    . VAL A 1 50  ? -9.059  10.355  -0.488  1.00 0.76  ? 564 VAL A N    5  
ATOM 9489  C CA   . VAL A 1 50  ? -9.946  10.402  0.696   1.00 0.70  ? 564 VAL A CA   5  
ATOM 9490  C C    . VAL A 1 50  ? -11.229 9.602   0.471   1.00 0.68  ? 564 VAL A C    5  
ATOM 9491  O O    . VAL A 1 50  ? -11.779 9.606   -0.632  1.00 0.74  ? 564 VAL A O    5  
ATOM 9492  C CB   . VAL A 1 50  ? -10.318 11.855  1.063   1.00 0.74  ? 564 VAL A CB   5  
ATOM 9493  C CG1  . VAL A 1 50  ? -10.980 11.992  2.433   1.00 0.84  ? 564 VAL A CG1  5  
ATOM 9494  C CG2  . VAL A 1 50  ? -9.094  12.770  1.090   1.00 0.75  ? 564 VAL A CG2  5  
ATOM 9495  H H    . VAL A 1 50  ? -9.466  10.573  -1.390  1.00 0.75  ? 564 VAL A H    5  
ATOM 9496  H HA   . VAL A 1 50  ? -9.427  9.963   1.545   1.00 0.69  ? 564 VAL A HA   5  
ATOM 9497  H HB   . VAL A 1 50  ? -11.019 12.246  0.331   1.00 0.76  ? 564 VAL A HB   5  
ATOM 9498  H HG11 . VAL A 1 50  ? -11.394 12.993  2.489   1.00 1.86  ? 564 VAL A HG11 5  
ATOM 9499  H HG12 . VAL A 1 50  ? -11.810 11.302  2.558   1.00 1.40  ? 564 VAL A HG12 5  
ATOM 9500  H HG13 . VAL A 1 50  ? -10.248 11.838  3.230   1.00 1.90  ? 564 VAL A HG13 5  
ATOM 9501  H HG21 . VAL A 1 50  ? -9.372  13.757  1.463   1.00 1.82  ? 564 VAL A HG21 5  
ATOM 9502  H HG22 . VAL A 1 50  ? -8.337  12.327  1.738   1.00 1.71  ? 564 VAL A HG22 5  
ATOM 9503  H HG23 . VAL A 1 50  ? -8.699  12.868  0.078   1.00 1.42  ? 564 VAL A HG23 5  
ATOM 9504  N N    . PHE A 1 51  ? -11.762 8.983   1.525   1.00 0.64  ? 565 PHE A N    5  
ATOM 9505  C CA   . PHE A 1 51  ? -13.090 8.357   1.543   1.00 0.65  ? 565 PHE A CA   5  
ATOM 9506  C C    . PHE A 1 51  ? -13.899 8.821   2.763   1.00 0.64  ? 565 PHE A C    5  
ATOM 9507  O O    . PHE A 1 51  ? -13.340 9.037   3.839   1.00 0.62  ? 565 PHE A O    5  
ATOM 9508  C CB   . PHE A 1 51  ? -12.958 6.834   1.502   1.00 0.65  ? 565 PHE A CB   5  
ATOM 9509  C CG   . PHE A 1 51  ? -12.241 6.288   0.279   1.00 0.70  ? 565 PHE A CG   5  
ATOM 9510  C CD1  . PHE A 1 51  ? -10.832 6.295   0.214   1.00 2.02  ? 565 PHE A CD1  5  
ATOM 9511  C CD2  . PHE A 1 51  ? -12.988 5.727   -0.773  1.00 1.55  ? 565 PHE A CD2  5  
ATOM 9512  C CE1  . PHE A 1 51  ? -10.175 5.738   -0.898  1.00 2.14  ? 565 PHE A CE1  5  
ATOM 9513  C CE2  . PHE A 1 51  ? -12.329 5.161   -1.877  1.00 1.50  ? 565 PHE A CE2  5  
ATOM 9514  C CZ   . PHE A 1 51  ? -10.924 5.158   -1.934  1.00 0.91  ? 565 PHE A CZ   5  
ATOM 9515  H H    . PHE A 1 51  ? -11.258 9.023   2.408   1.00 0.63  ? 565 PHE A H    5  
ATOM 9516  H HA   . PHE A 1 51  ? -13.644 8.656   0.654   1.00 0.73  ? 565 PHE A HA   5  
ATOM 9517  H HB2  . PHE A 1 51  ? -12.428 6.501   2.389   1.00 0.60  ? 565 PHE A HB2  5  
ATOM 9518  H HB3  . PHE A 1 51  ? -13.957 6.398   1.548   1.00 0.72  ? 565 PHE A HB3  5  
ATOM 9519  H HD1  . PHE A 1 51  ? -10.248 6.724   1.019   1.00 3.20  ? 565 PHE A HD1  5  
ATOM 9520  H HD2  . PHE A 1 51  ? -14.067 5.713   -0.728  1.00 2.77  ? 565 PHE A HD2  5  
ATOM 9521  H HE1  . PHE A 1 51  ? -9.096  5.744   -0.955  1.00 3.39  ? 565 PHE A HE1  5  
ATOM 9522  H HE2  . PHE A 1 51  ? -12.905 4.713   -2.673  1.00 2.63  ? 565 PHE A HE2  5  
ATOM 9523  H HZ   . PHE A 1 51  ? -10.416 4.708   -2.776  1.00 1.02  ? 565 PHE A HZ   5  
ATOM 9524  N N    . GLN A 1 52  ? -15.211 8.986   2.591   1.00 0.72  ? 566 GLN A N    5  
ATOM 9525  C CA   . GLN A 1 52  ? -16.134 9.451   3.634   1.00 0.75  ? 566 GLN A CA   5  
ATOM 9526  C C    . GLN A 1 52  ? -16.647 8.266   4.499   1.00 0.72  ? 566 GLN A C    5  
ATOM 9527  O O    . GLN A 1 52  ? -16.564 7.114   4.060   1.00 0.72  ? 566 GLN A O    5  
ATOM 9528  C CB   . GLN A 1 52  ? -17.306 10.212  2.980   1.00 0.86  ? 566 GLN A CB   5  
ATOM 9529  C CG   . GLN A 1 52  ? -17.030 11.213  1.854   1.00 1.19  ? 566 GLN A CG   5  
ATOM 9530  C CD   . GLN A 1 52  ? -16.176 12.355  2.342   1.00 1.37  ? 566 GLN A CD   5  
ATOM 9531  O OE1  . GLN A 1 52  ? -16.608 13.234  3.084   1.00 2.87  ? 566 GLN A OE1  5  
ATOM 9532  N NE2  . GLN A 1 52  ? -14.917 12.356  1.998   1.00 1.03  ? 566 GLN A NE2  5  
ATOM 9533  H H    . GLN A 1 52  ? -15.613 8.704   1.701   1.00 0.78  ? 566 GLN A H    5  
ATOM 9534  H HA   . GLN A 1 52  ? -15.598 10.142  4.292   1.00 0.79  ? 566 GLN A HA   5  
ATOM 9535  H HB2  . GLN A 1 52  ? -17.960 9.484   2.537   1.00 0.98  ? 566 GLN A HB2  5  
ATOM 9536  H HB3  . GLN A 1 52  ? -17.835 10.745  3.765   1.00 1.03  ? 566 GLN A HB3  5  
ATOM 9537  H HG2  . GLN A 1 52  ? -16.550 10.712  1.013   1.00 2.02  ? 566 GLN A HG2  5  
ATOM 9538  H HG3  . GLN A 1 52  ? -17.977 11.619  1.500   1.00 2.14  ? 566 GLN A HG3  5  
ATOM 9539  H HE21 . GLN A 1 52  ? -14.579 11.737  1.264   1.00 1.45  ? 566 GLN A HE21 5  
ATOM 9540  H HE22 . GLN A 1 52  ? -14.352 13.065  2.409   1.00 1.76  ? 566 GLN A HE22 5  
ATOM 9541  N N    . PRO A 1 53  ? -17.221 8.498   5.701   1.00 0.76  ? 567 PRO A N    5  
ATOM 9542  C CA   . PRO A 1 53  ? -17.593 7.417   6.620   1.00 0.77  ? 567 PRO A CA   5  
ATOM 9543  C C    . PRO A 1 53  ? -18.624 6.444   6.024   1.00 0.80  ? 567 PRO A C    5  
ATOM 9544  O O    . PRO A 1 53  ? -19.685 6.866   5.552   1.00 0.90  ? 567 PRO A O    5  
ATOM 9545  C CB   . PRO A 1 53  ? -18.147 8.090   7.885   1.00 0.84  ? 567 PRO A CB   5  
ATOM 9546  C CG   . PRO A 1 53  ? -17.720 9.553   7.785   1.00 0.85  ? 567 PRO A CG   5  
ATOM 9547  C CD   . PRO A 1 53  ? -17.516 9.795   6.294   1.00 0.83  ? 567 PRO A CD   5  
ATOM 9548  H HA   . PRO A 1 53  ? -16.689 6.867   6.885   1.00 0.74  ? 567 PRO A HA   5  
ATOM 9549  H HB2  . PRO A 1 53  ? -19.234 8.043   7.900   1.00 0.91  ? 567 PRO A HB2  5  
ATOM 9550  H HB3  . PRO A 1 53  ? -17.756 7.623   8.788   1.00 0.86  ? 567 PRO A HB3  5  
ATOM 9551  H HG2  . PRO A 1 53  ? -18.479 10.221  8.195   1.00 0.92  ? 567 PRO A HG2  5  
ATOM 9552  H HG3  . PRO A 1 53  ? -16.782 9.698   8.309   1.00 0.85  ? 567 PRO A HG3  5  
ATOM 9553  H HD2  . PRO A 1 53  ? -18.441 10.185  5.867   1.00 0.89  ? 567 PRO A HD2  5  
ATOM 9554  H HD3  . PRO A 1 53  ? -16.703 10.508  6.145   1.00 0.84  ? 567 PRO A HD3  5  
ATOM 9555  N N    . GLY A 1 54  ? -18.326 5.141   6.064   1.00 0.77  ? 568 GLY A N    5  
ATOM 9556  C CA   . GLY A 1 54  ? -19.209 4.057   5.625   1.00 0.85  ? 568 GLY A CA   5  
ATOM 9557  C C    . GLY A 1 54  ? -18.942 3.574   4.199   1.00 0.88  ? 568 GLY A C    5  
ATOM 9558  O O    . GLY A 1 54  ? -19.576 2.612   3.757   1.00 1.05  ? 568 GLY A O    5  
ATOM 9559  H H    . GLY A 1 54  ? -17.396 4.862   6.341   1.00 0.73  ? 568 GLY A H    5  
ATOM 9560  H HA2  . GLY A 1 54  ? -19.083 3.208   6.294   1.00 0.86  ? 568 GLY A HA2  5  
ATOM 9561  H HA3  . GLY A 1 54  ? -20.247 4.384   5.682   1.00 0.92  ? 568 GLY A HA3  5  
ATOM 9562  N N    . ASP A 1 55  ? -18.010 4.212   3.480   1.00 0.81  ? 569 ASP A N    5  
ATOM 9563  C CA   . ASP A 1 55  ? -17.736 3.938   2.077   1.00 0.86  ? 569 ASP A CA   5  
ATOM 9564  C C    . ASP A 1 55  ? -16.673 2.842   1.898   1.00 0.81  ? 569 ASP A C    5  
ATOM 9565  O O    . ASP A 1 55  ? -15.599 2.895   2.501   1.00 0.79  ? 569 ASP A O    5  
ATOM 9566  C CB   . ASP A 1 55  ? -17.364 5.246   1.347   1.00 0.91  ? 569 ASP A CB   5  
ATOM 9567  C CG   . ASP A 1 55  ? -17.619 5.179   -0.162  1.00 1.00  ? 569 ASP A CG   5  
ATOM 9568  O OD1  . ASP A 1 55  ? -18.715 4.722   -0.558  1.00 1.97  ? 569 ASP A OD1  5  
ATOM 9569  O OD2  . ASP A 1 55  ? -16.763 5.621   -0.967  1.00 2.12  ? 569 ASP A OD2  5  
ATOM 9570  H H    . ASP A 1 55  ? -17.499 4.975   3.895   1.00 0.76  ? 569 ASP A H    5  
ATOM 9571  H HA   . ASP A 1 55  ? -18.674 3.581   1.675   1.00 0.95  ? 569 ASP A HA   5  
ATOM 9572  H HB2  . ASP A 1 55  ? -17.971 6.061   1.745   1.00 1.03  ? 569 ASP A HB2  5  
ATOM 9573  H HB3  . ASP A 1 55  ? -16.316 5.484   1.540   1.00 0.91  ? 569 ASP A HB3  5  
ATOM 9574  N N    . TYR A 1 56  ? -16.957 1.845   1.059   1.00 0.85  ? 570 TYR A N    5  
ATOM 9575  C CA   . TYR A 1 56  ? -15.992 0.796   0.700   1.00 0.88  ? 570 TYR A CA   5  
ATOM 9576  C C    . TYR A 1 56  ? -14.810 1.402   -0.067  1.00 0.88  ? 570 TYR A C    5  
ATOM 9577  O O    . TYR A 1 56  ? -14.970 1.932   -1.173  1.00 0.96  ? 570 TYR A O    5  
ATOM 9578  C CB   . TYR A 1 56  ? -16.649 -0.343  -0.095  1.00 1.06  ? 570 TYR A CB   5  
ATOM 9579  C CG   . TYR A 1 56  ? -17.583 -1.199  0.739   1.00 1.19  ? 570 TYR A CG   5  
ATOM 9580  C CD1  . TYR A 1 56  ? -17.069 -2.198  1.589   1.00 1.99  ? 570 TYR A CD1  5  
ATOM 9581  C CD2  . TYR A 1 56  ? -18.969 -0.979  0.680   1.00 2.34  ? 570 TYR A CD2  5  
ATOM 9582  C CE1  . TYR A 1 56  ? -17.942 -2.948  2.406   1.00 2.09  ? 570 TYR A CE1  5  
ATOM 9583  C CE2  . TYR A 1 56  ? -19.842 -1.716  1.498   1.00 2.49  ? 570 TYR A CE2  5  
ATOM 9584  C CZ   . TYR A 1 56  ? -19.332 -2.690  2.381   1.00 1.60  ? 570 TYR A CZ   5  
ATOM 9585  O OH   . TYR A 1 56  ? -20.175 -3.366  3.210   1.00 1.83  ? 570 TYR A OH   5  
ATOM 9586  H H    . TYR A 1 56  ? -17.878 1.836   0.641   1.00 0.90  ? 570 TYR A H    5  
ATOM 9587  H HA   . TYR A 1 56  ? -15.605 0.356   1.615   1.00 0.84  ? 570 TYR A HA   5  
ATOM 9588  H HB2  . TYR A 1 56  ? -17.189 0.073   -0.947  1.00 1.13  ? 570 TYR A HB2  5  
ATOM 9589  H HB3  . TYR A 1 56  ? -15.865 -0.990  -0.490  1.00 1.11  ? 570 TYR A HB3  5  
ATOM 9590  H HD1  . TYR A 1 56  ? -16.003 -2.380  1.631   1.00 3.14  ? 570 TYR A HD1  5  
ATOM 9591  H HD2  . TYR A 1 56  ? -19.374 -0.238  0.007   1.00 3.51  ? 570 TYR A HD2  5  
ATOM 9592  H HE1  . TYR A 1 56  ? -17.552 -3.705  3.071   1.00 3.21  ? 570 TYR A HE1  5  
ATOM 9593  H HE2  . TYR A 1 56  ? -20.901 -1.527  1.448   1.00 3.72  ? 570 TYR A HE2  5  
ATOM 9594  H HH   . TYR A 1 56  ? -21.090 -3.033  3.130   1.00 2.39  ? 570 TYR A HH   5  
ATOM 9595  N N    . ILE A 1 57  ? -13.613 1.318   0.515   1.00 0.84  ? 571 ILE A N    5  
ATOM 9596  C CA   . ILE A 1 57  ? -12.412 1.965   -0.028  1.00 0.85  ? 571 ILE A CA   5  
ATOM 9597  C C    . ILE A 1 57  ? -11.827 1.182   -1.216  1.00 0.93  ? 571 ILE A C    5  
ATOM 9598  O O    . ILE A 1 57  ? -11.312 1.765   -2.169  1.00 1.07  ? 571 ILE A O    5  
ATOM 9599  C CB   . ILE A 1 57  ? -11.371 2.194   1.087   1.00 0.74  ? 571 ILE A CB   5  
ATOM 9600  C CG1  . ILE A 1 57  ? -10.945 0.890   1.783   1.00 0.70  ? 571 ILE A CG1  5  
ATOM 9601  C CG2  . ILE A 1 57  ? -11.895 3.153   2.167   1.00 0.73  ? 571 ILE A CG2  5  
ATOM 9602  C CD1  . ILE A 1 57  ? -9.545  0.997   2.351   1.00 0.79  ? 571 ILE A CD1  5  
ATOM 9603  H H    . ILE A 1 57  ? -13.534 0.846   1.407   1.00 0.82  ? 571 ILE A H    5  
ATOM 9604  H HA   . ILE A 1 57  ? -12.682 2.948   -0.405  1.00 0.90  ? 571 ILE A HA   5  
ATOM 9605  H HB   . ILE A 1 57  ? -10.499 2.655   0.619   1.00 0.79  ? 571 ILE A HB   5  
ATOM 9606  H HG12 . ILE A 1 57  ? -11.649 0.619   2.572   1.00 0.93  ? 571 ILE A HG12 5  
ATOM 9607  H HG13 . ILE A 1 57  ? -10.899 0.083   1.073   1.00 1.07  ? 571 ILE A HG13 5  
ATOM 9608  H HG21 . ILE A 1 57  ? -11.115 3.354   2.902   1.00 1.77  ? 571 ILE A HG21 5  
ATOM 9609  H HG22 . ILE A 1 57  ? -12.192 4.090   1.708   1.00 1.74  ? 571 ILE A HG22 5  
ATOM 9610  H HG23 . ILE A 1 57  ? -12.757 2.729   2.679   1.00 1.45  ? 571 ILE A HG23 5  
ATOM 9611  H HD11 . ILE A 1 57  ? -9.509  1.771   3.113   1.00 1.83  ? 571 ILE A HD11 5  
ATOM 9612  H HD12 . ILE A 1 57  ? -9.269  0.037   2.782   1.00 1.62  ? 571 ILE A HD12 5  
ATOM 9613  H HD13 . ILE A 1 57  ? -8.863  1.231   1.532   1.00 1.63  ? 571 ILE A HD13 5  
ATOM 9614  N N    . ILE A 1 58  ? -11.960 -0.147  -1.187  1.00 0.93  ? 572 ILE A N    5  
ATOM 9615  C CA   . ILE A 1 58  ? -11.340 -1.111  -2.094  1.00 1.01  ? 572 ILE A CA   5  
ATOM 9616  C C    . ILE A 1 58  ? -12.410 -2.066  -2.639  1.00 1.14  ? 572 ILE A C    5  
ATOM 9617  O O    . ILE A 1 58  ? -13.223 -2.588  -1.871  1.00 1.43  ? 572 ILE A O    5  
ATOM 9618  C CB   . ILE A 1 58  ? -10.223 -1.871  -1.332  1.00 1.24  ? 572 ILE A CB   5  
ATOM 9619  C CG1  . ILE A 1 58  ? -9.033  -0.915  -1.107  1.00 1.65  ? 572 ILE A CG1  5  
ATOM 9620  C CG2  . ILE A 1 58  ? -9.753  -3.136  -2.067  1.00 1.35  ? 572 ILE A CG2  5  
ATOM 9621  C CD1  . ILE A 1 58  ? -7.901  -1.459  -0.229  1.00 1.24  ? 572 ILE A CD1  5  
ATOM 9622  H H    . ILE A 1 58  ? -12.427 -0.544  -0.388  1.00 0.90  ? 572 ILE A H    5  
ATOM 9623  H HA   . ILE A 1 58  ? -10.878 -0.579  -2.924  1.00 1.20  ? 572 ILE A HA   5  
ATOM 9624  H HB   . ILE A 1 58  ? -10.613 -2.180  -0.360  1.00 1.35  ? 572 ILE A HB   5  
ATOM 9625  H HG12 . ILE A 1 58  ? -8.637  -0.617  -2.074  1.00 2.28  ? 572 ILE A HG12 5  
ATOM 9626  H HG13 . ILE A 1 58  ? -9.389  -0.012  -0.628  1.00 2.23  ? 572 ILE A HG13 5  
ATOM 9627  H HG21 . ILE A 1 58  ? -8.966  -3.625  -1.498  1.00 1.68  ? 572 ILE A HG21 5  
ATOM 9628  H HG22 . ILE A 1 58  ? -10.572 -3.851  -2.151  1.00 1.80  ? 572 ILE A HG22 5  
ATOM 9629  H HG23 . ILE A 1 58  ? -9.375  -2.873  -3.056  1.00 2.46  ? 572 ILE A HG23 5  
ATOM 9630  H HD11 . ILE A 1 58  ? -7.376  -2.273  -0.728  1.00 1.82  ? 572 ILE A HD11 5  
ATOM 9631  H HD12 . ILE A 1 58  ? -7.189  -0.656  -0.044  1.00 2.06  ? 572 ILE A HD12 5  
ATOM 9632  H HD13 . ILE A 1 58  ? -8.302  -1.805  0.726   1.00 1.54  ? 572 ILE A HD13 5  
ATOM 9633  N N    . ARG A 1 59  ? -12.348 -2.365  -3.942  1.00 1.34  ? 573 ARG A N    5  
ATOM 9634  C CA   . ARG A 1 59  ? -13.018 -3.515  -4.562  1.00 1.64  ? 573 ARG A CA   5  
ATOM 9635  C C    . ARG A 1 59  ? -12.024 -4.233  -5.479  1.00 1.39  ? 573 ARG A C    5  
ATOM 9636  O O    . ARG A 1 59  ? -11.783 -3.795  -6.604  1.00 1.91  ? 573 ARG A O    5  
ATOM 9637  C CB   . ARG A 1 59  ? -14.308 -3.065  -5.286  1.00 2.41  ? 573 ARG A CB   5  
ATOM 9638  C CG   . ARG A 1 59  ? -15.465 -4.073  -5.176  1.00 3.40  ? 573 ARG A CG   5  
ATOM 9639  C CD   . ARG A 1 59  ? -15.143 -5.527  -5.566  1.00 4.08  ? 573 ARG A CD   5  
ATOM 9640  N NE   . ARG A 1 59  ? -14.801 -5.687  -6.990  1.00 5.08  ? 573 ARG A NE   5  
ATOM 9641  C CZ   . ARG A 1 59  ? -15.648 -5.827  -7.992  1.00 6.10  ? 573 ARG A CZ   5  
ATOM 9642  N NH1  . ARG A 1 59  ? -16.936 -5.746  -7.853  1.00 6.41  ? 573 ARG A NH1  5  
ATOM 9643  N NH2  . ARG A 1 59  ? -15.237 -6.064  -9.198  1.00 7.44  ? 573 ARG A NH2  5  
ATOM 9644  H H    . ARG A 1 59  ? -11.689 -1.843  -4.517  1.00 1.48  ? 573 ARG A H    5  
ATOM 9645  H HA   . ARG A 1 59  ? -13.301 -4.209  -3.771  1.00 1.77  ? 573 ARG A HA   5  
ATOM 9646  H HB2  . ARG A 1 59  ? -14.660 -2.132  -4.841  1.00 2.90  ? 573 ARG A HB2  5  
ATOM 9647  H HB3  . ARG A 1 59  ? -14.105 -2.858  -6.337  1.00 2.50  ? 573 ARG A HB3  5  
ATOM 9648  H HG2  . ARG A 1 59  ? -15.812 -4.078  -4.143  1.00 3.95  ? 573 ARG A HG2  5  
ATOM 9649  H HG3  . ARG A 1 59  ? -16.290 -3.715  -5.792  1.00 4.07  ? 573 ARG A HG3  5  
ATOM 9650  H HD2  . ARG A 1 59  ? -14.314 -5.891  -4.961  1.00 4.40  ? 573 ARG A HD2  5  
ATOM 9651  H HD3  . ARG A 1 59  ? -16.003 -6.154  -5.326  1.00 4.52  ? 573 ARG A HD3  5  
ATOM 9652  H HE   . ARG A 1 59  ? -13.826 -5.867  -7.206  1.00 5.65  ? 573 ARG A HE   5  
ATOM 9653  H HH11 . ARG A 1 59  ? -17.359 -5.587  -6.946  1.00 6.03  ? 573 ARG A HH11 5  
ATOM 9654  H HH12 . ARG A 1 59  ? -17.503 -5.858  -8.685  1.00 7.48  ? 573 ARG A HH12 5  
ATOM 9655  H HH21 . ARG A 1 59  ? -14.255 -6.107  -9.438  1.00 7.88  ? 573 ARG A HH21 5  
ATOM 9656  H HH22 . ARG A 1 59  ? -15.943 -6.186  -9.916  1.00 8.30  ? 573 ARG A HH22 5  
ATOM 9657  N N    . GLU A 1 60  ? -11.432 -5.319  -4.982  1.00 1.68  ? 574 GLU A N    5  
ATOM 9658  C CA   . GLU A 1 60  ? -10.442 -6.112  -5.734  1.00 1.62  ? 574 GLU A CA   5  
ATOM 9659  C C    . GLU A 1 60  ? -11.095 -6.837  -6.924  1.00 1.84  ? 574 GLU A C    5  
ATOM 9660  O O    . GLU A 1 60  ? -12.318 -6.995  -6.987  1.00 2.81  ? 574 GLU A O    5  
ATOM 9661  C CB   . GLU A 1 60  ? -9.705  -7.104  -4.806  1.00 2.85  ? 574 GLU A CB   5  
ATOM 9662  C CG   . GLU A 1 60  ? -8.179  -6.905  -4.805  1.00 3.66  ? 574 GLU A CG   5  
ATOM 9663  C CD   . GLU A 1 60  ? -7.457  -7.423  -6.056  1.00 4.06  ? 574 GLU A CD   5  
ATOM 9664  O OE1  . GLU A 1 60  ? -7.677  -6.832  -7.141  1.00 4.41  ? 574 GLU A OE1  5  
ATOM 9665  O OE2  . GLU A 1 60  ? -6.614  -8.342  -5.915  1.00 4.93  ? 574 GLU A OE2  5  
ATOM 9666  H H    . GLU A 1 60  ? -11.736 -5.650  -4.077  1.00 2.42  ? 574 GLU A H    5  
ATOM 9667  H HA   . GLU A 1 60  ? -9.688  -5.428  -6.136  1.00 1.57  ? 574 GLU A HA   5  
ATOM 9668  H HB2  . GLU A 1 60  ? -10.056 -6.964  -3.781  1.00 3.35  ? 574 GLU A HB2  5  
ATOM 9669  H HB3  . GLU A 1 60  ? -9.932  -8.133  -5.086  1.00 3.38  ? 574 GLU A HB3  5  
ATOM 9670  H HG2  . GLU A 1 60  ? -7.963  -5.842  -4.697  1.00 4.38  ? 574 GLU A HG2  5  
ATOM 9671  H HG3  . GLU A 1 60  ? -7.774  -7.411  -3.929  1.00 4.33  ? 574 GLU A HG3  5  
ATOM 9672  N N    . GLY A 1 61  ? -10.281 -7.297  -7.868  1.00 1.70  ? 575 GLY A N    5  
ATOM 9673  C CA   . GLY A 1 61  ? -10.720 -8.067  -9.022  1.00 2.68  ? 575 GLY A CA   5  
ATOM 9674  C C    . GLY A 1 61  ? -9.778  -8.018  -10.223 1.00 2.52  ? 575 GLY A C    5  
ATOM 9675  O O    . GLY A 1 61  ? -10.256 -8.253  -11.332 1.00 3.43  ? 575 GLY A O    5  
ATOM 9676  H H    . GLY A 1 61  ? -9.286  -7.133  -7.750  1.00 1.43  ? 575 GLY A H    5  
ATOM 9677  H HA2  . GLY A 1 61  ? -10.819 -9.109  -8.720  1.00 3.34  ? 575 GLY A HA2  5  
ATOM 9678  H HA3  . GLY A 1 61  ? -11.698 -7.715  -9.347  1.00 3.34  ? 575 GLY A HA3  5  
ATOM 9679  N N    . THR A 1 62  ? -8.476  -7.719  -10.074 1.00 1.64  ? 576 THR A N    5  
ATOM 9680  C CA   . THR A 1 62  ? -7.576  -7.747  -11.250 1.00 1.69  ? 576 THR A CA   5  
ATOM 9681  C C    . THR A 1 62  ? -6.179  -8.296  -11.016 1.00 1.32  ? 576 THR A C    5  
ATOM 9682  O O    . THR A 1 62  ? -5.606  -8.226  -9.929  1.00 1.44  ? 576 THR A O    5  
ATOM 9683  C CB   . THR A 1 62  ? -7.510  -6.394  -11.967 1.00 2.16  ? 576 THR A CB   5  
ATOM 9684  O OG1  . THR A 1 62  ? -7.037  -6.603  -13.274 1.00 2.34  ? 576 THR A OG1  5  
ATOM 9685  C CG2  . THR A 1 62  ? -6.619  -5.342  -11.309 1.00 2.70  ? 576 THR A CG2  5  
ATOM 9686  H H    . THR A 1 62  ? -8.091  -7.509  -9.151  1.00 1.34  ? 576 THR A H    5  
ATOM 9687  H HA   . THR A 1 62  ? -8.016  -8.430  -11.976 1.00 2.16  ? 576 THR A HA   5  
ATOM 9688  H HB   . THR A 1 62  ? -8.519  -6.013  -12.036 1.00 2.74  ? 576 THR A HB   5  
ATOM 9689  H HG1  . THR A 1 62  ? -7.036  -5.743  -13.727 1.00 2.79  ? 576 THR A HG1  5  
ATOM 9690  H HG21 . THR A 1 62  ? -5.572  -5.638  -11.366 1.00 3.48  ? 576 THR A HG21 5  
ATOM 9691  H HG22 . THR A 1 62  ? -6.906  -5.230  -10.267 1.00 3.07  ? 576 THR A HG22 5  
ATOM 9692  H HG23 . THR A 1 62  ? -6.751  -4.386  -11.813 1.00 3.39  ? 576 THR A HG23 5  
ATOM 9693  N N    . ILE A 1 63  ? -5.615  -8.826  -12.100 1.00 1.36  ? 577 ILE A N    5  
ATOM 9694  C CA   . ILE A 1 63  ? -4.213  -9.214  -12.169 1.00 1.39  ? 577 ILE A CA   5  
ATOM 9695  C C    . ILE A 1 63  ? -3.394  -7.916  -12.286 1.00 1.35  ? 577 ILE A C    5  
ATOM 9696  O O    . ILE A 1 63  ? -3.639  -7.091  -13.175 1.00 1.48  ? 577 ILE A O    5  
ATOM 9697  C CB   . ILE A 1 63  ? -3.953  -10.180 -13.353 1.00 1.68  ? 577 ILE A CB   5  
ATOM 9698  C CG1  . ILE A 1 63  ? -4.510  -11.610 -13.138 1.00 1.95  ? 577 ILE A CG1  5  
ATOM 9699  C CG2  . ILE A 1 63  ? -2.442  -10.332 -13.621 1.00 1.92  ? 577 ILE A CG2  5  
ATOM 9700  C CD1  . ILE A 1 63  ? -6.019  -11.748 -12.914 1.00 2.05  ? 577 ILE A CD1  5  
ATOM 9701  H H    . ILE A 1 63  ? -6.122  -8.698  -12.969 1.00 1.65  ? 577 ILE A H    5  
ATOM 9702  H HA   . ILE A 1 63  ? -3.973  -9.737  -11.241 1.00 1.51  ? 577 ILE A HA   5  
ATOM 9703  H HB   . ILE A 1 63  ? -4.406  -9.760  -14.251 1.00 1.78  ? 577 ILE A HB   5  
ATOM 9704  H HG12 . ILE A 1 63  ? -4.262  -12.207 -14.015 1.00 2.55  ? 577 ILE A HG12 5  
ATOM 9705  H HG13 . ILE A 1 63  ? -4.001  -12.060 -12.291 1.00 2.06  ? 577 ILE A HG13 5  
ATOM 9706  H HG21 . ILE A 1 63  ? -2.010  -9.383  -13.941 1.00 2.38  ? 577 ILE A HG21 5  
ATOM 9707  H HG22 . ILE A 1 63  ? -1.931  -10.678 -12.721 1.00 2.18  ? 577 ILE A HG22 5  
ATOM 9708  H HG23 . ILE A 1 63  ? -2.277  -11.053 -14.423 1.00 2.84  ? 577 ILE A HG23 5  
ATOM 9709  H HD11 . ILE A 1 63  ? -6.291  -11.361 -11.934 1.00 2.49  ? 577 ILE A HD11 5  
ATOM 9710  H HD12 . ILE A 1 63  ? -6.567  -11.215 -13.690 1.00 2.81  ? 577 ILE A HD12 5  
ATOM 9711  H HD13 . ILE A 1 63  ? -6.292  -12.803 -12.950 1.00 2.59  ? 577 ILE A HD13 5  
ATOM 9712  N N    . GLY A 1 64  ? -2.408  -7.732  -11.407 1.00 1.42  ? 578 GLY A N    5  
ATOM 9713  C CA   . GLY A 1 64  ? -1.491  -6.591  -11.437 1.00 1.58  ? 578 GLY A CA   5  
ATOM 9714  C C    . GLY A 1 64  ? -1.944  -5.377  -10.620 1.00 1.42  ? 578 GLY A C    5  
ATOM 9715  O O    . GLY A 1 64  ? -1.457  -4.274  -10.877 1.00 1.65  ? 578 GLY A O    5  
ATOM 9716  H H    . GLY A 1 64  ? -2.288  -8.405  -10.658 1.00 1.53  ? 578 GLY A H    5  
ATOM 9717  H HA2  . GLY A 1 64  ? -0.527  -6.910  -11.048 1.00 1.84  ? 578 GLY A HA2  5  
ATOM 9718  H HA3  . GLY A 1 64  ? -1.342  -6.278  -12.472 1.00 1.74  ? 578 GLY A HA3  5  
ATOM 9719  N N    . LYS A 1 65  ? -2.885  -5.559  -9.681  1.00 1.31  ? 579 LYS A N    5  
ATOM 9720  C CA   . LYS A 1 65  ? -3.525  -4.500  -8.878  1.00 1.24  ? 579 LYS A CA   5  
ATOM 9721  C C    . LYS A 1 65  ? -2.551  -3.625  -8.060  1.00 1.06  ? 579 LYS A C    5  
ATOM 9722  O O    . LYS A 1 65  ? -1.463  -4.079  -7.698  1.00 1.19  ? 579 LYS A O    5  
ATOM 9723  C CB   . LYS A 1 65  ? -4.624  -5.126  -8.003  1.00 1.50  ? 579 LYS A CB   5  
ATOM 9724  C CG   . LYS A 1 65  ? -4.094  -6.060  -6.898  1.00 3.42  ? 579 LYS A CG   5  
ATOM 9725  C CD   . LYS A 1 65  ? -4.575  -5.577  -5.525  1.00 3.92  ? 579 LYS A CD   5  
ATOM 9726  C CE   . LYS A 1 65  ? -4.015  -6.405  -4.356  1.00 6.19  ? 579 LYS A CE   5  
ATOM 9727  N NZ   . LYS A 1 65  ? -4.266  -7.859  -4.489  1.00 7.35  ? 579 LYS A NZ   5  
ATOM 9728  H H    . LYS A 1 65  ? -3.236  -6.500  -9.561  1.00 1.48  ? 579 LYS A H    5  
ATOM 9729  H HA   . LYS A 1 65  ? -4.028  -3.836  -9.572  1.00 1.33  ? 579 LYS A HA   5  
ATOM 9730  H HB2  . LYS A 1 65  ? -5.217  -4.319  -7.567  1.00 1.92  ? 579 LYS A HB2  5  
ATOM 9731  H HB3  . LYS A 1 65  ? -5.298  -5.701  -8.638  1.00 2.42  ? 579 LYS A HB3  5  
ATOM 9732  H HG2  . LYS A 1 65  ? -4.465  -7.067  -7.088  1.00 4.47  ? 579 LYS A HG2  5  
ATOM 9733  H HG3  . LYS A 1 65  ? -3.005  -6.095  -6.903  1.00 4.59  ? 579 LYS A HG3  5  
ATOM 9734  H HD2  . LYS A 1 65  ? -4.252  -4.541  -5.402  1.00 4.31  ? 579 LYS A HD2  5  
ATOM 9735  H HD3  . LYS A 1 65  ? -5.668  -5.579  -5.506  1.00 3.22  ? 579 LYS A HD3  5  
ATOM 9736  H HE2  . LYS A 1 65  ? -2.937  -6.229  -4.278  1.00 7.06  ? 579 LYS A HE2  5  
ATOM 9737  H HE3  . LYS A 1 65  ? -4.473  -6.044  -3.433  1.00 6.67  ? 579 LYS A HE3  5  
ATOM 9738  H HZ1  . LYS A 1 65  ? -5.241  -8.070  -4.713  1.00 7.16  ? 579 LYS A HZ1  5  
ATOM 9739  H HZ2  . LYS A 1 65  ? -3.994  -8.352  -3.640  1.00 8.44  ? 579 LYS A HZ2  5  
ATOM 9740  H HZ3  . LYS A 1 65  ? -3.696  -8.254  -5.233  1.00 7.86  ? 579 LYS A HZ3  5  
ATOM 9741  N N    . LYS A 1 66  ? -2.952  -2.384  -7.744  1.00 0.96  ? 580 LYS A N    5  
ATOM 9742  C CA   . LYS A 1 66  ? -2.104  -1.379  -7.062  1.00 0.90  ? 580 LYS A CA   5  
ATOM 9743  C C    . LYS A 1 66  ? -2.163  -1.445  -5.525  1.00 0.85  ? 580 LYS A C    5  
ATOM 9744  O O    . LYS A 1 66  ? -2.986  -2.167  -4.964  1.00 1.00  ? 580 LYS A O    5  
ATOM 9745  C CB   . LYS A 1 66  ? -2.388  0.028   -7.625  1.00 1.03  ? 580 LYS A CB   5  
ATOM 9746  C CG   . LYS A 1 66  ? -3.657  0.724   -7.099  1.00 1.84  ? 580 LYS A CG   5  
ATOM 9747  C CD   . LYS A 1 66  ? -3.792  2.109   -7.752  1.00 2.46  ? 580 LYS A CD   5  
ATOM 9748  C CE   . LYS A 1 66  ? -5.064  2.850   -7.313  1.00 3.46  ? 580 LYS A CE   5  
ATOM 9749  N NZ   . LYS A 1 66  ? -5.312  4.056   -8.141  1.00 3.92  ? 580 LYS A NZ   5  
ATOM 9750  H H    . LYS A 1 66  ? -3.883  -2.106  -8.030  1.00 1.04  ? 580 LYS A H    5  
ATOM 9751  H HA   . LYS A 1 66  ? -1.070  -1.605  -7.319  1.00 0.99  ? 580 LYS A HA   5  
ATOM 9752  H HB2  . LYS A 1 66  ? -1.539  0.664   -7.385  1.00 1.75  ? 580 LYS A HB2  5  
ATOM 9753  H HB3  . LYS A 1 66  ? -2.435  -0.035  -8.713  1.00 1.90  ? 580 LYS A HB3  5  
ATOM 9754  H HG2  . LYS A 1 66  ? -4.532  0.121   -7.334  1.00 2.44  ? 580 LYS A HG2  5  
ATOM 9755  H HG3  . LYS A 1 66  ? -3.587  0.849   -6.017  1.00 2.76  ? 580 LYS A HG3  5  
ATOM 9756  H HD2  . LYS A 1 66  ? -2.913  2.703   -7.491  1.00 2.61  ? 580 LYS A HD2  5  
ATOM 9757  H HD3  . LYS A 1 66  ? -3.819  1.974   -8.833  1.00 2.74  ? 580 LYS A HD3  5  
ATOM 9758  H HE2  . LYS A 1 66  ? -5.911  2.168   -7.421  1.00 3.66  ? 580 LYS A HE2  5  
ATOM 9759  H HE3  . LYS A 1 66  ? -4.977  3.125   -6.259  1.00 4.21  ? 580 LYS A HE3  5  
ATOM 9760  H HZ1  . LYS A 1 66  ? -6.157  4.547   -7.857  1.00 4.92  ? 580 LYS A HZ1  5  
ATOM 9761  H HZ2  . LYS A 1 66  ? -5.427  3.804   -9.121  1.00 3.80  ? 580 LYS A HZ2  5  
ATOM 9762  H HZ3  . LYS A 1 66  ? -4.564  4.744   -8.076  1.00 4.25  ? 580 LYS A HZ3  5  
ATOM 9763  N N    . MET A 1 67  ? -1.275  -0.702  -4.855  1.00 0.77  ? 581 MET A N    5  
ATOM 9764  C CA   . MET A 1 67  ? -1.134  -0.664  -3.389  1.00 0.80  ? 581 MET A CA   5  
ATOM 9765  C C    . MET A 1 67  ? -1.745  0.608   -2.754  1.00 0.73  ? 581 MET A C    5  
ATOM 9766  O O    . MET A 1 67  ? -1.741  1.680   -3.369  1.00 0.69  ? 581 MET A O    5  
ATOM 9767  C CB   . MET A 1 67  ? 0.360   -0.868  -3.080  1.00 0.95  ? 581 MET A CB   5  
ATOM 9768  C CG   . MET A 1 67  ? 0.726   -0.886  -1.593  1.00 1.27  ? 581 MET A CG   5  
ATOM 9769  S SD   . MET A 1 67  ? 1.042   0.753   -0.886  1.00 2.25  ? 581 MET A SD   5  
ATOM 9770  C CE   . MET A 1 67  ? 1.454   0.252   0.802   1.00 1.59  ? 581 MET A CE   5  
ATOM 9771  H H    . MET A 1 67  ? -0.626  -0.131  -5.392  1.00 0.76  ? 581 MET A H    5  
ATOM 9772  H HA   . MET A 1 67  ? -1.668  -1.516  -2.965  1.00 0.89  ? 581 MET A HA   5  
ATOM 9773  H HB2  . MET A 1 67  ? 0.657   -1.829  -3.502  1.00 1.36  ? 581 MET A HB2  5  
ATOM 9774  H HB3  . MET A 1 67  ? 0.946   -0.093  -3.577  1.00 1.29  ? 581 MET A HB3  5  
ATOM 9775  H HG2  . MET A 1 67  ? -0.063  -1.385  -1.030  1.00 2.27  ? 581 MET A HG2  5  
ATOM 9776  H HG3  . MET A 1 67  ? 1.638   -1.472  -1.480  1.00 2.33  ? 581 MET A HG3  5  
ATOM 9777  H HE1  . MET A 1 67  ? 2.336   -0.386  0.788   1.00 2.07  ? 581 MET A HE1  5  
ATOM 9778  H HE2  . MET A 1 67  ? 1.652   1.132   1.414   1.00 2.53  ? 581 MET A HE2  5  
ATOM 9779  H HE3  . MET A 1 67  ? 0.619   -0.305  1.223   1.00 1.76  ? 581 MET A HE3  5  
ATOM 9780  N N    . TYR A 1 68  ? -2.268  0.495   -1.520  1.00 0.78  ? 582 TYR A N    5  
ATOM 9781  C CA   . TYR A 1 68  ? -2.968  1.576   -0.804  1.00 0.73  ? 582 TYR A CA   5  
ATOM 9782  C C    . TYR A 1 68  ? -2.645  1.592   0.711   1.00 0.74  ? 582 TYR A C    5  
ATOM 9783  O O    . TYR A 1 68  ? -2.463  0.537   1.325   1.00 0.81  ? 582 TYR A O    5  
ATOM 9784  C CB   . TYR A 1 68  ? -4.495  1.468   -1.005  1.00 0.74  ? 582 TYR A CB   5  
ATOM 9785  C CG   . TYR A 1 68  ? -5.015  0.782   -2.261  1.00 1.01  ? 582 TYR A CG   5  
ATOM 9786  C CD1  . TYR A 1 68  ? -5.111  -0.624  -2.300  1.00 2.47  ? 582 TYR A CD1  5  
ATOM 9787  C CD2  . TYR A 1 68  ? -5.475  1.543   -3.352  1.00 1.89  ? 582 TYR A CD2  5  
ATOM 9788  C CE1  . TYR A 1 68  ? -5.675  -1.266  -3.420  1.00 3.04  ? 582 TYR A CE1  5  
ATOM 9789  C CE2  . TYR A 1 68  ? -6.050  0.903   -4.467  1.00 2.10  ? 582 TYR A CE2  5  
ATOM 9790  C CZ   . TYR A 1 68  ? -6.152  -0.503  -4.504  1.00 2.24  ? 582 TYR A CZ   5  
ATOM 9791  O OH   . TYR A 1 68  ? -6.726  -1.120  -5.572  1.00 2.91  ? 582 TYR A OH   5  
ATOM 9792  H H    . TYR A 1 68  ? -2.225  -0.402  -1.051  1.00 0.85  ? 582 TYR A H    5  
ATOM 9793  H HA   . TYR A 1 68  ? -2.640  2.527   -1.224  1.00 0.70  ? 582 TYR A HA   5  
ATOM 9794  H HB2  . TYR A 1 68  ? -4.909  0.914   -0.171  1.00 0.90  ? 582 TYR A HB2  5  
ATOM 9795  H HB3  . TYR A 1 68  ? -4.918  2.471   -0.943  1.00 0.99  ? 582 TYR A HB3  5  
ATOM 9796  H HD1  . TYR A 1 68  ? -4.753  -1.212  -1.466  1.00 3.56  ? 582 TYR A HD1  5  
ATOM 9797  H HD2  . TYR A 1 68  ? -5.409  2.621   -3.324  1.00 3.12  ? 582 TYR A HD2  5  
ATOM 9798  H HE1  . TYR A 1 68  ? -5.736  -2.342  -3.464  1.00 4.44  ? 582 TYR A HE1  5  
ATOM 9799  H HE2  . TYR A 1 68  ? -6.428  1.488   -5.285  1.00 3.09  ? 582 TYR A HE2  5  
ATOM 9800  H HH   . TYR A 1 68  ? -6.988  -0.487  -6.263  1.00 2.79  ? 582 TYR A HH   5  
ATOM 9801  N N    . PHE A 1 69  ? -2.617  2.771   1.352   1.00 0.72  ? 583 PHE A N    5  
ATOM 9802  C CA   . PHE A 1 69  ? -2.227  2.899   2.773   1.00 0.73  ? 583 PHE A CA   5  
ATOM 9803  C C    . PHE A 1 69  ? -2.890  4.066   3.522   1.00 0.70  ? 583 PHE A C    5  
ATOM 9804  O O    . PHE A 1 69  ? -3.381  5.008   2.901   1.00 0.75  ? 583 PHE A O    5  
ATOM 9805  C CB   . PHE A 1 69  ? -0.693  2.912   2.915   1.00 0.88  ? 583 PHE A CB   5  
ATOM 9806  C CG   . PHE A 1 69  ? 0.089   4.054   2.287   1.00 1.17  ? 583 PHE A CG   5  
ATOM 9807  C CD1  . PHE A 1 69  ? 0.517   3.954   0.949   1.00 2.00  ? 583 PHE A CD1  5  
ATOM 9808  C CD2  . PHE A 1 69  ? 0.523   5.139   3.072   1.00 2.48  ? 583 PHE A CD2  5  
ATOM 9809  C CE1  . PHE A 1 69  ? 1.406   4.900   0.411   1.00 2.28  ? 583 PHE A CE1  5  
ATOM 9810  C CE2  . PHE A 1 69  ? 1.400   6.098   2.528   1.00 2.81  ? 583 PHE A CE2  5  
ATOM 9811  C CZ   . PHE A 1 69  ? 1.861   5.968   1.205   1.00 2.06  ? 583 PHE A CZ   5  
ATOM 9812  H H    . PHE A 1 69  ? -2.903  3.607   0.856   1.00 0.70  ? 583 PHE A H    5  
ATOM 9813  H HA   . PHE A 1 69  ? -2.579  2.006   3.285   1.00 0.73  ? 583 PHE A HA   5  
ATOM 9814  H HB2  . PHE A 1 69  ? -0.443  2.867   3.975   1.00 0.98  ? 583 PHE A HB2  5  
ATOM 9815  H HB3  . PHE A 1 69  ? -0.314  1.989   2.481   1.00 1.00  ? 583 PHE A HB3  5  
ATOM 9816  H HD1  . PHE A 1 69  ? 0.193   3.121   0.342   1.00 3.12  ? 583 PHE A HD1  5  
ATOM 9817  H HD2  . PHE A 1 69  ? 0.215   5.217   4.105   1.00 3.63  ? 583 PHE A HD2  5  
ATOM 9818  H HE1  . PHE A 1 69  ? 1.754   4.796   -0.608  1.00 3.39  ? 583 PHE A HE1  5  
ATOM 9819  H HE2  . PHE A 1 69  ? 1.744   6.922   3.135   1.00 4.06  ? 583 PHE A HE2  5  
ATOM 9820  H HZ   . PHE A 1 69  ? 2.568   6.683   0.803   1.00 2.40  ? 583 PHE A HZ   5  
ATOM 9821  N N    . ILE A 1 70  ? -2.942  3.984   4.859   1.00 0.66  ? 584 ILE A N    5  
ATOM 9822  C CA   . ILE A 1 70  ? -3.733  4.884   5.725   1.00 0.66  ? 584 ILE A CA   5  
ATOM 9823  C C    . ILE A 1 70  ? -2.867  6.010   6.304   1.00 0.77  ? 584 ILE A C    5  
ATOM 9824  O O    . ILE A 1 70  ? -1.981  5.748   7.117   1.00 0.78  ? 584 ILE A O    5  
ATOM 9825  C CB   . ILE A 1 70  ? -4.449  4.096   6.858   1.00 0.63  ? 584 ILE A CB   5  
ATOM 9826  C CG1  . ILE A 1 70  ? -5.074  2.791   6.316   1.00 0.58  ? 584 ILE A CG1  5  
ATOM 9827  C CG2  . ILE A 1 70  ? -5.542  4.992   7.501   1.00 0.64  ? 584 ILE A CG2  5  
ATOM 9828  C CD1  . ILE A 1 70  ? -5.850  1.997   7.357   1.00 0.58  ? 584 ILE A CD1  5  
ATOM 9829  H H    . ILE A 1 70  ? -2.504  3.175   5.308   1.00 0.64  ? 584 ILE A H    5  
ATOM 9830  H HA   . ILE A 1 70  ? -4.504  5.347   5.113   1.00 0.66  ? 584 ILE A HA   5  
ATOM 9831  H HB   . ILE A 1 70  ? -3.712  3.805   7.624   1.00 0.68  ? 584 ILE A HB   5  
ATOM 9832  H HG12 . ILE A 1 70  ? -5.739  3.017   5.486   1.00 0.55  ? 584 ILE A HG12 5  
ATOM 9833  H HG13 . ILE A 1 70  ? -4.289  2.133   5.947   1.00 0.62  ? 584 ILE A HG13 5  
ATOM 9834  H HG21 . ILE A 1 70  ? -6.382  5.150   6.819   1.00 1.57  ? 584 ILE A HG21 5  
ATOM 9835  H HG22 . ILE A 1 70  ? -5.933  4.524   8.405   1.00 1.91  ? 584 ILE A HG22 5  
ATOM 9836  H HG23 . ILE A 1 70  ? -5.139  5.965   7.777   1.00 1.56  ? 584 ILE A HG23 5  
ATOM 9837  H HD11 . ILE A 1 70  ? -5.923  0.965   7.013   1.00 1.57  ? 584 ILE A HD11 5  
ATOM 9838  H HD12 . ILE A 1 70  ? -5.321  2.026   8.306   1.00 1.55  ? 584 ILE A HD12 5  
ATOM 9839  H HD13 . ILE A 1 70  ? -6.841  2.432   7.479   1.00 1.52  ? 584 ILE A HD13 5  
ATOM 9840  N N    . GLN A 1 71  ? -3.154  7.269   5.947   1.00 0.92  ? 585 GLN A N    5  
ATOM 9841  C CA   . GLN A 1 71  ? -2.390  8.435   6.418   1.00 1.04  ? 585 GLN A CA   5  
ATOM 9842  C C    . GLN A 1 71  ? -3.024  9.066   7.665   1.00 1.04  ? 585 GLN A C    5  
ATOM 9843  O O    . GLN A 1 71  ? -2.307  9.406   8.608   1.00 1.14  ? 585 GLN A O    5  
ATOM 9844  C CB   . GLN A 1 71  ? -2.227  9.420   5.245   1.00 1.09  ? 585 GLN A CB   5  
ATOM 9845  C CG   . GLN A 1 71  ? -1.212  10.556  5.475   1.00 1.48  ? 585 GLN A CG   5  
ATOM 9846  C CD   . GLN A 1 71  ? -1.822  11.827  6.062   1.00 1.90  ? 585 GLN A CD   5  
ATOM 9847  O OE1  . GLN A 1 71  ? -2.364  12.668  5.353   1.00 2.60  ? 585 GLN A OE1  5  
ATOM 9848  N NE2  . GLN A 1 71  ? -1.788  12.008  7.360   1.00 2.48  ? 585 GLN A NE2  5  
ATOM 9849  H H    . GLN A 1 71  ? -3.951  7.448   5.341   1.00 0.99  ? 585 GLN A H    5  
ATOM 9850  H HA   . GLN A 1 71  ? -1.390  8.104   6.705   1.00 1.12  ? 585 GLN A HA   5  
ATOM 9851  H HB2  . GLN A 1 71  ? -1.868  8.841   4.393   1.00 1.21  ? 585 GLN A HB2  5  
ATOM 9852  H HB3  . GLN A 1 71  ? -3.192  9.844   4.971   1.00 1.31  ? 585 GLN A HB3  5  
ATOM 9853  H HG2  . GLN A 1 71  ? -0.401  10.204  6.111   1.00 2.08  ? 585 GLN A HG2  5  
ATOM 9854  H HG3  . GLN A 1 71  ? -0.774  10.824  4.514   1.00 1.58  ? 585 GLN A HG3  5  
ATOM 9855  H HE21 . GLN A 1 71  ? -1.401  11.301  7.967   1.00 3.04  ? 585 GLN A HE21 5  
ATOM 9856  H HE22 . GLN A 1 71  ? -2.114  12.896  7.735   1.00 2.83  ? 585 GLN A HE22 5  
ATOM 9857  N N    . HIS A 1 72  ? -4.355  9.183   7.695   1.00 0.97  ? 586 HIS A N    5  
ATOM 9858  C CA   . HIS A 1 72  ? -5.124  9.730   8.819   1.00 0.95  ? 586 HIS A CA   5  
ATOM 9859  C C    . HIS A 1 72  ? -6.562  9.192   8.798   1.00 0.86  ? 586 HIS A C    5  
ATOM 9860  O O    . HIS A 1 72  ? -7.337  9.509   7.898   1.00 0.84  ? 586 HIS A O    5  
ATOM 9861  C CB   . HIS A 1 72  ? -5.132  11.258  8.694   1.00 0.94  ? 586 HIS A CB   5  
ATOM 9862  C CG   . HIS A 1 72  ? -5.935  11.996  9.735   1.00 1.52  ? 586 HIS A CG   5  
ATOM 9863  N ND1  . HIS A 1 72  ? -5.452  12.480  10.927  1.00 2.14  ? 586 HIS A ND1  5  
ATOM 9864  C CD2  . HIS A 1 72  ? -7.227  12.438  9.617   1.00 2.88  ? 586 HIS A CD2  5  
ATOM 9865  C CE1  . HIS A 1 72  ? -6.418  13.204  11.512  1.00 2.62  ? 586 HIS A CE1  5  
ATOM 9866  N NE2  . HIS A 1 72  ? -7.525  13.215  10.746  1.00 3.23  ? 586 HIS A NE2  5  
ATOM 9867  H H    . HIS A 1 72  ? -4.872  8.926   6.860   1.00 0.92  ? 586 HIS A H    5  
ATOM 9868  H HA   . HIS A 1 72  ? -4.656  9.455   9.767   1.00 1.06  ? 586 HIS A HA   5  
ATOM 9869  H HB2  . HIS A 1 72  ? -4.107  11.625  8.740   1.00 1.22  ? 586 HIS A HB2  5  
ATOM 9870  H HB3  . HIS A 1 72  ? -5.538  11.509  7.720   1.00 1.01  ? 586 HIS A HB3  5  
ATOM 9871  H HD1  . HIS A 1 72  ? -4.511  12.328  11.298  1.00 3.03  ? 586 HIS A HD1  5  
ATOM 9872  H HD2  . HIS A 1 72  ? -7.881  12.265  8.772   1.00 3.98  ? 586 HIS A HD2  5  
ATOM 9873  H HE1  . HIS A 1 72  ? -6.312  13.720  12.461  1.00 3.25  ? 586 HIS A HE1  5  
ATOM 9874  N N    . GLY A 1 73  ? -6.929  8.370   9.779   1.00 0.86  ? 587 GLY A N    5  
ATOM 9875  C CA   . GLY A 1 73  ? -8.300  7.931   10.010  1.00 0.86  ? 587 GLY A CA   5  
ATOM 9876  C C    . GLY A 1 73  ? -8.329  6.561   10.674  1.00 0.82  ? 587 GLY A C    5  
ATOM 9877  O O    . GLY A 1 73  ? -7.358  6.142   11.314  1.00 0.98  ? 587 GLY A O    5  
ATOM 9878  H H    . GLY A 1 73  ? -6.235  8.001   10.407  1.00 0.88  ? 587 GLY A H    5  
ATOM 9879  H HA2  . GLY A 1 73  ? -8.812  8.645   10.655  1.00 0.97  ? 587 GLY A HA2  5  
ATOM 9880  H HA3  . GLY A 1 73  ? -8.841  7.876   9.065   1.00 0.87  ? 587 GLY A HA3  5  
ATOM 9881  N N    . VAL A 1 74  ? -9.445  5.861   10.480  1.00 0.70  ? 588 VAL A N    5  
ATOM 9882  C CA   . VAL A 1 74  ? -9.695  4.490   10.928  1.00 0.67  ? 588 VAL A CA   5  
ATOM 9883  C C    . VAL A 1 74  ? -10.501 3.765   9.835   1.00 0.58  ? 588 VAL A C    5  
ATOM 9884  O O    . VAL A 1 74  ? -11.263 4.392   9.091   1.00 0.57  ? 588 VAL A O    5  
ATOM 9885  C CB   . VAL A 1 74  ? -10.443 4.481   12.288  1.00 0.77  ? 588 VAL A CB   5  
ATOM 9886  C CG1  . VAL A 1 74  ? -10.759 3.075   12.814  1.00 0.82  ? 588 VAL A CG1  5  
ATOM 9887  C CG2  . VAL A 1 74  ? -9.635  5.183   13.389  1.00 0.92  ? 588 VAL A CG2  5  
ATOM 9888  H H    . VAL A 1 74  ? -10.179 6.279   9.927   1.00 0.67  ? 588 VAL A H    5  
ATOM 9889  H HA   . VAL A 1 74  ? -8.728  4.001   11.047  1.00 0.68  ? 588 VAL A HA   5  
ATOM 9890  H HB   . VAL A 1 74  ? -11.385 5.016   12.174  1.00 0.76  ? 588 VAL A HB   5  
ATOM 9891  H HG11 . VAL A 1 74  ? -11.264 3.144   13.778  1.00 1.57  ? 588 VAL A HG11 5  
ATOM 9892  H HG12 . VAL A 1 74  ? -11.427 2.548   12.138  1.00 1.82  ? 588 VAL A HG12 5  
ATOM 9893  H HG13 . VAL A 1 74  ? -9.840  2.503   12.944  1.00 1.51  ? 588 VAL A HG13 5  
ATOM 9894  H HG21 . VAL A 1 74  ? -9.527  6.243   13.164  1.00 1.47  ? 588 VAL A HG21 5  
ATOM 9895  H HG22 . VAL A 1 74  ? -10.155 5.104   14.341  1.00 1.95  ? 588 VAL A HG22 5  
ATOM 9896  H HG23 . VAL A 1 74  ? -8.652  4.722   13.486  1.00 1.72  ? 588 VAL A HG23 5  
ATOM 9897  N N    . VAL A 1 75  ? -10.353 2.449   9.726   1.00 0.58  ? 589 VAL A N    5  
ATOM 9898  C CA   . VAL A 1 75  ? -11.164 1.584   8.851   1.00 0.54  ? 589 VAL A CA   5  
ATOM 9899  C C    . VAL A 1 75  ? -11.794 0.443   9.644   1.00 0.60  ? 589 VAL A C    5  
ATOM 9900  O O    . VAL A 1 75  ? -11.197 -0.067  10.591  1.00 0.70  ? 589 VAL A O    5  
ATOM 9901  C CB   . VAL A 1 75  ? -10.367 1.044   7.651   1.00 0.57  ? 589 VAL A CB   5  
ATOM 9902  C CG1  . VAL A 1 75  ? -9.927  2.173   6.711   1.00 0.61  ? 589 VAL A CG1  5  
ATOM 9903  C CG2  . VAL A 1 75  ? -9.146  0.229   8.084   1.00 0.62  ? 589 VAL A CG2  5  
ATOM 9904  H H    . VAL A 1 75  ? -9.705  1.988   10.361  1.00 0.62  ? 589 VAL A H    5  
ATOM 9905  H HA   . VAL A 1 75  ? -11.987 2.163   8.441   1.00 0.54  ? 589 VAL A HA   5  
ATOM 9906  H HB   . VAL A 1 75  ? -11.021 0.385   7.084   1.00 0.60  ? 589 VAL A HB   5  
ATOM 9907  H HG11 . VAL A 1 75  ? -9.458  1.753   5.822   1.00 1.63  ? 589 VAL A HG11 5  
ATOM 9908  H HG12 . VAL A 1 75  ? -10.795 2.751   6.399   1.00 1.56  ? 589 VAL A HG12 5  
ATOM 9909  H HG13 . VAL A 1 75  ? -9.222  2.834   7.214   1.00 1.60  ? 589 VAL A HG13 5  
ATOM 9910  H HG21 . VAL A 1 75  ? -9.463  -0.592  8.726   1.00 1.84  ? 589 VAL A HG21 5  
ATOM 9911  H HG22 . VAL A 1 75  ? -8.653  -0.204  7.220   1.00 1.57  ? 589 VAL A HG22 5  
ATOM 9912  H HG23 . VAL A 1 75  ? -8.445  0.862   8.629   1.00 1.52  ? 589 VAL A HG23 5  
ATOM 9913  N N    . SER A 1 76  ? -12.977 0.020   9.205   1.00 0.63  ? 590 SER A N    5  
ATOM 9914  C CA   . SER A 1 76  ? -13.680 -1.185  9.664   1.00 0.87  ? 590 SER A CA   5  
ATOM 9915  C C    . SER A 1 76  ? -13.682 -2.148  8.487   1.00 1.00  ? 590 SER A C    5  
ATOM 9916  O O    . SER A 1 76  ? -14.025 -1.819  7.352   1.00 0.92  ? 590 SER A O    5  
ATOM 9917  C CB   . SER A 1 76  ? -15.135 -0.891  10.049  1.00 1.06  ? 590 SER A CB   5  
ATOM 9918  O OG   . SER A 1 76  ? -15.272 -0.417  11.370  1.00 1.13  ? 590 SER A OG   5  
ATOM 9919  H H    . SER A 1 76  ? -13.277 0.388   8.307   1.00 0.58  ? 590 SER A H    5  
ATOM 9920  H HA   . SER A 1 76  ? -13.139 -1.671  10.507  1.00 0.91  ? 590 SER A HA   5  
ATOM 9921  H HB2  . SER A 1 76  ? -15.576 -0.183  9.346   1.00 1.15  ? 590 SER A HB2  5  
ATOM 9922  H HB3  . SER A 1 76  ? -15.686 -1.829  9.990   1.00 1.42  ? 590 SER A HB3  5  
ATOM 9923  H HG   . SER A 1 76  ? -15.246 0.565   11.401  1.00 1.04  ? 590 SER A HG   5  
ATOM 9924  N N    . VAL A 1 77  ? -13.166 -3.324  8.756   1.00 1.22  ? 591 VAL A N    5  
ATOM 9925  C CA   . VAL A 1 77  ? -12.346 -4.103  7.850   1.00 1.02  ? 591 VAL A CA   5  
ATOM 9926  C C    . VAL A 1 77  ? -12.739 -5.555  8.048   1.00 0.86  ? 591 VAL A C    5  
ATOM 9927  O O    . VAL A 1 77  ? -13.113 -5.946  9.155   1.00 0.89  ? 591 VAL A O    5  
ATOM 9928  C CB   . VAL A 1 77  ? -10.876 -3.818  8.225   1.00 1.31  ? 591 VAL A CB   5  
ATOM 9929  C CG1  . VAL A 1 77  ? -10.629 -3.945  9.713   1.00 2.52  ? 591 VAL A CG1  5  
ATOM 9930  C CG2  . VAL A 1 77  ? -9.887  -4.830  7.751   1.00 1.10  ? 591 VAL A CG2  5  
ATOM 9931  H H    . VAL A 1 77  ? -13.007 -3.564  9.730   1.00 1.41  ? 591 VAL A H    5  
ATOM 9932  H HA   . VAL A 1 77  ? -12.499 -3.827  6.807   1.00 1.05  ? 591 VAL A HA   5  
ATOM 9933  H HB   . VAL A 1 77  ? -10.585 -2.824  7.890   1.00 2.20  ? 591 VAL A HB   5  
ATOM 9934  H HG11 . VAL A 1 77  ? -11.050 -4.920  10.007  1.00 3.12  ? 591 VAL A HG11 5  
ATOM 9935  H HG12 . VAL A 1 77  ? -9.575  -3.906  9.980   1.00 3.06  ? 591 VAL A HG12 5  
ATOM 9936  H HG13 . VAL A 1 77  ? -11.111 -3.101  10.171  1.00 3.59  ? 591 VAL A HG13 5  
ATOM 9937  H HG21 . VAL A 1 77  ? -10.091 -5.745  8.316   1.00 2.07  ? 591 VAL A HG21 5  
ATOM 9938  H HG22 . VAL A 1 77  ? -9.993  -4.951  6.682   1.00 2.23  ? 591 VAL A HG22 5  
ATOM 9939  H HG23 . VAL A 1 77  ? -8.916  -4.430  8.034   1.00 1.53  ? 591 VAL A HG23 5  
ATOM 9940  N N    . LEU A 1 78  ? -12.606 -6.373  7.015   1.00 0.90  ? 592 LEU A N    5  
ATOM 9941  C CA   . LEU A 1 78  ? -12.701 -7.812  7.181   1.00 1.15  ? 592 LEU A CA   5  
ATOM 9942  C C    . LEU A 1 78  ? -11.374 -8.437  6.776   1.00 1.35  ? 592 LEU A C    5  
ATOM 9943  O O    . LEU A 1 78  ? -10.889 -8.154  5.678   1.00 1.37  ? 592 LEU A O    5  
ATOM 9944  C CB   . LEU A 1 78  ? -13.831 -8.408  6.302   1.00 1.43  ? 592 LEU A CB   5  
ATOM 9945  C CG   . LEU A 1 78  ? -15.285 -7.913  6.439   1.00 1.67  ? 592 LEU A CG   5  
ATOM 9946  C CD1  . LEU A 1 78  ? -15.754 -7.931  7.884   1.00 1.70  ? 592 LEU A CD1  5  
ATOM 9947  C CD2  . LEU A 1 78  ? -15.559 -6.522  5.864   1.00 2.00  ? 592 LEU A CD2  5  
ATOM 9948  H H    . LEU A 1 78  ? -12.310 -6.012  6.111   1.00 0.90  ? 592 LEU A H    5  
ATOM 9949  H HA   . LEU A 1 78  ? -12.850 -8.026  8.242   1.00 1.19  ? 592 LEU A HA   5  
ATOM 9950  H HB2  . LEU A 1 78  ? -13.551 -8.289  5.254   1.00 1.52  ? 592 LEU A HB2  5  
ATOM 9951  H HB3  . LEU A 1 78  ? -13.845 -9.482  6.494   1.00 1.62  ? 592 LEU A HB3  5  
ATOM 9952  H HG   . LEU A 1 78  ? -15.907 -8.615  5.882   1.00 2.00  ? 592 LEU A HG   5  
ATOM 9953  H HD11 . LEU A 1 78  ? -15.248 -7.153  8.448   1.00 2.10  ? 592 LEU A HD11 5  
ATOM 9954  H HD12 . LEU A 1 78  ? -15.553 -8.908  8.322   1.00 2.14  ? 592 LEU A HD12 5  
ATOM 9955  H HD13 . LEU A 1 78  ? -16.824 -7.736  7.914   1.00 2.28  ? 592 LEU A HD13 5  
ATOM 9956  H HD21 . LEU A 1 78  ? -16.636 -6.353  5.830   1.00 2.42  ? 592 LEU A HD21 5  
ATOM 9957  H HD22 . LEU A 1 78  ? -15.170 -6.460  4.851   1.00 3.00  ? 592 LEU A HD22 5  
ATOM 9958  H HD23 . LEU A 1 78  ? -15.107 -5.747  6.476   1.00 2.14  ? 592 LEU A HD23 5  
ATOM 9959  N N    . THR A 1 79  ? -10.812 -9.333  7.593   1.00 1.66  ? 593 THR A N    5  
ATOM 9960  C CA   . THR A 1 79  ? -9.773  -10.247 7.072   1.00 1.97  ? 593 THR A CA   5  
ATOM 9961  C C    . THR A 1 79  ? -10.344 -11.621 6.726   1.00 2.20  ? 593 THR A C    5  
ATOM 9962  O O    . THR A 1 79  ? -10.972 -12.275 7.561   1.00 2.33  ? 593 THR A O    5  
ATOM 9963  C CB   . THR A 1 79  ? -8.524  -10.322 7.963   1.00 2.17  ? 593 THR A CB   5  
ATOM 9964  O OG1  . THR A 1 79  ? -8.813  -10.078 9.321   1.00 2.10  ? 593 THR A OG1  5  
ATOM 9965  C CG2  . THR A 1 79  ? -7.517  -9.266  7.511   1.00 2.22  ? 593 THR A CG2  5  
ATOM 9966  H H    . THR A 1 79  ? -11.148 -9.448  8.558   1.00 1.72  ? 593 THR A H    5  
ATOM 9967  H HA   . THR A 1 79  ? -9.406  -9.859  6.125   1.00 1.98  ? 593 THR A HA   5  
ATOM 9968  H HB   . THR A 1 79  ? -8.062  -11.305 7.863   1.00 2.43  ? 593 THR A HB   5  
ATOM 9969  H HG1  . THR A 1 79  ? -7.956  -10.152 9.798   1.00 2.39  ? 593 THR A HG1  5  
ATOM 9970  H HG21 . THR A 1 79  ? -7.156  -9.509  6.511   1.00 2.73  ? 593 THR A HG21 5  
ATOM 9971  H HG22 . THR A 1 79  ? -6.663  -9.245  8.188   1.00 2.75  ? 593 THR A HG22 5  
ATOM 9972  H HG23 . THR A 1 79  ? -7.995  -8.286  7.482   1.00 2.52  ? 593 THR A HG23 5  
ATOM 9973  N N    . LYS A 1 80  ? -10.132 -12.072 5.482   1.00 2.35  ? 594 LYS A N    5  
ATOM 9974  C CA   . LYS A 1 80  ? -10.496 -13.418 5.013   1.00 2.67  ? 594 LYS A CA   5  
ATOM 9975  C C    . LYS A 1 80  ? -9.736  -14.500 5.785   1.00 3.35  ? 594 LYS A C    5  
ATOM 9976  O O    . LYS A 1 80  ? -8.538  -14.363 6.045   1.00 4.40  ? 594 LYS A O    5  
ATOM 9977  C CB   . LYS A 1 80  ? -10.390 -13.549 3.479   1.00 2.67  ? 594 LYS A CB   5  
ATOM 9978  C CG   . LYS A 1 80  ? -8.981  -13.718 2.887   1.00 3.07  ? 594 LYS A CG   5  
ATOM 9979  C CD   . LYS A 1 80  ? -8.059  -12.509 3.101   1.00 3.13  ? 594 LYS A CD   5  
ATOM 9980  C CE   . LYS A 1 80  ? -6.683  -12.711 2.466   1.00 3.75  ? 594 LYS A CE   5  
ATOM 9981  N NZ   . LYS A 1 80  ? -6.705  -12.621 0.990   1.00 4.50  ? 594 LYS A NZ   5  
ATOM 9982  H H    . LYS A 1 80  ? -9.747  -11.422 4.802   1.00 2.31  ? 594 LYS A H    5  
ATOM 9983  H HA   . LYS A 1 80  ? -11.547 -13.558 5.246   1.00 2.61  ? 594 LYS A HA   5  
ATOM 9984  H HB2  . LYS A 1 80  ? -10.967 -14.427 3.185   1.00 2.81  ? 594 LYS A HB2  5  
ATOM 9985  H HB3  . LYS A 1 80  ? -10.868 -12.686 3.011   1.00 2.42  ? 594 LYS A HB3  5  
ATOM 9986  H HG2  . LYS A 1 80  ? -8.527  -14.605 3.328   1.00 3.36  ? 594 LYS A HG2  5  
ATOM 9987  H HG3  . LYS A 1 80  ? -9.089  -13.892 1.817   1.00 3.29  ? 594 LYS A HG3  5  
ATOM 9988  H HD2  . LYS A 1 80  ? -8.522  -11.610 2.692   1.00 3.11  ? 594 LYS A HD2  5  
ATOM 9989  H HD3  . LYS A 1 80  ? -7.896  -12.368 4.168   1.00 3.03  ? 594 LYS A HD3  5  
ATOM 9990  H HE2  . LYS A 1 80  ? -6.012  -11.937 2.851   1.00 3.98  ? 594 LYS A HE2  5  
ATOM 9991  H HE3  . LYS A 1 80  ? -6.273  -13.676 2.778   1.00 3.98  ? 594 LYS A HE3  5  
ATOM 9992  H HZ1  . LYS A 1 80  ? -7.153  -13.425 0.560   1.00 4.63  ? 594 LYS A HZ1  5  
ATOM 9993  H HZ2  . LYS A 1 80  ? -5.737  -12.569 0.665   1.00 4.97  ? 594 LYS A HZ2  5  
ATOM 9994  H HZ3  . LYS A 1 80  ? -7.200  -11.793 0.674   1.00 5.13  ? 594 LYS A HZ3  5  
ATOM 9995  N N    . GLY A 1 81  ? -10.455 -15.536 6.210   1.00 3.30  ? 595 GLY A N    5  
ATOM 9996  C CA   . GLY A 1 81  ? -10.006 -16.457 7.264   1.00 3.80  ? 595 GLY A CA   5  
ATOM 9997  C C    . GLY A 1 81  ? -10.518 -16.107 8.644   1.00 3.63  ? 595 GLY A C    5  
ATOM 9998  O O    . GLY A 1 81  ? -10.712 -16.977 9.488   1.00 3.88  ? 595 GLY A O    5  
ATOM 9999  H H    . GLY A 1 81  ? -11.435 -15.557 5.958   1.00 3.31  ? 595 GLY A H    5  
ATOM 10000 H HA2  . GLY A 1 81  ? -10.257 -17.488 7.026   1.00 4.22  ? 595 GLY A HA2  5  
ATOM 10001 H HA3  . GLY A 1 81  ? -8.931  -16.344 7.397   1.00 4.01  ? 595 GLY A HA3  5  
ATOM 10002 N N    . ASN A 1 82  ? -10.698 -14.814 8.881   1.00 3.21  ? 596 ASN A N    5  
ATOM 10003 C CA   . ASN A 1 82  ? -10.665 -14.227 10.203  1.00 2.95  ? 596 ASN A CA   5  
ATOM 10004 C C    . ASN A 1 82  ? -11.959 -13.436 10.446  1.00 2.60  ? 596 ASN A C    5  
ATOM 10005 O O    . ASN A 1 82  ? -13.033 -13.857 10.003  1.00 2.83  ? 596 ASN A O    5  
ATOM 10006 C CB   . ASN A 1 82  ? -9.395  -13.367 10.304  1.00 2.82  ? 596 ASN A CB   5  
ATOM 10007 C CG   . ASN A 1 82  ? -8.077  -14.027 9.931   1.00 3.24  ? 596 ASN A CG   5  
ATOM 10008 O OD1  . ASN A 1 82  ? -7.913  -15.236 9.995   1.00 3.69  ? 596 ASN A OD1  5  
ATOM 10009 N ND2  . ASN A 1 82  ? -7.044  -13.258 9.703   1.00 3.25  ? 596 ASN A ND2  5  
ATOM 10010 H H    . ASN A 1 82  ? -10.628 -14.170 8.105   1.00 3.03  ? 596 ASN A H    5  
ATOM 10011 H HA   . ASN A 1 82  ? -10.608 -15.011 10.960  1.00 3.21  ? 596 ASN A HA   5  
ATOM 10012 H HB2  . ASN A 1 82  ? -9.558  -12.445 9.769   1.00 2.54  ? 596 ASN A HB2  5  
ATOM 10013 H HB3  . ASN A 1 82  ? -9.264  -13.079 11.322  1.00 2.75  ? 596 ASN A HB3  5  
ATOM 10014 H HD21 . ASN A 1 82  ? -7.091  -12.263 9.892   1.00 3.07  ? 596 ASN A HD21 5  
ATOM 10015 H HD22 . ASN A 1 82  ? -6.140  -13.709 9.647   1.00 3.57  ? 596 ASN A HD22 5  
ATOM 10016 N N    . LYS A 1 83  ? -11.881 -12.351 11.223  1.00 2.22  ? 597 LYS A N    5  
ATOM 10017 C CA   . LYS A 1 83  ? -13.019 -11.602 11.744  1.00 2.01  ? 597 LYS A CA   5  
ATOM 10018 C C    . LYS A 1 83  ? -13.255 -10.251 11.072  1.00 1.62  ? 597 LYS A C    5  
ATOM 10019 O O    . LYS A 1 83  ? -12.395 -9.722  10.366  1.00 1.50  ? 597 LYS A O    5  
ATOM 10020 C CB   . LYS A 1 83  ? -12.915 -11.505 13.284  1.00 2.09  ? 597 LYS A CB   5  
ATOM 10021 C CG   . LYS A 1 83  ? -12.970 -12.833 14.077  1.00 2.54  ? 597 LYS A CG   5  
ATOM 10022 C CD   . LYS A 1 83  ? -11.816 -13.848 13.911  1.00 2.63  ? 597 LYS A CD   5  
ATOM 10023 C CE   . LYS A 1 83  ? -10.410 -13.230 13.928  1.00 2.96  ? 597 LYS A CE   5  
ATOM 10024 N NZ   . LYS A 1 83  ? -10.018 -12.808 15.293  1.00 3.59  ? 597 LYS A NZ   5  
ATOM 10025 H H    . LYS A 1 83  ? -10.962 -11.976 11.444  1.00 2.22  ? 597 LYS A H    5  
ATOM 10026 H HA   . LYS A 1 83  ? -13.902 -12.148 11.464  1.00 2.35  ? 597 LYS A HA   5  
ATOM 10027 H HB2  . LYS A 1 83  ? -12.005 -10.964 13.548  1.00 2.13  ? 597 LYS A HB2  5  
ATOM 10028 H HB3  . LYS A 1 83  ? -13.747 -10.898 13.643  1.00 2.12  ? 597 LYS A HB3  5  
ATOM 10029 H HG2  . LYS A 1 83  ? -13.026 -12.573 15.132  1.00 2.83  ? 597 LYS A HG2  5  
ATOM 10030 H HG3  . LYS A 1 83  ? -13.901 -13.345 13.835  1.00 2.94  ? 597 LYS A HG3  5  
ATOM 10031 H HD2  . LYS A 1 83  ? -11.887 -14.590 14.707  1.00 3.04  ? 597 LYS A HD2  5  
ATOM 10032 H HD3  . LYS A 1 83  ? -11.955 -14.387 12.977  1.00 3.07  ? 597 LYS A HD3  5  
ATOM 10033 H HE2  . LYS A 1 83  ? -9.688  -13.962 13.553  1.00 3.64  ? 597 LYS A HE2  5  
ATOM 10034 H HE3  . LYS A 1 83  ? -10.376 -12.385 13.230  1.00 3.01  ? 597 LYS A HE3  5  
ATOM 10035 H HZ1  . LYS A 1 83  ? -10.795 -12.413 15.821  1.00 4.02  ? 597 LYS A HZ1  5  
ATOM 10036 H HZ2  . LYS A 1 83  ? -9.303  -12.086 15.258  1.00 4.28  ? 597 LYS A HZ2  5  
ATOM 10037 H HZ3  . LYS A 1 83  ? -9.633  -13.588 15.819  1.00 3.79  ? 597 LYS A HZ3  5  
ATOM 10038 N N    . GLU A 1 84  ? -14.425 -9.677  11.363  1.00 1.74  ? 598 GLU A N    5  
ATOM 10039 C CA   . GLU A 1 84  ? -14.599 -8.232  11.249  1.00 1.57  ? 598 GLU A CA   5  
ATOM 10040 C C    . GLU A 1 84  ? -13.800 -7.515  12.343  1.00 1.43  ? 598 GLU A C    5  
ATOM 10041 O O    . GLU A 1 84  ? -13.819 -7.880  13.521  1.00 1.57  ? 598 GLU A O    5  
ATOM 10042 C CB   . GLU A 1 84  ? -16.075 -7.802  11.215  1.00 2.06  ? 598 GLU A CB   5  
ATOM 10043 C CG   . GLU A 1 84  ? -16.836 -7.967  12.538  1.00 2.33  ? 598 GLU A CG   5  
ATOM 10044 C CD   . GLU A 1 84  ? -17.114 -6.666  13.310  1.00 2.21  ? 598 GLU A CD   5  
ATOM 10045 O OE1  . GLU A 1 84  ? -17.461 -5.624  12.695  1.00 2.73  ? 598 GLU A OE1  5  
ATOM 10046 O OE2  . GLU A 1 84  ? -17.049 -6.709  14.564  1.00 3.10  ? 598 GLU A OE2  5  
ATOM 10047 H H    . GLU A 1 84  ? -15.077 -10.177 11.945  1.00 2.02  ? 598 GLU A H    5  
ATOM 10048 H HA   . GLU A 1 84  ? -14.173 -7.950  10.289  1.00 1.36  ? 598 GLU A HA   5  
ATOM 10049 H HB2  . GLU A 1 84  ? -16.118 -6.765  10.884  1.00 2.21  ? 598 GLU A HB2  5  
ATOM 10050 H HB3  . GLU A 1 84  ? -16.585 -8.407  10.466  1.00 2.70  ? 598 GLU A HB3  5  
ATOM 10051 H HG2  . GLU A 1 84  ? -17.795 -8.433  12.313  1.00 3.32  ? 598 GLU A HG2  5  
ATOM 10052 H HG3  . GLU A 1 84  ? -16.267 -8.650  13.165  1.00 2.92  ? 598 GLU A HG3  5  
ATOM 10053 N N    . MET A 1 85  ? -13.050 -6.520  11.906  1.00 1.28  ? 599 MET A N    5  
ATOM 10054 C CA   . MET A 1 85  ? -11.926 -5.909  12.584  1.00 1.28  ? 599 MET A CA   5  
ATOM 10055 C C    . MET A 1 85  ? -11.933 -4.388  12.381  1.00 1.30  ? 599 MET A C    5  
ATOM 10056 O O    . MET A 1 85  ? -12.789 -3.851  11.668  1.00 1.70  ? 599 MET A O    5  
ATOM 10057 C CB   . MET A 1 85  ? -10.715 -6.714  12.098  1.00 1.49  ? 599 MET A CB   5  
ATOM 10058 C CG   . MET A 1 85  ? -9.333  -6.212  12.500  1.00 1.65  ? 599 MET A CG   5  
ATOM 10059 S SD   . MET A 1 85  ? -7.994  -7.268  11.904  1.00 1.82  ? 599 MET A SD   5  
ATOM 10060 C CE   . MET A 1 85  ? -8.255  -7.016  10.132  1.00 1.87  ? 599 MET A CE   5  
ATOM 10061 H H    . MET A 1 85  ? -13.018 -6.397  10.901  1.00 1.19  ? 599 MET A H    5  
ATOM 10062 H HA   . MET A 1 85  ? -11.972 -6.036  13.637  1.00 1.32  ? 599 MET A HA   5  
ATOM 10063 H HB2  . MET A 1 85  ? -10.813 -7.730  12.484  1.00 2.38  ? 599 MET A HB2  5  
ATOM 10064 H HB3  . MET A 1 85  ? -10.771 -6.787  11.016  1.00 2.97  ? 599 MET A HB3  5  
ATOM 10065 H HG2  . MET A 1 85  ? -9.194  -5.223  12.072  1.00 3.05  ? 599 MET A HG2  5  
ATOM 10066 H HG3  . MET A 1 85  ? -9.279  -6.149  13.585  1.00 2.42  ? 599 MET A HG3  5  
ATOM 10067 H HE1  . MET A 1 85  ? -9.220  -7.437  9.833   1.00 2.13  ? 599 MET A HE1  5  
ATOM 10068 H HE2  . MET A 1 85  ? -8.259  -5.949  9.919   1.00 2.75  ? 599 MET A HE2  5  
ATOM 10069 H HE3  . MET A 1 85  ? -7.449  -7.493  9.582   1.00 2.20  ? 599 MET A HE3  5  
ATOM 10070 N N    . LYS A 1 86  ? -11.003 -3.690  13.032  1.00 1.14  ? 600 LYS A N    5  
ATOM 10071 C CA   . LYS A 1 86  ? -10.508 -2.351  12.768  1.00 1.04  ? 600 LYS A CA   5  
ATOM 10072 C C    . LYS A 1 86  ? -9.011  -2.259  12.433  1.00 1.05  ? 600 LYS A C    5  
ATOM 10073 O O    . LYS A 1 86  ? -8.212  -3.057  12.929  1.00 1.29  ? 600 LYS A O    5  
ATOM 10074 C CB   . LYS A 1 86  ? -10.769 -1.528  14.051  1.00 1.12  ? 600 LYS A CB   5  
ATOM 10075 C CG   . LYS A 1 86  ? -11.747 -0.378  13.925  1.00 1.02  ? 600 LYS A CG   5  
ATOM 10076 C CD   . LYS A 1 86  ? -13.162 -0.773  13.524  1.00 1.04  ? 600 LYS A CD   5  
ATOM 10077 C CE   . LYS A 1 86  ? -13.881 -1.677  14.529  1.00 1.35  ? 600 LYS A CE   5  
ATOM 10078 N NZ   . LYS A 1 86  ? -15.291 -1.856  14.124  1.00 2.19  ? 600 LYS A NZ   5  
ATOM 10079 H H    . LYS A 1 86  ? -10.630 -4.103  13.856  1.00 1.13  ? 600 LYS A H    5  
ATOM 10080 H HA   . LYS A 1 86  ? -11.035 -2.041  11.870  1.00 0.97  ? 600 LYS A HA   5  
ATOM 10081 H HB2  . LYS A 1 86  ? -11.103 -2.175  14.863  1.00 1.32  ? 600 LYS A HB2  5  
ATOM 10082 H HB3  . LYS A 1 86  ? -9.832  -1.086  14.390  1.00 1.42  ? 600 LYS A HB3  5  
ATOM 10083 H HG2  . LYS A 1 86  ? -11.782 0.123   14.888  1.00 1.15  ? 600 LYS A HG2  5  
ATOM 10084 H HG3  . LYS A 1 86  ? -11.347 0.301   13.180  1.00 1.15  ? 600 LYS A HG3  5  
ATOM 10085 H HD2  . LYS A 1 86  ? -13.726 0.151   13.407  1.00 1.18  ? 600 LYS A HD2  5  
ATOM 10086 H HD3  . LYS A 1 86  ? -13.126 -1.280  12.567  1.00 1.01  ? 600 LYS A HD3  5  
ATOM 10087 H HE2  . LYS A 1 86  ? -13.377 -2.646  14.579  1.00 1.51  ? 600 LYS A HE2  5  
ATOM 10088 H HE3  . LYS A 1 86  ? -13.838 -1.218  15.521  1.00 1.62  ? 600 LYS A HE3  5  
ATOM 10089 H HZ1  . LYS A 1 86  ? -15.804 -2.448  14.777  1.00 2.70  ? 600 LYS A HZ1  5  
ATOM 10090 H HZ2  . LYS A 1 86  ? -15.368 -2.302  13.210  1.00 3.25  ? 600 LYS A HZ2  5  
ATOM 10091 H HZ3  . LYS A 1 86  ? -15.759 -0.958  14.069  1.00 2.43  ? 600 LYS A HZ3  5  
ATOM 10092 N N    . LEU A 1 87  ? -8.648  -1.218  11.673  1.00 0.83  ? 601 LEU A N    5  
ATOM 10093 C CA   . LEU A 1 87  ? -7.270  -0.756  11.408  1.00 0.82  ? 601 LEU A CA   5  
ATOM 10094 C C    . LEU A 1 87  ? -7.180  0.783   11.563  1.00 0.79  ? 601 LEU A C    5  
ATOM 10095 O O    . LEU A 1 87  ? -8.144  1.489   11.268  1.00 0.71  ? 601 LEU A O    5  
ATOM 10096 C CB   . LEU A 1 87  ? -6.834  -1.185  9.983   1.00 0.80  ? 601 LEU A CB   5  
ATOM 10097 C CG   . LEU A 1 87  ? -5.683  -2.197  9.872   1.00 0.82  ? 601 LEU A CG   5  
ATOM 10098 C CD1  . LEU A 1 87  ? -6.085  -3.558  10.424  1.00 0.88  ? 601 LEU A CD1  5  
ATOM 10099 C CD2  . LEU A 1 87  ? -5.334  -2.393  8.394   1.00 0.87  ? 601 LEU A CD2  5  
ATOM 10100 H H    . LEU A 1 87  ? -9.403  -0.616  11.352  1.00 0.73  ? 601 LEU A H    5  
ATOM 10101 H HA   . LEU A 1 87  ? -6.595  -1.199  12.143  1.00 0.92  ? 601 LEU A HA   5  
ATOM 10102 H HB2  . LEU A 1 87  ? -7.685  -1.617  9.461   1.00 0.83  ? 601 LEU A HB2  5  
ATOM 10103 H HB3  . LEU A 1 87  ? -6.532  -0.293  9.433   1.00 0.99  ? 601 LEU A HB3  5  
ATOM 10104 H HG   . LEU A 1 87  ? -4.810  -1.825  10.406  1.00 0.98  ? 601 LEU A HG   5  
ATOM 10105 H HD11 . LEU A 1 87  ? -7.031  -3.870  9.982   1.00 1.57  ? 601 LEU A HD11 5  
ATOM 10106 H HD12 . LEU A 1 87  ? -6.191  -3.491  11.502  1.00 1.56  ? 601 LEU A HD12 5  
ATOM 10107 H HD13 . LEU A 1 87  ? -5.313  -4.296  10.204  1.00 1.88  ? 601 LEU A HD13 5  
ATOM 10108 H HD21 . LEU A 1 87  ? -5.101  -1.434  7.932   1.00 1.69  ? 601 LEU A HD21 5  
ATOM 10109 H HD22 . LEU A 1 87  ? -6.172  -2.849  7.866   1.00 1.64  ? 601 LEU A HD22 5  
ATOM 10110 H HD23 . LEU A 1 87  ? -4.463  -3.043  8.309   1.00 1.74  ? 601 LEU A HD23 5  
ATOM 10111 N N    . SER A 1 88  ? -6.016  1.315   11.954  1.00 0.89  ? 602 SER A N    5  
ATOM 10112 C CA   . SER A 1 88  ? -5.770  2.759   12.186  1.00 0.91  ? 602 SER A CA   5  
ATOM 10113 C C    . SER A 1 88  ? -4.656  3.350   11.306  1.00 0.89  ? 602 SER A C    5  
ATOM 10114 O O    . SER A 1 88  ? -3.971  2.630   10.572  1.00 0.91  ? 602 SER A O    5  
ATOM 10115 C CB   . SER A 1 88  ? -5.494  3.027   13.677  1.00 1.01  ? 602 SER A CB   5  
ATOM 10116 O OG   . SER A 1 88  ? -4.328  2.359   14.127  1.00 1.66  ? 602 SER A OG   5  
ATOM 10117 H H    . SER A 1 88  ? -5.253  0.682   12.137  1.00 0.99  ? 602 SER A H    5  
ATOM 10118 H HA   . SER A 1 88  ? -6.671  3.320   11.937  1.00 0.97  ? 602 SER A HA   5  
ATOM 10119 H HB2  . SER A 1 88  ? -5.371  4.099   13.836  1.00 1.24  ? 602 SER A HB2  5  
ATOM 10120 H HB3  . SER A 1 88  ? -6.352  2.698   14.263  1.00 1.20  ? 602 SER A HB3  5  
ATOM 10121 H HG   . SER A 1 88  ? -4.119  2.667   15.035  1.00 2.00  ? 602 SER A HG   5  
ATOM 10122 N N    . ASP A 1 89  ? -4.481  4.676   11.348  1.00 0.93  ? 603 ASP A N    5  
ATOM 10123 C CA   . ASP A 1 89  ? -3.446  5.394   10.589  1.00 0.97  ? 603 ASP A CA   5  
ATOM 10124 C C    . ASP A 1 89  ? -2.027  4.842   10.822  1.00 1.01  ? 603 ASP A C    5  
ATOM 10125 O O    . ASP A 1 89  ? -1.652  4.518   11.950  1.00 1.10  ? 603 ASP A O    5  
ATOM 10126 C CB   . ASP A 1 89  ? -3.528  6.905   10.846  1.00 1.10  ? 603 ASP A CB   5  
ATOM 10127 C CG   . ASP A 1 89  ? -3.155  7.344   12.267  1.00 1.28  ? 603 ASP A CG   5  
ATOM 10128 O OD1  . ASP A 1 89  ? -4.036  7.292   13.162  1.00 2.15  ? 603 ASP A OD1  5  
ATOM 10129 O OD2  . ASP A 1 89  ? -2.011  7.817   12.476  1.00 1.42  ? 603 ASP A OD2  5  
ATOM 10130 H H    . ASP A 1 89  ? -5.082  5.219   11.951  1.00 0.95  ? 603 ASP A H    5  
ATOM 10131 H HA   . ASP A 1 89  ? -3.666  5.245   9.534   1.00 0.96  ? 603 ASP A HA   5  
ATOM 10132 H HB2  . ASP A 1 89  ? -2.857  7.398   10.143  1.00 1.16  ? 603 ASP A HB2  5  
ATOM 10133 H HB3  . ASP A 1 89  ? -4.540  7.241   10.626  1.00 1.12  ? 603 ASP A HB3  5  
ATOM 10134 N N    . GLY A 1 90  ? -1.250  4.717   9.740   1.00 1.01  ? 604 GLY A N    5  
ATOM 10135 C CA   . GLY A 1 90  ? 0.027   3.993   9.719   1.00 1.10  ? 604 GLY A CA   5  
ATOM 10136 C C    . GLY A 1 90  ? -0.047  2.540   9.229   1.00 0.99  ? 604 GLY A C    5  
ATOM 10137 O O    . GLY A 1 90  ? 0.988   1.899   9.036   1.00 1.12  ? 604 GLY A O    5  
ATOM 10138 H H    . GLY A 1 90  ? -1.586  5.076   8.852   1.00 0.97  ? 604 GLY A H    5  
ATOM 10139 H HA2  . GLY A 1 90  ? 0.735   4.530   9.092   1.00 1.20  ? 604 GLY A HA2  5  
ATOM 10140 H HA3  . GLY A 1 90  ? 0.420   3.967   10.727  1.00 1.23  ? 604 GLY A HA3  5  
ATOM 10141 N N    . SER A 1 91  ? -1.254  2.019   8.997   1.00 0.85  ? 605 SER A N    5  
ATOM 10142 C CA   . SER A 1 91  ? -1.508  0.691   8.416   1.00 0.79  ? 605 SER A CA   5  
ATOM 10143 C C    . SER A 1 91  ? -1.595  0.730   6.880   1.00 0.76  ? 605 SER A C    5  
ATOM 10144 O O    . SER A 1 91  ? -1.752  1.802   6.290   1.00 0.75  ? 605 SER A O    5  
ATOM 10145 C CB   . SER A 1 91  ? -2.820  0.132   8.970   1.00 0.73  ? 605 SER A CB   5  
ATOM 10146 O OG   . SER A 1 91  ? -2.861  0.177   10.387  1.00 0.80  ? 605 SER A OG   5  
ATOM 10147 H H    . SER A 1 91  ? -2.057  2.588   9.219   1.00 0.85  ? 605 SER A H    5  
ATOM 10148 H HA   . SER A 1 91  ? -0.705  0.009   8.697   1.00 0.85  ? 605 SER A HA   5  
ATOM 10149 H HB2  . SER A 1 91  ? -3.635  0.741   8.572   1.00 0.70  ? 605 SER A HB2  5  
ATOM 10150 H HB3  . SER A 1 91  ? -2.938  -0.899  8.639   1.00 0.75  ? 605 SER A HB3  5  
ATOM 10151 H HG   . SER A 1 91  ? -3.141  1.085   10.621  1.00 0.97  ? 605 SER A HG   5  
ATOM 10152 N N    . TYR A 1 92  ? -1.565  -0.430  6.218   1.00 0.79  ? 606 TYR A N    5  
ATOM 10153 C CA   . TYR A 1 92  ? -1.778  -0.556  4.769   1.00 0.86  ? 606 TYR A CA   5  
ATOM 10154 C C    . TYR A 1 92  ? -2.538  -1.826  4.359   1.00 0.86  ? 606 TYR A C    5  
ATOM 10155 O O    . TYR A 1 92  ? -2.688  -2.771  5.141   1.00 0.98  ? 606 TYR A O    5  
ATOM 10156 C CB   . TYR A 1 92  ? -0.443  -0.452  4.017   1.00 1.12  ? 606 TYR A CB   5  
ATOM 10157 C CG   . TYR A 1 92  ? 0.427   -1.693  4.056   1.00 1.27  ? 606 TYR A CG   5  
ATOM 10158 C CD1  . TYR A 1 92  ? 1.256   -1.915  5.165   1.00 1.68  ? 606 TYR A CD1  5  
ATOM 10159 C CD2  . TYR A 1 92  ? 0.406   -2.619  2.994   1.00 2.86  ? 606 TYR A CD2  5  
ATOM 10160 C CE1  . TYR A 1 92  ? 2.069   -3.064  5.221   1.00 2.12  ? 606 TYR A CE1  5  
ATOM 10161 C CE2  . TYR A 1 92  ? 1.216   -3.771  3.047   1.00 3.55  ? 606 TYR A CE2  5  
ATOM 10162 C CZ   . TYR A 1 92  ? 2.051   -3.997  4.164   1.00 2.77  ? 606 TYR A CZ   5  
ATOM 10163 O OH   . TYR A 1 92  ? 2.808   -5.121  4.248   1.00 3.63  ? 606 TYR A OH   5  
ATOM 10164 H H    . TYR A 1 92  ? -1.432  -1.289  6.751   1.00 0.82  ? 606 TYR A H    5  
ATOM 10165 H HA   . TYR A 1 92  ? -2.399  0.278   4.449   1.00 0.92  ? 606 TYR A HA   5  
ATOM 10166 H HB2  . TYR A 1 92  ? -0.666  -0.235  2.977   1.00 1.81  ? 606 TYR A HB2  5  
ATOM 10167 H HB3  . TYR A 1 92  ? 0.128   0.392   4.406   1.00 1.35  ? 606 TYR A HB3  5  
ATOM 10168 H HD1  . TYR A 1 92  ? 1.250   -1.191  5.969   1.00 2.73  ? 606 TYR A HD1  5  
ATOM 10169 H HD2  . TYR A 1 92  ? -0.240  -2.448  2.141   1.00 3.89  ? 606 TYR A HD2  5  
ATOM 10170 H HE1  . TYR A 1 92  ? 2.695   -3.251  6.081   1.00 2.93  ? 606 TYR A HE1  5  
ATOM 10171 H HE2  . TYR A 1 92  ? 1.194   -4.483  2.236   1.00 4.97  ? 606 TYR A HE2  5  
ATOM 10172 H HH   . TYR A 1 92  ? 2.504   -5.815  3.642   1.00 4.48  ? 606 TYR A HH   5  
ATOM 10173 N N    . PHE A 1 93  ? -3.016  -1.837  3.114   1.00 0.79  ? 607 PHE A N    5  
ATOM 10174 C CA   . PHE A 1 93  ? -3.788  -2.937  2.515   1.00 0.85  ? 607 PHE A CA   5  
ATOM 10175 C C    . PHE A 1 93  ? -3.655  -2.987  0.975   1.00 1.16  ? 607 PHE A C    5  
ATOM 10176 O O    . PHE A 1 93  ? -2.935  -2.200  0.359   1.00 1.51  ? 607 PHE A O    5  
ATOM 10177 C CB   . PHE A 1 93  ? -5.253  -2.850  3.005   1.00 1.17  ? 607 PHE A CB   5  
ATOM 10178 C CG   . PHE A 1 93  ? -5.817  -1.451  3.193   1.00 0.78  ? 607 PHE A CG   5  
ATOM 10179 C CD1  . PHE A 1 93  ? -5.600  -0.459  2.222   1.00 1.94  ? 607 PHE A CD1  5  
ATOM 10180 C CD2  . PHE A 1 93  ? -6.534  -1.134  4.362   1.00 1.90  ? 607 PHE A CD2  5  
ATOM 10181 C CE1  . PHE A 1 93  ? -6.059  0.851   2.432   1.00 2.27  ? 607 PHE A CE1  5  
ATOM 10182 C CE2  . PHE A 1 93  ? -7.007  0.174   4.559   1.00 1.69  ? 607 PHE A CE2  5  
ATOM 10183 C CZ   . PHE A 1 93  ? -6.745  1.173   3.610   1.00 1.12  ? 607 PHE A CZ   5  
ATOM 10184 H H    . PHE A 1 93  ? -2.877  -1.007  2.543   1.00 0.75  ? 607 PHE A H    5  
ATOM 10185 H HA   . PHE A 1 93  ? -3.382  -3.884  2.874   1.00 1.28  ? 607 PHE A HA   5  
ATOM 10186 H HB2  . PHE A 1 93  ? -5.916  -3.404  2.342   1.00 1.89  ? 607 PHE A HB2  5  
ATOM 10187 H HB3  . PHE A 1 93  ? -5.293  -3.356  3.970   1.00 1.88  ? 607 PHE A HB3  5  
ATOM 10188 H HD1  . PHE A 1 93  ? -5.065  -0.697  1.317   1.00 3.15  ? 607 PHE A HD1  5  
ATOM 10189 H HD2  . PHE A 1 93  ? -6.719  -1.893  5.109   1.00 3.33  ? 607 PHE A HD2  5  
ATOM 10190 H HE1  . PHE A 1 93  ? -5.903  1.600   1.676   1.00 3.70  ? 607 PHE A HE1  5  
ATOM 10191 H HE2  . PHE A 1 93  ? -7.583  0.416   5.432   1.00 2.87  ? 607 PHE A HE2  5  
ATOM 10192 H HZ   . PHE A 1 93  ? -7.116  2.174   3.768   1.00 1.47  ? 607 PHE A HZ   5  
ATOM 10193 N N    . GLY A 1 94  ? -4.342  -3.946  0.350   1.00 1.34  ? 608 GLY A N    5  
ATOM 10194 C CA   . GLY A 1 94  ? -4.114  -4.385  -1.032  1.00 1.71  ? 608 GLY A CA   5  
ATOM 10195 C C    . GLY A 1 94  ? -3.205  -5.618  -1.101  1.00 1.89  ? 608 GLY A C    5  
ATOM 10196 O O    . GLY A 1 94  ? -2.132  -5.559  -1.699  1.00 3.05  ? 608 GLY A O    5  
ATOM 10197 H H    . GLY A 1 94  ? -4.971  -4.495  0.924   1.00 1.26  ? 608 GLY A H    5  
ATOM 10198 H HA2  . GLY A 1 94  ? -5.072  -4.636  -1.485  1.00 2.01  ? 608 GLY A HA2  5  
ATOM 10199 H HA3  . GLY A 1 94  ? -3.656  -3.583  -1.615  1.00 1.88  ? 608 GLY A HA3  5  
ATOM 10200 N N    . GLU A 1 95  ? -3.626  -6.725  -0.476  1.00 1.91  ? 609 GLU A N    5  
ATOM 10201 C CA   . GLU A 1 95  ? -2.778  -7.897  -0.197  1.00 2.35  ? 609 GLU A CA   5  
ATOM 10202 C C    . GLU A 1 95  ? -1.997  -8.450  -1.406  1.00 2.01  ? 609 GLU A C    5  
ATOM 10203 O O    . GLU A 1 95  ? -2.580  -8.852  -2.416  1.00 3.13  ? 609 GLU A O    5  
ATOM 10204 C CB   . GLU A 1 95  ? -3.596  -9.019  0.470   1.00 3.81  ? 609 GLU A CB   5  
ATOM 10205 C CG   . GLU A 1 95  ? -2.673  -10.142 0.976   1.00 4.71  ? 609 GLU A CG   5  
ATOM 10206 C CD   . GLU A 1 95  ? -3.449  -11.259 1.671   1.00 5.56  ? 609 GLU A CD   5  
ATOM 10207 O OE1  . GLU A 1 95  ? -4.027  -12.116 0.965   1.00 5.70  ? 609 GLU A OE1  5  
ATOM 10208 O OE2  . GLU A 1 95  ? -3.485  -11.290 2.925   1.00 6.56  ? 609 GLU A OE2  5  
ATOM 10209 H H    . GLU A 1 95  ? -4.497  -6.664  0.039   1.00 2.54  ? 609 GLU A H    5  
ATOM 10210 H HA   . GLU A 1 95  ? -2.045  -7.580  0.543   1.00 2.85  ? 609 GLU A HA   5  
ATOM 10211 H HB2  . GLU A 1 95  ? -4.142  -8.609  1.319   1.00 4.70  ? 609 GLU A HB2  5  
ATOM 10212 H HB3  . GLU A 1 95  ? -4.315  -9.425  -0.243  1.00 4.17  ? 609 GLU A HB3  5  
ATOM 10213 H HG2  . GLU A 1 95  ? -2.129  -10.576 0.137   1.00 4.68  ? 609 GLU A HG2  5  
ATOM 10214 H HG3  . GLU A 1 95  ? -1.946  -9.717  1.671   1.00 5.57  ? 609 GLU A HG3  5  
ATOM 10215 N N    . ILE A 1 96  ? -0.675  -8.508  -1.212  1.00 2.00  ? 610 ILE A N    5  
ATOM 10216 C CA   . ILE A 1 96  ? 0.393   -9.169  -1.976  1.00 2.31  ? 610 ILE A CA   5  
ATOM 10217 C C    . ILE A 1 96  ? 0.225   -9.136  -3.507  1.00 2.34  ? 610 ILE A C    5  
ATOM 10218 O O    . ILE A 1 96  ? -0.425  -9.991  -4.120  1.00 3.72  ? 610 ILE A O    5  
ATOM 10219 C CB   . ILE A 1 96  ? 0.687   -10.587 -1.425  1.00 3.42  ? 610 ILE A CB   5  
ATOM 10220 C CG1  . ILE A 1 96  ? 0.974   -10.601 0.094   1.00 4.49  ? 610 ILE A CG1  5  
ATOM 10221 C CG2  . ILE A 1 96  ? 1.892   -11.194 -2.175  1.00 3.89  ? 610 ILE A CG2  5  
ATOM 10222 C CD1  . ILE A 1 96  ? 0.874   -11.995 0.730   1.00 5.80  ? 610 ILE A CD1  5  
ATOM 10223 H H    . ILE A 1 96  ? -0.350  -8.045  -0.370  1.00 2.80  ? 610 ILE A H    5  
ATOM 10224 H HA   . ILE A 1 96  ? 1.292   -8.589  -1.766  1.00 2.78  ? 610 ILE A HA   5  
ATOM 10225 H HB   . ILE A 1 96  ? -0.183  -11.206 -1.590  1.00 3.72  ? 610 ILE A HB   5  
ATOM 10226 H HG12 . ILE A 1 96  ? 1.969   -10.202 0.260   1.00 4.90  ? 610 ILE A HG12 5  
ATOM 10227 H HG13 . ILE A 1 96  ? 0.270   -9.963  0.623   1.00 4.43  ? 610 ILE A HG13 5  
ATOM 10228 H HG21 . ILE A 1 96  ? 2.136   -12.184 -1.791  1.00 4.88  ? 610 ILE A HG21 5  
ATOM 10229 H HG22 . ILE A 1 96  ? 1.677   -11.291 -3.237  1.00 4.05  ? 610 ILE A HG22 5  
ATOM 10230 H HG23 . ILE A 1 96  ? 2.767   -10.552 -2.055  1.00 3.92  ? 610 ILE A HG23 5  
ATOM 10231 H HD11 . ILE A 1 96  ? -0.116  -12.416 0.552   1.00 6.17  ? 610 ILE A HD11 5  
ATOM 10232 H HD12 . ILE A 1 96  ? 1.631   -12.664 0.322   1.00 6.54  ? 610 ILE A HD12 5  
ATOM 10233 H HD13 . ILE A 1 96  ? 1.032   -11.910 1.805   1.00 6.29  ? 610 ILE A HD13 5  
ATOM 10234 N N    . CYS A 1 97  ? 0.943   -8.200  -4.130  1.00 1.91  ? 611 CYS A N    5  
ATOM 10235 C CA   . CYS A 1 97  ? 1.264   -8.195  -5.560  1.00 2.46  ? 611 CYS A CA   5  
ATOM 10236 C C    . CYS A 1 97  ? 2.776   -8.080  -5.812  1.00 1.80  ? 611 CYS A C    5  
ATOM 10237 O O    . CYS A 1 97  ? 3.501   -9.011  -5.474  1.00 2.41  ? 611 CYS A O    5  
ATOM 10238 C CB   . CYS A 1 97  ? 0.382   -7.180  -6.294  1.00 3.90  ? 611 CYS A CB   5  
ATOM 10239 S SG   . CYS A 1 97  ? 0.351   -5.552  -5.484  1.00 5.09  ? 611 CYS A SG   5  
ATOM 10240 H H    . CYS A 1 97  ? 1.335   -7.463  -3.559  1.00 2.18  ? 611 CYS A H    5  
ATOM 10241 H HA   . CYS A 1 97  ? 1.000   -9.169  -5.974  1.00 3.28  ? 611 CYS A HA   5  
ATOM 10242 H HB2  . CYS A 1 97  ? 0.704   -7.067  -7.328  1.00 4.83  ? 611 CYS A HB2  5  
ATOM 10243 H HB3  . CYS A 1 97  ? -0.610  -7.610  -6.300  1.00 4.44  ? 611 CYS A HB3  5  
ATOM 10244 H HG   . CYS A 1 97  ? -0.468  -4.940  -6.360  1.00 6.46  ? 611 CYS A HG   5  
ATOM 10245 N N    . LEU A 1 98  ? 3.242   -6.979  -6.417  1.00 1.89  ? 612 LEU A N    5  
ATOM 10246 C CA   . LEU A 1 98  ? 4.611   -6.675  -6.880  1.00 1.58  ? 612 LEU A CA   5  
ATOM 10247 C C    . LEU A 1 98  ? 5.308   -7.805  -7.668  1.00 1.75  ? 612 LEU A C    5  
ATOM 10248 O O    . LEU A 1 98  ? 5.445   -7.699  -8.887  1.00 2.04  ? 612 LEU A O    5  
ATOM 10249 C CB   . LEU A 1 98  ? 5.498   -6.195  -5.706  1.00 1.77  ? 612 LEU A CB   5  
ATOM 10250 C CG   . LEU A 1 98  ? 5.178   -4.779  -5.210  1.00 1.55  ? 612 LEU A CG   5  
ATOM 10251 C CD1  . LEU A 1 98  ? 5.829   -4.521  -3.857  1.00 2.17  ? 612 LEU A CD1  5  
ATOM 10252 C CD2  . LEU A 1 98  ? 5.681   -3.693  -6.167  1.00 1.15  ? 612 LEU A CD2  5  
ATOM 10253 H H    . LEU A 1 98  ? 2.545   -6.267  -6.589  1.00 2.83  ? 612 LEU A H    5  
ATOM 10254 H HA   . LEU A 1 98  ? 4.496   -5.840  -7.584  1.00 1.53  ? 612 LEU A HA   5  
ATOM 10255 H HB2  . LEU A 1 98  ? 5.387   -6.897  -4.879  1.00 2.47  ? 612 LEU A HB2  5  
ATOM 10256 H HB3  . LEU A 1 98  ? 6.543   -6.213  -6.017  1.00 2.13  ? 612 LEU A HB3  5  
ATOM 10257 H HG   . LEU A 1 98  ? 4.102   -4.691  -5.079  1.00 2.10  ? 612 LEU A HG   5  
ATOM 10258 H HD11 . LEU A 1 98  ? 5.424   -5.217  -3.124  1.00 3.21  ? 612 LEU A HD11 5  
ATOM 10259 H HD12 . LEU A 1 98  ? 5.603   -3.501  -3.544  1.00 2.49  ? 612 LEU A HD12 5  
ATOM 10260 H HD13 . LEU A 1 98  ? 6.907   -4.649  -3.931  1.00 2.53  ? 612 LEU A HD13 5  
ATOM 10261 H HD21 . LEU A 1 98  ? 5.080   -2.792  -6.006  1.00 1.56  ? 612 LEU A HD21 5  
ATOM 10262 H HD22 . LEU A 1 98  ? 5.565   -3.984  -7.213  1.00 1.76  ? 612 LEU A HD22 5  
ATOM 10263 H HD23 . LEU A 1 98  ? 6.731   -3.471  -6.001  1.00 1.89  ? 612 LEU A HD23 5  
ATOM 10264 N N    . LEU A 1 99  ? 5.766   -8.850  -6.968  1.00 1.75  ? 613 LEU A N    5  
ATOM 10265 C CA   . LEU A 1 99  ? 6.518   -10.002 -7.477  1.00 1.97  ? 613 LEU A CA   5  
ATOM 10266 C C    . LEU A 1 99  ? 5.649   -11.218 -7.841  1.00 1.98  ? 613 LEU A C    5  
ATOM 10267 O O    . LEU A 1 99  ? 6.135   -12.130 -8.520  1.00 2.33  ? 613 LEU A O    5  
ATOM 10268 C CB   . LEU A 1 99  ? 7.674   -10.343 -6.506  1.00 2.28  ? 613 LEU A CB   5  
ATOM 10269 C CG   . LEU A 1 99  ? 7.396   -11.072 -5.172  1.00 2.93  ? 613 LEU A CG   5  
ATOM 10270 C CD1  . LEU A 1 99  ? 6.330   -10.403 -4.310  1.00 2.86  ? 613 LEU A CD1  5  
ATOM 10271 C CD2  . LEU A 1 99  ? 7.041   -12.556 -5.311  1.00 4.30  ? 613 LEU A CD2  5  
ATOM 10272 H H    . LEU A 1 99  ? 5.512   -8.864  -5.988  1.00 1.71  ? 613 LEU A H    5  
ATOM 10273 H HA   . LEU A 1 99  ? 6.989   -9.686  -8.406  1.00 2.13  ? 613 LEU A HA   5  
ATOM 10274 H HB2  . LEU A 1 99  ? 8.395   -10.949 -7.051  1.00 2.72  ? 613 LEU A HB2  5  
ATOM 10275 H HB3  . LEU A 1 99  ? 8.190   -9.411  -6.271  1.00 2.57  ? 613 LEU A HB3  5  
ATOM 10276 H HG   . LEU A 1 99  ? 8.323   -11.029 -4.609  1.00 3.59  ? 613 LEU A HG   5  
ATOM 10277 H HD11 . LEU A 1 99  ? 6.547   -9.339  -4.218  1.00 2.93  ? 613 LEU A HD11 5  
ATOM 10278 H HD12 . LEU A 1 99  ? 6.328   -10.850 -3.317  1.00 3.42  ? 613 LEU A HD12 5  
ATOM 10279 H HD13 . LEU A 1 99  ? 5.348   -10.546 -4.755  1.00 3.54  ? 613 LEU A HD13 5  
ATOM 10280 H HD21 . LEU A 1 99  ? 7.137   -13.044 -4.341  1.00 4.87  ? 613 LEU A HD21 5  
ATOM 10281 H HD22 . LEU A 1 99  ? 7.723   -13.037 -6.012  1.00 4.68  ? 613 LEU A HD22 5  
ATOM 10282 H HD23 . LEU A 1 99  ? 6.019   -12.687 -5.657  1.00 5.18  ? 613 LEU A HD23 5  
ATOM 10283 N N    . THR A 1 100 ? 4.377   -11.243 -7.419  1.00 1.80  ? 614 THR A N    5  
ATOM 10284 C CA   . THR A 1 100 ? 3.375   -12.214 -7.902  1.00 1.99  ? 614 THR A CA   5  
ATOM 10285 C C    . THR A 1 100 ? 2.396   -11.544 -8.860  1.00 1.89  ? 614 THR A C    5  
ATOM 10286 O O    . THR A 1 100 ? 2.250   -10.319 -8.844  1.00 1.87  ? 614 THR A O    5  
ATOM 10287 C CB   . THR A 1 100 ? 2.664   -12.943 -6.751  1.00 2.43  ? 614 THR A CB   5  
ATOM 10288 O OG1  . THR A 1 100 ? 2.041   -14.116 -7.229  1.00 3.49  ? 614 THR A OG1  5  
ATOM 10289 C CG2  . THR A 1 100 ? 1.606   -12.122 -6.020  1.00 2.66  ? 614 THR A CG2  5  
ATOM 10290 H H    . THR A 1 100 ? 4.039   -10.453 -6.870  1.00 1.68  ? 614 THR A H    5  
ATOM 10291 H HA   . THR A 1 100 ? 3.885   -12.988 -8.473  1.00 2.27  ? 614 THR A HA   5  
ATOM 10292 H HB   . THR A 1 100 ? 3.424   -13.244 -6.036  1.00 2.71  ? 614 THR A HB   5  
ATOM 10293 H HG1  . THR A 1 100 ? 2.418   -14.838 -6.686  1.00 4.01  ? 614 THR A HG1  5  
ATOM 10294 H HG21 . THR A 1 100 ? 2.064   -11.228 -5.603  1.00 2.88  ? 614 THR A HG21 5  
ATOM 10295 H HG22 . THR A 1 100 ? 1.192   -12.716 -5.205  1.00 2.92  ? 614 THR A HG22 5  
ATOM 10296 H HG23 . THR A 1 100 ? 0.797   -11.840 -6.694  1.00 3.65  ? 614 THR A HG23 5  
ATOM 10297 N N    . ARG A 1 101 ? 1.732   -12.333 -9.709  1.00 2.24  ? 615 ARG A N    5  
ATOM 10298 C CA   . ARG A 1 101 ? 0.807   -11.847 -10.750 1.00 2.51  ? 615 ARG A CA   5  
ATOM 10299 C C    . ARG A 1 101 ? -0.506  -12.625 -10.673 1.00 2.52  ? 615 ARG A C    5  
ATOM 10300 O O    . ARG A 1 101 ? -0.619  -13.722 -11.222 1.00 3.55  ? 615 ARG A O    5  
ATOM 10301 C CB   . ARG A 1 101 ? 1.481   -11.956 -12.136 1.00 3.37  ? 615 ARG A CB   5  
ATOM 10302 C CG   . ARG A 1 101 ? 2.760   -11.106 -12.234 1.00 4.01  ? 615 ARG A CG   5  
ATOM 10303 C CD   . ARG A 1 101 ? 3.451   -11.247 -13.593 1.00 4.88  ? 615 ARG A CD   5  
ATOM 10304 N NE   . ARG A 1 101 ? 4.792   -10.641 -13.535 1.00 5.97  ? 615 ARG A NE   5  
ATOM 10305 C CZ   . ARG A 1 101 ? 5.908   -11.132 -14.038 1.00 6.65  ? 615 ARG A CZ   5  
ATOM 10306 N NH1  . ARG A 1 101 ? 5.958   -12.163 -14.830 1.00 6.59  ? 615 ARG A NH1  5  
ATOM 10307 N NH2  . ARG A 1 101 ? 7.052   -10.600 -13.740 1.00 7.95  ? 615 ARG A NH2  5  
ATOM 10308 H H    . ARG A 1 101 ? 1.877   -13.332 -9.610  1.00 2.54  ? 615 ARG A H    5  
ATOM 10309 H HA   . ARG A 1 101 ? 0.569   -10.795 -10.577 1.00 2.48  ? 615 ARG A HA   5  
ATOM 10310 H HB2  . ARG A 1 101 ? 1.735   -13.001 -12.332 1.00 3.66  ? 615 ARG A HB2  5  
ATOM 10311 H HB3  . ARG A 1 101 ? 0.777   -11.623 -12.900 1.00 4.09  ? 615 ARG A HB3  5  
ATOM 10312 H HG2  . ARG A 1 101 ? 2.516   -10.057 -12.060 1.00 4.65  ? 615 ARG A HG2  5  
ATOM 10313 H HG3  . ARG A 1 101 ? 3.465   -11.429 -11.469 1.00 4.06  ? 615 ARG A HG3  5  
ATOM 10314 H HD2  . ARG A 1 101 ? 3.533   -12.310 -13.832 1.00 4.65  ? 615 ARG A HD2  5  
ATOM 10315 H HD3  . ARG A 1 101 ? 2.855   -10.757 -14.364 1.00 5.64  ? 615 ARG A HD3  5  
ATOM 10316 H HE   . ARG A 1 101 ? 4.904   -9.830  -12.931 1.00 6.63  ? 615 ARG A HE   5  
ATOM 10317 H HH11 . ARG A 1 101 ? 5.107   -12.561 -15.215 1.00 6.15  ? 615 ARG A HH11 5  
ATOM 10318 H HH12 . ARG A 1 101 ? 6.872   -12.505 -15.099 1.00 7.41  ? 615 ARG A HH12 5  
ATOM 10319 H HH21 . ARG A 1 101 ? 7.126   -9.803  -13.120 1.00 8.55  ? 615 ARG A HH21 5  
ATOM 10320 H HH22 . ARG A 1 101 ? 7.883   -11.062 -14.090 1.00 8.60  ? 615 ARG A HH22 5  
ATOM 10321 N N    . GLY A 1 102 ? -1.487  -12.045 -9.984  1.00 1.91  ? 616 GLY A N    5  
ATOM 10322 C CA   . GLY A 1 102 ? -2.741  -12.703 -9.626  1.00 1.86  ? 616 GLY A CA   5  
ATOM 10323 C C    . GLY A 1 102 ? -3.614  -11.859 -8.690  1.00 1.61  ? 616 GLY A C    5  
ATOM 10324 O O    . GLY A 1 102 ? -3.099  -11.228 -7.764  1.00 1.87  ? 616 GLY A O    5  
ATOM 10325 H H    . GLY A 1 102 ? -1.316  -11.127 -9.586  1.00 2.13  ? 616 GLY A H    5  
ATOM 10326 H HA2  . GLY A 1 102 ? -3.292  -12.937 -10.532 1.00 2.19  ? 616 GLY A HA2  5  
ATOM 10327 H HA3  . GLY A 1 102 ? -2.520  -13.644 -9.123  1.00 2.18  ? 616 GLY A HA3  5  
ATOM 10328 N N    . ARG A 1 103 ? -4.936  -11.862 -8.910  1.00 1.64  ? 617 ARG A N    5  
ATOM 10329 C CA   . ARG A 1 103 ? -5.922  -11.155 -8.066  1.00 1.62  ? 617 ARG A CA   5  
ATOM 10330 C C    . ARG A 1 103 ? -6.041  -11.831 -6.697  1.00 1.46  ? 617 ARG A C    5  
ATOM 10331 O O    . ARG A 1 103 ? -6.226  -13.051 -6.622  1.00 1.82  ? 617 ARG A O    5  
ATOM 10332 C CB   . ARG A 1 103 ? -7.267  -11.021 -8.806  1.00 2.27  ? 617 ARG A CB   5  
ATOM 10333 C CG   . ARG A 1 103 ? -8.037  -12.342 -8.978  1.00 1.71  ? 617 ARG A CG   5  
ATOM 10334 C CD   . ARG A 1 103 ? -8.979  -12.288 -10.182 1.00 1.52  ? 617 ARG A CD   5  
ATOM 10335 N NE   . ARG A 1 103 ? -9.717  -13.559 -10.317 1.00 2.18  ? 617 ARG A NE   5  
ATOM 10336 C CZ   . ARG A 1 103 ? -10.324 -14.032 -11.389 1.00 2.71  ? 617 ARG A CZ   5  
ATOM 10337 N NH1  . ARG A 1 103 ? -10.488 -13.351 -12.484 1.00 3.07  ? 617 ARG A NH1  5  
ATOM 10338 N NH2  . ARG A 1 103 ? -10.779 -15.246 -11.363 1.00 3.71  ? 617 ARG A NH2  5  
ATOM 10339 H H    . ARG A 1 103 ? -5.280  -12.495 -9.626  1.00 1.94  ? 617 ARG A H    5  
ATOM 10340 H HA   . ARG A 1 103 ? -5.556  -10.137 -7.898  1.00 1.81  ? 617 ARG A HA   5  
ATOM 10341 H HB2  . ARG A 1 103 ? -7.902  -10.316 -8.267  1.00 3.64  ? 617 ARG A HB2  5  
ATOM 10342 H HB3  . ARG A 1 103 ? -7.067  -10.597 -9.789  1.00 3.19  ? 617 ARG A HB3  5  
ATOM 10343 H HG2  . ARG A 1 103 ? -7.339  -13.163 -9.135  1.00 2.13  ? 617 ARG A HG2  5  
ATOM 10344 H HG3  . ARG A 1 103 ? -8.612  -12.543 -8.073  1.00 2.68  ? 617 ARG A HG3  5  
ATOM 10345 H HD2  . ARG A 1 103 ? -9.679  -11.461 -10.051 1.00 2.02  ? 617 ARG A HD2  5  
ATOM 10346 H HD3  . ARG A 1 103 ? -8.371  -12.099 -11.073 1.00 1.71  ? 617 ARG A HD3  5  
ATOM 10347 H HE   . ARG A 1 103 ? -9.680  -14.203 -9.541  1.00 2.95  ? 617 ARG A HE   5  
ATOM 10348 H HH11 . ARG A 1 103 ? -10.218 -12.375 -12.517 1.00 3.10  ? 617 ARG A HH11 5  
ATOM 10349 H HH12 . ARG A 1 103 ? -10.930 -13.783 -13.292 1.00 3.84  ? 617 ARG A HH12 5  
ATOM 10350 H HH21 . ARG A 1 103 ? -10.641 -15.797 -10.521 1.00 4.25  ? 617 ARG A HH21 5  
ATOM 10351 H HH22 . ARG A 1 103 ? -11.248 -15.648 -12.163 1.00 4.26  ? 617 ARG A HH22 5  
ATOM 10352 N N    . ARG A 1 104 ? -5.878  -11.061 -5.621  1.00 1.52  ? 618 ARG A N    5  
ATOM 10353 C CA   . ARG A 1 104 ? -5.811  -11.548 -4.232  1.00 1.86  ? 618 ARG A CA   5  
ATOM 10354 C C    . ARG A 1 104 ? -6.682  -10.673 -3.328  1.00 2.20  ? 618 ARG A C    5  
ATOM 10355 O O    . ARG A 1 104 ? -6.336  -9.522  -3.063  1.00 3.33  ? 618 ARG A O    5  
ATOM 10356 C CB   . ARG A 1 104 ? -4.331  -11.654 -3.823  1.00 2.70  ? 618 ARG A CB   5  
ATOM 10357 C CG   . ARG A 1 104 ? -4.119  -12.244 -2.420  1.00 3.07  ? 618 ARG A CG   5  
ATOM 10358 C CD   . ARG A 1 104 ? -2.651  -12.646 -2.205  1.00 3.43  ? 618 ARG A CD   5  
ATOM 10359 N NE   . ARG A 1 104 ? -2.334  -13.952 -2.830  1.00 4.34  ? 618 ARG A NE   5  
ATOM 10360 C CZ   . ARG A 1 104 ? -1.135  -14.478 -3.032  1.00 5.32  ? 618 ARG A CZ   5  
ATOM 10361 N NH1  . ARG A 1 104 ? -0.035  -13.825 -2.796  1.00 5.73  ? 618 ARG A NH1  5  
ATOM 10362 N NH2  . ARG A 1 104 ? -1.026  -15.696 -3.471  1.00 6.38  ? 618 ARG A NH2  5  
ATOM 10363 H H    . ARG A 1 104 ? -5.893  -10.052 -5.777  1.00 1.69  ? 618 ARG A H    5  
ATOM 10364 H HA   . ARG A 1 104 ? -6.220  -12.557 -4.193  1.00 1.83  ? 618 ARG A HA   5  
ATOM 10365 H HB2  . ARG A 1 104 ? -3.829  -12.296 -4.549  1.00 3.76  ? 618 ARG A HB2  5  
ATOM 10366 H HB3  . ARG A 1 104 ? -3.864  -10.670 -3.869  1.00 3.02  ? 618 ARG A HB3  5  
ATOM 10367 H HG2  . ARG A 1 104 ? -4.390  -11.488 -1.682  1.00 3.42  ? 618 ARG A HG2  5  
ATOM 10368 H HG3  . ARG A 1 104 ? -4.759  -13.116 -2.276  1.00 3.97  ? 618 ARG A HG3  5  
ATOM 10369 H HD2  . ARG A 1 104 ? -2.015  -11.858 -2.611  1.00 3.36  ? 618 ARG A HD2  5  
ATOM 10370 H HD3  . ARG A 1 104 ? -2.469  -12.717 -1.131  1.00 3.85  ? 618 ARG A HD3  5  
ATOM 10371 H HE   . ARG A 1 104 ? -3.114  -14.559 -3.026  1.00 4.70  ? 618 ARG A HE   5  
ATOM 10372 H HH11 . ARG A 1 104 ? -0.088  -12.876 -2.485  1.00 5.29  ? 618 ARG A HH11 5  
ATOM 10373 H HH12 . ARG A 1 104 ? 0.873   -14.257 -2.969  1.00 6.76  ? 618 ARG A HH12 5  
ATOM 10374 H HH21 . ARG A 1 104 ? -1.862  -16.243 -3.640  1.00 6.54  ? 618 ARG A HH21 5  
ATOM 10375 H HH22 . ARG A 1 104 ? -0.120  -16.162 -3.505  1.00 7.25  ? 618 ARG A HH22 5  
ATOM 10376 N N    . THR A 1 105 ? -7.827  -11.206 -2.900  1.00 1.81  ? 619 THR A N    5  
ATOM 10377 C CA   . THR A 1 105 ? -8.994  -10.406 -2.484  1.00 1.84  ? 619 THR A CA   5  
ATOM 10378 C C    . THR A 1 105 ? -8.967  -9.997  -1.005  1.00 1.58  ? 619 THR A C    5  
ATOM 10379 O O    . THR A 1 105 ? -8.411  -10.699 -0.159  1.00 1.57  ? 619 THR A O    5  
ATOM 10380 C CB   . THR A 1 105 ? -10.303 -11.173 -2.772  1.00 2.12  ? 619 THR A CB   5  
ATOM 10381 O OG1  . THR A 1 105 ? -10.281 -11.774 -4.049  1.00 3.14  ? 619 THR A OG1  5  
ATOM 10382 C CG2  . THR A 1 105 ? -11.553 -10.288 -2.753  1.00 3.14  ? 619 THR A CG2  5  
ATOM 10383 H H    . THR A 1 105 ? -8.010  -12.173 -3.148  1.00 2.03  ? 619 THR A H    5  
ATOM 10384 H HA   . THR A 1 105 ? -9.006  -9.497  -3.085  1.00 2.11  ? 619 THR A HA   5  
ATOM 10385 H HB   . THR A 1 105 ? -10.417 -11.967 -2.032  1.00 2.56  ? 619 THR A HB   5  
ATOM 10386 H HG1  . THR A 1 105 ? -10.999 -12.438 -4.023  1.00 3.34  ? 619 THR A HG1  5  
ATOM 10387 H HG21 . THR A 1 105 ? -11.402 -9.407  -3.378  1.00 4.19  ? 619 THR A HG21 5  
ATOM 10388 H HG22 . THR A 1 105 ? -11.787 -9.983  -1.735  1.00 3.74  ? 619 THR A HG22 5  
ATOM 10389 H HG23 . THR A 1 105 ? -12.410 -10.842 -3.133  1.00 3.62  ? 619 THR A HG23 5  
ATOM 10390 N N    . ALA A 1 106 ? -9.623  -8.874  -0.697  1.00 1.53  ? 620 ALA A N    5  
ATOM 10391 C CA   . ALA A 1 106 ? -10.034 -8.454  0.644   1.00 1.27  ? 620 ALA A CA   5  
ATOM 10392 C C    . ALA A 1 106 ? -11.333 -7.613  0.580   1.00 1.21  ? 620 ALA A C    5  
ATOM 10393 O O    . ALA A 1 106 ? -11.762 -7.227  -0.514  1.00 1.59  ? 620 ALA A O    5  
ATOM 10394 C CB   . ALA A 1 106 ? -8.879  -7.670  1.286   1.00 1.64  ? 620 ALA A CB   5  
ATOM 10395 H H    . ALA A 1 106 ? -10.046 -8.354  -1.453  1.00 1.74  ? 620 ALA A H    5  
ATOM 10396 H HA   . ALA A 1 106 ? -10.238 -9.343  1.241   1.00 1.23  ? 620 ALA A HA   5  
ATOM 10397 H HB1  . ALA A 1 106 ? -8.665  -6.774  0.703   1.00 1.87  ? 620 ALA A HB1  5  
ATOM 10398 H HB2  . ALA A 1 106 ? -9.146  -7.385  2.305   1.00 2.47  ? 620 ALA A HB2  5  
ATOM 10399 H HB3  . ALA A 1 106 ? -7.988  -8.298  1.326   1.00 2.56  ? 620 ALA A HB3  5  
ATOM 10400 N N    . SER A 1 107 ? -11.935 -7.290  1.732   1.00 1.03  ? 621 SER A N    5  
ATOM 10401 C CA   . SER A 1 107 ? -13.084 -6.372  1.861   1.00 1.17  ? 621 SER A CA   5  
ATOM 10402 C C    . SER A 1 107 ? -12.896 -5.422  3.050   1.00 1.06  ? 621 SER A C    5  
ATOM 10403 O O    . SER A 1 107 ? -12.592 -5.861  4.159   1.00 1.12  ? 621 SER A O    5  
ATOM 10404 C CB   . SER A 1 107 ? -14.385 -7.164  2.022   1.00 1.39  ? 621 SER A CB   5  
ATOM 10405 O OG   . SER A 1 107 ? -15.479 -6.270  2.096   1.00 2.58  ? 621 SER A OG   5  
ATOM 10406 H H    . SER A 1 107 ? -11.550 -7.659  2.592   1.00 1.06  ? 621 SER A H    5  
ATOM 10407 H HA   . SER A 1 107 ? -13.175 -5.772  0.954   1.00 1.40  ? 621 SER A HA   5  
ATOM 10408 H HB2  . SER A 1 107 ? -14.517 -7.828  1.167   1.00 2.44  ? 621 SER A HB2  5  
ATOM 10409 H HB3  . SER A 1 107 ? -14.339 -7.765  2.932   1.00 1.68  ? 621 SER A HB3  5  
ATOM 10410 H HG   . SER A 1 107 ? -16.273 -6.786  2.356   1.00 2.86  ? 621 SER A HG   5  
ATOM 10411 N N    . VAL A 1 108 ? -12.996 -4.105  2.829   1.00 0.92  ? 622 VAL A N    5  
ATOM 10412 C CA   . VAL A 1 108 ? -12.873 -3.087  3.894   1.00 0.81  ? 622 VAL A CA   5  
ATOM 10413 C C    . VAL A 1 108 ? -13.599 -1.777  3.546   1.00 0.75  ? 622 VAL A C    5  
ATOM 10414 O O    . VAL A 1 108 ? -13.585 -1.343  2.389   1.00 0.75  ? 622 VAL A O    5  
ATOM 10415 C CB   . VAL A 1 108 ? -11.385 -2.881  4.270   1.00 0.83  ? 622 VAL A CB   5  
ATOM 10416 C CG1  . VAL A 1 108 ? -10.459 -2.697  3.068   1.00 0.91  ? 622 VAL A CG1  5  
ATOM 10417 C CG2  . VAL A 1 108 ? -11.142 -1.726  5.241   1.00 0.77  ? 622 VAL A CG2  5  
ATOM 10418 H H    . VAL A 1 108 ? -13.215 -3.788  1.894   1.00 0.91  ? 622 VAL A H    5  
ATOM 10419 H HA   . VAL A 1 108 ? -13.374 -3.480  4.779   1.00 0.84  ? 622 VAL A HA   5  
ATOM 10420 H HB   . VAL A 1 108 ? -11.050 -3.784  4.779   1.00 0.91  ? 622 VAL A HB   5  
ATOM 10421 H HG11 . VAL A 1 108 ? -10.431 -3.617  2.487   1.00 1.41  ? 622 VAL A HG11 5  
ATOM 10422 H HG12 . VAL A 1 108 ? -10.819 -1.883  2.447   1.00 1.97  ? 622 VAL A HG12 5  
ATOM 10423 H HG13 . VAL A 1 108 ? -9.449  -2.484  3.417   1.00 1.89  ? 622 VAL A HG13 5  
ATOM 10424 H HG21 . VAL A 1 108 ? -10.113 -1.763  5.596   1.00 1.31  ? 622 VAL A HG21 5  
ATOM 10425 H HG22 . VAL A 1 108 ? -11.317 -0.767  4.755   1.00 1.65  ? 622 VAL A HG22 5  
ATOM 10426 H HG23 . VAL A 1 108 ? -11.805 -1.828  6.095   1.00 1.61  ? 622 VAL A HG23 5  
ATOM 10427 N N    . ARG A 1 109 ? -14.192 -1.113  4.553   1.00 0.74  ? 623 ARG A N    5  
ATOM 10428 C CA   . ARG A 1 109 ? -14.794 0.226   4.437   1.00 0.69  ? 623 ARG A CA   5  
ATOM 10429 C C    . ARG A 1 109 ? -14.166 1.253   5.383   1.00 0.65  ? 623 ARG A C    5  
ATOM 10430 O O    . ARG A 1 109 ? -13.547 0.921   6.396   1.00 0.64  ? 623 ARG A O    5  
ATOM 10431 C CB   . ARG A 1 109 ? -16.338 0.172   4.536   1.00 0.83  ? 623 ARG A CB   5  
ATOM 10432 C CG   . ARG A 1 109 ? -16.951 0.097   5.948   1.00 1.03  ? 623 ARG A CG   5  
ATOM 10433 C CD   . ARG A 1 109 ? -17.279 -1.318  6.431   1.00 1.01  ? 623 ARG A CD   5  
ATOM 10434 N NE   . ARG A 1 109 ? -17.785 -1.287  7.818   1.00 2.23  ? 623 ARG A NE   5  
ATOM 10435 C CZ   . ARG A 1 109 ? -18.097 -2.342  8.551   1.00 3.18  ? 623 ARG A CZ   5  
ATOM 10436 N NH1  . ARG A 1 109 ? -18.090 -3.549  8.072   1.00 3.13  ? 623 ARG A NH1  5  
ATOM 10437 N NH2  . ARG A 1 109 ? -18.416 -2.216  9.803   1.00 4.69  ? 623 ARG A NH2  5  
ATOM 10438 H H    . ARG A 1 109 ? -14.118 -1.498  5.493   1.00 0.76  ? 623 ARG A H    5  
ATOM 10439 H HA   . ARG A 1 109 ? -14.570 0.604   3.442   1.00 0.67  ? 623 ARG A HA   5  
ATOM 10440 H HB2  . ARG A 1 109 ? -16.719 1.090   4.092   1.00 0.89  ? 623 ARG A HB2  5  
ATOM 10441 H HB3  . ARG A 1 109 ? -16.720 -0.646  3.926   1.00 0.89  ? 623 ARG A HB3  5  
ATOM 10442 H HG2  . ARG A 1 109 ? -16.291 0.573   6.670   1.00 1.68  ? 623 ARG A HG2  5  
ATOM 10443 H HG3  . ARG A 1 109 ? -17.886 0.660   5.935   1.00 1.54  ? 623 ARG A HG3  5  
ATOM 10444 H HD2  . ARG A 1 109 ? -18.037 -1.747  5.772   1.00 1.03  ? 623 ARG A HD2  5  
ATOM 10445 H HD3  . ARG A 1 109 ? -16.381 -1.934  6.380   1.00 1.99  ? 623 ARG A HD3  5  
ATOM 10446 H HE   . ARG A 1 109 ? -17.866 -0.378  8.261   1.00 2.96  ? 623 ARG A HE   5  
ATOM 10447 H HH11 . ARG A 1 109 ? -18.042 -3.698  7.069   1.00 2.53  ? 623 ARG A HH11 5  
ATOM 10448 H HH12 . ARG A 1 109 ? -18.260 -4.343  8.682   1.00 4.11  ? 623 ARG A HH12 5  
ATOM 10449 H HH21 . ARG A 1 109 ? -18.420 -1.306  10.248  1.00 5.27  ? 623 ARG A HH21 5  
ATOM 10450 H HH22 . ARG A 1 109 ? -18.688 -3.033  10.338  1.00 5.43  ? 623 ARG A HH22 5  
ATOM 10451 N N    . ALA A 1 110 ? -14.353 2.525   5.058   1.00 0.66  ? 624 ALA A N    5  
ATOM 10452 C CA   . ALA A 1 110 ? -13.980 3.635   5.919   1.00 0.61  ? 624 ALA A CA   5  
ATOM 10453 C C    . ALA A 1 110 ? -14.828 3.635   7.206   1.00 0.63  ? 624 ALA A C    5  
ATOM 10454 O O    . ALA A 1 110 ? -16.061 3.587   7.147   1.00 0.72  ? 624 ALA A O    5  
ATOM 10455 C CB   . ALA A 1 110 ? -14.150 4.918   5.102   1.00 0.63  ? 624 ALA A CB   5  
ATOM 10456 H H    . ALA A 1 110 ? -14.861 2.736   4.205   1.00 0.70  ? 624 ALA A H    5  
ATOM 10457 H HA   . ALA A 1 110 ? -12.929 3.539   6.191   1.00 0.63  ? 624 ALA A HA   5  
ATOM 10458 H HB1  . ALA A 1 110 ? -13.583 4.851   4.173   1.00 1.64  ? 624 ALA A HB1  5  
ATOM 10459 H HB2  . ALA A 1 110 ? -15.202 5.069   4.863   1.00 1.63  ? 624 ALA A HB2  5  
ATOM 10460 H HB3  . ALA A 1 110 ? -13.784 5.767   5.672   1.00 1.55  ? 624 ALA A HB3  5  
ATOM 10461 N N    . ASP A 1 111 ? -14.187 3.718   8.378   1.00 0.63  ? 625 ASP A N    5  
ATOM 10462 C CA   . ASP A 1 111 ? -14.903 3.929   9.652   1.00 0.72  ? 625 ASP A CA   5  
ATOM 10463 C C    . ASP A 1 111 ? -15.368 5.379   9.804   1.00 0.76  ? 625 ASP A C    5  
ATOM 10464 O O    . ASP A 1 111 ? -16.266 5.702   10.583  1.00 0.86  ? 625 ASP A O    5  
ATOM 10465 C CB   . ASP A 1 111 ? -13.975 3.622   10.833  1.00 0.78  ? 625 ASP A CB   5  
ATOM 10466 C CG   . ASP A 1 111 ? -14.785 3.186   12.050  1.00 1.12  ? 625 ASP A CG   5  
ATOM 10467 O OD1  . ASP A 1 111 ? -15.405 2.103   11.981  1.00 1.90  ? 625 ASP A OD1  5  
ATOM 10468 O OD2  . ASP A 1 111 ? -14.805 3.909   13.075  1.00 2.10  ? 625 ASP A OD2  5  
ATOM 10469 H H    . ASP A 1 111 ? -13.175 3.772   8.392   1.00 0.62  ? 625 ASP A H    5  
ATOM 10470 H HA   . ASP A 1 111 ? -15.774 3.271   9.694   1.00 0.77  ? 625 ASP A HA   5  
ATOM 10471 H HB2  . ASP A 1 111 ? -13.260 2.854   10.562  1.00 0.79  ? 625 ASP A HB2  5  
ATOM 10472 H HB3  . ASP A 1 111 ? -13.395 4.508   11.086  1.00 0.92  ? 625 ASP A HB3  5  
ATOM 10473 N N    . THR A 1 112 ? -14.662 6.264   9.104   1.00 0.72  ? 626 THR A N    5  
ATOM 10474 C CA   . THR A 1 112 ? -14.656 7.701   9.357   1.00 0.72  ? 626 THR A CA   5  
ATOM 10475 C C    . THR A 1 112 ? -14.283 8.430   8.065   1.00 0.68  ? 626 THR A C    5  
ATOM 10476 O O    . THR A 1 112 ? -14.065 7.782   7.041   1.00 0.70  ? 626 THR A O    5  
ATOM 10477 C CB   . THR A 1 112 ? -13.678 7.951   10.516  1.00 0.78  ? 626 THR A CB   5  
ATOM 10478 O OG1  . THR A 1 112 ? -13.594 9.307   10.844  1.00 0.86  ? 626 THR A OG1  5  
ATOM 10479 C CG2  . THR A 1 112 ? -12.269 7.413   10.269  1.00 0.76  ? 626 THR A CG2  5  
ATOM 10480 H H    . THR A 1 112 ? -13.909 5.917   8.502   1.00 0.67  ? 626 THR A H    5  
ATOM 10481 H HA   . THR A 1 112 ? -15.642 8.041   9.667   1.00 0.78  ? 626 THR A HA   5  
ATOM 10482 H HB   . THR A 1 112 ? -14.068 7.431   11.390  1.00 0.87  ? 626 THR A HB   5  
ATOM 10483 H HG1  . THR A 1 112 ? -13.330 9.335   11.778  1.00 1.03  ? 626 THR A HG1  5  
ATOM 10484 H HG21 . THR A 1 112 ? -11.869 7.802   9.333   1.00 1.74  ? 626 THR A HG21 5  
ATOM 10485 H HG22 . THR A 1 112 ? -12.309 6.322   10.242  1.00 1.85  ? 626 THR A HG22 5  
ATOM 10486 H HG23 . THR A 1 112 ? -11.620 7.706   11.092  1.00 1.51  ? 626 THR A HG23 5  
ATOM 10487 N N    . TYR A 1 113 ? -14.195 9.758   8.074   1.00 0.72  ? 627 TYR A N    5  
ATOM 10488 C CA   . TYR A 1 113 ? -13.508 10.477  7.002   1.00 0.74  ? 627 TYR A CA   5  
ATOM 10489 C C    . TYR A 1 113 ? -12.023 10.074  7.074   1.00 0.73  ? 627 TYR A C    5  
ATOM 10490 O O    . TYR A 1 113 ? -11.283 10.479  7.974   1.00 0.85  ? 627 TYR A O    5  
ATOM 10491 C CB   . TYR A 1 113 ? -13.832 11.980  7.107   1.00 0.86  ? 627 TYR A CB   5  
ATOM 10492 C CG   . TYR A 1 113 ? -12.723 12.953  6.750   1.00 1.33  ? 627 TYR A CG   5  
ATOM 10493 C CD1  . TYR A 1 113 ? -12.367 13.174  5.405   1.00 1.86  ? 627 TYR A CD1  5  
ATOM 10494 C CD2  . TYR A 1 113 ? -12.071 13.664  7.776   1.00 2.67  ? 627 TYR A CD2  5  
ATOM 10495 C CE1  . TYR A 1 113 ? -11.346 14.102  5.090   1.00 2.20  ? 627 TYR A CE1  5  
ATOM 10496 C CE2  . TYR A 1 113 ? -11.066 14.597  7.466   1.00 3.21  ? 627 TYR A CE2  5  
ATOM 10497 C CZ   . TYR A 1 113 ? -10.701 14.817  6.125   1.00 2.52  ? 627 TYR A CZ   5  
ATOM 10498 O OH   . TYR A 1 113 ? -9.724  15.717  5.847   1.00 3.16  ? 627 TYR A OH   5  
ATOM 10499 H H    . TYR A 1 113 ? -14.316 10.225  8.966   1.00 0.79  ? 627 TYR A H    5  
ATOM 10500 H HA   . TYR A 1 113 ? -13.894 10.136  6.043   1.00 0.71  ? 627 TYR A HA   5  
ATOM 10501 H HB2  . TYR A 1 113 ? -14.686 12.185  6.460   1.00 0.90  ? 627 TYR A HB2  5  
ATOM 10502 H HB3  . TYR A 1 113 ? -14.168 12.200  8.117   1.00 1.01  ? 627 TYR A HB3  5  
ATOM 10503 H HD1  . TYR A 1 113 ? -12.900 12.644  4.622   1.00 2.80  ? 627 TYR A HD1  5  
ATOM 10504 H HD2  . TYR A 1 113 ? -12.345 13.497  8.808   1.00 3.61  ? 627 TYR A HD2  5  
ATOM 10505 H HE1  . TYR A 1 113 ? -11.060 14.290  4.064   1.00 3.01  ? 627 TYR A HE1  5  
ATOM 10506 H HE2  . TYR A 1 113 ? -10.566 15.147  8.249   1.00 4.47  ? 627 TYR A HE2  5  
ATOM 10507 H HH   . TYR A 1 113 ? -9.451  15.701  4.919   1.00 2.95  ? 627 TYR A HH   5  
ATOM 10508 N N    . CYS A 1 114 ? -11.627 9.153   6.189   1.00 0.67  ? 628 CYS A N    5  
ATOM 10509 C CA   . CYS A 1 114 ? -10.306 8.532   6.165   1.00 0.63  ? 628 CYS A CA   5  
ATOM 10510 C C    . CYS A 1 114 ? -9.508  9.095   4.980   1.00 0.65  ? 628 CYS A C    5  
ATOM 10511 O O    . CYS A 1 114 ? -9.950  9.062   3.828   1.00 0.69  ? 628 CYS A O    5  
ATOM 10512 C CB   . CYS A 1 114 ? -10.412 6.984   6.212   1.00 0.56  ? 628 CYS A CB   5  
ATOM 10513 S SG   . CYS A 1 114 ? -10.875 6.224   4.635   1.00 2.09  ? 628 CYS A SG   5  
ATOM 10514 H H    . CYS A 1 114 ? -12.296 8.871   5.479   1.00 0.67  ? 628 CYS A H    5  
ATOM 10515 H HA   . CYS A 1 114 ? -9.778  8.832   7.070   1.00 0.68  ? 628 CYS A HA   5  
ATOM 10516 H HB2  . CYS A 1 114 ? -9.500  6.542   6.580   1.00 1.18  ? 628 CYS A HB2  5  
ATOM 10517 H HB3  . CYS A 1 114 ? -11.118 6.647   6.947   1.00 1.32  ? 628 CYS A HB3  5  
ATOM 10518 H HG   . CYS A 1 114 ? -11.931 7.015   4.392   1.00 2.99  ? 628 CYS A HG   5  
ATOM 10519 N N    . ARG A 1 115 ? -8.319  9.627   5.267   1.00 0.70  ? 629 ARG A N    5  
ATOM 10520 C CA   . ARG A 1 115 ? -7.354  10.090  4.272   1.00 0.73  ? 629 ARG A CA   5  
ATOM 10521 C C    . ARG A 1 115 ? -6.271  9.035   4.081   1.00 0.77  ? 629 ARG A C    5  
ATOM 10522 O O    . ARG A 1 115 ? -5.575  8.627   5.019   1.00 0.84  ? 629 ARG A O    5  
ATOM 10523 C CB   . ARG A 1 115 ? -6.844  11.482  4.649   1.00 0.92  ? 629 ARG A CB   5  
ATOM 10524 C CG   . ARG A 1 115 ? -5.708  11.941  3.746   1.00 1.67  ? 629 ARG A CG   5  
ATOM 10525 C CD   . ARG A 1 115 ? -5.412  13.427  3.941   1.00 1.82  ? 629 ARG A CD   5  
ATOM 10526 N NE   . ARG A 1 115 ? -4.984  13.769  5.312   1.00 2.27  ? 629 ARG A NE   5  
ATOM 10527 C CZ   . ARG A 1 115 ? -5.714  14.330  6.263   1.00 2.97  ? 629 ARG A CZ   5  
ATOM 10528 N NH1  . ARG A 1 115 ? -6.943  14.715  6.094   1.00 3.45  ? 629 ARG A NH1  5  
ATOM 10529 N NH2  . ARG A 1 115 ? -5.240  14.525  7.451   1.00 3.96  ? 629 ARG A NH2  5  
ATOM 10530 H H    . ARG A 1 115 ? -8.035  9.652   6.242   1.00 0.73  ? 629 ARG A H    5  
ATOM 10531 H HA   . ARG A 1 115 ? -7.866  10.198  3.312   1.00 0.73  ? 629 ARG A HA   5  
ATOM 10532 H HB2  . ARG A 1 115 ? -7.676  12.186  4.583   1.00 2.17  ? 629 ARG A HB2  5  
ATOM 10533 H HB3  . ARG A 1 115 ? -6.464  11.484  5.655   1.00 2.03  ? 629 ARG A HB3  5  
ATOM 10534 H HG2  . ARG A 1 115 ? -4.805  11.364  3.952   1.00 3.08  ? 629 ARG A HG2  5  
ATOM 10535 H HG3  . ARG A 1 115 ? -6.010  11.767  2.717   1.00 2.69  ? 629 ARG A HG3  5  
ATOM 10536 H HD2  . ARG A 1 115 ? -4.617  13.669  3.241   1.00 2.44  ? 629 ARG A HD2  5  
ATOM 10537 H HD3  . ARG A 1 115 ? -6.302  13.989  3.663   1.00 1.95  ? 629 ARG A HD3  5  
ATOM 10538 H HE   . ARG A 1 115 ? -4.032  13.518  5.562   1.00 2.85  ? 629 ARG A HE   5  
ATOM 10539 H HH11 . ARG A 1 115 ? -7.360  14.745  5.174   1.00 3.06  ? 629 ARG A HH11 5  
ATOM 10540 H HH12 . ARG A 1 115 ? -7.440  15.123  6.881   1.00 4.52  ? 629 ARG A HH12 5  
ATOM 10541 H HH21 . ARG A 1 115 ? -4.264  14.359  7.674   1.00 4.13  ? 629 ARG A HH21 5  
ATOM 10542 H HH22 . ARG A 1 115 ? -5.853  14.948  8.141   1.00 4.83  ? 629 ARG A HH22 5  
ATOM 10543 N N    . LEU A 1 116 ? -6.179  8.582   2.842   1.00 0.77  ? 630 LEU A N    5  
ATOM 10544 C CA   . LEU A 1 116 ? -5.404  7.438   2.382   1.00 0.78  ? 630 LEU A CA   5  
ATOM 10545 C C    . LEU A 1 116 ? -4.417  7.889   1.283   1.00 0.78  ? 630 LEU A C    5  
ATOM 10546 O O    . LEU A 1 116 ? -4.379  9.054   0.878   1.00 1.04  ? 630 LEU A O    5  
ATOM 10547 C CB   . LEU A 1 116 ? -6.363  6.320   1.891   1.00 0.78  ? 630 LEU A CB   5  
ATOM 10548 C CG   . LEU A 1 116 ? -7.541  5.910   2.809   1.00 0.79  ? 630 LEU A CG   5  
ATOM 10549 C CD1  . LEU A 1 116 ? -8.225  4.648   2.273   1.00 0.83  ? 630 LEU A CD1  5  
ATOM 10550 C CD2  . LEU A 1 116 ? -7.153  5.560   4.246   1.00 0.87  ? 630 LEU A CD2  5  
ATOM 10551 H H    . LEU A 1 116 ? -6.678  9.110   2.128   1.00 0.79  ? 630 LEU A H    5  
ATOM 10552 H HA   . LEU A 1 116 ? -4.819  7.042   3.213   1.00 0.79  ? 630 LEU A HA   5  
ATOM 10553 H HB2  . LEU A 1 116 ? -6.790  6.636   0.937   1.00 0.76  ? 630 LEU A HB2  5  
ATOM 10554 H HB3  . LEU A 1 116 ? -5.764  5.430   1.694   1.00 0.83  ? 630 LEU A HB3  5  
ATOM 10555 H HG   . LEU A 1 116 ? -8.269  6.721   2.834   1.00 0.78  ? 630 LEU A HG   5  
ATOM 10556 H HD11 . LEU A 1 116 ? -8.633  4.831   1.283   1.00 1.58  ? 630 LEU A HD11 5  
ATOM 10557 H HD12 . LEU A 1 116 ? -9.047  4.372   2.942   1.00 2.14  ? 630 LEU A HD12 5  
ATOM 10558 H HD13 . LEU A 1 116 ? -7.507  3.827   2.194   1.00 1.66  ? 630 LEU A HD13 5  
ATOM 10559 H HD21 . LEU A 1 116 ? -6.483  4.705   4.244   1.00 1.46  ? 630 LEU A HD21 5  
ATOM 10560 H HD22 . LEU A 1 116 ? -8.051  5.324   4.826   1.00 1.84  ? 630 LEU A HD22 5  
ATOM 10561 H HD23 . LEU A 1 116 ? -6.670  6.403   4.725   1.00 1.95  ? 630 LEU A HD23 5  
ATOM 10562 N N    . TYR A 1 117 ? -3.611  6.959   0.787   1.00 0.63  ? 631 TYR A N    5  
ATOM 10563 C CA   . TYR A 1 117 ? -2.657  7.173   -0.303  1.00 0.65  ? 631 TYR A CA   5  
ATOM 10564 C C    . TYR A 1 117 ? -2.750  6.065   -1.358  1.00 0.69  ? 631 TYR A C    5  
ATOM 10565 O O    . TYR A 1 117 ? -3.214  4.960   -1.049  1.00 0.85  ? 631 TYR A O    5  
ATOM 10566 C CB   . TYR A 1 117 ? -1.246  7.280   0.286   1.00 0.79  ? 631 TYR A CB   5  
ATOM 10567 C CG   . TYR A 1 117 ? -0.687  8.685   0.263   1.00 2.18  ? 631 TYR A CG   5  
ATOM 10568 C CD1  . TYR A 1 117 ? -0.033  9.126   -0.897  1.00 3.38  ? 631 TYR A CD1  5  
ATOM 10569 C CD2  . TYR A 1 117 ? -0.829  9.547   1.364   1.00 3.60  ? 631 TYR A CD2  5  
ATOM 10570 C CE1  . TYR A 1 117 ? 0.519   10.420  -0.951  1.00 4.95  ? 631 TYR A CE1  5  
ATOM 10571 C CE2  . TYR A 1 117 ? -0.289  10.848  1.315   1.00 5.12  ? 631 TYR A CE2  5  
ATOM 10572 C CZ   . TYR A 1 117 ? 0.399   11.282  0.161   1.00 5.58  ? 631 TYR A CZ   5  
ATOM 10573 O OH   . TYR A 1 117 ? 0.934   12.532  0.127   1.00 7.25  ? 631 TYR A OH   5  
ATOM 10574 H H    . TYR A 1 117 ? -3.641  6.039   1.211   1.00 0.63  ? 631 TYR A H    5  
ATOM 10575 H HA   . TYR A 1 117 ? -2.890  8.109   -0.811  1.00 0.71  ? 631 TYR A HA   5  
ATOM 10576 H HB2  . TYR A 1 117 ? -1.236  6.906   1.312   1.00 1.82  ? 631 TYR A HB2  5  
ATOM 10577 H HB3  . TYR A 1 117 ? -0.570  6.646   -0.288  1.00 1.63  ? 631 TYR A HB3  5  
ATOM 10578 H HD1  . TYR A 1 117 ? 0.016   8.456   -1.748  1.00 3.76  ? 631 TYR A HD1  5  
ATOM 10579 H HD2  . TYR A 1 117 ? -1.371  9.213   2.235   1.00 4.08  ? 631 TYR A HD2  5  
ATOM 10580 H HE1  . TYR A 1 117 ? 1.018   10.757  -1.846  1.00 6.09  ? 631 TYR A HE1  5  
ATOM 10581 H HE2  . TYR A 1 117 ? -0.408  11.526  2.148   1.00 6.36  ? 631 TYR A HE2  5  
ATOM 10582 H HH   . TYR A 1 117 ? 1.432   12.684  -0.699  1.00 7.66  ? 631 TYR A HH   5  
ATOM 10583 N N    . SER A 1 118 ? -2.304  6.353   -2.589  1.00 0.68  ? 632 SER A N    5  
ATOM 10584 C CA   . SER A 1 118 ? -2.313  5.401   -3.708  1.00 0.83  ? 632 SER A CA   5  
ATOM 10585 C C    . SER A 1 118 ? -0.967  5.288   -4.417  1.00 0.71  ? 632 SER A C    5  
ATOM 10586 O O    . SER A 1 118 ? -0.375  6.301   -4.800  1.00 0.89  ? 632 SER A O    5  
ATOM 10587 C CB   . SER A 1 118 ? -3.338  5.820   -4.760  1.00 1.28  ? 632 SER A CB   5  
ATOM 10588 O OG   . SER A 1 118 ? -4.645  5.853   -4.234  1.00 1.98  ? 632 SER A OG   5  
ATOM 10589 H H    . SER A 1 118 ? -2.010  7.305   -2.802  1.00 0.68  ? 632 SER A H    5  
ATOM 10590 H HA   . SER A 1 118 ? -2.570  4.416   -3.332  1.00 1.01  ? 632 SER A HA   5  
ATOM 10591 H HB2  . SER A 1 118 ? -3.079  6.814   -5.131  1.00 2.61  ? 632 SER A HB2  5  
ATOM 10592 H HB3  . SER A 1 118 ? -3.307  5.114   -5.592  1.00 1.82  ? 632 SER A HB3  5  
ATOM 10593 H HG   . SER A 1 118 ? -5.173  6.417   -4.842  1.00 2.54  ? 632 SER A HG   5  
ATOM 10594 N N    . LEU A 1 119 ? -0.517  4.056   -4.670  1.00 0.72  ? 633 LEU A N    5  
ATOM 10595 C CA   . LEU A 1 119 ? 0.773   3.776   -5.302  1.00 0.71  ? 633 LEU A CA   5  
ATOM 10596 C C    . LEU A 1 119 ? 0.635   2.665   -6.357  1.00 0.76  ? 633 LEU A C    5  
ATOM 10597 O O    . LEU A 1 119 ? 0.357   1.512   -6.020  1.00 0.77  ? 633 LEU A O    5  
ATOM 10598 C CB   . LEU A 1 119 ? 1.771   3.420   -4.177  1.00 0.88  ? 633 LEU A CB   5  
ATOM 10599 C CG   . LEU A 1 119 ? 3.232   3.809   -4.454  1.00 1.04  ? 633 LEU A CG   5  
ATOM 10600 C CD1  . LEU A 1 119 ? 4.074   3.453   -3.228  1.00 1.37  ? 633 LEU A CD1  5  
ATOM 10601 C CD2  . LEU A 1 119 ? 3.848   3.111   -5.665  1.00 1.38  ? 633 LEU A CD2  5  
ATOM 10602 H H    . LEU A 1 119 ? -1.040  3.258   -4.314  1.00 0.85  ? 633 LEU A H    5  
ATOM 10603 H HA   . LEU A 1 119 ? 1.131   4.677   -5.804  1.00 0.74  ? 633 LEU A HA   5  
ATOM 10604 H HB2  . LEU A 1 119 ? 1.475   3.953   -3.272  1.00 0.94  ? 633 LEU A HB2  5  
ATOM 10605 H HB3  . LEU A 1 119 ? 1.710   2.354   -3.953  1.00 1.07  ? 633 LEU A HB3  5  
ATOM 10606 H HG   . LEU A 1 119 ? 3.277   4.887   -4.618  1.00 1.02  ? 633 LEU A HG   5  
ATOM 10607 H HD11 . LEU A 1 119 ? 5.092   3.815   -3.364  1.00 1.62  ? 633 LEU A HD11 5  
ATOM 10608 H HD12 . LEU A 1 119 ? 4.093   2.372   -3.088  1.00 2.36  ? 633 LEU A HD12 5  
ATOM 10609 H HD13 . LEU A 1 119 ? 3.655   3.918   -2.336  1.00 2.15  ? 633 LEU A HD13 5  
ATOM 10610 H HD21 . LEU A 1 119 ? 3.393   3.485   -6.579  1.00 2.05  ? 633 LEU A HD21 5  
ATOM 10611 H HD22 . LEU A 1 119 ? 3.697   2.033   -5.594  1.00 2.34  ? 633 LEU A HD22 5  
ATOM 10612 H HD23 . LEU A 1 119 ? 4.916   3.322   -5.713  1.00 1.77  ? 633 LEU A HD23 5  
ATOM 10613 N N    . SER A 1 120 ? 0.862   3.002   -7.632  1.00 0.86  ? 634 SER A N    5  
ATOM 10614 C CA   . SER A 1 120 ? 0.964   2.023   -8.725  1.00 0.88  ? 634 SER A CA   5  
ATOM 10615 C C    . SER A 1 120 ? 2.069   1.015   -8.402  1.00 0.93  ? 634 SER A C    5  
ATOM 10616 O O    . SER A 1 120 ? 3.239   1.387   -8.268  1.00 0.88  ? 634 SER A O    5  
ATOM 10617 C CB   . SER A 1 120 ? 1.288   2.725   -10.052 1.00 0.92  ? 634 SER A CB   5  
ATOM 10618 O OG   . SER A 1 120 ? 1.489   1.788   -11.100 1.00 1.94  ? 634 SER A OG   5  
ATOM 10619 H H    . SER A 1 120 ? 0.952   3.982   -7.860  1.00 0.99  ? 634 SER A H    5  
ATOM 10620 H HA   . SER A 1 120 ? 0.017   1.498   -8.840  1.00 1.10  ? 634 SER A HA   5  
ATOM 10621 H HB2  . SER A 1 120 ? 0.468   3.390   -10.322 1.00 1.59  ? 634 SER A HB2  5  
ATOM 10622 H HB3  . SER A 1 120 ? 2.195   3.317   -9.926  1.00 1.78  ? 634 SER A HB3  5  
ATOM 10623 H HG   . SER A 1 120 ? 2.016   2.213   -11.810 1.00 1.92  ? 634 SER A HG   5  
ATOM 10624 N N    . VAL A 1 121 ? 1.700   -0.265  -8.308  1.00 1.20  ? 635 VAL A N    5  
ATOM 10625 C CA   . VAL A 1 121 ? 2.645   -1.368  -8.068  1.00 1.50  ? 635 VAL A CA   5  
ATOM 10626 C C    . VAL A 1 121 ? 3.788   -1.325  -9.059  1.00 1.49  ? 635 VAL A C    5  
ATOM 10627 O O    . VAL A 1 121 ? 4.951   -1.583  -8.750  1.00 1.75  ? 635 VAL A O    5  
ATOM 10628 C CB   . VAL A 1 121 ? 1.938   -2.736  -8.121  1.00 1.74  ? 635 VAL A CB   5  
ATOM 10629 C CG1  . VAL A 1 121 ? 1.996   -3.499  -9.442  1.00 1.63  ? 635 VAL A CG1  5  
ATOM 10630 C CG2  . VAL A 1 121 ? 2.790   -3.654  -7.297  1.00 2.62  ? 635 VAL A CG2  5  
ATOM 10631 H H    . VAL A 1 121 ? 0.755   -0.499  -8.598  1.00 1.26  ? 635 VAL A H    5  
ATOM 10632 H HA   . VAL A 1 121 ? 3.094   -1.266  -7.091  1.00 1.71  ? 635 VAL A HA   5  
ATOM 10633 H HB   . VAL A 1 121 ? 0.927   -2.688  -7.718  1.00 3.17  ? 635 VAL A HB   5  
ATOM 10634 H HG11 . VAL A 1 121 ? 1.551   -2.896  -10.217 1.00 2.70  ? 635 VAL A HG11 5  
ATOM 10635 H HG12 . VAL A 1 121 ? 3.052   -3.731  -9.658  1.00 2.27  ? 635 VAL A HG12 5  
ATOM 10636 H HG13 . VAL A 1 121 ? 1.462   -4.440  -9.337  1.00 2.44  ? 635 VAL A HG13 5  
ATOM 10637 H HG21 . VAL A 1 121 ? 3.748   -3.651  -7.829  1.00 2.69  ? 635 VAL A HG21 5  
ATOM 10638 H HG22 . VAL A 1 121 ? 2.865   -3.269  -6.285  1.00 3.88  ? 635 VAL A HG22 5  
ATOM 10639 H HG23 . VAL A 1 121 ? 2.370   -4.651  -7.294  1.00 3.18  ? 635 VAL A HG23 5  
ATOM 10640 N N    . ASP A 1 122 ? 3.441   -0.987  -10.290 1.00 1.30  ? 636 ASP A N    5  
ATOM 10641 C CA   . ASP A 1 122 ? 4.371   -1.122  -11.372 1.00 1.59  ? 636 ASP A CA   5  
ATOM 10642 C C    . ASP A 1 122 ? 5.480   -0.071  -11.280 1.00 1.52  ? 636 ASP A C    5  
ATOM 10643 O O    . ASP A 1 122 ? 6.603   -0.339  -11.699 1.00 1.83  ? 636 ASP A O    5  
ATOM 10644 C CB   . ASP A 1 122 ? 3.633   -0.912  -12.697 1.00 1.64  ? 636 ASP A CB   5  
ATOM 10645 C CG   . ASP A 1 122 ? 2.504   -1.916  -12.886 1.00 1.97  ? 636 ASP A CG   5  
ATOM 10646 O OD1  . ASP A 1 122 ? 1.363   -1.671  -12.432 1.00 2.34  ? 636 ASP A OD1  5  
ATOM 10647 O OD2  . ASP A 1 122 ? 2.773   -3.003  -13.455 1.00 2.68  ? 636 ASP A OD2  5  
ATOM 10648 H H    . ASP A 1 122 ? 2.454   -0.875  -10.479 1.00 1.16  ? 636 ASP A H    5  
ATOM 10649 H HA   . ASP A 1 122 ? 4.761   -2.143  -11.225 1.00 2.06  ? 636 ASP A HA   5  
ATOM 10650 H HB2  . ASP A 1 122 ? 3.252   0.112   -12.721 1.00 1.45  ? 636 ASP A HB2  5  
ATOM 10651 H HB3  . ASP A 1 122 ? 4.345   -1.007  -13.517 1.00 1.99  ? 636 ASP A HB3  5  
ATOM 10652 N N    . ASN A 1 123 ? 5.167   1.098   -10.706 1.00 1.19  ? 637 ASN A N    5  
ATOM 10653 C CA   . ASN A 1 123 ? 6.118   2.180   -10.475 1.00 1.09  ? 637 ASN A CA   5  
ATOM 10654 C C    . ASN A 1 123 ? 7.098   1.830   -9.349  1.00 1.06  ? 637 ASN A C    5  
ATOM 10655 O O    . ASN A 1 123 ? 8.274   2.148   -9.472  1.00 1.22  ? 637 ASN A O    5  
ATOM 10656 C CB   . ASN A 1 123 ? 5.364   3.486   -10.193 1.00 1.08  ? 637 ASN A CB   5  
ATOM 10657 C CG   . ASN A 1 123 ? 6.266   4.687   -10.401 1.00 2.13  ? 637 ASN A CG   5  
ATOM 10658 O OD1  . ASN A 1 123 ? 6.612   5.419   -9.480  1.00 3.71  ? 637 ASN A OD1  5  
ATOM 10659 N ND2  . ASN A 1 123 ? 6.682   4.918   -11.624 1.00 2.13  ? 637 ASN A ND2  5  
ATOM 10660 H H    . ASN A 1 123 ? 4.231   1.200   -10.331 1.00 1.09  ? 637 ASN A H    5  
ATOM 10661 H HA   . ASN A 1 123 ? 6.701   2.327   -11.387 1.00 1.18  ? 637 ASN A HA   5  
ATOM 10662 H HB2  . ASN A 1 123 ? 4.530   3.573   -10.885 1.00 1.50  ? 637 ASN A HB2  5  
ATOM 10663 H HB3  . ASN A 1 123 ? 4.976   3.490   -9.174  1.00 2.10  ? 637 ASN A HB3  5  
ATOM 10664 H HD21 . ASN A 1 123 ? 6.523   4.242   -12.368 1.00 2.64  ? 637 ASN A HD21 5  
ATOM 10665 H HD22 . ASN A 1 123 ? 7.237   5.745   -11.791 1.00 2.38  ? 637 ASN A HD22 5  
ATOM 10666 N N    . PHE A 1 124 ? 6.647   1.098   -8.321  1.00 1.03  ? 638 PHE A N    5  
ATOM 10667 C CA   . PHE A 1 124 ? 7.503   0.453   -7.314  1.00 1.11  ? 638 PHE A CA   5  
ATOM 10668 C C    . PHE A 1 124 ? 8.477   -0.527  -7.988  1.00 1.27  ? 638 PHE A C    5  
ATOM 10669 O O    . PHE A 1 124 ? 9.685   -0.458  -7.772  1.00 1.27  ? 638 PHE A O    5  
ATOM 10670 C CB   . PHE A 1 124 ? 6.617   -0.238  -6.270  1.00 1.23  ? 638 PHE A CB   5  
ATOM 10671 C CG   . PHE A 1 124 ? 7.296   -0.722  -4.996  1.00 1.35  ? 638 PHE A CG   5  
ATOM 10672 C CD1  . PHE A 1 124 ? 8.394   -1.609  -5.024  1.00 1.86  ? 638 PHE A CD1  5  
ATOM 10673 C CD2  . PHE A 1 124 ? 6.773   -0.322  -3.753  1.00 2.80  ? 638 PHE A CD2  5  
ATOM 10674 C CE1  . PHE A 1 124 ? 9.000   -2.037  -3.832  1.00 1.91  ? 638 PHE A CE1  5  
ATOM 10675 C CE2  . PHE A 1 124 ? 7.379   -0.746  -2.557  1.00 2.94  ? 638 PHE A CE2  5  
ATOM 10676 C CZ   . PHE A 1 124 ? 8.501   -1.593  -2.599  1.00 1.69  ? 638 PHE A CZ   5  
ATOM 10677 H H    . PHE A 1 124 ? 5.658   0.884   -8.301  1.00 1.04  ? 638 PHE A H    5  
ATOM 10678 H HA   . PHE A 1 124 ? 8.078   1.201   -6.779  1.00 1.00  ? 638 PHE A HA   5  
ATOM 10679 H HB2  . PHE A 1 124 ? 5.821   0.455   -5.995  1.00 1.18  ? 638 PHE A HB2  5  
ATOM 10680 H HB3  . PHE A 1 124 ? 6.146   -1.090  -6.736  1.00 1.38  ? 638 PHE A HB3  5  
ATOM 10681 H HD1  . PHE A 1 124 ? 8.773   -1.991  -5.955  1.00 3.09  ? 638 PHE A HD1  5  
ATOM 10682 H HD2  . PHE A 1 124 ? 5.894   0.310   -3.725  1.00 4.10  ? 638 PHE A HD2  5  
ATOM 10683 H HE1  . PHE A 1 124 ? 9.845   -2.710  -3.861  1.00 3.07  ? 638 PHE A HE1  5  
ATOM 10684 H HE2  . PHE A 1 124 ? 6.982   -0.421  -1.608  1.00 4.32  ? 638 PHE A HE2  5  
ATOM 10685 H HZ   . PHE A 1 124 ? 8.980   -1.919  -1.690  1.00 1.84  ? 638 PHE A HZ   5  
ATOM 10686 N N    . ASN A 1 125 ? 7.974   -1.406  -8.860  1.00 1.44  ? 639 ASN A N    5  
ATOM 10687 C CA   . ASN A 1 125 ? 8.795   -2.350  -9.631  1.00 1.64  ? 639 ASN A CA   5  
ATOM 10688 C C    . ASN A 1 125 ? 9.749   -1.660  -10.639 1.00 1.66  ? 639 ASN A C    5  
ATOM 10689 O O    . ASN A 1 125 ? 10.716  -2.271  -11.093 1.00 1.83  ? 639 ASN A O    5  
ATOM 10690 C CB   . ASN A 1 125 ? 7.831   -3.325  -10.348 1.00 1.77  ? 639 ASN A CB   5  
ATOM 10691 C CG   . ASN A 1 125 ? 7.300   -4.438  -9.462  1.00 2.08  ? 639 ASN A CG   5  
ATOM 10692 O OD1  . ASN A 1 125 ? 7.997   -4.950  -8.596  1.00 2.71  ? 639 ASN A OD1  5  
ATOM 10693 N ND2  . ASN A 1 125 ? 6.091   -4.897  -9.679  1.00 1.93  ? 639 ASN A ND2  5  
ATOM 10694 H H    . ASN A 1 125 ? 6.965   -1.433  -8.974  1.00 1.47  ? 639 ASN A H    5  
ATOM 10695 H HA   . ASN A 1 125 ? 9.437   -2.899  -8.931  1.00 1.71  ? 639 ASN A HA   5  
ATOM 10696 H HB2  . ASN A 1 125 ? 6.996   -2.773  -10.774 1.00 1.82  ? 639 ASN A HB2  5  
ATOM 10697 H HB3  . ASN A 1 125 ? 8.351   -3.807  -11.175 1.00 1.81  ? 639 ASN A HB3  5  
ATOM 10698 H HD21 . ASN A 1 125 ? 5.506   -4.529  -10.423 1.00 1.83  ? 639 ASN A HD21 5  
ATOM 10699 H HD22 . ASN A 1 125 ? 5.809   -5.735  -9.192  1.00 2.20  ? 639 ASN A HD22 5  
ATOM 10700 N N    . GLU A 1 126 ? 9.491   -0.402  -10.994 1.00 1.52  ? 640 GLU A N    5  
ATOM 10701 C CA   . GLU A 1 126 ? 10.245  0.425   -11.944 1.00 1.57  ? 640 GLU A CA   5  
ATOM 10702 C C    . GLU A 1 126 ? 11.355  1.249   -11.264 1.00 1.38  ? 640 GLU A C    5  
ATOM 10703 O O    . GLU A 1 126 ? 12.488  1.265   -11.751 1.00 1.57  ? 640 GLU A O    5  
ATOM 10704 C CB   . GLU A 1 126 ? 9.196   1.254   -12.695 1.00 1.74  ? 640 GLU A CB   5  
ATOM 10705 C CG   . GLU A 1 126 ? 9.642   2.557   -13.341 1.00 1.52  ? 640 GLU A CG   5  
ATOM 10706 C CD   . GLU A 1 126 ? 8.594   3.074   -14.340 1.00 2.25  ? 640 GLU A CD   5  
ATOM 10707 O OE1  . GLU A 1 126 ? 7.432   3.349   -13.948 1.00 3.71  ? 640 GLU A OE1  5  
ATOM 10708 O OE2  . GLU A 1 126 ? 8.924   3.203   -15.545 1.00 2.69  ? 640 GLU A OE2  5  
ATOM 10709 H H    . GLU A 1 126 ? 8.639   0.007   -10.636 1.00 1.42  ? 640 GLU A H    5  
ATOM 10710 H HA   . GLU A 1 126 ? 10.743  -0.204  -12.676 1.00 1.78  ? 640 GLU A HA   5  
ATOM 10711 H HB2  . GLU A 1 126 ? 8.742   0.615   -13.447 1.00 2.49  ? 640 GLU A HB2  5  
ATOM 10712 H HB3  . GLU A 1 126 ? 8.433   1.528   -11.980 1.00 2.70  ? 640 GLU A HB3  5  
ATOM 10713 H HG2  . GLU A 1 126 ? 9.753   3.268   -12.525 1.00 2.45  ? 640 GLU A HG2  5  
ATOM 10714 H HG3  . GLU A 1 126 ? 10.601  2.412   -13.843 1.00 2.42  ? 640 GLU A HG3  5  
ATOM 10715 N N    . VAL A 1 127 ? 11.077  1.851   -10.103 1.00 1.13  ? 641 VAL A N    5  
ATOM 10716 C CA   . VAL A 1 127 ? 12.104  2.456   -9.224  1.00 1.09  ? 641 VAL A CA   5  
ATOM 10717 C C    . VAL A 1 127 ? 13.051  1.400   -8.638  1.00 1.16  ? 641 VAL A C    5  
ATOM 10718 O O    . VAL A 1 127 ? 14.225  1.685   -8.413  1.00 1.20  ? 641 VAL A O    5  
ATOM 10719 C CB   . VAL A 1 127 ? 11.458  3.336   -8.133  1.00 0.98  ? 641 VAL A CB   5  
ATOM 10720 C CG1  . VAL A 1 127 ? 10.585  2.548   -7.164  1.00 1.03  ? 641 VAL A CG1  5  
ATOM 10721 C CG2  . VAL A 1 127 ? 12.469  4.101   -7.276  1.00 0.82  ? 641 VAL A CG2  5  
ATOM 10722 H H    . VAL A 1 127 ? 10.109  1.842   -9.793  1.00 1.05  ? 641 VAL A H    5  
ATOM 10723 H HA   . VAL A 1 127 ? 12.716  3.113   -9.840  1.00 1.13  ? 641 VAL A HA   5  
ATOM 10724 H HB   . VAL A 1 127 ? 10.823  4.071   -8.631  1.00 1.09  ? 641 VAL A HB   5  
ATOM 10725 H HG11 . VAL A 1 127 ? 9.832   2.015   -7.721  1.00 1.64  ? 641 VAL A HG11 5  
ATOM 10726 H HG12 . VAL A 1 127 ? 11.176  1.837   -6.592  1.00 1.85  ? 641 VAL A HG12 5  
ATOM 10727 H HG13 . VAL A 1 127 ? 10.087  3.233   -6.486  1.00 1.61  ? 641 VAL A HG13 5  
ATOM 10728 H HG21 . VAL A 1 127 ? 13.098  4.722   -7.911  1.00 1.47  ? 641 VAL A HG21 5  
ATOM 10729 H HG22 . VAL A 1 127 ? 11.936  4.723   -6.553  1.00 1.59  ? 641 VAL A HG22 5  
ATOM 10730 H HG23 . VAL A 1 127 ? 13.086  3.409   -6.708  1.00 1.89  ? 641 VAL A HG23 5  
ATOM 10731 N N    . LEU A 1 128 ? 12.586  0.153   -8.493  1.00 1.20  ? 642 LEU A N    5  
ATOM 10732 C CA   . LEU A 1 128 ? 13.406  -1.031  -8.196  1.00 1.31  ? 642 LEU A CA   5  
ATOM 10733 C C    . LEU A 1 128 ? 14.685  -1.152  -9.047  1.00 1.38  ? 642 LEU A C    5  
ATOM 10734 O O    . LEU A 1 128 ? 15.733  -1.562  -8.550  1.00 1.49  ? 642 LEU A O    5  
ATOM 10735 C CB   . LEU A 1 128 ? 12.548  -2.268  -8.327  1.00 1.31  ? 642 LEU A CB   5  
ATOM 10736 C CG   . LEU A 1 128 ? 12.951  -3.216  -7.188  1.00 1.42  ? 642 LEU A CG   5  
ATOM 10737 C CD1  . LEU A 1 128 ? 12.530  -2.803  -5.774  1.00 2.12  ? 642 LEU A CD1  5  
ATOM 10738 C CD2  . LEU A 1 128 ? 12.201  -4.467  -7.464  1.00 3.06  ? 642 LEU A CD2  5  
ATOM 10739 H H    . LEU A 1 128 ? 11.587  0.016   -8.607  1.00 1.19  ? 642 LEU A H    5  
ATOM 10740 H HA   . LEU A 1 128 ? 13.668  -1.096  -7.158  1.00 1.50  ? 642 LEU A HA   5  
ATOM 10741 H HB2  . LEU A 1 128 ? 11.495  -2.027  -8.223  1.00 1.66  ? 642 LEU A HB2  5  
ATOM 10742 H HB3  . LEU A 1 128 ? 12.711  -2.726  -9.303  1.00 1.58  ? 642 LEU A HB3  5  
ATOM 10743 H HG   . LEU A 1 128 ? 14.019  -3.397  -7.217  1.00 2.63  ? 642 LEU A HG   5  
ATOM 10744 H HD11 . LEU A 1 128 ? 13.183  -2.025  -5.392  1.00 3.28  ? 642 LEU A HD11 5  
ATOM 10745 H HD12 . LEU A 1 128 ? 12.638  -3.652  -5.097  1.00 3.00  ? 642 LEU A HD12 5  
ATOM 10746 H HD13 . LEU A 1 128 ? 11.492  -2.463  -5.796  1.00 2.59  ? 642 LEU A HD13 5  
ATOM 10747 H HD21 . LEU A 1 128 ? 11.157  -4.187  -7.396  1.00 3.95  ? 642 LEU A HD21 5  
ATOM 10748 H HD22 . LEU A 1 128 ? 12.479  -5.202  -6.722  1.00 3.65  ? 642 LEU A HD22 5  
ATOM 10749 H HD23 . LEU A 1 128 ? 12.470  -4.775  -8.463  1.00 3.96  ? 642 LEU A HD23 5  
ATOM 10750 N N    . GLU A 1 129 ? 14.597  -0.780  -10.325 1.00 1.39  ? 643 GLU A N    5  
ATOM 10751 C CA   . GLU A 1 129 ? 15.676  -0.915  -11.308 1.00 1.53  ? 643 GLU A CA   5  
ATOM 10752 C C    . GLU A 1 129 ? 16.616  0.315   -11.328 1.00 1.38  ? 643 GLU A C    5  
ATOM 10753 O O    . GLU A 1 129 ? 17.737  0.230   -11.838 1.00 1.38  ? 643 GLU A O    5  
ATOM 10754 C CB   . GLU A 1 129 ? 15.033  -1.162  -12.686 1.00 1.92  ? 643 GLU A CB   5  
ATOM 10755 C CG   . GLU A 1 129 ? 14.004  -2.308  -12.753 1.00 2.66  ? 643 GLU A CG   5  
ATOM 10756 C CD   . GLU A 1 129 ? 14.555  -3.599  -13.368 1.00 3.47  ? 643 GLU A CD   5  
ATOM 10757 O OE1  . GLU A 1 129 ? 15.142  -4.424  -12.626 1.00 4.64  ? 643 GLU A OE1  5  
ATOM 10758 O OE2  . GLU A 1 129 ? 14.385  -3.821  -14.594 1.00 3.64  ? 643 GLU A OE2  5  
ATOM 10759 H H    . GLU A 1 129 ? 13.693  -0.495  -10.680 1.00 1.38  ? 643 GLU A H    5  
ATOM 10760 H HA   . GLU A 1 129 ? 16.284  -1.782  -11.054 1.00 1.60  ? 643 GLU A HA   5  
ATOM 10761 H HB2  . GLU A 1 129 ? 14.499  -0.256  -12.950 1.00 2.03  ? 643 GLU A HB2  5  
ATOM 10762 H HB3  . GLU A 1 129 ? 15.810  -1.320  -13.436 1.00 2.11  ? 643 GLU A HB3  5  
ATOM 10763 H HG2  . GLU A 1 129 ? 13.598  -2.527  -11.769 1.00 2.77  ? 643 GLU A HG2  5  
ATOM 10764 H HG3  . GLU A 1 129 ? 13.158  -1.956  -13.340 1.00 2.90  ? 643 GLU A HG3  5  
ATOM 10765 N N    . GLU A 1 130 ? 16.217  1.454   -10.742 1.00 1.34  ? 644 GLU A N    5  
ATOM 10766 C CA   . GLU A 1 130 ? 17.053  2.656   -10.609 1.00 1.39  ? 644 GLU A CA   5  
ATOM 10767 C C    . GLU A 1 130 ? 18.128  2.513   -9.513  1.00 1.22  ? 644 GLU A C    5  
ATOM 10768 O O    . GLU A 1 130 ? 19.111  3.259   -9.478  1.00 1.36  ? 644 GLU A O    5  
ATOM 10769 C CB   . GLU A 1 130 ? 16.139  3.830   -10.284 1.00 1.52  ? 644 GLU A CB   5  
ATOM 10770 C CG   . GLU A 1 130 ? 15.159  4.146   -11.414 1.00 1.80  ? 644 GLU A CG   5  
ATOM 10771 C CD   . GLU A 1 130 ? 15.723  5.168   -12.401 1.00 2.13  ? 644 GLU A CD   5  
ATOM 10772 O OE1  . GLU A 1 130 ? 15.573  6.397   -12.171 1.00 2.53  ? 644 GLU A OE1  5  
ATOM 10773 O OE2  . GLU A 1 130 ? 16.346  4.736   -13.401 1.00 2.81  ? 644 GLU A OE2  5  
ATOM 10774 H H    . GLU A 1 130 ? 15.292  1.517   -10.328 1.00 1.35  ? 644 GLU A H    5  
ATOM 10775 H HA   . GLU A 1 130 ? 17.535  2.879   -11.555 1.00 1.55  ? 644 GLU A HA   5  
ATOM 10776 H HB2  . GLU A 1 130 ? 15.562  3.591   -9.395  1.00 1.37  ? 644 GLU A HB2  5  
ATOM 10777 H HB3  . GLU A 1 130 ? 16.747  4.702   -10.061 1.00 1.62  ? 644 GLU A HB3  5  
ATOM 10778 H HG2  . GLU A 1 130 ? 14.855  3.244   -11.947 1.00 1.85  ? 644 GLU A HG2  5  
ATOM 10779 H HG3  . GLU A 1 130 ? 14.268  4.526   -10.944 1.00 1.81  ? 644 GLU A HG3  5  
ATOM 10780 N N    . TYR A 1 131 ? 17.929  1.545   -8.619  1.00 1.02  ? 645 TYR A N    5  
ATOM 10781 C CA   . TYR A 1 131 ? 18.797  1.195   -7.493  1.00 0.92  ? 645 TYR A CA   5  
ATOM 10782 C C    . TYR A 1 131 ? 19.013  -0.330  -7.495  1.00 0.95  ? 645 TYR A C    5  
ATOM 10783 O O    . TYR A 1 131 ? 18.525  -1.013  -6.598  1.00 0.92  ? 645 TYR A O    5  
ATOM 10784 C CB   . TYR A 1 131 ? 18.190  1.748   -6.185  1.00 0.81  ? 645 TYR A CB   5  
ATOM 10785 C CG   . TYR A 1 131 ? 17.929  3.244   -6.247  1.00 0.86  ? 645 TYR A CG   5  
ATOM 10786 C CD1  . TYR A 1 131 ? 16.747  3.707   -6.856  1.00 2.23  ? 645 TYR A CD1  5  
ATOM 10787 C CD2  . TYR A 1 131 ? 18.909  4.166   -5.831  1.00 1.58  ? 645 TYR A CD2  5  
ATOM 10788 C CE1  . TYR A 1 131 ? 16.597  5.066   -7.173  1.00 2.42  ? 645 TYR A CE1  5  
ATOM 10789 C CE2  . TYR A 1 131 ? 18.736  5.541   -6.093  1.00 1.59  ? 645 TYR A CE2  5  
ATOM 10790 C CZ   . TYR A 1 131 ? 17.604  5.986   -6.809  1.00 1.29  ? 645 TYR A CZ   5  
ATOM 10791 O OH   . TYR A 1 131 ? 17.524  7.277   -7.223  1.00 1.64  ? 645 TYR A OH   5  
ATOM 10792 H H    . TYR A 1 131 ? 17.063  1.031   -8.717  1.00 1.00  ? 645 TYR A H    5  
ATOM 10793 H HA   . TYR A 1 131 ? 19.771  1.661   -7.622  1.00 1.02  ? 645 TYR A HA   5  
ATOM 10794 H HB2  . TYR A 1 131 ? 17.247  1.238   -5.982  1.00 0.78  ? 645 TYR A HB2  5  
ATOM 10795 H HB3  . TYR A 1 131 ? 18.871  1.535   -5.359  1.00 0.90  ? 645 TYR A HB3  5  
ATOM 10796 H HD1  . TYR A 1 131 ? 15.990  2.998   -7.163  1.00 3.42  ? 645 TYR A HD1  5  
ATOM 10797 H HD2  . TYR A 1 131 ? 19.817  3.819   -5.357  1.00 2.79  ? 645 TYR A HD2  5  
ATOM 10798 H HE1  . TYR A 1 131 ? 15.732  5.386   -7.736  1.00 3.72  ? 645 TYR A HE1  5  
ATOM 10799 H HE2  . TYR A 1 131 ? 19.502  6.248   -5.811  1.00 2.72  ? 645 TYR A HE2  5  
ATOM 10800 H HH   . TYR A 1 131 ? 16.863  7.364   -7.933  1.00 2.30  ? 645 TYR A HH   5  
ATOM 10801 N N    . PRO A 1 132 ? 19.682  -0.902  -8.521  1.00 1.13  ? 646 PRO A N    5  
ATOM 10802 C CA   . PRO A 1 132 ? 19.631  -2.333  -8.856  1.00 1.30  ? 646 PRO A CA   5  
ATOM 10803 C C    . PRO A 1 132 ? 20.156  -3.318  -7.794  1.00 1.23  ? 646 PRO A C    5  
ATOM 10804 O O    . PRO A 1 132 ? 19.982  -4.527  -7.960  1.00 1.28  ? 646 PRO A O    5  
ATOM 10805 C CB   . PRO A 1 132 ? 20.386  -2.470  -10.187 1.00 1.67  ? 646 PRO A CB   5  
ATOM 10806 C CG   . PRO A 1 132 ? 21.284  -1.238  -10.235 1.00 1.62  ? 646 PRO A CG   5  
ATOM 10807 C CD   . PRO A 1 132 ? 20.403  -0.189  -9.564  1.00 1.30  ? 646 PRO A CD   5  
ATOM 10808 H HA   . PRO A 1 132 ? 18.588  -2.597  -9.035  1.00 1.38  ? 646 PRO A HA   5  
ATOM 10809 H HB2  . PRO A 1 132 ? 20.964  -3.392  -10.254 1.00 1.85  ? 646 PRO A HB2  5  
ATOM 10810 H HB3  . PRO A 1 132 ? 19.674  -2.418  -11.010 1.00 1.84  ? 646 PRO A HB3  5  
ATOM 10811 H HG2  . PRO A 1 132 ? 22.179  -1.411  -9.639  1.00 1.65  ? 646 PRO A HG2  5  
ATOM 10812 H HG3  . PRO A 1 132 ? 21.540  -0.961  -11.259 1.00 1.83  ? 646 PRO A HG3  5  
ATOM 10813 H HD2  . PRO A 1 132 ? 21.003  0.630   -9.169  1.00 1.23  ? 646 PRO A HD2  5  
ATOM 10814 H HD3  . PRO A 1 132 ? 19.696  0.203   -10.293 1.00 1.38  ? 646 PRO A HD3  5  
ATOM 10815 N N    . MET A 1 133 ? 20.738  -2.865  -6.677  1.00 1.17  ? 647 MET A N    5  
ATOM 10816 C CA   . MET A 1 133 ? 20.932  -3.731  -5.503  1.00 1.22  ? 647 MET A CA   5  
ATOM 10817 C C    . MET A 1 133 ? 19.592  -4.083  -4.815  1.00 1.12  ? 647 MET A C    5  
ATOM 10818 O O    . MET A 1 133 ? 19.437  -5.179  -4.278  1.00 1.18  ? 647 MET A O    5  
ATOM 10819 C CB   . MET A 1 133 ? 21.922  -3.077  -4.527  1.00 1.27  ? 647 MET A CB   5  
ATOM 10820 C CG   . MET A 1 133 ? 21.230  -1.950  -3.772  1.00 1.77  ? 647 MET A CG   5  
ATOM 10821 S SD   . MET A 1 133 ? 22.219  -0.914  -2.687  1.00 1.79  ? 647 MET A SD   5  
ATOM 10822 C CE   . MET A 1 133 ? 20.779  -0.271  -1.797  1.00 1.32  ? 647 MET A CE   5  
ATOM 10823 H H    . MET A 1 133 ? 20.891  -1.866  -6.567  1.00 1.16  ? 647 MET A H    5  
ATOM 10824 H HA   . MET A 1 133 ? 21.387  -4.659  -5.831  1.00 1.38  ? 647 MET A HA   5  
ATOM 10825 H HB2  . MET A 1 133 ? 22.255  -3.820  -3.808  1.00 1.55  ? 647 MET A HB2  5  
ATOM 10826 H HB3  . MET A 1 133 ? 22.787  -2.693  -5.069  1.00 1.94  ? 647 MET A HB3  5  
ATOM 10827 H HG2  . MET A 1 133 ? 20.733  -1.314  -4.501  1.00 2.57  ? 647 MET A HG2  5  
ATOM 10828 H HG3  . MET A 1 133 ? 20.470  -2.406  -3.138  1.00 2.22  ? 647 MET A HG3  5  
ATOM 10829 H HE1  . MET A 1 133 ? 20.119  0.234   -2.505  1.00 2.00  ? 647 MET A HE1  5  
ATOM 10830 H HE2  . MET A 1 133 ? 20.226  -1.104  -1.351  1.00 1.69  ? 647 MET A HE2  5  
ATOM 10831 H HE3  . MET A 1 133 ? 21.102  0.419   -1.021  1.00 1.83  ? 647 MET A HE3  5  
ATOM 10832 N N    . MET A 1 134 ? 18.621  -3.158  -4.855  1.00 1.03  ? 648 MET A N    5  
ATOM 10833 C CA   . MET A 1 134 ? 17.295  -3.251  -4.231  1.00 0.95  ? 648 MET A CA   5  
ATOM 10834 C C    . MET A 1 134 ? 16.364  -4.153  -5.051  1.00 1.02  ? 648 MET A C    5  
ATOM 10835 O O    . MET A 1 134 ? 15.558  -4.875  -4.472  1.00 1.05  ? 648 MET A O    5  
ATOM 10836 C CB   . MET A 1 134 ? 16.669  -1.851  -4.046  1.00 0.88  ? 648 MET A CB   5  
ATOM 10837 C CG   . MET A 1 134 ? 17.471  -0.876  -3.171  1.00 1.09  ? 648 MET A CG   5  
ATOM 10838 S SD   . MET A 1 134 ? 16.963  -0.698  -1.432  1.00 1.52  ? 648 MET A SD   5  
ATOM 10839 C CE   . MET A 1 134 ? 17.352  -2.339  -0.760  1.00 1.88  ? 648 MET A CE   5  
ATOM 10840 H H    . MET A 1 134 ? 18.816  -2.301  -5.362  1.00 1.01  ? 648 MET A H    5  
ATOM 10841 H HA   . MET A 1 134 ? 17.412  -3.698  -3.248  1.00 0.98  ? 648 MET A HA   5  
ATOM 10842 H HB2  . MET A 1 134 ? 16.552  -1.392  -5.025  1.00 1.25  ? 648 MET A HB2  5  
ATOM 10843 H HB3  . MET A 1 134 ? 15.675  -1.956  -3.612  1.00 1.15  ? 648 MET A HB3  5  
ATOM 10844 H HG2  . MET A 1 134 ? 18.525  -1.142  -3.207  1.00 1.39  ? 648 MET A HG2  5  
ATOM 10845 H HG3  . MET A 1 134 ? 17.376  0.112   -3.623  1.00 1.67  ? 648 MET A HG3  5  
ATOM 10846 H HE1  . MET A 1 134 ? 18.379  -2.606  -1.004  1.00 3.10  ? 648 MET A HE1  5  
ATOM 10847 H HE2  . MET A 1 134 ? 17.235  -2.325  0.324   1.00 2.52  ? 648 MET A HE2  5  
ATOM 10848 H HE3  . MET A 1 134 ? 16.671  -3.080  -1.178  1.00 2.08  ? 648 MET A HE3  5  
ATOM 10849 N N    . ARG A 1 135 ? 16.541  -4.211  -6.384  1.00 1.12  ? 649 ARG A N    5  
ATOM 10850 C CA   . ARG A 1 135 ? 15.985  -5.285  -7.231  1.00 1.25  ? 649 ARG A CA   5  
ATOM 10851 C C    . ARG A 1 135 ? 16.354  -6.646  -6.659  1.00 1.33  ? 649 ARG A C    5  
ATOM 10852 O O    . ARG A 1 135 ? 15.476  -7.392  -6.236  1.00 1.46  ? 649 ARG A O    5  
ATOM 10853 C CB   . ARG A 1 135 ? 16.418  -5.087  -8.703  1.00 1.38  ? 649 ARG A CB   5  
ATOM 10854 C CG   . ARG A 1 135 ? 16.192  -6.283  -9.651  1.00 1.78  ? 649 ARG A CG   5  
ATOM 10855 C CD   . ARG A 1 135 ? 14.814  -6.924  -9.481  1.00 2.30  ? 649 ARG A CD   5  
ATOM 10856 N NE   . ARG A 1 135 ? 14.530  -7.970  -10.472 1.00 3.04  ? 649 ARG A NE   5  
ATOM 10857 C CZ   . ARG A 1 135 ? 13.825  -7.837  -11.572 1.00 3.62  ? 649 ARG A CZ   5  
ATOM 10858 N NH1  . ARG A 1 135 ? 13.577  -6.706  -12.163 1.00 4.11  ? 649 ARG A NH1  5  
ATOM 10859 N NH2  . ARG A 1 135 ? 13.316  -8.897  -12.106 1.00 4.79  ? 649 ARG A NH2  5  
ATOM 10860 H H    . ARG A 1 135 ? 17.145  -3.521  -6.809  1.00 1.16  ? 649 ARG A H    5  
ATOM 10861 H HA   . ARG A 1 135 ? 14.900  -5.260  -7.179  1.00 1.28  ? 649 ARG A HA   5  
ATOM 10862 H HB2  . ARG A 1 135 ? 15.873  -4.230  -9.103  1.00 1.69  ? 649 ARG A HB2  5  
ATOM 10863 H HB3  . ARG A 1 135 ? 17.479  -4.839  -8.739  1.00 1.39  ? 649 ARG A HB3  5  
ATOM 10864 H HG2  . ARG A 1 135 ? 16.297  -5.934  -10.676 1.00 2.25  ? 649 ARG A HG2  5  
ATOM 10865 H HG3  . ARG A 1 135 ? 16.956  -7.041  -9.469  1.00 2.97  ? 649 ARG A HG3  5  
ATOM 10866 H HD2  . ARG A 1 135 ? 14.784  -7.406  -8.505  1.00 3.07  ? 649 ARG A HD2  5  
ATOM 10867 H HD3  . ARG A 1 135 ? 14.044  -6.153  -9.520  1.00 2.83  ? 649 ARG A HD3  5  
ATOM 10868 H HE   . ARG A 1 135 ? 14.685  -8.931  -10.197 1.00 4.06  ? 649 ARG A HE   5  
ATOM 10869 H HH11 . ARG A 1 135 ? 14.121  -5.877  -11.946 1.00 4.03  ? 649 ARG A HH11 5  
ATOM 10870 H HH12 . ARG A 1 135 ? 13.024  -6.733  -13.005 1.00 5.10  ? 649 ARG A HH12 5  
ATOM 10871 H HH21 . ARG A 1 135 ? 13.452  -9.784  -11.631 1.00 5.52  ? 649 ARG A HH21 5  
ATOM 10872 H HH22 . ARG A 1 135 ? 12.754  -8.804  -12.935 1.00 5.40  ? 649 ARG A HH22 5  
ATOM 10873 N N    . ARG A 1 136 ? 17.646  -6.941  -6.567  1.00 1.32  ? 650 ARG A N    5  
ATOM 10874 C CA   . ARG A 1 136 ? 18.120  -8.227  -6.036  1.00 1.40  ? 650 ARG A CA   5  
ATOM 10875 C C    . ARG A 1 136 ? 17.626  -8.479  -4.607  1.00 1.39  ? 650 ARG A C    5  
ATOM 10876 O O    . ARG A 1 136 ? 17.210  -9.586  -4.282  1.00 1.53  ? 650 ARG A O    5  
ATOM 10877 C CB   . ARG A 1 136 ? 19.653  -8.251  -6.113  1.00 1.47  ? 650 ARG A CB   5  
ATOM 10878 C CG   . ARG A 1 136 ? 20.283  -9.343  -5.239  1.00 2.10  ? 650 ARG A CG   5  
ATOM 10879 C CD   . ARG A 1 136 ? 21.800  -9.342  -5.413  1.00 2.14  ? 650 ARG A CD   5  
ATOM 10880 N NE   . ARG A 1 136 ? 22.474  -10.178 -4.403  1.00 2.91  ? 650 ARG A NE   5  
ATOM 10881 C CZ   . ARG A 1 136 ? 22.264  -11.457 -4.144  1.00 4.22  ? 650 ARG A CZ   5  
ATOM 10882 N NH1  . ARG A 1 136 ? 21.585  -12.258 -4.916  1.00 5.28  ? 650 ARG A NH1  5  
ATOM 10883 N NH2  . ARG A 1 136 ? 22.719  -11.982 -3.050  1.00 5.25  ? 650 ARG A NH2  5  
ATOM 10884 H H    . ARG A 1 136 ? 18.303  -6.248  -6.894  1.00 1.31  ? 650 ARG A H    5  
ATOM 10885 H HA   . ARG A 1 136 ? 17.692  -9.010  -6.670  1.00 1.49  ? 650 ARG A HA   5  
ATOM 10886 H HB2  . ARG A 1 136 ? 19.945  -8.398  -7.153  1.00 1.93  ? 650 ARG A HB2  5  
ATOM 10887 H HB3  . ARG A 1 136 ? 20.038  -7.290  -5.770  1.00 2.09  ? 650 ARG A HB3  5  
ATOM 10888 H HG2  . ARG A 1 136 ? 20.071  -9.143  -4.188  1.00 2.91  ? 650 ARG A HG2  5  
ATOM 10889 H HG3  . ARG A 1 136 ? 19.861  -10.310 -5.508  1.00 3.17  ? 650 ARG A HG3  5  
ATOM 10890 H HD2  . ARG A 1 136 ? 22.054  -9.671  -6.421  1.00 3.10  ? 650 ARG A HD2  5  
ATOM 10891 H HD3  . ARG A 1 136 ? 22.124  -8.306  -5.280  1.00 2.35  ? 650 ARG A HD3  5  
ATOM 10892 H HE   . ARG A 1 136 ? 23.144  -9.711  -3.802  1.00 3.29  ? 650 ARG A HE   5  
ATOM 10893 H HH11 . ARG A 1 136 ? 21.250  -11.946 -5.824  1.00 5.26  ? 650 ARG A HH11 5  
ATOM 10894 H HH12 . ARG A 1 136 ? 21.441  -13.212 -4.606  1.00 6.54  ? 650 ARG A HH12 5  
ATOM 10895 H HH21 . ARG A 1 136 ? 23.223  -11.426 -2.370  1.00 5.35  ? 650 ARG A HH21 5  
ATOM 10896 H HH22 . ARG A 1 136 ? 22.410  -12.917 -2.811  1.00 6.36  ? 650 ARG A HH22 5  
ATOM 10897 N N    . ALA A 1 137 ? 17.622  -7.435  -3.785  1.00 1.28  ? 651 ALA A N    5  
ATOM 10898 C CA   . ALA A 1 137 ? 17.113  -7.464  -2.410  1.00 1.33  ? 651 ALA A CA   5  
ATOM 10899 C C    . ALA A 1 137 ? 15.630  -7.906  -2.312  1.00 1.38  ? 651 ALA A C    5  
ATOM 10900 O O    . ALA A 1 137 ? 15.221  -8.452  -1.289  1.00 1.52  ? 651 ALA A O    5  
ATOM 10901 C CB   . ALA A 1 137 ? 17.317  -6.088  -1.757  1.00 1.27  ? 651 ALA A CB   5  
ATOM 10902 H H    . ALA A 1 137 ? 18.090  -6.609  -4.130  1.00 1.21  ? 651 ALA A H    5  
ATOM 10903 H HA   . ALA A 1 137 ? 17.712  -8.189  -1.858  1.00 1.44  ? 651 ALA A HA   5  
ATOM 10904 H HB1  . ALA A 1 137 ? 18.337  -5.723  -1.902  1.00 2.26  ? 651 ALA A HB1  5  
ATOM 10905 H HB2  . ALA A 1 137 ? 16.610  -5.372  -2.171  1.00 1.89  ? 651 ALA A HB2  5  
ATOM 10906 H HB3  . ALA A 1 137 ? 17.130  -6.162  -0.686  1.00 2.02  ? 651 ALA A HB3  5  
ATOM 10907 N N    . PHE A 1 138 ? 14.826  -7.721  -3.366  1.00 1.33  ? 652 PHE A N    5  
ATOM 10908 C CA   . PHE A 1 138 ? 13.477  -8.291  -3.504  1.00 1.43  ? 652 PHE A CA   5  
ATOM 10909 C C    . PHE A 1 138 ? 13.434  -9.656  -4.227  1.00 1.62  ? 652 PHE A C    5  
ATOM 10910 O O    . PHE A 1 138 ? 12.473  -10.405 -4.066  1.00 1.77  ? 652 PHE A O    5  
ATOM 10911 C CB   . PHE A 1 138 ? 12.566  -7.261  -4.191  1.00 1.34  ? 652 PHE A CB   5  
ATOM 10912 C CG   . PHE A 1 138 ? 11.890  -6.280  -3.244  1.00 1.26  ? 652 PHE A CG   5  
ATOM 10913 C CD1  . PHE A 1 138 ? 12.620  -5.221  -2.670  1.00 2.03  ? 652 PHE A CD1  5  
ATOM 10914 C CD2  . PHE A 1 138 ? 10.522  -6.421  -2.941  1.00 2.44  ? 652 PHE A CD2  5  
ATOM 10915 C CE1  . PHE A 1 138 ? 11.988  -4.306  -1.809  1.00 2.01  ? 652 PHE A CE1  5  
ATOM 10916 C CE2  . PHE A 1 138 ? 9.890   -5.510  -2.072  1.00 2.49  ? 652 PHE A CE2  5  
ATOM 10917 C CZ   . PHE A 1 138 ? 10.624  -4.453  -1.505  1.00 1.33  ? 652 PHE A CZ   5  
ATOM 10918 H H    . PHE A 1 138 ? 15.185  -7.193  -4.154  1.00 1.24  ? 652 PHE A H    5  
ATOM 10919 H HA   . PHE A 1 138 ? 13.074  -8.479  -2.504  1.00 1.51  ? 652 PHE A HA   5  
ATOM 10920 H HB2  . PHE A 1 138 ? 13.143  -6.701  -4.928  1.00 1.33  ? 652 PHE A HB2  5  
ATOM 10921 H HB3  . PHE A 1 138 ? 11.789  -7.797  -4.736  1.00 1.42  ? 652 PHE A HB3  5  
ATOM 10922 H HD1  . PHE A 1 138 ? 13.668  -5.107  -2.898  1.00 3.30  ? 652 PHE A HD1  5  
ATOM 10923 H HD2  . PHE A 1 138 ? 9.955   -7.233  -3.373  1.00 3.74  ? 652 PHE A HD2  5  
ATOM 10924 H HE1  . PHE A 1 138 ? 12.550  -3.484  -1.383  1.00 3.25  ? 652 PHE A HE1  5  
ATOM 10925 H HE2  . PHE A 1 138 ? 8.841   -5.625  -1.837  1.00 3.82  ? 652 PHE A HE2  5  
ATOM 10926 H HZ   . PHE A 1 138 ? 10.142  -3.752  -0.834  1.00 1.43  ? 652 PHE A HZ   5  
ATOM 10927 N N    . GLU A 1 139 ? 14.450  -10.040 -5.002  1.00 1.70  ? 653 GLU A N    5  
ATOM 10928 C CA   . GLU A 1 139 ? 14.529  -11.362 -5.663  1.00 1.91  ? 653 GLU A CA   5  
ATOM 10929 C C    . GLU A 1 139 ? 15.019  -12.473 -4.721  1.00 2.06  ? 653 GLU A C    5  
ATOM 10930 O O    . GLU A 1 139 ? 14.571  -13.616 -4.814  1.00 2.26  ? 653 GLU A O    5  
ATOM 10931 C CB   . GLU A 1 139 ? 15.441  -11.286 -6.900  1.00 2.02  ? 653 GLU A CB   5  
ATOM 10932 C CG   . GLU A 1 139 ? 14.944  -10.336 -7.997  1.00 1.81  ? 653 GLU A CG   5  
ATOM 10933 C CD   . GLU A 1 139 ? 13.752  -10.892 -8.804  1.00 2.50  ? 653 GLU A CD   5  
ATOM 10934 O OE1  . GLU A 1 139 ? 12.749  -11.357 -8.212  1.00 3.81  ? 653 GLU A OE1  5  
ATOM 10935 O OE2  . GLU A 1 139 ? 13.804  -10.859 -10.059 1.00 2.66  ? 653 GLU A OE2  5  
ATOM 10936 H H    . GLU A 1 139 ? 15.206  -9.384  -5.154  1.00 1.64  ? 653 GLU A H    5  
ATOM 10937 H HA   . GLU A 1 139 ? 13.536  -11.663 -5.988  1.00 1.98  ? 653 GLU A HA   5  
ATOM 10938 H HB2  . GLU A 1 139 ? 16.432  -10.961 -6.581  1.00 2.43  ? 653 GLU A HB2  5  
ATOM 10939 H HB3  . GLU A 1 139 ? 15.545  -12.282 -7.326  1.00 2.55  ? 653 GLU A HB3  5  
ATOM 10940 H HG2  . GLU A 1 139 ? 14.705  -9.372  -7.543  1.00 1.76  ? 653 GLU A HG2  5  
ATOM 10941 H HG3  . GLU A 1 139 ? 15.773  -10.157 -8.684  1.00 1.89  ? 653 GLU A HG3  5  
ATOM 10942 N N    . THR A 1 140 ? 15.872  -12.129 -3.753  1.00 2.03  ? 654 THR A N    5  
ATOM 10943 C CA   . THR A 1 140 ? 16.433  -13.055 -2.742  1.00 2.25  ? 654 THR A CA   5  
ATOM 10944 C C    . THR A 1 140 ? 15.374  -13.554 -1.748  1.00 2.34  ? 654 THR A C    5  
ATOM 10945 O O    . THR A 1 140 ? 15.551  -14.562 -1.062  1.00 2.76  ? 654 THR A O    5  
ATOM 10946 C CB   . THR A 1 140 ? 17.607  -12.371 -2.025  1.00 2.22  ? 654 THR A CB   5  
ATOM 10947 O OG1  . THR A 1 140 ? 18.287  -13.230 -1.140  1.00 2.58  ? 654 THR A OG1  5  
ATOM 10948 C CG2  . THR A 1 140 ? 17.163  -11.176 -1.191  1.00 1.97  ? 654 THR A CG2  5  
ATOM 10949 H H    . THR A 1 140 ? 16.147  -11.150 -3.715  1.00 1.89  ? 654 THR A H    5  
ATOM 10950 H HA   . THR A 1 140 ? 16.833  -13.922 -3.254  1.00 2.42  ? 654 THR A HA   5  
ATOM 10951 H HB   . THR A 1 140 ? 18.299  -12.019 -2.786  1.00 2.20  ? 654 THR A HB   5  
ATOM 10952 H HG1  . THR A 1 140 ? 18.600  -14.008 -1.648  1.00 2.68  ? 654 THR A HG1  5  
ATOM 10953 H HG21 . THR A 1 140 ? 16.588  -11.509 -0.327  1.00 2.42  ? 654 THR A HG21 5  
ATOM 10954 H HG22 . THR A 1 140 ? 16.551  -10.522 -1.801  1.00 2.08  ? 654 THR A HG22 5  
ATOM 10955 H HG23 . THR A 1 140 ? 18.038  -10.623 -0.856  1.00 2.58  ? 654 THR A HG23 5  
ATOM 10956 N N    . VAL A 1 141 ? 14.254  -12.834 -1.687  1.00 2.08  ? 655 VAL A N    5  
ATOM 10957 C CA   . VAL A 1 141 ? 13.089  -13.066 -0.818  1.00 2.21  ? 655 VAL A CA   5  
ATOM 10958 C C    . VAL A 1 141 ? 11.854  -13.555 -1.586  1.00 2.31  ? 655 VAL A C    5  
ATOM 10959 O O    . VAL A 1 141 ? 11.029  -14.289 -1.044  1.00 2.55  ? 655 VAL A O    5  
ATOM 10960 C CB   . VAL A 1 141 ? 12.807  -11.779 -0.027  1.00 2.14  ? 655 VAL A CB   5  
ATOM 10961 C CG1  . VAL A 1 141 ? 12.424  -10.604 -0.916  1.00 1.93  ? 655 VAL A CG1  5  
ATOM 10962 C CG2  . VAL A 1 141 ? 11.756  -12.002 1.061   1.00 2.41  ? 655 VAL A CG2  5  
ATOM 10963 H H    . VAL A 1 141 ? 14.258  -12.001 -2.257  1.00 1.87  ? 655 VAL A H    5  
ATOM 10964 H HA   . VAL A 1 141 ? 13.337  -13.836 -0.093  1.00 2.35  ? 655 VAL A HA   5  
ATOM 10965 H HB   . VAL A 1 141 ? 13.740  -11.478 0.430   1.00 2.12  ? 655 VAL A HB   5  
ATOM 10966 H HG11 . VAL A 1 141 ? 11.510  -10.809 -1.470  1.00 2.29  ? 655 VAL A HG11 5  
ATOM 10967 H HG12 . VAL A 1 141 ? 12.282  -9.716  -0.301  1.00 2.77  ? 655 VAL A HG12 5  
ATOM 10968 H HG13 . VAL A 1 141 ? 13.255  -10.421 -1.596  1.00 2.22  ? 655 VAL A HG13 5  
ATOM 10969 H HG21 . VAL A 1 141 ? 11.676  -11.112 1.681   1.00 3.06  ? 655 VAL A HG21 5  
ATOM 10970 H HG22 . VAL A 1 141 ? 10.792  -12.217 0.603   1.00 2.55  ? 655 VAL A HG22 5  
ATOM 10971 H HG23 . VAL A 1 141 ? 12.048  -12.840 1.695   1.00 2.81  ? 655 VAL A HG23 5  
ATOM 10972 N N    . ALA A 1 142 ? 11.744  -13.212 -2.871  1.00 2.21  ? 656 ALA A N    5  
ATOM 10973 C CA   . ALA A 1 142 ? 10.649  -13.644 -3.751  1.00 2.37  ? 656 ALA A CA   5  
ATOM 10974 C C    . ALA A 1 142 ? 10.504  -15.173 -3.887  1.00 2.65  ? 656 ALA A C    5  
ATOM 10975 O O    . ALA A 1 142 ? 9.401   -15.649 -4.159  1.00 2.90  ? 656 ALA A O    5  
ATOM 10976 C CB   . ALA A 1 142 ? 10.839  -13.009 -5.128  1.00 2.28  ? 656 ALA A CB   5  
ATOM 10977 H H    . ALA A 1 142 ? 12.408  -12.534 -3.219  1.00 2.06  ? 656 ALA A H    5  
ATOM 10978 H HA   . ALA A 1 142 ? 9.709   -13.272 -3.339  1.00 2.42  ? 656 ALA A HA   5  
ATOM 10979 H HB1  . ALA A 1 142 ? 11.822  -13.259 -5.530  1.00 2.74  ? 656 ALA A HB1  5  
ATOM 10980 H HB2  . ALA A 1 142 ? 10.077  -13.383 -5.812  1.00 2.63  ? 656 ALA A HB2  5  
ATOM 10981 H HB3  . ALA A 1 142 ? 10.727  -11.930 -5.055  1.00 2.69  ? 656 ALA A HB3  5  
ATOM 10982 N N    . ILE A 1 143 ? 11.573  -15.942 -3.652  1.00 2.72  ? 657 ILE A N    5  
ATOM 10983 C CA   . ILE A 1 143 ? 11.547  -17.414 -3.587  1.00 3.06  ? 657 ILE A CA   5  
ATOM 10984 C C    . ILE A 1 143 ? 10.830  -17.957 -2.332  1.00 3.26  ? 657 ILE A C    5  
ATOM 10985 O O    . ILE A 1 143 ? 10.288  -19.062 -2.360  1.00 3.65  ? 657 ILE A O    5  
ATOM 10986 C CB   . ILE A 1 143 ? 12.985  -17.959 -3.741  1.00 3.35  ? 657 ILE A CB   5  
ATOM 10987 C CG1  . ILE A 1 143 ? 12.960  -19.484 -3.982  1.00 3.98  ? 657 ILE A CG1  5  
ATOM 10988 C CG2  . ILE A 1 143 ? 13.892  -17.579 -2.553  1.00 3.94  ? 657 ILE A CG2  5  
ATOM 10989 C CD1  . ILE A 1 143 ? 14.274  -20.028 -4.549  1.00 4.43  ? 657 ILE A CD1  5  
ATOM 10990 H H    . ILE A 1 143 ? 12.458  -15.480 -3.500  1.00 2.58  ? 657 ILE A H    5  
ATOM 10991 H HA   . ILE A 1 143 ? 10.983  -17.774 -4.449  1.00 3.16  ? 657 ILE A HA   5  
ATOM 10992 H HB   . ILE A 1 143 ? 13.405  -17.495 -4.637  1.00 3.45  ? 657 ILE A HB   5  
ATOM 10993 H HG12 . ILE A 1 143 ? 12.736  -20.004 -3.051  1.00 4.49  ? 657 ILE A HG12 5  
ATOM 10994 H HG13 . ILE A 1 143 ? 12.173  -19.716 -4.702  1.00 4.43  ? 657 ILE A HG13 5  
ATOM 10995 H HG21 . ILE A 1 143 ? 14.922  -17.871 -2.764  1.00 4.17  ? 657 ILE A HG21 5  
ATOM 10996 H HG22 . ILE A 1 143 ? 13.883  -16.503 -2.385  1.00 4.08  ? 657 ILE A HG22 5  
ATOM 10997 H HG23 . ILE A 1 143 ? 13.569  -18.089 -1.644  1.00 4.96  ? 657 ILE A HG23 5  
ATOM 10998 H HD11 . ILE A 1 143 ? 14.157  -21.089 -4.771  1.00 5.00  ? 657 ILE A HD11 5  
ATOM 10999 H HD12 . ILE A 1 143 ? 14.520  -19.499 -5.471  1.00 4.46  ? 657 ILE A HD12 5  
ATOM 11000 H HD13 . ILE A 1 143 ? 15.081  -19.905 -3.828  1.00 5.06  ? 657 ILE A HD13 5  
ATOM 11001 N N    . ASP A 1 144 ? 10.764  -17.171 -1.251  1.00 3.19  ? 658 ASP A N    5  
ATOM 11002 C CA   . ASP A 1 144 ? 10.066  -17.512 -0.003  1.00 3.68  ? 658 ASP A CA   5  
ATOM 11003 C C    . ASP A 1 144 ? 8.638   -16.938 0.024   1.00 3.79  ? 658 ASP A C    5  
ATOM 11004 O O    . ASP A 1 144 ? 7.671   -17.672 0.260   1.00 4.36  ? 658 ASP A O    5  
ATOM 11005 C CB   . ASP A 1 144 ? 10.890  -17.013 1.192   1.00 3.92  ? 658 ASP A CB   5  
ATOM 11006 C CG   . ASP A 1 144 ? 10.305  -17.519 2.508   1.00 4.83  ? 658 ASP A CG   5  
ATOM 11007 O OD1  . ASP A 1 144 ? 10.568  -18.695 2.854   1.00 5.09  ? 658 ASP A OD1  5  
ATOM 11008 O OD2  . ASP A 1 144 ? 9.576   -16.760 3.192   1.00 5.86  ? 658 ASP A OD2  5  
ATOM 11009 H H    . ASP A 1 144 ? 11.210  -16.264 -1.298  1.00 2.94  ? 658 ASP A H    5  
ATOM 11010 H HA   . ASP A 1 144 ? 9.996   -18.598 0.079   1.00 4.02  ? 658 ASP A HA   5  
ATOM 11011 H HB2  . ASP A 1 144 ? 11.915  -17.381 1.100   1.00 3.95  ? 658 ASP A HB2  5  
ATOM 11012 H HB3  . ASP A 1 144 ? 10.920  -15.923 1.197   1.00 3.69  ? 658 ASP A HB3  5  
ATOM 11013 N N    . ARG A 1 145 ? 8.501   -15.643 -0.308  1.00 3.42  ? 659 ARG A N    5  
ATOM 11014 C CA   . ARG A 1 145 ? 7.224   -14.910 -0.470  1.00 3.74  ? 659 ARG A CA   5  
ATOM 11015 C C    . ARG A 1 145 ? 6.352   -15.412 -1.632  1.00 4.11  ? 659 ARG A C    5  
ATOM 11016 O O    . ARG A 1 145 ? 5.173   -15.062 -1.724  1.00 4.75  ? 659 ARG A O    5  
ATOM 11017 C CB   . ARG A 1 145 ? 7.526   -13.416 -0.643  1.00 3.39  ? 659 ARG A CB   5  
ATOM 11018 C CG   . ARG A 1 145 ? 7.904   -12.713 0.665   1.00 3.64  ? 659 ARG A CG   5  
ATOM 11019 C CD   . ARG A 1 145 ? 8.133   -11.239 0.310   1.00 3.56  ? 659 ARG A CD   5  
ATOM 11020 N NE   . ARG A 1 145 ? 8.544   -10.413 1.461   1.00 4.68  ? 659 ARG A NE   5  
ATOM 11021 C CZ   . ARG A 1 145 ? 7.765   -9.903  2.397   1.00 5.47  ? 659 ARG A CZ   5  
ATOM 11022 N NH1  . ARG A 1 145 ? 6.490   -10.122 2.483   1.00 5.58  ? 659 ARG A NH1  5  
ATOM 11023 N NH2  . ARG A 1 145 ? 8.267   -9.119  3.293   1.00 6.85  ? 659 ARG A NH2  5  
ATOM 11024 H H    . ARG A 1 145 ? 9.363   -15.129 -0.474  1.00 3.04  ? 659 ARG A H    5  
ATOM 11025 H HA   . ARG A 1 145 ? 6.621   -15.040 0.432   1.00 4.24  ? 659 ARG A HA   5  
ATOM 11026 H HB2  . ARG A 1 145 ? 8.348   -13.291 -1.353  1.00 3.52  ? 659 ARG A HB2  5  
ATOM 11027 H HB3  . ARG A 1 145 ? 6.641   -12.921 -1.048  1.00 4.14  ? 659 ARG A HB3  5  
ATOM 11028 H HG2  . ARG A 1 145 ? 7.097   -12.808 1.391   1.00 4.62  ? 659 ARG A HG2  5  
ATOM 11029 H HG3  . ARG A 1 145 ? 8.810   -13.152 1.082   1.00 4.15  ? 659 ARG A HG3  5  
ATOM 11030 H HD2  . ARG A 1 145 ? 8.905   -11.199 -0.460  1.00 3.56  ? 659 ARG A HD2  5  
ATOM 11031 H HD3  . ARG A 1 145 ? 7.212   -10.840 -0.120  1.00 3.67  ? 659 ARG A HD3  5  
ATOM 11032 H HE   . ARG A 1 145 ? 9.516   -10.131 1.533   1.00 5.48  ? 659 ARG A HE   5  
ATOM 11033 H HH11 . ARG A 1 145 ? 6.014   -10.760 1.852   1.00 5.20  ? 659 ARG A HH11 5  
ATOM 11034 H HH12 . ARG A 1 145 ? 5.988   -9.726  3.266   1.00 6.53  ? 659 ARG A HH12 5  
ATOM 11035 H HH21 . ARG A 1 145 ? 9.261   -8.920  3.258   1.00 7.48  ? 659 ARG A HH21 5  
ATOM 11036 H HH22 . ARG A 1 145 ? 7.672   -8.797  4.047   1.00 7.55  ? 659 ARG A HH22 5  
ATOM 11037 N N    . LEU A 1 146 ? 6.923   -16.272 -2.475  1.00 3.86  ? 660 LEU A N    5  
ATOM 11038 C CA   . LEU A 1 146 ? 6.233   -17.170 -3.409  1.00 4.12  ? 660 LEU A CA   5  
ATOM 11039 C C    . LEU A 1 146 ? 4.950   -17.774 -2.804  1.00 4.95  ? 660 LEU A C    5  
ATOM 11040 O O    . LEU A 1 146 ? 3.896   -17.729 -3.441  1.00 5.62  ? 660 LEU A O    5  
ATOM 11041 C CB   . LEU A 1 146 ? 7.228   -18.293 -3.773  1.00 3.69  ? 660 LEU A CB   5  
ATOM 11042 C CG   . LEU A 1 146 ? 6.695   -19.391 -4.712  1.00 4.05  ? 660 LEU A CG   5  
ATOM 11043 C CD1  . LEU A 1 146 ? 6.317   -18.846 -6.089  1.00 4.42  ? 660 LEU A CD1  5  
ATOM 11044 C CD2  . LEU A 1 146 ? 7.785   -20.444 -4.902  1.00 4.73  ? 660 LEU A CD2  5  
ATOM 11045 H H    . LEU A 1 146 ? 7.928   -16.336 -2.405  1.00 3.53  ? 660 LEU A H    5  
ATOM 11046 H HA   . LEU A 1 146 ? 5.965   -16.614 -4.308  1.00 4.52  ? 660 LEU A HA   5  
ATOM 11047 H HB2  . LEU A 1 146 ? 8.108   -17.848 -4.237  1.00 3.71  ? 660 LEU A HB2  5  
ATOM 11048 H HB3  . LEU A 1 146 ? 7.552   -18.775 -2.849  1.00 3.92  ? 660 LEU A HB3  5  
ATOM 11049 H HG   . LEU A 1 146 ? 5.826   -19.873 -4.267  1.00 4.49  ? 660 LEU A HG   5  
ATOM 11050 H HD11 . LEU A 1 146 ? 6.011   -19.667 -6.734  1.00 5.03  ? 660 LEU A HD11 5  
ATOM 11051 H HD12 . LEU A 1 146 ? 7.168   -18.345 -6.544  1.00 4.87  ? 660 LEU A HD12 5  
ATOM 11052 H HD13 . LEU A 1 146 ? 5.480   -18.157 -6.001  1.00 4.52  ? 660 LEU A HD13 5  
ATOM 11053 H HD21 . LEU A 1 146 ? 8.687   -19.977 -5.296  1.00 5.12  ? 660 LEU A HD21 5  
ATOM 11054 H HD22 . LEU A 1 146 ? 7.443   -21.211 -5.595  1.00 5.24  ? 660 LEU A HD22 5  
ATOM 11055 H HD23 . LEU A 1 146 ? 8.009   -20.910 -3.944  1.00 5.34  ? 660 LEU A HD23 5  
ATOM 11056 N N    . ASP A 1 147 ? 5.028   -18.269 -1.563  1.00 5.22  ? 661 ASP A N    5  
ATOM 11057 C CA   . ASP A 1 147 ? 3.896   -18.834 -0.823  1.00 6.36  ? 661 ASP A CA   5  
ATOM 11058 C C    . ASP A 1 147 ? 3.202   -17.792 0.069   1.00 7.68  ? 661 ASP A C    5  
ATOM 11059 O O    . ASP A 1 147 ? 3.847   -17.088 0.854   1.00 7.85  ? 661 ASP A O    5  
ATOM 11060 C CB   . ASP A 1 147 ? 4.350   -20.026 0.026   1.00 6.14  ? 661 ASP A CB   5  
ATOM 11061 C CG   . ASP A 1 147 ? 4.895   -21.180 -0.811  1.00 6.34  ? 661 ASP A CG   5  
ATOM 11062 O OD1  . ASP A 1 147 ? 4.091   -21.923 -1.420  1.00 7.14  ? 661 ASP A OD1  5  
ATOM 11063 O OD2  . ASP A 1 147 ? 6.136   -21.328 -0.865  1.00 6.22  ? 661 ASP A OD2  5  
ATOM 11064 H H    . ASP A 1 147 ? 5.927   -18.244 -1.101  1.00 4.83  ? 661 ASP A H    5  
ATOM 11065 H HA   . ASP A 1 147 ? 3.164   -19.210 -1.537  1.00 6.99  ? 661 ASP A HA   5  
ATOM 11066 H HB2  . ASP A 1 147 ? 5.112   -19.697 0.731   1.00 5.78  ? 661 ASP A HB2  5  
ATOM 11067 H HB3  . ASP A 1 147 ? 3.495   -20.376 0.600   1.00 6.80  ? 661 ASP A HB3  5  
ATOM 11068 N N    . ARG A 1 148 ? 1.870   -17.736 -0.008  1.00 9.07  ? 662 ARG A N    5  
ATOM 11069 C CA   . ARG A 1 148 ? 0.974   -16.788 0.685   1.00 10.79 ? 662 ARG A CA   5  
ATOM 11070 C C    . ARG A 1 148 ? 0.656   -17.100 2.156   1.00 11.32 ? 662 ARG A C    5  
ATOM 11071 O O    . ARG A 1 148 ? -0.166  -16.409 2.764   1.00 12.67 ? 662 ARG A O    5  
ATOM 11072 C CB   . ARG A 1 148 ? -0.284  -16.602 -0.179  1.00 12.31 ? 662 ARG A CB   5  
ATOM 11073 C CG   . ARG A 1 148 ? -1.087  -17.864 -0.561  1.00 12.55 ? 662 ARG A CG   5  
ATOM 11074 C CD   . ARG A 1 148 ? -1.585  -18.667 0.644   1.00 13.00 ? 662 ARG A CD   5  
ATOM 11075 N NE   . ARG A 1 148 ? -2.426  -19.802 0.243   1.00 13.52 ? 662 ARG A NE   5  
ATOM 11076 C CZ   . ARG A 1 148 ? -3.023  -20.638 1.070   1.00 14.04 ? 662 ARG A CZ   5  
ATOM 11077 N NH1  . ARG A 1 148 ? -2.945  -20.529 2.364   1.00 14.18 ? 662 ARG A NH1  5  
ATOM 11078 N NH2  . ARG A 1 148 ? -3.720  -21.619 0.590   1.00 14.77 ? 662 ARG A NH2  5  
ATOM 11079 H H    . ARG A 1 148 ? 1.429   -18.366 -0.664  1.00 9.16  ? 662 ARG A H    5  
ATOM 11080 H HA   . ARG A 1 148 ? 1.475   -15.819 0.718   1.00 11.03 ? 662 ARG A HA   5  
ATOM 11081 H HB2  . ARG A 1 148 ? -0.949  -15.896 0.312   1.00 13.23 ? 662 ARG A HB2  5  
ATOM 11082 H HB3  . ARG A 1 148 ? 0.055   -16.142 -1.102  1.00 12.77 ? 662 ARG A HB3  5  
ATOM 11083 H HG2  . ARG A 1 148 ? -1.951  -17.549 -1.149  1.00 13.34 ? 662 ARG A HG2  5  
ATOM 11084 H HG3  . ARG A 1 148 ? -0.475  -18.512 -1.186  1.00 11.99 ? 662 ARG A HG3  5  
ATOM 11085 H HD2  . ARG A 1 148 ? -0.730  -19.061 1.190   1.00 12.25 ? 662 ARG A HD2  5  
ATOM 11086 H HD3  . ARG A 1 148 ? -2.153  -18.003 1.299   1.00 14.01 ? 662 ARG A HD3  5  
ATOM 11087 H HE   . ARG A 1 148 ? -2.550  -19.980 -0.741  1.00 13.71 ? 662 ARG A HE   5  
ATOM 11088 H HH11 . ARG A 1 148 ? -2.418  -19.769 2.773   1.00 13.90 ? 662 ARG A HH11 5  
ATOM 11089 H HH12 . ARG A 1 148 ? -3.455  -21.180 2.948   1.00 14.82 ? 662 ARG A HH12 5  
ATOM 11090 H HH21 . ARG A 1 148 ? -3.779  -21.736 -0.416  1.00 14.92 ? 662 ARG A HH21 5  
ATOM 11091 H HH22 . ARG A 1 148 ? -4.186  -22.268 1.208   1.00 15.34 ? 662 ARG A HH22 5  
ATOM 11092 N N    . ILE A 1 149 ? 1.290   -18.143 2.696   1.00 10.52 ? 663 ILE A N    5  
ATOM 11093 C CA   . ILE A 1 149 ? 1.099   -18.811 3.977   1.00 11.17 ? 663 ILE A CA   5  
ATOM 11094 C C    . ILE A 1 149 ? -0.346  -19.205 4.347   1.00 12.58 ? 663 ILE A C    5  
ATOM 11095 O O    . ILE A 1 149 ? -1.340  -18.632 3.891   1.00 13.46 ? 663 ILE A O    5  
ATOM 11096 C CB   . ILE A 1 149 ? 1.914   -18.051 5.052   1.00 11.34 ? 663 ILE A CB   5  
ATOM 11097 C CG1  . ILE A 1 149 ? 3.256   -17.551 4.454   1.00 10.23 ? 663 ILE A CG1  5  
ATOM 11098 C CG2  . ILE A 1 149 ? 2.347   -18.998 6.173   1.00 11.79 ? 663 ILE A CG2  5  
ATOM 11099 C CD1  . ILE A 1 149 ? 3.333   -16.074 4.034   1.00 10.92 ? 663 ILE A CD1  5  
ATOM 11100 H H    . ILE A 1 149 ? 2.232   -18.301 2.364   1.00 9.57  ? 663 ILE A H    5  
ATOM 11101 H HA   . ILE A 1 149 ? 1.605   -19.770 3.850   1.00 10.72 ? 663 ILE A HA   5  
ATOM 11102 H HB   . ILE A 1 149 ? 1.329   -17.224 5.453   1.00 12.29 ? 663 ILE A HB   5  
ATOM 11103 H HG12 . ILE A 1 149 ? 4.060   -17.707 5.131   1.00 9.97  ? 663 ILE A HG12 5  
ATOM 11104 H HG13 . ILE A 1 149 ? 3.551   -18.235 3.670   1.00 9.54  ? 663 ILE A HG13 5  
ATOM 11105 H HG21 . ILE A 1 149 ? 1.495   -19.465 6.661   1.00 12.24 ? 663 ILE A HG21 5  
ATOM 11106 H HG22 . ILE A 1 149 ? 3.004   -19.748 5.724   1.00 11.45 ? 663 ILE A HG22 5  
ATOM 11107 H HG23 . ILE A 1 149 ? 2.904   -18.437 6.923   1.00 12.30 ? 663 ILE A HG23 5  
ATOM 11108 H HD11 . ILE A 1 149 ? 2.577   -15.821 3.298   1.00 11.28 ? 663 ILE A HD11 5  
ATOM 11109 H HD12 . ILE A 1 149 ? 3.199   -15.441 4.910   1.00 11.77 ? 663 ILE A HD12 5  
ATOM 11110 H HD13 . ILE A 1 149 ? 4.316   -15.870 3.610   1.00 10.67 ? 663 ILE A HD13 5  
ATOM 11111 N N    . GLY A 1 150 ? -0.475  -20.236 5.179   1.00 13.10 ? 664 GLY A N    5  
ATOM 11112 C CA   . GLY A 1 150 ? -1.691  -20.525 5.932   1.00 14.74 ? 664 GLY A CA   5  
ATOM 11113 C C    . GLY A 1 150 ? -1.920  -19.462 7.010   1.00 16.01 ? 664 GLY A C    5  
ATOM 11114 O O    . GLY A 1 150 ? -0.974  -18.813 7.469   1.00 16.42 ? 664 GLY A O    5  
ATOM 11115 H H    . GLY A 1 150 ? 0.371   -20.695 5.501   1.00 12.58 ? 664 GLY A H    5  
ATOM 11116 H HA2  . GLY A 1 150 ? -2.547  -20.553 5.261   1.00 15.20 ? 664 GLY A HA2  5  
ATOM 11117 H HA3  . GLY A 1 150 ? -1.596  -21.497 6.415   1.00 14.90 ? 664 GLY A HA3  5  
ATOM 11118 N N    . LYS A 1 151 ? -3.181  -19.246 7.391   1.00 16.91 ? 665 LYS A N    5  
ATOM 11119 C CA   . LYS A 1 151 ? -3.586  -18.206 8.352   1.00 18.39 ? 665 LYS A CA   5  
ATOM 11120 C C    . LYS A 1 151 ? -4.115  -18.779 9.675   1.00 19.86 ? 665 LYS A C    5  
ATOM 11121 O O    . LYS A 1 151 ? -4.415  -19.969 9.791   1.00 19.93 ? 665 LYS A O    5  
ATOM 11122 C CB   . LYS A 1 151 ? -4.573  -17.233 7.680   1.00 18.68 ? 665 LYS A CB   5  
ATOM 11123 C CG   . LYS A 1 151 ? -3.919  -15.949 7.140   1.00 18.08 ? 665 LYS A CG   5  
ATOM 11124 C CD   . LYS A 1 151 ? -2.988  -16.099 5.926   1.00 16.66 ? 665 LYS A CD   5  
ATOM 11125 C CE   . LYS A 1 151 ? -3.735  -16.633 4.699   1.00 16.75 ? 665 LYS A CE   5  
ATOM 11126 N NZ   . LYS A 1 151 ? -3.077  -16.213 3.442   1.00 16.01 ? 665 LYS A NZ   5  
ATOM 11127 H H    . LYS A 1 151 ? -3.905  -19.812 6.960   1.00 16.74 ? 665 LYS A H    5  
ATOM 11128 H HA   . LYS A 1 151 ? -2.703  -17.634 8.612   1.00 18.47 ? 665 LYS A HA   5  
ATOM 11129 H HB2  . LYS A 1 151 ? -5.089  -17.745 6.875   1.00 18.53 ? 665 LYS A HB2  5  
ATOM 11130 H HB3  . LYS A 1 151 ? -5.330  -16.925 8.403   1.00 19.81 ? 665 LYS A HB3  5  
ATOM 11131 H HG2  . LYS A 1 151 ? -4.718  -15.260 6.863   1.00 18.79 ? 665 LYS A HG2  5  
ATOM 11132 H HG3  . LYS A 1 151 ? -3.357  -15.477 7.945   1.00 18.31 ? 665 LYS A HG3  5  
ATOM 11133 H HD2  . LYS A 1 151 ? -2.594  -15.106 5.702   1.00 16.75 ? 665 LYS A HD2  5  
ATOM 11134 H HD3  . LYS A 1 151 ? -2.139  -16.745 6.152   1.00 15.76 ? 665 LYS A HD3  5  
ATOM 11135 H HE2  . LYS A 1 151 ? -3.790  -17.724 4.755   1.00 16.60 ? 665 LYS A HE2  5  
ATOM 11136 H HE3  . LYS A 1 151 ? -4.755  -16.239 4.706   1.00 17.85 ? 665 LYS A HE3  5  
ATOM 11137 H HZ1  . LYS A 1 151 ? -3.122  -15.200 3.342   1.00 16.44 ? 665 LYS A HZ1  5  
ATOM 11138 H HZ2  . LYS A 1 151 ? -3.580  -16.595 2.642   1.00 16.04 ? 665 LYS A HZ2  5  
ATOM 11139 H HZ3  . LYS A 1 151 ? -2.111  -16.520 3.393   1.00 15.30 ? 665 LYS A HZ3  5  
ATOM 11140 N N    . LYS A 1 152 ? -4.285  -17.915 10.683  1.00 21.27 ? 666 LYS A N    5  
ATOM 11141 C CA   . LYS A 1 152 ? -4.902  -18.198 12.000  1.00 23.02 ? 666 LYS A CA   5  
ATOM 11142 C C    . LYS A 1 152 ? -6.440  -18.346 11.910  1.00 24.32 ? 666 LYS A C    5  
ATOM 11143 O O    . LYS A 1 152 ? -7.190  -17.734 12.677  1.00 25.44 ? 666 LYS A O    5  
ATOM 11144 C CB   . LYS A 1 152 ? -4.425  -17.107 12.984  1.00 23.99 ? 666 LYS A CB   5  
ATOM 11145 C CG   . LYS A 1 152 ? -4.547  -17.474 14.472  1.00 25.13 ? 666 LYS A CG   5  
ATOM 11146 C CD   . LYS A 1 152 ? -4.101  -16.291 15.346  1.00 25.99 ? 666 LYS A CD   5  
ATOM 11147 C CE   . LYS A 1 152 ? -4.140  -16.661 16.833  1.00 27.44 ? 666 LYS A CE   5  
ATOM 11148 N NZ   . LYS A 1 152 ? -3.811  -15.508 17.708  1.00 28.50 ? 666 LYS A NZ   5  
ATOM 11149 H H    . LYS A 1 152 ? -3.944  -16.974 10.523  1.00 21.23 ? 666 LYS A H    5  
ATOM 11150 H HA   . LYS A 1 152 ? -4.517  -19.152 12.360  1.00 22.83 ? 666 LYS A HA   5  
ATOM 11151 H HB2  . LYS A 1 152 ? -3.370  -16.899 12.790  1.00 23.47 ? 666 LYS A HB2  5  
ATOM 11152 H HB3  . LYS A 1 152 ? -4.981  -16.193 12.788  1.00 24.58 ? 666 LYS A HB3  5  
ATOM 11153 H HG2  . LYS A 1 152 ? -5.578  -17.730 14.715  1.00 25.73 ? 666 LYS A HG2  5  
ATOM 11154 H HG3  . LYS A 1 152 ? -3.910  -18.336 14.681  1.00 24.92 ? 666 LYS A HG3  5  
ATOM 11155 H HD2  . LYS A 1 152 ? -3.083  -16.008 15.074  1.00 25.48 ? 666 LYS A HD2  5  
ATOM 11156 H HD3  . LYS A 1 152 ? -4.762  -15.444 15.160  1.00 26.21 ? 666 LYS A HD3  5  
ATOM 11157 H HE2  . LYS A 1 152 ? -5.135  -17.037 17.084  1.00 27.98 ? 666 LYS A HE2  5  
ATOM 11158 H HE3  . LYS A 1 152 ? -3.420  -17.465 17.011  1.00 27.28 ? 666 LYS A HE3  5  
ATOM 11159 H HZ1  . LYS A 1 152 ? -3.707  -15.829 18.669  1.00 29.15 ? 666 LYS A HZ1  5  
ATOM 11160 H HZ2  . LYS A 1 152 ? -4.530  -14.786 17.669  1.00 29.20 ? 666 LYS A HZ2  5  
ATOM 11161 H HZ3  . LYS A 1 152 ? -2.927  -15.083 17.440  1.00 28.07 ? 666 LYS A HZ3  5  
ATOM 11162 N N    . ASN A 1 153 ? -6.918  -19.089 10.906  1.00 24.33 ? 667 ASN A N    5  
ATOM 11163 C CA   . ASN A 1 153 ? -8.306  -19.078 10.431  1.00 25.59 ? 667 ASN A CA   5  
ATOM 11164 C C    . ASN A 1 153 ? -9.318  -19.557 11.495  1.00 27.02 ? 667 ASN A C    5  
ATOM 11165 O O    . ASN A 1 153 ? -9.030  -20.464 12.284  1.00 27.14 ? 667 ASN A O    5  
ATOM 11166 C CB   . ASN A 1 153 ? -8.423  -19.940 9.158   1.00 25.19 ? 667 ASN A CB   5  
ATOM 11167 C CG   . ASN A 1 153 ? -7.538  -19.493 8.004   1.00 24.69 ? 667 ASN A CG   5  
ATOM 11168 O OD1  . ASN A 1 153 ? -7.644  -18.394 7.487   1.00 24.88 ? 667 ASN A OD1  5  
ATOM 11169 N ND2  . ASN A 1 153 ? -6.631  -20.327 7.560   1.00 24.23 ? 667 ASN A ND2  5  
ATOM 11170 H H    . ASN A 1 153 ? -6.241  -19.600 10.356  1.00 23.51 ? 667 ASN A H    5  
ATOM 11171 H HA   . ASN A 1 153 ? -8.559  -18.048 10.169  1.00 25.99 ? 667 ASN A HA   5  
ATOM 11172 H HB2  . ASN A 1 153 ? -8.195  -20.976 9.407   1.00 25.06 ? 667 ASN A HB2  5  
ATOM 11173 H HB3  . ASN A 1 153 ? -9.452  -19.907 8.801   1.00 25.61 ? 667 ASN A HB3  5  
ATOM 11174 H HD21 . ASN A 1 153 ? -6.494  -21.225 8.011   1.00 24.22 ? 667 ASN A HD21 5  
ATOM 11175 H HD22 . ASN A 1 153 ? -6.123  -20.076 6.718   1.00 24.04 ? 667 ASN A HD22 5  
ATOM 11176 N N    . SER A 1 154 ? -10.520 -18.979 11.495  1.00 28.26 ? 668 SER A N    5  
ATOM 11177 C CA   . SER A 1 154 ? -11.656 -19.382 12.336  1.00 29.78 ? 668 SER A CA   5  
ATOM 11178 C C    . SER A 1 154 ? -13.007 -18.909 11.773  1.00 30.88 ? 668 SER A C    5  
ATOM 11179 O O    . SER A 1 154 ? -13.099 -18.375 10.662  1.00 30.51 ? 668 SER A O    5  
ATOM 11180 C CB   . SER A 1 154 ? -11.455 -18.902 13.780  1.00 30.65 ? 668 SER A CB   5  
ATOM 11181 O OG   . SER A 1 154 ? -11.293 -17.495 13.857  1.00 30.57 ? 668 SER A OG   5  
ATOM 11182 H H    . SER A 1 154 ? -10.695 -18.243 10.815  1.00 28.22 ? 668 SER A H    5  
ATOM 11183 H HA   . SER A 1 154 ? -11.693 -20.472 12.363  1.00 29.66 ? 668 SER A HA   5  
ATOM 11184 H HB2  . SER A 1 154 ? -12.312 -19.215 14.381  1.00 31.70 ? 668 SER A HB2  5  
ATOM 11185 H HB3  . SER A 1 154 ? -10.569 -19.388 14.191  1.00 30.44 ? 668 SER A HB3  5  
ATOM 11186 H HG   . SER A 1 154 ? -12.141 -17.129 14.192  1.00 31.51 ? 668 SER A HG   5  
ATOM 11187 N N    . ILE A 1 155 ? -14.085 -19.180 12.513  1.00 32.36 ? 669 ILE A N    5  
ATOM 11188 C CA   . ILE A 1 155 ? -15.471 -19.167 12.021  1.00 33.61 ? 669 ILE A CA   5  
ATOM 11189 C C    . ILE A 1 155 ? -16.249 -17.902 12.415  1.00 34.68 ? 669 ILE A C    5  
ATOM 11190 O O    . ILE A 1 155 ? -15.963 -17.274 13.439  1.00 34.95 ? 669 ILE A O    5  
ATOM 11191 C CB   . ILE A 1 155 ? -16.189 -20.467 12.462  1.00 34.75 ? 669 ILE A CB   5  
ATOM 11192 C CG1  . ILE A 1 155 ? -16.445 -20.503 13.989  1.00 35.84 ? 669 ILE A CG1  5  
ATOM 11193 C CG2  . ILE A 1 155 ? -15.358 -21.679 11.994  1.00 33.82 ? 669 ILE A CG2  5  
ATOM 11194 C CD1  . ILE A 1 155 ? -17.114 -21.791 14.486  1.00 37.16 ? 669 ILE A CD1  5  
ATOM 11195 H H    . ILE A 1 155 ? -13.936 -19.604 13.417  1.00 32.69 ? 669 ILE A H    5  
ATOM 11196 H HA   . ILE A 1 155 ? -15.444 -19.184 10.929  1.00 33.07 ? 669 ILE A HA   5  
ATOM 11197 H HB   . ILE A 1 155 ? -17.154 -20.506 11.955  1.00 35.61 ? 669 ILE A HB   5  
ATOM 11198 H HG12 . ILE A 1 155 ? -15.504 -20.378 14.528  1.00 35.11 ? 669 ILE A HG12 5  
ATOM 11199 H HG13 . ILE A 1 155 ? -17.100 -19.674 14.257  1.00 36.57 ? 669 ILE A HG13 5  
ATOM 11200 H HG21 . ILE A 1 155 ? -15.117 -21.576 10.935  1.00 33.22 ? 669 ILE A HG21 5  
ATOM 11201 H HG22 . ILE A 1 155 ? -14.436 -21.752 12.576  1.00 33.42 ? 669 ILE A HG22 5  
ATOM 11202 H HG23 . ILE A 1 155 ? -15.927 -22.597 12.118  1.00 34.29 ? 669 ILE A HG23 5  
ATOM 11203 H HD11 . ILE A 1 155 ? -16.424 -22.632 14.407  1.00 36.77 ? 669 ILE A HD11 5  
ATOM 11204 H HD12 . ILE A 1 155 ? -17.394 -21.671 15.532  1.00 38.02 ? 669 ILE A HD12 5  
ATOM 11205 H HD13 . ILE A 1 155 ? -18.008 -21.992 13.897  1.00 37.78 ? 669 ILE A HD13 5  
ATOM 11206 N N    . LEU A 1 156 ? -17.266 -17.553 11.621  1.00 35.46 ? 670 LEU A N    5  
ATOM 11207 C CA   . LEU A 1 156 ? -18.188 -16.429 11.844  1.00 36.72 ? 670 LEU A CA   5  
ATOM 11208 C C    . LEU A 1 156 ? -19.665 -16.860 11.790  1.00 38.17 ? 670 LEU A C    5  
ATOM 11209 O O    . LEU A 1 156 ? -19.993 -17.974 11.369  1.00 38.21 ? 670 LEU A O    5  
ATOM 11210 C CB   . LEU A 1 156 ? -17.898 -15.326 10.806  1.00 36.36 ? 670 LEU A CB   5  
ATOM 11211 C CG   . LEU A 1 156 ? -16.590 -14.542 11.008  1.00 35.61 ? 670 LEU A CG   5  
ATOM 11212 C CD1  . LEU A 1 156 ? -16.423 -13.565 9.845   1.00 35.54 ? 670 LEU A CD1  5  
ATOM 11213 C CD2  . LEU A 1 156 ? -16.603 -13.739 12.312  1.00 36.20 ? 670 LEU A CD2  5  
ATOM 11214 H H    . LEU A 1 156 ? -17.404 -18.093 10.777  1.00 35.24 ? 670 LEU A H    5  
ATOM 11215 H HA   . LEU A 1 156 ? -18.033 -16.021 12.842  1.00 37.03 ? 670 LEU A HA   5  
ATOM 11216 H HB2  . LEU A 1 156 ? -17.885 -15.782 9.817   1.00 36.08 ? 670 LEU A HB2  5  
ATOM 11217 H HB3  . LEU A 1 156 ? -18.715 -14.604 10.819  1.00 37.10 ? 670 LEU A HB3  5  
ATOM 11218 H HG   . LEU A 1 156 ? -15.741 -15.226 11.017  1.00 34.85 ? 670 LEU A HG   5  
ATOM 11219 H HD11 . LEU A 1 156 ? -15.528 -12.965 9.985   1.00 35.26 ? 670 LEU A HD11 5  
ATOM 11220 H HD12 . LEU A 1 156 ? -17.284 -12.900 9.783   1.00 36.39 ? 670 LEU A HD12 5  
ATOM 11221 H HD13 . LEU A 1 156 ? -16.332 -14.116 8.909   1.00 35.04 ? 670 LEU A HD13 5  
ATOM 11222 H HD21 . LEU A 1 156 ? -17.490 -13.107 12.358  1.00 37.18 ? 670 LEU A HD21 5  
ATOM 11223 H HD22 . LEU A 1 156 ? -15.722 -13.106 12.363  1.00 35.73 ? 670 LEU A HD22 5  
ATOM 11224 H HD23 . LEU A 1 156 ? -16.587 -14.409 13.170  1.00 36.24 ? 670 LEU A HD23 5  
ATOM 11225 N N    . LEU A 1 157 ? -20.549 -15.953 12.217  1.00 39.48 ? 671 LEU A N    5  
ATOM 11226 C CA   . LEU A 1 157 ? -22.005 -16.108 12.272  1.00 41.09 ? 671 LEU A CA   5  
ATOM 11227 C C    . LEU A 1 157 ? -22.669 -16.211 10.882  1.00 41.55 ? 671 LEU A C    5  
ATOM 11228 O O    . LEU A 1 157 ? -22.187 -15.670 9.881   1.00 40.84 ? 671 LEU A O    5  
ATOM 11229 C CB   . LEU A 1 157 ? -22.566 -14.934 13.107  1.00 42.07 ? 671 LEU A CB   5  
ATOM 11230 C CG   . LEU A 1 157 ? -24.096 -14.856 13.303  1.00 43.73 ? 671 LEU A CG   5  
ATOM 11231 C CD1  . LEU A 1 157 ? -24.695 -16.077 14.009  1.00 44.67 ? 671 LEU A CD1  5  
ATOM 11232 C CD2  . LEU A 1 157 ? -24.416 -13.621 14.142  1.00 44.31 ? 671 LEU A CD2  5  
ATOM 11233 H H    . LEU A 1 157 ? -20.175 -15.083 12.568  1.00 39.43 ? 671 LEU A H    5  
ATOM 11234 H HA   . LEU A 1 157 ? -22.219 -17.035 12.805  1.00 41.41 ? 671 LEU A HA   5  
ATOM 11235 H HB2  . LEU A 1 157 ? -22.105 -14.971 14.094  1.00 41.88 ? 671 LEU A HB2  5  
ATOM 11236 H HB3  . LEU A 1 157 ? -22.246 -14.004 12.633  1.00 41.83 ? 671 LEU A HB3  5  
ATOM 11237 H HG   . LEU A 1 157 ? -24.584 -14.738 12.338  1.00 44.00 ? 671 LEU A HG   5  
ATOM 11238 H HD11 . LEU A 1 157 ? -24.546 -16.985 13.431  1.00 44.29 ? 671 LEU A HD11 5  
ATOM 11239 H HD12 . LEU A 1 157 ? -25.770 -15.937 14.122  1.00 45.54 ? 671 LEU A HD12 5  
ATOM 11240 H HD13 . LEU A 1 157 ? -24.243 -16.196 14.993  1.00 45.02 ? 671 LEU A HD13 5  
ATOM 11241 H HD21 . LEU A 1 157 ? -25.493 -13.532 14.274  1.00 45.12 ? 671 LEU A HD21 5  
ATOM 11242 H HD22 . LEU A 1 157 ? -24.060 -12.728 13.629  1.00 44.02 ? 671 LEU A HD22 5  
ATOM 11243 H HD23 . LEU A 1 157 ? -23.938 -13.692 15.118  1.00 44.30 ? 671 LEU A HD23 5  
ATOM 11244 N N    . HIS A 1 158 ? -23.826 -16.872 10.878  1.00 42.90 ? 672 HIS A N    5  
ATOM 11245 C CA   . HIS A 1 158 ? -24.740 -17.143 9.768   1.00 43.84 ? 672 HIS A CA   5  
ATOM 11246 C C    . HIS A 1 158 ? -25.291 -15.881 9.084   1.00 44.39 ? 672 HIS A C    5  
ATOM 11247 O O    . HIS A 1 158 ? -25.320 -15.859 7.834   1.00 44.24 ? 672 HIS A O    5  
ATOM 11248 C CB   . HIS A 1 158 ? -25.857 -18.027 10.349  1.00 45.29 ? 672 HIS A CB   5  
ATOM 11249 C CG   . HIS A 1 158 ? -26.543 -18.935 9.359   1.00 46.19 ? 672 HIS A CG   5  
ATOM 11250 N ND1  . HIS A 1 158 ? -27.310 -18.579 8.274   1.00 46.73 ? 672 HIS A ND1  5  
ATOM 11251 C CD2  . HIS A 1 158 ? -26.523 -20.302 9.401   1.00 46.76 ? 672 HIS A CD2  5  
ATOM 11252 C CE1  . HIS A 1 158 ? -27.742 -19.707 7.682   1.00 47.60 ? 672 HIS A CE1  5  
ATOM 11253 N NE2  . HIS A 1 158 ? -27.298 -20.793 8.344   1.00 47.66 ? 672 HIS A NE2  5  
ATOM 11254 H H    . HIS A 1 158 ? -24.102 -17.266 11.762  1.00 43.42 ? 672 HIS A H    5  
ATOM 11255 H HA   . HIS A 1 158 ? -24.196 -17.717 9.018   1.00 43.21 ? 672 HIS A HA   5  
ATOM 11256 H HB2  . HIS A 1 158 ? -25.423 -18.681 11.106  1.00 45.05 ? 672 HIS A HB2  5  
ATOM 11257 H HB3  . HIS A 1 158 ? -26.584 -17.407 10.876  1.00 46.05 ? 672 HIS A HB3  5  
ATOM 11258 H HD1  . HIS A 1 158 ? -27.483 -17.635 7.943   1.00 46.54 ? 672 HIS A HD1  5  
ATOM 11259 H HD2  . HIS A 1 158 ? -25.999 -20.894 10.138  1.00 46.61 ? 672 HIS A HD2  5  
ATOM 11260 H HE1  . HIS A 1 158 ? -28.360 -19.737 6.791   1.00 48.23 ? 672 HIS A HE1  5  
ATOM 11261 N N    . ASN A 1 20  ? 6.321   15.593  2.372   1.00 4.29  ? 534 ASN A N    6  
ATOM 11262 C CA   . ASN A 1 20  ? 6.131   14.169  2.625   1.00 3.59  ? 534 ASN A CA   6  
ATOM 11263 C C    . ASN A 1 20  ? 7.458   13.475  2.994   1.00 3.36  ? 534 ASN A C    6  
ATOM 11264 O O    . ASN A 1 20  ? 8.395   13.426  2.187   1.00 4.66  ? 534 ASN A O    6  
ATOM 11265 C CB   . ASN A 1 20  ? 5.455   13.548  1.390   1.00 4.85  ? 534 ASN A CB   6  
ATOM 11266 C CG   . ASN A 1 20  ? 4.945   12.139  1.632   1.00 5.51  ? 534 ASN A CG   6  
ATOM 11267 O OD1  . ASN A 1 20  ? 4.821   11.669  2.754   1.00 5.33  ? 534 ASN A OD1  6  
ATOM 11268 N ND2  . ASN A 1 20  ? 4.595   11.440  0.581   1.00 7.05  ? 534 ASN A ND2  6  
ATOM 11269 H H    . ASN A 1 20  ? 6.162   15.925  1.432   1.00 5.13  ? 534 ASN A H    6  
ATOM 11270 H HA   . ASN A 1 20  ? 5.451   14.074  3.473   1.00 3.50  ? 534 ASN A HA   6  
ATOM 11271 H HB2  . ASN A 1 20  ? 4.599   14.156  1.096   1.00 5.45  ? 534 ASN A HB2  6  
ATOM 11272 H HB3  . ASN A 1 20  ? 6.163   13.528  0.562   1.00 5.67  ? 534 ASN A HB3  6  
ATOM 11273 H HD21 . ASN A 1 20  ? 4.646   11.860  -0.343  1.00 7.61  ? 534 ASN A HD21 6  
ATOM 11274 H HD22 . ASN A 1 20  ? 4.190   10.539  0.749   1.00 7.94  ? 534 ASN A HD22 6  
ATOM 11275 N N    . CYS A 1 21  ? 7.537   12.950  4.218   1.00 3.02  ? 535 CYS A N    6  
ATOM 11276 C CA   . CYS A 1 21  ? 8.762   12.395  4.796   1.00 4.24  ? 535 CYS A CA   6  
ATOM 11277 C C    . CYS A 1 21  ? 8.815   10.861  4.695   1.00 3.09  ? 535 CYS A C    6  
ATOM 11278 O O    . CYS A 1 21  ? 7.816   10.169  4.919   1.00 2.90  ? 535 CYS A O    6  
ATOM 11279 C CB   . CYS A 1 21  ? 8.911   12.889  6.241   1.00 6.24  ? 535 CYS A CB   6  
ATOM 11280 S SG   . CYS A 1 21  ? 9.187   14.685  6.249   1.00 7.99  ? 535 CYS A SG   6  
ATOM 11281 H H    . CYS A 1 21  ? 6.718   12.983  4.805   1.00 3.14  ? 535 CYS A H    6  
ATOM 11282 H HA   . CYS A 1 21  ? 9.611   12.785  4.235   1.00 5.42  ? 535 CYS A HA   6  
ATOM 11283 H HB2  . CYS A 1 21  ? 8.017   12.644  6.817   1.00 6.34  ? 535 CYS A HB2  6  
ATOM 11284 H HB3  . CYS A 1 21  ? 9.773   12.406  6.707   1.00 7.22  ? 535 CYS A HB3  6  
ATOM 11285 H HG   . CYS A 1 21  ? 8.168   15.031  5.444   1.00 7.22  ? 535 CYS A HG   6  
ATOM 11286 N N    . ARG A 1 22  ? 10.006  10.310  4.413   1.00 2.70  ? 536 ARG A N    6  
ATOM 11287 C CA   . ARG A 1 22  ? 10.214  8.876   4.128   1.00 1.84  ? 536 ARG A CA   6  
ATOM 11288 C C    . ARG A 1 22  ? 9.760   7.941   5.251   1.00 1.48  ? 536 ARG A C    6  
ATOM 11289 O O    . ARG A 1 22  ? 9.345   6.822   4.955   1.00 1.20  ? 536 ARG A O    6  
ATOM 11290 C CB   . ARG A 1 22  ? 11.670  8.606   3.699   1.00 2.42  ? 536 ARG A CB   6  
ATOM 11291 C CG   . ARG A 1 22  ? 12.742  8.908   4.760   1.00 2.94  ? 536 ARG A CG   6  
ATOM 11292 C CD   . ARG A 1 22  ? 14.156  8.699   4.191   1.00 3.75  ? 536 ARG A CD   6  
ATOM 11293 N NE   . ARG A 1 22  ? 15.184  9.300   5.060   1.00 4.26  ? 536 ARG A NE   6  
ATOM 11294 C CZ   . ARG A 1 22  ? 15.631  8.838   6.213   1.00 5.17  ? 536 ARG A CZ   6  
ATOM 11295 N NH1  . ARG A 1 22  ? 15.317  7.669   6.681   1.00 6.10  ? 536 ARG A NH1  6  
ATOM 11296 N NH2  . ARG A 1 22  ? 16.413  9.562   6.951   1.00 5.75  ? 536 ARG A NH2  6  
ATOM 11297 H H    . ARG A 1 22  ? 10.792  10.947  4.296   1.00 3.29  ? 536 ARG A H    6  
ATOM 11298 H HA   . ARG A 1 22  ? 9.580   8.620   3.277   1.00 1.43  ? 536 ARG A HA   6  
ATOM 11299 H HB2  . ARG A 1 22  ? 11.749  7.554   3.425   1.00 3.12  ? 536 ARG A HB2  6  
ATOM 11300 H HB3  . ARG A 1 22  ? 11.879  9.202   2.807   1.00 2.71  ? 536 ARG A HB3  6  
ATOM 11301 H HG2  . ARG A 1 22  ? 12.645  9.941   5.089   1.00 3.09  ? 536 ARG A HG2  6  
ATOM 11302 H HG3  . ARG A 1 22  ? 12.602  8.256   5.623   1.00 3.47  ? 536 ARG A HG3  6  
ATOM 11303 H HD2  . ARG A 1 22  ? 14.345  7.632   4.054   1.00 4.50  ? 536 ARG A HD2  6  
ATOM 11304 H HD3  . ARG A 1 22  ? 14.218  9.178   3.211   1.00 3.89  ? 536 ARG A HD3  6  
ATOM 11305 H HE   . ARG A 1 22  ? 15.594  10.171  4.737   1.00 4.45  ? 536 ARG A HE   6  
ATOM 11306 H HH11 . ARG A 1 22  ? 14.818  7.003   6.101   1.00 6.16  ? 536 ARG A HH11 6  
ATOM 11307 H HH12 . ARG A 1 22  ? 15.598  7.414   7.617   1.00 7.07  ? 536 ARG A HH12 6  
ATOM 11308 H HH21 . ARG A 1 22  ? 16.559  10.533  6.699   1.00 5.63  ? 536 ARG A HH21 6  
ATOM 11309 H HH22 . ARG A 1 22  ? 16.856  9.150   7.761   1.00 6.65  ? 536 ARG A HH22 6  
ATOM 11310 N N    . LYS A 1 23  ? 9.735   8.414   6.505   1.00 1.76  ? 537 LYS A N    6  
ATOM 11311 C CA   . LYS A 1 23  ? 9.184   7.726   7.685   1.00 1.49  ? 537 LYS A CA   6  
ATOM 11312 C C    . LYS A 1 23  ? 7.835   7.034   7.453   1.00 1.25  ? 537 LYS A C    6  
ATOM 11313 O O    . LYS A 1 23  ? 7.637   5.940   7.979   1.00 1.17  ? 537 LYS A O    6  
ATOM 11314 C CB   . LYS A 1 23  ? 9.083   8.768   8.801   1.00 1.63  ? 537 LYS A CB   6  
ATOM 11315 C CG   . LYS A 1 23  ? 8.673   8.133   10.132  1.00 2.16  ? 537 LYS A CG   6  
ATOM 11316 C CD   . LYS A 1 23  ? 8.861   9.153   11.253  1.00 2.78  ? 537 LYS A CD   6  
ATOM 11317 C CE   . LYS A 1 23  ? 8.450   8.553   12.596  1.00 3.20  ? 537 LYS A CE   6  
ATOM 11318 N NZ   . LYS A 1 23  ? 9.430   7.558   13.086  1.00 4.17  ? 537 LYS A NZ   6  
ATOM 11319 H H    . LYS A 1 23  ? 10.101  9.345   6.650   1.00 2.27  ? 537 LYS A H    6  
ATOM 11320 H HA   . LYS A 1 23  ? 9.877   6.961   8.034   1.00 1.59  ? 537 LYS A HA   6  
ATOM 11321 H HB2  . LYS A 1 23  ? 10.066  9.227   8.925   1.00 2.07  ? 537 LYS A HB2  6  
ATOM 11322 H HB3  . LYS A 1 23  ? 8.366   9.545   8.528   1.00 1.89  ? 537 LYS A HB3  6  
ATOM 11323 H HG2  . LYS A 1 23  ? 7.626   7.827   10.092  1.00 2.54  ? 537 LYS A HG2  6  
ATOM 11324 H HG3  . LYS A 1 23  ? 9.294   7.258   10.324  1.00 3.11  ? 537 LYS A HG3  6  
ATOM 11325 H HD2  . LYS A 1 23  ? 9.902   9.479   11.283  1.00 3.68  ? 537 LYS A HD2  6  
ATOM 11326 H HD3  . LYS A 1 23  ? 8.232   10.018  11.045  1.00 3.07  ? 537 LYS A HD3  6  
ATOM 11327 H HE2  . LYS A 1 23  ? 8.353   9.361   13.324  1.00 3.84  ? 537 LYS A HE2  6  
ATOM 11328 H HE3  . LYS A 1 23  ? 7.476   8.078   12.466  1.00 3.59  ? 537 LYS A HE3  6  
ATOM 11329 H HZ1  . LYS A 1 23  ? 9.496   6.758   12.464  1.00 4.65  ? 537 LYS A HZ1  6  
ATOM 11330 H HZ2  . LYS A 1 23  ? 9.156   7.175   13.990  1.00 4.68  ? 537 LYS A HZ2  6  
ATOM 11331 H HZ3  . LYS A 1 23  ? 10.357  7.955   13.193  1.00 4.93  ? 537 LYS A HZ3  6  
ATOM 11332 N N    . LEU A 1 24  ? 6.922   7.616   6.665   1.00 1.35  ? 538 LEU A N    6  
ATOM 11333 C CA   . LEU A 1 24  ? 5.583   7.043   6.466   1.00 1.42  ? 538 LEU A CA   6  
ATOM 11334 C C    . LEU A 1 24  ? 5.630   5.743   5.646   1.00 1.27  ? 538 LEU A C    6  
ATOM 11335 O O    . LEU A 1 24  ? 5.046   4.742   6.048   1.00 1.40  ? 538 LEU A O    6  
ATOM 11336 C CB   . LEU A 1 24  ? 4.653   8.103   5.845   1.00 1.73  ? 538 LEU A CB   6  
ATOM 11337 C CG   . LEU A 1 24  ? 3.214   7.608   5.587   1.00 1.47  ? 538 LEU A CG   6  
ATOM 11338 C CD1  . LEU A 1 24  ? 2.497   7.127   6.852   1.00 1.79  ? 538 LEU A CD1  6  
ATOM 11339 C CD2  . LEU A 1 24  ? 2.377   8.732   4.976   1.00 2.89  ? 538 LEU A CD2  6  
ATOM 11340 H H    . LEU A 1 24  ? 7.161   8.484   6.199   1.00 1.52  ? 538 LEU A H    6  
ATOM 11341 H HA   . LEU A 1 24  ? 5.184   6.781   7.448   1.00 1.54  ? 538 LEU A HA   6  
ATOM 11342 H HB2  . LEU A 1 24  ? 4.613   8.965   6.514   1.00 2.22  ? 538 LEU A HB2  6  
ATOM 11343 H HB3  . LEU A 1 24  ? 5.081   8.435   4.897   1.00 2.79  ? 538 LEU A HB3  6  
ATOM 11344 H HG   . LEU A 1 24  ? 3.242   6.787   4.873   1.00 2.28  ? 538 LEU A HG   6  
ATOM 11345 H HD11 . LEU A 1 24  ? 1.468   6.858   6.616   1.00 2.56  ? 538 LEU A HD11 6  
ATOM 11346 H HD12 . LEU A 1 24  ? 2.496   7.915   7.603   1.00 2.74  ? 538 LEU A HD12 6  
ATOM 11347 H HD13 . LEU A 1 24  ? 2.992   6.242   7.252   1.00 2.49  ? 538 LEU A HD13 6  
ATOM 11348 H HD21 . LEU A 1 24  ? 1.378   8.363   4.750   1.00 3.45  ? 538 LEU A HD21 6  
ATOM 11349 H HD22 . LEU A 1 24  ? 2.845   9.086   4.056   1.00 4.17  ? 538 LEU A HD22 6  
ATOM 11350 H HD23 . LEU A 1 24  ? 2.298   9.561   5.678   1.00 3.29  ? 538 LEU A HD23 6  
ATOM 11351 N N    . VAL A 1 25  ? 6.375   5.723   4.537   1.00 1.12  ? 539 VAL A N    6  
ATOM 11352 C CA   . VAL A 1 25  ? 6.539   4.516   3.706   1.00 1.02  ? 539 VAL A CA   6  
ATOM 11353 C C    . VAL A 1 25  ? 7.555   3.539   4.327   1.00 1.04  ? 539 VAL A C    6  
ATOM 11354 O O    . VAL A 1 25  ? 7.334   2.330   4.354   1.00 1.16  ? 539 VAL A O    6  
ATOM 11355 C CB   . VAL A 1 25  ? 6.792   4.916   2.240   1.00 0.85  ? 539 VAL A CB   6  
ATOM 11356 C CG1  . VAL A 1 25  ? 8.267   5.144   1.929   1.00 0.83  ? 539 VAL A CG1  6  
ATOM 11357 C CG2  . VAL A 1 25  ? 6.177   3.881   1.301   1.00 0.93  ? 539 VAL A CG2  6  
ATOM 11358 H H    . VAL A 1 25  ? 6.881   6.561   4.288   1.00 1.22  ? 539 VAL A H    6  
ATOM 11359 H HA   . VAL A 1 25  ? 5.600   3.969   3.679   1.00 1.16  ? 539 VAL A HA   6  
ATOM 11360 H HB   . VAL A 1 25  ? 6.271   5.856   2.043   1.00 0.79  ? 539 VAL A HB   6  
ATOM 11361 H HG11 . VAL A 1 25  ? 8.650   5.916   2.595   1.00 2.09  ? 539 VAL A HG11 6  
ATOM 11362 H HG12 . VAL A 1 25  ? 8.816   4.216   2.080   1.00 1.79  ? 539 VAL A HG12 6  
ATOM 11363 H HG13 . VAL A 1 25  ? 8.378   5.470   0.894   1.00 1.54  ? 539 VAL A HG13 6  
ATOM 11364 H HG21 . VAL A 1 25  ? 6.484   4.070   0.271   1.00 1.47  ? 539 VAL A HG21 6  
ATOM 11365 H HG22 . VAL A 1 25  ? 6.487   2.884   1.608   1.00 1.84  ? 539 VAL A HG22 6  
ATOM 11366 H HG23 . VAL A 1 25  ? 5.090   3.934   1.360   1.00 1.73  ? 539 VAL A HG23 6  
ATOM 11367 N N    . ALA A 1 26  ? 8.597   4.059   4.984   1.00 1.05  ? 540 ALA A N    6  
ATOM 11368 C CA   . ALA A 1 26  ? 9.568   3.288   5.766   1.00 1.22  ? 540 ALA A CA   6  
ATOM 11369 C C    . ALA A 1 26  ? 8.994   2.652   7.047   1.00 1.39  ? 540 ALA A C    6  
ATOM 11370 O O    . ALA A 1 26  ? 9.723   1.971   7.776   1.00 1.59  ? 540 ALA A O    6  
ATOM 11371 C CB   . ALA A 1 26  ? 10.743  4.204   6.122   1.00 1.29  ? 540 ALA A CB   6  
ATOM 11372 H H    . ALA A 1 26  ? 8.733   5.063   4.945   1.00 1.04  ? 540 ALA A H    6  
ATOM 11373 H HA   . ALA A 1 26  ? 9.943   2.480   5.140   1.00 1.29  ? 540 ALA A HA   6  
ATOM 11374 H HB1  . ALA A 1 26  ? 10.403  4.966   6.823   1.00 2.02  ? 540 ALA A HB1  6  
ATOM 11375 H HB2  . ALA A 1 26  ? 11.529  3.619   6.602   1.00 2.13  ? 540 ALA A HB2  6  
ATOM 11376 H HB3  . ALA A 1 26  ? 11.146  4.673   5.224   1.00 1.57  ? 540 ALA A HB3  6  
ATOM 11377 N N    . SER A 1 27  ? 7.707   2.851   7.357   1.00 1.42  ? 541 SER A N    6  
ATOM 11378 C CA   . SER A 1 27  ? 7.065   2.291   8.545   1.00 1.65  ? 541 SER A CA   6  
ATOM 11379 C C    . SER A 1 27  ? 6.714   0.810   8.364   1.00 1.66  ? 541 SER A C    6  
ATOM 11380 O O    . SER A 1 27  ? 6.349   0.125   9.323   1.00 1.86  ? 541 SER A O    6  
ATOM 11381 C CB   . SER A 1 27  ? 5.829   3.106   8.880   1.00 1.77  ? 541 SER A CB   6  
ATOM 11382 O OG   . SER A 1 27  ? 6.176   4.333   9.497   1.00 2.61  ? 541 SER A OG   6  
ATOM 11383 H H    . SER A 1 27  ? 7.092   3.283   6.684   1.00 1.32  ? 541 SER A H    6  
ATOM 11384 H HA   . SER A 1 27  ? 7.738   2.396   9.380   1.00 1.83  ? 541 SER A HA   6  
ATOM 11385 H HB2  . SER A 1 27  ? 5.288   3.280   7.965   1.00 1.92  ? 541 SER A HB2  6  
ATOM 11386 H HB3  . SER A 1 27  ? 5.197   2.535   9.544   1.00 2.01  ? 541 SER A HB3  6  
ATOM 11387 H HG   . SER A 1 27  ? 6.740   4.842   8.876   1.00 2.88  ? 541 SER A HG   6  
ATOM 11388 N N    . MET A 1 28  ? 6.847   0.315   7.131   1.00 1.54  ? 542 MET A N    6  
ATOM 11389 C CA   . MET A 1 28  ? 6.580   -1.048  6.699   1.00 1.58  ? 542 MET A CA   6  
ATOM 11390 C C    . MET A 1 28  ? 7.810   -1.969  6.853   1.00 1.56  ? 542 MET A C    6  
ATOM 11391 O O    . MET A 1 28  ? 8.932   -1.536  6.565   1.00 1.52  ? 542 MET A O    6  
ATOM 11392 C CB   . MET A 1 28  ? 6.183   -0.987  5.224   1.00 1.53  ? 542 MET A CB   6  
ATOM 11393 C CG   . MET A 1 28  ? 4.810   -0.358  4.979   1.00 1.87  ? 542 MET A CG   6  
ATOM 11394 S SD   . MET A 1 28  ? 4