data_2MPR
# 
_entry.id   2MPR 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2MPR         
WWPDB D_1000178376 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2MPR 
_pdbx_database_status.recvd_initial_deposition_date   1997-02-07 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    BNL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Meyer, J.E.W.' 1 
'Schulz, G.E.'  2 
# 
_citation.id                        primary 
_citation.title                     'Structure of maltoporin from Salmonella typhimurium ligated with a nitrophenyl-maltotrioside.' 
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            266 
_citation.page_first                761 
_citation.page_last                 775 
_citation.year                      1997 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2836 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   9102468 
_citation.pdbx_database_id_DOI      10.1006/jmbi.1996.0823 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Meyer, J.E.'  1 ? 
primary 'Hofnung, M.'  2 ? 
primary 'Schulz, G.E.' 3 ? 
# 
_cell.entry_id           2MPR 
_cell.length_a           124.500 
_cell.length_b           211.800 
_cell.length_c           184.300 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              24 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2MPR 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                20 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     nat MALTOPORIN                                                                     48064.535 3   ? ? 
'MATURE PROTEIN, SIGNAL SEQUENCE CLEAVED OFF' ? 
2 branched    man 'alpha-D-glucopyranose-(1-4)-alpha-D-glucopyranose-(1-4)-beta-D-glucopyranose' 504.438   3   ? ? ? ? 
3 non-polymer syn 'CALCIUM ION'                                                                  40.078    1   ? ? ? ? 
4 water       nat water                                                                          18.015    560 ? ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'LAM-B, MAL-L'   
2 beta-maltotriose 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;VDFHGYARSGIGWTGSGGEQQCFQATGAQSKYRLGNECETYAELKLGQEVWKEGDKSFYFDTNVAYSVNQQNDWESTDPA
FREANVQGKNLIEWLPGSTIWAGKRFYQRHDVHMIDFYYWDISGPGAGIENIDLGFGKLSLAATRSTEAGGSYTFSSQNI
YDEVKDTANDVFDVRLAGLQTNPDGVLELGVDYGRANTTDGYKLADGASKDGWMFTAEHTQSMLKGYNKFVVQYATDAMT
TQGKGQARGSDGSSSFTEELSDGTKINYANKVINNNGNMWRILDHGAISLGDKWDLMYVGMYQNIDWDNNLGTEWWTVGV
RPMYKWTPIMSTLLEVGYDNVKSQQTGDRNNQYKITLAQQWQAGDSIWSRPAIRIFATYAKWDEKWGYIKDGDNISRYAA
ATNSGISTNSRGDSDEWTFGAQMEIWW
;
_entity_poly.pdbx_seq_one_letter_code_can   
;VDFHGYARSGIGWTGSGGEQQCFQATGAQSKYRLGNECETYAELKLGQEVWKEGDKSFYFDTNVAYSVNQQNDWESTDPA
FREANVQGKNLIEWLPGSTIWAGKRFYQRHDVHMIDFYYWDISGPGAGIENIDLGFGKLSLAATRSTEAGGSYTFSSQNI
YDEVKDTANDVFDVRLAGLQTNPDGVLELGVDYGRANTTDGYKLADGASKDGWMFTAEHTQSMLKGYNKFVVQYATDAMT
TQGKGQARGSDGSSSFTEELSDGTKINYANKVINNNGNMWRILDHGAISLGDKWDLMYVGMYQNIDWDNNLGTEWWTVGV
RPMYKWTPIMSTLLEVGYDNVKSQQTGDRNNQYKITLAQQWQAGDSIWSRPAIRIFATYAKWDEKWGYIKDGDNISRYAA
ATNSGISTNSRGDSDEWTFGAQMEIWW
;
_entity_poly.pdbx_strand_id                 A,B,C 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   VAL n 
1 2   ASP n 
1 3   PHE n 
1 4   HIS n 
1 5   GLY n 
1 6   TYR n 
1 7   ALA n 
1 8   ARG n 
1 9   SER n 
1 10  GLY n 
1 11  ILE n 
1 12  GLY n 
1 13  TRP n 
1 14  THR n 
1 15  GLY n 
1 16  SER n 
1 17  GLY n 
1 18  GLY n 
1 19  GLU n 
1 20  GLN n 
1 21  GLN n 
1 22  CYS n 
1 23  PHE n 
1 24  GLN n 
1 25  ALA n 
1 26  THR n 
1 27  GLY n 
1 28  ALA n 
1 29  GLN n 
1 30  SER n 
1 31  LYS n 
1 32  TYR n 
1 33  ARG n 
1 34  LEU n 
1 35  GLY n 
1 36  ASN n 
1 37  GLU n 
1 38  CYS n 
1 39  GLU n 
1 40  THR n 
1 41  TYR n 
1 42  ALA n 
1 43  GLU n 
1 44  LEU n 
1 45  LYS n 
1 46  LEU n 
1 47  GLY n 
1 48  GLN n 
1 49  GLU n 
1 50  VAL n 
1 51  TRP n 
1 52  LYS n 
1 53  GLU n 
1 54  GLY n 
1 55  ASP n 
1 56  LYS n 
1 57  SER n 
1 58  PHE n 
1 59  TYR n 
1 60  PHE n 
1 61  ASP n 
1 62  THR n 
1 63  ASN n 
1 64  VAL n 
1 65  ALA n 
1 66  TYR n 
1 67  SER n 
1 68  VAL n 
1 69  ASN n 
1 70  GLN n 
1 71  GLN n 
1 72  ASN n 
1 73  ASP n 
1 74  TRP n 
1 75  GLU n 
1 76  SER n 
1 77  THR n 
1 78  ASP n 
1 79  PRO n 
1 80  ALA n 
1 81  PHE n 
1 82  ARG n 
1 83  GLU n 
1 84  ALA n 
1 85  ASN n 
1 86  VAL n 
1 87  GLN n 
1 88  GLY n 
1 89  LYS n 
1 90  ASN n 
1 91  LEU n 
1 92  ILE n 
1 93  GLU n 
1 94  TRP n 
1 95  LEU n 
1 96  PRO n 
1 97  GLY n 
1 98  SER n 
1 99  THR n 
1 100 ILE n 
1 101 TRP n 
1 102 ALA n 
1 103 GLY n 
1 104 LYS n 
1 105 ARG n 
1 106 PHE n 
1 107 TYR n 
1 108 GLN n 
1 109 ARG n 
1 110 HIS n 
1 111 ASP n 
1 112 VAL n 
1 113 HIS n 
1 114 MET n 
1 115 ILE n 
1 116 ASP n 
1 117 PHE n 
1 118 TYR n 
1 119 TYR n 
1 120 TRP n 
1 121 ASP n 
1 122 ILE n 
1 123 SER n 
1 124 GLY n 
1 125 PRO n 
1 126 GLY n 
1 127 ALA n 
1 128 GLY n 
1 129 ILE n 
1 130 GLU n 
1 131 ASN n 
1 132 ILE n 
1 133 ASP n 
1 134 LEU n 
1 135 GLY n 
1 136 PHE n 
1 137 GLY n 
1 138 LYS n 
1 139 LEU n 
1 140 SER n 
1 141 LEU n 
1 142 ALA n 
1 143 ALA n 
1 144 THR n 
1 145 ARG n 
1 146 SER n 
1 147 THR n 
1 148 GLU n 
1 149 ALA n 
1 150 GLY n 
1 151 GLY n 
1 152 SER n 
1 153 TYR n 
1 154 THR n 
1 155 PHE n 
1 156 SER n 
1 157 SER n 
1 158 GLN n 
1 159 ASN n 
1 160 ILE n 
1 161 TYR n 
1 162 ASP n 
1 163 GLU n 
1 164 VAL n 
1 165 LYS n 
1 166 ASP n 
1 167 THR n 
1 168 ALA n 
1 169 ASN n 
1 170 ASP n 
1 171 VAL n 
1 172 PHE n 
1 173 ASP n 
1 174 VAL n 
1 175 ARG n 
1 176 LEU n 
1 177 ALA n 
1 178 GLY n 
1 179 LEU n 
1 180 GLN n 
1 181 THR n 
1 182 ASN n 
1 183 PRO n 
1 184 ASP n 
1 185 GLY n 
1 186 VAL n 
1 187 LEU n 
1 188 GLU n 
1 189 LEU n 
1 190 GLY n 
1 191 VAL n 
1 192 ASP n 
1 193 TYR n 
1 194 GLY n 
1 195 ARG n 
1 196 ALA n 
1 197 ASN n 
1 198 THR n 
1 199 THR n 
1 200 ASP n 
1 201 GLY n 
1 202 TYR n 
1 203 LYS n 
1 204 LEU n 
1 205 ALA n 
1 206 ASP n 
1 207 GLY n 
1 208 ALA n 
1 209 SER n 
1 210 LYS n 
1 211 ASP n 
1 212 GLY n 
1 213 TRP n 
1 214 MET n 
1 215 PHE n 
1 216 THR n 
1 217 ALA n 
1 218 GLU n 
1 219 HIS n 
1 220 THR n 
1 221 GLN n 
1 222 SER n 
1 223 MET n 
1 224 LEU n 
1 225 LYS n 
1 226 GLY n 
1 227 TYR n 
1 228 ASN n 
1 229 LYS n 
1 230 PHE n 
1 231 VAL n 
1 232 VAL n 
1 233 GLN n 
1 234 TYR n 
1 235 ALA n 
1 236 THR n 
1 237 ASP n 
1 238 ALA n 
1 239 MET n 
1 240 THR n 
1 241 THR n 
1 242 GLN n 
1 243 GLY n 
1 244 LYS n 
1 245 GLY n 
1 246 GLN n 
1 247 ALA n 
1 248 ARG n 
1 249 GLY n 
1 250 SER n 
1 251 ASP n 
1 252 GLY n 
1 253 SER n 
1 254 SER n 
1 255 SER n 
1 256 PHE n 
1 257 THR n 
1 258 GLU n 
1 259 GLU n 
1 260 LEU n 
1 261 SER n 
1 262 ASP n 
1 263 GLY n 
1 264 THR n 
1 265 LYS n 
1 266 ILE n 
1 267 ASN n 
1 268 TYR n 
1 269 ALA n 
1 270 ASN n 
1 271 LYS n 
1 272 VAL n 
1 273 ILE n 
1 274 ASN n 
1 275 ASN n 
1 276 ASN n 
1 277 GLY n 
1 278 ASN n 
1 279 MET n 
1 280 TRP n 
1 281 ARG n 
1 282 ILE n 
1 283 LEU n 
1 284 ASP n 
1 285 HIS n 
1 286 GLY n 
1 287 ALA n 
1 288 ILE n 
1 289 SER n 
1 290 LEU n 
1 291 GLY n 
1 292 ASP n 
1 293 LYS n 
1 294 TRP n 
1 295 ASP n 
1 296 LEU n 
1 297 MET n 
1 298 TYR n 
1 299 VAL n 
1 300 GLY n 
1 301 MET n 
1 302 TYR n 
1 303 GLN n 
1 304 ASN n 
1 305 ILE n 
1 306 ASP n 
1 307 TRP n 
1 308 ASP n 
1 309 ASN n 
1 310 ASN n 
1 311 LEU n 
1 312 GLY n 
1 313 THR n 
1 314 GLU n 
1 315 TRP n 
1 316 TRP n 
1 317 THR n 
1 318 VAL n 
1 319 GLY n 
1 320 VAL n 
1 321 ARG n 
1 322 PRO n 
1 323 MET n 
1 324 TYR n 
1 325 LYS n 
1 326 TRP n 
1 327 THR n 
1 328 PRO n 
1 329 ILE n 
1 330 MET n 
1 331 SER n 
1 332 THR n 
1 333 LEU n 
1 334 LEU n 
1 335 GLU n 
1 336 VAL n 
1 337 GLY n 
1 338 TYR n 
1 339 ASP n 
1 340 ASN n 
1 341 VAL n 
1 342 LYS n 
1 343 SER n 
1 344 GLN n 
1 345 GLN n 
1 346 THR n 
1 347 GLY n 
1 348 ASP n 
1 349 ARG n 
1 350 ASN n 
1 351 ASN n 
1 352 GLN n 
1 353 TYR n 
1 354 LYS n 
1 355 ILE n 
1 356 THR n 
1 357 LEU n 
1 358 ALA n 
1 359 GLN n 
1 360 GLN n 
1 361 TRP n 
1 362 GLN n 
1 363 ALA n 
1 364 GLY n 
1 365 ASP n 
1 366 SER n 
1 367 ILE n 
1 368 TRP n 
1 369 SER n 
1 370 ARG n 
1 371 PRO n 
1 372 ALA n 
1 373 ILE n 
1 374 ARG n 
1 375 ILE n 
1 376 PHE n 
1 377 ALA n 
1 378 THR n 
1 379 TYR n 
1 380 ALA n 
1 381 LYS n 
1 382 TRP n 
1 383 ASP n 
1 384 GLU n 
1 385 LYS n 
1 386 TRP n 
1 387 GLY n 
1 388 TYR n 
1 389 ILE n 
1 390 LYS n 
1 391 ASP n 
1 392 GLY n 
1 393 ASP n 
1 394 ASN n 
1 395 ILE n 
1 396 SER n 
1 397 ARG n 
1 398 TYR n 
1 399 ALA n 
1 400 ALA n 
1 401 ALA n 
1 402 THR n 
1 403 ASN n 
1 404 SER n 
1 405 GLY n 
1 406 ILE n 
1 407 SER n 
1 408 THR n 
1 409 ASN n 
1 410 SER n 
1 411 ARG n 
1 412 GLY n 
1 413 ASP n 
1 414 SER n 
1 415 ASP n 
1 416 GLU n 
1 417 TRP n 
1 418 THR n 
1 419 PHE n 
1 420 GLY n 
1 421 ALA n 
1 422 GLN n 
1 423 MET n 
1 424 GLU n 
1 425 ILE n 
1 426 TRP n 
1 427 TRP n 
# 
_entity_src_nat.entity_id                  1 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           ? 
_entity_src_nat.pdbx_end_seq_num           ? 
_entity_src_nat.common_name                ? 
_entity_src_nat.pdbx_organism_scientific   'Salmonella typhimurium' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      602 
_entity_src_nat.genus                      Salmonella 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     SL3749 
_entity_src_nat.tissue                     ? 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               ? 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     'OUTER MEMBRANE' 
_entity_src_nat.pdbx_organ                 ? 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    LAMB_SALTY 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P26466 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   
;MMITLRKLPLAVAVAAGVMSAQAMAVDFHGYARSGIGWTGSGGEQQCFQATGAQSKYRLGNECETYAELKLGQEVWKEGD
KSFYFDTNVAYSVNQQNDWESTDPAFREANVQGKNLIEWLPGSTIWAGKRFYQRHDVHMIDFYYWDISGPGAGIENIDLG
FGKLSLAATRSTEAGGSYTFSSQNIYDEVKDTANDVFDVRLAGLQTNPDGVLELGVDYGRANTTDGYKLADGASKDGWMF
TAEHTQSMLKGYNKFVVQYATDAMTTQGKGQARGSDGSSSFTEELSDGTKINYANKVINNNGNMWRILDHGAISLGDKWD
LMYVGMYQNIDWDNNLGTEWWTVGVRPMYKWTPIMSTLLEVGYDNVKSQQTGDRNNQYKITLAQQWQAGDSIWSRPAIRI
FATYAKWDEKWGYIKDGDNISRYAAATNSGISTNSRGDSDEWTFGAQMEIWW
;
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2MPR A 1 ? 427 ? P26466 26 ? 452 ? 1 427 
2 1 2MPR B 1 ? 427 ? P26466 26 ? 452 ? 1 427 
3 1 2MPR C 1 ? 427 ? P26466 26 ? 452 ? 1 427 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'           y ALANINE               ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'           y ARGININE              ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'           y ASPARAGINE            ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'           y 'ASPARTIC ACID'       ? 'C4 H7 N O4'     133.103 
BGC 'D-saccharide, beta linking'  . beta-D-glucopyranose  ? 'C6 H12 O6'      180.156 
CA  non-polymer                   . 'CALCIUM ION'         ? 'Ca 2'           40.078  
CYS 'L-peptide linking'           y CYSTEINE              ? 'C3 H7 N O2 S'   121.158 
GLC 'D-saccharide, alpha linking' . alpha-D-glucopyranose ? 'C6 H12 O6'      180.156 
GLN 'L-peptide linking'           y GLUTAMINE             ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'           y 'GLUTAMIC ACID'       ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'             y GLYCINE               ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking'           y HISTIDINE             ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer                   . WATER                 ? 'H2 O'           18.015  
ILE 'L-peptide linking'           y ISOLEUCINE            ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking'           y LEUCINE               ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'           y LYSINE                ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking'           y METHIONINE            ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking'           y PHENYLALANINE         ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking'           y PROLINE               ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking'           y SERINE                ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking'           y THREONINE             ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'           y TRYPTOPHAN            ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'           y TYROSINE              ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking'           y VALINE                ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2MPR 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      4.3 
_exptl_crystal.density_percent_sol   71. 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
;MALTOPORIN WAS CRYSTALLIZED BY HANGING-DROP METHOD. DROP: 5-8 MG/ML PROTEIN, 0.3% C8E4, 0.8% C6DAO, 1 MM CACL2, 1MM MGCL2, 14-18% PEG 1500, 0.02% NAN3 RESERVOIR: 28-32% PEG 1500, vapor diffusion - hanging drop
;
# 
_diffrn.id                     1 
_diffrn.ambient_temp           298 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'AREA DETECTOR' 
_diffrn_detector.type                   'SIEMENS-NICOLET X100' 
_diffrn_detector.pdbx_collection_date   1995-09-04 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'GRAPHITE(002)' 
_diffrn_radiation.pdbx_diffrn_protocol             ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'MACSCIENCE M18X' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     2MPR 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             25. 
_reflns.d_resolution_high            2.4 
_reflns.number_obs                   90607 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         ? 
_reflns.pdbx_Rmerge_I_obs            0.07 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        12.0 
_reflns.B_iso_Wilson_estimate        36. 
_reflns.pdbx_redundancy              3.1 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.40 
_reflns_shell.d_res_low              2.48 
_reflns_shell.percent_possible_all   62.4 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.167 
_reflns_shell.meanI_over_sigI_obs    4.3 
_reflns_shell.pdbx_redundancy        1.4 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 2MPR 
_refine.ls_number_reflns_obs                     82445 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               10000000.00 
_refine.pdbx_data_cutoff_low_absF                0.0 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             10.0 
_refine.ls_d_res_high                            2.4 
_refine.ls_percent_reflns_obs                    88.1 
_refine.ls_R_factor_obs                          0.191 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.191 
_refine.ls_R_factor_R_free                       0.222 
_refine.ls_R_factor_R_free_error                 0.0034 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  4219 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               26.7 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               'THROUGHOUT, EXCEPT FOR VERY LAST ROUND (REFINEMENT AGAINST ALL REFLECTIONS)' 
_refine.details                                  
;THE ENTRY PRESENTS THE REFINED STRUCTURE CONTAINING 1
MALTOTRIOSE PER MONOMER.

ALL SIDE CHAIN ATOMS WITHOUT DENSITY WERE ASSIGNED ZERO
OCCUPANCY.

B-VALUES OF WILSON PLOT WAS CALCULATED WITH THE CCP4
PROGRAM WILSON.
;
_refine.pdbx_starting_model                      'PDB ENTRY 1MPR' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        2MPR 
_refine_analyze.Luzzati_coordinate_error_obs    ? 
_refine_analyze.Luzzati_sigma_a_obs             0.38 
_refine_analyze.Luzzati_d_res_low_obs           3.53 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        10056 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         103 
_refine_hist.number_atoms_solvent             560 
_refine_hist.number_atoms_total               10719 
_refine_hist.d_res_high                       2.4 
_refine_hist.d_res_low                        10.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.010 ?    ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             1.62  ?    ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      27.4  ?    ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      1.16  ?    ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             ?     1.50 ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            ?     2.00 ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             ?     2.0  ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            ?     2.5  ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_restr_ncs.dom_id              1 
_refine_ls_restr_ncs.ncs_model_details   RESTRAINTS 
_refine_ls_restr_ncs.rms_dev_position    0.2 
_refine_ls_restr_ncs.weight_position     100 
_refine_ls_restr_ncs.rms_dev_B_iso       1.7 
_refine_ls_restr_ncs.weight_B_iso        0.2 
_refine_ls_restr_ncs.pdbx_type           . 
_refine_ls_restr_ncs.pdbx_auth_asym_id   . 
_refine_ls_restr_ncs.pdbx_ens_id         1 
_refine_ls_restr_ncs.pdbx_refine_id      'X-RAY DIFFRACTION' 
_refine_ls_restr_ncs.pdbx_ordinal        1 
_refine_ls_restr_ncs.pdbx_number         ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   10 
_refine_ls_shell.d_res_high                       2.40 
_refine_ls_shell.d_res_low                        2.48 
_refine_ls_shell.number_reflns_R_work             5737 
_refine_ls_shell.R_factor_R_work                  0.271 
_refine_ls_shell.percent_reflns_obs               62.0 
_refine_ls_shell.R_factor_R_free                  0.293 
_refine_ls_shell.R_factor_R_free_error            0.017 
_refine_ls_shell.percent_reflns_R_free            5.4 
_refine_ls_shell.number_reflns_R_free             307 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PARHCSDX.PRO TOPHCSDX.PRO 'X-RAY DIFFRACTION' 
2 PARAM3.CHO   TOPH3.CHO    'X-RAY DIFFRACTION' 
# 
loop_
_struct_ncs_oper.id 
_struct_ncs_oper.code 
_struct_ncs_oper.details 
_struct_ncs_oper.matrix[1][1] 
_struct_ncs_oper.matrix[1][2] 
_struct_ncs_oper.matrix[1][3] 
_struct_ncs_oper.matrix[2][1] 
_struct_ncs_oper.matrix[2][2] 
_struct_ncs_oper.matrix[2][3] 
_struct_ncs_oper.matrix[3][1] 
_struct_ncs_oper.matrix[3][2] 
_struct_ncs_oper.matrix[3][3] 
_struct_ncs_oper.vector[1] 
_struct_ncs_oper.vector[2] 
_struct_ncs_oper.vector[3] 
1 given ? -0.487541 -0.864344 -0.123338 0.863609  -0.498178 0.077447  -0.128385 -0.068757 0.989338 65.33897  99.95940  5.30578  
2 given ? -0.486621 -0.864788 -0.123859 0.864061  -0.497347 0.077743  -0.128832 -0.069190 0.989250 65.39000  99.90000  5.33000  
3 given ? -0.489234 0.862345  -0.130424 -0.862697 -0.500449 -0.072835 -0.128080 0.076883  0.988779 -53.57000 107.05000 -4.72000 
4 given ? -0.488529 0.862765  -0.130288 -0.863157 -0.499701 -0.072512 -0.127666 0.077035  0.988821 -53.59000 107.00000 -4.72000 
5 given ? -0.478397 -0.869753 -0.121105 0.869924  -0.488216 0.069840  -0.119869 -0.071941 0.990180 65.45000  99.95000  5.39000  
6 given ? -0.494168 0.859698  -0.129292 -0.860255 -0.505026 -0.070072 -0.125536 0.076597  0.989128 -53.49000 107.11000 -4.73000 
# 
_struct_ncs_dom.id            1 
_struct_ncs_dom.pdbx_ens_id   1 
_struct_ncs_dom.details       ? 
# 
_struct_ncs_ens.id        1 
_struct_ncs_ens.details   ? 
# 
_struct.entry_id                  2MPR 
_struct.title                     'MALTOPORIN FROM SALMONELLA TYPHIMURIUM' 
_struct.pdbx_descriptor           MALTOPORIN 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2MPR 
_struct_keywords.pdbx_keywords   'OUTER MEMBRANE PROTEIN' 
_struct_keywords.text            'OUTER MEMBRANE PROTEIN, OLIGOSACCHARIDE BINDING, SUGAR TRANSPORT, PHAGE RECOGNITION' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 2 ? 
E N N 2 ? 
F N N 2 ? 
G N N 3 ? 
H N N 4 ? 
I N N 4 ? 
J N N 4 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 GLU A 93  ? LEU A 95  ? GLU A 93  LEU A 95  5 ? 3 
HELX_P HELX_P2 2 HIS A 113 ? ILE A 115 ? HIS A 113 ILE A 115 5 ? 3 
HELX_P HELX_P3 3 ASP A 237 ? MET A 239 ? ASP A 237 MET A 239 5 ? 3 
HELX_P HELX_P4 4 GLU B 93  ? LEU B 95  ? GLU B 93  LEU B 95  5 ? 3 
HELX_P HELX_P5 5 HIS B 113 ? ILE B 115 ? HIS B 113 ILE B 115 5 ? 3 
HELX_P HELX_P6 6 ASP B 237 ? MET B 239 ? ASP B 237 MET B 239 5 ? 3 
HELX_P HELX_P7 7 GLU C 93  ? LEU C 95  ? GLU C 93  LEU C 95  5 ? 3 
HELX_P HELX_P8 8 HIS C 113 ? ILE C 115 ? HIS C 113 ILE C 115 5 ? 3 
HELX_P HELX_P9 9 ASP C 237 ? MET C 239 ? ASP C 237 MET C 239 5 ? 3 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1 disulf ?    ? A CYS 22 SG  ? ? ? 1_555 A CYS 38 SG  ? ? A CYS 22  A CYS 38  1_555 ? ? ? ? ? ? ? 2.022 ? ? 
disulf2 disulf ?    ? B CYS 22 SG  ? ? ? 1_555 B CYS 38 SG  ? ? B CYS 22  B CYS 38  1_555 ? ? ? ? ? ? ? 2.036 ? ? 
disulf3 disulf ?    ? C CYS 22 SG  ? ? ? 1_555 C CYS 38 SG  ? ? C CYS 22  C CYS 38  1_555 ? ? ? ? ? ? ? 2.030 ? ? 
covale1 covale both ? D BGC .  O4  ? ? ? 1_555 D GLC .  C1  ? ? D BGC 1   D GLC 2   1_555 ? ? ? ? ? ? ? 1.392 ? ? 
covale2 covale both ? D GLC .  O4  ? ? ? 1_555 D GLC .  C1  ? ? D GLC 2   D GLC 3   1_555 ? ? ? ? ? ? ? 1.381 ? ? 
covale3 covale both ? E BGC .  O4  ? ? ? 1_555 E GLC .  C1  ? ? E BGC 1   E GLC 2   1_555 ? ? ? ? ? ? ? 1.387 ? ? 
covale4 covale both ? E GLC .  O4  ? ? ? 1_555 E GLC .  C1  ? ? E GLC 2   E GLC 3   1_555 ? ? ? ? ? ? ? 1.382 ? ? 
covale5 covale both ? F BGC .  O4  ? ? ? 1_555 F GLC .  C1  ? ? F BGC 1   F GLC 2   1_555 ? ? ? ? ? ? ? 1.390 ? ? 
covale6 covale both ? F GLC .  O4  ? ? ? 1_555 F GLC .  C1  ? ? F GLC 2   F GLC 3   1_555 ? ? ? ? ? ? ? 1.385 ? ? 
metalc1 metalc ?    ? A ASP 78 OD1 ? ? ? 1_555 G CA  .  CA  ? ? A ASP 78  A CA  431 1_555 ? ? ? ? ? ? ? 2.186 ? ? 
metalc2 metalc ?    ? G CA  .  CA  ? ? ? 1_555 B ASP 78 OD1 ? ? A CA  431 B ASP 78  1_555 ? ? ? ? ? ? ? 2.264 ? ? 
metalc3 metalc ?    ? G CA  .  CA  ? ? ? 1_555 C ASP 78 OD1 ? ? A CA  431 C ASP 78  1_555 ? ? ? ? ? ? ? 2.112 ? ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
metalc ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 ARG 370 A . ? ARG 370 A PRO 371 A ? PRO 371 A 1 0.25 
2 ARG 370 B . ? ARG 370 B PRO 371 B ? PRO 371 B 1 0.23 
3 ARG 370 C . ? ARG 370 C PRO 371 C ? PRO 371 C 1 0.20 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 19 ? 
B ? 2  ? 
C ? 2  ? 
D ? 19 ? 
E ? 2  ? 
F ? 2  ? 
G ? 19 ? 
H ? 2  ? 
I ? 2  ? 
J ? 2  ? 
K ? 2  ? 
L ? 2  ? 
M ? 2  ? 
N ? 2  ? 
O ? 2  ? 
P ? 2  ? 
Q ? 2  ? 
R ? 2  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1  2  ? anti-parallel 
A 2  3  ? anti-parallel 
A 3  4  ? anti-parallel 
A 4  5  ? anti-parallel 
A 5  6  ? anti-parallel 
A 6  7  ? anti-parallel 
A 7  8  ? anti-parallel 
A 8  9  ? anti-parallel 
A 9  10 ? anti-parallel 
A 10 11 ? anti-parallel 
A 11 12 ? anti-parallel 
A 12 13 ? anti-parallel 
A 13 14 ? anti-parallel 
A 14 15 ? anti-parallel 
A 15 16 ? anti-parallel 
A 16 17 ? anti-parallel 
A 17 18 ? anti-parallel 
A 18 19 ? anti-parallel 
B 1  2  ? anti-parallel 
C 1  2  ? anti-parallel 
D 1  2  ? anti-parallel 
D 2  3  ? anti-parallel 
D 3  4  ? anti-parallel 
D 4  5  ? anti-parallel 
D 5  6  ? anti-parallel 
D 6  7  ? anti-parallel 
D 7  8  ? anti-parallel 
D 8  9  ? anti-parallel 
D 9  10 ? anti-parallel 
D 10 11 ? anti-parallel 
D 11 12 ? anti-parallel 
D 12 13 ? anti-parallel 
D 13 14 ? anti-parallel 
D 14 15 ? anti-parallel 
D 15 16 ? anti-parallel 
D 16 17 ? anti-parallel 
D 17 18 ? anti-parallel 
D 18 19 ? anti-parallel 
E 1  2  ? anti-parallel 
F 1  2  ? anti-parallel 
G 1  2  ? anti-parallel 
G 2  3  ? anti-parallel 
G 3  4  ? anti-parallel 
G 4  5  ? anti-parallel 
G 5  6  ? anti-parallel 
G 6  7  ? anti-parallel 
G 7  8  ? anti-parallel 
G 8  9  ? anti-parallel 
G 9  10 ? anti-parallel 
G 10 11 ? anti-parallel 
G 11 12 ? anti-parallel 
G 12 13 ? anti-parallel 
G 13 14 ? anti-parallel 
G 14 15 ? anti-parallel 
G 15 16 ? anti-parallel 
G 16 17 ? anti-parallel 
G 17 18 ? anti-parallel 
G 18 19 ? anti-parallel 
H 1  2  ? anti-parallel 
I 1  2  ? anti-parallel 
J 1  2  ? anti-parallel 
K 1  2  ? anti-parallel 
L 1  2  ? anti-parallel 
M 1  2  ? anti-parallel 
N 1  2  ? anti-parallel 
O 1  2  ? anti-parallel 
P 1  2  ? anti-parallel 
Q 1  2  ? anti-parallel 
R 1  2  ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1  TYR A 41  ? GLY A 47  ? TYR A 41  GLY A 47  
A 2  ASP A 2   ? THR A 14  ? ASP A 2   THR A 14  
A 3  ASP A 413 ? TRP A 426 ? ASP A 413 TRP A 426 
A 4  ALA A 372 ? GLU A 384 ? ALA A 372 GLU A 384 
A 5  ARG A 349 ? GLN A 362 ? ARG A 349 GLN A 362 
A 6  MET A 330 ? SER A 343 ? MET A 330 SER A 343 
A 7  THR A 313 ? LYS A 325 ? THR A 313 LYS A 325 
A 8  TRP A 294 ? TRP A 307 ? TRP A 294 TRP A 307 
A 9  GLY A 277 ? LEU A 290 ? GLY A 277 LEU A 290 
A 10 GLY A 226 ? THR A 236 ? GLY A 226 THR A 236 
A 11 ASP A 211 ? MET A 223 ? ASP A 211 MET A 223 
A 12 GLY A 185 ? ASN A 197 ? GLY A 185 ASN A 197 
A 13 VAL A 164 ? ALA A 177 ? VAL A 164 ALA A 177 
A 14 LYS A 138 ? TYR A 153 ? LYS A 138 TYR A 153 
A 15 GLY A 124 ? GLU A 130 ? GLY A 124 GLU A 130 
A 16 THR A 99  ? ARG A 105 ? THR A 99  ARG A 105 
A 17 ALA A 80  ? LYS A 89  ? ALA A 80  LYS A 89  
A 18 SER A 57  ? VAL A 68  ? SER A 57  VAL A 68  
A 19 THR A 40  ? LEU A 44  ? THR A 40  LEU A 44  
B 1  SER A 255 ? THR A 257 ? SER A 255 THR A 257 
B 2  ASN A 267 ? ALA A 269 ? ASN A 267 ALA A 269 
C 1  TRP A 386 ? TYR A 388 ? TRP A 386 TYR A 388 
C 2  ALA A 399 ? ALA A 401 ? ALA A 399 ALA A 401 
D 1  TYR B 41  ? GLY B 47  ? TYR B 41  GLY B 47  
D 2  ASP B 2   ? THR B 14  ? ASP B 2   THR B 14  
D 3  ASP B 413 ? TRP B 426 ? ASP B 413 TRP B 426 
D 4  ALA B 372 ? GLU B 384 ? ALA B 372 GLU B 384 
D 5  ARG B 349 ? GLN B 362 ? ARG B 349 GLN B 362 
D 6  MET B 330 ? SER B 343 ? MET B 330 SER B 343 
D 7  THR B 313 ? THR B 327 ? THR B 313 THR B 327 
D 8  TRP B 294 ? TRP B 307 ? TRP B 294 TRP B 307 
D 9  GLY B 277 ? LEU B 290 ? GLY B 277 LEU B 290 
D 10 GLY B 226 ? THR B 236 ? GLY B 226 THR B 236 
D 11 ASP B 211 ? MET B 223 ? ASP B 211 MET B 223 
D 12 GLY B 185 ? ASN B 197 ? GLY B 185 ASN B 197 
D 13 VAL B 164 ? ALA B 177 ? VAL B 164 ALA B 177 
D 14 LYS B 138 ? TYR B 153 ? LYS B 138 TYR B 153 
D 15 GLY B 124 ? GLU B 130 ? GLY B 124 GLU B 130 
D 16 THR B 99  ? ARG B 105 ? THR B 99  ARG B 105 
D 17 ALA B 80  ? LYS B 89  ? ALA B 80  LYS B 89  
D 18 SER B 57  ? VAL B 68  ? SER B 57  VAL B 68  
D 19 THR B 40  ? LEU B 44  ? THR B 40  LEU B 44  
E 1  SER B 255 ? THR B 257 ? SER B 255 THR B 257 
E 2  ASN B 267 ? ALA B 269 ? ASN B 267 ALA B 269 
F 1  TRP B 386 ? TYR B 388 ? TRP B 386 TYR B 388 
F 2  ALA B 399 ? ALA B 401 ? ALA B 399 ALA B 401 
G 1  TYR C 41  ? GLY C 47  ? TYR C 41  GLY C 47  
G 2  ASP C 2   ? THR C 14  ? ASP C 2   THR C 14  
G 3  ASP C 413 ? TRP C 426 ? ASP C 413 TRP C 426 
G 4  ALA C 372 ? GLU C 384 ? ALA C 372 GLU C 384 
G 5  ARG C 349 ? GLN C 362 ? ARG C 349 GLN C 362 
G 6  MET C 330 ? SER C 343 ? MET C 330 SER C 343 
G 7  THR C 313 ? LYS C 325 ? THR C 313 LYS C 325 
G 8  TRP C 294 ? TRP C 307 ? TRP C 294 TRP C 307 
G 9  GLY C 277 ? LEU C 290 ? GLY C 277 LEU C 290 
G 10 GLY C 226 ? THR C 236 ? GLY C 226 THR C 236 
G 11 ASP C 211 ? MET C 223 ? ASP C 211 MET C 223 
G 12 GLY C 185 ? ASN C 197 ? GLY C 185 ASN C 197 
G 13 VAL C 164 ? ALA C 177 ? VAL C 164 ALA C 177 
G 14 LYS C 138 ? TYR C 153 ? LYS C 138 TYR C 153 
G 15 GLY C 124 ? GLU C 130 ? GLY C 124 GLU C 130 
G 16 THR C 99  ? ARG C 105 ? THR C 99  ARG C 105 
G 17 ALA C 80  ? LYS C 89  ? ALA C 80  LYS C 89  
G 18 SER C 57  ? VAL C 68  ? SER C 57  VAL C 68  
G 19 THR C 40  ? LEU C 44  ? THR C 40  LEU C 44  
H 1  SER C 255 ? THR C 257 ? SER C 255 THR C 257 
H 2  ASN C 267 ? ALA C 269 ? ASN C 267 ALA C 269 
I 1  TRP C 386 ? TYR C 388 ? TRP C 386 TYR C 388 
I 2  ALA C 399 ? ALA C 401 ? ALA C 399 ALA C 401 
J 1  GLN A 48  ? GLU A 53  ? GLN A 48  GLU A 53  
J 2  LYS A 56  ? PHE A 60  ? LYS A 56  PHE A 60  
K 1  HIS A 110 ? VAL A 112 ? HIS A 110 VAL A 112 
K 2  PHE A 117 ? TRP A 120 ? PHE A 117 TRP A 120 
L 1  LEU A 179 ? ASN A 182 ? LEU A 179 ASN A 182 
L 2  GLY A 185 ? LEU A 187 ? GLY A 185 LEU A 187 
M 1  GLN B 48  ? GLU B 53  ? GLN B 48  GLU B 53  
M 2  LYS B 56  ? PHE B 60  ? LYS B 56  PHE B 60  
N 1  HIS B 110 ? VAL B 112 ? HIS B 110 VAL B 112 
N 2  PHE B 117 ? TRP B 120 ? PHE B 117 TRP B 120 
O 1  LEU B 179 ? ASN B 182 ? LEU B 179 ASN B 182 
O 2  GLY B 185 ? LEU B 187 ? GLY B 185 LEU B 187 
P 1  GLN C 48  ? GLU C 53  ? GLN C 48  GLU C 53  
P 2  LYS C 56  ? PHE C 60  ? LYS C 56  PHE C 60  
Q 1  HIS C 110 ? VAL C 112 ? HIS C 110 VAL C 112 
Q 2  PHE C 117 ? TRP C 120 ? PHE C 117 TRP C 120 
R 1  LEU C 179 ? ASN C 182 ? LEU C 179 ASN C 182 
R 2  GLY C 185 ? LEU C 187 ? GLY C 185 LEU C 187 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1  2  O TYR A 41  ? O TYR A 41  N ARG A 8   ? N ARG A 8   
A 2  3  O ALA A 7   ? O ALA A 7   N ILE A 425 ? N ILE A 425 
A 3  4  O SER A 414 ? O SER A 414 N TRP A 382 ? N TRP A 382 
A 4  5  O ILE A 373 ? O ILE A 373 N TRP A 361 ? N TRP A 361 
A 5  6  O ASN A 350 ? O ASN A 350 N VAL A 341 ? N VAL A 341 
A 6  7  O THR A 332 ? O THR A 332 N TYR A 324 ? N TYR A 324 
A 7  8  O THR A 313 ? O THR A 313 N ILE A 305 ? N ILE A 305 
A 8  9  O TRP A 294 ? O TRP A 294 N LEU A 290 ? N LEU A 290 
A 9  10 O MET A 279 ? O MET A 279 N ALA A 235 ? N ALA A 235 
A 10 11 O GLY A 226 ? O GLY A 226 N MET A 223 ? N MET A 223 
A 11 12 O GLY A 212 ? O GLY A 212 N GLY A 194 ? N GLY A 194 
A 12 13 O LEU A 189 ? O LEU A 189 N LEU A 176 ? N LEU A 176 
A 13 14 O LYS A 165 ? O LYS A 165 N SER A 152 ? N SER A 152 
A 14 15 O LEU A 141 ? O LEU A 141 N ILE A 129 ? N ILE A 129 
A 15 16 O GLY A 124 ? O GLY A 124 N ARG A 105 ? N ARG A 105 
A 16 17 O ILE A 100 ? O ILE A 100 N GLY A 88  ? N GLY A 88  
A 17 18 O ALA A 80  ? O ALA A 80  N ALA A 65  ? N ALA A 65  
A 18 19 O VAL A 64  ? O VAL A 64  N LEU A 44  ? N LEU A 44  
B 1  2  O PHE A 256 ? O PHE A 256 N TYR A 268 ? N TYR A 268 
C 1  2  O GLY A 387 ? O GLY A 387 N ALA A 400 ? N ALA A 400 
D 1  2  O TYR B 41  ? O TYR B 41  N ARG B 8   ? N ARG B 8   
D 2  3  O ALA B 7   ? O ALA B 7   N ILE B 425 ? N ILE B 425 
D 3  4  O SER B 414 ? O SER B 414 N TRP B 382 ? N TRP B 382 
D 4  5  O ILE B 373 ? O ILE B 373 N TRP B 361 ? N TRP B 361 
D 5  6  O ASN B 350 ? O ASN B 350 N VAL B 341 ? N VAL B 341 
D 6  7  O MET B 330 ? O MET B 330 N THR B 327 ? N THR B 327 
D 7  8  O THR B 313 ? O THR B 313 N ILE B 305 ? N ILE B 305 
D 8  9  O TRP B 294 ? O TRP B 294 N LEU B 290 ? N LEU B 290 
D 9  10 O MET B 279 ? O MET B 279 N ALA B 235 ? N ALA B 235 
D 10 11 O GLY B 226 ? O GLY B 226 N MET B 223 ? N MET B 223 
D 11 12 O GLY B 212 ? O GLY B 212 N GLY B 194 ? N GLY B 194 
D 12 13 O LEU B 189 ? O LEU B 189 N LEU B 176 ? N LEU B 176 
D 13 14 O LYS B 165 ? O LYS B 165 N SER B 152 ? N SER B 152 
D 14 15 O LEU B 141 ? O LEU B 141 N ILE B 129 ? N ILE B 129 
D 15 16 O GLY B 124 ? O GLY B 124 N ARG B 105 ? N ARG B 105 
D 16 17 O ILE B 100 ? O ILE B 100 N GLY B 88  ? N GLY B 88  
D 17 18 O ALA B 80  ? O ALA B 80  N ALA B 65  ? N ALA B 65  
D 18 19 O VAL B 64  ? O VAL B 64  N LEU B 44  ? N LEU B 44  
E 1  2  O PHE B 256 ? O PHE B 256 N TYR B 268 ? N TYR B 268 
F 1  2  O GLY B 387 ? O GLY B 387 N ALA B 400 ? N ALA B 400 
G 1  2  O TYR C 41  ? O TYR C 41  N ARG C 8   ? N ARG C 8   
G 2  3  O ALA C 7   ? O ALA C 7   N ILE C 425 ? N ILE C 425 
G 3  4  O SER C 414 ? O SER C 414 N TRP C 382 ? N TRP C 382 
G 4  5  O ILE C 373 ? O ILE C 373 N TRP C 361 ? N TRP C 361 
G 5  6  O ASN C 350 ? O ASN C 350 N VAL C 341 ? N VAL C 341 
G 6  7  O THR C 332 ? O THR C 332 N TYR C 324 ? N TYR C 324 
G 7  8  O THR C 313 ? O THR C 313 N ILE C 305 ? N ILE C 305 
G 8  9  O TRP C 294 ? O TRP C 294 N LEU C 290 ? N LEU C 290 
G 9  10 O MET C 279 ? O MET C 279 N ALA C 235 ? N ALA C 235 
G 10 11 O GLY C 226 ? O GLY C 226 N MET C 223 ? N MET C 223 
G 11 12 O GLY C 212 ? O GLY C 212 N GLY C 194 ? N GLY C 194 
G 12 13 O LEU C 189 ? O LEU C 189 N LEU C 176 ? N LEU C 176 
G 13 14 O LYS C 165 ? O LYS C 165 N SER C 152 ? N SER C 152 
G 14 15 O LEU C 141 ? O LEU C 141 N ILE C 129 ? N ILE C 129 
G 15 16 O GLY C 124 ? O GLY C 124 N ARG C 105 ? N ARG C 105 
G 16 17 O ILE C 100 ? O ILE C 100 N GLY C 88  ? N GLY C 88  
G 17 18 O ALA C 80  ? O ALA C 80  N ALA C 65  ? N ALA C 65  
G 18 19 O VAL C 64  ? O VAL C 64  N LEU C 44  ? N LEU C 44  
H 1  2  O PHE C 256 ? O PHE C 256 N TYR C 268 ? N TYR C 268 
I 1  2  O GLY C 387 ? O GLY C 387 N ALA C 400 ? N ALA C 400 
J 1  2  O GLN A 48  ? O GLN A 48  N PHE A 60  ? N PHE A 60  
K 1  2  O HIS A 110 ? O HIS A 110 N TRP A 120 ? N TRP A 120 
L 1  2  O LEU A 179 ? O LEU A 179 N LEU A 187 ? N LEU A 187 
M 1  2  O GLN B 48  ? O GLN B 48  N PHE B 60  ? N PHE B 60  
N 1  2  O HIS B 110 ? O HIS B 110 N TRP B 120 ? N TRP B 120 
O 1  2  O LEU B 179 ? O LEU B 179 N LEU B 187 ? N LEU B 187 
P 1  2  O GLN C 48  ? O GLN C 48  N PHE C 60  ? N PHE C 60  
Q 1  2  O HIS C 110 ? O HIS C 110 N TRP C 120 ? N TRP C 120 
R 1  2  O LEU C 179 ? O LEU C 179 N LEU C 187 ? N LEU C 187 
# 
_database_PDB_matrix.entry_id          2MPR 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2MPR 
_atom_sites.fract_transf_matrix[1][1]   0.008032 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.004721 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005426 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N   . VAL A 1 1   ? 3.888   68.608  51.985  1.00 26.85  ? 1   VAL A N   1 
ATOM   2     C  CA  . VAL A 1 1   ? 3.967   67.942  53.307  1.00 22.64  ? 1   VAL A CA  1 
ATOM   3     C  C   . VAL A 1 1   ? 3.452   66.502  53.234  1.00 21.62  ? 1   VAL A C   1 
ATOM   4     O  O   . VAL A 1 1   ? 2.424   66.234  52.602  1.00 23.20  ? 1   VAL A O   1 
ATOM   5     C  CB  . VAL A 1 1   ? 3.164   68.733  54.386  1.00 21.48  ? 1   VAL A CB  1 
ATOM   6     C  CG1 . VAL A 1 1   ? 1.691   68.839  54.005  1.00 21.74  ? 1   VAL A CG1 1 
ATOM   7     C  CG2 . VAL A 1 1   ? 3.297   68.060  55.725  1.00 22.67  ? 1   VAL A CG2 1 
ATOM   8     N  N   . ASP A 1 2   ? 4.192   65.580  53.846  1.00 18.27  ? 2   ASP A N   1 
ATOM   9     C  CA  . ASP A 1 2   ? 3.802   64.174  53.883  1.00 15.89  ? 2   ASP A CA  1 
ATOM   10    C  C   . ASP A 1 2   ? 2.964   63.960  55.132  1.00 13.94  ? 2   ASP A C   1 
ATOM   11    O  O   . ASP A 1 2   ? 3.353   64.372  56.224  1.00 17.56  ? 2   ASP A O   1 
ATOM   12    C  CB  . ASP A 1 2   ? 5.031   63.264  53.932  1.00 17.98  ? 2   ASP A CB  1 
ATOM   13    C  CG  . ASP A 1 2   ? 5.950   63.446  52.732  1.00 23.55  ? 2   ASP A CG  1 
ATOM   14    O  OD1 . ASP A 1 2   ? 5.465   63.856  51.653  1.00 30.14  ? 2   ASP A OD1 1 
ATOM   15    O  OD2 . ASP A 1 2   ? 7.163   63.178  52.872  1.00 22.55  ? 2   ASP A OD2 1 
ATOM   16    N  N   . PHE A 1 3   ? 1.808   63.339  54.970  1.00 13.14  ? 3   PHE A N   1 
ATOM   17    C  CA  . PHE A 1 3   ? 0.921   63.090  56.089  1.00 12.39  ? 3   PHE A CA  1 
ATOM   18    C  C   . PHE A 1 3   ? 0.874   61.590  56.270  1.00 14.66  ? 3   PHE A C   1 
ATOM   19    O  O   . PHE A 1 3   ? 0.538   60.866  55.341  1.00 16.30  ? 3   PHE A O   1 
ATOM   20    C  CB  . PHE A 1 3   ? -0.461  63.657  55.774  1.00 10.85  ? 3   PHE A CB  1 
ATOM   21    C  CG  . PHE A 1 3   ? -1.504  63.382  56.829  1.00 14.77  ? 3   PHE A CG  1 
ATOM   22    C  CD1 . PHE A 1 3   ? -1.242  63.601  58.176  1.00 13.56  ? 3   PHE A CD1 1 
ATOM   23    C  CD2 . PHE A 1 3   ? -2.777  62.939  56.464  1.00 12.87  ? 3   PHE A CD2 1 
ATOM   24    C  CE1 . PHE A 1 3   ? -2.234  63.388  59.137  1.00 12.29  ? 3   PHE A CE1 1 
ATOM   25    C  CE2 . PHE A 1 3   ? -3.769  62.722  57.421  1.00 6.60   ? 3   PHE A CE2 1 
ATOM   26    C  CZ  . PHE A 1 3   ? -3.499  62.946  58.755  1.00 8.76   ? 3   PHE A CZ  1 
ATOM   27    N  N   . HIS A 1 4   ? 1.245   61.125  57.457  1.00 14.11  ? 4   HIS A N   1 
ATOM   28    C  CA  . HIS A 1 4   ? 1.261   59.699  57.767  1.00 9.75   ? 4   HIS A CA  1 
ATOM   29    C  C   . HIS A 1 4   ? 0.830   59.489  59.204  1.00 10.76  ? 4   HIS A C   1 
ATOM   30    O  O   . HIS A 1 4   ? 0.693   60.456  59.949  1.00 10.94  ? 4   HIS A O   1 
ATOM   31    C  CB  . HIS A 1 4   ? 2.675   59.140  57.604  1.00 10.77  ? 4   HIS A CB  1 
ATOM   32    C  CG  . HIS A 1 4   ? 3.176   59.165  56.196  1.00 18.15  ? 4   HIS A CG  1 
ATOM   33    N  ND1 . HIS A 1 4   ? 2.607   58.414  55.194  1.00 15.19  ? 4   HIS A ND1 1 
ATOM   34    C  CD2 . HIS A 1 4   ? 4.192   59.847  55.622  1.00 16.42  ? 4   HIS A CD2 1 
ATOM   35    C  CE1 . HIS A 1 4   ? 3.246   58.629  54.063  1.00 15.10  ? 4   HIS A CE1 1 
ATOM   36    N  NE2 . HIS A 1 4   ? 4.214   59.495  54.294  1.00 17.15  ? 4   HIS A NE2 1 
ATOM   37    N  N   . GLY A 1 5   ? 0.654   58.229  59.602  1.00 9.29   ? 5   GLY A N   1 
ATOM   38    C  CA  . GLY A 1 5   ? 0.271   57.939  60.971  1.00 9.63   ? 5   GLY A CA  1 
ATOM   39    C  C   . GLY A 1 5   ? -0.411  56.606  61.202  1.00 12.61  ? 5   GLY A C   1 
ATOM   40    O  O   . GLY A 1 5   ? -0.266  55.646  60.436  1.00 14.29  ? 5   GLY A O   1 
ATOM   41    N  N   . TYR A 1 6   ? -1.148  56.551  62.297  1.00 10.64  ? 6   TYR A N   1 
ATOM   42    C  CA  . TYR A 1 6   ? -1.883  55.369  62.683  1.00 8.21   ? 6   TYR A CA  1 
ATOM   43    C  C   . TYR A 1 6   ? -3.053  55.866  63.516  1.00 9.76   ? 6   TYR A C   1 
ATOM   44    O  O   . TYR A 1 6   ? -2.940  56.890  64.184  1.00 16.65  ? 6   TYR A O   1 
ATOM   45    C  CB  . TYR A 1 6   ? -1.002  54.455  63.549  1.00 6.69   ? 6   TYR A CB  1 
ATOM   46    C  CG  . TYR A 1 6   ? -1.777  53.348  64.241  1.00 12.14  ? 6   TYR A CG  1 
ATOM   47    C  CD1 . TYR A 1 6   ? -2.402  53.567  65.474  1.00 12.02  ? 6   TYR A CD1 1 
ATOM   48    C  CD2 . TYR A 1 6   ? -1.983  52.120  63.617  1.00 9.52   ? 6   TYR A CD2 1 
ATOM   49    C  CE1 . TYR A 1 6   ? -3.232  52.589  66.048  1.00 9.92   ? 6   TYR A CE1 1 
ATOM   50    C  CE2 . TYR A 1 6   ? -2.797  51.147  64.185  1.00 8.13   ? 6   TYR A CE2 1 
ATOM   51    C  CZ  . TYR A 1 6   ? -3.426  51.389  65.393  1.00 10.97  ? 6   TYR A CZ  1 
ATOM   52    O  OH  . TYR A 1 6   ? -4.298  50.458  65.914  1.00 14.56  ? 6   TYR A OH  1 
ATOM   53    N  N   . ALA A 1 7   ? -4.181  55.167  63.465  1.00 8.33   ? 7   ALA A N   1 
ATOM   54    C  CA  . ALA A 1 7   ? -5.338  55.518  64.286  1.00 8.95   ? 7   ALA A CA  1 
ATOM   55    C  C   . ALA A 1 7   ? -6.280  54.333  64.408  1.00 11.45  ? 7   ALA A C   1 
ATOM   56    O  O   . ALA A 1 7   ? -6.323  53.474  63.508  1.00 13.58  ? 7   ALA A O   1 
ATOM   57    C  CB  . ALA A 1 7   ? -6.076  56.698  63.719  1.00 6.78   ? 7   ALA A CB  1 
ATOM   58    N  N   . ARG A 1 8   ? -6.934  54.219  65.565  1.00 8.11   ? 8   ARG A N   1 
ATOM   59    C  CA  . ARG A 1 8   ? -7.942  53.191  65.776  1.00 6.69   ? 8   ARG A CA  1 
ATOM   60    C  C   . ARG A 1 8   ? -8.980  53.891  66.610  1.00 9.04   ? 8   ARG A C   1 
ATOM   61    O  O   . ARG A 1 8   ? -8.630  54.754  67.415  1.00 11.89  ? 8   ARG A O   1 
ATOM   62    C  CB  . ARG A 1 8   ? -7.415  51.958  66.500  1.00 6.51   ? 8   ARG A CB  1 
ATOM   63    C  CG  . ARG A 1 8   ? -6.843  52.211  67.860  1.00 11.20  ? 8   ARG A CG  1 
ATOM   64    C  CD  . ARG A 1 8   ? -6.705  50.902  68.613  1.00 12.91  ? 8   ARG A CD  1 
ATOM   65    N  NE  . ARG A 1 8   ? -5.929  51.060  69.839  1.00 8.75   ? 8   ARG A NE  1 
ATOM   66    C  CZ  . ARG A 1 8   ? -4.602  51.040  69.891  1.00 13.38  ? 8   ARG A CZ  1 
ATOM   67    N  NH1 . ARG A 1 8   ? -3.896  50.859  68.787  1.00 13.73  ? 8   ARG A NH1 1 
ATOM   68    N  NH2 . ARG A 1 8   ? -3.982  51.244  71.046  1.00 14.05  ? 8   ARG A NH2 1 
ATOM   69    N  N   . SER A 1 9   ? -10.248 53.603  66.344  1.00 5.33   ? 9   SER A N   1 
ATOM   70    C  CA  . SER A 1 9   ? -11.353 54.186  67.075  1.00 6.85   ? 9   SER A CA  1 
ATOM   71    C  C   . SER A 1 9   ? -12.566 53.301  66.831  1.00 10.51  ? 9   SER A C   1 
ATOM   72    O  O   . SER A 1 9   ? -12.683 52.693  65.765  1.00 17.29  ? 9   SER A O   1 
ATOM   73    C  CB  . SER A 1 9   ? -11.613 55.607  66.585  1.00 6.97   ? 9   SER A CB  1 
ATOM   74    O  OG  . SER A 1 9   ? -12.574 56.285  67.390  1.00 12.82  ? 9   SER A OG  1 
ATOM   75    N  N   . GLY A 1 10  ? -13.443 53.192  67.825  1.00 13.43  ? 10  GLY A N   1 
ATOM   76    C  CA  . GLY A 1 10  ? -14.630 52.363  67.692  1.00 11.47  ? 10  GLY A CA  1 
ATOM   77    C  C   . GLY A 1 10  ? -15.622 52.543  68.830  1.00 14.15  ? 10  GLY A C   1 
ATOM   78    O  O   . GLY A 1 10  ? -15.529 53.494  69.599  1.00 13.88  ? 10  GLY A O   1 
ATOM   79    N  N   . ILE A 1 11  ? -16.617 51.668  68.888  1.00 14.15  ? 11  ILE A N   1 
ATOM   80    C  CA  . ILE A 1 11  ? -17.634 51.693  69.930  1.00 11.94  ? 11  ILE A CA  1 
ATOM   81    C  C   . ILE A 1 11  ? -17.917 50.235  70.254  1.00 14.55  ? 11  ILE A C   1 
ATOM   82    O  O   . ILE A 1 11  ? -17.937 49.397  69.358  1.00 13.96  ? 11  ILE A O   1 
ATOM   83    C  CB  . ILE A 1 11  ? -18.924 52.386  69.454  1.00 12.64  ? 11  ILE A CB  1 
ATOM   84    C  CG1 . ILE A 1 11  ? -19.955 52.424  70.588  1.00 8.81   ? 11  ILE A CG1 1 
ATOM   85    C  CG2 . ILE A 1 11  ? -19.490 51.667  68.225  1.00 9.55   ? 11  ILE A CG2 1 
ATOM   86    C  CD1 . ILE A 1 11  ? -21.161 53.269  70.280  1.00 5.66   ? 11  ILE A CD1 1 
ATOM   87    N  N   . GLY A 1 12  ? -18.097 49.921  71.528  1.00 14.33  ? 12  GLY A N   1 
ATOM   88    C  CA  . GLY A 1 12  ? -18.349 48.539  71.906  1.00 17.47  ? 12  GLY A CA  1 
ATOM   89    C  C   . GLY A 1 12  ? -19.227 48.366  73.132  1.00 18.53  ? 12  GLY A C   1 
ATOM   90    O  O   . GLY A 1 12  ? -19.435 49.311  73.907  1.00 16.90  ? 12  GLY A O   1 
ATOM   91    N  N   . TRP A 1 13  ? -19.730 47.147  73.303  1.00 16.96  ? 13  TRP A N   1 
ATOM   92    C  CA  . TRP A 1 13  ? -20.612 46.792  74.408  1.00 15.83  ? 13  TRP A CA  1 
ATOM   93    C  C   . TRP A 1 13  ? -20.155 45.496  75.052  1.00 18.72  ? 13  TRP A C   1 
ATOM   94    O  O   . TRP A 1 13  ? -19.562 44.636  74.393  1.00 20.12  ? 13  TRP A O   1 
ATOM   95    C  CB  . TRP A 1 13  ? -22.043 46.585  73.902  1.00 15.04  ? 13  TRP A CB  1 
ATOM   96    C  CG  . TRP A 1 13  ? -22.691 47.810  73.356  1.00 15.46  ? 13  TRP A CG  1 
ATOM   97    C  CD1 . TRP A 1 13  ? -23.435 48.715  74.047  1.00 15.77  ? 13  TRP A CD1 1 
ATOM   98    C  CD2 . TRP A 1 13  ? -22.608 48.302  72.011  1.00 16.85  ? 13  TRP A CD2 1 
ATOM   99    N  NE1 . TRP A 1 13  ? -23.812 49.750  73.223  1.00 17.31  ? 13  TRP A NE1 1 
ATOM   100   C  CE2 . TRP A 1 13  ? -23.317 49.522  71.968  1.00 18.01  ? 13  TRP A CE2 1 
ATOM   101   C  CE3 . TRP A 1 13  ? -21.999 47.834  70.838  1.00 18.36  ? 13  TRP A CE3 1 
ATOM   102   C  CZ2 . TRP A 1 13  ? -23.431 50.283  70.798  1.00 18.41  ? 13  TRP A CZ2 1 
ATOM   103   C  CZ3 . TRP A 1 13  ? -22.115 48.592  69.673  1.00 14.89  ? 13  TRP A CZ3 1 
ATOM   104   C  CH2 . TRP A 1 13  ? -22.822 49.800  69.665  1.00 15.94  ? 13  TRP A CH2 1 
ATOM   105   N  N   . THR A 1 14  ? -20.385 45.383  76.354  1.00 20.53  ? 14  THR A N   1 
ATOM   106   C  CA  . THR A 1 14  ? -20.036 44.176  77.095  1.00 18.40  ? 14  THR A CA  1 
ATOM   107   C  C   . THR A 1 14  ? -21.340 43.401  77.219  1.00 18.24  ? 14  THR A C   1 
ATOM   108   O  O   . THR A 1 14  ? -22.370 43.979  77.552  1.00 19.19  ? 14  THR A O   1 
ATOM   109   C  CB  . THR A 1 14  ? -19.506 44.501  78.511  1.00 19.42  ? 14  THR A CB  1 
ATOM   110   O  OG1 . THR A 1 14  ? -18.271 45.208  78.408  1.00 20.56  ? 14  THR A OG1 1 
ATOM   111   C  CG2 . THR A 1 14  ? -19.251 43.229  79.284  1.00 18.53  ? 14  THR A CG2 1 
ATOM   112   N  N   . GLY A 1 15  ? -21.301 42.110  76.920  1.00 19.31  ? 15  GLY A N   1 
ATOM   113   C  CA  . GLY A 1 15  ? -22.495 41.296  76.997  1.00 18.75  ? 15  GLY A CA  1 
ATOM   114   C  C   . GLY A 1 15  ? -23.299 41.468  78.273  1.00 22.28  ? 15  GLY A C   1 
ATOM   115   O  O   . GLY A 1 15  ? -24.513 41.576  78.233  1.00 26.12  ? 15  GLY A O   1 
ATOM   116   N  N   . SER A 1 16  ? -22.633 41.513  79.415  1.00 24.44  ? 16  SER A N   1 
ATOM   117   C  CA  . SER A 1 16  ? -23.346 41.664  80.676  1.00 23.46  ? 16  SER A CA  1 
ATOM   118   C  C   . SER A 1 16  ? -23.766 43.085  81.024  1.00 25.62  ? 16  SER A C   1 
ATOM   119   O  O   . SER A 1 16  ? -24.387 43.301  82.063  1.00 30.87  ? 16  SER A O   1 
ATOM   120   C  CB  . SER A 1 16  ? -22.525 41.083  81.827  1.00 22.71  ? 16  SER A CB  1 
ATOM   121   O  OG  . SER A 1 16  ? -21.255 41.710  81.935  1.00 24.55  ? 16  SER A OG  1 
ATOM   122   N  N   . GLY A 1 17  ? -23.372 44.061  80.210  1.00 27.05  ? 17  GLY A N   1 
ATOM   123   C  CA  . GLY A 1 17  ? -23.768 45.435  80.488  1.00 20.63  ? 17  GLY A CA  1 
ATOM   124   C  C   . GLY A 1 17  ? -22.697 46.487  80.313  1.00 20.55  ? 17  GLY A C   1 
ATOM   125   O  O   . GLY A 1 17  ? -21.507 46.217  80.448  1.00 22.70  ? 17  GLY A O   1 
ATOM   126   N  N   . GLY A 1 18  ? -23.133 47.684  79.957  1.00 19.52  ? 18  GLY A N   1 
ATOM   127   C  CA  . GLY A 1 18  ? -22.235 48.803  79.778  1.00 18.55  ? 18  GLY A CA  1 
ATOM   128   C  C   . GLY A 1 18  ? -21.265 48.743  78.618  1.00 17.77  ? 18  GLY A C   1 
ATOM   129   O  O   . GLY A 1 18  ? -21.335 47.849  77.765  1.00 15.45  ? 18  GLY A O   1 
ATOM   130   N  N   . GLU A 1 19  ? -20.360 49.722  78.607  1.00 16.76  ? 19  GLU A N   1 
ATOM   131   C  CA  . GLU A 1 19  ? -19.320 49.848  77.594  1.00 19.64  ? 19  GLU A CA  1 
ATOM   132   C  C   . GLU A 1 19  ? -18.518 48.565  77.449  1.00 22.43  ? 19  GLU A C   1 
ATOM   133   O  O   . GLU A 1 19  ? -18.522 47.709  78.333  1.00 24.50  ? 19  GLU A O   1 
ATOM   134   C  CB  . GLU A 1 19  ? -18.296 50.921  77.965  1.00 19.20  ? 19  GLU A CB  1 
ATOM   135   C  CG  . GLU A 1 19  ? -18.725 51.980  78.941  1.00 32.26  ? 19  GLU A CG  1 
ATOM   136   C  CD  . GLU A 1 19  ? -18.671 51.528  80.385  1.00 26.89  ? 19  GLU A CD  1 
ATOM   137   O  OE1 . GLU A 1 19  ? -17.567 51.392  80.948  1.00 26.63  ? 19  GLU A OE1 1 
ATOM   138   O  OE2 . GLU A 1 19  ? -19.752 51.336  80.955  1.00 28.72  ? 19  GLU A OE2 1 
ATOM   139   N  N   . GLN A 1 20  ? -17.747 48.508  76.368  1.00 22.13  ? 20  GLN A N   1 
ATOM   140   C  CA  . GLN A 1 20  ? -16.882 47.384  76.068  1.00 20.03  ? 20  GLN A CA  1 
ATOM   141   C  C   . GLN A 1 20  ? -15.778 47.327  77.117  1.00 21.42  ? 20  GLN A C   1 
ATOM   142   O  O   . GLN A 1 20  ? -15.353 48.354  77.635  1.00 23.15  ? 20  GLN A O   1 
ATOM   143   C  CB  . GLN A 1 20  ? -16.247 47.578  74.684  1.00 17.89  ? 20  GLN A CB  1 
ATOM   144   C  CG  . GLN A 1 20  ? -15.252 46.494  74.272  1.00 15.18  ? 20  GLN A CG  1 
ATOM   145   C  CD  . GLN A 1 20  ? -14.584 46.805  72.963  1.00 15.28  ? 20  GLN A CD  1 
ATOM   146   O  OE1 . GLN A 1 20  ? -14.798 47.872  72.392  1.00 21.22  ? 20  GLN A OE1 1 
ATOM   147   N  NE2 . GLN A 1 20  ? -13.769 45.884  72.476  1.00 10.58  ? 20  GLN A NE2 1 
ATOM   148   N  N   . GLN A 1 21  ? -15.338 46.118  77.435  1.00 22.79  ? 21  GLN A N   1 
ATOM   149   C  CA  . GLN A 1 21  ? -14.259 45.903  78.381  1.00 20.69  ? 21  GLN A CA  1 
ATOM   150   C  C   . GLN A 1 21  ? -13.229 45.089  77.609  1.00 20.22  ? 21  GLN A C   1 
ATOM   151   O  O   . GLN A 1 21  ? -13.595 44.317  76.723  1.00 22.30  ? 21  GLN A O   1 
ATOM   152   C  CB  . GLN A 1 21  ? -14.757 45.114  79.588  1.00 24.41  ? 21  GLN A CB  1 
ATOM   153   C  CG  . GLN A 1 21  ? -15.513 45.948  80.600  1.00 33.10  ? 21  GLN A CG  1 
ATOM   154   C  CD  . GLN A 1 21  ? -16.176 45.097  81.662  1.00 38.19  ? 21  GLN A CD  1 
ATOM   155   O  OE1 . GLN A 1 21  ? -15.605 44.108  82.125  1.00 44.13  ? 21  GLN A OE1 1 
ATOM   156   N  NE2 . GLN A 1 21  ? -17.396 45.463  82.041  1.00 39.71  ? 21  GLN A NE2 1 
ATOM   157   N  N   . CYS A 1 22  ? -11.951 45.289  77.911  1.00 17.25  ? 22  CYS A N   1 
ATOM   158   C  CA  . CYS A 1 22  ? -10.879 44.575  77.234  1.00 16.09  ? 22  CYS A CA  1 
ATOM   159   C  C   . CYS A 1 22  ? -10.212 43.583  78.182  1.00 18.80  ? 22  CYS A C   1 
ATOM   160   O  O   . CYS A 1 22  ? -10.031 43.858  79.365  1.00 23.17  ? 22  CYS A O   1 
ATOM   161   C  CB  . CYS A 1 22  ? -9.890  45.564  76.663  1.00 17.61  ? 22  CYS A CB  1 
ATOM   162   S  SG  . CYS A 1 22  ? -10.571 46.406  75.210  1.00 17.80  ? 22  CYS A SG  1 
ATOM   163   N  N   . PHE A 1 23  ? -9.803  42.448  77.635  1.00 18.46  ? 23  PHE A N   1 
ATOM   164   C  CA  . PHE A 1 23  ? -9.235  41.362  78.410  1.00 15.34  ? 23  PHE A CA  1 
ATOM   165   C  C   . PHE A 1 23  ? -7.746  41.060  78.233  1.00 16.80  ? 23  PHE A C   1 
ATOM   166   O  O   . PHE A 1 23  ? -7.294  40.657  77.149  1.00 19.02  ? 23  PHE A O   1 
ATOM   167   C  CB  . PHE A 1 23  ? -10.059 40.105  78.116  1.00 14.09  ? 23  PHE A CB  1 
ATOM   168   C  CG  . PHE A 1 23  ? -11.548 40.371  78.032  1.00 19.04  ? 23  PHE A CG  1 
ATOM   169   C  CD1 . PHE A 1 23  ? -12.280 40.685  79.175  1.00 16.59  ? 23  PHE A CD1 1 
ATOM   170   C  CD2 . PHE A 1 23  ? -12.205 40.355  76.805  1.00 15.54  ? 23  PHE A CD2 1 
ATOM   171   C  CE1 . PHE A 1 23  ? -13.638 40.983  79.094  1.00 19.04  ? 23  PHE A CE1 1 
ATOM   172   C  CE2 . PHE A 1 23  ? -13.565 40.652  76.716  1.00 15.71  ? 23  PHE A CE2 1 
ATOM   173   C  CZ  . PHE A 1 23  ? -14.281 40.967  77.863  1.00 14.48  ? 23  PHE A CZ  1 
ATOM   174   N  N   . GLN A 1 24  ? -7.000  41.214  79.323  1.00 17.21  ? 24  GLN A N   1 
ATOM   175   C  CA  . GLN A 1 24  ? -5.571  40.928  79.355  1.00 18.51  ? 24  GLN A CA  1 
ATOM   176   C  C   . GLN A 1 24  ? -5.240  40.112  80.603  1.00 20.75  ? 24  GLN A C   1 
ATOM   177   O  O   . GLN A 1 24  ? -5.654  40.466  81.716  1.00 23.53  ? 24  GLN A O   1 
ATOM   178   C  CB  . GLN A 1 24  ? -4.768  42.211  79.378  1.00 13.81  ? 24  GLN A CB  1 
ATOM   179   C  CG  . GLN A 1 24  ? -3.282  41.970  79.424  1.00 16.56  ? 24  GLN A CG  1 
ATOM   180   C  CD  . GLN A 1 24  ? -2.508  43.236  79.198  1.00 19.22  ? 24  GLN A CD  1 
ATOM   181   O  OE1 . GLN A 1 24  ? -3.077  44.252  78.810  1.00 27.02  ? 24  GLN A OE1 1 
ATOM   182   N  NE2 . GLN A 1 24  ? -1.210  43.197  79.447  1.00 23.83  ? 24  GLN A NE2 1 
ATOM   183   N  N   . ALA A 1 25  ? -4.507  39.017  80.423  1.00 19.73  ? 25  ALA A N   1 
ATOM   184   C  CA  . ALA A 1 25  ? -4.144  38.158  81.543  1.00 17.37  ? 25  ALA A CA  1 
ATOM   185   C  C   . ALA A 1 25  ? -3.216  38.876  82.513  1.00 19.23  ? 25  ALA A C   1 
ATOM   186   O  O   . ALA A 1 25  ? -2.207  39.432  82.096  1.00 22.25  ? 25  ALA A O   1 
ATOM   187   C  CB  . ALA A 1 25  ? -3.477  36.900  81.042  1.00 16.54  ? 25  ALA A CB  1 
ATOM   188   N  N   . THR A 1 26  ? -3.566  38.882  83.797  1.00 19.69  ? 26  THR A N   1 
ATOM   189   C  CA  . THR A 1 26  ? -2.734  39.505  84.830  1.00 18.91  ? 26  THR A CA  1 
ATOM   190   C  C   . THR A 1 26  ? -1.346  38.853  84.785  1.00 20.03  ? 26  THR A C   1 
ATOM   191   O  O   . THR A 1 26  ? -1.213  37.622  84.862  1.00 18.61  ? 26  THR A O   1 
ATOM   192   C  CB  . THR A 1 26  ? -3.354  39.324  86.237  1.00 19.00  ? 26  THR A CB  1 
ATOM   193   O  OG1 . THR A 1 26  ? -4.683  39.868  86.243  1.00 19.70  ? 26  THR A OG1 1 
ATOM   194   C  CG2 . THR A 1 26  ? -2.511  40.032  87.293  1.00 18.95  ? 26  THR A CG2 1 
ATOM   195   N  N   . GLY A 1 27  ? -0.324  39.681  84.588  1.00 21.98  ? 27  GLY A N   1 
ATOM   196   C  CA  . GLY A 1 27  ? 1.039   39.181  84.507  1.00 19.35  ? 27  GLY A CA  1 
ATOM   197   C  C   . GLY A 1 27  ? 1.585   39.192  83.089  1.00 22.16  ? 27  GLY A C   1 
ATOM   198   O  O   . GLY A 1 27  ? 2.802   39.209  82.894  1.00 24.76  ? 27  GLY A O   1 
ATOM   199   N  N   . ALA A 1 28  ? 0.689   39.186  82.102  1.00 21.40  ? 28  ALA A N   1 
ATOM   200   C  CA  . ALA A 1 28  ? 1.068   39.197  80.687  1.00 17.51  ? 28  ALA A CA  1 
ATOM   201   C  C   . ALA A 1 28  ? 1.393   40.623  80.257  1.00 18.01  ? 28  ALA A C   1 
ATOM   202   O  O   . ALA A 1 28  ? 0.762   41.576  80.721  1.00 21.35  ? 28  ALA A O   1 
ATOM   203   C  CB  . ALA A 1 28  ? -0.081  38.638  79.839  1.00 11.18  ? 28  ALA A CB  1 
ATOM   204   N  N   . GLN A 1 29  ? 2.366   40.781  79.369  1.00 17.77  ? 29  GLN A N   1 
ATOM   205   C  CA  . GLN A 1 29  ? 2.722   42.112  78.909  1.00 17.46  ? 29  GLN A CA  1 
ATOM   206   C  C   . GLN A 1 29  ? 1.955   42.577  77.671  1.00 19.67  ? 29  GLN A C   1 
ATOM   207   O  O   . GLN A 1 29  ? 2.236   43.653  77.147  1.00 20.97  ? 29  GLN A O   1 
ATOM   208   C  CB  . GLN A 1 29  ? 4.217   42.210  78.649  1.00 18.32  ? 29  GLN A CB  1 
ATOM   209   C  CG  . GLN A 1 29  ? 5.060   42.105  79.891  1.00 18.69  ? 29  GLN A CG  1 
ATOM   210   C  CD  . GLN A 1 29  ? 6.528   42.272  79.603  1.00 24.50  ? 29  GLN A CD  1 
ATOM   211   O  OE1 . GLN A 1 29  ? 6.966   42.190  78.461  1.00 31.12  ? 29  GLN A OE1 1 
ATOM   212   N  NE2 . GLN A 1 29  ? 7.299   42.493  80.640  1.00 30.17  ? 29  GLN A NE2 1 
ATOM   213   N  N   . SER A 1 30  ? 0.976   41.794  77.222  1.00 19.16  ? 30  SER A N   1 
ATOM   214   C  CA  . SER A 1 30  ? 0.198   42.161  76.047  1.00 17.54  ? 30  SER A CA  1 
ATOM   215   C  C   . SER A 1 30  ? -1.119  41.414  76.029  1.00 17.63  ? 30  SER A C   1 
ATOM   216   O  O   . SER A 1 30  ? -1.410  40.636  76.937  1.00 19.25  ? 30  SER A O   1 
ATOM   217   C  CB  . SER A 1 30  ? 0.975   41.797  74.792  1.00 17.85  ? 30  SER A CB  1 
ATOM   218   O  OG  . SER A 1 30  ? 1.114   40.388  74.713  1.00 15.45  ? 30  SER A OG  1 
ATOM   219   N  N   . LYS A 1 31  ? -1.912  41.663  74.994  1.00 14.08  ? 31  LYS A N   1 
ATOM   220   C  CA  . LYS A 1 31  ? -3.190  41.001  74.815  1.00 13.42  ? 31  LYS A CA  1 
ATOM   221   C  C   . LYS A 1 31  ? -3.467  40.877  73.332  1.00 17.63  ? 31  LYS A C   1 
ATOM   222   O  O   . LYS A 1 31  ? -2.882  41.606  72.519  1.00 21.36  ? 31  LYS A O   1 
ATOM   223   C  CB  . LYS A 1 31  ? -4.326  41.758  75.505  1.00 11.86  ? 31  LYS A CB  1 
ATOM   224   C  CG  . LYS A 1 31  ? -4.493  43.200  75.100  1.00 10.14  ? 31  LYS A CG  1 
ATOM   225   C  CD  . LYS A 1 31  ? -5.738  43.779  75.727  1.00 8.62   ? 31  LYS A CD  1 
ATOM   226   C  CE  . LYS A 1 31  ? -5.719  45.294  75.718  1.00 7.83   ? 31  LYS A CE  1 
ATOM   227   N  NZ  . LYS A 1 31  ? -5.814  45.861  74.341  1.00 10.84  ? 31  LYS A NZ  1 
ATOM   228   N  N   . TYR A 1 32  ? -4.281  39.885  72.982  1.00 18.10  ? 32  TYR A N   1 
ATOM   229   C  CA  . TYR A 1 32  ? -4.681  39.638  71.601  1.00 14.60  ? 32  TYR A CA  1 
ATOM   230   C  C   . TYR A 1 32  ? -5.670  40.751  71.283  1.00 17.06  ? 32  TYR A C   1 
ATOM   231   O  O   . TYR A 1 32  ? -6.751  40.827  71.867  1.00 18.57  ? 32  TYR A O   1 
ATOM   232   C  CB  . TYR A 1 32  ? -5.262  38.224  71.477  1.00 17.30  ? 32  TYR A CB  1 
ATOM   233   C  CG  . TYR A 1 32  ? -4.152  37.191  71.525  1.00 16.48  ? 32  TYR A CG  1 
ATOM   234   C  CD1 . TYR A 1 32  ? -3.443  36.864  70.372  1.00 13.89  ? 32  TYR A CD1 1 
ATOM   235   C  CD2 . TYR A 1 32  ? -3.699  36.671  72.741  1.00 16.91  ? 32  TYR A CD2 1 
ATOM   236   C  CE1 . TYR A 1 32  ? -2.308  36.071  70.419  1.00 14.84  ? 32  TYR A CE1 1 
ATOM   237   C  CE2 . TYR A 1 32  ? -2.552  35.870  72.796  1.00 16.93  ? 32  TYR A CE2 1 
ATOM   238   C  CZ  . TYR A 1 32  ? -1.864  35.586  71.627  1.00 16.56  ? 32  TYR A CZ  1 
ATOM   239   O  OH  . TYR A 1 32  ? -0.708  34.857  71.652  1.00 17.52  ? 32  TYR A OH  1 
ATOM   240   N  N   . ARG A 1 33  ? -5.264  41.642  70.386  1.00 14.38  ? 33  ARG A N   1 
ATOM   241   C  CA  . ARG A 1 33  ? -6.042  42.830  70.064  1.00 13.27  ? 33  ARG A CA  1 
ATOM   242   C  C   . ARG A 1 33  ? -7.343  42.853  69.280  1.00 14.41  ? 33  ARG A C   1 
ATOM   243   O  O   . ARG A 1 33  ? -8.160  43.715  69.548  1.00 16.42  ? 33  ARG A O   1 
ATOM   244   C  CB  . ARG A 1 33  ? -5.112  43.893  69.506  1.00 16.23  ? 33  ARG A CB  1 
ATOM   245   C  CG  . ARG A 1 33  ? -4.537  43.558  68.145  1.00 14.60  ? 33  ARG A CG  1 
ATOM   246   C  CD  . ARG A 1 33  ? -4.358  44.836  67.382  1.00 16.19  ? 33  ARG A CD  1 
ATOM   247   N  NE  . ARG A 1 33  ? -2.966  45.184  67.248  1.00 11.78  ? 33  ARG A NE  1 
ATOM   248   C  CZ  . ARG A 1 33  ? -2.491  46.425  67.250  1.00 12.36  ? 33  ARG A CZ  1 
ATOM   249   N  NH1 . ARG A 1 33  ? -3.292  47.472  67.398  1.00 4.04   ? 33  ARG A NH1 1 
ATOM   250   N  NH2 . ARG A 1 33  ? -1.205  46.609  67.012  1.00 13.26  ? 33  ARG A NH2 1 
ATOM   251   N  N   . LEU A 1 34  ? -7.534  41.968  68.304  1.00 15.89  ? 34  LEU A N   1 
ATOM   252   C  CA  . LEU A 1 34  ? -8.766  41.973  67.504  1.00 17.19  ? 34  LEU A CA  1 
ATOM   253   C  C   . LEU A 1 34  ? -9.992  42.015  68.407  1.00 19.93  ? 34  LEU A C   1 
ATOM   254   O  O   . LEU A 1 34  ? -10.185 41.141  69.250  1.00 24.66  ? 34  LEU A O   1 
ATOM   255   C  CB  . LEU A 1 34  ? -8.847  40.732  66.609  1.00 17.89  ? 34  LEU A CB  1 
ATOM   256   C  CG  . LEU A 1 34  ? -9.279  40.804  65.132  1.00 19.60  ? 34  LEU A CG  1 
ATOM   257   C  CD1 . LEU A 1 34  ? -10.292 39.704  64.846  1.00 16.44  ? 34  LEU A CD1 1 
ATOM   258   C  CD2 . LEU A 1 34  ? -9.842  42.154  64.759  1.00 10.60  ? 34  LEU A CD2 1 
ATOM   259   N  N   . GLY A 1 35  ? -10.804 43.049  68.239  1.00 18.73  ? 35  GLY A N   1 
ATOM   260   C  CA  . GLY A 1 35  ? -12.000 43.193  69.044  1.00 19.55  ? 35  GLY A CA  1 
ATOM   261   C  C   . GLY A 1 35  ? -11.679 43.153  70.525  1.00 20.56  ? 35  GLY A C   1 
ATOM   262   O  O   . GLY A 1 35  ? -12.445 42.618  71.327  1.00 21.64  ? 35  GLY A O   1 
ATOM   263   N  N   . ASN A 1 36  ? -10.562 43.762  70.900  1.00 18.88  ? 36  ASN A N   1 
ATOM   264   C  CA  . ASN A 1 36  ? -10.137 43.758  72.282  1.00 15.54  ? 36  ASN A CA  1 
ATOM   265   C  C   . ASN A 1 36  ? -9.301  45.000  72.538  1.00 15.29  ? 36  ASN A C   1 
ATOM   266   O  O   . ASN A 1 36  ? -8.296  44.954  73.255  1.00 17.07  ? 36  ASN A O   1 
ATOM   267   C  CB  . ASN A 1 36  ? -9.330  42.486  72.546  1.00 13.42  ? 36  ASN A CB  1 
ATOM   268   C  CG  . ASN A 1 36  ? -9.191  42.167  74.021  1.00 15.48  ? 36  ASN A CG  1 
ATOM   269   O  OD1 . ASN A 1 36  ? -10.026 42.549  74.842  1.00 13.37  ? 36  ASN A OD1 1 
ATOM   270   N  ND2 . ASN A 1 36  ? -8.144  41.444  74.360  1.00 8.97   ? 36  ASN A ND2 1 
ATOM   271   N  N   . GLU A 1 37  ? -9.685  46.097  71.884  1.00 12.57  ? 37  GLU A N   1 
ATOM   272   C  CA  . GLU A 1 37  ? -9.023  47.389  72.060  1.00 8.41   ? 37  GLU A CA  1 
ATOM   273   C  C   . GLU A 1 37  ? -10.108 48.330  72.549  1.00 10.26  ? 37  GLU A C   1 
ATOM   274   O  O   . GLU A 1 37  ? -11.194 48.384  71.962  1.00 14.74  ? 37  GLU A O   1 
ATOM   275   C  CB  . GLU A 1 37  ? -8.417  47.852  70.750  1.00 9.51   ? 37  GLU A CB  1 
ATOM   276   C  CG  . GLU A 1 37  ? -7.204  47.040  70.406  1.00 10.39  ? 37  GLU A CG  1 
ATOM   277   C  CD  . GLU A 1 37  ? -6.745  47.251  69.011  1.00 14.73  ? 37  GLU A CD  1 
ATOM   278   O  OE1 . GLU A 1 37  ? -7.597  47.206  68.110  1.00 12.26  ? 37  GLU A OE1 1 
ATOM   279   O  OE2 . GLU A 1 37  ? -5.528  47.432  68.806  1.00 15.03  ? 37  GLU A OE2 1 
ATOM   280   N  N   . CYS A 1 38  ? -9.821  49.036  73.643  1.00 14.09  ? 38  CYS A N   1 
ATOM   281   C  CA  . CYS A 1 38  ? -10.781 49.922  74.300  1.00 15.75  ? 38  CYS A CA  1 
ATOM   282   C  C   . CYS A 1 38  ? -10.498 51.430  74.326  1.00 17.38  ? 38  CYS A C   1 
ATOM   283   O  O   . CYS A 1 38  ? -10.964 52.139  75.215  1.00 21.79  ? 38  CYS A O   1 
ATOM   284   C  CB  . CYS A 1 38  ? -10.980 49.431  75.733  1.00 13.18  ? 38  CYS A CB  1 
ATOM   285   S  SG  . CYS A 1 38  ? -11.825 47.833  75.902  1.00 13.67  ? 38  CYS A SG  1 
ATOM   286   N  N   . GLU A 1 39  ? -9.741  51.934  73.367  1.00 16.47  ? 39  GLU A N   1 
ATOM   287   C  CA  . GLU A 1 39  ? -9.469  53.363  73.335  1.00 14.81  ? 39  GLU A CA  1 
ATOM   288   C  C   . GLU A 1 39  ? -9.300  53.828  71.903  1.00 16.85  ? 39  GLU A C   1 
ATOM   289   O  O   . GLU A 1 39  ? -9.169  53.014  70.984  1.00 17.30  ? 39  GLU A O   1 
ATOM   290   C  CB  . GLU A 1 39  ? -8.184  53.688  74.107  1.00 12.82  ? 39  GLU A CB  1 
ATOM   291   C  CG  . GLU A 1 39  ? -6.895  53.121  73.502  1.00 11.47  ? 39  GLU A CG  1 
ATOM   292   C  CD  . GLU A 1 39  ? -6.731  51.623  73.717  1.00 23.73  ? 39  GLU A CD  1 
ATOM   293   O  OE1 . GLU A 1 39  ? -6.857  51.171  74.880  1.00 27.54  ? 39  GLU A OE1 1 
ATOM   294   O  OE2 . GLU A 1 39  ? -6.455  50.894  72.734  1.00 24.08  ? 39  GLU A OE2 1 
ATOM   295   N  N   . THR A 1 40  ? -9.347  55.137  71.722  1.00 13.58  ? 40  THR A N   1 
ATOM   296   C  CA  . THR A 1 40  ? -9.113  55.737  70.432  1.00 11.47  ? 40  THR A CA  1 
ATOM   297   C  C   . THR A 1 40  ? -7.652  56.180  70.561  1.00 14.59  ? 40  THR A C   1 
ATOM   298   O  O   . THR A 1 40  ? -7.302  56.900  71.500  1.00 17.59  ? 40  THR A O   1 
ATOM   299   C  CB  . THR A 1 40  ? -10.028 56.965  70.206  1.00 12.27  ? 40  THR A CB  1 
ATOM   300   O  OG1 . THR A 1 40  ? -11.357 56.523  69.916  1.00 15.21  ? 40  THR A OG1 1 
ATOM   301   C  CG2 . THR A 1 40  ? -9.533  57.825  69.058  1.00 10.93  ? 40  THR A CG2 1 
ATOM   302   N  N   . TYR A 1 41  ? -6.783  55.659  69.703  1.00 11.99  ? 41  TYR A N   1 
ATOM   303   C  CA  . TYR A 1 41  ? -5.376  56.046  69.724  1.00 10.53  ? 41  TYR A CA  1 
ATOM   304   C  C   . TYR A 1 41  ? -5.035  56.545  68.324  1.00 14.34  ? 41  TYR A C   1 
ATOM   305   O  O   . TYR A 1 41  ? -5.436  55.921  67.343  1.00 18.42  ? 41  TYR A O   1 
ATOM   306   C  CB  . TYR A 1 41  ? -4.475  54.857  70.059  1.00 8.51   ? 41  TYR A CB  1 
ATOM   307   C  CG  . TYR A 1 41  ? -3.017  55.235  70.083  1.00 10.59  ? 41  TYR A CG  1 
ATOM   308   C  CD1 . TYR A 1 41  ? -2.478  55.926  71.162  1.00 11.16  ? 41  TYR A CD1 1 
ATOM   309   C  CD2 . TYR A 1 41  ? -2.193  54.962  69.014  1.00 8.78   ? 41  TYR A CD2 1 
ATOM   310   C  CE1 . TYR A 1 41  ? -1.159  56.333  71.170  1.00 9.17   ? 41  TYR A CE1 1 
ATOM   311   C  CE2 . TYR A 1 41  ? -0.871  55.372  69.008  1.00 8.70   ? 41  TYR A CE2 1 
ATOM   312   C  CZ  . TYR A 1 41  ? -0.370  56.050  70.091  1.00 10.37  ? 41  TYR A CZ  1 
ATOM   313   O  OH  . TYR A 1 41  ? 0.943   56.407  70.125  1.00 14.21  ? 41  TYR A OH  1 
ATOM   314   N  N   . ALA A 1 42  ? -4.277  57.636  68.222  1.00 12.61  ? 42  ALA A N   1 
ATOM   315   C  CA  . ALA A 1 42  ? -3.927  58.181  66.925  1.00 9.53   ? 42  ALA A CA  1 
ATOM   316   C  C   . ALA A 1 42  ? -2.591  58.893  66.939  1.00 10.78  ? 42  ALA A C   1 
ATOM   317   O  O   . ALA A 1 42  ? -2.269  59.593  67.886  1.00 16.38  ? 42  ALA A O   1 
ATOM   318   C  CB  . ALA A 1 42  ? -5.013  59.138  66.457  1.00 4.79   ? 42  ALA A CB  1 
ATOM   319   N  N   . GLU A 1 43  ? -1.808  58.689  65.889  1.00 11.98  ? 43  GLU A N   1 
ATOM   320   C  CA  . GLU A 1 43  ? -0.523  59.345  65.732  1.00 11.13  ? 43  GLU A CA  1 
ATOM   321   C  C   . GLU A 1 43  ? -0.604  60.116  64.418  1.00 12.23  ? 43  GLU A C   1 
ATOM   322   O  O   . GLU A 1 43  ? -0.853  59.518  63.366  1.00 13.66  ? 43  GLU A O   1 
ATOM   323   C  CB  . GLU A 1 43  ? 0.606   58.326  65.642  1.00 10.07  ? 43  GLU A CB  1 
ATOM   324   C  CG  . GLU A 1 43  ? 0.907   57.605  66.948  1.00 19.14  ? 43  GLU A CG  1 
ATOM   325   C  CD  . GLU A 1 43  ? 2.032   56.593  66.830  1.00 18.99  ? 43  GLU A CD  1 
ATOM   326   O  OE1 . GLU A 1 43  ? 2.581   56.412  65.728  1.00 22.88  ? 43  GLU A OE1 1 
ATOM   327   O  OE2 . GLU A 1 43  ? 2.363   55.963  67.844  1.00 27.48  ? 43  GLU A OE2 1 
ATOM   328   N  N   . LEU A 1 44  ? -0.455  61.436  64.488  1.00 10.05  ? 44  LEU A N   1 
ATOM   329   C  CA  . LEU A 1 44  ? -0.489  62.273  63.299  1.00 9.18   ? 44  LEU A CA  1 
ATOM   330   C  C   . LEU A 1 44  ? 0.926   62.723  62.975  1.00 9.92   ? 44  LEU A C   1 
ATOM   331   O  O   . LEU A 1 44  ? 1.524   63.472  63.738  1.00 12.61  ? 44  LEU A O   1 
ATOM   332   C  CB  . LEU A 1 44  ? -1.384  63.498  63.521  1.00 6.74   ? 44  LEU A CB  1 
ATOM   333   C  CG  . LEU A 1 44  ? -2.821  63.204  63.996  1.00 9.50   ? 44  LEU A CG  1 
ATOM   334   C  CD1 . LEU A 1 44  ? -3.659  64.434  63.800  1.00 12.29  ? 44  LEU A CD1 1 
ATOM   335   C  CD2 . LEU A 1 44  ? -3.443  62.048  63.245  1.00 6.93   ? 44  LEU A CD2 1 
ATOM   336   N  N   . LYS A 1 45  ? 1.470   62.241  61.865  1.00 10.10  ? 45  LYS A N   1 
ATOM   337   C  CA  . LYS A 1 45  ? 2.822   62.605  61.447  1.00 9.47   ? 45  LYS A CA  1 
ATOM   338   C  C   . LYS A 1 45  ? 2.797   63.549  60.253  1.00 11.15  ? 45  LYS A C   1 
ATOM   339   O  O   . LYS A 1 45  ? 2.059   63.334  59.288  1.00 14.10  ? 45  LYS A O   1 
ATOM   340   C  CB  . LYS A 1 45  ? 3.607   61.359  61.050  1.00 9.64   ? 45  LYS A CB  1 
ATOM   341   C  CG  . LYS A 1 45  ? 3.778   60.346  62.157  1.00 10.33  ? 45  LYS A CG  1 
ATOM   342   C  CD  . LYS A 1 45  ? 4.433   59.061  61.662  1.00 9.25   ? 45  LYS A CD  1 
ATOM   343   C  CE  . LYS A 1 45  ? 5.798   59.313  61.060  1.00 10.20  ? 45  LYS A CE  1 
ATOM   344   N  NZ  . LYS A 1 45  ? 6.700   59.952  62.034  1.00 17.00  ? 45  LYS A NZ  1 
ATOM   345   N  N   . LEU A 1 46  ? 3.589   64.606  60.329  1.00 11.70  ? 46  LEU A N   1 
ATOM   346   C  CA  . LEU A 1 46  ? 3.703   65.577  59.258  1.00 10.61  ? 46  LEU A CA  1 
ATOM   347   C  C   . LEU A 1 46  ? 5.196   65.699  59.039  1.00 11.91  ? 46  LEU A C   1 
ATOM   348   O  O   . LEU A 1 46  ? 5.922   66.101  59.933  1.00 14.94  ? 46  LEU A O   1 
ATOM   349   C  CB  . LEU A 1 46  ? 3.119   66.931  59.662  1.00 8.19   ? 46  LEU A CB  1 
ATOM   350   C  CG  . LEU A 1 46  ? 1.596   67.036  59.795  1.00 11.74  ? 46  LEU A CG  1 
ATOM   351   C  CD1 . LEU A 1 46  ? 1.251   68.412  60.286  1.00 9.83   ? 46  LEU A CD1 1 
ATOM   352   C  CD2 . LEU A 1 46  ? 0.896   66.779  58.482  1.00 9.48   ? 46  LEU A CD2 1 
ATOM   353   N  N   . GLY A 1 47  ? 5.664   65.279  57.875  1.00 12.92  ? 47  GLY A N   1 
ATOM   354   C  CA  . GLY A 1 47  ? 7.081   65.345  57.588  1.00 13.80  ? 47  GLY A CA  1 
ATOM   355   C  C   . GLY A 1 47  ? 7.309   65.931  56.215  1.00 16.66  ? 47  GLY A C   1 
ATOM   356   O  O   . GLY A 1 47  ? 6.349   66.197  55.477  1.00 16.10  ? 47  GLY A O   1 
ATOM   357   N  N   . GLN A 1 48  ? 8.570   66.068  55.827  1.00 16.57  ? 48  GLN A N   1 
ATOM   358   C  CA  . GLN A 1 48  ? 8.872   66.648  54.533  1.00 15.93  ? 48  GLN A CA  1 
ATOM   359   C  C   . GLN A 1 48  ? 10.330  66.493  54.136  1.00 17.04  ? 48  GLN A C   1 
ATOM   360   O  O   . GLN A 1 48  ? 11.214  66.513  54.995  1.00 19.49  ? 48  GLN A O   1 
ATOM   361   C  CB  . GLN A 1 48  ? 8.517   68.136  54.590  1.00 16.46  ? 48  GLN A CB  1 
ATOM   362   C  CG  . GLN A 1 48  ? 8.436   68.811  53.260  1.00 25.78  ? 48  GLN A CG  1 
ATOM   363   C  CD  . GLN A 1 48  ? 7.767   70.156  53.362  1.00 33.90  ? 48  GLN A CD  1 
ATOM   364   O  OE1 . GLN A 1 48  ? 6.543   70.278  53.207  1.00 39.50  ? 48  GLN A OE1 1 
ATOM   365   N  NE2 . GLN A 1 48  ? 8.557   71.181  53.635  1.00 41.86  ? 48  GLN A NE2 1 
ATOM   366   N  N   . GLU A 1 49  ? 10.591  66.264  52.852  1.00 17.39  ? 49  GLU A N   1 
ATOM   367   C  CA  . GLU A 1 49  ? 11.977  66.192  52.403  1.00 18.67  ? 49  GLU A CA  1 
ATOM   368   C  C   . GLU A 1 49  ? 12.271  67.652  52.184  1.00 19.03  ? 49  GLU A C   1 
ATOM   369   O  O   . GLU A 1 49  ? 11.798  68.226  51.226  1.00 23.69  ? 49  GLU A O   1 
ATOM   370   C  CB  . GLU A 1 49  ? 12.088  65.454  51.095  1.00 17.57  ? 49  GLU A CB  1 
ATOM   371   C  CG  . GLU A 1 49  ? 13.516  65.211  50.680  1.00 30.84  ? 49  GLU A CG  1 
ATOM   372   C  CD  . GLU A 1 49  ? 13.594  64.326  49.468  1.00 35.87  ? 49  GLU A CD  1 
ATOM   373   O  OE1 . GLU A 1 49  ? 13.157  64.778  48.387  1.00 42.13  ? 49  GLU A OE1 1 
ATOM   374   O  OE2 . GLU A 1 49  ? 14.072  63.178  49.598  1.00 42.02  ? 49  GLU A OE2 1 
ATOM   375   N  N   . VAL A 1 50  ? 13.006  68.270  53.093  1.00 19.76  ? 50  VAL A N   1 
ATOM   376   C  CA  . VAL A 1 50  ? 13.257  69.707  52.993  1.00 18.26  ? 50  VAL A CA  1 
ATOM   377   C  C   . VAL A 1 50  ? 14.384  70.183  52.089  1.00 20.92  ? 50  VAL A C   1 
ATOM   378   O  O   . VAL A 1 50  ? 14.470  71.366  51.774  1.00 26.37  ? 50  VAL A O   1 
ATOM   379   C  CB  . VAL A 1 50  ? 13.418  70.334  54.393  1.00 13.26  ? 50  VAL A CB  1 
ATOM   380   C  CG1 . VAL A 1 50  ? 12.094  70.262  55.139  1.00 13.30  ? 50  VAL A CG1 1 
ATOM   381   C  CG2 . VAL A 1 50  ? 14.501  69.592  55.169  1.00 13.76  ? 50  VAL A CG2 1 
ATOM   382   N  N   . TRP A 1 51  ? 15.237  69.273  51.645  1.00 21.32  ? 51  TRP A N   1 
ATOM   383   C  CA  . TRP A 1 51  ? 16.338  69.670  50.793  1.00 16.82  ? 51  TRP A CA  1 
ATOM   384   C  C   . TRP A 1 51  ? 16.836  68.441  50.092  1.00 18.25  ? 51  TRP A C   1 
ATOM   385   O  O   . TRP A 1 51  ? 16.865  67.340  50.668  1.00 15.96  ? 51  TRP A O   1 
ATOM   386   C  CB  . TRP A 1 51  ? 17.450  70.275  51.647  1.00 16.74  ? 51  TRP A CB  1 
ATOM   387   C  CG  . TRP A 1 51  ? 18.671  70.752  50.907  1.00 17.45  ? 51  TRP A CG  1 
ATOM   388   C  CD1 . TRP A 1 51  ? 18.903  72.019  50.451  1.00 17.86  ? 51  TRP A CD1 1 
ATOM   389   C  CD2 . TRP A 1 51  ? 19.880  70.012  50.659  1.00 14.38  ? 51  TRP A CD2 1 
ATOM   390   N  NE1 . TRP A 1 51  ? 20.183  72.118  49.954  1.00 15.47  ? 51  TRP A NE1 1 
ATOM   391   C  CE2 . TRP A 1 51  ? 20.802  70.902  50.071  1.00 11.21  ? 51  TRP A CE2 1 
ATOM   392   C  CE3 . TRP A 1 51  ? 20.275  68.692  50.891  1.00 18.85  ? 51  TRP A CE3 1 
ATOM   393   C  CZ2 . TRP A 1 51  ? 22.089  70.517  49.715  1.00 13.81  ? 51  TRP A CZ2 1 
ATOM   394   C  CZ3 . TRP A 1 51  ? 21.566  68.306  50.536  1.00 19.71  ? 51  TRP A CZ3 1 
ATOM   395   C  CH2 . TRP A 1 51  ? 22.454  69.219  49.955  1.00 16.69  ? 51  TRP A CH2 1 
ATOM   396   N  N   . LYS A 1 52  ? 17.201  68.627  48.834  1.00 20.32  ? 52  LYS A N   1 
ATOM   397   C  CA  . LYS A 1 52  ? 17.725  67.539  48.035  1.00 25.34  ? 52  LYS A CA  1 
ATOM   398   C  C   . LYS A 1 52  ? 18.636  68.111  46.970  1.00 25.31  ? 52  LYS A C   1 
ATOM   399   O  O   . LYS A 1 52  ? 18.315  69.103  46.330  1.00 28.48  ? 52  LYS A O   1 
ATOM   400   C  CB  . LYS A 1 52  ? 16.597  66.746  47.389  1.00 27.48  ? 52  LYS A CB  1 
ATOM   401   C  CG  . LYS A 1 52  ? 17.089  65.503  46.679  1.00 37.56  ? 52  LYS A CG  1 
ATOM   402   C  CD  . LYS A 1 52  ? 15.940  64.643  46.190  1.00 47.90  ? 52  LYS A CD  1 
ATOM   403   C  CE  . LYS A 1 52  ? 16.459  63.314  45.656  1.00 59.19  ? 52  LYS A CE  1 
ATOM   404   N  NZ  . LYS A 1 52  ? 17.274  62.550  46.663  1.00 62.75  ? 52  LYS A NZ  1 
ATOM   405   N  N   . GLU A 1 53  ? 19.801  67.510  46.824  1.00 27.98  ? 53  GLU A N   1 
ATOM   406   C  CA  . GLU A 1 53  ? 20.756  67.951  45.836  1.00 34.69  ? 53  GLU A CA  1 
ATOM   407   C  C   . GLU A 1 53  ? 21.569  66.722  45.461  1.00 36.22  ? 53  GLU A C   1 
ATOM   408   O  O   . GLU A 1 53  ? 22.477  66.308  46.186  1.00 40.64  ? 53  GLU A O   1 
ATOM   409   C  CB  . GLU A 1 53  ? 21.634  69.050  46.420  1.00 39.97  ? 53  GLU A CB  1 
ATOM   410   C  CG  . GLU A 1 53  ? 22.421  69.841  45.393  1.00 57.37  ? 53  GLU A CG  1 
ATOM   411   C  CD  . GLU A 1 53  ? 23.007  71.128  45.972  1.00 69.06  ? 53  GLU A CD  1 
ATOM   412   O  OE1 . GLU A 1 53  ? 22.281  72.154  46.006  1.00 73.72  ? 53  GLU A OE1 1 
ATOM   413   O  OE2 . GLU A 1 53  ? 24.189  71.109  46.397  1.00 74.33  ? 53  GLU A OE2 1 
ATOM   414   N  N   . GLY A 1 54  ? 21.173  66.094  44.359  1.00 38.07  ? 54  GLY A N   1 
ATOM   415   C  CA  . GLY A 1 54  ? 21.853  64.904  43.896  1.00 38.03  ? 54  GLY A CA  1 
ATOM   416   C  C   . GLY A 1 54  ? 21.337  63.707  44.656  1.00 39.65  ? 54  GLY A C   1 
ATOM   417   O  O   . GLY A 1 54  ? 20.136  63.441  44.659  1.00 38.83  ? 54  GLY A O   1 
ATOM   418   N  N   . ASP A 1 55  ? 22.249  62.986  45.299  1.00 42.76  ? 55  ASP A N   1 
ATOM   419   C  CA  . ASP A 1 55  ? 21.888  61.816  46.089  1.00 44.91  ? 55  ASP A CA  1 
ATOM   420   C  C   . ASP A 1 55  ? 21.698  62.202  47.547  1.00 38.50  ? 55  ASP A C   1 
ATOM   421   O  O   . ASP A 1 55  ? 21.203  61.401  48.339  1.00 38.53  ? 55  ASP A O   1 
ATOM   422   C  CB  . ASP A 1 55  ? 22.981  60.750  45.996  1.00 59.60  ? 55  ASP A CB  1 
ATOM   423   C  CG  . ASP A 1 55  ? 23.188  60.245  44.582  1.00 74.89  ? 55  ASP A CG  1 
ATOM   424   O  OD1 . ASP A 1 55  ? 22.254  59.614  44.022  1.00 79.69  ? 55  ASP A OD1 1 
ATOM   425   O  OD2 . ASP A 1 55  ? 24.291  60.479  44.033  1.00 85.98  ? 55  ASP A OD2 1 
ATOM   426   N  N   . LYS A 1 56  ? 22.106  63.421  47.892  1.00 29.59  ? 56  LYS A N   1 
ATOM   427   C  CA  . LYS A 1 56  ? 22.009  63.933  49.249  1.00 24.93  ? 56  LYS A CA  1 
ATOM   428   C  C   . LYS A 1 56  ? 20.656  64.553  49.531  1.00 22.54  ? 56  LYS A C   1 
ATOM   429   O  O   . LYS A 1 56  ? 20.072  65.176  48.660  1.00 23.64  ? 56  LYS A O   1 
ATOM   430   C  CB  . LYS A 1 56  ? 23.086  64.978  49.461  1.00 25.49  ? 56  LYS A CB  1 
ATOM   431   C  CG  . LYS A 1 56  ? 24.452  64.476  49.109  1.00 27.65  ? 56  LYS A CG  1 
ATOM   432   C  CD  . LYS A 1 56  ? 25.453  65.596  49.100  1.00 32.83  ? 56  LYS A CD  1 
ATOM   433   C  CE  . LYS A 1 56  ? 26.738  65.174  48.401  1.00 40.54  ? 56  LYS A CE  1 
ATOM   434   N  NZ  . LYS A 1 56  ? 27.376  63.967  49.006  1.00 47.73  ? 56  LYS A NZ  1 
ATOM   435   N  N   . SER A 1 57  ? 20.154  64.366  50.743  1.00 20.03  ? 57  SER A N   1 
ATOM   436   C  CA  . SER A 1 57  ? 18.877  64.944  51.129  1.00 17.65  ? 57  SER A CA  1 
ATOM   437   C  C   . SER A 1 57  ? 18.743  65.036  52.634  1.00 15.76  ? 57  SER A C   1 
ATOM   438   O  O   . SER A 1 57  ? 19.486  64.398  53.382  1.00 13.93  ? 57  SER A O   1 
ATOM   439   C  CB  . SER A 1 57  ? 17.715  64.120  50.582  1.00 16.52  ? 57  SER A CB  1 
ATOM   440   O  OG  . SER A 1 57  ? 17.697  62.848  51.190  1.00 20.44  ? 57  SER A OG  1 
ATOM   441   N  N   . PHE A 1 58  ? 17.782  65.838  53.062  1.00 16.03  ? 58  PHE A N   1 
ATOM   442   C  CA  . PHE A 1 58  ? 17.484  66.036  54.463  1.00 11.72  ? 58  PHE A CA  1 
ATOM   443   C  C   . PHE A 1 58  ? 15.987  65.834  54.604  1.00 13.26  ? 58  PHE A C   1 
ATOM   444   O  O   . PHE A 1 58  ? 15.198  66.475  53.902  1.00 13.23  ? 58  PHE A O   1 
ATOM   445   C  CB  . PHE A 1 58  ? 17.827  67.457  54.886  1.00 11.85  ? 58  PHE A CB  1 
ATOM   446   C  CG  . PHE A 1 58  ? 19.292  67.688  55.147  1.00 14.65  ? 58  PHE A CG  1 
ATOM   447   C  CD1 . PHE A 1 58  ? 19.839  67.434  56.405  1.00 17.34  ? 58  PHE A CD1 1 
ATOM   448   C  CD2 . PHE A 1 58  ? 20.118  68.222  54.166  1.00 17.49  ? 58  PHE A CD2 1 
ATOM   449   C  CE1 . PHE A 1 58  ? 21.185  67.716  56.673  1.00 13.47  ? 58  PHE A CE1 1 
ATOM   450   C  CE2 . PHE A 1 58  ? 21.462  68.506  54.426  1.00 16.50  ? 58  PHE A CE2 1 
ATOM   451   C  CZ  . PHE A 1 58  ? 21.993  68.254  55.676  1.00 16.06  ? 58  PHE A CZ  1 
ATOM   452   N  N   . TYR A 1 59  ? 15.591  64.903  55.460  1.00 11.69  ? 59  TYR A N   1 
ATOM   453   C  CA  . TYR A 1 59  ? 14.182  64.666  55.684  1.00 10.07  ? 59  TYR A CA  1 
ATOM   454   C  C   . TYR A 1 59  ? 13.846  65.057  57.113  1.00 13.23  ? 59  TYR A C   1 
ATOM   455   O  O   . TYR A 1 59  ? 14.543  64.667  58.038  1.00 16.76  ? 59  TYR A O   1 
ATOM   456   C  CB  . TYR A 1 59  ? 13.833  63.205  55.470  1.00 8.11   ? 59  TYR A CB  1 
ATOM   457   C  CG  . TYR A 1 59  ? 12.347  62.988  55.420  1.00 14.25  ? 59  TYR A CG  1 
ATOM   458   C  CD1 . TYR A 1 59  ? 11.644  63.166  54.237  1.00 14.66  ? 59  TYR A CD1 1 
ATOM   459   C  CD2 . TYR A 1 59  ? 11.635  62.650  56.562  1.00 14.59  ? 59  TYR A CD2 1 
ATOM   460   C  CE1 . TYR A 1 59  ? 10.264  63.015  54.187  1.00 16.57  ? 59  TYR A CE1 1 
ATOM   461   C  CE2 . TYR A 1 59  ? 10.249  62.500  56.529  1.00 17.25  ? 59  TYR A CE2 1 
ATOM   462   C  CZ  . TYR A 1 59  ? 9.569   62.687  55.339  1.00 18.10  ? 59  TYR A CZ  1 
ATOM   463   O  OH  . TYR A 1 59  ? 8.195   62.568  55.296  1.00 20.80  ? 59  TYR A OH  1 
ATOM   464   N  N   . PHE A 1 60  ? 12.758  65.792  57.290  1.00 13.10  ? 60  PHE A N   1 
ATOM   465   C  CA  . PHE A 1 60  ? 12.315  66.245  58.601  1.00 9.88   ? 60  PHE A CA  1 
ATOM   466   C  C   . PHE A 1 60  ? 11.027  65.509  58.938  1.00 11.80  ? 60  PHE A C   1 
ATOM   467   O  O   . PHE A 1 60  ? 10.108  65.519  58.131  1.00 13.97  ? 60  PHE A O   1 
ATOM   468   C  CB  . PHE A 1 60  ? 12.057  67.747  58.539  1.00 7.93   ? 60  PHE A CB  1 
ATOM   469   C  CG  . PHE A 1 60  ? 11.353  68.280  59.732  1.00 13.59  ? 60  PHE A CG  1 
ATOM   470   C  CD1 . PHE A 1 60  ? 11.898  68.133  61.001  1.00 12.80  ? 60  PHE A CD1 1 
ATOM   471   C  CD2 . PHE A 1 60  ? 10.137  68.921  59.598  1.00 12.59  ? 60  PHE A CD2 1 
ATOM   472   C  CE1 . PHE A 1 60  ? 11.236  68.620  62.125  1.00 10.56  ? 60  PHE A CE1 1 
ATOM   473   C  CE2 . PHE A 1 60  ? 9.471   69.407  60.721  1.00 12.30  ? 60  PHE A CE2 1 
ATOM   474   C  CZ  . PHE A 1 60  ? 10.024  69.255  61.983  1.00 12.98  ? 60  PHE A CZ  1 
ATOM   475   N  N   . ASP A 1 61  ? 10.929  64.913  60.127  1.00 9.83   ? 61  ASP A N   1 
ATOM   476   C  CA  . ASP A 1 61  ? 9.724   64.162  60.485  1.00 7.32   ? 61  ASP A CA  1 
ATOM   477   C  C   . ASP A 1 61  ? 9.253   64.480  61.895  1.00 10.19  ? 61  ASP A C   1 
ATOM   478   O  O   . ASP A 1 61  ? 10.068  64.769  62.758  1.00 10.52  ? 61  ASP A O   1 
ATOM   479   C  CB  . ASP A 1 61  ? 10.030  62.679  60.385  1.00 8.49   ? 61  ASP A CB  1 
ATOM   480   C  CG  . ASP A 1 61  ? 8.781   61.815  60.302  1.00 14.97  ? 61  ASP A CG  1 
ATOM   481   O  OD1 . ASP A 1 61  ? 7.688   62.315  59.973  1.00 15.99  ? 61  ASP A OD1 1 
ATOM   482   O  OD2 . ASP A 1 61  ? 8.904   60.600  60.543  1.00 16.26  ? 61  ASP A OD2 1 
ATOM   483   N  N   . THR A 1 62  ? 7.942   64.471  62.115  1.00 8.53   ? 62  THR A N   1 
ATOM   484   C  CA  . THR A 1 62  ? 7.371   64.741  63.425  1.00 8.45   ? 62  THR A CA  1 
ATOM   485   C  C   . THR A 1 62  ? 6.295   63.701  63.745  1.00 11.40  ? 62  THR A C   1 
ATOM   486   O  O   . THR A 1 62  ? 5.900   62.927  62.876  1.00 13.96  ? 62  THR A O   1 
ATOM   487   C  CB  . THR A 1 62  ? 6.692   66.121  63.490  1.00 7.65   ? 62  THR A CB  1 
ATOM   488   O  OG1 . THR A 1 62  ? 5.519   66.105  62.675  1.00 9.26   ? 62  THR A OG1 1 
ATOM   489   C  CG2 . THR A 1 62  ? 7.607   67.211  63.024  1.00 5.47   ? 62  THR A CG2 1 
ATOM   490   N  N   . ASN A 1 63  ? 5.812   63.698  64.986  1.00 10.77  ? 63  ASN A N   1 
ATOM   491   C  CA  . ASN A 1 63  ? 4.774   62.768  65.406  1.00 7.37   ? 63  ASN A CA  1 
ATOM   492   C  C   . ASN A 1 63  ? 4.134   63.268  66.711  1.00 10.56  ? 63  ASN A C   1 
ATOM   493   O  O   . ASN A 1 63  ? 4.829   63.544  67.685  1.00 13.48  ? 63  ASN A O   1 
ATOM   494   C  CB  . ASN A 1 63  ? 5.363   61.364  65.605  1.00 7.99   ? 63  ASN A CB  1 
ATOM   495   C  CG  . ASN A 1 63  ? 4.297   60.308  65.845  1.00 7.98   ? 63  ASN A CG  1 
ATOM   496   O  OD1 . ASN A 1 63  ? 3.160   60.636  66.136  1.00 16.04  ? 63  ASN A OD1 1 
ATOM   497   N  ND2 . ASN A 1 63  ? 4.658   59.039  65.704  1.00 6.93   ? 63  ASN A ND2 1 
ATOM   498   N  N   . VAL A 1 64  ? 2.818   63.446  66.696  1.00 11.50  ? 64  VAL A N   1 
ATOM   499   C  CA  . VAL A 1 64  ? 2.064   63.898  67.845  1.00 10.32  ? 64  VAL A CA  1 
ATOM   500   C  C   . VAL A 1 64  ? 1.005   62.819  68.087  1.00 11.95  ? 64  VAL A C   1 
ATOM   501   O  O   . VAL A 1 64  ? 0.188   62.537  67.210  1.00 13.10  ? 64  VAL A O   1 
ATOM   502   C  CB  . VAL A 1 64  ? 1.392   65.250  67.565  1.00 10.01  ? 64  VAL A CB  1 
ATOM   503   C  CG1 . VAL A 1 64  ? 0.569   65.672  68.754  1.00 8.89   ? 64  VAL A CG1 1 
ATOM   504   C  CG2 . VAL A 1 64  ? 2.447   66.294  67.284  1.00 7.63   ? 64  VAL A CG2 1 
ATOM   505   N  N   . ALA A 1 65  ? 1.039   62.210  69.269  1.00 9.84   ? 65  ALA A N   1 
ATOM   506   C  CA  . ALA A 1 65  ? 0.125   61.137  69.609  1.00 9.57   ? 65  ALA A CA  1 
ATOM   507   C  C   . ALA A 1 65  ? -0.997  61.532  70.564  1.00 9.98   ? 65  ALA A C   1 
ATOM   508   O  O   . ALA A 1 65  ? -0.809  62.351  71.446  1.00 12.74  ? 65  ALA A O   1 
ATOM   509   C  CB  . ALA A 1 65  ? 0.900   59.986  70.161  1.00 4.73   ? 65  ALA A CB  1 
ATOM   510   N  N   . TYR A 1 66  ? -2.167  60.942  70.364  1.00 11.07  ? 66  TYR A N   1 
ATOM   511   C  CA  . TYR A 1 66  ? -3.337  61.221  71.179  1.00 11.17  ? 66  TYR A CA  1 
ATOM   512   C  C   . TYR A 1 66  ? -3.961  59.909  71.604  1.00 14.84  ? 66  TYR A C   1 
ATOM   513   O  O   . TYR A 1 66  ? -4.068  58.974  70.807  1.00 16.45  ? 66  TYR A O   1 
ATOM   514   C  CB  . TYR A 1 66  ? -4.397  61.975  70.381  1.00 10.43  ? 66  TYR A CB  1 
ATOM   515   C  CG  . TYR A 1 66  ? -3.947  63.287  69.783  1.00 12.13  ? 66  TYR A CG  1 
ATOM   516   C  CD1 . TYR A 1 66  ? -3.226  63.327  68.582  1.00 12.33  ? 66  TYR A CD1 1 
ATOM   517   C  CD2 . TYR A 1 66  ? -4.230  64.492  70.420  1.00 9.63   ? 66  TYR A CD2 1 
ATOM   518   C  CE1 . TYR A 1 66  ? -2.790  64.538  68.037  1.00 9.25   ? 66  TYR A CE1 1 
ATOM   519   C  CE2 . TYR A 1 66  ? -3.805  65.705  69.883  1.00 11.52  ? 66  TYR A CE2 1 
ATOM   520   C  CZ  . TYR A 1 66  ? -3.080  65.717  68.691  1.00 12.08  ? 66  TYR A CZ  1 
ATOM   521   O  OH  . TYR A 1 66  ? -2.637  66.919  68.182  1.00 12.96  ? 66  TYR A OH  1 
ATOM   522   N  N   . SER A 1 67  ? -4.361  59.843  72.864  1.00 15.38  ? 67  SER A N   1 
ATOM   523   C  CA  . SER A 1 67  ? -5.022  58.670  73.394  1.00 15.37  ? 67  SER A CA  1 
ATOM   524   C  C   . SER A 1 67  ? -6.201  59.180  74.217  1.00 16.60  ? 67  SER A C   1 
ATOM   525   O  O   . SER A 1 67  ? -6.014  59.997  75.120  1.00 21.60  ? 67  SER A O   1 
ATOM   526   C  CB  . SER A 1 67  ? -4.069  57.875  74.274  1.00 14.32  ? 67  SER A CB  1 
ATOM   527   O  OG  . SER A 1 67  ? -4.590  56.583  74.539  1.00 27.09  ? 67  SER A OG  1 
ATOM   528   N  N   . VAL A 1 68  ? -7.416  58.814  73.815  1.00 12.58  ? 68  VAL A N   1 
ATOM   529   C  CA  . VAL A 1 68  ? -8.625  59.212  74.521  1.00 9.56   ? 68  VAL A CA  1 
ATOM   530   C  C   . VAL A 1 68  ? -9.485  57.975  74.727  1.00 13.86  ? 68  VAL A C   1 
ATOM   531   O  O   . VAL A 1 68  ? -9.356  56.983  74.003  1.00 13.53  ? 68  VAL A O   1 
ATOM   532   C  CB  . VAL A 1 68  ? -9.401  60.348  73.821  1.00 11.07  ? 68  VAL A CB  1 
ATOM   533   C  CG1 . VAL A 1 68  ? -8.625  61.644  73.922  1.00 11.82  ? 68  VAL A CG1 1 
ATOM   534   C  CG2 . VAL A 1 68  ? -9.705  60.010  72.378  1.00 10.27  ? 68  VAL A CG2 1 
ATOM   535   N  N   . ASN A 1 69  ? -10.363 58.030  75.720  1.00 16.89  ? 69  ASN A N   1 
ATOM   536   C  CA  . ASN A 1 69  ? -11.183 56.874  76.062  1.00 18.29  ? 69  ASN A CA  1 
ATOM   537   C  C   . ASN A 1 69  ? -12.431 56.621  75.276  1.00 17.90  ? 69  ASN A C   1 
ATOM   538   O  O   . ASN A 1 69  ? -13.164 55.691  75.594  1.00 20.40  ? 69  ASN A O   1 
ATOM   539   C  CB  . ASN A 1 69  ? -11.525 56.874  77.544  1.00 24.74  ? 69  ASN A CB  1 
ATOM   540   C  CG  . ASN A 1 69  ? -10.298 56.774  78.423  1.00 32.47  ? 69  ASN A CG  1 
ATOM   541   O  OD1 . ASN A 1 69  ? -9.503  55.824  78.325  1.00 39.40  ? 69  ASN A OD1 1 
ATOM   542   N  ND2 . ASN A 1 69  ? -10.122 57.769  79.285  1.00 34.97  ? 69  ASN A ND2 1 
ATOM   543   N  N   . GLN A 1 70  ? -12.665 57.418  74.239  1.00 16.14  ? 70  GLN A N   1 
ATOM   544   C  CA  . GLN A 1 70  ? -13.838 57.265  73.392  1.00 14.79  ? 70  GLN A CA  1 
ATOM   545   C  C   . GLN A 1 70  ? -15.104 57.046  74.206  1.00 17.01  ? 70  GLN A C   1 
ATOM   546   O  O   . GLN A 1 70  ? -15.807 56.048  74.037  1.00 18.36  ? 70  GLN A O   1 
ATOM   547   C  CB  . GLN A 1 70  ? -13.627 56.173  72.320  1.00 9.10   ? 70  GLN A CB  1 
ATOM   548   C  CG  . GLN A 1 70  ? -13.209 54.803  72.820  1.00 9.10   ? 70  GLN A CG  1 
ATOM   549   C  CD  . GLN A 1 70  ? -12.882 53.852  71.691  1.00 14.88  ? 70  GLN A CD  1 
ATOM   550   O  OE1 . GLN A 1 70  ? -12.378 54.269  70.648  1.00 18.53  ? 70  GLN A OE1 1 
ATOM   551   N  NE2 . GLN A 1 70  ? -13.154 52.570  71.890  1.00 11.12  ? 70  GLN A NE2 1 
ATOM   552   N  N   . GLN A 1 71  ? -15.370 57.984  75.109  1.00 15.45  ? 71  GLN A N   1 
ATOM   553   C  CA  . GLN A 1 71  ? -16.556 57.942  75.960  1.00 16.62  ? 71  GLN A CA  1 
ATOM   554   C  C   . GLN A 1 71  ? -17.482 59.092  75.612  1.00 15.15  ? 71  GLN A C   1 
ATOM   555   O  O   . GLN A 1 71  ? -18.650 59.097  75.990  1.00 15.79  ? 71  GLN A O   1 
ATOM   556   C  CB  . GLN A 1 71  ? -16.175 58.092  77.431  1.00 19.77  ? 71  GLN A CB  1 
ATOM   557   C  CG  . GLN A 1 71  ? -15.219 57.051  77.945  1.00 29.39  ? 71  GLN A CG  1 
ATOM   558   C  CD  . GLN A 1 71  ? -14.835 57.297  79.392  1.00 34.18  ? 71  GLN A CD  1 
ATOM   559   O  OE1 . GLN A 1 71  ? -14.928 56.398  80.228  1.00 39.94  ? 71  GLN A OE1 1 
ATOM   560   N  NE2 . GLN A 1 71  ? -14.398 58.517  79.695  1.00 31.80  ? 71  GLN A NE2 1 
ATOM   561   N  N   . ASN A 1 72  ? -16.940 60.095  74.936  1.00 15.07  ? 72  ASN A N   1 
ATOM   562   C  CA  . ASN A 1 72  ? -17.718 61.264  74.577  1.00 13.35  ? 72  ASN A CA  1 
ATOM   563   C  C   . ASN A 1 72  ? -17.112 61.924  73.362  1.00 13.88  ? 72  ASN A C   1 
ATOM   564   O  O   . ASN A 1 72  ? -16.060 61.512  72.875  1.00 16.49  ? 72  ASN A O   1 
ATOM   565   C  CB  . ASN A 1 72  ? -17.691 62.277  75.724  1.00 13.81  ? 72  ASN A CB  1 
ATOM   566   C  CG  . ASN A 1 72  ? -18.721 61.996  76.795  1.00 15.26  ? 72  ASN A CG  1 
ATOM   567   O  OD1 . ASN A 1 72  ? -19.922 61.978  76.535  1.00 22.24  ? 72  ASN A OD1 1 
ATOM   568   N  ND2 . ASN A 1 72  ? -18.259 61.829  78.021  1.00 21.29  ? 72  ASN A ND2 1 
ATOM   569   N  N   . ASP A 1 73  ? -17.788 62.962  72.885  1.00 13.36  ? 73  ASP A N   1 
ATOM   570   C  CA  . ASP A 1 73  ? -17.341 63.752  71.748  1.00 12.92  ? 73  ASP A CA  1 
ATOM   571   C  C   . ASP A 1 73  ? -16.136 64.562  72.239  1.00 14.09  ? 73  ASP A C   1 
ATOM   572   O  O   . ASP A 1 73  ? -14.991 64.281  71.885  1.00 16.63  ? 73  ASP A O   1 
ATOM   573   C  CB  . ASP A 1 73  ? -18.512 64.656  71.307  1.00 14.40  ? 73  ASP A CB  1 
ATOM   574   C  CG  . ASP A 1 73  ? -18.098 65.809  70.412  1.00 16.04  ? 73  ASP A CG  1 
ATOM   575   O  OD1 . ASP A 1 73  ? -16.937 65.912  69.983  1.00 16.72  ? 73  ASP A OD1 1 
ATOM   576   O  OD2 . ASP A 1 73  ? -18.972 66.642  70.131  1.00 18.40  ? 73  ASP A OD2 1 
ATOM   577   N  N   . TRP A 1 74  ? -16.390 65.525  73.114  1.00 15.09  ? 74  TRP A N   1 
ATOM   578   C  CA  . TRP A 1 74  ? -15.327 66.375  73.616  1.00 13.21  ? 74  TRP A CA  1 
ATOM   579   C  C   . TRP A 1 74  ? -14.465 65.666  74.648  1.00 14.36  ? 74  TRP A C   1 
ATOM   580   O  O   . TRP A 1 74  ? -14.876 65.491  75.784  1.00 18.93  ? 74  TRP A O   1 
ATOM   581   C  CB  . TRP A 1 74  ? -15.911 67.655  74.211  1.00 12.81  ? 74  TRP A CB  1 
ATOM   582   C  CG  . TRP A 1 74  ? -14.860 68.660  74.592  1.00 17.27  ? 74  TRP A CG  1 
ATOM   583   C  CD1 . TRP A 1 74  ? -14.087 68.652  75.721  1.00 14.26  ? 74  TRP A CD1 1 
ATOM   584   C  CD2 . TRP A 1 74  ? -14.428 69.795  73.821  1.00 18.43  ? 74  TRP A CD2 1 
ATOM   585   N  NE1 . TRP A 1 74  ? -13.198 69.698  75.697  1.00 15.76  ? 74  TRP A NE1 1 
ATOM   586   C  CE2 . TRP A 1 74  ? -13.383 70.421  74.546  1.00 22.26  ? 74  TRP A CE2 1 
ATOM   587   C  CE3 . TRP A 1 74  ? -14.818 70.343  72.593  1.00 21.58  ? 74  TRP A CE3 1 
ATOM   588   C  CZ2 . TRP A 1 74  ? -12.719 71.577  74.077  1.00 22.51  ? 74  TRP A CZ2 1 
ATOM   589   C  CZ3 . TRP A 1 74  ? -14.157 71.495  72.129  1.00 22.29  ? 74  TRP A CZ3 1 
ATOM   590   C  CH2 . TRP A 1 74  ? -13.123 72.094  72.871  1.00 20.51  ? 74  TRP A CH2 1 
ATOM   591   N  N   . GLU A 1 75  ? -13.273 65.250  74.249  1.00 13.06  ? 75  GLU A N   1 
ATOM   592   C  CA  . GLU A 1 75  ? -12.359 64.590  75.160  1.00 11.05  ? 75  GLU A CA  1 
ATOM   593   C  C   . GLU A 1 75  ? -11.003 65.270  75.119  1.00 15.02  ? 75  GLU A C   1 
ATOM   594   O  O   . GLU A 1 75  ? -10.267 65.156  74.145  1.00 17.81  ? 75  GLU A O   1 
ATOM   595   C  CB  . GLU A 1 75  ? -12.208 63.105  74.827  1.00 9.89   ? 75  GLU A CB  1 
ATOM   596   C  CG  . GLU A 1 75  ? -13.474 62.306  75.047  1.00 10.88  ? 75  GLU A CG  1 
ATOM   597   C  CD  . GLU A 1 75  ? -13.297 60.832  74.776  1.00 13.39  ? 75  GLU A CD  1 
ATOM   598   O  OE1 . GLU A 1 75  ? -12.916 60.446  73.648  1.00 20.46  ? 75  GLU A OE1 1 
ATOM   599   O  OE2 . GLU A 1 75  ? -13.551 60.046  75.697  1.00 19.74  ? 75  GLU A OE2 1 
ATOM   600   N  N   . SER A 1 76  ? -10.711 66.028  76.170  1.00 17.40  ? 76  SER A N   1 
ATOM   601   C  CA  . SER A 1 76  ? -9.445  66.733  76.306  1.00 19.12  ? 76  SER A CA  1 
ATOM   602   C  C   . SER A 1 76  ? -8.342  65.744  76.653  1.00 19.39  ? 76  SER A C   1 
ATOM   603   O  O   . SER A 1 76  ? -8.587  64.719  77.293  1.00 23.13  ? 76  SER A O   1 
ATOM   604   C  CB  . SER A 1 76  ? -9.542  67.787  77.405  1.00 20.00  ? 76  SER A CB  1 
ATOM   605   O  OG  . SER A 1 76  ? -10.346 68.877  76.978  1.00 38.37  ? 76  SER A OG  1 
ATOM   606   N  N   . THR A 1 77  ? -7.121  66.060  76.246  1.00 18.02  ? 77  THR A N   1 
ATOM   607   C  CA  . THR A 1 77  ? -6.007  65.185  76.516  1.00 16.64  ? 77  THR A CA  1 
ATOM   608   C  C   . THR A 1 77  ? -4.705  65.958  76.399  1.00 16.61  ? 77  THR A C   1 
ATOM   609   O  O   . THR A 1 77  ? -4.690  67.108  75.975  1.00 18.52  ? 77  THR A O   1 
ATOM   610   C  CB  . THR A 1 77  ? -6.011  63.988  75.535  1.00 19.86  ? 77  THR A CB  1 
ATOM   611   O  OG1 . THR A 1 77  ? -5.021  63.033  75.945  1.00 23.34  ? 77  THR A OG1 1 
ATOM   612   C  CG2 . THR A 1 77  ? -5.720  64.447  74.096  1.00 14.18  ? 77  THR A CG2 1 
ATOM   613   N  N   . ASP A 1 78  ? -3.628  65.340  76.859  1.00 17.71  ? 78  ASP A N   1 
ATOM   614   C  CA  . ASP A 1 78  ? -2.307  65.931  76.778  1.00 22.14  ? 78  ASP A CA  1 
ATOM   615   C  C   . ASP A 1 78  ? -1.619  65.104  75.725  1.00 19.28  ? 78  ASP A C   1 
ATOM   616   O  O   . ASP A 1 78  ? -1.279  63.941  75.959  1.00 22.12  ? 78  ASP A O   1 
ATOM   617   C  CB  . ASP A 1 78  ? -1.532  65.763  78.079  1.00 31.77  ? 78  ASP A CB  1 
ATOM   618   C  CG  . ASP A 1 78  ? -2.225  66.382  79.245  1.00 40.34  ? 78  ASP A CG  1 
ATOM   619   O  OD1 . ASP A 1 78  ? -2.379  67.619  79.244  1.00 43.67  ? 78  ASP A OD1 1 
ATOM   620   O  OD2 . ASP A 1 78  ? -2.616  65.621  80.158  1.00 54.05  ? 78  ASP A OD2 1 
ATOM   621   N  N   . PRO A 1 79  ? -1.486  65.651  74.524  1.00 15.39  ? 79  PRO A N   1 
ATOM   622   C  CA  . PRO A 1 79  ? -0.821  64.878  73.482  1.00 13.22  ? 79  PRO A CA  1 
ATOM   623   C  C   . PRO A 1 79  ? 0.644   64.629  73.821  1.00 13.51  ? 79  PRO A C   1 
ATOM   624   O  O   . PRO A 1 79  ? 1.274   65.420  74.518  1.00 16.63  ? 79  PRO A O   1 
ATOM   625   C  CB  . PRO A 1 79  ? -0.970  65.777  72.251  1.00 14.55  ? 79  PRO A CB  1 
ATOM   626   C  CG  . PRO A 1 79  ? -1.040  67.162  72.830  1.00 13.74  ? 79  PRO A CG  1 
ATOM   627   C  CD  . PRO A 1 79  ? -1.938  66.961  74.024  1.00 13.16  ? 79  PRO A CD  1 
ATOM   628   N  N   . ALA A 1 80  ? 1.167   63.505  73.354  1.00 9.79   ? 80  ALA A N   1 
ATOM   629   C  CA  . ALA A 1 80  ? 2.559   63.179  73.561  1.00 9.22   ? 80  ALA A CA  1 
ATOM   630   C  C   . ALA A 1 80  ? 3.312   63.577  72.280  1.00 12.29  ? 80  ALA A C   1 
ATOM   631   O  O   . ALA A 1 80  ? 2.972   63.141  71.185  1.00 14.01  ? 80  ALA A O   1 
ATOM   632   C  CB  . ALA A 1 80  ? 2.700   61.701  73.807  1.00 8.47   ? 80  ALA A CB  1 
ATOM   633   N  N   . PHE A 1 81  ? 4.301   64.443  72.412  1.00 11.09  ? 81  PHE A N   1 
ATOM   634   C  CA  . PHE A 1 81  ? 5.085   64.857  71.273  1.00 10.76  ? 81  PHE A CA  1 
ATOM   635   C  C   . PHE A 1 81  ? 6.177   63.789  71.206  1.00 13.39  ? 81  PHE A C   1 
ATOM   636   O  O   . PHE A 1 81  ? 7.178   63.881  71.896  1.00 15.70  ? 81  PHE A O   1 
ATOM   637   C  CB  . PHE A 1 81  ? 5.667   66.241  71.534  1.00 10.21  ? 81  PHE A CB  1 
ATOM   638   C  CG  . PHE A 1 81  ? 6.297   66.868  70.332  1.00 14.85  ? 81  PHE A CG  1 
ATOM   639   C  CD1 . PHE A 1 81  ? 5.562   67.081  69.179  1.00 18.36  ? 81  PHE A CD1 1 
ATOM   640   C  CD2 . PHE A 1 81  ? 7.632   67.254  70.346  1.00 18.93  ? 81  PHE A CD2 1 
ATOM   641   C  CE1 . PHE A 1 81  ? 6.145   67.667  68.058  1.00 16.52  ? 81  PHE A CE1 1 
ATOM   642   C  CE2 . PHE A 1 81  ? 8.221   67.843  69.227  1.00 17.70  ? 81  PHE A CE2 1 
ATOM   643   C  CZ  . PHE A 1 81  ? 7.473   68.046  68.086  1.00 16.31  ? 81  PHE A CZ  1 
ATOM   644   N  N   . ARG A 1 82  ? 5.985   62.772  70.375  1.00 12.55  ? 82  ARG A N   1 
ATOM   645   C  CA  . ARG A 1 82  ? 6.943   61.674  70.306  1.00 9.73   ? 82  ARG A CA  1 
ATOM   646   C  C   . ARG A 1 82  ? 8.111   61.726  69.329  1.00 10.16  ? 82  ARG A C   1 
ATOM   647   O  O   . ARG A 1 82  ? 9.138   61.086  69.568  1.00 14.36  ? 82  ARG A O   1 
ATOM   648   C  CB  . ARG A 1 82  ? 6.184   60.355  70.160  1.00 3.83   ? 82  ARG A CB  1 
ATOM   649   C  CG  . ARG A 1 82  ? 5.087   60.239  71.195  1.00 9.14   ? 82  ARG A CG  1 
ATOM   650   C  CD  . ARG A 1 82  ? 4.353   58.941  71.098  1.00 10.85  ? 82  ARG A CD  1 
ATOM   651   N  NE  . ARG A 1 82  ? 5.233   57.827  71.408  1.00 7.24   ? 82  ARG A NE  1 
ATOM   652   C  CZ  . ARG A 1 82  ? 4.869   56.557  71.331  1.00 10.55  ? 82  ARG A CZ  1 
ATOM   653   N  NH1 . ARG A 1 82  ? 3.641   56.238  70.959  1.00 8.58   ? 82  ARG A NH1 1 
ATOM   654   N  NH2 . ARG A 1 82  ? 5.735   55.609  71.616  1.00 11.34  ? 82  ARG A NH2 1 
ATOM   655   N  N   . GLU A 1 83  ? 7.962   62.431  68.218  1.00 11.12  ? 83  GLU A N   1 
ATOM   656   C  CA  . GLU A 1 83  ? 9.039   62.514  67.239  1.00 9.53   ? 83  GLU A CA  1 
ATOM   657   C  C   . GLU A 1 83  ? 9.259   63.913  66.716  1.00 7.75   ? 83  GLU A C   1 
ATOM   658   O  O   . GLU A 1 83  ? 8.316   64.688  66.561  1.00 10.81  ? 83  GLU A O   1 
ATOM   659   C  CB  . GLU A 1 83  ? 8.778   61.597  66.047  1.00 8.49   ? 83  GLU A CB  1 
ATOM   660   C  CG  . GLU A 1 83  ? 8.819   60.152  66.376  1.00 11.44  ? 83  GLU A CG  1 
ATOM   661   C  CD  . GLU A 1 83  ? 8.668   59.288  65.153  1.00 12.40  ? 83  GLU A CD  1 
ATOM   662   O  OE1 . GLU A 1 83  ? 7.527   59.034  64.728  1.00 15.08  ? 83  GLU A OE1 1 
ATOM   663   O  OE2 . GLU A 1 83  ? 9.690   58.836  64.629  1.00 15.25  ? 83  GLU A OE2 1 
ATOM   664   N  N   . ALA A 1 84  ? 10.522  64.207  66.443  1.00 8.38   ? 84  ALA A N   1 
ATOM   665   C  CA  . ALA A 1 84  ? 10.958  65.480  65.900  1.00 9.86   ? 84  ALA A CA  1 
ATOM   666   C  C   . ALA A 1 84  ? 12.442  65.252  65.650  1.00 13.01  ? 84  ALA A C   1 
ATOM   667   O  O   . ALA A 1 84  ? 13.249  65.394  66.558  1.00 17.29  ? 84  ALA A O   1 
ATOM   668   C  CB  . ALA A 1 84  ? 10.745  66.586  66.889  1.00 5.69   ? 84  ALA A CB  1 
ATOM   669   N  N   . ASN A 1 85  ? 12.779  64.820  64.436  1.00 13.70  ? 85  ASN A N   1 
ATOM   670   C  CA  . ASN A 1 85  ? 14.158  64.541  64.056  1.00 13.72  ? 85  ASN A CA  1 
ATOM   671   C  C   . ASN A 1 85  ? 14.435  64.883  62.594  1.00 15.16  ? 85  ASN A C   1 
ATOM   672   O  O   . ASN A 1 85  ? 13.512  65.072  61.798  1.00 16.79  ? 85  ASN A O   1 
ATOM   673   C  CB  . ASN A 1 85  ? 14.468  63.058  64.267  1.00 13.71  ? 85  ASN A CB  1 
ATOM   674   C  CG  . ASN A 1 85  ? 13.650  62.157  63.356  1.00 14.12  ? 85  ASN A CG  1 
ATOM   675   O  OD1 . ASN A 1 85  ? 14.043  61.885  62.244  1.00 19.40  ? 85  ASN A OD1 1 
ATOM   676   N  ND2 . ASN A 1 85  ? 12.504  61.699  63.833  1.00 10.79  ? 85  ASN A ND2 1 
ATOM   677   N  N   . VAL A 1 86  ? 15.717  64.965  62.258  1.00 13.10  ? 86  VAL A N   1 
ATOM   678   C  CA  . VAL A 1 86  ? 16.164  65.253  60.907  1.00 12.56  ? 86  VAL A CA  1 
ATOM   679   C  C   . VAL A 1 86  ? 17.093  64.117  60.537  1.00 12.29  ? 86  VAL A C   1 
ATOM   680   O  O   . VAL A 1 86  ? 17.860  63.639  61.366  1.00 11.75  ? 86  VAL A O   1 
ATOM   681   C  CB  . VAL A 1 86  ? 16.942  66.586  60.814  1.00 11.19  ? 86  VAL A CB  1 
ATOM   682   C  CG1 . VAL A 1 86  ? 17.563  66.743  59.443  1.00 13.23  ? 86  VAL A CG1 1 
ATOM   683   C  CG2 . VAL A 1 86  ? 16.025  67.748  61.066  1.00 6.29   ? 86  VAL A CG2 1 
ATOM   684   N  N   . GLN A 1 87  ? 16.968  63.642  59.307  1.00 13.78  ? 87  GLN A N   1 
ATOM   685   C  CA  . GLN A 1 87  ? 17.798  62.560  58.791  1.00 14.28  ? 87  GLN A CA  1 
ATOM   686   C  C   . GLN A 1 87  ? 18.489  63.072  57.538  1.00 14.17  ? 87  GLN A C   1 
ATOM   687   O  O   . GLN A 1 87  ? 17.826  63.597  56.637  1.00 18.99  ? 87  GLN A O   1 
ATOM   688   C  CB  . GLN A 1 87  ? 16.923  61.353  58.460  1.00 15.77  ? 87  GLN A CB  1 
ATOM   689   C  CG  . GLN A 1 87  ? 16.199  60.781  59.673  1.00 22.56  ? 87  GLN A CG  1 
ATOM   690   C  CD  . GLN A 1 87  ? 14.991  59.940  59.308  1.00 25.77  ? 87  GLN A CD  1 
ATOM   691   O  OE1 . GLN A 1 87  ? 15.035  59.136  58.375  1.00 31.58  ? 87  GLN A OE1 1 
ATOM   692   N  NE2 . GLN A 1 87  ? 13.902  60.118  60.044  1.00 28.98  ? 87  GLN A NE2 1 
ATOM   693   N  N   . GLY A 1 88  ? 19.816  63.022  57.519  1.00 14.02  ? 88  GLY A N   1 
ATOM   694   C  CA  . GLY A 1 88  ? 20.559  63.473  56.360  1.00 14.36  ? 88  GLY A CA  1 
ATOM   695   C  C   . GLY A 1 88  ? 21.092  62.238  55.662  1.00 18.54  ? 88  GLY A C   1 
ATOM   696   O  O   . GLY A 1 88  ? 21.819  61.455  56.286  1.00 17.78  ? 88  GLY A O   1 
ATOM   697   N  N   . LYS A 1 89  ? 20.713  62.022  54.402  1.00 20.40  ? 89  LYS A N   1 
ATOM   698   C  CA  . LYS A 1 89  ? 21.176  60.842  53.671  1.00 22.54  ? 89  LYS A CA  1 
ATOM   699   C  C   . LYS A 1 89  ? 22.348  61.177  52.787  1.00 20.98  ? 89  LYS A C   1 
ATOM   700   O  O   . LYS A 1 89  ? 22.348  62.219  52.143  1.00 19.76  ? 89  LYS A O   1 
ATOM   701   C  CB  . LYS A 1 89  ? 20.075  60.252  52.783  1.00 29.13  ? 89  LYS A CB  1 
ATOM   702   C  CG  . LYS A 1 89  ? 18.820  59.778  53.501  1.00 42.60  ? 89  LYS A CG  1 
ATOM   703   C  CD  . LYS A 1 89  ? 17.854  60.929  53.785  1.00 50.40  ? 89  LYS A CD  1 
ATOM   704   C  CE  . LYS A 1 89  ? 16.565  60.445  54.475  1.00 55.31  ? 89  LYS A CE  1 
ATOM   705   N  NZ  . LYS A 1 89  ? 15.688  59.570  53.630  1.00 59.86  ? 89  LYS A NZ  1 
ATOM   706   N  N   . ASN A 1 90  ? 23.335  60.286  52.758  1.00 22.29  ? 90  ASN A N   1 
ATOM   707   C  CA  . ASN A 1 90  ? 24.523  60.440  51.924  1.00 27.86  ? 90  ASN A CA  1 
ATOM   708   C  C   . ASN A 1 90  ? 25.347  61.693  52.127  1.00 28.06  ? 90  ASN A C   1 
ATOM   709   O  O   . ASN A 1 90  ? 25.871  62.248  51.159  1.00 33.10  ? 90  ASN A O   1 
ATOM   710   C  CB  . ASN A 1 90  ? 24.142  60.372  50.449  1.00 34.32  ? 90  ASN A CB  1 
ATOM   711   C  CG  . ASN A 1 90  ? 23.950  58.972  49.977  1.00 43.38  ? 90  ASN A CG  1 
ATOM   712   O  OD1 . ASN A 1 90  ? 24.899  58.184  49.951  1.00 51.58  ? 90  ASN A OD1 1 
ATOM   713   N  ND2 . ASN A 1 90  ? 22.717  58.632  49.608  1.00 46.83  ? 90  ASN A ND2 1 
ATOM   714   N  N   . LEU A 1 91  ? 25.506  62.126  53.366  1.00 25.39  ? 91  LEU A N   1 
ATOM   715   C  CA  . LEU A 1 91  ? 26.268  63.324  53.622  1.00 24.96  ? 91  LEU A CA  1 
ATOM   716   C  C   . LEU A 1 91  ? 27.723  62.999  53.917  1.00 25.75  ? 91  LEU A C   1 
ATOM   717   O  O   . LEU A 1 91  ? 28.597  63.844  53.750  1.00 28.07  ? 91  LEU A O   1 
ATOM   718   C  CB  . LEU A 1 91  ? 25.642  64.099  54.780  1.00 25.27  ? 91  LEU A CB  1 
ATOM   719   C  CG  . LEU A 1 91  ? 24.157  64.431  54.653  1.00 19.01  ? 91  LEU A CG  1 
ATOM   720   C  CD1 . LEU A 1 91  ? 23.764  65.239  55.851  1.00 21.10  ? 91  LEU A CD1 1 
ATOM   721   C  CD2 . LEU A 1 91  ? 23.862  65.208  53.376  1.00 20.12  ? 91  LEU A CD2 1 
ATOM   722   N  N   . ILE A 1 92  ? 27.977  61.781  54.380  1.00 27.46  ? 92  ILE A N   1 
ATOM   723   C  CA  . ILE A 1 92  ? 29.327  61.350  54.720  1.00 29.86  ? 92  ILE A CA  1 
ATOM   724   C  C   . ILE A 1 92  ? 29.866  60.579  53.531  1.00 34.32  ? 92  ILE A C   1 
ATOM   725   O  O   . ILE A 1 92  ? 29.558  59.392  53.354  1.00 34.16  ? 92  ILE A O   1 
ATOM   726   C  CB  . ILE A 1 92  ? 29.346  60.404  55.949  1.00 29.21  ? 92  ILE A CB  1 
ATOM   727   C  CG1 . ILE A 1 92  ? 28.505  60.969  57.099  1.00 26.66  ? 92  ILE A CG1 1 
ATOM   728   C  CG2 . ILE A 1 92  ? 30.771  60.184  56.407  1.00 26.58  ? 92  ILE A CG2 1 
ATOM   729   C  CD1 . ILE A 1 92  ? 28.961  62.322  57.589  1.00 27.50  ? 92  ILE A CD1 1 
ATOM   730   N  N   . GLU A 1 93  ? 30.678  61.258  52.730  1.00 40.79  ? 93  GLU A N   1 
ATOM   731   C  CA  . GLU A 1 93  ? 31.280  60.678  51.526  1.00 47.96  ? 93  GLU A CA  1 
ATOM   732   C  C   . GLU A 1 93  ? 31.920  59.299  51.713  1.00 44.99  ? 93  GLU A C   1 
ATOM   733   O  O   . GLU A 1 93  ? 31.699  58.393  50.914  1.00 45.69  ? 93  GLU A O   1 
ATOM   734   C  CB  . GLU A 1 93  ? 32.323  61.640  50.932  1.00 58.04  ? 93  GLU A CB  1 
ATOM   735   C  CG  . GLU A 1 93  ? 31.769  62.892  50.236  1.00 74.26  ? 93  GLU A CG  1 
ATOM   736   C  CD  . GLU A 1 93  ? 31.472  64.049  51.185  1.00 84.19  ? 93  GLU A CD  1 
ATOM   737   O  OE1 . GLU A 1 93  ? 32.256  64.278  52.139  1.00 88.76  ? 93  GLU A OE1 1 
ATOM   738   O  OE2 . GLU A 1 93  ? 30.456  64.745  50.959  1.00 88.60  ? 93  GLU A OE2 1 
ATOM   739   N  N   . TRP A 1 94  ? 32.712  59.150  52.770  1.00 43.79  ? 94  TRP A N   1 
ATOM   740   C  CA  . TRP A 1 94  ? 33.390  57.892  53.037  1.00 41.49  ? 94  TRP A CA  1 
ATOM   741   C  C   . TRP A 1 94  ? 32.524  56.796  53.650  1.00 38.94  ? 94  TRP A C   1 
ATOM   742   O  O   . TRP A 1 94  ? 32.995  55.689  53.897  1.00 42.24  ? 94  TRP A O   1 
ATOM   743   C  CB  . TRP A 1 94  ? 34.664  58.119  53.853  1.00 45.47  ? 94  TRP A CB  1 
ATOM   744   C  CG  . TRP A 1 94  ? 34.488  58.983  55.035  1.00 51.06  ? 94  TRP A CG  1 
ATOM   745   C  CD1 . TRP A 1 94  ? 34.379  60.341  55.046  1.00 54.11  ? 94  TRP A CD1 1 
ATOM   746   C  CD2 . TRP A 1 94  ? 34.377  58.555  56.392  1.00 55.89  ? 94  TRP A CD2 1 
ATOM   747   N  NE1 . TRP A 1 94  ? 34.197  60.787  56.330  1.00 59.22  ? 94  TRP A NE1 1 
ATOM   748   C  CE2 . TRP A 1 94  ? 34.191  59.710  57.178  1.00 58.15  ? 94  TRP A CE2 1 
ATOM   749   C  CE3 . TRP A 1 94  ? 34.413  57.303  57.023  1.00 59.41  ? 94  TRP A CE3 1 
ATOM   750   C  CZ2 . TRP A 1 94  ? 34.037  59.655  58.567  1.00 61.37  ? 94  TRP A CZ2 1 
ATOM   751   C  CZ3 . TRP A 1 94  ? 34.260  57.246  58.408  1.00 61.92  ? 94  TRP A CZ3 1 
ATOM   752   C  CH2 . TRP A 1 94  ? 34.073  58.417  59.163  1.00 63.28  ? 94  TRP A CH2 1 
ATOM   753   N  N   . LEU A 1 95  ? 31.262  57.106  53.908  1.00 34.32  ? 95  LEU A N   1 
ATOM   754   C  CA  . LEU A 1 95  ? 30.326  56.123  54.436  1.00 31.31  ? 95  LEU A CA  1 
ATOM   755   C  C   . LEU A 1 95  ? 29.131  56.289  53.537  1.00 33.79  ? 95  LEU A C   1 
ATOM   756   O  O   . LEU A 1 95  ? 28.058  56.691  53.975  1.00 35.39  ? 95  LEU A O   1 
ATOM   757   C  CB  . LEU A 1 95  ? 29.945  56.444  55.869  1.00 27.33  ? 95  LEU A CB  1 
ATOM   758   C  CG  . LEU A 1 95  ? 31.067  56.233  56.872  1.00 24.88  ? 95  LEU A CG  1 
ATOM   759   C  CD1 . LEU A 1 95  ? 30.579  56.585  58.252  1.00 23.95  ? 95  LEU A CD1 1 
ATOM   760   C  CD2 . LEU A 1 95  ? 31.536  54.798  56.808  1.00 22.57  ? 95  LEU A CD2 1 
ATOM   761   N  N   . PRO A 1 96  ? 29.312  56.010  52.242  1.00 35.68  ? 96  PRO A N   1 
ATOM   762   C  CA  . PRO A 1 96  ? 28.245  56.140  51.253  1.00 32.93  ? 96  PRO A CA  1 
ATOM   763   C  C   . PRO A 1 96  ? 26.988  55.359  51.596  1.00 31.26  ? 96  PRO A C   1 
ATOM   764   O  O   . PRO A 1 96  ? 27.062  54.194  52.008  1.00 33.55  ? 96  PRO A O   1 
ATOM   765   C  CB  . PRO A 1 96  ? 28.912  55.621  49.979  1.00 34.61  ? 96  PRO A CB  1 
ATOM   766   C  CG  . PRO A 1 96  ? 29.871  54.605  50.490  1.00 35.05  ? 96  PRO A CG  1 
ATOM   767   C  CD  . PRO A 1 96  ? 30.481  55.330  51.654  1.00 34.95  ? 96  PRO A CD  1 
ATOM   768   N  N   . GLY A 1 97  ? 25.837  56.011  51.434  1.00 29.49  ? 97  GLY A N   1 
ATOM   769   C  CA  . GLY A 1 97  ? 24.554  55.377  51.714  1.00 27.18  ? 97  GLY A CA  1 
ATOM   770   C  C   . GLY A 1 97  ? 24.038  55.475  53.141  1.00 24.87  ? 97  GLY A C   1 
ATOM   771   O  O   . GLY A 1 97  ? 22.845  55.277  53.387  1.00 29.12  ? 97  GLY A O   1 
ATOM   772   N  N   . SER A 1 98  ? 24.920  55.811  54.076  1.00 23.21  ? 98  SER A N   1 
ATOM   773   C  CA  . SER A 1 98  ? 24.552  55.919  55.477  1.00 22.87  ? 98  SER A CA  1 
ATOM   774   C  C   . SER A 1 98  ? 23.731  57.174  55.743  1.00 21.40  ? 98  SER A C   1 
ATOM   775   O  O   . SER A 1 98  ? 23.826  58.164  55.026  1.00 23.05  ? 98  SER A O   1 
ATOM   776   C  CB  . SER A 1 98  ? 25.804  55.933  56.340  1.00 19.78  ? 98  SER A CB  1 
ATOM   777   O  OG  . SER A 1 98  ? 26.562  57.087  56.054  1.00 24.54  ? 98  SER A OG  1 
ATOM   778   N  N   . THR A 1 99  ? 22.917  57.112  56.780  1.00 19.97  ? 99  THR A N   1 
ATOM   779   C  CA  . THR A 1 99  ? 22.077  58.217  57.164  1.00 17.93  ? 99  THR A CA  1 
ATOM   780   C  C   . THR A 1 99  ? 22.471  58.641  58.576  1.00 19.69  ? 99  THR A C   1 
ATOM   781   O  O   . THR A 1 99  ? 22.631  57.780  59.450  1.00 22.53  ? 99  THR A O   1 
ATOM   782   C  CB  . THR A 1 99  ? 20.600  57.765  57.181  1.00 16.74  ? 99  THR A CB  1 
ATOM   783   O  OG1 . THR A 1 99  ? 20.208  57.369  55.865  1.00 26.93  ? 99  THR A OG1 1 
ATOM   784   C  CG2 . THR A 1 99  ? 19.686  58.880  57.631  1.00 17.90  ? 99  THR A CG2 1 
ATOM   785   N  N   . ILE A 1 100 ? 22.702  59.941  58.782  1.00 17.39  ? 100 ILE A N   1 
ATOM   786   C  CA  . ILE A 1 100 ? 23.010  60.458  60.119  1.00 15.25  ? 100 ILE A CA  1 
ATOM   787   C  C   . ILE A 1 100 ? 21.739  61.164  60.598  1.00 14.58  ? 100 ILE A C   1 
ATOM   788   O  O   . ILE A 1 100 ? 21.030  61.784  59.803  1.00 15.58  ? 100 ILE A O   1 
ATOM   789   C  CB  . ILE A 1 100 ? 24.216  61.433  60.137  1.00 15.23  ? 100 ILE A CB  1 
ATOM   790   C  CG1 . ILE A 1 100 ? 23.960  62.642  59.247  1.00 16.95  ? 100 ILE A CG1 1 
ATOM   791   C  CG2 . ILE A 1 100 ? 25.465  60.726  59.671  1.00 19.81  ? 100 ILE A CG2 1 
ATOM   792   C  CD1 . ILE A 1 100 ? 24.989  63.734  59.433  1.00 16.70  ? 100 ILE A CD1 1 
ATOM   793   N  N   . TRP A 1 101 ? 21.417  61.053  61.879  1.00 15.81  ? 101 TRP A N   1 
ATOM   794   C  CA  . TRP A 1 101 ? 20.195  61.680  62.360  1.00 13.92  ? 101 TRP A CA  1 
ATOM   795   C  C   . TRP A 1 101 ? 20.314  62.092  63.800  1.00 13.15  ? 101 TRP A C   1 
ATOM   796   O  O   . TRP A 1 101 ? 21.161  61.572  64.515  1.00 15.96  ? 101 TRP A O   1 
ATOM   797   C  CB  . TRP A 1 101 ? 19.034  60.708  62.217  1.00 10.44  ? 101 TRP A CB  1 
ATOM   798   C  CG  . TRP A 1 101 ? 19.227  59.468  63.023  1.00 11.74  ? 101 TRP A CG  1 
ATOM   799   C  CD1 . TRP A 1 101 ? 19.930  58.347  62.663  1.00 10.76  ? 101 TRP A CD1 1 
ATOM   800   C  CD2 . TRP A 1 101 ? 18.715  59.219  64.338  1.00 13.68  ? 101 TRP A CD2 1 
ATOM   801   N  NE1 . TRP A 1 101 ? 19.880  57.409  63.681  1.00 11.90  ? 101 TRP A NE1 1 
ATOM   802   C  CE2 . TRP A 1 101 ? 19.146  57.922  64.718  1.00 13.87  ? 101 TRP A CE2 1 
ATOM   803   C  CE3 . TRP A 1 101 ? 17.937  59.968  65.236  1.00 9.61   ? 101 TRP A CE3 1 
ATOM   804   C  CZ2 . TRP A 1 101 ? 18.825  57.362  65.959  1.00 18.11  ? 101 TRP A CZ2 1 
ATOM   805   C  CZ3 . TRP A 1 101 ? 17.616  59.409  66.467  1.00 14.23  ? 101 TRP A CZ3 1 
ATOM   806   C  CH2 . TRP A 1 101 ? 18.061  58.115  66.820  1.00 14.31  ? 101 TRP A CH2 1 
ATOM   807   N  N   . ALA A 1 102 ? 19.440  62.994  64.233  1.00 11.91  ? 102 ALA A N   1 
ATOM   808   C  CA  . ALA A 1 102 ? 19.430  63.471  65.610  1.00 9.15   ? 102 ALA A CA  1 
ATOM   809   C  C   . ALA A 1 102 ? 18.034  63.954  65.886  1.00 10.69  ? 102 ALA A C   1 
ATOM   810   O  O   . ALA A 1 102 ? 17.389  64.493  64.995  1.00 12.07  ? 102 ALA A O   1 
ATOM   811   C  CB  . ALA A 1 102 ? 20.417  64.617  65.800  1.00 7.95   ? 102 ALA A CB  1 
ATOM   812   N  N   . GLY A 1 103 ? 17.555  63.711  67.099  1.00 11.49  ? 103 GLY A N   1 
ATOM   813   C  CA  . GLY A 1 103 ? 16.232  64.160  67.492  1.00 9.91   ? 103 GLY A CA  1 
ATOM   814   C  C   . GLY A 1 103 ? 15.431  63.024  68.064  1.00 12.49  ? 103 GLY A C   1 
ATOM   815   O  O   . GLY A 1 103 ? 15.937  61.904  68.162  1.00 16.31  ? 103 GLY A O   1 
ATOM   816   N  N   . LYS A 1 104 ? 14.199  63.300  68.481  1.00 11.46  ? 104 LYS A N   1 
ATOM   817   C  CA  . LYS A 1 104 ? 13.346  62.237  69.019  1.00 11.44  ? 104 LYS A CA  1 
ATOM   818   C  C   . LYS A 1 104 ? 12.901  61.399  67.826  1.00 12.25  ? 104 LYS A C   1 
ATOM   819   O  O   . LYS A 1 104 ? 12.402  61.939  66.831  1.00 12.08  ? 104 LYS A O   1 
ATOM   820   C  CB  . LYS A 1 104 ? 12.131  62.796  69.767  1.00 9.24   ? 104 LYS A CB  1 
ATOM   821   C  CG  . LYS A 1 104 ? 12.473  63.608  71.005  1.00 7.77   ? 104 LYS A CG  1 
ATOM   822   C  CD  . LYS A 1 104 ? 11.238  63.895  71.820  1.00 2.33   ? 104 LYS A CD  1 
ATOM   823   C  CE  . LYS A 1 104 ? 10.696  62.643  72.434  1.00 2.75   ? 104 LYS A CE  1 
ATOM   824   N  NZ  . LYS A 1 104 ? 9.482   62.944  73.265  1.00 8.90   ? 104 LYS A NZ  1 
ATOM   825   N  N   . ARG A 1 105 ? 13.033  60.086  67.925  1.00 12.09  ? 105 ARG A N   1 
ATOM   826   C  CA  . ARG A 1 105 ? 12.675  59.270  66.796  1.00 10.12  ? 105 ARG A CA  1 
ATOM   827   C  C   . ARG A 1 105 ? 12.317  57.844  67.147  1.00 12.88  ? 105 ARG A C   1 
ATOM   828   O  O   . ARG A 1 105 ? 12.885  57.279  68.077  1.00 17.16  ? 105 ARG A O   1 
ATOM   829   C  CB  . ARG A 1 105 ? 13.874  59.263  65.835  1.00 12.67  ? 105 ARG A CB  1 
ATOM   830   C  CG  . ARG A 1 105 ? 13.776  58.266  64.719  1.00 11.90  ? 105 ARG A CG  1 
ATOM   831   C  CD  . ARG A 1 105 ? 14.969  58.327  63.817  1.00 11.54  ? 105 ARG A CD  1 
ATOM   832   N  NE  . ARG A 1 105 ? 14.809  57.347  62.747  1.00 17.47  ? 105 ARG A NE  1 
ATOM   833   C  CZ  . ARG A 1 105 ? 15.785  56.917  61.954  1.00 16.42  ? 105 ARG A CZ  1 
ATOM   834   N  NH1 . ARG A 1 105 ? 17.021  57.373  62.098  1.00 18.99  ? 105 ARG A NH1 1 
ATOM   835   N  NH2 . ARG A 1 105 ? 15.518  56.027  61.015  1.00 18.05  ? 105 ARG A NH2 1 
ATOM   836   N  N   . PHE A 1 106 ? 11.333  57.283  66.440  1.00 12.70  ? 106 PHE A N   1 
ATOM   837   C  CA  . PHE A 1 106 ? 10.974  55.875  66.610  1.00 11.66  ? 106 PHE A CA  1 
ATOM   838   C  C   . PHE A 1 106 ? 12.121  55.172  65.845  1.00 13.80  ? 106 PHE A C   1 
ATOM   839   O  O   . PHE A 1 106 ? 12.172  55.190  64.614  1.00 17.98  ? 106 PHE A O   1 
ATOM   840   C  CB  . PHE A 1 106 ? 9.632   55.555  65.943  1.00 8.13   ? 106 PHE A CB  1 
ATOM   841   C  CG  . PHE A 1 106 ? 8.432   56.035  66.705  1.00 11.92  ? 106 PHE A CG  1 
ATOM   842   C  CD1 . PHE A 1 106 ? 8.559   56.596  67.972  1.00 10.40  ? 106 PHE A CD1 1 
ATOM   843   C  CD2 . PHE A 1 106 ? 7.157   55.900  66.154  1.00 6.72   ? 106 PHE A CD2 1 
ATOM   844   C  CE1 . PHE A 1 106 ? 7.432   57.011  68.683  1.00 12.47  ? 106 PHE A CE1 1 
ATOM   845   C  CE2 . PHE A 1 106 ? 6.030   56.307  66.843  1.00 8.74   ? 106 PHE A CE2 1 
ATOM   846   C  CZ  . PHE A 1 106 ? 6.160   56.866  68.116  1.00 10.24  ? 106 PHE A CZ  1 
ATOM   847   N  N   . TYR A 1 107 ? 13.075  54.612  66.567  1.00 13.66  ? 107 TYR A N   1 
ATOM   848   C  CA  . TYR A 1 107 ? 14.212  53.999  65.918  1.00 10.66  ? 107 TYR A CA  1 
ATOM   849   C  C   . TYR A 1 107 ? 14.119  52.516  65.707  1.00 13.28  ? 107 TYR A C   1 
ATOM   850   O  O   . TYR A 1 107 ? 14.116  51.749  66.659  1.00 13.94  ? 107 TYR A O   1 
ATOM   851   C  CB  . TYR A 1 107 ? 15.473  54.307  66.708  1.00 10.75  ? 107 TYR A CB  1 
ATOM   852   C  CG  . TYR A 1 107 ? 16.718  53.773  66.066  1.00 12.90  ? 107 TYR A CG  1 
ATOM   853   C  CD1 . TYR A 1 107 ? 17.251  54.396  64.953  1.00 11.81  ? 107 TYR A CD1 1 
ATOM   854   C  CD2 . TYR A 1 107 ? 17.374  52.656  66.574  1.00 8.85   ? 107 TYR A CD2 1 
ATOM   855   C  CE1 . TYR A 1 107 ? 18.394  53.943  64.357  1.00 11.96  ? 107 TYR A CE1 1 
ATOM   856   C  CE2 . TYR A 1 107 ? 18.544  52.185  65.972  1.00 12.14  ? 107 TYR A CE2 1 
ATOM   857   C  CZ  . TYR A 1 107 ? 19.039  52.846  64.862  1.00 13.33  ? 107 TYR A CZ  1 
ATOM   858   O  OH  . TYR A 1 107 ? 20.181  52.438  64.231  1.00 14.46  ? 107 TYR A OH  1 
ATOM   859   N  N   . GLN A 1 108 ? 14.046  52.119  64.445  1.00 13.05  ? 108 GLN A N   1 
ATOM   860   C  CA  . GLN A 1 108 ? 14.000  50.717  64.058  1.00 9.63   ? 108 GLN A CA  1 
ATOM   861   C  C   . GLN A 1 108 ? 13.286  49.762  65.009  1.00 13.05  ? 108 GLN A C   1 
ATOM   862   O  O   . GLN A 1 108 ? 13.857  48.763  65.430  1.00 16.57  ? 108 GLN A O   1 
ATOM   863   C  CB  . GLN A 1 108 ? 15.425  50.213  63.800  1.00 10.70  ? 108 GLN A CB  1 
ATOM   864   C  CG  . GLN A 1 108 ? 16.152  50.945  62.661  1.00 11.07  ? 108 GLN A CG  1 
ATOM   865   C  CD  . GLN A 1 108 ? 17.480  50.279  62.272  1.00 14.48  ? 108 GLN A CD  1 
ATOM   866   O  OE1 . GLN A 1 108 ? 17.689  49.092  62.510  1.00 18.53  ? 108 GLN A OE1 1 
ATOM   867   N  NE2 . GLN A 1 108 ? 18.369  51.041  61.667  1.00 12.75  ? 108 GLN A NE2 1 
ATOM   868   N  N   . ARG A 1 109 ? 12.019  50.040  65.290  1.00 14.23  ? 109 ARG A N   1 
ATOM   869   C  CA  . ARG A 1 109 ? 11.203  49.218  66.192  1.00 13.59  ? 109 ARG A CA  1 
ATOM   870   C  C   . ARG A 1 109 ? 10.790  47.889  65.565  1.00 14.28  ? 109 ARG A C   1 
ATOM   871   O  O   . ARG A 1 109 ? 10.499  47.832  64.368  1.00 18.63  ? 109 ARG A O   1 
ATOM   872   C  CB  . ARG A 1 109 ? 9.943   49.994  66.603  1.00 10.04  ? 109 ARG A CB  1 
ATOM   873   C  CG  . ARG A 1 109 ? 10.245  51.401  67.096  1.00 7.80   ? 109 ARG A CG  1 
ATOM   874   C  CD  . ARG A 1 109 ? 9.013   52.066  67.603  1.00 9.85   ? 109 ARG A CD  1 
ATOM   875   N  NE  . ARG A 1 109 ? 8.040   52.227  66.540  1.00 12.72  ? 109 ARG A NE  1 
ATOM   876   C  CZ  . ARG A 1 109 ? 6.801   52.646  66.740  1.00 16.33  ? 109 ARG A CZ  1 
ATOM   877   N  NH1 . ARG A 1 109 ? 6.401   52.941  67.956  1.00 18.43  ? 109 ARG A NH1 1 
ATOM   878   N  NH2 . ARG A 1 109 ? 5.963   52.782  65.730  1.00 14.43  ? 109 ARG A NH2 1 
ATOM   879   N  N   . HIS A 1 110 ? 10.780  46.827  66.375  1.00 13.18  ? 110 HIS A N   1 
ATOM   880   C  CA  . HIS A 1 110 ? 10.367  45.482  65.946  1.00 8.35   ? 110 HIS A CA  1 
ATOM   881   C  C   . HIS A 1 110 ? 9.182   45.116  66.838  1.00 12.52  ? 110 HIS A C   1 
ATOM   882   O  O   . HIS A 1 110 ? 9.298   45.179  68.068  1.00 15.45  ? 110 HIS A O   1 
ATOM   883   C  CB  . HIS A 1 110 ? 11.476  44.459  66.185  1.00 9.71   ? 110 HIS A CB  1 
ATOM   884   C  CG  . HIS A 1 110 ? 12.681  44.651  65.323  1.00 8.55   ? 110 HIS A CG  1 
ATOM   885   N  ND1 . HIS A 1 110 ? 13.246  43.621  64.604  1.00 10.40  ? 110 HIS A ND1 1 
ATOM   886   C  CD2 . HIS A 1 110 ? 13.444  45.744  65.077  1.00 7.57   ? 110 HIS A CD2 1 
ATOM   887   C  CE1 . HIS A 1 110 ? 14.305  44.068  63.953  1.00 12.54  ? 110 HIS A CE1 1 
ATOM   888   N  NE2 . HIS A 1 110 ? 14.446  45.353  64.222  1.00 9.17   ? 110 HIS A NE2 1 
ATOM   889   N  N   . ASP A 1 111 ? 8.077   44.673  66.246  1.00 13.30  ? 111 ASP A N   1 
ATOM   890   C  CA  . ASP A 1 111 ? 6.885   44.350  67.025  1.00 12.22  ? 111 ASP A CA  1 
ATOM   891   C  C   . ASP A 1 111 ? 6.114   43.209  66.401  1.00 11.51  ? 111 ASP A C   1 
ATOM   892   O  O   . ASP A 1 111 ? 6.427   42.791  65.303  1.00 15.41  ? 111 ASP A O   1 
ATOM   893   C  CB  . ASP A 1 111 ? 5.961   45.579  67.086  1.00 14.80  ? 111 ASP A CB  1 
ATOM   894   C  CG  . ASP A 1 111 ? 5.300   45.890  65.741  1.00 18.02  ? 111 ASP A CG  1 
ATOM   895   O  OD1 . ASP A 1 111 ? 6.020   46.203  64.773  1.00 20.57  ? 111 ASP A OD1 1 
ATOM   896   O  OD2 . ASP A 1 111 ? 4.059   45.814  65.655  1.00 19.21  ? 111 ASP A OD2 1 
ATOM   897   N  N   . VAL A 1 112 ? 5.103   42.725  67.112  1.00 11.16  ? 112 VAL A N   1 
ATOM   898   C  CA  . VAL A 1 112 ? 4.239   41.669  66.630  1.00 11.03  ? 112 VAL A CA  1 
ATOM   899   C  C   . VAL A 1 112 ? 2.884   42.349  66.606  1.00 13.16  ? 112 VAL A C   1 
ATOM   900   O  O   . VAL A 1 112 ? 2.327   42.659  67.650  1.00 18.97  ? 112 VAL A O   1 
ATOM   901   C  CB  . VAL A 1 112 ? 4.195   40.470  67.589  1.00 11.03  ? 112 VAL A CB  1 
ATOM   902   C  CG1 . VAL A 1 112 ? 3.253   39.403  67.034  1.00 7.35   ? 112 VAL A CG1 1 
ATOM   903   C  CG2 . VAL A 1 112 ? 5.588   39.896  67.765  1.00 12.25  ? 112 VAL A CG2 1 
ATOM   904   N  N   . HIS A 1 113 ? 2.362   42.601  65.417  1.00 12.45  ? 113 HIS A N   1 
ATOM   905   C  CA  . HIS A 1 113 ? 1.100   43.303  65.287  1.00 10.12  ? 113 HIS A CA  1 
ATOM   906   C  C   . HIS A 1 113 ? -0.099  42.761  66.047  1.00 12.59  ? 113 HIS A C   1 
ATOM   907   O  O   . HIS A 1 113 ? -0.752  43.512  66.777  1.00 12.47  ? 113 HIS A O   1 
ATOM   908   C  CB  . HIS A 1 113 ? 0.706   43.485  63.822  1.00 8.06   ? 113 HIS A CB  1 
ATOM   909   C  CG  . HIS A 1 113 ? -0.646  44.093  63.658  1.00 8.48   ? 113 HIS A CG  1 
ATOM   910   N  ND1 . HIS A 1 113 ? -0.873  45.447  63.809  1.00 8.80   ? 113 HIS A ND1 1 
ATOM   911   C  CD2 . HIS A 1 113 ? -1.860  43.527  63.453  1.00 5.22   ? 113 HIS A CD2 1 
ATOM   912   C  CE1 . HIS A 1 113 ? -2.168  45.688  63.709  1.00 9.57   ? 113 HIS A CE1 1 
ATOM   913   N  NE2 . HIS A 1 113 ? -2.790  44.540  63.492  1.00 8.87   ? 113 HIS A NE2 1 
ATOM   914   N  N   . MET A 1 114 ? -0.400  41.473  65.895  1.00 12.26  ? 114 MET A N   1 
ATOM   915   C  CA  . MET A 1 114 ? -1.586  40.925  66.548  1.00 11.59  ? 114 MET A CA  1 
ATOM   916   C  C   . MET A 1 114 ? -1.701  41.052  68.071  1.00 14.73  ? 114 MET A C   1 
ATOM   917   O  O   . MET A 1 114 ? -2.812  41.055  68.602  1.00 17.72  ? 114 MET A O   1 
ATOM   918   C  CB  . MET A 1 114 ? -1.905  39.512  66.050  1.00 12.74  ? 114 MET A CB  1 
ATOM   919   C  CG  . MET A 1 114 ? -0.814  38.485  66.222  1.00 11.80  ? 114 MET A CG  1 
ATOM   920   S  SD  . MET A 1 114 ? -1.336  36.817  65.662  1.00 17.47  ? 114 MET A SD  1 
ATOM   921   C  CE  . MET A 1 114 ? -2.904  36.645  66.496  1.00 10.58  ? 114 MET A CE  1 
ATOM   922   N  N   . ILE A 1 115 ? -0.578  41.193  68.776  1.00 14.00  ? 115 ILE A N   1 
ATOM   923   C  CA  . ILE A 1 115 ? -0.617  41.340  70.229  1.00 12.52  ? 115 ILE A CA  1 
ATOM   924   C  C   . ILE A 1 115 ? -0.112  42.727  70.593  1.00 14.97  ? 115 ILE A C   1 
ATOM   925   O  O   . ILE A 1 115 ? 0.031   43.056  71.769  1.00 18.82  ? 115 ILE A O   1 
ATOM   926   C  CB  . ILE A 1 115 ? 0.226   40.250  70.980  1.00 10.58  ? 115 ILE A CB  1 
ATOM   927   C  CG1 . ILE A 1 115 ? 1.637   40.126  70.390  1.00 10.76  ? 115 ILE A CG1 1 
ATOM   928   C  CG2 . ILE A 1 115 ? -0.482  38.912  70.947  1.00 11.38  ? 115 ILE A CG2 1 
ATOM   929   C  CD1 . ILE A 1 115 ? 2.543   39.165  71.145  1.00 8.21   ? 115 ILE A CD1 1 
ATOM   930   N  N   . ASP A 1 116 ? 0.136   43.541  69.570  1.00 13.88  ? 116 ASP A N   1 
ATOM   931   C  CA  . ASP A 1 116 ? 0.632   44.909  69.739  1.00 13.28  ? 116 ASP A CA  1 
ATOM   932   C  C   . ASP A 1 116 ? 1.808   44.924  70.717  1.00 13.22  ? 116 ASP A C   1 
ATOM   933   O  O   . ASP A 1 116 ? 1.909   45.785  71.584  1.00 16.53  ? 116 ASP A O   1 
ATOM   934   C  CB  . ASP A 1 116 ? -0.484  45.805  70.255  1.00 9.44   ? 116 ASP A CB  1 
ATOM   935   C  CG  . ASP A 1 116 ? -0.217  47.290  70.010  1.00 12.86  ? 116 ASP A CG  1 
ATOM   936   O  OD1 . ASP A 1 116 ? 0.728   47.651  69.272  1.00 11.96  ? 116 ASP A OD1 1 
ATOM   937   O  OD2 . ASP A 1 116 ? -0.985  48.100  70.556  1.00 12.94  ? 116 ASP A OD2 1 
ATOM   938   N  N   . PHE A 1 117 ? 2.732   44.004  70.510  1.00 13.26  ? 117 PHE A N   1 
ATOM   939   C  CA  . PHE A 1 117 ? 3.873   43.850  71.382  1.00 12.74  ? 117 PHE A CA  1 
ATOM   940   C  C   . PHE A 1 117 ? 5.180   44.218  70.719  1.00 14.80  ? 117 PHE A C   1 
ATOM   941   O  O   . PHE A 1 117 ? 5.572   43.601  69.736  1.00 17.51  ? 117 PHE A O   1 
ATOM   942   C  CB  . PHE A 1 117 ? 3.931   42.383  71.834  1.00 13.14  ? 117 PHE A CB  1 
ATOM   943   C  CG  . PHE A 1 117 ? 4.984   42.104  72.832  1.00 12.79  ? 117 PHE A CG  1 
ATOM   944   C  CD1 . PHE A 1 117 ? 4.857   42.562  74.139  1.00 12.99  ? 117 PHE A CD1 1 
ATOM   945   C  CD2 . PHE A 1 117 ? 6.126   41.411  72.470  1.00 15.28  ? 117 PHE A CD2 1 
ATOM   946   C  CE1 . PHE A 1 117 ? 5.869   42.332  75.071  1.00 10.12  ? 117 PHE A CE1 1 
ATOM   947   C  CE2 . PHE A 1 117 ? 7.149   41.179  73.399  1.00 17.25  ? 117 PHE A CE2 1 
ATOM   948   C  CZ  . PHE A 1 117 ? 7.020   41.642  74.702  1.00 7.74   ? 117 PHE A CZ  1 
ATOM   949   N  N   . TYR A 1 118 ? 5.874   45.199  71.278  1.00 15.25  ? 118 TYR A N   1 
ATOM   950   C  CA  . TYR A 1 118 ? 7.163   45.616  70.755  1.00 13.19  ? 118 TYR A CA  1 
ATOM   951   C  C   . TYR A 1 118 ? 8.237   44.862  71.520  1.00 16.59  ? 118 TYR A C   1 
ATOM   952   O  O   . TYR A 1 118 ? 8.225   44.831  72.746  1.00 21.20  ? 118 TYR A O   1 
ATOM   953   C  CB  . TYR A 1 118 ? 7.354   47.123  70.931  1.00 12.98  ? 118 TYR A CB  1 
ATOM   954   C  CG  . TYR A 1 118 ? 6.576   47.942  69.935  1.00 13.65  ? 118 TYR A CG  1 
ATOM   955   C  CD1 . TYR A 1 118 ? 5.198   48.096  70.054  1.00 14.06  ? 118 TYR A CD1 1 
ATOM   956   C  CD2 . TYR A 1 118 ? 7.209   48.511  68.837  1.00 14.12  ? 118 TYR A CD2 1 
ATOM   957   C  CE1 . TYR A 1 118 ? 4.469   48.786  69.101  1.00 15.34  ? 118 TYR A CE1 1 
ATOM   958   C  CE2 . TYR A 1 118 ? 6.488   49.201  67.877  1.00 14.10  ? 118 TYR A CE2 1 
ATOM   959   C  CZ  . TYR A 1 118 ? 5.121   49.329  68.016  1.00 16.01  ? 118 TYR A CZ  1 
ATOM   960   O  OH  . TYR A 1 118 ? 4.400   49.965  67.048  1.00 18.51  ? 118 TYR A OH  1 
ATOM   961   N  N   . TYR A 1 119 ? 9.154   44.228  70.809  1.00 16.19  ? 119 TYR A N   1 
ATOM   962   C  CA  . TYR A 1 119 ? 10.202  43.493  71.490  1.00 14.73  ? 119 TYR A CA  1 
ATOM   963   C  C   . TYR A 1 119 ? 11.585  44.102  71.327  1.00 15.56  ? 119 TYR A C   1 
ATOM   964   O  O   . TYR A 1 119 ? 12.545  43.650  71.937  1.00 20.54  ? 119 TYR A O   1 
ATOM   965   C  CB  . TYR A 1 119 ? 10.196  42.023  71.081  1.00 13.00  ? 119 TYR A CB  1 
ATOM   966   C  CG  . TYR A 1 119 ? 10.255  41.779  69.597  1.00 12.49  ? 119 TYR A CG  1 
ATOM   967   C  CD1 . TYR A 1 119 ? 9.085   41.672  68.848  1.00 13.84  ? 119 TYR A CD1 1 
ATOM   968   C  CD2 . TYR A 1 119 ? 11.471  41.577  68.950  1.00 15.43  ? 119 TYR A CD2 1 
ATOM   969   C  CE1 . TYR A 1 119 ? 9.119   41.361  67.496  1.00 12.95  ? 119 TYR A CE1 1 
ATOM   970   C  CE2 . TYR A 1 119 ? 11.517  41.261  67.587  1.00 12.38  ? 119 TYR A CE2 1 
ATOM   971   C  CZ  . TYR A 1 119 ? 10.329  41.152  66.872  1.00 16.94  ? 119 TYR A CZ  1 
ATOM   972   O  OH  . TYR A 1 119 ? 10.338  40.797  65.545  1.00 16.83  ? 119 TYR A OH  1 
ATOM   973   N  N   . TRP A 1 120 ? 11.695  45.145  70.525  1.00 12.23  ? 120 TRP A N   1 
ATOM   974   C  CA  . TRP A 1 120 ? 12.982  45.784  70.335  1.00 10.49  ? 120 TRP A CA  1 
ATOM   975   C  C   . TRP A 1 120 ? 12.585  47.193  70.006  1.00 14.04  ? 120 TRP A C   1 
ATOM   976   O  O   . TRP A 1 120 ? 12.179  47.487  68.889  1.00 17.47  ? 120 TRP A O   1 
ATOM   977   C  CB  . TRP A 1 120 ? 13.749  45.135  69.183  1.00 11.51  ? 120 TRP A CB  1 
ATOM   978   C  CG  . TRP A 1 120 ? 15.235  45.379  69.226  1.00 14.92  ? 120 TRP A CG  1 
ATOM   979   C  CD1 . TRP A 1 120 ? 15.926  46.100  70.166  1.00 13.89  ? 120 TRP A CD1 1 
ATOM   980   C  CD2 . TRP A 1 120 ? 16.214  44.915  68.280  1.00 16.56  ? 120 TRP A CD2 1 
ATOM   981   N  NE1 . TRP A 1 120 ? 17.269  46.118  69.859  1.00 15.58  ? 120 TRP A NE1 1 
ATOM   982   C  CE2 . TRP A 1 120 ? 17.472  45.399  68.709  1.00 18.08  ? 120 TRP A CE2 1 
ATOM   983   C  CE3 . TRP A 1 120 ? 16.150  44.142  67.112  1.00 17.82  ? 120 TRP A CE3 1 
ATOM   984   C  CZ2 . TRP A 1 120 ? 18.652  45.135  68.008  1.00 18.22  ? 120 TRP A CZ2 1 
ATOM   985   C  CZ3 . TRP A 1 120 ? 17.332  43.882  66.413  1.00 15.63  ? 120 TRP A CZ3 1 
ATOM   986   C  CH2 . TRP A 1 120 ? 18.560  44.377  66.866  1.00 15.18  ? 120 TRP A CH2 1 
ATOM   987   N  N   . ASP A 1 121 ? 12.635  48.046  71.017  1.00 14.67  ? 121 ASP A N   1 
ATOM   988   C  CA  . ASP A 1 121 ? 12.235  49.425  70.882  1.00 11.60  ? 121 ASP A CA  1 
ATOM   989   C  C   . ASP A 1 121 ? 13.023  50.339  71.824  1.00 13.88  ? 121 ASP A C   1 
ATOM   990   O  O   . ASP A 1 121 ? 12.696  50.468  73.008  1.00 16.63  ? 121 ASP A O   1 
ATOM   991   C  CB  . ASP A 1 121 ? 10.732  49.510  71.174  1.00 10.63  ? 121 ASP A CB  1 
ATOM   992   C  CG  . ASP A 1 121 ? 10.191  50.930  71.125  1.00 15.80  ? 121 ASP A CG  1 
ATOM   993   O  OD1 . ASP A 1 121 ? 10.876  51.838  70.601  1.00 15.89  ? 121 ASP A OD1 1 
ATOM   994   O  OD2 . ASP A 1 121 ? 9.060   51.130  71.620  1.00 14.57  ? 121 ASP A OD2 1 
ATOM   995   N  N   . ILE A 1 122 ? 14.032  51.011  71.283  1.00 12.83  ? 122 ILE A N   1 
ATOM   996   C  CA  . ILE A 1 122 ? 14.834  51.919  72.073  1.00 7.22   ? 122 ILE A CA  1 
ATOM   997   C  C   . ILE A 1 122 ? 14.534  53.366  71.664  1.00 11.47  ? 122 ILE A C   1 
ATOM   998   O  O   . ILE A 1 122 ? 15.379  54.248  71.819  1.00 13.62  ? 122 ILE A O   1 
ATOM   999   C  CB  . ILE A 1 122 ? 16.309  51.637  71.857  1.00 8.39   ? 122 ILE A CB  1 
ATOM   1000  C  CG1 . ILE A 1 122 ? 16.681  51.922  70.410  1.00 7.01   ? 122 ILE A CG1 1 
ATOM   1001  C  CG2 . ILE A 1 122 ? 16.609  50.186  72.165  1.00 6.34   ? 122 ILE A CG2 1 
ATOM   1002  C  CD1 . ILE A 1 122 ? 18.176  52.028  70.169  1.00 7.86   ? 122 ILE A CD1 1 
ATOM   1003  N  N   . SER A 1 123 ? 13.324  53.612  71.166  1.00 12.52  ? 123 SER A N   1 
ATOM   1004  C  CA  . SER A 1 123 ? 12.920  54.941  70.705  1.00 11.87  ? 123 SER A CA  1 
ATOM   1005  C  C   . SER A 1 123 ? 13.012  55.990  71.786  1.00 15.03  ? 123 SER A C   1 
ATOM   1006  O  O   . SER A 1 123 ? 12.862  55.684  72.964  1.00 18.80  ? 123 SER A O   1 
ATOM   1007  C  CB  . SER A 1 123 ? 11.477  54.914  70.199  1.00 12.72  ? 123 SER A CB  1 
ATOM   1008  O  OG  . SER A 1 123 ? 11.278  53.912  69.219  1.00 14.23  ? 123 SER A OG  1 
ATOM   1009  N  N   . GLY A 1 124 ? 13.200  57.239  71.373  1.00 12.89  ? 124 GLY A N   1 
ATOM   1010  C  CA  . GLY A 1 124 ? 13.262  58.333  72.323  1.00 12.88  ? 124 GLY A CA  1 
ATOM   1011  C  C   . GLY A 1 124 ? 14.248  59.346  71.806  1.00 12.12  ? 124 GLY A C   1 
ATOM   1012  O  O   . GLY A 1 124 ? 14.573  59.305  70.636  1.00 15.73  ? 124 GLY A O   1 
ATOM   1013  N  N   . PRO A 1 125 ? 14.702  60.303  72.621  1.00 10.88  ? 125 PRO A N   1 
ATOM   1014  C  CA  . PRO A 1 125 ? 15.672  61.294  72.141  1.00 10.60  ? 125 PRO A CA  1 
ATOM   1015  C  C   . PRO A 1 125 ? 16.950  60.526  71.778  1.00 11.93  ? 125 PRO A C   1 
ATOM   1016  O  O   . PRO A 1 125 ? 17.301  59.555  72.443  1.00 16.48  ? 125 PRO A O   1 
ATOM   1017  C  CB  . PRO A 1 125 ? 15.885  62.181  73.369  1.00 7.06   ? 125 PRO A CB  1 
ATOM   1018  C  CG  . PRO A 1 125 ? 14.604  62.041  74.123  1.00 12.87  ? 125 PRO A CG  1 
ATOM   1019  C  CD  . PRO A 1 125 ? 14.311  60.574  74.010  1.00 8.92   ? 125 PRO A CD  1 
ATOM   1020  N  N   . GLY A 1 126 ? 17.626  60.916  70.710  1.00 14.49  ? 126 GLY A N   1 
ATOM   1021  C  CA  . GLY A 1 126 ? 18.823  60.189  70.350  1.00 10.53  ? 126 GLY A CA  1 
ATOM   1022  C  C   . GLY A 1 126 ? 19.517  60.740  69.132  1.00 14.02  ? 126 GLY A C   1 
ATOM   1023  O  O   . GLY A 1 126 ? 19.200  61.823  68.635  1.00 13.27  ? 126 GLY A O   1 
ATOM   1024  N  N   . ALA A 1 127 ? 20.491  59.978  68.665  1.00 11.84  ? 127 ALA A N   1 
ATOM   1025  C  CA  . ALA A 1 127 ? 21.280  60.337  67.511  1.00 9.85   ? 127 ALA A CA  1 
ATOM   1026  C  C   . ALA A 1 127 ? 22.023  59.080  67.120  1.00 14.30  ? 127 ALA A C   1 
ATOM   1027  O  O   . ALA A 1 127 ? 22.146  58.154  67.924  1.00 17.42  ? 127 ALA A O   1 
ATOM   1028  C  CB  . ALA A 1 127 ? 22.250  61.427  67.863  1.00 9.13   ? 127 ALA A CB  1 
ATOM   1029  N  N   . GLY A 1 128 ? 22.468  59.013  65.872  1.00 16.36  ? 128 GLY A N   1 
ATOM   1030  C  CA  . GLY A 1 128 ? 23.190  57.839  65.412  1.00 16.13  ? 128 GLY A CA  1 
ATOM   1031  C  C   . GLY A 1 128 ? 23.474  57.893  63.929  1.00 15.72  ? 128 GLY A C   1 
ATOM   1032  O  O   . GLY A 1 128 ? 23.246  58.918  63.275  1.00 15.86  ? 128 GLY A O   1 
ATOM   1033  N  N   . ILE A 1 129 ? 24.073  56.829  63.416  1.00 16.34  ? 129 ILE A N   1 
ATOM   1034  C  CA  . ILE A 1 129 ? 24.353  56.736  62.005  1.00 14.94  ? 129 ILE A CA  1 
ATOM   1035  C  C   . ILE A 1 129 ? 23.943  55.349  61.604  1.00 15.64  ? 129 ILE A C   1 
ATOM   1036  O  O   . ILE A 1 129 ? 24.352  54.350  62.209  1.00 15.54  ? 129 ILE A O   1 
ATOM   1037  C  CB  . ILE A 1 129 ? 25.813  57.007  61.663  1.00 17.86  ? 129 ILE A CB  1 
ATOM   1038  C  CG1 . ILE A 1 129 ? 26.052  56.719  60.182  1.00 22.14  ? 129 ILE A CG1 1 
ATOM   1039  C  CG2 . ILE A 1 129 ? 26.720  56.195  62.530  1.00 19.78  ? 129 ILE A CG2 1 
ATOM   1040  C  CD1 . ILE A 1 129 ? 27.340  57.266  59.658  1.00 24.40  ? 129 ILE A CD1 1 
ATOM   1041  N  N   . GLU A 1 130 ? 23.034  55.278  60.654  1.00 14.68  ? 130 GLU A N   1 
ATOM   1042  C  CA  . GLU A 1 130 ? 22.586  53.982  60.243  1.00 18.39  ? 130 GLU A CA  1 
ATOM   1043  C  C   . GLU A 1 130 ? 22.905  53.676  58.807  1.00 21.20  ? 130 GLU A C   1 
ATOM   1044  O  O   . GLU A 1 130 ? 23.225  54.575  58.012  1.00 19.10  ? 130 GLU A O   1 
ATOM   1045  C  CB  . GLU A 1 130 ? 21.092  53.843  60.488  1.00 16.45  ? 130 GLU A CB  1 
ATOM   1046  C  CG  . GLU A 1 130 ? 20.289  54.956  59.888  1.00 13.34  ? 130 GLU A CG  1 
ATOM   1047  C  CD  . GLU A 1 130 ? 18.794  54.773  60.074  1.00 18.12  ? 130 GLU A CD  1 
ATOM   1048  O  OE1 . GLU A 1 130 ? 18.326  53.654  60.366  1.00 20.24  ? 130 GLU A OE1 1 
ATOM   1049  O  OE2 . GLU A 1 130 ? 18.066  55.762  59.918  1.00 24.84  ? 130 GLU A OE2 1 
ATOM   1050  N  N   . ASN A 1 131 ? 22.815  52.379  58.511  1.00 22.98  ? 131 ASN A N   1 
ATOM   1051  C  CA  . ASN A 1 131 ? 23.035  51.811  57.195  1.00 26.57  ? 131 ASN A CA  1 
ATOM   1052  C  C   . ASN A 1 131 ? 24.408  52.027  56.615  1.00 24.85  ? 131 ASN A C   1 
ATOM   1053  O  O   . ASN A 1 131 ? 24.560  52.504  55.492  1.00 28.58  ? 131 ASN A O   1 
ATOM   1054  C  CB  . ASN A 1 131 ? 21.946  52.250  56.214  1.00 33.69  ? 131 ASN A CB  1 
ATOM   1055  C  CG  . ASN A 1 131 ? 20.559  51.782  56.641  1.00 46.85  ? 131 ASN A CG  1 
ATOM   1056  O  OD1 . ASN A 1 131 ? 20.405  50.701  57.237  1.00 48.29  ? 131 ASN A OD1 1 
ATOM   1057  N  ND2 . ASN A 1 131 ? 19.543  52.607  56.374  1.00 49.99  ? 131 ASN A ND2 1 
ATOM   1058  N  N   . ILE A 1 132 ? 25.415  51.708  57.410  1.00 23.73  ? 132 ILE A N   1 
ATOM   1059  C  CA  . ILE A 1 132 ? 26.791  51.789  56.963  1.00 22.05  ? 132 ILE A CA  1 
ATOM   1060  C  C   . ILE A 1 132 ? 26.945  50.452  56.254  1.00 25.85  ? 132 ILE A C   1 
ATOM   1061  O  O   . ILE A 1 132 ? 26.662  49.399  56.842  1.00 24.52  ? 132 ILE A O   1 
ATOM   1062  C  CB  . ILE A 1 132 ? 27.754  51.876  58.152  1.00 18.64  ? 132 ILE A CB  1 
ATOM   1063  C  CG1 . ILE A 1 132 ? 27.553  53.215  58.877  1.00 16.52  ? 132 ILE A CG1 1 
ATOM   1064  C  CG2 . ILE A 1 132 ? 29.190  51.711  57.684  1.00 17.41  ? 132 ILE A CG2 1 
ATOM   1065  C  CD1 . ILE A 1 132 ? 28.374  53.358  60.131  1.00 17.05  ? 132 ILE A CD1 1 
ATOM   1066  N  N   . ASP A 1 133 ? 27.300  50.502  54.972  1.00 29.20  ? 133 ASP A N   1 
ATOM   1067  C  CA  . ASP A 1 133 ? 27.463  49.298  54.162  1.00 28.50  ? 133 ASP A CA  1 
ATOM   1068  C  C   . ASP A 1 133 ? 28.786  48.577  54.395  1.00 28.92  ? 133 ASP A C   1 
ATOM   1069  O  O   . ASP A 1 133 ? 29.854  49.109  54.091  1.00 28.58  ? 133 ASP A O   1 
ATOM   1070  C  CB  . ASP A 1 133 ? 27.319  49.641  52.680  1.00 33.96  ? 133 ASP A CB  1 
ATOM   1071  C  CG  . ASP A 1 133 ? 27.132  48.402  51.795  1.00 41.68  ? 133 ASP A CG  1 
ATOM   1072  O  OD1 . ASP A 1 133 ? 26.904  47.278  52.309  1.00 42.30  ? 133 ASP A OD1 1 
ATOM   1073  O  OD2 . ASP A 1 133 ? 27.197  48.564  50.557  1.00 51.93  ? 133 ASP A OD2 1 
ATOM   1074  N  N   . LEU A 1 134 ? 28.702  47.367  54.940  1.00 29.16  ? 134 LEU A N   1 
ATOM   1075  C  CA  . LEU A 1 134 ? 29.878  46.545  55.198  1.00 30.10  ? 134 LEU A CA  1 
ATOM   1076  C  C   . LEU A 1 134 ? 30.041  45.495  54.093  1.00 33.55  ? 134 LEU A C   1 
ATOM   1077  O  O   . LEU A 1 134 ? 30.897  44.608  54.181  1.00 36.08  ? 134 LEU A O   1 
ATOM   1078  C  CB  . LEU A 1 134 ? 29.743  45.835  56.542  1.00 26.63  ? 134 LEU A CB  1 
ATOM   1079  C  CG  . LEU A 1 134 ? 29.699  46.712  57.783  1.00 28.81  ? 134 LEU A CG  1 
ATOM   1080  C  CD1 . LEU A 1 134 ? 29.740  45.824  58.998  1.00 25.02  ? 134 LEU A CD1 1 
ATOM   1081  C  CD2 . LEU A 1 134 ? 30.875  47.672  57.788  1.00 26.67  ? 134 LEU A CD2 1 
ATOM   1082  N  N   . GLY A 1 135 ? 29.214  45.582  53.056  1.00 30.49  ? 135 GLY A N   1 
ATOM   1083  C  CA  . GLY A 1 135 ? 29.293  44.608  51.987  1.00 29.93  ? 135 GLY A CA  1 
ATOM   1084  C  C   . GLY A 1 135 ? 28.440  43.400  52.312  1.00 30.55  ? 135 GLY A C   1 
ATOM   1085  O  O   . GLY A 1 135 ? 27.431  43.149  51.653  1.00 34.66  ? 135 GLY A O   1 
ATOM   1086  N  N   . PHE A 1 136 ? 28.810  42.668  53.354  1.00 28.17  ? 136 PHE A N   1 
ATOM   1087  C  CA  . PHE A 1 136 ? 28.038  41.496  53.751  1.00 26.20  ? 136 PHE A CA  1 
ATOM   1088  C  C   . PHE A 1 136 ? 26.847  41.848  54.655  1.00 25.89  ? 136 PHE A C   1 
ATOM   1089  O  O   . PHE A 1 136 ? 26.143  40.962  55.121  1.00 26.96  ? 136 PHE A O   1 
ATOM   1090  C  CB  . PHE A 1 136 ? 28.944  40.510  54.464  1.00 25.80  ? 136 PHE A CB  1 
ATOM   1091  C  CG  . PHE A 1 136 ? 29.648  41.102  55.635  1.00 28.29  ? 136 PHE A CG  1 
ATOM   1092  C  CD1 . PHE A 1 136 ? 29.051  41.099  56.892  1.00 28.32  ? 136 PHE A CD1 1 
ATOM   1093  C  CD2 . PHE A 1 136 ? 30.885  41.703  55.476  1.00 27.94  ? 136 PHE A CD2 1 
ATOM   1094  C  CE1 . PHE A 1 136 ? 29.676  41.690  57.973  1.00 31.60  ? 136 PHE A CE1 1 
ATOM   1095  C  CE2 . PHE A 1 136 ? 31.521  42.299  56.553  1.00 30.13  ? 136 PHE A CE2 1 
ATOM   1096  C  CZ  . PHE A 1 136 ? 30.917  42.294  57.804  1.00 28.41  ? 136 PHE A CZ  1 
ATOM   1097  N  N   . GLY A 1 137 ? 26.642  43.135  54.925  1.00 26.22  ? 137 GLY A N   1 
ATOM   1098  C  CA  . GLY A 1 137 ? 25.539  43.553  55.771  1.00 22.44  ? 137 GLY A CA  1 
ATOM   1099  C  C   . GLY A 1 137 ? 25.607  45.032  56.091  1.00 20.36  ? 137 GLY A C   1 
ATOM   1100  O  O   . GLY A 1 137 ? 26.571  45.703  55.724  1.00 19.15  ? 137 GLY A O   1 
ATOM   1101  N  N   . LYS A 1 138 ? 24.593  45.531  56.788  1.00 18.44  ? 138 LYS A N   1 
ATOM   1102  C  CA  . LYS A 1 138 ? 24.517  46.931  57.165  1.00 17.85  ? 138 LYS A CA  1 
ATOM   1103  C  C   . LYS A 1 138 ? 24.728  47.113  58.658  1.00 19.58  ? 138 LYS A C   1 
ATOM   1104  O  O   . LYS A 1 138 ? 24.103  46.434  59.470  1.00 21.05  ? 138 LYS A O   1 
ATOM   1105  C  CB  . LYS A 1 138 ? 23.151  47.495  56.795  1.00 22.45  ? 138 LYS A CB  1 
ATOM   1106  C  CG  . LYS A 1 138 ? 22.821  47.391  55.325  1.00 27.86  ? 138 LYS A CG  1 
ATOM   1107  C  CD  . LYS A 1 138 ? 23.902  48.031  54.482  1.00 38.19  ? 138 LYS A CD  1 
ATOM   1108  C  CE  . LYS A 1 138 ? 23.604  47.906  52.995  1.00 46.59  ? 138 LYS A CE  1 
ATOM   1109  N  NZ  . LYS A 1 138 ? 22.441  48.737  52.603  1.00 54.95  ? 138 LYS A NZ  1 
ATOM   1110  N  N   . LEU A 1 139 ? 25.585  48.060  59.010  1.00 18.94  ? 139 LEU A N   1 
ATOM   1111  C  CA  . LEU A 1 139 ? 25.890  48.378  60.395  1.00 17.78  ? 139 LEU A CA  1 
ATOM   1112  C  C   . LEU A 1 139 ? 25.194  49.690  60.784  1.00 18.99  ? 139 LEU A C   1 
ATOM   1113  O  O   . LEU A 1 139 ? 25.171  50.629  60.004  1.00 20.98  ? 139 LEU A O   1 
ATOM   1114  C  CB  . LEU A 1 139 ? 27.398  48.542  60.550  1.00 16.82  ? 139 LEU A CB  1 
ATOM   1115  C  CG  . LEU A 1 139 ? 27.923  48.846  61.945  1.00 18.51  ? 139 LEU A CG  1 
ATOM   1116  C  CD1 . LEU A 1 139 ? 27.735  47.638  62.846  1.00 17.95  ? 139 LEU A CD1 1 
ATOM   1117  C  CD2 . LEU A 1 139 ? 29.384  49.162  61.831  1.00 18.92  ? 139 LEU A CD2 1 
ATOM   1118  N  N   . SER A 1 140 ? 24.624  49.745  61.980  1.00 19.99  ? 140 SER A N   1 
ATOM   1119  C  CA  . SER A 1 140 ? 23.949  50.944  62.474  1.00 18.96  ? 140 SER A CA  1 
ATOM   1120  C  C   . SER A 1 140 ? 24.345  51.148  63.927  1.00 17.27  ? 140 SER A C   1 
ATOM   1121  O  O   . SER A 1 140 ? 24.395  50.203  64.698  1.00 17.21  ? 140 SER A O   1 
ATOM   1122  C  CB  . SER A 1 140 ? 22.432  50.791  62.373  1.00 17.17  ? 140 SER A CB  1 
ATOM   1123  O  OG  . SER A 1 140 ? 22.031  50.641  61.019  1.00 22.77  ? 140 SER A OG  1 
ATOM   1124  N  N   . LEU A 1 141 ? 24.678  52.377  64.276  1.00 17.48  ? 141 LEU A N   1 
ATOM   1125  C  CA  . LEU A 1 141 ? 25.074  52.724  65.634  1.00 17.83  ? 141 LEU A CA  1 
ATOM   1126  C  C   . LEU A 1 141 ? 24.137  53.814  66.111  1.00 19.45  ? 141 LEU A C   1 
ATOM   1127  O  O   . LEU A 1 141 ? 23.835  54.741  65.358  1.00 19.77  ? 141 LEU A O   1 
ATOM   1128  C  CB  . LEU A 1 141 ? 26.490  53.280  65.629  1.00 19.52  ? 141 LEU A CB  1 
ATOM   1129  C  CG  . LEU A 1 141 ? 27.510  52.392  64.923  1.00 23.15  ? 141 LEU A CG  1 
ATOM   1130  C  CD1 . LEU A 1 141 ? 28.826  53.119  64.849  1.00 23.77  ? 141 LEU A CD1 1 
ATOM   1131  C  CD2 . LEU A 1 141 ? 27.667  51.081  65.639  1.00 23.16  ? 141 LEU A CD2 1 
ATOM   1132  N  N   . ALA A 1 142 ? 23.671  53.712  67.351  1.00 19.01  ? 142 ALA A N   1 
ATOM   1133  C  CA  . ALA A 1 142 ? 22.769  54.720  67.915  1.00 16.99  ? 142 ALA A CA  1 
ATOM   1134  C  C   . ALA A 1 142 ? 22.872  54.812  69.437  1.00 15.39  ? 142 ALA A C   1 
ATOM   1135  O  O   . ALA A 1 142 ? 23.311  53.875  70.092  1.00 17.00  ? 142 ALA A O   1 
ATOM   1136  C  CB  . ALA A 1 142 ? 21.321  54.429  67.499  1.00 12.46  ? 142 ALA A CB  1 
ATOM   1137  N  N   . ALA A 1 143 ? 22.504  55.968  69.975  1.00 17.46  ? 143 ALA A N   1 
ATOM   1138  C  CA  . ALA A 1 143 ? 22.508  56.227  71.407  1.00 15.06  ? 143 ALA A CA  1 
ATOM   1139  C  C   . ALA A 1 143 ? 21.197  56.926  71.670  1.00 14.41  ? 143 ALA A C   1 
ATOM   1140  O  O   . ALA A 1 143 ? 20.891  57.914  71.004  1.00 17.57  ? 143 ALA A O   1 
ATOM   1141  C  CB  . ALA A 1 143 ? 23.637  57.146  71.770  1.00 13.24  ? 143 ALA A CB  1 
ATOM   1142  N  N   . THR A 1 144 ? 20.377  56.376  72.550  1.00 11.58  ? 144 THR A N   1 
ATOM   1143  C  CA  . THR A 1 144 ? 19.116  57.015  72.869  1.00 13.44  ? 144 THR A CA  1 
ATOM   1144  C  C   . THR A 1 144 ? 19.006  57.161  74.384  1.00 16.14  ? 144 THR A C   1 
ATOM   1145  O  O   . THR A 1 144 ? 19.837  56.628  75.126  1.00 16.34  ? 144 THR A O   1 
ATOM   1146  C  CB  . THR A 1 144 ? 17.902  56.250  72.308  1.00 12.06  ? 144 THR A CB  1 
ATOM   1147  O  OG1 . THR A 1 144 ? 17.888  54.918  72.820  1.00 13.87  ? 144 THR A OG1 1 
ATOM   1148  C  CG2 . THR A 1 144 ? 17.962  56.181  70.794  1.00 12.88  ? 144 THR A CG2 1 
ATOM   1149  N  N   . ARG A 1 145 ? 18.008  57.917  74.833  1.00 16.57  ? 145 ARG A N   1 
ATOM   1150  C  CA  . ARG A 1 145 ? 17.788  58.155  76.248  1.00 14.20  ? 145 ARG A CA  1 
ATOM   1151  C  C   . ARG A 1 145 ? 16.374  57.892  76.753  1.00 14.68  ? 145 ARG A C   1 
ATOM   1152  O  O   . ARG A 1 145 ? 15.390  58.050  76.023  1.00 15.77  ? 145 ARG A O   1 
ATOM   1153  C  CB  . ARG A 1 145 ? 18.137  59.603  76.600  1.00 15.56  ? 145 ARG A CB  1 
ATOM   1154  C  CG  . ARG A 1 145 ? 17.739  59.969  78.022  1.00 18.61  ? 145 ARG A CG  1 
ATOM   1155  C  CD  . ARG A 1 145 ? 18.640  60.981  78.676  1.00 14.27  ? 145 ARG A CD  1 
ATOM   1156  N  NE  . ARG A 1 145 ? 20.048  60.678  78.448  1.00 8.56   ? 145 ARG A NE  1 
ATOM   1157  C  CZ  . ARG A 1 145 ? 20.923  61.626  78.127  1.00 14.98  ? 145 ARG A CZ  1 
ATOM   1158  N  NH1 . ARG A 1 145 ? 20.500  62.882  78.017  1.00 7.86   ? 145 ARG A NH1 1 
ATOM   1159  N  NH2 . ARG A 1 145 ? 22.197  61.336  77.897  1.00 14.58  ? 145 ARG A NH2 1 
ATOM   1160  N  N   . SER A 1 146 ? 16.299  57.471  78.011  1.00 14.97  ? 146 SER A N   1 
ATOM   1161  C  CA  . SER A 1 146 ? 15.040  57.279  78.708  1.00 14.68  ? 146 SER A CA  1 
ATOM   1162  C  C   . SER A 1 146 ? 15.343  57.834  80.105  1.00 15.53  ? 146 SER A C   1 
ATOM   1163  O  O   . SER A 1 146 ? 16.509  58.048  80.460  1.00 16.36  ? 146 SER A O   1 
ATOM   1164  C  CB  . SER A 1 146 ? 14.608  55.821  78.749  1.00 10.45  ? 146 SER A CB  1 
ATOM   1165  O  OG  . SER A 1 146 ? 15.412  55.070  79.622  1.00 21.62  ? 146 SER A OG  1 
ATOM   1166  N  N   . THR A 1 147 ? 14.307  58.122  80.877  1.00 16.91  ? 147 THR A N   1 
ATOM   1167  C  CA  . THR A 1 147 ? 14.480  58.683  82.207  1.00 13.52  ? 147 THR A CA  1 
ATOM   1168  C  C   . THR A 1 147 ? 13.491  58.079  83.187  1.00 16.85  ? 147 THR A C   1 
ATOM   1169  O  O   . THR A 1 147 ? 12.315  57.873  82.873  1.00 19.32  ? 147 THR A O   1 
ATOM   1170  C  CB  . THR A 1 147 ? 14.288  60.198  82.179  1.00 13.07  ? 147 THR A CB  1 
ATOM   1171  O  OG1 . THR A 1 147 ? 15.228  60.783  81.270  1.00 13.38  ? 147 THR A OG1 1 
ATOM   1172  C  CG2 . THR A 1 147 ? 14.488  60.779  83.538  1.00 12.65  ? 147 THR A CG2 1 
ATOM   1173  N  N   . GLU A 1 148 ? 14.001  57.732  84.356  1.00 18.14  ? 148 GLU A N   1 
ATOM   1174  C  CA  . GLU A 1 148 ? 13.187  57.157  85.407  1.00 16.75  ? 148 GLU A CA  1 
ATOM   1175  C  C   . GLU A 1 148 ? 12.888  58.267  86.371  1.00 17.88  ? 148 GLU A C   1 
ATOM   1176  O  O   . GLU A 1 148 ? 13.658  59.232  86.488  1.00 18.17  ? 148 GLU A O   1 
ATOM   1177  C  CB  . GLU A 1 148 ? 13.951  56.058  86.129  1.00 15.88  ? 148 GLU A CB  1 
ATOM   1178  C  CG  . GLU A 1 148 ? 14.184  54.846  85.288  1.00 18.58  ? 148 GLU A CG  1 
ATOM   1179  C  CD  . GLU A 1 148 ? 15.103  53.873  85.948  1.00 21.74  ? 148 GLU A CD  1 
ATOM   1180  O  OE1 . GLU A 1 148 ? 16.285  54.216  86.147  1.00 19.37  ? 148 GLU A OE1 1 
ATOM   1181  O  OE2 . GLU A 1 148 ? 14.644  52.758  86.256  1.00 20.85  ? 148 GLU A OE2 1 
ATOM   1182  N  N   . ALA A 1 149 ? 11.752  58.149  87.046  1.00 22.21  ? 149 ALA A N   1 
ATOM   1183  C  CA  . ALA A 1 149 ? 11.351  59.140  88.036  1.00 23.76  ? 149 ALA A CA  1 
ATOM   1184  C  C   . ALA A 1 149 ? 12.120  58.876  89.345  1.00 23.48  ? 149 ALA A C   1 
ATOM   1185  O  O   . ALA A 1 149 ? 12.165  57.742  89.840  1.00 25.27  ? 149 ALA A O   1 
ATOM   1186  C  CB  . ALA A 1 149 ? 9.856   59.065  88.254  1.00 21.47  ? 149 ALA A CB  1 
ATOM   1187  N  N   . GLY A 1 150 ? 12.791  59.906  89.847  1.00 23.40  ? 150 GLY A N   1 
ATOM   1188  C  CA  . GLY A 1 150 ? 13.559  59.773  91.068  1.00 21.66  ? 150 GLY A CA  1 
ATOM   1189  C  C   . GLY A 1 150 ? 14.724  58.835  90.843  1.00 22.39  ? 150 GLY A C   1 
ATOM   1190  O  O   . GLY A 1 150 ? 15.184  58.691  89.704  1.00 25.56  ? 150 GLY A O   1 
ATOM   1191  N  N   . GLY A 1 151 ? 15.215  58.221  91.918  1.00 23.18  ? 151 GLY A N   1 
ATOM   1192  C  CA  . GLY A 1 151 ? 16.318  57.284  91.808  1.00 19.13  ? 151 GLY A CA  1 
ATOM   1193  C  C   . GLY A 1 151 ? 17.692  57.867  92.035  1.00 20.23  ? 151 GLY A C   1 
ATOM   1194  O  O   . GLY A 1 151 ? 18.642  57.115  92.215  1.00 22.21  ? 151 GLY A O   1 
ATOM   1195  N  N   . SER A 1 152 ? 17.815  59.187  91.984  1.00 21.64  ? 152 SER A N   1 
ATOM   1196  C  CA  . SER A 1 152 ? 19.101  59.839  92.212  1.00 24.38  ? 152 SER A CA  1 
ATOM   1197  C  C   . SER A 1 152 ? 18.952  60.755  93.423  1.00 26.96  ? 152 SER A C   1 
ATOM   1198  O  O   . SER A 1 152 ? 18.087  61.632  93.440  1.00 26.46  ? 152 SER A O   1 
ATOM   1199  C  CB  . SER A 1 152 ? 19.527  60.621  90.971  1.00 27.55  ? 152 SER A CB  1 
ATOM   1200  O  OG  . SER A 1 152 ? 19.717  59.743  89.870  1.00 27.73  ? 152 SER A OG  1 
ATOM   1201  N  N   . TYR A 1 153 ? 19.788  60.537  94.434  1.00 28.14  ? 153 TYR A N   1 
ATOM   1202  C  CA  . TYR A 1 153 ? 19.722  61.301  95.673  1.00 26.31  ? 153 TYR A CA  1 
ATOM   1203  C  C   . TYR A 1 153 ? 21.042  61.909  96.084  1.00 28.85  ? 153 TYR A C   1 
ATOM   1204  O  O   . TYR A 1 153 ? 22.105  61.364  95.796  1.00 28.33  ? 153 TYR A O   1 
ATOM   1205  C  CB  . TYR A 1 153 ? 19.315  60.377  96.803  1.00 21.01  ? 153 TYR A CB  1 
ATOM   1206  C  CG  . TYR A 1 153 ? 18.212  59.425  96.456  1.00 17.99  ? 153 TYR A CG  1 
ATOM   1207  C  CD1 . TYR A 1 153 ? 18.488  58.166  95.935  1.00 16.56  ? 153 TYR A CD1 1 
ATOM   1208  C  CD2 . TYR A 1 153 ? 16.888  59.766  96.683  1.00 18.98  ? 153 TYR A CD2 1 
ATOM   1209  C  CE1 . TYR A 1 153 ? 17.469  57.269  95.658  1.00 19.31  ? 153 TYR A CE1 1 
ATOM   1210  C  CE2 . TYR A 1 153 ? 15.855  58.875  96.407  1.00 16.77  ? 153 TYR A CE2 1 
ATOM   1211  C  CZ  . TYR A 1 153 ? 16.152  57.633  95.903  1.00 17.89  ? 153 TYR A CZ  1 
ATOM   1212  O  OH  . TYR A 1 153 ? 15.121  56.745  95.679  1.00 25.74  ? 153 TYR A OH  1 
ATOM   1213  N  N   . THR A 1 154 ? 20.967  63.045  96.763  1.00 32.06  ? 154 THR A N   1 
ATOM   1214  C  CA  . THR A 1 154 ? 22.159  63.701  97.281  1.00 36.80  ? 154 THR A CA  1 
ATOM   1215  C  C   . THR A 1 154 ? 22.217  63.247  98.749  1.00 41.05  ? 154 THR A C   1 
ATOM   1216  O  O   . THR A 1 154 ? 21.580  63.840  99.619  1.00 41.61  ? 154 THR A O   1 
ATOM   1217  C  CB  . THR A 1 154 ? 22.040  65.238  97.201  1.00 35.13  ? 154 THR A CB  1 
ATOM   1218  O  OG1 . THR A 1 154 ? 20.666  65.620  97.319  1.00 39.73  ? 154 THR A OG1 1 
ATOM   1219  C  CG2 . THR A 1 154 ? 22.588  65.750  95.890  1.00 35.08  ? 154 THR A CG2 1 
ATOM   1220  N  N   . PHE A 1 155 ? 22.902  62.139  99.003  1.00 44.22  ? 155 PHE A N   1 
ATOM   1221  C  CA  . PHE A 1 155 ? 23.007  61.600  100.352 1.00 46.56  ? 155 PHE A CA  1 
ATOM   1222  C  C   . PHE A 1 155 ? 23.885  62.407  101.292 1.00 51.73  ? 155 PHE A C   1 
ATOM   1223  O  O   . PHE A 1 155 ? 25.035  62.706  100.973 1.00 52.88  ? 155 PHE A O   1 
ATOM   1224  C  CB  . PHE A 1 155 ? 23.518  60.172  100.303 1.00 38.75  ? 155 PHE A CB  1 
ATOM   1225  C  CG  . PHE A 1 155 ? 22.539  59.209  99.736  1.00 34.31  ? 155 PHE A CG  1 
ATOM   1226  C  CD1 . PHE A 1 155 ? 21.313  59.009  100.353 1.00 30.55  ? 155 PHE A CD1 1 
ATOM   1227  C  CD2 . PHE A 1 155 ? 22.839  58.481  98.597  1.00 32.95  ? 155 PHE A CD2 1 
ATOM   1228  C  CE1 . PHE A 1 155 ? 20.394  58.088  99.845  1.00 32.65  ? 155 PHE A CE1 1 
ATOM   1229  C  CE2 . PHE A 1 155 ? 21.927  57.557  98.081  1.00 32.63  ? 155 PHE A CE2 1 
ATOM   1230  C  CZ  . PHE A 1 155 ? 20.703  57.362  98.709  1.00 32.64  ? 155 PHE A CZ  1 
ATOM   1231  N  N   . SER A 1 156 ? 23.331  62.762  102.447 1.00 56.61  ? 156 SER A N   1 
ATOM   1232  C  CA  . SER A 1 156 ? 24.064  63.511  103.462 1.00 60.19  ? 156 SER A CA  1 
ATOM   1233  C  C   . SER A 1 156 ? 24.729  62.516  104.405 1.00 62.29  ? 156 SER A C   1 
ATOM   1234  O  O   . SER A 1 156 ? 25.930  62.588  104.664 1.00 63.84  ? 156 SER A O   1 
ATOM   1235  C  CB  . SER A 1 156 ? 23.120  64.433  104.242 1.00 58.26  ? 156 SER A CB  1 
ATOM   1236  O  OG  . SER A 1 156 ? 22.024  63.723  104.795 1.00 59.76  ? 156 SER A OG  1 
ATOM   1237  N  N   . SER A 1 157 ? 23.945  61.553  104.873 1.00 61.34  ? 157 SER A N   1 
ATOM   1238  C  CA  . SER A 1 157 ? 24.437  60.530  105.783 1.00 64.27  ? 157 SER A CA  1 
ATOM   1239  C  C   . SER A 1 157 ? 23.574  59.276  105.662 1.00 65.02  ? 157 SER A C   1 
ATOM   1240  O  O   . SER A 1 157 ? 22.346  59.358  105.662 1.00 61.59  ? 157 SER A O   1 
ATOM   1241  C  CB  . SER A 1 157 ? 24.416  61.052  107.224 1.00 66.13  ? 157 SER A CB  1 
ATOM   1242  O  OG  . SER A 1 157 ? 24.939  60.095  108.129 0.00 65.46  ? 157 SER A OG  1 
ATOM   1243  N  N   . GLN A 1 158 ? 24.231  58.119  105.589 1.00 68.95  ? 158 GLN A N   1 
ATOM   1244  C  CA  . GLN A 1 158 ? 23.562  56.822  105.450 1.00 71.05  ? 158 GLN A CA  1 
ATOM   1245  C  C   . GLN A 1 158 ? 22.594  56.886  104.273 1.00 69.80  ? 158 GLN A C   1 
ATOM   1246  O  O   . GLN A 1 158 ? 22.995  57.269  103.174 1.00 71.62  ? 158 GLN A O   1 
ATOM   1247  C  CB  . GLN A 1 158 ? 22.852  56.410  106.754 1.00 75.01  ? 158 GLN A CB  1 
ATOM   1248  C  CG  . GLN A 1 158 ? 23.804  56.018  107.898 1.00 81.81  ? 158 GLN A CG  1 
ATOM   1249  C  CD  . GLN A 1 158 ? 23.103  55.325  109.059 1.00 82.86  ? 158 GLN A CD  1 
ATOM   1250  O  OE1 . GLN A 1 158 ? 22.613  54.202  108.922 1.00 82.59  ? 158 GLN A OE1 1 
ATOM   1251  N  NE2 . GLN A 1 158 ? 23.068  55.986  110.214 1.00 85.51  ? 158 GLN A NE2 1 
ATOM   1252  N  N   . ASN A 1 159 ? 21.333  56.526  104.493 1.00 67.79  ? 159 ASN A N   1 
ATOM   1253  C  CA  . ASN A 1 159 ? 20.335  56.576  103.432 1.00 62.61  ? 159 ASN A CA  1 
ATOM   1254  C  C   . ASN A 1 159 ? 19.482  57.833  103.585 1.00 57.36  ? 159 ASN A C   1 
ATOM   1255  O  O   . ASN A 1 159 ? 18.329  57.877  103.172 1.00 52.61  ? 159 ASN A O   1 
ATOM   1256  C  CB  . ASN A 1 159 ? 19.468  55.309  103.421 1.00 66.90  ? 159 ASN A CB  1 
ATOM   1257  C  CG  . ASN A 1 159 ? 18.664  55.127  104.697 1.00 73.28  ? 159 ASN A CG  1 
ATOM   1258  O  OD1 . ASN A 1 159 ? 18.985  55.702  105.736 1.00 80.35  ? 159 ASN A OD1 1 
ATOM   1259  N  ND2 . ASN A 1 159 ? 17.618  54.308  104.627 1.00 77.15  ? 159 ASN A ND2 1 
ATOM   1260  N  N   . ILE A 1 160 ? 20.060  58.861  104.184 1.00 54.27  ? 160 ILE A N   1 
ATOM   1261  C  CA  . ILE A 1 160 ? 19.344  60.103  104.364 1.00 52.89  ? 160 ILE A CA  1 
ATOM   1262  C  C   . ILE A 1 160 ? 19.862  61.022  103.274 1.00 49.25  ? 160 ILE A C   1 
ATOM   1263  O  O   . ILE A 1 160 ? 21.081  61.122  103.046 1.00 45.85  ? 160 ILE A O   1 
ATOM   1264  C  CB  . ILE A 1 160 ? 19.591  60.701  105.754 1.00 56.29  ? 160 ILE A CB  1 
ATOM   1265  C  CG1 . ILE A 1 160 ? 19.195  59.685  106.824 1.00 57.92  ? 160 ILE A CG1 1 
ATOM   1266  C  CG2 . ILE A 1 160 ? 18.789  61.981  105.924 1.00 54.68  ? 160 ILE A CG2 1 
ATOM   1267  C  CD1 . ILE A 1 160 ? 19.767  59.983  108.187 1.00 62.63  ? 160 ILE A CD1 1 
ATOM   1268  N  N   . TYR A 1 161 ? 18.939  61.675  102.583 1.00 44.24  ? 161 TYR A N   1 
ATOM   1269  C  CA  . TYR A 1 161 ? 19.316  62.551  101.495 1.00 41.21  ? 161 TYR A CA  1 
ATOM   1270  C  C   . TYR A 1 161 ? 18.613  63.894  101.569 1.00 42.02  ? 161 TYR A C   1 
ATOM   1271  O  O   . TYR A 1 161 ? 17.556  64.018  102.194 1.00 41.01  ? 161 TYR A O   1 
ATOM   1272  C  CB  . TYR A 1 161 ? 18.998  61.870  100.155 1.00 33.14  ? 161 TYR A CB  1 
ATOM   1273  C  CG  . TYR A 1 161 ? 17.512  61.676  99.891  1.00 24.51  ? 161 TYR A CG  1 
ATOM   1274  C  CD1 . TYR A 1 161 ? 16.751  62.701  99.323  1.00 23.54  ? 161 TYR A CD1 1 
ATOM   1275  C  CD2 . TYR A 1 161 ? 16.865  60.481  100.215 1.00 21.41  ? 161 TYR A CD2 1 
ATOM   1276  C  CE1 . TYR A 1 161 ? 15.393  62.551  99.086  1.00 18.40  ? 161 TYR A CE1 1 
ATOM   1277  C  CE2 . TYR A 1 161 ? 15.489  60.320  99.976  1.00 18.97  ? 161 TYR A CE2 1 
ATOM   1278  C  CZ  . TYR A 1 161 ? 14.768  61.368  99.410  1.00 20.24  ? 161 TYR A CZ  1 
ATOM   1279  O  OH  . TYR A 1 161 ? 13.416  61.257  99.163  1.00 28.97  ? 161 TYR A OH  1 
ATOM   1280  N  N   . ASP A 1 162 ? 19.205  64.887  100.912 1.00 45.26  ? 162 ASP A N   1 
ATOM   1281  C  CA  . ASP A 1 162 ? 18.645  66.228  100.850 1.00 50.56  ? 162 ASP A CA  1 
ATOM   1282  C  C   . ASP A 1 162 ? 17.715  66.342  99.634  1.00 52.25  ? 162 ASP A C   1 
ATOM   1283  O  O   . ASP A 1 162 ? 16.539  66.685  99.779  1.00 54.47  ? 162 ASP A O   1 
ATOM   1284  C  CB  . ASP A 1 162 ? 19.759  67.282  100.735 1.00 58.10  ? 162 ASP A CB  1 
ATOM   1285  C  CG  . ASP A 1 162 ? 20.810  67.158  101.829 1.00 67.42  ? 162 ASP A CG  1 
ATOM   1286  O  OD1 . ASP A 1 162 ? 20.435  66.987  103.013 1.00 73.09  ? 162 ASP A OD1 1 
ATOM   1287  O  OD2 . ASP A 1 162 ? 22.016  67.240  101.500 1.00 70.84  ? 162 ASP A OD2 1 
ATOM   1288  N  N   . GLU A 1 163 ? 18.234  66.024  98.443  1.00 50.83  ? 163 GLU A N   1 
ATOM   1289  C  CA  . GLU A 1 163 ? 17.455  66.117  97.205  1.00 47.81  ? 163 GLU A CA  1 
ATOM   1290  C  C   . GLU A 1 163 ? 17.394  64.853  96.359  1.00 41.88  ? 163 GLU A C   1 
ATOM   1291  O  O   . GLU A 1 163 ? 18.320  64.026  96.367  1.00 39.30  ? 163 GLU A O   1 
ATOM   1292  C  CB  . GLU A 1 163 ? 17.991  67.246  96.332  1.00 53.30  ? 163 GLU A CB  1 
ATOM   1293  C  CG  . GLU A 1 163 ? 17.943  68.612  96.980  1.00 66.15  ? 163 GLU A CG  1 
ATOM   1294  C  CD  . GLU A 1 163 ? 19.165  69.449  96.642  1.00 75.72  ? 163 GLU A CD  1 
ATOM   1295  O  OE1 . GLU A 1 163 ? 20.270  69.127  97.142  1.00 78.26  ? 163 GLU A OE1 1 
ATOM   1296  O  OE2 . GLU A 1 163 ? 19.021  70.424  95.872  1.00 83.28  ? 163 GLU A OE2 1 
ATOM   1297  N  N   . VAL A 1 164 ? 16.286  64.726  95.633  1.00 37.60  ? 164 VAL A N   1 
ATOM   1298  C  CA  . VAL A 1 164 ? 16.051  63.611  94.727  1.00 37.78  ? 164 VAL A CA  1 
ATOM   1299  C  C   . VAL A 1 164 ? 16.108  64.226  93.346  1.00 37.85  ? 164 VAL A C   1 
ATOM   1300  O  O   . VAL A 1 164 ? 15.924  65.437  93.191  1.00 41.12  ? 164 VAL A O   1 
ATOM   1301  C  CB  . VAL A 1 164 ? 14.644  63.009  94.841  1.00 36.12  ? 164 VAL A CB  1 
ATOM   1302  C  CG1 . VAL A 1 164 ? 14.700  61.519  94.568  1.00 33.28  ? 164 VAL A CG1 1 
ATOM   1303  C  CG2 . VAL A 1 164 ? 14.022  63.317  96.174  1.00 44.79  ? 164 VAL A CG2 1 
ATOM   1304  N  N   . LYS A 1 165 ? 16.267  63.380  92.340  1.00 35.84  ? 165 LYS A N   1 
ATOM   1305  C  CA  . LYS A 1 165 ? 16.350  63.828  90.960  1.00 28.87  ? 165 LYS A CA  1 
ATOM   1306  C  C   . LYS A 1 165 ? 15.964  62.634  90.100  1.00 29.75  ? 165 LYS A C   1 
ATOM   1307  O  O   . LYS A 1 165 ? 16.072  61.483  90.551  1.00 28.41  ? 165 LYS A O   1 
ATOM   1308  C  CB  . LYS A 1 165 ? 17.799  64.179  90.658  1.00 27.86  ? 165 LYS A CB  1 
ATOM   1309  C  CG  . LYS A 1 165 ? 18.005  65.362  89.792  1.00 29.08  ? 165 LYS A CG  1 
ATOM   1310  C  CD  . LYS A 1 165 ? 19.454  65.409  89.382  1.00 31.58  ? 165 LYS A CD  1 
ATOM   1311  C  CE  . LYS A 1 165 ? 19.725  64.339  88.358  1.00 38.10  ? 165 LYS A CE  1 
ATOM   1312  N  NZ  . LYS A 1 165 ? 19.232  64.734  87.012  1.00 31.80  ? 165 LYS A NZ  1 
ATOM   1313  N  N   . ASP A 1 166 ? 15.505  62.898  88.880  1.00 27.56  ? 166 ASP A N   1 
ATOM   1314  C  CA  . ASP A 1 166 ? 15.147  61.823  87.966  1.00 23.21  ? 166 ASP A CA  1 
ATOM   1315  C  C   . ASP A 1 166 ? 16.440  61.247  87.410  1.00 21.54  ? 166 ASP A C   1 
ATOM   1316  O  O   . ASP A 1 166 ? 17.429  61.966  87.248  1.00 21.00  ? 166 ASP A O   1 
ATOM   1317  C  CB  . ASP A 1 166 ? 14.268  62.341  86.843  1.00 25.71  ? 166 ASP A CB  1 
ATOM   1318  C  CG  . ASP A 1 166 ? 12.905  62.778  87.327  1.00 31.62  ? 166 ASP A CG  1 
ATOM   1319  O  OD1 . ASP A 1 166 ? 12.435  62.278  88.367  1.00 33.69  ? 166 ASP A OD1 1 
ATOM   1320  O  OD2 . ASP A 1 166 ? 12.293  63.630  86.656  1.00 42.58  ? 166 ASP A OD2 1 
ATOM   1321  N  N   . THR A 1 167 ? 16.418  59.965  87.081  1.00 16.21  ? 167 THR A N   1 
ATOM   1322  C  CA  . THR A 1 167 ? 17.610  59.297  86.599  1.00 17.04  ? 167 THR A CA  1 
ATOM   1323  C  C   . THR A 1 167 ? 17.623  59.004  85.097  1.00 19.19  ? 167 THR A C   1 
ATOM   1324  O  O   . THR A 1 167 ? 16.766  58.274  84.579  1.00 20.47  ? 167 THR A O   1 
ATOM   1325  C  CB  . THR A 1 167 ? 17.803  57.988  87.397  1.00 16.26  ? 167 THR A CB  1 
ATOM   1326  O  OG1 . THR A 1 167 ? 17.632  58.270  88.794  1.00 14.64  ? 167 THR A OG1 1 
ATOM   1327  C  CG2 . THR A 1 167 ? 19.197  57.392  87.163  1.00 14.14  ? 167 THR A CG2 1 
ATOM   1328  N  N   . ALA A 1 168 ? 18.614  59.562  84.406  1.00 17.21  ? 168 ALA A N   1 
ATOM   1329  C  CA  . ALA A 1 168 ? 18.792  59.359  82.971  1.00 14.80  ? 168 ALA A CA  1 
ATOM   1330  C  C   . ALA A 1 168 ? 19.403  57.985  82.720  1.00 18.44  ? 168 ALA A C   1 
ATOM   1331  O  O   . ALA A 1 168 ? 20.325  57.582  83.418  1.00 24.50  ? 168 ALA A O   1 
ATOM   1332  C  CB  . ALA A 1 168 ? 19.712  60.430  82.410  1.00 10.65  ? 168 ALA A CB  1 
ATOM   1333  N  N   . ASN A 1 169 ? 18.876  57.252  81.749  1.00 19.03  ? 169 ASN A N   1 
ATOM   1334  C  CA  . ASN A 1 169 ? 19.417  55.940  81.394  1.00 18.36  ? 169 ASN A CA  1 
ATOM   1335  C  C   . ASN A 1 169 ? 19.829  55.980  79.919  1.00 20.50  ? 169 ASN A C   1 
ATOM   1336  O  O   . ASN A 1 169 ? 18.990  56.183  79.043  1.00 26.10  ? 169 ASN A O   1 
ATOM   1337  C  CB  . ASN A 1 169 ? 18.374  54.848  81.593  1.00 15.48  ? 169 ASN A CB  1 
ATOM   1338  C  CG  . ASN A 1 169 ? 18.140  54.519  83.043  1.00 18.75  ? 169 ASN A CG  1 
ATOM   1339  O  OD1 . ASN A 1 169 ? 18.587  53.485  83.536  1.00 20.88  ? 169 ASN A OD1 1 
ATOM   1340  N  ND2 . ASN A 1 169 ? 17.422  55.390  83.739  1.00 18.60  ? 169 ASN A ND2 1 
ATOM   1341  N  N   . ASP A 1 170 ? 21.115  55.795  79.646  1.00 19.74  ? 170 ASP A N   1 
ATOM   1342  C  CA  . ASP A 1 170 ? 21.634  55.841  78.286  1.00 16.31  ? 170 ASP A CA  1 
ATOM   1343  C  C   . ASP A 1 170 ? 21.709  54.457  77.707  1.00 17.91  ? 170 ASP A C   1 
ATOM   1344  O  O   . ASP A 1 170 ? 22.067  53.522  78.410  1.00 21.01  ? 170 ASP A O   1 
ATOM   1345  C  CB  . ASP A 1 170 ? 23.053  56.406  78.279  1.00 15.44  ? 170 ASP A CB  1 
ATOM   1346  C  CG  . ASP A 1 170 ? 23.113  57.879  78.649  1.00 20.27  ? 170 ASP A CG  1 
ATOM   1347  O  OD1 . ASP A 1 170 ? 22.123  58.612  78.432  1.00 22.52  ? 170 ASP A OD1 1 
ATOM   1348  O  OD2 . ASP A 1 170 ? 24.177  58.310  79.143  1.00 23.01  ? 170 ASP A OD2 1 
ATOM   1349  N  N   . VAL A 1 171 ? 21.386  54.330  76.424  1.00 18.81  ? 171 VAL A N   1 
ATOM   1350  C  CA  . VAL A 1 171 ? 21.470  53.053  75.723  1.00 18.07  ? 171 VAL A CA  1 
ATOM   1351  C  C   . VAL A 1 171 ? 22.371  53.265  74.515  1.00 19.19  ? 171 VAL A C   1 
ATOM   1352  O  O   . VAL A 1 171 ? 22.269  54.283  73.830  1.00 18.38  ? 171 VAL A O   1 
ATOM   1353  C  CB  . VAL A 1 171 ? 20.113  52.562  75.199  1.00 17.79  ? 171 VAL A CB  1 
ATOM   1354  C  CG1 . VAL A 1 171 ? 20.268  51.195  74.583  1.00 17.03  ? 171 VAL A CG1 1 
ATOM   1355  C  CG2 . VAL A 1 171 ? 19.120  52.496  76.317  1.00 26.42  ? 171 VAL A CG2 1 
ATOM   1356  N  N   . PHE A 1 172 ? 23.293  52.332  74.307  1.00 19.18  ? 172 PHE A N   1 
ATOM   1357  C  CA  . PHE A 1 172 ? 24.226  52.373  73.191  1.00 18.96  ? 172 PHE A CA  1 
ATOM   1358  C  C   . PHE A 1 172 ? 23.888  51.105  72.442  1.00 19.87  ? 172 PHE A C   1 
ATOM   1359  O  O   . PHE A 1 172 ? 23.969  49.994  72.983  1.00 17.05  ? 172 PHE A O   1 
ATOM   1360  C  CB  . PHE A 1 172 ? 25.645  52.399  73.713  1.00 22.25  ? 172 PHE A CB  1 
ATOM   1361  C  CG  . PHE A 1 172 ? 25.870  53.484  74.729  1.00 34.40  ? 172 PHE A CG  1 
ATOM   1362  C  CD1 . PHE A 1 172 ? 26.096  54.801  74.317  1.00 35.40  ? 172 PHE A CD1 1 
ATOM   1363  C  CD2 . PHE A 1 172 ? 25.791  53.208  76.104  1.00 36.44  ? 172 PHE A CD2 1 
ATOM   1364  C  CE1 . PHE A 1 172 ? 26.238  55.832  75.251  1.00 34.96  ? 172 PHE A CE1 1 
ATOM   1365  C  CE2 . PHE A 1 172 ? 25.931  54.222  77.049  1.00 35.13  ? 172 PHE A CE2 1 
ATOM   1366  C  CZ  . PHE A 1 172 ? 26.155  55.543  76.622  1.00 35.26  ? 172 PHE A CZ  1 
ATOM   1367  N  N   . ASP A 1 173 ? 23.438  51.310  71.208  1.00 20.36  ? 173 ASP A N   1 
ATOM   1368  C  CA  . ASP A 1 173 ? 22.924  50.264  70.342  1.00 18.72  ? 173 ASP A CA  1 
ATOM   1369  C  C   . ASP A 1 173 ? 23.732  50.031  69.061  1.00 18.55  ? 173 ASP A C   1 
ATOM   1370  O  O   . ASP A 1 173 ? 24.102  50.980  68.362  1.00 18.77  ? 173 ASP A O   1 
ATOM   1371  C  CB  . ASP A 1 173 ? 21.469  50.663  70.045  1.00 18.38  ? 173 ASP A CB  1 
ATOM   1372  C  CG  . ASP A 1 173 ? 20.759  49.715  69.137  1.00 20.19  ? 173 ASP A CG  1 
ATOM   1373  O  OD1 . ASP A 1 173 ? 20.900  49.865  67.912  1.00 23.29  ? 173 ASP A OD1 1 
ATOM   1374  O  OD2 . ASP A 1 173 ? 20.001  48.865  69.636  1.00 19.78  ? 173 ASP A OD2 1 
ATOM   1375  N  N   . VAL A 1 174 ? 24.003  48.757  68.770  1.00 16.95  ? 174 VAL A N   1 
ATOM   1376  C  CA  . VAL A 1 174 ? 24.756  48.355  67.585  1.00 15.87  ? 174 VAL A CA  1 
ATOM   1377  C  C   . VAL A 1 174 ? 24.010  47.218  66.904  1.00 17.08  ? 174 VAL A C   1 
ATOM   1378  O  O   . VAL A 1 174 ? 23.605  46.252  67.544  1.00 18.41  ? 174 VAL A O   1 
ATOM   1379  C  CB  . VAL A 1 174 ? 26.167  47.874  67.954  1.00 18.02  ? 174 VAL A CB  1 
ATOM   1380  C  CG1 . VAL A 1 174 ? 26.991  47.660  66.704  1.00 14.57  ? 174 VAL A CG1 1 
ATOM   1381  C  CG2 . VAL A 1 174 ? 26.840  48.884  68.831  1.00 18.71  ? 174 VAL A CG2 1 
ATOM   1382  N  N   . ARG A 1 175 ? 23.789  47.352  65.610  1.00 17.09  ? 175 ARG A N   1 
ATOM   1383  C  CA  . ARG A 1 175 ? 23.066  46.338  64.867  1.00 15.23  ? 175 ARG A CA  1 
ATOM   1384  C  C   . ARG A 1 175 ? 23.755  46.031  63.542  1.00 18.16  ? 175 ARG A C   1 
ATOM   1385  O  O   . ARG A 1 175 ? 24.316  46.916  62.887  1.00 16.80  ? 175 ARG A O   1 
ATOM   1386  C  CB  . ARG A 1 175 ? 21.635  46.817  64.597  1.00 15.92  ? 175 ARG A CB  1 
ATOM   1387  C  CG  . ARG A 1 175 ? 20.741  46.793  65.809  1.00 19.09  ? 175 ARG A CG  1 
ATOM   1388  C  CD  . ARG A 1 175 ? 19.916  48.062  65.942  1.00 15.96  ? 175 ARG A CD  1 
ATOM   1389  N  NE  . ARG A 1 175 ? 18.493  47.807  65.843  1.00 17.55  ? 175 ARG A NE  1 
ATOM   1390  C  CZ  . ARG A 1 175 ? 17.572  48.164  66.734  1.00 16.76  ? 175 ARG A CZ  1 
ATOM   1391  N  NH1 . ARG A 1 175 ? 17.877  48.809  67.855  1.00 10.97  ? 175 ARG A NH1 1 
ATOM   1392  N  NH2 . ARG A 1 175 ? 16.306  47.897  66.465  1.00 21.06  ? 175 ARG A NH2 1 
ATOM   1393  N  N   . LEU A 1 176 ? 23.714  44.762  63.162  1.00 19.35  ? 176 LEU A N   1 
ATOM   1394  C  CA  . LEU A 1 176 ? 24.288  44.291  61.911  1.00 17.32  ? 176 LEU A CA  1 
ATOM   1395  C  C   . LEU A 1 176 ? 23.143  43.534  61.265  1.00 17.28  ? 176 LEU A C   1 
ATOM   1396  O  O   . LEU A 1 176 ? 22.673  42.516  61.786  1.00 19.07  ? 176 LEU A O   1 
ATOM   1397  C  CB  . LEU A 1 176 ? 25.472  43.361  62.179  1.00 20.41  ? 176 LEU A CB  1 
ATOM   1398  C  CG  . LEU A 1 176 ? 26.240  42.861  60.950  1.00 22.88  ? 176 LEU A CG  1 
ATOM   1399  C  CD1 . LEU A 1 176 ? 26.724  44.015  60.089  1.00 21.88  ? 176 LEU A CD1 1 
ATOM   1400  C  CD2 . LEU A 1 176 ? 27.412  42.028  61.411  1.00 22.30  ? 176 LEU A CD2 1 
ATOM   1401  N  N   . ALA A 1 177 ? 22.631  44.084  60.174  1.00 18.24  ? 177 ALA A N   1 
ATOM   1402  C  CA  . ALA A 1 177 ? 21.502  43.469  59.492  1.00 19.01  ? 177 ALA A CA  1 
ATOM   1403  C  C   . ALA A 1 177 ? 21.826  43.026  58.079  1.00 19.79  ? 177 ALA A C   1 
ATOM   1404  O  O   . ALA A 1 177 ? 22.831  43.439  57.501  1.00 20.11  ? 177 ALA A O   1 
ATOM   1405  C  CB  . ALA A 1 177 ? 20.325  44.442  59.469  1.00 16.64  ? 177 ALA A CB  1 
ATOM   1406  N  N   . GLY A 1 178 ? 20.951  42.197  57.522  1.00 22.17  ? 178 GLY A N   1 
ATOM   1407  C  CA  . GLY A 1 178 ? 21.140  41.735  56.166  1.00 24.48  ? 178 GLY A CA  1 
ATOM   1408  C  C   . GLY A 1 178 ? 22.130  40.608  55.964  1.00 26.89  ? 178 GLY A C   1 
ATOM   1409  O  O   . GLY A 1 178 ? 22.675  40.465  54.873  1.00 32.62  ? 178 GLY A O   1 
ATOM   1410  N  N   . LEU A 1 179 ? 22.393  39.815  56.993  1.00 28.51  ? 179 LEU A N   1 
ATOM   1411  C  CA  . LEU A 1 179 ? 23.307  38.696  56.828  1.00 27.35  ? 179 LEU A CA  1 
ATOM   1412  C  C   . LEU A 1 179 ? 22.533  37.599  56.115  1.00 29.15  ? 179 LEU A C   1 
ATOM   1413  O  O   . LEU A 1 179 ? 21.536  37.096  56.638  1.00 29.31  ? 179 LEU A O   1 
ATOM   1414  C  CB  . LEU A 1 179 ? 23.808  38.187  58.179  1.00 24.23  ? 179 LEU A CB  1 
ATOM   1415  C  CG  . LEU A 1 179 ? 24.541  39.216  59.034  1.00 24.43  ? 179 LEU A CG  1 
ATOM   1416  C  CD1 . LEU A 1 179 ? 24.824  38.628  60.400  1.00 22.74  ? 179 LEU A CD1 1 
ATOM   1417  C  CD2 . LEU A 1 179 ? 25.824  39.669  58.358  1.00 22.97  ? 179 LEU A CD2 1 
ATOM   1418  N  N   . GLN A 1 180 ? 22.932  37.302  54.883  1.00 32.53  ? 180 GLN A N   1 
ATOM   1419  C  CA  . GLN A 1 180 ? 22.284  36.264  54.090  1.00 35.54  ? 180 GLN A CA  1 
ATOM   1420  C  C   . GLN A 1 180 ? 22.731  34.911  54.626  1.00 33.73  ? 180 GLN A C   1 
ATOM   1421  O  O   . GLN A 1 180 ? 23.855  34.483  54.382  1.00 34.58  ? 180 GLN A O   1 
ATOM   1422  C  CB  . GLN A 1 180 ? 22.675  36.405  52.615  1.00 42.92  ? 180 GLN A CB  1 
ATOM   1423  C  CG  . GLN A 1 180 ? 21.810  37.377  51.802  1.00 59.71  ? 180 GLN A CG  1 
ATOM   1424  C  CD  . GLN A 1 180 ? 20.351  36.914  51.644  1.00 72.01  ? 180 GLN A CD  1 
ATOM   1425  O  OE1 . GLN A 1 180 ? 19.447  37.737  51.467  1.00 78.88  ? 180 GLN A OE1 1 
ATOM   1426  N  NE2 . GLN A 1 180 ? 20.122  35.598  51.682  1.00 73.21  ? 180 GLN A NE2 1 
ATOM   1427  N  N   . THR A 1 181 ? 21.867  34.237  55.369  1.00 31.76  ? 181 THR A N   1 
ATOM   1428  C  CA  . THR A 1 181 ? 22.241  32.949  55.937  1.00 31.30  ? 181 THR A CA  1 
ATOM   1429  C  C   . THR A 1 181 ? 21.846  31.743  55.101  1.00 33.05  ? 181 THR A C   1 
ATOM   1430  O  O   . THR A 1 181 ? 22.486  30.701  55.148  1.00 36.45  ? 181 THR A O   1 
ATOM   1431  C  CB  . THR A 1 181 ? 21.670  32.791  57.340  1.00 27.70  ? 181 THR A CB  1 
ATOM   1432  O  OG1 . THR A 1 181 ? 20.261  33.066  57.320  1.00 32.04  ? 181 THR A OG1 1 
ATOM   1433  C  CG2 . THR A 1 181 ? 22.364  33.742  58.274  1.00 24.27  ? 181 THR A CG2 1 
ATOM   1434  N  N   . ASN A 1 182 ? 20.796  31.887  54.320  1.00 33.48  ? 182 ASN A N   1 
ATOM   1435  C  CA  . ASN A 1 182 ? 20.319  30.792  53.506  1.00 32.64  ? 182 ASN A CA  1 
ATOM   1436  C  C   . ASN A 1 182 ? 19.407  31.418  52.476  1.00 35.69  ? 182 ASN A C   1 
ATOM   1437  O  O   . ASN A 1 182 ? 19.081  32.601  52.569  1.00 39.46  ? 182 ASN A O   1 
ATOM   1438  C  CB  . ASN A 1 182 ? 19.549  29.796  54.386  1.00 30.58  ? 182 ASN A CB  1 
ATOM   1439  C  CG  . ASN A 1 182 ? 18.354  30.425  55.080  1.00 29.56  ? 182 ASN A CG  1 
ATOM   1440  O  OD1 . ASN A 1 182 ? 18.507  31.284  55.947  1.00 31.79  ? 182 ASN A OD1 1 
ATOM   1441  N  ND2 . ASN A 1 182 ? 17.163  30.007  54.699  1.00 31.17  ? 182 ASN A ND2 1 
ATOM   1442  N  N   . PRO A 1 183 ? 19.024  30.661  51.443  1.00 37.66  ? 183 PRO A N   1 
ATOM   1443  C  CA  . PRO A 1 183 ? 18.136  31.216  50.413  1.00 37.24  ? 183 PRO A CA  1 
ATOM   1444  C  C   . PRO A 1 183 ? 16.842  31.789  51.001  1.00 34.77  ? 183 PRO A C   1 
ATOM   1445  O  O   . PRO A 1 183 ? 16.103  31.083  51.702  1.00 34.27  ? 183 PRO A O   1 
ATOM   1446  C  CB  . PRO A 1 183 ? 17.881  30.011  49.494  1.00 38.37  ? 183 PRO A CB  1 
ATOM   1447  C  CG  . PRO A 1 183 ? 18.188  28.809  50.378  1.00 39.67  ? 183 PRO A CG  1 
ATOM   1448  C  CD  . PRO A 1 183 ? 19.385  29.268  51.135  1.00 36.06  ? 183 PRO A CD  1 
ATOM   1449  N  N   . ASP A 1 184 ? 16.602  33.078  50.740  1.00 32.61  ? 184 ASP A N   1 
ATOM   1450  C  CA  . ASP A 1 184 ? 15.423  33.792  51.232  1.00 32.16  ? 184 ASP A CA  1 
ATOM   1451  C  C   . ASP A 1 184 ? 15.421  33.977  52.751  1.00 29.74  ? 184 ASP A C   1 
ATOM   1452  O  O   . ASP A 1 184 ? 14.390  34.293  53.342  1.00 29.81  ? 184 ASP A O   1 
ATOM   1453  C  CB  . ASP A 1 184 ? 14.134  33.084  50.795  1.00 37.58  ? 184 ASP A CB  1 
ATOM   1454  C  CG  . ASP A 1 184 ? 13.924  33.112  49.283  1.00 41.89  ? 184 ASP A CG  1 
ATOM   1455  O  OD1 . ASP A 1 184 ? 14.270  34.132  48.648  1.00 37.51  ? 184 ASP A OD1 1 
ATOM   1456  O  OD2 . ASP A 1 184 ? 13.403  32.112  48.733  1.00 46.59  ? 184 ASP A OD2 1 
ATOM   1457  N  N   . GLY A 1 185 ? 16.573  33.773  53.375  1.00 25.80  ? 185 GLY A N   1 
ATOM   1458  C  CA  . GLY A 1 185 ? 16.672  33.926  54.808  1.00 22.65  ? 185 GLY A CA  1 
ATOM   1459  C  C   . GLY A 1 185 ? 17.713  34.978  55.107  1.00 22.42  ? 185 GLY A C   1 
ATOM   1460  O  O   . GLY A 1 185 ? 18.765  35.023  54.466  1.00 25.11  ? 185 GLY A O   1 
ATOM   1461  N  N   . VAL A 1 186 ? 17.421  35.841  56.065  1.00 22.32  ? 186 VAL A N   1 
ATOM   1462  C  CA  . VAL A 1 186 ? 18.336  36.907  56.448  1.00 21.57  ? 186 VAL A CA  1 
ATOM   1463  C  C   . VAL A 1 186 ? 18.402  36.965  57.969  1.00 20.94  ? 186 VAL A C   1 
ATOM   1464  O  O   . VAL A 1 186 ? 17.416  36.660  58.656  1.00 22.08  ? 186 VAL A O   1 
ATOM   1465  C  CB  . VAL A 1 186 ? 17.866  38.253  55.882  1.00 20.86  ? 186 VAL A CB  1 
ATOM   1466  C  CG1 . VAL A 1 186 ? 18.661  39.376  56.471  1.00 32.56  ? 186 VAL A CG1 1 
ATOM   1467  C  CG2 . VAL A 1 186 ? 18.063  38.266  54.399  1.00 27.85  ? 186 VAL A CG2 1 
ATOM   1468  N  N   . LEU A 1 187 ? 19.559  37.359  58.487  1.00 19.47  ? 187 LEU A N   1 
ATOM   1469  C  CA  . LEU A 1 187 ? 19.773  37.430  59.921  1.00 16.52  ? 187 LEU A CA  1 
ATOM   1470  C  C   . LEU A 1 187 ? 20.237  38.800  60.346  1.00 17.40  ? 187 LEU A C   1 
ATOM   1471  O  O   . LEU A 1 187 ? 21.047  39.416  59.665  1.00 18.83  ? 187 LEU A O   1 
ATOM   1472  C  CB  . LEU A 1 187 ? 20.842  36.414  60.326  1.00 15.40  ? 187 LEU A CB  1 
ATOM   1473  C  CG  . LEU A 1 187 ? 21.226  36.319  61.807  1.00 18.11  ? 187 LEU A CG  1 
ATOM   1474  C  CD1 . LEU A 1 187 ? 20.092  35.736  62.598  1.00 14.19  ? 187 LEU A CD1 1 
ATOM   1475  C  CD2 . LEU A 1 187 ? 22.449  35.469  61.968  1.00 18.37  ? 187 LEU A CD2 1 
ATOM   1476  N  N   . GLU A 1 188 ? 19.730  39.258  61.488  1.00 16.71  ? 188 GLU A N   1 
ATOM   1477  C  CA  . GLU A 1 188 ? 20.114  40.545  62.065  1.00 13.73  ? 188 GLU A CA  1 
ATOM   1478  C  C   . GLU A 1 188 ? 20.538  40.299  63.500  1.00 15.89  ? 188 GLU A C   1 
ATOM   1479  O  O   . GLU A 1 188 ? 19.857  39.578  64.245  1.00 12.86  ? 188 GLU A O   1 
ATOM   1480  C  CB  . GLU A 1 188 ? 18.950  41.537  62.062  1.00 13.98  ? 188 GLU A CB  1 
ATOM   1481  C  CG  . GLU A 1 188 ? 19.243  42.802  62.870  1.00 11.34  ? 188 GLU A CG  1 
ATOM   1482  C  CD  . GLU A 1 188 ? 18.183  43.870  62.705  1.00 15.76  ? 188 GLU A CD  1 
ATOM   1483  O  OE1 . GLU A 1 188 ? 17.019  43.531  62.457  1.00 16.72  ? 188 GLU A OE1 1 
ATOM   1484  O  OE2 . GLU A 1 188 ? 18.511  45.065  62.830  1.00 13.02  ? 188 GLU A OE2 1 
ATOM   1485  N  N   . LEU A 1 189 ? 21.675  40.875  63.871  1.00 17.85  ? 189 LEU A N   1 
ATOM   1486  C  CA  . LEU A 1 189 ? 22.225  40.757  65.220  1.00 17.93  ? 189 LEU A CA  1 
ATOM   1487  C  C   . LEU A 1 189 ? 22.244  42.142  65.845  1.00 19.02  ? 189 LEU A C   1 
ATOM   1488  O  O   . LEU A 1 189 ? 22.506  43.132  65.161  1.00 19.93  ? 189 LEU A O   1 
ATOM   1489  C  CB  . LEU A 1 189 ? 23.663  40.238  65.157  1.00 18.73  ? 189 LEU A CB  1 
ATOM   1490  C  CG  . LEU A 1 189 ? 24.019  38.743  65.165  1.00 21.23  ? 189 LEU A CG  1 
ATOM   1491  C  CD1 . LEU A 1 189 ? 22.798  37.861  65.089  1.00 19.69  ? 189 LEU A CD1 1 
ATOM   1492  C  CD2 . LEU A 1 189 ? 24.987  38.443  64.041  1.00 16.88  ? 189 LEU A CD2 1 
ATOM   1493  N  N   . GLY A 1 190 ? 21.984  42.221  67.139  1.00 17.78  ? 190 GLY A N   1 
ATOM   1494  C  CA  . GLY A 1 190 ? 22.010  43.510  67.805  1.00 18.40  ? 190 GLY A CA  1 
ATOM   1495  C  C   . GLY A 1 190 ? 22.465  43.373  69.245  1.00 20.35  ? 190 GLY A C   1 
ATOM   1496  O  O   . GLY A 1 190 ? 22.221  42.341  69.874  1.00 20.57  ? 190 GLY A O   1 
ATOM   1497  N  N   . VAL A 1 191 ? 23.166  44.386  69.748  1.00 20.89  ? 191 VAL A N   1 
ATOM   1498  C  CA  . VAL A 1 191 ? 23.651  44.414  71.130  1.00 22.19  ? 191 VAL A CA  1 
ATOM   1499  C  C   . VAL A 1 191 ? 23.261  45.752  71.725  1.00 22.79  ? 191 VAL A C   1 
ATOM   1500  O  O   . VAL A 1 191 ? 23.384  46.785  71.073  1.00 23.38  ? 191 VAL A O   1 
ATOM   1501  C  CB  . VAL A 1 191 ? 25.196  44.313  71.223  1.00 23.02  ? 191 VAL A CB  1 
ATOM   1502  C  CG1 . VAL A 1 191 ? 25.647  44.448  72.669  1.00 22.95  ? 191 VAL A CG1 1 
ATOM   1503  C  CG2 . VAL A 1 191 ? 25.666  42.989  70.679  1.00 25.55  ? 191 VAL A CG2 1 
ATOM   1504  N  N   . ASP A 1 192 ? 22.775  45.734  72.954  1.00 22.50  ? 192 ASP A N   1 
ATOM   1505  C  CA  . ASP A 1 192 ? 22.399  46.960  73.627  1.00 18.93  ? 192 ASP A CA  1 
ATOM   1506  C  C   . ASP A 1 192 ? 23.038  46.986  75.004  1.00 18.70  ? 192 ASP A C   1 
ATOM   1507  O  O   . ASP A 1 192 ? 22.950  46.013  75.754  1.00 19.96  ? 192 ASP A O   1 
ATOM   1508  C  CB  . ASP A 1 192 ? 20.884  47.026  73.818  1.00 18.19  ? 192 ASP A CB  1 
ATOM   1509  C  CG  . ASP A 1 192 ? 20.148  47.419  72.571  1.00 17.08  ? 192 ASP A CG  1 
ATOM   1510  O  OD1 . ASP A 1 192 ? 20.284  48.581  72.150  1.00 20.78  ? 192 ASP A OD1 1 
ATOM   1511  O  OD2 . ASP A 1 192 ? 19.382  46.591  72.045  1.00 15.47  ? 192 ASP A OD2 1 
ATOM   1512  N  N   . TYR A 1 193 ? 23.727  48.068  75.316  1.00 16.62  ? 193 TYR A N   1 
ATOM   1513  C  CA  . TYR A 1 193 ? 24.308  48.225  76.636  1.00 17.81  ? 193 TYR A CA  1 
ATOM   1514  C  C   . TYR A 1 193 ? 23.702  49.510  77.217  1.00 18.95  ? 193 TYR A C   1 
ATOM   1515  O  O   . TYR A 1 193 ? 23.852  50.585  76.629  1.00 17.50  ? 193 TYR A O   1 
ATOM   1516  C  CB  . TYR A 1 193 ? 25.828  48.357  76.581  1.00 17.71  ? 193 TYR A CB  1 
ATOM   1517  C  CG  . TYR A 1 193 ? 26.377  48.738  77.931  1.00 21.54  ? 193 TYR A CG  1 
ATOM   1518  C  CD1 . TYR A 1 193 ? 26.350  47.831  78.982  1.00 21.81  ? 193 TYR A CD1 1 
ATOM   1519  C  CD2 . TYR A 1 193 ? 26.806  50.040  78.195  1.00 22.04  ? 193 TYR A CD2 1 
ATOM   1520  C  CE1 . TYR A 1 193 ? 26.725  48.203  80.260  1.00 22.30  ? 193 TYR A CE1 1 
ATOM   1521  C  CE2 . TYR A 1 193 ? 27.177  50.428  79.474  1.00 20.59  ? 193 TYR A CE2 1 
ATOM   1522  C  CZ  . TYR A 1 193 ? 27.132  49.502  80.505  1.00 23.45  ? 193 TYR A CZ  1 
ATOM   1523  O  OH  . TYR A 1 193 ? 27.481  49.865  81.789  1.00 27.12  ? 193 TYR A OH  1 
ATOM   1524  N  N   . GLY A 1 194 ? 23.023  49.405  78.355  1.00 19.79  ? 194 GLY A N   1 
ATOM   1525  C  CA  . GLY A 1 194 ? 22.416  50.583  78.957  1.00 20.75  ? 194 GLY A CA  1 
ATOM   1526  C  C   . GLY A 1 194 ? 22.812  50.790  80.405  1.00 22.27  ? 194 GLY A C   1 
ATOM   1527  O  O   . GLY A 1 194 ? 23.104  49.832  81.118  1.00 25.00  ? 194 GLY A O   1 
ATOM   1528  N  N   . ARG A 1 195 ? 22.826  52.038  80.850  1.00 20.86  ? 195 ARG A N   1 
ATOM   1529  C  CA  . ARG A 1 195 ? 23.189  52.345  82.226  1.00 23.78  ? 195 ARG A CA  1 
ATOM   1530  C  C   . ARG A 1 195 ? 22.599  53.661  82.734  1.00 22.27  ? 195 ARG A C   1 
ATOM   1531  O  O   . ARG A 1 195 ? 22.447  54.622  81.961  1.00 20.48  ? 195 ARG A O   1 
ATOM   1532  C  CB  . ARG A 1 195 ? 24.710  52.389  82.384  1.00 30.08  ? 195 ARG A CB  1 
ATOM   1533  C  CG  . ARG A 1 195 ? 25.385  53.258  81.373  1.00 45.41  ? 195 ARG A CG  1 
ATOM   1534  C  CD  . ARG A 1 195 ? 26.696  53.829  81.881  1.00 58.37  ? 195 ARG A CD  1 
ATOM   1535  N  NE  . ARG A 1 195 ? 27.242  54.793  80.920  1.00 71.35  ? 195 ARG A NE  1 
ATOM   1536  C  CZ  . ARG A 1 195 ? 26.618  55.908  80.523  1.00 76.63  ? 195 ARG A CZ  1 
ATOM   1537  N  NH1 . ARG A 1 195 ? 25.415  56.219  80.997  1.00 78.68  ? 195 ARG A NH1 1 
ATOM   1538  N  NH2 . ARG A 1 195 ? 27.197  56.724  79.646  1.00 79.68  ? 195 ARG A NH2 1 
ATOM   1539  N  N   . ALA A 1 196 ? 22.245  53.684  84.024  1.00 16.34  ? 196 ALA A N   1 
ATOM   1540  C  CA  . ALA A 1 196 ? 21.710  54.877  84.666  1.00 13.47  ? 196 ALA A CA  1 
ATOM   1541  C  C   . ALA A 1 196 ? 22.924  55.783  84.706  1.00 13.46  ? 196 ALA A C   1 
ATOM   1542  O  O   . ALA A 1 196 ? 24.016  55.335  85.019  1.00 20.71  ? 196 ALA A O   1 
ATOM   1543  C  CB  . ALA A 1 196 ? 21.226  54.552  86.070  1.00 11.95  ? 196 ALA A CB  1 
ATOM   1544  N  N   . ASN A 1 197 ? 22.749  57.047  84.370  1.00 14.14  ? 197 ASN A N   1 
ATOM   1545  C  CA  . ASN A 1 197 ? 23.861  57.983  84.319  1.00 17.24  ? 197 ASN A CA  1 
ATOM   1546  C  C   . ASN A 1 197 ? 23.534  59.146  85.236  1.00 20.46  ? 197 ASN A C   1 
ATOM   1547  O  O   . ASN A 1 197 ? 22.871  60.108  84.837  1.00 20.52  ? 197 ASN A O   1 
ATOM   1548  C  CB  . ASN A 1 197 ? 24.035  58.444  82.871  1.00 18.59  ? 197 ASN A CB  1 
ATOM   1549  C  CG  . ASN A 1 197 ? 25.177  59.385  82.689  1.00 20.55  ? 197 ASN A CG  1 
ATOM   1550  O  OD1 . ASN A 1 197 ? 25.840  59.766  83.638  1.00 21.92  ? 197 ASN A OD1 1 
ATOM   1551  N  ND2 . ASN A 1 197 ? 25.417  59.778  81.450  1.00 27.99  ? 197 ASN A ND2 1 
ATOM   1552  N  N   . THR A 1 198 ? 24.037  59.068  86.462  1.00 22.99  ? 198 THR A N   1 
ATOM   1553  C  CA  . THR A 1 198 ? 23.765  60.072  87.491  1.00 20.63  ? 198 THR A CA  1 
ATOM   1554  C  C   . THR A 1 198 ? 24.517  61.379  87.405  1.00 18.04  ? 198 THR A C   1 
ATOM   1555  O  O   . THR A 1 198 ? 25.682  61.417  87.016  1.00 18.44  ? 198 THR A O   1 
ATOM   1556  C  CB  . THR A 1 198 ? 24.004  59.474  88.877  1.00 23.66  ? 198 THR A CB  1 
ATOM   1557  O  OG1 . THR A 1 198 ? 25.246  58.759  88.863  1.00 24.40  ? 198 THR A OG1 1 
ATOM   1558  C  CG2 . THR A 1 198 ? 22.882  58.505  89.247  1.00 21.69  ? 198 THR A CG2 1 
ATOM   1559  N  N   . THR A 1 199 ? 23.832  62.445  87.798  1.00 17.85  ? 199 THR A N   1 
ATOM   1560  C  CA  . THR A 1 199 ? 24.379  63.787  87.823  1.00 20.20  ? 199 THR A CA  1 
ATOM   1561  C  C   . THR A 1 199 ? 25.418  63.838  88.925  1.00 24.10  ? 199 THR A C   1 
ATOM   1562  O  O   . THR A 1 199 ? 25.271  63.162  89.939  1.00 29.81  ? 199 THR A O   1 
ATOM   1563  C  CB  . THR A 1 199 ? 23.278  64.759  88.176  1.00 19.41  ? 199 THR A CB  1 
ATOM   1564  O  OG1 . THR A 1 199 ? 22.225  64.610  87.221  1.00 23.39  ? 199 THR A OG1 1 
ATOM   1565  C  CG2 . THR A 1 199 ? 23.784  66.175  88.151  1.00 13.09  ? 199 THR A CG2 1 
ATOM   1566  N  N   . ASP A 1 200 ? 26.456  64.640  88.743  1.00 29.95  ? 200 ASP A N   1 
ATOM   1567  C  CA  . ASP A 1 200 ? 27.493  64.746  89.752  1.00 33.90  ? 200 ASP A CA  1 
ATOM   1568  C  C   . ASP A 1 200 ? 26.891  65.167  91.084  1.00 35.24  ? 200 ASP A C   1 
ATOM   1569  O  O   . ASP A 1 200 ? 26.092  66.105  91.161  1.00 35.61  ? 200 ASP A O   1 
ATOM   1570  C  CB  . ASP A 1 200 ? 28.562  65.741  89.319  1.00 39.88  ? 200 ASP A CB  1 
ATOM   1571  C  CG  . ASP A 1 200 ? 29.755  65.768  90.262  1.00 44.20  ? 200 ASP A CG  1 
ATOM   1572  O  OD1 . ASP A 1 200 ? 30.296  64.690  90.605  1.00 46.30  ? 200 ASP A OD1 1 
ATOM   1573  O  OD2 . ASP A 1 200 ? 30.163  66.882  90.647  1.00 51.11  ? 200 ASP A OD2 1 
ATOM   1574  N  N   . GLY A 1 201 ? 27.254  64.436  92.132  1.00 38.09  ? 201 GLY A N   1 
ATOM   1575  C  CA  . GLY A 1 201 ? 26.743  64.736  93.456  1.00 36.26  ? 201 GLY A CA  1 
ATOM   1576  C  C   . GLY A 1 201 ? 25.621  63.799  93.858  1.00 36.98  ? 201 GLY A C   1 
ATOM   1577  O  O   . GLY A 1 201 ? 25.421  63.531  95.045  1.00 43.06  ? 201 GLY A O   1 
ATOM   1578  N  N   . TYR A 1 202 ? 24.873  63.313  92.874  1.00 33.74  ? 202 TYR A N   1 
ATOM   1579  C  CA  . TYR A 1 202 ? 23.781  62.399  93.142  1.00 27.19  ? 202 TYR A CA  1 
ATOM   1580  C  C   . TYR A 1 202 ? 24.270  60.985  93.022  1.00 27.02  ? 202 TYR A C   1 
ATOM   1581  O  O   . TYR A 1 202 ? 25.254  60.711  92.336  1.00 26.08  ? 202 TYR A O   1 
ATOM   1582  C  CB  . TYR A 1 202 ? 22.641  62.628  92.172  1.00 23.61  ? 202 TYR A CB  1 
ATOM   1583  C  CG  . TYR A 1 202 ? 21.954  63.937  92.380  1.00 19.00  ? 202 TYR A CG  1 
ATOM   1584  C  CD1 . TYR A 1 202 ? 22.540  65.123  91.962  1.00 17.86  ? 202 TYR A CD1 1 
ATOM   1585  C  CD2 . TYR A 1 202 ? 20.699  63.990  92.967  1.00 20.16  ? 202 TYR A CD2 1 
ATOM   1586  C  CE1 . TYR A 1 202 ? 21.885  66.338  92.122  1.00 15.29  ? 202 TYR A CE1 1 
ATOM   1587  C  CE2 . TYR A 1 202 ? 20.033  65.196  93.129  1.00 20.06  ? 202 TYR A CE2 1 
ATOM   1588  C  CZ  . TYR A 1 202 ? 20.630  66.366  92.703  1.00 18.47  ? 202 TYR A CZ  1 
ATOM   1589  O  OH  . TYR A 1 202 ? 19.957  67.567  92.833  1.00 30.49  ? 202 TYR A OH  1 
ATOM   1590  N  N   . LYS A 1 203 ? 23.573  60.086  93.699  1.00 28.40  ? 203 LYS A N   1 
ATOM   1591  C  CA  . LYS A 1 203 ? 23.913  58.678  93.694  1.00 30.22  ? 203 LYS A CA  1 
ATOM   1592  C  C   . LYS A 1 203 ? 22.637  57.855  93.719  1.00 28.11  ? 203 LYS A C   1 
ATOM   1593  O  O   . LYS A 1 203 ? 21.579  58.352  94.094  1.00 26.22  ? 203 LYS A O   1 
ATOM   1594  C  CB  . LYS A 1 203 ? 24.762  58.334  94.924  1.00 39.03  ? 203 LYS A CB  1 
ATOM   1595  C  CG  . LYS A 1 203 ? 26.139  58.981  94.942  1.00 51.18  ? 203 LYS A CG  1 
ATOM   1596  C  CD  . LYS A 1 203 ? 26.909  58.656  96.215  1.00 61.71  ? 203 LYS A CD  1 
ATOM   1597  C  CE  . LYS A 1 203 ? 28.298  59.304  96.205  1.00 69.98  ? 203 LYS A CE  1 
ATOM   1598  N  NZ  . LYS A 1 203 ? 29.105  58.980  97.424  1.00 77.43  ? 203 LYS A NZ  1 
ATOM   1599  N  N   . LEU A 1 204 ? 22.738  56.611  93.269  1.00 28.49  ? 204 LEU A N   1 
ATOM   1600  C  CA  . LEU A 1 204 ? 21.611  55.701  93.266  1.00 30.75  ? 204 LEU A CA  1 
ATOM   1601  C  C   . LEU A 1 204 ? 21.547  55.103  94.678  1.00 33.74  ? 204 LEU A C   1 
ATOM   1602  O  O   . LEU A 1 204 ? 22.559  55.050  95.378  1.00 35.39  ? 204 LEU A O   1 
ATOM   1603  C  CB  . LEU A 1 204 ? 21.833  54.589  92.238  1.00 29.12  ? 204 LEU A CB  1 
ATOM   1604  C  CG  . LEU A 1 204 ? 22.085  54.947  90.772  1.00 27.54  ? 204 LEU A CG  1 
ATOM   1605  C  CD1 . LEU A 1 204 ? 22.445  53.690  90.046  1.00 24.87  ? 204 LEU A CD1 1 
ATOM   1606  C  CD2 . LEU A 1 204 ? 20.877  55.600  90.147  1.00 22.97  ? 204 LEU A CD2 1 
ATOM   1607  N  N   . ALA A 1 205 ? 20.362  54.683  95.107  1.00 35.71  ? 205 ALA A N   1 
ATOM   1608  C  CA  . ALA A 1 205 ? 20.193  54.084  96.429  1.00 34.39  ? 205 ALA A CA  1 
ATOM   1609  C  C   . ALA A 1 205 ? 20.847  52.706  96.443  1.00 37.35  ? 205 ALA A C   1 
ATOM   1610  O  O   . ALA A 1 205 ? 21.313  52.217  95.408  1.00 40.06  ? 205 ALA A O   1 
ATOM   1611  C  CB  . ALA A 1 205 ? 18.716  53.977  96.781  1.00 29.37  ? 205 ALA A CB  1 
ATOM   1612  N  N   . ASP A 1 206 ? 20.869  52.081  97.615  1.00 36.31  ? 206 ASP A N   1 
ATOM   1613  C  CA  . ASP A 1 206 ? 21.470  50.764  97.785  1.00 37.13  ? 206 ASP A CA  1 
ATOM   1614  C  C   . ASP A 1 206 ? 20.657  49.712  97.064  1.00 31.57  ? 206 ASP A C   1 
ATOM   1615  O  O   . ASP A 1 206 ? 19.450  49.683  97.201  1.00 32.22  ? 206 ASP A O   1 
ATOM   1616  C  CB  . ASP A 1 206 ? 21.540  50.396  99.278  1.00 49.62  ? 206 ASP A CB  1 
ATOM   1617  C  CG  . ASP A 1 206 ? 22.567  51.219  100.044 1.00 62.78  ? 206 ASP A CG  1 
ATOM   1618  O  OD1 . ASP A 1 206 ? 22.463  52.467  100.039 1.00 72.25  ? 206 ASP A OD1 1 
ATOM   1619  O  OD2 . ASP A 1 206 ? 23.480  50.614  100.654 1.00 70.51  ? 206 ASP A OD2 1 
ATOM   1620  N  N   . GLY A 1 207 ? 21.307  48.853  96.291  1.00 29.12  ? 207 GLY A N   1 
ATOM   1621  C  CA  . GLY A 1 207 ? 20.571  47.809  95.604  1.00 26.54  ? 207 GLY A CA  1 
ATOM   1622  C  C   . GLY A 1 207 ? 20.260  48.051  94.142  1.00 25.58  ? 207 GLY A C   1 
ATOM   1623  O  O   . GLY A 1 207 ? 19.926  47.098  93.441  1.00 26.06  ? 207 GLY A O   1 
ATOM   1624  N  N   . ALA A 1 208 ? 20.359  49.298  93.674  1.00 23.69  ? 208 ALA A N   1 
ATOM   1625  C  CA  . ALA A 1 208 ? 20.091  49.618  92.267  1.00 22.98  ? 208 ALA A CA  1 
ATOM   1626  C  C   . ALA A 1 208 ? 20.909  48.701  91.342  1.00 23.58  ? 208 ALA A C   1 
ATOM   1627  O  O   . ALA A 1 208 ? 22.053  48.372  91.660  1.00 33.36  ? 208 ALA A O   1 
ATOM   1628  C  CB  . ALA A 1 208 ? 20.430  51.066  91.997  1.00 12.87  ? 208 ALA A CB  1 
ATOM   1629  N  N   . SER A 1 209 ? 20.322  48.258  90.230  1.00 22.97  ? 209 SER A N   1 
ATOM   1630  C  CA  . SER A 1 209 ? 21.014  47.385  89.275  1.00 14.72  ? 209 SER A CA  1 
ATOM   1631  C  C   . SER A 1 209 ? 22.044  48.139  88.433  1.00 18.70  ? 209 SER A C   1 
ATOM   1632  O  O   . SER A 1 209 ? 23.035  47.560  87.980  1.00 19.62  ? 209 SER A O   1 
ATOM   1633  C  CB  . SER A 1 209 ? 20.007  46.739  88.346  1.00 16.75  ? 209 SER A CB  1 
ATOM   1634  O  OG  . SER A 1 209 ? 19.252  47.728  87.676  1.00 17.63  ? 209 SER A OG  1 
ATOM   1635  N  N   . LYS A 1 210 ? 21.762  49.416  88.171  1.00 21.78  ? 210 LYS A N   1 
ATOM   1636  C  CA  . LYS A 1 210 ? 22.626  50.328  87.401  1.00 23.09  ? 210 LYS A CA  1 
ATOM   1637  C  C   . LYS A 1 210 ? 22.829  50.117  85.894  1.00 22.51  ? 210 LYS A C   1 
ATOM   1638  O  O   . LYS A 1 210 ? 22.678  51.069  85.126  1.00 23.00  ? 210 LYS A O   1 
ATOM   1639  C  CB  . LYS A 1 210 ? 23.992  50.510  88.071  1.00 24.15  ? 210 LYS A CB  1 
ATOM   1640  C  CG  . LYS A 1 210 ? 24.635  51.844  87.730  1.00 21.44  ? 210 LYS A CG  1 
ATOM   1641  C  CD  . LYS A 1 210 ? 25.834  51.680  86.839  1.00 26.36  ? 210 LYS A CD  1 
ATOM   1642  C  CE  . LYS A 1 210 ? 26.221  53.024  86.230  1.00 36.17  ? 210 LYS A CE  1 
ATOM   1643  N  NZ  . LYS A 1 210 ? 26.402  54.098  87.243  1.00 34.74  ? 210 LYS A NZ  1 
ATOM   1644  N  N   . ASP A 1 211 ? 23.227  48.921  85.470  1.00 17.20  ? 211 ASP A N   1 
ATOM   1645  C  CA  . ASP A 1 211 ? 23.432  48.684  84.054  1.00 16.20  ? 211 ASP A CA  1 
ATOM   1646  C  C   . ASP A 1 211 ? 23.014  47.293  83.610  1.00 18.18  ? 211 ASP A C   1 
ATOM   1647  O  O   . ASP A 1 211 ? 22.608  46.472  84.427  1.00 19.63  ? 211 ASP A O   1 
ATOM   1648  C  CB  . ASP A 1 211 ? 24.877  49.006  83.649  1.00 15.62  ? 211 ASP A CB  1 
ATOM   1649  C  CG  . ASP A 1 211 ? 25.888  47.979  84.128  1.00 22.11  ? 211 ASP A CG  1 
ATOM   1650  O  OD1 . ASP A 1 211 ? 25.519  46.894  84.625  1.00 25.75  ? 211 ASP A OD1 1 
ATOM   1651  O  OD2 . ASP A 1 211 ? 27.094  48.253  83.973  1.00 28.19  ? 211 ASP A OD2 1 
ATOM   1652  N  N   . GLY A 1 212 ? 23.114  47.022  82.316  1.00 17.67  ? 212 GLY A N   1 
ATOM   1653  C  CA  . GLY A 1 212 ? 22.722  45.726  81.820  1.00 16.05  ? 212 GLY A CA  1 
ATOM   1654  C  C   . GLY A 1 212 ? 22.983  45.627  80.344  1.00 17.55  ? 212 GLY A C   1 
ATOM   1655  O  O   . GLY A 1 212 ? 23.329  46.616  79.699  1.00 20.99  ? 212 GLY A O   1 
ATOM   1656  N  N   . TRP A 1 213 ? 22.786  44.428  79.814  1.00 19.45  ? 213 TRP A N   1 
ATOM   1657  C  CA  . TRP A 1 213 ? 23.004  44.130  78.410  1.00 18.79  ? 213 TRP A CA  1 
ATOM   1658  C  C   . TRP A 1 213 ? 21.807  43.420  77.835  1.00 19.27  ? 213 TRP A C   1 
ATOM   1659  O  O   . TRP A 1 213 ? 21.065  42.761  78.562  1.00 18.43  ? 213 TRP A O   1 
ATOM   1660  C  CB  . TRP A 1 213 ? 24.165  43.150  78.263  1.00 20.20  ? 213 TRP A CB  1 
ATOM   1661  C  CG  . TRP A 1 213 ? 25.483  43.712  78.603  1.00 25.68  ? 213 TRP A CG  1 
ATOM   1662  C  CD1 . TRP A 1 213 ? 26.044  43.789  79.841  1.00 26.24  ? 213 TRP A CD1 1 
ATOM   1663  C  CD2 . TRP A 1 213 ? 26.431  44.283  77.689  1.00 27.59  ? 213 TRP A CD2 1 
ATOM   1664  N  NE1 . TRP A 1 213 ? 27.284  44.375  79.759  1.00 28.53  ? 213 TRP A NE1 1 
ATOM   1665  C  CE2 . TRP A 1 213 ? 27.549  44.687  78.450  1.00 28.85  ? 213 TRP A CE2 1 
ATOM   1666  C  CE3 . TRP A 1 213 ? 26.446  44.489  76.300  1.00 26.50  ? 213 TRP A CE3 1 
ATOM   1667  C  CZ2 . TRP A 1 213 ? 28.676  45.287  77.867  1.00 26.18  ? 213 TRP A CZ2 1 
ATOM   1668  C  CZ3 . TRP A 1 213 ? 27.564  45.084  75.725  1.00 26.76  ? 213 TRP A CZ3 1 
ATOM   1669  C  CH2 . TRP A 1 213 ? 28.662  45.476  76.508  1.00 26.55  ? 213 TRP A CH2 1 
ATOM   1670  N  N   . MET A 1 214 ? 21.651  43.521  76.519  1.00 19.23  ? 214 MET A N   1 
ATOM   1671  C  CA  . MET A 1 214 ? 20.583  42.810  75.823  1.00 17.53  ? 214 MET A CA  1 
ATOM   1672  C  C   . MET A 1 214 ? 21.148  42.391  74.489  1.00 17.44  ? 214 MET A C   1 
ATOM   1673  O  O   . MET A 1 214 ? 21.852  43.173  73.834  1.00 16.81  ? 214 MET A O   1 
ATOM   1674  C  CB  . MET A 1 214 ? 19.335  43.664  75.611  1.00 15.32  ? 214 MET A CB  1 
ATOM   1675  C  CG  . MET A 1 214 ? 18.183  42.828  75.082  1.00 18.75  ? 214 MET A CG  1 
ATOM   1676  S  SD  . MET A 1 214 ? 16.675  43.719  74.760  1.00 27.37  ? 214 MET A SD  1 
ATOM   1677  C  CE  . MET A 1 214 ? 15.620  42.897  75.780  1.00 29.49  ? 214 MET A CE  1 
ATOM   1678  N  N   . PHE A 1 215 ? 20.876  41.151  74.111  1.00 16.73  ? 215 PHE A N   1 
ATOM   1679  C  CA  . PHE A 1 215 ? 21.358  40.619  72.851  1.00 19.76  ? 215 PHE A CA  1 
ATOM   1680  C  C   . PHE A 1 215 ? 20.163  40.120  72.073  1.00 20.55  ? 215 PHE A C   1 
ATOM   1681  O  O   . PHE A 1 215 ? 19.268  39.505  72.643  1.00 19.64  ? 215 PHE A O   1 
ATOM   1682  C  CB  . PHE A 1 215 ? 22.346  39.493  73.109  1.00 24.96  ? 215 PHE A CB  1 
ATOM   1683  C  CG  . PHE A 1 215 ? 23.471  39.879  74.050  1.00 31.21  ? 215 PHE A CG  1 
ATOM   1684  C  CD1 . PHE A 1 215 ? 24.627  40.494  73.565  1.00 32.18  ? 215 PHE A CD1 1 
ATOM   1685  C  CD2 . PHE A 1 215 ? 23.372  39.633  75.423  1.00 31.12  ? 215 PHE A CD2 1 
ATOM   1686  C  CE1 . PHE A 1 215 ? 25.662  40.856  74.430  1.00 32.93  ? 215 PHE A CE1 1 
ATOM   1687  C  CE2 . PHE A 1 215 ? 24.400  39.992  76.293  1.00 30.00  ? 215 PHE A CE2 1 
ATOM   1688  C  CZ  . PHE A 1 215 ? 25.545  40.602  75.797  1.00 29.77  ? 215 PHE A CZ  1 
ATOM   1689  N  N   . THR A 1 216 ? 20.144  40.406  70.777  1.00 19.60  ? 216 THR A N   1 
ATOM   1690  C  CA  . THR A 1 216 ? 19.039  40.035  69.918  1.00 16.86  ? 216 THR A CA  1 
ATOM   1691  C  C   . THR A 1 216 ? 19.544  39.409  68.645  1.00 16.25  ? 216 THR A C   1 
ATOM   1692  O  O   . THR A 1 216 ? 20.538  39.856  68.078  1.00 17.83  ? 216 THR A O   1 
ATOM   1693  C  CB  . THR A 1 216 ? 18.232  41.299  69.509  1.00 15.00  ? 216 THR A CB  1 
ATOM   1694  O  OG1 . THR A 1 216 ? 17.695  41.926  70.679  1.00 16.94  ? 216 THR A OG1 1 
ATOM   1695  C  CG2 . THR A 1 216 ? 17.095  40.953  68.548  1.00 13.82  ? 216 THR A CG2 1 
ATOM   1696  N  N   . ALA A 1 217 ? 18.839  38.385  68.194  1.00 16.85  ? 217 ALA A N   1 
ATOM   1697  C  CA  . ALA A 1 217 ? 19.138  37.707  66.947  1.00 16.91  ? 217 ALA A CA  1 
ATOM   1698  C  C   . ALA A 1 217 ? 17.763  37.488  66.340  1.00 18.81  ? 217 ALA A C   1 
ATOM   1699  O  O   . ALA A 1 217 ? 16.868  36.932  66.992  1.00 19.68  ? 217 ALA A O   1 
ATOM   1700  C  CB  . ALA A 1 217 ? 19.819  36.384  67.202  1.00 13.97  ? 217 ALA A CB  1 
ATOM   1701  N  N   . GLU A 1 218 ? 17.564  38.005  65.132  1.00 21.10  ? 218 GLU A N   1 
ATOM   1702  C  CA  . GLU A 1 218 ? 16.283  37.862  64.433  1.00 18.70  ? 218 GLU A CA  1 
ATOM   1703  C  C   . GLU A 1 218 ? 16.498  37.353  63.023  1.00 20.06  ? 218 GLU A C   1 
ATOM   1704  O  O   . GLU A 1 218 ? 17.256  37.945  62.243  1.00 20.95  ? 218 GLU A O   1 
ATOM   1705  C  CB  . GLU A 1 218 ? 15.554  39.209  64.374  1.00 18.73  ? 218 GLU A CB  1 
ATOM   1706  C  CG  . GLU A 1 218 ? 14.215  39.152  63.653  1.00 18.21  ? 218 GLU A CG  1 
ATOM   1707  C  CD  . GLU A 1 218 ? 13.472  40.464  63.707  1.00 23.89  ? 218 GLU A CD  1 
ATOM   1708  O  OE1 . GLU A 1 218 ? 12.777  40.717  64.714  1.00 26.40  ? 218 GLU A OE1 1 
ATOM   1709  O  OE2 . GLU A 1 218 ? 13.580  41.246  62.744  1.00 27.01  ? 218 GLU A OE2 1 
ATOM   1710  N  N   . HIS A 1 219 ? 15.844  36.246  62.704  1.00 17.66  ? 219 HIS A N   1 
ATOM   1711  C  CA  . HIS A 1 219 ? 15.960  35.657  61.385  1.00 19.07  ? 219 HIS A CA  1 
ATOM   1712  C  C   . HIS A 1 219 ? 14.650  35.809  60.638  1.00 21.33  ? 219 HIS A C   1 
ATOM   1713  O  O   . HIS A 1 219 ? 13.575  35.459  61.151  1.00 19.71  ? 219 HIS A O   1 
ATOM   1714  C  CB  . HIS A 1 219 ? 16.337  34.176  61.485  1.00 21.64  ? 219 HIS A CB  1 
ATOM   1715  C  CG  . HIS A 1 219 ? 16.457  33.496  60.158  1.00 23.14  ? 219 HIS A CG  1 
ATOM   1716  N  ND1 . HIS A 1 219 ? 15.404  32.831  59.568  1.00 21.28  ? 219 HIS A ND1 1 
ATOM   1717  C  CD2 . HIS A 1 219 ? 17.490  33.419  59.284  1.00 20.69  ? 219 HIS A CD2 1 
ATOM   1718  C  CE1 . HIS A 1 219 ? 15.783  32.377  58.386  1.00 18.74  ? 219 HIS A CE1 1 
ATOM   1719  N  NE2 . HIS A 1 219 ? 17.045  32.721  58.190  1.00 20.36  ? 219 HIS A NE2 1 
ATOM   1720  N  N   . THR A 1 220 ? 14.738  36.362  59.436  1.00 21.60  ? 220 THR A N   1 
ATOM   1721  C  CA  . THR A 1 220 ? 13.559  36.558  58.613  1.00 20.70  ? 220 THR A CA  1 
ATOM   1722  C  C   . THR A 1 220 ? 13.619  35.644  57.416  1.00 21.36  ? 220 THR A C   1 
ATOM   1723  O  O   . THR A 1 220 ? 14.610  35.641  56.680  1.00 24.11  ? 220 THR A O   1 
ATOM   1724  C  CB  . THR A 1 220 ? 13.478  37.988  58.103  1.00 19.20  ? 220 THR A CB  1 
ATOM   1725  O  OG1 . THR A 1 220 ? 13.646  38.882  59.203  1.00 20.87  ? 220 THR A OG1 1 
ATOM   1726  C  CG2 . THR A 1 220 ? 12.131  38.238  57.480  1.00 15.56  ? 220 THR A CG2 1 
ATOM   1727  N  N   . GLN A 1 221 ? 12.564  34.867  57.226  1.00 19.27  ? 221 GLN A N   1 
ATOM   1728  C  CA  . GLN A 1 221 ? 12.495  33.953  56.100  1.00 20.02  ? 221 GLN A CA  1 
ATOM   1729  C  C   . GLN A 1 221 ? 11.300  34.337  55.251  1.00 21.10  ? 221 GLN A C   1 
ATOM   1730  O  O   . GLN A 1 221 ? 10.168  34.408  55.751  1.00 22.89  ? 221 GLN A O   1 
ATOM   1731  C  CB  . GLN A 1 221 ? 12.320  32.517  56.590  1.00 20.71  ? 221 GLN A CB  1 
ATOM   1732  C  CG  . GLN A 1 221 ? 12.299  31.471  55.481  1.00 21.05  ? 221 GLN A CG  1 
ATOM   1733  C  CD  . GLN A 1 221 ? 13.628  31.344  54.765  1.00 26.99  ? 221 GLN A CD  1 
ATOM   1734  O  OE1 . GLN A 1 221 ? 14.683  31.292  55.393  1.00 29.19  ? 221 GLN A OE1 1 
ATOM   1735  N  NE2 . GLN A 1 221 ? 13.586  31.302  53.443  1.00 31.50  ? 221 GLN A NE2 1 
ATOM   1736  N  N   . SER A 1 222 ? 11.555  34.629  53.980  1.00 22.62  ? 222 SER A N   1 
ATOM   1737  C  CA  . SER A 1 222 ? 10.494  34.985  53.046  1.00 23.29  ? 222 SER A CA  1 
ATOM   1738  C  C   . SER A 1 222 ? 9.860   33.715  52.524  1.00 21.82  ? 222 SER A C   1 
ATOM   1739  O  O   . SER A 1 222 ? 10.554  32.792  52.112  1.00 26.11  ? 222 SER A O   1 
ATOM   1740  C  CB  . SER A 1 222 ? 11.060  35.788  51.895  1.00 23.37  ? 222 SER A CB  1 
ATOM   1741  O  OG  . SER A 1 222 ? 11.726  36.929  52.407  1.00 34.96  ? 222 SER A OG  1 
ATOM   1742  N  N   . MET A 1 223 ? 8.540   33.663  52.543  1.00 23.10  ? 223 MET A N   1 
ATOM   1743  C  CA  . MET A 1 223 ? 7.850   32.482  52.085  1.00 23.10  ? 223 MET A CA  1 
ATOM   1744  C  C   . MET A 1 223 ? 6.367   32.760  52.047  1.00 26.03  ? 223 MET A C   1 
ATOM   1745  O  O   . MET A 1 223 ? 5.894   33.708  52.679  1.00 26.37  ? 223 MET A O   1 
ATOM   1746  C  CB  . MET A 1 223 ? 8.106   31.350  53.070  1.00 28.56  ? 223 MET A CB  1 
ATOM   1747  C  CG  . MET A 1 223 ? 7.673   31.698  54.472  1.00 28.37  ? 223 MET A CG  1 
ATOM   1748  S  SD  . MET A 1 223 ? 7.938   30.352  55.582  1.00 34.09  ? 223 MET A SD  1 
ATOM   1749  C  CE  . MET A 1 223 ? 6.297   30.129  56.175  1.00 35.18  ? 223 MET A CE  1 
ATOM   1750  N  N   . LEU A 1 224 ? 5.641   31.911  51.326  1.00 24.35  ? 224 LEU A N   1 
ATOM   1751  C  CA  . LEU A 1 224 ? 4.193   32.013  51.198  1.00 23.64  ? 224 LEU A CA  1 
ATOM   1752  C  C   . LEU A 1 224 ? 3.688   33.448  51.069  1.00 26.43  ? 224 LEU A C   1 
ATOM   1753  O  O   . LEU A 1 224 ? 2.685   33.839  51.677  1.00 26.39  ? 224 LEU A O   1 
ATOM   1754  C  CB  . LEU A 1 224 ? 3.517   31.295  52.365  1.00 27.34  ? 224 LEU A CB  1 
ATOM   1755  C  CG  . LEU A 1 224 ? 3.344   29.763  52.311  1.00 29.61  ? 224 LEU A CG  1 
ATOM   1756  C  CD1 . LEU A 1 224 ? 4.009   29.151  51.090  1.00 27.84  ? 224 LEU A CD1 1 
ATOM   1757  C  CD2 . LEU A 1 224 ? 3.888   29.142  53.584  1.00 30.96  ? 224 LEU A CD2 1 
ATOM   1758  N  N   . LYS A 1 225 ? 4.393   34.221  50.246  1.00 30.19  ? 225 LYS A N   1 
ATOM   1759  C  CA  . LYS A 1 225 ? 4.056   35.618  49.990  1.00 35.61  ? 225 LYS A CA  1 
ATOM   1760  C  C   . LYS A 1 225 ? 3.964   36.417  51.282  1.00 33.88  ? 225 LYS A C   1 
ATOM   1761  O  O   . LYS A 1 225 ? 3.218   37.391  51.383  1.00 37.22  ? 225 LYS A O   1 
ATOM   1762  C  CB  . LYS A 1 225 ? 2.771   35.720  49.146  1.00 41.21  ? 225 LYS A CB  1 
ATOM   1763  C  CG  . LYS A 1 225 ? 3.032   35.435  47.667  1.00 51.32  ? 225 LYS A CG  1 
ATOM   1764  C  CD  . LYS A 1 225 ? 1.771   35.138  46.876  1.00 59.25  ? 225 LYS A CD  1 
ATOM   1765  C  CE  . LYS A 1 225 ? 2.095   34.766  45.408  1.00 64.23  ? 225 LYS A CE  1 
ATOM   1766  N  NZ  . LYS A 1 225 ? 2.695   35.883  44.594  1.00 62.23  ? 225 LYS A NZ  1 
ATOM   1767  N  N   . GLY A 1 226 ? 4.794   36.024  52.237  1.00 30.52  ? 226 GLY A N   1 
ATOM   1768  C  CA  . GLY A 1 226 ? 4.834   36.671  53.525  1.00 24.38  ? 226 GLY A CA  1 
ATOM   1769  C  C   . GLY A 1 226 ? 6.171   36.368  54.147  1.00 22.80  ? 226 GLY A C   1 
ATOM   1770  O  O   . GLY A 1 226 ? 7.178   36.259  53.442  1.00 22.75  ? 226 GLY A O   1 
ATOM   1771  N  N   . TYR A 1 227 ? 6.181   36.161  55.454  1.00 21.39  ? 227 TYR A N   1 
ATOM   1772  C  CA  . TYR A 1 227 ? 7.431   35.896  56.142  1.00 19.97  ? 227 TYR A CA  1 
ATOM   1773  C  C   . TYR A 1 227 ? 7.181   35.180  57.434  1.00 19.05  ? 227 TYR A C   1 
ATOM   1774  O  O   . TYR A 1 227 ? 6.036   35.027  57.886  1.00 17.85  ? 227 TYR A O   1 
ATOM   1775  C  CB  . TYR A 1 227 ? 8.157   37.214  56.485  1.00 17.95  ? 227 TYR A CB  1 
ATOM   1776  C  CG  . TYR A 1 227 ? 7.387   38.096  57.459  1.00 19.50  ? 227 TYR A CG  1 
ATOM   1777  C  CD1 . TYR A 1 227 ? 7.389   37.842  58.836  1.00 21.53  ? 227 TYR A CD1 1 
ATOM   1778  C  CD2 . TYR A 1 227 ? 6.617   39.157  56.998  1.00 26.03  ? 227 TYR A CD2 1 
ATOM   1779  C  CE1 . TYR A 1 227 ? 6.634   38.622  59.720  1.00 22.05  ? 227 TYR A CE1 1 
ATOM   1780  C  CE2 . TYR A 1 227 ? 5.861   39.951  57.874  1.00 25.20  ? 227 TYR A CE2 1 
ATOM   1781  C  CZ  . TYR A 1 227 ? 5.872   39.679  59.230  1.00 25.97  ? 227 TYR A CZ  1 
ATOM   1782  O  OH  . TYR A 1 227 ? 5.118   40.473  60.074  1.00 27.44  ? 227 TYR A OH  1 
ATOM   1783  N  N   . ASN A 1 228 ? 8.301   34.825  58.050  1.00 18.56  ? 228 ASN A N   1 
ATOM   1784  C  CA  . ASN A 1 228 ? 8.344   34.185  59.345  1.00 20.26  ? 228 ASN A CA  1 
ATOM   1785  C  C   . ASN A 1 228 ? 9.580   34.748  60.013  1.00 20.30  ? 228 ASN A C   1 
ATOM   1786  O  O   . ASN A 1 228 ? 10.658  34.751  59.418  1.00 22.76  ? 228 ASN A O   1 
ATOM   1787  C  CB  . ASN A 1 228 ? 8.494   32.682  59.236  1.00 17.52  ? 228 ASN A CB  1 
ATOM   1788  C  CG  . ASN A 1 228 ? 8.748   32.051  60.580  1.00 23.20  ? 228 ASN A CG  1 
ATOM   1789  O  OD1 . ASN A 1 228 ? 9.899   31.924  61.018  1.00 25.09  ? 228 ASN A OD1 1 
ATOM   1790  N  ND2 . ASN A 1 228 ? 7.679   31.726  61.286  1.00 15.91  ? 228 ASN A ND2 1 
ATOM   1791  N  N   . LYS A 1 229 ? 9.410   35.279  61.215  1.00 18.25  ? 229 LYS A N   1 
ATOM   1792  C  CA  . LYS A 1 229 ? 10.520  35.835  61.950  1.00 16.29  ? 229 LYS A CA  1 
ATOM   1793  C  C   . LYS A 1 229 ? 10.732  35.017  63.199  1.00 18.50  ? 229 LYS A C   1 
ATOM   1794  O  O   . LYS A 1 229 ? 9.776   34.681  63.911  1.00 19.51  ? 229 LYS A O   1 
ATOM   1795  C  CB  . LYS A 1 229 ? 10.248  37.289  62.319  1.00 15.11  ? 229 LYS A CB  1 
ATOM   1796  C  CG  . LYS A 1 229 ? 10.477  38.255  61.182  1.00 15.97  ? 229 LYS A CG  1 
ATOM   1797  C  CD  . LYS A 1 229 ? 9.998   39.617  61.563  1.00 21.90  ? 229 LYS A CD  1 
ATOM   1798  C  CE  . LYS A 1 229 ? 10.188  40.625  60.444  1.00 23.04  ? 229 LYS A CE  1 
ATOM   1799  N  NZ  . LYS A 1 229 ? 11.617  40.854  60.113  1.00 28.05  ? 229 LYS A NZ  1 
ATOM   1800  N  N   . PHE A 1 230 ? 11.987  34.647  63.421  1.00 19.20  ? 230 PHE A N   1 
ATOM   1801  C  CA  . PHE A 1 230 ? 12.379  33.881  64.586  1.00 18.91  ? 230 PHE A CA  1 
ATOM   1802  C  C   . PHE A 1 230 ? 13.303  34.781  65.385  1.00 18.98  ? 230 PHE A C   1 
ATOM   1803  O  O   . PHE A 1 230 ? 14.328  35.240  64.888  1.00 18.39  ? 230 PHE A O   1 
ATOM   1804  C  CB  . PHE A 1 230 ? 13.101  32.606  64.175  1.00 22.29  ? 230 PHE A CB  1 
ATOM   1805  C  CG  . PHE A 1 230 ? 13.490  31.755  65.328  1.00 25.66  ? 230 PHE A CG  1 
ATOM   1806  C  CD1 . PHE A 1 230 ? 12.523  31.119  66.089  1.00 25.23  ? 230 PHE A CD1 1 
ATOM   1807  C  CD2 . PHE A 1 230 ? 14.820  31.627  65.690  1.00 28.25  ? 230 PHE A CD2 1 
ATOM   1808  C  CE1 . PHE A 1 230 ? 12.876  30.367  67.202  1.00 25.40  ? 230 PHE A CE1 1 
ATOM   1809  C  CE2 . PHE A 1 230 ? 15.180  30.882  66.794  1.00 25.97  ? 230 PHE A CE2 1 
ATOM   1810  C  CZ  . PHE A 1 230 ? 14.205  30.251  67.554  1.00 24.70  ? 230 PHE A CZ  1 
ATOM   1811  N  N   . VAL A 1 231 ? 12.934  35.027  66.628  1.00 19.92  ? 231 VAL A N   1 
ATOM   1812  C  CA  . VAL A 1 231 ? 13.687  35.912  67.486  1.00 17.88  ? 231 VAL A CA  1 
ATOM   1813  C  C   . VAL A 1 231 ? 14.129  35.258  68.780  1.00 19.42  ? 231 VAL A C   1 
ATOM   1814  O  O   . VAL A 1 231 ? 13.374  34.526  69.415  1.00 19.39  ? 231 VAL A O   1 
ATOM   1815  C  CB  . VAL A 1 231 ? 12.820  37.118  67.885  1.00 15.35  ? 231 VAL A CB  1 
ATOM   1816  C  CG1 . VAL A 1 231 ? 13.674  38.176  68.533  1.00 13.94  ? 231 VAL A CG1 1 
ATOM   1817  C  CG2 . VAL A 1 231 ? 12.098  37.671  66.682  1.00 11.96  ? 231 VAL A CG2 1 
ATOM   1818  N  N   . VAL A 1 232 ? 15.358  35.542  69.172  1.00 17.90  ? 232 VAL A N   1 
ATOM   1819  C  CA  . VAL A 1 232 ? 15.895  35.045  70.424  1.00 19.60  ? 232 VAL A CA  1 
ATOM   1820  C  C   . VAL A 1 232 ? 16.517  36.258  71.084  1.00 18.60  ? 232 VAL A C   1 
ATOM   1821  O  O   . VAL A 1 232 ? 17.294  36.984  70.448  1.00 19.53  ? 232 VAL A O   1 
ATOM   1822  C  CB  . VAL A 1 232 ? 16.989  33.991  70.210  1.00 23.15  ? 232 VAL A CB  1 
ATOM   1823  C  CG1 . VAL A 1 232 ? 17.670  33.664  71.523  1.00 22.23  ? 232 VAL A CG1 1 
ATOM   1824  C  CG2 . VAL A 1 232 ? 16.389  32.745  69.627  1.00 23.83  ? 232 VAL A CG2 1 
ATOM   1825  N  N   . GLN A 1 233 ? 16.147  36.510  72.333  1.00 17.25  ? 233 GLN A N   1 
ATOM   1826  C  CA  . GLN A 1 233 ? 16.693  37.645  73.065  1.00 15.30  ? 233 GLN A CA  1 
ATOM   1827  C  C   . GLN A 1 233 ? 17.053  37.257  74.488  1.00 18.54  ? 233 GLN A C   1 
ATOM   1828  O  O   . GLN A 1 233 ? 16.364  36.440  75.118  1.00 17.57  ? 233 GLN A O   1 
ATOM   1829  C  CB  . GLN A 1 233 ? 15.711  38.821  73.080  1.00 13.33  ? 233 GLN A CB  1 
ATOM   1830  C  CG  . GLN A 1 233 ? 15.552  39.501  71.739  1.00 14.62  ? 233 GLN A CG  1 
ATOM   1831  C  CD  . GLN A 1 233 ? 14.487  40.559  71.747  1.00 15.24  ? 233 GLN A CD  1 
ATOM   1832  O  OE1 . GLN A 1 233 ? 13.321  40.286  72.050  1.00 16.00  ? 233 GLN A OE1 1 
ATOM   1833  N  NE2 . GLN A 1 233 ? 14.872  41.777  71.403  1.00 10.49  ? 233 GLN A NE2 1 
ATOM   1834  N  N   . TYR A 1 234 ? 18.141  37.845  74.971  1.00 17.36  ? 234 TYR A N   1 
ATOM   1835  C  CA  . TYR A 1 234 ? 18.639  37.605  76.305  1.00 16.77  ? 234 TYR A CA  1 
ATOM   1836  C  C   . TYR A 1 234 ? 19.003  38.948  76.907  1.00 16.51  ? 234 TYR A C   1 
ATOM   1837  O  O   . TYR A 1 234 ? 19.789  39.701  76.325  1.00 16.57  ? 234 TYR A O   1 
ATOM   1838  C  CB  . TYR A 1 234 ? 19.868  36.720  76.245  1.00 19.94  ? 234 TYR A CB  1 
ATOM   1839  C  CG  . TYR A 1 234 ? 20.478  36.492  77.598  1.00 23.75  ? 234 TYR A CG  1 
ATOM   1840  C  CD1 . TYR A 1 234 ? 19.834  35.700  78.546  1.00 26.21  ? 234 TYR A CD1 1 
ATOM   1841  C  CD2 . TYR A 1 234 ? 21.694  37.075  77.943  1.00 24.83  ? 234 TYR A CD2 1 
ATOM   1842  C  CE1 . TYR A 1 234 ? 20.391  35.493  79.806  1.00 25.03  ? 234 TYR A CE1 1 
ATOM   1843  C  CE2 . TYR A 1 234 ? 22.256  36.875  79.197  1.00 28.23  ? 234 TYR A CE2 1 
ATOM   1844  C  CZ  . TYR A 1 234 ? 21.597  36.086  80.119  1.00 27.31  ? 234 TYR A CZ  1 
ATOM   1845  O  OH  . TYR A 1 234 ? 22.131  35.904  81.366  1.00 38.15  ? 234 TYR A OH  1 
ATOM   1846  N  N   . ALA A 1 235 ? 18.407  39.261  78.049  1.00 17.19  ? 235 ALA A N   1 
ATOM   1847  C  CA  . ALA A 1 235 ? 18.658  40.529  78.708  1.00 17.06  ? 235 ALA A CA  1 
ATOM   1848  C  C   . ALA A 1 235 ? 19.196  40.285  80.097  1.00 19.05  ? 235 ALA A C   1 
ATOM   1849  O  O   . ALA A 1 235 ? 18.818  39.332  80.765  1.00 23.53  ? 235 ALA A O   1 
ATOM   1850  C  CB  . ALA A 1 235 ? 17.389  41.360  78.776  1.00 15.98  ? 235 ALA A CB  1 
ATOM   1851  N  N   . THR A 1 236 ? 19.965  41.239  80.579  1.00 18.11  ? 236 THR A N   1 
ATOM   1852  C  CA  . THR A 1 236 ? 20.612  41.174  81.870  1.00 15.65  ? 236 THR A CA  1 
ATOM   1853  C  C   . THR A 1 236 ? 20.282  42.386  82.732  1.00 16.65  ? 236 THR A C   1 
ATOM   1854  O  O   . THR A 1 236 ? 20.106  43.491  82.231  1.00 16.69  ? 236 THR A O   1 
ATOM   1855  C  CB  . THR A 1 236 ? 22.119  41.116  81.589  1.00 18.16  ? 236 THR A CB  1 
ATOM   1856  O  OG1 . THR A 1 236 ? 22.500  39.757  81.379  1.00 30.63  ? 236 THR A OG1 1 
ATOM   1857  C  CG2 . THR A 1 236 ? 22.942  41.738  82.654  1.00 21.34  ? 236 THR A CG2 1 
ATOM   1858  N  N   . ASP A 1 237 ? 20.126  42.167  84.027  1.00 18.08  ? 237 ASP A N   1 
ATOM   1859  C  CA  . ASP A 1 237 ? 19.876  43.251  84.983  1.00 13.69  ? 237 ASP A CA  1 
ATOM   1860  C  C   . ASP A 1 237 ? 18.966  44.431  84.620  1.00 14.43  ? 237 ASP A C   1 
ATOM   1861  O  O   . ASP A 1 237 ? 17.753  44.269  84.501  1.00 20.15  ? 237 ASP A O   1 
ATOM   1862  C  CB  . ASP A 1 237 ? 21.216  43.765  85.504  1.00 12.59  ? 237 ASP A CB  1 
ATOM   1863  C  CG  . ASP A 1 237 ? 22.100  42.647  86.055  1.00 20.45  ? 237 ASP A CG  1 
ATOM   1864  O  OD1 . ASP A 1 237 ? 21.561  41.598  86.486  1.00 26.58  ? 237 ASP A OD1 1 
ATOM   1865  O  OD2 . ASP A 1 237 ? 23.340  42.813  86.039  1.00 23.35  ? 237 ASP A OD2 1 
ATOM   1866  N  N   . ALA A 1 238 ? 19.541  45.620  84.453  1.00 16.11  ? 238 ALA A N   1 
ATOM   1867  C  CA  . ALA A 1 238 ? 18.751  46.822  84.156  1.00 18.53  ? 238 ALA A CA  1 
ATOM   1868  C  C   . ALA A 1 238 ? 17.912  46.754  82.890  1.00 20.88  ? 238 ALA A C   1 
ATOM   1869  O  O   . ALA A 1 238 ? 17.002  47.569  82.708  1.00 23.49  ? 238 ALA A O   1 
ATOM   1870  C  CB  . ALA A 1 238 ? 19.648  48.080  84.125  1.00 9.31   ? 238 ALA A CB  1 
ATOM   1871  N  N   . MET A 1 239 ? 18.217  45.802  82.015  1.00 19.45  ? 239 MET A N   1 
ATOM   1872  C  CA  . MET A 1 239 ? 17.484  45.658  80.766  1.00 17.72  ? 239 MET A CA  1 
ATOM   1873  C  C   . MET A 1 239 ? 16.282  44.723  80.851  1.00 20.38  ? 239 MET A C   1 
ATOM   1874  O  O   . MET A 1 239 ? 15.585  44.525  79.860  1.00 25.74  ? 239 MET A O   1 
ATOM   1875  C  CB  . MET A 1 239 ? 18.412  45.158  79.654  1.00 16.22  ? 239 MET A CB  1 
ATOM   1876  C  CG  . MET A 1 239 ? 19.644  46.009  79.403  1.00 19.02  ? 239 MET A CG  1 
ATOM   1877  S  SD  . MET A 1 239 ? 19.304  47.639  78.736  1.00 24.56  ? 239 MET A SD  1 
ATOM   1878  C  CE  . MET A 1 239 ? 19.649  47.407  77.065  1.00 24.80  ? 239 MET A CE  1 
ATOM   1879  N  N   . THR A 1 240 ? 16.009  44.173  82.025  1.00 19.47  ? 240 THR A N   1 
ATOM   1880  C  CA  . THR A 1 240 ? 14.899  43.234  82.181  1.00 15.83  ? 240 THR A CA  1 
ATOM   1881  C  C   . THR A 1 240 ? 13.532  43.861  82.474  1.00 17.44  ? 240 THR A C   1 
ATOM   1882  O  O   . THR A 1 240 ? 12.488  43.259  82.218  1.00 17.98  ? 240 THR A O   1 
ATOM   1883  C  CB  . THR A 1 240 ? 15.205  42.234  83.298  1.00 16.08  ? 240 THR A CB  1 
ATOM   1884  O  OG1 . THR A 1 240 ? 15.438  42.955  84.520  1.00 18.57  ? 240 THR A OG1 1 
ATOM   1885  C  CG2 . THR A 1 240 ? 16.439  41.432  82.965  1.00 14.46  ? 240 THR A CG2 1 
ATOM   1886  N  N   . THR A 1 241 ? 13.525  45.050  83.054  1.00 17.84  ? 241 THR A N   1 
ATOM   1887  C  CA  . THR A 1 241 ? 12.262  45.683  83.377  1.00 17.75  ? 241 THR A CA  1 
ATOM   1888  C  C   . THR A 1 241 ? 11.469  46.078  82.130  1.00 17.11  ? 241 THR A C   1 
ATOM   1889  O  O   . THR A 1 241 ? 10.374  45.577  81.910  1.00 18.14  ? 241 THR A O   1 
ATOM   1890  C  CB  . THR A 1 241 ? 12.481  46.855  84.312  1.00 17.99  ? 241 THR A CB  1 
ATOM   1891  O  OG1 . THR A 1 241 ? 13.061  46.366  85.528  1.00 22.32  ? 241 THR A OG1 1 
ATOM   1892  C  CG2 . THR A 1 241 ? 11.172  47.535  84.620  1.00 14.06  ? 241 THR A CG2 1 
ATOM   1893  N  N   . GLN A 1 242 ? 12.013  46.969  81.312  1.00 18.05  ? 242 GLN A N   1 
ATOM   1894  C  CA  . GLN A 1 242 ? 11.329  47.367  80.092  1.00 16.01  ? 242 GLN A CA  1 
ATOM   1895  C  C   . GLN A 1 242 ? 11.338  46.178  79.137  1.00 16.29  ? 242 GLN A C   1 
ATOM   1896  O  O   . GLN A 1 242 ? 10.325  45.863  78.521  1.00 17.95  ? 242 GLN A O   1 
ATOM   1897  C  CB  . GLN A 1 242 ? 12.009  48.566  79.459  1.00 14.08  ? 242 GLN A CB  1 
ATOM   1898  C  CG  . GLN A 1 242 ? 11.154  49.216  78.382  1.00 16.47  ? 242 GLN A CG  1 
ATOM   1899  C  CD  . GLN A 1 242 ? 11.827  49.205  77.034  1.00 17.76  ? 242 GLN A CD  1 
ATOM   1900  O  OE1 . GLN A 1 242 ? 12.776  48.446  76.811  1.00 21.60  ? 242 GLN A OE1 1 
ATOM   1901  N  NE2 . GLN A 1 242 ? 11.364  50.059  76.127  1.00 16.39  ? 242 GLN A NE2 1 
ATOM   1902  N  N   . GLY A 1 243 ? 12.493  45.534  79.007  1.00 15.10  ? 243 GLY A N   1 
ATOM   1903  C  CA  . GLY A 1 243 ? 12.604  44.350  78.175  1.00 14.54  ? 243 GLY A CA  1 
ATOM   1904  C  C   . GLY A 1 243 ? 12.545  44.494  76.671  1.00 17.37  ? 243 GLY A C   1 
ATOM   1905  O  O   . GLY A 1 243 ? 12.252  43.525  75.967  1.00 17.09  ? 243 GLY A O   1 
ATOM   1906  N  N   . LYS A 1 244 ? 12.852  45.681  76.166  1.00 15.71  ? 244 LYS A N   1 
ATOM   1907  C  CA  . LYS A 1 244 ? 12.830  45.918  74.730  1.00 14.38  ? 244 LYS A CA  1 
ATOM   1908  C  C   . LYS A 1 244 ? 14.099  46.652  74.311  1.00 16.87  ? 244 LYS A C   1 
ATOM   1909  O  O   . LYS A 1 244 ? 14.234  47.028  73.152  1.00 17.02  ? 244 LYS A O   1 
ATOM   1910  C  CB  . LYS A 1 244 ? 11.602  46.745  74.330  1.00 14.27  ? 244 LYS A CB  1 
ATOM   1911  C  CG  . LYS A 1 244 ? 10.278  46.232  74.901  1.00 14.22  ? 244 LYS A CG  1 
ATOM   1912  C  CD  . LYS A 1 244 ? 9.134   47.217  74.635  1.00 12.06  ? 244 LYS A CD  1 
ATOM   1913  C  CE  . LYS A 1 244 ? 7.886   46.883  75.475  1.00 12.60  ? 244 LYS A CE  1 
ATOM   1914  N  NZ  . LYS A 1 244 ? 7.390   45.467  75.347  1.00 13.49  ? 244 LYS A NZ  1 
ATOM   1915  N  N   . GLY A 1 245 ? 15.026  46.865  75.246  1.00 15.96  ? 245 GLY A N   1 
ATOM   1916  C  CA  . GLY A 1 245 ? 16.260  47.548  74.903  1.00 13.76  ? 245 GLY A CA  1 
ATOM   1917  C  C   . GLY A 1 245 ? 16.536  48.831  75.663  1.00 18.66  ? 245 GLY A C   1 
ATOM   1918  O  O   . GLY A 1 245 ? 17.615  49.404  75.520  1.00 17.72  ? 245 GLY A O   1 
ATOM   1919  N  N   . GLN A 1 246 ? 15.556  49.337  76.407  1.00 18.22  ? 246 GLN A N   1 
ATOM   1920  C  CA  . GLN A 1 246 ? 15.767  50.548  77.195  1.00 19.65  ? 246 GLN A CA  1 
ATOM   1921  C  C   . GLN A 1 246 ? 16.197  50.131  78.603  1.00 20.74  ? 246 GLN A C   1 
ATOM   1922  O  O   . GLN A 1 246 ? 15.726  49.120  79.129  1.00 21.34  ? 246 GLN A O   1 
ATOM   1923  C  CB  . GLN A 1 246 ? 14.494  51.374  77.250  1.00 18.56  ? 246 GLN A CB  1 
ATOM   1924  C  CG  . GLN A 1 246 ? 14.213  52.112  75.963  1.00 24.61  ? 246 GLN A CG  1 
ATOM   1925  C  CD  . GLN A 1 246 ? 12.918  52.867  76.002  1.00 25.28  ? 246 GLN A CD  1 
ATOM   1926  O  OE1 . GLN A 1 246 ? 12.482  53.323  77.047  1.00 31.09  ? 246 GLN A OE1 1 
ATOM   1927  N  NE2 . GLN A 1 246 ? 12.276  52.977  74.861  1.00 28.45  ? 246 GLN A NE2 1 
ATOM   1928  N  N   . ALA A 1 247 ? 17.102  50.892  79.205  1.00 20.69  ? 247 ALA A N   1 
ATOM   1929  C  CA  . ALA A 1 247 ? 17.598  50.576  80.538  1.00 18.02  ? 247 ALA A CA  1 
ATOM   1930  C  C   . ALA A 1 247 ? 16.788  51.198  81.671  1.00 20.05  ? 247 ALA A C   1 
ATOM   1931  O  O   . ALA A 1 247 ? 16.320  52.329  81.555  1.00 20.43  ? 247 ALA A O   1 
ATOM   1932  C  CB  . ALA A 1 247 ? 19.045  50.988  80.651  1.00 19.16  ? 247 ALA A CB  1 
ATOM   1933  N  N   . ARG A 1 248 ? 16.593  50.430  82.740  1.00 21.44  ? 248 ARG A N   1 
ATOM   1934  C  CA  . ARG A 1 248 ? 15.876  50.872  83.944  1.00 22.33  ? 248 ARG A CA  1 
ATOM   1935  C  C   . ARG A 1 248 ? 16.846  50.567  85.102  1.00 22.36  ? 248 ARG A C   1 
ATOM   1936  O  O   . ARG A 1 248 ? 16.618  49.658  85.910  1.00 23.04  ? 248 ARG A O   1 
ATOM   1937  C  CB  . ARG A 1 248 ? 14.590  50.063  84.142  1.00 22.74  ? 248 ARG A CB  1 
ATOM   1938  C  CG  . ARG A 1 248 ? 13.590  50.093  83.012  1.00 27.15  ? 248 ARG A CG  1 
ATOM   1939  C  CD  . ARG A 1 248 ? 12.787  51.380  82.988  1.00 25.61  ? 248 ARG A CD  1 
ATOM   1940  N  NE  . ARG A 1 248 ? 13.288  52.308  81.976  1.00 36.51  ? 248 ARG A NE  1 
ATOM   1941  C  CZ  . ARG A 1 248 ? 12.627  52.652  80.871  1.00 33.71  ? 248 ARG A CZ  1 
ATOM   1942  N  NH1 . ARG A 1 248 ? 11.422  52.161  80.617  1.00 31.30  ? 248 ARG A NH1 1 
ATOM   1943  N  NH2 . ARG A 1 248 ? 13.200  53.449  79.988  1.00 36.26  ? 248 ARG A NH2 1 
ATOM   1944  N  N   . GLY A 1 249 ? 17.943  51.312  85.147  1.00 19.75  ? 249 GLY A N   1 
ATOM   1945  C  CA  . GLY A 1 249 ? 18.975  51.096  86.142  1.00 19.88  ? 249 GLY A CA  1 
ATOM   1946  C  C   . GLY A 1 249 ? 18.694  51.435  87.591  1.00 23.15  ? 249 GLY A C   1 
ATOM   1947  O  O   . GLY A 1 249 ? 19.430  50.996  88.462  1.00 23.29  ? 249 GLY A O   1 
ATOM   1948  N  N   . SER A 1 250 ? 17.680  52.248  87.860  1.00 21.85  ? 250 SER A N   1 
ATOM   1949  C  CA  . SER A 1 250 ? 17.352  52.604  89.233  1.00 21.76  ? 250 SER A CA  1 
ATOM   1950  C  C   . SER A 1 250 ? 15.980  52.062  89.573  1.00 23.82  ? 250 SER A C   1 
ATOM   1951  O  O   . SER A 1 250 ? 15.375  52.454  90.560  1.00 25.15  ? 250 SER A O   1 
ATOM   1952  C  CB  . SER A 1 250 ? 17.388  54.127  89.431  1.00 22.55  ? 250 SER A CB  1 
ATOM   1953  O  OG  . SER A 1 250 ? 16.270  54.769  88.847  1.00 23.73  ? 250 SER A OG  1 
ATOM   1954  N  N   . ASP A 1 251 ? 15.503  51.134  88.757  1.00 25.19  ? 251 ASP A N   1 
ATOM   1955  C  CA  . ASP A 1 251 ? 14.192  50.543  88.947  1.00 25.37  ? 251 ASP A CA  1 
ATOM   1956  C  C   . ASP A 1 251 ? 14.065  49.915  90.329  1.00 27.15  ? 251 ASP A C   1 
ATOM   1957  O  O   . ASP A 1 251 ? 14.939  49.158  90.744  1.00 28.60  ? 251 ASP A O   1 
ATOM   1958  C  CB  . ASP A 1 251 ? 13.955  49.492  87.861  1.00 26.36  ? 251 ASP A CB  1 
ATOM   1959  C  CG  . ASP A 1 251 ? 12.570  48.882  87.928  1.00 28.49  ? 251 ASP A CG  1 
ATOM   1960  O  OD1 . ASP A 1 251 ? 11.580  49.642  87.849  1.00 28.28  ? 251 ASP A OD1 1 
ATOM   1961  O  OD2 . ASP A 1 251 ? 12.469  47.641  88.047  1.00 37.06  ? 251 ASP A OD2 1 
ATOM   1962  N  N   . GLY A 1 252 ? 12.985  50.239  91.035  1.00 27.16  ? 252 GLY A N   1 
ATOM   1963  C  CA  . GLY A 1 252 ? 12.750  49.695  92.366  1.00 30.83  ? 252 GLY A CA  1 
ATOM   1964  C  C   . GLY A 1 252 ? 13.070  50.634  93.522  1.00 31.53  ? 252 GLY A C   1 
ATOM   1965  O  O   . GLY A 1 252 ? 12.945  50.256  94.688  1.00 31.05  ? 252 GLY A O   1 
ATOM   1966  N  N   . SER A 1 253 ? 13.506  51.849  93.198  1.00 31.00  ? 253 SER A N   1 
ATOM   1967  C  CA  . SER A 1 253 ? 13.867  52.839  94.199  1.00 31.93  ? 253 SER A CA  1 
ATOM   1968  C  C   . SER A 1 253 ? 12.639  53.452  94.820  1.00 37.69  ? 253 SER A C   1 
ATOM   1969  O  O   . SER A 1 253 ? 11.591  53.507  94.190  1.00 40.44  ? 253 SER A O   1 
ATOM   1970  C  CB  . SER A 1 253 ? 14.721  53.928  93.564  1.00 25.76  ? 253 SER A CB  1 
ATOM   1971  O  OG  . SER A 1 253 ? 15.891  53.353  93.003  1.00 21.66  ? 253 SER A OG  1 
ATOM   1972  N  N   . SER A 1 254 ? 12.764  53.887  96.069  1.00 44.79  ? 254 SER A N   1 
ATOM   1973  C  CA  . SER A 1 254 ? 11.661  54.519  96.791  1.00 48.32  ? 254 SER A CA  1 
ATOM   1974  C  C   . SER A 1 254 ? 12.243  55.227  97.991  1.00 52.58  ? 254 SER A C   1 
ATOM   1975  O  O   . SER A 1 254 ? 13.374  54.951  98.396  1.00 52.15  ? 254 SER A O   1 
ATOM   1976  C  CB  . SER A 1 254 ? 10.631  53.488  97.257  1.00 45.43  ? 254 SER A CB  1 
ATOM   1977  O  OG  . SER A 1 254 ? 11.169  52.630  98.241  1.00 43.93  ? 254 SER A OG  1 
ATOM   1978  N  N   . SER A 1 255 ? 11.472  56.138  98.563  1.00 60.04  ? 255 SER A N   1 
ATOM   1979  C  CA  . SER A 1 255 ? 11.925  56.883  99.721  1.00 69.03  ? 255 SER A CA  1 
ATOM   1980  C  C   . SER A 1 255 ? 10.742  57.275  100.596 1.00 75.18  ? 255 SER A C   1 
ATOM   1981  O  O   . SER A 1 255 ? 9.588   57.130  100.186 1.00 76.59  ? 255 SER A O   1 
ATOM   1982  C  CB  . SER A 1 255 ? 12.702  58.131  99.277  1.00 66.95  ? 255 SER A CB  1 
ATOM   1983  O  OG  . SER A 1 255 ? 11.948  58.930  98.385  1.00 65.74  ? 255 SER A OG  1 
ATOM   1984  N  N   . PHE A 1 256 ? 11.029  57.681  101.829 1.00 82.17  ? 256 PHE A N   1 
ATOM   1985  C  CA  . PHE A 1 256 ? 9.998   58.121  102.753 1.00 87.02  ? 256 PHE A CA  1 
ATOM   1986  C  C   . PHE A 1 256 ? 10.587  59.238  103.590 1.00 89.13  ? 256 PHE A C   1 
ATOM   1987  O  O   . PHE A 1 256 ? 11.771  59.213  103.943 1.00 85.87  ? 256 PHE A O   1 
ATOM   1988  C  CB  . PHE A 1 256 ? 9.450   56.964  103.614 1.00 89.58  ? 256 PHE A CB  1 
ATOM   1989  C  CG  . PHE A 1 256 ? 10.366  56.512  104.720 1.00 92.79  ? 256 PHE A CG  1 
ATOM   1990  C  CD1 . PHE A 1 256 ? 11.434  55.657  104.460 1.00 94.71  ? 256 PHE A CD1 1 
ATOM   1991  C  CD2 . PHE A 1 256 ? 10.132  56.909  106.035 1.00 94.93  ? 256 PHE A CD2 1 
ATOM   1992  C  CE1 . PHE A 1 256 ? 12.258  55.201  105.493 1.00 97.32  ? 256 PHE A CE1 1 
ATOM   1993  C  CE2 . PHE A 1 256 ? 10.946  56.461  107.075 1.00 97.17  ? 256 PHE A CE2 1 
ATOM   1994  C  CZ  . PHE A 1 256 ? 12.012  55.603  106.804 1.00 97.58  ? 256 PHE A CZ  1 
ATOM   1995  N  N   . THR A 1 257 ? 9.774   60.251  103.838 1.00 93.91  ? 257 THR A N   1 
ATOM   1996  C  CA  . THR A 1 257 ? 10.203  61.400  104.609 1.00 99.64  ? 257 THR A CA  1 
ATOM   1997  C  C   . THR A 1 257 ? 9.405   61.521  105.899 1.00 103.95 ? 257 THR A C   1 
ATOM   1998  O  O   . THR A 1 257 ? 8.199   61.266  105.912 1.00 104.73 ? 257 THR A O   1 
ATOM   1999  C  CB  . THR A 1 257 ? 10.024  62.674  103.785 1.00 99.13  ? 257 THR A CB  1 
ATOM   2000  O  OG1 . THR A 1 257 ? 10.656  62.500  102.511 1.00 99.86  ? 257 THR A OG1 1 
ATOM   2001  C  CG2 . THR A 1 257 ? 10.633  63.865  104.501 1.00 101.05 ? 257 THR A CG2 1 
ATOM   2002  N  N   . GLU A 1 258 ? 10.094  61.875  106.981 1.00 108.91 ? 258 GLU A N   1 
ATOM   2003  C  CA  . GLU A 1 258 ? 9.466   62.055  108.286 1.00 113.73 ? 258 GLU A CA  1 
ATOM   2004  C  C   . GLU A 1 258 ? 10.077  63.270  108.983 1.00 115.25 ? 258 GLU A C   1 
ATOM   2005  O  O   . GLU A 1 258 ? 9.336   64.248  109.225 1.00 118.02 ? 258 GLU A O   1 
ATOM   2006  C  CB  . GLU A 1 258 ? 9.622   60.797  109.152 1.00 115.54 ? 258 GLU A CB  1 
ATOM   2007  C  CG  . GLU A 1 258 ? 11.042  60.260  109.250 1.00 119.54 ? 258 GLU A CG  1 
ATOM   2008  C  CD  . GLU A 1 258 ? 11.209  59.240  110.358 1.00 122.57 ? 258 GLU A CD  1 
ATOM   2009  O  OE1 . GLU A 1 258 ? 10.474  58.228  110.362 1.00 124.78 ? 258 GLU A OE1 1 
ATOM   2010  O  OE2 . GLU A 1 258 ? 12.083  59.454  111.226 1.00 124.04 ? 258 GLU A OE2 1 
ATOM   2011  N  N   . LYS A 1 265 ? 11.216  66.368  108.956 1.00 97.93  ? 265 LYS A N   1 
ATOM   2012  C  CA  . LYS A 1 265 ? 11.494  65.993  107.546 1.00 94.17  ? 265 LYS A CA  1 
ATOM   2013  C  C   . LYS A 1 265 ? 12.921  65.527  107.299 1.00 89.81  ? 265 LYS A C   1 
ATOM   2014  O  O   . LYS A 1 265 ? 13.832  66.330  107.078 1.00 89.00  ? 265 LYS A O   1 
ATOM   2015  C  CB  . LYS A 1 265 ? 11.112  67.121  106.588 1.00 99.16  ? 265 LYS A CB  1 
ATOM   2016  C  CG  . LYS A 1 265 ? 9.609   67.283  106.443 1.00 106.66 ? 265 LYS A CG  1 
ATOM   2017  C  CD  . LYS A 1 265 ? 9.238   68.097  105.215 1.00 112.69 ? 265 LYS A CD  1 
ATOM   2018  C  CE  . LYS A 1 265 ? 7.722   68.257  105.093 1.00 115.93 ? 265 LYS A CE  1 
ATOM   2019  N  NZ  . LYS A 1 265 ? 6.997   66.953  104.980 1.00 116.94 ? 265 LYS A NZ  1 
ATOM   2020  N  N   . ILE A 1 266 ? 13.100  64.216  107.415 1.00 83.90  ? 266 ILE A N   1 
ATOM   2021  C  CA  . ILE A 1 266 ? 14.367  63.551  107.185 1.00 77.84  ? 266 ILE A CA  1 
ATOM   2022  C  C   . ILE A 1 266 ? 13.992  62.603  106.067 1.00 74.18  ? 266 ILE A C   1 
ATOM   2023  O  O   . ILE A 1 266 ? 13.037  61.834  106.196 1.00 73.68  ? 266 ILE A O   1 
ATOM   2024  C  CB  . ILE A 1 266 ? 14.808  62.736  108.399 1.00 77.72  ? 266 ILE A CB  1 
ATOM   2025  C  CG1 . ILE A 1 266 ? 15.031  63.665  109.590 1.00 80.87  ? 266 ILE A CG1 1 
ATOM   2026  C  CG2 . ILE A 1 266 ? 16.074  61.971  108.068 1.00 76.17  ? 266 ILE A CG2 1 
ATOM   2027  C  CD1 . ILE A 1 266 ? 15.323  62.942  110.894 1.00 86.67  ? 266 ILE A CD1 1 
ATOM   2028  N  N   . ASN A 1 267 ? 14.694  62.706  104.949 1.00 67.58  ? 267 ASN A N   1 
ATOM   2029  C  CA  . ASN A 1 267 ? 14.398  61.874  103.802 1.00 59.56  ? 267 ASN A CA  1 
ATOM   2030  C  C   . ASN A 1 267 ? 15.222  60.611  103.802 1.00 54.84  ? 267 ASN A C   1 
ATOM   2031  O  O   . ASN A 1 267 ? 16.452  60.665  103.881 1.00 51.89  ? 267 ASN A O   1 
ATOM   2032  C  CB  . ASN A 1 267 ? 14.665  62.653  102.530 1.00 61.81  ? 267 ASN A CB  1 
ATOM   2033  C  CG  . ASN A 1 267 ? 13.992  64.007  102.524 1.00 61.38  ? 267 ASN A CG  1 
ATOM   2034  O  OD1 . ASN A 1 267 ? 12.780  64.115  102.326 1.00 60.37  ? 267 ASN A OD1 1 
ATOM   2035  N  ND2 . ASN A 1 267 ? 14.779  65.055  102.732 1.00 62.68  ? 267 ASN A ND2 1 
ATOM   2036  N  N   . TYR A 1 268 ? 14.542  59.476  103.715 1.00 51.54  ? 268 TYR A N   1 
ATOM   2037  C  CA  . TYR A 1 268 ? 15.215  58.187  103.699 1.00 53.22  ? 268 TYR A CA  1 
ATOM   2038  C  C   . TYR A 1 268 ? 15.015  57.484  102.362 1.00 50.62  ? 268 TYR A C   1 
ATOM   2039  O  O   . TYR A 1 268 ? 13.892  57.321  101.905 1.00 49.74  ? 268 TYR A O   1 
ATOM   2040  C  CB  . TYR A 1 268 ? 14.686  57.279  104.808 1.00 60.11  ? 268 TYR A CB  1 
ATOM   2041  C  CG  . TYR A 1 268 ? 14.924  57.790  106.200 1.00 69.71  ? 268 TYR A CG  1 
ATOM   2042  C  CD1 . TYR A 1 268 ? 16.142  57.576  106.844 1.00 73.61  ? 268 TYR A CD1 1 
ATOM   2043  C  CD2 . TYR A 1 268 ? 13.932  58.488  106.880 1.00 73.68  ? 268 TYR A CD2 1 
ATOM   2044  C  CE1 . TYR A 1 268 ? 16.362  58.046  108.134 1.00 78.43  ? 268 TYR A CE1 1 
ATOM   2045  C  CE2 . TYR A 1 268 ? 14.138  58.960  108.166 1.00 78.22  ? 268 TYR A CE2 1 
ATOM   2046  C  CZ  . TYR A 1 268 ? 15.352  58.738  108.788 1.00 80.64  ? 268 TYR A CZ  1 
ATOM   2047  O  OH  . TYR A 1 268 ? 15.547  59.216  110.063 1.00 86.85  ? 268 TYR A OH  1 
ATOM   2048  N  N   . ALA A 1 269 ? 16.110  57.079  101.732 1.00 47.06  ? 269 ALA A N   1 
ATOM   2049  C  CA  . ALA A 1 269 ? 16.048  56.366  100.474 1.00 42.36  ? 269 ALA A CA  1 
ATOM   2050  C  C   . ALA A 1 269 ? 16.053  54.884  100.819 1.00 41.71  ? 269 ALA A C   1 
ATOM   2051  O  O   . ALA A 1 269 ? 17.040  54.364  101.345 1.00 42.03  ? 269 ALA A O   1 
ATOM   2052  C  CB  . ALA A 1 269 ? 17.256  56.716  99.613  1.00 42.20  ? 269 ALA A CB  1 
ATOM   2053  N  N   . ASN A 1 270 ? 14.938  54.212  100.579 1.00 40.97  ? 270 ASN A N   1 
ATOM   2054  C  CA  . ASN A 1 270 ? 14.853  52.788  100.849 1.00 42.06  ? 270 ASN A CA  1 
ATOM   2055  C  C   . ASN A 1 270 ? 15.781  51.957  99.995  1.00 43.41  ? 270 ASN A C   1 
ATOM   2056  O  O   . ASN A 1 270 ? 16.344  52.414  98.999  1.00 44.13  ? 270 ASN A O   1 
ATOM   2057  C  CB  . ASN A 1 270 ? 13.450  52.276  100.629 1.00 45.93  ? 270 ASN A CB  1 
ATOM   2058  C  CG  . ASN A 1 270 ? 12.530  52.674  101.725 1.00 51.50  ? 270 ASN A CG  1 
ATOM   2059  O  OD1 . ASN A 1 270 ? 12.917  52.705  102.894 1.00 58.49  ? 270 ASN A OD1 1 
ATOM   2060  N  ND2 . ASN A 1 270 ? 11.300  52.995  101.369 1.00 53.79  ? 270 ASN A ND2 1 
ATOM   2061  N  N   . LYS A 1 271 ? 15.916  50.705  100.393 1.00 43.77  ? 271 LYS A N   1 
ATOM   2062  C  CA  . LYS A 1 271 ? 16.756  49.781  99.674  1.00 43.10  ? 271 LYS A CA  1 
ATOM   2063  C  C   . LYS A 1 271 ? 16.031  49.564  98.349  1.00 41.61  ? 271 LYS A C   1 
ATOM   2064  O  O   . LYS A 1 271 ? 14.808  49.428  98.322  1.00 41.02  ? 271 LYS A O   1 
ATOM   2065  C  CB  . LYS A 1 271 ? 16.869  48.466  100.456 1.00 45.11  ? 271 LYS A CB  1 
ATOM   2066  C  CG  . LYS A 1 271 ? 18.030  47.557  100.055 1.00 51.86  ? 271 LYS A CG  1 
ATOM   2067  C  CD  . LYS A 1 271 ? 17.844  46.149  100.622 1.00 56.24  ? 271 LYS A CD  1 
ATOM   2068  C  CE  . LYS A 1 271 ? 19.003  45.221  100.263 1.00 57.07  ? 271 LYS A CE  1 
ATOM   2069  N  NZ  . LYS A 1 271 ? 18.707  43.812  100.661 1.00 53.35  ? 271 LYS A NZ  1 
ATOM   2070  N  N   . VAL A 1 272 ? 16.772  49.634  97.253  1.00 37.26  ? 272 VAL A N   1 
ATOM   2071  C  CA  . VAL A 1 272 ? 16.201  49.426  95.938  1.00 33.26  ? 272 VAL A CA  1 
ATOM   2072  C  C   . VAL A 1 272 ? 15.838  47.957  95.781  1.00 33.04  ? 272 VAL A C   1 
ATOM   2073  O  O   . VAL A 1 272 ? 16.657  47.063  96.016  1.00 36.15  ? 272 VAL A O   1 
ATOM   2074  C  CB  . VAL A 1 272 ? 17.207  49.802  94.815  1.00 28.08  ? 272 VAL A CB  1 
ATOM   2075  C  CG1 . VAL A 1 272 ? 16.605  49.564  93.469  1.00 28.51  ? 272 VAL A CG1 1 
ATOM   2076  C  CG2 . VAL A 1 272 ? 17.629  51.240  94.930  1.00 28.63  ? 272 VAL A CG2 1 
ATOM   2077  N  N   . ILE A 1 273 ? 14.580  47.703  95.473  1.00 33.84  ? 273 ILE A N   1 
ATOM   2078  C  CA  . ILE A 1 273 ? 14.148  46.338  95.210  1.00 35.77  ? 273 ILE A CA  1 
ATOM   2079  C  C   . ILE A 1 273 ? 14.392  46.197  93.684  1.00 34.76  ? 273 ILE A C   1 
ATOM   2080  O  O   . ILE A 1 273 ? 13.512  46.392  92.845  1.00 35.51  ? 273 ILE A O   1 
ATOM   2081  C  CB  . ILE A 1 273 ? 12.676  46.086  95.679  1.00 37.62  ? 273 ILE A CB  1 
ATOM   2082  C  CG1 . ILE A 1 273 ? 12.064  44.910  94.929  1.00 41.83  ? 273 ILE A CG1 1 
ATOM   2083  C  CG2 . ILE A 1 273 ? 11.839  47.333  95.575  1.00 44.18  ? 273 ILE A CG2 1 
ATOM   2084  C  CD1 . ILE A 1 273 ? 10.629  44.694  95.263  1.00 48.15  ? 273 ILE A CD1 1 
ATOM   2085  N  N   . ASN A 1 274 ? 15.661  45.954  93.371  1.00 32.39  ? 274 ASN A N   1 
ATOM   2086  C  CA  . ASN A 1 274 ? 16.187  45.861  92.020  1.00 28.78  ? 274 ASN A CA  1 
ATOM   2087  C  C   . ASN A 1 274 ? 15.676  44.815  91.044  1.00 29.23  ? 274 ASN A C   1 
ATOM   2088  O  O   . ASN A 1 274 ? 14.955  43.886  91.408  1.00 28.17  ? 274 ASN A O   1 
ATOM   2089  C  CB  . ASN A 1 274 ? 17.707  45.766  92.089  1.00 27.50  ? 274 ASN A CB  1 
ATOM   2090  C  CG  . ASN A 1 274 ? 18.179  44.443  92.644  1.00 28.52  ? 274 ASN A CG  1 
ATOM   2091  O  OD1 . ASN A 1 274 ? 17.778  43.372  92.177  1.00 29.07  ? 274 ASN A OD1 1 
ATOM   2092  N  ND2 . ASN A 1 274 ? 19.053  44.503  93.628  1.00 31.35  ? 274 ASN A ND2 1 
ATOM   2093  N  N   . ASN A 1 275 ? 16.113  44.981  89.794  1.00 27.62  ? 275 ASN A N   1 
ATOM   2094  C  CA  . ASN A 1 275 ? 15.780  44.094  88.685  1.00 24.49  ? 275 ASN A CA  1 
ATOM   2095  C  C   . ASN A 1 275 ? 16.977  43.227  88.294  1.00 24.87  ? 275 ASN A C   1 
ATOM   2096  O  O   . ASN A 1 275 ? 17.105  42.841  87.142  1.00 26.95  ? 275 ASN A O   1 
ATOM   2097  C  CB  . ASN A 1 275 ? 15.275  44.890  87.465  1.00 19.96  ? 275 ASN A CB  1 
ATOM   2098  C  CG  . ASN A 1 275 ? 16.170  46.060  87.110  1.00 21.86  ? 275 ASN A CG  1 
ATOM   2099  O  OD1 . ASN A 1 275 ? 17.335  46.119  87.505  1.00 21.56  ? 275 ASN A OD1 1 
ATOM   2100  N  ND2 . ASN A 1 275 ? 15.621  47.014  86.388  1.00 19.22  ? 275 ASN A ND2 1 
ATOM   2101  N  N   . ASN A 1 276 ? 17.864  42.940  89.247  1.00 23.55  ? 276 ASN A N   1 
ATOM   2102  C  CA  . ASN A 1 276 ? 19.020  42.093  88.963  1.00 20.21  ? 276 ASN A CA  1 
ATOM   2103  C  C   . ASN A 1 276 ? 18.472  40.725  88.576  1.00 18.23  ? 276 ASN A C   1 
ATOM   2104  O  O   . ASN A 1 276 ? 17.586  40.194  89.247  1.00 19.43  ? 276 ASN A O   1 
ATOM   2105  C  CB  . ASN A 1 276 ? 19.949  41.963  90.182  1.00 21.41  ? 276 ASN A CB  1 
ATOM   2106  C  CG  . ASN A 1 276 ? 20.824  43.196  90.406  1.00 24.04  ? 276 ASN A CG  1 
ATOM   2107  O  OD1 . ASN A 1 276 ? 21.064  43.978  89.495  1.00 28.41  ? 276 ASN A OD1 1 
ATOM   2108  N  ND2 . ASN A 1 276 ? 21.313  43.359  91.622  1.00 30.64  ? 276 ASN A ND2 1 
ATOM   2109  N  N   . GLY A 1 277 ? 18.990  40.161  87.492  1.00 16.60  ? 277 GLY A N   1 
ATOM   2110  C  CA  . GLY A 1 277 ? 18.508  38.872  87.030  1.00 16.59  ? 277 GLY A CA  1 
ATOM   2111  C  C   . GLY A 1 277 ? 18.689  38.784  85.526  1.00 17.87  ? 277 GLY A C   1 
ATOM   2112  O  O   . GLY A 1 277 ? 19.540  39.471  84.955  1.00 22.60  ? 277 GLY A O   1 
ATOM   2113  N  N   . ASN A 1 278 ? 17.889  37.964  84.866  1.00 20.29  ? 278 ASN A N   1 
ATOM   2114  C  CA  . ASN A 1 278 ? 18.014  37.832  83.421  1.00 24.03  ? 278 ASN A CA  1 
ATOM   2115  C  C   . ASN A 1 278 ? 16.684  37.557  82.749  1.00 22.66  ? 278 ASN A C   1 
ATOM   2116  O  O   . ASN A 1 278 ? 15.718  37.143  83.401  1.00 21.66  ? 278 ASN A O   1 
ATOM   2117  C  CB  . ASN A 1 278 ? 19.009  36.722  83.061  1.00 26.39  ? 278 ASN A CB  1 
ATOM   2118  C  CG  . ASN A 1 278 ? 18.569  35.351  83.558  1.00 32.33  ? 278 ASN A CG  1 
ATOM   2119  O  OD1 . ASN A 1 278 ? 19.080  34.857  84.558  1.00 41.61  ? 278 ASN A OD1 1 
ATOM   2120  N  ND2 . ASN A 1 278 ? 17.615  34.734  82.865  1.00 33.75  ? 278 ASN A ND2 1 
ATOM   2121  N  N   . MET A 1 279 ? 16.634  37.784  81.442  1.00 20.74  ? 279 MET A N   1 
ATOM   2122  C  CA  . MET A 1 279 ? 15.420  37.522  80.697  1.00 19.41  ? 279 MET A CA  1 
ATOM   2123  C  C   . MET A 1 279 ? 15.743  36.765  79.441  1.00 18.21  ? 279 MET A C   1 
ATOM   2124  O  O   . MET A 1 279 ? 16.735  37.049  78.773  1.00 19.44  ? 279 MET A O   1 
ATOM   2125  C  CB  . MET A 1 279 ? 14.701  38.817  80.321  1.00 20.14  ? 279 MET A CB  1 
ATOM   2126  C  CG  . MET A 1 279 ? 13.449  38.576  79.480  1.00 22.49  ? 279 MET A CG  1 
ATOM   2127  S  SD  . MET A 1 279 ? 12.751  40.078  78.813  1.00 27.97  ? 279 MET A SD  1 
ATOM   2128  C  CE  . MET A 1 279 ? 13.957  40.403  77.518  1.00 16.44  ? 279 MET A CE  1 
ATOM   2129  N  N   . TRP A 1 280 ? 14.903  35.785  79.148  1.00 18.35  ? 280 TRP A N   1 
ATOM   2130  C  CA  . TRP A 1 280 ? 15.025  34.983  77.949  1.00 17.39  ? 280 TRP A CA  1 
ATOM   2131  C  C   . TRP A 1 280 ? 13.736  35.127  77.189  1.00 19.14  ? 280 TRP A C   1 
ATOM   2132  O  O   . TRP A 1 280 ? 12.658  34.939  77.769  1.00 18.65  ? 280 TRP A O   1 
ATOM   2133  C  CB  . TRP A 1 280 ? 15.171  33.522  78.301  1.00 23.92  ? 280 TRP A CB  1 
ATOM   2134  C  CG  . TRP A 1 280 ? 16.559  33.119  78.462  1.00 33.92  ? 280 TRP A CG  1 
ATOM   2135  C  CD1 . TRP A 1 280 ? 17.209  32.848  79.632  1.00 36.22  ? 280 TRP A CD1 1 
ATOM   2136  C  CD2 . TRP A 1 280 ? 17.513  32.936  77.414  1.00 37.26  ? 280 TRP A CD2 1 
ATOM   2137  N  NE1 . TRP A 1 280 ? 18.518  32.506  79.373  1.00 37.94  ? 280 TRP A NE1 1 
ATOM   2138  C  CE2 . TRP A 1 280 ? 18.729  32.552  78.019  1.00 37.78  ? 280 TRP A CE2 1 
ATOM   2139  C  CE3 . TRP A 1 280 ? 17.457  33.056  76.018  1.00 37.58  ? 280 TRP A CE3 1 
ATOM   2140  C  CZ2 . TRP A 1 280 ? 19.884  32.286  77.273  1.00 38.88  ? 280 TRP A CZ2 1 
ATOM   2141  C  CZ3 . TRP A 1 280 ? 18.606  32.792  75.276  1.00 37.18  ? 280 TRP A CZ3 1 
ATOM   2142  C  CH2 . TRP A 1 280 ? 19.801  32.411  75.905  1.00 38.87  ? 280 TRP A CH2 1 
ATOM   2143  N  N   . ARG A 1 281 ? 13.833  35.460  75.904  1.00 20.30  ? 281 ARG A N   1 
ATOM   2144  C  CA  . ARG A 1 281 ? 12.651  35.584  75.065  1.00 18.32  ? 281 ARG A CA  1 
ATOM   2145  C  C   . ARG A 1 281 ? 12.918  34.840  73.767  1.00 19.91  ? 281 ARG A C   1 
ATOM   2146  O  O   . ARG A 1 281 ? 13.943  35.049  73.107  1.00 20.24  ? 281 ARG A O   1 
ATOM   2147  C  CB  . ARG A 1 281 ? 12.317  37.048  74.783  1.00 16.48  ? 281 ARG A CB  1 
ATOM   2148  C  CG  . ARG A 1 281 ? 11.035  37.258  73.978  1.00 14.48  ? 281 ARG A CG  1 
ATOM   2149  C  CD  . ARG A 1 281 ? 10.847  38.727  73.597  1.00 14.41  ? 281 ARG A CD  1 
ATOM   2150  N  NE  . ARG A 1 281 ? 10.369  39.528  74.721  1.00 16.36  ? 281 ARG A NE  1 
ATOM   2151  C  CZ  . ARG A 1 281 ? 10.811  40.746  75.022  1.00 17.10  ? 281 ARG A CZ  1 
ATOM   2152  N  NH1 . ARG A 1 281 ? 11.750  41.309  74.281  1.00 16.07  ? 281 ARG A NH1 1 
ATOM   2153  N  NH2 . ARG A 1 281 ? 10.306  41.407  76.056  1.00 15.20  ? 281 ARG A NH2 1 
ATOM   2154  N  N   . ILE A 1 282 ? 12.047  33.886  73.479  1.00 18.10  ? 282 ILE A N   1 
ATOM   2155  C  CA  . ILE A 1 282 ? 12.132  33.106  72.261  1.00 18.82  ? 282 ILE A CA  1 
ATOM   2156  C  C   . ILE A 1 282 ? 10.778  33.362  71.628  1.00 20.76  ? 282 ILE A C   1 
ATOM   2157  O  O   . ILE A 1 282 ? 9.724   33.059  72.218  1.00 18.56  ? 282 ILE A O   1 
ATOM   2158  C  CB  . ILE A 1 282 ? 12.348  31.627  72.559  1.00 20.97  ? 282 ILE A CB  1 
ATOM   2159  C  CG1 . ILE A 1 282 ? 13.638  31.475  73.374  1.00 21.62  ? 282 ILE A CG1 1 
ATOM   2160  C  CG2 . ILE A 1 282 ? 12.485  30.849  71.254  1.00 15.59  ? 282 ILE A CG2 1 
ATOM   2161  C  CD1 . ILE A 1 282 ? 13.863  30.085  73.898  1.00 30.17  ? 282 ILE A CD1 1 
ATOM   2162  N  N   . LEU A 1 283 ? 10.818  33.972  70.452  1.00 17.02  ? 283 LEU A N   1 
ATOM   2163  C  CA  . LEU A 1 283 ? 9.619   34.390  69.758  1.00 18.17  ? 283 LEU A CA  1 
ATOM   2164  C  C   . LEU A 1 283 ? 9.596   33.955  68.312  1.00 19.97  ? 283 LEU A C   1 
ATOM   2165  O  O   . LEU A 1 283 ? 10.621  34.002  67.617  1.00 19.32  ? 283 LEU A O   1 
ATOM   2166  C  CB  . LEU A 1 283 ? 9.594   35.925  69.754  1.00 13.30  ? 283 LEU A CB  1 
ATOM   2167  C  CG  . LEU A 1 283 ? 8.324   36.775  69.709  1.00 17.23  ? 283 LEU A CG  1 
ATOM   2168  C  CD1 . LEU A 1 283 ? 8.703   38.145  69.207  1.00 14.82  ? 283 LEU A CD1 1 
ATOM   2169  C  CD2 . LEU A 1 283 ? 7.235   36.185  68.848  1.00 14.61  ? 283 LEU A CD2 1 
ATOM   2170  N  N   . ASP A 1 284 ? 8.424   33.542  67.853  1.00 17.02  ? 284 ASP A N   1 
ATOM   2171  C  CA  . ASP A 1 284 ? 8.275   33.220  66.453  1.00 18.12  ? 284 ASP A CA  1 
ATOM   2172  C  C   . ASP A 1 284 ? 6.926   33.729  65.993  1.00 17.92  ? 284 ASP A C   1 
ATOM   2173  O  O   . ASP A 1 284 ? 5.892   33.378  66.569  1.00 19.09  ? 284 ASP A O   1 
ATOM   2174  C  CB  . ASP A 1 284 ? 8.426   31.746  66.169  1.00 20.22  ? 284 ASP A CB  1 
ATOM   2175  C  CG  . ASP A 1 284 ? 8.492   31.463  64.678  1.00 23.43  ? 284 ASP A CG  1 
ATOM   2176  O  OD1 . ASP A 1 284 ? 7.435   31.493  64.024  1.00 22.92  ? 284 ASP A OD1 1 
ATOM   2177  O  OD2 . ASP A 1 284 ? 9.597   31.259  64.141  1.00 22.93  ? 284 ASP A OD2 1 
ATOM   2178  N  N   . HIS A 1 285 ? 6.945   34.617  65.003  1.00 16.07  ? 285 HIS A N   1 
ATOM   2179  C  CA  . HIS A 1 285 ? 5.714   35.176  64.471  1.00 15.83  ? 285 HIS A CA  1 
ATOM   2180  C  C   . HIS A 1 285 ? 5.821   35.344  62.963  1.00 14.71  ? 285 HIS A C   1 
ATOM   2181  O  O   . HIS A 1 285 ? 6.924   35.373  62.415  1.00 18.66  ? 285 HIS A O   1 
ATOM   2182  C  CB  . HIS A 1 285 ? 5.401   36.512  65.140  1.00 14.86  ? 285 HIS A CB  1 
ATOM   2183  C  CG  . HIS A 1 285 ? 6.418   37.581  64.875  1.00 12.12  ? 285 HIS A CG  1 
ATOM   2184  N  ND1 . HIS A 1 285 ? 6.164   38.659  64.057  1.00 8.75   ? 285 HIS A ND1 1 
ATOM   2185  C  CD2 . HIS A 1 285 ? 7.671   37.762  65.353  1.00 12.68  ? 285 HIS A CD2 1 
ATOM   2186  C  CE1 . HIS A 1 285 ? 7.215   39.460  64.047  1.00 13.29  ? 285 HIS A CE1 1 
ATOM   2187  N  NE2 . HIS A 1 285 ? 8.144   38.939  64.825  1.00 11.16  ? 285 HIS A NE2 1 
ATOM   2188  N  N   . GLY A 1 286 ? 4.684   35.436  62.284  1.00 15.51  ? 286 GLY A N   1 
ATOM   2189  C  CA  . GLY A 1 286 ? 4.714   35.577  60.845  1.00 15.41  ? 286 GLY A CA  1 
ATOM   2190  C  C   . GLY A 1 286 ? 3.370   35.946  60.278  1.00 16.79  ? 286 GLY A C   1 
ATOM   2191  O  O   . GLY A 1 286 ? 2.386   36.093  61.019  1.00 16.34  ? 286 GLY A O   1 
ATOM   2192  N  N   . ALA A 1 287 ? 3.340   36.106  58.962  1.00 15.36  ? 287 ALA A N   1 
ATOM   2193  C  CA  . ALA A 1 287 ? 2.141   36.468  58.212  1.00 16.49  ? 287 ALA A CA  1 
ATOM   2194  C  C   . ALA A 1 287 ? 2.387   35.854  56.840  1.00 18.24  ? 287 ALA A C   1 
ATOM   2195  O  O   . ALA A 1 287 ? 3.418   36.097  56.206  1.00 20.82  ? 287 ALA A O   1 
ATOM   2196  C  CB  . ALA A 1 287 ? 2.008   37.996  58.113  1.00 13.10  ? 287 ALA A CB  1 
ATOM   2197  N  N   . ILE A 1 288 ? 1.483   34.993  56.416  1.00 18.59  ? 288 ILE A N   1 
ATOM   2198  C  CA  . ILE A 1 288 ? 1.639   34.309  55.147  1.00 17.31  ? 288 ILE A CA  1 
ATOM   2199  C  C   . ILE A 1 288 ? 0.282   34.149  54.466  1.00 20.73  ? 288 ILE A C   1 
ATOM   2200  O  O   . ILE A 1 288 ? -0.763  34.347  55.093  1.00 21.49  ? 288 ILE A O   1 
ATOM   2201  C  CB  . ILE A 1 288 ? 2.240   32.898  55.373  1.00 15.66  ? 288 ILE A CB  1 
ATOM   2202  C  CG1 . ILE A 1 288 ? 1.359   32.110  56.342  1.00 14.54  ? 288 ILE A CG1 1 
ATOM   2203  C  CG2 . ILE A 1 288 ? 3.660   32.985  55.927  1.00 14.97  ? 288 ILE A CG2 1 
ATOM   2204  C  CD1 . ILE A 1 288 ? 1.732   30.648  56.415  1.00 19.29  ? 288 ILE A CD1 1 
ATOM   2205  N  N   . SER A 1 289 ? 0.303   33.805  53.181  1.00 22.78  ? 289 SER A N   1 
ATOM   2206  C  CA  . SER A 1 289 ? -0.921  33.573  52.423  1.00 23.89  ? 289 SER A CA  1 
ATOM   2207  C  C   . SER A 1 289 ? -1.013  32.097  52.082  1.00 24.06  ? 289 SER A C   1 
ATOM   2208  O  O   . SER A 1 289 ? -0.054  31.513  51.578  1.00 26.87  ? 289 SER A O   1 
ATOM   2209  C  CB  . SER A 1 289 ? -0.915  34.369  51.127  1.00 21.40  ? 289 SER A CB  1 
ATOM   2210  O  OG  . SER A 1 289 ? -1.022  35.746  51.398  1.00 33.60  ? 289 SER A OG  1 
ATOM   2211  N  N   . LEU A 1 290 ? -2.144  31.488  52.411  1.00 26.16  ? 290 LEU A N   1 
ATOM   2212  C  CA  . LEU A 1 290 ? -2.393  30.083  52.108  1.00 30.49  ? 290 LEU A CA  1 
ATOM   2213  C  C   . LEU A 1 290 ? -3.357  30.059  50.927  1.00 33.50  ? 290 LEU A C   1 
ATOM   2214  O  O   . LEU A 1 290 ? -4.565  29.907  51.095  1.00 38.90  ? 290 LEU A O   1 
ATOM   2215  C  CB  . LEU A 1 290 ? -3.046  29.362  53.292  1.00 32.48  ? 290 LEU A CB  1 
ATOM   2216  C  CG  . LEU A 1 290 ? -2.232  29.078  54.549  1.00 31.81  ? 290 LEU A CG  1 
ATOM   2217  C  CD1 . LEU A 1 290 ? -0.854  28.635  54.123  1.00 29.50  ? 290 LEU A CD1 1 
ATOM   2218  C  CD2 . LEU A 1 290 ? -2.143  30.308  55.429  1.00 37.55  ? 290 LEU A CD2 1 
ATOM   2219  N  N   . GLY A 1 291 ? -2.834  30.257  49.729  1.00 35.96  ? 291 GLY A N   1 
ATOM   2220  C  CA  . GLY A 1 291 ? -3.698  30.250  48.568  1.00 35.09  ? 291 GLY A CA  1 
ATOM   2221  C  C   . GLY A 1 291 ? -4.332  31.597  48.265  1.00 34.58  ? 291 GLY A C   1 
ATOM   2222  O  O   . GLY A 1 291 ? -3.838  32.648  48.679  1.00 36.30  ? 291 GLY A O   1 
ATOM   2223  N  N   . ASP A 1 292 ? -5.454  31.557  47.556  1.00 32.03  ? 292 ASP A N   1 
ATOM   2224  C  CA  . ASP A 1 292 ? -6.144  32.766  47.150  1.00 32.89  ? 292 ASP A CA  1 
ATOM   2225  C  C   . ASP A 1 292 ? -7.099  33.354  48.161  1.00 30.57  ? 292 ASP A C   1 
ATOM   2226  O  O   . ASP A 1 292 ? -7.289  34.564  48.175  1.00 35.57  ? 292 ASP A O   1 
ATOM   2227  C  CB  . ASP A 1 292 ? -6.946  32.529  45.856  1.00 41.51  ? 292 ASP A CB  1 
ATOM   2228  C  CG  . ASP A 1 292 ? -6.076  32.166  44.652  1.00 47.65  ? 292 ASP A CG  1 
ATOM   2229  O  OD1 . ASP A 1 292 ? -4.836  32.379  44.684  1.00 50.23  ? 292 ASP A OD1 1 
ATOM   2230  O  OD2 . ASP A 1 292 ? -6.661  31.664  43.661  1.00 50.37  ? 292 ASP A OD2 1 
ATOM   2231  N  N   . LYS A 1 293 ? -7.732  32.508  48.967  1.00 25.22  ? 293 LYS A N   1 
ATOM   2232  C  CA  . LYS A 1 293 ? -8.734  32.969  49.921  1.00 20.62  ? 293 LYS A CA  1 
ATOM   2233  C  C   . LYS A 1 293 ? -8.313  33.089  51.359  1.00 21.02  ? 293 LYS A C   1 
ATOM   2234  O  O   . LYS A 1 293 ? -9.090  33.584  52.172  1.00 21.74  ? 293 LYS A O   1 
ATOM   2235  C  CB  . LYS A 1 293 ? -9.936  32.035  49.888  1.00 23.78  ? 293 LYS A CB  1 
ATOM   2236  C  CG  . LYS A 1 293 ? -10.559 31.851  48.528  1.00 27.99  ? 293 LYS A CG  1 
ATOM   2237  C  CD  . LYS A 1 293 ? -11.421 33.024  48.154  1.00 37.96  ? 293 LYS A CD  1 
ATOM   2238  C  CE  . LYS A 1 293 ? -12.173 32.779  46.862  1.00 39.45  ? 293 LYS A CE  1 
ATOM   2239  N  NZ  . LYS A 1 293 ? -13.298 33.743  46.755  1.00 48.70  ? 293 LYS A NZ  1 
ATOM   2240  N  N   . TRP A 1 294 ? -7.096  32.670  51.678  1.00 19.35  ? 294 TRP A N   1 
ATOM   2241  C  CA  . TRP A 1 294 ? -6.646  32.688  53.060  1.00 18.82  ? 294 TRP A CA  1 
ATOM   2242  C  C   . TRP A 1 294 ? -5.352  33.370  53.360  1.00 18.58  ? 294 TRP A C   1 
ATOM   2243  O  O   . TRP A 1 294 ? -4.334  33.093  52.728  1.00 20.82  ? 294 TRP A O   1 
ATOM   2244  C  CB  . TRP A 1 294 ? -6.465  31.264  53.561  1.00 20.68  ? 294 TRP A CB  1 
ATOM   2245  C  CG  . TRP A 1 294 ? -7.704  30.471  53.625  1.00 25.69  ? 294 TRP A CG  1 
ATOM   2246  C  CD1 . TRP A 1 294 ? -8.170  29.601  52.685  1.00 23.70  ? 294 TRP A CD1 1 
ATOM   2247  C  CD2 . TRP A 1 294 ? -8.626  30.423  54.715  1.00 27.03  ? 294 TRP A CD2 1 
ATOM   2248  N  NE1 . TRP A 1 294 ? -9.325  29.007  53.125  1.00 25.65  ? 294 TRP A NE1 1 
ATOM   2249  C  CE2 . TRP A 1 294 ? -9.629  29.492  54.369  1.00 26.30  ? 294 TRP A CE2 1 
ATOM   2250  C  CE3 . TRP A 1 294 ? -8.702  31.076  55.955  1.00 29.77  ? 294 TRP A CE3 1 
ATOM   2251  C  CZ2 . TRP A 1 294 ? -10.699 29.194  55.219  1.00 26.88  ? 294 TRP A CZ2 1 
ATOM   2252  C  CZ3 . TRP A 1 294 ? -9.765  30.783  56.801  1.00 29.23  ? 294 TRP A CZ3 1 
ATOM   2253  C  CH2 . TRP A 1 294 ? -10.749 29.848  56.427  1.00 29.26  ? 294 TRP A CH2 1 
ATOM   2254  N  N   . ASP A 1 295 ? -5.372  34.162  54.421  1.00 17.65  ? 295 ASP A N   1 
ATOM   2255  C  CA  . ASP A 1 295 ? -4.177  34.823  54.912  1.00 18.93  ? 295 ASP A CA  1 
ATOM   2256  C  C   . ASP A 1 295 ? -4.094  34.388  56.359  1.00 20.41  ? 295 ASP A C   1 
ATOM   2257  O  O   . ASP A 1 295 ? -5.111  34.033  56.957  1.00 20.69  ? 295 ASP A O   1 
ATOM   2258  C  CB  . ASP A 1 295 ? -4.291  36.337  54.806  1.00 21.07  ? 295 ASP A CB  1 
ATOM   2259  C  CG  . ASP A 1 295 ? -3.726  36.868  53.505  1.00 22.65  ? 295 ASP A CG  1 
ATOM   2260  O  OD1 . ASP A 1 295 ? -3.468  36.068  52.574  1.00 22.23  ? 295 ASP A OD1 1 
ATOM   2261  O  OD2 . ASP A 1 295 ? -3.525  38.096  53.421  1.00 24.72  ? 295 ASP A OD2 1 
ATOM   2262  N  N   . LEU A 1 296 ? -2.903  34.412  56.932  1.00 20.05  ? 296 LEU A N   1 
ATOM   2263  C  CA  . LEU A 1 296 ? -2.757  33.980  58.306  1.00 18.86  ? 296 LEU A CA  1 
ATOM   2264  C  C   . LEU A 1 296 ? -1.649  34.695  59.067  1.00 18.76  ? 296 LEU A C   1 
ATOM   2265  O  O   . LEU A 1 296 ? -0.539  34.865  58.555  1.00 22.07  ? 296 LEU A O   1 
ATOM   2266  C  CB  . LEU A 1 296 ? -2.479  32.475  58.327  1.00 18.76  ? 296 LEU A CB  1 
ATOM   2267  C  CG  . LEU A 1 296 ? -2.213  31.836  59.692  1.00 19.94  ? 296 LEU A CG  1 
ATOM   2268  C  CD1 . LEU A 1 296 ? -3.511  31.729  60.451  1.00 20.51  ? 296 LEU A CD1 1 
ATOM   2269  C  CD2 . LEU A 1 296 ? -1.614  30.460  59.516  1.00 18.42  ? 296 LEU A CD2 1 
ATOM   2270  N  N   . MET A 1 297 ? -1.979  35.158  60.267  1.00 18.44  ? 297 MET A N   1 
ATOM   2271  C  CA  . MET A 1 297 ? -1.015  35.790  61.161  1.00 16.17  ? 297 MET A CA  1 
ATOM   2272  C  C   . MET A 1 297 ? -0.912  34.831  62.347  1.00 17.93  ? 297 MET A C   1 
ATOM   2273  O  O   . MET A 1 297 ? -1.903  34.196  62.729  1.00 17.67  ? 297 MET A O   1 
ATOM   2274  C  CB  . MET A 1 297 ? -1.536  37.132  61.667  1.00 17.23  ? 297 MET A CB  1 
ATOM   2275  C  CG  . MET A 1 297 ? -1.075  38.340  60.907  1.00 16.06  ? 297 MET A CG  1 
ATOM   2276  S  SD  . MET A 1 297 ? -1.861  39.759  61.638  1.00 20.97  ? 297 MET A SD  1 
ATOM   2277  C  CE  . MET A 1 297 ? -1.227  41.057  60.650  1.00 17.81  ? 297 MET A CE  1 
ATOM   2278  N  N   . TYR A 1 298 ? 0.270   34.707  62.934  1.00 17.63  ? 298 TYR A N   1 
ATOM   2279  C  CA  . TYR A 1 298 ? 0.441   33.816  64.078  1.00 16.88  ? 298 TYR A CA  1 
ATOM   2280  C  C   . TYR A 1 298 ? 1.568   34.286  64.968  1.00 18.30  ? 298 TYR A C   1 
ATOM   2281  O  O   . TYR A 1 298 ? 2.450   35.016  64.510  1.00 18.97  ? 298 TYR A O   1 
ATOM   2282  C  CB  . TYR A 1 298 ? 0.705   32.381  63.608  1.00 15.30  ? 298 TYR A CB  1 
ATOM   2283  C  CG  . TYR A 1 298 ? 1.898   32.232  62.691  1.00 15.48  ? 298 TYR A CG  1 
ATOM   2284  C  CD1 . TYR A 1 298 ? 3.180   32.007  63.206  1.00 13.64  ? 298 TYR A CD1 1 
ATOM   2285  C  CD2 . TYR A 1 298 ? 1.756   32.362  61.305  1.00 15.49  ? 298 TYR A CD2 1 
ATOM   2286  C  CE1 . TYR A 1 298 ? 4.302   31.923  62.360  1.00 17.83  ? 298 TYR A CE1 1 
ATOM   2287  C  CE2 . TYR A 1 298 ? 2.872   32.284  60.448  1.00 15.76  ? 298 TYR A CE2 1 
ATOM   2288  C  CZ  . TYR A 1 298 ? 4.138   32.069  60.981  1.00 18.25  ? 298 TYR A CZ  1 
ATOM   2289  O  OH  . TYR A 1 298 ? 5.230   32.035  60.133  1.00 18.99  ? 298 TYR A OH  1 
ATOM   2290  N  N   . VAL A 1 299 ? 1.516   33.896  66.242  1.00 19.10  ? 299 VAL A N   1 
ATOM   2291  C  CA  . VAL A 1 299 ? 2.551   34.238  67.218  1.00 14.63  ? 299 VAL A CA  1 
ATOM   2292  C  C   . VAL A 1 299 ? 2.713   33.063  68.143  1.00 15.78  ? 299 VAL A C   1 
ATOM   2293  O  O   . VAL A 1 299 ? 1.734   32.419  68.529  1.00 16.95  ? 299 VAL A O   1 
ATOM   2294  C  CB  . VAL A 1 299 ? 2.158   35.310  68.240  1.00 14.14  ? 299 VAL A CB  1 
ATOM   2295  C  CG1 . VAL A 1 299 ? 3.311   36.249  68.492  1.00 14.63  ? 299 VAL A CG1 1 
ATOM   2296  C  CG2 . VAL A 1 299 ? 0.903   35.999  67.886  1.00 18.45  ? 299 VAL A CG2 1 
ATOM   2297  N  N   . GLY A 1 300 ? 3.935   32.912  68.621  1.00 16.67  ? 300 GLY A N   1 
ATOM   2298  C  CA  . GLY A 1 300 ? 4.264   31.880  69.575  1.00 14.31  ? 300 GLY A CA  1 
ATOM   2299  C  C   . GLY A 1 300 ? 5.411   32.494  70.353  1.00 16.82  ? 300 GLY A C   1 
ATOM   2300  O  O   . GLY A 1 300 ? 6.420   32.889  69.743  1.00 16.97  ? 300 GLY A O   1 
ATOM   2301  N  N   . MET A 1 301 ? 5.239   32.676  71.658  1.00 15.93  ? 301 MET A N   1 
ATOM   2302  C  CA  . MET A 1 301 ? 6.304   33.257  72.471  1.00 16.58  ? 301 MET A CA  1 
ATOM   2303  C  C   . MET A 1 301 ? 6.461   32.697  73.883  1.00 18.44  ? 301 MET A C   1 
ATOM   2304  O  O   . MET A 1 301 ? 5.480   32.365  74.562  1.00 18.04  ? 301 MET A O   1 
ATOM   2305  C  CB  . MET A 1 301 ? 6.161   34.776  72.568  1.00 13.90  ? 301 MET A CB  1 
ATOM   2306  C  CG  . MET A 1 301 ? 7.274   35.402  73.372  1.00 13.25  ? 301 MET A CG  1 
ATOM   2307  S  SD  . MET A 1 301 ? 7.270   37.171  73.309  1.00 21.64  ? 301 MET A SD  1 
ATOM   2308  C  CE  . MET A 1 301 ? 5.776   37.487  74.118  1.00 13.92  ? 301 MET A CE  1 
ATOM   2309  N  N   . TYR A 1 302 ? 7.716   32.572  74.295  1.00 16.84  ? 302 TYR A N   1 
ATOM   2310  C  CA  . TYR A 1 302 ? 8.051   32.127  75.629  1.00 16.08  ? 302 TYR A CA  1 
ATOM   2311  C  C   . TYR A 1 302 ? 8.938   33.212  76.182  1.00 14.67  ? 302 TYR A C   1 
ATOM   2312  O  O   . TYR A 1 302 ? 9.942   33.577  75.562  1.00 14.66  ? 302 TYR A O   1 
ATOM   2313  C  CB  . TYR A 1 302 ? 8.833   30.825  75.606  1.00 17.93  ? 302 TYR A CB  1 
ATOM   2314  C  CG  . TYR A 1 302 ? 9.397   30.482  76.966  1.00 19.99  ? 302 TYR A CG  1 
ATOM   2315  C  CD1 . TYR A 1 302 ? 8.588   29.933  77.957  1.00 21.74  ? 302 TYR A CD1 1 
ATOM   2316  C  CD2 . TYR A 1 302 ? 10.735  30.732  77.272  1.00 22.17  ? 302 TYR A CD2 1 
ATOM   2317  C  CE1 . TYR A 1 302 ? 9.091   29.635  79.222  1.00 21.14  ? 302 TYR A CE1 1 
ATOM   2318  C  CE2 . TYR A 1 302 ? 11.256  30.443  78.539  1.00 21.20  ? 302 TYR A CE2 1 
ATOM   2319  C  CZ  . TYR A 1 302 ? 10.427  29.892  79.505  1.00 23.47  ? 302 TYR A CZ  1 
ATOM   2320  O  OH  . TYR A 1 302 ? 10.927  29.572  80.747  1.00 32.05  ? 302 TYR A OH  1 
ATOM   2321  N  N   . GLN A 1 303 ? 8.572   33.740  77.334  1.00 14.45  ? 303 GLN A N   1 
ATOM   2322  C  CA  . GLN A 1 303 ? 9.366   34.792  77.939  1.00 17.01  ? 303 GLN A CA  1 
ATOM   2323  C  C   . GLN A 1 303 ? 9.507   34.476  79.410  1.00 19.81  ? 303 GLN A C   1 
ATOM   2324  O  O   . GLN A 1 303 ? 8.523   34.200  80.089  1.00 21.32  ? 303 GLN A O   1 
ATOM   2325  C  CB  . GLN A 1 303 ? 8.706   36.163  77.753  1.00 14.05  ? 303 GLN A CB  1 
ATOM   2326  C  CG  . GLN A 1 303 ? 9.473   37.271  78.434  1.00 12.42  ? 303 GLN A CG  1 
ATOM   2327  C  CD  . GLN A 1 303 ? 8.900   38.623  78.155  1.00 17.26  ? 303 GLN A CD  1 
ATOM   2328  O  OE1 . GLN A 1 303 ? 9.101   39.177  77.074  1.00 18.86  ? 303 GLN A OE1 1 
ATOM   2329  N  NE2 . GLN A 1 303 ? 8.190   39.180  79.131  1.00 16.17  ? 303 GLN A NE2 1 
ATOM   2330  N  N   . ASN A 1 304 ? 10.736  34.512  79.896  1.00 20.04  ? 304 ASN A N   1 
ATOM   2331  C  CA  . ASN A 1 304 ? 11.009  34.218  81.289  1.00 18.55  ? 304 ASN A CA  1 
ATOM   2332  C  C   . ASN A 1 304 ? 11.869  35.286  81.941  1.00 18.41  ? 304 ASN A C   1 
ATOM   2333  O  O   . ASN A 1 304 ? 13.025  35.504  81.545  1.00 19.87  ? 304 ASN A O   1 
ATOM   2334  C  CB  . ASN A 1 304 ? 11.697  32.858  81.395  1.00 24.78  ? 304 ASN A CB  1 
ATOM   2335  C  CG  . ASN A 1 304 ? 11.990  32.463  82.823  1.00 27.69  ? 304 ASN A CG  1 
ATOM   2336  O  OD1 . ASN A 1 304 ? 11.115  32.503  83.681  1.00 30.51  ? 304 ASN A OD1 1 
ATOM   2337  N  ND2 . ASN A 1 304 ? 13.231  32.090  83.086  1.00 33.94  ? 304 ASN A ND2 1 
ATOM   2338  N  N   . ILE A 1 305 ? 11.269  36.016  82.872  1.00 19.58  ? 305 ILE A N   1 
ATOM   2339  C  CA  . ILE A 1 305 ? 11.985  37.054  83.596  1.00 20.88  ? 305 ILE A CA  1 
ATOM   2340  C  C   . ILE A 1 305 ? 12.327  36.431  84.938  1.00 23.75  ? 305 ILE A C   1 
ATOM   2341  O  O   . ILE A 1 305 ? 11.457  36.202  85.775  1.00 22.53  ? 305 ILE A O   1 
ATOM   2342  C  CB  . ILE A 1 305 ? 11.149  38.324  83.795  1.00 18.41  ? 305 ILE A CB  1 
ATOM   2343  C  CG1 . ILE A 1 305 ? 10.709  38.880  82.434  1.00 18.14  ? 305 ILE A CG1 1 
ATOM   2344  C  CG2 . ILE A 1 305 ? 11.984  39.369  84.535  1.00 18.38  ? 305 ILE A CG2 1 
ATOM   2345  C  CD1 . ILE A 1 305 ? 10.008  40.219  82.502  1.00 17.04  ? 305 ILE A CD1 1 
ATOM   2346  N  N   . ASP A 1 306 ? 13.589  36.044  85.067  1.00 24.46  ? 306 ASP A N   1 
ATOM   2347  C  CA  . ASP A 1 306 ? 14.111  35.408  86.265  1.00 24.67  ? 306 ASP A CA  1 
ATOM   2348  C  C   . ASP A 1 306 ? 14.850  36.438  87.116  1.00 22.93  ? 306 ASP A C   1 
ATOM   2349  O  O   . ASP A 1 306 ? 16.015  36.765  86.868  1.00 22.95  ? 306 ASP A O   1 
ATOM   2350  C  CB  . ASP A 1 306 ? 15.062  34.278  85.847  1.00 29.99  ? 306 ASP A CB  1 
ATOM   2351  C  CG  . ASP A 1 306 ? 15.624  33.491  87.021  1.00 33.41  ? 306 ASP A CG  1 
ATOM   2352  O  OD1 . ASP A 1 306 ? 15.364  33.834  88.192  1.00 42.03  ? 306 ASP A OD1 1 
ATOM   2353  O  OD2 . ASP A 1 306 ? 16.342  32.509  86.759  1.00 44.36  ? 306 ASP A OD2 1 
ATOM   2354  N  N   . TRP A 1 307 ? 14.176  36.955  88.124  1.00 22.73  ? 307 TRP A N   1 
ATOM   2355  C  CA  . TRP A 1 307 ? 14.807  37.939  88.977  1.00 22.55  ? 307 TRP A CA  1 
ATOM   2356  C  C   . TRP A 1 307 ? 15.388  37.313  90.228  1.00 24.08  ? 307 TRP A C   1 
ATOM   2357  O  O   . TRP A 1 307 ? 14.806  36.374  90.788  1.00 21.68  ? 307 TRP A O   1 
ATOM   2358  C  CB  . TRP A 1 307 ? 13.813  39.025  89.352  1.00 19.53  ? 307 TRP A CB  1 
ATOM   2359  C  CG  . TRP A 1 307 ? 13.729  40.077  88.341  1.00 20.90  ? 307 TRP A CG  1 
ATOM   2360  C  CD1 . TRP A 1 307 ? 14.740  40.531  87.555  1.00 20.72  ? 307 TRP A CD1 1 
ATOM   2361  C  CD2 . TRP A 1 307 ? 12.580  40.843  88.005  1.00 21.06  ? 307 TRP A CD2 1 
ATOM   2362  N  NE1 . TRP A 1 307 ? 14.295  41.538  86.751  1.00 20.28  ? 307 TRP A NE1 1 
ATOM   2363  C  CE2 . TRP A 1 307 ? 12.968  41.754  87.004  1.00 20.01  ? 307 TRP A CE2 1 
ATOM   2364  C  CE3 . TRP A 1 307 ? 11.256  40.853  88.456  1.00 25.91  ? 307 TRP A CE3 1 
ATOM   2365  C  CZ2 . TRP A 1 307 ? 12.081  42.670  86.440  1.00 22.17  ? 307 TRP A CZ2 1 
ATOM   2366  C  CZ3 . TRP A 1 307 ? 10.376  41.760  87.902  1.00 27.97  ? 307 TRP A CZ3 1 
ATOM   2367  C  CH2 . TRP A 1 307 ? 10.793  42.661  86.899  1.00 24.54  ? 307 TRP A CH2 1 
ATOM   2368  N  N   . ASP A 1 308 ? 16.534  37.844  90.658  1.00 27.08  ? 308 ASP A N   1 
ATOM   2369  C  CA  . ASP A 1 308 ? 17.221  37.384  91.864  1.00 23.87  ? 308 ASP A CA  1 
ATOM   2370  C  C   . ASP A 1 308 ? 16.233  37.377  93.031  1.00 26.52  ? 308 ASP A C   1 
ATOM   2371  O  O   . ASP A 1 308 ? 16.239  36.460  93.857  1.00 28.00  ? 308 ASP A O   1 
ATOM   2372  C  CB  . ASP A 1 308 ? 18.374  38.327  92.217  1.00 21.11  ? 308 ASP A CB  1 
ATOM   2373  C  CG  . ASP A 1 308 ? 19.629  38.067  91.411  1.00 21.53  ? 308 ASP A CG  1 
ATOM   2374  O  OD1 . ASP A 1 308 ? 19.663  37.127  90.587  1.00 24.53  ? 308 ASP A OD1 1 
ATOM   2375  O  OD2 . ASP A 1 308 ? 20.601  38.821  91.616  1.00 21.41  ? 308 ASP A OD2 1 
ATOM   2376  N  N   . ASN A 1 309 ? 15.388  38.405  93.091  1.00 24.31  ? 309 ASN A N   1 
ATOM   2377  C  CA  . ASN A 1 309 ? 14.397  38.527  94.156  1.00 25.26  ? 309 ASN A CA  1 
ATOM   2378  C  C   . ASN A 1 309 ? 13.154  37.670  93.992  1.00 25.49  ? 309 ASN A C   1 
ATOM   2379  O  O   . ASN A 1 309 ? 12.211  37.794  94.768  1.00 30.43  ? 309 ASN A O   1 
ATOM   2380  C  CB  . ASN A 1 309 ? 14.003  39.995  94.400  1.00 25.86  ? 309 ASN A CB  1 
ATOM   2381  C  CG  . ASN A 1 309 ? 13.363  40.649  93.196  1.00 27.48  ? 309 ASN A CG  1 
ATOM   2382  O  OD1 . ASN A 1 309 ? 12.667  40.001  92.407  1.00 28.27  ? 309 ASN A OD1 1 
ATOM   2383  N  ND2 . ASN A 1 309 ? 13.581  41.948  93.054  1.00 25.87  ? 309 ASN A ND2 1 
ATOM   2384  N  N   . ASN A 1 310 ? 13.149  36.810  92.983  1.00 27.15  ? 310 ASN A N   1 
ATOM   2385  C  CA  . ASN A 1 310 ? 12.021  35.920  92.729  1.00 29.10  ? 310 ASN A CA  1 
ATOM   2386  C  C   . ASN A 1 310 ? 10.676  36.574  92.431  1.00 26.83  ? 310 ASN A C   1 
ATOM   2387  O  O   . ASN A 1 310 ? 9.643   35.909  92.500  1.00 26.35  ? 310 ASN A O   1 
ATOM   2388  C  CB  . ASN A 1 310 ? 11.861  34.937  93.887  1.00 33.60  ? 310 ASN A CB  1 
ATOM   2389  C  CG  . ASN A 1 310 ? 12.931  33.889  93.891  1.00 42.13  ? 310 ASN A CG  1 
ATOM   2390  O  OD1 . ASN A 1 310 ? 12.704  32.759  93.463  1.00 51.76  ? 310 ASN A OD1 1 
ATOM   2391  N  ND2 . ASN A 1 310 ? 14.127  34.263  94.329  1.00 48.94  ? 310 ASN A ND2 1 
ATOM   2392  N  N   . LEU A 1 311 ? 10.685  37.853  92.067  1.00 24.68  ? 311 LEU A N   1 
ATOM   2393  C  CA  . LEU A 1 311 ? 9.443   38.566  91.774  1.00 23.28  ? 311 LEU A CA  1 
ATOM   2394  C  C   . LEU A 1 311 ? 9.069   38.569  90.287  1.00 23.51  ? 311 LEU A C   1 
ATOM   2395  O  O   . LEU A 1 311 ? 8.137   39.253  89.888  1.00 25.18  ? 311 LEU A O   1 
ATOM   2396  C  CB  . LEU A 1 311 ? 9.529   39.997  92.298  1.00 19.44  ? 311 LEU A CB  1 
ATOM   2397  C  CG  . LEU A 1 311 ? 9.841   40.184  93.785  1.00 20.30  ? 311 LEU A CG  1 
ATOM   2398  C  CD1 . LEU A 1 311 ? 9.836   41.675  94.131  1.00 13.99  ? 311 LEU A CD1 1 
ATOM   2399  C  CD2 . LEU A 1 311 ? 8.822   39.459  94.632  1.00 16.52  ? 311 LEU A CD2 1 
ATOM   2400  N  N   . GLY A 1 312 ? 9.763   37.756  89.491  1.00 25.31  ? 312 GLY A N   1 
ATOM   2401  C  CA  . GLY A 1 312 ? 9.525   37.680  88.056  1.00 22.07  ? 312 GLY A CA  1 
ATOM   2402  C  C   . GLY A 1 312 ? 8.314   36.886  87.590  1.00 23.77  ? 312 GLY A C   1 
ATOM   2403  O  O   . GLY A 1 312 ? 7.409   36.585  88.384  1.00 24.16  ? 312 GLY A O   1 
ATOM   2404  N  N   . THR A 1 313 ? 8.309   36.529  86.300  1.00 23.02  ? 313 THR A N   1 
ATOM   2405  C  CA  . THR A 1 313 ? 7.212   35.785  85.675  1.00 20.08  ? 313 THR A CA  1 
ATOM   2406  C  C   . THR A 1 313 ? 7.701   34.937  84.509  1.00 19.78  ? 313 THR A C   1 
ATOM   2407  O  O   . THR A 1 313 ? 8.724   35.236  83.902  1.00 22.36  ? 313 THR A O   1 
ATOM   2408  C  CB  . THR A 1 313 ? 6.137   36.739  85.100  1.00 21.13  ? 313 THR A CB  1 
ATOM   2409  O  OG1 . THR A 1 313 ? 6.762   37.710  84.250  1.00 22.86  ? 313 THR A OG1 1 
ATOM   2410  C  CG2 . THR A 1 313 ? 5.370   37.468  86.211  1.00 20.18  ? 313 THR A CG2 1 
ATOM   2411  N  N   . GLU A 1 314 ? 6.989   33.850  84.239  1.00 19.59  ? 314 GLU A N   1 
ATOM   2412  C  CA  . GLU A 1 314 ? 7.289   32.962  83.127  1.00 21.34  ? 314 GLU A CA  1 
ATOM   2413  C  C   . GLU A 1 314 ? 6.019   33.030  82.297  1.00 22.85  ? 314 GLU A C   1 
ATOM   2414  O  O   . GLU A 1 314 ? 4.939   32.654  82.764  1.00 25.27  ? 314 GLU A O   1 
ATOM   2415  C  CB  . GLU A 1 314 ? 7.522   31.540  83.599  1.00 24.28  ? 314 GLU A CB  1 
ATOM   2416  C  CG  . GLU A 1 314 ? 7.776   30.609  82.438  1.00 35.63  ? 314 GLU A CG  1 
ATOM   2417  C  CD  . GLU A 1 314 ? 7.957   29.170  82.839  1.00 41.19  ? 314 GLU A CD  1 
ATOM   2418  O  OE1 . GLU A 1 314 ? 6.949   28.435  82.905  1.00 48.62  ? 314 GLU A OE1 1 
ATOM   2419  O  OE2 . GLU A 1 314 ? 9.117   28.767  83.044  1.00 45.54  ? 314 GLU A OE2 1 
ATOM   2420  N  N   . TRP A 1 315 ? 6.158   33.457  81.051  1.00 22.40  ? 315 TRP A N   1 
ATOM   2421  C  CA  . TRP A 1 315 ? 5.009   33.681  80.188  1.00 20.32  ? 315 TRP A CA  1 
ATOM   2422  C  C   . TRP A 1 315 ? 5.022   32.956  78.856  1.00 20.29  ? 315 TRP A C   1 
ATOM   2423  O  O   . TRP A 1 315 ? 6.027   32.966  78.134  1.00 21.60  ? 315 TRP A O   1 
ATOM   2424  C  CB  . TRP A 1 315 ? 4.893   35.195  79.980  1.00 19.77  ? 315 TRP A CB  1 
ATOM   2425  C  CG  . TRP A 1 315 ? 3.783   35.682  79.124  1.00 18.77  ? 315 TRP A CG  1 
ATOM   2426  C  CD1 . TRP A 1 315 ? 2.553   35.115  78.944  1.00 18.52  ? 315 TRP A CD1 1 
ATOM   2427  C  CD2 . TRP A 1 315 ? 3.804   36.868  78.334  1.00 16.78  ? 315 TRP A CD2 1 
ATOM   2428  N  NE1 . TRP A 1 315 ? 1.808   35.878  78.084  1.00 19.26  ? 315 TRP A NE1 1 
ATOM   2429  C  CE2 . TRP A 1 315 ? 2.553   36.964  77.694  1.00 19.70  ? 315 TRP A CE2 1 
ATOM   2430  C  CE3 . TRP A 1 315 ? 4.764   37.866  78.104  1.00 16.05  ? 315 TRP A CE3 1 
ATOM   2431  C  CZ2 . TRP A 1 315 ? 2.234   38.023  76.833  1.00 19.10  ? 315 TRP A CZ2 1 
ATOM   2432  C  CZ3 . TRP A 1 315 ? 4.446   38.916  77.249  1.00 15.16  ? 315 TRP A CZ3 1 
ATOM   2433  C  CH2 . TRP A 1 315 ? 3.192   38.984  76.625  1.00 16.65  ? 315 TRP A CH2 1 
ATOM   2434  N  N   . TRP A 1 316 ? 3.888   32.331  78.554  1.00 19.59  ? 316 TRP A N   1 
ATOM   2435  C  CA  . TRP A 1 316 ? 3.671   31.588  77.317  1.00 21.23  ? 316 TRP A CA  1 
ATOM   2436  C  C   . TRP A 1 316 ? 2.484   32.231  76.636  1.00 21.99  ? 316 TRP A C   1 
ATOM   2437  O  O   . TRP A 1 316 ? 1.454   32.480  77.280  1.00 20.30  ? 316 TRP A O   1 
ATOM   2438  C  CB  . TRP A 1 316 ? 3.252   30.144  77.602  1.00 26.71  ? 316 TRP A CB  1 
ATOM   2439  C  CG  . TRP A 1 316 ? 4.271   29.298  78.256  1.00 38.01  ? 316 TRP A CG  1 
ATOM   2440  C  CD1 . TRP A 1 316 ? 4.459   29.121  79.600  1.00 41.61  ? 316 TRP A CD1 1 
ATOM   2441  C  CD2 . TRP A 1 316 ? 5.246   28.489  77.599  1.00 43.36  ? 316 TRP A CD2 1 
ATOM   2442  N  NE1 . TRP A 1 316 ? 5.501   28.249  79.816  1.00 45.47  ? 316 TRP A NE1 1 
ATOM   2443  C  CE2 . TRP A 1 316 ? 6.000   27.845  78.604  1.00 44.74  ? 316 TRP A CE2 1 
ATOM   2444  C  CE3 . TRP A 1 316 ? 5.557   28.244  76.252  1.00 47.15  ? 316 TRP A CE3 1 
ATOM   2445  C  CZ2 . TRP A 1 316 ? 7.050   26.968  78.305  1.00 48.03  ? 316 TRP A CZ2 1 
ATOM   2446  C  CZ3 . TRP A 1 316 ? 6.603   27.371  75.953  1.00 49.21  ? 316 TRP A CZ3 1 
ATOM   2447  C  CH2 . TRP A 1 316 ? 7.336   26.744  76.979  1.00 50.12  ? 316 TRP A CH2 1 
ATOM   2448  N  N   . THR A 1 317 ? 2.604   32.487  75.341  1.00 21.19  ? 317 THR A N   1 
ATOM   2449  C  CA  . THR A 1 317 ? 1.489   33.054  74.608  1.00 20.83  ? 317 THR A CA  1 
ATOM   2450  C  C   . THR A 1 317 ? 1.494   32.479  73.201  1.00 21.08  ? 317 THR A C   1 
ATOM   2451  O  O   . THR A 1 317 ? 2.552   32.291  72.597  1.00 23.38  ? 317 THR A O   1 
ATOM   2452  C  CB  . THR A 1 317 ? 1.519   34.592  74.600  1.00 18.00  ? 317 THR A CB  1 
ATOM   2453  O  OG1 . THR A 1 317 ? 0.252   35.076  74.150  1.00 23.82  ? 317 THR A OG1 1 
ATOM   2454  C  CG2 . THR A 1 317 ? 2.619   35.123  73.699  1.00 15.95  ? 317 THR A CG2 1 
ATOM   2455  N  N   . VAL A 1 318 ? 0.324   32.084  72.728  1.00 19.73  ? 318 VAL A N   1 
ATOM   2456  C  CA  . VAL A 1 318 ? 0.217   31.515  71.400  1.00 20.11  ? 318 VAL A CA  1 
ATOM   2457  C  C   . VAL A 1 318 ? -1.062  32.025  70.822  1.00 20.54  ? 318 VAL A C   1 
ATOM   2458  O  O   . VAL A 1 318 ? -2.073  32.109  71.527  1.00 19.86  ? 318 VAL A O   1 
ATOM   2459  C  CB  . VAL A 1 318 ? 0.084   30.001  71.429  1.00 23.22  ? 318 VAL A CB  1 
ATOM   2460  C  CG1 . VAL A 1 318 ? 0.598   29.426  70.125  1.00 26.48  ? 318 VAL A CG1 1 
ATOM   2461  C  CG2 . VAL A 1 318 ? 0.813   29.416  72.601  1.00 32.17  ? 318 VAL A CG2 1 
ATOM   2462  N  N   . GLY A 1 319 ? -1.043  32.322  69.532  1.00 18.86  ? 319 GLY A N   1 
ATOM   2463  C  CA  . GLY A 1 319 ? -2.245  32.820  68.901  1.00 18.55  ? 319 GLY A CA  1 
ATOM   2464  C  C   . GLY A 1 319 ? -2.205  32.685  67.405  1.00 17.88  ? 319 GLY A C   1 
ATOM   2465  O  O   . GLY A 1 319 ? -1.137  32.626  66.786  1.00 16.57  ? 319 GLY A O   1 
ATOM   2466  N  N   . VAL A 1 320 ? -3.382  32.738  66.813  1.00 17.88  ? 320 VAL A N   1 
ATOM   2467  C  CA  . VAL A 1 320 ? -3.497  32.585  65.390  1.00 17.92  ? 320 VAL A CA  1 
ATOM   2468  C  C   . VAL A 1 320 ? -4.646  33.466  64.882  1.00 17.64  ? 320 VAL A C   1 
ATOM   2469  O  O   . VAL A 1 320 ? -5.675  33.626  65.554  1.00 13.92  ? 320 VAL A O   1 
ATOM   2470  C  CB  . VAL A 1 320 ? -3.712  31.083  65.096  1.00 18.42  ? 320 VAL A CB  1 
ATOM   2471  C  CG1 . VAL A 1 320 ? -5.178  30.751  64.907  1.00 19.99  ? 320 VAL A CG1 1 
ATOM   2472  C  CG2 . VAL A 1 320 ? -2.861  30.639  63.962  1.00 24.19  ? 320 VAL A CG2 1 
ATOM   2473  N  N   . ARG A 1 321 ? -4.461  34.062  63.712  1.00 19.03  ? 321 ARG A N   1 
ATOM   2474  C  CA  . ARG A 1 321 ? -5.484  34.926  63.137  1.00 18.58  ? 321 ARG A CA  1 
ATOM   2475  C  C   . ARG A 1 321 ? -5.660  34.676  61.642  1.00 20.01  ? 321 ARG A C   1 
ATOM   2476  O  O   . ARG A 1 321 ? -4.932  35.228  60.811  1.00 19.85  ? 321 ARG A O   1 
ATOM   2477  C  CB  . ARG A 1 321 ? -5.128  36.388  63.398  1.00 17.69  ? 321 ARG A CB  1 
ATOM   2478  C  CG  . ARG A 1 321 ? -6.040  37.432  62.748  1.00 13.82  ? 321 ARG A CG  1 
ATOM   2479  C  CD  . ARG A 1 321 ? -6.202  38.586  63.683  1.00 17.60  ? 321 ARG A CD  1 
ATOM   2480  N  NE  . ARG A 1 321 ? -5.668  39.827  63.163  1.00 17.38  ? 321 ARG A NE  1 
ATOM   2481  C  CZ  . ARG A 1 321 ? -5.341  40.876  63.911  1.00 20.02  ? 321 ARG A CZ  1 
ATOM   2482  N  NH1 . ARG A 1 321 ? -5.472  40.839  65.226  1.00 13.15  ? 321 ARG A NH1 1 
ATOM   2483  N  NH2 . ARG A 1 321 ? -4.970  42.005  63.328  1.00 26.57  ? 321 ARG A NH2 1 
ATOM   2484  N  N   . PRO A 1 322 ? -6.542  33.740  61.289  1.00 19.37  ? 322 PRO A N   1 
ATOM   2485  C  CA  . PRO A 1 322 ? -6.768  33.454  59.871  1.00 18.89  ? 322 PRO A CA  1 
ATOM   2486  C  C   . PRO A 1 322 ? -7.754  34.450  59.281  1.00 19.14  ? 322 PRO A C   1 
ATOM   2487  O  O   . PRO A 1 322 ? -8.644  34.936  59.978  1.00 19.35  ? 322 PRO A O   1 
ATOM   2488  C  CB  . PRO A 1 322 ? -7.352  32.045  59.897  1.00 17.68  ? 322 PRO A CB  1 
ATOM   2489  C  CG  . PRO A 1 322 ? -8.108  32.019  61.172  1.00 18.92  ? 322 PRO A CG  1 
ATOM   2490  C  CD  . PRO A 1 322 ? -7.154  32.706  62.139  1.00 18.31  ? 322 PRO A CD  1 
ATOM   2491  N  N   . MET A 1 323 ? -7.600  34.740  57.997  1.00 19.28  ? 323 MET A N   1 
ATOM   2492  C  CA  . MET A 1 323 ? -8.486  35.669  57.311  1.00 18.99  ? 323 MET A CA  1 
ATOM   2493  C  C   . MET A 1 323 ? -9.028  34.985  56.065  1.00 19.53  ? 323 MET A C   1 
ATOM   2494  O  O   . MET A 1 323 ? -8.253  34.469  55.254  1.00 19.63  ? 323 MET A O   1 
ATOM   2495  C  CB  . MET A 1 323 ? -7.711  36.926  56.891  1.00 19.28  ? 323 MET A CB  1 
ATOM   2496  C  CG  . MET A 1 323 ? -8.511  37.938  56.062  1.00 18.65  ? 323 MET A CG  1 
ATOM   2497  S  SD  . MET A 1 323 ? -7.448  39.210  55.361  1.00 25.23  ? 323 MET A SD  1 
ATOM   2498  C  CE  . MET A 1 323 ? -8.625  40.264  54.531  1.00 23.86  ? 323 MET A CE  1 
ATOM   2499  N  N   . TYR A 1 324 ? -10.350 34.949  55.930  1.00 18.36  ? 324 TYR A N   1 
ATOM   2500  C  CA  . TYR A 1 324 ? -10.971 34.353  54.756  1.00 17.86  ? 324 TYR A CA  1 
ATOM   2501  C  C   . TYR A 1 324 ? -11.521 35.472  53.883  1.00 20.24  ? 324 TYR A C   1 
ATOM   2502  O  O   . TYR A 1 324 ? -12.376 36.250  54.322  1.00 18.76  ? 324 TYR A O   1 
ATOM   2503  C  CB  . TYR A 1 324 ? -12.097 33.411  55.136  1.00 19.58  ? 324 TYR A CB  1 
ATOM   2504  C  CG  . TYR A 1 324 ? -12.708 32.790  53.920  1.00 24.95  ? 324 TYR A CG  1 
ATOM   2505  C  CD1 . TYR A 1 324 ? -12.062 31.758  53.249  1.00 26.50  ? 324 TYR A CD1 1 
ATOM   2506  C  CD2 . TYR A 1 324 ? -13.905 33.268  53.403  1.00 27.48  ? 324 TYR A CD2 1 
ATOM   2507  C  CE1 . TYR A 1 324 ? -12.593 31.217  52.089  1.00 31.45  ? 324 TYR A CE1 1 
ATOM   2508  C  CE2 . TYR A 1 324 ? -14.442 32.737  52.244  1.00 32.20  ? 324 TYR A CE2 1 
ATOM   2509  C  CZ  . TYR A 1 324 ? -13.784 31.713  51.589  1.00 33.72  ? 324 TYR A CZ  1 
ATOM   2510  O  OH  . TYR A 1 324 ? -14.311 31.195  50.425  1.00 41.43  ? 324 TYR A OH  1 
ATOM   2511  N  N   . LYS A 1 325 ? -11.072 35.505  52.633  1.00 18.77  ? 325 LYS A N   1 
ATOM   2512  C  CA  . LYS A 1 325 ? -11.465 36.538  51.690  1.00 17.75  ? 325 LYS A CA  1 
ATOM   2513  C  C   . LYS A 1 325 ? -12.691 36.213  50.840  1.00 18.06  ? 325 LYS A C   1 
ATOM   2514  O  O   . LYS A 1 325 ? -12.587 35.540  49.820  1.00 23.20  ? 325 LYS A O   1 
ATOM   2515  C  CB  . LYS A 1 325 ? -10.282 36.855  50.784  1.00 12.84  ? 325 LYS A CB  1 
ATOM   2516  C  CG  . LYS A 1 325 ? -8.983  36.909  51.538  1.00 13.24  ? 325 LYS A CG  1 
ATOM   2517  C  CD  . LYS A 1 325 ? -7.811  37.130  50.621  1.00 13.67  ? 325 LYS A CD  1 
ATOM   2518  C  CE  . LYS A 1 325 ? -6.504  36.983  51.383  1.00 15.39  ? 325 LYS A CE  1 
ATOM   2519  N  NZ  . LYS A 1 325 ? -5.318  37.295  50.532  1.00 20.13  ? 325 LYS A NZ  1 
ATOM   2520  N  N   . TRP A 1 326 ? -13.847 36.711  51.255  1.00 20.94  ? 326 TRP A N   1 
ATOM   2521  C  CA  . TRP A 1 326 ? -15.086 36.493  50.520  1.00 22.59  ? 326 TRP A CA  1 
ATOM   2522  C  C   . TRP A 1 326 ? -14.967 37.175  49.174  1.00 27.24  ? 326 TRP A C   1 
ATOM   2523  O  O   . TRP A 1 326 ? -15.315 36.609  48.136  1.00 32.51  ? 326 TRP A O   1 
ATOM   2524  C  CB  . TRP A 1 326 ? -16.264 37.102  51.280  1.00 21.71  ? 326 TRP A CB  1 
ATOM   2525  C  CG  . TRP A 1 326 ? -16.542 36.379  52.535  1.00 29.77  ? 326 TRP A CG  1 
ATOM   2526  C  CD1 . TRP A 1 326 ? -16.194 36.759  53.796  1.00 28.67  ? 326 TRP A CD1 1 
ATOM   2527  C  CD2 . TRP A 1 326 ? -17.158 35.091  52.656  1.00 33.93  ? 326 TRP A CD2 1 
ATOM   2528  N  NE1 . TRP A 1 326 ? -16.543 35.785  54.690  1.00 31.41  ? 326 TRP A NE1 1 
ATOM   2529  C  CE2 . TRP A 1 326 ? -17.139 34.750  54.021  1.00 34.65  ? 326 TRP A CE2 1 
ATOM   2530  C  CE3 . TRP A 1 326 ? -17.720 34.189  51.739  1.00 34.82  ? 326 TRP A CE3 1 
ATOM   2531  C  CZ2 . TRP A 1 326 ? -17.660 33.546  54.498  1.00 37.93  ? 326 TRP A CZ2 1 
ATOM   2532  C  CZ3 . TRP A 1 326 ? -18.236 32.994  52.210  1.00 36.23  ? 326 TRP A CZ3 1 
ATOM   2533  C  CH2 . TRP A 1 326 ? -18.201 32.683  53.580  1.00 38.73  ? 326 TRP A CH2 1 
ATOM   2534  N  N   . THR A 1 327 ? -14.544 38.431  49.222  1.00 26.23  ? 327 THR A N   1 
ATOM   2535  C  CA  . THR A 1 327 ? -14.351 39.253  48.037  1.00 23.47  ? 327 THR A CA  1 
ATOM   2536  C  C   . THR A 1 327 ? -13.057 40.007  48.310  1.00 24.91  ? 327 THR A C   1 
ATOM   2537  O  O   . THR A 1 327 ? -12.495 39.912  49.401  1.00 31.17  ? 327 THR A O   1 
ATOM   2538  C  CB  . THR A 1 327 ? -15.526 40.268  47.823  1.00 22.81  ? 327 THR A CB  1 
ATOM   2539  O  OG1 . THR A 1 327 ? -15.420 41.346  48.753  1.00 26.49  ? 327 THR A OG1 1 
ATOM   2540  C  CG2 . THR A 1 327 ? -16.888 39.598  48.000  1.00 19.99  ? 327 THR A CG2 1 
ATOM   2541  N  N   . PRO A 1 328 ? -12.558 40.765  47.332  1.00 27.08  ? 328 PRO A N   1 
ATOM   2542  C  CA  . PRO A 1 328 ? -11.312 41.509  47.545  1.00 27.24  ? 328 PRO A CA  1 
ATOM   2543  C  C   . PRO A 1 328 ? -11.357 42.531  48.679  1.00 27.20  ? 328 PRO A C   1 
ATOM   2544  O  O   . PRO A 1 328 ? -10.331 42.830  49.273  1.00 29.92  ? 328 PRO A O   1 
ATOM   2545  C  CB  . PRO A 1 328 ? -11.099 42.194  46.199  1.00 29.04  ? 328 PRO A CB  1 
ATOM   2546  C  CG  . PRO A 1 328 ? -11.701 41.231  45.235  1.00 29.15  ? 328 PRO A CG  1 
ATOM   2547  C  CD  . PRO A 1 328 ? -12.986 40.859  45.925  1.00 25.85  ? 328 PRO A CD  1 
ATOM   2548  N  N   . ILE A 1 329 ? -12.540 43.060  48.974  1.00 24.35  ? 329 ILE A N   1 
ATOM   2549  C  CA  . ILE A 1 329 ? -12.679 44.056  50.028  1.00 22.81  ? 329 ILE A CA  1 
ATOM   2550  C  C   . ILE A 1 329 ? -13.451 43.588  51.256  1.00 20.99  ? 329 ILE A C   1 
ATOM   2551  O  O   . ILE A 1 329 ? -13.633 44.365  52.193  1.00 26.08  ? 329 ILE A O   1 
ATOM   2552  C  CB  . ILE A 1 329 ? -13.352 45.366  49.511  1.00 21.46  ? 329 ILE A CB  1 
ATOM   2553  C  CG1 . ILE A 1 329 ? -14.774 45.077  49.028  1.00 20.47  ? 329 ILE A CG1 1 
ATOM   2554  C  CG2 . ILE A 1 329 ? -12.512 45.994  48.414  1.00 17.33  ? 329 ILE A CG2 1 
ATOM   2555  C  CD1 . ILE A 1 329 ? -15.607 46.296  48.795  1.00 27.57  ? 329 ILE A CD1 1 
ATOM   2556  N  N   . MET A 1 330 ? -13.945 42.356  51.260  1.00 17.42  ? 330 MET A N   1 
ATOM   2557  C  CA  . MET A 1 330 ? -14.699 41.879  52.417  1.00 17.51  ? 330 MET A CA  1 
ATOM   2558  C  C   . MET A 1 330 ? -14.165 40.545  52.850  1.00 18.34  ? 330 MET A C   1 
ATOM   2559  O  O   . MET A 1 330 ? -13.867 39.683  52.020  1.00 19.97  ? 330 MET A O   1 
ATOM   2560  C  CB  . MET A 1 330 ? -16.188 41.769  52.111  1.00 15.55  ? 330 MET A CB  1 
ATOM   2561  C  CG  . MET A 1 330 ? -17.002 41.305  53.286  1.00 20.48  ? 330 MET A CG  1 
ATOM   2562  S  SD  . MET A 1 330 ? -18.658 40.845  52.792  1.00 29.06  ? 330 MET A SD  1 
ATOM   2563  C  CE  . MET A 1 330 ? -19.535 41.435  54.054  1.00 27.42  ? 330 MET A CE  1 
ATOM   2564  N  N   . SER A 1 331 ? -14.050 40.369  54.158  1.00 18.39  ? 331 SER A N   1 
ATOM   2565  C  CA  . SER A 1 331 ? -13.523 39.136  54.707  1.00 16.78  ? 331 SER A CA  1 
ATOM   2566  C  C   . SER A 1 331 ? -14.047 38.866  56.106  1.00 17.85  ? 331 SER A C   1 
ATOM   2567  O  O   . SER A 1 331 ? -14.722 39.709  56.710  1.00 20.06  ? 331 SER A O   1 
ATOM   2568  C  CB  . SER A 1 331 ? -12.009 39.228  54.764  1.00 16.14  ? 331 SER A CB  1 
ATOM   2569  O  OG  . SER A 1 331 ? -11.637 40.363  55.518  1.00 17.45  ? 331 SER A OG  1 
ATOM   2570  N  N   . THR A 1 332 ? -13.773 37.658  56.583  1.00 18.35  ? 332 THR A N   1 
ATOM   2571  C  CA  . THR A 1 332 ? -14.153 37.241  57.915  1.00 19.15  ? 332 THR A CA  1 
ATOM   2572  C  C   . THR A 1 332 ? -12.854 36.880  58.603  1.00 20.38  ? 332 THR A C   1 
ATOM   2573  O  O   . THR A 1 332 ? -12.013 36.167  58.025  1.00 20.40  ? 332 THR A O   1 
ATOM   2574  C  CB  . THR A 1 332 ? -15.034 36.005  57.880  1.00 18.34  ? 332 THR A CB  1 
ATOM   2575  O  OG1 . THR A 1 332 ? -16.287 36.346  57.285  1.00 20.61  ? 332 THR A OG1 1 
ATOM   2576  C  CG2 . THR A 1 332 ? -15.277 35.485  59.296  1.00 16.71  ? 332 THR A CG2 1 
ATOM   2577  N  N   . LEU A 1 333 ? -12.641 37.449  59.784  1.00 21.56  ? 333 LEU A N   1 
ATOM   2578  C  CA  . LEU A 1 333 ? -11.441 37.173  60.566  1.00 21.45  ? 333 LEU A CA  1 
ATOM   2579  C  C   . LEU A 1 333 ? -11.779 36.448  61.860  1.00 21.00  ? 333 LEU A C   1 
ATOM   2580  O  O   . LEU A 1 333 ? -12.835 36.676  62.472  1.00 20.14  ? 333 LEU A O   1 
ATOM   2581  C  CB  . LEU A 1 333 ? -10.689 38.463  60.921  1.00 17.97  ? 333 LEU A CB  1 
ATOM   2582  C  CG  . LEU A 1 333 ? -9.934  39.142  59.785  1.00 17.62  ? 333 LEU A CG  1 
ATOM   2583  C  CD1 . LEU A 1 333 ? -10.715 40.345  59.311  1.00 23.57  ? 333 LEU A CD1 1 
ATOM   2584  C  CD2 . LEU A 1 333 ? -8.576  39.564  60.276  1.00 21.82  ? 333 LEU A CD2 1 
ATOM   2585  N  N   . LEU A 1 334 ? -10.875 35.570  62.264  1.00 20.57  ? 334 LEU A N   1 
ATOM   2586  C  CA  . LEU A 1 334 ? -11.026 34.851  63.508  1.00 22.91  ? 334 LEU A CA  1 
ATOM   2587  C  C   . LEU A 1 334 ? -9.694  34.995  64.214  1.00 23.09  ? 334 LEU A C   1 
ATOM   2588  O  O   . LEU A 1 334 ? -8.635  34.924  63.582  1.00 24.10  ? 334 LEU A O   1 
ATOM   2589  C  CB  . LEU A 1 334 ? -11.307 33.372  63.263  1.00 24.34  ? 334 LEU A CB  1 
ATOM   2590  C  CG  . LEU A 1 334 ? -11.228 32.526  64.528  1.00 26.14  ? 334 LEU A CG  1 
ATOM   2591  C  CD1 . LEU A 1 334 ? -12.513 32.638  65.316  1.00 24.72  ? 334 LEU A CD1 1 
ATOM   2592  C  CD2 . LEU A 1 334 ? -10.957 31.099  64.156  1.00 27.96  ? 334 LEU A CD2 1 
ATOM   2593  N  N   . GLU A 1 335 ? -9.739  35.273  65.505  1.00 20.95  ? 335 GLU A N   1 
ATOM   2594  C  CA  . GLU A 1 335 ? -8.510  35.367  66.256  1.00 19.20  ? 335 GLU A CA  1 
ATOM   2595  C  C   . GLU A 1 335 ? -8.666  34.560  67.519  1.00 19.30  ? 335 GLU A C   1 
ATOM   2596  O  O   . GLU A 1 335 ? -9.663  34.700  68.225  1.00 18.91  ? 335 GLU A O   1 
ATOM   2597  C  CB  . GLU A 1 335 ? -8.165  36.806  66.605  1.00 18.39  ? 335 GLU A CB  1 
ATOM   2598  C  CG  . GLU A 1 335 ? -6.911  36.893  67.438  1.00 17.22  ? 335 GLU A CG  1 
ATOM   2599  C  CD  . GLU A 1 335 ? -6.393  38.294  67.587  1.00 19.48  ? 335 GLU A CD  1 
ATOM   2600  O  OE1 . GLU A 1 335 ? -6.873  39.012  68.484  1.00 22.69  ? 335 GLU A OE1 1 
ATOM   2601  O  OE2 . GLU A 1 335 ? -5.482  38.668  66.822  1.00 19.71  ? 335 GLU A OE2 1 
ATOM   2602  N  N   . VAL A 1 336 ? -7.718  33.666  67.759  1.00 18.05  ? 336 VAL A N   1 
ATOM   2603  C  CA  . VAL A 1 336 ? -7.735  32.842  68.948  1.00 17.32  ? 336 VAL A CA  1 
ATOM   2604  C  C   . VAL A 1 336 ? -6.377  32.994  69.604  1.00 17.62  ? 336 VAL A C   1 
ATOM   2605  O  O   . VAL A 1 336 ? -5.353  32.756  68.971  1.00 17.70  ? 336 VAL A O   1 
ATOM   2606  C  CB  . VAL A 1 336 ? -7.988  31.362  68.610  1.00 19.73  ? 336 VAL A CB  1 
ATOM   2607  C  CG1 . VAL A 1 336 ? -8.054  30.535  69.880  1.00 21.49  ? 336 VAL A CG1 1 
ATOM   2608  C  CG2 . VAL A 1 336 ? -9.290  31.220  67.873  1.00 20.50  ? 336 VAL A CG2 1 
ATOM   2609  N  N   . GLY A 1 337 ? -6.371  33.426  70.859  1.00 17.48  ? 337 GLY A N   1 
ATOM   2610  C  CA  . GLY A 1 337 ? -5.128  33.617  71.581  1.00 17.48  ? 337 GLY A CA  1 
ATOM   2611  C  C   . GLY A 1 337 ? -5.184  33.044  72.984  1.00 21.76  ? 337 GLY A C   1 
ATOM   2612  O  O   . GLY A 1 337 ? -6.213  33.109  73.659  1.00 18.83  ? 337 GLY A O   1 
ATOM   2613  N  N   . TYR A 1 338 ? -4.060  32.496  73.424  1.00 21.58  ? 338 TYR A N   1 
ATOM   2614  C  CA  . TYR A 1 338 ? -3.940  31.895  74.737  1.00 21.29  ? 338 TYR A CA  1 
ATOM   2615  C  C   . TYR A 1 338 ? -2.723  32.453  75.471  1.00 21.42  ? 338 TYR A C   1 
ATOM   2616  O  O   . TYR A 1 338 ? -1.630  32.568  74.897  1.00 20.40  ? 338 TYR A O   1 
ATOM   2617  C  CB  . TYR A 1 338 ? -3.803  30.380  74.581  1.00 24.10  ? 338 TYR A CB  1 
ATOM   2618  C  CG  . TYR A 1 338 ? -3.504  29.636  75.865  1.00 31.51  ? 338 TYR A CG  1 
ATOM   2619  C  CD1 . TYR A 1 338 ? -4.508  29.396  76.805  1.00 31.87  ? 338 TYR A CD1 1 
ATOM   2620  C  CD2 . TYR A 1 338 ? -2.209  29.179  76.151  1.00 34.04  ? 338 TYR A CD2 1 
ATOM   2621  C  CE1 . TYR A 1 338 ? -4.237  28.728  77.998  1.00 32.77  ? 338 TYR A CE1 1 
ATOM   2622  C  CE2 . TYR A 1 338 ? -1.927  28.508  77.343  1.00 37.54  ? 338 TYR A CE2 1 
ATOM   2623  C  CZ  . TYR A 1 338 ? -2.946  28.289  78.262  1.00 37.86  ? 338 TYR A CZ  1 
ATOM   2624  O  OH  . TYR A 1 338 ? -2.679  27.659  79.460  1.00 44.11  ? 338 TYR A OH  1 
ATOM   2625  N  N   . ASP A 1 339 ? -2.925  32.805  76.739  1.00 20.87  ? 339 ASP A N   1 
ATOM   2626  C  CA  . ASP A 1 339 ? -1.859  33.322  77.600  1.00 20.32  ? 339 ASP A CA  1 
ATOM   2627  C  C   . ASP A 1 339 ? -1.771  32.505  78.865  1.00 19.89  ? 339 ASP A C   1 
ATOM   2628  O  O   . ASP A 1 339 ? -2.792  32.170  79.461  1.00 19.64  ? 339 ASP A O   1 
ATOM   2629  C  CB  . ASP A 1 339 ? -2.149  34.751  78.030  1.00 19.95  ? 339 ASP A CB  1 
ATOM   2630  C  CG  . ASP A 1 339 ? -1.955  35.723  76.927  1.00 20.22  ? 339 ASP A CG  1 
ATOM   2631  O  OD1 . ASP A 1 339 ? -0.799  35.876  76.492  1.00 18.41  ? 339 ASP A OD1 1 
ATOM   2632  O  OD2 . ASP A 1 339 ? -2.954  36.320  76.490  1.00 18.79  ? 339 ASP A OD2 1 
ATOM   2633  N  N   . ASN A 1 340 ? -0.558  32.231  79.307  1.00 20.92  ? 340 ASN A N   1 
ATOM   2634  C  CA  . ASN A 1 340 ? -0.350  31.489  80.538  1.00 19.53  ? 340 ASN A CA  1 
ATOM   2635  C  C   . ASN A 1 340 ? 0.845   32.139  81.240  1.00 21.31  ? 340 ASN A C   1 
ATOM   2636  O  O   . ASN A 1 340 ? 1.943   32.194  80.678  1.00 23.14  ? 340 ASN A O   1 
ATOM   2637  C  CB  . ASN A 1 340 ? -0.077  30.010  80.245  1.00 21.43  ? 340 ASN A CB  1 
ATOM   2638  C  CG  . ASN A 1 340 ? 0.023   29.188  81.510  1.00 26.05  ? 340 ASN A CG  1 
ATOM   2639  O  OD1 . ASN A 1 340 ? 1.038   29.224  82.202  1.00 25.47  ? 340 ASN A OD1 1 
ATOM   2640  N  ND2 . ASN A 1 340 ? -1.047  28.473  81.842  1.00 23.48  ? 340 ASN A ND2 1 
ATOM   2641  N  N   . VAL A 1 341 ? 0.612   32.689  82.430  1.00 21.87  ? 341 VAL A N   1 
ATOM   2642  C  CA  . VAL A 1 341 ? 1.665   33.368  83.188  1.00 22.08  ? 341 VAL A CA  1 
ATOM   2643  C  C   . VAL A 1 341 ? 1.865   32.755  84.578  1.00 25.64  ? 341 VAL A C   1 
ATOM   2644  O  O   . VAL A 1 341 ? 0.927   32.669  85.375  1.00 24.67  ? 341 VAL A O   1 
ATOM   2645  C  CB  . VAL A 1 341 ? 1.347   34.872  83.390  1.00 18.70  ? 341 VAL A CB  1 
ATOM   2646  C  CG1 . VAL A 1 341 ? 2.628   35.628  83.672  1.00 17.38  ? 341 VAL A CG1 1 
ATOM   2647  C  CG2 . VAL A 1 341 ? 0.619   35.446  82.185  1.00 17.30  ? 341 VAL A CG2 1 
ATOM   2648  N  N   . LYS A 1 342 ? 3.093   32.355  84.873  1.00 25.88  ? 342 LYS A N   1 
ATOM   2649  C  CA  . LYS A 1 342 ? 3.410   31.768  86.160  1.00 26.63  ? 342 LYS A CA  1 
ATOM   2650  C  C   . LYS A 1 342 ? 4.158   32.782  87.003  1.00 25.31  ? 342 LYS A C   1 
ATOM   2651  O  O   . LYS A 1 342 ? 5.140   33.364  86.545  1.00 26.06  ? 342 LYS A O   1 
ATOM   2652  C  CB  . LYS A 1 342 ? 4.272   30.525  85.967  1.00 28.27  ? 342 LYS A CB  1 
ATOM   2653  C  CG  . LYS A 1 342 ? 4.387   29.656  87.202  1.00 32.46  ? 342 LYS A CG  1 
ATOM   2654  C  CD  . LYS A 1 342 ? 5.742   29.771  87.852  1.00 43.34  ? 342 LYS A CD  1 
ATOM   2655  C  CE  . LYS A 1 342 ? 6.792   29.005  87.065  1.00 48.72  ? 342 LYS A CE  1 
ATOM   2656  N  NZ  . LYS A 1 342 ? 8.171   29.217  87.603  1.00 55.16  ? 342 LYS A NZ  1 
ATOM   2657  N  N   . SER A 1 343 ? 3.675   33.035  88.212  1.00 24.79  ? 343 SER A N   1 
ATOM   2658  C  CA  . SER A 1 343 ? 4.347   33.977  89.106  1.00 23.68  ? 343 SER A CA  1 
ATOM   2659  C  C   . SER A 1 343 ? 5.614   33.312  89.607  1.00 23.05  ? 343 SER A C   1 
ATOM   2660  O  O   . SER A 1 343 ? 5.560   32.179  90.079  1.00 22.84  ? 343 SER A O   1 
ATOM   2661  C  CB  . SER A 1 343 ? 3.468   34.294  90.301  1.00 22.67  ? 343 SER A CB  1 
ATOM   2662  O  OG  . SER A 1 343 ? 4.221   35.005  91.262  1.00 23.33  ? 343 SER A OG  1 
ATOM   2663  N  N   . GLN A 1 344 ? 6.755   33.977  89.481  1.00 23.82  ? 344 GLN A N   1 
ATOM   2664  C  CA  . GLN A 1 344 ? 8.001   33.376  89.961  1.00 25.27  ? 344 GLN A CA  1 
ATOM   2665  C  C   . GLN A 1 344 ? 7.942   33.289  91.482  1.00 28.63  ? 344 GLN A C   1 
ATOM   2666  O  O   . GLN A 1 344 ? 8.388   32.316  92.085  1.00 30.47  ? 344 GLN A O   1 
ATOM   2667  C  CB  . GLN A 1 344 ? 9.218   34.217  89.562  1.00 23.09  ? 344 GLN A CB  1 
ATOM   2668  C  CG  . GLN A 1 344 ? 10.552  33.589  89.962  1.00 19.07  ? 344 GLN A CG  1 
ATOM   2669  C  CD  . GLN A 1 344 ? 11.745  34.446  89.604  1.00 19.66  ? 344 GLN A CD  1 
ATOM   2670  O  OE1 . GLN A 1 344 ? 11.621  35.648  89.417  1.00 23.32  ? 344 GLN A OE1 1 
ATOM   2671  N  NE2 . GLN A 1 344 ? 12.913  33.834  89.525  1.00 18.74  ? 344 GLN A NE2 1 
ATOM   2672  N  N   . GLN A 1 345 ? 7.325   34.299  92.083  1.00 30.60  ? 345 GLN A N   1 
ATOM   2673  C  CA  . GLN A 1 345 ? 7.206   34.393  93.525  1.00 30.17  ? 345 GLN A CA  1 
ATOM   2674  C  C   . GLN A 1 345 ? 6.348   33.315  94.158  1.00 31.36  ? 345 GLN A C   1 
ATOM   2675  O  O   . GLN A 1 345 ? 6.827   32.592  95.020  1.00 34.39  ? 345 GLN A O   1 
ATOM   2676  C  CB  . GLN A 1 345 ? 6.658   35.758  93.908  1.00 30.30  ? 345 GLN A CB  1 
ATOM   2677  C  CG  . GLN A 1 345 ? 6.852   36.095  95.348  1.00 32.53  ? 345 GLN A CG  1 
ATOM   2678  C  CD  . GLN A 1 345 ? 6.004   37.266  95.780  1.00 36.07  ? 345 GLN A CD  1 
ATOM   2679  O  OE1 . GLN A 1 345 ? 5.884   38.278  95.079  1.00 37.41  ? 345 GLN A OE1 1 
ATOM   2680  N  NE2 . GLN A 1 345 ? 5.398   37.135  96.943  1.00 41.67  ? 345 GLN A NE2 1 
ATOM   2681  N  N   . THR A 1 346 ? 5.077   33.226  93.760  1.00 31.14  ? 346 THR A N   1 
ATOM   2682  C  CA  . THR A 1 346 ? 4.163   32.239  94.342  1.00 28.04  ? 346 THR A CA  1 
ATOM   2683  C  C   . THR A 1 346 ? 4.097   30.900  93.626  1.00 29.18  ? 346 THR A C   1 
ATOM   2684  O  O   . THR A 1 346 ? 3.624   29.924  94.201  1.00 35.42  ? 346 THR A O   1 
ATOM   2685  C  CB  . THR A 1 346 ? 2.718   32.766  94.455  1.00 27.84  ? 346 THR A CB  1 
ATOM   2686  O  OG1 . THR A 1 346 ? 2.016   32.535  93.223  1.00 28.72  ? 346 THR A OG1 1 
ATOM   2687  C  CG2 . THR A 1 346 ? 2.710   34.257  94.788  1.00 29.35  ? 346 THR A CG2 1 
ATOM   2688  N  N   . GLY A 1 347 ? 4.507   30.862  92.360  1.00 31.17  ? 347 GLY A N   1 
ATOM   2689  C  CA  . GLY A 1 347 ? 4.473   29.618  91.601  1.00 26.26  ? 347 GLY A CA  1 
ATOM   2690  C  C   . GLY A 1 347 ? 3.119   29.320  90.979  1.00 27.95  ? 347 GLY A C   1 
ATOM   2691  O  O   . GLY A 1 347 ? 2.948   28.303  90.299  1.00 30.32  ? 347 GLY A O   1 
ATOM   2692  N  N   . ASP A 1 348 ? 2.148   30.196  91.231  1.00 28.38  ? 348 ASP A N   1 
ATOM   2693  C  CA  . ASP A 1 348 ? 0.810   30.023  90.684  1.00 31.59  ? 348 ASP A CA  1 
ATOM   2694  C  C   . ASP A 1 348 ? 0.740   30.457  89.231  1.00 32.36  ? 348 ASP A C   1 
ATOM   2695  O  O   . ASP A 1 348 ? 1.551   31.273  88.765  1.00 32.50  ? 348 ASP A O   1 
ATOM   2696  C  CB  . ASP A 1 348 ? -0.216  30.808  91.493  1.00 35.81  ? 348 ASP A CB  1 
ATOM   2697  C  CG  . ASP A 1 348 ? -0.440  30.222  92.867  1.00 39.80  ? 348 ASP A CG  1 
ATOM   2698  O  OD1 . ASP A 1 348 ? -0.906  29.055  92.939  1.00 42.44  ? 348 ASP A OD1 1 
ATOM   2699  O  OD2 . ASP A 1 348 ? -0.152  30.932  93.863  1.00 40.64  ? 348 ASP A OD2 1 
ATOM   2700  N  N   . ARG A 1 349 ? -0.268  29.948  88.531  1.00 30.58  ? 349 ARG A N   1 
ATOM   2701  C  CA  . ARG A 1 349 ? -0.446  30.272  87.129  1.00 29.62  ? 349 ARG A CA  1 
ATOM   2702  C  C   . ARG A 1 349 ? -1.772  30.938  86.813  1.00 27.97  ? 349 ARG A C   1 
ATOM   2703  O  O   . ARG A 1 349 ? -2.804  30.628  87.405  1.00 29.35  ? 349 ARG A O   1 
ATOM   2704  C  CB  . ARG A 1 349 ? -0.279  29.017  86.271  1.00 29.69  ? 349 ARG A CB  1 
ATOM   2705  C  CG  . ARG A 1 349 ? 1.146   28.491  86.229  1.00 37.21  ? 349 ARG A CG  1 
ATOM   2706  C  CD  . ARG A 1 349 ? 1.260   27.281  85.312  1.00 45.10  ? 349 ARG A CD  1 
ATOM   2707  N  NE  . ARG A 1 349 ? 2.632   26.781  85.201  1.00 54.85  ? 349 ARG A NE  1 
ATOM   2708  C  CZ  . ARG A 1 349 ? 3.560   27.269  84.375  1.00 62.21  ? 349 ARG A CZ  1 
ATOM   2709  N  NH1 . ARG A 1 349 ? 3.297   28.291  83.562  1.00 64.50  ? 349 ARG A NH1 1 
ATOM   2710  N  NH2 . ARG A 1 349 ? 4.765   26.715  84.349  1.00 67.52  ? 349 ARG A NH2 1 
ATOM   2711  N  N   . ASN A 1 350 ? -1.712  31.891  85.896  1.00 27.24  ? 350 ASN A N   1 
ATOM   2712  C  CA  . ASN A 1 350 ? -2.877  32.610  85.420  1.00 24.65  ? 350 ASN A CA  1 
ATOM   2713  C  C   . ASN A 1 350 ? -3.009  32.238  83.958  1.00 25.82  ? 350 ASN A C   1 
ATOM   2714  O  O   . ASN A 1 350 ? -1.999  32.083  83.256  1.00 26.92  ? 350 ASN A O   1 
ATOM   2715  C  CB  . ASN A 1 350 ? -2.646  34.119  85.501  1.00 22.43  ? 350 ASN A CB  1 
ATOM   2716  C  CG  . ASN A 1 350 ? -2.826  34.648  86.885  1.00 23.75  ? 350 ASN A CG  1 
ATOM   2717  O  OD1 . ASN A 1 350 ? -3.431  33.989  87.731  1.00 29.45  ? 350 ASN A OD1 1 
ATOM   2718  N  ND2 . ASN A 1 350 ? -2.309  35.834  87.137  1.00 20.97  ? 350 ASN A ND2 1 
ATOM   2719  N  N   . ASN A 1 351 ? -4.229  32.010  83.502  1.00 25.00  ? 351 ASN A N   1 
ATOM   2720  C  CA  . ASN A 1 351 ? -4.401  31.731  82.091  1.00 28.86  ? 351 ASN A CA  1 
ATOM   2721  C  C   . ASN A 1 351 ? -5.671  32.336  81.518  1.00 27.87  ? 351 ASN A C   1 
ATOM   2722  O  O   . ASN A 1 351 ? -6.606  32.656  82.251  1.00 27.23  ? 351 ASN A O   1 
ATOM   2723  C  CB  . ASN A 1 351 ? -4.227  30.240  81.744  1.00 34.30  ? 351 ASN A CB  1 
ATOM   2724  C  CG  . ASN A 1 351 ? -5.329  29.372  82.271  1.00 41.89  ? 351 ASN A CG  1 
ATOM   2725  O  OD1 . ASN A 1 351 ? -6.496  29.512  81.891  1.00 45.43  ? 351 ASN A OD1 1 
ATOM   2726  N  ND2 . ASN A 1 351 ? -4.961  28.419  83.116  1.00 50.83  ? 351 ASN A ND2 1 
ATOM   2727  N  N   . GLN A 1 352 ? -5.636  32.614  80.221  1.00 26.19  ? 352 GLN A N   1 
ATOM   2728  C  CA  . GLN A 1 352 ? -6.777  33.189  79.523  1.00 23.78  ? 352 GLN A CA  1 
ATOM   2729  C  C   . GLN A 1 352 ? -6.756  32.779  78.079  1.00 22.63  ? 352 GLN A C   1 
ATOM   2730  O  O   . GLN A 1 352 ? -5.694  32.539  77.495  1.00 21.92  ? 352 GLN A O   1 
ATOM   2731  C  CB  . GLN A 1 352 ? -6.734  34.722  79.558  1.00 20.15  ? 352 GLN A CB  1 
ATOM   2732  C  CG  . GLN A 1 352 ? -7.856  35.388  78.763  1.00 20.51  ? 352 GLN A CG  1 
ATOM   2733  C  CD  . GLN A 1 352 ? -7.808  36.915  78.810  1.00 23.01  ? 352 GLN A CD  1 
ATOM   2734  O  OE1 . GLN A 1 352 ? -8.326  37.539  79.741  1.00 23.39  ? 352 GLN A OE1 1 
ATOM   2735  N  NE2 . GLN A 1 352 ? -7.194  37.523  77.799  1.00 23.12  ? 352 GLN A NE2 1 
ATOM   2736  N  N   . TYR A 1 353 ? -7.937  32.645  77.516  1.00 24.05  ? 353 TYR A N   1 
ATOM   2737  C  CA  . TYR A 1 353 ? -8.026  32.356  76.114  1.00 28.53  ? 353 TYR A CA  1 
ATOM   2738  C  C   . TYR A 1 353 ? -9.177  33.192  75.635  1.00 26.58  ? 353 TYR A C   1 
ATOM   2739  O  O   . TYR A 1 353 ? -10.158 33.403  76.369  1.00 23.97  ? 353 TYR A O   1 
ATOM   2740  C  CB  . TYR A 1 353 ? -8.188  30.868  75.816  1.00 39.11  ? 353 TYR A CB  1 
ATOM   2741  C  CG  . TYR A 1 353 ? -9.523  30.262  76.099  1.00 51.55  ? 353 TYR A CG  1 
ATOM   2742  C  CD1 . TYR A 1 353 ? -10.574 30.395  75.191  1.00 59.72  ? 353 TYR A CD1 1 
ATOM   2743  C  CD2 . TYR A 1 353 ? -9.723  29.480  77.236  1.00 60.21  ? 353 TYR A CD2 1 
ATOM   2744  C  CE1 . TYR A 1 353 ? -11.804 29.755  75.402  1.00 69.39  ? 353 TYR A CE1 1 
ATOM   2745  C  CE2 . TYR A 1 353 ? -10.947 28.830  77.463  1.00 70.28  ? 353 TYR A CE2 1 
ATOM   2746  C  CZ  . TYR A 1 353 ? -11.986 28.969  76.541  1.00 72.12  ? 353 TYR A CZ  1 
ATOM   2747  O  OH  . TYR A 1 353 ? -13.190 28.319  76.753  1.00 75.45  ? 353 TYR A OH  1 
ATOM   2748  N  N   . LYS A 1 354 ? -8.976  33.817  74.485  1.00 24.87  ? 354 LYS A N   1 
ATOM   2749  C  CA  . LYS A 1 354 ? -10.009 34.649  73.920  1.00 25.05  ? 354 LYS A CA  1 
ATOM   2750  C  C   . LYS A 1 354 ? -10.210 34.269  72.465  1.00 23.47  ? 354 LYS A C   1 
ATOM   2751  O  O   . LYS A 1 354 ? -9.264  33.868  71.799  1.00 23.88  ? 354 LYS A O   1 
ATOM   2752  C  CB  . LYS A 1 354 ? -9.658  36.130  74.095  1.00 22.46  ? 354 LYS A CB  1 
ATOM   2753  C  CG  . LYS A 1 354 ? -8.985  36.810  72.921  1.00 27.64  ? 354 LYS A CG  1 
ATOM   2754  C  CD  . LYS A 1 354 ? -9.606  38.181  72.743  1.00 21.97  ? 354 LYS A CD  1 
ATOM   2755  C  CE  . LYS A 1 354 ? -8.961  38.942  71.616  1.00 23.69  ? 354 LYS A CE  1 
ATOM   2756  N  NZ  . LYS A 1 354 ? -9.023  38.234  70.336  1.00 18.31  ? 354 LYS A NZ  1 
ATOM   2757  N  N   . ILE A 1 355 ? -11.462 34.295  72.023  1.00 18.74  ? 355 ILE A N   1 
ATOM   2758  C  CA  . ILE A 1 355 ? -11.827 33.959  70.656  1.00 19.58  ? 355 ILE A CA  1 
ATOM   2759  C  C   . ILE A 1 355 ? -12.552 35.172  70.094  1.00 20.43  ? 355 ILE A C   1 
ATOM   2760  O  O   . ILE A 1 355 ? -13.495 35.672  70.717  1.00 18.08  ? 355 ILE A O   1 
ATOM   2761  C  CB  . ILE A 1 355 ? -12.853 32.802  70.586  1.00 22.89  ? 355 ILE A CB  1 
ATOM   2762  C  CG1 . ILE A 1 355 ? -12.609 31.773  71.691  1.00 30.16  ? 355 ILE A CG1 1 
ATOM   2763  C  CG2 . ILE A 1 355 ? -12.814 32.146  69.202  1.00 21.88  ? 355 ILE A CG2 1 
ATOM   2764  C  CD1 . ILE A 1 355 ? -11.365 30.935  71.514  1.00 41.50  ? 355 ILE A CD1 1 
ATOM   2765  N  N   . THR A 1 356 ? -12.138 35.632  68.923  1.00 18.00  ? 356 THR A N   1 
ATOM   2766  C  CA  . THR A 1 356 ? -12.800 36.766  68.305  1.00 19.00  ? 356 THR A CA  1 
ATOM   2767  C  C   . THR A 1 356 ? -13.175 36.434  66.876  1.00 19.83  ? 356 THR A C   1 
ATOM   2768  O  O   . THR A 1 356 ? -12.381 35.828  66.134  1.00 18.63  ? 356 THR A O   1 
ATOM   2769  C  CB  . THR A 1 356 ? -11.933 38.038  68.331  1.00 17.74  ? 356 THR A CB  1 
ATOM   2770  O  OG1 . THR A 1 356 ? -11.752 38.454  69.688  1.00 17.78  ? 356 THR A OG1 1 
ATOM   2771  C  CG2 . THR A 1 356 ? -12.611 39.161  67.556  1.00 10.97  ? 356 THR A CG2 1 
ATOM   2772  N  N   . LEU A 1 357 ? -14.404 36.807  66.520  1.00 21.48  ? 357 LEU A N   1 
ATOM   2773  C  CA  . LEU A 1 357 ? -14.960 36.600  65.182  1.00 20.73  ? 357 LEU A CA  1 
ATOM   2774  C  C   . LEU A 1 357 ? -15.331 38.004  64.674  1.00 20.92  ? 357 LEU A C   1 
ATOM   2775  O  O   . LEU A 1 357 ? -16.032 38.754  65.364  1.00 17.17  ? 357 LEU A O   1 
ATOM   2776  C  CB  . LEU A 1 357 ? -16.193 35.704  65.290  1.00 26.55  ? 357 LEU A CB  1 
ATOM   2777  C  CG  . LEU A 1 357 ? -16.776 34.975  64.081  1.00 31.61  ? 357 LEU A CG  1 
ATOM   2778  C  CD1 . LEU A 1 357 ? -17.775 35.852  63.365  1.00 38.46  ? 357 LEU A CD1 1 
ATOM   2779  C  CD2 . LEU A 1 357 ? -15.672 34.514  63.150  1.00 33.44  ? 357 LEU A CD2 1 
ATOM   2780  N  N   . ALA A 1 358 ? -14.805 38.390  63.512  1.00 18.68  ? 358 ALA A N   1 
ATOM   2781  C  CA  . ALA A 1 358 ? -15.083 39.719  62.984  1.00 17.14  ? 358 ALA A CA  1 
ATOM   2782  C  C   . ALA A 1 358 ? -15.335 39.724  61.488  1.00 19.39  ? 358 ALA A C   1 
ATOM   2783  O  O   . ALA A 1 358 ? -14.705 38.972  60.737  1.00 21.74  ? 358 ALA A O   1 
ATOM   2784  C  CB  . ALA A 1 358 ? -13.936 40.649  63.308  1.00 15.06  ? 358 ALA A CB  1 
ATOM   2785  N  N   . GLN A 1 359 ? -16.291 40.544  61.064  1.00 18.86  ? 359 GLN A N   1 
ATOM   2786  C  CA  . GLN A 1 359 ? -16.605 40.689  59.648  1.00 17.82  ? 359 GLN A CA  1 
ATOM   2787  C  C   . GLN A 1 359 ? -15.912 42.004  59.317  1.00 17.96  ? 359 GLN A C   1 
ATOM   2788  O  O   . GLN A 1 359 ? -16.052 43.003  60.052  1.00 17.18  ? 359 GLN A O   1 
ATOM   2789  C  CB  . GLN A 1 359 ? -18.120 40.777  59.424  1.00 19.42  ? 359 GLN A CB  1 
ATOM   2790  C  CG  . GLN A 1 359 ? -18.537 40.581  57.972  1.00 26.77  ? 359 GLN A CG  1 
ATOM   2791  C  CD  . GLN A 1 359 ? -18.123 39.220  57.431  1.00 34.35  ? 359 GLN A CD  1 
ATOM   2792  O  OE1 . GLN A 1 359 ? -17.896 38.278  58.191  1.00 32.37  ? 359 GLN A OE1 1 
ATOM   2793  N  NE2 . GLN A 1 359 ? -18.024 39.110  56.113  1.00 37.26  ? 359 GLN A NE2 1 
ATOM   2794  N  N   . GLN A 1 360 ? -15.170 42.023  58.223  1.00 14.96  ? 360 GLN A N   1 
ATOM   2795  C  CA  . GLN A 1 360 ? -14.417 43.210  57.892  1.00 14.74  ? 360 GLN A CA  1 
ATOM   2796  C  C   . GLN A 1 360 ? -14.444 43.655  56.428  1.00 17.37  ? 360 GLN A C   1 
ATOM   2797  O  O   . GLN A 1 360 ? -14.600 42.833  55.517  1.00 19.31  ? 360 GLN A O   1 
ATOM   2798  C  CB  . GLN A 1 360 ? -12.970 42.963  58.338  1.00 11.22  ? 360 GLN A CB  1 
ATOM   2799  C  CG  . GLN A 1 360 ? -11.984 44.018  57.931  1.00 12.08  ? 360 GLN A CG  1 
ATOM   2800  C  CD  . GLN A 1 360 ? -10.591 43.651  58.306  1.00 15.65  ? 360 GLN A CD  1 
ATOM   2801  O  OE1 . GLN A 1 360 ? -10.194 43.815  59.448  1.00 18.38  ? 360 GLN A OE1 1 
ATOM   2802  N  NE2 . GLN A 1 360 ? -9.833  43.135  57.351  1.00 20.36  ? 360 GLN A NE2 1 
ATOM   2803  N  N   . TRP A 1 361 ? -14.318 44.972  56.231  1.00 17.42  ? 361 TRP A N   1 
ATOM   2804  C  CA  . TRP A 1 361 ? -14.245 45.602  54.912  1.00 14.42  ? 361 TRP A CA  1 
ATOM   2805  C  C   . TRP A 1 361 ? -12.929 46.354  54.966  1.00 15.44  ? 361 TRP A C   1 
ATOM   2806  O  O   . TRP A 1 361 ? -12.724 47.169  55.857  1.00 19.89  ? 361 TRP A O   1 
ATOM   2807  C  CB  . TRP A 1 361 ? -15.401 46.576  54.685  1.00 14.75  ? 361 TRP A CB  1 
ATOM   2808  C  CG  . TRP A 1 361 ? -16.724 45.895  54.547  1.00 21.16  ? 361 TRP A CG  1 
ATOM   2809  C  CD1 . TRP A 1 361 ? -17.339 45.514  53.384  1.00 18.29  ? 361 TRP A CD1 1 
ATOM   2810  C  CD2 . TRP A 1 361 ? -17.575 45.457  55.617  1.00 25.44  ? 361 TRP A CD2 1 
ATOM   2811  N  NE1 . TRP A 1 361 ? -18.512 44.858  53.668  1.00 21.86  ? 361 TRP A NE1 1 
ATOM   2812  C  CE2 . TRP A 1 361 ? -18.684 44.812  55.029  1.00 23.76  ? 361 TRP A CE2 1 
ATOM   2813  C  CE3 . TRP A 1 361 ? -17.507 45.549  57.015  1.00 24.54  ? 361 TRP A CE3 1 
ATOM   2814  C  CZ2 . TRP A 1 361 ? -19.716 44.262  55.792  1.00 21.49  ? 361 TRP A CZ2 1 
ATOM   2815  C  CZ3 . TRP A 1 361 ? -18.530 45.005  57.771  1.00 22.35  ? 361 TRP A CZ3 1 
ATOM   2816  C  CH2 . TRP A 1 361 ? -19.621 44.368  57.159  1.00 22.94  ? 361 TRP A CH2 1 
ATOM   2817  N  N   . GLN A 1 362 ? -12.005 46.030  54.074  1.00 14.55  ? 362 GLN A N   1 
ATOM   2818  C  CA  . GLN A 1 362 ? -10.706 46.676  54.086  1.00 13.61  ? 362 GLN A CA  1 
ATOM   2819  C  C   . GLN A 1 362 ? -10.262 47.152  52.700  1.00 17.63  ? 362 GLN A C   1 
ATOM   2820  O  O   . GLN A 1 362 ? -10.703 46.626  51.672  1.00 20.36  ? 362 GLN A O   1 
ATOM   2821  C  CB  . GLN A 1 362 ? -9.664  45.732  54.692  1.00 15.45  ? 362 GLN A CB  1 
ATOM   2822  C  CG  . GLN A 1 362 ? -9.220  44.568  53.802  1.00 14.02  ? 362 GLN A CG  1 
ATOM   2823  C  CD  . GLN A 1 362 ? -10.240 43.446  53.692  1.00 16.29  ? 362 GLN A CD  1 
ATOM   2824  O  OE1 . GLN A 1 362 ? -10.943 43.146  54.649  1.00 22.79  ? 362 GLN A OE1 1 
ATOM   2825  N  NE2 . GLN A 1 362 ? -10.300 42.799  52.534  1.00 16.17  ? 362 GLN A NE2 1 
ATOM   2826  N  N   . ALA A 1 363 ? -9.377  48.143  52.676  1.00 14.83  ? 363 ALA A N   1 
ATOM   2827  C  CA  . ALA A 1 363 ? -8.873  48.705  51.440  1.00 11.58  ? 363 ALA A CA  1 
ATOM   2828  C  C   . ALA A 1 363 ? -7.792  47.818  50.852  1.00 12.60  ? 363 ALA A C   1 
ATOM   2829  O  O   . ALA A 1 363 ? -6.621  48.179  50.846  1.00 17.48  ? 363 ALA A O   1 
ATOM   2830  C  CB  . ALA A 1 363 ? -8.330  50.076  51.701  1.00 7.72   ? 363 ALA A CB  1 
ATOM   2831  N  N   . GLY A 1 364 ? -8.178  46.651  50.363  1.00 13.32  ? 364 GLY A N   1 
ATOM   2832  C  CA  . GLY A 1 364 ? -7.209  45.739  49.785  1.00 14.45  ? 364 GLY A CA  1 
ATOM   2833  C  C   . GLY A 1 364 ? -7.581  44.323  50.152  1.00 17.56  ? 364 GLY A C   1 
ATOM   2834  O  O   . GLY A 1 364 ? -8.506  44.118  50.927  1.00 20.81  ? 364 GLY A O   1 
ATOM   2835  N  N   . ASP A 1 365 ? -6.839  43.345  49.649  1.00 21.30  ? 365 ASP A N   1 
ATOM   2836  C  CA  . ASP A 1 365 ? -7.138  41.936  49.938  1.00 25.38  ? 365 ASP A CA  1 
ATOM   2837  C  C   . ASP A 1 365 ? -6.082  41.265  50.820  1.00 23.39  ? 365 ASP A C   1 
ATOM   2838  O  O   . ASP A 1 365 ? -5.928  40.048  50.806  1.00 25.85  ? 365 ASP A O   1 
ATOM   2839  C  CB  . ASP A 1 365 ? -7.288  41.152  48.624  1.00 31.67  ? 365 ASP A CB  1 
ATOM   2840  C  CG  . ASP A 1 365 ? -5.970  41.040  47.835  1.00 41.63  ? 365 ASP A CG  1 
ATOM   2841  O  OD1 . ASP A 1 365 ? -5.005  41.802  48.090  1.00 46.08  ? 365 ASP A OD1 1 
ATOM   2842  O  OD2 . ASP A 1 365 ? -5.899  40.166  46.946  1.00 53.24  ? 365 ASP A OD2 1 
ATOM   2843  N  N   . SER A 1 366 ? -5.331  42.055  51.566  1.00 20.48  ? 366 SER A N   1 
ATOM   2844  C  CA  . SER A 1 366 ? -4.304  41.495  52.417  1.00 17.21  ? 366 SER A CA  1 
ATOM   2845  C  C   . SER A 1 366 ? -4.699  41.608  53.877  1.00 20.49  ? 366 SER A C   1 
ATOM   2846  O  O   . SER A 1 366 ? -5.413  42.538  54.275  1.00 19.82  ? 366 SER A O   1 
ATOM   2847  C  CB  . SER A 1 366 ? -2.999  42.243  52.190  1.00 16.15  ? 366 SER A CB  1 
ATOM   2848  O  OG  . SER A 1 366 ? -1.969  41.716  52.998  1.00 20.70  ? 366 SER A OG  1 
ATOM   2849  N  N   . ILE A 1 367 ? -4.176  40.702  54.693  1.00 20.16  ? 367 ILE A N   1 
ATOM   2850  C  CA  . ILE A 1 367 ? -4.449  40.741  56.120  1.00 18.72  ? 367 ILE A CA  1 
ATOM   2851  C  C   . ILE A 1 367 ? -3.792  42.024  56.669  1.00 18.79  ? 367 ILE A C   1 
ATOM   2852  O  O   . ILE A 1 367 ? -4.089  42.467  57.770  1.00 22.01  ? 367 ILE A O   1 
ATOM   2853  C  CB  . ILE A 1 367 ? -3.916  39.454  56.804  1.00 17.64  ? 367 ILE A CB  1 
ATOM   2854  C  CG1 . ILE A 1 367 ? -4.412  39.360  58.244  1.00 16.51  ? 367 ILE A CG1 1 
ATOM   2855  C  CG2 . ILE A 1 367 ? -2.405  39.385  56.721  1.00 11.18  ? 367 ILE A CG2 1 
ATOM   2856  C  CD1 . ILE A 1 367 ? -4.424  37.951  58.771  1.00 14.32  ? 367 ILE A CD1 1 
ATOM   2857  N  N   . TRP A 1 368 ? -2.915  42.625  55.865  1.00 17.62  ? 368 TRP A N   1 
ATOM   2858  C  CA  . TRP A 1 368 ? -2.229  43.866  56.221  1.00 14.39  ? 368 TRP A CA  1 
ATOM   2859  C  C   . TRP A 1 368 ? -2.882  45.109  55.611  1.00 14.14  ? 368 TRP A C   1 
ATOM   2860  O  O   . TRP A 1 368 ? -2.381  46.201  55.796  1.00 16.78  ? 368 TRP A O   1 
ATOM   2861  C  CB  . TRP A 1 368 ? -0.786  43.844  55.732  1.00 13.97  ? 368 TRP A CB  1 
ATOM   2862  C  CG  . TRP A 1 368 ? 0.111   42.875  56.424  1.00 20.50  ? 368 TRP A CG  1 
ATOM   2863  C  CD1 . TRP A 1 368 ? 0.680   41.751  55.884  1.00 18.78  ? 368 TRP A CD1 1 
ATOM   2864  C  CD2 . TRP A 1 368 ? 0.595   42.961  57.772  1.00 22.36  ? 368 TRP A CD2 1 
ATOM   2865  N  NE1 . TRP A 1 368 ? 1.491   41.133  56.815  1.00 23.61  ? 368 TRP A NE1 1 
ATOM   2866  C  CE2 . TRP A 1 368 ? 1.458   41.852  57.981  1.00 26.09  ? 368 TRP A CE2 1 
ATOM   2867  C  CE3 . TRP A 1 368 ? 0.386   43.863  58.823  1.00 21.17  ? 368 TRP A CE3 1 
ATOM   2868  C  CZ2 . TRP A 1 368 ? 2.110   41.627  59.202  1.00 27.70  ? 368 TRP A CZ2 1 
ATOM   2869  C  CZ3 . TRP A 1 368 ? 1.037   43.638  60.032  1.00 24.42  ? 368 TRP A CZ3 1 
ATOM   2870  C  CH2 . TRP A 1 368 ? 1.888   42.528  60.211  1.00 24.33  ? 368 TRP A CH2 1 
ATOM   2871  N  N   . SER A 1 369 ? -3.964  44.953  54.857  1.00 16.14  ? 369 SER A N   1 
ATOM   2872  C  CA  . SER A 1 369 ? -4.599  46.103  54.236  1.00 13.71  ? 369 SER A CA  1 
ATOM   2873  C  C   . SER A 1 369 ? -5.357  46.952  55.241  1.00 15.60  ? 369 SER A C   1 
ATOM   2874  O  O   . SER A 1 369 ? -6.139  46.428  56.036  1.00 17.35  ? 369 SER A O   1 
ATOM   2875  C  CB  . SER A 1 369 ? -5.563  45.679  53.118  1.00 15.40  ? 369 SER A CB  1 
ATOM   2876  O  OG  . SER A 1 369 ? -4.914  44.910  52.125  1.00 18.61  ? 369 SER A OG  1 
ATOM   2877  N  N   . ARG A 1 370 ? -5.116  48.262  55.191  1.00 14.80  ? 370 ARG A N   1 
ATOM   2878  C  CA  . ARG A 1 370 ? -5.794  49.244  56.045  1.00 16.86  ? 370 ARG A CA  1 
ATOM   2879  C  C   . ARG A 1 370 ? -6.136  50.430  55.136  1.00 16.98  ? 370 ARG A C   1 
ATOM   2880  O  O   . ARG A 1 370 ? -5.379  50.743  54.217  1.00 20.67  ? 370 ARG A O   1 
ATOM   2881  C  CB  . ARG A 1 370 ? -4.890  49.726  57.184  1.00 12.11  ? 370 ARG A CB  1 
ATOM   2882  C  CG  . ARG A 1 370 ? -4.515  48.660  58.176  1.00 12.06  ? 370 ARG A CG  1 
ATOM   2883  C  CD  . ARG A 1 370 ? -5.727  48.021  58.787  1.00 12.13  ? 370 ARG A CD  1 
ATOM   2884  N  NE  . ARG A 1 370 ? -5.324  47.131  59.865  1.00 16.61  ? 370 ARG A NE  1 
ATOM   2885  C  CZ  . ARG A 1 370 ? -4.926  45.878  59.704  1.00 16.84  ? 370 ARG A CZ  1 
ATOM   2886  N  NH1 . ARG A 1 370 ? -4.883  45.343  58.492  1.00 20.85  ? 370 ARG A NH1 1 
ATOM   2887  N  NH2 . ARG A 1 370 ? -4.538  45.166  60.756  1.00 18.03  ? 370 ARG A NH2 1 
ATOM   2888  N  N   . PRO A 1 371 ? -7.213  51.170  55.436  1.00 15.54  ? 371 PRO A N   1 
ATOM   2889  C  CA  . PRO A 1 371 ? -8.156  51.022  56.548  1.00 14.87  ? 371 PRO A CA  1 
ATOM   2890  C  C   . PRO A 1 371 ? -8.970  49.750  56.548  1.00 17.51  ? 371 PRO A C   1 
ATOM   2891  O  O   . PRO A 1 371 ? -9.000  49.014  55.564  1.00 20.71  ? 371 PRO A O   1 
ATOM   2892  C  CB  . PRO A 1 371 ? -9.050  52.255  56.401  1.00 14.13  ? 371 PRO A CB  1 
ATOM   2893  C  CG  . PRO A 1 371 ? -9.022  52.519  54.942  1.00 15.31  ? 371 PRO A CG  1 
ATOM   2894  C  CD  . PRO A 1 371 ? -7.568  52.334  54.607  1.00 10.28  ? 371 PRO A CD  1 
ATOM   2895  N  N   . ALA A 1 372 ? -9.593  49.477  57.686  1.00 15.05  ? 372 ALA A N   1 
ATOM   2896  C  CA  . ALA A 1 372 ? -10.435 48.312  57.846  1.00 11.84  ? 372 ALA A CA  1 
ATOM   2897  C  C   . ALA A 1 372 ? -11.546 48.750  58.770  1.00 14.02  ? 372 ALA A C   1 
ATOM   2898  O  O   . ALA A 1 372 ? -11.321 49.574  59.657  1.00 17.75  ? 372 ALA A O   1 
ATOM   2899  C  CB  . ALA A 1 372 ? -9.664  47.202  58.480  1.00 8.24   ? 372 ALA A CB  1 
ATOM   2900  N  N   . ILE A 1 373 ? -12.761 48.309  58.487  1.00 11.68  ? 373 ILE A N   1 
ATOM   2901  C  CA  . ILE A 1 373 ? -13.903 48.617  59.331  1.00 10.08  ? 373 ILE A CA  1 
ATOM   2902  C  C   . ILE A 1 373 ? -14.364 47.223  59.740  1.00 13.72  ? 373 ILE A C   1 
ATOM   2903  O  O   . ILE A 1 373 ? -14.535 46.341  58.890  1.00 17.27  ? 373 ILE A O   1 
ATOM   2904  C  CB  . ILE A 1 373 ? -15.000 49.358  58.566  1.00 11.12  ? 373 ILE A CB  1 
ATOM   2905  C  CG1 . ILE A 1 373 ? -14.501 50.744  58.160  1.00 11.24  ? 373 ILE A CG1 1 
ATOM   2906  C  CG2 . ILE A 1 373 ? -16.221 49.508  59.431  1.00 10.33  ? 373 ILE A CG2 1 
ATOM   2907  C  CD1 . ILE A 1 373 ? -15.519 51.556  57.456  1.00 12.94  ? 373 ILE A CD1 1 
ATOM   2908  N  N   . ARG A 1 374 ? -14.494 47.008  61.041  1.00 13.70  ? 374 ARG A N   1 
ATOM   2909  C  CA  . ARG A 1 374 ? -14.852 45.711  61.582  1.00 12.02  ? 374 ARG A CA  1 
ATOM   2910  C  C   . ARG A 1 374 ? -16.070 45.725  62.461  1.00 12.81  ? 374 ARG A C   1 
ATOM   2911  O  O   . ARG A 1 374 ? -16.370 46.724  63.116  1.00 18.28  ? 374 ARG A O   1 
ATOM   2912  C  CB  . ARG A 1 374 ? -13.710 45.207  62.469  1.00 9.84   ? 374 ARG A CB  1 
ATOM   2913  C  CG  . ARG A 1 374 ? -12.380 45.086  61.791  1.00 12.37  ? 374 ARG A CG  1 
ATOM   2914  C  CD  . ARG A 1 374 ? -11.271 45.472  62.731  1.00 13.65  ? 374 ARG A CD  1 
ATOM   2915  N  NE  . ARG A 1 374 ? -9.947  45.258  62.151  1.00 11.43  ? 374 ARG A NE  1 
ATOM   2916  C  CZ  . ARG A 1 374 ? -8.809  45.590  62.754  1.00 14.70  ? 374 ARG A CZ  1 
ATOM   2917  N  NH1 . ARG A 1 374 ? -8.825  46.165  63.954  1.00 13.33  ? 374 ARG A NH1 1 
ATOM   2918  N  NH2 . ARG A 1 374 ? -7.647  45.305  62.185  1.00 10.58  ? 374 ARG A NH2 1 
ATOM   2919  N  N   . ILE A 1 375 ? -16.773 44.606  62.469  1.00 11.16  ? 375 ILE A N   1 
ATOM   2920  C  CA  . ILE A 1 375 ? -17.889 44.415  63.369  1.00 15.60  ? 375 ILE A CA  1 
ATOM   2921  C  C   . ILE A 1 375 ? -17.459 43.084  63.953  1.00 16.30  ? 375 ILE A C   1 
ATOM   2922  O  O   . ILE A 1 375 ? -17.036 42.191  63.218  1.00 15.83  ? 375 ILE A O   1 
ATOM   2923  C  CB  . ILE A 1 375 ? -19.258 44.389  62.681  1.00 15.83  ? 375 ILE A CB  1 
ATOM   2924  C  CG1 . ILE A 1 375 ? -19.314 43.345  61.591  1.00 27.11  ? 375 ILE A CG1 1 
ATOM   2925  C  CG2 . ILE A 1 375 ? -19.551 45.739  62.081  1.00 16.15  ? 375 ILE A CG2 1 
ATOM   2926  C  CD1 . ILE A 1 375 ? -20.616 43.401  60.836  1.00 34.23  ? 375 ILE A CD1 1 
ATOM   2927  N  N   . PHE A 1 376 ? -17.455 42.990  65.277  1.00 16.54  ? 376 PHE A N   1 
ATOM   2928  C  CA  . PHE A 1 376 ? -16.952 41.792  65.944  1.00 14.69  ? 376 PHE A CA  1 
ATOM   2929  C  C   . PHE A 1 376 ? -17.728 41.377  67.191  1.00 17.32  ? 376 PHE A C   1 
ATOM   2930  O  O   . PHE A 1 376 ? -18.527 42.140  67.740  1.00 17.79  ? 376 PHE A O   1 
ATOM   2931  C  CB  . PHE A 1 376 ? -15.512 42.077  66.388  1.00 11.97  ? 376 PHE A CB  1 
ATOM   2932  C  CG  . PHE A 1 376 ? -15.414 43.176  67.428  1.00 16.25  ? 376 PHE A CG  1 
ATOM   2933  C  CD1 . PHE A 1 376 ? -15.616 42.899  68.779  1.00 12.66  ? 376 PHE A CD1 1 
ATOM   2934  C  CD2 . PHE A 1 376 ? -15.175 44.493  67.061  1.00 16.60  ? 376 PHE A CD2 1 
ATOM   2935  C  CE1 . PHE A 1 376 ? -15.588 43.916  69.744  1.00 15.88  ? 376 PHE A CE1 1 
ATOM   2936  C  CE2 . PHE A 1 376 ? -15.144 45.517  68.026  1.00 15.98  ? 376 PHE A CE2 1 
ATOM   2937  C  CZ  . PHE A 1 376 ? -15.353 45.225  69.364  1.00 15.91  ? 376 PHE A CZ  1 
ATOM   2938  N  N   . ALA A 1 377 ? -17.356 40.209  67.701  1.00 16.99  ? 377 ALA A N   1 
ATOM   2939  C  CA  . ALA A 1 377 ? -17.910 39.621  68.915  1.00 17.06  ? 377 ALA A CA  1 
ATOM   2940  C  C   . ALA A 1 377 ? -16.716 38.896  69.515  1.00 18.02  ? 377 ALA A C   1 
ATOM   2941  O  O   . ALA A 1 377 ? -16.052 38.119  68.822  1.00 17.90  ? 377 ALA A O   1 
ATOM   2942  C  CB  . ALA A 1 377 ? -19.005 38.625  68.587  1.00 13.19  ? 377 ALA A CB  1 
ATOM   2943  N  N   . THR A 1 378 ? -16.407 39.211  70.768  1.00 19.09  ? 378 THR A N   1 
ATOM   2944  C  CA  . THR A 1 378 ? -15.288 38.608  71.478  1.00 20.48  ? 378 THR A CA  1 
ATOM   2945  C  C   . THR A 1 378 ? -15.744 37.846  72.724  1.00 21.61  ? 378 THR A C   1 
ATOM   2946  O  O   . THR A 1 378 ? -16.681 38.249  73.407  1.00 21.29  ? 378 THR A O   1 
ATOM   2947  C  CB  . THR A 1 378 ? -14.237 39.684  71.890  1.00 19.46  ? 378 THR A CB  1 
ATOM   2948  O  OG1 . THR A 1 378 ? -13.610 40.209  70.721  1.00 20.13  ? 378 THR A OG1 1 
ATOM   2949  C  CG2 . THR A 1 378 ? -13.150 39.086  72.769  1.00 18.38  ? 378 THR A CG2 1 
ATOM   2950  N  N   . TYR A 1 379 ? -15.105 36.712  72.974  1.00 19.49  ? 379 TYR A N   1 
ATOM   2951  C  CA  . TYR A 1 379 ? -15.387 35.912  74.145  1.00 19.94  ? 379 TYR A CA  1 
ATOM   2952  C  C   . TYR A 1 379 ? -14.043 35.648  74.810  1.00 20.02  ? 379 TYR A C   1 
ATOM   2953  O  O   . TYR A 1 379 ? -13.073 35.282  74.147  1.00 20.57  ? 379 TYR A O   1 
ATOM   2954  C  CB  . TYR A 1 379 ? -16.026 34.583  73.757  1.00 20.65  ? 379 TYR A CB  1 
ATOM   2955  C  CG  . TYR A 1 379 ? -16.147 33.638  74.927  1.00 23.01  ? 379 TYR A CG  1 
ATOM   2956  C  CD1 . TYR A 1 379 ? -17.071 33.878  75.940  1.00 22.92  ? 379 TYR A CD1 1 
ATOM   2957  C  CD2 . TYR A 1 379 ? -15.309 32.531  75.049  1.00 25.76  ? 379 TYR A CD2 1 
ATOM   2958  C  CE1 . TYR A 1 379 ? -17.156 33.047  77.040  1.00 24.19  ? 379 TYR A CE1 1 
ATOM   2959  C  CE2 . TYR A 1 379 ? -15.388 31.695  76.145  1.00 23.46  ? 379 TYR A CE2 1 
ATOM   2960  C  CZ  . TYR A 1 379 ? -16.314 31.961  77.134  1.00 25.20  ? 379 TYR A CZ  1 
ATOM   2961  O  OH  . TYR A 1 379 ? -16.408 31.145  78.228  1.00 30.20  ? 379 TYR A OH  1 
ATOM   2962  N  N   . ALA A 1 380 ? -13.976 35.866  76.110  1.00 20.84  ? 380 ALA A N   1 
ATOM   2963  C  CA  . ALA A 1 380 ? -12.750 35.631  76.849  1.00 21.75  ? 380 ALA A CA  1 
ATOM   2964  C  C   . ALA A 1 380 ? -13.099 34.860  78.112  1.00 24.21  ? 380 ALA A C   1 
ATOM   2965  O  O   . ALA A 1 380 ? -14.099 35.154  78.774  1.00 23.47  ? 380 ALA A O   1 
ATOM   2966  C  CB  . ALA A 1 380 ? -12.107 36.954  77.210  1.00 17.95  ? 380 ALA A CB  1 
ATOM   2967  N  N   . LYS A 1 381 ? -12.307 33.843  78.415  1.00 23.59  ? 381 LYS A N   1 
ATOM   2968  C  CA  . LYS A 1 381 ? -12.509 33.042  79.613  1.00 21.61  ? 381 LYS A CA  1 
ATOM   2969  C  C   . LYS A 1 381 ? -11.154 33.009  80.284  1.00 22.81  ? 381 LYS A C   1 
ATOM   2970  O  O   . LYS A 1 381 ? -10.136 32.769  79.630  1.00 22.86  ? 381 LYS A O   1 
ATOM   2971  C  CB  . LYS A 1 381 ? -12.942 31.624  79.239  1.00 25.02  ? 381 LYS A CB  1 
ATOM   2972  C  CG  . LYS A 1 381 ? -12.927 30.620  80.382  1.00 30.91  ? 381 LYS A CG  1 
ATOM   2973  C  CD  . LYS A 1 381 ? -14.056 30.864  81.376  1.00 44.99  ? 381 LYS A CD  1 
ATOM   2974  C  CE  . LYS A 1 381 ? -13.908 30.021  82.646  1.00 45.13  ? 381 LYS A CE  1 
ATOM   2975  N  NZ  . LYS A 1 381 ? -12.779 30.489  83.506  1.00 43.06  ? 381 LYS A NZ  1 
ATOM   2976  N  N   . TRP A 1 382 ? -11.131 33.276  81.579  1.00 23.47  ? 382 TRP A N   1 
ATOM   2977  C  CA  . TRP A 1 382 ? -9.882  33.271  82.320  1.00 23.18  ? 382 TRP A CA  1 
ATOM   2978  C  C   . TRP A 1 382 ? -10.002 32.615  83.684  1.00 25.00  ? 382 TRP A C   1 
ATOM   2979  O  O   . TRP A 1 382 ? -11.070 32.590  84.294  1.00 22.31  ? 382 TRP A O   1 
ATOM   2980  C  CB  . TRP A 1 382 ? -9.392  34.696  82.505  1.00 22.22  ? 382 TRP A CB  1 
ATOM   2981  C  CG  . TRP A 1 382 ? -10.365 35.550  83.216  1.00 21.39  ? 382 TRP A CG  1 
ATOM   2982  C  CD1 . TRP A 1 382 ? -10.453 35.745  84.561  1.00 19.63  ? 382 TRP A CD1 1 
ATOM   2983  C  CD2 . TRP A 1 382 ? -11.380 36.360  82.623  1.00 22.08  ? 382 TRP A CD2 1 
ATOM   2984  N  NE1 . TRP A 1 382 ? -11.457 36.636  84.844  1.00 23.37  ? 382 TRP A NE1 1 
ATOM   2985  C  CE2 . TRP A 1 382 ? -12.045 37.031  83.673  1.00 23.00  ? 382 TRP A CE2 1 
ATOM   2986  C  CE3 . TRP A 1 382 ? -11.789 36.590  81.303  1.00 19.87  ? 382 TRP A CE3 1 
ATOM   2987  C  CZ2 . TRP A 1 382 ? -13.102 37.918  83.447  1.00 21.48  ? 382 TRP A CZ2 1 
ATOM   2988  C  CZ3 . TRP A 1 382 ? -12.840 37.470  81.072  1.00 18.26  ? 382 TRP A CZ3 1 
ATOM   2989  C  CH2 . TRP A 1 382 ? -13.487 38.126  82.143  1.00 21.43  ? 382 TRP A CH2 1 
ATOM   2990  N  N   . ASP A 1 383 ? -8.866  32.147  84.176  1.00 26.81  ? 383 ASP A N   1 
ATOM   2991  C  CA  . ASP A 1 383 ? -8.758  31.507  85.475  1.00 28.50  ? 383 ASP A CA  1 
ATOM   2992  C  C   . ASP A 1 383 ? -7.454  32.011  86.083  1.00 25.95  ? 383 ASP A C   1 
ATOM   2993  O  O   . ASP A 1 383 ? -6.371  31.508  85.779  1.00 24.09  ? 383 ASP A O   1 
ATOM   2994  C  CB  . ASP A 1 383 ? -8.710  29.992  85.295  1.00 37.32  ? 383 ASP A CB  1 
ATOM   2995  C  CG  . ASP A 1 383 ? -8.469  29.252  86.597  1.00 43.69  ? 383 ASP A CG  1 
ATOM   2996  O  OD1 . ASP A 1 383 ? -8.842  29.774  87.674  1.00 45.21  ? 383 ASP A OD1 1 
ATOM   2997  O  OD2 . ASP A 1 383 ? -7.905  28.137  86.533  1.00 52.08  ? 383 ASP A OD2 1 
ATOM   2998  N  N   . GLU A 1 384 ? -7.555  33.024  86.923  1.00 26.05  ? 384 GLU A N   1 
ATOM   2999  C  CA  . GLU A 1 384 ? -6.373  33.604  87.535  1.00 26.96  ? 384 GLU A CA  1 
ATOM   3000  C  C   . GLU A 1 384 ? -6.188  33.185  88.987  1.00 29.80  ? 384 GLU A C   1 
ATOM   3001  O  O   . GLU A 1 384 ? -7.000  33.520  89.863  1.00 30.89  ? 384 GLU A O   1 
ATOM   3002  C  CB  . GLU A 1 384 ? -6.405  35.128  87.388  1.00 23.78  ? 384 GLU A CB  1 
ATOM   3003  C  CG  . GLU A 1 384 ? -6.588  35.542  85.947  1.00 22.75  ? 384 GLU A CG  1 
ATOM   3004  C  CD  . GLU A 1 384 ? -6.274  36.998  85.684  1.00 27.38  ? 384 GLU A CD  1 
ATOM   3005  O  OE1 . GLU A 1 384 ? -6.322  37.841  86.613  1.00 25.85  ? 384 GLU A OE1 1 
ATOM   3006  O  OE2 . GLU A 1 384 ? -5.978  37.298  84.515  1.00 31.10  ? 384 GLU A OE2 1 
ATOM   3007  N  N   . LYS A 1 385 ? -5.116  32.440  89.230  1.00 28.79  ? 385 LYS A N   1 
ATOM   3008  C  CA  . LYS A 1 385 ? -4.809  31.952  90.561  1.00 27.45  ? 385 LYS A CA  1 
ATOM   3009  C  C   . LYS A 1 385 ? -4.013  32.933  91.423  1.00 28.02  ? 385 LYS A C   1 
ATOM   3010  O  O   . LYS A 1 385 ? -3.883  32.734  92.638  1.00 33.91  ? 385 LYS A O   1 
ATOM   3011  C  CB  . LYS A 1 385 ? -4.048  30.629  90.480  1.00 28.15  ? 385 LYS A CB  1 
ATOM   3012  C  CG  . LYS A 1 385 ? -4.813  29.466  89.836  1.00 32.09  ? 385 LYS A CG  1 
ATOM   3013  C  CD  . LYS A 1 385 ? -6.127  29.170  90.537  1.00 37.69  ? 385 LYS A CD  1 
ATOM   3014  C  CE  . LYS A 1 385 ? -6.818  27.967  89.920  1.00 43.08  ? 385 LYS A CE  1 
ATOM   3015  N  NZ  . LYS A 1 385 ? -8.238  27.890  90.372  1.00 48.45  ? 385 LYS A NZ  1 
ATOM   3016  N  N   . TRP A 1 386 ? -3.462  33.974  90.811  1.00 26.21  ? 386 TRP A N   1 
ATOM   3017  C  CA  . TRP A 1 386 ? -2.666  34.953  91.549  1.00 24.40  ? 386 TRP A CA  1 
ATOM   3018  C  C   . TRP A 1 386 ? -2.850  36.345  90.955  1.00 24.67  ? 386 TRP A C   1 
ATOM   3019  O  O   . TRP A 1 386 ? -3.401  36.495  89.866  1.00 28.87  ? 386 TRP A O   1 
ATOM   3020  C  CB  . TRP A 1 386 ? -1.175  34.556  91.541  1.00 19.42  ? 386 TRP A CB  1 
ATOM   3021  C  CG  . TRP A 1 386 ? -0.489  34.623  90.183  1.00 22.96  ? 386 TRP A CG  1 
ATOM   3022  C  CD1 . TRP A 1 386 ? -0.424  33.630  89.240  1.00 21.85  ? 386 TRP A CD1 1 
ATOM   3023  C  CD2 . TRP A 1 386 ? 0.248   35.731  89.642  1.00 23.29  ? 386 TRP A CD2 1 
ATOM   3024  N  NE1 . TRP A 1 386 ? 0.306   34.050  88.153  1.00 22.08  ? 386 TRP A NE1 1 
ATOM   3025  C  CE2 . TRP A 1 386 ? 0.731   35.334  88.372  1.00 21.75  ? 386 TRP A CE2 1 
ATOM   3026  C  CE3 . TRP A 1 386 ? 0.557   37.021  90.113  1.00 25.39  ? 386 TRP A CE3 1 
ATOM   3027  C  CZ2 . TRP A 1 386 ? 1.507   36.181  87.566  1.00 22.19  ? 386 TRP A CZ2 1 
ATOM   3028  C  CZ3 . TRP A 1 386 ? 1.339   37.871  89.306  1.00 21.02  ? 386 TRP A CZ3 1 
ATOM   3029  C  CH2 . TRP A 1 386 ? 1.801   37.440  88.049  1.00 22.53  ? 386 TRP A CH2 1 
ATOM   3030  N  N   . GLY A 1 387 ? -2.406  37.355  91.688  1.00 23.23  ? 387 GLY A N   1 
ATOM   3031  C  CA  . GLY A 1 387 ? -2.505  38.724  91.228  1.00 22.45  ? 387 GLY A CA  1 
ATOM   3032  C  C   . GLY A 1 387 ? -1.508  39.541  92.018  1.00 23.57  ? 387 GLY A C   1 
ATOM   3033  O  O   . GLY A 1 387 ? -0.956  39.057  92.992  1.00 26.11  ? 387 GLY A O   1 
ATOM   3034  N  N   . TYR A 1 388 ? -1.233  40.761  91.596  1.00 25.94  ? 388 TYR A N   1 
ATOM   3035  C  CA  . TYR A 1 388 ? -0.298  41.589  92.330  1.00 28.02  ? 388 TYR A CA  1 
ATOM   3036  C  C   . TYR A 1 388 ? -1.019  42.191  93.510  1.00 31.82  ? 388 TYR A C   1 
ATOM   3037  O  O   . TYR A 1 388 ? -2.183  42.565  93.415  1.00 30.46  ? 388 TYR A O   1 
ATOM   3038  C  CB  . TYR A 1 388 ? 0.286   42.668  91.435  1.00 27.80  ? 388 TYR A CB  1 
ATOM   3039  C  CG  . TYR A 1 388 ? 1.221   42.111  90.387  1.00 29.85  ? 388 TYR A CG  1 
ATOM   3040  C  CD1 . TYR A 1 388 ? 2.536   41.758  90.708  1.00 27.93  ? 388 TYR A CD1 1 
ATOM   3041  C  CD2 . TYR A 1 388 ? 0.788   41.905  89.079  1.00 29.65  ? 388 TYR A CD2 1 
ATOM   3042  C  CE1 . TYR A 1 388 ? 3.389   41.214  89.748  1.00 27.85  ? 388 TYR A CE1 1 
ATOM   3043  C  CE2 . TYR A 1 388 ? 1.636   41.359  88.118  1.00 28.55  ? 388 TYR A CE2 1 
ATOM   3044  C  CZ  . TYR A 1 388 ? 2.925   41.019  88.460  1.00 27.40  ? 388 TYR A CZ  1 
ATOM   3045  O  OH  . TYR A 1 388 ? 3.742   40.480  87.507  1.00 31.35  ? 388 TYR A OH  1 
ATOM   3046  N  N   . ILE A 1 389 ? -0.344  42.223  94.644  1.00 36.38  ? 389 ILE A N   1 
ATOM   3047  C  CA  . ILE A 1 389 ? -0.931  42.755  95.852  1.00 39.29  ? 389 ILE A CA  1 
ATOM   3048  C  C   . ILE A 1 389 ? -1.330  44.194  95.634  1.00 41.03  ? 389 ILE A C   1 
ATOM   3049  O  O   . ILE A 1 389 ? -0.494  45.052  95.376  1.00 39.11  ? 389 ILE A O   1 
ATOM   3050  C  CB  . ILE A 1 389 ? 0.032   42.614  97.044  1.00 37.30  ? 389 ILE A CB  1 
ATOM   3051  C  CG1 . ILE A 1 389 ? 0.238   41.128  97.343  1.00 34.75  ? 389 ILE A CG1 1 
ATOM   3052  C  CG2 . ILE A 1 389 ? -0.525  43.336  98.261  1.00 38.37  ? 389 ILE A CG2 1 
ATOM   3053  C  CD1 . ILE A 1 389 ? 1.343   40.835  98.310  1.00 34.53  ? 389 ILE A CD1 1 
ATOM   3054  N  N   . LYS A 1 390 ? -2.630  44.423  95.639  1.00 48.74  ? 390 LYS A N   1 
ATOM   3055  C  CA  . LYS A 1 390 ? -3.171  45.749  95.453  1.00 59.07  ? 390 LYS A CA  1 
ATOM   3056  C  C   . LYS A 1 390 ? -3.060  46.463  96.781  1.00 64.76  ? 390 LYS A C   1 
ATOM   3057  O  O   . LYS A 1 390 ? -3.847  46.219  97.695  1.00 67.55  ? 390 LYS A O   1 
ATOM   3058  C  CB  . LYS A 1 390 ? -4.628  45.660  95.002  1.00 59.11  ? 390 LYS A CB  1 
ATOM   3059  C  CG  . LYS A 1 390 ? -5.231  46.992  94.611  1.00 66.36  ? 390 LYS A CG  1 
ATOM   3060  C  CD  . LYS A 1 390 ? -6.243  46.837  93.483  1.00 70.76  ? 390 LYS A CD  1 
ATOM   3061  C  CE  . LYS A 1 390 ? -7.426  45.971  93.886  1.00 74.10  ? 390 LYS A CE  1 
ATOM   3062  N  NZ  . LYS A 1 390 ? -8.318  46.662  94.860  1.00 79.54  ? 390 LYS A NZ  1 
ATOM   3063  N  N   . ASP A 1 391 ? -2.025  47.284  96.911  1.00 74.49  ? 391 ASP A N   1 
ATOM   3064  C  CA  . ASP A 1 391 ? -1.794  48.054  98.133  1.00 84.09  ? 391 ASP A CA  1 
ATOM   3065  C  C   . ASP A 1 391 ? -2.719  49.285  98.127  1.00 89.11  ? 391 ASP A C   1 
ATOM   3066  O  O   . ASP A 1 391 ? -2.297  50.412  97.811  1.00 91.09  ? 391 ASP A O   1 
ATOM   3067  C  CB  . ASP A 1 391 ? -0.318  48.475  98.231  1.00 84.37  ? 391 ASP A CB  1 
ATOM   3068  C  CG  . ASP A 1 391 ? 0.009   49.166  99.546  0.00 84.14  ? 391 ASP A CG  1 
ATOM   3069  O  OD1 . ASP A 1 391 ? 0.063   48.477  100.586 0.00 84.13  ? 391 ASP A OD1 1 
ATOM   3070  O  OD2 . ASP A 1 391 ? 0.215   50.398  99.537  0.00 84.13  ? 391 ASP A OD2 1 
ATOM   3071  N  N   . GLY A 1 392 ? -3.988  49.056  98.460  1.00 92.44  ? 392 GLY A N   1 
ATOM   3072  C  CA  . GLY A 1 392 ? -4.965  50.131  98.474  1.00 95.00  ? 392 GLY A CA  1 
ATOM   3073  C  C   . GLY A 1 392 ? -5.453  50.438  97.066  1.00 96.05  ? 392 GLY A C   1 
ATOM   3074  O  O   . GLY A 1 392 ? -6.461  49.894  96.612  1.00 98.09  ? 392 GLY A O   1 
ATOM   3075  N  N   . ASP A 1 393 ? -4.730  51.303  96.367  1.00 95.54  ? 393 ASP A N   1 
ATOM   3076  C  CA  . ASP A 1 393 ? -5.097  51.671  95.007  1.00 94.82  ? 393 ASP A CA  1 
ATOM   3077  C  C   . ASP A 1 393 ? -3.944  51.338  94.076  1.00 93.43  ? 393 ASP A C   1 
ATOM   3078  O  O   . ASP A 1 393 ? -4.152  51.003  92.909  1.00 94.45  ? 393 ASP A O   1 
ATOM   3079  C  CB  . ASP A 1 393 ? -5.414  53.164  94.934  1.00 96.74  ? 393 ASP A CB  1 
ATOM   3080  C  CG  . ASP A 1 393 ? -5.879  53.597  93.558  0.00 96.45  ? 393 ASP A CG  1 
ATOM   3081  O  OD1 . ASP A 1 393 ? -7.032  53.286  93.191  0.00 96.75  ? 393 ASP A OD1 1 
ATOM   3082  O  OD2 . ASP A 1 393 ? -5.089  54.250  92.843  0.00 96.75  ? 393 ASP A OD2 1 
ATOM   3083  N  N   . ASN A 1 394 ? -2.728  51.448  94.607  1.00 89.68  ? 394 ASN A N   1 
ATOM   3084  C  CA  . ASN A 1 394 ? -1.511  51.159  93.851  1.00 84.36  ? 394 ASN A CA  1 
ATOM   3085  C  C   . ASN A 1 394 ? -1.224  49.650  93.847  1.00 78.32  ? 394 ASN A C   1 
ATOM   3086  O  O   . ASN A 1 394 ? -1.508  48.947  94.822  1.00 77.95  ? 394 ASN A O   1 
ATOM   3087  C  CB  . ASN A 1 394 ? -0.316  51.915  94.453  1.00 86.27  ? 394 ASN A CB  1 
ATOM   3088  C  CG  . ASN A 1 394 ? -0.474  53.421  94.376  0.00 86.80  ? 394 ASN A CG  1 
ATOM   3089  O  OD1 . ASN A 1 394 ? -0.835  53.969  93.336  0.00 87.45  ? 394 ASN A OD1 1 
ATOM   3090  N  ND2 . ASN A 1 394 ? -0.196  54.101  95.480  0.00 87.45  ? 394 ASN A ND2 1 
ATOM   3091  N  N   . ILE A 1 395 ? -0.694  49.151  92.737  1.00 69.85  ? 395 ILE A N   1 
ATOM   3092  C  CA  . ILE A 1 395 ? -0.369  47.738  92.619  1.00 61.59  ? 395 ILE A CA  1 
ATOM   3093  C  C   . ILE A 1 395 ? 1.087   47.539  93.019  1.00 56.83  ? 395 ILE A C   1 
ATOM   3094  O  O   . ILE A 1 395 ? 1.953   48.319  92.638  1.00 57.60  ? 395 ILE A O   1 
ATOM   3095  C  CB  . ILE A 1 395 ? -0.649  47.213  91.185  1.00 59.67  ? 395 ILE A CB  1 
ATOM   3096  C  CG1 . ILE A 1 395 ? -2.125  46.846  91.046  1.00 61.31  ? 395 ILE A CG1 1 
ATOM   3097  C  CG2 . ILE A 1 395 ? 0.189   45.993  90.873  1.00 59.09  ? 395 ILE A CG2 1 
ATOM   3098  C  CD1 . ILE A 1 395 ? -3.083  48.000  91.248  1.00 65.48  ? 395 ILE A CD1 1 
ATOM   3099  N  N   . SER A 1 396 ? 1.336   46.511  93.819  1.00 51.69  ? 396 SER A N   1 
ATOM   3100  C  CA  . SER A 1 396 ? 2.670   46.193  94.314  1.00 46.10  ? 396 SER A CA  1 
ATOM   3101  C  C   . SER A 1 396 ? 3.447   45.237  93.390  1.00 43.87  ? 396 SER A C   1 
ATOM   3102  O  O   . SER A 1 396 ? 2.870   44.613  92.500  1.00 45.72  ? 396 SER A O   1 
ATOM   3103  C  CB  . SER A 1 396 ? 2.525   45.578  95.705  1.00 44.98  ? 396 SER A CB  1 
ATOM   3104  O  OG  . SER A 1 396 ? 3.778   45.281  96.286  1.00 51.48  ? 396 SER A OG  1 
ATOM   3105  N  N   . ARG A 1 397 ? 4.757   45.130  93.607  1.00 41.01  ? 397 ARG A N   1 
ATOM   3106  C  CA  . ARG A 1 397 ? 5.611   44.239  92.824  1.00 39.44  ? 397 ARG A CA  1 
ATOM   3107  C  C   . ARG A 1 397 ? 5.433   42.821  93.356  1.00 37.49  ? 397 ARG A C   1 
ATOM   3108  O  O   . ARG A 1 397 ? 5.838   41.839  92.730  1.00 37.76  ? 397 ARG A O   1 
ATOM   3109  C  CB  . ARG A 1 397 ? 7.073   44.653  92.973  1.00 44.18  ? 397 ARG A CB  1 
ATOM   3110  C  CG  . ARG A 1 397 ? 7.338   46.086  92.548  1.00 59.11  ? 397 ARG A CG  1 
ATOM   3111  C  CD  . ARG A 1 397 ? 8.758   46.540  92.864  1.00 69.08  ? 397 ARG A CD  1 
ATOM   3112  N  NE  . ARG A 1 397 ? 9.579   46.773  91.671  1.00 78.35  ? 397 ARG A NE  1 
ATOM   3113  C  CZ  . ARG A 1 397 ? 9.975   45.823  90.823  1.00 84.21  ? 397 ARG A CZ  1 
ATOM   3114  N  NH1 . ARG A 1 397 ? 9.622   44.550  91.006  1.00 83.24  ? 397 ARG A NH1 1 
ATOM   3115  N  NH2 . ARG A 1 397 ? 10.780  46.137  89.816  1.00 88.45  ? 397 ARG A NH2 1 
ATOM   3116  N  N   . TYR A 1 398 ? 4.818   42.726  94.528  1.00 34.70  ? 398 TYR A N   1 
ATOM   3117  C  CA  . TYR A 1 398 ? 4.596   41.449  95.179  1.00 31.83  ? 398 TYR A CA  1 
ATOM   3118  C  C   . TYR A 1 398 ? 3.281   40.829  94.784  1.00 31.24  ? 398 TYR A C   1 
ATOM   3119  O  O   . TYR A 1 398 ? 2.292   41.529  94.604  1.00 33.10  ? 398 TYR A O   1 
ATOM   3120  C  CB  . TYR A 1 398 ? 4.679   41.627  96.695  1.00 30.84  ? 398 TYR A CB  1 
ATOM   3121  C  CG  . TYR A 1 398 ? 6.052   42.061  97.151  1.00 29.69  ? 398 TYR A CG  1 
ATOM   3122  C  CD1 . TYR A 1 398 ? 7.090   41.139  97.253  1.00 34.09  ? 398 TYR A CD1 1 
ATOM   3123  C  CD2 . TYR A 1 398 ? 6.329   43.401  97.427  1.00 32.14  ? 398 TYR A CD2 1 
ATOM   3124  C  CE1 . TYR A 1 398 ? 8.370   41.532  97.612  1.00 35.44  ? 398 TYR A CE1 1 
ATOM   3125  C  CE2 . TYR A 1 398 ? 7.609   43.814  97.789  1.00 34.08  ? 398 TYR A CE2 1 
ATOM   3126  C  CZ  . TYR A 1 398 ? 8.628   42.869  97.879  1.00 36.63  ? 398 TYR A CZ  1 
ATOM   3127  O  OH  . TYR A 1 398 ? 9.910   43.248  98.230  1.00 43.56  ? 398 TYR A OH  1 
ATOM   3128  N  N   . ALA A 1 399 ? 3.280   39.507  94.680  1.00 30.91  ? 399 ALA A N   1 
ATOM   3129  C  CA  . ALA A 1 399 ? 2.096   38.749  94.294  1.00 33.16  ? 399 ALA A CA  1 
ATOM   3130  C  C   . ALA A 1 399 ? 1.552   37.945  95.468  1.00 35.51  ? 399 ALA A C   1 
ATOM   3131  O  O   . ALA A 1 399 ? 2.257   37.715  96.446  1.00 40.18  ? 399 ALA A O   1 
ATOM   3132  C  CB  . ALA A 1 399 ? 2.438   37.803  93.139  1.00 31.07  ? 399 ALA A CB  1 
ATOM   3133  N  N   . ALA A 1 400 ? 0.305   37.501  95.353  1.00 35.89  ? 400 ALA A N   1 
ATOM   3134  C  CA  . ALA A 1 400 ? -0.356  36.705  96.383  1.00 35.17  ? 400 ALA A CA  1 
ATOM   3135  C  C   . ALA A 1 400 ? -1.399  35.848  95.681  1.00 35.40  ? 400 ALA A C   1 
ATOM   3136  O  O   . ALA A 1 400 ? -1.958  36.251  94.656  1.00 36.61  ? 400 ALA A O   1 
ATOM   3137  C  CB  . ALA A 1 400 ? -1.025  37.615  97.411  1.00 35.17  ? 400 ALA A CB  1 
ATOM   3138  N  N   . ALA A 1 401 ? -1.613  34.638  96.178  1.00 35.25  ? 401 ALA A N   1 
ATOM   3139  C  CA  . ALA A 1 401 ? -2.603  33.773  95.568  1.00 36.22  ? 401 ALA A CA  1 
ATOM   3140  C  C   . ALA A 1 401 ? -3.962  34.425  95.752  1.00 38.38  ? 401 ALA A C   1 
ATOM   3141  O  O   . ALA A 1 401 ? -4.207  35.091  96.753  1.00 39.92  ? 401 ALA A O   1 
ATOM   3142  C  CB  . ALA A 1 401 ? -2.580  32.420  96.208  1.00 35.87  ? 401 ALA A CB  1 
ATOM   3143  N  N   . THR A 1 402 ? -4.832  34.252  94.769  1.00 45.07  ? 402 THR A N   1 
ATOM   3144  C  CA  . THR A 1 402 ? -6.171  34.818  94.803  1.00 51.70  ? 402 THR A CA  1 
ATOM   3145  C  C   . THR A 1 402 ? -6.871  34.453  96.114  1.00 57.32  ? 402 THR A C   1 
ATOM   3146  O  O   . THR A 1 402 ? -7.481  35.304  96.758  1.00 58.50  ? 402 THR A O   1 
ATOM   3147  C  CB  . THR A 1 402 ? -7.008  34.272  93.620  1.00 50.86  ? 402 THR A CB  1 
ATOM   3148  O  OG1 . THR A 1 402 ? -6.304  34.479  92.390  1.00 54.44  ? 402 THR A OG1 1 
ATOM   3149  C  CG2 . THR A 1 402 ? -8.340  34.979  93.535  1.00 53.88  ? 402 THR A CG2 1 
ATOM   3150  N  N   . ASN A 1 403 ? -6.741  33.186  96.509  1.00 64.05  ? 403 ASN A N   1 
ATOM   3151  C  CA  . ASN A 1 403 ? -7.374  32.665  97.721  1.00 69.72  ? 403 ASN A CA  1 
ATOM   3152  C  C   . ASN A 1 403 ? -6.851  33.210  99.044  1.00 69.88  ? 403 ASN A C   1 
ATOM   3153  O  O   . ASN A 1 403 ? -7.627  33.394  99.980  1.00 72.53  ? 403 ASN A O   1 
ATOM   3154  C  CB  . ASN A 1 403 ? -7.374  31.125  97.737  1.00 77.70  ? 403 ASN A CB  1 
ATOM   3155  C  CG  . ASN A 1 403 ? -5.974  30.525  97.755  1.00 85.72  ? 403 ASN A CG  1 
ATOM   3156  O  OD1 . ASN A 1 403 ? -5.110  30.940  98.530  1.00 90.92  ? 403 ASN A OD1 1 
ATOM   3157  N  ND2 . ASN A 1 403 ? -5.750  29.529  96.905  1.00 90.85  ? 403 ASN A ND2 1 
ATOM   3158  N  N   . SER A 1 404 ? -5.542  33.419  99.152  1.00 68.53  ? 404 SER A N   1 
ATOM   3159  C  CA  . SER A 1 404 ? -4.979  33.963  100.380 1.00 65.27  ? 404 SER A CA  1 
ATOM   3160  C  C   . SER A 1 404 ? -5.740  35.262  100.520 1.00 65.00  ? 404 SER A C   1 
ATOM   3161  O  O   . SER A 1 404 ? -5.802  36.038  99.567  1.00 69.97  ? 404 SER A O   1 
ATOM   3162  C  CB  . SER A 1 404 ? -3.488  34.246  100.205 1.00 66.21  ? 404 SER A CB  1 
ATOM   3163  O  OG  . SER A 1 404 ? -3.261  35.324  99.308  1.00 62.28  ? 404 SER A OG  1 
ATOM   3164  N  N   . GLY A 1 405 ? -6.347  35.481  101.678 1.00 60.74  ? 405 GLY A N   1 
ATOM   3165  C  CA  . GLY A 1 405 ? -7.141  36.681  101.896 1.00 59.67  ? 405 GLY A CA  1 
ATOM   3166  C  C   . GLY A 1 405 ? -6.573  38.045  101.520 1.00 58.94  ? 405 GLY A C   1 
ATOM   3167  O  O   . GLY A 1 405 ? -7.221  39.075  101.758 1.00 61.30  ? 405 GLY A O   1 
ATOM   3168  N  N   . ILE A 1 406 ? -5.372  38.070  100.953 1.00 56.97  ? 406 ILE A N   1 
ATOM   3169  C  CA  . ILE A 1 406 ? -4.744  39.316  100.560 1.00 53.80  ? 406 ILE A CA  1 
ATOM   3170  C  C   . ILE A 1 406 ? -5.397  39.920  99.312  1.00 52.31  ? 406 ILE A C   1 
ATOM   3171  O  O   . ILE A 1 406 ? -5.805  39.208  98.384  1.00 50.22  ? 406 ILE A O   1 
ATOM   3172  C  CB  . ILE A 1 406 ? -3.244  39.114  100.330 1.00 53.89  ? 406 ILE A CB  1 
ATOM   3173  C  CG1 . ILE A 1 406 ? -2.660  38.289  101.478 1.00 54.95  ? 406 ILE A CG1 1 
ATOM   3174  C  CG2 . ILE A 1 406 ? -2.542  40.465  100.271 1.00 53.25  ? 406 ILE A CG2 1 
ATOM   3175  C  CD1 . ILE A 1 406 ? -1.212  37.903  101.297 1.00 57.32  ? 406 ILE A CD1 1 
ATOM   3176  N  N   . SER A 1 407 ? -5.502  41.245  99.319  1.00 52.39  ? 407 SER A N   1 
ATOM   3177  C  CA  . SER A 1 407 ? -6.098  42.007  98.226  1.00 53.57  ? 407 SER A CA  1 
ATOM   3178  C  C   . SER A 1 407 ? -5.132  42.135  97.037  1.00 51.77  ? 407 SER A C   1 
ATOM   3179  O  O   . SER A 1 407 ? -4.119  42.834  97.105  1.00 52.14  ? 407 SER A O   1 
ATOM   3180  C  CB  . SER A 1 407 ? -6.508  43.396  98.732  1.00 56.12  ? 407 SER A CB  1 
ATOM   3181  O  OG  . SER A 1 407 ? -7.320  44.075  97.789  1.00 64.98  ? 407 SER A OG  1 
ATOM   3182  N  N   . THR A 1 408 ? -5.447  41.436  95.955  1.00 49.29  ? 408 THR A N   1 
ATOM   3183  C  CA  . THR A 1 408 ? -4.628  41.458  94.756  1.00 44.18  ? 408 THR A CA  1 
ATOM   3184  C  C   . THR A 1 408 ? -5.471  42.005  93.605  1.00 42.00  ? 408 THR A C   1 
ATOM   3185  O  O   . THR A 1 408 ? -6.653  42.313  93.787  1.00 42.13  ? 408 THR A O   1 
ATOM   3186  C  CB  . THR A 1 408 ? -4.138  40.030  94.410  1.00 43.37  ? 408 THR A CB  1 
ATOM   3187  O  OG1 . THR A 1 408 ? -5.263  39.158  94.234  1.00 42.49  ? 408 THR A OG1 1 
ATOM   3188  C  CG2 . THR A 1 408 ? -3.271  39.482  95.529  1.00 44.53  ? 408 THR A CG2 1 
ATOM   3189  N  N   . ASN A 1 409 ? -4.862  42.156  92.431  1.00 40.17  ? 409 ASN A N   1 
ATOM   3190  C  CA  . ASN A 1 409 ? -5.591  42.640  91.259  1.00 33.79  ? 409 ASN A CA  1 
ATOM   3191  C  C   . ASN A 1 409 ? -6.034  41.483  90.358  1.00 31.54  ? 409 ASN A C   1 
ATOM   3192  O  O   . ASN A 1 409 ? -6.357  41.692  89.199  1.00 35.81  ? 409 ASN A O   1 
ATOM   3193  C  CB  . ASN A 1 409 ? -4.768  43.668  90.471  1.00 31.36  ? 409 ASN A CB  1 
ATOM   3194  C  CG  . ASN A 1 409 ? -3.562  43.064  89.801  1.00 33.71  ? 409 ASN A CG  1 
ATOM   3195  O  OD1 . ASN A 1 409 ? -3.180  41.925  90.082  1.00 36.11  ? 409 ASN A OD1 1 
ATOM   3196  N  ND2 . ASN A 1 409 ? -2.940  43.827  88.916  1.00 36.55  ? 409 ASN A ND2 1 
ATOM   3197  N  N   . SER A 1 410 ? -6.055  40.272  90.914  1.00 29.03  ? 410 SER A N   1 
ATOM   3198  C  CA  . SER A 1 410 ? -6.478  39.068  90.205  1.00 27.28  ? 410 SER A CA  1 
ATOM   3199  C  C   . SER A 1 410 ? -7.937  39.198  89.774  1.00 29.72  ? 410 SER A C   1 
ATOM   3200  O  O   . SER A 1 410 ? -8.770  39.729  90.516  1.00 31.47  ? 410 SER A O   1 
ATOM   3201  C  CB  . SER A 1 410 ? -6.317  37.851  91.114  1.00 25.01  ? 410 SER A CB  1 
ATOM   3202  O  OG  . SER A 1 410 ? -6.924  36.694  90.569  1.00 26.03  ? 410 SER A OG  1 
ATOM   3203  N  N   . ARG A 1 411 ? -8.240  38.711  88.572  1.00 31.26  ? 411 ARG A N   1 
ATOM   3204  C  CA  . ARG A 1 411 ? -9.595  38.779  88.014  1.00 30.21  ? 411 ARG A CA  1 
ATOM   3205  C  C   . ARG A 1 411 ? -10.395 37.518  88.340  1.00 30.41  ? 411 ARG A C   1 
ATOM   3206  O  O   . ARG A 1 411 ? -11.549 37.371  87.934  1.00 32.64  ? 411 ARG A O   1 
ATOM   3207  C  CB  . ARG A 1 411 ? -9.538  39.001  86.492  1.00 28.41  ? 411 ARG A CB  1 
ATOM   3208  C  CG  . ARG A 1 411 ? -8.875  40.309  86.073  1.00 26.56  ? 411 ARG A CG  1 
ATOM   3209  C  CD  . ARG A 1 411 ? -8.100  40.163  84.759  1.00 25.63  ? 411 ARG A CD  1 
ATOM   3210  N  NE  . ARG A 1 411 ? -8.987  39.983  83.618  1.00 23.82  ? 411 ARG A NE  1 
ATOM   3211  C  CZ  . ARG A 1 411 ? -8.835  39.054  82.680  1.00 22.68  ? 411 ARG A CZ  1 
ATOM   3212  N  NH1 . ARG A 1 411 ? -7.823  38.201  82.721  1.00 17.91  ? 411 ARG A NH1 1 
ATOM   3213  N  NH2 . ARG A 1 411 ? -9.732  38.957  81.715  1.00 28.27  ? 411 ARG A NH2 1 
ATOM   3214  N  N   . GLY A 1 412 ? -9.767  36.598  89.058  1.00 29.68  ? 412 GLY A N   1 
ATOM   3215  C  CA  . GLY A 1 412 ? -10.451 35.384  89.440  1.00 27.56  ? 412 GLY A CA  1 
ATOM   3216  C  C   . GLY A 1 412 ? -10.710 34.404  88.326  1.00 29.76  ? 412 GLY A C   1 
ATOM   3217  O  O   . GLY A 1 412 ? -9.895  34.229  87.420  1.00 31.57  ? 412 GLY A O   1 
ATOM   3218  N  N   . ASP A 1 413 ? -11.834 33.713  88.437  1.00 31.81  ? 413 ASP A N   1 
ATOM   3219  C  CA  . ASP A 1 413 ? -12.235 32.715  87.464  1.00 34.57  ? 413 ASP A CA  1 
ATOM   3220  C  C   . ASP A 1 413 ? -13.560 33.196  86.882  1.00 34.42  ? 413 ASP A C   1 
ATOM   3221  O  O   . ASP A 1 413 ? -14.577 33.235  87.575  1.00 35.39  ? 413 ASP A O   1 
ATOM   3222  C  CB  . ASP A 1 413 ? -12.408 31.362  88.158  1.00 41.12  ? 413 ASP A CB  1 
ATOM   3223  C  CG  . ASP A 1 413 ? -12.807 30.250  87.199  1.00 51.90  ? 413 ASP A CG  1 
ATOM   3224  O  OD1 . ASP A 1 413 ? -13.779 30.422  86.427  1.00 60.63  ? 413 ASP A OD1 1 
ATOM   3225  O  OD2 . ASP A 1 413 ? -12.158 29.182  87.228  1.00 61.86  ? 413 ASP A OD2 1 
ATOM   3226  N  N   . SER A 1 414 ? -13.564 33.525  85.599  1.00 32.88  ? 414 SER A N   1 
ATOM   3227  C  CA  . SER A 1 414 ? -14.779 34.016  84.994  1.00 29.15  ? 414 SER A CA  1 
ATOM   3228  C  C   . SER A 1 414 ? -14.631 34.081  83.484  1.00 27.70  ? 414 SER A C   1 
ATOM   3229  O  O   . SER A 1 414 ? -13.672 33.558  82.914  1.00 28.59  ? 414 SER A O   1 
ATOM   3230  C  CB  . SER A 1 414 ? -15.055 35.407  85.561  1.00 27.68  ? 414 SER A CB  1 
ATOM   3231  O  OG  . SER A 1 414 ? -16.371 35.825  85.275  1.00 37.36  ? 414 SER A OG  1 
ATOM   3232  N  N   . ASP A 1 415 ? -15.611 34.692  82.837  1.00 26.22  ? 415 ASP A N   1 
ATOM   3233  C  CA  . ASP A 1 415 ? -15.595 34.877  81.395  1.00 29.05  ? 415 ASP A CA  1 
ATOM   3234  C  C   . ASP A 1 415 ? -16.483 36.064  81.052  1.00 27.84  ? 415 ASP A C   1 
ATOM   3235  O  O   . ASP A 1 415 ? -17.197 36.587  81.913  1.00 28.49  ? 415 ASP A O   1 
ATOM   3236  C  CB  . ASP A 1 415 ? -16.012 33.599  80.637  1.00 30.50  ? 415 ASP A CB  1 
ATOM   3237  C  CG  . ASP A 1 415 ? -17.428 33.133  80.954  1.00 33.64  ? 415 ASP A CG  1 
ATOM   3238  O  OD1 . ASP A 1 415 ? -18.153 33.789  81.736  1.00 39.65  ? 415 ASP A OD1 1 
ATOM   3239  O  OD2 . ASP A 1 415 ? -17.817 32.083  80.401  1.00 33.95  ? 415 ASP A OD2 1 
ATOM   3240  N  N   . GLU A 1 416 ? -16.403 36.522  79.815  1.00 26.45  ? 416 GLU A N   1 
ATOM   3241  C  CA  . GLU A 1 416 ? -17.202 37.652  79.376  1.00 21.90  ? 416 GLU A CA  1 
ATOM   3242  C  C   . GLU A 1 416 ? -17.143 37.678  77.865  1.00 19.97  ? 416 GLU A C   1 
ATOM   3243  O  O   . GLU A 1 416 ? -16.310 36.996  77.254  1.00 18.94  ? 416 GLU A O   1 
ATOM   3244  C  CB  . GLU A 1 416 ? -16.638 38.950  79.951  1.00 22.06  ? 416 GLU A CB  1 
ATOM   3245  C  CG  . GLU A 1 416 ? -17.481 40.179  79.685  1.00 25.33  ? 416 GLU A CG  1 
ATOM   3246  C  CD  . GLU A 1 416 ? -18.826 40.121  80.374  1.00 28.97  ? 416 GLU A CD  1 
ATOM   3247  O  OE1 . GLU A 1 416 ? -18.868 40.359  81.600  1.00 33.40  ? 416 GLU A OE1 1 
ATOM   3248  O  OE2 . GLU A 1 416 ? -19.843 39.843  79.703  1.00 32.00  ? 416 GLU A OE2 1 
ATOM   3249  N  N   . TRP A 1 417 ? -18.090 38.387  77.265  1.00 20.74  ? 417 TRP A N   1 
ATOM   3250  C  CA  . TRP A 1 417 ? -18.135 38.526  75.819  1.00 22.85  ? 417 TRP A CA  1 
ATOM   3251  C  C   . TRP A 1 417 ? -18.510 39.970  75.505  1.00 21.15  ? 417 TRP A C   1 
ATOM   3252  O  O   . TRP A 1 417 ? -19.230 40.613  76.277  1.00 19.30  ? 417 TRP A O   1 
ATOM   3253  C  CB  . TRP A 1 417 ? -19.096 37.513  75.175  1.00 29.73  ? 417 TRP A CB  1 
ATOM   3254  C  CG  . TRP A 1 417 ? -20.525 37.793  75.384  1.00 40.06  ? 417 TRP A CG  1 
ATOM   3255  C  CD1 . TRP A 1 417 ? -21.250 37.537  76.505  1.00 47.16  ? 417 TRP A CD1 1 
ATOM   3256  C  CD2 . TRP A 1 417 ? -21.430 38.388  74.442  1.00 50.11  ? 417 TRP A CD2 1 
ATOM   3257  N  NE1 . TRP A 1 417 ? -22.557 37.938  76.326  1.00 53.53  ? 417 TRP A NE1 1 
ATOM   3258  C  CE2 . TRP A 1 417 ? -22.695 38.462  75.067  1.00 53.07  ? 417 TRP A CE2 1 
ATOM   3259  C  CE3 . TRP A 1 417 ? -21.295 38.866  73.128  1.00 53.27  ? 417 TRP A CE3 1 
ATOM   3260  C  CZ2 . TRP A 1 417 ? -23.822 38.995  74.425  1.00 55.38  ? 417 TRP A CZ2 1 
ATOM   3261  C  CZ3 . TRP A 1 417 ? -22.416 39.396  72.487  1.00 53.01  ? 417 TRP A CZ3 1 
ATOM   3262  C  CH2 . TRP A 1 417 ? -23.662 39.455  73.138  1.00 55.27  ? 417 TRP A CH2 1 
ATOM   3263  N  N   . THR A 1 418 ? -17.936 40.504  74.435  1.00 17.72  ? 418 THR A N   1 
ATOM   3264  C  CA  . THR A 1 418 ? -18.187 41.880  74.028  1.00 17.53  ? 418 THR A CA  1 
ATOM   3265  C  C   . THR A 1 418 ? -18.431 41.889  72.529  1.00 16.76  ? 418 THR A C   1 
ATOM   3266  O  O   . THR A 1 418 ? -18.202 40.893  71.841  1.00 17.52  ? 418 THR A O   1 
ATOM   3267  C  CB  . THR A 1 418 ? -16.964 42.751  74.293  1.00 15.73  ? 418 THR A CB  1 
ATOM   3268  O  OG1 . THR A 1 418 ? -15.830 42.147  73.664  1.00 20.03  ? 418 THR A OG1 1 
ATOM   3269  C  CG2 . THR A 1 418 ? -16.694 42.860  75.771  1.00 17.30  ? 418 THR A CG2 1 
ATOM   3270  N  N   . PHE A 1 419 ? -18.890 43.014  72.014  1.00 17.65  ? 419 PHE A N   1 
ATOM   3271  C  CA  . PHE A 1 419 ? -19.129 43.121  70.587  1.00 18.88  ? 419 PHE A CA  1 
ATOM   3272  C  C   . PHE A 1 419 ? -19.152 44.594  70.263  1.00 17.85  ? 419 PHE A C   1 
ATOM   3273  O  O   . PHE A 1 419 ? -19.320 45.423  71.158  1.00 17.85  ? 419 PHE A O   1 
ATOM   3274  C  CB  . PHE A 1 419 ? -20.456 42.445  70.198  1.00 21.46  ? 419 PHE A CB  1 
ATOM   3275  C  CG  . PHE A 1 419 ? -21.646 42.966  70.951  1.00 28.56  ? 419 PHE A CG  1 
ATOM   3276  C  CD1 . PHE A 1 419 ? -21.972 42.450  72.207  1.00 31.17  ? 419 PHE A CD1 1 
ATOM   3277  C  CD2 . PHE A 1 419 ? -22.424 43.995  70.425  1.00 31.58  ? 419 PHE A CD2 1 
ATOM   3278  C  CE1 . PHE A 1 419 ? -23.053 42.954  72.933  1.00 32.60  ? 419 PHE A CE1 1 
ATOM   3279  C  CE2 . PHE A 1 419 ? -23.513 44.511  71.140  1.00 32.86  ? 419 PHE A CE2 1 
ATOM   3280  C  CZ  . PHE A 1 419 ? -23.827 43.989  72.400  1.00 31.75  ? 419 PHE A CZ  1 
ATOM   3281  N  N   . GLY A 1 420 ? -18.924 44.923  69.000  1.00 18.69  ? 420 GLY A N   1 
ATOM   3282  C  CA  . GLY A 1 420 ? -18.946 46.311  68.591  1.00 15.82  ? 420 GLY A CA  1 
ATOM   3283  C  C   . GLY A 1 420 ? -18.423 46.518  67.189  1.00 14.64  ? 420 GLY A C   1 
ATOM   3284  O  O   . GLY A 1 420 ? -18.320 45.563  66.393  1.00 14.76  ? 420 GLY A O   1 
ATOM   3285  N  N   . ALA A 1 421 ? -18.133 47.777  66.879  1.00 12.23  ? 421 ALA A N   1 
ATOM   3286  C  CA  . ALA A 1 421 ? -17.594 48.168  65.585  1.00 10.96  ? 421 ALA A CA  1 
ATOM   3287  C  C   . ALA A 1 421 ? -16.316 48.956  65.835  1.00 11.57  ? 421 ALA A C   1 
ATOM   3288  O  O   . ALA A 1 421 ? -16.202 49.660  66.842  1.00 14.51  ? 421 ALA A O   1 
ATOM   3289  C  CB  . ALA A 1 421 ? -18.592 49.020  64.841  1.00 14.67  ? 421 ALA A CB  1 
ATOM   3290  N  N   . GLN A 1 422 ? -15.359 48.850  64.923  1.00 11.59  ? 422 GLN A N   1 
ATOM   3291  C  CA  . GLN A 1 422 ? -14.101 49.566  65.071  1.00 11.72  ? 422 GLN A CA  1 
ATOM   3292  C  C   . GLN A 1 422 ? -13.418 49.787  63.728  1.00 13.75  ? 422 GLN A C   1 
ATOM   3293  O  O   . GLN A 1 422 ? -13.602 49.001  62.809  1.00 15.71  ? 422 GLN A O   1 
ATOM   3294  C  CB  . GLN A 1 422 ? -13.148 48.756  65.949  1.00 7.55   ? 422 GLN A CB  1 
ATOM   3295  C  CG  . GLN A 1 422 ? -11.849 49.480  66.252  1.00 6.42   ? 422 GLN A CG  1 
ATOM   3296  C  CD  . GLN A 1 422 ? -10.698 48.538  66.473  1.00 10.20  ? 422 GLN A CD  1 
ATOM   3297  O  OE1 . GLN A 1 422 ? -10.654 47.460  65.895  1.00 15.82  ? 422 GLN A OE1 1 
ATOM   3298  N  NE2 . GLN A 1 422 ? -9.755  48.933  67.311  1.00 9.13   ? 422 GLN A NE2 1 
ATOM   3299  N  N   . MET A 1 423 ? -12.632 50.853  63.622  1.00 11.84  ? 423 MET A N   1 
ATOM   3300  C  CA  . MET A 1 423 ? -11.874 51.109  62.414  1.00 12.41  ? 423 MET A CA  1 
ATOM   3301  C  C   . MET A 1 423 ? -10.417 51.146  62.840  1.00 12.74  ? 423 MET A C   1 
ATOM   3302  O  O   . MET A 1 423 ? -10.126 51.423  63.994  1.00 17.49  ? 423 MET A O   1 
ATOM   3303  C  CB  . MET A 1 423 ? -12.263 52.451  61.789  1.00 9.11   ? 423 MET A CB  1 
ATOM   3304  C  CG  . MET A 1 423 ? -11.816 53.677  62.569  1.00 6.36   ? 423 MET A CG  1 
ATOM   3305  S  SD  . MET A 1 423 ? -10.081 54.105  62.362  1.00 12.79  ? 423 MET A SD  1 
ATOM   3306  C  CE  . MET A 1 423 ? -10.099 55.773  62.826  1.00 2.07   ? 423 MET A CE  1 
ATOM   3307  N  N   . GLU A 1 424 ? -9.518  50.762  61.946  1.00 14.60  ? 424 GLU A N   1 
ATOM   3308  C  CA  . GLU A 1 424 ? -8.095  50.827  62.207  1.00 11.72  ? 424 GLU A CA  1 
ATOM   3309  C  C   . GLU A 1 424 ? -7.468  51.235  60.894  1.00 13.77  ? 424 GLU A C   1 
ATOM   3310  O  O   . GLU A 1 424 ? -7.900  50.782  59.831  1.00 15.82  ? 424 GLU A O   1 
ATOM   3311  C  CB  . GLU A 1 424 ? -7.508  49.496  62.642  1.00 10.89  ? 424 GLU A CB  1 
ATOM   3312  C  CG  . GLU A 1 424 ? -6.001  49.595  62.814  1.00 9.48   ? 424 GLU A CG  1 
ATOM   3313  C  CD  . GLU A 1 424 ? -5.375  48.338  63.371  1.00 15.69  ? 424 GLU A CD  1 
ATOM   3314  O  OE1 . GLU A 1 424 ? -5.411  47.278  62.695  1.00 13.80  ? 424 GLU A OE1 1 
ATOM   3315  O  OE2 . GLU A 1 424 ? -4.821  48.418  64.491  1.00 15.24  ? 424 GLU A OE2 1 
ATOM   3316  N  N   . ILE A 1 425 ? -6.442  52.073  60.953  1.00 12.71  ? 425 ILE A N   1 
ATOM   3317  C  CA  . ILE A 1 425 ? -5.797  52.517  59.743  1.00 10.61  ? 425 ILE A CA  1 
ATOM   3318  C  C   . ILE A 1 425 ? -4.384  53.002  59.984  1.00 12.83  ? 425 ILE A C   1 
ATOM   3319  O  O   . ILE A 1 425 ? -4.068  53.466  61.064  1.00 18.07  ? 425 ILE A O   1 
ATOM   3320  C  CB  . ILE A 1 425 ? -6.596  53.717  59.133  1.00 9.30   ? 425 ILE A CB  1 
ATOM   3321  C  CG1 . ILE A 1 425 ? -5.994  54.154  57.785  1.00 10.44  ? 425 ILE A CG1 1 
ATOM   3322  C  CG2 . ILE A 1 425 ? -6.577  54.891  60.097  1.00 6.59   ? 425 ILE A CG2 1 
ATOM   3323  C  CD1 . ILE A 1 425 ? -6.593  55.444  57.213  1.00 5.65   ? 425 ILE A CD1 1 
ATOM   3324  N  N   . TRP A 1 426 ? -3.517  52.794  59.006  1.00 11.82  ? 426 TRP A N   1 
ATOM   3325  C  CA  . TRP A 1 426 ? -2.177  53.359  59.046  1.00 14.61  ? 426 TRP A CA  1 
ATOM   3326  C  C   . TRP A 1 426 ? -2.040  53.909  57.628  1.00 16.83  ? 426 TRP A C   1 
ATOM   3327  O  O   . TRP A 1 426 ? -2.629  53.365  56.676  1.00 17.04  ? 426 TRP A O   1 
ATOM   3328  C  CB  . TRP A 1 426 ? -1.049  52.392  59.469  1.00 14.25  ? 426 TRP A CB  1 
ATOM   3329  C  CG  . TRP A 1 426 ? -1.010  51.047  58.858  1.00 21.06  ? 426 TRP A CG  1 
ATOM   3330  C  CD1 . TRP A 1 426 ? -0.735  50.749  57.565  1.00 24.73  ? 426 TRP A CD1 1 
ATOM   3331  C  CD2 . TRP A 1 426 ? -1.218  49.792  59.525  1.00 24.17  ? 426 TRP A CD2 1 
ATOM   3332  N  NE1 . TRP A 1 426 ? -0.761  49.385  57.373  1.00 29.01  ? 426 TRP A NE1 1 
ATOM   3333  C  CE2 . TRP A 1 426 ? -1.055  48.772  58.560  1.00 24.87  ? 426 TRP A CE2 1 
ATOM   3334  C  CE3 . TRP A 1 426 ? -1.528  49.430  60.839  1.00 16.29  ? 426 TRP A CE3 1 
ATOM   3335  C  CZ2 . TRP A 1 426 ? -1.192  47.409  58.871  1.00 23.41  ? 426 TRP A CZ2 1 
ATOM   3336  C  CZ3 . TRP A 1 426 ? -1.665  48.080  61.146  1.00 18.29  ? 426 TRP A CZ3 1 
ATOM   3337  C  CH2 . TRP A 1 426 ? -1.498  47.087  60.168  1.00 22.13  ? 426 TRP A CH2 1 
ATOM   3338  N  N   . TRP A 1 427 ? -1.417  55.070  57.506  1.00 13.81  ? 427 TRP A N   1 
ATOM   3339  C  CA  . TRP A 1 427 ? -1.279  55.684  56.201  1.00 11.65  ? 427 TRP A CA  1 
ATOM   3340  C  C   . TRP A 1 427 ? 0.050   56.415  56.127  1.00 15.71  ? 427 TRP A C   1 
ATOM   3341  O  O   . TRP A 1 427 ? 0.306   57.000  55.066  1.00 20.77  ? 427 TRP A O   1 
ATOM   3342  C  CB  . TRP A 1 427 ? -2.451  56.651  55.951  1.00 8.80   ? 427 TRP A CB  1 
ATOM   3343  C  CG  . TRP A 1 427 ? -2.418  57.866  56.812  1.00 11.50  ? 427 TRP A CG  1 
ATOM   3344  C  CD1 . TRP A 1 427 ? -1.894  59.076  56.488  1.00 13.48  ? 427 TRP A CD1 1 
ATOM   3345  C  CD2 . TRP A 1 427 ? -2.847  57.963  58.177  1.00 14.61  ? 427 TRP A CD2 1 
ATOM   3346  N  NE1 . TRP A 1 427 ? -1.952  59.925  57.570  1.00 16.71  ? 427 TRP A NE1 1 
ATOM   3347  C  CE2 . TRP A 1 427 ? -2.529  59.266  58.623  1.00 16.91  ? 427 TRP A CE2 1 
ATOM   3348  C  CE3 . TRP A 1 427 ? -3.460  57.074  59.070  1.00 12.67  ? 427 TRP A CE3 1 
ATOM   3349  C  CZ2 . TRP A 1 427 ? -2.801  59.703  59.935  1.00 19.38  ? 427 TRP A CZ2 1 
ATOM   3350  C  CZ3 . TRP A 1 427 ? -3.731  57.506  60.367  1.00 13.56  ? 427 TRP A CZ3 1 
ATOM   3351  C  CH2 . TRP A 1 427 ? -3.399  58.809  60.789  1.00 16.28  ? 427 TRP A CH2 1 
ATOM   3352  O  OXT . TRP A 1 427 ? 0.813   56.398  57.121  1.00 18.90  ? 427 TRP A OXT 1 
ATOM   3353  N  N   . VAL B 1 1   ? -2.219  73.145  51.465  1.00 26.89  ? 1   VAL B N   1 
ATOM   3354  C  CA  . VAL B 1 1   ? -1.849  73.644  52.809  1.00 22.33  ? 1   VAL B CA  1 
ATOM   3355  C  C   . VAL B 1 1   ? -0.357  73.914  52.902  1.00 21.44  ? 1   VAL B C   1 
ATOM   3356  O  O   . VAL B 1 1   ? 0.450   73.131  52.404  1.00 22.86  ? 1   VAL B O   1 
ATOM   3357  C  CB  . VAL B 1 1   ? -2.276  72.647  53.913  1.00 21.13  ? 1   VAL B CB  1 
ATOM   3358  C  CG1 . VAL B 1 1   ? -1.619  71.300  53.720  1.00 21.49  ? 1   VAL B CG1 1 
ATOM   3359  C  CG2 . VAL B 1 1   ? -1.943  73.204  55.266  1.00 22.97  ? 1   VAL B CG2 1 
ATOM   3360  N  N   . ASP B 1 2   ? -0.005  75.059  53.483  1.00 18.39  ? 2   ASP B N   1 
ATOM   3361  C  CA  . ASP B 1 2   ? 1.387   75.446  53.683  1.00 15.59  ? 2   ASP B CA  1 
ATOM   3362  C  C   . ASP B 1 2   ? 1.812   74.950  55.056  1.00 13.76  ? 2   ASP B C   1 
ATOM   3363  O  O   . ASP B 1 2   ? 1.153   75.229  56.050  1.00 17.94  ? 2   ASP B O   1 
ATOM   3364  C  CB  . ASP B 1 2   ? 1.545   76.967  53.652  1.00 17.86  ? 2   ASP B CB  1 
ATOM   3365  C  CG  . ASP B 1 2   ? 1.095   77.582  52.343  1.00 23.41  ? 2   ASP B CG  1 
ATOM   3366  O  OD1 . ASP B 1 2   ? 1.100   76.886  51.300  1.00 30.32  ? 2   ASP B OD1 1 
ATOM   3367  O  OD2 . ASP B 1 2   ? 0.729   78.774  52.364  1.00 22.52  ? 2   ASP B OD2 1 
ATOM   3368  N  N   . PHE B 1 3   ? 2.915   74.224  55.101  1.00 13.16  ? 3   PHE B N   1 
ATOM   3369  C  CA  . PHE B 1 3   ? 3.441   73.670  56.329  1.00 12.56  ? 3   PHE B CA  1 
ATOM   3370  C  C   . PHE B 1 3   ? 4.741   74.410  56.618  1.00 14.83  ? 3   PHE B C   1 
ATOM   3371  O  O   . PHE B 1 3   ? 5.663   74.406  55.798  1.00 15.89  ? 3   PHE B O   1 
ATOM   3372  C  CB  . PHE B 1 3   ? 3.700   72.169  56.125  1.00 10.96  ? 3   PHE B CB  1 
ATOM   3373  C  CG  . PHE B 1 3   ? 4.293   71.472  57.320  1.00 14.59  ? 3   PHE B CG  1 
ATOM   3374  C  CD1 . PHE B 1 3   ? 3.813   71.709  58.603  1.00 13.78  ? 3   PHE B CD1 1 
ATOM   3375  C  CD2 . PHE B 1 3   ? 5.317   70.546  57.152  1.00 12.76  ? 3   PHE B CD2 1 
ATOM   3376  C  CE1 . PHE B 1 3   ? 4.344   71.029  59.695  1.00 12.22  ? 3   PHE B CE1 1 
ATOM   3377  C  CE2 . PHE B 1 3   ? 5.854   69.865  58.226  1.00 6.48   ? 3   PHE B CE2 1 
ATOM   3378  C  CZ  . PHE B 1 3   ? 5.363   70.108  59.508  1.00 9.12   ? 3   PHE B CZ  1 
ATOM   3379  N  N   . HIS B 1 4   ? 4.800   75.058  57.777  1.00 14.13  ? 4   HIS B N   1 
ATOM   3380  C  CA  . HIS B 1 4   ? 5.979   75.812  58.182  1.00 9.93   ? 4   HIS B CA  1 
ATOM   3381  C  C   . HIS B 1 4   ? 6.206   75.656  59.666  1.00 10.43  ? 4   HIS B C   1 
ATOM   3382  O  O   . HIS B 1 4   ? 5.357   75.128  60.360  1.00 11.38  ? 4   HIS B O   1 
ATOM   3383  C  CB  . HIS B 1 4   ? 5.781   77.289  57.876  1.00 10.76  ? 4   HIS B CB  1 
ATOM   3384  C  CG  . HIS B 1 4   ? 5.692   77.590  56.414  1.00 18.40  ? 4   HIS B CG  1 
ATOM   3385  N  ND1 . HIS B 1 4   ? 6.738   77.364  55.543  1.00 15.59  ? 4   HIS B ND1 1 
ATOM   3386  C  CD2 . HIS B 1 4   ? 4.682   78.096  55.665  1.00 16.41  ? 4   HIS B CD2 1 
ATOM   3387  C  CE1 . HIS B 1 4   ? 6.377   77.715  54.323  1.00 15.47  ? 4   HIS B CE1 1 
ATOM   3388  N  NE2 . HIS B 1 4   ? 5.134   78.163  54.370  1.00 17.31  ? 4   HIS B NE2 1 
ATOM   3389  N  N   . GLY B 1 5   ? 7.347   76.114  60.155  1.00 9.08   ? 5   GLY B N   1 
ATOM   3390  C  CA  . GLY B 1 5   ? 7.595   76.010  61.575  1.00 10.07  ? 5   GLY B CA  1 
ATOM   3391  C  C   . GLY B 1 5   ? 9.047   76.095  61.981  1.00 12.70  ? 5   GLY B C   1 
ATOM   3392  O  O   . GLY B 1 5   ? 9.890   76.598  61.241  1.00 14.23  ? 5   GLY B O   1 
ATOM   3393  N  N   . TYR B 1 6   ? 9.328   75.584  63.174  1.00 11.05  ? 6   TYR B N   1 
ATOM   3394  C  CA  . TYR B 1 6   ? 10.669  75.577  63.736  1.00 8.29   ? 6   TYR B CA  1 
ATOM   3395  C  C   . TYR B 1 6   ? 10.712  74.387  64.674  1.00 9.69   ? 6   TYR B C   1 
ATOM   3396  O  O   . TYR B 1 6   ? 9.697   74.007  65.251  1.00 16.14  ? 6   TYR B O   1 
ATOM   3397  C  CB  . TYR B 1 6   ? 10.930  76.866  64.534  1.00 6.67   ? 6   TYR B CB  1 
ATOM   3398  C  CG  . TYR B 1 6   ? 12.196  76.817  65.391  1.00 12.28  ? 6   TYR B CG  1 
ATOM   3399  C  CD1 . TYR B 1 6   ? 12.168  76.280  66.680  1.00 11.63  ? 6   TYR B CD1 1 
ATOM   3400  C  CD2 . TYR B 1 6   ? 13.432  77.203  64.873  1.00 9.45   ? 6   TYR B CD2 1 
ATOM   3401  C  CE1 . TYR B 1 6   ? 13.332  76.112  67.403  1.00 10.04  ? 6   TYR B CE1 1 
ATOM   3402  C  CE2 . TYR B 1 6   ? 14.593  77.043  65.594  1.00 7.98   ? 6   TYR B CE2 1 
ATOM   3403  C  CZ  . TYR B 1 6   ? 14.540  76.488  66.851  1.00 11.11  ? 6   TYR B CZ  1 
ATOM   3404  O  OH  . TYR B 1 6   ? 15.704  76.246  67.540  1.00 15.13  ? 6   TYR B OH  1 
ATOM   3405  N  N   . ALA B 1 7   ? 11.886  73.807  64.838  1.00 7.97   ? 7   ALA B N   1 
ATOM   3406  C  CA  . ALA B 1 7   ? 12.039  72.688  65.736  1.00 9.23   ? 7   ALA B CA  1 
ATOM   3407  C  C   . ALA B 1 7   ? 13.503  72.475  66.056  1.00 11.56  ? 7   ALA B C   1 
ATOM   3408  O  O   . ALA B 1 7   ? 14.373  72.822  65.246  1.00 13.11  ? 7   ALA B O   1 
ATOM   3409  C  CB  . ALA B 1 7   ? 11.447  71.432  65.138  1.00 6.75   ? 7   ALA B CB  1 
ATOM   3410  N  N   . ARG B 1 8   ? 13.769  72.059  67.296  1.00 8.57   ? 8   ARG B N   1 
ATOM   3411  C  CA  . ARG B 1 8   ? 15.117  71.714  67.724  1.00 6.82   ? 8   ARG B CA  1 
ATOM   3412  C  C   . ARG B 1 8   ? 14.929  70.515  68.637  1.00 9.21   ? 8   ARG B C   1 
ATOM   3413  O  O   . ARG B 1 8   ? 13.922  70.434  69.336  1.00 11.74  ? 8   ARG B O   1 
ATOM   3414  C  CB  . ARG B 1 8   ? 15.814  72.846  68.461  1.00 6.51   ? 8   ARG B CB  1 
ATOM   3415  C  CG  . ARG B 1 8   ? 15.159  73.298  69.735  1.00 11.15  ? 8   ARG B CG  1 
ATOM   3416  C  CD  . ARG B 1 8   ? 16.134  74.142  70.518  1.00 12.28  ? 8   ARG B CD  1 
ATOM   3417  N  NE  . ARG B 1 8   ? 15.486  74.812  71.630  1.00 8.58   ? 8   ARG B NE  1 
ATOM   3418  C  CZ  . ARG B 1 8   ? 14.850  75.974  71.525  1.00 13.40  ? 8   ARG B CZ  1 
ATOM   3419  N  NH1 . ARG B 1 8   ? 14.779  76.593  70.356  1.00 14.08  ? 8   ARG B NH1 1 
ATOM   3420  N  NH2 . ARG B 1 8   ? 14.282  76.517  72.587  1.00 13.93  ? 8   ARG B NH2 1 
ATOM   3421  N  N   . SER B 1 9   ? 15.833  69.546  68.553  1.00 5.54   ? 9   SER B N   1 
ATOM   3422  C  CA  . SER B 1 9   ? 15.763  68.356  69.383  1.00 7.34   ? 9   SER B CA  1 
ATOM   3423  C  C   . SER B 1 9   ? 17.143  67.707  69.375  1.00 10.41  ? 9   SER B C   1 
ATOM   3424  O  O   . SER B 1 9   ? 17.835  67.770  68.368  1.00 17.35  ? 9   SER B O   1 
ATOM   3425  C  CB  . SER B 1 9   ? 14.721  67.394  68.807  1.00 7.03   ? 9   SER B CB  1 
ATOM   3426  O  OG  . SER B 1 9   ? 14.517  66.288  69.661  1.00 12.83  ? 9   SER B OG  1 
ATOM   3427  N  N   . GLY B 1 10  ? 17.562  67.128  70.495  1.00 13.54  ? 10  GLY B N   1 
ATOM   3428  C  CA  . GLY B 1 10  ? 18.861  66.478  70.548  1.00 11.36  ? 10  GLY B CA  1 
ATOM   3429  C  C   . GLY B 1 10  ? 19.044  65.611  71.780  1.00 14.26  ? 10  GLY B C   1 
ATOM   3430  O  O   . GLY B 1 10  ? 18.070  65.303  72.473  1.00 14.03  ? 10  GLY B O   1 
ATOM   3431  N  N   . ILE B 1 11  ? 20.276  65.167  72.020  1.00 13.74  ? 11  ILE B N   1 
ATOM   3432  C  CA  . ILE B 1 11  ? 20.611  64.353  73.179  1.00 11.70  ? 11  ILE B CA  1 
ATOM   3433  C  C   . ILE B 1 11  ? 21.970  64.863  73.635  1.00 14.79  ? 11  ILE B C   1 
ATOM   3434  O  O   . ILE B 1 11  ? 22.817  65.177  72.799  1.00 14.22  ? 11  ILE B O   1 
ATOM   3435  C  CB  . ILE B 1 11  ? 20.688  62.855  72.824  1.00 12.33  ? 11  ILE B CB  1 
ATOM   3436  C  CG1 . ILE B 1 11  ? 21.034  62.044  74.062  1.00 8.66   ? 11  ILE B CG1 1 
ATOM   3437  C  CG2 . ILE B 1 11  ? 21.720  62.597  71.730  1.00 9.60   ? 11  ILE B CG2 1 
ATOM   3438  C  CD1 . ILE B 1 11  ? 20.939  60.545  73.835  1.00 5.37   ? 11  ILE B CD1 1 
ATOM   3439  N  N   . GLY B 1 12  ? 22.170  64.996  74.942  1.00 14.42  ? 12  GLY B N   1 
ATOM   3440  C  CA  . GLY B 1 12  ? 23.441  65.497  75.433  1.00 17.22  ? 12  GLY B CA  1 
ATOM   3441  C  C   . GLY B 1 12  ? 23.889  64.897  76.752  1.00 18.55  ? 12  GLY B C   1 
ATOM   3442  O  O   . GLY B 1 12  ? 23.099  64.272  77.457  1.00 16.83  ? 12  GLY B O   1 
ATOM   3443  N  N   . TRP B 1 13  ? 25.161  65.103  77.084  1.00 16.83  ? 13  TRP B N   1 
ATOM   3444  C  CA  . TRP B 1 13  ? 25.749  64.594  78.312  1.00 15.83  ? 13  TRP B CA  1 
ATOM   3445  C  C   . TRP B 1 13  ? 26.575  65.681  79.000  1.00 19.14  ? 13  TRP B C   1 
ATOM   3446  O  O   . TRP B 1 13  ? 27.136  66.572  78.332  1.00 20.38  ? 13  TRP B O   1 
ATOM   3447  C  CB  . TRP B 1 13  ? 26.673  63.414  78.010  1.00 15.12  ? 13  TRP B CB  1 
ATOM   3448  C  CG  . TRP B 1 13  ? 25.984  62.220  77.469  1.00 15.59  ? 13  TRP B CG  1 
ATOM   3449  C  CD1 . TRP B 1 13  ? 25.469  61.187  78.186  1.00 16.01  ? 13  TRP B CD1 1 
ATOM   3450  C  CD2 . TRP B 1 13  ? 25.694  61.941  76.096  1.00 16.72  ? 13  TRP B CD2 1 
ATOM   3451  N  NE1 . TRP B 1 13  ? 24.865  60.285  77.346  1.00 17.52  ? 13  TRP B NE1 1 
ATOM   3452  C  CE2 . TRP B 1 13  ? 24.991  60.726  76.057  1.00 17.94  ? 13  TRP B CE2 1 
ATOM   3453  C  CE3 . TRP B 1 13  ? 25.959  62.603  74.891  1.00 18.69  ? 13  TRP B CE3 1 
ATOM   3454  C  CZ2 . TRP B 1 13  ? 24.546  60.157  74.865  1.00 18.23  ? 13  TRP B CZ2 1 
ATOM   3455  C  CZ3 . TRP B 1 13  ? 25.514  62.032  73.703  1.00 14.83  ? 13  TRP B CZ3 1 
ATOM   3456  C  CH2 . TRP B 1 13  ? 24.818  60.825  73.704  1.00 15.79  ? 13  TRP B CH2 1 
ATOM   3457  N  N   . THR B 1 14  ? 26.608  65.643  80.333  1.00 20.77  ? 14  THR B N   1 
ATOM   3458  C  CA  . THR B 1 14  ? 27.399  66.603  81.099  1.00 18.19  ? 14  THR B CA  1 
ATOM   3459  C  C   . THR B 1 14  ? 28.686  65.884  81.435  1.00 18.22  ? 14  THR B C   1 
ATOM   3460  O  O   . THR B 1 14  ? 28.660  64.714  81.804  1.00 18.97  ? 14  THR B O   1 
ATOM   3461  C  CB  . THR B 1 14  ? 26.699  67.006  82.376  1.00 19.20  ? 14  THR B CB  1 
ATOM   3462  O  OG1 . THR B 1 14  ? 25.528  67.756  82.045  1.00 20.54  ? 14  THR B OG1 1 
ATOM   3463  C  CG2 . THR B 1 14  ? 27.609  67.858  83.224  1.00 18.39  ? 14  THR B CG2 1 
ATOM   3464  N  N   . GLY B 1 15  ? 29.810  66.559  81.255  1.00 19.14  ? 15  GLY B N   1 
ATOM   3465  C  CA  . GLY B 1 15  ? 31.090  65.942  81.529  1.00 18.72  ? 15  GLY B CA  1 
ATOM   3466  C  C   . GLY B 1 15  ? 31.194  65.235  82.870  1.00 22.42  ? 15  GLY B C   1 
ATOM   3467  O  O   . GLY B 1 15  ? 31.731  64.134  82.959  1.00 26.33  ? 15  GLY B O   1 
ATOM   3468  N  N   . SER B 1 16  ? 30.674  65.858  83.919  1.00 24.79  ? 16  SER B N   1 
ATOM   3469  C  CA  . SER B 1 16  ? 30.733  65.278  85.251  1.00 23.32  ? 16  SER B CA  1 
ATOM   3470  C  C   . SER B 1 16  ? 29.690  64.205  85.534  1.00 25.71  ? 16  SER B C   1 
ATOM   3471  O  O   . SER B 1 16  ? 29.730  63.577  86.585  1.00 31.02  ? 16  SER B O   1 
ATOM   3472  C  CB  . SER B 1 16  ? 30.645  66.379  86.305  1.00 22.55  ? 16  SER B CB  1 
ATOM   3473  O  OG  . SER B 1 16  ? 29.455  67.136  86.166  1.00 24.34  ? 16  SER B OG  1 
ATOM   3474  N  N   . GLY B 1 17  ? 28.723  64.032  84.637  1.00 27.12  ? 17  GLY B N   1 
ATOM   3475  C  CA  . GLY B 1 17  ? 27.711  63.008  84.844  1.00 20.73  ? 17  GLY B CA  1 
ATOM   3476  C  C   . GLY B 1 17  ? 26.290  63.401  84.482  1.00 20.88  ? 17  GLY B C   1 
ATOM   3477  O  O   . GLY B 1 17  ? 25.903  64.580  84.555  1.00 22.64  ? 17  GLY B O   1 
ATOM   3478  N  N   . GLY B 1 18  ? 25.524  62.397  84.065  1.00 19.53  ? 18  GLY B N   1 
ATOM   3479  C  CA  . GLY B 1 18  ? 24.134  62.589  83.704  1.00 18.57  ? 18  GLY B CA  1 
ATOM   3480  C  C   . GLY B 1 18  ? 23.859  63.348  82.428  1.00 17.49  ? 18  GLY B C   1 
ATOM   3481  O  O   . GLY B 1 18  ? 24.757  63.593  81.632  1.00 15.75  ? 18  GLY B O   1 
ATOM   3482  N  N   . GLU B 1 19  ? 22.588  63.696  82.249  1.00 16.94  ? 19  GLU B N   1 
ATOM   3483  C  CA  . GLU B 1 19  ? 22.094  64.440  81.096  1.00 19.77  ? 19  GLU B CA  1 
ATOM   3484  C  C   . GLU B 1 19  ? 22.846  65.736  80.940  1.00 22.42  ? 19  GLU B C   1 
ATOM   3485  O  O   . GLU B 1 19  ? 23.502  66.192  81.871  1.00 25.07  ? 19  GLU B O   1 
ATOM   3486  C  CB  . GLU B 1 19  ? 20.626  64.855  81.274  1.00 19.29  ? 19  GLU B CB  1 
ATOM   3487  C  CG  . GLU B 1 19  ? 19.796  64.012  82.192  1.00 32.07  ? 19  GLU B CG  1 
ATOM   3488  C  CD  . GLU B 1 19  ? 19.955  64.391  83.638  1.00 26.89  ? 19  GLU B CD  1 
ATOM   3489  O  OE1 . GLU B 1 19  ? 19.486  65.470  84.050  1.00 26.95  ? 19  GLU B OE1 1 
ATOM   3490  O  OE2 . GLU B 1 19  ? 20.537  63.579  84.366  1.00 29.08  ? 19  GLU B OE2 1 
ATOM   3491  N  N   . GLN B 1 20  ? 22.655  66.365  79.783  1.00 22.34  ? 20  GLN B N   1 
ATOM   3492  C  CA  . GLN B 1 20  ? 23.259  67.647  79.452  1.00 20.06  ? 20  GLN B CA  1 
ATOM   3493  C  C   . GLN B 1 20  ? 22.641  68.711  80.345  1.00 21.51  ? 20  GLN B C   1 
ATOM   3494  O  O   . GLN B 1 20  ? 21.482  68.602  80.732  1.00 23.24  ? 20  GLN B O   1 
ATOM   3495  C  CB  . GLN B 1 20  ? 22.967  67.984  77.984  1.00 17.92  ? 20  GLN B CB  1 
ATOM   3496  C  CG  . GLN B 1 20  ? 23.400  69.375  77.530  1.00 15.33  ? 20  GLN B CG  1 
ATOM   3497  C  CD  . GLN B 1 20  ? 23.022  69.667  76.088  1.00 15.59  ? 20  GLN B CD  1 
ATOM   3498  O  OE1 . GLN B 1 20  ? 22.299  68.897  75.451  1.00 21.60  ? 20  GLN B OE1 1 
ATOM   3499  N  NE2 . GLN B 1 20  ? 23.507  70.777  75.569  1.00 10.76  ? 20  GLN B NE2 1 
ATOM   3500  N  N   . GLN B 1 21  ? 23.431  69.725  80.683  1.00 22.94  ? 21  GLN B N   1 
ATOM   3501  C  CA  . GLN B 1 21  ? 22.972  70.836  81.504  1.00 20.48  ? 21  GLN B CA  1 
ATOM   3502  C  C   . GLN B 1 21  ? 23.254  72.075  80.691  1.00 20.26  ? 21  GLN B C   1 
ATOM   3503  O  O   . GLN B 1 21  ? 24.240  72.113  79.955  1.00 22.48  ? 21  GLN B O   1 
ATOM   3504  C  CB  . GLN B 1 21  ? 23.746  70.886  82.813  1.00 24.20  ? 21  GLN B CB  1 
ATOM   3505  C  CG  . GLN B 1 21  ? 23.297  69.852  83.820  1.00 33.06  ? 21  GLN B CG  1 
ATOM   3506  C  CD  . GLN B 1 21  ? 24.190  69.820  85.033  1.00 38.27  ? 21  GLN B CD  1 
ATOM   3507  O  OE1 . GLN B 1 21  ? 24.645  70.862  85.509  1.00 44.22  ? 21  GLN B OE1 1 
ATOM   3508  N  NE2 . GLN B 1 21  ? 24.461  68.623  85.538  1.00 39.63  ? 21  GLN B NE2 1 
ATOM   3509  N  N   . CYS B 1 22  ? 22.398  73.081  80.813  1.00 16.99  ? 22  CYS B N   1 
ATOM   3510  C  CA  . CYS B 1 22  ? 22.567  74.299  80.056  1.00 16.10  ? 22  CYS B CA  1 
ATOM   3511  C  C   . CYS B 1 22  ? 22.987  75.445  80.950  1.00 18.81  ? 22  CYS B C   1 
ATOM   3512  O  O   . CYS B 1 22  ? 22.505  75.577  82.074  1.00 23.53  ? 22  CYS B O   1 
ATOM   3513  C  CB  . CYS B 1 22  ? 21.292  74.580  79.280  1.00 17.97  ? 22  CYS B CB  1 
ATOM   3514  S  SG  . CYS B 1 22  ? 21.133  73.427  77.870  1.00 17.19  ? 22  CYS B SG  1 
ATOM   3515  N  N   . PHE B 1 23  ? 23.855  76.300  80.432  1.00 18.43  ? 23  PHE B N   1 
ATOM   3516  C  CA  . PHE B 1 23  ? 24.418  77.384  81.209  1.00 15.27  ? 23  PHE B CA  1 
ATOM   3517  C  C   . PHE B 1 23  ? 23.983  78.796  80.880  1.00 16.65  ? 23  PHE B C   1 
ATOM   3518  O  O   . PHE B 1 23  ? 24.265  79.298  79.792  1.00 18.90  ? 23  PHE B O   1 
ATOM   3519  C  CB  . PHE B 1 23  ? 25.940  77.290  81.106  1.00 14.06  ? 23  PHE B CB  1 
ATOM   3520  C  CG  . PHE B 1 23  ? 26.454  75.876  81.192  1.00 18.86  ? 23  PHE B CG  1 
ATOM   3521  C  CD1 . PHE B 1 23  ? 26.401  75.176  82.390  1.00 16.59  ? 23  PHE B CD1 1 
ATOM   3522  C  CD2 . PHE B 1 23  ? 26.930  75.223  80.062  1.00 15.57  ? 23  PHE B CD2 1 
ATOM   3523  C  CE1 . PHE B 1 23  ? 26.811  73.837  82.459  1.00 19.09  ? 23  PHE B CE1 1 
ATOM   3524  C  CE2 . PHE B 1 23  ? 27.340  73.887  80.125  1.00 15.79  ? 23  PHE B CE2 1 
ATOM   3525  C  CZ  . PHE B 1 23  ? 27.279  73.194  81.322  1.00 14.31  ? 23  PHE B CZ  1 
ATOM   3526  N  N   . GLN B 1 24  ? 23.358  79.452  81.860  1.00 17.50  ? 24  GLN B N   1 
ATOM   3527  C  CA  . GLN B 1 24  ? 22.915  80.843  81.736  1.00 18.86  ? 24  GLN B CA  1 
ATOM   3528  C  C   . GLN B 1 24  ? 23.308  81.638  82.986  1.00 20.62  ? 24  GLN B C   1 
ATOM   3529  O  O   . GLN B 1 24  ? 23.077  81.185  84.109  1.00 23.60  ? 24  GLN B O   1 
ATOM   3530  C  CB  . GLN B 1 24  ? 21.401  80.920  81.545  1.00 14.13  ? 24  GLN B CB  1 
ATOM   3531  C  CG  . GLN B 1 24  ? 20.861  82.349  81.427  1.00 16.52  ? 24  GLN B CG  1 
ATOM   3532  C  CD  . GLN B 1 24  ? 19.411  82.380  80.987  1.00 19.34  ? 24  GLN B CD  1 
ATOM   3533  O  OE1 . GLN B 1 24  ? 18.857  81.371  80.554  1.00 27.16  ? 24  GLN B OE1 1 
ATOM   3534  N  NE2 . GLN B 1 24  ? 18.790  83.539  81.089  1.00 24.20  ? 24  GLN B NE2 1 
ATOM   3535  N  N   . ALA B 1 25  ? 23.883  82.822  82.791  1.00 19.69  ? 25  ALA B N   1 
ATOM   3536  C  CA  . ALA B 1 25  ? 24.296  83.662  83.912  1.00 17.37  ? 25  ALA B CA  1 
ATOM   3537  C  C   . ALA B 1 25  ? 23.089  84.182  84.677  1.00 19.36  ? 25  ALA B C   1 
ATOM   3538  O  O   . ALA B 1 25  ? 22.161  84.728  84.066  1.00 21.92  ? 25  ALA B O   1 
ATOM   3539  C  CB  . ALA B 1 25  ? 25.137  84.839  83.419  1.00 16.86  ? 25  ALA B CB  1 
ATOM   3540  N  N   . THR B 1 26  ? 23.097  84.000  86.002  1.00 19.71  ? 26  THR B N   1 
ATOM   3541  C  CA  . THR B 1 26  ? 22.021  84.484  86.873  1.00 18.63  ? 26  THR B CA  1 
ATOM   3542  C  C   . THR B 1 26  ? 21.908  85.993  86.666  1.00 19.92  ? 26  THR B C   1 
ATOM   3543  O  O   . THR B 1 26  ? 22.905  86.723  86.730  1.00 18.62  ? 26  THR B O   1 
ATOM   3544  C  CB  . THR B 1 26  ? 22.322  84.172  88.360  1.00 18.82  ? 26  THR B CB  1 
ATOM   3545  O  OG1 . THR B 1 26  ? 22.482  82.756  88.521  1.00 19.81  ? 26  THR B OG1 1 
ATOM   3546  C  CG2 . THR B 1 26  ? 21.198  84.642  89.252  1.00 18.73  ? 26  THR B CG2 1 
ATOM   3547  N  N   . GLY B 1 27  ? 20.709  86.443  86.322  1.00 21.75  ? 27  GLY B N   1 
ATOM   3548  C  CA  . GLY B 1 27  ? 20.494  87.855  86.090  1.00 18.92  ? 27  GLY B CA  1 
ATOM   3549  C  C   . GLY B 1 27  ? 20.419  88.198  84.617  1.00 22.10  ? 27  GLY B C   1 
ATOM   3550  O  O   . GLY B 1 27  ? 19.860  89.231  84.260  1.00 24.97  ? 27  GLY B O   1 
ATOM   3551  N  N   . ALA B 1 28  ? 20.989  87.352  83.762  1.00 21.41  ? 28  ALA B N   1 
ATOM   3552  C  CA  . ALA B 1 28  ? 20.978  87.589  82.322  1.00 17.34  ? 28  ALA B CA  1 
ATOM   3553  C  C   . ALA B 1 28  ? 19.666  87.086  81.755  1.00 17.83  ? 28  ALA B C   1 
ATOM   3554  O  O   . ALA B 1 28  ? 19.142  86.079  82.212  1.00 20.66  ? 28  ALA B O   1 
ATOM   3555  C  CB  . ALA B 1 28  ? 22.159  86.879  81.658  1.00 11.32  ? 28  ALA B CB  1 
ATOM   3556  N  N   . GLN B 1 29  ? 19.128  87.798  80.773  1.00 18.07  ? 29  GLN B N   1 
ATOM   3557  C  CA  . GLN B 1 29  ? 17.867  87.407  80.152  1.00 17.68  ? 29  GLN B CA  1 
ATOM   3558  C  C   . GLN B 1 29  ? 18.007  86.431  78.977  1.00 19.42  ? 29  GLN B C   1 
ATOM   3559  O  O   . GLN B 1 29  ? 17.025  86.139  78.307  1.00 20.77  ? 29  GLN B O   1 
ATOM   3560  C  CB  . GLN B 1 29  ? 17.101  88.642  79.690  1.00 18.40  ? 29  GLN B CB  1 
ATOM   3561  C  CG  . GLN B 1 29  ? 16.635  89.530  80.798  1.00 18.63  ? 29  GLN B CG  1 
ATOM   3562  C  CD  . GLN B 1 29  ? 15.797  90.689  80.308  1.00 24.71  ? 29  GLN B CD  1 
ATOM   3563  O  OE1 . GLN B 1 29  ? 15.814  91.036  79.130  1.00 31.47  ? 29  GLN B OE1 1 
ATOM   3564  N  NE2 . GLN B 1 29  ? 15.084  91.317  81.219  1.00 30.23  ? 29  GLN B NE2 1 
ATOM   3565  N  N   . SER B 1 30  ? 19.213  85.920  78.736  1.00 18.90  ? 30  SER B N   1 
ATOM   3566  C  CA  . SER B 1 30  ? 19.438  84.985  77.640  1.00 17.70  ? 30  SER B CA  1 
ATOM   3567  C  C   . SER B 1 30  ? 20.741  84.222  77.847  1.00 17.64  ? 30  SER B C   1 
ATOM   3568  O  O   . SER B 1 30  ? 21.441  84.423  78.838  1.00 19.15  ? 30  SER B O   1 
ATOM   3569  C  CB  . SER B 1 30  ? 19.532  85.750  76.321  1.00 17.83  ? 30  SER B CB  1 
ATOM   3570  O  OG  . SER B 1 30  ? 20.716  86.536  76.307  1.00 15.61  ? 30  SER B OG  1 
ATOM   3571  N  N   . LYS B 1 31  ? 21.062  83.358  76.897  1.00 13.73  ? 31  LYS B N   1 
ATOM   3572  C  CA  . LYS B 1 31  ? 22.288  82.592  76.934  1.00 13.33  ? 31  LYS B CA  1 
ATOM   3573  C  C   . LYS B 1 31  ? 22.718  82.311  75.506  1.00 17.94  ? 31  LYS B C   1 
ATOM   3574  O  O   . LYS B 1 31  ? 21.935  82.466  74.558  1.00 21.66  ? 31  LYS B O   1 
ATOM   3575  C  CB  . LYS B 1 31  ? 22.109  81.273  77.690  1.00 12.16  ? 31  LYS B CB  1 
ATOM   3576  C  CG  . LYS B 1 31  ? 20.994  80.353  77.182  1.00 10.41  ? 31  LYS B CG  1 
ATOM   3577  C  CD  . LYS B 1 31  ? 21.020  78.999  77.940  1.00 8.93   ? 31  LYS B CD  1 
ATOM   3578  C  CE  . LYS B 1 31  ? 19.672  78.272  77.867  1.00 7.91   ? 31  LYS B CE  1 
ATOM   3579  N  NZ  . LYS B 1 31  ? 19.411  77.780  76.498  1.00 10.32  ? 31  LYS B NZ  1 
ATOM   3580  N  N   . TYR B 1 32  ? 23.986  81.962  75.344  1.00 18.27  ? 32  TYR B N   1 
ATOM   3581  C  CA  . TYR B 1 32  ? 24.526  81.640  74.039  1.00 14.27  ? 32  TYR B CA  1 
ATOM   3582  C  C   . TYR B 1 32  ? 24.084  80.201  73.771  1.00 16.96  ? 32  TYR B C   1 
ATOM   3583  O  O   . TYR B 1 32  ? 24.469  79.267  74.475  1.00 17.95  ? 32  TYR B O   1 
ATOM   3584  C  CB  . TYR B 1 32  ? 26.039  81.868  74.045  1.00 17.09  ? 32  TYR B CB  1 
ATOM   3585  C  CG  . TYR B 1 32  ? 26.361  83.351  74.026  1.00 16.21  ? 32  TYR B CG  1 
ATOM   3586  C  CD1 . TYR B 1 32  ? 26.422  84.092  75.205  1.00 16.94  ? 32  TYR B CD1 1 
ATOM   3587  C  CD2 . TYR B 1 32  ? 26.468  84.035  72.818  1.00 13.83  ? 32  TYR B CD2 1 
ATOM   3588  C  CE1 . TYR B 1 32  ? 26.567  85.488  75.176  1.00 16.89  ? 32  TYR B CE1 1 
ATOM   3589  C  CE2 . TYR B 1 32  ? 26.613  85.413  72.777  1.00 14.91  ? 32  TYR B CE2 1 
ATOM   3590  C  CZ  . TYR B 1 32  ? 26.658  86.138  73.956  1.00 16.63  ? 32  TYR B CZ  1 
ATOM   3591  O  OH  . TYR B 1 32  ? 26.765  87.509  73.898  1.00 17.80  ? 32  TYR B OH  1 
ATOM   3592  N  N   . ARG B 1 33  ? 23.215  80.049  72.775  1.00 14.28  ? 33  ARG B N   1 
ATOM   3593  C  CA  . ARG B 1 33  ? 22.609  78.768  72.458  1.00 13.01  ? 33  ARG B CA  1 
ATOM   3594  C  C   . ARG B 1 33  ? 23.351  77.599  71.840  1.00 14.75  ? 33  ARG B C   1 
ATOM   3595  O  O   . ARG B 1 33  ? 23.033  76.467  72.173  1.00 16.42  ? 33  ARG B O   1 
ATOM   3596  C  CB  . ARG B 1 33  ? 21.315  78.988  71.702  1.00 15.64  ? 33  ARG B CB  1 
ATOM   3597  C  CG  . ARG B 1 33  ? 21.487  79.530  70.309  1.00 14.32  ? 33  ARG B CG  1 
ATOM   3598  C  CD  . ARG B 1 33  ? 20.337  79.026  69.484  1.00 16.41  ? 33  ARG B CD  1 
ATOM   3599  N  NE  . ARG B 1 33  ? 19.382  80.060  69.141  1.00 11.47  ? 33  ARG B NE  1 
ATOM   3600  C  CZ  . ARG B 1 33  ? 18.085  79.847  68.966  1.00 12.10  ? 33  ARG B CZ  1 
ATOM   3601  N  NH1 . ARG B 1 33  ? 17.565  78.641  69.115  1.00 4.07   ? 33  ARG B NH1 1 
ATOM   3602  N  NH2 . ARG B 1 33  ? 17.325  80.836  68.540  1.00 13.23  ? 33  ARG B NH2 1 
ATOM   3603  N  N   . LEU B 1 34  ? 24.324  77.829  70.963  1.00 15.69  ? 34  LEU B N   1 
ATOM   3604  C  CA  . LEU B 1 34  ? 25.024  76.700  70.341  1.00 17.24  ? 34  LEU B CA  1 
ATOM   3605  C  C   . LEU B 1 34  ? 25.472  75.671  71.380  1.00 19.92  ? 34  LEU B C   1 
ATOM   3606  O  O   . LEU B 1 34  ? 26.250  75.985  72.269  1.00 24.83  ? 34  LEU B O   1 
ATOM   3607  C  CB  . LEU B 1 34  ? 26.242  77.164  69.536  1.00 17.79  ? 34  LEU B CB  1 
ATOM   3608  C  CG  . LEU B 1 34  ? 26.538  76.632  68.118  1.00 19.62  ? 34  LEU B CG  1 
ATOM   3609  C  CD1 . LEU B 1 34  ? 28.007  76.259  68.026  1.00 16.27  ? 34  LEU B CD1 1 
ATOM   3610  C  CD2 . LEU B 1 34  ? 25.675  75.449  67.734  1.00 10.69  ? 34  LEU B CD2 1 
ATOM   3611  N  N   . GLY B 1 35  ? 24.963  74.452  71.261  1.00 18.66  ? 35  GLY B N   1 
ATOM   3612  C  CA  . GLY B 1 35  ? 25.318  73.386  72.176  1.00 19.70  ? 35  GLY B CA  1 
ATOM   3613  C  C   . GLY B 1 35  ? 25.013  73.779  73.603  1.00 20.32  ? 35  GLY B C   1 
ATOM   3614  O  O   . GLY B 1 35  ? 25.728  73.421  74.533  1.00 21.28  ? 35  GLY B O   1 
ATOM   3615  N  N   . ASN B 1 36  ? 23.911  74.479  73.781  1.00 18.58  ? 36  ASN B N   1 
ATOM   3616  C  CA  . ASN B 1 36  ? 23.543  74.953  75.100  1.00 15.75  ? 36  ASN B CA  1 
ATOM   3617  C  C   . ASN B 1 36  ? 22.025  75.089  75.152  1.00 15.12  ? 36  ASN B C   1 
ATOM   3618  O  O   . ASN B 1 36  ? 21.488  76.057  75.702  1.00 17.25  ? 36  ASN B O   1 
ATOM   3619  C  CB  . ASN B 1 36  ? 24.234  76.301  75.347  1.00 13.70  ? 36  ASN B CB  1 
ATOM   3620  C  CG  . ASN B 1 36  ? 24.255  76.696  76.798  1.00 15.61  ? 36  ASN B CG  1 
ATOM   3621  O  OD1 . ASN B 1 36  ? 24.203  75.841  77.690  1.00 13.41  ? 36  ASN B OD1 1 
ATOM   3622  N  ND2 . ASN B 1 36  ? 24.340  77.998  77.051  1.00 8.92   ? 36  ASN B ND2 1 
ATOM   3623  N  N   . GLU B 1 37  ? 21.347  74.128  74.521  1.00 12.49  ? 37  GLU B N   1 
ATOM   3624  C  CA  . GLU B 1 37  ? 19.889  74.065  74.488  1.00 8.71   ? 37  GLU B CA  1 
ATOM   3625  C  C   . GLU B 1 37  ? 19.534  72.690  75.045  1.00 9.97   ? 37  GLU B C   1 
ATOM   3626  O  O   . GLU B 1 37  ? 20.061  71.680  74.602  1.00 14.42  ? 37  GLU B O   1 
ATOM   3627  C  CB  . GLU B 1 37  ? 19.380  74.271  73.068  1.00 9.24   ? 37  GLU B CB  1 
ATOM   3628  C  CG  . GLU B 1 37  ? 19.530  75.707  72.625  1.00 10.60  ? 37  GLU B CG  1 
ATOM   3629  C  CD  . GLU B 1 37  ? 19.273  75.910  71.151  1.00 15.00  ? 37  GLU B CD  1 
ATOM   3630  O  OE1 . GLU B 1 37  ? 19.803  75.127  70.344  1.00 11.68  ? 37  GLU B OE1 1 
ATOM   3631  O  OE2 . GLU B 1 37  ? 18.559  76.873  70.797  1.00 15.35  ? 37  GLU B OE2 1 
ATOM   3632  N  N   . CYS B 1 38  ? 18.650  72.668  76.036  1.00 14.22  ? 38  CYS B N   1 
ATOM   3633  C  CA  . CYS B 1 38  ? 18.292  71.436  76.738  1.00 16.02  ? 38  CYS B CA  1 
ATOM   3634  C  C   . CYS B 1 38  ? 16.846  70.931  76.616  1.00 17.73  ? 38  CYS B C   1 
ATOM   3635  O  O   . CYS B 1 38  ? 16.381  70.157  77.453  1.00 21.83  ? 38  CYS B O   1 
ATOM   3636  C  CB  . CYS B 1 38  ? 18.663  71.602  78.225  1.00 13.37  ? 38  CYS B CB  1 
ATOM   3637  S  SG  . CYS B 1 38  ? 20.457  71.649  78.596  1.00 14.05  ? 38  CYS B SG  1 
ATOM   3638  N  N   . GLU B 1 39  ? 16.125  71.373  75.596  1.00 16.52  ? 39  GLU B N   1 
ATOM   3639  C  CA  . GLU B 1 39  ? 14.767  70.904  75.404  1.00 14.49  ? 39  GLU B CA  1 
ATOM   3640  C  C   . GLU B 1 39  ? 14.467  70.724  73.922  1.00 16.78  ? 39  GLU B C   1 
ATOM   3641  O  O   . GLU B 1 39  ? 15.215  71.201  73.060  1.00 16.83  ? 39  GLU B O   1 
ATOM   3642  C  CB  . GLU B 1 39  ? 13.772  71.898  75.987  1.00 12.54  ? 39  GLU B CB  1 
ATOM   3643  C  CG  . GLU B 1 39  ? 13.709  73.235  75.250  1.00 11.75  ? 39  GLU B CG  1 
ATOM   3644  C  CD  . GLU B 1 39  ? 14.910  74.144  75.519  1.00 23.74  ? 39  GLU B CD  1 
ATOM   3645  O  OE1 . GLU B 1 39  ? 15.251  74.364  76.705  1.00 27.39  ? 39  GLU B OE1 1 
ATOM   3646  O  OE2 . GLU B 1 39  ? 15.495  74.671  74.544  1.00 24.02  ? 39  GLU B OE2 1 
ATOM   3647  N  N   . THR B 1 40  ? 13.392  69.994  73.647  1.00 13.69  ? 40  THR B N   1 
ATOM   3648  C  CA  . THR B 1 40  ? 12.912  69.778  72.300  1.00 11.09  ? 40  THR B CA  1 
ATOM   3649  C  C   . THR B 1 40  ? 11.793  70.800  72.208  1.00 14.44  ? 40  THR B C   1 
ATOM   3650  O  O   . THR B 1 40  ? 10.877  70.803  73.033  1.00 17.81  ? 40  THR B O   1 
ATOM   3651  C  CB  . THR B 1 40  ? 12.343  68.352  72.121  1.00 12.24  ? 40  THR B CB  1 
ATOM   3652  O  OG1 . THR B 1 40  ? 13.421  67.449  71.889  1.00 15.71  ? 40  THR B OG1 1 
ATOM   3653  C  CG2 . THR B 1 40  ? 11.388  68.261  70.947  1.00 11.25  ? 40  THR B CG2 1 
ATOM   3654  N  N   . TYR B 1 41  ? 11.921  71.732  71.278  1.00 11.81  ? 41  TYR B N   1 
ATOM   3655  C  CA  . TYR B 1 41  ? 10.908  72.749  71.099  1.00 10.55  ? 41  TYR B CA  1 
ATOM   3656  C  C   . TYR B 1 41  ? 10.499  72.712  69.638  1.00 14.24  ? 41  TYR B C   1 
ATOM   3657  O  O   . TYR B 1 41  ? 11.357  72.639  68.758  1.00 18.29  ? 41  TYR B O   1 
ATOM   3658  C  CB  . TYR B 1 41  ? 11.460  74.130  71.441  1.00 8.41   ? 41  TYR B CB  1 
ATOM   3659  C  CG  . TYR B 1 41  ? 10.428  75.225  71.249  1.00 11.16  ? 41  TYR B CG  1 
ATOM   3660  C  CD1 . TYR B 1 41  ? 9.432   75.441  72.200  1.00 10.97  ? 41  TYR B CD1 1 
ATOM   3661  C  CD2 . TYR B 1 41  ? 10.401  75.997  70.082  1.00 8.89   ? 41  TYR B CD2 1 
ATOM   3662  C  CE1 . TYR B 1 41  ? 8.437   76.390  72.000  1.00 9.65   ? 41  TYR B CE1 1 
ATOM   3663  C  CE2 . TYR B 1 41  ? 9.403   76.942  69.878  1.00 8.72   ? 41  TYR B CE2 1 
ATOM   3664  C  CZ  . TYR B 1 41  ? 8.425   77.134  70.841  1.00 10.43  ? 41  TYR B CZ  1 
ATOM   3665  O  OH  . TYR B 1 41  ? 7.443   78.081  70.659  1.00 13.94  ? 41  TYR B OH  1 
ATOM   3666  N  N   . ALA B 1 42  ? 9.199   72.784  69.373  1.00 12.63  ? 42  ALA B N   1 
ATOM   3667  C  CA  . ALA B 1 42  ? 8.716   72.752  67.998  1.00 9.89   ? 42  ALA B CA  1 
ATOM   3668  C  C   . ALA B 1 42  ? 7.460   73.562  67.797  1.00 10.40  ? 42  ALA B C   1 
ATOM   3669  O  O   . ALA B 1 42  ? 6.587   73.564  68.642  1.00 15.99  ? 42  ALA B O   1 
ATOM   3670  C  CB  . ALA B 1 42  ? 8.460   71.309  67.561  1.00 4.39   ? 42  ALA B CB  1 
ATOM   3671  N  N   . GLU B 1 43  ? 7.395   74.284  66.689  1.00 12.11  ? 43  GLU B N   1 
ATOM   3672  C  CA  . GLU B 1 43  ? 6.203   75.044  66.322  1.00 11.48  ? 43  GLU B CA  1 
ATOM   3673  C  C   . GLU B 1 43  ? 5.760   74.476  64.978  1.00 12.16  ? 43  GLU B C   1 
ATOM   3674  O  O   . GLU B 1 43  ? 6.554   74.407  64.035  1.00 13.89  ? 43  GLU B O   1 
ATOM   3675  C  CB  . GLU B 1 43  ? 6.510   76.525  66.164  1.00 10.20  ? 43  GLU B CB  1 
ATOM   3676  C  CG  . GLU B 1 43  ? 6.836   77.218  67.455  1.00 18.49  ? 43  GLU B CG  1 
ATOM   3677  C  CD  . GLU B 1 43  ? 7.123   78.681  67.276  1.00 18.72  ? 43  GLU B CD  1 
ATOM   3678  O  OE1 . GLU B 1 43  ? 7.064   79.183  66.139  1.00 22.75  ? 43  GLU B OE1 1 
ATOM   3679  O  OE2 . GLU B 1 43  ? 7.408   79.346  68.290  1.00 27.73  ? 43  GLU B OE2 1 
ATOM   3680  N  N   . LEU B 1 44  ? 4.524   74.005  64.915  1.00 10.35  ? 44  LEU B N   1 
ATOM   3681  C  CA  . LEU B 1 44  ? 3.987   73.454  63.684  1.00 9.34   ? 44  LEU B CA  1 
ATOM   3682  C  C   . LEU B 1 44  ? 2.935   74.415  63.175  1.00 9.73   ? 44  LEU B C   1 
ATOM   3683  O  O   . LEU B 1 44  ? 1.894   74.591  63.805  1.00 12.85  ? 44  LEU B O   1 
ATOM   3684  C  CB  . LEU B 1 44  ? 3.354   72.072  63.922  1.00 6.66   ? 44  LEU B CB  1 
ATOM   3685  C  CG  . LEU B 1 44  ? 4.231   71.022  64.602  1.00 9.24   ? 44  LEU B CG  1 
ATOM   3686  C  CD1 . LEU B 1 44  ? 3.603   69.641  64.458  1.00 12.16  ? 44  LEU B CD1 1 
ATOM   3687  C  CD2 . LEU B 1 44  ? 5.594   71.036  63.975  1.00 7.10   ? 44  LEU B CD2 1 
ATOM   3688  N  N   . LYS B 1 45  ? 3.210   75.027  62.034  1.00 10.16  ? 45  LYS B N   1 
ATOM   3689  C  CA  . LYS B 1 45  ? 2.298   75.974  61.409  1.00 9.38   ? 45  LYS B CA  1 
ATOM   3690  C  C   . LYS B 1 45  ? 1.624   75.404  60.164  1.00 10.88  ? 45  LYS B C   1 
ATOM   3691  O  O   . LYS B 1 45  ? 2.283   74.880  59.270  1.00 13.65  ? 45  LYS B O   1 
ATOM   3692  C  CB  . LYS B 1 45  ? 3.052   77.235  61.000  1.00 9.42   ? 45  LYS B CB  1 
ATOM   3693  C  CG  . LYS B 1 45  ? 3.695   77.990  62.134  1.00 10.28  ? 45  LYS B CG  1 
ATOM   3694  C  CD  . LYS B 1 45  ? 4.526   79.172  61.644  1.00 9.39   ? 45  LYS B CD  1 
ATOM   3695  C  CE  . LYS B 1 45  ? 3.705   80.173  60.847  1.00 10.24  ? 45  LYS B CE  1 
ATOM   3696  N  NZ  . LYS B 1 45  ? 2.579   80.692  61.662  1.00 17.13  ? 45  LYS B NZ  1 
ATOM   3697  N  N   . LEU B 1 46  ? 0.307   75.523  60.109  1.00 11.75  ? 46  LEU B N   1 
ATOM   3698  C  CA  . LEU B 1 46  ? -0.461  75.080  58.956  1.00 10.69  ? 46  LEU B CA  1 
ATOM   3699  C  C   . LEU B 1 46  ? -1.267  76.303  58.532  1.00 11.90  ? 46  LEU B C   1 
ATOM   3700  O  O   . LEU B 1 46  ? -2.096  76.799  59.288  1.00 14.61  ? 46  LEU B O   1 
ATOM   3701  C  CB  . LEU B 1 46  ? -1.403  73.935  59.321  1.00 8.48   ? 46  LEU B CB  1 
ATOM   3702  C  CG  . LEU B 1 46  ? -0.776  72.583  59.676  1.00 11.74  ? 46  LEU B CG  1 
ATOM   3703  C  CD1 . LEU B 1 46  ? -1.855  71.639  60.162  1.00 10.13  ? 46  LEU B CD1 1 
ATOM   3704  C  CD2 . LEU B 1 46  ? -0.071  71.989  58.474  1.00 9.97   ? 46  LEU B CD2 1 
ATOM   3705  N  N   . GLY B 1 47  ? -0.972  76.823  57.347  1.00 13.00  ? 47  GLY B N   1 
ATOM   3706  C  CA  . GLY B 1 47  ? -1.681  77.989  56.852  1.00 13.95  ? 47  GLY B CA  1 
ATOM   3707  C  C   . GLY B 1 47  ? -2.138  77.788  55.417  1.00 16.63  ? 47  GLY B C   1 
ATOM   3708  O  O   . GLY B 1 47  ? -1.814  76.771  54.792  1.00 16.20  ? 47  GLY B O   1 
ATOM   3709  N  N   . GLN B 1 48  ? -2.814  78.782  54.858  1.00 16.44  ? 48  GLN B N   1 
ATOM   3710  C  CA  . GLN B 1 48  ? -3.322  78.664  53.511  1.00 15.75  ? 48  GLN B CA  1 
ATOM   3711  C  C   . GLN B 1 48  ? -3.870  79.982  52.987  1.00 17.26  ? 48  GLN B C   1 
ATOM   3712  O  O   . GLN B 1 48  ? -4.443  80.769  53.744  1.00 19.73  ? 48  GLN B O   1 
ATOM   3713  C  CB  . GLN B 1 48  ? -4.454  77.646  53.525  1.00 16.66  ? 48  GLN B CB  1 
ATOM   3714  C  CG  . GLN B 1 48  ? -4.802  77.099  52.183  1.00 25.90  ? 48  GLN B CG  1 
ATOM   3715  C  CD  . GLN B 1 48  ? -5.642  75.860  52.292  1.00 33.62  ? 48  GLN B CD  1 
ATOM   3716  O  OE1 . GLN B 1 48  ? -5.118  74.744  52.298  1.00 39.47  ? 48  GLN B OE1 1 
ATOM   3717  N  NE2 . GLN B 1 48  ? -6.951  76.037  52.388  1.00 41.65  ? 48  GLN B NE2 1 
ATOM   3718  N  N   . GLU B 1 49  ? -3.640  80.259  51.709  1.00 17.57  ? 49  GLU B N   1 
ATOM   3719  C  CA  . GLU B 1 49  ? -4.202  81.458  51.092  1.00 18.77  ? 49  GLU B CA  1 
ATOM   3720  C  C   . GLU B 1 49  ? -5.584  80.944  50.725  1.00 19.10  ? 49  GLU B C   1 
ATOM   3721  O  O   . GLU B 1 49  ? -5.737  80.168  49.797  1.00 23.82  ? 49  GLU B O   1 
ATOM   3722  C  CB  . GLU B 1 49  ? -3.441  81.824  49.834  1.00 17.72  ? 49  GLU B CB  1 
ATOM   3723  C  CG  . GLU B 1 49  ? -3.907  83.117  49.217  1.00 30.93  ? 49  GLU B CG  1 
ATOM   3724  C  CD  . GLU B 1 49  ? -3.018  83.539  48.082  1.00 35.91  ? 49  GLU B CD  1 
ATOM   3725  O  OE1 . GLU B 1 49  ? -3.044  82.852  47.038  1.00 42.19  ? 49  GLU B OE1 1 
ATOM   3726  O  OE2 . GLU B 1 49  ? -2.283  84.539  48.243  1.00 42.05  ? 49  GLU B OE2 1 
ATOM   3727  N  N   . VAL B 1 50  ? -6.585  81.332  51.487  1.00 19.62  ? 50  VAL B N   1 
ATOM   3728  C  CA  . VAL B 1 50  ? -7.916  80.807  51.264  1.00 18.05  ? 50  VAL B CA  1 
ATOM   3729  C  C   . VAL B 1 50  ? -8.759  81.486  50.208  1.00 21.03  ? 50  VAL B C   1 
ATOM   3730  O  O   . VAL B 1 50  ? -9.818  80.974  49.859  1.00 26.34  ? 50  VAL B O   1 
ATOM   3731  C  CB  . VAL B 1 50  ? -8.704  80.766  52.583  1.00 13.04  ? 50  VAL B CB  1 
ATOM   3732  C  CG1 . VAL B 1 50  ? -8.106  79.725  53.524  1.00 13.36  ? 50  VAL B CG1 1 
ATOM   3733  C  CG2 . VAL B 1 50  ? -8.664  82.122  53.231  1.00 13.43  ? 50  VAL B CG2 1 
ATOM   3734  N  N   . TRP B 1 51  ? -8.322  82.638  49.713  1.00 21.16  ? 51  TRP B N   1 
ATOM   3735  C  CA  . TRP B 1 51  ? -9.095  83.352  48.702  1.00 17.01  ? 51  TRP B CA  1 
ATOM   3736  C  C   . TRP B 1 51  ? -8.209  84.364  48.016  1.00 18.20  ? 51  TRP B C   1 
ATOM   3737  O  O   . TRP B 1 51  ? -7.384  85.025  48.658  1.00 16.05  ? 51  TRP B O   1 
ATOM   3738  C  CB  . TRP B 1 51  ? -10.279 84.063  49.359  1.00 16.85  ? 51  TRP B CB  1 
ATOM   3739  C  CG  . TRP B 1 51  ? -11.189 84.808  48.432  1.00 17.47  ? 51  TRP B CG  1 
ATOM   3740  C  CD1 . TRP B 1 51  ? -12.329 84.336  47.848  1.00 17.70  ? 51  TRP B CD1 1 
ATOM   3741  C  CD2 . TRP B 1 51  ? -11.114 86.200  48.091  1.00 14.86  ? 51  TRP B CD2 1 
ATOM   3742  N  NE1 . TRP B 1 51  ? -12.978 85.351  47.187  1.00 15.47  ? 51  TRP B NE1 1 
ATOM   3743  C  CE2 . TRP B 1 51  ? -12.255 86.504  47.323  1.00 11.25  ? 51  TRP B CE2 1 
ATOM   3744  C  CE3 . TRP B 1 51  ? -10.197 87.221  48.375  1.00 18.80  ? 51  TRP B CE3 1 
ATOM   3745  C  CZ2 . TRP B 1 51  ? -12.507 87.785  46.840  1.00 14.08  ? 51  TRP B CZ2 1 
ATOM   3746  C  CZ3 . TRP B 1 51  ? -10.447 88.499  47.892  1.00 19.51  ? 51  TRP B CZ3 1 
ATOM   3747  C  CH2 . TRP B 1 51  ? -11.592 88.768  47.136  1.00 16.50  ? 51  TRP B CH2 1 
ATOM   3748  N  N   . LYS B 1 52  ? -8.362  84.453  46.706  1.00 20.23  ? 52  LYS B N   1 
ATOM   3749  C  CA  . LYS B 1 52  ? -7.592  85.383  45.912  1.00 25.28  ? 52  LYS B CA  1 
ATOM   3750  C  C   . LYS B 1 52  ? -8.419  85.791  44.714  1.00 25.22  ? 52  LYS B C   1 
ATOM   3751  O  O   . LYS B 1 52  ? -9.105  84.973  44.103  1.00 28.50  ? 52  LYS B O   1 
ATOM   3752  C  CB  . LYS B 1 52  ? -6.279  84.752  45.462  1.00 27.37  ? 52  LYS B CB  1 
ATOM   3753  C  CG  . LYS B 1 52  ? -5.353  85.732  44.779  1.00 37.55  ? 52  LYS B CG  1 
ATOM   3754  C  CD  . LYS B 1 52  ? -3.985  85.118  44.490  1.00 47.98  ? 52  LYS B CD  1 
ATOM   3755  C  CE  . LYS B 1 52  ? -3.023  86.174  43.967  1.00 59.14  ? 52  LYS B CE  1 
ATOM   3756  N  NZ  . LYS B 1 52  ? -2.919  87.347  44.900  1.00 62.77  ? 52  LYS B NZ  1 
ATOM   3757  N  N   . GLU B 1 53  ? -8.406  87.077  44.423  1.00 27.81  ? 53  GLU B N   1 
ATOM   3758  C  CA  . GLU B 1 53  ? -9.140  87.595  43.298  1.00 34.69  ? 53  GLU B CA  1 
ATOM   3759  C  C   . GLU B 1 53  ? -8.442  88.879  42.917  1.00 36.16  ? 53  GLU B C   1 
ATOM   3760  O  O   . GLU B 1 53  ? -8.625  89.913  43.550  1.00 40.63  ? 53  GLU B O   1 
ATOM   3761  C  CB  . GLU B 1 53  ? -10.589 87.846  43.681  1.00 39.94  ? 53  GLU B CB  1 
ATOM   3762  C  CG  . GLU B 1 53  ? -11.501 88.048  42.504  1.00 57.26  ? 53  GLU B CG  1 
ATOM   3763  C  CD  . GLU B 1 53  ? -12.962 87.964  42.898  1.00 69.11  ? 53  GLU B CD  1 
ATOM   3764  O  OE1 . GLU B 1 53  ? -13.486 86.825  42.984  1.00 73.82  ? 53  GLU B OE1 1 
ATOM   3765  O  OE2 . GLU B 1 53  ? -13.578 89.034  43.133  1.00 74.45  ? 53  GLU B OE2 1 
ATOM   3766  N  N   . GLY B 1 54  ? -7.575  88.779  41.918  1.00 38.24  ? 54  GLY B N   1 
ATOM   3767  C  CA  . GLY B 1 54  ? -6.833  89.934  41.464  1.00 37.99  ? 54  GLY B CA  1 
ATOM   3768  C  C   . GLY B 1 54  ? -5.641  90.130  42.368  1.00 39.70  ? 54  GLY B C   1 
ATOM   3769  O  O   . GLY B 1 54  ? -4.834  89.208  42.556  1.00 38.92  ? 54  GLY B O   1 
ATOM   3770  N  N   . ASP B 1 55  ? -5.528  91.334  42.921  1.00 42.77  ? 55  ASP B N   1 
ATOM   3771  C  CA  . ASP B 1 55  ? -4.439  91.661  43.834  1.00 45.03  ? 55  ASP B CA  1 
ATOM   3772  C  C   . ASP B 1 55  ? -4.881  91.442  45.284  1.00 38.66  ? 55  ASP B C   1 
ATOM   3773  O  O   . ASP B 1 55  ? -4.075  91.568  46.208  1.00 38.62  ? 55  ASP B O   1 
ATOM   3774  C  CB  . ASP B 1 55  ? -4.005  93.123  43.658  1.00 59.69  ? 55  ASP B CB  1 
ATOM   3775  C  CG  . ASP B 1 55  ? -3.493  93.425  42.255  1.00 74.90  ? 55  ASP B CG  1 
ATOM   3776  O  OD1 . ASP B 1 55  ? -2.417  92.900  41.862  1.00 79.62  ? 55  ASP B OD1 1 
ATOM   3777  O  OD2 . ASP B 1 55  ? -4.172  94.207  41.551  1.00 85.93  ? 55  ASP B OD2 1 
ATOM   3778  N  N   . LYS B 1 56  ? -6.162  91.133  45.472  1.00 29.35  ? 56  LYS B N   1 
ATOM   3779  C  CA  . LYS B 1 56  ? -6.725  90.916  46.793  1.00 24.97  ? 56  LYS B CA  1 
ATOM   3780  C  C   . LYS B 1 56  ? -6.630  89.460  47.215  1.00 22.92  ? 56  LYS B C   1 
ATOM   3781  O  O   . LYS B 1 56  ? -6.809  88.561  46.398  1.00 23.95  ? 56  LYS B O   1 
ATOM   3782  C  CB  . LYS B 1 56  ? -8.188  91.353  46.803  1.00 25.62  ? 56  LYS B CB  1 
ATOM   3783  C  CG  . LYS B 1 56  ? -8.380  92.784  46.352  1.00 27.76  ? 56  LYS B CG  1 
ATOM   3784  C  CD  . LYS B 1 56  ? -9.836  93.115  46.163  1.00 32.83  ? 56  LYS B CD  1 
ATOM   3785  C  CE  . LYS B 1 56  ? -10.000 94.388  45.326  1.00 40.76  ? 56  LYS B CE  1 
ATOM   3786  N  NZ  . LYS B 1 56  ? -9.305  95.580  45.913  1.00 47.60  ? 56  LYS B NZ  1 
ATOM   3787  N  N   . SER B 1 57  ? -6.326  89.220  48.486  1.00 20.47  ? 57  SER B N   1 
ATOM   3788  C  CA  . SER B 1 57  ? -6.247  87.854  48.992  1.00 17.68  ? 57  SER B CA  1 
ATOM   3789  C  C   . SER B 1 57  ? -6.443  87.811  50.502  1.00 16.28  ? 57  SER B C   1 
ATOM   3790  O  O   . SER B 1 57  ? -6.346  88.839  51.195  1.00 13.72  ? 57  SER B O   1 
ATOM   3791  C  CB  . SER B 1 57  ? -4.913  87.210  48.635  1.00 16.30  ? 57  SER B CB  1 
ATOM   3792  O  OG  . SER B 1 57  ? -3.854  87.831  49.329  1.00 20.31  ? 57  SER B OG  1 
ATOM   3793  N  N   . PHE B 1 58  ? -6.773  86.619  50.989  1.00 16.39  ? 58  PHE B N   1 
ATOM   3794  C  CA  . PHE B 1 58  ? -6.969  86.376  52.407  1.00 11.73  ? 58  PHE B CA  1 
ATOM   3795  C  C   . PHE B 1 58  ? -6.076  85.204  52.748  1.00 13.29  ? 58  PHE B C   1 
ATOM   3796  O  O   . PHE B 1 58  ? -6.143  84.148  52.100  1.00 13.58  ? 58  PHE B O   1 
ATOM   3797  C  CB  . PHE B 1 58  ? -8.417  85.985  52.712  1.00 12.06  ? 58  PHE B CB  1 
ATOM   3798  C  CG  . PHE B 1 58  ? -9.374  87.146  52.770  1.00 14.72  ? 58  PHE B CG  1 
ATOM   3799  C  CD1 . PHE B 1 58  ? -9.573  87.844  53.964  1.00 16.86  ? 58  PHE B CD1 1 
ATOM   3800  C  CD2 . PHE B 1 58  ? -10.117 87.512  51.650  1.00 17.80  ? 58  PHE B CD2 1 
ATOM   3801  C  CE1 . PHE B 1 58  ? -10.500 88.884  54.050  1.00 13.33  ? 58  PHE B CE1 1 
ATOM   3802  C  CE2 . PHE B 1 58  ? -11.057 88.559  51.721  1.00 16.88  ? 58  PHE B CE2 1 
ATOM   3803  C  CZ  . PHE B 1 58  ? -11.246 89.244  52.929  1.00 16.25  ? 58  PHE B CZ  1 
ATOM   3804  N  N   . TYR B 1 59  ? -5.185  85.401  53.711  1.00 11.95  ? 59  TYR B N   1 
ATOM   3805  C  CA  . TYR B 1 59  ? -4.319  84.320  54.134  1.00 10.18  ? 59  TYR B CA  1 
ATOM   3806  C  C   . TYR B 1 59  ? -4.691  83.936  55.565  1.00 13.23  ? 59  TYR B C   1 
ATOM   3807  O  O   . TYR B 1 59  ? -4.872  84.805  56.425  1.00 16.97  ? 59  TYR B O   1 
ATOM   3808  C  CB  . TYR B 1 59  ? -2.857  84.734  54.077  1.00 7.92   ? 59  TYR B CB  1 
ATOM   3809  C  CG  . TYR B 1 59  ? -1.934  83.555  54.244  1.00 14.37  ? 59  TYR B CG  1 
ATOM   3810  C  CD1 . TYR B 1 59  ? -1.621  82.747  53.164  1.00 15.01  ? 59  TYR B CD1 1 
ATOM   3811  C  CD2 . TYR B 1 59  ? -1.415  83.213  55.488  1.00 14.72  ? 59  TYR B CD2 1 
ATOM   3812  C  CE1 . TYR B 1 59  ? -0.816  81.622  53.309  1.00 16.86  ? 59  TYR B CE1 1 
ATOM   3813  C  CE2 . TYR B 1 59  ? -0.606  82.082  55.641  1.00 17.32  ? 59  TYR B CE2 1 
ATOM   3814  C  CZ  . TYR B 1 59  ? -0.318  81.294  54.543  1.00 18.00  ? 59  TYR B CZ  1 
ATOM   3815  O  OH  . TYR B 1 59  ? 0.445   80.163  54.670  1.00 20.72  ? 59  TYR B OH  1 
ATOM   3816  N  N   . PHE B 1 60  ? -4.797  82.641  55.821  1.00 13.00  ? 60  PHE B N   1 
ATOM   3817  C  CA  . PHE B 1 60  ? -5.143  82.141  57.139  1.00 9.73   ? 60  PHE B CA  1 
ATOM   3818  C  C   . PHE B 1 60  ? -3.922  81.418  57.688  1.00 12.00  ? 60  PHE B C   1 
ATOM   3819  O  O   . PHE B 1 60  ? -3.355  80.579  56.993  1.00 14.06  ? 60  PHE B O   1 
ATOM   3820  C  CB  . PHE B 1 60  ? -6.321  81.192  57.018  1.00 7.58   ? 60  PHE B CB  1 
ATOM   3821  C  CG  . PHE B 1 60  ? -6.589  80.427  58.245  1.00 13.67  ? 60  PHE B CG  1 
ATOM   3822  C  CD1 . PHE B 1 60  ? -6.852  81.082  59.443  1.00 12.79  ? 60  PHE B CD1 1 
ATOM   3823  C  CD2 . PHE B 1 60  ? -6.571  79.039  58.219  1.00 12.41  ? 60  PHE B CD2 1 
ATOM   3824  C  CE1 . PHE B 1 60  ? -7.098  80.364  60.607  1.00 10.60  ? 60  PHE B CE1 1 
ATOM   3825  C  CE2 . PHE B 1 60  ? -6.812  78.310  59.369  1.00 11.79  ? 60  PHE B CE2 1 
ATOM   3826  C  CZ  . PHE B 1 60  ? -7.078  78.972  60.570  1.00 13.24  ? 60  PHE B CZ  1 
ATOM   3827  N  N   . ASP B 1 61  ? -3.517  81.721  58.922  1.00 9.67   ? 61  ASP B N   1 
ATOM   3828  C  CA  . ASP B 1 61  ? -2.339  81.085  59.500  1.00 7.34   ? 61  ASP B CA  1 
ATOM   3829  C  C   . ASP B 1 61  ? -2.571  80.588  60.945  1.00 10.42  ? 61  ASP B C   1 
ATOM   3830  O  O   . ASP B 1 61  ? -3.360  81.171  61.698  1.00 10.18  ? 61  ASP B O   1 
ATOM   3831  C  CB  . ASP B 1 61  ? -1.188  82.085  59.455  1.00 8.53   ? 61  ASP B CB  1 
ATOM   3832  C  CG  . ASP B 1 61  ? 0.169   81.439  59.595  1.00 14.81  ? 61  ASP B CG  1 
ATOM   3833  O  OD1 . ASP B 1 61  ? 0.317   80.222  59.370  1.00 16.19  ? 61  ASP B OD1 1 
ATOM   3834  O  OD2 . ASP B 1 61  ? 1.116   82.180  59.895  1.00 16.18  ? 61  ASP B OD2 1 
ATOM   3835  N  N   . THR B 1 62  ? -1.925  79.483  61.312  1.00 8.48   ? 62  THR B N   1 
ATOM   3836  C  CA  . THR B 1 62  ? -2.051  78.939  62.663  1.00 8.58   ? 62  THR B CA  1 
ATOM   3837  C  C   . THR B 1 62  ? -0.676  78.571  63.190  1.00 11.53  ? 62  THR B C   1 
ATOM   3838  O  O   . THR B 1 62  ? 0.288   78.556  62.428  1.00 14.54  ? 62  THR B O   1 
ATOM   3839  C  CB  . THR B 1 62  ? -2.884  77.653  62.717  1.00 7.64   ? 62  THR B CB  1 
ATOM   3840  O  OG1 . THR B 1 62  ? -2.203  76.604  62.012  1.00 9.26   ? 62  THR B OG1 1 
ATOM   3841  C  CG2 . THR B 1 62  ? -4.249  77.870  62.132  1.00 5.31   ? 62  THR B CG2 1 
ATOM   3842  N  N   . ASN B 1 63  ? -0.579  78.282  64.486  1.00 10.88  ? 63  ASN B N   1 
ATOM   3843  C  CA  . ASN B 1 63  ? 0.693   77.885  65.087  1.00 7.47   ? 63  ASN B CA  1 
ATOM   3844  C  C   . ASN B 1 63  ? 0.426   77.172  66.401  1.00 10.34  ? 63  ASN B C   1 
ATOM   3845  O  O   . ASN B 1 63  ? -0.247  77.719  67.268  1.00 13.19  ? 63  ASN B O   1 
ATOM   3846  C  CB  . ASN B 1 63  ? 1.584   79.112  65.336  1.00 8.08   ? 63  ASN B CB  1 
ATOM   3847  C  CG  . ASN B 1 63  ? 3.005   78.741  65.748  1.00 8.04   ? 63  ASN B CG  1 
ATOM   3848  O  OD1 . ASN B 1 63  ? 3.263   77.627  66.198  1.00 16.24  ? 63  ASN B OD1 1 
ATOM   3849  N  ND2 . ASN B 1 63  ? 3.934   79.672  65.577  1.00 7.40   ? 63  ASN B ND2 1 
ATOM   3850  N  N   . VAL B 1 64  ? 0.902   75.938  66.519  1.00 11.53  ? 64  VAL B N   1 
ATOM   3851  C  CA  . VAL B 1 64  ? 0.750   75.144  67.742  1.00 10.73  ? 64  VAL B CA  1 
ATOM   3852  C  C   . VAL B 1 64  ? 2.171   74.801  68.169  1.00 11.85  ? 64  VAL B C   1 
ATOM   3853  O  O   . VAL B 1 64  ? 2.922   74.187  67.407  1.00 13.42  ? 64  VAL B O   1 
ATOM   3854  C  CB  . VAL B 1 64  ? -0.049  73.849  67.484  1.00 10.04  ? 64  VAL B CB  1 
ATOM   3855  C  CG1 . VAL B 1 64  ? -0.128  73.009  68.749  1.00 8.63   ? 64  VAL B CG1 1 
ATOM   3856  C  CG2 . VAL B 1 64  ? -1.437  74.200  67.001  1.00 7.61   ? 64  VAL B CG2 1 
ATOM   3857  N  N   . ALA B 1 65  ? 2.538   75.231  69.367  1.00 9.75   ? 65  ALA B N   1 
ATOM   3858  C  CA  . ALA B 1 65  ? 3.883   75.036  69.903  1.00 9.67   ? 65  ALA B CA  1 
ATOM   3859  C  C   . ALA B 1 65  ? 3.978   73.964  70.980  1.00 9.92   ? 65  ALA B C   1 
ATOM   3860  O  O   . ALA B 1 65  ? 3.121   73.880  71.858  1.00 12.99  ? 65  ALA B O   1 
ATOM   3861  C  CB  . ALA B 1 65  ? 4.402   76.368  70.451  1.00 5.19   ? 65  ALA B CB  1 
ATOM   3862  N  N   . TYR B 1 66  ? 5.054   73.190  70.935  1.00 10.98  ? 66  TYR B N   1 
ATOM   3863  C  CA  . TYR B 1 66  ? 5.295   72.118  71.887  1.00 11.25  ? 66  TYR B CA  1 
ATOM   3864  C  C   . TYR B 1 66  ? 6.672   72.262  72.496  1.00 14.65  ? 66  TYR B C   1 
ATOM   3865  O  O   . TYR B 1 66  ? 7.636   72.564  71.804  1.00 16.18  ? 66  TYR B O   1 
ATOM   3866  C  CB  . TYR B 1 66  ? 5.255   70.748  71.205  1.00 10.46  ? 66  TYR B CB  1 
ATOM   3867  C  CG  . TYR B 1 66  ? 3.978   70.407  70.473  1.00 12.26  ? 66  TYR B CG  1 
ATOM   3868  C  CD1 . TYR B 1 66  ? 3.746   70.885  69.179  1.00 12.45  ? 66  TYR B CD1 1 
ATOM   3869  C  CD2 . TYR B 1 66  ? 2.994   69.617  71.073  1.00 9.66   ? 66  TYR B CD2 1 
ATOM   3870  C  CE1 . TYR B 1 66  ? 2.559   70.596  68.501  1.00 9.87   ? 66  TYR B CE1 1 
ATOM   3871  C  CE2 . TYR B 1 66  ? 1.801   69.313  70.403  1.00 11.33  ? 66  TYR B CE2 1 
ATOM   3872  C  CZ  . TYR B 1 66  ? 1.589   69.812  69.118  1.00 12.12  ? 66  TYR B CZ  1 
ATOM   3873  O  OH  . TYR B 1 66  ? 0.403   69.562  68.463  1.00 12.86  ? 66  TYR B OH  1 
ATOM   3874  N  N   . SER B 1 67  ? 6.763   72.024  73.795  1.00 15.81  ? 67  SER B N   1 
ATOM   3875  C  CA  . SER B 1 67  ? 8.038   72.077  74.490  1.00 15.31  ? 67  SER B CA  1 
ATOM   3876  C  C   . SER B 1 67  ? 8.055   70.869  75.414  1.00 16.41  ? 67  SER B C   1 
ATOM   3877  O  O   . SER B 1 67  ? 7.133   70.684  76.203  1.00 21.51  ? 67  SER B O   1 
ATOM   3878  C  CB  . SER B 1 67  ? 8.136   73.352  75.302  1.00 14.36  ? 67  SER B CB  1 
ATOM   3879  O  OG  . SER B 1 67  ? 9.472   73.579  75.687  1.00 27.30  ? 67  SER B OG  1 
ATOM   3880  N  N   . VAL B 1 68  ? 9.004   69.967  75.195  1.00 12.43  ? 68  VAL B N   1 
ATOM   3881  C  CA  . VAL B 1 68  ? 9.154   68.773  76.017  1.00 9.99   ? 68  VAL B CA  1 
ATOM   3882  C  C   . VAL B 1 68  ? 10.625  68.674  76.434  1.00 14.00  ? 68  VAL B C   1 
ATOM   3883  O  O   . VAL B 1 68  ? 11.507  69.258  75.798  1.00 13.68  ? 68  VAL B O   1 
ATOM   3884  C  CB  . VAL B 1 68  ? 8.663   67.476  75.322  1.00 11.52  ? 68  VAL B CB  1 
ATOM   3885  C  CG1 . VAL B 1 68  ? 7.145   67.487  75.214  1.00 12.08  ? 68  VAL B CG1 1 
ATOM   3886  C  CG2 . VAL B 1 68  ? 9.295   67.320  73.964  1.00 9.84   ? 68  VAL B CG2 1 
ATOM   3887  N  N   . ASN B 1 69  ? 10.889  67.958  77.514  1.00 16.86  ? 69  ASN B N   1 
ATOM   3888  C  CA  . ASN B 1 69  ? 12.253  67.867  78.023  1.00 18.59  ? 69  ASN B CA  1 
ATOM   3889  C  C   . ASN B 1 69  ? 13.149  66.817  77.420  1.00 17.43  ? 69  ASN B C   1 
ATOM   3890  O  O   . ASN B 1 69  ? 14.241  66.608  77.910  1.00 19.84  ? 69  ASN B O   1 
ATOM   3891  C  CB  . ASN B 1 69  ? 12.245  67.708  79.539  1.00 24.90  ? 69  ASN B CB  1 
ATOM   3892  C  CG  . ASN B 1 69  ? 11.608  68.889  80.245  1.00 32.34  ? 69  ASN B CG  1 
ATOM   3893  O  OD1 . ASN B 1 69  ? 11.990  70.046  80.042  1.00 39.20  ? 69  ASN B OD1 1 
ATOM   3894  N  ND2 . ASN B 1 69  ? 10.623  68.603  81.078  1.00 35.06  ? 69  ASN B ND2 1 
ATOM   3895  N  N   . GLN B 1 70  ? 12.711  66.167  76.355  1.00 15.53  ? 70  GLN B N   1 
ATOM   3896  C  CA  . GLN B 1 70  ? 13.526  65.140  75.721  1.00 14.80  ? 70  GLN B CA  1 
ATOM   3897  C  C   . GLN B 1 70  ? 14.219  64.199  76.722  1.00 17.05  ? 70  GLN B C   1 
ATOM   3898  O  O   . GLN B 1 70  ? 15.438  64.014  76.703  1.00 18.20  ? 70  GLN B O   1 
ATOM   3899  C  CB  . GLN B 1 70  ? 14.527  65.761  74.722  1.00 9.54   ? 70  GLN B CB  1 
ATOM   3900  C  CG  . GLN B 1 70  ? 15.415  66.890  75.239  1.00 9.34   ? 70  GLN B CG  1 
ATOM   3901  C  CD  . GLN B 1 70  ? 16.250  67.521  74.134  1.00 14.87  ? 70  GLN B CD  1 
ATOM   3902  O  OE1 . GLN B 1 70  ? 15.816  67.595  72.991  1.00 18.07  ? 70  GLN B OE1 1 
ATOM   3903  N  NE2 . GLN B 1 70  ? 17.447  67.984  74.472  1.00 11.36  ? 70  GLN B NE2 1 
ATOM   3904  N  N   . GLN B 1 71  ? 13.417  63.599  77.599  1.00 15.77  ? 71  GLN B N   1 
ATOM   3905  C  CA  . GLN B 1 71  ? 13.914  62.672  78.605  1.00 16.40  ? 71  GLN B CA  1 
ATOM   3906  C  C   . GLN B 1 71  ? 13.412  61.277  78.295  1.00 15.64  ? 71  GLN B C   1 
ATOM   3907  O  O   . GLN B 1 71  ? 13.936  60.286  78.815  1.00 15.74  ? 71  GLN B O   1 
ATOM   3908  C  CB  . GLN B 1 71  ? 13.399  63.049  79.988  1.00 19.84  ? 71  GLN B CB  1 
ATOM   3909  C  CG  . GLN B 1 71  ? 13.818  64.396  80.479  1.00 29.22  ? 71  GLN B CG  1 
ATOM   3910  C  CD  . GLN B 1 71  ? 13.219  64.717  81.836  1.00 34.10  ? 71  GLN B CD  1 
ATOM   3911  O  OE1 . GLN B 1 71  ? 13.908  65.217  82.714  1.00 39.89  ? 71  GLN B OE1 1 
ATOM   3912  N  NE2 . GLN B 1 71  ? 11.928  64.441  82.009  1.00 31.70  ? 71  GLN B NE2 1 
ATOM   3913  N  N   . ASN B 1 72  ? 12.364  61.202  77.477  1.00 15.49  ? 72  ASN B N   1 
ATOM   3914  C  CA  . ASN B 1 72  ? 11.773  59.923  77.116  1.00 13.65  ? 72  ASN B CA  1 
ATOM   3915  C  C   . ASN B 1 72  ? 11.076  60.002  75.772  1.00 13.82  ? 72  ASN B C   1 
ATOM   3916  O  O   . ASN B 1 72  ? 10.968  61.066  75.185  1.00 16.10  ? 72  ASN B O   1 
ATOM   3917  C  CB  . ASN B 1 72  ? 10.739  59.531  78.167  1.00 13.77  ? 72  ASN B CB  1 
ATOM   3918  C  CG  . ASN B 1 72  ? 11.343  58.828  79.350  1.00 15.34  ? 72  ASN B CG  1 
ATOM   3919  O  OD1 . ASN B 1 72  ? 11.962  57.771  79.211  1.00 21.98  ? 72  ASN B OD1 1 
ATOM   3920  N  ND2 . ASN B 1 72  ? 11.143  59.389  80.532  1.00 21.11  ? 72  ASN B ND2 1 
ATOM   3921  N  N   . ASP B 1 73  ? 10.613  58.855  75.299  1.00 12.64  ? 73  ASP B N   1 
ATOM   3922  C  CA  . ASP B 1 73  ? 9.858   58.758  74.066  1.00 12.60  ? 73  ASP B CA  1 
ATOM   3923  C  C   . ASP B 1 73  ? 8.500   59.420  74.352  1.00 14.04  ? 73  ASP B C   1 
ATOM   3924  O  O   . ASP B 1 73  ? 8.227   60.519  73.884  1.00 16.66  ? 73  ASP B O   1 
ATOM   3925  C  CB  . ASP B 1 73  ? 9.710   57.265  73.703  1.00 14.51  ? 73  ASP B CB  1 
ATOM   3926  C  CG  . ASP B 1 73  ? 8.633   56.984  72.660  1.00 16.11  ? 73  ASP B CG  1 
ATOM   3927  O  OD1 . ASP B 1 73  ? 8.030   57.902  72.087  1.00 16.46  ? 73  ASP B OD1 1 
ATOM   3928  O  OD2 . ASP B 1 73  ? 8.372   55.799  72.415  1.00 18.32  ? 73  ASP B OD2 1 
ATOM   3929  N  N   . TRP B 1 74  ? 7.663   58.778  75.159  1.00 14.95  ? 74  TRP B N   1 
ATOM   3930  C  CA  . TRP B 1 74  ? 6.357   59.340  75.473  1.00 13.06  ? 74  TRP B CA  1 
ATOM   3931  C  C   . TRP B 1 74  ? 6.466   60.516  76.444  1.00 14.22  ? 74  TRP B C   1 
ATOM   3932  O  O   . TRP B 1 74  ? 6.815   60.347  77.598  1.00 19.12  ? 74  TRP B O   1 
ATOM   3933  C  CB  . TRP B 1 74  ? 5.449   58.252  76.059  1.00 13.11  ? 74  TRP B CB  1 
ATOM   3934  C  CG  . TRP B 1 74  ? 4.016   58.686  76.223  1.00 16.95  ? 74  TRP B CG  1 
ATOM   3935  C  CD1 . TRP B 1 74  ? 3.505   59.444  77.231  1.00 14.39  ? 74  TRP B CD1 1 
ATOM   3936  C  CD2 . TRP B 1 74  ? 2.931   58.445  75.315  1.00 18.24  ? 74  TRP B CD2 1 
ATOM   3937  N  NE1 . TRP B 1 74  ? 2.175   59.706  77.007  1.00 15.81  ? 74  TRP B NE1 1 
ATOM   3938  C  CE2 . TRP B 1 74  ? 1.795   59.104  75.837  1.00 22.16  ? 74  TRP B CE2 1 
ATOM   3939  C  CE3 . TRP B 1 74  ? 2.808   57.741  74.111  1.00 21.42  ? 74  TRP B CE3 1 
ATOM   3940  C  CZ2 . TRP B 1 74  ? 0.547   59.082  75.191  1.00 22.27  ? 74  TRP B CZ2 1 
ATOM   3941  C  CZ3 . TRP B 1 74  ? 1.569   57.717  73.471  1.00 21.92  ? 74  TRP B CZ3 1 
ATOM   3942  C  CH2 . TRP B 1 74  ? 0.458   58.384  74.013  1.00 20.62  ? 74  TRP B CH2 1 
ATOM   3943  N  N   . GLU B 1 75  ? 6.204   61.716  75.969  1.00 13.27  ? 75  GLU B N   1 
ATOM   3944  C  CA  . GLU B 1 75  ? 6.258   62.887  76.830  1.00 11.26  ? 75  GLU B CA  1 
ATOM   3945  C  C   . GLU B 1 75  ? 5.022   63.730  76.575  1.00 15.13  ? 75  GLU B C   1 
ATOM   3946  O  O   . GLU B 1 75  ? 4.891   64.343  75.516  1.00 17.85  ? 75  GLU B O   1 
ATOM   3947  C  CB  . GLU B 1 75  ? 7.506   63.727  76.552  1.00 9.89   ? 75  GLU B CB  1 
ATOM   3948  C  CG  . GLU B 1 75  ? 8.803   63.069  76.936  1.00 10.96  ? 75  GLU B CG  1 
ATOM   3949  C  CD  . GLU B 1 75  ? 10.014  63.973  76.729  1.00 13.34  ? 75  GLU B CD  1 
ATOM   3950  O  OE1 . GLU B 1 75  ? 10.298  64.355  75.572  1.00 20.51  ? 75  GLU B OE1 1 
ATOM   3951  O  OE2 . GLU B 1 75  ? 10.694  64.293  77.723  1.00 19.52  ? 75  GLU B OE2 1 
ATOM   3952  N  N   . SER B 1 76  ? 4.076   63.671  77.502  1.00 17.02  ? 76  SER B N   1 
ATOM   3953  C  CA  . SER B 1 76  ? 2.848   64.453  77.412  1.00 18.83  ? 76  SER B CA  1 
ATOM   3954  C  C   . SER B 1 76  ? 3.127   65.932  77.656  1.00 19.16  ? 76  SER B C   1 
ATOM   3955  O  O   . SER B 1 76  ? 4.081   66.281  78.354  1.00 23.42  ? 76  SER B O   1 
ATOM   3956  C  CB  . SER B 1 76  ? 1.851   63.952  78.441  1.00 20.04  ? 76  SER B CB  1 
ATOM   3957  O  OG  . SER B 1 76  ? 1.317   62.701  78.037  1.00 38.45  ? 76  SER B OG  1 
ATOM   3958  N  N   . THR B 1 77  ? 2.313   66.804  77.077  1.00 17.57  ? 77  THR B N   1 
ATOM   3959  C  CA  . THR B 1 77  ? 2.507   68.230  77.251  1.00 16.47  ? 77  THR B CA  1 
ATOM   3960  C  C   . THR B 1 77  ? 1.223   68.959  76.923  1.00 16.53  ? 77  THR B C   1 
ATOM   3961  O  O   . THR B 1 77  ? 0.278   68.367  76.399  1.00 18.34  ? 77  THR B O   1 
ATOM   3962  C  CB  . THR B 1 77  ? 3.651   68.769  76.335  1.00 19.99  ? 77  THR B CB  1 
ATOM   3963  O  OG1 . THR B 1 77  ? 3.878   70.158  76.612  1.00 23.15  ? 77  THR B OG1 1 
ATOM   3964  C  CG2 . THR B 1 77  ? 3.294   68.619  74.852  1.00 14.24  ? 77  THR B CG2 1 
ATOM   3965  N  N   . ASP B 1 78  ? 1.172   70.224  77.309  1.00 17.61  ? 78  ASP B N   1 
ATOM   3966  C  CA  . ASP B 1 78  ? 0.026   71.072  77.018  1.00 22.42  ? 78  ASP B CA  1 
ATOM   3967  C  C   . ASP B 1 78  ? 0.535   72.007  75.944  1.00 19.29  ? 78  ASP B C   1 
ATOM   3968  O  O   . ASP B 1 78  ? 1.343   72.896  76.221  1.00 21.97  ? 78  ASP B O   1 
ATOM   3969  C  CB  . ASP B 1 78  ? -0.360  71.928  78.222  1.00 31.95  ? 78  ASP B CB  1 
ATOM   3970  C  CG  . ASP B 1 78  ? -0.723  71.112  79.414  1.00 40.43  ? 78  ASP B CG  1 
ATOM   3971  O  OD1 . ASP B 1 78  ? -1.726  70.368  79.335  1.00 43.84  ? 78  ASP B OD1 1 
ATOM   3972  O  OD2 . ASP B 1 78  ? 0.007   71.222  80.426  1.00 54.17  ? 78  ASP B OD2 1 
ATOM   3973  N  N   . PRO B 1 79  ? 0.120   71.791  74.703  1.00 15.00  ? 79  PRO B N   1 
ATOM   3974  C  CA  . PRO B 1 79  ? 0.589   72.668  73.633  1.00 13.01  ? 79  PRO B CA  1 
ATOM   3975  C  C   . PRO B 1 79  ? 0.081   74.083  73.794  1.00 13.70  ? 79  PRO B C   1 
ATOM   3976  O  O   . PRO B 1 79  ? -0.974  74.312  74.384  1.00 17.46  ? 79  PRO B O   1 
ATOM   3977  C  CB  . PRO B 1 79  ? 0.010   72.016  72.387  1.00 14.55  ? 79  PRO B CB  1 
ATOM   3978  C  CG  . PRO B 1 79  ? -1.234  71.337  72.903  1.00 14.21  ? 79  PRO B CG  1 
ATOM   3979  C  CD  . PRO B 1 79  ? -0.774  70.740  74.197  1.00 13.19  ? 79  PRO B CD  1 
ATOM   3980  N  N   . ALA B 1 80  ? 0.859   75.042  73.322  1.00 9.50   ? 80  ALA B N   1 
ATOM   3981  C  CA  . ALA B 1 80  ? 0.437   76.422  73.382  1.00 9.05   ? 80  ALA B CA  1 
ATOM   3982  C  C   . ALA B 1 80  ? -0.161  76.751  72.019  1.00 12.27  ? 80  ALA B C   1 
ATOM   3983  O  O   . ALA B 1 80  ? 0.476   76.523  71.000  1.00 14.52  ? 80  ALA B O   1 
ATOM   3984  C  CB  . ALA B 1 80  ? 1.626   77.310  73.639  1.00 8.23   ? 80  ALA B CB  1 
ATOM   3985  N  N   . PHE B 1 81  ? -1.394  77.230  71.982  1.00 11.36  ? 81  PHE B N   1 
ATOM   3986  C  CA  . PHE B 1 81  ? -2.008  77.603  70.718  1.00 10.76  ? 81  PHE B CA  1 
ATOM   3987  C  C   . PHE B 1 81  ? -1.641  79.076  70.570  1.00 13.43  ? 81  PHE B C   1 
ATOM   3988  O  O   . PHE B 1 81  ? -2.324  79.946  71.107  1.00 15.04  ? 81  PHE B O   1 
ATOM   3989  C  CB  . PHE B 1 81  ? -3.517  77.423  70.803  1.00 10.69  ? 81  PHE B CB  1 
ATOM   3990  C  CG  . PHE B 1 81  ? -4.208  77.546  69.488  1.00 14.96  ? 81  PHE B CG  1 
ATOM   3991  C  CD1 . PHE B 1 81  ? -3.871  76.707  68.432  1.00 18.34  ? 81  PHE B CD1 1 
ATOM   3992  C  CD2 . PHE B 1 81  ? -5.204  78.491  69.301  1.00 18.55  ? 81  PHE B CD2 1 
ATOM   3993  C  CE1 . PHE B 1 81  ? -4.527  76.806  67.194  1.00 16.61  ? 81  PHE B CE1 1 
ATOM   3994  C  CE2 . PHE B 1 81  ? -5.860  78.599  68.081  1.00 17.85  ? 81  PHE B CE2 1 
ATOM   3995  C  CZ  . PHE B 1 81  ? -5.521  77.753  67.023  1.00 16.46  ? 81  PHE B CZ  1 
ATOM   3996  N  N   . ARG B 1 82  ? -0.573  79.353  69.826  1.00 12.80  ? 82  ARG B N   1 
ATOM   3997  C  CA  . ARG B 1 82  ? -0.069  80.718  69.705  1.00 9.57   ? 82  ARG B CA  1 
ATOM   3998  C  C   . ARG B 1 82  ? -0.537  81.620  68.582  1.00 10.11  ? 82  ARG B C   1 
ATOM   3999  O  O   . ARG B 1 82  ? -0.493  82.844  68.721  1.00 13.74  ? 82  ARG B O   1 
ATOM   4000  C  CB  . ARG B 1 82  ? 1.460   80.701  69.773  1.00 3.95   ? 82  ARG B CB  1 
ATOM   4001  C  CG  . ARG B 1 82  ? 1.968   79.904  70.964  1.00 9.38   ? 82  ARG B CG  1 
ATOM   4002  C  CD  . ARG B 1 82  ? 3.475   79.870  71.056  1.00 11.05  ? 82  ARG B CD  1 
ATOM   4003  N  NE  . ARG B 1 82  ? 3.986   81.192  71.349  1.00 7.11   ? 82  ARG B NE  1 
ATOM   4004  C  CZ  . ARG B 1 82  ? 5.275   81.484  71.410  1.00 10.60  ? 82  ARG B CZ  1 
ATOM   4005  N  NH1 . ARG B 1 82  ? 6.185   80.546  71.198  1.00 8.20   ? 82  ARG B NH1 1 
ATOM   4006  N  NH2 . ARG B 1 82  ? 5.648   82.718  71.697  1.00 11.52  ? 82  ARG B NH2 1 
ATOM   4007  N  N   . GLU B 1 83  ? -0.960  81.051  67.462  1.00 11.18  ? 83  GLU B N   1 
ATOM   4008  C  CA  . GLU B 1 83  ? -1.419  81.881  66.356  1.00 9.19   ? 83  GLU B CA  1 
ATOM   4009  C  C   . GLU B 1 83  ? -2.663  81.333  65.726  1.00 7.78   ? 83  GLU B C   1 
ATOM   4010  O  O   . GLU B 1 83  ? -2.838  80.127  65.635  1.00 11.12  ? 83  GLU B O   1 
ATOM   4011  C  CB  . GLU B 1 83  ? -0.361  81.996  65.269  1.00 8.31   ? 83  GLU B CB  1 
ATOM   4012  C  CG  . GLU B 1 83  ? 0.857   82.733  65.680  1.00 11.47  ? 83  GLU B CG  1 
ATOM   4013  C  CD  . GLU B 1 83  ? 1.815   82.926  64.543  1.00 12.63  ? 83  GLU B CD  1 
ATOM   4014  O  OE1 . GLU B 1 83  ? 2.541   81.980  64.190  1.00 14.89  ? 83  GLU B OE1 1 
ATOM   4015  O  OE2 . GLU B 1 83  ? 1.850   84.038  64.002  1.00 15.76  ? 83  GLU B OE2 1 
ATOM   4016  N  N   . ALA B 1 84  ? -3.510  82.237  65.264  1.00 8.27   ? 84  ALA B N   1 
ATOM   4017  C  CA  . ALA B 1 84  ? -4.748  81.903  64.587  1.00 10.07  ? 84  ALA B CA  1 
ATOM   4018  C  C   . ALA B 1 84  ? -5.247  83.264  64.170  1.00 12.80  ? 84  ALA B C   1 
ATOM   4019  O  O   . ALA B 1 84  ? -5.877  83.965  64.958  1.00 17.26  ? 84  ALA B O   1 
ATOM   4020  C  CB  . ALA B 1 84  ? -5.728  81.222  65.530  1.00 5.83   ? 84  ALA B CB  1 
ATOM   4021  N  N   . ASN B 1 85  ? -4.881  83.673  62.958  1.00 13.73  ? 85  ASN B N   1 
ATOM   4022  C  CA  . ASN B 1 85  ? -5.267  84.981  62.429  1.00 13.99  ? 85  ASN B CA  1 
ATOM   4023  C  C   . ASN B 1 85  ? -5.516  84.948  60.923  1.00 15.17  ? 85  ASN B C   1 
ATOM   4024  O  O   . ASN B 1 85  ? -5.150  83.988  60.236  1.00 16.56  ? 85  ASN B O   1 
ATOM   4025  C  CB  . ASN B 1 85  ? -4.174  86.011  62.714  1.00 13.50  ? 85  ASN B CB  1 
ATOM   4026  C  CG  . ASN B 1 85  ? -2.894  85.710  61.974  1.00 14.16  ? 85  ASN B CG  1 
ATOM   4027  O  OD1 . ASN B 1 85  ? -2.721  86.122  60.835  1.00 20.01  ? 85  ASN B OD1 1 
ATOM   4028  N  ND2 . ASN B 1 85  ? -1.989  84.987  62.614  1.00 10.86  ? 85  ASN B ND2 1 
ATOM   4029  N  N   . VAL B 1 86  ? -6.158  86.005  60.433  1.00 13.07  ? 86  VAL B N   1 
ATOM   4030  C  CA  . VAL B 1 86  ? -6.467  86.157  59.022  1.00 12.95  ? 86  VAL B CA  1 
ATOM   4031  C  C   . VAL B 1 86  ? -5.875  87.493  58.586  1.00 12.51  ? 86  VAL B C   1 
ATOM   4032  O  O   . VAL B 1 86  ? -5.936  88.467  59.336  1.00 11.66  ? 86  VAL B O   1 
ATOM   4033  C  CB  . VAL B 1 86  ? -8.006  86.135  58.747  1.00 10.97  ? 86  VAL B CB  1 
ATOM   4034  C  CG1 . VAL B 1 86  ? -8.288  86.538  57.317  1.00 13.30  ? 86  VAL B CG1 1 
ATOM   4035  C  CG2 . VAL B 1 86  ? -8.556  84.736  58.953  1.00 6.30   ? 86  VAL B CG2 1 
ATOM   4036  N  N   . GLN B 1 87  ? -5.222  87.505  57.425  1.00 13.47  ? 87  GLN B N   1 
ATOM   4037  C  CA  . GLN B 1 87  ? -4.641  88.728  56.879  1.00 14.44  ? 87  GLN B CA  1 
ATOM   4038  C  C   . GLN B 1 87  ? -5.256  88.957  55.510  1.00 14.28  ? 87  GLN B C   1 
ATOM   4039  O  O   . GLN B 1 87  ? -5.268  88.048  54.670  1.00 18.44  ? 87  GLN B O   1 
ATOM   4040  C  CB  . GLN B 1 87  ? -3.135  88.577  56.759  1.00 15.85  ? 87  GLN B CB  1 
ATOM   4041  C  CG  . GLN B 1 87  ? -2.454  88.310  58.082  1.00 22.59  ? 87  GLN B CG  1 
ATOM   4042  C  CD  . GLN B 1 87  ? -1.119  87.621  57.926  1.00 25.65  ? 87  GLN B CD  1 
ATOM   4043  O  OE1 . GLN B 1 87  ? -0.317  87.980  57.071  1.00 31.56  ? 87  GLN B OE1 1 
ATOM   4044  N  NE2 . GLN B 1 87  ? -0.871  86.624  58.757  1.00 29.23  ? 87  GLN B NE2 1 
ATOM   4045  N  N   . GLY B 1 88  ? -5.831  90.141  55.318  1.00 14.39  ? 88  GLY B N   1 
ATOM   4046  C  CA  . GLY B 1 88  ? -6.460  90.486  54.051  1.00 14.59  ? 88  GLY B CA  1 
ATOM   4047  C  C   . GLY B 1 88  ? -5.601  91.533  53.389  1.00 18.32  ? 88  GLY B C   1 
ATOM   4048  O  O   . GLY B 1 88  ? -5.409  92.607  53.960  1.00 17.59  ? 88  GLY B O   1 
ATOM   4049  N  N   . LYS B 1 89  ? -5.030  91.214  52.229  1.00 20.49  ? 89  LYS B N   1 
ATOM   4050  C  CA  . LYS B 1 89  ? -4.154  92.153  51.522  1.00 22.49  ? 89  LYS B CA  1 
ATOM   4051  C  C   . LYS B 1 89  ? -4.911  92.909  50.463  1.00 21.04  ? 89  LYS B C   1 
ATOM   4052  O  O   . LYS B 1 89  ? -5.729  92.327  49.760  1.00 19.72  ? 89  LYS B O   1 
ATOM   4053  C  CB  . LYS B 1 89  ? -2.995  91.424  50.831  1.00 29.11  ? 89  LYS B CB  1 
ATOM   4054  C  CG  . LYS B 1 89  ? -2.079  90.591  51.732  1.00 42.76  ? 89  LYS B CG  1 
ATOM   4055  C  CD  . LYS B 1 89  ? -2.648  89.192  52.025  1.00 50.47  ? 89  LYS B CD  1 
ATOM   4056  C  CE  . LYS B 1 89  ? -1.703  88.352  52.895  1.00 55.19  ? 89  LYS B CE  1 
ATOM   4057  N  NZ  . LYS B 1 89  ? -0.436  87.949  52.211  1.00 59.88  ? 89  LYS B NZ  1 
ATOM   4058  N  N   . ASN B 1 90  ? -4.626  94.202  50.348  1.00 22.38  ? 90  ASN B N   1 
ATOM   4059  C  CA  . ASN B 1 90  ? -5.250  95.060  49.343  1.00 27.68  ? 90  ASN B CA  1 
ATOM   4060  C  C   . ASN B 1 90  ? -6.754  95.159  49.367  1.00 27.69  ? 90  ASN B C   1 
ATOM   4061  O  O   . ASN B 1 90  ? -7.379  95.265  48.315  1.00 33.26  ? 90  ASN B O   1 
ATOM   4062  C  CB  . ASN B 1 90  ? -4.834  94.632  47.940  1.00 34.13  ? 90  ASN B CB  1 
ATOM   4063  C  CG  . ASN B 1 90  ? -3.481  95.130  47.574  1.00 43.15  ? 90  ASN B CG  1 
ATOM   4064  O  OD1 . ASN B 1 90  ? -3.259  96.340  47.490  1.00 51.44  ? 90  ASN B OD1 1 
ATOM   4065  N  ND2 . ASN B 1 90  ? -2.548  94.211  47.369  1.00 46.59  ? 90  ASN B ND2 1 
ATOM   4066  N  N   . LEU B 1 91  ? -7.347  95.177  50.549  1.00 25.52  ? 91  LEU B N   1 
ATOM   4067  C  CA  . LEU B 1 91  ? -8.799  95.258  50.646  1.00 25.24  ? 91  LEU B CA  1 
ATOM   4068  C  C   . LEU B 1 91  ? -9.284  96.690  50.786  1.00 25.68  ? 91  LEU B C   1 
ATOM   4069  O  O   . LEU B 1 91  ? -10.435 96.988  50.469  1.00 27.77  ? 91  LEU B O   1 
ATOM   4070  C  CB  . LEU B 1 91  ? -9.307  94.410  51.816  1.00 25.31  ? 91  LEU B CB  1 
ATOM   4071  C  CG  . LEU B 1 91  ? -8.870  92.948  51.828  1.00 18.91  ? 91  LEU B CG  1 
ATOM   4072  C  CD1 . LEU B 1 91  ? -9.555  92.262  52.963  1.00 21.23  ? 91  LEU B CD1 1 
ATOM   4073  C  CD2 . LEU B 1 91  ? -9.231  92.286  50.532  1.00 19.94  ? 91  LEU B CD2 1 
ATOM   4074  N  N   . ILE B 1 92  ? -8.411  97.564  51.276  1.00 27.45  ? 92  ILE B N   1 
ATOM   4075  C  CA  . ILE B 1 92  ? -8.741  98.977  51.462  1.00 30.03  ? 92  ILE B CA  1 
ATOM   4076  C  C   . ILE B 1 92  ? -8.202  99.738  50.261  1.00 34.17  ? 92  ILE B C   1 
ATOM   4077  O  O   . ILE B 1 92  ? -7.010  100.038 50.200  1.00 34.24  ? 92  ILE B O   1 
ATOM   4078  C  CB  . ILE B 1 92  ? -8.080  99.553  52.730  1.00 28.99  ? 92  ILE B CB  1 
ATOM   4079  C  CG1 . ILE B 1 92  ? -8.296  98.617  53.916  1.00 26.58  ? 92  ILE B CG1 1 
ATOM   4080  C  CG2 . ILE B 1 92  ? -8.627  100.938 53.019  1.00 26.51  ? 92  ILE B CG2 1 
ATOM   4081  C  CD1 . ILE B 1 92  ? -9.733  98.350  54.227  1.00 27.56  ? 92  ILE B CD1 1 
ATOM   4082  N  N   . GLU B 1 93  ? -9.089  100.063 49.326  1.00 40.70  ? 93  GLU B N   1 
ATOM   4083  C  CA  . GLU B 1 93  ? -8.734  100.777 48.094  1.00 47.80  ? 93  GLU B CA  1 
ATOM   4084  C  C   . GLU B 1 93  ? -7.867  102.010 48.289  1.00 45.00  ? 93  GLU B C   1 
ATOM   4085  O  O   . GLU B 1 93  ? -6.858  102.174 47.613  1.00 45.90  ? 93  GLU B O   1 
ATOM   4086  C  CB  . GLU B 1 93  ? -9.988  101.182 47.312  1.00 57.81  ? 93  GLU B CB  1 
ATOM   4087  C  CG  . GLU B 1 93  ? -10.712 100.041 46.599  1.00 74.27  ? 93  GLU B CG  1 
ATOM   4088  C  CD  . GLU B 1 93  ? -11.653 99.256  47.509  1.00 84.29  ? 93  GLU B CD  1 
ATOM   4089  O  OE1 . GLU B 1 93  ? -12.361 99.896  48.330  1.00 88.84  ? 93  GLU B OE1 1 
ATOM   4090  O  OE2 . GLU B 1 93  ? -11.695 98.002  47.391  1.00 88.65  ? 93  GLU B OE2 1 
ATOM   4091  N  N   . TRP B 1 94  ? -8.256  102.865 49.226  1.00 43.93  ? 94  TRP B N   1 
ATOM   4092  C  CA  . TRP B 1 94  ? -7.521  104.095 49.492  1.00 41.49  ? 94  TRP B CA  1 
ATOM   4093  C  C   . TRP B 1 94  ? -6.223  103.939 50.277  1.00 38.88  ? 94  TRP B C   1 
ATOM   4094  O  O   . TRP B 1 94  ? -5.525  104.913 50.524  1.00 42.22  ? 94  TRP B O   1 
ATOM   4095  C  CB  . TRP B 1 94  ? -8.439  105.134 50.133  1.00 45.37  ? 94  TRP B CB  1 
ATOM   4096  C  CG  . TRP B 1 94  ? -9.242  104.619 51.263  1.00 51.07  ? 94  TRP B CG  1 
ATOM   4097  C  CD1 . TRP B 1 94  ? -10.356 103.826 51.191  1.00 54.17  ? 94  TRP B CD1 1 
ATOM   4098  C  CD2 . TRP B 1 94  ? -8.991  104.840 52.653  1.00 56.05  ? 94  TRP B CD2 1 
ATOM   4099  N  NE1 . TRP B 1 94  ? -10.808 103.532 52.455  1.00 59.18  ? 94  TRP B NE1 1 
ATOM   4100  C  CE2 . TRP B 1 94  ? -9.991  104.143 53.373  1.00 58.26  ? 94  TRP B CE2 1 
ATOM   4101  C  CE3 . TRP B 1 94  ? -8.015  105.562 53.365  1.00 59.49  ? 94  TRP B CE3 1 
ATOM   4102  C  CZ2 . TRP B 1 94  ? -10.046 104.142 54.777  1.00 61.38  ? 94  TRP B CZ2 1 
ATOM   4103  C  CZ3 . TRP B 1 94  ? -8.068  105.566 54.765  1.00 61.98  ? 94  TRP B CZ3 1 
ATOM   4104  C  CH2 . TRP B 1 94  ? -9.079  104.857 55.454  1.00 63.26  ? 94  TRP B CH2 1 
ATOM   4105  N  N   . LEU B 1 95  ? -5.913  102.718 50.690  1.00 34.31  ? 95  LEU B N   1 
ATOM   4106  C  CA  . LEU B 1 95  ? -4.672  102.437 51.393  1.00 31.32  ? 95  LEU B CA  1 
ATOM   4107  C  C   . LEU B 1 95  ? -4.113  101.253 50.642  1.00 33.76  ? 95  LEU B C   1 
ATOM   4108  O  O   . LEU B 1 95  ? -3.996  100.165 51.186  1.00 35.44  ? 95  LEU B O   1 
ATOM   4109  C  CB  . LEU B 1 95  ? -4.941  102.052 52.834  1.00 27.27  ? 95  LEU B CB  1 
ATOM   4110  C  CG  . LEU B 1 95  ? -5.426  103.193 53.705  1.00 25.00  ? 95  LEU B CG  1 
ATOM   4111  C  CD1 . LEU B 1 95  ? -5.687  102.671 55.095  1.00 23.98  ? 95  LEU B CD1 1 
ATOM   4112  C  CD2 . LEU B 1 95  ? -4.386  104.291 53.723  1.00 22.45  ? 95  LEU B CD2 1 
ATOM   4113  N  N   . PRO B 1 96  ? -3.791  101.446 49.355  1.00 35.62  ? 96  PRO B N   1 
ATOM   4114  C  CA  . PRO B 1 96  ? -3.252  100.389 48.501  1.00 32.87  ? 96  PRO B CA  1 
ATOM   4115  C  C   . PRO B 1 96  ? -1.999  99.729  49.057  1.00 31.23  ? 96  PRO B C   1 
ATOM   4116  O  O   . PRO B 1 96  ? -1.071  100.410 49.510  1.00 32.99  ? 96  PRO B O   1 
ATOM   4117  C  CB  . PRO B 1 96  ? -2.972  101.127 47.197  1.00 34.53  ? 96  PRO B CB  1 
ATOM   4118  C  CG  . PRO B 1 96  ? -2.599  102.486 47.672  1.00 35.08  ? 96  PRO B CG  1 
ATOM   4119  C  CD  . PRO B 1 96  ? -3.669  102.753 48.687  1.00 34.86  ? 96  PRO B CD  1 
ATOM   4120  N  N   . GLY B 1 97  ? -1.985  98.398  48.996  1.00 29.60  ? 97  GLY B N   1 
ATOM   4121  C  CA  . GLY B 1 97  ? -0.859  97.618  49.487  1.00 27.39  ? 97  GLY B CA  1 
ATOM   4122  C  C   . GLY B 1 97  ? -0.877  97.248  50.966  1.00 25.09  ? 97  GLY B C   1 
ATOM   4123  O  O   . GLY B 1 97  ? -0.147  96.346  51.379  1.00 29.42  ? 97  GLY B O   1 
ATOM   4124  N  N   . SER B 1 98  ? -1.708  97.922  51.757  1.00 23.22  ? 98  SER B N   1 
ATOM   4125  C  CA  . SER B 1 98  ? -1.789  97.654  53.183  1.00 22.73  ? 98  SER B CA  1 
ATOM   4126  C  C   . SER B 1 98  ? -2.515  96.347  53.443  1.00 21.39  ? 98  SER B C   1 
ATOM   4127  O  O   . SER B 1 98  ? -3.319  95.902  52.625  1.00 23.72  ? 98  SER B O   1 
ATOM   4128  C  CB  . SER B 1 98  ? -2.517  98.787  53.882  1.00 19.80  ? 98  SER B CB  1 
ATOM   4129  O  OG  . SER B 1 98  ? -3.858  98.821  53.449  1.00 24.43  ? 98  SER B OG  1 
ATOM   4130  N  N   . THR B 1 99  ? -2.214  95.734  54.582  1.00 20.11  ? 99  THR B N   1 
ATOM   4131  C  CA  . THR B 1 99  ? -2.825  94.480  55.001  1.00 17.90  ? 99  THR B CA  1 
ATOM   4132  C  C   . THR B 1 99  ? -3.559  94.707  56.323  1.00 19.68  ? 99  THR B C   1 
ATOM   4133  O  O   . THR B 1 99  ? -3.021  95.368  57.223  1.00 22.84  ? 99  THR B O   1 
ATOM   4134  C  CB  . THR B 1 99  ? -1.747  93.426  55.243  1.00 16.67  ? 99  THR B CB  1 
ATOM   4135  O  OG1 . THR B 1 99  ? -1.056  93.148  54.018  1.00 26.91  ? 99  THR B OG1 1 
ATOM   4136  C  CG2 . THR B 1 99  ? -2.348  92.164  55.783  1.00 17.69  ? 99  THR B CG2 1 
ATOM   4137  N  N   . ILE B 1 100 ? -4.803  94.251  56.419  1.00 17.08  ? 100 ILE B N   1 
ATOM   4138  C  CA  . ILE B 1 100 ? -5.538  94.377  57.672  1.00 15.06  ? 100 ILE B CA  1 
ATOM   4139  C  C   . ILE B 1 100 ? -5.568  92.972  58.243  1.00 14.45  ? 100 ILE B C   1 
ATOM   4140  O  O   . ILE B 1 100 ? -5.609  92.000  57.500  1.00 16.02  ? 100 ILE B O   1 
ATOM   4141  C  CB  . ILE B 1 100 ? -6.966  94.918  57.491  1.00 15.04  ? 100 ILE B CB  1 
ATOM   4142  C  CG1 . ILE B 1 100 ? -7.783  94.024  56.570  1.00 16.61  ? 100 ILE B CG1 1 
ATOM   4143  C  CG2 . ILE B 1 100 ? -6.922  96.311  56.920  1.00 19.93  ? 100 ILE B CG2 1 
ATOM   4144  C  CD1 . ILE B 1 100 ? -9.219  94.433  56.476  1.00 16.17  ? 100 ILE B CD1 1 
ATOM   4145  N  N   . TRP B 1 101 ? -5.488  92.843  59.554  1.00 16.05  ? 101 TRP B N   1 
ATOM   4146  C  CA  . TRP B 1 101 ? -5.488  91.510  60.157  1.00 14.14  ? 101 TRP B CA  1 
ATOM   4147  C  C   . TRP B 1 101 ? -6.080  91.538  61.561  1.00 13.10  ? 101 TRP B C   1 
ATOM   4148  O  O   . TRP B 1 101 ? -6.101  92.586  62.209  1.00 15.58  ? 101 TRP B O   1 
ATOM   4149  C  CB  . TRP B 1 101 ? -4.052  90.986  60.221  1.00 10.38  ? 101 TRP B CB  1 
ATOM   4150  C  CG  . TRP B 1 101 ? -3.181  91.847  61.054  1.00 11.63  ? 101 TRP B CG  1 
ATOM   4151  C  CD1 . TRP B 1 101 ? -2.538  92.994  60.673  1.00 10.52  ? 101 TRP B CD1 1 
ATOM   4152  C  CD2 . TRP B 1 101 ? -2.877  91.654  62.433  1.00 13.57  ? 101 TRP B CD2 1 
ATOM   4153  N  NE1 . TRP B 1 101 ? -1.848  93.526  61.733  1.00 11.32  ? 101 TRP B NE1 1 
ATOM   4154  C  CE2 . TRP B 1 101 ? -2.036  92.726  62.830  1.00 14.22  ? 101 TRP B CE2 1 
ATOM   4155  C  CE3 . TRP B 1 101 ? -3.232  90.679  63.379  1.00 9.71   ? 101 TRP B CE3 1 
ATOM   4156  C  CZ2 . TRP B 1 101 ? -1.537  92.850  64.145  1.00 18.08  ? 101 TRP B CZ2 1 
ATOM   4157  C  CZ3 . TRP B 1 101 ? -2.738  90.798  64.687  1.00 14.29  ? 101 TRP B CZ3 1 
ATOM   4158  C  CH2 . TRP B 1 101 ? -1.896  91.880  65.055  1.00 14.56  ? 101 TRP B CH2 1 
ATOM   4159  N  N   . ALA B 1 102 ? -6.556  90.384  62.015  1.00 11.92  ? 102 ALA B N   1 
ATOM   4160  C  CA  . ALA B 1 102 ? -7.120  90.226  63.351  1.00 9.08   ? 102 ALA B CA  1 
ATOM   4161  C  C   . ALA B 1 102 ? -6.891  88.778  63.760  1.00 10.77  ? 102 ALA B C   1 
ATOM   4162  O  O   . ALA B 1 102 ? -6.911  87.891  62.914  1.00 12.06  ? 102 ALA B O   1 
ATOM   4163  C  CB  . ALA B 1 102 ? -8.613  90.549  63.360  1.00 7.77   ? 102 ALA B CB  1 
ATOM   4164  N  N   . GLY B 1 103 ? -6.603  88.560  65.042  1.00 11.71  ? 103 GLY B N   1 
ATOM   4165  C  CA  . GLY B 1 103 ? -6.382  87.222  65.573  1.00 10.22  ? 103 GLY B CA  1 
ATOM   4166  C  C   . GLY B 1 103 ? -5.080  87.141  66.338  1.00 12.70  ? 103 GLY B C   1 
ATOM   4167  O  O   . GLY B 1 103 ? -4.386  88.144  66.483  1.00 16.40  ? 103 GLY B O   1 
ATOM   4168  N  N   . LYS B 1 104 ? -4.747  85.965  66.854  1.00 11.35  ? 104 LYS B N   1 
ATOM   4169  C  CA  . LYS B 1 104 ? -3.489  85.817  67.573  1.00 11.08  ? 104 LYS B CA  1 
ATOM   4170  C  C   . LYS B 1 104 ? -2.412  85.756  66.506  1.00 12.10  ? 104 LYS B C   1 
ATOM   4171  O  O   . LYS B 1 104 ? -2.509  84.968  65.561  1.00 11.27  ? 104 LYS B O   1 
ATOM   4172  C  CB  . LYS B 1 104 ? -3.479  84.541  68.423  1.00 9.55   ? 104 LYS B CB  1 
ATOM   4173  C  CG  . LYS B 1 104 ? -4.532  84.521  69.547  1.00 7.77   ? 104 LYS B CG  1 
ATOM   4174  C  CD  . LYS B 1 104 ? -4.272  83.411  70.551  1.00 2.36   ? 104 LYS B CD  1 
ATOM   4175  C  CE  . LYS B 1 104 ? -2.953  83.599  71.262  1.00 2.69   ? 104 LYS B CE  1 
ATOM   4176  N  NZ  . LYS B 1 104 ? -2.743  82.484  72.217  1.00 8.58   ? 104 LYS B NZ  1 
ATOM   4177  N  N   . ARG B 1 105 ? -1.359  86.542  66.675  1.00 12.54  ? 105 ARG B N   1 
ATOM   4178  C  CA  . ARG B 1 105 ? -0.323  86.558  65.672  1.00 10.07  ? 105 ARG B CA  1 
ATOM   4179  C  C   . ARG B 1 105 ? 1.037   86.989  66.161  1.00 12.72  ? 105 ARG B C   1 
ATOM   4180  O  O   . ARG B 1 105 ? 1.139   87.836  67.038  1.00 17.28  ? 105 ARG B O   1 
ATOM   4181  C  CB  . ARG B 1 105 ? -0.779  87.491  64.549  1.00 12.50  ? 105 ARG B CB  1 
ATOM   4182  C  CG  . ARG B 1 105 ? 0.283   87.857  63.569  1.00 11.74  ? 105 ARG B CG  1 
ATOM   4183  C  CD  . ARG B 1 105 ? -0.256  88.762  62.502  1.00 11.40  ? 105 ARG B CD  1 
ATOM   4184  N  NE  . ARG B 1 105 ? 0.806   89.064  61.561  1.00 17.58  ? 105 ARG B NE  1 
ATOM   4185  C  CZ  . ARG B 1 105 ? 0.792   90.068  60.695  1.00 16.45  ? 105 ARG B CZ  1 
ATOM   4186  N  NH1 . ARG B 1 105 ? -0.243  90.893  60.635  1.00 19.00  ? 105 ARG B NH1 1 
ATOM   4187  N  NH2 . ARG B 1 105 ? 1.835   90.249  59.900  1.00 18.04  ? 105 ARG B NH2 1 
ATOM   4188  N  N   . PHE B 1 106 ? 2.081   86.355  65.637  1.00 12.55  ? 106 PHE B N   1 
ATOM   4189  C  CA  . PHE B 1 106 ? 3.443   86.757  65.951  1.00 11.56  ? 106 PHE B CA  1 
ATOM   4190  C  C   . PHE B 1 106 ? 3.593   88.022  65.083  1.00 13.67  ? 106 PHE B C   1 
ATOM   4191  O  O   . PHE B 1 106 ? 3.759   87.940  63.869  1.00 18.08  ? 106 PHE B O   1 
ATOM   4192  C  CB  . PHE B 1 106 ? 4.459   85.713  65.478  1.00 8.26   ? 106 PHE B CB  1 
ATOM   4193  C  CG  . PHE B 1 106 ? 4.556   84.491  66.353  1.00 12.04  ? 106 PHE B CG  1 
ATOM   4194  C  CD1 . PHE B 1 106 ? 3.888   84.424  67.569  1.00 10.48  ? 106 PHE B CD1 1 
ATOM   4195  C  CD2 . PHE B 1 106 ? 5.344   83.414  65.960  1.00 6.58   ? 106 PHE B CD2 1 
ATOM   4196  C  CE1 . PHE B 1 106 ? 4.009   83.308  68.371  1.00 12.33  ? 106 PHE B CE1 1 
ATOM   4197  C  CE2 . PHE B 1 106 ? 5.472   82.287  66.758  1.00 9.36   ? 106 PHE B CE2 1 
ATOM   4198  C  CZ  . PHE B 1 106 ? 4.806   82.230  67.967  1.00 10.16  ? 106 PHE B CZ  1 
ATOM   4199  N  N   . TYR B 1 107 ? 3.511   89.191  65.694  1.00 13.72  ? 107 TYR B N   1 
ATOM   4200  C  CA  . TYR B 1 107 ? 3.590   90.431  64.940  1.00 10.88  ? 107 TYR B CA  1 
ATOM   4201  C  C   . TYR B 1 107 ? 4.961   91.085  64.869  1.00 13.43  ? 107 TYR B C   1 
ATOM   4202  O  O   . TYR B 1 107 ? 5.480   91.562  65.882  1.00 14.07  ? 107 TYR B O   1 
ATOM   4203  C  CB  . TYR B 1 107 ? 2.613   91.426  65.534  1.00 11.05  ? 107 TYR B CB  1 
ATOM   4204  C  CG  . TYR B 1 107 ? 2.566   92.720  64.781  1.00 13.18  ? 107 TYR B CG  1 
ATOM   4205  C  CD1 . TYR B 1 107 ? 1.925   92.788  63.548  1.00 11.82  ? 107 TYR B CD1 1 
ATOM   4206  C  CD2 . TYR B 1 107 ? 3.135   93.882  65.302  1.00 8.74   ? 107 TYR B CD2 1 
ATOM   4207  C  CE1 . TYR B 1 107 ? 1.850   93.964  62.856  1.00 12.03  ? 107 TYR B CE1 1 
ATOM   4208  C  CE2 . TYR B 1 107 ? 3.054   95.074  64.602  1.00 12.13  ? 107 TYR B CE2 1 
ATOM   4209  C  CZ  . TYR B 1 107 ? 2.410   95.098  63.384  1.00 13.00  ? 107 TYR B CZ  1 
ATOM   4210  O  OH  . TYR B 1 107 ? 2.314   96.249  62.669  1.00 14.23  ? 107 TYR B OH  1 
ATOM   4211  N  N   . GLN B 1 108 ? 5.515   91.146  63.659  1.00 13.19  ? 108 GLN B N   1 
ATOM   4212  C  CA  . GLN B 1 108 ? 6.814   91.769  63.380  1.00 9.51   ? 108 GLN B CA  1 
ATOM   4213  C  C   . GLN B 1 108 ? 7.854   91.704  64.492  1.00 13.11  ? 108 GLN B C   1 
ATOM   4214  O  O   . GLN B 1 108 ? 8.375   92.730  64.930  1.00 16.11  ? 108 GLN B O   1 
ATOM   4215  C  CB  . GLN B 1 108 ? 6.606   93.218  62.968  1.00 10.20  ? 108 GLN B CB  1 
ATOM   4216  C  CG  . GLN B 1 108 ? 5.715   93.376  61.765  1.00 11.19  ? 108 GLN B CG  1 
ATOM   4217  C  CD  . GLN B 1 108 ? 5.647   94.807  61.285  1.00 14.33  ? 108 GLN B CD  1 
ATOM   4218  O  OE1 . GLN B 1 108 ? 6.509   95.618  61.605  1.00 18.28  ? 108 GLN B OE1 1 
ATOM   4219  N  NE2 . GLN B 1 108 ? 4.626   95.122  60.503  1.00 13.20  ? 108 GLN B NE2 1 
ATOM   4220  N  N   . ARG B 1 109 ? 8.186   90.488  64.906  1.00 14.03  ? 109 ARG B N   1 
ATOM   4221  C  CA  . ARG B 1 109 ? 9.152   90.260  65.969  1.00 13.48  ? 109 ARG B CA  1 
ATOM   4222  C  C   . ARG B 1 109 ? 10.587  90.530  65.509  1.00 13.95  ? 109 ARG B C   1 
ATOM   4223  O  O   . ARG B 1 109 ? 10.932  90.264  64.359  1.00 18.66  ? 109 ARG B O   1 
ATOM   4224  C  CB  . ARG B 1 109 ? 9.022   88.804  66.461  1.00 10.43  ? 109 ARG B CB  1 
ATOM   4225  C  CG  . ARG B 1 109 ? 7.599   88.419  66.885  1.00 7.87   ? 109 ARG B CG  1 
ATOM   4226  C  CD  . ARG B 1 109 ? 7.544   87.031  67.466  1.00 9.76   ? 109 ARG B CD  1 
ATOM   4227  N  NE  . ARG B 1 109 ? 8.037   86.017  66.540  1.00 13.33  ? 109 ARG B NE  1 
ATOM   4228  C  CZ  . ARG B 1 109 ? 8.270   84.747  66.872  1.00 16.56  ? 109 ARG B CZ  1 
ATOM   4229  N  NH1 . ARG B 1 109 ? 8.054   84.334  68.110  1.00 17.95  ? 109 ARG B NH1 1 
ATOM   4230  N  NH2 . ARG B 1 109 ? 8.730   83.893  65.970  1.00 14.22  ? 109 ARG B NH2 1 
ATOM   4231  N  N   . HIS B 1 110 ? 11.411  91.080  66.397  1.00 12.84  ? 110 HIS B N   1 
ATOM   4232  C  CA  . HIS B 1 110 ? 12.820  91.346  66.100  1.00 8.43   ? 110 HIS B CA  1 
ATOM   4233  C  C   . HIS B 1 110 ? 13.607  90.577  67.152  1.00 12.16  ? 110 HIS B C   1 
ATOM   4234  O  O   . HIS B 1 110 ? 13.363  90.756  68.344  1.00 15.25  ? 110 HIS B O   1 
ATOM   4235  C  CB  . HIS B 1 110 ? 13.156  92.835  66.234  1.00 9.91   ? 110 HIS B CB  1 
ATOM   4236  C  CG  . HIS B 1 110 ? 12.512  93.713  65.209  1.00 8.28   ? 110 HIS B CG  1 
ATOM   4237  N  ND1 . HIS B 1 110 ? 13.219  94.658  64.499  1.00 10.61  ? 110 HIS B ND1 1 
ATOM   4238  C  CD2 . HIS B 1 110 ? 11.221  93.839  64.819  1.00 7.72   ? 110 HIS B CD2 1 
ATOM   4239  C  CE1 . HIS B 1 110 ? 12.393  95.334  63.720  1.00 12.67  ? 110 HIS B CE1 1 
ATOM   4240  N  NE2 . HIS B 1 110 ? 11.174  94.856  63.894  1.00 9.32   ? 110 HIS B NE2 1 
ATOM   4241  N  N   . ASP B 1 111 ? 14.583  89.780  66.728  1.00 12.80  ? 111 ASP B N   1 
ATOM   4242  C  CA  . ASP B 1 111 ? 15.364  88.982  67.663  1.00 12.00  ? 111 ASP B CA  1 
ATOM   4243  C  C   . ASP B 1 111 ? 16.811  88.822  67.222  1.00 11.32  ? 111 ASP B C   1 
ATOM   4244  O  O   . ASP B 1 111 ? 17.145  89.149  66.097  1.00 15.23  ? 111 ASP B O   1 
ATOM   4245  C  CB  . ASP B 1 111 ? 14.741  87.590  67.775  1.00 14.74  ? 111 ASP B CB  1 
ATOM   4246  C  CG  . ASP B 1 111 ? 14.958  86.750  66.524  1.00 18.22  ? 111 ASP B CG  1 
ATOM   4247  O  OD1 . ASP B 1 111 ? 14.465  87.139  65.440  1.00 21.10  ? 111 ASP B OD1 1 
ATOM   4248  O  OD2 . ASP B 1 111 ? 15.645  85.711  66.622  1.00 19.31  ? 111 ASP B OD2 1 
ATOM   4249  N  N   . VAL B 1 112 ? 17.653  88.305  68.114  1.00 11.36  ? 112 VAL B N   1 
ATOM   4250  C  CA  . VAL B 1 112 ? 19.063  88.037  67.830  1.00 11.03  ? 112 VAL B CA  1 
ATOM   4251  C  C   . VAL B 1 112 ? 19.187  86.513  67.900  1.00 13.03  ? 112 VAL B C   1 
ATOM   4252  O  O   . VAL B 1 112 ? 19.176  85.936  68.980  1.00 19.11  ? 112 VAL B O   1 
ATOM   4253  C  CB  . VAL B 1 112 ? 19.985  88.677  68.878  1.00 11.02  ? 112 VAL B CB  1 
ATOM   4254  C  CG1 . VAL B 1 112 ? 21.419  88.350  68.559  1.00 7.48   ? 112 VAL B CG1 1 
ATOM   4255  C  CG2 . VAL B 1 112 ? 19.793  90.187  68.886  1.00 11.96  ? 112 VAL B CG2 1 
ATOM   4256  N  N   . HIS B 1 113 ? 19.316  85.859  66.757  1.00 12.09  ? 113 HIS B N   1 
ATOM   4257  C  CA  . HIS B 1 113 ? 19.361  84.413  66.743  1.00 9.90   ? 113 HIS B CA  1 
ATOM   4258  C  C   . HIS B 1 113 ? 20.303  83.716  67.702  1.00 12.61  ? 113 HIS B C   1 
ATOM   4259  O  O   . HIS B 1 113 ? 19.872  82.839  68.456  1.00 12.61  ? 113 HIS B O   1 
ATOM   4260  C  CB  . HIS B 1 113 ? 19.601  83.858  65.332  1.00 7.84   ? 113 HIS B CB  1 
ATOM   4261  C  CG  . HIS B 1 113 ? 19.732  82.364  65.301  1.00 8.48   ? 113 HIS B CG  1 
ATOM   4262  N  ND1 . HIS B 1 113 ? 18.649  81.514  65.393  1.00 8.85   ? 113 HIS B ND1 1 
ATOM   4263  C  CD2 . HIS B 1 113 ? 20.827  81.568  65.293  1.00 5.12   ? 113 HIS B CD2 1 
ATOM   4264  C  CE1 . HIS B 1 113 ? 19.070  80.265  65.451  1.00 9.29   ? 113 HIS B CE1 1 
ATOM   4265  N  NE2 . HIS B 1 113 ? 20.388  80.271  65.392  1.00 8.36   ? 113 HIS B NE2 1 
ATOM   4266  N  N   . MET B 1 114 ? 21.576  84.092  67.702  1.00 12.13  ? 114 MET B N   1 
ATOM   4267  C  CA  . MET B 1 114 ? 22.527  83.369  68.534  1.00 11.69  ? 114 MET B CA  1 
ATOM   4268  C  C   . MET B 1 114 ? 22.307  83.345  70.043  1.00 14.72  ? 114 MET B C   1 
ATOM   4269  O  O   . MET B 1 114 ? 22.845  82.470  70.724  1.00 17.43  ? 114 MET B O   1 
ATOM   4270  C  CB  . MET B 1 114 ? 23.978  83.717  68.177  1.00 13.03  ? 114 MET B CB  1 
ATOM   4271  C  CG  . MET B 1 114 ? 24.356  85.159  68.348  1.00 11.73  ? 114 MET B CG  1 
ATOM   4272  S  SD  . MET B 1 114 ? 26.082  85.389  67.930  1.00 17.34  ? 114 MET B SD  1 
ATOM   4273  C  CE  . MET B 1 114 ? 26.865  84.238  68.985  1.00 10.52  ? 114 MET B CE  1 
ATOM   4274  N  N   . ILE B 1 115 ? 21.545  84.297  70.576  1.00 13.95  ? 115 ILE B N   1 
ATOM   4275  C  CA  . ILE B 1 115 ? 21.264  84.299  72.008  1.00 12.54  ? 115 ILE B CA  1 
ATOM   4276  C  C   . ILE B 1 115 ? 19.775  84.049  72.207  1.00 15.04  ? 115 ILE B C   1 
ATOM   4277  O  O   . ILE B 1 115 ? 19.272  84.130  73.324  1.00 19.06  ? 115 ILE B O   1 
ATOM   4278  C  CB  . ILE B 1 115 ? 21.693  85.622  72.726  1.00 10.13  ? 115 ILE B CB  1 
ATOM   4279  C  CG1 . ILE B 1 115 ? 21.254  86.855  71.949  1.00 10.57  ? 115 ILE B CG1 1 
ATOM   4280  C  CG2 . ILE B 1 115 ? 23.179  85.661  72.917  1.00 11.38  ? 115 ILE B CG2 1 
ATOM   4281  C  CD1 . ILE B 1 115 ? 21.523  88.137  72.681  1.00 8.21   ? 115 ILE B CD1 1 
ATOM   4282  N  N   . ASP B 1 116 ? 19.080  83.759  71.109  1.00 13.84  ? 116 ASP B N   1 
ATOM   4283  C  CA  . ASP B 1 116 ? 17.640  83.499  71.109  1.00 13.12  ? 116 ASP B CA  1 
ATOM   4284  C  C   . ASP B 1 116 ? 16.921  84.573  71.905  1.00 13.03  ? 116 ASP B C   1 
ATOM   4285  O  O   . ASP B 1 116 ? 16.002  84.283  72.656  1.00 16.42  ? 116 ASP B O   1 
ATOM   4286  C  CB  . ASP B 1 116 ? 17.367  82.121  71.703  1.00 9.09   ? 116 ASP B CB  1 
ATOM   4287  C  CG  . ASP B 1 116 ? 15.983  81.598  71.370  1.00 13.09  ? 116 ASP B CG  1 
ATOM   4288  O  OD1 . ASP B 1 116 ? 15.253  82.235  70.570  1.00 12.46  ? 116 ASP B OD1 1 
ATOM   4289  O  OD2 . ASP B 1 116 ? 15.625  80.535  71.914  1.00 12.78  ? 116 ASP B OD2 1 
ATOM   4290  N  N   . PHE B 1 117 ? 17.279  85.821  71.648  1.00 13.25  ? 117 PHE B N   1 
ATOM   4291  C  CA  . PHE B 1 117 ? 16.746  86.957  72.374  1.00 12.44  ? 117 PHE B CA  1 
ATOM   4292  C  C   . PHE B 1 117 ? 15.882  87.854  71.525  1.00 14.78  ? 117 PHE B C   1 
ATOM   4293  O  O   . PHE B 1 117 ? 16.364  88.432  70.552  1.00 17.64  ? 117 PHE B O   1 
ATOM   4294  C  CB  . PHE B 1 117 ? 17.937  87.772  72.913  1.00 13.26  ? 117 PHE B CB  1 
ATOM   4295  C  CG  . PHE B 1 117 ? 17.555  88.918  73.795  1.00 12.99  ? 117 PHE B CG  1 
ATOM   4296  C  CD1 . PHE B 1 117 ? 17.097  88.690  75.094  1.00 12.85  ? 117 PHE B CD1 1 
ATOM   4297  C  CD2 . PHE B 1 117 ? 17.645  90.222  73.331  1.00 15.08  ? 117 PHE B CD2 1 
ATOM   4298  C  CE1 . PHE B 1 117 ? 16.729  89.750  75.917  1.00 9.75   ? 117 PHE B CE1 1 
ATOM   4299  C  CE2 . PHE B 1 117 ? 17.278  91.289  74.147  1.00 17.22  ? 117 PHE B CE2 1 
ATOM   4300  C  CZ  . PHE B 1 117 ? 16.817  91.049  75.444  1.00 8.18   ? 117 PHE B CZ  1 
ATOM   4301  N  N   . TYR B 1 118 ? 14.623  88.010  71.916  1.00 14.95  ? 118 TYR B N   1 
ATOM   4302  C  CA  . TYR B 1 118 ? 13.685  88.881  71.212  1.00 13.25  ? 118 TYR B CA  1 
ATOM   4303  C  C   . TYR B 1 118 ? 13.722  90.251  71.878  1.00 16.55  ? 118 TYR B C   1 
ATOM   4304  O  O   . TYR B 1 118 ? 13.577  90.357  73.092  1.00 21.13  ? 118 TYR B O   1 
ATOM   4305  C  CB  . TYR B 1 118 ? 12.264  88.300  71.285  1.00 13.06  ? 118 TYR B CB  1 
ATOM   4306  C  CG  . TYR B 1 118 ? 12.041  87.147  70.340  1.00 13.45  ? 118 TYR B CG  1 
ATOM   4307  C  CD1 . TYR B 1 118 ? 12.584  85.895  70.596  1.00 14.09  ? 118 TYR B CD1 1 
ATOM   4308  C  CD2 . TYR B 1 118 ? 11.367  87.330  69.144  1.00 13.91  ? 118 TYR B CD2 1 
ATOM   4309  C  CE1 . TYR B 1 118 ? 12.472  84.866  69.682  1.00 15.28  ? 118 TYR B CE1 1 
ATOM   4310  C  CE2 . TYR B 1 118 ? 11.249  86.306  68.224  1.00 13.83  ? 118 TYR B CE2 1 
ATOM   4311  C  CZ  . TYR B 1 118 ? 11.804  85.083  68.497  1.00 15.70  ? 118 TYR B CZ  1 
ATOM   4312  O  OH  . TYR B 1 118 ? 11.707  84.084  67.569  1.00 18.50  ? 118 TYR B OH  1 
ATOM   4313  N  N   . TYR B 1 119 ? 13.918  91.305  71.105  1.00 16.24  ? 119 TYR B N   1 
ATOM   4314  C  CA  . TYR B 1 119 ? 13.969  92.623  71.711  1.00 14.48  ? 119 TYR B CA  1 
ATOM   4315  C  C   . TYR B 1 119 ? 12.809  93.506  71.339  1.00 15.14  ? 119 TYR B C   1 
ATOM   4316  O  O   . TYR B 1 119 ? 12.677  94.615  71.840  1.00 20.20  ? 119 TYR B O   1 
ATOM   4317  C  CB  . TYR B 1 119 ? 15.311  93.310  71.444  1.00 13.13  ? 119 TYR B CB  1 
ATOM   4318  C  CG  . TYR B 1 119 ? 15.702  93.384  70.006  1.00 12.33  ? 119 TYR B CG  1 
ATOM   4319  C  CD1 . TYR B 1 119 ? 16.434  92.358  69.420  1.00 13.84  ? 119 TYR B CD1 1 
ATOM   4320  C  CD2 . TYR B 1 119 ? 15.362  94.492  69.228  1.00 15.57  ? 119 TYR B CD2 1 
ATOM   4321  C  CE1 . TYR B 1 119 ? 16.823  92.427  68.097  1.00 12.99  ? 119 TYR B CE1 1 
ATOM   4322  C  CE2 . TYR B 1 119 ? 15.744  94.581  67.896  1.00 12.12  ? 119 TYR B CE2 1 
ATOM   4323  C  CZ  . TYR B 1 119 ? 16.476  93.544  67.340  1.00 17.26  ? 119 TYR B CZ  1 
ATOM   4324  O  OH  . TYR B 1 119 ? 16.887  93.625  66.033  1.00 17.52  ? 119 TYR B OH  1 
ATOM   4325  N  N   . TRP B 1 120 ? 11.964  93.029  70.446  1.00 12.40  ? 120 TRP B N   1 
ATOM   4326  C  CA  . TRP B 1 120 ? 10.795  93.798  70.065  1.00 10.57  ? 120 TRP B CA  1 
ATOM   4327  C  C   . TRP B 1 120 ? 9.799   92.715  69.712  1.00 14.19  ? 120 TRP B C   1 
ATOM   4328  O  O   . TRP B 1 120 ? 9.923   92.054  68.682  1.00 17.40  ? 120 TRP B O   1 
ATOM   4329  C  CB  . TRP B 1 120 ? 11.117  94.706  68.886  1.00 11.23  ? 120 TRP B CB  1 
ATOM   4330  C  CG  . TRP B 1 120 ? 10.156  95.850  68.721  1.00 14.59  ? 120 TRP B CG  1 
ATOM   4331  C  CD1 . TRP B 1 120 ? 9.082   96.141  69.511  1.00 13.70  ? 120 TRP B CD1 1 
ATOM   4332  C  CD2 . TRP B 1 120 ? 10.180  96.851  67.690  1.00 16.65  ? 120 TRP B CD2 1 
ATOM   4333  N  NE1 . TRP B 1 120 ? 8.431   97.259  69.038  1.00 15.56  ? 120 TRP B NE1 1 
ATOM   4334  C  CE2 . TRP B 1 120 ? 9.087   97.719  67.924  1.00 18.24  ? 120 TRP B CE2 1 
ATOM   4335  C  CE3 . TRP B 1 120 ? 11.021  97.100  66.590  1.00 17.86  ? 120 TRP B CE3 1 
ATOM   4336  C  CZ2 . TRP B 1 120 ? 8.813   98.822  67.097  1.00 18.24  ? 120 TRP B CZ2 1 
ATOM   4337  C  CZ3 . TRP B 1 120 ? 10.748  98.197  65.771  1.00 15.88  ? 120 TRP B CZ3 1 
ATOM   4338  C  CH2 . TRP B 1 120 ? 9.653   99.043  66.032  1.00 15.57  ? 120 TRP B CH2 1 
ATOM   4339  N  N   . ASP B 1 121 ? 8.883   92.453  70.633  1.00 14.24  ? 121 ASP B N   1 
ATOM   4340  C  CA  . ASP B 1 121 ? 7.907   91.399  70.455  1.00 11.26  ? 121 ASP B CA  1 
ATOM   4341  C  C   . ASP B 1 121 ? 6.628   91.679  71.215  1.00 13.54  ? 121 ASP B C   1 
ATOM   4342  O  O   . ASP B 1 121 ? 6.538   91.419  72.420  1.00 16.40  ? 121 ASP B O   1 
ATOM   4343  C  CB  . ASP B 1 121 ? 8.530   90.083  70.929  1.00 10.64  ? 121 ASP B CB  1 
ATOM   4344  C  CG  . ASP B 1 121 ? 7.559   88.907  70.892  1.00 15.48  ? 121 ASP B CG  1 
ATOM   4345  O  OD1 . ASP B 1 121 ? 6.499   88.998  70.254  1.00 15.82  ? 121 ASP B OD1 1 
ATOM   4346  O  OD2 . ASP B 1 121 ? 7.869   87.877  71.508  1.00 14.11  ? 121 ASP B OD2 1 
ATOM   4347  N  N   . ILE B 1 122 ? 5.621   92.168  70.506  1.00 12.50  ? 122 ILE B N   1 
ATOM   4348  C  CA  . ILE B 1 122 ? 4.343   92.470  71.122  1.00 7.17   ? 122 ILE B CA  1 
ATOM   4349  C  C   . ILE B 1 122 ? 3.281   91.451  70.668  1.00 11.49  ? 122 ILE B C   1 
ATOM   4350  O  O   . ILE B 1 122 ? 2.075   91.731  70.692  1.00 13.60  ? 122 ILE B O   1 
ATOM   4351  C  CB  . ILE B 1 122 ? 3.876   93.895  70.750  1.00 8.88   ? 122 ILE B CB  1 
ATOM   4352  C  CG1 . ILE B 1 122 ? 3.596   93.986  69.259  1.00 7.15   ? 122 ILE B CG1 1 
ATOM   4353  C  CG2 . ILE B 1 122 ? 4.947   94.908  71.092  1.00 6.64   ? 122 ILE B CG2 1 
ATOM   4354  C  CD1 . ILE B 1 122 ? 2.718   95.166  68.874  1.00 7.77   ? 122 ILE B CD1 1 
ATOM   4355  N  N   . SER B 1 123 ? 3.735   90.264  70.270  1.00 12.46  ? 123 SER B N   1 
ATOM   4356  C  CA  . SER B 1 123 ? 2.852   89.193  69.796  1.00 12.00  ? 123 SER B CA  1 
ATOM   4357  C  C   . SER B 1 123 ? 1.745   88.828  70.787  1.00 15.19  ? 123 SER B C   1 
ATOM   4358  O  O   . SER B 1 123 ? 1.928   88.914  72.005  1.00 19.27  ? 123 SER B O   1 
ATOM   4359  C  CB  . SER B 1 123 ? 3.668   87.927  69.501  1.00 12.83  ? 123 SER B CB  1 
ATOM   4360  O  OG  . SER B 1 123 ? 4.757   88.193  68.634  1.00 14.31  ? 123 SER B OG  1 
ATOM   4361  N  N   . GLY B 1 124 ? 0.607   88.395  70.264  1.00 13.00  ? 124 GLY B N   1 
ATOM   4362  C  CA  . GLY B 1 124 ? -0.492  87.993  71.119  1.00 12.75  ? 124 GLY B CA  1 
ATOM   4363  C  C   . GLY B 1 124 ? -1.786  88.291  70.416  1.00 11.60  ? 124 GLY B C   1 
ATOM   4364  O  O   . GLY B 1 124 ? -1.780  88.509  69.213  1.00 15.38  ? 124 GLY B O   1 
ATOM   4365  N  N   . PRO B 1 125 ? -2.921  88.235  71.112  1.00 10.69  ? 125 PRO B N   1 
ATOM   4366  C  CA  . PRO B 1 125 ? -4.197  88.535  70.458  1.00 10.20  ? 125 PRO B CA  1 
ATOM   4367  C  C   . PRO B 1 125 ? -4.133  89.997  70.015  1.00 11.80  ? 125 PRO B C   1 
ATOM   4368  O  O   . PRO B 1 125 ? -3.618  90.840  70.748  1.00 16.84  ? 125 PRO B O   1 
ATOM   4369  C  CB  . PRO B 1 125 ? -5.206  88.373  71.587  1.00 6.87   ? 125 PRO B CB  1 
ATOM   4370  C  CG  . PRO B 1 125 ? -4.518  87.447  72.548  1.00 13.05  ? 125 PRO B CG  1 
ATOM   4371  C  CD  . PRO B 1 125 ? -3.105  87.902  72.532  1.00 8.62   ? 125 PRO B CD  1 
ATOM   4372  N  N   . GLY B 1 126 ? -4.627  90.311  68.828  1.00 14.24  ? 126 GLY B N   1 
ATOM   4373  C  CA  . GLY B 1 126 ? -4.561  91.685  68.383  1.00 10.57  ? 126 GLY B CA  1 
ATOM   4374  C  C   . GLY B 1 126 ? -5.221  91.941  67.057  1.00 14.04  ? 126 GLY B C   1 
ATOM   4375  O  O   . GLY B 1 126 ? -5.982  91.112  66.553  1.00 13.35  ? 126 GLY B O   1 
ATOM   4376  N  N   . ALA B 1 127 ? -4.972  93.128  66.519  1.00 12.12  ? 127 ALA B N   1 
ATOM   4377  C  CA  . ALA B 1 127 ? -5.527  93.529  65.242  1.00 10.02  ? 127 ALA B CA  1 
ATOM   4378  C  C   . ALA B 1 127 ? -4.752  94.764  64.819  1.00 14.46  ? 127 ALA B C   1 
ATOM   4379  O  O   . ALA B 1 127 ? -4.122  95.417  65.662  1.00 17.53  ? 127 ALA B O   1 
ATOM   4380  C  CB  . ALA B 1 127 ? -6.997  93.843  65.388  1.00 8.99   ? 127 ALA B CB  1 
ATOM   4381  N  N   . GLY B 1 128 ? -4.741  95.057  63.523  1.00 16.20  ? 128 GLY B N   1 
ATOM   4382  C  CA  . GLY B 1 128 ? -4.023  96.228  63.043  1.00 16.27  ? 128 GLY B CA  1 
ATOM   4383  C  C   . GLY B 1 128 ? -4.034  96.347  61.539  1.00 15.50  ? 128 GLY B C   1 
ATOM   4384  O  O   . GLY B 1 128 ? -4.730  95.598  60.853  1.00 15.64  ? 128 GLY B O   1 
ATOM   4385  N  N   . ILE B 1 129 ? -3.342  97.352  61.030  1.00 16.30  ? 129 ILE B N   1 
ATOM   4386  C  CA  . ILE B 1 129 ? -3.230  97.552  59.593  1.00 15.24  ? 129 ILE B CA  1 
ATOM   4387  C  C   . ILE B 1 129 ? -1.783  97.883  59.372  1.00 15.69  ? 129 ILE B C   1 
ATOM   4388  O  O   . ILE B 1 129 ? -1.235  98.778  60.021  1.00 15.65  ? 129 ILE B O   1 
ATOM   4389  C  CB  . ILE B 1 129 ? -4.129  98.658  59.058  1.00 17.79  ? 129 ILE B CB  1 
ATOM   4390  C  CG1 . ILE B 1 129 ? -3.790  98.922  57.599  1.00 22.13  ? 129 ILE B CG1 1 
ATOM   4391  C  CG2 . ILE B 1 129 ? -3.979  99.904  59.855  1.00 19.76  ? 129 ILE B CG2 1 
ATOM   4392  C  CD1 . ILE B 1 129 ? -4.835  99.699  56.874  1.00 24.27  ? 129 ILE B CD1 1 
ATOM   4393  N  N   . GLU B 1 130 ? -1.130  97.076  58.550  1.00 14.96  ? 130 GLU B N   1 
ATOM   4394  C  CA  . GLU B 1 130 ? 0.278   97.278  58.304  1.00 18.29  ? 130 GLU B CA  1 
ATOM   4395  C  C   . GLU B 1 130 ? 0.570   97.576  56.863  1.00 21.01  ? 130 GLU B C   1 
ATOM   4396  O  O   . GLU B 1 130 ? -0.264  97.341  55.985  1.00 19.50  ? 130 GLU B O   1 
ATOM   4397  C  CB  . GLU B 1 130 ? 1.088   96.065  58.764  1.00 16.37  ? 130 GLU B CB  1 
ATOM   4398  C  CG  . GLU B 1 130 ? 0.577   94.769  58.235  1.00 13.28  ? 130 GLU B CG  1 
ATOM   4399  C  CD  . GLU B 1 130 ? 1.440   93.590  58.615  1.00 18.04  ? 130 GLU B CD  1 
ATOM   4400  O  OE1 . GLU B 1 130 ? 2.613   93.770  58.987  1.00 19.93  ? 130 GLU B OE1 1 
ATOM   4401  O  OE2 . GLU B 1 130 ? 0.936   92.462  58.519  1.00 24.59  ? 130 GLU B OE2 1 
ATOM   4402  N  N   . ASN B 1 131 ? 1.772   98.097  56.647  1.00 22.80  ? 131 ASN B N   1 
ATOM   4403  C  CA  . ASN B 1 131 ? 2.285   98.463  55.338  1.00 26.70  ? 131 ASN B CA  1 
ATOM   4404  C  C   . ASN B 1 131 ? 1.494   99.513  54.599  1.00 24.58  ? 131 ASN B C   1 
ATOM   4405  O  O   . ASN B 1 131 ? 1.137   99.335  53.441  1.00 28.35  ? 131 ASN B O   1 
ATOM   4406  C  CB  . ASN B 1 131 ? 2.542   97.235  54.458  1.00 33.56  ? 131 ASN B CB  1 
ATOM   4407  C  CG  . ASN B 1 131 ? 3.577   96.294  55.062  1.00 46.76  ? 131 ASN B CG  1 
ATOM   4408  O  OD1 . ASN B 1 131 ? 4.519   96.738  55.731  1.00 48.30  ? 131 ASN B OD1 1 
ATOM   4409  N  ND2 . ASN B 1 131 ? 3.390   94.985  54.863  1.00 49.95  ? 131 ASN B ND2 1 
ATOM   4410  N  N   . ILE B 1 132 ? 1.179   100.592 55.297  1.00 23.20  ? 132 ILE B N   1 
ATOM   4411  C  CA  . ILE B 1 132 ? 0.502   101.707 54.681  1.00 21.87  ? 132 ILE B CA  1 
ATOM   4412  C  C   . ILE B 1 132 ? 1.670   102.463 54.040  1.00 26.01  ? 132 ILE B C   1 
ATOM   4413  O  O   . ILE B 1 132 ? 2.639   102.807 54.721  1.00 24.43  ? 132 ILE B O   1 
ATOM   4414  C  CB  . ILE B 1 132 ? -0.168  102.568 55.714  1.00 18.26  ? 132 ILE B CB  1 
ATOM   4415  C  CG1 . ILE B 1 132 ? -1.306  101.791 56.370  1.00 16.33  ? 132 ILE B CG1 1 
ATOM   4416  C  CG2 . ILE B 1 132 ? -0.680  103.833 55.074  1.00 17.42  ? 132 ILE B CG2 1 
ATOM   4417  C  CD1 . ILE B 1 132 ? -1.955  102.516 57.527  1.00 16.78  ? 132 ILE B CD1 1 
ATOM   4418  N  N   . ASP B 1 133 ? 1.623   102.629 52.723  1.00 29.09  ? 133 ASP B N   1 
ATOM   4419  C  CA  . ASP B 1 133 ? 2.694   103.296 52.003  1.00 28.22  ? 133 ASP B CA  1 
ATOM   4420  C  C   . ASP B 1 133 ? 2.641   104.800 52.142  1.00 28.81  ? 133 ASP B C   1 
ATOM   4421  O  O   . ASP B 1 133 ? 1.657   105.416 51.766  1.00 28.73  ? 133 ASP B O   1 
ATOM   4422  C  CB  . ASP B 1 133 ? 2.645   102.913 50.527  1.00 33.98  ? 133 ASP B CB  1 
ATOM   4423  C  CG  . ASP B 1 133 ? 3.931   103.259 49.771  1.00 41.62  ? 133 ASP B CG  1 
ATOM   4424  O  OD1 . ASP B 1 133 ? 4.964   103.618 50.386  1.00 42.26  ? 133 ASP B OD1 1 
ATOM   4425  O  OD2 . ASP B 1 133 ? 3.906   103.154 48.529  1.00 52.04  ? 133 ASP B OD2 1 
ATOM   4426  N  N   . LEU B 1 134 ? 3.694   105.383 52.711  1.00 29.24  ? 134 LEU B N   1 
ATOM   4427  C  CA  . LEU B 1 134 ? 3.791   106.833 52.880  1.00 30.13  ? 134 LEU B CA  1 
ATOM   4428  C  C   . LEU B 1 134 ? 4.748   107.432 51.837  1.00 33.50  ? 134 LEU B C   1 
ATOM   4429  O  O   . LEU B 1 134 ? 5.064   108.629 51.869  1.00 35.98  ? 134 LEU B O   1 
ATOM   4430  C  CB  . LEU B 1 134 ? 4.285   107.188 54.283  1.00 26.92  ? 134 LEU B CB  1 
ATOM   4431  C  CG  . LEU B 1 134 ? 3.373   106.886 55.471  1.00 28.88  ? 134 LEU B CG  1 
ATOM   4432  C  CD1 . LEU B 1 134 ? 3.974   107.491 56.721  1.00 24.81  ? 134 LEU B CD1 1 
ATOM   4433  C  CD2 . LEU B 1 134 ? 1.992   107.449 55.237  1.00 26.78  ? 134 LEU B CD2 1 
ATOM   4434  N  N   . GLY B 1 135 ? 5.206   106.598 50.910  1.00 30.57  ? 135 GLY B N   1 
ATOM   4435  C  CA  . GLY B 1 135 ? 6.119   107.069 49.893  1.00 29.86  ? 135 GLY B CA  1 
ATOM   4436  C  C   . GLY B 1 135 ? 7.534   106.956 50.410  1.00 30.65  ? 135 GLY B C   1 
ATOM   4437  O  O   . GLY B 1 135 ? 8.322   106.154 49.907  1.00 34.73  ? 135 GLY B O   1 
ATOM   4438  N  N   . PHE B 1 136 ? 7.850   107.723 51.447  1.00 28.31  ? 136 PHE B N   1 
ATOM   4439  C  CA  . PHE B 1 136 ? 9.188   107.683 52.031  1.00 26.52  ? 136 PHE B CA  1 
ATOM   4440  C  C   . PHE B 1 136 ? 9.340   106.560 53.067  1.00 25.94  ? 136 PHE B C   1 
ATOM   4441  O  O   . PHE B 1 136 ? 10.385  106.455 53.709  1.00 26.67  ? 136 PHE B O   1 
ATOM   4442  C  CB  . PHE B 1 136 ? 9.500   109.019 52.680  1.00 25.52  ? 136 PHE B CB  1 
ATOM   4443  C  CG  . PHE B 1 136 ? 8.495   109.419 53.702  1.00 28.33  ? 136 PHE B CG  1 
ATOM   4444  C  CD1 . PHE B 1 136 ? 8.637   109.022 55.025  1.00 28.47  ? 136 PHE B CD1 1 
ATOM   4445  C  CD2 . PHE B 1 136 ? 7.392   110.182 53.346  1.00 28.11  ? 136 PHE B CD2 1 
ATOM   4446  C  CE1 . PHE B 1 136 ? 7.690   109.383 55.983  1.00 31.68  ? 136 PHE B CE1 1 
ATOM   4447  C  CE2 . PHE B 1 136 ? 6.439   110.546 54.299  1.00 29.96  ? 136 PHE B CE2 1 
ATOM   4448  C  CZ  . PHE B 1 136 ? 6.591   110.146 55.615  1.00 28.13  ? 136 PHE B CZ  1 
ATOM   4449  N  N   . GLY B 1 137 ? 8.284   105.772 53.272  1.00 26.21  ? 137 GLY B N   1 
ATOM   4450  C  CA  . GLY B 1 137 ? 8.342   104.675 54.226  1.00 22.68  ? 137 GLY B CA  1 
ATOM   4451  C  C   . GLY B 1 137 ? 7.012   103.978 54.400  1.00 20.48  ? 137 GLY B C   1 
ATOM   4452  O  O   . GLY B 1 137 ? 6.018   104.398 53.809  1.00 19.22  ? 137 GLY B O   1 
ATOM   4453  N  N   . LYS B 1 138 ? 6.995   102.910 55.191  1.00 18.31  ? 138 LYS B N   1 
ATOM   4454  C  CA  . LYS B 1 138 ? 5.774   102.167 55.450  1.00 17.73  ? 138 LYS B CA  1 
ATOM   4455  C  C   . LYS B 1 138 ? 5.317   102.359 56.881  1.00 19.55  ? 138 LYS B C   1 
ATOM   4456  O  O   . LYS B 1 138 ? 6.115   102.256 57.820  1.00 21.03  ? 138 LYS B O   1 
ATOM   4457  C  CB  . LYS B 1 138 ? 6.004   100.695 55.202  1.00 22.59  ? 138 LYS B CB  1 
ATOM   4458  C  CG  . LYS B 1 138 ? 6.435   100.390 53.801  1.00 27.75  ? 138 LYS B CG  1 
ATOM   4459  C  CD  . LYS B 1 138 ? 5.469   100.982 52.809  1.00 38.02  ? 138 LYS B CD  1 
ATOM   4460  C  CE  . LYS B 1 138 ? 5.884   100.656 51.391  1.00 46.64  ? 138 LYS B CE  1 
ATOM   4461  N  NZ  . LYS B 1 138 ? 5.877   99.184  51.134  1.00 55.02  ? 138 LYS B NZ  1 
ATOM   4462  N  N   . LEU B 1 139 ? 4.030   102.629 57.045  1.00 18.37  ? 139 LEU B N   1 
ATOM   4463  C  CA  . LEU B 1 139 ? 3.449   102.847 58.356  1.00 17.70  ? 139 LEU B CA  1 
ATOM   4464  C  C   . LEU B 1 139 ? 2.601   101.651 58.775  1.00 19.20  ? 139 LEU B C   1 
ATOM   4465  O  O   . LEU B 1 139 ? 1.831   101.130 57.983  1.00 21.05  ? 139 LEU B O   1 
ATOM   4466  C  CB  . LEU B 1 139 ? 2.571   104.094 58.329  1.00 16.86  ? 139 LEU B CB  1 
ATOM   4467  C  CG  . LEU B 1 139 ? 1.910   104.514 59.645  1.00 18.89  ? 139 LEU B CG  1 
ATOM   4468  C  CD1 . LEU B 1 139 ? 2.953   105.090 60.583  1.00 18.02  ? 139 LEU B CD1 1 
ATOM   4469  C  CD2 . LEU B 1 139 ? 0.863   105.572 59.375  1.00 18.95  ? 139 LEU B CD2 1 
ATOM   4470  N  N   . SER B 1 140 ? 2.746   101.219 60.021  1.00 20.14  ? 140 SER B N   1 
ATOM   4471  C  CA  . SER B 1 140 ? 1.977   100.097 60.552  1.00 18.88  ? 140 SER B CA  1 
ATOM   4472  C  C   . SER B 1 140 ? 1.418   100.462 61.920  1.00 17.46  ? 140 SER B C   1 
ATOM   4473  O  O   . SER B 1 140 ? 2.134   101.003 62.770  1.00 17.35  ? 140 SER B O   1 
ATOM   4474  C  CB  . SER B 1 140 ? 2.857   98.851  60.683  1.00 17.37  ? 140 SER B CB  1 
ATOM   4475  O  OG  . SER B 1 140 ? 3.319   98.399  59.420  1.00 22.99  ? 140 SER B OG  1 
ATOM   4476  N  N   . LEU B 1 141 ? 0.147   100.158 62.130  1.00 17.28  ? 141 LEU B N   1 
ATOM   4477  C  CA  . LEU B 1 141 ? -0.510  100.440 63.391  1.00 17.69  ? 141 LEU B CA  1 
ATOM   4478  C  C   . LEU B 1 141 ? -1.066  99.137  63.917  1.00 19.43  ? 141 LEU B C   1 
ATOM   4479  O  O   . LEU B 1 141 ? -1.663  98.372  63.158  1.00 19.75  ? 141 LEU B O   1 
ATOM   4480  C  CB  . LEU B 1 141 ? -1.673  101.384 63.157  1.00 19.52  ? 141 LEU B CB  1 
ATOM   4481  C  CG  . LEU B 1 141 ? -1.317  102.645 62.393  1.00 23.19  ? 141 LEU B CG  1 
ATOM   4482  C  CD1 . LEU B 1 141 ? -2.584  103.385 62.033  1.00 23.94  ? 141 LEU B CD1 1 
ATOM   4483  C  CD2 . LEU B 1 141 ? -0.408  103.505 63.255  1.00 23.30  ? 141 LEU B CD2 1 
ATOM   4484  N  N   . ALA B 1 142 ? -0.909  98.888  65.212  1.00 18.88  ? 142 ALA B N   1 
ATOM   4485  C  CA  . ALA B 1 142 ? -1.436  97.663  65.805  1.00 16.86  ? 142 ALA B CA  1 
ATOM   4486  C  C   . ALA B 1 142 ? -1.768  97.813  67.286  1.00 15.33  ? 142 ALA B C   1 
ATOM   4487  O  O   . ALA B 1 142 ? -1.251  98.690  67.960  1.00 16.86  ? 142 ALA B O   1 
ATOM   4488  C  CB  . ALA B 1 142 ? -0.452  96.520  65.607  1.00 12.68  ? 142 ALA B CB  1 
ATOM   4489  N  N   . ALA B 1 143 ? -2.643  96.947  67.774  1.00 17.20  ? 143 ALA B N   1 
ATOM   4490  C  CA  . ALA B 1 143 ? -3.037  96.917  69.171  1.00 14.90  ? 143 ALA B CA  1 
ATOM   4491  C  C   . ALA B 1 143 ? -3.019  95.457  69.541  1.00 14.43  ? 143 ALA B C   1 
ATOM   4492  O  O   . ALA B 1 143 ? -3.625  94.644  68.843  1.00 17.14  ? 143 ALA B O   1 
ATOM   4493  C  CB  . ALA B 1 143 ? -4.441  97.457  69.340  1.00 13.48  ? 143 ALA B CB  1 
ATOM   4494  N  N   . THR B 1 144 ? -2.255  95.095  70.563  1.00 12.48  ? 144 THR B N   1 
ATOM   4495  C  CA  . THR B 1 144 ? -2.232  93.703  70.999  1.00 13.54  ? 144 THR B CA  1 
ATOM   4496  C  C   . THR B 1 144 ? -2.493  93.660  72.493  1.00 16.13  ? 144 THR B C   1 
ATOM   4497  O  O   . THR B 1 144 ? -2.530  94.704  73.145  1.00 16.54  ? 144 THR B O   1 
ATOM   4498  C  CB  . THR B 1 144 ? -0.921  92.989  70.652  1.00 12.23  ? 144 THR B CB  1 
ATOM   4499  O  OG1 . THR B 1 144 ? 0.167   93.603  71.344  1.00 13.95  ? 144 THR B OG1 1 
ATOM   4500  C  CG2 . THR B 1 144 ? -0.676  93.041  69.140  1.00 12.41  ? 144 THR B CG2 1 
ATOM   4501  N  N   . ARG B 1 145 ? -2.707  92.462  73.025  1.00 16.90  ? 145 ARG B N   1 
ATOM   4502  C  CA  . ARG B 1 145 ? -2.990  92.291  74.435  1.00 14.25  ? 145 ARG B CA  1 
ATOM   4503  C  C   . ARG B 1 145 ? -2.151  91.241  75.131  1.00 14.55  ? 145 ARG B C   1 
ATOM   4504  O  O   . ARG B 1 145 ? -1.727  90.271  74.516  1.00 15.79  ? 145 ARG B O   1 
ATOM   4505  C  CB  . ARG B 1 145 ? -4.461  91.911  74.630  1.00 15.68  ? 145 ARG B CB  1 
ATOM   4506  C  CG  . ARG B 1 145 ? -4.772  91.514  76.072  1.00 18.38  ? 145 ARG B CG  1 
ATOM   4507  C  CD  . ARG B 1 145 ? -6.190  91.788  76.470  1.00 14.22  ? 145 ARG B CD  1 
ATOM   4508  N  NE  . ARG B 1 145 ? -6.607  93.129  76.092  1.00 8.68   ? 145 ARG B NE  1 
ATOM   4509  C  CZ  . ARG B 1 145 ? -7.830  93.404  75.654  1.00 14.91  ? 145 ARG B CZ  1 
ATOM   4510  N  NH1 . ARG B 1 145 ? -8.717  92.429  75.556  1.00 7.96   ? 145 ARG B NH1 1 
ATOM   4511  N  NH2 . ARG B 1 145 ? -8.159  94.633  75.278  1.00 14.61  ? 145 ARG B NH2 1 
ATOM   4512  N  N   . SER B 1 146 ? -1.922  91.461  76.422  1.00 14.89  ? 146 SER B N   1 
ATOM   4513  C  CA  . SER B 1 146 ? -1.221  90.520  77.287  1.00 14.69  ? 146 SER B CA  1 
ATOM   4514  C  C   . SER B 1 146 ? -1.999  90.606  78.612  1.00 15.82  ? 146 SER B C   1 
ATOM   4515  O  O   . SER B 1 146 ? -2.770  91.546  78.826  1.00 16.54  ? 146 SER B O   1 
ATOM   4516  C  CB  . SER B 1 146 ? 0.240   90.896  77.481  1.00 10.68  ? 146 SER B CB  1 
ATOM   4517  O  OG  . SER B 1 146 ? 0.366   92.055  78.281  1.00 21.88  ? 146 SER B OG  1 
ATOM   4518  N  N   . THR B 1 147 ? -1.837  89.619  79.481  1.00 17.00  ? 147 THR B N   1 
ATOM   4519  C  CA  . THR B 1 147 ? -2.562  89.605  80.738  1.00 13.47  ? 147 THR B CA  1 
ATOM   4520  C  C   . THR B 1 147 ? -1.673  89.145  81.878  1.00 17.14  ? 147 THR B C   1 
ATOM   4521  O  O   . THR B 1 147 ? -0.858  88.220  81.734  1.00 19.81  ? 147 THR B O   1 
ATOM   4522  C  CB  . THR B 1 147 ? -3.788  88.696  80.637  1.00 13.28  ? 147 THR B CB  1 
ATOM   4523  O  OG1 . THR B 1 147 ? -4.604  89.147  79.556  1.00 13.76  ? 147 THR B OG1 1 
ATOM   4524  C  CG2 . THR B 1 147 ? -4.600  88.712  81.904  1.00 12.54  ? 147 THR B CG2 1 
ATOM   4525  N  N   . GLU B 1 148 ? -1.774  89.868  82.986  1.00 18.35  ? 148 GLU B N   1 
ATOM   4526  C  CA  . GLU B 1 148 ? -1.015  89.561  84.180  1.00 17.08  ? 148 GLU B CA  1 
ATOM   4527  C  C   . GLU B 1 148 ? -1.920  88.795  85.119  1.00 17.65  ? 148 GLU B C   1 
ATOM   4528  O  O   . GLU B 1 148 ? -3.140  88.932  85.056  1.00 18.17  ? 148 GLU B O   1 
ATOM   4529  C  CB  . GLU B 1 148 ? -0.571  90.846  84.846  1.00 15.90  ? 148 GLU B CB  1 
ATOM   4530  C  CG  . GLU B 1 148 ? 0.494   91.580  84.096  1.00 18.55  ? 148 GLU B CG  1 
ATOM   4531  C  CD  . GLU B 1 148 ? 0.795   92.920  84.718  1.00 21.61  ? 148 GLU B CD  1 
ATOM   4532  O  OE1 . GLU B 1 148 ? -0.111  93.769  84.752  1.00 19.21  ? 148 GLU B OE1 1 
ATOM   4533  O  OE2 . GLU B 1 148 ? 1.933   93.135  85.172  1.00 20.53  ? 148 GLU B OE2 1 
ATOM   4534  N  N   . ALA B 1 149 ? -1.328  87.959  85.957  1.00 21.69  ? 149 ALA B N   1 
ATOM   4535  C  CA  . ALA B 1 149 ? -2.110  87.196  86.914  1.00 23.82  ? 149 ALA B CA  1 
ATOM   4536  C  C   . ALA B 1 149 ? -2.447  88.112  88.085  1.00 23.62  ? 149 ALA B C   1 
ATOM   4537  O  O   . ALA B 1 149 ? -1.564  88.777  88.633  1.00 25.24  ? 149 ALA B O   1 
ATOM   4538  C  CB  . ALA B 1 149 ? -1.328  85.990  87.393  1.00 21.56  ? 149 ALA B CB  1 
ATOM   4539  N  N   . GLY B 1 150 ? -3.728  88.176  88.435  1.00 23.74  ? 150 GLY B N   1 
ATOM   4540  C  CA  . GLY B 1 150 ? -4.167  89.013  89.540  1.00 21.74  ? 150 GLY B CA  1 
ATOM   4541  C  C   . GLY B 1 150 ? -3.904  90.469  89.251  1.00 22.07  ? 150 GLY B C   1 
ATOM   4542  O  O   . GLY B 1 150 ? -3.871  90.866  88.095  1.00 25.28  ? 150 GLY B O   1 
ATOM   4543  N  N   . GLY B 1 151 ? -3.746  91.271  90.295  1.00 23.23  ? 151 GLY B N   1 
ATOM   4544  C  CA  . GLY B 1 151 ? -3.460  92.680  90.097  1.00 18.90  ? 151 GLY B CA  1 
ATOM   4545  C  C   . GLY B 1 151 ? -4.662  93.597  90.107  1.00 20.37  ? 151 GLY B C   1 
ATOM   4546  O  O   . GLY B 1 151 ? -4.499  94.814  90.202  1.00 22.47  ? 151 GLY B O   1 
ATOM   4547  N  N   . SER B 1 152 ? -5.857  93.042  89.936  1.00 21.97  ? 152 SER B N   1 
ATOM   4548  C  CA  . SER B 1 152 ? -7.084  93.840  89.956  1.00 24.21  ? 152 SER B CA  1 
ATOM   4549  C  C   . SER B 1 152 ? -7.947  93.354  91.119  1.00 27.07  ? 152 SER B C   1 
ATOM   4550  O  O   . SER B 1 152 ? -8.275  92.157  91.224  1.00 26.80  ? 152 SER B O   1 
ATOM   4551  C  CB  . SER B 1 152 ? -7.833  93.708  88.633  1.00 27.62  ? 152 SER B CB  1 
ATOM   4552  O  OG  . SER B 1 152 ? -7.084  94.284  87.574  1.00 28.09  ? 152 SER B OG  1 
ATOM   4553  N  N   . TYR B 1 153 ? -8.304  94.283  92.002  1.00 28.24  ? 153 TYR B N   1 
ATOM   4554  C  CA  . TYR B 1 153 ? -9.073  93.948  93.195  1.00 26.49  ? 153 TYR B CA  1 
ATOM   4555  C  C   . TYR B 1 153 ? -10.301 94.809  93.388  1.00 28.82  ? 153 TYR B C   1 
ATOM   4556  O  O   . TYR B 1 153 ? -10.308 95.982  93.022  1.00 28.07  ? 153 TYR B O   1 
ATOM   4557  C  CB  . TYR B 1 153 ? -8.206  94.145  94.443  1.00 20.77  ? 153 TYR B CB  1 
ATOM   4558  C  CG  . TYR B 1 153 ? -6.789  93.639  94.340  1.00 17.92  ? 153 TYR B CG  1 
ATOM   4559  C  CD1 . TYR B 1 153 ? -5.762  94.467  93.891  1.00 16.58  ? 153 TYR B CD1 1 
ATOM   4560  C  CD2 . TYR B 1 153 ? -6.465  92.338  94.716  1.00 18.91  ? 153 TYR B CD2 1 
ATOM   4561  C  CE1 . TYR B 1 153 ? -4.443  94.005  93.822  1.00 19.64  ? 153 TYR B CE1 1 
ATOM   4562  C  CE2 . TYR B 1 153 ? -5.154  91.871  94.650  1.00 16.76  ? 153 TYR B CE2 1 
ATOM   4563  C  CZ  . TYR B 1 153 ? -4.150  92.704  94.204  1.00 17.98  ? 153 TYR B CZ  1 
ATOM   4564  O  OH  . TYR B 1 153 ? -2.858  92.234  94.131  1.00 25.43  ? 153 TYR B OH  1 
ATOM   4565  N  N   . THR B 1 154 ? -11.337 94.217  93.974  1.00 32.20  ? 154 THR B N   1 
ATOM   4566  C  CA  . THR B 1 154 ? -12.563 94.948  94.304  1.00 36.84  ? 154 THR B CA  1 
ATOM   4567  C  C   . THR B 1 154 ? -12.374 95.328  95.778  1.00 41.07  ? 154 THR B C   1 
ATOM   4568  O  O   . THR B 1 154 ? -12.670 94.533  96.679  1.00 41.71  ? 154 THR B O   1 
ATOM   4569  C  CB  . THR B 1 154 ? -13.826 94.072  94.162  1.00 34.94  ? 154 THR B CB  1 
ATOM   4570  O  OG1 . THR B 1 154 ? -13.507 92.705  94.463  1.00 40.17  ? 154 THR B OG1 1 
ATOM   4571  C  CG2 . THR B 1 154 ? -14.370 94.161  92.764  1.00 35.05  ? 154 THR B CG2 1 
ATOM   4572  N  N   . PHE B 1 155 ? -11.777 96.491  96.012  1.00 44.22  ? 155 PHE B N   1 
ATOM   4573  C  CA  . PHE B 1 155 ? -11.508 96.957  97.369  1.00 46.73  ? 155 PHE B CA  1 
ATOM   4574  C  C   . PHE B 1 155 ? -12.764 97.369  98.130  1.00 51.87  ? 155 PHE B C   1 
ATOM   4575  O  O   . PHE B 1 155 ? -13.568 98.163  97.623  1.00 52.81  ? 155 PHE B O   1 
ATOM   4576  C  CB  . PHE B 1 155 ? -10.525 98.129  97.343  1.00 38.86  ? 155 PHE B CB  1 
ATOM   4577  C  CG  . PHE B 1 155 ? -9.134  97.739  96.989  1.00 34.26  ? 155 PHE B CG  1 
ATOM   4578  C  CD1 . PHE B 1 155 ? -8.446  96.822  97.768  1.00 30.39  ? 155 PHE B CD1 1 
ATOM   4579  C  CD2 . PHE B 1 155 ? -8.508  98.288  95.872  1.00 32.74  ? 155 PHE B CD2 1 
ATOM   4580  C  CE1 . PHE B 1 155 ? -7.146  96.450  97.449  1.00 32.67  ? 155 PHE B CE1 1 
ATOM   4581  C  CE2 . PHE B 1 155 ? -7.208  97.929  95.536  1.00 32.56  ? 155 PHE B CE2 1 
ATOM   4582  C  CZ  . PHE B 1 155 ? -6.521  97.005  96.328  1.00 32.99  ? 155 PHE B CZ  1 
ATOM   4583  N  N   . SER B 1 156 ? -12.932 96.812  99.332  1.00 56.68  ? 156 SER B N   1 
ATOM   4584  C  CA  . SER B 1 156 ? -14.073 97.134  100.199 1.00 60.34  ? 156 SER B CA  1 
ATOM   4585  C  C   . SER B 1 156 ? -13.704 98.319  101.104 1.00 62.59  ? 156 SER B C   1 
ATOM   4586  O  O   . SER B 1 156 ? -14.408 99.332  101.148 1.00 63.97  ? 156 SER B O   1 
ATOM   4587  C  CB  . SER B 1 156 ? -14.490 95.917  101.041 1.00 58.35  ? 156 SER B CB  1 
ATOM   4588  O  OG  . SER B 1 156 ? -13.404 95.393  101.792 1.00 60.02  ? 156 SER B OG  1 
ATOM   4589  N  N   . SER B 1 157 ? -12.573 98.211  101.787 1.00 66.80  ? 157 SER B N   1 
ATOM   4590  C  CA  . SER B 1 157 ? -12.122 99.279  102.658 1.00 69.55  ? 157 SER B CA  1 
ATOM   4591  C  C   . SER B 1 157 ? -10.608 99.281  102.642 1.00 72.12  ? 157 SER B C   1 
ATOM   4592  O  O   . SER B 1 157 ? -9.978  98.232  102.832 1.00 71.81  ? 157 SER B O   1 
ATOM   4593  C  CB  . SER B 1 157 ? -12.622 99.047  104.086 1.00 72.37  ? 157 SER B CB  1 
ATOM   4594  O  OG  . SER B 1 157 ? -14.033 98.900  104.128 0.00 71.15  ? 157 SER B OG  1 
ATOM   4595  N  N   . GLN B 1 158 ? -10.027 100.449 102.372 1.00 74.67  ? 158 GLN B N   1 
ATOM   4596  C  CA  . GLN B 1 158 ? -8.574  100.603 102.345 1.00 77.05  ? 158 GLN B CA  1 
ATOM   4597  C  C   . GLN B 1 158 ? -7.970  99.600  101.361 1.00 73.87  ? 158 GLN B C   1 
ATOM   4598  O  O   . GLN B 1 158 ? -8.289  99.646  100.174 1.00 77.46  ? 158 GLN B O   1 
ATOM   4599  C  CB  . GLN B 1 158 ? -7.998  100.392 103.755 1.00 86.12  ? 158 GLN B CB  1 
ATOM   4600  C  CG  . GLN B 1 158 ? -8.604  101.290 104.840 1.00 95.79  ? 158 GLN B CG  1 
ATOM   4601  C  CD  . GLN B 1 158 ? -8.507  100.684 106.239 1.00 100.32 ? 158 GLN B CD  1 
ATOM   4602  O  OE1 . GLN B 1 158 ? -9.520  100.507 106.919 1.00 103.09 ? 158 GLN B OE1 1 
ATOM   4603  N  NE2 . GLN B 1 158 ? -7.290  100.363 106.670 1.00 102.32 ? 158 GLN B NE2 1 
ATOM   4604  N  N   . ASN B 1 159 ? -7.158  98.667  101.858 1.00 67.82  ? 159 ASN B N   1 
ATOM   4605  C  CA  . ASN B 1 159 ? -6.522  97.661  101.009 1.00 63.03  ? 159 ASN B CA  1 
ATOM   4606  C  C   . ASN B 1 159 ? -7.059  96.253  101.239 1.00 57.49  ? 159 ASN B C   1 
ATOM   4607  O  O   . ASN B 1 159 ? -6.356  95.252  101.047 1.00 53.79  ? 159 ASN B O   1 
ATOM   4608  C  CB  . ASN B 1 159 ? -5.000  97.683  101.180 1.00 71.17  ? 159 ASN B CB  1 
ATOM   4609  C  CG  . ASN B 1 159 ? -4.561  97.307  102.579 1.00 77.20  ? 159 ASN B CG  1 
ATOM   4610  O  OD1 . ASN B 1 159 ? -5.102  97.808  103.568 1.00 82.14  ? 159 ASN B OD1 1 
ATOM   4611  N  ND2 . ASN B 1 159 ? -3.565  96.431  102.672 1.00 80.55  ? 159 ASN B ND2 1 
ATOM   4612  N  N   . ILE B 1 160 ? -8.301  96.185  101.690 1.00 54.18  ? 160 ILE B N   1 
ATOM   4613  C  CA  . ILE B 1 160 ? -8.957  94.912  101.918 1.00 53.14  ? 160 ILE B CA  1 
ATOM   4614  C  C   . ILE B 1 160 ? -9.871  94.790  100.709 1.00 49.29  ? 160 ILE B C   1 
ATOM   4615  O  O   . ILE B 1 160 ? -10.541 95.759  100.334 1.00 45.69  ? 160 ILE B O   1 
ATOM   4616  C  CB  . ILE B 1 160 ? -9.768  94.924  103.225 1.00 56.32  ? 160 ILE B CB  1 
ATOM   4617  C  CG1 . ILE B 1 160 ? -8.823  95.175  104.400 1.00 57.97  ? 160 ILE B CG1 1 
ATOM   4618  C  CG2 . ILE B 1 160 ? -10.491 93.593  103.412 1.00 54.77  ? 160 ILE B CG2 1 
ATOM   4619  C  CD1 . ILE B 1 160 ? -9.517  95.558  105.664 1.00 62.66  ? 160 ILE B CD1 1 
ATOM   4620  N  N   . TYR B 1 161 ? -9.871  93.620  100.080 1.00 44.46  ? 161 TYR B N   1 
ATOM   4621  C  CA  . TYR B 1 161 ? -10.673 93.403  98.885  1.00 41.47  ? 161 TYR B CA  1 
ATOM   4622  C  C   . TYR B 1 161 ? -11.510 92.130  98.978  1.00 42.13  ? 161 TYR B C   1 
ATOM   4623  O  O   . TYR B 1 161 ? -11.216 91.236  99.783  1.00 41.18  ? 161 TYR B O   1 
ATOM   4624  C  CB  . TYR B 1 161 ? -9.755  93.352  97.643  1.00 33.01  ? 161 TYR B CB  1 
ATOM   4625  C  CG  . TYR B 1 161 ? -8.843  92.142  97.586  1.00 24.23  ? 161 TYR B CG  1 
ATOM   4626  C  CD1 . TYR B 1 161 ? -9.310  90.924  97.100  1.00 23.56  ? 161 TYR B CD1 1 
ATOM   4627  C  CD2 . TYR B 1 161 ? -7.529  92.201  98.052  1.00 21.36  ? 161 TYR B CD2 1 
ATOM   4628  C  CE1 . TYR B 1 161 ? -8.499  89.782  97.087  1.00 18.49  ? 161 TYR B CE1 1 
ATOM   4629  C  CE2 . TYR B 1 161 ? -6.697  91.057  98.040  1.00 18.74  ? 161 TYR B CE2 1 
ATOM   4630  C  CZ  . TYR B 1 161 ? -7.200  89.851  97.558  1.00 20.25  ? 161 TYR B CZ  1 
ATOM   4631  O  OH  . TYR B 1 161 ? -6.440  88.695  97.574  1.00 28.98  ? 161 TYR B OH  1 
ATOM   4632  N  N   . ASP B 1 162 ? -12.558 92.064  98.161  1.00 45.27  ? 162 ASP B N   1 
ATOM   4633  C  CA  . ASP B 1 162 ? -13.431 90.902  98.120  1.00 50.45  ? 162 ASP B CA  1 
ATOM   4634  C  C   . ASP B 1 162 ? -12.928 89.957  97.040  1.00 52.14  ? 162 ASP B C   1 
ATOM   4635  O  O   . ASP B 1 162 ? -12.654 88.786  97.313  1.00 54.36  ? 162 ASP B O   1 
ATOM   4636  C  CB  . ASP B 1 162 ? -14.868 91.309  97.800  1.00 57.94  ? 162 ASP B CB  1 
ATOM   4637  C  CG  . ASP B 1 162 ? -15.404 92.366  98.752  1.00 67.48  ? 162 ASP B CG  1 
ATOM   4638  O  OD1 . ASP B 1 162 ? -15.234 92.206  99.985  1.00 73.14  ? 162 ASP B OD1 1 
ATOM   4639  O  OD2 . ASP B 1 162 ? -15.994 93.359  98.263  1.00 70.90  ? 162 ASP B OD2 1 
ATOM   4640  N  N   . GLU B 1 163 ? -12.735 90.488  95.833  1.00 50.73  ? 163 GLU B N   1 
ATOM   4641  C  CA  . GLU B 1 163 ? -12.282 89.678  94.710  1.00 47.89  ? 163 GLU B CA  1 
ATOM   4642  C  C   . GLU B 1 163 ? -11.061 90.207  93.984  1.00 41.83  ? 163 GLU B C   1 
ATOM   4643  O  O   . GLU B 1 163 ? -10.804 91.412  93.956  1.00 38.82  ? 163 GLU B O   1 
ATOM   4644  C  CB  . GLU B 1 163 ? -13.416 89.514  93.698  1.00 53.38  ? 163 GLU B CB  1 
ATOM   4645  C  CG  . GLU B 1 163 ? -14.654 88.835  94.244  1.00 66.04  ? 163 GLU B CG  1 
ATOM   4646  C  CD  . GLU B 1 163 ? -15.924 89.442  93.689  1.00 75.70  ? 163 GLU B CD  1 
ATOM   4647  O  OE1 . GLU B 1 163 ? -16.249 90.595  94.070  1.00 78.21  ? 163 GLU B OE1 1 
ATOM   4648  O  OE2 . GLU B 1 163 ? -16.592 88.769  92.868  1.00 83.33  ? 163 GLU B OE2 1 
ATOM   4649  N  N   . VAL B 1 164 ? -10.327 89.269  93.396  1.00 37.91  ? 164 VAL B N   1 
ATOM   4650  C  CA  . VAL B 1 164 ? -9.138  89.548  92.603  1.00 37.93  ? 164 VAL B CA  1 
ATOM   4651  C  C   . VAL B 1 164 ? -9.513  89.166  91.177  1.00 37.76  ? 164 VAL B C   1 
ATOM   4652  O  O   . VAL B 1 164 ? -10.417 88.359  90.960  1.00 41.09  ? 164 VAL B O   1 
ATOM   4653  C  CB  . VAL B 1 164 ? -7.955  88.638  92.952  1.00 36.31  ? 164 VAL B CB  1 
ATOM   4654  C  CG1 . VAL B 1 164 ? -6.667  89.408  92.822  1.00 33.45  ? 164 VAL B CG1 1 
ATOM   4655  C  CG2 . VAL B 1 164 ? -8.118  88.005  94.311  1.00 44.79  ? 164 VAL B CG2 1 
ATOM   4656  N  N   . LYS B 1 165 ? -8.744  89.652  90.217  1.00 35.87  ? 165 LYS B N   1 
ATOM   4657  C  CA  . LYS B 1 165 ? -8.999  89.369  88.813  1.00 28.89  ? 165 LYS B CA  1 
ATOM   4658  C  C   . LYS B 1 165 ? -7.679  89.563  88.090  1.00 29.82  ? 165 LYS B C   1 
ATOM   4659  O  O   . LYS B 1 165 ? -6.800  90.280  88.590  1.00 28.54  ? 165 LYS B O   1 
ATOM   4660  C  CB  . LYS B 1 165 ? -9.976  90.405  88.286  1.00 27.59  ? 165 LYS B CB  1 
ATOM   4661  C  CG  . LYS B 1 165 ? -10.974 89.905  87.313  1.00 28.99  ? 165 LYS B CG  1 
ATOM   4662  C  CD  . LYS B 1 165 ? -11.691 91.084  86.694  1.00 31.75  ? 165 LYS B CD  1 
ATOM   4663  C  CE  . LYS B 1 165 ? -10.758 91.789  85.738  1.00 38.08  ? 165 LYS B CE  1 
ATOM   4664  N  NZ  . LYS B 1 165 ? -10.581 91.035  84.476  1.00 31.75  ? 165 LYS B NZ  1 
ATOM   4665  N  N   . ASP B 1 166 ? -7.533  88.924  86.930  1.00 27.81  ? 166 ASP B N   1 
ATOM   4666  C  CA  . ASP B 1 166 ? -6.334  89.070  86.120  1.00 23.18  ? 166 ASP B CA  1 
ATOM   4667  C  C   . ASP B 1 166 ? -6.414  90.440  85.449  1.00 21.51  ? 166 ASP B C   1 
ATOM   4668  O  O   . ASP B 1 166 ? -7.507  90.930  85.134  1.00 20.96  ? 166 ASP B O   1 
ATOM   4669  C  CB  . ASP B 1 166 ? -6.261  87.963  85.090  1.00 25.48  ? 166 ASP B CB  1 
ATOM   4670  C  CG  . ASP B 1 166 ? -6.016  86.625  85.710  1.00 31.33  ? 166 ASP B CG  1 
ATOM   4671  O  OD1 . ASP B 1 166 ? -5.472  86.569  86.828  1.00 33.49  ? 166 ASP B OD1 1 
ATOM   4672  O  OD2 . ASP B 1 166 ? -6.358  85.616  85.073  1.00 42.50  ? 166 ASP B OD2 1 
ATOM   4673  N  N   . THR B 1 167 ? -5.266  91.050  85.216  1.00 16.17  ? 167 THR B N   1 
ATOM   4674  C  CA  . THR B 1 167 ? -5.226  92.385  84.641  1.00 17.15  ? 167 THR B CA  1 
ATOM   4675  C  C   . THR B 1 167 ? -4.783  92.450  83.173  1.00 19.16  ? 167 THR B C   1 
ATOM   4676  O  O   . THR B 1 167 ? -3.649  92.086  82.830  1.00 20.26  ? 167 THR B O   1 
ATOM   4677  C  CB  . THR B 1 167 ? -4.317  93.280  85.511  1.00 16.18  ? 167 THR B CB  1 
ATOM   4678  O  OG1 . THR B 1 167 ? -4.681  93.118  86.888  1.00 14.83  ? 167 THR B OG1 1 
ATOM   4679  C  CG2 . THR B 1 167 ? -4.446  94.737  85.128  1.00 14.20  ? 167 THR B CG2 1 
ATOM   4680  N  N   . ALA B 1 168 ? -5.683  92.927  82.319  1.00 16.66  ? 168 ALA B N   1 
ATOM   4681  C  CA  . ALA B 1 168 ? -5.424  93.075  80.895  1.00 14.65  ? 168 ALA B CA  1 
ATOM   4682  C  C   . ALA B 1 168 ? -4.501  94.255  80.684  1.00 18.43  ? 168 ALA B C   1 
ATOM   4683  O  O   . ALA B 1 168 ? -4.670  95.285  81.336  1.00 24.49  ? 168 ALA B O   1 
ATOM   4684  C  CB  . ALA B 1 168 ? -6.714  93.335  80.174  1.00 10.95  ? 168 ALA B CB  1 
ATOM   4685  N  N   . ASN B 1 169 ? -3.518  94.102  79.799  1.00 19.29  ? 169 ASN B N   1 
ATOM   4686  C  CA  . ASN B 1 169 ? -2.568  95.170  79.473  1.00 18.43  ? 169 ASN B CA  1 
ATOM   4687  C  C   . ASN B 1 169 ? -2.644  95.370  77.972  1.00 20.49  ? 169 ASN B C   1 
ATOM   4688  O  O   . ASN B 1 169 ? -2.436  94.424  77.200  1.00 26.14  ? 169 ASN B O   1 
ATOM   4689  C  CB  . ASN B 1 169 ? -1.136  94.799  79.873  1.00 15.49  ? 169 ASN B CB  1 
ATOM   4690  C  CG  . ASN B 1 169 ? -0.896  94.916  81.373  1.00 19.07  ? 169 ASN B CG  1 
ATOM   4691  O  OD1 . ASN B 1 169 ? -0.291  95.878  81.842  1.00 21.24  ? 169 ASN B OD1 1 
ATOM   4692  N  ND2 . ASN B 1 169 ? -1.363  93.933  82.129  1.00 18.34  ? 169 ASN B ND2 1 
ATOM   4693  N  N   . ASP B 1 170 ? -3.019  96.575  77.561  1.00 19.54  ? 170 ASP B N   1 
ATOM   4694  C  CA  . ASP B 1 170 ? -3.137  96.900  76.144  1.00 16.67  ? 170 ASP B CA  1 
ATOM   4695  C  C   . ASP B 1 170 ? -1.901  97.611  75.660  1.00 17.83  ? 170 ASP B C   1 
ATOM   4696  O  O   . ASP B 1 170 ? -1.342  98.428  76.385  1.00 20.68  ? 170 ASP B O   1 
ATOM   4697  C  CB  . ASP B 1 170 ? -4.313  97.830  75.906  1.00 15.52  ? 170 ASP B CB  1 
ATOM   4698  C  CG  . ASP B 1 170 ? -5.644  97.183  76.180  1.00 20.08  ? 170 ASP B CG  1 
ATOM   4699  O  OD1 . ASP B 1 170 ? -5.768  95.948  76.068  1.00 22.86  ? 170 ASP B OD1 1 
ATOM   4700  O  OD2 . ASP B 1 170 ? -6.591  97.924  76.485  1.00 22.75  ? 170 ASP B OD2 1 
ATOM   4701  N  N   . VAL B 1 171 ? -1.489  97.315  74.432  1.00 18.80  ? 171 VAL B N   1 
ATOM   4702  C  CA  . VAL B 1 171 ? -0.336  97.967  73.823  1.00 17.84  ? 171 VAL B CA  1 
ATOM   4703  C  C   . VAL B 1 171 ? -0.814  98.531  72.503  1.00 19.23  ? 171 VAL B C   1 
ATOM   4704  O  O   . VAL B 1 171 ? -1.565  97.872  71.772  1.00 18.59  ? 171 VAL B O   1 
ATOM   4705  C  CB  . VAL B 1 171 ? 0.833   96.997  73.516  1.00 17.91  ? 171 VAL B CB  1 
ATOM   4706  C  CG1 . VAL B 1 171 ? 2.022   97.769  72.991  1.00 16.86  ? 171 VAL B CG1 1 
ATOM   4707  C  CG2 . VAL B 1 171 ? 1.247   96.261  74.752  1.00 26.46  ? 171 VAL B CG2 1 
ATOM   4708  N  N   . PHE B 1 172 ? -0.415  99.767  72.229  1.00 19.50  ? 172 PHE B N   1 
ATOM   4709  C  CA  . PHE B 1 172 ? -0.756  100.451 70.995  1.00 18.98  ? 172 PHE B CA  1 
ATOM   4710  C  C   . PHE B 1 172 ? 0.604   100.717 70.392  1.00 19.69  ? 172 PHE B C   1 
ATOM   4711  O  O   . PHE B 1 172 ? 1.463   101.357 70.997  1.00 17.03  ? 172 PHE B O   1 
ATOM   4712  C  CB  . PHE B 1 172 ? -1.541  101.704 71.307  1.00 22.33  ? 172 PHE B CB  1 
ATOM   4713  C  CG  . PHE B 1 172 ? -2.723  101.437 72.199  1.00 34.44  ? 172 PHE B CG  1 
ATOM   4714  C  CD1 . PHE B 1 172 ? -3.923  100.965 71.665  1.00 35.36  ? 172 PHE B CD1 1 
ATOM   4715  C  CD2 . PHE B 1 172 ? -2.622  101.602 73.585  1.00 36.60  ? 172 PHE B CD2 1 
ATOM   4716  C  CE1 . PHE B 1 172 ? -5.009  100.654 72.494  1.00 34.75  ? 172 PHE B CE1 1 
ATOM   4717  C  CE2 . PHE B 1 172 ? -3.699  101.297 74.426  1.00 35.38  ? 172 PHE B CE2 1 
ATOM   4718  C  CZ  . PHE B 1 172 ? -4.896  100.821 73.876  1.00 35.14  ? 172 PHE B CZ  1 
ATOM   4719  N  N   . ASP B 1 173 ? 0.792   100.152 69.209  1.00 20.29  ? 173 ASP B N   1 
ATOM   4720  C  CA  . ASP B 1 173 ? 2.060   100.154 68.501  1.00 18.81  ? 173 ASP B CA  1 
ATOM   4721  C  C   . ASP B 1 173 ? 2.030   100.865 67.152  1.00 18.27  ? 173 ASP B C   1 
ATOM   4722  O  O   . ASP B 1 173 ? 1.131   100.638 66.343  1.00 18.70  ? 173 ASP B O   1 
ATOM   4723  C  CB  . ASP B 1 173 ? 2.437   98.671  68.350  1.00 18.56  ? 173 ASP B CB  1 
ATOM   4724  C  CG  . ASP B 1 173 ? 3.721   98.447  67.611  1.00 20.34  ? 173 ASP B CG  1 
ATOM   4725  O  OD1 . ASP B 1 173 ? 3.667   98.395  66.374  1.00 23.75  ? 173 ASP B OD1 1 
ATOM   4726  O  OD2 . ASP B 1 173 ? 4.768   98.261  68.255  1.00 19.44  ? 173 ASP B OD2 1 
ATOM   4727  N  N   . VAL B 1 174 ? 3.024   101.716 66.918  1.00 16.59  ? 174 VAL B N   1 
ATOM   4728  C  CA  . VAL B 1 174 ? 3.134   102.467 65.671  1.00 15.92  ? 174 VAL B CA  1 
ATOM   4729  C  C   . VAL B 1 174 ? 4.564   102.336 65.166  1.00 17.44  ? 174 VAL B C   1 
ATOM   4730  O  O   . VAL B 1 174 ? 5.523   102.548 65.917  1.00 18.64  ? 174 VAL B O   1 
ATOM   4731  C  CB  . VAL B 1 174 ? 2.806   103.945 65.883  1.00 17.91  ? 174 VAL B CB  1 
ATOM   4732  C  CG1 . VAL B 1 174 ? 2.793   104.674 64.570  1.00 14.27  ? 174 VAL B CG1 1 
ATOM   4733  C  CG2 . VAL B 1 174 ? 1.471   104.072 66.543  1.00 18.49  ? 174 VAL B CG2 1 
ATOM   4734  N  N   . ARG B 1 175 ? 4.712   101.970 63.900  1.00 17.16  ? 175 ARG B N   1 
ATOM   4735  C  CA  . ARG B 1 175 ? 6.032   101.785 63.327  1.00 15.09  ? 175 ARG B CA  1 
ATOM   4736  C  C   . ARG B 1 175 ? 6.152   102.440 61.961  1.00 18.10  ? 175 ARG B C   1 
ATOM   4737  O  O   . ARG B 1 175 ? 5.195   102.457 61.186  1.00 17.17  ? 175 ARG B O   1 
ATOM   4738  C  CB  . ARG B 1 175 ? 6.316   100.285 63.204  1.00 16.05  ? 175 ARG B CB  1 
ATOM   4739  C  CG  . ARG B 1 175 ? 6.721   99.613  64.495  1.00 18.76  ? 175 ARG B CG  1 
ATOM   4740  C  CD  . ARG B 1 175 ? 5.986   98.310  64.701  1.00 16.31  ? 175 ARG B CD  1 
ATOM   4741  N  NE  . ARG B 1 175 ? 6.878   97.157  64.763  1.00 18.31  ? 175 ARG B NE  1 
ATOM   4742  C  CZ  . ARG B 1 175 ? 6.889   96.230  65.722  1.00 17.03  ? 175 ARG B CZ  1 
ATOM   4743  N  NH1 . ARG B 1 175 ? 6.056   96.283  66.749  1.00 10.80  ? 175 ARG B NH1 1 
ATOM   4744  N  NH2 . ARG B 1 175 ? 7.752   95.226  65.634  1.00 20.83  ? 175 ARG B NH2 1 
ATOM   4745  N  N   . LEU B 1 176 ? 7.320   103.007 61.684  1.00 19.17  ? 176 LEU B N   1 
ATOM   4746  C  CA  . LEU B 1 176 ? 7.594   103.632 60.405  1.00 17.18  ? 176 LEU B CA  1 
ATOM   4747  C  C   . LEU B 1 176 ? 8.866   102.963 59.960  1.00 17.20  ? 176 LEU B C   1 
ATOM   4748  O  O   . LEU B 1 176 ? 9.904   103.100 60.601  1.00 19.17  ? 176 LEU B O   1 
ATOM   4749  C  CB  . LEU B 1 176 ? 7.815   105.137 60.560  1.00 20.59  ? 176 LEU B CB  1 
ATOM   4750  C  CG  . LEU B 1 176 ? 7.982   105.949 59.260  1.00 22.56  ? 176 LEU B CG  1 
ATOM   4751  C  CD1 . LEU B 1 176 ? 6.813   105.745 58.322  1.00 21.96  ? 176 LEU B CD1 1 
ATOM   4752  C  CD2 . LEU B 1 176 ? 8.089   107.411 59.595  1.00 22.36  ? 176 LEU B CD2 1 
ATOM   4753  N  N   . ALA B 1 177 ? 8.787   102.185 58.896  1.00 17.90  ? 177 ALA B N   1 
ATOM   4754  C  CA  . ALA B 1 177 ? 9.971   101.488 58.433  1.00 18.76  ? 177 ALA B CA  1 
ATOM   4755  C  C   . ALA B 1 177 ? 10.365  101.846 57.020  1.00 19.73  ? 177 ALA B C   1 
ATOM   4756  O  O   . ALA B 1 177 ? 9.579   102.435 56.272  1.00 20.12  ? 177 ALA B O   1 
ATOM   4757  C  CB  . ALA B 1 177 ? 9.758   99.997  58.538  1.00 16.60  ? 177 ALA B CB  1 
ATOM   4758  N  N   . GLY B 1 178 ? 11.587  101.468 56.662  1.00 21.84  ? 178 GLY B N   1 
ATOM   4759  C  CA  . GLY B 1 178 ? 12.071  101.710 55.323  1.00 24.40  ? 178 GLY B CA  1 
ATOM   4760  C  C   . GLY B 1 178 ? 12.579  103.093 55.021  1.00 26.69  ? 178 GLY B C   1 
ATOM   4761  O  O   . GLY B 1 178 ? 12.595  103.484 53.865  1.00 32.63  ? 178 GLY B O   1 
ATOM   4762  N  N   . LEU B 1 179 ? 12.987  103.841 56.038  1.00 28.71  ? 179 LEU B N   1 
ATOM   4763  C  CA  . LEU B 1 179 ? 13.505  105.186 55.809  1.00 27.35  ? 179 LEU B CA  1 
ATOM   4764  C  C   . LEU B 1 179 ? 14.918  105.004 55.284  1.00 29.24  ? 179 LEU B C   1 
ATOM   4765  O  O   . LEU B 1 179 ? 15.755  104.381 55.943  1.00 29.48  ? 179 LEU B O   1 
ATOM   4766  C  CB  . LEU B 1 179 ? 13.524  106.001 57.111  1.00 24.49  ? 179 LEU B CB  1 
ATOM   4767  C  CG  . LEU B 1 179 ? 12.194  106.189 57.839  1.00 24.17  ? 179 LEU B CG  1 
ATOM   4768  C  CD1 . LEU B 1 179 ? 12.434  106.835 59.167  1.00 22.58  ? 179 LEU B CD1 1 
ATOM   4769  C  CD2 . LEU B 1 179 ? 11.255  107.022 57.014  1.00 23.04  ? 179 LEU B CD2 1 
ATOM   4770  N  N   . GLN B 1 180 ? 15.146  105.443 54.051  1.00 32.74  ? 180 GLN B N   1 
ATOM   4771  C  CA  . GLN B 1 180 ? 16.463  105.350 53.430  1.00 35.61  ? 180 GLN B CA  1 
ATOM   4772  C  C   . GLN B 1 180 ? 17.334  106.474 53.998  1.00 33.67  ? 180 GLN B C   1 
ATOM   4773  O  O   . GLN B 1 180 ? 17.164  107.641 53.658  1.00 34.43  ? 180 GLN B O   1 
ATOM   4774  C  CB  . GLN B 1 180 ? 16.347  105.467 51.906  1.00 42.86  ? 180 GLN B CB  1 
ATOM   4775  C  CG  . GLN B 1 180 ? 16.011  104.160 51.170  1.00 59.65  ? 180 GLN B CG  1 
ATOM   4776  C  CD  . GLN B 1 180 ? 17.135  103.105 51.238  1.00 72.07  ? 180 GLN B CD  1 
ATOM   4777  O  OE1 . GLN B 1 180 ? 16.874  101.905 51.123  1.00 78.91  ? 180 GLN B OE1 1 
ATOM   4778  N  NE2 . GLN B 1 180 ? 18.383  103.551 51.402  1.00 73.28  ? 180 GLN B NE2 1 
ATOM   4779  N  N   . THR B 1 181 ? 18.247  106.119 54.888  1.00 31.65  ? 181 THR B N   1 
ATOM   4780  C  CA  . THR B 1 181 ? 19.105  107.101 55.512  1.00 31.19  ? 181 THR B CA  1 
ATOM   4781  C  C   . THR B 1 181 ? 20.450  107.273 54.810  1.00 33.09  ? 181 THR B C   1 
ATOM   4782  O  O   . THR B 1 181 ? 21.033  108.355 54.817  1.00 36.52  ? 181 THR B O   1 
ATOM   4783  C  CB  . THR B 1 181 ? 19.329  106.745 56.998  1.00 27.71  ? 181 THR B CB  1 
ATOM   4784  O  OG1 . THR B 1 181 ? 19.715  105.368 57.105  1.00 32.20  ? 181 THR B OG1 1 
ATOM   4785  C  CG2 . THR B 1 181 ? 18.063  106.961 57.785  1.00 24.11  ? 181 THR B CG2 1 
ATOM   4786  N  N   . ASN B 1 182 ? 20.948  106.208 54.204  1.00 33.48  ? 182 ASN B N   1 
ATOM   4787  C  CA  . ASN B 1 182 ? 22.232  106.258 53.526  1.00 32.69  ? 182 ASN B CA  1 
ATOM   4788  C  C   . ASN B 1 182 ? 22.279  105.078 52.582  1.00 35.72  ? 182 ASN B C   1 
ATOM   4789  O  O   . ASN B 1 182 ? 21.420  104.194 52.632  1.00 39.25  ? 182 ASN B O   1 
ATOM   4790  C  CB  . ASN B 1 182 ? 23.372  106.151 54.547  1.00 30.57  ? 182 ASN B CB  1 
ATOM   4791  C  CG  . ASN B 1 182 ? 23.310  104.875 55.358  1.00 29.46  ? 182 ASN B CG  1 
ATOM   4792  O  OD1 . ASN B 1 182 ? 22.410  104.693 56.171  1.00 31.35  ? 182 ASN B OD1 1 
ATOM   4793  N  ND2 . ASN B 1 182 ? 24.250  103.979 55.127  1.00 31.34  ? 182 ASN B ND2 1 
ATOM   4794  N  N   . PRO B 1 183 ? 23.249  105.066 51.667  1.00 37.58  ? 183 PRO B N   1 
ATOM   4795  C  CA  . PRO B 1 183 ? 23.343  103.943 50.728  1.00 37.32  ? 183 PRO B CA  1 
ATOM   4796  C  C   . PRO B 1 183 ? 23.407  102.600 51.447  1.00 34.61  ? 183 PRO B C   1 
ATOM   4797  O  O   . PRO B 1 183 ? 24.256  102.385 52.309  1.00 33.94  ? 183 PRO B O   1 
ATOM   4798  C  CB  . PRO B 1 183 ? 24.628  104.246 49.948  1.00 38.30  ? 183 PRO B CB  1 
ATOM   4799  C  CG  . PRO B 1 183 ? 25.388  105.190 50.861  1.00 39.91  ? 183 PRO B CG  1 
ATOM   4800  C  CD  . PRO B 1 183 ? 24.297  106.061 51.403  1.00 36.17  ? 183 PRO B CD  1 
ATOM   4801  N  N   . ASP B 1 184 ? 22.465  101.727 51.103  1.00 32.56  ? 184 ASP B N   1 
ATOM   4802  C  CA  . ASP B 1 184 ? 22.361  100.403 51.692  1.00 32.30  ? 184 ASP B CA  1 
ATOM   4803  C  C   . ASP B 1 184 ? 21.998  100.435 53.170  1.00 29.57  ? 184 ASP B C   1 
ATOM   4804  O  O   . ASP B 1 184 ? 22.153  99.435  53.866  1.00 29.66  ? 184 ASP B O   1 
ATOM   4805  C  CB  . ASP B 1 184 ? 23.657  99.614  51.487  1.00 37.54  ? 184 ASP B CB  1 
ATOM   4806  C  CG  . ASP B 1 184 ? 23.926  99.285  50.023  1.00 41.89  ? 184 ASP B CG  1 
ATOM   4807  O  OD1 . ASP B 1 184 ? 22.965  99.023  49.261  1.00 37.40  ? 184 ASP B OD1 1 
ATOM   4808  O  OD2 . ASP B 1 184 ? 25.116  99.276  49.642  1.00 46.40  ? 184 ASP B OD2 1 
ATOM   4809  N  N   . GLY B 1 185 ? 21.517  101.582 53.639  1.00 25.82  ? 185 GLY B N   1 
ATOM   4810  C  CA  . GLY B 1 185 ? 21.136  101.720 55.028  1.00 22.74  ? 185 GLY B CA  1 
ATOM   4811  C  C   . GLY B 1 185 ? 19.677  102.098 55.116  1.00 22.40  ? 185 GLY B C   1 
ATOM   4812  O  O   . GLY B 1 185 ? 19.189  102.903 54.319  1.00 24.95  ? 185 GLY B O   1 
ATOM   4813  N  N   . VAL B 1 186 ? 18.958  101.478 56.039  1.00 22.22  ? 186 VAL B N   1 
ATOM   4814  C  CA  . VAL B 1 186 ? 17.550  101.771 56.229  1.00 21.31  ? 186 VAL B CA  1 
ATOM   4815  C  C   . VAL B 1 186 ? 17.297  101.912 57.720  1.00 20.80  ? 186 VAL B C   1 
ATOM   4816  O  O   . VAL B 1 186 ? 17.984  101.287 58.535  1.00 21.73  ? 186 VAL B O   1 
ATOM   4817  C  CB  . VAL B 1 186 ? 16.672  100.674 55.634  1.00 20.71  ? 186 VAL B CB  1 
ATOM   4818  C  CG1 . VAL B 1 186 ? 15.248  100.871 56.032  1.00 32.38  ? 186 VAL B CG1 1 
ATOM   4819  C  CG2 . VAL B 1 186 ? 16.741  100.733 54.142  1.00 27.95  ? 186 VAL B CG2 1 
ATOM   4820  N  N   . LEU B 1 187 ? 16.306  102.726 58.068  1.00 19.17  ? 187 LEU B N   1 
ATOM   4821  C  CA  . LEU B 1 187 ? 15.961  102.990 59.456  1.00 16.59  ? 187 LEU B CA  1 
ATOM   4822  C  C   . LEU B 1 187 ? 14.486  102.756 59.737  1.00 17.49  ? 187 LEU B C   1 
ATOM   4823  O  O   . LEU B 1 187 ? 13.630  103.077 58.911  1.00 18.83  ? 187 LEU B O   1 
ATOM   4824  C  CB  . LEU B 1 187 ? 16.300  104.444 59.802  1.00 15.10  ? 187 LEU B CB  1 
ATOM   4825  C  CG  . LEU B 1 187 ? 15.988  104.950 61.213  1.00 18.28  ? 187 LEU B CG  1 
ATOM   4826  C  CD1 . LEU B 1 187 ? 16.924  104.302 62.222  1.00 14.17  ? 187 LEU B CD1 1 
ATOM   4827  C  CD2 . LEU B 1 187 ? 16.134  106.466 61.258  1.00 18.42  ? 187 LEU B CD2 1 
ATOM   4828  N  N   . GLU B 1 188 ? 14.205  102.173 60.896  1.00 16.30  ? 188 GLU B N   1 
ATOM   4829  C  CA  . GLU B 1 188 ? 12.843  101.920 61.339  1.00 13.62  ? 188 GLU B CA  1 
ATOM   4830  C  C   . GLU B 1 188 ? 12.701  102.524 62.719  1.00 16.07  ? 188 GLU B C   1 
ATOM   4831  O  O   . GLU B 1 188 ? 13.586  102.359 63.572  1.00 12.85  ? 188 GLU B O   1 
ATOM   4832  C  CB  . GLU B 1 188 ? 12.551  100.429 61.438  1.00 13.67  ? 188 GLU B CB  1 
ATOM   4833  C  CG  . GLU B 1 188 ? 11.216  100.126 62.117  1.00 11.36  ? 188 GLU B CG  1 
ATOM   4834  C  CD  . GLU B 1 188 ? 10.806  98.664  62.007  1.00 15.80  ? 188 GLU B CD  1 
ATOM   4835  O  OE1 . GLU B 1 188 ? 11.677  97.778  61.903  1.00 17.12  ? 188 GLU B OE1 1 
ATOM   4836  O  OE2 . GLU B 1 188 ? 9.598   98.386  62.006  1.00 12.58  ? 188 GLU B OE2 1 
ATOM   4837  N  N   . LEU B 1 189 ? 11.589  103.223 62.920  1.00 17.90  ? 189 LEU B N   1 
ATOM   4838  C  CA  . LEU B 1 189 ? 11.259  103.885 64.175  1.00 18.12  ? 189 LEU B CA  1 
ATOM   4839  C  C   . LEU B 1 189 ? 9.959   103.291 64.691  1.00 19.41  ? 189 LEU B C   1 
ATOM   4840  O  O   . LEU B 1 189 ? 9.039   103.040 63.906  1.00 20.26  ? 189 LEU B O   1 
ATOM   4841  C  CB  . LEU B 1 189 ? 11.038  105.376 63.933  1.00 18.93  ? 189 LEU B CB  1 
ATOM   4842  C  CG  . LEU B 1 189 ? 12.148  106.433 64.002  1.00 21.41  ? 189 LEU B CG  1 
ATOM   4843  C  CD1 . LEU B 1 189 ? 13.528  105.832 64.134  1.00 19.94  ? 189 LEU B CD1 1 
ATOM   4844  C  CD2 . LEU B 1 189 ? 12.043  107.335 62.784  1.00 17.06  ? 189 LEU B CD2 1 
ATOM   4845  N  N   . GLY B 1 190 ? 9.869   103.080 65.998  1.00 17.62  ? 190 GLY B N   1 
ATOM   4846  C  CA  . GLY B 1 190 ? 8.652   102.527 66.545  1.00 18.50  ? 190 GLY B CA  1 
ATOM   4847  C  C   . GLY B 1 190 ? 8.385   103.070 67.924  1.00 20.24  ? 190 GLY B C   1 
ATOM   4848  O  O   . GLY B 1 190 ? 9.327   103.341 68.657  1.00 20.74  ? 190 GLY B O   1 
ATOM   4849  N  N   . VAL B 1 191 ? 7.112   103.272 68.252  1.00 20.76  ? 191 VAL B N   1 
ATOM   4850  C  CA  . VAL B 1 191 ? 6.688   103.768 69.565  1.00 22.32  ? 191 VAL B CA  1 
ATOM   4851  C  C   . VAL B 1 191 ? 5.639   102.806 70.098  1.00 22.82  ? 191 VAL B C   1 
ATOM   4852  O  O   . VAL B 1 191 ? 4.773   102.333 69.347  1.00 23.00  ? 191 VAL B O   1 
ATOM   4853  C  CB  . VAL B 1 191 ? 6.013   105.180 69.493  1.00 23.03  ? 191 VAL B CB  1 
ATOM   4854  C  CG1 . VAL B 1 191 ? 5.531   105.609 70.867  1.00 22.95  ? 191 VAL B CG1 1 
ATOM   4855  C  CG2 . VAL B 1 191 ? 6.979   106.203 68.974  1.00 25.37  ? 191 VAL B CG2 1 
ATOM   4856  N  N   . ASP B 1 192 ? 5.729   102.509 71.387  1.00 22.60  ? 192 ASP B N   1 
ATOM   4857  C  CA  . ASP B 1 192 ? 4.777   101.631 72.033  1.00 18.95  ? 192 ASP B CA  1 
ATOM   4858  C  C   . ASP B 1 192 ? 4.267   102.276 73.309  1.00 18.79  ? 192 ASP B C   1 
ATOM   4859  O  O   . ASP B 1 192 ? 5.059   102.747 74.129  1.00 19.83  ? 192 ASP B O   1 
ATOM   4860  C  CB  . ASP B 1 192 ? 5.443   100.308 72.408  1.00 18.20  ? 192 ASP B CB  1 
ATOM   4861  C  CG  . ASP B 1 192 ? 5.603   99.382  71.242  1.00 17.20  ? 192 ASP B CG  1 
ATOM   4862  O  OD1 . ASP B 1 192 ? 4.580   98.893  70.749  1.00 21.35  ? 192 ASP B OD1 1 
ATOM   4863  O  OD2 . ASP B 1 192 ? 6.740   99.104  70.834  1.00 15.33  ? 192 ASP B OD2 1 
ATOM   4864  N  N   . TYR B 1 193 ? 2.951   102.321 73.463  1.00 16.70  ? 193 TYR B N   1 
ATOM   4865  C  CA  . TYR B 1 193 ? 2.349   102.835 74.678  1.00 17.67  ? 193 TYR B CA  1 
ATOM   4866  C  C   . TYR B 1 193 ? 1.467   101.734 75.235  1.00 18.75  ? 193 TYR B C   1 
ATOM   4867  O  O   . TYR B 1 193 ? 0.534   101.288 74.562  1.00 17.30  ? 193 TYR B O   1 
ATOM   4868  C  CB  . TYR B 1 193 ? 1.492   104.071 74.424  1.00 17.99  ? 193 TYR B CB  1 
ATOM   4869  C  CG  . TYR B 1 193 ? 0.756   104.485 75.677  1.00 21.80  ? 193 TYR B CG  1 
ATOM   4870  C  CD1 . TYR B 1 193 ? 1.448   105.001 76.781  1.00 21.93  ? 193 TYR B CD1 1 
ATOM   4871  C  CD2 . TYR B 1 193 ? -0.616  104.267 75.803  1.00 22.12  ? 193 TYR B CD2 1 
ATOM   4872  C  CE1 . TYR B 1 193 ? 0.788   105.276 77.978  1.00 22.17  ? 193 TYR B CE1 1 
ATOM   4873  C  CE2 . TYR B 1 193 ? -1.283  104.539 76.992  1.00 20.59  ? 193 TYR B CE2 1 
ATOM   4874  C  CZ  . TYR B 1 193 ? -0.578  105.040 78.076  1.00 23.42  ? 193 TYR B CZ  1 
ATOM   4875  O  OH  . TYR B 1 193 ? -1.239  105.289 79.259  1.00 27.03  ? 193 TYR B OH  1 
ATOM   4876  N  N   . GLY B 1 194 ? 1.758   101.295 76.456  1.00 19.76  ? 194 GLY B N   1 
ATOM   4877  C  CA  . GLY B 1 194 ? 0.969   100.238 77.076  1.00 21.06  ? 194 GLY B CA  1 
ATOM   4878  C  C   . GLY B 1 194 ? 0.403   100.614 78.438  1.00 22.56  ? 194 GLY B C   1 
ATOM   4879  O  O   . GLY B 1 194 ? 1.017   101.386 79.177  1.00 25.17  ? 194 GLY B O   1 
ATOM   4880  N  N   . ARG B 1 195 ? -0.766  100.089 78.783  1.00 22.27  ? 195 ARG B N   1 
ATOM   4881  C  CA  . ARG B 1 195 ? -1.352  100.413 80.071  1.00 23.99  ? 195 ARG B CA  1 
ATOM   4882  C  C   . ARG B 1 195 ? -2.245  99.314  80.587  1.00 24.11  ? 195 ARG B C   1 
ATOM   4883  O  O   . ARG B 1 195 ? -2.840  98.587  79.795  1.00 27.29  ? 195 ARG B O   1 
ATOM   4884  C  CB  . ARG B 1 195 ? -2.168  101.692 79.966  1.00 29.85  ? 195 ARG B CB  1 
ATOM   4885  C  CG  . ARG B 1 195 ? -3.486  101.523 79.276  1.00 37.76  ? 195 ARG B CG  1 
ATOM   4886  C  CD  . ARG B 1 195 ? -4.227  102.835 79.265  1.00 53.21  ? 195 ARG B CD  1 
ATOM   4887  N  NE  . ARG B 1 195 ? -5.666  102.640 79.400  1.00 69.28  ? 195 ARG B NE  1 
ATOM   4888  C  CZ  . ARG B 1 195 ? -6.301  102.524 80.567  1.00 78.42  ? 195 ARG B CZ  1 
ATOM   4889  N  NH1 . ARG B 1 195 ? -5.621  102.587 81.711  1.00 82.15  ? 195 ARG B NH1 1 
ATOM   4890  N  NH2 . ARG B 1 195 ? -7.618  102.331 80.592  1.00 82.11  ? 195 ARG B NH2 1 
ATOM   4891  N  N   . ALA B 1 196 ? -2.304  99.161  81.910  1.00 20.60  ? 196 ALA B N   1 
ATOM   4892  C  CA  . ALA B 1 196 ? -3.177  98.161  82.515  1.00 19.70  ? 196 ALA B CA  1 
ATOM   4893  C  C   . ALA B 1 196 ? -4.543  98.767  82.330  1.00 19.76  ? 196 ALA B C   1 
ATOM   4894  O  O   . ALA B 1 196 ? -4.728  99.975  82.501  1.00 21.59  ? 196 ALA B O   1 
ATOM   4895  C  CB  . ALA B 1 196 ? -2.885  97.973  83.989  1.00 19.08  ? 196 ALA B CB  1 
ATOM   4896  N  N   . ASN B 1 197 ? -5.485  97.926  81.952  1.00 19.95  ? 197 ASN B N   1 
ATOM   4897  C  CA  . ASN B 1 197 ? -6.846  98.344  81.680  1.00 21.58  ? 197 ASN B CA  1 
ATOM   4898  C  C   . ASN B 1 197 ? -7.753  97.489  82.564  1.00 23.42  ? 197 ASN B C   1 
ATOM   4899  O  O   . ASN B 1 197 ? -8.056  96.343  82.235  1.00 26.46  ? 197 ASN B O   1 
ATOM   4900  C  CB  . ASN B 1 197 ? -7.110  98.104  80.189  1.00 24.70  ? 197 ASN B CB  1 
ATOM   4901  C  CG  . ASN B 1 197 ? -8.513  98.434  79.775  1.00 26.44  ? 197 ASN B CG  1 
ATOM   4902  O  OD1 . ASN B 1 197 ? -9.274  99.019  80.529  1.00 31.18  ? 197 ASN B OD1 1 
ATOM   4903  N  ND2 . ASN B 1 197 ? -8.866  98.056  78.558  1.00 34.11  ? 197 ASN B ND2 1 
ATOM   4904  N  N   . THR B 1 198 ? -8.157  98.043  83.702  1.00 22.87  ? 198 THR B N   1 
ATOM   4905  C  CA  . THR B 1 198 ? -8.992  97.335  84.667  1.00 20.56  ? 198 THR B CA  1 
ATOM   4906  C  C   . THR B 1 198 ? -10.486 97.318  84.381  1.00 18.21  ? 198 THR B C   1 
ATOM   4907  O  O   . THR B 1 198 ? -11.036 98.263  83.825  1.00 18.53  ? 198 THR B O   1 
ATOM   4908  C  CB  . THR B 1 198 ? -8.778  97.897  86.075  1.00 23.43  ? 198 THR B CB  1 
ATOM   4909  O  OG1 . THR B 1 198 ? -8.834  99.332  86.027  1.00 24.42  ? 198 THR B OG1 1 
ATOM   4910  C  CG2 . THR B 1 198 ? -7.423  97.451  86.623  1.00 21.90  ? 198 THR B CG2 1 
ATOM   4911  N  N   . THR B 1 199 ? -11.124 96.215  84.756  1.00 17.87  ? 199 THR B N   1 
ATOM   4912  C  CA  . THR B 1 199 ? -12.555 96.016  84.603  1.00 19.99  ? 199 THR B CA  1 
ATOM   4913  C  C   . THR B 1 199 ? -13.225 96.976  85.566  1.00 24.12  ? 199 THR B C   1 
ATOM   4914  O  O   . THR B 1 199 ? -12.683 97.248  86.634  1.00 30.13  ? 199 THR B O   1 
ATOM   4915  C  CB  . THR B 1 199 ? -12.904 94.619  85.066  1.00 19.14  ? 199 THR B CB  1 
ATOM   4916  O  OG1 . THR B 1 199 ? -12.150 93.683  84.301  1.00 23.08  ? 199 THR B OG1 1 
ATOM   4917  C  CG2 . THR B 1 199 ? -14.356 94.336  84.900  1.00 12.89  ? 199 THR B CG2 1 
ATOM   4918  N  N   . ASP B 1 200 ? -14.414 97.457  85.230  1.00 30.10  ? 200 ASP B N   1 
ATOM   4919  C  CA  . ASP B 1 200 ? -15.129 98.381  86.113  1.00 34.13  ? 200 ASP B CA  1 
ATOM   4920  C  C   . ASP B 1 200 ? -15.368 97.737  87.479  1.00 35.32  ? 200 ASP B C   1 
ATOM   4921  O  O   . ASP B 1 200 ? -15.788 96.580  87.569  1.00 35.91  ? 200 ASP B O   1 
ATOM   4922  C  CB  . ASP B 1 200 ? -16.466 98.804  85.496  1.00 40.15  ? 200 ASP B CB  1 
ATOM   4923  C  CG  . ASP B 1 200 ? -17.166 99.908  86.294  1.00 44.26  ? 200 ASP B CG  1 
ATOM   4924  O  OD1 . ASP B 1 200 ? -16.520 100.921 86.653  1.00 46.42  ? 200 ASP B OD1 1 
ATOM   4925  O  OD2 . ASP B 1 200 ? -18.379 99.764  86.544  1.00 50.95  ? 200 ASP B OD2 1 
ATOM   4926  N  N   . GLY B 1 201 ? -15.067 98.489  88.533  1.00 38.12  ? 201 GLY B N   1 
ATOM   4927  C  CA  . GLY B 1 201 ? -15.235 97.987  89.882  1.00 36.10  ? 201 GLY B CA  1 
ATOM   4928  C  C   . GLY B 1 201 ? -13.922 97.532  90.483  1.00 36.84  ? 201 GLY B C   1 
ATOM   4929  O  O   . GLY B 1 201 ? -13.759 97.538  91.704  1.00 43.15  ? 201 GLY B O   1 
ATOM   4930  N  N   . TYR B 1 202 ? -12.994 97.107  89.635  1.00 33.56  ? 202 TYR B N   1 
ATOM   4931  C  CA  . TYR B 1 202 ? -11.697 96.650  90.099  1.00 27.29  ? 202 TYR B CA  1 
ATOM   4932  C  C   . TYR B 1 202 ? -10.679 97.771  90.023  1.00 27.23  ? 202 TYR B C   1 
ATOM   4933  O  O   . TYR B 1 202 ? -10.838 98.721  89.258  1.00 26.28  ? 202 TYR B O   1 
ATOM   4934  C  CB  . TYR B 1 202 ? -11.236 95.464  89.272  1.00 23.64  ? 202 TYR B CB  1 
ATOM   4935  C  CG  . TYR B 1 202 ? -12.073 94.235  89.478  1.00 19.12  ? 202 TYR B CG  1 
ATOM   4936  C  CD1 . TYR B 1 202 ? -13.334 94.108  88.891  1.00 17.92  ? 202 TYR B CD1 1 
ATOM   4937  C  CD2 . TYR B 1 202 ? -11.597 93.181  90.244  1.00 20.38  ? 202 TYR B CD2 1 
ATOM   4938  C  CE1 . TYR B 1 202 ? -14.093 92.952  89.062  1.00 15.08  ? 202 TYR B CE1 1 
ATOM   4939  C  CE2 . TYR B 1 202 ? -12.348 92.026  90.422  1.00 20.22  ? 202 TYR B CE2 1 
ATOM   4940  C  CZ  . TYR B 1 202 ? -13.589 91.918  89.828  1.00 18.33  ? 202 TYR B CZ  1 
ATOM   4941  O  OH  . TYR B 1 202 ? -14.300 90.752  89.989  1.00 30.25  ? 202 TYR B OH  1 
ATOM   4942  N  N   . LYS B 1 203 ? -9.649  97.680  90.850  1.00 28.41  ? 203 LYS B N   1 
ATOM   4943  C  CA  . LYS B 1 203 ? -8.610  98.688  90.868  1.00 30.21  ? 203 LYS B CA  1 
ATOM   4944  C  C   . LYS B 1 203 ? -7.294  98.003  91.114  1.00 28.32  ? 203 LYS B C   1 
ATOM   4945  O  O   . LYS B 1 203 ? -7.259  96.861  91.593  1.00 26.57  ? 203 LYS B O   1 
ATOM   4946  C  CB  . LYS B 1 203 ? -8.854  99.693  91.987  1.00 38.97  ? 203 LYS B CB  1 
ATOM   4947  C  CG  . LYS B 1 203 ? -10.038 100.586 91.765  1.00 50.95  ? 203 LYS B CG  1 
ATOM   4948  C  CD  . LYS B 1 203 ? -10.269 101.502 92.949  1.00 61.62  ? 203 LYS B CD  1 
ATOM   4949  C  CE  . LYS B 1 203 ? -11.519 102.350 92.731  1.00 70.04  ? 203 LYS B CE  1 
ATOM   4950  N  NZ  . LYS B 1 203 ? -11.805 103.247 93.888  1.00 77.57  ? 203 LYS B NZ  1 
ATOM   4951  N  N   . LEU B 1 204 ? -6.218  98.684  90.740  1.00 28.35  ? 204 LEU B N   1 
ATOM   4952  C  CA  . LEU B 1 204 ? -4.884  98.161  90.959  1.00 31.04  ? 204 LEU B CA  1 
ATOM   4953  C  C   . LEU B 1 204 ? -4.487  98.553  92.400  1.00 33.85  ? 204 LEU B C   1 
ATOM   4954  O  O   . LEU B 1 204 ? -4.970  99.560  92.926  1.00 35.49  ? 204 LEU B O   1 
ATOM   4955  C  CB  . LEU B 1 204 ? -3.912  98.791  89.961  1.00 29.51  ? 204 LEU B CB  1 
ATOM   4956  C  CG  . LEU B 1 204 ? -4.176  98.695  88.456  1.00 27.76  ? 204 LEU B CG  1 
ATOM   4957  C  CD1 . LEU B 1 204 ? -3.170  99.590  87.754  1.00 25.07  ? 204 LEU B CD1 1 
ATOM   4958  C  CD2 . LEU B 1 204 ? -4.067  97.255  87.961  1.00 23.13  ? 204 LEU B CD2 1 
ATOM   4959  N  N   . ALA B 1 205 ? -3.642  97.749  93.046  1.00 35.75  ? 205 ALA B N   1 
ATOM   4960  C  CA  . ALA B 1 205 ? -3.195  98.042  94.402  1.00 34.19  ? 205 ALA B CA  1 
ATOM   4961  C  C   . ALA B 1 205 ? -2.367  99.330  94.345  1.00 37.45  ? 205 ALA B C   1 
ATOM   4962  O  O   . ALA B 1 205 ? -1.981  99.784  93.266  1.00 39.90  ? 205 ALA B O   1 
ATOM   4963  C  CB  . ALA B 1 205 ? -2.359  96.873  94.948  1.00 29.74  ? 205 ALA B CB  1 
ATOM   4964  N  N   . ASP B 1 206 ? -2.127  99.953  95.489  1.00 42.79  ? 206 ASP B N   1 
ATOM   4965  C  CA  . ASP B 1 206 ? -1.348  101.192 95.525  1.00 44.79  ? 206 ASP B CA  1 
ATOM   4966  C  C   . ASP B 1 206 ? 0.089   101.013 95.047  1.00 42.68  ? 206 ASP B C   1 
ATOM   4967  O  O   . ASP B 1 206 ? 0.753   100.020 95.377  1.00 42.16  ? 206 ASP B O   1 
ATOM   4968  C  CB  . ASP B 1 206 ? -1.318  101.777 96.945  1.00 54.21  ? 206 ASP B CB  1 
ATOM   4969  C  CG  . ASP B 1 206 ? -2.423  102.795 97.195  1.00 61.90  ? 206 ASP B CG  1 
ATOM   4970  O  OD1 . ASP B 1 206 ? -3.132  103.186 96.238  1.00 64.91  ? 206 ASP B OD1 1 
ATOM   4971  O  OD2 . ASP B 1 206 ? -2.569  103.214 98.367  1.00 68.35  ? 206 ASP B OD2 1 
ATOM   4972  N  N   . GLY B 1 207 ? 0.564   101.980 94.266  1.00 38.74  ? 207 GLY B N   1 
ATOM   4973  C  CA  . GLY B 1 207 ? 1.931   101.932 93.787  1.00 36.29  ? 207 GLY B CA  1 
ATOM   4974  C  C   . GLY B 1 207 ? 2.167   101.314 92.428  1.00 35.85  ? 207 GLY B C   1 
ATOM   4975  O  O   . GLY B 1 207 ? 3.277   101.415 91.905  1.00 37.31  ? 207 GLY B O   1 
ATOM   4976  N  N   . ALA B 1 208 ? 1.142   100.682 91.856  1.00 36.46  ? 208 ALA B N   1 
ATOM   4977  C  CA  . ALA B 1 208 ? 1.258   100.051 90.543  1.00 33.10  ? 208 ALA B CA  1 
ATOM   4978  C  C   . ALA B 1 208 ? 1.616   101.116 89.518  1.00 30.99  ? 208 ALA B C   1 
ATOM   4979  O  O   . ALA B 1 208 ? 1.024   102.201 89.525  1.00 31.90  ? 208 ALA B O   1 
ATOM   4980  C  CB  . ALA B 1 208 ? -0.046  99.385  90.164  1.00 31.67  ? 208 ALA B CB  1 
ATOM   4981  N  N   . SER B 1 209 ? 2.597   100.815 88.662  1.00 28.48  ? 209 SER B N   1 
ATOM   4982  C  CA  . SER B 1 209 ? 3.052   101.745 87.626  1.00 24.84  ? 209 SER B CA  1 
ATOM   4983  C  C   . SER B 1 209 ? 1.948   102.079 86.627  1.00 22.11  ? 209 SER B C   1 
ATOM   4984  O  O   . SER B 1 209 ? 1.894   103.197 86.110  1.00 24.04  ? 209 SER B O   1 
ATOM   4985  C  CB  . SER B 1 209 ? 4.279   101.189 86.902  1.00 24.16  ? 209 SER B CB  1 
ATOM   4986  O  OG  . SER B 1 209 ? 3.993   99.944  86.293  1.00 23.56  ? 209 SER B OG  1 
ATOM   4987  N  N   . LYS B 1 210 ? 1.072   101.111 86.365  1.00 20.06  ? 210 LYS B N   1 
ATOM   4988  C  CA  . LYS B 1 210 ? -0.060  101.281 85.452  1.00 20.53  ? 210 LYS B CA  1 
ATOM   4989  C  C   . LYS B 1 210 ? 0.238   101.416 83.957  1.00 19.18  ? 210 LYS B C   1 
ATOM   4990  O  O   . LYS B 1 210 ? -0.406  100.761 83.152  1.00 25.93  ? 210 LYS B O   1 
ATOM   4991  C  CB  . LYS B 1 210 ? -0.951  102.443 85.889  1.00 26.92  ? 210 LYS B CB  1 
ATOM   4992  C  CG  . LYS B 1 210 ? -2.075  102.715 84.900  1.00 42.80  ? 210 LYS B CG  1 
ATOM   4993  C  CD  . LYS B 1 210 ? -2.828  103.990 85.214  1.00 56.24  ? 210 LYS B CD  1 
ATOM   4994  C  CE  . LYS B 1 210 ? -3.804  104.357 84.081  1.00 65.56  ? 210 LYS B CE  1 
ATOM   4995  N  NZ  . LYS B 1 210 ? -3.142  104.736 82.783  1.00 69.19  ? 210 LYS B NZ  1 
ATOM   4996  N  N   . ASP B 1 211 ? 1.181   102.264 83.569  1.00 15.56  ? 211 ASP B N   1 
ATOM   4997  C  CA  . ASP B 1 211 ? 1.471   102.424 82.156  1.00 15.46  ? 211 ASP B CA  1 
ATOM   4998  C  C   . ASP B 1 211 ? 2.938   102.690 81.846  1.00 18.91  ? 211 ASP B C   1 
ATOM   4999  O  O   . ASP B 1 211 ? 3.777   102.689 82.753  1.00 21.31  ? 211 ASP B O   1 
ATOM   5000  C  CB  . ASP B 1 211 ? 0.578   103.505 81.558  1.00 17.68  ? 211 ASP B CB  1 
ATOM   5001  C  CG  . ASP B 1 211 ? 0.943   104.910 82.006  1.00 23.95  ? 211 ASP B CG  1 
ATOM   5002  O  OD1 . ASP B 1 211 ? 1.878   105.110 82.817  1.00 31.08  ? 211 ASP B OD1 1 
ATOM   5003  O  OD2 . ASP B 1 211 ? 0.280   105.845 81.514  1.00 30.12  ? 211 ASP B OD2 1 
ATOM   5004  N  N   . GLY B 1 212 ? 3.255   102.888 80.569  1.00 17.80  ? 212 GLY B N   1 
ATOM   5005  C  CA  . GLY B 1 212 ? 4.635   103.134 80.185  1.00 16.47  ? 212 GLY B CA  1 
ATOM   5006  C  C   . GLY B 1 212 ? 4.810   103.307 78.692  1.00 17.56  ? 212 GLY B C   1 
ATOM   5007  O  O   . GLY B 1 212 ? 3.876   103.103 77.917  1.00 20.46  ? 212 GLY B O   1 
ATOM   5008  N  N   . TRP B 1 213 ? 6.025   103.648 78.292  1.00 19.29  ? 213 TRP B N   1 
ATOM   5009  C  CA  . TRP B 1 213 ? 6.347   103.876 76.893  1.00 18.78  ? 213 TRP B CA  1 
ATOM   5010  C  C   . TRP B 1 213 ? 7.617   103.145 76.521  1.00 19.34  ? 213 TRP B C   1 
ATOM   5011  O  O   . TRP B 1 213 ? 8.442   102.825 77.383  1.00 18.53  ? 213 TRP B O   1 
ATOM   5012  C  CB  . TRP B 1 213 ? 6.629   105.360 76.648  1.00 19.84  ? 213 TRP B CB  1 
ATOM   5013  C  CG  . TRP B 1 213 ? 5.462   106.251 76.779  1.00 25.43  ? 213 TRP B CG  1 
ATOM   5014  C  CD1 . TRP B 1 213 ? 4.957   106.768 77.930  1.00 26.32  ? 213 TRP B CD1 1 
ATOM   5015  C  CD2 . TRP B 1 213 ? 4.637   106.752 75.714  1.00 27.63  ? 213 TRP B CD2 1 
ATOM   5016  N  NE1 . TRP B 1 213 ? 3.862   107.562 77.655  1.00 28.69  ? 213 TRP B NE1 1 
ATOM   5017  C  CE2 . TRP B 1 213 ? 3.643   107.569 76.303  1.00 28.74  ? 213 TRP B CE2 1 
ATOM   5018  C  CE3 . TRP B 1 213 ? 4.639   106.587 74.322  1.00 26.46  ? 213 TRP B CE3 1 
ATOM   5019  C  CZ2 . TRP B 1 213 ? 2.657   108.219 75.548  1.00 26.17  ? 213 TRP B CZ2 1 
ATOM   5020  C  CZ3 . TRP B 1 213 ? 3.656   107.233 73.570  1.00 26.86  ? 213 TRP B CZ3 1 
ATOM   5021  C  CH2 . TRP B 1 213 ? 2.680   108.037 74.186  1.00 26.61  ? 213 TRP B CH2 1 
ATOM   5022  N  N   . MET B 1 214 ? 7.764   102.867 75.232  1.00 19.00  ? 214 MET B N   1 
ATOM   5023  C  CA  . MET B 1 214 ? 8.983   102.258 74.732  1.00 17.38  ? 214 MET B CA  1 
ATOM   5024  C  C   . MET B 1 214 ? 9.222   102.833 73.354  1.00 17.34  ? 214 MET B C   1 
ATOM   5025  O  O   . MET B 1 214 ? 8.286   102.991 72.573  1.00 16.38  ? 214 MET B O   1 
ATOM   5026  C  CB  . MET B 1 214 ? 8.908   100.748 74.653  1.00 15.38  ? 214 MET B CB  1 
ATOM   5027  C  CG  . MET B 1 214 ? 10.258  100.155 74.304  1.00 18.49  ? 214 MET B CG  1 
ATOM   5028  S  SD  . MET B 1 214 ? 10.228  98.375  74.072  1.00 28.16  ? 214 MET B SD  1 
ATOM   5029  C  CE  . MET B 1 214 ? 11.258  97.876  75.315  1.00 29.56  ? 214 MET B CE  1 
ATOM   5030  N  N   . PHE B 1 215 ? 10.466  103.215 73.099  1.00 16.75  ? 215 PHE B N   1 
ATOM   5031  C  CA  . PHE B 1 215 ? 10.858  103.796 71.829  1.00 19.91  ? 215 PHE B CA  1 
ATOM   5032  C  C   . PHE B 1 215 ? 11.960  102.928 71.243  1.00 20.79  ? 215 PHE B C   1 
ATOM   5033  O  O   . PHE B 1 215 ? 12.890  102.521 71.953  1.00 19.85  ? 215 PHE B O   1 
ATOM   5034  C  CB  . PHE B 1 215 ? 11.357  105.237 72.019  1.00 24.80  ? 215 PHE B CB  1 
ATOM   5035  C  CG  . PHE B 1 215 ? 10.387  106.114 72.755  1.00 30.88  ? 215 PHE B CG  1 
ATOM   5036  C  CD1 . PHE B 1 215 ? 9.358   106.762 72.075  1.00 31.90  ? 215 PHE B CD1 1 
ATOM   5037  C  CD2 . PHE B 1 215 ? 10.474  106.258 74.142  1.00 31.08  ? 215 PHE B CD2 1 
ATOM   5038  C  CE1 . PHE B 1 215 ? 8.422   107.537 72.767  1.00 33.09  ? 215 PHE B CE1 1 
ATOM   5039  C  CE2 . PHE B 1 215 ? 9.549   107.029 74.844  1.00 30.20  ? 215 PHE B CE2 1 
ATOM   5040  C  CZ  . PHE B 1 215 ? 8.518   107.671 74.158  1.00 29.84  ? 215 PHE B CZ  1 
ATOM   5041  N  N   . THR B 1 216 ? 11.845  102.645 69.948  1.00 19.79  ? 216 THR B N   1 
ATOM   5042  C  CA  . THR B 1 216 ? 12.816  101.815 69.251  1.00 17.26  ? 216 THR B CA  1 
ATOM   5043  C  C   . THR B 1 216 ? 13.293  102.454 67.968  1.00 16.20  ? 216 THR B C   1 
ATOM   5044  O  O   . THR B 1 216 ? 12.496  103.025 67.219  1.00 17.72  ? 216 THR B O   1 
ATOM   5045  C  CB  . THR B 1 216 ? 12.192  100.461 68.885  1.00 15.05  ? 216 THR B CB  1 
ATOM   5046  O  OG1 . THR B 1 216 ? 11.829  99.769  70.083  1.00 16.87  ? 216 THR B OG1 1 
ATOM   5047  C  CG2 . THR B 1 216 ? 13.164  99.615  68.074  1.00 14.12  ? 216 THR B CG2 1 
ATOM   5048  N  N   . ALA B 1 217 ? 14.595  102.359 67.731  1.00 16.59  ? 217 ALA B N   1 
ATOM   5049  C  CA  . ALA B 1 217 ? 15.208  102.864 66.510  1.00 17.19  ? 217 ALA B CA  1 
ATOM   5050  C  C   . ALA B 1 217 ? 16.123  101.741 66.059  1.00 18.89  ? 217 ALA B C   1 
ATOM   5051  O  O   . ALA B 1 217 ? 16.978  101.295 66.826  1.00 19.81  ? 217 ALA B O   1 
ATOM   5052  C  CB  . ALA B 1 217 ? 16.011  104.109 66.784  1.00 14.27  ? 217 ALA B CB  1 
ATOM   5053  N  N   . GLU B 1 218 ? 15.899  101.230 64.852  1.00 20.96  ? 218 GLU B N   1 
ATOM   5054  C  CA  . GLU B 1 218 ? 16.718  100.144 64.333  1.00 18.61  ? 218 GLU B CA  1 
ATOM   5055  C  C   . GLU B 1 218 ? 17.240  100.476 62.945  1.00 20.13  ? 218 GLU B C   1 
ATOM   5056  O  O   . GLU B 1 218 ? 16.471  100.779 62.030  1.00 21.24  ? 218 GLU B O   1 
ATOM   5057  C  CB  . GLU B 1 218 ? 15.920  98.844  64.281  1.00 18.08  ? 218 GLU B CB  1 
ATOM   5058  C  CG  . GLU B 1 218 ? 16.714  97.671  63.745  1.00 17.99  ? 218 GLU B CG  1 
ATOM   5059  C  CD  . GLU B 1 218 ? 15.945  96.371  63.787  1.00 23.95  ? 218 GLU B CD  1 
ATOM   5060  O  OE1 . GLU B 1 218 ? 15.914  95.729  64.851  1.00 26.18  ? 218 GLU B OE1 1 
ATOM   5061  O  OE2 . GLU B 1 218 ? 15.364  95.990  62.755  1.00 26.99  ? 218 GLU B OE2 1 
ATOM   5062  N  N   . HIS B 1 219 ? 18.554  100.456 62.797  1.00 17.71  ? 219 HIS B N   1 
ATOM   5063  C  CA  . HIS B 1 219 ? 19.162  100.740 61.515  1.00 19.13  ? 219 HIS B CA  1 
ATOM   5064  C  C   . HIS B 1 219 ? 19.748  99.463  60.945  1.00 21.36  ? 219 HIS B C   1 
ATOM   5065  O  O   . HIS B 1 219 ? 20.485  98.747  61.636  1.00 20.30  ? 219 HIS B O   1 
ATOM   5066  C  CB  . HIS B 1 219 ? 20.261  101.789 61.659  1.00 21.63  ? 219 HIS B CB  1 
ATOM   5067  C  CG  . HIS B 1 219 ? 20.945  102.120 60.370  1.00 23.42  ? 219 HIS B CG  1 
ATOM   5068  N  ND1 . HIS B 1 219 ? 22.113  101.505 59.969  1.00 21.54  ? 219 HIS B ND1 1 
ATOM   5069  C  CD2 . HIS B 1 219 ? 20.613  102.982 59.379  1.00 20.54  ? 219 HIS B CD2 1 
ATOM   5070  C  CE1 . HIS B 1 219 ? 22.470  101.975 58.786  1.00 19.01  ? 219 HIS B CE1 1 
ATOM   5071  N  NE2 . HIS B 1 219 ? 21.576  102.872 58.407  1.00 20.47  ? 219 HIS B NE2 1 
ATOM   5072  N  N   . THR B 1 220 ? 19.377  99.149  59.706  1.00 21.72  ? 220 THR B N   1 
ATOM   5073  C  CA  . THR B 1 220 ? 19.892  97.961  59.038  1.00 20.37  ? 220 THR B CA  1 
ATOM   5074  C  C   . THR B 1 220 ? 20.810  98.392  57.908  1.00 21.21  ? 220 THR B C   1 
ATOM   5075  O  O   . THR B 1 220 ? 20.427  99.222  57.075  1.00 24.15  ? 220 THR B O   1 
ATOM   5076  C  CB  . THR B 1 220 ? 18.769  97.135  58.444  1.00 19.24  ? 220 THR B CB  1 
ATOM   5077  O  OG1 . THR B 1 220 ? 17.772  96.919  59.446  1.00 20.81  ? 220 THR B OG1 1 
ATOM   5078  C  CG2 . THR B 1 220 ? 19.296  95.785  57.971  1.00 15.45  ? 220 THR B CG2 1 
ATOM   5079  N  N   . GLN B 1 221 ? 22.029  97.868  57.902  1.00 19.24  ? 221 GLN B N   1 
ATOM   5080  C  CA  . GLN B 1 221 ? 22.993  98.199  56.859  1.00 20.21  ? 221 GLN B CA  1 
ATOM   5081  C  C   . GLN B 1 221 ? 23.361  96.914  56.147  1.00 20.90  ? 221 GLN B C   1 
ATOM   5082  O  O   . GLN B 1 221 ? 23.776  95.955  56.795  1.00 23.13  ? 221 GLN B O   1 
ATOM   5083  C  CB  . GLN B 1 221 ? 24.242  98.829  57.476  1.00 20.80  ? 221 GLN B CB  1 
ATOM   5084  C  CG  . GLN B 1 221 ? 25.289  99.279  56.483  1.00 21.15  ? 221 GLN B CG  1 
ATOM   5085  C  CD  . GLN B 1 221 ? 24.803  100.397 55.579  1.00 27.00  ? 221 GLN B CD  1 
ATOM   5086  O  OE1 . GLN B 1 221 ? 24.263  101.403 56.035  1.00 28.85  ? 221 GLN B OE1 1 
ATOM   5087  N  NE2 . GLN B 1 221 ? 24.990  100.219 54.282  1.00 31.42  ? 221 GLN B NE2 1 
ATOM   5088  N  N   . SER B 1 222 ? 23.134  96.864  54.836  1.00 22.29  ? 222 SER B N   1 
ATOM   5089  C  CA  . SER B 1 222 ? 23.465  95.684  54.046  1.00 23.08  ? 222 SER B CA  1 
ATOM   5090  C  C   . SER B 1 222 ? 24.928  95.747  53.685  1.00 22.03  ? 222 SER B C   1 
ATOM   5091  O  O   . SER B 1 222 ? 25.416  96.780  53.211  1.00 26.29  ? 222 SER B O   1 
ATOM   5092  C  CB  . SER B 1 222 ? 22.640  95.639  52.778  1.00 23.30  ? 222 SER B CB  1 
ATOM   5093  O  OG  . SER B 1 222 ? 21.270  95.676  53.109  1.00 34.88  ? 222 SER B OG  1 
ATOM   5094  N  N   . MET B 1 223 ? 25.629  94.640  53.886  1.00 23.27  ? 223 MET B N   1 
ATOM   5095  C  CA  . MET B 1 223 ? 27.054  94.594  53.603  1.00 23.18  ? 223 MET B CA  1 
ATOM   5096  C  C   . MET B 1 223 ? 27.542  93.169  53.737  1.00 26.05  ? 223 MET B C   1 
ATOM   5097  O  O   . MET B 1 223 ? 26.878  92.339  54.357  1.00 26.19  ? 223 MET B O   1 
ATOM   5098  C  CB  . MET B 1 223 ? 27.794  95.444  54.625  1.00 28.51  ? 223 MET B CB  1 
ATOM   5099  C  CG  . MET B 1 223 ? 27.511  95.002  56.057  1.00 28.34  ? 223 MET B CG  1 
ATOM   5100  S  SD  . MET B 1 223 ? 28.354  96.008  57.243  1.00 33.55  ? 223 MET B SD  1 
ATOM   5101  C  CE  . MET B 1 223 ? 29.313  94.772  58.031  1.00 35.00  ? 223 MET B CE  1 
ATOM   5102  N  N   . LEU B 1 224 ? 28.716  92.907  53.169  1.00 24.65  ? 224 LEU B N   1 
ATOM   5103  C  CA  . LEU B 1 224 ? 29.351  91.600  53.211  1.00 23.53  ? 224 LEU B CA  1 
ATOM   5104  C  C   . LEU B 1 224 ? 28.379  90.446  53.038  1.00 25.96  ? 224 LEU B C   1 
ATOM   5105  O  O   . LEU B 1 224 ? 28.460  89.445  53.746  1.00 26.12  ? 224 LEU B O   1 
ATOM   5106  C  CB  . LEU B 1 224 ? 30.144  91.457  54.511  1.00 27.23  ? 224 LEU B CB  1 
ATOM   5107  C  CG  . LEU B 1 224 ? 31.547  92.068  54.604  1.00 29.36  ? 224 LEU B CG  1 
ATOM   5108  C  CD1 . LEU B 1 224 ? 31.892  92.827  53.343  1.00 27.88  ? 224 LEU B CD1 1 
ATOM   5109  C  CD2 . LEU B 1 224 ? 31.651  92.968  55.825  1.00 30.92  ? 224 LEU B CD2 1 
ATOM   5110  N  N   . LYS B 1 225 ? 27.458  90.597  52.090  1.00 29.88  ? 225 LYS B N   1 
ATOM   5111  C  CA  . LYS B 1 225 ? 26.451  89.568  51.804  1.00 35.50  ? 225 LYS B CA  1 
ATOM   5112  C  C   . LYS B 1 225 ? 25.642  89.164  53.035  1.00 33.94  ? 225 LYS B C   1 
ATOM   5113  O  O   . LYS B 1 225 ? 25.221  88.005  53.189  1.00 37.15  ? 225 LYS B O   1 
ATOM   5114  C  CB  . LYS B 1 225 ? 27.092  88.352  51.119  1.00 41.11  ? 225 LYS B CB  1 
ATOM   5115  C  CG  . LYS B 1 225 ? 27.401  88.620  49.640  1.00 51.39  ? 225 LYS B CG  1 
ATOM   5116  C  CD  . LYS B 1 225 ? 28.369  87.617  49.028  1.00 59.26  ? 225 LYS B CD  1 
ATOM   5117  C  CE  . LYS B 1 225 ? 28.701  87.968  47.564  1.00 64.14  ? 225 LYS B CE  1 
ATOM   5118  N  NZ  . LYS B 1 225 ? 27.538  87.831  46.624  1.00 62.27  ? 225 LYS B NZ  1 
ATOM   5119  N  N   . GLY B 1 226 ? 25.392  90.165  53.874  1.00 30.60  ? 226 GLY B N   1 
ATOM   5120  C  CA  . GLY B 1 226 ? 24.638  89.990  55.095  1.00 24.41  ? 226 GLY B CA  1 
ATOM   5121  C  C   . GLY B 1 226 ? 24.193  91.355  55.576  1.00 22.82  ? 226 GLY B C   1 
ATOM   5122  O  O   . GLY B 1 226 ? 23.928  92.249  54.762  1.00 22.79  ? 226 GLY B O   1 
ATOM   5123  N  N   . TYR B 1 227 ? 24.190  91.551  56.887  1.00 21.30  ? 227 TYR B N   1 
ATOM   5124  C  CA  . TYR B 1 227 ? 23.763  92.818  57.450  1.00 19.92  ? 227 TYR B CA  1 
ATOM   5125  C  C   . TYR B 1 227 ? 24.349  93.052  58.817  1.00 19.05  ? 227 TYR B C   1 
ATOM   5126  O  O   . TYR B 1 227 ? 25.012  92.189  59.414  1.00 17.85  ? 227 TYR B O   1 
ATOM   5127  C  CB  . TYR B 1 227 ? 22.235  92.856  57.595  1.00 17.80  ? 227 TYR B CB  1 
ATOM   5128  C  CG  . TYR B 1 227 ? 21.707  91.845  58.585  1.00 19.67  ? 227 TYR B CG  1 
ATOM   5129  C  CD1 . TYR B 1 227 ? 21.709  92.099  59.954  1.00 21.45  ? 227 TYR B CD1 1 
ATOM   5130  C  CD2 . TYR B 1 227 ? 21.263  90.595  58.153  1.00 26.38  ? 227 TYR B CD2 1 
ATOM   5131  C  CE1 . TYR B 1 227 ? 21.293  91.129  60.868  1.00 22.05  ? 227 TYR B CE1 1 
ATOM   5132  C  CE2 . TYR B 1 227 ? 20.841  89.615  59.058  1.00 25.35  ? 227 TYR B CE2 1 
ATOM   5133  C  CZ  . TYR B 1 227 ? 20.862  89.889  60.411  1.00 25.89  ? 227 TYR B CZ  1 
ATOM   5134  O  OH  . TYR B 1 227 ? 20.464  88.905  61.287  1.00 27.48  ? 227 TYR B OH  1 
ATOM   5135  N  N   . ASN B 1 228 ? 24.031  94.234  59.315  1.00 18.58  ? 228 ASN B N   1 
ATOM   5136  C  CA  . ASN B 1 228 ? 24.404  94.671  60.630  1.00 20.04  ? 228 ASN B CA  1 
ATOM   5137  C  C   . ASN B 1 228 ? 23.239  95.526  61.065  1.00 20.15  ? 228 ASN B C   1 
ATOM   5138  O  O   . ASN B 1 228 ? 22.793  96.399  60.322  1.00 22.53  ? 228 ASN B O   1 
ATOM   5139  C  CB  . ASN B 1 228 ? 25.646  95.528  60.620  1.00 17.63  ? 228 ASN B CB  1 
ATOM   5140  C  CG  . ASN B 1 228 ? 25.875  96.200  61.955  1.00 22.98  ? 228 ASN B CG  1 
ATOM   5141  O  OD1 . ASN B 1 228 ? 25.376  97.303  62.220  1.00 24.95  ? 228 ASN B OD1 1 
ATOM   5142  N  ND2 . ASN B 1 228 ? 26.574  95.515  62.829  1.00 15.94  ? 228 ASN B ND2 1 
ATOM   5143  N  N   . LYS B 1 229 ? 22.721  95.250  62.251  1.00 18.46  ? 229 LYS B N   1 
ATOM   5144  C  CA  . LYS B 1 229 ? 21.610  96.007  62.772  1.00 16.47  ? 229 LYS B CA  1 
ATOM   5145  C  C   . LYS B 1 229 ? 22.070  96.694  64.025  1.00 18.50  ? 229 LYS B C   1 
ATOM   5146  O  O   . LYS B 1 229 ? 22.759  96.102  64.860  1.00 19.49  ? 229 LYS B O   1 
ATOM   5147  C  CB  . LYS B 1 229 ? 20.432  95.089  63.077  1.00 15.10  ? 229 LYS B CB  1 
ATOM   5148  C  CG  . LYS B 1 229 ? 19.618  94.732  61.861  1.00 16.08  ? 229 LYS B CG  1 
ATOM   5149  C  CD  . LYS B 1 229 ? 18.642  93.628  62.180  1.00 22.06  ? 229 LYS B CD  1 
ATOM   5150  C  CE  . LYS B 1 229 ? 17.851  93.183  60.958  1.00 22.94  ? 229 LYS B CE  1 
ATOM   5151  N  NZ  . LYS B 1 229 ? 17.004  94.280  60.422  1.00 27.83  ? 229 LYS B NZ  1 
ATOM   5152  N  N   . PHE B 1 230 ? 21.755  97.973  64.113  1.00 19.12  ? 230 PHE B N   1 
ATOM   5153  C  CA  . PHE B 1 230 ? 22.100  98.764  65.273  1.00 18.99  ? 230 PHE B CA  1 
ATOM   5154  C  C   . PHE B 1 230 ? 20.783  99.200  65.892  1.00 18.99  ? 230 PHE B C   1 
ATOM   5155  O  O   . PHE B 1 230 ? 19.973  99.864  65.247  1.00 17.92  ? 230 PHE B O   1 
ATOM   5156  C  CB  . PHE B 1 230 ? 22.931  99.973  64.864  1.00 22.51  ? 230 PHE B CB  1 
ATOM   5157  C  CG  . PHE B 1 230 ? 23.337  100.833 66.020  1.00 25.71  ? 230 PHE B CG  1 
ATOM   5158  C  CD1 . PHE B 1 230 ? 24.272  100.377 66.939  1.00 24.95  ? 230 PHE B CD1 1 
ATOM   5159  C  CD2 . PHE B 1 230 ? 22.739  102.073 66.223  1.00 28.50  ? 230 PHE B CD2 1 
ATOM   5160  C  CE1 . PHE B 1 230 ? 24.602  101.138 68.050  1.00 25.38  ? 230 PHE B CE1 1 
ATOM   5161  C  CE2 . PHE B 1 230 ? 23.064  102.850 67.337  1.00 25.89  ? 230 PHE B CE2 1 
ATOM   5162  C  CZ  . PHE B 1 230 ? 23.996  102.376 68.251  1.00 24.77  ? 230 PHE B CZ  1 
ATOM   5163  N  N   . VAL B 1 231 ? 20.563  98.793  67.134  1.00 19.98  ? 231 VAL B N   1 
ATOM   5164  C  CA  . VAL B 1 231 ? 19.327  99.098  67.839  1.00 17.83  ? 231 VAL B CA  1 
ATOM   5165  C  C   . VAL B 1 231 ? 19.523  99.916  69.117  1.00 19.53  ? 231 VAL B C   1 
ATOM   5166  O  O   . VAL B 1 231 ? 20.467  99.696  69.880  1.00 19.54  ? 231 VAL B O   1 
ATOM   5167  C  CB  . VAL B 1 231 ? 18.623  97.791  68.246  1.00 15.40  ? 231 VAL B CB  1 
ATOM   5168  C  CG1 . VAL B 1 231 ? 17.209  98.066  68.689  1.00 13.92  ? 231 VAL B CG1 1 
ATOM   5169  C  CG2 . VAL B 1 231 ? 18.655  96.803  67.113  1.00 12.02  ? 231 VAL B CG2 1 
ATOM   5170  N  N   . VAL B 1 232 ? 18.611  100.848 69.349  1.00 17.89  ? 232 VAL B N   1 
ATOM   5171  C  CA  . VAL B 1 232 ? 18.617  101.664 70.546  1.00 19.31  ? 232 VAL B CA  1 
ATOM   5172  C  C   . VAL B 1 232 ? 17.172  101.649 71.008  1.00 18.56  ? 232 VAL B C   1 
ATOM   5173  O  O   . VAL B 1 232 ? 16.257  101.889 70.217  1.00 19.54  ? 232 VAL B O   1 
ATOM   5174  C  CB  . VAL B 1 232 ? 19.030  103.134 70.260  1.00 23.48  ? 232 VAL B CB  1 
ATOM   5175  C  CG1 . VAL B 1 232 ? 18.876  103.985 71.522  1.00 22.46  ? 232 VAL B CG1 1 
ATOM   5176  C  CG2 . VAL B 1 232 ? 20.458  103.196 69.795  1.00 23.59  ? 232 VAL B CG2 1 
ATOM   5177  N  N   . GLN B 1 233 ? 16.958  101.309 72.268  1.00 17.49  ? 233 GLN B N   1 
ATOM   5178  C  CA  . GLN B 1 233 ? 15.616  101.283 72.827  1.00 15.08  ? 233 GLN B CA  1 
ATOM   5179  C  C   . GLN B 1 233 ? 15.631  101.878 74.216  1.00 18.53  ? 233 GLN B C   1 
ATOM   5180  O  O   . GLN B 1 233 ? 16.599  101.720 74.978  1.00 17.66  ? 233 GLN B O   1 
ATOM   5181  C  CB  . GLN B 1 233 ? 15.077  99.862  72.898  1.00 13.39  ? 233 GLN B CB  1 
ATOM   5182  C  CG  . GLN B 1 233 ? 14.779  99.256  71.546  1.00 14.78  ? 233 GLN B CG  1 
ATOM   5183  C  CD  . GLN B 1 233 ? 14.367  97.805  71.634  1.00 15.29  ? 233 GLN B CD  1 
ATOM   5184  O  OE1 . GLN B 1 233 ? 15.114  96.962  72.132  1.00 16.23  ? 233 GLN B OE1 1 
ATOM   5185  N  NE2 . GLN B 1 233 ? 13.186  97.501  71.130  1.00 10.87  ? 233 GLN B NE2 1 
ATOM   5186  N  N   . TYR B 1 234 ? 14.537  102.540 74.550  1.00 17.73  ? 234 TYR B N   1 
ATOM   5187  C  CA  . TYR B 1 234 ? 14.382  103.176 75.841  1.00 16.75  ? 234 TYR B CA  1 
ATOM   5188  C  C   . TYR B 1 234 ? 12.980  102.855 76.276  1.00 16.03  ? 234 TYR B C   1 
ATOM   5189  O  O   . TYR B 1 234 ? 12.018  103.132 75.561  1.00 16.34  ? 234 TYR B O   1 
ATOM   5190  C  CB  . TYR B 1 234 ? 14.556  104.690 75.694  1.00 20.19  ? 234 TYR B CB  1 
ATOM   5191  C  CG  . TYR B 1 234 ? 14.286  105.457 76.958  1.00 23.61  ? 234 TYR B CG  1 
ATOM   5192  C  CD1 . TYR B 1 234 ? 15.154  105.368 78.045  1.00 25.87  ? 234 TYR B CD1 1 
ATOM   5193  C  CD2 . TYR B 1 234 ? 13.146  106.249 77.082  1.00 24.77  ? 234 TYR B CD2 1 
ATOM   5194  C  CE1 . TYR B 1 234 ? 14.899  106.048 79.229  1.00 25.05  ? 234 TYR B CE1 1 
ATOM   5195  C  CE2 . TYR B 1 234 ? 12.873  106.938 78.271  1.00 28.51  ? 234 TYR B CE2 1 
ATOM   5196  C  CZ  . TYR B 1 234 ? 13.757  106.831 79.337  1.00 27.67  ? 234 TYR B CZ  1 
ATOM   5197  O  OH  . TYR B 1 234 ? 13.507  107.512 80.508  1.00 38.26  ? 234 TYR B OH  1 
ATOM   5198  N  N   . ALA B 1 235 ? 12.858  102.230 77.430  1.00 17.29  ? 235 ALA B N   1 
ATOM   5199  C  CA  . ALA B 1 235 ? 11.551  101.864 77.937  1.00 17.12  ? 235 ALA B CA  1 
ATOM   5200  C  C   . ALA B 1 235 ? 11.321  102.553 79.253  1.00 19.25  ? 235 ALA B C   1 
ATOM   5201  O  O   . ALA B 1 235 ? 12.243  102.802 80.029  1.00 23.03  ? 235 ALA B O   1 
ATOM   5202  C  CB  . ALA B 1 235 ? 11.430  100.364 78.104  1.00 16.07  ? 235 ALA B CB  1 
ATOM   5203  N  N   . THR B 1 236 ? 10.059  102.643 79.592  1.00 21.83  ? 236 THR B N   1 
ATOM   5204  C  CA  . THR B 1 236 ? 9.672   103.354 80.766  1.00 20.98  ? 236 THR B CA  1 
ATOM   5205  C  C   . THR B 1 236 ? 8.628   102.606 81.572  1.00 22.11  ? 236 THR B C   1 
ATOM   5206  O  O   . THR B 1 236 ? 7.733   101.970 81.009  1.00 24.16  ? 236 THR B O   1 
ATOM   5207  C  CB  . THR B 1 236 ? 9.167   104.719 80.267  1.00 19.16  ? 236 THR B CB  1 
ATOM   5208  O  OG1 . THR B 1 236 ? 10.164  105.712 80.506  1.00 31.73  ? 236 THR B OG1 1 
ATOM   5209  C  CG2 . THR B 1 236 ? 7.829   105.102 80.818  1.00 15.89  ? 236 THR B CG2 1 
ATOM   5210  N  N   . ASP B 1 237 ? 8.822   102.612 82.886  1.00 19.93  ? 237 ASP B N   1 
ATOM   5211  C  CA  . ASP B 1 237 ? 7.905   102.017 83.847  1.00 17.65  ? 237 ASP B CA  1 
ATOM   5212  C  C   . ASP B 1 237 ? 7.349   100.644 83.511  1.00 20.49  ? 237 ASP B C   1 
ATOM   5213  O  O   . ASP B 1 237 ? 8.104   99.666  83.476  1.00 18.37  ? 237 ASP B O   1 
ATOM   5214  C  CB  . ASP B 1 237 ? 6.761   103.001 84.159  1.00 21.35  ? 237 ASP B CB  1 
ATOM   5215  C  CG  . ASP B 1 237 ? 7.265   104.342 84.718  1.00 27.98  ? 237 ASP B CG  1 
ATOM   5216  O  OD1 . ASP B 1 237 ? 8.381   104.376 85.297  1.00 28.54  ? 237 ASP B OD1 1 
ATOM   5217  O  OD2 . ASP B 1 237 ? 6.549   105.365 84.566  1.00 32.04  ? 237 ASP B OD2 1 
ATOM   5218  N  N   . ALA B 1 238 ? 6.036   100.575 83.270  1.00 18.51  ? 238 ALA B N   1 
ATOM   5219  C  CA  . ALA B 1 238 ? 5.346   99.321  82.958  1.00 18.43  ? 238 ALA B CA  1 
ATOM   5220  C  C   . ALA B 1 238 ? 5.970   98.512  81.831  1.00 18.64  ? 238 ALA B C   1 
ATOM   5221  O  O   . ALA B 1 238 ? 5.773   97.303  81.765  1.00 22.16  ? 238 ALA B O   1 
ATOM   5222  C  CB  . ALA B 1 238 ? 3.883   99.590  82.650  1.00 12.08  ? 238 ALA B CB  1 
ATOM   5223  N  N   . MET B 1 239 ? 6.707   99.181  80.945  1.00 19.99  ? 239 MET B N   1 
ATOM   5224  C  CA  . MET B 1 239 ? 7.357   98.534  79.809  1.00 17.83  ? 239 MET B CA  1 
ATOM   5225  C  C   . MET B 1 239 ? 8.746   97.978  80.122  1.00 20.60  ? 239 MET B C   1 
ATOM   5226  O  O   . MET B 1 239 ? 9.363   97.369  79.251  1.00 26.03  ? 239 MET B O   1 
ATOM   5227  C  CB  . MET B 1 239 ? 7.481   99.511  78.640  1.00 16.23  ? 239 MET B CB  1 
ATOM   5228  C  CG  . MET B 1 239 ? 6.179   100.120 78.183  1.00 19.00  ? 239 MET B CG  1 
ATOM   5229  S  SD  . MET B 1 239 ? 5.059   98.919  77.427  1.00 25.66  ? 239 MET B SD  1 
ATOM   5230  C  CE  . MET B 1 239 ? 5.264   99.309  75.748  1.00 24.90  ? 239 MET B CE  1 
ATOM   5231  N  N   . THR B 1 240 ? 9.236   98.152  81.349  1.00 19.66  ? 240 THR B N   1 
ATOM   5232  C  CA  . THR B 1 240 ? 10.572  97.674  81.711  1.00 15.81  ? 240 THR B CA  1 
ATOM   5233  C  C   . THR B 1 240 ? 10.642  96.216  82.146  1.00 17.39  ? 240 THR B C   1 
ATOM   5234  O  O   . THR B 1 240 ? 11.701  95.601  82.069  1.00 18.24  ? 240 THR B O   1 
ATOM   5235  C  CB  . THR B 1 240 ? 11.173  98.513  82.843  1.00 15.84  ? 240 THR B CB  1 
ATOM   5236  O  OG1 . THR B 1 240 ? 10.318  98.431  83.987  1.00 18.65  ? 240 THR B OG1 1 
ATOM   5237  C  CG2 . THR B 1 240 ? 11.307  99.953  82.428  1.00 14.48  ? 240 THR B CG2 1 
ATOM   5238  N  N   . THR B 1 241 ? 9.536   95.664  82.632  1.00 18.03  ? 241 THR B N   1 
ATOM   5239  C  CA  . THR B 1 241 ? 9.552   94.276  83.082  1.00 18.02  ? 241 THR B CA  1 
ATOM   5240  C  C   . THR B 1 241 ? 9.745   93.284  81.946  1.00 17.05  ? 241 THR B C   1 
ATOM   5241  O  O   . THR B 1 241 ? 10.710  92.528  81.955  1.00 18.60  ? 241 THR B O   1 
ATOM   5242  C  CB  . THR B 1 241 ? 8.322   93.944  83.904  1.00 17.64  ? 241 THR B CB  1 
ATOM   5243  O  OG1 . THR B 1 241 ? 8.314   94.788  85.051  1.00 22.18  ? 241 THR B OG1 1 
ATOM   5244  C  CG2 . THR B 1 241 ? 8.352   92.504  84.357  1.00 13.76  ? 241 THR B CG2 1 
ATOM   5245  N  N   . GLN B 1 242 ? 8.818   93.248  80.996  1.00 18.09  ? 242 GLN B N   1 
ATOM   5246  C  CA  . GLN B 1 242 ? 8.960   92.351  79.851  1.00 16.36  ? 242 GLN B CA  1 
ATOM   5247  C  C   . GLN B 1 242 ? 10.103  92.880  78.973  1.00 16.22  ? 242 GLN B C   1 
ATOM   5248  O  O   . GLN B 1 242 ? 10.936  92.117  78.501  1.00 17.87  ? 242 GLN B O   1 
ATOM   5249  C  CB  . GLN B 1 242 ? 7.657   92.260  79.069  1.00 13.96  ? 242 GLN B CB  1 
ATOM   5250  C  CG  . GLN B 1 242 ? 7.663   91.127  78.063  1.00 16.56  ? 242 GLN B CG  1 
ATOM   5251  C  CD  . GLN B 1 242 ? 7.512   91.602  76.637  1.00 17.89  ? 242 GLN B CD  1 
ATOM   5252  O  OE1 . GLN B 1 242 ? 7.711   92.784  76.333  1.00 21.74  ? 242 GLN B OE1 1 
ATOM   5253  N  NE2 . GLN B 1 242 ? 7.138   90.693  75.754  1.00 16.11  ? 242 GLN B NE2 1 
ATOM   5254  N  N   . GLY B 1 243 ? 10.134  94.194  78.782  1.00 15.15  ? 243 GLY B N   1 
ATOM   5255  C  CA  . GLY B 1 243 ? 11.195  94.832  78.016  1.00 14.91  ? 243 GLY B CA  1 
ATOM   5256  C  C   . GLY B 1 243 ? 11.287  94.587  76.528  1.00 17.29  ? 243 GLY B C   1 
ATOM   5257  O  O   . GLY B 1 243 ? 12.355  94.790  75.939  1.00 17.11  ? 243 GLY B O   1 
ATOM   5258  N  N   . LYS B 1 244 ? 10.178  94.189  75.911  1.00 15.75  ? 244 LYS B N   1 
ATOM   5259  C  CA  . LYS B 1 244 ? 10.144  93.916  74.475  1.00 14.11  ? 244 LYS B CA  1 
ATOM   5260  C  C   . LYS B 1 244 ? 8.944   94.590  73.820  1.00 16.79  ? 244 LYS B C   1 
ATOM   5261  O  O   . LYS B 1 244 ? 8.650   94.341  72.651  1.00 16.78  ? 244 LYS B O   1 
ATOM   5262  C  CB  . LYS B 1 244 ? 10.061  92.411  74.217  1.00 14.03  ? 244 LYS B CB  1 
ATOM   5263  C  CG  . LYS B 1 244 ? 11.078  91.589  74.972  1.00 13.97  ? 244 LYS B CG  1 
ATOM   5264  C  CD  . LYS B 1 244 ? 10.866  90.113  74.747  1.00 12.22  ? 244 LYS B CD  1 
ATOM   5265  C  CE  . LYS B 1 244 ? 11.649  89.283  75.767  1.00 12.48  ? 244 LYS B CE  1 
ATOM   5266  N  NZ  . LYS B 1 244 ? 13.133  89.540  75.743  1.00 14.14  ? 244 LYS B NZ  1 
ATOM   5267  N  N   . GLY B 1 245 ? 8.220   95.410  74.574  1.00 15.87  ? 245 GLY B N   1 
ATOM   5268  C  CA  . GLY B 1 245 ? 7.076   96.089  73.999  1.00 13.92  ? 245 GLY B CA  1 
ATOM   5269  C  C   . GLY B 1 245 ? 5.746   95.771  74.643  1.00 18.62  ? 245 GLY B C   1 
ATOM   5270  O  O   . GLY B 1 245 ? 4.758   96.454  74.358  1.00 17.73  ? 245 GLY B O   1 
ATOM   5271  N  N   . GLN B 1 246 ? 5.692   94.720  75.459  1.00 17.79  ? 246 GLN B N   1 
ATOM   5272  C  CA  . GLN B 1 246 ? 4.454   94.374  76.145  1.00 19.82  ? 246 GLN B CA  1 
ATOM   5273  C  C   . GLN B 1 246 ? 4.430   95.057  77.516  1.00 20.94  ? 246 GLN B C   1 
ATOM   5274  O  O   . GLN B 1 246 ? 5.476   95.205  78.156  1.00 21.61  ? 246 GLN B O   1 
ATOM   5275  C  CB  . GLN B 1 246 ? 4.341   92.868  76.305  1.00 18.65  ? 246 GLN B CB  1 
ATOM   5276  C  CG  . GLN B 1 246 ? 3.992   92.172  75.023  1.00 24.27  ? 246 GLN B CG  1 
ATOM   5277  C  CD  . GLN B 1 246 ? 3.955   90.675  75.170  1.00 25.49  ? 246 GLN B CD  1 
ATOM   5278  O  OE1 . GLN B 1 246 ? 3.642   90.145  76.234  1.00 31.45  ? 246 GLN B OE1 1 
ATOM   5279  N  NE2 . GLN B 1 246 ? 4.307   89.977  74.107  1.00 28.40  ? 246 GLN B NE2 1 
ATOM   5280  N  N   . ALA B 1 247 ? 3.246   95.459  77.970  1.00 20.97  ? 247 ALA B N   1 
ATOM   5281  C  CA  . ALA B 1 247 ? 3.096   96.135  79.260  1.00 17.87  ? 247 ALA B CA  1 
ATOM   5282  C  C   . ALA B 1 247 ? 2.792   95.230  80.450  1.00 19.79  ? 247 ALA B C   1 
ATOM   5283  O  O   . ALA B 1 247 ? 1.994   94.303  80.351  1.00 20.05  ? 247 ALA B O   1 
ATOM   5284  C  CB  . ALA B 1 247 ? 2.034   97.208  79.152  1.00 19.47  ? 247 ALA B CB  1 
ATOM   5285  N  N   . ARG B 1 248 ? 3.456   95.513  81.569  1.00 21.62  ? 248 ARG B N   1 
ATOM   5286  C  CA  . ARG B 1 248 ? 3.278   94.802  82.841  1.00 22.21  ? 248 ARG B CA  1 
ATOM   5287  C  C   . ARG B 1 248 ? 2.927   95.918  83.861  1.00 22.62  ? 248 ARG B C   1 
ATOM   5288  O  O   . ARG B 1 248 ? 3.739   96.291  84.718  1.00 23.20  ? 248 ARG B O   1 
ATOM   5289  C  CB  . ARG B 1 248 ? 4.584   94.129  83.261  1.00 22.71  ? 248 ARG B CB  1 
ATOM   5290  C  CG  . ARG B 1 248 ? 5.195   93.165  82.260  1.00 27.45  ? 248 ARG B CG  1 
ATOM   5291  C  CD  . ARG B 1 248 ? 4.484   91.835  82.227  1.00 25.33  ? 248 ARG B CD  1 
ATOM   5292  N  NE  . ARG B 1 248 ? 3.557   91.767  81.104  1.00 36.44  ? 248 ARG B NE  1 
ATOM   5293  C  CZ  . ARG B 1 248 ? 3.694   90.947  80.065  1.00 33.78  ? 248 ARG B CZ  1 
ATOM   5294  N  NH1 . ARG B 1 248 ? 4.716   90.101  79.990  1.00 31.23  ? 248 ARG B NH1 1 
ATOM   5295  N  NH2 . ARG B 1 248 ? 2.824   91.010  79.072  1.00 36.18  ? 248 ARG B NH2 1 
ATOM   5296  N  N   . GLY B 1 249 ? 1.714   96.446  83.749  1.00 19.97  ? 249 GLY B N   1 
ATOM   5297  C  CA  . GLY B 1 249 ? 1.277   97.547  84.588  1.00 20.04  ? 249 GLY B CA  1 
ATOM   5298  C  C   . GLY B 1 249 ? 0.930   97.305  86.042  1.00 23.25  ? 249 GLY B C   1 
ATOM   5299  O  O   . GLY B 1 249 ? 0.818   98.262  86.817  1.00 22.73  ? 249 GLY B O   1 
ATOM   5300  N  N   . SER B 1 250 ? 0.702   96.051  86.406  1.00 22.04  ? 250 SER B N   1 
ATOM   5301  C  CA  . SER B 1 250 ? 0.377   95.725  87.782  1.00 21.66  ? 250 SER B CA  1 
ATOM   5302  C  C   . SER B 1 250 ? 1.483   94.825  88.317  1.00 23.96  ? 250 SER B C   1 
ATOM   5303  O  O   . SER B 1 250 ? 1.310   94.135  89.327  1.00 25.23  ? 250 SER B O   1 
ATOM   5304  C  CB  . SER B 1 250 ? -0.983  95.023  87.859  1.00 22.15  ? 250 SER B CB  1 
ATOM   5305  O  OG  . SER B 1 250 ? -0.926  93.694  87.370  1.00 23.69  ? 250 SER B OG  1 
ATOM   5306  N  N   . ASP B 1 251 ? 2.626   94.834  87.636  1.00 25.37  ? 251 ASP B N   1 
ATOM   5307  C  CA  . ASP B 1 251 ? 3.745   93.992  88.031  1.00 25.65  ? 251 ASP B CA  1 
ATOM   5308  C  C   . ASP B 1 251 ? 4.177   94.343  89.445  1.00 27.31  ? 251 ASP B C   1 
ATOM   5309  O  O   . ASP B 1 251 ? 4.346   95.517  89.769  1.00 28.11  ? 251 ASP B O   1 
ATOM   5310  C  CB  . ASP B 1 251 ? 4.910   94.160  87.057  1.00 26.51  ? 251 ASP B CB  1 
ATOM   5311  C  CG  . ASP B 1 251 ? 6.089   93.271  87.402  1.00 28.44  ? 251 ASP B CG  1 
ATOM   5312  O  OD1 . ASP B 1 251 ? 5.917   92.039  87.459  1.00 28.20  ? 251 ASP B OD1 1 
ATOM   5313  O  OD2 . ASP B 1 251 ? 7.195   93.807  87.621  1.00 37.10  ? 251 ASP B OD2 1 
ATOM   5314  N  N   . GLY B 1 252 ? 4.315   93.324  90.285  1.00 27.41  ? 252 GLY B N   1 
ATOM   5315  C  CA  . GLY B 1 252 ? 4.729   93.539  91.660  1.00 30.97  ? 252 GLY B CA  1 
ATOM   5316  C  C   . GLY B 1 252 ? 3.619   93.404  92.695  1.00 31.56  ? 252 GLY B C   1 
ATOM   5317  O  O   . GLY B 1 252 ? 3.863   93.538  93.892  1.00 31.54  ? 252 GLY B O   1 
ATOM   5318  N  N   . SER B 1 253 ? 2.394   93.184  92.242  1.00 31.06  ? 253 SER B N   1 
ATOM   5319  C  CA  . SER B 1 253 ? 1.267   93.030  93.146  1.00 31.92  ? 253 SER B CA  1 
ATOM   5320  C  C   . SER B 1 253 ? 1.301   91.688  93.862  1.00 37.75  ? 253 SER B C   1 
ATOM   5321  O  O   . SER B 1 253 ? 1.855   90.705  93.357  1.00 40.56  ? 253 SER B O   1 
ATOM   5322  C  CB  . SER B 1 253 ? -0.045  93.130  92.377  1.00 25.74  ? 253 SER B CB  1 
ATOM   5323  O  OG  . SER B 1 253 ? -0.109  94.332  91.650  1.00 21.49  ? 253 SER B OG  1 
ATOM   5324  N  N   . SER B 1 254 ? 0.682   91.655  95.035  1.00 44.67  ? 254 SER B N   1 
ATOM   5325  C  CA  . SER B 1 254 ? 0.587   90.447  95.842  1.00 48.45  ? 254 SER B CA  1 
ATOM   5326  C  C   . SER B 1 254 ? -0.477  90.679  96.896  1.00 52.59  ? 254 SER B C   1 
ATOM   5327  O  O   . SER B 1 254 ? -0.869  91.819  97.156  1.00 51.84  ? 254 SER B O   1 
ATOM   5328  C  CB  . SER B 1 254 ? 1.921   90.133  96.523  1.00 45.83  ? 254 SER B CB  1 
ATOM   5329  O  OG  . SER B 1 254 ? 2.267   91.135  97.464  1.00 43.84  ? 254 SER B OG  1 
ATOM   5330  N  N   . SER B 1 255 ? -0.952  89.598  97.495  1.00 60.19  ? 255 SER B N   1 
ATOM   5331  C  CA  . SER B 1 255 ? -1.962  89.700  98.532  1.00 69.00  ? 255 SER B CA  1 
ATOM   5332  C  C   . SER B 1 255 ? -1.855  88.535  99.513  1.00 75.18  ? 255 SER B C   1 
ATOM   5333  O  O   . SER B 1 255 ? -1.169  87.538  99.243  1.00 76.66  ? 255 SER B O   1 
ATOM   5334  C  CB  . SER B 1 255 ? -3.357  89.738  97.907  1.00 66.84  ? 255 SER B CB  1 
ATOM   5335  O  OG  . SER B 1 255 ? -3.566  88.623  97.061  1.00 65.95  ? 255 SER B OG  1 
ATOM   5336  N  N   . PHE B 1 256 ? -2.469  88.702  100.680 1.00 82.04  ? 256 PHE B N   1 
ATOM   5337  C  CA  . PHE B 1 256 ? -2.481  87.656  101.685 1.00 87.10  ? 256 PHE B CA  1 
ATOM   5338  C  C   . PHE B 1 256 ? -3.828  87.685  102.377 1.00 89.16  ? 256 PHE B C   1 
ATOM   5339  O  O   . PHE B 1 256 ? -4.399  88.752  102.622 1.00 85.62  ? 256 PHE B O   1 
ATOM   5340  C  CB  . PHE B 1 256 ? -1.327  87.801  102.683 1.00 89.73  ? 256 PHE B CB  1 
ATOM   5341  C  CG  . PHE B 1 256 ? -1.515  88.892  103.689 1.00 92.78  ? 256 PHE B CG  1 
ATOM   5342  C  CD1 . PHE B 1 256 ? -1.271  90.216  103.352 1.00 94.66  ? 256 PHE B CD1 1 
ATOM   5343  C  CD2 . PHE B 1 256 ? -1.895  88.589  104.992 1.00 94.96  ? 256 PHE B CD2 1 
ATOM   5344  C  CE1 . PHE B 1 256 ? -1.399  91.227  104.300 1.00 97.31  ? 256 PHE B CE1 1 
ATOM   5345  C  CE2 . PHE B 1 256 ? -2.026  89.589  105.945 1.00 97.20  ? 256 PHE B CE2 1 
ATOM   5346  C  CZ  . PHE B 1 256 ? -1.776  90.914  105.599 1.00 97.54  ? 256 PHE B CZ  1 
ATOM   5347  N  N   . THR B 1 257 ? -4.339  86.497  102.648 1.00 93.98  ? 257 THR B N   1 
ATOM   5348  C  CA  . THR B 1 257 ? -5.628  86.342  103.275 1.00 99.56  ? 257 THR B CA  1 
ATOM   5349  C  C   . THR B 1 257 ? -5.483  85.691  104.636 1.00 103.90 ? 257 THR B C   1 
ATOM   5350  O  O   . THR B 1 257 ? -4.650  84.798  104.820 1.00 104.74 ? 257 THR B O   1 
ATOM   5351  C  CB  . THR B 1 257 ? -6.528  85.467  102.395 1.00 99.17  ? 257 THR B CB  1 
ATOM   5352  O  OG1 . THR B 1 257 ? -6.538  85.994  101.061 1.00 99.88  ? 257 THR B OG1 1 
ATOM   5353  C  CG2 . THR B 1 257 ? -7.943  85.431  102.941 1.00 101.08 ? 257 THR B CG2 1 
ATOM   5354  N  N   . GLU B 1 258 ? -6.278  86.169  105.587 1.00 108.89 ? 258 GLU B N   1 
ATOM   5355  C  CA  . GLU B 1 258 ? -6.290  85.638  106.943 1.00 113.79 ? 258 GLU B CA  1 
ATOM   5356  C  C   . GLU B 1 258 ? -7.726  85.611  107.478 1.00 115.26 ? 258 GLU B C   1 
ATOM   5357  O  O   . GLU B 1 258 ? -8.248  84.506  107.751 1.00 117.99 ? 258 GLU B O   1 
ATOM   5358  C  CB  . GLU B 1 258 ? -5.386  86.467  107.860 1.00 115.55 ? 258 GLU B CB  1 
ATOM   5359  C  CG  . GLU B 1 258 ? -5.631  87.965  107.809 1.00 119.47 ? 258 GLU B CG  1 
ATOM   5360  C  CD  . GLU B 1 258 ? -4.970  88.697  108.959 1.00 122.57 ? 258 GLU B CD  1 
ATOM   5361  O  OE1 . GLU B 1 258 ? -3.741  88.553  109.135 1.00 124.86 ? 258 GLU B OE1 1 
ATOM   5362  O  OE2 . GLU B 1 258 ? -5.681  89.417  109.692 1.00 123.95 ? 258 GLU B OE2 1 
ATOM   5363  N  N   . LYS B 1 265 ? -10.951 85.049  107.103 1.00 97.89  ? 265 LYS B N   1 
ATOM   5364  C  CA  . LYS B 1 265 ? -10.581 85.364  105.699 1.00 94.12  ? 265 LYS B CA  1 
ATOM   5365  C  C   . LYS B 1 265 ? -10.859 86.804  105.317 1.00 89.80  ? 265 LYS B C   1 
ATOM   5366  O  O   . LYS B 1 265 ? -11.983 87.168  104.971 1.00 89.02  ? 265 LYS B O   1 
ATOM   5367  C  CB  . LYS B 1 265 ? -11.243 84.403  104.710 1.00 99.12  ? 265 LYS B CB  1 
ATOM   5368  C  CG  . LYS B 1 265 ? -10.616 83.015  104.725 1.00 106.71 ? 265 LYS B CG  1 
ATOM   5369  C  CD  . LYS B 1 265 ? -11.002 82.187  103.502 1.00 112.73 ? 265 LYS B CD  1 
ATOM   5370  C  CE  . LYS B 1 265 ? -10.395 80.781  103.559 1.00 115.95 ? 265 LYS B CE  1 
ATOM   5371  N  NZ  . LYS B 1 265 ? -8.899  80.779  103.632 1.00 116.99 ? 265 LYS B NZ  1 
ATOM   5372  N  N   . ILE B 1 266 ? -9.826  87.623  105.476 1.00 83.97  ? 266 ILE B N   1 
ATOM   5373  C  CA  . ILE B 1 266 ? -9.847  89.033  105.132 1.00 77.83  ? 266 ILE B CA  1 
ATOM   5374  C  C   . ILE B 1 266 ? -8.695  89.105  104.155 1.00 74.17  ? 266 ILE B C   1 
ATOM   5375  O  O   . ILE B 1 266 ? -7.574  88.688  104.475 1.00 73.78  ? 266 ILE B O   1 
ATOM   5376  C  CB  . ILE B 1 266 ? -9.523  89.919  106.326 1.00 77.79  ? 266 ILE B CB  1 
ATOM   5377  C  CG1 . ILE B 1 266 ? -10.591 89.745  107.401 1.00 80.95  ? 266 ILE B CG1 1 
ATOM   5378  C  CG2 . ILE B 1 266 ? -9.445  91.370  105.889 1.00 76.12  ? 266 ILE B CG2 1 
ATOM   5379  C  CD1 . ILE B 1 266 ? -10.274 90.466  108.696 1.00 86.68  ? 266 ILE B CD1 1 
ATOM   5380  N  N   . ASN B 1 267 ? -8.985  89.581  102.952 1.00 67.59  ? 267 ASN B N   1 
ATOM   5381  C  CA  . ASN B 1 267 ? -7.981  89.666  101.909 1.00 59.71  ? 267 ASN B CA  1 
ATOM   5382  C  C   . ASN B 1 267 ? -7.282  91.017  101.899 1.00 54.85  ? 267 ASN B C   1 
ATOM   5383  O  O   . ASN B 1 267 ? -7.932  92.067  101.835 1.00 51.59  ? 267 ASN B O   1 
ATOM   5384  C  CB  . ASN B 1 267 ? -8.629  89.397  100.554 1.00 61.79  ? 267 ASN B CB  1 
ATOM   5385  C  CG  . ASN B 1 267 ? -9.462  88.130  100.540 1.00 61.29  ? 267 ASN B CG  1 
ATOM   5386  O  OD1 . ASN B 1 267 ? -8.931  87.017  100.524 1.00 60.41  ? 267 ASN B OD1 1 
ATOM   5387  N  ND2 . ASN B 1 267 ? -10.778 88.295  100.527 1.00 62.53  ? 267 ASN B ND2 1 
ATOM   5388  N  N   . TYR B 1 268 ? -5.956  90.986  101.959 1.00 51.59  ? 268 TYR B N   1 
ATOM   5389  C  CA  . TYR B 1 268 ? -5.171  92.209  101.955 1.00 53.12  ? 268 TYR B CA  1 
ATOM   5390  C  C   . TYR B 1 268 ? -4.298  92.293  100.730 1.00 50.35  ? 268 TYR B C   1 
ATOM   5391  O  O   . TYR B 1 268 ? -3.526  91.379  100.443 1.00 49.70  ? 268 TYR B O   1 
ATOM   5392  C  CB  . TYR B 1 268 ? -4.268  92.269  103.176 1.00 60.27  ? 268 TYR B CB  1 
ATOM   5393  C  CG  . TYR B 1 268 ? -4.999  92.321  104.487 1.00 69.80  ? 268 TYR B CG  1 
ATOM   5394  C  CD1 . TYR B 1 268 ? -5.481  93.529  104.987 1.00 73.52  ? 268 TYR B CD1 1 
ATOM   5395  C  CD2 . TYR B 1 268 ? -5.219  91.161  105.230 1.00 73.76  ? 268 TYR B CD2 1 
ATOM   5396  C  CE1 . TYR B 1 268 ? -6.163  93.584  106.194 1.00 78.28  ? 268 TYR B CE1 1 
ATOM   5397  C  CE2 . TYR B 1 268 ? -5.899  91.204  106.436 1.00 78.20  ? 268 TYR B CE2 1 
ATOM   5398  C  CZ  . TYR B 1 268 ? -6.368  92.420  106.911 1.00 80.55  ? 268 TYR B CZ  1 
ATOM   5399  O  OH  . TYR B 1 268 ? -7.039  92.474  108.108 1.00 86.76  ? 268 TYR B OH  1 
ATOM   5400  N  N   . ALA B 1 269 ? -4.413  93.398  100.013 1.00 46.70  ? 269 ALA B N   1 
ATOM   5401  C  CA  . ALA B 1 269 ? -3.607  93.610  98.828  1.00 42.64  ? 269 ALA B CA  1 
ATOM   5402  C  C   . ALA B 1 269 ? -2.375  94.395  99.246  1.00 41.86  ? 269 ALA B C   1 
ATOM   5403  O  O   . ALA B 1 269 ? -2.474  95.562  99.625  1.00 41.71  ? 269 ALA B O   1 
ATOM   5404  C  CB  . ALA B 1 269 ? -4.394  94.384  97.783  1.00 42.33  ? 269 ALA B CB  1 
ATOM   5405  N  N   . ASN B 1 270 ? -1.221  93.745  99.223  1.00 41.32  ? 270 ASN B N   1 
ATOM   5406  C  CA  . ASN B 1 270 ? 0.020   94.415  99.586  1.00 42.15  ? 270 ASN B CA  1 
ATOM   5407  C  C   . ASN B 1 270 ? 0.317   95.560  98.638  1.00 43.35  ? 270 ASN B C   1 
ATOM   5408  O  O   . ASN B 1 270 ? -0.282  95.667  97.562  1.00 44.13  ? 270 ASN B O   1 
ATOM   5409  C  CB  . ASN B 1 270 ? 1.190   93.440  99.563  1.00 46.14  ? 270 ASN B CB  1 
ATOM   5410  C  CG  . ASN B 1 270 ? 1.182   92.516  100.741 1.00 51.60  ? 270 ASN B CG  1 
ATOM   5411  O  OD1 . ASN B 1 270 ? 0.834   92.924  101.848 1.00 58.55  ? 270 ASN B OD1 1 
ATOM   5412  N  ND2 . ASN B 1 270 ? 1.561   91.260  100.522 1.00 54.13  ? 270 ASN B ND2 1 
ATOM   5413  N  N   . LYS B 1 271 ? 1.213   96.447  99.055  1.00 44.90  ? 271 LYS B N   1 
ATOM   5414  C  CA  . LYS B 1 271 ? 1.578   97.563  98.205  1.00 44.62  ? 271 LYS B CA  1 
ATOM   5415  C  C   . LYS B 1 271 ? 2.446   96.952  97.125  1.00 42.63  ? 271 LYS B C   1 
ATOM   5416  O  O   . LYS B 1 271 ? 3.293   96.091  97.392  1.00 41.75  ? 271 LYS B O   1 
ATOM   5417  C  CB  . LYS B 1 271 ? 2.338   98.647  98.969  1.00 49.05  ? 271 LYS B CB  1 
ATOM   5418  C  CG  . LYS B 1 271 ? 2.433   99.965  98.202  1.00 53.87  ? 271 LYS B CG  1 
ATOM   5419  C  CD  . LYS B 1 271 ? 2.992   101.093 99.061  1.00 62.38  ? 271 LYS B CD  1 
ATOM   5420  C  CE  . LYS B 1 271 ? 2.966   102.435 98.323  1.00 67.63  ? 271 LYS B CE  1 
ATOM   5421  N  NZ  . LYS B 1 271 ? 3.413   103.591 99.171  1.00 72.44  ? 271 LYS B NZ  1 
ATOM   5422  N  N   . VAL B 1 272 ? 2.171   97.361  95.898  1.00 37.35  ? 272 VAL B N   1 
ATOM   5423  C  CA  . VAL B 1 272 ? 2.872   96.866  94.732  1.00 33.61  ? 272 VAL B CA  1 
ATOM   5424  C  C   . VAL B 1 272 ? 4.343   97.239  94.728  1.00 33.36  ? 272 VAL B C   1 
ATOM   5425  O  O   . VAL B 1 272 ? 4.688   98.412  94.894  1.00 36.13  ? 272 VAL B O   1 
ATOM   5426  C  CB  . VAL B 1 272 ? 2.227   97.435  93.455  1.00 28.10  ? 272 VAL B CB  1 
ATOM   5427  C  CG1 . VAL B 1 272 ? 2.921   96.902  92.233  1.00 28.56  ? 272 VAL B CG1 1 
ATOM   5428  C  CG2 . VAL B 1 272 ? 0.757   97.090  93.427  1.00 28.62  ? 272 VAL B CG2 1 
ATOM   5429  N  N   . ILE B 1 273 ? 5.213   96.239  94.620  1.00 34.18  ? 273 ILE B N   1 
ATOM   5430  C  CA  . ILE B 1 273 ? 6.646   96.512  94.513  1.00 35.72  ? 273 ILE B CA  1 
ATOM   5431  C  C   . ILE B 1 273 ? 6.824   96.668  92.980  1.00 34.84  ? 273 ILE B C   1 
ATOM   5432  O  O   . ILE B 1 273 ? 7.143   95.724  92.250  1.00 35.98  ? 273 ILE B O   1 
ATOM   5433  C  CB  . ILE B 1 273 ? 7.509   95.397  95.172  1.00 37.62  ? 273 ILE B CB  1 
ATOM   5434  C  CG1 . ILE B 1 273 ? 8.938   95.438  94.639  1.00 41.90  ? 273 ILE B CG1 1 
ATOM   5435  C  CG2 . ILE B 1 273 ? 6.852   94.032  95.041  1.00 44.26  ? 273 ILE B CG2 1 
ATOM   5436  C  CD1 . ILE B 1 273 ? 9.801   94.315  95.157  1.00 48.17  ? 273 ILE B CD1 1 
ATOM   5437  N  N   . ASN B 1 274 ? 6.480   97.869  92.516  1.00 32.16  ? 274 ASN B N   1 
ATOM   5438  C  CA  . ASN B 1 274 ? 6.469   98.252  91.110  1.00 28.76  ? 274 ASN B CA  1 
ATOM   5439  C  C   . ASN B 1 274 ? 7.739   98.252  90.265  1.00 29.50  ? 274 ASN B C   1 
ATOM   5440  O  O   . ASN B 1 274 ? 8.861   98.129  90.765  1.00 28.19  ? 274 ASN B O   1 
ATOM   5441  C  CB  . ASN B 1 274 ? 5.763   99.602  90.954  1.00 27.37  ? 274 ASN B CB  1 
ATOM   5442  C  CG  . ASN B 1 274 ? 6.586   100.760 91.476  1.00 28.62  ? 274 ASN B CG  1 
ATOM   5443  O  OD1 . ASN B 1 274 ? 7.747   100.951 91.091  1.00 29.41  ? 274 ASN B OD1 1 
ATOM   5444  N  ND2 . ASN B 1 274 ? 5.981   101.565 92.327  1.00 31.34  ? 274 ASN B ND2 1 
ATOM   5445  N  N   . ASN B 1 275 ? 7.526   98.440  88.962  1.00 27.69  ? 275 ASN B N   1 
ATOM   5446  C  CA  . ASN B 1 275 ? 8.596   98.484  87.978  1.00 24.49  ? 275 ASN B CA  1 
ATOM   5447  C  C   . ASN B 1 275 ? 8.829   99.910  87.473  1.00 24.97  ? 275 ASN B C   1 
ATOM   5448  O  O   . ASN B 1 275 ? 9.273   100.105 86.344  1.00 27.07  ? 275 ASN B O   1 
ATOM   5449  C  CB  . ASN B 1 275 ? 8.304   97.528  86.802  1.00 20.35  ? 275 ASN B CB  1 
ATOM   5450  C  CG  . ASN B 1 275 ? 6.895   97.692  86.240  1.00 21.87  ? 275 ASN B CG  1 
ATOM   5451  O  OD1 . ASN B 1 275 ? 6.216   98.679  86.516  1.00 21.68  ? 275 ASN B OD1 1 
ATOM   5452  N  ND2 . ASN B 1 275 ? 6.436   96.705  85.487  1.00 19.15  ? 275 ASN B ND2 1 
ATOM   5453  N  N   . ASN B 1 276 ? 8.528   100.910 88.302  1.00 25.07  ? 276 ASN B N   1 
ATOM   5454  C  CA  . ASN B 1 276 ? 8.757   102.291 87.900  1.00 19.07  ? 276 ASN B CA  1 
ATOM   5455  C  C   . ASN B 1 276 ? 10.258  102.401 87.750  1.00 19.28  ? 276 ASN B C   1 
ATOM   5456  O  O   . ASN B 1 276 ? 11.016  101.885 88.575  1.00 20.54  ? 276 ASN B O   1 
ATOM   5457  C  CB  . ASN B 1 276 ? 8.271   103.291 88.952  1.00 18.63  ? 276 ASN B CB  1 
ATOM   5458  C  CG  . ASN B 1 276 ? 6.761   103.499 88.931  1.00 22.23  ? 276 ASN B CG  1 
ATOM   5459  O  OD1 . ASN B 1 276 ? 6.135   103.599 87.876  1.00 24.61  ? 276 ASN B OD1 1 
ATOM   5460  N  ND2 . ASN B 1 276 ? 6.174   103.591 90.110  1.00 30.01  ? 276 ASN B ND2 1 
ATOM   5461  N  N   . GLY B 1 277 ? 10.676  103.027 86.661  1.00 19.71  ? 277 GLY B N   1 
ATOM   5462  C  CA  . GLY B 1 277 ? 12.086  103.190 86.373  1.00 19.16  ? 277 GLY B CA  1 
ATOM   5463  C  C   . GLY B 1 277 ? 12.235  103.323 84.865  1.00 23.12  ? 277 GLY B C   1 
ATOM   5464  O  O   . GLY B 1 277 ? 11.306  103.741 84.165  1.00 22.51  ? 277 GLY B O   1 
ATOM   5465  N  N   . ASN B 1 278 ? 13.387  102.952 84.338  1.00 20.57  ? 278 ASN B N   1 
ATOM   5466  C  CA  . ASN B 1 278 ? 13.576  103.049 82.903  1.00 24.04  ? 278 ASN B CA  1 
ATOM   5467  C  C   . ASN B 1 278 ? 14.573  102.020 82.444  1.00 22.63  ? 278 ASN B C   1 
ATOM   5468  O  O   . ASN B 1 278 ? 15.346  101.494 83.245  1.00 21.33  ? 278 ASN B O   1 
ATOM   5469  C  CB  . ASN B 1 278 ? 14.046  104.453 82.495  1.00 26.39  ? 278 ASN B CB  1 
ATOM   5470  C  CG  . ASN B 1 278 ? 15.381  104.831 83.114  1.00 32.31  ? 278 ASN B CG  1 
ATOM   5471  O  OD1 . ASN B 1 278 ? 15.429  105.637 84.040  1.00 41.60  ? 278 ASN B OD1 1 
ATOM   5472  N  ND2 . ASN B 1 278 ? 16.472  104.261 82.602  1.00 33.50  ? 278 ASN B ND2 1 
ATOM   5473  N  N   . MET B 1 279 ? 14.545  101.731 81.150  1.00 21.09  ? 279 MET B N   1 
ATOM   5474  C  CA  . MET B 1 279 ? 15.471  100.779 80.567  1.00 19.28  ? 279 MET B CA  1 
ATOM   5475  C  C   . MET B 1 279 ? 16.106  101.347 79.330  1.00 18.24  ? 279 MET B C   1 
ATOM   5476  O  O   . MET B 1 279 ? 15.448  102.008 78.520  1.00 19.92  ? 279 MET B O   1 
ATOM   5477  C  CB  . MET B 1 279 ? 14.780  99.473  80.190  1.00 20.18  ? 279 MET B CB  1 
ATOM   5478  C  CG  . MET B 1 279 ? 15.725  98.470  79.514  1.00 22.38  ? 279 MET B CG  1 
ATOM   5479  S  SD  . MET B 1 279 ? 14.906  97.015  78.836  1.00 28.37  ? 279 MET B SD  1 
ATOM   5480  C  CE  . MET B 1 279 ? 13.986  97.763  77.517  1.00 16.02  ? 279 MET B CE  1 
ATOM   5481  N  N   . TRP B 1 280 ? 17.395  101.086 79.204  1.00 18.11  ? 280 TRP B N   1 
ATOM   5482  C  CA  . TRP B 1 280 ? 18.175  101.507 78.059  1.00 17.43  ? 280 TRP B CA  1 
ATOM   5483  C  C   . TRP B 1 280 ? 18.768  100.250 77.484  1.00 19.01  ? 280 TRP B C   1 
ATOM   5484  O  O   . TRP B 1 280 ? 19.368  99.450  78.220  1.00 18.52  ? 280 TRP B O   1 
ATOM   5485  C  CB  . TRP B 1 280 ? 19.341  102.402 78.478  1.00 24.09  ? 280 TRP B CB  1 
ATOM   5486  C  CG  . TRP B 1 280 ? 19.021  103.834 78.489  1.00 33.78  ? 280 TRP B CG  1 
ATOM   5487  C  CD1 . TRP B 1 280 ? 18.804  104.617 79.581  1.00 36.16  ? 280 TRP B CD1 1 
ATOM   5488  C  CD2 . TRP B 1 280 ? 18.831  104.670 77.344  1.00 37.26  ? 280 TRP B CD2 1 
ATOM   5489  N  NE1 . TRP B 1 280 ? 18.478  105.894 79.187  1.00 37.99  ? 280 TRP B NE1 1 
ATOM   5490  C  CE2 . TRP B 1 280 ? 18.487  105.956 77.819  1.00 37.71  ? 280 TRP B CE2 1 
ATOM   5491  C  CE3 . TRP B 1 280 ? 18.915  104.457 75.960  1.00 37.45  ? 280 TRP B CE3 1 
ATOM   5492  C  CZ2 . TRP B 1 280 ? 18.223  107.030 76.958  1.00 38.51  ? 280 TRP B CZ2 1 
ATOM   5493  C  CZ3 . TRP B 1 280 ? 18.654  105.523 75.102  1.00 37.30  ? 280 TRP B CZ3 1 
ATOM   5494  C  CH2 . TRP B 1 280 ? 18.310  106.797 75.608  1.00 38.87  ? 280 TRP B CH2 1 
ATOM   5495  N  N   . ARG B 1 281 ? 18.601  100.068 76.181  1.00 19.92  ? 281 ARG B N   1 
ATOM   5496  C  CA  . ARG B 1 281 ? 19.172  98.919  75.496  1.00 18.53  ? 281 ARG B CA  1 
ATOM   5497  C  C   . ARG B 1 281 ? 19.859  99.424  74.235  1.00 19.83  ? 281 ARG B C   1 
ATOM   5498  O  O   . ARG B 1 281 ? 19.257  100.146 73.440  1.00 20.39  ? 281 ARG B O   1 
ATOM   5499  C  CB  . ARG B 1 281 ? 18.093  97.898  75.124  1.00 16.66  ? 281 ARG B CB  1 
ATOM   5500  C  CG  . ARG B 1 281 ? 18.647  96.621  74.529  1.00 14.38  ? 281 ARG B CG  1 
ATOM   5501  C  CD  . ARG B 1 281 ? 17.538  95.708  74.067  1.00 14.45  ? 281 ARG B CD  1 
ATOM   5502  N  NE  . ARG B 1 281 ? 16.916  94.996  75.171  1.00 16.30  ? 281 ARG B NE  1 
ATOM   5503  C  CZ  . ARG B 1 281 ? 15.608  94.821  75.312  1.00 16.98  ? 281 ARG B CZ  1 
ATOM   5504  N  NH1 . ARG B 1 281 ? 14.768  95.308  74.414  1.00 15.63  ? 281 ARG B NH1 1 
ATOM   5505  N  NH2 . ARG B 1 281 ? 15.140  94.161  76.361  1.00 15.13  ? 281 ARG B NH2 1 
ATOM   5506  N  N   . ILE B 1 282 ? 21.152  99.150  74.134  1.00 18.26  ? 282 ILE B N   1 
ATOM   5507  C  CA  . ILE B 1 282 ? 21.943  99.519  72.972  1.00 18.84  ? 282 ILE B CA  1 
ATOM   5508  C  C   . ILE B 1 282 ? 22.453  98.162  72.506  1.00 20.63  ? 282 ILE B C   1 
ATOM   5509  O  O   . ILE B 1 282 ? 23.125  97.434  73.257  1.00 18.03  ? 282 ILE B O   1 
ATOM   5510  C  CB  . ILE B 1 282 ? 23.083  100.453 73.341  1.00 20.83  ? 282 ILE B CB  1 
ATOM   5511  C  CG1 . ILE B 1 282 ? 22.515  101.684 74.024  1.00 21.41  ? 282 ILE B CG1 1 
ATOM   5512  C  CG2 . ILE B 1 282 ? 23.790  100.909 72.104  1.00 15.57  ? 282 ILE B CG2 1 
ATOM   5513  C  CD1 . ILE B 1 282 ? 23.565  102.560 74.607  1.00 30.04  ? 282 ILE B CD1 1 
ATOM   5514  N  N   . LEU B 1 283 ? 22.054  97.802  71.291  1.00 17.49  ? 283 LEU B N   1 
ATOM   5515  C  CA  . LEU B 1 283 ? 22.361  96.501  70.719  1.00 18.19  ? 283 LEU B CA  1 
ATOM   5516  C  C   . LEU B 1 283 ? 22.904  96.633  69.321  1.00 19.98  ? 283 LEU B C   1 
ATOM   5517  O  O   . LEU B 1 283 ? 22.486  97.512  68.551  1.00 19.59  ? 283 LEU B O   1 
ATOM   5518  C  CB  . LEU B 1 283 ? 21.054  95.703  70.595  1.00 13.56  ? 283 LEU B CB  1 
ATOM   5519  C  CG  . LEU B 1 283 ? 20.919  94.171  70.666  1.00 17.35  ? 283 LEU B CG  1 
ATOM   5520  C  CD1 . LEU B 1 283 ? 19.622  93.817  69.970  1.00 14.99  ? 283 LEU B CD1 1 
ATOM   5521  C  CD2 . LEU B 1 283 ? 22.058  93.393  70.060  1.00 14.04  ? 283 LEU B CD2 1 
ATOM   5522  N  N   . ASP B 1 284 ? 23.814  95.734  68.991  1.00 16.50  ? 284 ASP B N   1 
ATOM   5523  C  CA  . ASP B 1 284 ? 24.368  95.673  67.667  1.00 18.08  ? 284 ASP B CA  1 
ATOM   5524  C  C   . ASP B 1 284 ? 24.680  94.219  67.376  1.00 17.79  ? 284 ASP B C   1 
ATOM   5525  O  O   . ASP B 1 284 ? 25.403  93.558  68.135  1.00 19.07  ? 284 ASP B O   1 
ATOM   5526  C  CB  . ASP B 1 284 ? 25.603  96.540  67.516  1.00 20.57  ? 284 ASP B CB  1 
ATOM   5527  C  CG  . ASP B 1 284 ? 26.041  96.647  66.077  1.00 23.40  ? 284 ASP B CG  1 
ATOM   5528  O  OD1 . ASP B 1 284 ? 26.693  95.696  65.604  1.00 22.79  ? 284 ASP B OD1 1 
ATOM   5529  O  OD2 . ASP B 1 284 ? 25.693  97.655  65.416  1.00 23.10  ? 284 ASP B OD2 1 
ATOM   5530  N  N   . HIS B 1 285 ? 24.051  93.699  66.326  1.00 16.11  ? 285 HIS B N   1 
ATOM   5531  C  CA  . HIS B 1 285 ? 24.238  92.313  65.928  1.00 15.84  ? 285 HIS B CA  1 
ATOM   5532  C  C   . HIS B 1 285 ? 24.215  92.205  64.427  1.00 14.74  ? 285 HIS B C   1 
ATOM   5533  O  O   . HIS B 1 285 ? 23.735  93.102  63.737  1.00 18.60  ? 285 HIS B O   1 
ATOM   5534  C  CB  . HIS B 1 285 ? 23.149  91.419  66.526  1.00 14.57  ? 285 HIS B CB  1 
ATOM   5535  C  CG  . HIS B 1 285 ? 21.763  91.756  66.076  1.00 11.84  ? 285 HIS B CG  1 
ATOM   5536  N  ND1 . HIS B 1 285 ? 21.027  90.924  65.261  1.00 9.01   ? 285 HIS B ND1 1 
ATOM   5537  C  CD2 . HIS B 1 285 ? 20.954  92.798  66.377  1.00 12.44  ? 285 HIS B CD2 1 
ATOM   5538  C  CE1 . HIS B 1 285 ? 19.820  91.434  65.083  1.00 13.13  ? 285 HIS B CE1 1 
ATOM   5539  N  NE2 . HIS B 1 285 ? 19.750  92.572  65.751  1.00 11.60  ? 285 HIS B NE2 1 
ATOM   5540  N  N   . GLY B 1 286 ? 24.735  91.104  63.912  1.00 15.72  ? 286 GLY B N   1 
ATOM   5541  C  CA  . GLY B 1 286 ? 24.750  90.935  62.478  1.00 15.62  ? 286 GLY B CA  1 
ATOM   5542  C  C   . GLY B 1 286 ? 25.205  89.561  62.063  1.00 17.03  ? 286 GLY B C   1 
ATOM   5543  O  O   . GLY B 1 286 ? 25.542  88.712  62.902  1.00 16.07  ? 286 GLY B O   1 
ATOM   5544  N  N   . ALA B 1 287 ? 25.231  89.366  60.750  1.00 16.08  ? 287 ALA B N   1 
ATOM   5545  C  CA  . ALA B 1 287 ? 25.626  88.114  60.123  1.00 16.58  ? 287 ALA B CA  1 
ATOM   5546  C  C   . ALA B 1 287 ? 26.197  88.535  58.778  1.00 18.22  ? 287 ALA B C   1 
ATOM   5547  O  O   . ALA B 1 287 ? 25.527  89.209  57.995  1.00 20.61  ? 287 ALA B O   1 
ATOM   5548  C  CB  . ALA B 1 287 ? 24.412  87.219  59.934  1.00 13.16  ? 287 ALA B CB  1 
ATOM   5549  N  N   . ILE B 1 288 ? 27.456  88.194  58.539  1.00 18.53  ? 288 ILE B N   1 
ATOM   5550  C  CA  . ILE B 1 288 ? 28.127  88.569  57.307  1.00 16.87  ? 288 ILE B CA  1 
ATOM   5551  C  C   . ILE B 1 288 ? 29.004  87.432  56.808  1.00 20.57  ? 288 ILE B C   1 
ATOM   5552  O  O   . ILE B 1 288 ? 29.259  86.477  57.543  1.00 21.28  ? 288 ILE B O   1 
ATOM   5553  C  CB  . ILE B 1 288 ? 29.005  89.800  57.545  1.00 15.72  ? 288 ILE B CB  1 
ATOM   5554  C  CG1 . ILE B 1 288 ? 30.025  89.506  58.642  1.00 14.61  ? 288 ILE B CG1 1 
ATOM   5555  C  CG2 . ILE B 1 288 ? 28.153  91.000  57.979  1.00 14.91  ? 288 ILE B CG2 1 
ATOM   5556  C  CD1 . ILE B 1 288 ? 30.998  90.642  58.865  1.00 19.17  ? 288 ILE B CD1 1 
ATOM   5557  N  N   . SER B 1 289 ? 29.432  87.515  55.548  1.00 22.76  ? 289 SER B N   1 
ATOM   5558  C  CA  . SER B 1 289 ? 30.315  86.512  54.954  1.00 23.69  ? 289 SER B CA  1 
ATOM   5559  C  C   . SER B 1 289 ? 31.687  87.127  54.726  1.00 23.97  ? 289 SER B C   1 
ATOM   5560  O  O   . SER B 1 289 ? 31.806  88.198  54.126  1.00 26.43  ? 289 SER B O   1 
ATOM   5561  C  CB  . SER B 1 289 ? 29.777  86.017  53.619  1.00 21.15  ? 289 SER B CB  1 
ATOM   5562  O  OG  . SER B 1 289 ? 28.572  85.310  53.796  1.00 33.47  ? 289 SER B OG  1 
ATOM   5563  N  N   . LEU B 1 290 ? 32.714  86.457  55.238  1.00 26.09  ? 290 LEU B N   1 
ATOM   5564  C  CA  . LEU B 1 290 ? 34.098  86.894  55.098  1.00 30.45  ? 290 LEU B CA  1 
ATOM   5565  C  C   . LEU B 1 290 ? 34.740  85.997  54.053  1.00 33.63  ? 290 LEU B C   1 
ATOM   5566  O  O   . LEU B 1 290 ? 35.455  85.045  54.378  1.00 39.10  ? 290 LEU B O   1 
ATOM   5567  C  CB  . LEU B 1 290 ? 34.868  86.756  56.423  1.00 32.56  ? 290 LEU B CB  1 
ATOM   5568  C  CG  . LEU B 1 290 ? 34.619  87.722  57.585  1.00 31.88  ? 290 LEU B CG  1 
ATOM   5569  C  CD1 . LEU B 1 290 ? 34.358  89.105  57.020  1.00 29.39  ? 290 LEU B CD1 1 
ATOM   5570  C  CD2 . LEU B 1 290 ? 33.449  87.267  58.425  1.00 37.52  ? 290 LEU B CD2 1 
ATOM   5571  N  N   . GLY B 1 291 ? 34.440  86.261  52.792  1.00 35.98  ? 291 GLY B N   1 
ATOM   5572  C  CA  . GLY B 1 291 ? 35.010  85.451  51.739  1.00 35.02  ? 291 GLY B CA  1 
ATOM   5573  C  C   . GLY B 1 291 ? 34.205  84.210  51.434  1.00 34.47  ? 291 GLY B C   1 
ATOM   5574  O  O   . GLY B 1 291 ? 33.016  84.127  51.743  1.00 36.48  ? 291 GLY B O   1 
ATOM   5575  N  N   . ASP B 1 292 ? 34.879  83.220  50.868  1.00 31.95  ? 292 ASP B N   1 
ATOM   5576  C  CA  . ASP B 1 292 ? 34.224  81.989  50.467  1.00 32.83  ? 292 ASP B CA  1 
ATOM   5577  C  C   . ASP B 1 292 ? 34.058  80.957  51.553  1.00 30.58  ? 292 ASP B C   1 
ATOM   5578  O  O   . ASP B 1 292 ? 33.098  80.192  51.520  1.00 35.45  ? 292 ASP B O   1 
ATOM   5579  C  CB  . ASP B 1 292 ? 34.991  81.326  49.311  1.00 41.40  ? 292 ASP B CB  1 
ATOM   5580  C  CG  . ASP B 1 292 ? 35.092  82.202  48.062  1.00 47.51  ? 292 ASP B CG  1 
ATOM   5581  O  OD1 . ASP B 1 292 ? 34.329  83.186  47.914  1.00 50.00  ? 292 ASP B OD1 1 
ATOM   5582  O  OD2 . ASP B 1 292 ? 35.960  81.890  47.217  1.00 50.23  ? 292 ASP B OD2 1 
ATOM   5583  N  N   . LYS B 1 293 ? 34.999  80.912  52.492  1.00 25.29  ? 293 LYS B N   1 
ATOM   5584  C  CA  . LYS B 1 293 ? 34.976  79.900  53.539  1.00 20.73  ? 293 LYS B CA  1 
ATOM   5585  C  C   . LYS B 1 293 ? 34.470  80.322  54.905  1.00 21.04  ? 293 LYS B C   1 
ATOM   5586  O  O   . LYS B 1 293 ? 34.304  79.469  55.779  1.00 21.97  ? 293 LYS B O   1 
ATOM   5587  C  CB  . LYS B 1 293 ? 36.379  79.313  53.713  1.00 23.81  ? 293 LYS B CB  1 
ATOM   5588  C  CG  . LYS B 1 293 ? 37.010  78.762  52.456  1.00 27.71  ? 293 LYS B CG  1 
ATOM   5589  C  CD  . LYS B 1 293 ? 36.443  77.409  52.118  1.00 38.03  ? 293 LYS B CD  1 
ATOM   5590  C  CE  . LYS B 1 293 ? 37.222  76.735  51.004  1.00 39.70  ? 293 LYS B CE  1 
ATOM   5591  N  NZ  . LYS B 1 293 ? 36.924  75.271  50.972  1.00 48.77  ? 293 LYS B NZ  1 
ATOM   5592  N  N   . TRP B 1 294 ? 34.205  81.609  55.093  1.00 19.00  ? 294 TRP B N   1 
ATOM   5593  C  CA  . TRP B 1 294 ? 33.788  82.076  56.403  1.00 19.06  ? 294 TRP B CA  1 
ATOM   5594  C  C   . TRP B 1 294 ? 32.515  82.852  56.497  1.00 18.66  ? 294 TRP B C   1 
ATOM   5595  O  O   . TRP B 1 294 ? 32.304  83.809  55.760  1.00 20.59  ? 294 TRP B O   1 
ATOM   5596  C  CB  . TRP B 1 294 ? 34.860  82.977  57.020  1.00 20.72  ? 294 TRP B CB  1 
ATOM   5597  C  CG  . TRP B 1 294 ? 36.147  82.311  57.299  1.00 25.71  ? 294 TRP B CG  1 
ATOM   5598  C  CD1 . TRP B 1 294 ? 37.236  82.246  56.472  1.00 23.77  ? 294 TRP B CD1 1 
ATOM   5599  C  CD2 . TRP B 1 294 ? 36.504  81.608  58.489  1.00 26.99  ? 294 TRP B CD2 1 
ATOM   5600  N  NE1 . TRP B 1 294 ? 38.246  81.543  57.077  1.00 25.52  ? 294 TRP B NE1 1 
ATOM   5601  C  CE2 . TRP B 1 294 ? 37.826  81.142  58.318  1.00 26.22  ? 294 TRP B CE2 1 
ATOM   5602  C  CE3 . TRP B 1 294 ? 35.837  81.326  59.686  1.00 29.74  ? 294 TRP B CE3 1 
ATOM   5603  C  CZ2 . TRP B 1 294 ? 38.493  80.411  59.301  1.00 26.74  ? 294 TRP B CZ2 1 
ATOM   5604  C  CZ3 . TRP B 1 294 ? 36.500  80.596  60.662  1.00 29.24  ? 294 TRP B CZ3 1 
ATOM   5605  C  CH2 . TRP B 1 294 ? 37.814  80.149  60.464  1.00 29.24  ? 294 TRP B CH2 1 
ATOM   5606  N  N   . ASP B 1 295 ? 31.711  82.491  57.484  1.00 17.74  ? 295 ASP B N   1 
ATOM   5607  C  CA  . ASP B 1 295 ? 30.489  83.217  57.777  1.00 18.81  ? 295 ASP B CA  1 
ATOM   5608  C  C   . ASP B 1 295 ? 30.653  83.632  59.235  1.00 20.49  ? 295 ASP B C   1 
ATOM   5609  O  O   . ASP B 1 295 ? 31.381  82.981  59.989  1.00 20.76  ? 295 ASP B O   1 
ATOM   5610  C  CB  . ASP B 1 295 ? 29.263  82.346  57.578  1.00 20.87  ? 295 ASP B CB  1 
ATOM   5611  C  CG  . ASP B 1 295 ? 28.681  82.469  56.177  1.00 22.57  ? 295 ASP B CG  1 
ATOM   5612  O  OD1 . ASP B 1 295 ? 29.335  83.041  55.276  1.00 22.66  ? 295 ASP B OD1 1 
ATOM   5613  O  OD2 . ASP B 1 295 ? 27.550  82.002  55.978  1.00 24.49  ? 295 ASP B OD2 1 
ATOM   5614  N  N   . LEU B 1 296 ? 30.016  84.719  59.637  1.00 19.97  ? 296 LEU B N   1 
ATOM   5615  C  CA  . LEU B 1 296 ? 30.152  85.180  61.007  1.00 18.76  ? 296 LEU B CA  1 
ATOM   5616  C  C   . LEU B 1 296 ? 28.898  85.828  61.566  1.00 18.57  ? 296 LEU B C   1 
ATOM   5617  O  O   . LEU B 1 296 ? 28.294  86.690  60.931  1.00 21.68  ? 296 LEU B O   1 
ATOM   5618  C  CB  . LEU B 1 296 ? 31.300  86.194  61.088  1.00 18.61  ? 296 LEU B CB  1 
ATOM   5619  C  CG  . LEU B 1 296 ? 31.589  86.854  62.433  1.00 19.72  ? 296 LEU B CG  1 
ATOM   5620  C  CD1 . LEU B 1 296 ? 32.255  85.852  63.348  1.00 20.49  ? 296 LEU B CD1 1 
ATOM   5621  C  CD2 . LEU B 1 296 ? 32.485  88.045  62.245  1.00 18.00  ? 296 LEU B CD2 1 
ATOM   5622  N  N   . MET B 1 297 ? 28.491  85.377  62.744  1.00 18.92  ? 297 MET B N   1 
ATOM   5623  C  CA  . MET B 1 297 ? 27.354  85.959  63.458  1.00 16.49  ? 297 MET B CA  1 
ATOM   5624  C  C   . MET B 1 297 ? 27.990  86.619  64.692  1.00 18.19  ? 297 MET B C   1 
ATOM   5625  O  O   . MET B 1 297 ? 28.967  86.093  65.243  1.00 17.77  ? 297 MET B O   1 
ATOM   5626  C  CB  . MET B 1 297 ? 26.382  84.872  63.914  1.00 17.36  ? 297 MET B CB  1 
ATOM   5627  C  CG  . MET B 1 297 ? 25.180  84.666  63.030  1.00 16.30  ? 297 MET B CG  1 
ATOM   5628  S  SD  . MET B 1 297 ? 24.237  83.325  63.709  1.00 20.47  ? 297 MET B SD  1 
ATOM   5629  C  CE  . MET B 1 297 ? 22.992  83.192  62.526  1.00 17.92  ? 297 MET B CE  1 
ATOM   5630  N  N   . TYR B 1 298 ? 27.472  87.767  65.115  1.00 17.15  ? 298 TYR B N   1 
ATOM   5631  C  CA  . TYR B 1 298 ? 28.018  88.435  66.290  1.00 16.90  ? 298 TYR B CA  1 
ATOM   5632  C  C   . TYR B 1 298 ? 26.958  89.275  67.008  1.00 18.46  ? 298 TYR B C   1 
ATOM   5633  O  O   . TYR B 1 298 ? 25.971  89.693  66.385  1.00 19.27  ? 298 TYR B O   1 
ATOM   5634  C  CB  . TYR B 1 298 ? 29.194  89.322  65.881  1.00 15.24  ? 298 TYR B CB  1 
ATOM   5635  C  CG  . TYR B 1 298 ? 28.834  90.363  64.842  1.00 15.73  ? 298 TYR B CG  1 
ATOM   5636  C  CD1 . TYR B 1 298 ? 28.332  91.611  65.220  1.00 13.56  ? 298 TYR B CD1 1 
ATOM   5637  C  CD2 . TYR B 1 298 ? 28.959  90.084  63.475  1.00 15.26  ? 298 TYR B CD2 1 
ATOM   5638  C  CE1 . TYR B 1 298 ? 27.955  92.560  64.253  1.00 18.19  ? 298 TYR B CE1 1 
ATOM   5639  C  CE2 . TYR B 1 298 ? 28.588  91.016  62.502  1.00 15.32  ? 298 TYR B CE2 1 
ATOM   5640  C  CZ  . TYR B 1 298 ? 28.085  92.249  62.893  1.00 18.30  ? 298 TYR B CZ  1 
ATOM   5641  O  OH  . TYR B 1 298 ? 27.684  93.158  61.935  1.00 19.05  ? 298 TYR B OH  1 
ATOM   5642  N  N   . VAL B 1 299 ? 27.148  89.488  68.312  1.00 19.03  ? 299 VAL B N   1 
ATOM   5643  C  CA  . VAL B 1 299 ? 26.239  90.316  69.111  1.00 14.94  ? 299 VAL B CA  1 
ATOM   5644  C  C   . VAL B 1 299 ? 27.050  91.112  70.082  1.00 15.49  ? 299 VAL B C   1 
ATOM   5645  O  O   . VAL B 1 299 ? 28.025  90.616  70.633  1.00 17.01  ? 299 VAL B O   1 
ATOM   5646  C  CB  . VAL B 1 299 ? 25.360  89.543  70.090  1.00 14.06  ? 299 VAL B CB  1 
ATOM   5647  C  CG1 . VAL B 1 299 ? 23.976  90.125  70.094  1.00 14.24  ? 299 VAL B CG1 1 
ATOM   5648  C  CG2 . VAL B 1 299 ? 25.436  88.067  69.885  1.00 18.00  ? 299 VAL B CG2 1 
ATOM   5649  N  N   . GLY B 1 300 ? 26.527  92.274  70.421  1.00 16.58  ? 300 GLY B N   1 
ATOM   5650  C  CA  . GLY B 1 300 ? 27.152  93.130  71.399  1.00 13.87  ? 300 GLY B CA  1 
ATOM   5651  C  C   . GLY B 1 300 ? 25.978  93.879  71.997  1.00 16.76  ? 300 GLY B C   1 
ATOM   5652  O  O   . GLY B 1 300 ? 25.247  94.537  71.259  1.00 17.12  ? 300 GLY B O   1 
ATOM   5653  N  N   . MET B 1 301 ? 25.734  93.739  73.296  1.00 16.56  ? 301 MET B N   1 
ATOM   5654  C  CA  . MET B 1 301 ? 24.612  94.437  73.907  1.00 16.73  ? 301 MET B CA  1 
ATOM   5655  C  C   . MET B 1 301 ? 24.833  94.911  75.330  1.00 18.41  ? 301 MET B C   1 
ATOM   5656  O  O   . MET B 1 301 ? 25.476  94.235  76.151  1.00 17.96  ? 301 MET B O   1 
ATOM   5657  C  CB  . MET B 1 301 ? 23.340  93.581  73.865  1.00 14.01  ? 301 MET B CB  1 
ATOM   5658  C  CG  . MET B 1 301 ? 22.160  94.274  74.501  1.00 13.24  ? 301 MET B CG  1 
ATOM   5659  S  SD  . MET B 1 301 ? 20.632  93.387  74.316  1.00 22.03  ? 301 MET B SD  1 
ATOM   5660  C  CE  . MET B 1 301 ? 21.006  91.925  75.166  1.00 13.62  ? 301 MET B CE  1 
ATOM   5661  N  N   . TYR B 1 302 ? 24.291  96.095  75.587  1.00 16.76  ? 302 TYR B N   1 
ATOM   5662  C  CA  . TYR B 1 302 ? 24.323  96.721  76.889  1.00 16.00  ? 302 TYR B CA  1 
ATOM   5663  C  C   . TYR B 1 302 ? 22.870  96.986  77.245  1.00 14.76  ? 302 TYR B C   1 
ATOM   5664  O  O   . TYR B 1 302 ? 22.148  97.629  76.481  1.00 14.36  ? 302 TYR B O   1 
ATOM   5665  C  CB  . TYR B 1 302 ? 25.058  98.055  76.837  1.00 17.98  ? 302 TYR B CB  1 
ATOM   5666  C  CG  . TYR B 1 302 ? 24.915  98.839  78.121  1.00 20.24  ? 302 TYR B CG  1 
ATOM   5667  C  CD1 . TYR B 1 302 ? 25.629  98.471  79.264  1.00 21.71  ? 302 TYR B CD1 1 
ATOM   5668  C  CD2 . TYR B 1 302 ? 24.045  99.931  78.205  1.00 22.12  ? 302 TYR B CD2 1 
ATOM   5669  C  CE1 . TYR B 1 302 ? 25.488  99.162  80.457  1.00 21.02  ? 302 TYR B CE1 1 
ATOM   5670  C  CE2 . TYR B 1 302 ? 23.892  100.635 79.397  1.00 21.21  ? 302 TYR B CE2 1 
ATOM   5671  C  CZ  . TYR B 1 302 ? 24.621  100.242 80.520  1.00 23.40  ? 302 TYR B CZ  1 
ATOM   5672  O  OH  . TYR B 1 302 ? 24.483  100.925 81.710  1.00 32.15  ? 302 TYR B OH  1 
ATOM   5673  N  N   . GLN B 1 303 ? 22.427  96.453  78.372  1.00 14.44  ? 303 GLN B N   1 
ATOM   5674  C  CA  . GLN B 1 303 ? 21.059  96.677  78.809  1.00 16.82  ? 303 GLN B CA  1 
ATOM   5675  C  C   . GLN B 1 303 ? 21.063  97.084  80.281  1.00 20.03  ? 303 GLN B C   1 
ATOM   5676  O  O   . GLN B 1 303 ? 21.647  96.405  81.133  1.00 21.36  ? 303 GLN B O   1 
ATOM   5677  C  CB  . GLN B 1 303 ? 20.220  95.424  78.622  1.00 14.17  ? 303 GLN B CB  1 
ATOM   5678  C  CG  . GLN B 1 303 ? 18.799  95.569  79.130  1.00 12.55  ? 303 GLN B CG  1 
ATOM   5679  C  CD  . GLN B 1 303 ? 17.974  94.348  78.850  1.00 17.15  ? 303 GLN B CD  1 
ATOM   5680  O  OE1 . GLN B 1 303 ? 17.558  94.110  77.712  1.00 19.14  ? 303 GLN B OE1 1 
ATOM   5681  N  NE2 . GLN B 1 303 ? 17.747  93.544  79.873  1.00 16.02  ? 303 GLN B NE2 1 
ATOM   5682  N  N   . ASN B 1 304 ? 20.416  98.204  80.575  1.00 20.65  ? 304 ASN B N   1 
ATOM   5683  C  CA  . ASN B 1 304 ? 20.357  98.710  81.937  1.00 18.66  ? 304 ASN B CA  1 
ATOM   5684  C  C   . ASN B 1 304 ? 18.934  98.959  82.373  1.00 18.66  ? 304 ASN B C   1 
ATOM   5685  O  O   . ASN B 1 304 ? 18.251  99.818  81.810  1.00 20.26  ? 304 ASN B O   1 
ATOM   5686  C  CB  . ASN B 1 304 ? 21.138  100.015 82.049  1.00 24.66  ? 304 ASN B CB  1 
ATOM   5687  C  CG  . ASN B 1 304 ? 21.173  100.547 83.467  1.00 27.86  ? 304 ASN B CG  1 
ATOM   5688  O  OD1 . ASN B 1 304 ? 21.529  99.827  84.405  1.00 30.52  ? 304 ASN B OD1 1 
ATOM   5689  N  ND2 . ASN B 1 304 ? 20.790  101.806 83.634  1.00 34.05  ? 304 ASN B ND2 1 
ATOM   5690  N  N   . ILE B 1 305 ? 18.475  98.165  83.331  1.00 19.40  ? 305 ILE B N   1 
ATOM   5691  C  CA  . ILE B 1 305 ? 17.140  98.323  83.870  1.00 20.78  ? 305 ILE B CA  1 
ATOM   5692  C  C   . ILE B 1 305 ? 17.331  99.036  85.203  1.00 23.66  ? 305 ILE B C   1 
ATOM   5693  O  O   . ILE B 1 305 ? 17.790  98.442  86.183  1.00 22.84  ? 305 ILE B O   1 
ATOM   5694  C  CB  . ILE B 1 305 ? 16.431  96.972  84.075  1.00 18.24  ? 305 ILE B CB  1 
ATOM   5695  C  CG1 . ILE B 1 305 ? 16.299  96.240  82.740  1.00 18.01  ? 305 ILE B CG1 1 
ATOM   5696  C  CG2 . ILE B 1 305 ? 15.047  97.200  84.629  1.00 18.18  ? 305 ILE B CG2 1 
ATOM   5697  C  CD1 . ILE B 1 305 ? 15.525  94.946  82.832  1.00 16.83  ? 305 ILE B CD1 1 
ATOM   5698  N  N   . ASP B 1 306 ? 17.064  100.337 85.195  1.00 24.66  ? 306 ASP B N   1 
ATOM   5699  C  CA  . ASP B 1 306 ? 17.202  101.194 86.368  1.00 24.49  ? 306 ASP B CA  1 
ATOM   5700  C  C   . ASP B 1 306 ? 15.847  101.372 87.042  1.00 22.79  ? 306 ASP B C   1 
ATOM   5701  O  O   . ASP B 1 306 ? 15.020  102.179 86.625  1.00 22.82  ? 306 ASP B O   1 
ATOM   5702  C  CB  . ASP B 1 306 ? 17.759  102.550 85.922  1.00 29.85  ? 306 ASP B CB  1 
ATOM   5703  C  CG  . ASP B 1 306 ? 18.048  103.500 87.075  1.00 33.51  ? 306 ASP B CG  1 
ATOM   5704  O  OD1 . ASP B 1 306 ? 17.708  103.223 88.246  1.00 41.95  ? 306 ASP B OD1 1 
ATOM   5705  O  OD2 . ASP B 1 306 ? 18.627  104.564 86.787  1.00 44.39  ? 306 ASP B OD2 1 
ATOM   5706  N  N   . TRP B 1 307 ? 15.608  100.606 88.085  1.00 22.70  ? 307 TRP B N   1 
ATOM   5707  C  CA  . TRP B 1 307 ? 14.348  100.722 88.778  1.00 22.48  ? 307 TRP B CA  1 
ATOM   5708  C  C   . TRP B 1 307 ? 14.463  101.622 89.975  1.00 24.07  ? 307 TRP B C   1 
ATOM   5709  O  O   . TRP B 1 307 ? 15.501  101.664 90.657  1.00 21.92  ? 307 TRP B O   1 
ATOM   5710  C  CB  . TRP B 1 307 ? 13.861  99.359  89.222  1.00 19.33  ? 307 TRP B CB  1 
ATOM   5711  C  CG  . TRP B 1 307 ? 13.108  98.679  88.167  1.00 21.06  ? 307 TRP B CG  1 
ATOM   5712  C  CD1 . TRP B 1 307 ? 12.297  99.262  87.237  1.00 20.83  ? 307 TRP B CD1 1 
ATOM   5713  C  CD2 . TRP B 1 307 ? 13.047  97.274  87.935  1.00 20.84  ? 307 TRP B CD2 1 
ATOM   5714  N  NE1 . TRP B 1 307 ? 11.727  98.303  86.447  1.00 20.13  ? 307 TRP B NE1 1 
ATOM   5715  C  CE2 . TRP B 1 307 ? 12.170  97.072  86.850  1.00 19.66  ? 307 TRP B CE2 1 
ATOM   5716  C  CE3 . TRP B 1 307 ? 13.649  96.162  88.541  1.00 25.95  ? 307 TRP B CE3 1 
ATOM   5717  C  CZ2 . TRP B 1 307 ? 11.875  95.803  86.351  1.00 22.11  ? 307 TRP B CZ2 1 
ATOM   5718  C  CZ3 . TRP B 1 307 ? 13.360  94.895  88.045  1.00 28.05  ? 307 TRP B CZ3 1 
ATOM   5719  C  CH2 . TRP B 1 307 ? 12.476  94.728  86.956  1.00 24.53  ? 307 TRP B CH2 1 
ATOM   5720  N  N   . ASP B 1 308 ? 13.373  102.319 90.247  1.00 22.42  ? 308 ASP B N   1 
ATOM   5721  C  CA  . ASP B 1 308 ? 13.325  103.206 91.383  1.00 23.15  ? 308 ASP B CA  1 
ATOM   5722  C  C   . ASP B 1 308 ? 13.543  102.422 92.682  1.00 23.21  ? 308 ASP B C   1 
ATOM   5723  O  O   . ASP B 1 308 ? 14.225  102.890 93.583  1.00 27.25  ? 308 ASP B O   1 
ATOM   5724  C  CB  . ASP B 1 308 ? 11.993  103.930 91.394  1.00 23.66  ? 308 ASP B CB  1 
ATOM   5725  C  CG  . ASP B 1 308 ? 11.874  104.931 90.274  1.00 25.30  ? 308 ASP B CG  1 
ATOM   5726  O  OD1 . ASP B 1 308 ? 12.887  105.214 89.593  1.00 26.15  ? 308 ASP B OD1 1 
ATOM   5727  O  OD2 . ASP B 1 308 ? 10.760  105.457 90.086  1.00 30.91  ? 308 ASP B OD2 1 
ATOM   5728  N  N   . ASN B 1 309 ? 13.000  101.215 92.762  1.00 22.54  ? 309 ASN B N   1 
ATOM   5729  C  CA  . ASN B 1 309 ? 13.177  100.403 93.954  1.00 21.82  ? 309 ASN B CA  1 
ATOM   5730  C  C   . ASN B 1 309 ? 14.568  99.771  94.060  1.00 29.18  ? 309 ASN B C   1 
ATOM   5731  O  O   . ASN B 1 309 ? 14.811  98.968  94.966  1.00 34.79  ? 309 ASN B O   1 
ATOM   5732  C  CB  . ASN B 1 309 ? 12.080  99.328  94.063  1.00 22.94  ? 309 ASN B CB  1 
ATOM   5733  C  CG  . ASN B 1 309 ? 12.087  98.340  92.911  1.00 29.14  ? 309 ASN B CG  1 
ATOM   5734  O  OD1 . ASN B 1 309 ? 13.121  98.068  92.306  1.00 31.01  ? 309 ASN B OD1 1 
ATOM   5735  N  ND2 . ASN B 1 309 ? 10.929  97.778  92.618  1.00 32.44  ? 309 ASN B ND2 1 
ATOM   5736  N  N   . ASN B 1 310 ? 15.463  100.110 93.127  1.00 31.47  ? 310 ASN B N   1 
ATOM   5737  C  CA  . ASN B 1 310 ? 16.848  99.592  93.091  1.00 31.10  ? 310 ASN B CA  1 
ATOM   5738  C  C   . ASN B 1 310 ? 17.028  98.071  92.959  1.00 30.42  ? 310 ASN B C   1 
ATOM   5739  O  O   . ASN B 1 310 ? 18.070  97.515  93.321  1.00 30.26  ? 310 ASN B O   1 
ATOM   5740  C  CB  . ASN B 1 310 ? 17.645  100.110 94.291  1.00 34.83  ? 310 ASN B CB  1 
ATOM   5741  C  CG  . ASN B 1 310 ? 17.736  101.615 94.310  1.00 40.93  ? 310 ASN B CG  1 
ATOM   5742  O  OD1 . ASN B 1 310 ? 18.339  102.223 93.421  1.00 48.62  ? 310 ASN B OD1 1 
ATOM   5743  N  ND2 . ASN B 1 310 ? 17.102  102.233 95.297  1.00 43.74  ? 310 ASN B ND2 1 
ATOM   5744  N  N   . LEU B 1 311 ? 16.032  97.403  92.394  1.00 24.79  ? 311 LEU B N   1 
ATOM   5745  C  CA  . LEU B 1 311 ? 16.087  95.966  92.217  1.00 23.23  ? 311 LEU B CA  1 
ATOM   5746  C  C   . LEU B 1 311 ? 16.448  95.545  90.786  1.00 23.56  ? 311 LEU B C   1 
ATOM   5747  O  O   . LEU B 1 311 ? 16.386  94.364  90.454  1.00 25.06  ? 311 LEU B O   1 
ATOM   5748  C  CB  . LEU B 1 311 ? 14.750  95.356  92.628  1.00 19.94  ? 311 LEU B CB  1 
ATOM   5749  C  CG  . LEU B 1 311 ? 14.285  95.670  94.053  1.00 20.39  ? 311 LEU B CG  1 
ATOM   5750  C  CD1 . LEU B 1 311 ? 12.952  94.989  94.314  1.00 13.92  ? 311 LEU B CD1 1 
ATOM   5751  C  CD2 . LEU B 1 311 ? 15.336  95.225  95.051  1.00 16.11  ? 311 LEU B CD2 1 
ATOM   5752  N  N   . GLY B 1 312 ? 16.887  96.496  89.967  1.00 24.91  ? 312 GLY B N   1 
ATOM   5753  C  CA  . GLY B 1 312 ? 17.239  96.206  88.582  1.00 22.18  ? 312 GLY B CA  1 
ATOM   5754  C  C   . GLY B 1 312 ? 18.579  95.524  88.335  1.00 23.69  ? 312 GLY B C   1 
ATOM   5755  O  O   . GLY B 1 312 ? 19.190  94.985  89.272  1.00 23.73  ? 312 GLY B O   1 
ATOM   5756  N  N   . THR B 1 313 ? 19.049  95.577  87.082  1.00 22.91  ? 313 THR B N   1 
ATOM   5757  C  CA  . THR B 1 313 ? 20.320  94.962  86.668  1.00 20.23  ? 313 THR B CA  1 
ATOM   5758  C  C   . THR B 1 313 ? 20.973  95.695  85.499  1.00 19.94  ? 313 THR B C   1 
ATOM   5759  O  O   . THR B 1 313 ? 20.290  96.322  84.696  1.00 22.39  ? 313 THR B O   1 
ATOM   5760  C  CB  . THR B 1 313 ? 20.108  93.531  86.172  1.00 21.02  ? 313 THR B CB  1 
ATOM   5761  O  OG1 . THR B 1 313 ? 19.064  93.539  85.194  1.00 22.93  ? 313 THR B OG1 1 
ATOM   5762  C  CG2 . THR B 1 313 ? 19.731  92.585  87.309  1.00 20.06  ? 313 THR B CG2 1 
ATOM   5763  N  N   . GLU B 1 314 ? 22.295  95.614  85.415  1.00 19.47  ? 314 GLU B N   1 
ATOM   5764  C  CA  . GLU B 1 314 ? 23.051  96.231  84.338  1.00 21.38  ? 314 GLU B CA  1 
ATOM   5765  C  C   . GLU B 1 314 ? 23.724  95.042  83.692  1.00 22.97  ? 314 GLU B C   1 
ATOM   5766  O  O   . GLU B 1 314 ? 24.525  94.357  84.335  1.00 25.62  ? 314 GLU B O   1 
ATOM   5767  C  CB  . GLU B 1 314 ? 24.099  97.182  84.874  1.00 24.08  ? 314 GLU B CB  1 
ATOM   5768  C  CG  . GLU B 1 314 ? 24.901  97.797  83.769  1.00 35.49  ? 314 GLU B CG  1 
ATOM   5769  C  CD  . GLU B 1 314 ? 25.985  98.711  84.273  1.00 41.26  ? 314 GLU B CD  1 
ATOM   5770  O  OE1 . GLU B 1 314 ? 27.115  98.220  84.509  1.00 48.79  ? 314 GLU B OE1 1 
ATOM   5771  O  OE2 . GLU B 1 314 ? 25.712  99.922  84.420  1.00 45.56  ? 314 GLU B OE2 1 
ATOM   5772  N  N   . TRP B 1 315 ? 23.441  94.826  82.414  1.00 22.30  ? 315 TRP B N   1 
ATOM   5773  C  CA  . TRP B 1 315 ? 23.933  93.650  81.703  1.00 20.17  ? 315 TRP B CA  1 
ATOM   5774  C  C   . TRP B 1 315 ? 24.716  93.945  80.425  1.00 20.07  ? 315 TRP B C   1 
ATOM   5775  O  O   . TRP B 1 315 ? 24.335  94.799  79.610  1.00 21.30  ? 315 TRP B O   1 
ATOM   5776  C  CB  . TRP B 1 315 ? 22.711  92.762  81.425  1.00 19.59  ? 315 TRP B CB  1 
ATOM   5777  C  CG  . TRP B 1 315 ? 22.924  91.506  80.658  1.00 18.77  ? 315 TRP B CG  1 
ATOM   5778  C  CD1 . TRP B 1 315 ? 24.029  90.705  80.664  1.00 18.78  ? 315 TRP B CD1 1 
ATOM   5779  C  CD2 . TRP B 1 315 ? 21.977  90.876  79.789  1.00 16.71  ? 315 TRP B CD2 1 
ATOM   5780  N  NE1 . TRP B 1 315 ? 23.830  89.608  79.852  1.00 18.92  ? 315 TRP B NE1 1 
ATOM   5781  C  CE2 . TRP B 1 315 ? 22.579  89.689  79.302  1.00 19.55  ? 315 TRP B CE2 1 
ATOM   5782  C  CE3 . TRP B 1 315 ? 20.676  91.198  79.375  1.00 15.81  ? 315 TRP B CE3 1 
ATOM   5783  C  CZ2 . TRP B 1 315 ? 21.921  88.821  78.416  1.00 19.17  ? 315 TRP B CZ2 1 
ATOM   5784  C  CZ3 . TRP B 1 315 ? 20.019  90.336  78.496  1.00 15.13  ? 315 TRP B CZ3 1 
ATOM   5785  C  CH2 . TRP B 1 315 ? 20.647  89.159  78.024  1.00 16.62  ? 315 TRP B CH2 1 
ATOM   5786  N  N   . TRP B 1 316 ? 25.847  93.260  80.307  1.00 19.53  ? 316 TRP B N   1 
ATOM   5787  C  CA  . TRP B 1 316 ? 26.757  93.360  79.165  1.00 21.43  ? 316 TRP B CA  1 
ATOM   5788  C  C   . TRP B 1 316 ? 26.883  91.976  78.583  1.00 22.09  ? 316 TRP B C   1 
ATOM   5789  O  O   . TRP B 1 316 ? 27.190  91.018  79.311  1.00 20.34  ? 316 TRP B O   1 
ATOM   5790  C  CB  . TRP B 1 316 ? 28.171  93.732  79.604  1.00 26.54  ? 316 TRP B CB  1 
ATOM   5791  C  CG  . TRP B 1 316 ? 28.312  95.077  80.162  1.00 38.02  ? 316 TRP B CG  1 
ATOM   5792  C  CD1 . TRP B 1 316 ? 28.217  95.440  81.479  1.00 41.71  ? 316 TRP B CD1 1 
ATOM   5793  C  CD2 . TRP B 1 316 ? 28.602  96.267  79.434  1.00 43.49  ? 316 TRP B CD2 1 
ATOM   5794  N  NE1 . TRP B 1 316 ? 28.433  96.790  81.611  1.00 45.33  ? 316 TRP B NE1 1 
ATOM   5795  C  CE2 . TRP B 1 316 ? 28.674  97.323  80.372  1.00 44.72  ? 316 TRP B CE2 1 
ATOM   5796  C  CE3 . TRP B 1 316 ? 28.812  96.548  78.077  1.00 47.05  ? 316 TRP B CE3 1 
ATOM   5797  C  CZ2 . TRP B 1 316 ? 28.948  98.640  79.996  1.00 48.12  ? 316 TRP B CZ2 1 
ATOM   5798  C  CZ3 . TRP B 1 316 ? 29.084  97.860  77.700  1.00 49.17  ? 316 TRP B CZ3 1 
ATOM   5799  C  CH2 . TRP B 1 316 ? 29.150  98.890  78.660  1.00 50.18  ? 316 TRP B CH2 1 
ATOM   5800  N  N   . THR B 1 317 ? 26.702  91.857  77.276  1.00 21.64  ? 317 THR B N   1 
ATOM   5801  C  CA  . THR B 1 317 ? 26.848  90.549  76.644  1.00 20.97  ? 317 THR B CA  1 
ATOM   5802  C  C   . THR B 1 317 ? 27.521  90.723  75.284  1.00 20.97  ? 317 THR B C   1 
ATOM   5803  O  O   . THR B 1 317 ? 27.270  91.701  74.573  1.00 23.38  ? 317 THR B O   1 
ATOM   5804  C  CB  . THR B 1 317 ? 25.491  89.817  76.562  1.00 17.96  ? 317 THR B CB  1 
ATOM   5805  O  OG1 . THR B 1 317 ? 25.704  88.434  76.246  1.00 23.93  ? 317 THR B OG1 1 
ATOM   5806  C  CG2 . THR B 1 317 ? 24.586  90.473  75.549  1.00 16.11  ? 317 THR B CG2 1 
ATOM   5807  N  N   . VAL B 1 318 ? 28.478  89.855  74.994  1.00 19.66  ? 318 VAL B N   1 
ATOM   5808  C  CA  . VAL B 1 318 ? 29.214  89.922  73.740  1.00 20.42  ? 318 VAL B CA  1 
ATOM   5809  C  C   . VAL B 1 318 ? 29.499  88.502  73.312  1.00 20.61  ? 318 VAL B C   1 
ATOM   5810  O  O   . VAL B 1 318 ? 29.882  87.665  74.123  1.00 19.88  ? 318 VAL B O   1 
ATOM   5811  C  CB  . VAL B 1 318 ? 30.596  90.602  73.888  1.00 23.21  ? 318 VAL B CB  1 
ATOM   5812  C  CG1 . VAL B 1 318 ? 31.026  91.195  72.559  1.00 26.20  ? 318 VAL B CG1 1 
ATOM   5813  C  CG2 . VAL B 1 318 ? 30.577  91.647  74.955  1.00 32.05  ? 318 VAL B CG2 1 
ATOM   5814  N  N   . GLY B 1 319 ? 29.336  88.231  72.033  1.00 19.02  ? 319 GLY B N   1 
ATOM   5815  C  CA  . GLY B 1 319 ? 29.594  86.897  71.555  1.00 18.49  ? 319 GLY B CA  1 
ATOM   5816  C  C   . GLY B 1 319 ? 29.881  86.923  70.082  1.00 17.87  ? 319 GLY B C   1 
ATOM   5817  O  O   . GLY B 1 319 ? 29.467  87.840  69.352  1.00 16.74  ? 319 GLY B O   1 
ATOM   5818  N  N   . VAL B 1 320 ? 30.528  85.868  69.626  1.00 17.98  ? 320 VAL B N   1 
ATOM   5819  C  CA  . VAL B 1 320 ? 30.888  85.764  68.232  1.00 18.03  ? 320 VAL B CA  1 
ATOM   5820  C  C   . VAL B 1 320 ? 30.740  84.296  67.816  1.00 17.48  ? 320 VAL B C   1 
ATOM   5821  O  O   . VAL B 1 320 ? 31.008  83.380  68.606  1.00 13.60  ? 320 VAL B O   1 
ATOM   5822  C  CB  . VAL B 1 320 ? 32.315  86.301  68.070  1.00 18.21  ? 320 VAL B CB  1 
ATOM   5823  C  CG1 . VAL B 1 320 ? 33.319  85.190  68.046  1.00 19.67  ? 320 VAL B CG1 1 
ATOM   5824  C  CG2 . VAL B 1 320 ? 32.411  87.202  66.896  1.00 24.27  ? 320 VAL B CG2 1 
ATOM   5825  N  N   . ARG B 1 321 ? 30.264  84.075  66.596  1.00 19.30  ? 321 ARG B N   1 
ATOM   5826  C  CA  . ARG B 1 321 ? 30.066  82.719  66.083  1.00 18.66  ? 321 ARG B CA  1 
ATOM   5827  C  C   . ARG B 1 321 ? 30.538  82.595  64.634  1.00 20.38  ? 321 ARG B C   1 
ATOM   5828  O  O   . ARG B 1 321 ? 29.797  82.927  63.695  1.00 20.30  ? 321 ARG B O   1 
ATOM   5829  C  CB  . ARG B 1 321 ? 28.587  82.325  66.201  1.00 17.85  ? 321 ARG B CB  1 
ATOM   5830  C  CG  . ARG B 1 321 ? 28.201  80.974  65.604  1.00 13.76  ? 321 ARG B CG  1 
ATOM   5831  C  CD  . ARG B 1 321 ? 27.112  80.380  66.451  1.00 17.72  ? 321 ARG B CD  1 
ATOM   5832  N  NE  . ARG B 1 321 ? 25.848  80.185  65.772  1.00 16.76  ? 321 ARG B NE  1 
ATOM   5833  C  CZ  . ARG B 1 321 ? 24.704  79.936  66.402  1.00 19.93  ? 321 ARG B CZ  1 
ATOM   5834  N  NH1 . ARG B 1 321 ? 24.658  79.868  67.721  1.00 13.29  ? 321 ARG B NH1 1 
ATOM   5835  N  NH2 . ARG B 1 321 ? 23.615  79.674  65.712  1.00 26.52  ? 321 ARG B NH2 1 
ATOM   5836  N  N   . PRO B 1 322 ? 31.827  82.271  64.442  1.00 19.55  ? 322 PRO B N   1 
ATOM   5837  C  CA  . PRO B 1 322 ? 32.359  82.119  63.088  1.00 18.75  ? 322 PRO B CA  1 
ATOM   5838  C  C   . PRO B 1 322 ? 32.063  80.708  62.554  1.00 19.08  ? 322 PRO B C   1 
ATOM   5839  O  O   . PRO B 1 322 ? 32.015  79.744  63.325  1.00 19.07  ? 322 PRO B O   1 
ATOM   5840  C  CB  . PRO B 1 322 ? 33.859  82.343  63.293  1.00 17.76  ? 322 PRO B CB  1 
ATOM   5841  C  CG  . PRO B 1 322 ? 34.098  81.788  64.659  1.00 18.68  ? 322 PRO B CG  1 
ATOM   5842  C  CD  . PRO B 1 322 ? 32.917  82.310  65.437  1.00 18.29  ? 322 PRO B CD  1 
ATOM   5843  N  N   . MET B 1 323 ? 31.868  80.594  61.242  1.00 19.48  ? 323 MET B N   1 
ATOM   5844  C  CA  . MET B 1 323 ? 31.596  79.307  60.594  1.00 18.93  ? 323 MET B CA  1 
ATOM   5845  C  C   . MET B 1 323 ? 32.616  79.092  59.478  1.00 19.57  ? 323 MET B C   1 
ATOM   5846  O  O   . MET B 1 323 ? 32.804  79.965  58.618  1.00 19.05  ? 323 MET B O   1 
ATOM   5847  C  CB  . MET B 1 323 ? 30.178  79.290  60.000  1.00 18.90  ? 323 MET B CB  1 
ATOM   5848  C  CG  . MET B 1 323 ? 29.798  78.020  59.240  1.00 18.39  ? 323 MET B CG  1 
ATOM   5849  S  SD  . MET B 1 323 ? 28.272  78.234  58.332  1.00 24.96  ? 323 MET B SD  1 
ATOM   5850  C  CE  . MET B 1 323 ? 28.043  76.656  57.602  1.00 23.86  ? 323 MET B CE  1 
ATOM   5851  N  N   . TYR B 1 324 ? 33.305  77.959  59.525  1.00 18.13  ? 324 TYR B N   1 
ATOM   5852  C  CA  . TYR B 1 324 ? 34.272  77.634  58.502  1.00 17.74  ? 324 TYR B CA  1 
ATOM   5853  C  C   . TYR B 1 324 ? 33.682  76.535  57.641  1.00 20.36  ? 324 TYR B C   1 
ATOM   5854  O  O   . TYR B 1 324 ? 33.392  75.440  58.132  1.00 18.55  ? 324 TYR B O   1 
ATOM   5855  C  CB  . TYR B 1 324 ? 35.571  77.141  59.101  1.00 19.70  ? 324 TYR B CB  1 
ATOM   5856  C  CG  . TYR B 1 324 ? 36.562  76.809  58.028  1.00 24.99  ? 324 TYR B CG  1 
ATOM   5857  C  CD1 . TYR B 1 324 ? 37.253  77.820  57.363  1.00 26.52  ? 324 TYR B CD1 1 
ATOM   5858  C  CD2 . TYR B 1 324 ? 36.764  75.492  57.627  1.00 27.51  ? 324 TYR B CD2 1 
ATOM   5859  C  CE1 . TYR B 1 324 ? 38.115  77.536  56.324  1.00 31.18  ? 324 TYR B CE1 1 
ATOM   5860  C  CE2 . TYR B 1 324 ? 37.627  75.196  56.584  1.00 32.28  ? 324 TYR B CE2 1 
ATOM   5861  C  CZ  . TYR B 1 324 ? 38.300  76.222  55.936  1.00 33.72  ? 324 TYR B CZ  1 
ATOM   5862  O  OH  . TYR B 1 324 ? 39.155  75.927  54.895  1.00 41.36  ? 324 TYR B OH  1 
ATOM   5863  N  N   . LYS B 1 325 ? 33.609  76.795  56.340  1.00 19.10  ? 325 LYS B N   1 
ATOM   5864  C  CA  . LYS B 1 325 ? 33.017  75.856  55.406  1.00 17.73  ? 325 LYS B CA  1 
ATOM   5865  C  C   . LYS B 1 325 ? 33.994  74.886  54.769  1.00 17.55  ? 325 LYS B C   1 
ATOM   5866  O  O   . LYS B 1 325 ? 34.686  75.226  53.833  1.00 22.95  ? 325 LYS B O   1 
ATOM   5867  C  CB  . LYS B 1 325 ? 32.253  76.636  54.336  1.00 13.28  ? 325 LYS B CB  1 
ATOM   5868  C  CG  . LYS B 1 325 ? 31.371  77.726  54.918  1.00 13.01  ? 325 LYS B CG  1 
ATOM   5869  C  CD  . LYS B 1 325 ? 30.847  78.645  53.848  1.00 13.19  ? 325 LYS B CD  1 
ATOM   5870  C  CE  . LYS B 1 325 ? 30.193  79.866  54.450  1.00 15.11  ? 325 LYS B CE  1 
ATOM   5871  N  NZ  . LYS B 1 325 ? 29.517  80.708  53.434  1.00 19.89  ? 325 LYS B NZ  1 
ATOM   5872  N  N   . TRP B 1 326 ? 34.068  73.678  55.298  1.00 20.61  ? 326 TRP B N   1 
ATOM   5873  C  CA  . TRP B 1 326 ? 34.947  72.667  54.725  1.00 22.70  ? 326 TRP B CA  1 
ATOM   5874  C  C   . TRP B 1 326 ? 34.460  72.328  53.325  1.00 27.38  ? 326 TRP B C   1 
ATOM   5875  O  O   . TRP B 1 326 ? 35.252  72.255  52.385  1.00 32.59  ? 326 TRP B O   1 
ATOM   5876  C  CB  . TRP B 1 326 ? 34.913  71.409  55.566  1.00 21.82  ? 326 TRP B CB  1 
ATOM   5877  C  CG  . TRP B 1 326 ? 35.499  71.637  56.869  1.00 29.61  ? 326 TRP B CG  1 
ATOM   5878  C  CD1 . TRP B 1 326 ? 34.842  71.837  58.039  1.00 28.83  ? 326 TRP B CD1 1 
ATOM   5879  C  CD2 . TRP B 1 326 ? 36.883  71.752  57.155  1.00 33.87  ? 326 TRP B CD2 1 
ATOM   5880  N  NE1 . TRP B 1 326 ? 35.736  72.077  59.044  1.00 31.52  ? 326 TRP B NE1 1 
ATOM   5881  C  CE2 . TRP B 1 326 ? 37.001  72.028  58.531  1.00 34.66  ? 326 TRP B CE2 1 
ATOM   5882  C  CE3 . TRP B 1 326 ? 38.044  71.652  56.378  1.00 35.00  ? 326 TRP B CE3 1 
ATOM   5883  C  CZ2 . TRP B 1 326 ? 38.238  72.205  59.159  1.00 38.19  ? 326 TRP B CZ2 1 
ATOM   5884  C  CZ3 . TRP B 1 326 ? 39.281  71.828  57.000  1.00 36.47  ? 326 TRP B CZ3 1 
ATOM   5885  C  CH2 . TRP B 1 326 ? 39.366  72.101  58.380  1.00 38.87  ? 326 TRP B CH2 1 
ATOM   5886  N  N   . THR B 1 327 ? 33.162  72.045  53.219  1.00 26.24  ? 327 THR B N   1 
ATOM   5887  C  CA  . THR B 1 327 ? 32.512  71.728  51.955  1.00 23.27  ? 327 THR B CA  1 
ATOM   5888  C  C   . THR B 1 327 ? 31.186  72.481  51.994  1.00 25.10  ? 327 THR B C   1 
ATOM   5889  O  O   . THR B 1 327 ? 30.838  73.095  53.003  1.00 31.32  ? 327 THR B O   1 
ATOM   5890  C  CB  . THR B 1 327 ? 32.235  70.211  51.789  1.00 22.54  ? 327 THR B CB  1 
ATOM   5891  O  OG1 . THR B 1 327 ? 31.100  69.826  52.576  1.00 26.69  ? 327 THR B OG1 1 
ATOM   5892  C  CG2 . THR B 1 327 ? 33.431  69.397  52.187  1.00 19.65  ? 327 THR B CG2 1 
ATOM   5893  N  N   . PRO B 1 328 ? 30.410  72.429  50.912  1.00 27.01  ? 328 PRO B N   1 
ATOM   5894  C  CA  . PRO B 1 328 ? 29.134  73.147  50.924  1.00 27.25  ? 328 PRO B CA  1 
ATOM   5895  C  C   . PRO B 1 328 ? 28.135  72.683  51.979  1.00 27.38  ? 328 PRO B C   1 
ATOM   5896  O  O   . PRO B 1 328 ? 27.284  73.466  52.400  1.00 30.11  ? 328 PRO B O   1 
ATOM   5897  C  CB  . PRO B 1 328 ? 28.603  72.900  49.517  1.00 29.11  ? 328 PRO B CB  1 
ATOM   5898  C  CG  . PRO B 1 328 ? 29.855  72.777  48.710  1.00 29.28  ? 328 PRO B CG  1 
ATOM   5899  C  CD  . PRO B 1 328 ? 30.689  71.887  49.573  1.00 25.71  ? 328 PRO B CD  1 
ATOM   5900  N  N   . ILE B 1 329 ? 28.229  71.425  52.403  1.00 24.34  ? 329 ILE B N   1 
ATOM   5901  C  CA  . ILE B 1 329 ? 27.294  70.912  53.397  1.00 22.88  ? 329 ILE B CA  1 
ATOM   5902  C  C   . ILE B 1 329 ? 27.925  70.587  54.744  1.00 20.76  ? 329 ILE B C   1 
ATOM   5903  O  O   . ILE B 1 329 ? 27.245  70.125  55.653  1.00 25.55  ? 329 ILE B O   1 
ATOM   5904  C  CB  . ILE B 1 329 ? 26.565  69.653  52.889  1.00 21.48  ? 329 ILE B CB  1 
ATOM   5905  C  CG1 . ILE B 1 329 ? 27.577  68.539  52.646  1.00 20.41  ? 329 ILE B CG1 1 
ATOM   5906  C  CG2 . ILE B 1 329 ? 25.782  69.980  51.627  1.00 17.40  ? 329 ILE B CG2 1 
ATOM   5907  C  CD1 . ILE B 1 329 ? 26.964  67.213  52.347  1.00 27.69  ? 329 ILE B CD1 1 
ATOM   5908  N  N   . MET B 1 330 ? 29.226  70.781  54.876  1.00 17.12  ? 330 MET B N   1 
ATOM   5909  C  CA  . MET B 1 330 ? 29.861  70.465  56.142  1.00 17.75  ? 330 MET B CA  1 
ATOM   5910  C  C   . MET B 1 330 ? 30.705  71.622  56.617  1.00 18.32  ? 330 MET B C   1 
ATOM   5911  O  O   . MET B 1 330 ? 31.413  72.249  55.838  1.00 19.44  ? 330 MET B O   1 
ATOM   5912  C  CB  . MET B 1 330 ? 30.690  69.190  56.051  1.00 15.68  ? 330 MET B CB  1 
ATOM   5913  C  CG  . MET B 1 330 ? 31.381  68.836  57.339  1.00 20.37  ? 330 MET B CG  1 
ATOM   5914  S  SD  . MET B 1 330 ? 32.616  67.583  57.063  1.00 29.19  ? 330 MET B SD  1 
ATOM   5915  C  CE  . MET B 1 330 ? 32.398  66.595  58.398  1.00 27.63  ? 330 MET B CE  1 
ATOM   5916  N  N   . SER B 1 331 ? 30.621  71.901  57.908  1.00 18.24  ? 331 SER B N   1 
ATOM   5917  C  CA  . SER B 1 331 ? 31.347  73.010  58.473  1.00 16.65  ? 331 SER B CA  1 
ATOM   5918  C  C   . SER B 1 331 ? 31.671  72.811  59.940  1.00 17.59  ? 331 SER B C   1 
ATOM   5919  O  O   . SER B 1 331 ? 31.218  71.854  60.577  1.00 20.20  ? 331 SER B O   1 
ATOM   5920  C  CB  . SER B 1 331 ? 30.526  74.285  58.300  1.00 16.20  ? 331 SER B CB  1 
ATOM   5921  O  OG  . SER B 1 331 ? 29.251  74.169  58.906  1.00 17.50  ? 331 SER B OG  1 
ATOM   5922  N  N   . THR B 1 332 ? 32.528  73.683  60.444  1.00 17.99  ? 332 THR B N   1 
ATOM   5923  C  CA  . THR B 1 332 ? 32.913  73.669  61.834  1.00 19.41  ? 332 THR B CA  1 
ATOM   5924  C  C   . THR B 1 332 ? 32.486  75.014  62.371  1.00 20.19  ? 332 THR B C   1 
ATOM   5925  O  O   . THR B 1 332 ? 32.738  76.043  61.733  1.00 19.76  ? 332 THR B O   1 
ATOM   5926  C  CB  . THR B 1 332 ? 34.431  73.520  62.003  1.00 18.47  ? 332 THR B CB  1 
ATOM   5927  O  OG1 . THR B 1 332 ? 34.817  72.208  61.590  1.00 20.72  ? 332 THR B OG1 1 
ATOM   5928  C  CG2 . THR B 1 332 ? 34.833  73.702  63.461  1.00 16.52  ? 332 THR B CG2 1 
ATOM   5929  N  N   . LEU B 1 333 ? 31.767  74.997  63.489  1.00 21.56  ? 333 LEU B N   1 
ATOM   5930  C  CA  . LEU B 1 333 ? 31.318  76.228  64.136  1.00 21.44  ? 333 LEU B CA  1 
ATOM   5931  C  C   . LEU B 1 333 ? 31.963  76.394  65.500  1.00 20.95  ? 333 LEU B C   1 
ATOM   5932  O  O   . LEU B 1 333 ? 32.262  75.416  66.192  1.00 20.57  ? 333 LEU B O   1 
ATOM   5933  C  CB  . LEU B 1 333 ? 29.800  76.254  64.312  1.00 18.06  ? 333 LEU B CB  1 
ATOM   5934  C  CG  . LEU B 1 333 ? 28.976  76.437  63.049  1.00 17.52  ? 333 LEU B CG  1 
ATOM   5935  C  CD1 . LEU B 1 333 ? 28.425  75.100  62.635  1.00 23.66  ? 333 LEU B CD1 1 
ATOM   5936  C  CD2 . LEU B 1 333 ? 27.859  77.398  63.321  1.00 21.78  ? 333 LEU B CD2 1 
ATOM   5937  N  N   . LEU B 1 334 ? 32.204  77.641  65.862  1.00 20.77  ? 334 LEU B N   1 
ATOM   5938  C  CA  . LEU B 1 334 ? 32.768  77.966  67.149  1.00 22.81  ? 334 LEU B CA  1 
ATOM   5939  C  C   . LEU B 1 334 ? 31.914  79.103  67.674  1.00 23.23  ? 334 LEU B C   1 
ATOM   5940  O  O   . LEU B 1 334 ? 31.541  80.018  66.922  1.00 24.33  ? 334 LEU B O   1 
ATOM   5941  C  CB  . LEU B 1 334 ? 34.210  78.445  67.011  1.00 24.36  ? 334 LEU B CB  1 
ATOM   5942  C  CG  . LEU B 1 334 ? 34.769  78.997  68.323  1.00 26.18  ? 334 LEU B CG  1 
ATOM   5943  C  CD1 . LEU B 1 334 ? 35.206  77.864  69.223  1.00 24.66  ? 334 LEU B CD1 1 
ATOM   5944  C  CD2 . LEU B 1 334 ? 35.924  79.931  68.041  1.00 28.28  ? 334 LEU B CD2 1 
ATOM   5945  N  N   . GLU B 1 335 ? 31.550  79.024  68.944  1.00 20.83  ? 335 GLU B N   1 
ATOM   5946  C  CA  . GLU B 1 335 ? 30.771  80.085  69.535  1.00 18.94  ? 335 GLU B CA  1 
ATOM   5947  C  C   . GLU B 1 335 ? 31.382  80.438  70.867  1.00 19.31  ? 335 GLU B C   1 
ATOM   5948  O  O   . GLU B 1 335 ? 31.643  79.564  71.696  1.00 18.86  ? 335 GLU B O   1 
ATOM   5949  C  CB  . GLU B 1 335 ? 29.322  79.674  69.727  1.00 18.11  ? 335 GLU B CB  1 
ATOM   5950  C  CG  . GLU B 1 335 ? 28.498  80.787  70.323  1.00 17.45  ? 335 GLU B CG  1 
ATOM   5951  C  CD  . GLU B 1 335 ? 27.026  80.487  70.316  1.00 19.62  ? 335 GLU B CD  1 
ATOM   5952  O  OE1 . GLU B 1 335 ? 26.578  79.723  71.190  1.00 23.04  ? 335 GLU B OE1 1 
ATOM   5953  O  OE2 . GLU B 1 335 ? 26.315  81.018  69.439  1.00 19.90  ? 335 GLU B OE2 1 
ATOM   5954  N  N   . VAL B 1 336 ? 31.670  81.718  71.040  1.00 18.16  ? 336 VAL B N   1 
ATOM   5955  C  CA  . VAL B 1 336 ? 32.237  82.222  72.274  1.00 17.21  ? 336 VAL B CA  1 
ATOM   5956  C  C   . VAL B 1 336 ? 31.357  83.374  72.733  1.00 17.85  ? 336 VAL B C   1 
ATOM   5957  O  O   . VAL B 1 336 ? 31.130  84.336  71.986  1.00 17.46  ? 336 VAL B O   1 
ATOM   5958  C  CB  . VAL B 1 336 ? 33.663  82.740  72.068  1.00 19.63  ? 336 VAL B CB  1 
ATOM   5959  C  CG1 . VAL B 1 336 ? 34.223  83.221  73.388  1.00 21.61  ? 336 VAL B CG1 1 
ATOM   5960  C  CG2 . VAL B 1 336 ? 34.541  81.644  71.501  1.00 20.53  ? 336 VAL B CG2 1 
ATOM   5961  N  N   . GLY B 1 337 ? 30.838  83.262  73.950  1.00 17.58  ? 337 GLY B N   1 
ATOM   5962  C  CA  . GLY B 1 337 ? 29.986  84.305  74.475  1.00 17.50  ? 337 GLY B CA  1 
ATOM   5963  C  C   . GLY B 1 337 ? 30.337  84.656  75.904  1.00 22.03  ? 337 GLY B C   1 
ATOM   5964  O  O   . GLY B 1 337 ? 30.703  83.785  76.707  1.00 18.93  ? 337 GLY B O   1 
ATOM   5965  N  N   . TYR B 1 338 ? 30.175  85.934  76.228  1.00 21.64  ? 338 TYR B N   1 
ATOM   5966  C  CA  . TYR B 1 338 ? 30.467  86.444  77.551  1.00 21.47  ? 338 TYR B CA  1 
ATOM   5967  C  C   . TYR B 1 338 ? 29.318  87.284  78.088  1.00 21.48  ? 338 TYR B C   1 
ATOM   5968  O  O   . TYR B 1 338 ? 28.786  88.152  77.383  1.00 20.53  ? 338 TYR B O   1 
ATOM   5969  C  CB  . TYR B 1 338 ? 31.737  87.295  77.501  1.00 24.28  ? 338 TYR B CB  1 
ATOM   5970  C  CG  . TYR B 1 338 ? 32.056  88.000  78.803  1.00 31.41  ? 338 TYR B CG  1 
ATOM   5971  C  CD1 . TYR B 1 338 ? 32.635  87.310  79.871  1.00 31.86  ? 338 TYR B CD1 1 
ATOM   5972  C  CD2 . TYR B 1 338 ? 31.782  89.357  78.966  1.00 34.11  ? 338 TYR B CD2 1 
ATOM   5973  C  CE1 . TYR B 1 338 ? 32.936  87.950  81.061  1.00 32.69  ? 338 TYR B CE1 1 
ATOM   5974  C  CE2 . TYR B 1 338 ? 32.078  90.010  80.159  1.00 37.72  ? 338 TYR B CE2 1 
ATOM   5975  C  CZ  . TYR B 1 338 ? 32.658  89.297  81.201  1.00 37.92  ? 338 TYR B CZ  1 
ATOM   5976  O  OH  . TYR B 1 338 ? 32.962  89.931  82.387  1.00 44.26  ? 338 TYR B OH  1 
ATOM   5977  N  N   . ASP B 1 339 ? 28.949  87.023  79.339  1.00 20.77  ? 339 ASP B N   1 
ATOM   5978  C  CA  . ASP B 1 339 ? 27.890  87.755  80.022  1.00 20.31  ? 339 ASP B CA  1 
ATOM   5979  C  C   . ASP B 1 339 ? 28.405  88.321  81.322  1.00 19.90  ? 339 ASP B C   1 
ATOM   5980  O  O   . ASP B 1 339 ? 29.110  87.636  82.061  1.00 19.39  ? 339 ASP B O   1 
ATOM   5981  C  CB  . ASP B 1 339 ? 26.735  86.835  80.385  1.00 19.91  ? 339 ASP B CB  1 
ATOM   5982  C  CG  . ASP B 1 339 ? 25.944  86.412  79.201  1.00 19.91  ? 339 ASP B CG  1 
ATOM   5983  O  OD1 . ASP B 1 339 ? 25.224  87.261  78.632  1.00 18.15  ? 339 ASP B OD1 1 
ATOM   5984  O  OD2 . ASP B 1 339 ? 26.031  85.224  78.860  1.00 18.43  ? 339 ASP B OD2 1 
ATOM   5985  N  N   . ASN B 1 340 ? 28.020  89.553  81.620  1.00 21.14  ? 340 ASN B N   1 
ATOM   5986  C  CA  . ASN B 1 340 ? 28.397  90.199  82.866  1.00 19.21  ? 340 ASN B CA  1 
ATOM   5987  C  C   . ASN B 1 340 ? 27.177  90.961  83.356  1.00 21.20  ? 340 ASN B C   1 
ATOM   5988  O  O   . ASN B 1 340 ? 26.698  91.865  82.671  1.00 23.44  ? 340 ASN B O   1 
ATOM   5989  C  CB  . ASN B 1 340 ? 29.554  91.155  82.654  1.00 21.43  ? 340 ASN B CB  1 
ATOM   5990  C  CG  . ASN B 1 340 ? 30.072  91.705  83.961  1.00 26.11  ? 340 ASN B CG  1 
ATOM   5991  O  OD1 . ASN B 1 340 ? 29.475  92.608  84.547  1.00 25.35  ? 340 ASN B OD1 1 
ATOM   5992  N  ND2 . ASN B 1 340 ? 31.164  91.135  84.448  1.00 23.17  ? 340 ASN B ND2 1 
ATOM   5993  N  N   . VAL B 1 341 ? 26.641  90.566  84.510  1.00 21.93  ? 341 VAL B N   1 
ATOM   5994  C  CA  . VAL B 1 341 ? 25.440  91.205  85.075  1.00 22.04  ? 341 VAL B CA  1 
ATOM   5995  C  C   . VAL B 1 341 ? 25.683  91.771  86.471  1.00 25.59  ? 341 VAL B C   1 
ATOM   5996  O  O   . VAL B 1 341 ? 26.053  91.039  87.403  1.00 24.58  ? 341 VAL B O   1 
ATOM   5997  C  CB  . VAL B 1 341 ? 24.268  90.207  85.227  1.00 18.59  ? 341 VAL B CB  1 
ATOM   5998  C  CG1 . VAL B 1 341 ? 22.950  90.952  85.274  1.00 17.33  ? 341 VAL B CG1 1 
ATOM   5999  C  CG2 . VAL B 1 341 ? 24.287  89.177  84.123  1.00 17.64  ? 341 VAL B CG2 1 
ATOM   6000  N  N   . LYS B 1 342 ? 25.392  93.055  86.631  1.00 25.96  ? 342 LYS B N   1 
ATOM   6001  C  CA  . LYS B 1 342 ? 25.569  93.723  87.907  1.00 26.96  ? 342 LYS B CA  1 
ATOM   6002  C  C   . LYS B 1 342 ? 24.222  93.935  88.571  1.00 25.67  ? 342 LYS B C   1 
ATOM   6003  O  O   . LYS B 1 342 ? 23.323  94.517  87.957  1.00 26.25  ? 342 LYS B O   1 
ATOM   6004  C  CB  . LYS B 1 342 ? 26.249  95.079  87.699  1.00 28.52  ? 342 LYS B CB  1 
ATOM   6005  C  CG  . LYS B 1 342 ? 26.785  95.705  88.974  1.00 32.42  ? 342 LYS B CG  1 
ATOM   6006  C  CD  . LYS B 1 342 ? 25.960  96.896  89.408  1.00 43.40  ? 342 LYS B CD  1 
ATOM   6007  C  CE  . LYS B 1 342 ? 26.211  98.107  88.526  1.00 48.63  ? 342 LYS B CE  1 
ATOM   6008  N  NZ  . LYS B 1 342 ? 25.322  99.256  88.879  1.00 55.25  ? 342 LYS B NZ  1 
ATOM   6009  N  N   . SER B 1 343 ? 24.074  93.450  89.806  1.00 25.07  ? 343 SER B N   1 
ATOM   6010  C  CA  . SER B 1 343 ? 22.831  93.630  90.551  1.00 23.56  ? 343 SER B CA  1 
ATOM   6011  C  C   . SER B 1 343 ? 22.744  95.094  90.941  1.00 23.01  ? 343 SER B C   1 
ATOM   6012  O  O   . SER B 1 343 ? 23.690  95.635  91.516  1.00 23.12  ? 343 SER B O   1 
ATOM   6013  C  CB  . SER B 1 343 ? 22.845  92.773  91.810  1.00 22.95  ? 343 SER B CB  1 
ATOM   6014  O  OG  . SER B 1 343 ? 21.737  93.084  92.636  1.00 23.36  ? 343 SER B OG  1 
ATOM   6015  N  N   . GLN B 1 344 ? 21.643  95.755  90.607  1.00 24.00  ? 344 GLN B N   1 
ATOM   6016  C  CA  . GLN B 1 344 ? 21.514  97.169  90.962  1.00 25.16  ? 344 GLN B CA  1 
ATOM   6017  C  C   . GLN B 1 344 ? 21.429  97.261  92.478  1.00 28.49  ? 344 GLN B C   1 
ATOM   6018  O  O   . GLN B 1 344 ? 22.010  98.161  93.093  1.00 30.43  ? 344 GLN B O   1 
ATOM   6019  C  CB  . GLN B 1 344 ? 20.264  97.794  90.332  1.00 23.01  ? 344 GLN B CB  1 
ATOM   6020  C  CG  . GLN B 1 344 ? 20.063  99.279  90.641  1.00 18.98  ? 344 GLN B CG  1 
ATOM   6021  C  CD  . GLN B 1 344 ? 18.789  99.844  90.045  1.00 19.64  ? 344 GLN B CD  1 
ATOM   6022  O  OE1 . GLN B 1 344 ? 17.831  99.118  89.781  1.00 22.93  ? 344 GLN B OE1 1 
ATOM   6023  N  NE2 . GLN B 1 344 ? 18.769  101.148 89.829  1.00 18.62  ? 344 GLN B NE2 1 
ATOM   6024  N  N   . GLN B 1 345 ? 20.777  96.263  93.070  1.00 30.37  ? 345 GLN B N   1 
ATOM   6025  C  CA  . GLN B 1 345 ? 20.575  96.204  94.511  1.00 30.30  ? 345 GLN B CA  1 
ATOM   6026  C  C   . GLN B 1 345 ? 21.844  96.051  95.354  1.00 31.35  ? 345 GLN B C   1 
ATOM   6027  O  O   . GLN B 1 345 ? 22.115  96.874  96.222  1.00 34.36  ? 345 GLN B O   1 
ATOM   6028  C  CB  . GLN B 1 345 ? 19.601  95.083  94.852  1.00 30.40  ? 345 GLN B CB  1 
ATOM   6029  C  CG  . GLN B 1 345 ? 19.002  95.208  96.232  1.00 32.78  ? 345 GLN B CG  1 
ATOM   6030  C  CD  . GLN B 1 345 ? 18.353  93.926  96.691  1.00 36.08  ? 345 GLN B CD  1 
ATOM   6031  O  OE1 . GLN B 1 345 ? 17.589  93.291  95.958  1.00 37.29  ? 345 GLN B OE1 1 
ATOM   6032  N  NE2 . GLN B 1 345 ? 18.658  93.528  97.911  1.00 41.76  ? 345 GLN B NE2 1 
ATOM   6033  N  N   . THR B 1 346 ? 22.606  94.989  95.119  1.00 30.99  ? 346 THR B N   1 
ATOM   6034  C  CA  . THR B 1 346 ? 23.815  94.757  95.892  1.00 27.98  ? 346 THR B CA  1 
ATOM   6035  C  C   . THR B 1 346 ? 25.090  95.315  95.272  1.00 29.13  ? 346 THR B C   1 
ATOM   6036  O  O   . THR B 1 346 ? 26.100  95.446  95.962  1.00 35.49  ? 346 THR B O   1 
ATOM   6037  C  CB  . THR B 1 346 ? 24.036  93.270  96.168  1.00 27.74  ? 346 THR B CB  1 
ATOM   6038  O  OG1 . THR B 1 346 ? 24.701  92.666  95.055  1.00 29.06  ? 346 THR B OG1 1 
ATOM   6039  C  CG2 . THR B 1 346 ? 22.713  92.572  96.376  1.00 29.25  ? 346 THR B CG2 1 
ATOM   6040  N  N   . GLY B 1 347 ? 25.064  95.614  93.976  1.00 31.17  ? 347 GLY B N   1 
ATOM   6041  C  CA  . GLY B 1 347 ? 26.251  96.143  93.315  1.00 26.08  ? 347 GLY B CA  1 
ATOM   6042  C  C   . GLY B 1 347 ? 27.261  95.072  92.913  1.00 28.04  ? 347 GLY B C   1 
ATOM   6043  O  O   . GLY B 1 347 ? 28.319  95.392  92.357  1.00 30.81  ? 347 GLY B O   1 
ATOM   6044  N  N   . ASP B 1 348 ? 26.972  93.809  93.224  1.00 28.44  ? 348 ASP B N   1 
ATOM   6045  C  CA  . ASP B 1 348 ? 27.861  92.704  92.866  1.00 31.63  ? 348 ASP B CA  1 
ATOM   6046  C  C   . ASP B 1 348 ? 27.702  92.301  91.399  1.00 32.28  ? 348 ASP B C   1 
ATOM   6047  O  O   . ASP B 1 348 ? 26.667  92.567  90.773  1.00 32.54  ? 348 ASP B O   1 
ATOM   6048  C  CB  . ASP B 1 348 ? 27.595  91.495  93.758  1.00 35.78  ? 348 ASP B CB  1 
ATOM   6049  C  CG  . ASP B 1 348 ? 28.040  91.720  95.184  1.00 39.80  ? 348 ASP B CG  1 
ATOM   6050  O  OD1 . ASP B 1 348 ? 29.265  91.865  95.419  1.00 42.36  ? 348 ASP B OD1 1 
ATOM   6051  O  OD2 . ASP B 1 348 ? 27.163  91.763  96.067  1.00 40.59  ? 348 ASP B OD2 1 
ATOM   6052  N  N   . ARG B 1 349 ? 28.710  91.620  90.865  1.00 30.36  ? 349 ARG B N   1 
ATOM   6053  C  CA  . ARG B 1 349 ? 28.670  91.205  89.478  1.00 29.39  ? 349 ARG B CA  1 
ATOM   6054  C  C   . ARG B 1 349 ? 28.767  89.719  89.295  1.00 27.98  ? 349 ARG B C   1 
ATOM   6055  O  O   . ARG B 1 349 ? 29.458  89.035  90.043  1.00 29.36  ? 349 ARG B O   1 
ATOM   6056  C  CB  . ARG B 1 349 ? 29.784  91.878  88.687  1.00 29.48  ? 349 ARG B CB  1 
ATOM   6057  C  CG  . ARG B 1 349 ? 29.564  93.369  88.483  1.00 37.30  ? 349 ARG B CG  1 
ATOM   6058  C  CD  . ARG B 1 349 ? 30.659  94.002  87.630  1.00 45.00  ? 349 ARG B CD  1 
ATOM   6059  N  NE  . ARG B 1 349 ? 30.454  95.435  87.398  1.00 54.86  ? 349 ARG B NE  1 
ATOM   6060  C  CZ  . ARG B 1 349 ? 29.696  95.950  86.427  1.00 62.20  ? 349 ARG B CZ  1 
ATOM   6061  N  NH1 . ARG B 1 349 ? 29.044  95.162  85.573  1.00 64.43  ? 349 ARG B NH1 1 
ATOM   6062  N  NH2 . ARG B 1 349 ? 29.596  97.269  86.303  1.00 67.52  ? 349 ARG B NH2 1 
ATOM   6063  N  N   . ASN B 1 350 ? 28.018  89.221  88.322  1.00 27.27  ? 350 ASN B N   1 
ATOM   6064  C  CA  . ASN B 1 350 ? 28.023  87.811  87.953  1.00 24.69  ? 350 ASN B CA  1 
ATOM   6065  C  C   . ASN B 1 350 ? 28.578  87.771  86.544  1.00 25.87  ? 350 ASN B C   1 
ATOM   6066  O  O   . ASN B 1 350 ? 28.307  88.667  85.734  1.00 27.06  ? 350 ASN B O   1 
ATOM   6067  C  CB  . ASN B 1 350 ? 26.603  87.247  87.901  1.00 22.26  ? 350 ASN B CB  1 
ATOM   6068  C  CG  . ASN B 1 350 ? 26.060  86.930  89.259  1.00 23.76  ? 350 ASN B CG  1 
ATOM   6069  O  OD1 . ASN B 1 350 ? 26.810  86.825  90.214  1.00 29.72  ? 350 ASN B OD1 1 
ATOM   6070  N  ND2 . ASN B 1 350 ? 24.755  86.788  89.363  1.00 21.48  ? 350 ASN B ND2 1 
ATOM   6071  N  N   . ASN B 1 351 ? 29.414  86.794  86.254  1.00 24.92  ? 351 ASN B N   1 
ATOM   6072  C  CA  . ASN B 1 351 ? 29.908  86.684  84.903  1.00 28.76  ? 351 ASN B CA  1 
ATOM   6073  C  C   . ASN B 1 351 ? 30.076  85.231  84.466  1.00 28.16  ? 351 ASN B C   1 
ATOM   6074  O  O   . ASN B 1 351 ? 30.121  84.308  85.300  1.00 27.15  ? 351 ASN B O   1 
ATOM   6075  C  CB  . ASN B 1 351 ? 31.151  87.563  84.642  1.00 34.22  ? 351 ASN B CB  1 
ATOM   6076  C  CG  . ASN B 1 351 ? 32.376  87.090  85.368  1.00 41.95  ? 351 ASN B CG  1 
ATOM   6077  O  OD1 . ASN B 1 351 ? 32.888  85.991  85.122  1.00 45.45  ? 351 ASN B OD1 1 
ATOM   6078  N  ND2 . ASN B 1 351 ? 32.890  87.938  86.247  1.00 50.87  ? 351 ASN B ND2 1 
ATOM   6079  N  N   . GLN B 1 352 ? 29.994  85.029  83.152  1.00 26.55  ? 352 GLN B N   1 
ATOM   6080  C  CA  . GLN B 1 352 ? 30.127  83.711  82.559  1.00 23.75  ? 352 GLN B CA  1 
ATOM   6081  C  C   . GLN B 1 352 ? 30.637  83.819  81.146  1.00 22.76  ? 352 GLN B C   1 
ATOM   6082  O  O   . GLN B 1 352 ? 30.346  84.783  80.435  1.00 22.20  ? 352 GLN B O   1 
ATOM   6083  C  CB  . GLN B 1 352 ? 28.773  83.001  82.495  1.00 20.08  ? 352 GLN B CB  1 
ATOM   6084  C  CG  . GLN B 1 352 ? 28.863  81.617  81.860  1.00 20.75  ? 352 GLN B CG  1 
ATOM   6085  C  CD  . GLN B 1 352 ? 27.532  80.907  81.746  1.00 22.75  ? 352 GLN B CD  1 
ATOM   6086  O  OE1 . GLN B 1 352 ? 27.112  80.211  82.663  1.00 23.34  ? 352 GLN B OE1 1 
ATOM   6087  N  NE2 . GLN B 1 352 ? 26.870  81.060  80.604  1.00 23.24  ? 352 GLN B NE2 1 
ATOM   6088  N  N   . TYR B 1 353 ? 31.466  82.866  80.766  1.00 24.04  ? 353 TYR B N   1 
ATOM   6089  C  CA  . TYR B 1 353 ? 31.917  82.819  79.408  1.00 28.63  ? 353 TYR B CA  1 
ATOM   6090  C  C   . TYR B 1 353 ? 31.806  81.369  79.013  1.00 26.54  ? 353 TYR B C   1 
ATOM   6091  O  O   . TYR B 1 353 ? 32.036  80.467  79.835  1.00 23.73  ? 353 TYR B O   1 
ATOM   6092  C  CB  . TYR B 1 353 ? 33.320  83.394  79.221  1.00 39.13  ? 353 TYR B CB  1 
ATOM   6093  C  CG  . TYR B 1 353 ? 34.447  82.551  79.717  1.00 51.62  ? 353 TYR B CG  1 
ATOM   6094  C  CD1 . TYR B 1 353 ? 34.937  81.491  78.951  1.00 59.72  ? 353 TYR B CD1 1 
ATOM   6095  C  CD2 . TYR B 1 353 ? 35.080  82.852  80.922  1.00 60.24  ? 353 TYR B CD2 1 
ATOM   6096  C  CE1 . TYR B 1 353 ? 36.038  80.746  79.369  1.00 69.34  ? 353 TYR B CE1 1 
ATOM   6097  C  CE2 . TYR B 1 353 ? 36.186  82.118  81.354  1.00 70.31  ? 353 TYR B CE2 1 
ATOM   6098  C  CZ  . TYR B 1 353 ? 36.664  81.064  80.572  1.00 72.11  ? 353 TYR B CZ  1 
ATOM   6099  O  OH  . TYR B 1 353 ? 37.775  80.344  80.981  1.00 75.60  ? 353 TYR B OH  1 
ATOM   6100  N  N   . LYS B 1 354 ? 31.306  81.148  77.802  1.00 25.02  ? 354 LYS B N   1 
ATOM   6101  C  CA  . LYS B 1 354 ? 31.148  79.801  77.308  1.00 24.99  ? 354 LYS B CA  1 
ATOM   6102  C  C   . LYS B 1 354 ? 31.772  79.698  75.917  1.00 23.94  ? 354 LYS B C   1 
ATOM   6103  O  O   . LYS B 1 354 ? 31.760  80.671  75.150  1.00 24.29  ? 354 LYS B O   1 
ATOM   6104  C  CB  . LYS B 1 354 ? 29.667  79.402  77.329  1.00 22.40  ? 354 LYS B CB  1 
ATOM   6105  C  CG  . LYS B 1 354 ? 28.920  79.521  76.020  1.00 27.69  ? 354 LYS B CG  1 
ATOM   6106  C  CD  . LYS B 1 354 ? 28.128  78.246  75.789  1.00 22.06  ? 354 LYS B CD  1 
ATOM   6107  C  CE  . LYS B 1 354 ? 27.233  78.340  74.572  1.00 23.72  ? 354 LYS B CE  1 
ATOM   6108  N  NZ  . LYS B 1 354 ? 27.991  78.475  73.323  1.00 18.45  ? 354 LYS B NZ  1 
ATOM   6109  N  N   . ILE B 1 355 ? 32.391  78.554  75.640  1.00 18.86  ? 355 ILE B N   1 
ATOM   6110  C  CA  . ILE B 1 355 ? 33.042  78.304  74.362  1.00 19.57  ? 355 ILE B CA  1 
ATOM   6111  C  C   . ILE B 1 355 ? 32.416  77.036  73.817  1.00 20.40  ? 355 ILE B C   1 
ATOM   6112  O  O   . ILE B 1 355 ? 32.377  76.023  74.522  1.00 18.03  ? 355 ILE B O   1 
ATOM   6113  C  CB  . ILE B 1 355 ? 34.544  77.970  74.538  1.00 22.87  ? 355 ILE B CB  1 
ATOM   6114  C  CG1 . ILE B 1 355 ? 35.158  78.797  75.669  1.00 30.13  ? 355 ILE B CG1 1 
ATOM   6115  C  CG2 . ILE B 1 355 ? 35.295  78.188  73.228  1.00 22.02  ? 355 ILE B CG2 1 
ATOM   6116  C  CD1 . ILE B 1 355 ? 35.233  80.278  75.394  1.00 41.53  ? 355 ILE B CD1 1 
ATOM   6117  N  N   . THR B 1 356 ? 31.936  77.080  72.579  1.00 18.20  ? 356 THR B N   1 
ATOM   6118  C  CA  . THR B 1 356 ? 31.358  75.895  71.968  1.00 18.94  ? 356 THR B CA  1 
ATOM   6119  C  C   . THR B 1 356 ? 32.019  75.617  70.635  1.00 19.42  ? 356 THR B C   1 
ATOM   6120  O  O   . THR B 1 356 ? 32.278  76.527  69.857  1.00 18.48  ? 356 THR B O   1 
ATOM   6121  C  CB  . THR B 1 356 ? 29.834  76.015  71.798  1.00 18.01  ? 356 THR B CB  1 
ATOM   6122  O  OG1 . THR B 1 356 ? 29.230  76.097  73.095  1.00 18.02  ? 356 THR B OG1 1 
ATOM   6123  C  CG2 . THR B 1 356 ? 29.266  74.795  71.073  1.00 10.73  ? 356 THR B CG2 1 
ATOM   6124  N  N   . LEU B 1 357 ? 32.320  74.348  70.404  1.00 21.38  ? 357 LEU B N   1 
ATOM   6125  C  CA  . LEU B 1 357 ? 32.942  73.882  69.171  1.00 20.54  ? 357 LEU B CA  1 
ATOM   6126  C  C   . LEU B 1 357 ? 31.988  72.823  68.618  1.00 20.72  ? 357 LEU B C   1 
ATOM   6127  O  O   . LEU B 1 357 ? 31.625  71.880  69.327  1.00 17.38  ? 357 LEU B O   1 
ATOM   6128  C  CB  . LEU B 1 357 ? 34.308  73.277  69.502  1.00 26.52  ? 357 LEU B CB  1 
ATOM   6129  C  CG  . LEU B 1 357 ? 35.415  73.052  68.468  1.00 31.66  ? 357 LEU B CG  1 
ATOM   6130  C  CD1 . LEU B 1 357 ? 35.290  71.669  67.831  1.00 38.65  ? 357 LEU B CD1 1 
ATOM   6131  C  CD2 . LEU B 1 357 ? 35.404  74.168  67.433  1.00 33.53  ? 357 LEU B CD2 1 
ATOM   6132  N  N   . ALA B 1 358 ? 31.550  72.987  67.373  1.00 18.72  ? 358 ALA B N   1 
ATOM   6133  C  CA  . ALA B 1 358 ? 30.618  72.034  66.781  1.00 17.08  ? 358 ALA B CA  1 
ATOM   6134  C  C   . ALA B 1 358 ? 30.924  71.681  65.329  1.00 19.24  ? 358 ALA B C   1 
ATOM   6135  O  O   . ALA B 1 358 ? 31.330  72.532  64.543  1.00 21.86  ? 358 ALA B O   1 
ATOM   6136  C  CB  . ALA B 1 358 ? 29.191  72.580  66.881  1.00 15.08  ? 358 ALA B CB  1 
ATOM   6137  N  N   . GLN B 1 359 ? 30.753  70.412  64.991  1.00 18.78  ? 359 GLN B N   1 
ATOM   6138  C  CA  . GLN B 1 359 ? 30.935  69.948  63.631  1.00 17.78  ? 359 GLN B CA  1 
ATOM   6139  C  C   . GLN B 1 359 ? 29.494  69.861  63.127  1.00 17.73  ? 359 GLN B C   1 
ATOM   6140  O  O   . GLN B 1 359 ? 28.628  69.277  63.782  1.00 17.07  ? 359 GLN B O   1 
ATOM   6141  C  CB  . GLN B 1 359 ? 31.605  68.583  63.615  1.00 19.14  ? 359 GLN B CB  1 
ATOM   6142  C  CG  . GLN B 1 359 ? 32.179  68.209  62.267  1.00 26.74  ? 359 GLN B CG  1 
ATOM   6143  C  CD  . GLN B 1 359 ? 33.193  69.228  61.757  1.00 34.30  ? 359 GLN B CD  1 
ATOM   6144  O  OE1 . GLN B 1 359 ? 33.812  69.953  62.538  1.00 31.99  ? 359 GLN B OE1 1 
ATOM   6145  N  NE2 . GLN B 1 359 ? 33.375  69.276  60.441  1.00 37.11  ? 359 GLN B NE2 1 
ATOM   6146  N  N   . GLN B 1 360 ? 29.235  70.430  61.963  1.00 14.66  ? 360 GLN B N   1 
ATOM   6147  C  CA  . GLN B 1 360 ? 27.882  70.464  61.452  1.00 14.84  ? 360 GLN B CA  1 
ATOM   6148  C  C   . GLN B 1 360 ? 27.695  70.075  59.976  1.00 17.10  ? 360 GLN B C   1 
ATOM   6149  O  O   . GLN B 1 360 ? 28.596  70.251  59.152  1.00 18.94  ? 360 GLN B O   1 
ATOM   6150  C  CB  . GLN B 1 360 ? 27.357  71.889  61.689  1.00 10.94  ? 360 GLN B CB  1 
ATOM   6151  C  CG  . GLN B 1 360 ? 25.993  72.182  61.151  1.00 11.97  ? 360 GLN B CG  1 
ATOM   6152  C  CD  . GLN B 1 360 ? 25.594  73.631  61.347  1.00 16.21  ? 360 GLN B CD  1 
ATOM   6153  O  OE1 . GLN B 1 360 ? 25.075  74.006  62.398  1.00 18.42  ? 360 GLN B OE1 1 
ATOM   6154  N  NE2 . GLN B 1 360 ? 25.825  74.455  60.330  1.00 20.04  ? 360 GLN B NE2 1 
ATOM   6155  N  N   . TRP B 1 361 ? 26.524  69.518  59.674  1.00 17.19  ? 361 TRP B N   1 
ATOM   6156  C  CA  . TRP B 1 361 ? 26.118  69.161  58.315  1.00 14.53  ? 361 TRP B CA  1 
ATOM   6157  C  C   . TRP B 1 361 ? 24.822  69.929  58.144  1.00 15.56  ? 361 TRP B C   1 
ATOM   6158  O  O   . TRP B 1 361 ? 23.899  69.746  58.938  1.00 19.47  ? 361 TRP B O   1 
ATOM   6159  C  CB  . TRP B 1 361 ? 25.847  67.672  58.195  1.00 14.24  ? 361 TRP B CB  1 
ATOM   6160  C  CG  . TRP B 1 361 ? 27.090  66.888  58.267  1.00 20.72  ? 361 TRP B CG  1 
ATOM   6161  C  CD1 . TRP B 1 361 ? 27.842  66.448  57.222  1.00 18.19  ? 361 TRP B CD1 1 
ATOM   6162  C  CD2 . TRP B 1 361 ? 27.769  66.478  59.457  1.00 25.43  ? 361 TRP B CD2 1 
ATOM   6163  N  NE1 . TRP B 1 361 ? 28.955  65.788  57.688  1.00 21.80  ? 361 TRP B NE1 1 
ATOM   6164  C  CE2 . TRP B 1 361 ? 28.933  65.791  59.057  1.00 23.70  ? 361 TRP B CE2 1 
ATOM   6165  C  CE3 . TRP B 1 361 ? 27.508  66.628  60.826  1.00 24.80  ? 361 TRP B CE3 1 
ATOM   6166  C  CZ2 . TRP B 1 361 ? 29.833  65.254  59.974  1.00 21.44  ? 361 TRP B CZ2 1 
ATOM   6167  C  CZ3 . TRP B 1 361 ? 28.405  66.095  61.735  1.00 22.49  ? 361 TRP B CZ3 1 
ATOM   6168  C  CH2 . TRP B 1 361 ? 29.552  65.417  61.305  1.00 22.79  ? 361 TRP B CH2 1 
ATOM   6169  N  N   . GLN B 1 362 ? 24.769  70.833  57.173  1.00 14.33  ? 362 GLN B N   1 
ATOM   6170  C  CA  . GLN B 1 362 ? 23.570  71.630  56.953  1.00 13.91  ? 362 GLN B CA  1 
ATOM   6171  C  C   . GLN B 1 362 ? 23.114  71.652  55.505  1.00 17.16  ? 362 GLN B C   1 
ATOM   6172  O  O   . GLN B 1 362 ? 23.890  71.400  54.586  1.00 19.70  ? 362 GLN B O   1 
ATOM   6173  C  CB  . GLN B 1 362 ? 23.756  73.071  57.469  1.00 15.25  ? 362 GLN B CB  1 
ATOM   6174  C  CG  . GLN B 1 362 ? 24.662  73.976  56.635  1.00 14.03  ? 362 GLN B CG  1 
ATOM   6175  C  CD  . GLN B 1 362 ? 26.158  73.671  56.753  1.00 16.23  ? 362 GLN B CD  1 
ATOM   6176  O  OE1 . GLN B 1 362 ? 26.660  73.348  57.823  1.00 22.83  ? 362 GLN B OE1 1 
ATOM   6177  N  NE2 . GLN B 1 362 ? 26.876  73.829  55.662  1.00 16.11  ? 362 GLN B NE2 1 
ATOM   6178  N  N   . ALA B 1 363 ? 21.834  71.954  55.324  1.00 14.97  ? 363 ALA B N   1 
ATOM   6179  C  CA  . ALA B 1 363 ? 21.196  72.034  54.011  1.00 11.95  ? 363 ALA B CA  1 
ATOM   6180  C  C   . ALA B 1 363 ? 21.535  73.369  53.320  1.00 12.69  ? 363 ALA B C   1 
ATOM   6181  O  O   . ALA B 1 363 ? 20.678  74.243  53.179  1.00 17.45  ? 363 ALA B O   1 
ATOM   6182  C  CB  . ALA B 1 363 ? 19.685  71.880  54.182  1.00 7.33   ? 363 ALA B CB  1 
ATOM   6183  N  N   . GLY B 1 364 ? 22.789  73.534  52.908  1.00 13.28  ? 364 GLY B N   1 
ATOM   6184  C  CA  . GLY B 1 364 ? 23.195  74.778  52.270  1.00 14.33  ? 364 GLY B CA  1 
ATOM   6185  C  C   . GLY B 1 364 ? 24.548  75.210  52.810  1.00 17.54  ? 364 GLY B C   1 
ATOM   6186  O  O   . GLY B 1 364 ? 25.073  74.579  53.716  1.00 20.89  ? 364 GLY B O   1 
ATOM   6187  N  N   . ASP B 1 365 ? 25.094  76.307  52.308  1.00 21.04  ? 365 ASP B N   1 
ATOM   6188  C  CA  . ASP B 1 365 ? 26.412  76.772  52.750  1.00 25.54  ? 365 ASP B CA  1 
ATOM   6189  C  C   . ASP B 1 365 ? 26.378  78.088  53.528  1.00 23.50  ? 365 ASP B C   1 
ATOM   6190  O  O   . ASP B 1 365 ? 27.356  78.843  53.537  1.00 25.48  ? 365 ASP B O   1 
ATOM   6191  C  CB  . ASP B 1 365 ? 27.340  76.935  51.538  1.00 31.89  ? 365 ASP B CB  1 
ATOM   6192  C  CG  . ASP B 1 365 ? 26.890  78.055  50.586  1.00 41.58  ? 365 ASP B CG  1 
ATOM   6193  O  OD1 . ASP B 1 365 ? 25.729  78.531  50.670  1.00 45.81  ? 365 ASP B OD1 1 
ATOM   6194  O  OD2 . ASP B 1 365 ? 27.715  78.461  49.738  1.00 53.33  ? 365 ASP B OD2 1 
ATOM   6195  N  N   . SER B 1 366 ? 25.240  78.396  54.127  1.00 20.35  ? 366 SER B N   1 
ATOM   6196  C  CA  . SER B 1 366 ? 25.124  79.621  54.885  1.00 17.17  ? 366 SER B CA  1 
ATOM   6197  C  C   . SER B 1 366 ? 25.047  79.329  56.367  1.00 20.07  ? 366 SER B C   1 
ATOM   6198  O  O   . SER B 1 366 ? 24.617  78.250  56.785  1.00 19.49  ? 366 SER B O   1 
ATOM   6199  C  CB  . SER B 1 366 ? 23.879  80.379  54.473  1.00 16.26  ? 366 SER B CB  1 
ATOM   6200  O  OG  . SER B 1 366 ? 23.761  81.564  55.234  1.00 20.40  ? 366 SER B OG  1 
ATOM   6201  N  N   . ILE B 1 367 ? 25.418  80.322  57.161  1.00 19.91  ? 367 ILE B N   1 
ATOM   6202  C  CA  . ILE B 1 367 ? 25.359  80.194  58.609  1.00 18.93  ? 367 ILE B CA  1 
ATOM   6203  C  C   . ILE B 1 367 ? 23.878  80.155  58.977  1.00 18.79  ? 367 ILE B C   1 
ATOM   6204  O  O   . ILE B 1 367 ? 23.513  79.731  60.068  1.00 21.66  ? 367 ILE B O   1 
ATOM   6205  C  CB  . ILE B 1 367 ? 26.109  81.359  59.318  1.00 17.93  ? 367 ILE B CB  1 
ATOM   6206  C  CG1 . ILE B 1 367 ? 26.295  81.040  60.800  1.00 16.49  ? 367 ILE B CG1 1 
ATOM   6207  C  CG2 . ILE B 1 367 ? 25.412  82.685  59.093  1.00 10.64  ? 367 ILE B CG2 1 
ATOM   6208  C  CD1 . ILE B 1 367 ? 27.478  81.725  61.397  1.00 14.45  ? 367 ILE B CD1 1 
ATOM   6209  N  N   . TRP B 1 368 ? 23.030  80.538  58.018  1.00 17.99  ? 368 TRP B N   1 
ATOM   6210  C  CA  . TRP B 1 368 ? 21.576  80.529  58.182  1.00 14.41  ? 368 TRP B CA  1 
ATOM   6211  C  C   . TRP B 1 368 ? 20.896  79.298  57.558  1.00 14.21  ? 368 TRP B C   1 
ATOM   6212  O  O   . TRP B 1 368 ? 19.675  79.201  57.553  1.00 16.67  ? 368 TRP B O   1 
ATOM   6213  C  CB  . TRP B 1 368 ? 20.971  81.764  57.523  1.00 13.92  ? 368 TRP B CB  1 
ATOM   6214  C  CG  . TRP B 1 368 ? 21.300  83.065  58.182  1.00 20.48  ? 368 TRP B CG  1 
ATOM   6215  C  CD1 . TRP B 1 368 ? 22.069  84.067  57.669  1.00 18.46  ? 368 TRP B CD1 1 
ATOM   6216  C  CD2 . TRP B 1 368 ? 20.809  83.542  59.446  1.00 22.43  ? 368 TRP B CD2 1 
ATOM   6217  N  NE1 . TRP B 1 368 ? 22.081  85.139  58.523  1.00 23.77  ? 368 TRP B NE1 1 
ATOM   6218  C  CE2 . TRP B 1 368 ? 21.319  84.846  59.623  1.00 25.87  ? 368 TRP B CE2 1 
ATOM   6219  C  CE3 . TRP B 1 368 ? 19.987  82.996  60.441  1.00 21.07  ? 368 TRP B CE3 1 
ATOM   6220  C  CZ2 . TRP B 1 368 ? 21.033  85.615  60.756  1.00 27.66  ? 368 TRP B CZ2 1 
ATOM   6221  C  CZ3 . TRP B 1 368 ? 19.702  83.762  61.566  1.00 24.33  ? 368 TRP B CZ3 1 
ATOM   6222  C  CH2 . TRP B 1 368 ? 20.225  85.058  61.713  1.00 24.37  ? 368 TRP B CH2 1 
ATOM   6223  N  N   . SER B 1 369 ? 21.665  78.377  56.995  1.00 16.33  ? 369 SER B N   1 
ATOM   6224  C  CA  . SER B 1 369 ? 21.057  77.213  56.364  1.00 13.66  ? 369 SER B CA  1 
ATOM   6225  C  C   . SER B 1 369 ? 20.575  76.212  57.393  1.00 15.20  ? 369 SER B C   1 
ATOM   6226  O  O   . SER B 1 369 ? 21.312  75.867  58.311  1.00 16.84  ? 369 SER B O   1 
ATOM   6227  C  CB  . SER B 1 369 ? 22.056  76.532  55.417  1.00 15.49  ? 369 SER B CB  1 
ATOM   6228  O  OG  . SER B 1 369 ? 22.524  77.395  54.387  1.00 18.60  ? 369 SER B OG  1 
ATOM   6229  N  N   . ARG B 1 370 ? 19.328  75.776  57.239  1.00 14.65  ? 370 ARG B N   1 
ATOM   6230  C  CA  . ARG B 1 370 ? 18.701  74.770  58.105  1.00 16.85  ? 370 ARG B CA  1 
ATOM   6231  C  C   . ARG B 1 370 ? 17.977  73.812  57.160  1.00 16.75  ? 370 ARG B C   1 
ATOM   6232  O  O   . ARG B 1 370 ? 17.497  74.236  56.117  1.00 20.72  ? 370 ARG B O   1 
ATOM   6233  C  CB  . ARG B 1 370 ? 17.678  75.408  59.052  1.00 11.81  ? 370 ARG B CB  1 
ATOM   6234  C  CG  . ARG B 1 370 ? 18.282  76.326  60.089  1.00 12.16  ? 370 ARG B CG  1 
ATOM   6235  C  CD  . ARG B 1 370 ? 19.319  75.602  60.941  1.00 12.46  ? 370 ARG B CD  1 
ATOM   6236  N  NE  . ARG B 1 370 ? 19.818  76.459  62.009  1.00 16.51  ? 370 ARG B NE  1 
ATOM   6237  C  CZ  . ARG B 1 370 ? 20.708  77.435  61.848  1.00 17.04  ? 370 ARG B CZ  1 
ATOM   6238  N  NH1 . ARG B 1 370 ? 21.233  77.691  60.652  1.00 20.70  ? 370 ARG B NH1 1 
ATOM   6239  N  NH2 . ARG B 1 370 ? 21.020  78.210  62.877  1.00 18.30  ? 370 ARG B NH2 1 
ATOM   6240  N  N   . PRO B 1 371 ? 17.820  72.534  57.535  1.00 15.30  ? 371 PRO B N   1 
ATOM   6241  C  CA  . PRO B 1 371 ? 18.248  71.877  58.767  1.00 14.84  ? 371 PRO B CA  1 
ATOM   6242  C  C   . PRO B 1 371 ? 19.737  71.805  58.944  1.00 17.57  ? 371 PRO B C   1 
ATOM   6243  O  O   . PRO B 1 371 ? 20.496  72.054  58.012  1.00 20.79  ? 371 PRO B O   1 
ATOM   6244  C  CB  . PRO B 1 371 ? 17.649  70.479  58.636  1.00 14.12  ? 371 PRO B CB  1 
ATOM   6245  C  CG  . PRO B 1 371 ? 17.581  70.266  57.175  1.00 14.91  ? 371 PRO B CG  1 
ATOM   6246  C  CD  . PRO B 1 371 ? 17.079  71.589  56.685  1.00 10.38  ? 371 PRO B CD  1 
ATOM   6247  N  N   . ALA B 1 372 ? 20.142  71.498  60.169  1.00 15.41  ? 372 ALA B N   1 
ATOM   6248  C  CA  . ALA B 1 372 ? 21.541  71.357  60.522  1.00 11.88  ? 372 ALA B CA  1 
ATOM   6249  C  C   . ALA B 1 372 ? 21.600  70.253  61.551  1.00 13.60  ? 372 ALA B C   1 
ATOM   6250  O  O   . ALA B 1 372 ? 20.696  70.120  62.374  1.00 18.00  ? 372 ALA B O   1 
ATOM   6251  C  CB  . ALA B 1 372 ? 22.066  72.651  61.115  1.00 8.22   ? 372 ALA B CB  1 
ATOM   6252  N  N   . ILE B 1 373 ? 22.603  69.400  61.444  1.00 11.63  ? 373 ILE B N   1 
ATOM   6253  C  CA  . ILE B 1 373 ? 22.794  68.326  62.402  1.00 10.26  ? 373 ILE B CA  1 
ATOM   6254  C  C   . ILE B 1 373 ? 24.146  68.661  62.994  1.00 13.22  ? 373 ILE B C   1 
ATOM   6255  O  O   . ILE B 1 373 ? 25.106  68.850  62.256  1.00 17.38  ? 373 ILE B O   1 
ATOM   6256  C  CB  . ILE B 1 373 ? 22.808  66.949  61.718  1.00 10.85  ? 373 ILE B CB  1 
ATOM   6257  C  CG1 . ILE B 1 373 ? 21.435  66.657  61.136  1.00 10.98  ? 373 ILE B CG1 1 
ATOM   6258  C  CG2 . ILE B 1 373 ? 23.136  65.858  62.722  1.00 10.74  ? 373 ILE B CG2 1 
ATOM   6259  C  CD1 . ILE B 1 373 ? 21.335  65.299  60.516  1.00 13.00  ? 373 ILE B CD1 1 
ATOM   6260  N  N   . ARG B 1 374 ? 24.221  68.765  64.313  1.00 13.42  ? 374 ARG B N   1 
ATOM   6261  C  CA  . ARG B 1 374 ? 25.455  69.134  64.977  1.00 11.94  ? 374 ARG B CA  1 
ATOM   6262  C  C   . ARG B 1 374 ? 25.925  68.150  65.994  1.00 12.67  ? 374 ARG B C   1 
ATOM   6263  O  O   . ARG B 1 374 ? 25.123  67.448  66.595  1.00 18.33  ? 374 ARG B O   1 
ATOM   6264  C  CB  . ARG B 1 374 ? 25.228  70.427  65.745  1.00 10.09  ? 374 ARG B CB  1 
ATOM   6265  C  CG  . ARG B 1 374 ? 24.763  71.575  64.894  1.00 12.30  ? 374 ARG B CG  1 
ATOM   6266  C  CD  . ARG B 1 374 ? 23.783  72.403  65.661  1.00 13.86  ? 374 ARG B CD  1 
ATOM   6267  N  NE  . ARG B 1 374 ? 23.422  73.628  64.957  1.00 11.50  ? 374 ARG B NE  1 
ATOM   6268  C  CZ  . ARG B 1 374 ? 22.467  74.450  65.375  1.00 14.82  ? 374 ARG B CZ  1 
ATOM   6269  N  NH1 . ARG B 1 374 ? 21.793  74.160  66.485  1.00 13.28  ? 374 ARG B NH1 1 
ATOM   6270  N  NH2 . ARG B 1 374 ? 22.194  75.564  64.702  1.00 10.89  ? 374 ARG B NH2 1 
ATOM   6271  N  N   . ILE B 1 375 ? 27.238  68.082  66.162  1.00 11.55  ? 375 ILE B N   1 
ATOM   6272  C  CA  . ILE B 1 375 ? 27.841  67.281  67.223  1.00 15.68  ? 375 ILE B CA  1 
ATOM   6273  C  C   . ILE B 1 375 ? 28.732  68.350  67.852  1.00 16.61  ? 375 ILE B C   1 
ATOM   6274  O  O   . ILE B 1 375 ? 29.430  69.078  67.142  1.00 15.66  ? 375 ILE B O   1 
ATOM   6275  C  CB  . ILE B 1 375 ? 28.602  66.051  66.741  1.00 15.72  ? 375 ILE B CB  1 
ATOM   6276  C  CG1 . ILE B 1 375 ? 29.656  66.428  65.729  1.00 27.16  ? 375 ILE B CG1 1 
ATOM   6277  C  CG2 . ILE B 1 375 ? 27.636  65.054  66.158  1.00 15.80  ? 375 ILE B CG2 1 
ATOM   6278  C  CD1 . ILE B 1 375 ? 30.349  65.217  65.150  1.00 34.22  ? 375 ILE B CD1 1 
ATOM   6279  N  N   . PHE B 1 376 ? 28.621  68.516  69.165  1.00 16.40  ? 376 PHE B N   1 
ATOM   6280  C  CA  . PHE B 1 376 ? 29.333  69.582  69.845  1.00 14.44  ? 376 PHE B CA  1 
ATOM   6281  C  C   . PHE B 1 376 ? 29.942  69.218  71.188  1.00 17.27  ? 376 PHE B C   1 
ATOM   6282  O  O   . PHE B 1 376 ? 29.681  68.151  71.742  1.00 17.57  ? 376 PHE B O   1 
ATOM   6283  C  CB  . PHE B 1 376 ? 28.345  70.723  70.084  1.00 12.00  ? 376 PHE B CB  1 
ATOM   6284  C  CG  . PHE B 1 376 ? 27.235  70.362  71.038  1.00 16.35  ? 376 PHE B CG  1 
ATOM   6285  C  CD1 . PHE B 1 376 ? 27.418  70.463  72.414  1.00 12.24  ? 376 PHE B CD1 1 
ATOM   6286  C  CD2 . PHE B 1 376 ? 26.021  69.874  70.563  1.00 16.44  ? 376 PHE B CD2 1 
ATOM   6287  C  CE1 . PHE B 1 376 ? 26.408  70.082  73.294  1.00 15.79  ? 376 PHE B CE1 1 
ATOM   6288  C  CE2 . PHE B 1 376 ? 25.003  69.489  71.437  1.00 15.81  ? 376 PHE B CE2 1 
ATOM   6289  C  CZ  . PHE B 1 376 ? 25.193  69.592  72.796  1.00 16.20  ? 376 PHE B CZ  1 
ATOM   6290  N  N   . ALA B 1 377 ? 30.694  70.172  71.728  1.00 16.79  ? 377 ALA B N   1 
ATOM   6291  C  CA  . ALA B 1 377 ? 31.340  70.080  73.032  1.00 16.94  ? 377 ALA B CA  1 
ATOM   6292  C  C   . ALA B 1 377 ? 31.285  71.517  73.521  1.00 18.34  ? 377 ALA B C   1 
ATOM   6293  O  O   . ALA B 1 377 ? 31.643  72.441  72.777  1.00 18.12  ? 377 ALA B O   1 
ATOM   6294  C  CB  . ALA B 1 377 ? 32.784  69.620  72.907  1.00 12.74  ? 377 ALA B CB  1 
ATOM   6295  N  N   . THR B 1 378 ? 30.770  71.710  74.730  1.00 19.00  ? 378 THR B N   1 
ATOM   6296  C  CA  . THR B 1 378 ? 30.638  73.034  75.313  1.00 20.53  ? 378 THR B CA  1 
ATOM   6297  C  C   . THR B 1 378 ? 31.342  73.121  76.657  1.00 21.80  ? 378 THR B C   1 
ATOM   6298  O  O   . THR B 1 378 ? 31.347  72.157  77.431  1.00 21.64  ? 378 THR B O   1 
ATOM   6299  C  CB  . THR B 1 378 ? 29.149  73.413  75.506  1.00 19.79  ? 378 THR B CB  1 
ATOM   6300  O  OG1 . THR B 1 378 ? 28.546  73.603  74.223  1.00 20.29  ? 378 THR B OG1 1 
ATOM   6301  C  CG2 . THR B 1 378 ? 29.004  74.700  76.322  1.00 18.28  ? 378 THR B CG2 1 
ATOM   6302  N  N   . TYR B 1 379 ? 31.982  74.259  76.896  1.00 19.42  ? 379 TYR B N   1 
ATOM   6303  C  CA  . TYR B 1 379 ? 32.665  74.505  78.147  1.00 20.03  ? 379 TYR B CA  1 
ATOM   6304  C  C   . TYR B 1 379 ? 32.198  75.852  78.648  1.00 20.09  ? 379 TYR B C   1 
ATOM   6305  O  O   . TYR B 1 379 ? 32.174  76.814  77.886  1.00 20.72  ? 379 TYR B O   1 
ATOM   6306  C  CB  . TYR B 1 379 ? 34.172  74.551  77.955  1.00 20.72  ? 379 TYR B CB  1 
ATOM   6307  C  CG  . TYR B 1 379 ? 34.897  75.002  79.207  1.00 23.06  ? 379 TYR B CG  1 
ATOM   6308  C  CD1 . TYR B 1 379 ? 35.057  74.140  80.290  1.00 22.62  ? 379 TYR B CD1 1 
ATOM   6309  C  CD2 . TYR B 1 379 ? 35.390  76.307  79.319  1.00 26.14  ? 379 TYR B CD2 1 
ATOM   6310  C  CE1 . TYR B 1 379 ? 35.686  74.558  81.448  1.00 24.09  ? 379 TYR B CE1 1 
ATOM   6311  C  CE2 . TYR B 1 379 ? 36.020  76.740  80.478  1.00 23.81  ? 379 TYR B CE2 1 
ATOM   6312  C  CZ  . TYR B 1 379 ? 36.162  75.856  81.540  1.00 25.46  ? 379 TYR B CZ  1 
ATOM   6313  O  OH  . TYR B 1 379 ? 36.773  76.275  82.697  1.00 30.18  ? 379 TYR B OH  1 
ATOM   6314  N  N   . ALA B 1 380 ? 31.808  75.914  79.917  1.00 21.06  ? 380 ALA B N   1 
ATOM   6315  C  CA  . ALA B 1 380 ? 31.352  77.161  80.506  1.00 21.77  ? 380 ALA B CA  1 
ATOM   6316  C  C   . ALA B 1 380 ? 32.026  77.309  81.851  1.00 24.18  ? 380 ALA B C   1 
ATOM   6317  O  O   . ALA B 1 380 ? 32.203  76.331  82.577  1.00 23.32  ? 380 ALA B O   1 
ATOM   6318  C  CB  . ALA B 1 380 ? 29.842  77.147  80.676  1.00 18.07  ? 380 ALA B CB  1 
ATOM   6319  N  N   . LYS B 1 381 ? 32.457  78.527  82.143  1.00 23.40  ? 381 LYS B N   1 
ATOM   6320  C  CA  . LYS B 1 381 ? 33.099  78.847  83.405  1.00 21.45  ? 381 LYS B CA  1 
ATOM   6321  C  C   . LYS B 1 381 ? 32.402  80.101  83.911  1.00 23.12  ? 381 LYS B C   1 
ATOM   6322  O  O   . LYS B 1 381 ? 32.270  81.086  83.177  1.00 22.89  ? 381 LYS B O   1 
ATOM   6323  C  CB  . LYS B 1 381 ? 34.584  79.130  83.188  1.00 24.99  ? 381 LYS B CB  1 
ATOM   6324  C  CG  . LYS B 1 381 ? 35.310  79.755  84.377  1.00 30.84  ? 381 LYS B CG  1 
ATOM   6325  C  CD  . LYS B 1 381 ? 35.531  78.742  85.492  1.00 45.00  ? 381 LYS B CD  1 
ATOM   6326  C  CE  . LYS B 1 381 ? 35.969  79.386  86.818  1.00 45.19  ? 381 LYS B CE  1 
ATOM   6327  N  NZ  . LYS B 1 381 ? 34.871  80.118  87.526  1.00 43.01  ? 381 LYS B NZ  1 
ATOM   6328  N  N   . TRP B 1 382 ? 31.939  80.060  85.157  1.00 23.56  ? 382 TRP B N   1 
ATOM   6329  C  CA  . TRP B 1 382 ? 31.253  81.200  85.746  1.00 23.25  ? 382 TRP B CA  1 
ATOM   6330  C  C   . TRP B 1 382 ? 31.723  81.521  87.153  1.00 25.05  ? 382 TRP B C   1 
ATOM   6331  O  O   . TRP B 1 382 ? 32.218  80.656  87.893  1.00 22.07  ? 382 TRP B O   1 
ATOM   6332  C  CB  . TRP B 1 382 ? 29.752  80.955  85.781  1.00 22.32  ? 382 TRP B CB  1 
ATOM   6333  C  CG  . TRP B 1 382 ? 29.397  79.744  86.549  1.00 21.73  ? 382 TRP B CG  1 
ATOM   6334  C  CD1 . TRP B 1 382 ? 29.126  79.673  87.881  1.00 19.59  ? 382 TRP B CD1 1 
ATOM   6335  C  CD2 . TRP B 1 382 ? 29.266  78.414  86.035  1.00 22.01  ? 382 TRP B CD2 1 
ATOM   6336  N  NE1 . TRP B 1 382 ? 28.827  78.380  88.230  1.00 23.55  ? 382 TRP B NE1 1 
ATOM   6337  C  CE2 . TRP B 1 382 ? 28.906  77.586  87.115  1.00 23.00  ? 382 TRP B CE2 1 
ATOM   6338  C  CE3 . TRP B 1 382 ? 29.412  77.845  84.764  1.00 20.07  ? 382 TRP B CE3 1 
ATOM   6339  C  CZ2 . TRP B 1 382 ? 28.691  76.214  86.967  1.00 21.44  ? 382 TRP B CZ2 1 
ATOM   6340  C  CZ3 . TRP B 1 382 ? 29.198  76.483  84.615  1.00 18.36  ? 382 TRP B CZ3 1 
ATOM   6341  C  CH2 . TRP B 1 382 ? 28.841  75.683  85.711  1.00 21.21  ? 382 TRP B CH2 1 
ATOM   6342  N  N   . ASP B 1 383 ? 31.494  82.773  87.519  1.00 26.60  ? 383 ASP B N   1 
ATOM   6343  C  CA  . ASP B 1 383 ? 31.844  83.307  88.821  1.00 28.73  ? 383 ASP B CA  1 
ATOM   6344  C  C   . ASP B 1 383 ? 30.696  84.233  89.212  1.00 26.07  ? 383 ASP B C   1 
ATOM   6345  O  O   . ASP B 1 383 ? 30.632  85.387  88.791  1.00 24.34  ? 383 ASP B O   1 
ATOM   6346  C  CB  . ASP B 1 383 ? 33.164  84.081  88.719  1.00 37.53  ? 383 ASP B CB  1 
ATOM   6347  C  CG  . ASP B 1 383 ? 33.566  84.745  90.025  1.00 43.66  ? 383 ASP B CG  1 
ATOM   6348  O  OD1 . ASP B 1 383 ? 33.172  84.247  91.108  1.00 45.35  ? 383 ASP B OD1 1 
ATOM   6349  O  OD2 . ASP B 1 383 ? 34.288  85.769  89.958  1.00 51.95  ? 383 ASP B OD2 1 
ATOM   6350  N  N   . GLU B 1 384 ? 29.769  83.709  89.995  1.00 26.28  ? 384 GLU B N   1 
ATOM   6351  C  CA  . GLU B 1 384 ? 28.609  84.478  90.404  1.00 26.90  ? 384 GLU B CA  1 
ATOM   6352  C  C   . GLU B 1 384 ? 28.716  84.942  91.854  1.00 29.88  ? 384 GLU B C   1 
ATOM   6353  O  O   . GLU B 1 384 ? 28.759  84.120  92.782  1.00 30.84  ? 384 GLU B O   1 
ATOM   6354  C  CB  . GLU B 1 384 ? 27.332  83.662  90.155  1.00 23.70  ? 384 GLU B CB  1 
ATOM   6355  C  CG  . GLU B 1 384 ? 27.265  83.145  88.720  1.00 22.95  ? 384 GLU B CG  1 
ATOM   6356  C  CD  . GLU B 1 384 ? 25.900  82.653  88.281  1.00 27.18  ? 384 GLU B CD  1 
ATOM   6357  O  OE1 . GLU B 1 384 ? 25.077  82.248  89.121  1.00 26.03  ? 384 GLU B OE1 1 
ATOM   6358  O  OE2 . GLU B 1 384 ? 25.654  82.674  87.063  1.00 30.97  ? 384 GLU B OE2 1 
ATOM   6359  N  N   . LYS B 1 385 ? 28.812  86.263  92.025  1.00 29.08  ? 385 LYS B N   1 
ATOM   6360  C  CA  . LYS B 1 385 ? 28.922  86.887  93.341  1.00 27.44  ? 385 LYS B CA  1 
ATOM   6361  C  C   . LYS B 1 385 ? 27.568  87.160  93.994  1.00 27.97  ? 385 LYS B C   1 
ATOM   6362  O  O   . LYS B 1 385 ? 27.519  87.469  95.180  1.00 33.93  ? 385 LYS B O   1 
ATOM   6363  C  CB  . LYS B 1 385 ? 29.702  88.196  93.259  1.00 27.94  ? 385 LYS B CB  1 
ATOM   6364  C  CG  . LYS B 1 385 ? 31.133  88.068  92.787  1.00 31.72  ? 385 LYS B CG  1 
ATOM   6365  C  CD  . LYS B 1 385 ? 31.939  87.182  93.693  1.00 37.57  ? 385 LYS B CD  1 
ATOM   6366  C  CE  . LYS B 1 385 ? 33.385  87.097  93.214  1.00 43.34  ? 385 LYS B CE  1 
ATOM   6367  N  NZ  . LYS B 1 385 ? 34.141  85.973  93.866  1.00 48.52  ? 385 LYS B NZ  1 
ATOM   6368  N  N   . TRP B 1 386 ? 26.477  87.044  93.243  1.00 25.76  ? 386 TRP B N   1 
ATOM   6369  C  CA  . TRP B 1 386 ? 25.159  87.294  93.800  1.00 24.22  ? 386 TRP B CA  1 
ATOM   6370  C  C   . TRP B 1 386 ? 24.121  86.391  93.180  1.00 24.50  ? 386 TRP B C   1 
ATOM   6371  O  O   . TRP B 1 386 ? 24.377  85.762  92.164  1.00 28.72  ? 386 TRP B O   1 
ATOM   6372  C  CB  . TRP B 1 386 ? 24.753  88.755  93.601  1.00 19.39  ? 386 TRP B CB  1 
ATOM   6373  C  CG  . TRP B 1 386 ? 24.548  89.172  92.172  1.00 22.86  ? 386 TRP B CG  1 
ATOM   6374  C  CD1 . TRP B 1 386 ? 25.494  89.640  91.310  1.00 21.74  ? 386 TRP B CD1 1 
ATOM   6375  C  CD2 . TRP B 1 386 ? 23.300  89.236  91.468  1.00 23.29  ? 386 TRP B CD2 1 
ATOM   6376  N  NE1 . TRP B 1 386 ? 24.915  90.004  90.125  1.00 22.37  ? 386 TRP B NE1 1 
ATOM   6377  C  CE2 . TRP B 1 386 ? 23.569  89.765  90.193  1.00 21.83  ? 386 TRP B CE2 1 
ATOM   6378  C  CE3 . TRP B 1 386 ? 21.979  88.904  91.799  1.00 25.20  ? 386 TRP B CE3 1 
ATOM   6379  C  CZ2 . TRP B 1 386 ? 22.568  89.971  89.244  1.00 22.03  ? 386 TRP B CZ2 1 
ATOM   6380  C  CZ3 . TRP B 1 386 ? 20.984  89.109  90.860  1.00 21.01  ? 386 TRP B CZ3 1 
ATOM   6381  C  CH2 . TRP B 1 386 ? 21.286  89.638  89.595  1.00 22.78  ? 386 TRP B CH2 1 
ATOM   6382  N  N   . GLY B 1 387 ? 22.947  86.352  93.793  1.00 23.07  ? 387 GLY B N   1 
ATOM   6383  C  CA  . GLY B 1 387 ? 21.858  85.537  93.297  1.00 22.57  ? 387 GLY B CA  1 
ATOM   6384  C  C   . GLY B 1 387 ? 20.561  86.072  93.861  1.00 23.87  ? 387 GLY B C   1 
ATOM   6385  O  O   . GLY B 1 387 ? 20.573  86.912  94.757  1.00 26.11  ? 387 GLY B O   1 
ATOM   6386  N  N   . TYR B 1 388 ? 19.434  85.651  93.311  1.00 25.89  ? 388 TYR B N   1 
ATOM   6387  C  CA  . TYR B 1 388 ? 18.166  86.111  93.832  1.00 28.14  ? 388 TYR B CA  1 
ATOM   6388  C  C   . TYR B 1 388 ? 17.846  85.260  95.045  1.00 31.96  ? 388 TYR B C   1 
ATOM   6389  O  O   . TYR B 1 388 ? 18.045  84.043  95.038  1.00 30.20  ? 388 TYR B O   1 
ATOM   6390  C  CB  . TYR B 1 388 ? 17.066  86.001  92.777  1.00 27.89  ? 388 TYR B CB  1 
ATOM   6391  C  CG  . TYR B 1 388 ? 17.217  87.005  91.660  1.00 29.91  ? 388 TYR B CG  1 
ATOM   6392  C  CD1 . TYR B 1 388 ? 16.852  88.345  91.842  1.00 27.89  ? 388 TYR B CD1 1 
ATOM   6393  C  CD2 . TYR B 1 388 ? 17.761  86.631  90.430  1.00 29.70  ? 388 TYR B CD2 1 
ATOM   6394  C  CE1 . TYR B 1 388 ? 17.030  89.286  90.831  1.00 27.95  ? 388 TYR B CE1 1 
ATOM   6395  C  CE2 . TYR B 1 388 ? 17.942  87.568  89.416  1.00 28.69  ? 388 TYR B CE2 1 
ATOM   6396  C  CZ  . TYR B 1 388 ? 17.576  88.888  89.626  1.00 27.74  ? 388 TYR B CZ  1 
ATOM   6397  O  OH  . TYR B 1 388 ? 17.766  89.809  88.629  1.00 31.60  ? 388 TYR B OH  1 
ATOM   6398  N  N   . ILE B 1 389 ? 17.396  85.917  96.104  1.00 36.49  ? 389 ILE B N   1 
ATOM   6399  C  CA  . ILE B 1 389 ? 17.060  85.231  97.333  1.00 39.22  ? 389 ILE B CA  1 
ATOM   6400  C  C   . ILE B 1 389 ? 16.011  84.177  97.060  1.00 41.00  ? 389 ILE B C   1 
ATOM   6401  O  O   . ILE B 1 389 ? 14.893  84.468  96.642  1.00 38.94  ? 389 ILE B O   1 
ATOM   6402  C  CB  . ILE B 1 389 ? 16.568  86.214  98.400  1.00 37.44  ? 389 ILE B CB  1 
ATOM   6403  C  CG1 . ILE B 1 389 ? 17.699  87.179  98.764  1.00 34.95  ? 389 ILE B CG1 1 
ATOM   6404  C  CG2 . ILE B 1 389 ? 16.106  85.462  99.626  1.00 38.47  ? 389 ILE B CG2 1 
ATOM   6405  C  CD1 . ILE B 1 389 ? 17.260  88.345  99.611  1.00 34.74  ? 389 ILE B CD1 1 
ATOM   6406  N  N   . LYS B 1 390 ? 16.428  82.937  97.221  1.00 48.82  ? 390 LYS B N   1 
ATOM   6407  C  CA  . LYS B 1 390 ? 15.564  81.806  97.009  1.00 59.07  ? 390 LYS B CA  1 
ATOM   6408  C  C   . LYS B 1 390 ? 14.731  81.652  98.263  1.00 64.81  ? 390 LYS B C   1 
ATOM   6409  O  O   . LYS B 1 390 ? 15.217  81.165  99.283  1.00 67.59  ? 390 LYS B O   1 
ATOM   6410  C  CB  . LYS B 1 390 ? 16.407  80.557  96.756  1.00 59.16  ? 390 LYS B CB  1 
ATOM   6411  C  CG  . LYS B 1 390 ? 15.603  79.347  96.341  1.00 66.50  ? 390 LYS B CG  1 
ATOM   6412  C  CD  . LYS B 1 390 ? 16.375  78.471  95.358  1.00 70.83  ? 390 LYS B CD  1 
ATOM   6413  C  CE  . LYS B 1 390 ? 17.638  77.885  95.975  1.00 74.16  ? 390 LYS B CE  1 
ATOM   6414  N  NZ  . LYS B 1 390 ? 17.337  76.847  97.006  1.00 79.51  ? 390 LYS B NZ  1 
ATOM   6415  N  N   . ASP B 1 391 ? 13.499  82.147  98.206  1.00 74.53  ? 391 ASP B N   1 
ATOM   6416  C  CA  . ASP B 1 391 ? 12.572  82.063  99.333  1.00 84.07  ? 391 ASP B CA  1 
ATOM   6417  C  C   . ASP B 1 391 ? 11.967  80.650  99.364  1.00 89.05  ? 391 ASP B C   1 
ATOM   6418  O  O   . ASP B 1 391 ? 10.835  80.422  98.909  1.00 91.02  ? 391 ASP B O   1 
ATOM   6419  C  CB  . ASP B 1 391 ? 11.471  83.130  99.200  1.00 84.34  ? 391 ASP B CB  1 
ATOM   6420  C  CG  . ASP B 1 391 ? 10.550  83.175  100.406 0.00 84.14  ? 391 ASP B CG  1 
ATOM   6421  O  OD1 . ASP B 1 391 ? 10.991  83.648  101.476 0.00 84.13  ? 391 ASP B OD1 1 
ATOM   6422  O  OD2 . ASP B 1 391 ? 9.386   82.741  100.284 0.00 84.13  ? 391 ASP B OD2 1 
ATOM   6423  N  N   . GLY B 1 392 ? 12.744  79.699  99.878  1.00 92.37  ? 392 GLY B N   1 
ATOM   6424  C  CA  . GLY B 1 392 ? 12.293  78.321  99.945  1.00 94.98  ? 392 GLY B CA  1 
ATOM   6425  C  C   . GLY B 1 392 ? 12.441  77.630  98.598  1.00 96.04  ? 392 GLY B C   1 
ATOM   6426  O  O   . GLY B 1 392 ? 13.452  76.974  98.338  1.00 98.05  ? 392 GLY B O   1 
ATOM   6427  N  N   . ASP B 1 393 ? 11.438  77.786  97.739  1.00 95.67  ? 393 ASP B N   1 
ATOM   6428  C  CA  . ASP B 1 393 ? 11.452  77.182  96.404  1.00 94.98  ? 393 ASP B CA  1 
ATOM   6429  C  C   . ASP B 1 393 ? 11.280  78.269  95.341  1.00 93.45  ? 393 ASP B C   1 
ATOM   6430  O  O   . ASP B 1 393 ? 11.821  78.169  94.235  1.00 94.44  ? 393 ASP B O   1 
ATOM   6431  C  CB  . ASP B 1 393 ? 10.332  76.137  96.280  1.00 96.85  ? 393 ASP B CB  1 
ATOM   6432  C  CG  . ASP B 1 393 ? 10.340  75.425  94.937  0.00 96.45  ? 393 ASP B CG  1 
ATOM   6433  O  OD1 . ASP B 1 393 ? 11.210  74.553  94.731  0.00 96.75  ? 393 ASP B OD1 1 
ATOM   6434  O  OD2 . ASP B 1 393 ? 9.474   75.734  94.091  0.00 96.75  ? 393 ASP B OD2 1 
ATOM   6435  N  N   . ASN B 1 394 ? 10.521  79.304  95.691  1.00 89.61  ? 394 ASN B N   1 
ATOM   6436  C  CA  . ASN B 1 394 ? 10.267  80.422  94.792  1.00 84.30  ? 394 ASN B CA  1 
ATOM   6437  C  C   . ASN B 1 394 ? 11.435  81.410  94.845  1.00 78.24  ? 394 ASN B C   1 
ATOM   6438  O  O   . ASN B 1 394 ? 12.071  81.579  95.888  1.00 78.03  ? 394 ASN B O   1 
ATOM   6439  C  CB  . ASN B 1 394 ? 8.963   81.131  95.186  1.00 86.27  ? 394 ASN B CB  1 
ATOM   6440  C  CG  . ASN B 1 394 ? 7.745   80.241  95.044  0.00 86.80  ? 394 ASN B CG  1 
ATOM   6441  O  OD1 . ASN B 1 394 ? 7.568   79.569  94.031  0.00 87.45  ? 394 ASN B OD1 1 
ATOM   6442  N  ND2 . ASN B 1 394 ? 6.895   80.234  96.062  0.00 87.45  ? 394 ASN B ND2 1 
ATOM   6443  N  N   . ILE B 1 395 ? 11.739  82.032  93.713  1.00 69.75  ? 395 ILE B N   1 
ATOM   6444  C  CA  . ILE B 1 395 ? 12.818  83.006  93.654  1.00 61.58  ? 395 ILE B CA  1 
ATOM   6445  C  C   . ILE B 1 395 ? 12.230  84.394  93.870  1.00 56.75  ? 395 ILE B C   1 
ATOM   6446  O  O   . ILE B 1 395 ? 11.186  84.726  93.317  1.00 57.35  ? 395 ILE B O   1 
ATOM   6447  C  CB  . ILE B 1 395 ? 13.588  82.911  92.320  1.00 59.58  ? 395 ILE B CB  1 
ATOM   6448  C  CG1 . ILE B 1 395 ? 14.648  81.822  92.417  1.00 61.28  ? 395 ILE B CG1 1 
ATOM   6449  C  CG2 . ILE B 1 395 ? 14.275  84.206  91.997  1.00 59.20  ? 395 ILE B CG2 1 
ATOM   6450  C  CD1 . ILE B 1 395 ? 14.092  80.445  92.648  1.00 65.52  ? 395 ILE B CD1 1 
ATOM   6451  N  N   . SER B 1 396 ? 12.891  85.177  94.711  1.00 51.63  ? 396 SER B N   1 
ATOM   6452  C  CA  . SER B 1 396 ? 12.453  86.522  95.058  1.00 46.03  ? 396 SER B CA  1 
ATOM   6453  C  C   . SER B 1 396 ? 12.999  87.591  94.100  1.00 43.88  ? 396 SER B C   1 
ATOM   6454  O  O   . SER B 1 396 ? 13.887  87.315  93.296  1.00 45.74  ? 396 SER B O   1 
ATOM   6455  C  CB  . SER B 1 396 ? 12.903  86.807  96.494  1.00 44.93  ? 396 SER B CB  1 
ATOM   6456  O  OG  . SER B 1 396 ? 12.438  88.058  96.956  1.00 51.76  ? 396 SER B OG  1 
ATOM   6457  N  N   . ARG B 1 397 ? 12.456  88.804  94.187  1.00 41.04  ? 397 ARG B N   1 
ATOM   6458  C  CA  . ARG B 1 397 ? 12.902  89.932  93.363  1.00 39.64  ? 397 ARG B CA  1 
ATOM   6459  C  C   . ARG B 1 397 ? 14.156  90.543  93.984  1.00 37.40  ? 397 ARG B C   1 
ATOM   6460  O  O   . ARG B 1 397 ? 14.851  91.355  93.366  1.00 37.67  ? 397 ARG B O   1 
ATOM   6461  C  CB  . ARG B 1 397 ? 11.812  91.001  93.309  1.00 44.28  ? 397 ARG B CB  1 
ATOM   6462  C  CG  . ARG B 1 397 ? 10.489  90.496  92.767  1.00 59.13  ? 397 ARG B CG  1 
ATOM   6463  C  CD  . ARG B 1 397 ? 9.393   91.548  92.876  1.00 69.03  ? 397 ARG B CD  1 
ATOM   6464  N  NE  . ARG B 1 397 ? 8.950   92.067  91.578  1.00 78.39  ? 397 ARG B NE  1 
ATOM   6465  C  CZ  . ARG B 1 397 ? 9.697   92.797  90.746  1.00 84.26  ? 397 ARG B CZ  1 
ATOM   6466  N  NH1 . ARG B 1 397 ? 10.956  93.111  91.047  1.00 83.24  ? 397 ARG B NH1 1 
ATOM   6467  N  NH2 . ARG B 1 397 ? 9.163   93.264  89.622  1.00 88.54  ? 397 ARG B NH2 1 
ATOM   6468  N  N   . TYR B 1 398 ? 14.422  90.147  95.225  1.00 34.75  ? 398 TYR B N   1 
ATOM   6469  C  CA  . TYR B 1 398 ? 15.552  90.640  95.990  1.00 31.70  ? 398 TYR B CA  1 
ATOM   6470  C  C   . TYR B 1 398 ? 16.776  89.764  95.825  1.00 31.31  ? 398 TYR B C   1 
ATOM   6471  O  O   . TYR B 1 398 ? 16.673  88.545  95.729  1.00 33.32  ? 398 TYR B O   1 
ATOM   6472  C  CB  . TYR B 1 398 ? 15.157  90.746  97.461  1.00 30.80  ? 398 TYR B CB  1 
ATOM   6473  C  CG  . TYR B 1 398 ? 14.044  91.736  97.694  1.00 29.66  ? 398 TYR B CG  1 
ATOM   6474  C  CD1 . TYR B 1 398 ? 14.304  93.101  97.702  1.00 34.33  ? 398 TYR B CD1 1 
ATOM   6475  C  CD2 . TYR B 1 398 ? 12.725  91.313  97.875  1.00 32.17  ? 398 TYR B CD2 1 
ATOM   6476  C  CE1 . TYR B 1 398 ? 13.287  94.022  97.881  1.00 35.53  ? 398 TYR B CE1 1 
ATOM   6477  C  CE2 . TYR B 1 398 ? 11.697  92.226  98.054  1.00 34.08  ? 398 TYR B CE2 1 
ATOM   6478  C  CZ  . TYR B 1 398 ? 11.986  93.579  98.055  1.00 36.49  ? 398 TYR B CZ  1 
ATOM   6479  O  OH  . TYR B 1 398 ? 10.977  94.502  98.227  1.00 43.63  ? 398 TYR B OH  1 
ATOM   6480  N  N   . ALA B 1 399 ? 17.936  90.397  95.805  1.00 30.92  ? 399 ALA B N   1 
ATOM   6481  C  CA  . ALA B 1 399 ? 19.191  89.691  95.640  1.00 33.01  ? 399 ALA B CA  1 
ATOM   6482  C  C   . ALA B 1 399 ? 19.988  89.721  96.935  1.00 35.34  ? 399 ALA B C   1 
ATOM   6483  O  O   . ALA B 1 399 ? 19.725  90.525  97.822  1.00 40.05  ? 399 ALA B O   1 
ATOM   6484  C  CB  . ALA B 1 399 ? 19.997  90.345  94.526  1.00 30.86  ? 399 ALA B CB  1 
ATOM   6485  N  N   . ALA B 1 400 ? 20.994  88.868  97.015  1.00 35.43  ? 400 ALA B N   1 
ATOM   6486  C  CA  . ALA B 1 400 ? 21.864  88.794  98.172  1.00 35.04  ? 400 ALA B CA  1 
ATOM   6487  C  C   . ALA B 1 400 ? 23.201  88.256  97.683  1.00 35.33  ? 400 ALA B C   1 
ATOM   6488  O  O   . ALA B 1 400 ? 23.240  87.469  96.736  1.00 36.62  ? 400 ALA B O   1 
ATOM   6489  C  CB  . ALA B 1 400 ? 21.270  87.864  99.208  1.00 35.31  ? 400 ALA B CB  1 
ATOM   6490  N  N   . ALA B 1 401 ? 24.298  88.720  98.271  1.00 35.20  ? 401 ALA B N   1 
ATOM   6491  C  CA  . ALA B 1 401 ? 25.607  88.234  97.868  1.00 36.28  ? 401 ALA B CA  1 
ATOM   6492  C  C   . ALA B 1 401 ? 25.694  86.747  98.188  1.00 38.35  ? 401 ALA B C   1 
ATOM   6493  O  O   . ALA B 1 401 ? 25.088  86.265  99.137  1.00 39.67  ? 401 ALA B O   1 
ATOM   6494  C  CB  . ALA B 1 401 ? 26.707  88.998  98.570  1.00 35.95  ? 401 ALA B CB  1 
ATOM   6495  N  N   . THR B 1 402 ? 26.393  86.018  97.335  1.00 45.10  ? 402 THR B N   1 
ATOM   6496  C  CA  . THR B 1 402 ? 26.572  84.587  97.492  1.00 51.67  ? 402 THR B CA  1 
ATOM   6497  C  C   . THR B 1 402 ? 27.073  84.266  98.894  1.00 57.25  ? 402 THR B C   1 
ATOM   6498  O  O   . THR B 1 402 ? 26.578  83.347  99.544  1.00 58.44  ? 402 THR B O   1 
ATOM   6499  C  CB  . THR B 1 402 ? 27.605  84.077  96.464  1.00 50.87  ? 402 THR B CB  1 
ATOM   6500  O  OG1 . THR B 1 402 ? 27.218  84.498  95.150  1.00 54.49  ? 402 THR B OG1 1 
ATOM   6501  C  CG2 . THR B 1 402 ? 27.692  82.570  96.489  1.00 53.84  ? 402 THR B CG2 1 
ATOM   6502  N  N   . ASN B 1 403 ? 28.050  85.044  99.352  1.00 64.03  ? 403 ASN B N   1 
ATOM   6503  C  CA  . ASN B 1 403 ? 28.657  84.851  100.669 1.00 69.80  ? 403 ASN B CA  1 
ATOM   6504  C  C   . ASN B 1 403 ? 27.755  85.117  101.878 1.00 69.95  ? 403 ASN B C   1 
ATOM   6505  O  O   . ASN B 1 403 ? 27.842  84.401  102.879 1.00 72.52  ? 403 ASN B O   1 
ATOM   6506  C  CB  . ASN B 1 403 ? 29.983  85.635  100.795 1.00 77.87  ? 403 ASN B CB  1 
ATOM   6507  C  CG  . ASN B 1 403 ? 29.806  87.161  100.689 1.00 85.83  ? 403 ASN B CG  1 
ATOM   6508  O  OD1 . ASN B 1 403 ? 28.940  87.760  101.339 1.00 90.92  ? 403 ASN B OD1 1 
ATOM   6509  N  ND2 . ASN B 1 403 ? 30.656  87.794  99.885  1.00 90.85  ? 403 ASN B ND2 1 
ATOM   6510  N  N   . SER B 1 404 ? 26.936  86.168  101.817 1.00 68.60  ? 404 SER B N   1 
ATOM   6511  C  CA  . SER B 1 404 ? 26.026  86.474  102.916 1.00 65.32  ? 404 SER B CA  1 
ATOM   6512  C  C   . SER B 1 404 ? 25.250  85.177  103.072 1.00 65.07  ? 404 SER B C   1 
ATOM   6513  O  O   . SER B 1 404 ? 24.713  84.658  102.093 1.00 70.00  ? 404 SER B O   1 
ATOM   6514  C  CB  . SER B 1 404 ? 25.087  87.623  102.533 1.00 66.13  ? 404 SER B CB  1 
ATOM   6515  O  OG  . SER B 1 404 ? 24.158  87.239  101.531 1.00 62.28  ? 404 SER B OG  1 
ATOM   6516  N  N   . GLY B 1 405 ? 25.231  84.631  104.279 1.00 60.65  ? 405 GLY B N   1 
ATOM   6517  C  CA  . GLY B 1 405 ? 24.553  83.368  104.511 1.00 59.59  ? 405 GLY B CA  1 
ATOM   6518  C  C   . GLY B 1 405 ? 23.154  83.156  103.960 1.00 58.79  ? 405 GLY B C   1 
ATOM   6519  O  O   . GLY B 1 405 ? 22.565  82.096  104.182 1.00 61.14  ? 405 GLY B O   1 
ATOM   6520  N  N   . ILE B 1 406 ? 22.609  84.142  103.257 1.00 57.04  ? 406 ILE B N   1 
ATOM   6521  C  CA  . ILE B 1 406 ? 21.271  84.034  102.697 1.00 53.92  ? 406 ILE B CA  1 
ATOM   6522  C  C   . ILE B 1 406 ? 21.219  83.090  101.499 1.00 52.28  ? 406 ILE B C   1 
ATOM   6523  O  O   . ILE B 1 406 ? 22.123  83.054  100.659 1.00 50.35  ? 406 ILE B O   1 
ATOM   6524  C  CB  . ILE B 1 406 ? 20.722  85.415  102.301 1.00 53.86  ? 406 ILE B CB  1 
ATOM   6525  C  CG1 . ILE B 1 406 ? 20.974  86.411  103.436 1.00 55.04  ? 406 ILE B CG1 1 
ATOM   6526  C  CG2 . ILE B 1 406 ? 19.232  85.325  102.034 1.00 53.06  ? 406 ILE B CG2 1 
ATOM   6527  C  CD1 . ILE B 1 406 ? 20.643  87.861  103.106 1.00 57.35  ? 406 ILE B CD1 1 
ATOM   6528  N  N   . SER B 1 407 ? 20.142  82.318  101.448 1.00 52.33  ? 407 SER B N   1 
ATOM   6529  C  CA  . SER B 1 407 ? 19.913  81.356  100.382 1.00 53.57  ? 407 SER B CA  1 
ATOM   6530  C  C   . SER B 1 407 ? 19.470  82.055  99.085  1.00 51.77  ? 407 SER B C   1 
ATOM   6531  O  O   . SER B 1 407 ? 18.377  82.634  99.010  1.00 52.19  ? 407 SER B O   1 
ATOM   6532  C  CB  . SER B 1 407 ? 18.860  80.340  100.833 1.00 56.12  ? 407 SER B CB  1 
ATOM   6533  O  OG  . SER B 1 407 ? 18.809  79.225  99.961  1.00 64.96  ? 407 SER B OG  1 
ATOM   6534  N  N   . THR B 1 408 ? 20.341  82.019  98.081  1.00 49.23  ? 408 THR B N   1 
ATOM   6535  C  CA  . THR B 1 408 ? 20.077  82.629  96.783  1.00 44.16  ? 408 THR B CA  1 
ATOM   6536  C  C   . THR B 1 408 ? 20.199  81.548  95.713  1.00 42.02  ? 408 THR B C   1 
ATOM   6537  O  O   . THR B 1 408 ? 20.583  80.416  96.018  1.00 42.17  ? 408 THR B O   1 
ATOM   6538  C  CB  . THR B 1 408 ? 21.096  83.739  96.488  1.00 43.33  ? 408 THR B CB  1 
ATOM   6539  O  OG1 . THR B 1 408 ? 22.420  83.192  96.522  1.00 42.54  ? 408 THR B OG1 1 
ATOM   6540  C  CG2 . THR B 1 408 ? 20.989  84.844  97.529  1.00 44.53  ? 408 THR B CG2 1 
ATOM   6541  N  N   . ASN B 1 409 ? 19.859  81.880  94.469  1.00 40.09  ? 409 ASN B N   1 
ATOM   6542  C  CA  . ASN B 1 409 ? 19.961  80.913  93.368  1.00 33.85  ? 409 ASN B CA  1 
ATOM   6543  C  C   . ASN B 1 409 ? 21.291  81.034  92.617  1.00 31.91  ? 409 ASN B C   1 
ATOM   6544  O  O   . ASN B 1 409 ? 21.414  80.555  91.487  1.00 36.02  ? 409 ASN B O   1 
ATOM   6545  C  CB  . ASN B 1 409 ? 18.788  81.048  92.387  1.00 31.38  ? 409 ASN B CB  1 
ATOM   6546  C  CG  . ASN B 1 409 ? 18.804  82.358  91.634  1.00 33.78  ? 409 ASN B CG  1 
ATOM   6547  O  OD1 . ASN B 1 409 ? 19.585  83.263  91.941  1.00 36.22  ? 409 ASN B OD1 1 
ATOM   6548  N  ND2 . ASN B 1 409 ? 17.929  82.478  90.653  1.00 36.79  ? 409 ASN B ND2 1 
ATOM   6549  N  N   . SER B 1 410 ? 22.269  81.688  93.245  1.00 29.13  ? 410 SER B N   1 
ATOM   6550  C  CA  . SER B 1 410 ? 23.602  81.868  92.675  1.00 27.43  ? 410 SER B CA  1 
ATOM   6551  C  C   . SER B 1 410 ? 24.258  80.506  92.418  1.00 29.73  ? 410 SER B C   1 
ATOM   6552  O  O   . SER B 1 410 ? 24.121  79.585  93.223  1.00 31.71  ? 410 SER B O   1 
ATOM   6553  C  CB  . SER B 1 410 ? 24.464  82.707  93.630  1.00 25.23  ? 410 SER B CB  1 
ATOM   6554  O  OG  . SER B 1 410 ? 25.841  82.697  93.283  1.00 25.67  ? 410 SER B OG  1 
ATOM   6555  N  N   . ARG B 1 411 ? 24.966  80.388  91.294  1.00 31.33  ? 411 ARG B N   1 
ATOM   6556  C  CA  . ARG B 1 411 ? 25.636  79.142  90.903  1.00 30.14  ? 411 ARG B CA  1 
ATOM   6557  C  C   . ARG B 1 411 ? 27.071  79.090  91.407  1.00 30.41  ? 411 ARG B C   1 
ATOM   6558  O  O   . ARG B 1 411 ? 27.802  78.130  91.149  1.00 32.58  ? 411 ARG B O   1 
ATOM   6559  C  CB  . ARG B 1 411 ? 25.610  78.972  89.381  1.00 28.41  ? 411 ARG B CB  1 
ATOM   6560  C  CG  . ARG B 1 411 ? 24.211  78.855  88.802  1.00 26.50  ? 411 ARG B CG  1 
ATOM   6561  C  CD  . ARG B 1 411 ? 24.134  79.502  87.433  1.00 25.62  ? 411 ARG B CD  1 
ATOM   6562  N  NE  . ARG B 1 411 ? 24.858  78.732  86.432  1.00 23.80  ? 411 ARG B NE  1 
ATOM   6563  C  CZ  . ARG B 1 411 ? 25.689  79.252  85.537  1.00 22.50  ? 411 ARG B CZ  1 
ATOM   6564  N  NH1 . ARG B 1 411 ? 25.925  80.552  85.496  1.00 17.99  ? 411 ARG B NH1 1 
ATOM   6565  N  NH2 . ARG B 1 411 ? 26.283  78.458  84.671  1.00 28.12  ? 411 ARG B NH2 1 
ATOM   6566  N  N   . GLY B 1 412 ? 27.481  80.143  92.097  1.00 29.76  ? 412 GLY B N   1 
ATOM   6567  C  CA  . GLY B 1 412 ? 28.812  80.168  92.652  1.00 27.57  ? 412 GLY B CA  1 
ATOM   6568  C  C   . GLY B 1 412 ? 29.909  80.375  91.645  1.00 29.84  ? 412 GLY B C   1 
ATOM   6569  O  O   . GLY B 1 412 ? 29.750  81.100  90.667  1.00 31.32  ? 412 GLY B O   1 
ATOM   6570  N  N   . ASP B 1 413 ? 31.052  79.772  91.937  1.00 31.90  ? 413 ASP B N   1 
ATOM   6571  C  CA  . ASP B 1 413 ? 32.238  79.872  91.103  1.00 34.50  ? 413 ASP B CA  1 
ATOM   6572  C  C   . ASP B 1 413 ? 32.532  78.459  90.679  1.00 34.27  ? 413 ASP B C   1 
ATOM   6573  O  O   . ASP B 1 413 ? 32.904  77.628  91.511  1.00 35.56  ? 413 ASP B O   1 
ATOM   6574  C  CB  . ASP B 1 413 ? 33.409  80.411  91.935  1.00 41.20  ? 413 ASP B CB  1 
ATOM   6575  C  CG  . ASP B 1 413 ? 34.694  80.551  91.135  1.00 51.86  ? 413 ASP B CG  1 
ATOM   6576  O  OD1 . ASP B 1 413 ? 35.147  79.562  90.516  1.00 60.48  ? 413 ASP B OD1 1 
ATOM   6577  O  OD2 . ASP B 1 413 ? 35.266  81.662  91.136  1.00 61.88  ? 413 ASP B OD2 1 
ATOM   6578  N  N   . SER B 1 414 ? 32.410  78.182  89.389  1.00 32.95  ? 414 SER B N   1 
ATOM   6579  C  CA  . SER B 1 414 ? 32.663  76.834  88.917  1.00 29.08  ? 414 SER B CA  1 
ATOM   6580  C  C   . SER B 1 414 ? 32.707  76.804  87.402  1.00 27.65  ? 414 SER B C   1 
ATOM   6581  O  O   . SER B 1 414 ? 32.747  77.847  86.748  1.00 28.25  ? 414 SER B O   1 
ATOM   6582  C  CB  . SER B 1 414 ? 31.561  75.913  89.443  1.00 27.65  ? 414 SER B CB  1 
ATOM   6583  O  OG  . SER B 1 414 ? 31.911  74.549  89.323  1.00 37.16  ? 414 SER B OG  1 
ATOM   6584  N  N   . ASP B 1 415 ? 32.774  75.596  86.859  1.00 26.03  ? 415 ASP B N   1 
ATOM   6585  C  CA  . ASP B 1 415 ? 32.788  75.383  85.419  1.00 28.99  ? 415 ASP B CA  1 
ATOM   6586  C  C   . ASP B 1 415 ? 32.242  73.988  85.110  1.00 28.06  ? 415 ASP B C   1 
ATOM   6587  O  O   . ASP B 1 415 ? 32.042  73.173  86.017  1.00 28.41  ? 415 ASP B O   1 
ATOM   6588  C  CB  . ASP B 1 415 ? 34.189  75.587  84.820  1.00 30.58  ? 415 ASP B CB  1 
ATOM   6589  C  CG  . ASP B 1 415 ? 35.229  74.620  85.368  1.00 33.58  ? 415 ASP B CG  1 
ATOM   6590  O  OD1 . ASP B 1 415 ? 34.905  73.733  86.189  1.00 39.85  ? 415 ASP B OD1 1 
ATOM   6591  O  OD2 . ASP B 1 415 ? 36.399  74.747  84.963  1.00 34.01  ? 415 ASP B OD2 1 
ATOM   6592  N  N   . GLU B 1 416 ? 31.985  73.720  83.839  1.00 26.48  ? 416 GLU B N   1 
ATOM   6593  C  CA  . GLU B 1 416 ? 31.448  72.434  83.440  1.00 21.93  ? 416 GLU B CA  1 
ATOM   6594  C  C   . GLU B 1 416 ? 31.571  72.365  81.934  1.00 20.06  ? 416 GLU B C   1 
ATOM   6595  O  O   . GLU B 1 416 ? 31.811  73.381  81.268  1.00 19.26  ? 416 GLU B O   1 
ATOM   6596  C  CB  . GLU B 1 416 ? 29.968  72.340  83.848  1.00 22.56  ? 416 GLU B CB  1 
ATOM   6597  C  CG  . GLU B 1 416 ? 29.319  70.973  83.655  1.00 25.42  ? 416 GLU B CG  1 
ATOM   6598  C  CD  . GLU B 1 416 ? 29.947  69.889  84.523  1.00 28.99  ? 416 GLU B CD  1 
ATOM   6599  O  OE1 . GLU B 1 416 ? 29.620  69.828  85.727  1.00 32.92  ? 416 GLU B OE1 1 
ATOM   6600  O  OE2 . GLU B 1 416 ? 30.753  69.086  84.001  1.00 32.19  ? 416 GLU B OE2 1 
ATOM   6601  N  N   . TRP B 1 417 ? 31.434  71.160  81.406  1.00 20.33  ? 417 TRP B N   1 
ATOM   6602  C  CA  . TRP B 1 417 ? 31.505  70.955  79.982  1.00 22.73  ? 417 TRP B CA  1 
ATOM   6603  C  C   . TRP B 1 417 ? 30.482  69.894  79.604  1.00 21.15  ? 417 TRP B C   1 
ATOM   6604  O  O   . TRP B 1 417 ? 30.172  68.999  80.396  1.00 19.15  ? 417 TRP B O   1 
ATOM   6605  C  CB  . TRP B 1 417 ? 32.930  70.582  79.552  1.00 29.62  ? 417 TRP B CB  1 
ATOM   6606  C  CG  . TRP B 1 417 ? 33.359  69.221  79.925  1.00 40.05  ? 417 TRP B CG  1 
ATOM   6607  C  CD1 . TRP B 1 417 ? 33.802  68.808  81.144  1.00 47.19  ? 417 TRP B CD1 1 
ATOM   6608  C  CD2 . TRP B 1 417 ? 33.398  68.069  79.068  1.00 50.12  ? 417 TRP B CD2 1 
ATOM   6609  N  NE1 . TRP B 1 417 ? 34.115  67.464  81.106  1.00 53.39  ? 417 TRP B NE1 1 
ATOM   6610  C  CE2 . TRP B 1 417 ? 33.877  66.988  79.843  1.00 53.04  ? 417 TRP B CE2 1 
ATOM   6611  C  CE3 . TRP B 1 417 ? 33.076  67.846  77.718  1.00 53.18  ? 417 TRP B CE3 1 
ATOM   6612  C  CZ2 . TRP B 1 417 ? 34.044  65.701  79.315  1.00 55.31  ? 417 TRP B CZ2 1 
ATOM   6613  C  CZ3 . TRP B 1 417 ? 33.243  66.570  77.193  1.00 53.01  ? 417 TRP B CZ3 1 
ATOM   6614  C  CH2 . TRP B 1 417 ? 33.723  65.513  77.992  1.00 55.17  ? 417 TRP B CH2 1 
ATOM   6615  N  N   . THR B 1 418 ? 29.888  70.048  78.433  1.00 17.44  ? 418 THR B N   1 
ATOM   6616  C  CA  . THR B 1 418 ? 28.886  69.104  77.971  1.00 17.38  ? 418 THR B CA  1 
ATOM   6617  C  C   . THR B 1 418 ? 29.190  68.773  76.530  1.00 16.56  ? 418 THR B C   1 
ATOM   6618  O  O   . THR B 1 418 ? 30.023  69.411  75.891  1.00 17.18  ? 418 THR B O   1 
ATOM   6619  C  CB  . THR B 1 418 ? 27.488  69.723  78.012  1.00 15.88  ? 418 THR B CB  1 
ATOM   6620  O  OG1 . THR B 1 418 ? 27.502  70.930  77.252  1.00 19.90  ? 418 THR B OG1 1 
ATOM   6621  C  CG2 . THR B 1 418 ? 27.074  70.051  79.431  1.00 17.56  ? 418 THR B CG2 1 
ATOM   6622  N  N   . PHE B 1 419 ? 28.517  67.767  76.012  1.00 17.52  ? 419 PHE B N   1 
ATOM   6623  C  CA  . PHE B 1 419 ? 28.708  67.391  74.630  1.00 18.60  ? 419 PHE B CA  1 
ATOM   6624  C  C   . PHE B 1 419 ? 27.482  66.614  74.211  1.00 18.10  ? 419 PHE B C   1 
ATOM   6625  O  O   . PHE B 1 419 ? 26.733  66.126  75.061  1.00 17.81  ? 419 PHE B O   1 
ATOM   6626  C  CB  . PHE B 1 419 ? 29.969  66.554  74.472  1.00 21.28  ? 419 PHE B CB  1 
ATOM   6627  C  CG  . PHE B 1 419 ? 29.989  65.336  75.327  1.00 28.40  ? 419 PHE B CG  1 
ATOM   6628  C  CD1 . PHE B 1 419 ? 30.429  65.405  76.642  1.00 31.22  ? 419 PHE B CD1 1 
ATOM   6629  C  CD2 . PHE B 1 419 ? 29.558  64.110  74.827  1.00 31.80  ? 419 PHE B CD2 1 
ATOM   6630  C  CE1 . PHE B 1 419 ? 30.442  64.269  77.458  1.00 32.56  ? 419 PHE B CE1 1 
ATOM   6631  C  CE2 . PHE B 1 419 ? 29.565  62.959  75.636  1.00 32.91  ? 419 PHE B CE2 1 
ATOM   6632  C  CZ  . PHE B 1 419 ? 30.009  63.043  76.956  1.00 31.55  ? 419 PHE B CZ  1 
ATOM   6633  N  N   . GLY B 1 420 ? 27.247  66.542  72.907  1.00 19.04  ? 420 GLY B N   1 
ATOM   6634  C  CA  . GLY B 1 420 ? 26.096  65.811  72.410  1.00 16.17  ? 420 GLY B CA  1 
ATOM   6635  C  C   . GLY B 1 420 ? 25.846  66.038  70.934  1.00 14.74  ? 420 GLY B C   1 
ATOM   6636  O  O   . GLY B 1 420 ? 26.731  66.509  70.216  1.00 14.63  ? 420 GLY B O   1 
ATOM   6637  N  N   . ALA B 1 421 ? 24.625  65.731  70.502  1.00 12.61  ? 421 ALA B N   1 
ATOM   6638  C  CA  . ALA B 1 421 ? 24.198  65.881  69.118  1.00 10.77  ? 421 ALA B CA  1 
ATOM   6639  C  C   . ALA B 1 421 ? 22.857  66.607  69.120  1.00 11.63  ? 421 ALA B C   1 
ATOM   6640  O  O   . ALA B 1 421 ? 22.053  66.430  70.026  1.00 14.72  ? 421 ALA B O   1 
ATOM   6641  C  CB  . ALA B 1 421 ? 24.043  64.520  68.486  1.00 14.64  ? 421 ALA B CB  1 
ATOM   6642  N  N   . GLN B 1 422 ? 22.584  67.382  68.084  1.00 11.70  ? 422 GLN B N   1 
ATOM   6643  C  CA  . GLN B 1 422 ? 21.334  68.104  68.038  1.00 11.66  ? 422 GLN B CA  1 
ATOM   6644  C  C   . GLN B 1 422 ? 20.998  68.469  66.611  1.00 13.73  ? 422 GLN B C   1 
ATOM   6645  O  O   . GLN B 1 422 ? 21.891  68.578  65.787  1.00 16.08  ? 422 GLN B O   1 
ATOM   6646  C  CB  . GLN B 1 422 ? 21.477  69.404  68.830  1.00 7.78   ? 422 GLN B CB  1 
ATOM   6647  C  CG  . GLN B 1 422 ? 20.192  70.160  68.965  1.00 6.30   ? 422 GLN B CG  1 
ATOM   6648  C  CD  . GLN B 1 422 ? 20.412  71.635  69.105  1.00 10.28  ? 422 GLN B CD  1 
ATOM   6649  O  OE1 . GLN B 1 422 ? 21.372  72.180  68.569  1.00 15.85  ? 422 GLN B OE1 1 
ATOM   6650  N  NE2 . GLN B 1 422 ? 19.524  72.303  69.834  1.00 9.43   ? 422 GLN B NE2 1 
ATOM   6651  N  N   . MET B 1 423 ? 19.711  68.636  66.324  1.00 11.92  ? 423 MET B N   1 
ATOM   6652  C  CA  . MET B 1 423 ? 19.257  69.083  65.011  1.00 12.58  ? 423 MET B CA  1 
ATOM   6653  C  C   . MET B 1 423 ? 18.470  70.367  65.247  1.00 12.76  ? 423 MET B C   1 
ATOM   6654  O  O   . MET B 1 423 ? 17.941  70.588  66.337  1.00 17.40  ? 423 MET B O   1 
ATOM   6655  C  CB  . MET B 1 423 ? 18.351  68.049  64.321  1.00 8.62   ? 423 MET B CB  1 
ATOM   6656  C  CG  . MET B 1 423 ? 16.977  67.855  64.939  1.00 6.09   ? 423 MET B CG  1 
ATOM   6657  S  SD  . MET B 1 423 ? 15.783  69.113  64.510  1.00 12.76  ? 423 MET B SD  1 
ATOM   6658  C  CE  . MET B 1 423 ? 14.265  68.354  64.899  1.00 2.00   ? 423 MET B CE  1 
ATOM   6659  N  N   . GLU B 1 424 ? 18.488  71.258  64.269  1.00 14.81  ? 424 GLU B N   1 
ATOM   6660  C  CA  . GLU B 1 424 ? 17.711  72.485  64.343  1.00 11.93  ? 424 GLU B CA  1 
ATOM   6661  C  C   . GLU B 1 424 ? 17.202  72.714  62.935  1.00 13.94  ? 424 GLU B C   1 
ATOM   6662  O  O   . GLU B 1 424 ? 17.923  72.468  61.965  1.00 15.63  ? 424 GLU B O   1 
ATOM   6663  C  CB  . GLU B 1 424 ? 18.532  73.684  64.790  1.00 10.77  ? 424 GLU B CB  1 
ATOM   6664  C  CG  . GLU B 1 424 ? 17.680  74.941  64.788  1.00 9.91   ? 424 GLU B CG  1 
ATOM   6665  C  CD  . GLU B 1 424 ? 18.385  76.150  65.320  1.00 15.33  ? 424 GLU B CD  1 
ATOM   6666  O  OE1 . GLU B 1 424 ? 19.428  76.524  64.752  1.00 13.46  ? 424 GLU B OE1 1 
ATOM   6667  O  OE2 . GLU B 1 424 ? 17.887  76.733  66.305  1.00 15.17  ? 424 GLU B OE2 1 
ATOM   6668  N  N   . ILE B 1 425 ? 15.969  73.188  62.814  1.00 12.98  ? 425 ILE B N   1 
ATOM   6669  C  CA  . ILE B 1 425 ? 15.401  73.428  61.510  1.00 10.50  ? 425 ILE B CA  1 
ATOM   6670  C  C   . ILE B 1 425 ? 14.267  74.423  61.542  1.00 12.84  ? 425 ILE B C   1 
ATOM   6671  O  O   . ILE B 1 425 ? 13.605  74.583  62.555  1.00 18.37  ? 425 ILE B O   1 
ATOM   6672  C  CB  . ILE B 1 425 ? 14.835  72.113  60.918  1.00 9.22   ? 425 ILE B CB  1 
ATOM   6673  C  CG1 . ILE B 1 425 ? 14.288  72.351  59.496  1.00 10.48  ? 425 ILE B CG1 1 
ATOM   6674  C  CG2 . ILE B 1 425 ? 13.735  71.581  61.809  1.00 6.63   ? 425 ILE B CG2 1 
ATOM   6675  C  CD1 . ILE B 1 425 ? 13.566  71.141  58.878  1.00 5.64   ? 425 ILE B CD1 1 
ATOM   6676  N  N   . TRP B 1 426 ? 14.145  75.191  60.471  1.00 11.94  ? 426 TRP B N   1 
ATOM   6677  C  CA  . TRP B 1 426 ? 13.011  76.077  60.290  1.00 14.63  ? 426 TRP B CA  1 
ATOM   6678  C  C   . TRP B 1 426 ? 12.644  75.826  58.835  1.00 16.52  ? 426 TRP B C   1 
ATOM   6679  O  O   . TRP B 1 426 ? 13.509  75.550  58.003  1.00 16.94  ? 426 TRP B O   1 
ATOM   6680  C  CB  . TRP B 1 426 ? 13.265  77.547  60.641  1.00 14.35  ? 426 TRP B CB  1 
ATOM   6681  C  CG  . TRP B 1 426 ? 14.494  78.173  60.125  1.00 21.30  ? 426 TRP B CG  1 
ATOM   6682  C  CD1 . TRP B 1 426 ? 14.777  78.479  58.825  1.00 25.06  ? 426 TRP B CD1 1 
ATOM   6683  C  CD2 . TRP B 1 426 ? 15.596  78.672  60.905  1.00 24.32  ? 426 TRP B CD2 1 
ATOM   6684  N  NE1 . TRP B 1 426 ? 15.979  79.140  58.748  1.00 28.94  ? 426 TRP B NE1 1 
ATOM   6685  C  CE2 . TRP B 1 426 ? 16.503  79.273  60.007  1.00 24.46  ? 426 TRP B CE2 1 
ATOM   6686  C  CE3 . TRP B 1 426 ? 15.902  78.669  62.276  1.00 16.38  ? 426 TRP B CE3 1 
ATOM   6687  C  CZ2 . TRP B 1 426 ? 17.700  79.868  60.435  1.00 23.13  ? 426 TRP B CZ2 1 
ATOM   6688  C  CZ3 . TRP B 1 426 ? 17.092  79.260  62.697  1.00 18.12  ? 426 TRP B CZ3 1 
ATOM   6689  C  CH2 . TRP B 1 426 ? 17.974  79.851  61.778  1.00 21.91  ? 426 TRP B CH2 1 
ATOM   6690  N  N   . TRP B 1 427 ? 11.355  75.750  58.567  1.00 13.89  ? 427 TRP B N   1 
ATOM   6691  C  CA  . TRP B 1 427 ? 10.895  75.452  57.232  1.00 11.73  ? 427 TRP B CA  1 
ATOM   6692  C  C   . TRP B 1 427 ? 9.626   76.213  56.915  1.00 15.76  ? 427 TRP B C   1 
ATOM   6693  O  O   . TRP B 1 427 ? 9.155   76.075  55.768  1.00 20.46  ? 427 TRP B O   1 
ATOM   6694  C  CB  . TRP B 1 427 ? 10.636  73.951  57.112  1.00 8.78   ? 427 TRP B CB  1 
ATOM   6695  C  CG  . TRP B 1 427 ? 9.466   73.478  57.887  1.00 11.24  ? 427 TRP B CG  1 
ATOM   6696  C  CD1 . TRP B 1 427 ? 8.195   73.308  57.424  1.00 13.71  ? 427 TRP B CD1 1 
ATOM   6697  C  CD2 . TRP B 1 427 ? 9.431   73.153  59.282  1.00 14.81  ? 427 TRP B CD2 1 
ATOM   6698  N  NE1 . TRP B 1 427 ? 7.362   72.909  58.449  1.00 17.02  ? 427 TRP B NE1 1 
ATOM   6699  C  CE2 . TRP B 1 427 ? 8.096   72.807  59.599  1.00 16.67  ? 427 TRP B CE2 1 
ATOM   6700  C  CE3 . TRP B 1 427 ? 10.397  73.126  60.299  1.00 12.81  ? 427 TRP B CE3 1 
ATOM   6701  C  CZ2 . TRP B 1 427 ? 7.704   72.444  60.885  1.00 19.09  ? 427 TRP B CZ2 1 
ATOM   6702  C  CZ3 . TRP B 1 427 ? 10.008  72.765  61.575  1.00 13.41  ? 427 TRP B CZ3 1 
ATOM   6703  C  CH2 . TRP B 1 427 ? 8.671   72.429  61.859  1.00 16.21  ? 427 TRP B CH2 1 
ATOM   6704  O  OXT . TRP B 1 427 ? 9.120   76.919  57.816  1.00 18.94  ? 427 TRP B OXT 1 
ATOM   6705  N  N   . VAL C 1 1   ? -3.058  65.659  51.421  1.00 27.11  ? 1   VAL C N   1 
ATOM   6706  C  CA  . VAL C 1 1   ? -3.854  65.799  52.661  1.00 22.65  ? 1   VAL C CA  1 
ATOM   6707  C  C   . VAL C 1 1   ? -4.845  66.953  52.549  1.00 21.54  ? 1   VAL C C   1 
ATOM   6708  O  O   . VAL C 1 1   ? -4.500  68.019  52.029  1.00 22.89  ? 1   VAL C O   1 
ATOM   6709  C  CB  . VAL C 1 1   ? -2.926  66.013  53.896  1.00 21.61  ? 1   VAL C CB  1 
ATOM   6710  C  CG1 . VAL C 1 1   ? -2.062  67.250  53.718  1.00 21.44  ? 1   VAL C CG1 1 
ATOM   6711  C  CG2 . VAL C 1 1   ? -3.761  66.116  55.160  1.00 22.99  ? 1   VAL C CG2 1 
ATOM   6712  N  N   . ASP C 1 2   ? -6.076  66.718  53.003  1.00 18.28  ? 2   ASP C N   1 
ATOM   6713  C  CA  . ASP C 1 2   ? -7.130  67.731  52.995  1.00 15.82  ? 2   ASP C CA  1 
ATOM   6714  C  C   . ASP C 1 2   ? -7.074  68.452  54.322  1.00 13.70  ? 2   ASP C C   1 
ATOM   6715  O  O   . ASP C 1 2   ? -7.077  67.814  55.358  1.00 17.75  ? 2   ASP C O   1 
ATOM   6716  C  CB  . ASP C 1 2   ? -8.513  67.094  52.834  1.00 17.63  ? 2   ASP C CB  1 
ATOM   6717  C  CG  . ASP C 1 2   ? -8.643  66.299  51.554  1.00 23.17  ? 2   ASP C CG  1 
ATOM   6718  O  OD1 . ASP C 1 2   ? -7.909  66.591  50.593  1.00 30.03  ? 2   ASP C OD1 1 
ATOM   6719  O  OD2 . ASP C 1 2   ? -9.466  65.366  51.503  1.00 22.24  ? 2   ASP C OD2 1 
ATOM   6720  N  N   . PHE C 1 3   ? -7.009  69.779  54.277  1.00 13.52  ? 3   PHE C N   1 
ATOM   6721  C  CA  . PHE C 1 3   ? -6.952  70.619  55.464  1.00 12.50  ? 3   PHE C CA  1 
ATOM   6722  C  C   . PHE C 1 3   ? -8.266  71.389  55.544  1.00 14.70  ? 3   PHE C C   1 
ATOM   6723  O  O   . PHE C 1 3   ? -8.630  72.094  54.613  1.00 16.62  ? 3   PHE C O   1 
ATOM   6724  C  CB  . PHE C 1 3   ? -5.769  71.580  55.344  1.00 10.99  ? 3   PHE C CB  1 
ATOM   6725  C  CG  . PHE C 1 3   ? -5.620  72.537  56.499  1.00 14.64  ? 3   PHE C CG  1 
ATOM   6726  C  CD1 . PHE C 1 3   ? -5.737  72.101  57.812  1.00 13.68  ? 3   PHE C CD1 1 
ATOM   6727  C  CD2 . PHE C 1 3   ? -5.296  73.869  56.265  1.00 12.75  ? 3   PHE C CD2 1 
ATOM   6728  C  CE1 . PHE C 1 3   ? -5.525  72.977  58.868  1.00 12.38  ? 3   PHE C CE1 1 
ATOM   6729  C  CE2 . PHE C 1 3   ? -5.083  74.748  57.314  1.00 6.53   ? 3   PHE C CE2 1 
ATOM   6730  C  CZ  . PHE C 1 3   ? -5.196  74.300  58.615  1.00 8.95   ? 3   PHE C CZ  1 
ATOM   6731  N  N   . HIS C 1 4   ? -8.987  71.240  56.647  1.00 14.08  ? 4   HIS C N   1 
ATOM   6732  C  CA  . HIS C 1 4   ? -10.262 71.909  56.825  1.00 9.19   ? 4   HIS C CA  1 
ATOM   6733  C  C   . HIS C 1 4   ? -10.417 72.242  58.283  1.00 10.49  ? 4   HIS C C   1 
ATOM   6734  O  O   . HIS C 1 4   ? -9.623  71.784  59.096  1.00 11.35  ? 4   HIS C O   1 
ATOM   6735  C  CB  . HIS C 1 4   ? -11.383 70.975  56.450  1.00 10.64  ? 4   HIS C CB  1 
ATOM   6736  C  CG  . HIS C 1 4   ? -11.422 70.630  54.998  1.00 18.29  ? 4   HIS C CG  1 
ATOM   6737  N  ND1 . HIS C 1 4   ? -11.665 71.568  54.021  1.00 15.53  ? 4   HIS C ND1 1 
ATOM   6738  C  CD2 . HIS C 1 4   ? -11.269 69.450  54.356  1.00 16.22  ? 4   HIS C CD2 1 
ATOM   6739  C  CE1 . HIS C 1 4   ? -11.656 70.986  52.839  1.00 15.29  ? 4   HIS C CE1 1 
ATOM   6740  N  NE2 . HIS C 1 4   ? -11.418 69.701  53.014  1.00 17.24  ? 4   HIS C NE2 1 
ATOM   6741  N  N   . GLY C 1 5   ? -11.447 73.012  58.622  1.00 8.90   ? 5   GLY C N   1 
ATOM   6742  C  CA  . GLY C 1 5   ? -11.674 73.355  60.004  1.00 9.47   ? 5   GLY C CA  1 
ATOM   6743  C  C   . GLY C 1 5   ? -12.486 74.612  60.219  1.00 12.68  ? 5   GLY C C   1 
ATOM   6744  O  O   . GLY C 1 5   ? -13.195 75.081  59.332  1.00 14.70  ? 5   GLY C O   1 
ATOM   6745  N  N   . TYR C 1 6   ? -12.347 75.181  61.408  1.00 10.85  ? 6   TYR C N   1 
ATOM   6746  C  CA  . TYR C 1 6   ? -13.060 76.386  61.791  1.00 8.39   ? 6   TYR C CA  1 
ATOM   6747  C  C   . TYR C 1 6   ? -12.183 77.100  62.791  1.00 9.66   ? 6   TYR C C   1 
ATOM   6748  O  O   . TYR C 1 6   ? -11.422 76.461  63.519  1.00 16.30  ? 6   TYR C O   1 
ATOM   6749  C  CB  . TYR C 1 6   ? -14.410 76.030  62.445  1.00 6.63   ? 6   TYR C CB  1 
ATOM   6750  C  CG  . TYR C 1 6   ? -15.095 77.208  63.119  1.00 12.11  ? 6   TYR C CG  1 
ATOM   6751  C  CD1 . TYR C 1 6   ? -14.768 77.573  64.428  1.00 11.73  ? 6   TYR C CD1 1 
ATOM   6752  C  CD2 . TYR C 1 6   ? -15.981 78.033  62.414  1.00 9.67   ? 6   TYR C CD2 1 
ATOM   6753  C  CE1 . TYR C 1 6   ? -15.289 78.733  65.008  1.00 9.90   ? 6   TYR C CE1 1 
ATOM   6754  C  CE2 . TYR C 1 6   ? -16.510 79.206  62.997  1.00 8.17   ? 6   TYR C CE2 1 
ATOM   6755  C  CZ  . TYR C 1 6   ? -16.153 79.545  64.290  1.00 11.26  ? 6   TYR C CZ  1 
ATOM   6756  O  OH  . TYR C 1 6   ? -16.634 80.706  64.865  1.00 15.23  ? 6   TYR C OH  1 
ATOM   6757  N  N   . ALA C 1 7   ? -12.258 78.421  62.810  1.00 7.86   ? 7   ALA C N   1 
ATOM   6758  C  CA  . ALA C 1 7   ? -11.499 79.202  63.767  1.00 8.97   ? 7   ALA C CA  1 
ATOM   6759  C  C   . ALA C 1 7   ? -12.086 80.585  63.915  1.00 10.92  ? 7   ALA C C   1 
ATOM   6760  O  O   . ALA C 1 7   ? -12.741 81.073  63.002  1.00 13.38  ? 7   ALA C O   1 
ATOM   6761  C  CB  . ALA C 1 7   ? -10.049 79.293  63.349  1.00 7.28   ? 7   ALA C CB  1 
ATOM   6762  N  N   . ARG C 1 8   ? -11.964 81.148  65.113  1.00 8.34   ? 8   ARG C N   1 
ATOM   6763  C  CA  . ARG C 1 8   ? -12.394 82.515  65.407  1.00 6.87   ? 8   ARG C CA  1 
ATOM   6764  C  C   . ARG C 1 8   ? -11.379 83.021  66.416  1.00 9.16   ? 8   ARG C C   1 
ATOM   6765  O  O   . ARG C 1 8   ? -10.882 82.246  67.238  1.00 11.81  ? 8   ARG C O   1 
ATOM   6766  C  CB  . ARG C 1 8   ? -13.813 82.600  65.980  1.00 6.44   ? 8   ARG C CB  1 
ATOM   6767  C  CG  . ARG C 1 8   ? -14.020 81.939  67.315  1.00 11.11  ? 8   ARG C CG  1 
ATOM   6768  C  CD  . ARG C 1 8   ? -15.317 82.413  67.944  1.00 12.38  ? 8   ARG C CD  1 
ATOM   6769  N  NE  . ARG C 1 8   ? -15.713 81.550  69.046  1.00 7.76   ? 8   ARG C NE  1 
ATOM   6770  C  CZ  . ARG C 1 8   ? -16.395 80.414  68.900  1.00 13.38  ? 8   ARG C CZ  1 
ATOM   6771  N  NH1 . ARG C 1 8   ? -16.760 79.999  67.693  1.00 13.74  ? 8   ARG C NH1 1 
ATOM   6772  N  NH2 . ARG C 1 8   ? -16.706 79.676  69.960  1.00 13.74  ? 8   ARG C NH2 1 
ATOM   6773  N  N   . SER C 1 9   ? -11.012 84.290  66.308  1.00 5.55   ? 9   SER C N   1 
ATOM   6774  C  CA  . SER C 1 9   ? -10.039 84.883  67.212  1.00 7.05   ? 9   SER C CA  1 
ATOM   6775  C  C   . SER C 1 9   ? -10.153 86.392  67.054  1.00 10.72  ? 9   SER C C   1 
ATOM   6776  O  O   . SER C 1 9   ? -10.460 86.887  65.961  1.00 17.08  ? 9   SER C O   1 
ATOM   6777  C  CB  . SER C 1 9   ? -8.627  84.423  66.841  1.00 7.09   ? 9   SER C CB  1 
ATOM   6778  O  OG  . SER C 1 9   ? -7.667  84.851  67.796  1.00 12.88  ? 9   SER C OG  1 
ATOM   6779  N  N   . GLY C 1 10  ? -9.964  87.120  68.149  1.00 13.47  ? 10  GLY C N   1 
ATOM   6780  C  CA  . GLY C 1 10  ? -10.053 88.567  68.104  1.00 11.57  ? 10  GLY C CA  1 
ATOM   6781  C  C   . GLY C 1 10  ? -9.570  89.240  69.377  1.00 14.35  ? 10  GLY C C   1 
ATOM   6782  O  O   . GLY C 1 10  ? -8.929  88.611  70.230  1.00 14.06  ? 10  GLY C O   1 
ATOM   6783  N  N   . ILE C 1 11  ? -9.861  90.533  69.486  1.00 14.10  ? 11  ILE C N   1 
ATOM   6784  C  CA  . ILE C 1 11  ? -9.485  91.340  70.636  1.00 12.04  ? 11  ILE C CA  1 
ATOM   6785  C  C   . ILE C 1 11  ? -10.639 92.304  70.858  1.00 14.63  ? 11  ILE C C   1 
ATOM   6786  O  O   . ILE C 1 11  ? -11.220 92.812  69.903  1.00 13.81  ? 11  ILE C O   1 
ATOM   6787  C  CB  . ILE C 1 11  ? -8.167  92.103  70.388  1.00 12.40  ? 11  ILE C CB  1 
ATOM   6788  C  CG1 . ILE C 1 11  ? -7.773  92.911  71.626  1.00 8.97   ? 11  ILE C CG1 1 
ATOM   6789  C  CG2 . ILE C 1 11  ? -8.280  92.993  69.171  1.00 9.40   ? 11  ILE C CG2 1 
ATOM   6790  C  CD1 . ILE C 1 11  ? -6.380  93.531  71.543  1.00 5.01   ? 11  ILE C CD1 1 
ATOM   6791  N  N   . GLY C 1 12  ? -11.014 92.501  72.111  1.00 14.20  ? 12  GLY C N   1 
ATOM   6792  C  CA  . GLY C 1 12  ? -12.126 93.377  72.407  1.00 17.13  ? 12  GLY C CA  1 
ATOM   6793  C  C   . GLY C 1 12  ? -11.977 94.127  73.714  1.00 18.44  ? 12  GLY C C   1 
ATOM   6794  O  O   . GLY C 1 12  ? -11.123 93.795  74.541  1.00 17.10  ? 12  GLY C O   1 
ATOM   6795  N  N   . TRP C 1 13  ? -12.829 95.133  73.890  1.00 17.31  ? 13  TRP C N   1 
ATOM   6796  C  CA  . TRP C 1 13  ? -12.840 95.986  75.068  1.00 15.81  ? 13  TRP C CA  1 
ATOM   6797  C  C   . TRP C 1 13  ? -14.262 96.190  75.555  1.00 18.77  ? 13  TRP C C   1 
ATOM   6798  O  O   . TRP C 1 13  ? -15.212 96.175  74.762  1.00 19.78  ? 13  TRP C O   1 
ATOM   6799  C  CB  . TRP C 1 13  ? -12.263 97.354  74.719  1.00 14.86  ? 13  TRP C CB  1 
ATOM   6800  C  CG  . TRP C 1 13  ? -10.807 97.339  74.369  1.00 15.77  ? 13  TRP C CG  1 
ATOM   6801  C  CD1 . TRP C 1 13  ? -9.758  97.492  75.225  1.00 15.62  ? 13  TRP C CD1 1 
ATOM   6802  C  CD2 . TRP C 1 13  ? -10.237 97.140  73.068  1.00 16.93  ? 13  TRP C CD2 1 
ATOM   6803  N  NE1 . TRP C 1 13  ? -8.571  97.392  74.543  1.00 17.64  ? 13  TRP C NE1 1 
ATOM   6804  C  CE2 . TRP C 1 13  ? -8.835  97.179  73.216  1.00 18.16  ? 13  TRP C CE2 1 
ATOM   6805  C  CE3 . TRP C 1 13  ? -10.776 96.935  71.793  1.00 18.56  ? 13  TRP C CE3 1 
ATOM   6806  C  CZ2 . TRP C 1 13  ? -7.963  97.021  72.134  1.00 18.01  ? 13  TRP C CZ2 1 
ATOM   6807  C  CZ3 . TRP C 1 13  ? -9.908  96.778  70.717  1.00 15.13  ? 13  TRP C CZ3 1 
ATOM   6808  C  CH2 . TRP C 1 13  ? -8.518  96.822  70.897  1.00 16.08  ? 13  TRP C CH2 1 
ATOM   6809  N  N   . THR C 1 14  ? -14.410 96.344  76.866  1.00 20.64  ? 14  THR C N   1 
ATOM   6810  C  CA  . THR C 1 14  ? -15.710 96.604  77.449  1.00 18.17  ? 14  THR C CA  1 
ATOM   6811  C  C   . THR C 1 14  ? -15.739 98.098  77.660  1.00 17.99  ? 14  THR C C   1 
ATOM   6812  O  O   . THR C 1 14  ? -14.762 98.675  78.116  1.00 18.93  ? 14  THR C O   1 
ATOM   6813  C  CB  . THR C 1 14  ? -15.878 95.902  78.776  1.00 19.23  ? 14  THR C CB  1 
ATOM   6814  O  OG1 . THR C 1 14  ? -15.909 94.491  78.552  1.00 20.40  ? 14  THR C OG1 1 
ATOM   6815  C  CG2 . THR C 1 14  ? -17.162 96.319  79.427  1.00 18.23  ? 14  THR C CG2 1 
ATOM   6816  N  N   . GLY C 1 15  ? -16.839 98.730  77.288  1.00 19.36  ? 15  GLY C N   1 
ATOM   6817  C  CA  . GLY C 1 15  ? -16.969 100.171 77.430  1.00 18.94  ? 15  GLY C CA  1 
ATOM   6818  C  C   . GLY C 1 15  ? -16.585 100.720 78.790  1.00 22.43  ? 15  GLY C C   1 
ATOM   6819  O  O   . GLY C 1 15  ? -15.895 101.728 78.858  1.00 26.10  ? 15  GLY C O   1 
ATOM   6820  N  N   . SER C 1 16  ? -17.006 100.054 79.865  1.00 24.63  ? 16  SER C N   1 
ATOM   6821  C  CA  . SER C 1 16  ? -16.705 100.511 81.221  1.00 23.31  ? 16  SER C CA  1 
ATOM   6822  C  C   . SER C 1 16  ? -15.318 100.153 81.728  1.00 25.74  ? 16  SER C C   1 
ATOM   6823  O  O   . SER C 1 16  ? -14.950 100.557 82.832  1.00 31.00  ? 16  SER C O   1 
ATOM   6824  C  CB  . SER C 1 16  ? -17.744 99.995  82.207  1.00 22.53  ? 16  SER C CB  1 
ATOM   6825  O  OG  . SER C 1 16  ? -17.834 98.583  82.160  1.00 24.62  ? 16  SER C OG  1 
ATOM   6826  N  N   . GLY C 1 17  ? -14.571 99.359  80.962  1.00 27.03  ? 17  GLY C N   1 
ATOM   6827  C  CA  . GLY C 1 17  ? -13.231 98.989  81.378  1.00 20.59  ? 17  GLY C CA  1 
ATOM   6828  C  C   . GLY C 1 17  ? -12.824 97.549  81.178  1.00 20.54  ? 17  GLY C C   1 
ATOM   6829  O  O   . GLY C 1 17  ? -13.644 96.632  81.269  1.00 22.88  ? 17  GLY C O   1 
ATOM   6830  N  N   . GLY C 1 18  ? -11.540 97.361  80.887  1.00 19.67  ? 18  GLY C N   1 
ATOM   6831  C  CA  . GLY C 1 18  ? -10.964 96.038  80.696  1.00 18.63  ? 18  GLY C CA  1 
ATOM   6832  C  C   . GLY C 1 18  ? -11.314 95.316  79.412  1.00 17.51  ? 18  GLY C C   1 
ATOM   6833  O  O   . GLY C 1 18  ? -11.876 95.898  78.481  1.00 15.55  ? 18  GLY C O   1 
ATOM   6834  N  N   . GLU C 1 19  ? -10.971 94.033  79.385  1.00 16.51  ? 19  GLU C N   1 
ATOM   6835  C  CA  . GLU C 1 19  ? -11.238 93.143  78.257  1.00 19.48  ? 19  GLU C CA  1 
ATOM   6836  C  C   . GLU C 1 19  ? -12.715 93.097  77.938  1.00 22.32  ? 19  GLU C C   1 
ATOM   6837  O  O   . GLU C 1 19  ? -13.563 93.406  78.776  1.00 24.58  ? 19  GLU C O   1 
ATOM   6838  C  CB  . GLU C 1 19  ? -10.865 91.690  78.575  1.00 18.95  ? 19  GLU C CB  1 
ATOM   6839  C  CG  . GLU C 1 19  ? -9.878  91.456  79.695  1.00 32.11  ? 19  GLU C CG  1 
ATOM   6840  C  CD  . GLU C 1 19  ? -10.490 91.559  81.084  1.00 27.09  ? 19  GLU C CD  1 
ATOM   6841  O  OE1 . GLU C 1 19  ? -11.228 90.639  81.495  1.00 27.13  ? 19  GLU C OE1 1 
ATOM   6842  O  OE2 . GLU C 1 19  ? -10.202 92.555  81.772  1.00 28.84  ? 19  GLU C OE2 1 
ATOM   6843  N  N   . GLN C 1 20  ? -13.008 92.563  76.764  1.00 21.98  ? 20  GLN C N   1 
ATOM   6844  C  CA  . GLN C 1 20  ? -14.363 92.404  76.292  1.00 19.85  ? 20  GLN C CA  1 
ATOM   6845  C  C   . GLN C 1 20  ? -15.081 91.410  77.183  1.00 21.59  ? 20  GLN C C   1 
ATOM   6846  O  O   . GLN C 1 20  ? -14.462 90.492  77.723  1.00 23.41  ? 20  GLN C O   1 
ATOM   6847  C  CB  . GLN C 1 20  ? -14.332 91.861  74.861  1.00 17.83  ? 20  GLN C CB  1 
ATOM   6848  C  CG  . GLN C 1 20  ? -15.685 91.551  74.243  1.00 15.05  ? 20  GLN C CG  1 
ATOM   6849  C  CD  . GLN C 1 20  ? -15.549 90.946  72.859  1.00 15.55  ? 20  GLN C CD  1 
ATOM   6850  O  OE1 . GLN C 1 20  ? -14.436 90.692  72.387  1.00 21.14  ? 20  GLN C OE1 1 
ATOM   6851  N  NE2 . GLN C 1 20  ? -16.675 90.705  72.204  1.00 10.63  ? 20  GLN C NE2 1 
ATOM   6852  N  N   . GLN C 1 21  ? -16.387 91.607  77.341  1.00 22.98  ? 21  GLN C N   1 
ATOM   6853  C  CA  . GLN C 1 21  ? -17.234 90.714  78.119  1.00 20.64  ? 21  GLN C CA  1 
ATOM   6854  C  C   . GLN C 1 21  ? -18.335 90.258  77.169  1.00 20.17  ? 21  GLN C C   1 
ATOM   6855  O  O   . GLN C 1 21  ? -18.712 90.999  76.272  1.00 22.45  ? 21  GLN C O   1 
ATOM   6856  C  CB  . GLN C 1 21  ? -17.837 91.442  79.318  1.00 24.39  ? 21  GLN C CB  1 
ATOM   6857  C  CG  . GLN C 1 21  ? -16.882 91.597  80.496  1.00 33.14  ? 21  GLN C CG  1 
ATOM   6858  C  CD  . GLN C 1 21  ? -17.415 92.541  81.562  1.00 38.11  ? 21  GLN C CD  1 
ATOM   6859  O  OE1 . GLN C 1 21  ? -18.590 92.489  81.922  1.00 44.23  ? 21  GLN C OE1 1 
ATOM   6860  N  NE2 . GLN C 1 21  ? -16.553 93.416  82.064  1.00 39.57  ? 21  GLN C NE2 1 
ATOM   6861  N  N   . CYS C 1 22  ? -18.799 89.023  77.327  1.00 17.33  ? 22  CYS C N   1 
ATOM   6862  C  CA  . CYS C 1 22  ? -19.844 88.473  76.477  1.00 16.26  ? 22  CYS C CA  1 
ATOM   6863  C  C   . CYS C 1 22  ? -21.152 88.348  77.243  1.00 18.74  ? 22  CYS C C   1 
ATOM   6864  O  O   . CYS C 1 22  ? -21.158 88.001  78.418  1.00 23.07  ? 22  CYS C O   1 
ATOM   6865  C  CB  . CYS C 1 22  ? -19.386 87.154  75.896  1.00 17.68  ? 22  CYS C CB  1 
ATOM   6866  S  SG  . CYS C 1 22  ? -18.196 87.462  74.571  1.00 16.45  ? 22  CYS C SG  1 
ATOM   6867  N  N   . PHE C 1 23  ? -22.260 88.592  76.554  1.00 18.73  ? 23  PHE C N   1 
ATOM   6868  C  CA  . PHE C 1 23  ? -23.569 88.620  77.173  1.00 15.29  ? 23  PHE C CA  1 
ATOM   6869  C  C   . PHE C 1 23  ? -24.541 87.521  76.799  1.00 16.39  ? 23  PHE C C   1 
ATOM   6870  O  O   . PHE C 1 23  ? -24.962 87.422  75.655  1.00 19.13  ? 23  PHE C O   1 
ATOM   6871  C  CB  . PHE C 1 23  ? -24.200 89.983  76.872  1.00 13.96  ? 23  PHE C CB  1 
ATOM   6872  C  CG  . PHE C 1 23  ? -23.236 91.143  77.012  1.00 18.96  ? 23  PHE C CG  1 
ATOM   6873  C  CD1 . PHE C 1 23  ? -22.754 91.529  78.262  1.00 16.80  ? 23  PHE C CD1 1 
ATOM   6874  C  CD2 . PHE C 1 23  ? -22.779 91.827  75.887  1.00 16.11  ? 23  PHE C CD2 1 
ATOM   6875  C  CE1 . PHE C 1 23  ? -21.827 92.578  78.389  1.00 19.06  ? 23  PHE C CE1 1 
ATOM   6876  C  CE2 . PHE C 1 23  ? -21.848 92.879  76.009  1.00 15.86  ? 23  PHE C CE2 1 
ATOM   6877  C  CZ  . PHE C 1 23  ? -21.375 93.249  77.258  1.00 14.39  ? 23  PHE C CZ  1 
ATOM   6878  N  N   . GLN C 1 24  ? -24.947 86.741  77.790  1.00 17.24  ? 24  GLN C N   1 
ATOM   6879  C  CA  . GLN C 1 24  ? -25.908 85.664  77.594  1.00 18.66  ? 24  GLN C CA  1 
ATOM   6880  C  C   . GLN C 1 24  ? -26.918 85.688  78.744  1.00 20.81  ? 24  GLN C C   1 
ATOM   6881  O  O   . GLN C 1 24  ? -26.539 85.789  79.915  1.00 23.86  ? 24  GLN C O   1 
ATOM   6882  C  CB  . GLN C 1 24  ? -25.201 84.316  77.550  1.00 13.77  ? 24  GLN C CB  1 
ATOM   6883  C  CG  . GLN C 1 24  ? -26.141 83.138  77.417  1.00 16.51  ? 24  GLN C CG  1 
ATOM   6884  C  CD  . GLN C 1 24  ? -25.399 81.825  77.240  1.00 19.37  ? 24  GLN C CD  1 
ATOM   6885  O  OE1 . GLN C 1 24  ? -24.186 81.807  77.053  1.00 27.40  ? 24  GLN C OE1 1 
ATOM   6886  N  NE2 . GLN C 1 24  ? -26.123 80.725  77.287  1.00 23.93  ? 24  GLN C NE2 1 
ATOM   6887  N  N   . ALA C 1 25  ? -28.200 85.576  78.415  1.00 20.15  ? 25  ALA C N   1 
ATOM   6888  C  CA  . ALA C 1 25  ? -29.259 85.599  79.418  1.00 17.40  ? 25  ALA C CA  1 
ATOM   6889  C  C   . ALA C 1 25  ? -29.218 84.357  80.293  1.00 19.19  ? 25  ALA C C   1 
ATOM   6890  O  O   . ALA C 1 25  ? -29.152 83.241  79.784  1.00 21.74  ? 25  ALA C O   1 
ATOM   6891  C  CB  . ALA C 1 25  ? -30.609 85.706  78.742  1.00 16.90  ? 25  ALA C CB  1 
ATOM   6892  N  N   . THR C 1 26  ? -29.262 84.558  81.611  1.00 19.95  ? 26  THR C N   1 
ATOM   6893  C  CA  . THR C 1 26  ? -29.248 83.459  82.576  1.00 18.57  ? 26  THR C CA  1 
ATOM   6894  C  C   . THR C 1 26  ? -30.458 82.567  82.292  1.00 19.94  ? 26  THR C C   1 
ATOM   6895  O  O   . THR C 1 26  ? -31.593 83.040  82.284  1.00 18.49  ? 26  THR C O   1 
ATOM   6896  C  CB  . THR C 1 26  ? -29.318 83.995  84.032  1.00 18.92  ? 26  THR C CB  1 
ATOM   6897  O  OG1 . THR C 1 26  ? -28.220 84.882  84.279  1.00 20.21  ? 26  THR C OG1 1 
ATOM   6898  C  CG2 . THR C 1 26  ? -29.254 82.865  85.025  1.00 18.99  ? 26  THR C CG2 1 
ATOM   6899  N  N   . GLY C 1 27  ? -30.203 81.290  82.007  1.00 21.80  ? 27  GLY C N   1 
ATOM   6900  C  CA  . GLY C 1 27  ? -31.279 80.362  81.715  1.00 19.07  ? 27  GLY C CA  1 
ATOM   6901  C  C   . GLY C 1 27  ? -31.366 80.001  80.245  1.00 22.15  ? 27  GLY C C   1 
ATOM   6902  O  O   . GLY C 1 27  ? -31.944 78.968  79.897  1.00 24.48  ? 27  GLY C O   1 
ATOM   6903  N  N   . ALA C 1 28  ? -30.819 80.862  79.386  1.00 21.24  ? 28  ALA C N   1 
ATOM   6904  C  CA  . ALA C 1 28  ? -30.818 80.643  77.940  1.00 17.28  ? 28  ALA C CA  1 
ATOM   6905  C  C   . ALA C 1 28  ? -29.672 79.704  77.589  1.00 18.27  ? 28  ALA C C   1 
ATOM   6906  O  O   . ALA C 1 28  ? -28.601 79.766  78.195  1.00 21.06  ? 28  ALA C O   1 
ATOM   6907  C  CB  . ALA C 1 28  ? -30.646 81.962  77.209  1.00 11.04  ? 28  ALA C CB  1 
ATOM   6908  N  N   . GLN C 1 29  ? -29.890 78.837  76.608  1.00 18.10  ? 29  GLN C N   1 
ATOM   6909  C  CA  . GLN C 1 29  ? -28.854 77.901  76.198  1.00 17.53  ? 29  GLN C CA  1 
ATOM   6910  C  C   . GLN C 1 29  ? -27.941 78.438  75.107  1.00 19.55  ? 29  GLN C C   1 
ATOM   6911  O  O   . GLN C 1 29  ? -27.125 77.696  74.577  1.00 21.29  ? 29  GLN C O   1 
ATOM   6912  C  CB  . GLN C 1 29  ? -29.463 76.566  75.751  1.00 18.08  ? 29  GLN C CB  1 
ATOM   6913  C  CG  . GLN C 1 29  ? -30.131 75.803  76.869  1.00 18.58  ? 29  GLN C CG  1 
ATOM   6914  C  CD  . GLN C 1 29  ? -30.669 74.462  76.432  1.00 24.74  ? 29  GLN C CD  1 
ATOM   6915  O  OE1 . GLN C 1 29  ? -30.770 74.177  75.240  1.00 31.42  ? 29  GLN C OE1 1 
ATOM   6916  N  NE2 . GLN C 1 29  ? -31.035 73.634  77.395  1.00 29.91  ? 29  GLN C NE2 1 
ATOM   6917  N  N   . SER C 1 30  ? -28.036 79.726  74.793  1.00 19.13  ? 30  SER C N   1 
ATOM   6918  C  CA  . SER C 1 30  ? -27.200 80.289  73.747  1.00 17.42  ? 30  SER C CA  1 
ATOM   6919  C  C   . SER C 1 30  ? -27.201 81.805  73.824  1.00 17.68  ? 30  SER C C   1 
ATOM   6920  O  O   . SER C 1 30  ? -27.846 82.389  74.692  1.00 19.45  ? 30  SER C O   1 
ATOM   6921  C  CB  . SER C 1 30  ? -27.746 79.864  72.378  1.00 18.02  ? 30  SER C CB  1 
ATOM   6922  O  OG  . SER C 1 30  ? -29.004 80.474  72.114  1.00 15.47  ? 30  SER C OG  1 
ATOM   6923  N  N   . LYS C 1 31  ? -26.452 82.433  72.927  1.00 14.00  ? 31  LYS C N   1 
ATOM   6924  C  CA  . LYS C 1 31  ? -26.391 83.876  72.832  1.00 13.53  ? 31  LYS C CA  1 
ATOM   6925  C  C   . LYS C 1 31  ? -26.182 84.272  71.375  1.00 17.87  ? 31  LYS C C   1 
ATOM   6926  O  O   . LYS C 1 31  ? -25.760 83.454  70.538  1.00 21.49  ? 31  LYS C O   1 
ATOM   6927  C  CB  . LYS C 1 31  ? -25.279 84.452  73.702  1.00 12.06  ? 31  LYS C CB  1 
ATOM   6928  C  CG  . LYS C 1 31  ? -23.894 83.927  73.399  1.00 10.39  ? 31  LYS C CG  1 
ATOM   6929  C  CD  . LYS C 1 31  ? -22.875 84.628  74.289  1.00 9.29   ? 31  LYS C CD  1 
ATOM   6930  C  CE  . LYS C 1 31  ? -21.607 83.794  74.439  1.00 7.73   ? 31  LYS C CE  1 
ATOM   6931  N  NZ  . LYS C 1 31  ? -20.836 83.768  73.183  1.00 10.61  ? 31  LYS C NZ  1 
ATOM   6932  N  N   . TYR C 1 32  ? -26.575 85.501  71.058  1.00 18.27  ? 32  TYR C N   1 
ATOM   6933  C  CA  . TYR C 1 32  ? -26.418 86.043  69.718  1.00 14.49  ? 32  TYR C CA  1 
ATOM   6934  C  C   . TYR C 1 32  ? -24.949 86.381  69.619  1.00 17.00  ? 32  TYR C C   1 
ATOM   6935  O  O   . TYR C 1 32  ? -24.464 87.281  70.314  1.00 18.21  ? 32  TYR C O   1 
ATOM   6936  C  CB  . TYR C 1 32  ? -27.344 87.246  69.549  1.00 17.41  ? 32  TYR C CB  1 
ATOM   6937  C  CG  . TYR C 1 32  ? -28.773 86.771  69.377  1.00 16.68  ? 32  TYR C CG  1 
ATOM   6938  C  CD1 . TYR C 1 32  ? -29.250 86.402  68.112  1.00 14.03  ? 32  TYR C CD1 1 
ATOM   6939  C  CD2 . TYR C 1 32  ? -29.601 86.549  70.482  1.00 16.89  ? 32  TYR C CD2 1 
ATOM   6940  C  CE1 . TYR C 1 32  ? -30.498 85.816  67.948  1.00 14.60  ? 32  TYR C CE1 1 
ATOM   6941  C  CE2 . TYR C 1 32  ? -30.857 85.958  70.324  1.00 16.83  ? 32  TYR C CE2 1 
ATOM   6942  C  CZ  . TYR C 1 32  ? -31.291 85.593  69.050  1.00 16.48  ? 32  TYR C CZ  1 
ATOM   6943  O  OH  . TYR C 1 32  ? -32.507 84.981  68.869  1.00 17.94  ? 32  TYR C OH  1 
ATOM   6944  N  N   . ARG C 1 33  ? -24.249 85.622  68.777  1.00 13.97  ? 33  ARG C N   1 
ATOM   6945  C  CA  . ARG C 1 33  ? -22.803 85.725  68.637  1.00 12.98  ? 33  ARG C CA  1 
ATOM   6946  C  C   . ARG C 1 33  ? -22.053 86.886  67.999  1.00 14.82  ? 33  ARG C C   1 
ATOM   6947  O  O   . ARG C 1 33  ? -20.906 87.118  68.372  1.00 16.76  ? 33  ARG C O   1 
ATOM   6948  C  CB  . ARG C 1 33  ? -22.264 84.435  68.054  1.00 15.92  ? 33  ARG C CB  1 
ATOM   6949  C  CG  . ARG C 1 33  ? -22.595 84.231  66.598  1.00 14.46  ? 33  ARG C CG  1 
ATOM   6950  C  CD  . ARG C 1 33  ? -21.470 83.444  66.000  1.00 16.15  ? 33  ARG C CD  1 
ATOM   6951  N  NE  . ARG C 1 33  ? -21.872 82.095  65.684  1.00 11.39  ? 33  ARG C NE  1 
ATOM   6952  C  CZ  . ARG C 1 33  ? -21.065 81.035  65.685  1.00 12.41  ? 33  ARG C CZ  1 
ATOM   6953  N  NH1 . ARG C 1 33  ? -19.770 81.129  66.011  1.00 4.38   ? 33  ARG C NH1 1 
ATOM   6954  N  NH2 . ARG C 1 33  ? -21.549 79.883  65.252  1.00 12.88  ? 33  ARG C NH2 1 
ATOM   6955  N  N   . LEU C 1 34  ? -22.634 87.595  67.037  1.00 16.08  ? 34  LEU C N   1 
ATOM   6956  C  CA  . LEU C 1 34  ? -21.908 88.699  66.398  1.00 17.20  ? 34  LEU C CA  1 
ATOM   6957  C  C   . LEU C 1 34  ? -21.397 89.695  67.445  1.00 20.05  ? 34  LEU C C   1 
ATOM   6958  O  O   . LEU C 1 34  ? -22.184 90.277  68.201  1.00 24.56  ? 34  LEU C O   1 
ATOM   6959  C  CB  . LEU C 1 34  ? -22.788 89.424  65.367  1.00 17.82  ? 34  LEU C CB  1 
ATOM   6960  C  CG  . LEU C 1 34  ? -22.269 89.880  63.986  1.00 19.37  ? 34  LEU C CG  1 
ATOM   6961  C  CD1 . LEU C 1 34  ? -22.666 91.311  63.738  1.00 16.34  ? 34  LEU C CD1 1 
ATOM   6962  C  CD2 . LEU C 1 34  ? -20.785 89.733  63.838  1.00 10.56  ? 34  LEU C CD2 1 
ATOM   6963  N  N   . GLY C 1 35  ? -20.078 89.871  67.479  1.00 18.84  ? 35  GLY C N   1 
ATOM   6964  C  CA  . GLY C 1 35  ? -19.451 90.785  68.416  1.00 19.76  ? 35  GLY C CA  1 
ATOM   6965  C  C   . GLY C 1 35  ? -19.800 90.418  69.844  1.00 20.21  ? 35  GLY C C   1 
ATOM   6966  O  O   . GLY C 1 35  ? -19.947 91.284  70.692  1.00 21.20  ? 35  GLY C O   1 
ATOM   6967  N  N   . ASN C 1 36  ? -19.884 89.126  70.118  1.00 18.28  ? 36  ASN C N   1 
ATOM   6968  C  CA  . ASN C 1 36  ? -20.265 88.656  71.436  1.00 15.63  ? 36  ASN C CA  1 
ATOM   6969  C  C   . ASN C 1 36  ? -19.628 87.298  71.680  1.00 14.95  ? 36  ASN C C   1 
ATOM   6970  O  O   . ASN C 1 36  ? -20.245 86.397  72.256  1.00 16.79  ? 36  ASN C O   1 
ATOM   6971  C  CB  . ASN C 1 36  ? -21.795 88.552  71.495  1.00 13.46  ? 36  ASN C CB  1 
ATOM   6972  C  CG  . ASN C 1 36  ? -22.331 88.493  72.911  1.00 15.71  ? 36  ASN C CG  1 
ATOM   6973  O  OD1 . ASN C 1 36  ? -21.676 88.945  73.846  1.00 13.20  ? 36  ASN C OD1 1 
ATOM   6974  N  ND2 . ASN C 1 36  ? -23.539 87.945  73.073  1.00 9.21   ? 36  ASN C ND2 1 
ATOM   6975  N  N   . GLU C 1 37  ? -18.404 87.150  71.183  1.00 12.14  ? 37  GLU C N   1 
ATOM   6976  C  CA  . GLU C 1 37  ? -17.636 85.925  71.335  1.00 8.82   ? 37  GLU C CA  1 
ATOM   6977  C  C   . GLU C 1 37  ? -16.354 86.329  72.020  1.00 10.11  ? 37  GLU C C   1 
ATOM   6978  O  O   . GLU C 1 37  ? -15.675 87.245  71.585  1.00 14.36  ? 37  GLU C O   1 
ATOM   6979  C  CB  . GLU C 1 37  ? -17.390 85.276  69.987  1.00 9.48   ? 37  GLU C CB  1 
ATOM   6980  C  CG  . GLU C 1 37  ? -18.644 84.608  69.433  1.00 10.59  ? 37  GLU C CG  1 
ATOM   6981  C  CD  . GLU C 1 37  ? -18.494 84.195  68.002  1.00 14.61  ? 37  GLU C CD  1 
ATOM   6982  O  OE1 . GLU C 1 37  ? -17.974 84.999  67.209  1.00 12.38  ? 37  GLU C OE1 1 
ATOM   6983  O  OE2 . GLU C 1 37  ? -18.906 83.079  67.663  1.00 14.74  ? 37  GLU C OE2 1 
ATOM   6984  N  N   . CYS C 1 38  ? -16.039 85.644  73.109  1.00 13.93  ? 38  CYS C N   1 
ATOM   6985  C  CA  . CYS C 1 38  ? -14.900 85.994  73.941  1.00 15.95  ? 38  CYS C CA  1 
ATOM   6986  C  C   . CYS C 1 38  ? -13.749 85.000  74.037  1.00 17.54  ? 38  CYS C C   1 
ATOM   6987  O  O   . CYS C 1 38  ? -13.009 85.006  75.025  1.00 22.18  ? 38  CYS C O   1 
ATOM   6988  C  CB  . CYS C 1 38  ? -15.425 86.325  75.358  1.00 13.16  ? 38  CYS C CB  1 
ATOM   6989  S  SG  . CYS C 1 38  ? -16.423 87.850  75.480  1.00 13.82  ? 38  CYS C SG  1 
ATOM   6990  N  N   . GLU C 1 39  ? -13.603 84.123  73.053  1.00 16.47  ? 39  GLU C N   1 
ATOM   6991  C  CA  . GLU C 1 39  ? -12.497 83.175  73.088  1.00 14.48  ? 39  GLU C CA  1 
ATOM   6992  C  C   . GLU C 1 39  ? -12.027 82.892  71.686  1.00 16.80  ? 39  GLU C C   1 
ATOM   6993  O  O   . GLU C 1 39  ? -12.711 83.233  70.717  1.00 17.23  ? 39  GLU C O   1 
ATOM   6994  C  CB  . GLU C 1 39  ? -12.905 81.852  73.732  1.00 12.72  ? 39  GLU C CB  1 
ATOM   6995  C  CG  . GLU C 1 39  ? -13.941 81.042  72.943  1.00 11.80  ? 39  GLU C CG  1 
ATOM   6996  C  CD  . GLU C 1 39  ? -15.325 81.666  72.984  1.00 23.50  ? 39  GLU C CD  1 
ATOM   6997  O  OE1 . GLU C 1 39  ? -15.835 81.939  74.098  1.00 27.57  ? 39  GLU C OE1 1 
ATOM   6998  O  OE2 . GLU C 1 39  ? -15.909 81.889  71.907  1.00 24.16  ? 39  GLU C OE2 1 
ATOM   6999  N  N   . THR C 1 40  ? -10.823 82.342  71.595  1.00 13.71  ? 40  THR C N   1 
ATOM   7000  C  CA  . THR C 1 40  ? -10.237 81.927  70.342  1.00 11.23  ? 40  THR C CA  1 
ATOM   7001  C  C   . THR C 1 40  ? -10.546 80.432  70.324  1.00 14.44  ? 40  THR C C   1 
ATOM   7002  O  O   . THR C 1 40  ? -10.162 79.721  71.243  1.00 18.07  ? 40  THR C O   1 
ATOM   7003  C  CB  . THR C 1 40  ? -8.709  82.139  70.343  1.00 12.28  ? 40  THR C CB  1 
ATOM   7004  O  OG1 . THR C 1 40  ? -8.424  83.527  70.146  1.00 15.59  ? 40  THR C OG1 1 
ATOM   7005  C  CG2 . THR C 1 40  ? -8.024  81.327  69.248  1.00 11.30  ? 40  THR C CG2 1 
ATOM   7006  N  N   . TYR C 1 41  ? -11.308 79.980  69.339  1.00 11.87  ? 41  TYR C N   1 
ATOM   7007  C  CA  . TYR C 1 41  ? -11.649 78.576  69.213  1.00 10.41  ? 41  TYR C CA  1 
ATOM   7008  C  C   . TYR C 1 41  ? -11.191 78.156  67.825  1.00 14.30  ? 41  TYR C C   1 
ATOM   7009  O  O   . TYR C 1 41  ? -11.317 78.931  66.874  1.00 17.98  ? 41  TYR C O   1 
ATOM   7010  C  CB  . TYR C 1 41  ? -13.154 78.377  69.344  1.00 8.30   ? 41  TYR C CB  1 
ATOM   7011  C  CG  . TYR C 1 41  ? -13.559 76.938  69.203  1.00 10.68  ? 41  TYR C CG  1 
ATOM   7012  C  CD1 . TYR C 1 41  ? -13.424 76.056  70.264  1.00 11.00  ? 41  TYR C CD1 1 
ATOM   7013  C  CD2 . TYR C 1 41  ? -14.020 76.439  67.992  1.00 8.78   ? 41  TYR C CD2 1 
ATOM   7014  C  CE1 . TYR C 1 41  ? -13.733 74.703  70.120  1.00 9.74   ? 41  TYR C CE1 1 
ATOM   7015  C  CE2 . TYR C 1 41  ? -14.332 75.087  67.839  1.00 9.08   ? 41  TYR C CE2 1 
ATOM   7016  C  CZ  . TYR C 1 41  ? -14.185 74.227  68.907  1.00 10.35  ? 41  TYR C CZ  1 
ATOM   7017  O  OH  . TYR C 1 41  ? -14.499 72.896  68.772  1.00 14.06  ? 41  TYR C OH  1 
ATOM   7018  N  N   . ALA C 1 42  ? -10.649 76.948  67.704  1.00 12.30  ? 42  ALA C N   1 
ATOM   7019  C  CA  . ALA C 1 42  ? -10.179 76.474  66.421  1.00 9.28   ? 42  ALA C CA  1 
ATOM   7020  C  C   . ALA C 1 42  ? -10.240 74.967  66.312  1.00 10.91  ? 42  ALA C C   1 
ATOM   7021  O  O   . ALA C 1 42  ? -9.945  74.276  67.270  1.00 16.41  ? 42  ALA C O   1 
ATOM   7022  C  CB  . ALA C 1 42  ? -8.772  76.939  66.194  1.00 4.57   ? 42  ALA C CB  1 
ATOM   7023  N  N   . GLU C 1 43  ? -10.676 74.462  65.162  1.00 12.14  ? 43  GLU C N   1 
ATOM   7024  C  CA  . GLU C 1 43  ? -10.728 73.032  64.901  1.00 11.27  ? 43  GLU C CA  1 
ATOM   7025  C  C   . GLU C 1 43  ? -9.872  72.829  63.665  1.00 12.11  ? 43  GLU C C   1 
ATOM   7026  O  O   . GLU C 1 43  ? -10.111 73.476  62.649  1.00 14.00  ? 43  GLU C O   1 
ATOM   7027  C  CB  . GLU C 1 43  ? -12.145 72.573  64.598  1.00 10.25  ? 43  GLU C CB  1 
ATOM   7028  C  CG  . GLU C 1 43  ? -13.052 72.547  65.802  1.00 18.83  ? 43  GLU C CG  1 
ATOM   7029  C  CD  . GLU C 1 43  ? -14.451 72.085  65.472  1.00 18.94  ? 43  GLU C CD  1 
ATOM   7030  O  OE1 . GLU C 1 43  ? -14.721 71.762  64.305  1.00 23.04  ? 43  GLU C OE1 1 
ATOM   7031  O  OE2 . GLU C 1 43  ? -15.298 72.039  66.381  1.00 27.68  ? 43  GLU C OE2 1 
ATOM   7032  N  N   . LEU C 1 44  ? -8.826  72.015  63.788  1.00 10.41  ? 44  LEU C N   1 
ATOM   7033  C  CA  . LEU C 1 44  ? -7.907  71.718  62.691  1.00 9.11   ? 44  LEU C CA  1 
ATOM   7034  C  C   . LEU C 1 44  ? -8.130  70.289  62.214  1.00 9.94   ? 44  LEU C C   1 
ATOM   7035  O  O   . LEU C 1 44  ? -7.791  69.329  62.910  1.00 12.93  ? 44  LEU C O   1 
ATOM   7036  C  CB  . LEU C 1 44  ? -6.449  71.887  63.130  1.00 6.28   ? 44  LEU C CB  1 
ATOM   7037  C  CG  . LEU C 1 44  ? -6.046  73.229  63.737  1.00 9.38   ? 44  LEU C CG  1 
ATOM   7038  C  CD1 . LEU C 1 44  ? -4.542  73.327  63.738  1.00 12.42  ? 44  LEU C CD1 1 
ATOM   7039  C  CD2 . LEU C 1 44  ? -6.615  74.380  62.954  1.00 6.94   ? 44  LEU C CD2 1 
ATOM   7040  N  N   . LYS C 1 45  ? -8.717  70.150  61.033  1.00 10.29  ? 45  LYS C N   1 
ATOM   7041  C  CA  . LYS C 1 45  ? -8.994  68.840  60.461  1.00 9.59   ? 45  LYS C CA  1 
ATOM   7042  C  C   . LYS C 1 45  ? -8.007  68.476  59.360  1.00 11.11  ? 45  LYS C C   1 
ATOM   7043  O  O   . LYS C 1 45  ? -7.739  69.282  58.468  1.00 13.57  ? 45  LYS C O   1 
ATOM   7044  C  CB  . LYS C 1 45  ? -10.408 68.809  59.879  1.00 9.40   ? 45  LYS C CB  1 
ATOM   7045  C  CG  . LYS C 1 45  ? -11.507 69.090  60.891  1.00 10.40  ? 45  LYS C CG  1 
ATOM   7046  C  CD  . LYS C 1 45  ? -12.888 69.162  60.251  1.00 9.27   ? 45  LYS C CD  1 
ATOM   7047  C  CE  . LYS C 1 45  ? -13.273 67.908  59.484  1.00 10.02  ? 45  LYS C CE  1 
ATOM   7048  N  NZ  . LYS C 1 45  ? -13.258 66.747  60.383  1.00 16.90  ? 45  LYS C NZ  1 
ATOM   7049  N  N   . LEU C 1 46  ? -7.454  67.273  59.446  1.00 11.76  ? 46  LEU C N   1 
ATOM   7050  C  CA  . LEU C 1 46  ? -6.545  66.749  58.446  1.00 10.52  ? 46  LEU C CA  1 
ATOM   7051  C  C   . LEU C 1 46  ? -7.184  65.412  58.047  1.00 11.82  ? 46  LEU C C   1 
ATOM   7052  O  O   . LEU C 1 46  ? -7.366  64.536  58.885  1.00 14.81  ? 46  LEU C O   1 
ATOM   7053  C  CB  . LEU C 1 46  ? -5.147  66.524  59.028  1.00 8.10   ? 46  LEU C CB  1 
ATOM   7054  C  CG  . LEU C 1 46  ? -4.312  67.755  59.388  1.00 11.53  ? 46  LEU C CG  1 
ATOM   7055  C  CD1 . LEU C 1 46  ? -3.023  67.294  60.001  1.00 9.79   ? 46  LEU C CD1 1 
ATOM   7056  C  CD2 . LEU C 1 46  ? -4.008  68.606  58.189  1.00 9.70   ? 46  LEU C CD2 1 
ATOM   7057  N  N   . GLY C 1 47  ? -7.609  65.285  56.799  1.00 13.08  ? 47  GLY C N   1 
ATOM   7058  C  CA  . GLY C 1 47  ? -8.219  64.037  56.359  1.00 13.76  ? 47  GLY C CA  1 
ATOM   7059  C  C   . GLY C 1 47  ? -7.642  63.630  55.015  1.00 16.69  ? 47  GLY C C   1 
ATOM   7060  O  O   . GLY C 1 47  ? -6.841  64.361  54.435  1.00 16.18  ? 47  GLY C O   1 
ATOM   7061  N  N   . GLN C 1 48  ? -8.054  62.487  54.491  1.00 16.52  ? 48  GLN C N   1 
ATOM   7062  C  CA  . GLN C 1 48  ? -7.537  62.054  53.215  1.00 15.62  ? 48  GLN C CA  1 
ATOM   7063  C  C   . GLN C 1 48  ? -8.334  60.885  52.647  1.00 17.13  ? 48  GLN C C   1 
ATOM   7064  O  O   . GLN C 1 48  ? -8.866  60.068  53.398  1.00 19.47  ? 48  GLN C O   1 
ATOM   7065  C  CB  . GLN C 1 48  ? -6.087  61.657  53.405  1.00 16.49  ? 48  GLN C CB  1 
ATOM   7066  C  CG  . GLN C 1 48  ? -5.298  61.526  52.142  1.00 25.99  ? 48  GLN C CG  1 
ATOM   7067  C  CD  . GLN C 1 48  ? -3.825  61.406  52.429  1.00 33.76  ? 48  GLN C CD  1 
ATOM   7068  O  OE1 . GLN C 1 48  ? -3.103  62.401  52.438  1.00 39.25  ? 48  GLN C OE1 1 
ATOM   7069  N  NE2 . GLN C 1 48  ? -3.370  60.192  52.689  1.00 41.70  ? 48  GLN C NE2 1 
ATOM   7070  N  N   . GLU C 1 49  ? -8.506  60.854  51.329  1.00 17.49  ? 49  GLU C N   1 
ATOM   7071  C  CA  . GLU C 1 49  ? -9.198  59.738  50.694  1.00 18.57  ? 49  GLU C CA  1 
ATOM   7072  C  C   . GLU C 1 49  ? -8.046  58.776  50.540  1.00 19.25  ? 49  GLU C C   1 
ATOM   7073  O  O   . GLU C 1 49  ? -7.183  58.976  49.693  1.00 23.95  ? 49  GLU C O   1 
ATOM   7074  C  CB  . GLU C 1 49  ? -9.731  60.130  49.332  1.00 17.41  ? 49  GLU C CB  1 
ATOM   7075  C  CG  . GLU C 1 49  ? -10.567 59.036  48.685  1.00 30.98  ? 49  GLU C CG  1 
ATOM   7076  C  CD  . GLU C 1 49  ? -11.260 59.513  47.420  1.00 36.01  ? 49  GLU C CD  1 
ATOM   7077  O  OE1 . GLU C 1 49  ? -10.553 59.773  46.421  1.00 42.13  ? 49  GLU C OE1 1 
ATOM   7078  O  OE2 . GLU C 1 49  ? -12.507 59.641  47.427  1.00 42.06  ? 49  GLU C OE2 1 
ATOM   7079  N  N   . VAL C 1 50  ? -7.985  57.767  51.395  1.00 19.81  ? 50  VAL C N   1 
ATOM   7080  C  CA  . VAL C 1 50  ? -6.854  56.848  51.370  1.00 18.20  ? 50  VAL C CA  1 
ATOM   7081  C  C   . VAL C 1 50  ? -6.888  55.720  50.361  1.00 20.90  ? 50  VAL C C   1 
ATOM   7082  O  O   . VAL C 1 50  ? -5.853  55.121  50.074  1.00 26.30  ? 50  VAL C O   1 
ATOM   7083  C  CB  . VAL C 1 50  ? -6.574  56.287  52.775  1.00 13.25  ? 50  VAL C CB  1 
ATOM   7084  C  CG1 . VAL C 1 50  ? -6.108  57.410  53.678  1.00 13.52  ? 50  VAL C CG1 1 
ATOM   7085  C  CG2 . VAL C 1 50  ? -7.834  55.670  53.351  1.00 13.34  ? 50  VAL C CG2 1 
ATOM   7086  N  N   . TRP C 1 51  ? -8.050  55.465  49.772  1.00 21.35  ? 51  TRP C N   1 
ATOM   7087  C  CA  . TRP C 1 51  ? -8.171  54.378  48.807  1.00 17.06  ? 51  TRP C CA  1 
ATOM   7088  C  C   . TRP C 1 51  ? -9.392  54.592  47.959  1.00 18.08  ? 51  TRP C C   1 
ATOM   7089  O  O   . TRP C 1 51  ? -10.447 55.005  48.451  1.00 15.88  ? 51  TRP C O   1 
ATOM   7090  C  CB  . TRP C 1 51  ? -8.292  53.050  49.548  1.00 16.62  ? 51  TRP C CB  1 
ATOM   7091  C  CG  . TRP C 1 51  ? -8.375  51.827  48.709  1.00 17.58  ? 51  TRP C CG  1 
ATOM   7092  C  CD1 . TRP C 1 51  ? -7.334  51.030  48.319  1.00 18.20  ? 51  TRP C CD1 1 
ATOM   7093  C  CD2 . TRP C 1 51  ? -9.567  51.168  48.266  1.00 14.62  ? 51  TRP C CD2 1 
ATOM   7094  N  NE1 . TRP C 1 51  ? -7.808  49.908  47.684  1.00 15.60  ? 51  TRP C NE1 1 
ATOM   7095  C  CE2 . TRP C 1 51  ? -9.173  49.970  47.632  1.00 11.38  ? 51  TRP C CE2 1 
ATOM   7096  C  CE3 . TRP C 1 51  ? -10.928 51.470  48.351  1.00 18.71  ? 51  TRP C CE3 1 
ATOM   7097  C  CZ2 . TRP C 1 51  ? -10.090 49.072  47.083  1.00 13.99  ? 51  TRP C CZ2 1 
ATOM   7098  C  CZ3 . TRP C 1 51  ? -11.846 50.574  47.805  1.00 19.74  ? 51  TRP C CZ3 1 
ATOM   7099  C  CH2 . TRP C 1 51  ? -11.419 49.389  47.178  1.00 16.46  ? 51  TRP C CH2 1 
ATOM   7100  N  N   . LYS C 1 52  ? -9.224  54.333  46.671  1.00 20.44  ? 52  LYS C N   1 
ATOM   7101  C  CA  . LYS C 1 52  ? -10.298 54.467  45.705  1.00 25.15  ? 52  LYS C CA  1 
ATOM   7102  C  C   . LYS C 1 52  ? -10.106 53.456  44.587  1.00 25.24  ? 52  LYS C C   1 
ATOM   7103  O  O   . LYS C 1 52  ? -9.001  53.262  44.079  1.00 28.60  ? 52  LYS C O   1 
ATOM   7104  C  CB  . LYS C 1 52  ? -10.331 55.872  45.122  1.00 27.31  ? 52  LYS C CB  1 
ATOM   7105  C  CG  . LYS C 1 52  ? -11.516 56.092  44.226  1.00 37.36  ? 52  LYS C CG  1 
ATOM   7106  C  CD  . LYS C 1 52  ? -11.642 57.544  43.829  1.00 48.04  ? 52  LYS C CD  1 
ATOM   7107  C  CE  . LYS C 1 52  ? -13.006 57.814  43.197  1.00 59.35  ? 52  LYS C CE  1 
ATOM   7108  N  NZ  . LYS C 1 52  ? -14.163 57.425  44.086  1.00 62.76  ? 52  LYS C NZ  1 
ATOM   7109  N  N   . GLU C 1 53  ? -11.180 52.774  44.240  1.00 27.85  ? 53  GLU C N   1 
ATOM   7110  C  CA  . GLU C 1 53  ? -11.132 51.797  43.182  1.00 34.73  ? 53  GLU C CA  1 
ATOM   7111  C  C   . GLU C 1 53  ? -12.539 51.724  42.616  1.00 36.24  ? 53  GLU C C   1 
ATOM   7112  O  O   . GLU C 1 53  ? -13.435 51.112  43.196  1.00 40.59  ? 53  GLU C O   1 
ATOM   7113  C  CB  . GLU C 1 53  ? -10.666 50.447  43.718  1.00 40.00  ? 53  GLU C CB  1 
ATOM   7114  C  CG  . GLU C 1 53  ? -10.226 49.479  42.646  1.00 57.26  ? 53  GLU C CG  1 
ATOM   7115  C  CD  . GLU C 1 53  ? -9.487  48.291  43.218  1.00 69.11  ? 53  GLU C CD  1 
ATOM   7116  O  OE1 . GLU C 1 53  ? -8.259  48.421  43.452  1.00 73.78  ? 53  GLU C OE1 1 
ATOM   7117  O  OE2 . GLU C 1 53  ? -10.138 47.239  43.440  1.00 74.45  ? 53  GLU C OE2 1 
ATOM   7118  N  N   . GLY C 1 54  ? -12.741 52.439  41.517  1.00 38.32  ? 54  GLY C N   1 
ATOM   7119  C  CA  . GLY C 1 54  ? -14.038 52.467  40.877  1.00 38.06  ? 54  GLY C CA  1 
ATOM   7120  C  C   . GLY C 1 54  ? -14.897 53.465  41.605  1.00 39.63  ? 54  GLY C C   1 
ATOM   7121  O  O   . GLY C 1 54  ? -14.517 54.626  41.742  1.00 38.97  ? 54  GLY C O   1 
ATOM   7122  N  N   . ASP C 1 55  ? -16.048 53.004  42.079  1.00 42.90  ? 55  ASP C N   1 
ATOM   7123  C  CA  . ASP C 1 55  ? -16.972 53.854  42.818  1.00 44.99  ? 55  ASP C CA  1 
ATOM   7124  C  C   . ASP C 1 55  ? -16.724 53.725  44.320  1.00 38.59  ? 55  ASP C C   1 
ATOM   7125  O  O   . ASP C 1 55  ? -17.253 54.512  45.103  1.00 38.56  ? 55  ASP C O   1 
ATOM   7126  C  CB  . ASP C 1 55  ? -18.424 53.471  42.499  1.00 59.66  ? 55  ASP C CB  1 
ATOM   7127  C  CG  . ASP C 1 55  ? -18.773 53.650  41.024  1.00 74.92  ? 55  ASP C CG  1 
ATOM   7128  O  OD1 . ASP C 1 55  ? -18.827 54.813  40.543  1.00 79.61  ? 55  ASP C OD1 1 
ATOM   7129  O  OD2 . ASP C 1 55  ? -18.999 52.616  40.351  1.00 85.92  ? 55  ASP C OD2 1 
ATOM   7130  N  N   . LYS C 1 56  ? -15.928 52.728  44.708  1.00 29.52  ? 56  LYS C N   1 
ATOM   7131  C  CA  . LYS C 1 56  ? -15.621 52.476  46.107  1.00 24.94  ? 56  LYS C CA  1 
ATOM   7132  C  C   . LYS C 1 56  ? -14.459 53.319  46.606  1.00 23.01  ? 56  LYS C C   1 
ATOM   7133  O  O   . LYS C 1 56  ? -13.507 53.575  45.868  1.00 23.93  ? 56  LYS C O   1 
ATOM   7134  C  CB  . LYS C 1 56  ? -15.292 51.009  46.294  1.00 25.49  ? 56  LYS C CB  1 
ATOM   7135  C  CG  . LYS C 1 56  ? -16.350 50.093  45.716  1.00 27.90  ? 56  LYS C CG  1 
ATOM   7136  C  CD  . LYS C 1 56  ? -15.887 48.660  45.688  1.00 32.81  ? 56  LYS C CD  1 
ATOM   7137  C  CE  . LYS C 1 56  ? -16.788 47.805  44.813  1.00 40.67  ? 56  LYS C CE  1 
ATOM   7138  N  NZ  . LYS C 1 56  ? -18.213 47.800  45.276  1.00 47.71  ? 56  LYS C NZ  1 
ATOM   7139  N  N   . SER C 1 57  ? -14.541 53.762  47.853  1.00 20.15  ? 57  SER C N   1 
ATOM   7140  C  CA  . SER C 1 57  ? -13.476 54.552  48.434  1.00 17.58  ? 57  SER C CA  1 
ATOM   7141  C  C   . SER C 1 57  ? -13.528 54.530  49.947  1.00 15.92  ? 57  SER C C   1 
ATOM   7142  O  O   . SER C 1 57  ? -14.549 54.219  50.546  1.00 13.65  ? 57  SER C O   1 
ATOM   7143  C  CB  . SER C 1 57  ? -13.566 56.000  47.967  1.00 16.57  ? 57  SER C CB  1 
ATOM   7144  O  OG  . SER C 1 57  ? -14.774 56.577  48.408  1.00 20.12  ? 57  SER C OG  1 
ATOM   7145  N  N   . PHE C 1 58  ? -12.399 54.865  50.550  1.00 16.44  ? 58  PHE C N   1 
ATOM   7146  C  CA  . PHE C 1 58  ? -12.267 54.952  51.984  1.00 11.88  ? 58  PHE C CA  1 
ATOM   7147  C  C   . PHE C 1 58  ? -11.735 56.356  52.259  1.00 13.39  ? 58  PHE C C   1 
ATOM   7148  O  O   . PHE C 1 58  ? -10.753 56.796  51.638  1.00 13.10  ? 58  PHE C O   1 
ATOM   7149  C  CB  . PHE C 1 58  ? -11.254 53.930  52.491  1.00 12.17  ? 58  PHE C CB  1 
ATOM   7150  C  CG  . PHE C 1 58  ? -11.788 52.530  52.599  1.00 14.78  ? 58  PHE C CG  1 
ATOM   7151  C  CD1 . PHE C 1 58  ? -12.475 52.119  53.735  1.00 16.82  ? 58  PHE C CD1 1 
ATOM   7152  C  CD2 . PHE C 1 58  ? -11.573 51.610  51.577  1.00 17.79  ? 58  PHE C CD2 1 
ATOM   7153  C  CE1 . PHE C 1 58  ? -12.940 50.813  53.856  1.00 13.47  ? 58  PHE C CE1 1 
ATOM   7154  C  CE2 . PHE C 1 58  ? -12.036 50.293  51.684  1.00 16.84  ? 58  PHE C CE2 1 
ATOM   7155  C  CZ  . PHE C 1 58  ? -12.719 49.897  52.826  1.00 16.29  ? 58  PHE C CZ  1 
ATOM   7156  N  N   . TYR C 1 59  ? -12.423 57.086  53.126  1.00 12.00  ? 59  TYR C N   1 
ATOM   7157  C  CA  . TYR C 1 59  ? -11.979 58.417  53.506  1.00 10.11  ? 59  TYR C CA  1 
ATOM   7158  C  C   . TYR C 1 59  ? -11.674 58.383  55.003  1.00 13.20  ? 59  TYR C C   1 
ATOM   7159  O  O   . TYR C 1 59  ? -12.459 57.860  55.791  1.00 16.34  ? 59  TYR C O   1 
ATOM   7160  C  CB  . TYR C 1 59  ? -13.061 59.445  53.240  1.00 7.83   ? 59  TYR C CB  1 
ATOM   7161  C  CG  . TYR C 1 59  ? -12.541 60.850  53.381  1.00 14.70  ? 59  TYR C CG  1 
ATOM   7162  C  CD1 . TYR C 1 59  ? -11.870 61.462  52.330  1.00 15.07  ? 59  TYR C CD1 1 
ATOM   7163  C  CD2 . TYR C 1 59  ? -12.661 61.553  54.579  1.00 14.40  ? 59  TYR C CD2 1 
ATOM   7164  C  CE1 . TYR C 1 59  ? -11.321 62.725  52.463  1.00 16.52  ? 59  TYR C CE1 1 
ATOM   7165  C  CE2 . TYR C 1 59  ? -12.118 62.826  54.714  1.00 17.11  ? 59  TYR C CE2 1 
ATOM   7166  C  CZ  . TYR C 1 59  ? -11.445 63.400  53.652  1.00 17.81  ? 59  TYR C CZ  1 
ATOM   7167  O  OH  . TYR C 1 59  ? -10.884 64.648  53.772  1.00 20.73  ? 59  TYR C OH  1 
ATOM   7168  N  N   . PHE C 1 60  ? -10.532 58.936  55.384  1.00 13.06  ? 60  PHE C N   1 
ATOM   7169  C  CA  . PHE C 1 60  ? -10.102 58.999  56.769  1.00 9.29   ? 60  PHE C CA  1 
ATOM   7170  C  C   . PHE C 1 60  ? -10.151 60.461  57.203  1.00 11.59  ? 60  PHE C C   1 
ATOM   7171  O  O   . PHE C 1 60  ? -9.592  61.314  56.517  1.00 13.95  ? 60  PHE C O   1 
ATOM   7172  C  CB  . PHE C 1 60  ? -8.678  58.488  56.862  1.00 7.97   ? 60  PHE C CB  1 
ATOM   7173  C  CG  . PHE C 1 60  ? -8.029  58.764  58.178  1.00 13.69  ? 60  PHE C CG  1 
ATOM   7174  C  CD1 . PHE C 1 60  ? -8.602  58.294  59.361  1.00 12.86  ? 60  PHE C CD1 1 
ATOM   7175  C  CD2 . PHE C 1 60  ? -6.858  59.505  58.243  1.00 12.05  ? 60  PHE C CD2 1 
ATOM   7176  C  CE1 . PHE C 1 60  ? -8.011  58.558  60.605  1.00 10.50  ? 60  PHE C CE1 1 
ATOM   7177  C  CE2 . PHE C 1 60  ? -6.263  59.776  59.469  1.00 11.95  ? 60  PHE C CE2 1 
ATOM   7178  C  CZ  . PHE C 1 60  ? -6.842  59.298  60.657  1.00 13.10  ? 60  PHE C CZ  1 
ATOM   7179  N  N   . ASP C 1 61  ? -10.749 60.755  58.357  1.00 9.84   ? 61  ASP C N   1 
ATOM   7180  C  CA  . ASP C 1 61  ? -10.870 62.148  58.814  1.00 7.57   ? 61  ASP C CA  1 
ATOM   7181  C  C   . ASP C 1 61  ? -10.511 62.299  60.276  1.00 10.21  ? 61  ASP C C   1 
ATOM   7182  O  O   . ASP C 1 61  ? -10.708 61.372  61.044  1.00 10.54  ? 61  ASP C O   1 
ATOM   7183  C  CB  . ASP C 1 61  ? -12.302 62.621  58.610  1.00 8.80   ? 61  ASP C CB  1 
ATOM   7184  C  CG  . ASP C 1 61  ? -12.428 64.128  58.564  1.00 15.23  ? 61  ASP C CG  1 
ATOM   7185  O  OD1 . ASP C 1 61  ? -11.410 64.842  58.406  1.00 16.51  ? 61  ASP C OD1 1 
ATOM   7186  O  OD2 . ASP C 1 61  ? -13.577 64.601  58.658  1.00 16.33  ? 61  ASP C OD2 1 
ATOM   7187  N  N   . THR C 1 62  ? -9.940  63.443  60.651  1.00 8.47   ? 62  THR C N   1 
ATOM   7188  C  CA  . THR C 1 62  ? -9.566  63.697  62.048  1.00 8.46   ? 62  THR C CA  1 
ATOM   7189  C  C   . THR C 1 62  ? -9.995  65.114  62.413  1.00 11.56  ? 62  THR C C   1 
ATOM   7190  O  O   . THR C 1 62  ? -10.373 65.896  61.536  1.00 13.95  ? 62  THR C O   1 
ATOM   7191  C  CB  . THR C 1 62  ? -8.039  63.611  62.290  1.00 7.76   ? 62  THR C CB  1 
ATOM   7192  O  OG1 . THR C 1 62  ? -7.380  64.672  61.588  1.00 9.19   ? 62  THR C OG1 1 
ATOM   7193  C  CG2 . THR C 1 62  ? -7.473  62.293  61.819  1.00 5.35   ? 62  THR C CG2 1 
ATOM   7194  N  N   . ASN C 1 63  ? -9.945  65.447  63.702  1.00 11.11  ? 63  ASN C N   1 
ATOM   7195  C  CA  . ASN C 1 63  ? -10.309 66.792  64.165  1.00 7.54   ? 63  ASN C CA  1 
ATOM   7196  C  C   . ASN C 1 63  ? -9.760  66.998  65.561  1.00 10.38  ? 63  ASN C C   1 
ATOM   7197  O  O   . ASN C 1 63  ? -10.063 66.217  66.465  1.00 13.38  ? 63  ASN C O   1 
ATOM   7198  C  CB  . ASN C 1 63  ? -11.829 66.966  64.190  1.00 7.75   ? 63  ASN C CB  1 
ATOM   7199  C  CG  . ASN C 1 63  ? -12.247 68.396  64.436  1.00 8.14   ? 63  ASN C CG  1 
ATOM   7200  O  OD1 . ASN C 1 63  ? -11.473 69.205  64.933  1.00 16.33  ? 63  ASN C OD1 1 
ATOM   7201  N  ND2 . ASN C 1 63  ? -13.476 68.723  64.071  1.00 7.67   ? 63  ASN C ND2 1 
ATOM   7202  N  N   . VAL C 1 64  ? -8.918  68.015  65.716  1.00 11.74  ? 64  VAL C N   1 
ATOM   7203  C  CA  . VAL C 1 64  ? -8.311  68.365  66.997  1.00 10.52  ? 64  VAL C CA  1 
ATOM   7204  C  C   . VAL C 1 64  ? -8.766  69.794  67.290  1.00 11.94  ? 64  VAL C C   1 
ATOM   7205  O  O   . VAL C 1 64  ? -8.515  70.691  66.486  1.00 13.31  ? 64  VAL C O   1 
ATOM   7206  C  CB  . VAL C 1 64  ? -6.768  68.318  66.921  1.00 10.06  ? 64  VAL C CB  1 
ATOM   7207  C  CG1 . VAL C 1 64  ? -6.165  68.779  68.237  1.00 8.93   ? 64  VAL C CG1 1 
ATOM   7208  C  CG2 . VAL C 1 64  ? -6.310  66.909  66.597  1.00 7.59   ? 64  VAL C CG2 1 
ATOM   7209  N  N   . ALA C 1 65  ? -9.463  69.991  68.412  1.00 9.95   ? 65  ALA C N   1 
ATOM   7210  C  CA  . ALA C 1 65  ? -9.986  71.299  68.795  1.00 9.29   ? 65  ALA C CA  1 
ATOM   7211  C  C   . ALA C 1 65  ? -9.207  71.990  69.910  1.00 10.32  ? 65  ALA C C   1 
ATOM   7212  O  O   . ALA C 1 65  ? -8.728  71.343  70.838  1.00 13.48  ? 65  ALA C O   1 
ATOM   7213  C  CB  . ALA C 1 65  ? -11.428 71.179  69.179  1.00 4.90   ? 65  ALA C CB  1 
ATOM   7214  N  N   . TYR C 1 66  ? -9.118  73.317  69.823  1.00 11.47  ? 66  TYR C N   1 
ATOM   7215  C  CA  . TYR C 1 66  ? -8.405  74.136  70.783  1.00 10.87  ? 66  TYR C CA  1 
ATOM   7216  C  C   . TYR C 1 66  ? -9.275  75.297  71.184  1.00 14.70  ? 66  TYR C C   1 
ATOM   7217  O  O   . TYR C 1 66  ? -9.885  75.952  70.337  1.00 16.31  ? 66  TYR C O   1 
ATOM   7218  C  CB  . TYR C 1 66  ? -7.153  74.736  70.150  1.00 10.55  ? 66  TYR C CB  1 
ATOM   7219  C  CG  . TYR C 1 66  ? -6.160  73.744  69.613  1.00 12.06  ? 66  TYR C CG  1 
ATOM   7220  C  CD1 . TYR C 1 66  ? -6.320  73.193  68.340  1.00 12.29  ? 66  TYR C CD1 1 
ATOM   7221  C  CD2 . TYR C 1 66  ? -5.068  73.343  70.380  1.00 9.30   ? 66  TYR C CD2 1 
ATOM   7222  C  CE1 . TYR C 1 66  ? -5.416  72.257  67.845  1.00 9.82   ? 66  TYR C CE1 1 
ATOM   7223  C  CE2 . TYR C 1 66  ? -4.162  72.413  69.901  1.00 11.21  ? 66  TYR C CE2 1 
ATOM   7224  C  CZ  . TYR C 1 66  ? -4.341  71.870  68.632  1.00 12.35  ? 66  TYR C CZ  1 
ATOM   7225  O  OH  . TYR C 1 66  ? -3.458  70.925  68.154  1.00 13.21  ? 66  TYR C OH  1 
ATOM   7226  N  N   . SER C 1 67  ? -9.309  75.565  72.478  1.00 15.61  ? 67  SER C N   1 
ATOM   7227  C  CA  . SER C 1 67  ? -10.059 76.693  72.997  1.00 15.43  ? 67  SER C CA  1 
ATOM   7228  C  C   . SER C 1 67  ? -9.131  77.401  73.992  1.00 16.31  ? 67  SER C C   1 
ATOM   7229  O  O   . SER C 1 67  ? -8.608  76.764  74.907  1.00 21.37  ? 67  SER C O   1 
ATOM   7230  C  CB  . SER C 1 67  ? -11.328 76.207  73.691  1.00 14.47  ? 67  SER C CB  1 
ATOM   7231  O  OG  . SER C 1 67  ? -12.270 77.258  73.847  1.00 27.01  ? 67  SER C OG  1 
ATOM   7232  N  N   . VAL C 1 68  ? -8.814  78.664  73.724  1.00 12.14  ? 68  VAL C N   1 
ATOM   7233  C  CA  . VAL C 1 68  ? -7.970  79.457  74.599  1.00 9.43   ? 68  VAL C CA  1 
ATOM   7234  C  C   . VAL C 1 68  ? -8.658  80.794  74.818  1.00 13.90  ? 68  VAL C C   1 
ATOM   7235  O  O   . VAL C 1 68  ? -9.481  81.222  74.011  1.00 13.68  ? 68  VAL C O   1 
ATOM   7236  C  CB  . VAL C 1 68  ? -6.537  79.638  74.068  1.00 11.07  ? 68  VAL C CB  1 
ATOM   7237  C  CG1 . VAL C 1 68  ? -5.786  78.326  74.162  1.00 12.30  ? 68  VAL C CG1 1 
ATOM   7238  C  CG2 . VAL C 1 68  ? -6.540  80.132  72.642  1.00 9.95   ? 68  VAL C CG2 1 
ATOM   7239  N  N   . ASN C 1 69  ? -8.319  81.464  75.909  1.00 17.01  ? 69  ASN C N   1 
ATOM   7240  C  CA  . ASN C 1 69  ? -8.976  82.717  76.247  1.00 18.10  ? 69  ASN C CA  1 
ATOM   7241  C  C   . ASN C 1 69  ? -8.461  83.970  75.612  1.00 17.50  ? 69  ASN C C   1 
ATOM   7242  O  O   . ASN C 1 69  ? -8.903  85.043  75.960  1.00 20.20  ? 69  ASN C O   1 
ATOM   7243  C  CB  . ASN C 1 69  ? -9.002  82.900  77.756  1.00 24.81  ? 69  ASN C CB  1 
ATOM   7244  C  CG  . ASN C 1 69  ? -9.760  81.796  78.453  1.00 32.38  ? 69  ASN C CG  1 
ATOM   7245  O  OD1 . ASN C 1 69  ? -10.931 81.531  78.151  1.00 39.62  ? 69  ASN C OD1 1 
ATOM   7246  N  ND2 . ASN C 1 69  ? -9.094  81.125  79.379  1.00 34.95  ? 69  ASN C ND2 1 
ATOM   7247  N  N   . GLN C 1 70  ? -7.534  83.853  74.677  1.00 16.01  ? 70  GLN C N   1 
ATOM   7248  C  CA  . GLN C 1 70  ? -6.975  85.023  74.010  1.00 14.89  ? 70  GLN C CA  1 
ATOM   7249  C  C   . GLN C 1 70  ? -6.612  86.166  74.961  1.00 17.15  ? 70  GLN C C   1 
ATOM   7250  O  O   . GLN C 1 70  ? -7.031  87.312  74.781  1.00 18.37  ? 70  GLN C O   1 
ATOM   7251  C  CB  . GLN C 1 70  ? -7.876  85.498  72.852  1.00 9.34   ? 70  GLN C CB  1 
ATOM   7252  C  CG  . GLN C 1 70  ? -9.357  85.715  73.156  1.00 9.43   ? 70  GLN C CG  1 
ATOM   7253  C  CD  . GLN C 1 70  ? -10.153 86.057  71.910  1.00 14.82  ? 70  GLN C CD  1 
ATOM   7254  O  OE1 . GLN C 1 70  ? -9.845  85.575  70.831  1.00 18.38  ? 70  GLN C OE1 1 
ATOM   7255  N  NE2 . GLN C 1 70  ? -11.175 86.882  72.051  1.00 11.24  ? 70  GLN C NE2 1 
ATOM   7256  N  N   . GLN C 1 71  ? -5.824  85.842  75.980  1.00 15.39  ? 71  GLN C N   1 
ATOM   7257  C  CA  . GLN C 1 71  ? -5.380  86.833  76.954  1.00 16.55  ? 71  GLN C CA  1 
ATOM   7258  C  C   . GLN C 1 71  ? -3.889  87.083  76.811  1.00 15.09  ? 71  GLN C C   1 
ATOM   7259  O  O   . GLN C 1 71  ? -3.365  88.057  77.325  1.00 15.75  ? 71  GLN C O   1 
ATOM   7260  C  CB  . GLN C 1 71  ? -5.625  86.342  78.379  1.00 19.90  ? 71  GLN C CB  1 
ATOM   7261  C  CG  . GLN C 1 71  ? -7.052  85.973  78.700  1.00 29.55  ? 71  GLN C CG  1 
ATOM   7262  C  CD  . GLN C 1 71  ? -7.205  85.411  80.114  1.00 34.11  ? 71  GLN C CD  1 
ATOM   7263  O  OE1 . GLN C 1 71  ? -8.095  85.822  80.857  1.00 39.91  ? 71  GLN C OE1 1 
ATOM   7264  N  NE2 . GLN C 1 71  ? -6.341  84.464  80.486  1.00 31.84  ? 71  GLN C NE2 1 
ATOM   7265  N  N   . ASN C 1 72  ? -3.196  86.159  76.167  1.00 14.99  ? 72  ASN C N   1 
ATOM   7266  C  CA  . ASN C 1 72  ? -1.764  86.257  76.002  1.00 13.13  ? 72  ASN C CA  1 
ATOM   7267  C  C   . ASN C 1 72  ? -1.322  85.498  74.773  1.00 13.68  ? 72  ASN C C   1 
ATOM   7268  O  O   . ASN C 1 72  ? -2.120  84.820  74.129  1.00 16.47  ? 72  ASN C O   1 
ATOM   7269  C  CB  . ASN C 1 72  ? -1.065  85.630  77.209  1.00 13.73  ? 72  ASN C CB  1 
ATOM   7270  C  CG  . ASN C 1 72  ? -0.906  86.588  78.364  1.00 15.48  ? 72  ASN C CG  1 
ATOM   7271  O  OD1 . ASN C 1 72  ? -0.261  87.624  78.243  1.00 22.62  ? 72  ASN C OD1 1 
ATOM   7272  N  ND2 . ASN C 1 72  ? -1.452  86.227  79.508  1.00 21.52  ? 72  ASN C ND2 1 
ATOM   7273  N  N   . ASP C 1 73  ? -0.035  85.612  74.468  1.00 12.87  ? 73  ASP C N   1 
ATOM   7274  C  CA  . ASP C 1 73  ? 0.589   84.919  73.355  1.00 12.98  ? 73  ASP C CA  1 
ATOM   7275  C  C   . ASP C 1 73  ? 0.631   83.440  73.732  1.00 14.12  ? 73  ASP C C   1 
ATOM   7276  O  O   . ASP C 1 73  ? -0.118  82.622  73.199  1.00 16.53  ? 73  ASP C O   1 
ATOM   7277  C  CB  . ASP C 1 73  ? 2.003   85.489  73.151  1.00 14.40  ? 73  ASP C CB  1 
ATOM   7278  C  CG  . ASP C 1 73  ? 2.879   84.653  72.223  1.00 16.07  ? 73  ASP C CG  1 
ATOM   7279  O  OD1 . ASP C 1 73  ? 2.446   83.626  71.680  1.00 16.41  ? 73  ASP C OD1 1 
ATOM   7280  O  OD2 . ASP C 1 73  ? 4.047   85.034  72.045  1.00 18.23  ? 73  ASP C OD2 1 
ATOM   7281  N  N   . TRP C 1 74  ? 1.489   83.101  74.680  1.00 15.05  ? 74  TRP C N   1 
ATOM   7282  C  CA  . TRP C 1 74  ? 1.614   81.719  75.098  1.00 13.25  ? 74  TRP C CA  1 
ATOM   7283  C  C   . TRP C 1 74  ? 0.421   81.273  75.939  1.00 14.52  ? 74  TRP C C   1 
ATOM   7284  O  O   . TRP C 1 74  ? 0.288   81.676  77.084  1.00 19.21  ? 74  TRP C O   1 
ATOM   7285  C  CB  . TRP C 1 74  ? 2.911   81.541  75.896  1.00 13.20  ? 74  TRP C CB  1 
ATOM   7286  C  CG  . TRP C 1 74  ? 3.219   80.109  76.196  1.00 17.13  ? 74  TRP C CG  1 
ATOM   7287  C  CD1 . TRP C 1 74  ? 2.676   79.349  77.191  1.00 14.32  ? 74  TRP C CD1 1 
ATOM   7288  C  CD2 . TRP C 1 74  ? 4.083   79.234  75.450  1.00 18.31  ? 74  TRP C CD2 1 
ATOM   7289  N  NE1 . TRP C 1 74  ? 3.135   78.054  77.104  1.00 15.38  ? 74  TRP C NE1 1 
ATOM   7290  C  CE2 . TRP C 1 74  ? 3.998   77.954  76.046  1.00 21.84  ? 74  TRP C CE2 1 
ATOM   7291  C  CE3 . TRP C 1 74  ? 4.914   79.403  74.334  1.00 21.50  ? 74  TRP C CE3 1 
ATOM   7292  C  CZ2 . TRP C 1 74  ? 4.711   76.850  75.562  1.00 22.06  ? 74  TRP C CZ2 1 
ATOM   7293  C  CZ3 . TRP C 1 74  ? 5.625   78.301  73.855  1.00 22.04  ? 74  TRP C CZ3 1 
ATOM   7294  C  CH2 . TRP C 1 74  ? 5.514   77.043  74.472  1.00 20.41  ? 74  TRP C CH2 1 
ATOM   7295  N  N   . GLU C 1 75  ? -0.457  80.461  75.367  1.00 13.26  ? 75  GLU C N   1 
ATOM   7296  C  CA  . GLU C 1 75  ? -1.603  79.955  76.099  1.00 10.68  ? 75  GLU C CA  1 
ATOM   7297  C  C   . GLU C 1 75  ? -1.688  78.445  75.941  1.00 15.00  ? 75  GLU C C   1 
ATOM   7298  O  O   . GLU C 1 75  ? -2.036  77.942  74.871  1.00 17.84  ? 75  GLU C O   1 
ATOM   7299  C  CB  . GLU C 1 75  ? -2.894  80.600  75.606  1.00 10.12  ? 75  GLU C CB  1 
ATOM   7300  C  CG  . GLU C 1 75  ? -3.006  82.069  75.931  1.00 10.83  ? 75  GLU C CG  1 
ATOM   7301  C  CD  . GLU C 1 75  ? -4.320  82.655  75.521  1.00 13.08  ? 75  GLU C CD  1 
ATOM   7302  O  OE1 . GLU C 1 75  ? -4.640  82.645  74.323  1.00 20.36  ? 75  GLU C OE1 1 
ATOM   7303  O  OE2 . GLU C 1 75  ? -5.041  83.146  76.400  1.00 20.03  ? 75  GLU C OE2 1 
ATOM   7304  N  N   . SER C 1 76  ? -1.320  77.728  77.001  1.00 17.36  ? 76  SER C N   1 
ATOM   7305  C  CA  . SER C 1 76  ? -1.354  76.274  77.024  1.00 18.74  ? 76  SER C CA  1 
ATOM   7306  C  C   . SER C 1 76  ? -2.784  75.793  77.114  1.00 19.13  ? 76  SER C C   1 
ATOM   7307  O  O   . SER C 1 76  ? -3.646  76.483  77.660  1.00 23.28  ? 76  SER C O   1 
ATOM   7308  C  CB  . SER C 1 76  ? -0.572  75.746  78.226  1.00 20.00  ? 76  SER C CB  1 
ATOM   7309  O  OG  . SER C 1 76  ? 0.821   75.814  77.987  1.00 38.26  ? 76  SER C OG  1 
ATOM   7310  N  N   . THR C 1 77  ? -3.043  74.603  76.592  1.00 17.79  ? 77  THR C N   1 
ATOM   7311  C  CA  . THR C 1 77  ? -4.387  74.054  76.643  1.00 16.65  ? 77  THR C CA  1 
ATOM   7312  C  C   . THR C 1 77  ? -4.341  72.540  76.440  1.00 16.52  ? 77  THR C C   1 
ATOM   7313  O  O   . THR C 1 77  ? -3.295  71.969  76.125  1.00 18.26  ? 77  THR C O   1 
ATOM   7314  C  CB  . THR C 1 77  ? -5.301  74.723  75.568  1.00 19.94  ? 77  THR C CB  1 
ATOM   7315  O  OG1 . THR C 1 77  ? -6.667  74.340  75.783  1.00 23.14  ? 77  THR C OG1 1 
ATOM   7316  C  CG2 . THR C 1 77  ? -4.860  74.320  74.149  1.00 14.29  ? 77  THR C CG2 1 
ATOM   7317  N  N   . ASP C 1 78  ? -5.460  71.890  76.725  1.00 17.78  ? 78  ASP C N   1 
ATOM   7318  C  CA  . ASP C 1 78  ? -5.592  70.456  76.542  1.00 22.17  ? 78  ASP C CA  1 
ATOM   7319  C  C   . ASP C 1 78  ? -6.508  70.366  75.345  1.00 19.30  ? 78  ASP C C   1 
ATOM   7320  O  O   . ASP C 1 78  ? -7.706  70.665  75.440  1.00 21.98  ? 78  ASP C O   1 
ATOM   7321  C  CB  . ASP C 1 78  ? -6.292  69.814  77.733  1.00 31.86  ? 78  ASP C CB  1 
ATOM   7322  C  CG  . ASP C 1 78  ? -5.559  70.030  79.012  1.00 40.23  ? 78  ASP C CG  1 
ATOM   7323  O  OD1 . ASP C 1 78  ? -4.413  69.550  79.108  1.00 43.77  ? 78  ASP C OD1 1 
ATOM   7324  O  OD2 . ASP C 1 78  ? -6.129  70.685  79.914  1.00 53.89  ? 78  ASP C OD2 1 
ATOM   7325  N  N   . PRO C 1 79  ? -5.947  70.060  74.179  1.00 15.18  ? 79  PRO C N   1 
ATOM   7326  C  CA  . PRO C 1 79  ? -6.802  69.965  73.002  1.00 12.92  ? 79  PRO C CA  1 
ATOM   7327  C  C   . PRO C 1 79  ? -7.806  68.834  73.133  1.00 13.67  ? 79  PRO C C   1 
ATOM   7328  O  O   . PRO C 1 79  ? -7.557  67.853  73.840  1.00 17.54  ? 79  PRO C O   1 
ATOM   7329  C  CB  . PRO C 1 79  ? -5.790  69.707  71.882  1.00 14.66  ? 79  PRO C CB  1 
ATOM   7330  C  CG  . PRO C 1 79  ? -4.628  69.060  72.581  1.00 13.82  ? 79  PRO C CG  1 
ATOM   7331  C  CD  . PRO C 1 79  ? -4.531  69.832  73.845  1.00 13.03  ? 79  PRO C CD  1 
ATOM   7332  N  N   . ALA C 1 80  ? -8.966  68.981  72.512  1.00 9.91   ? 80  ALA C N   1 
ATOM   7333  C  CA  . ALA C 1 80  ? -9.961  67.916  72.548  1.00 9.10   ? 80  ALA C CA  1 
ATOM   7334  C  C   . ALA C 1 80  ? -9.776  67.132  71.248  1.00 12.32  ? 80  ALA C C   1 
ATOM   7335  O  O   . ALA C 1 80  ? -9.732  67.734  70.182  1.00 14.21  ? 80  ALA C O   1 
ATOM   7336  C  CB  . ALA C 1 80  ? -11.344 68.509  72.596  1.00 8.24   ? 80  ALA C CB  1 
ATOM   7337  N  N   . PHE C 1 81  ? -9.613  65.815  71.324  1.00 11.25  ? 81  PHE C N   1 
ATOM   7338  C  CA  . PHE C 1 81  ? -9.460  65.005  70.119  1.00 10.74  ? 81  PHE C CA  1 
ATOM   7339  C  C   . PHE C 1 81  ? -10.884 64.565  69.805  1.00 13.46  ? 81  PHE C C   1 
ATOM   7340  O  O   . PHE C 1 81  ? -11.360 63.552  70.315  1.00 15.68  ? 81  PHE C O   1 
ATOM   7341  C  CB  . PHE C 1 81  ? -8.560  63.808  70.392  1.00 10.55  ? 81  PHE C CB  1 
ATOM   7342  C  CG  . PHE C 1 81  ? -8.170  63.053  69.154  1.00 15.26  ? 81  PHE C CG  1 
ATOM   7343  C  CD1 . PHE C 1 81  ? -7.462  63.679  68.135  1.00 18.19  ? 81  PHE C CD1 1 
ATOM   7344  C  CD2 . PHE C 1 81  ? -8.483  61.701  69.018  1.00 18.81  ? 81  PHE C CD2 1 
ATOM   7345  C  CE1 . PHE C 1 81  ? -7.065  62.966  67.002  1.00 16.73  ? 81  PHE C CE1 1 
ATOM   7346  C  CE2 . PHE C 1 81  ? -8.091  60.980  67.889  1.00 17.70  ? 81  PHE C CE2 1 
ATOM   7347  C  CZ  . PHE C 1 81  ? -7.379  61.613  66.881  1.00 16.64  ? 81  PHE C CZ  1 
ATOM   7348  N  N   . ARG C 1 82  ? -11.556 65.322  68.942  1.00 13.08  ? 82  ARG C N   1 
ATOM   7349  C  CA  . ARG C 1 82  ? -12.959 65.074  68.640  1.00 9.69   ? 82  ARG C CA  1 
ATOM   7350  C  C   . ARG C 1 82  ? -13.365 64.110  67.554  1.00 9.77   ? 82  ARG C C   1 
ATOM   7351  O  O   . ARG C 1 82  ? -14.426 63.508  67.643  1.00 13.92  ? 82  ARG C O   1 
ATOM   7352  C  CB  . ARG C 1 82  ? -13.663 66.412  68.468  1.00 4.13   ? 82  ARG C CB  1 
ATOM   7353  C  CG  . ARG C 1 82  ? -13.360 67.346  69.614  1.00 8.81   ? 82  ARG C CG  1 
ATOM   7354  C  CD  . ARG C 1 82  ? -14.123 68.630  69.505  1.00 10.71  ? 82  ARG C CD  1 
ATOM   7355  N  NE  . ARG C 1 82  ? -15.550 68.401  69.651  1.00 6.88   ? 82  ARG C NE  1 
ATOM   7356  C  CZ  . ARG C 1 82  ? -16.462 69.353  69.571  1.00 10.33  ? 82  ARG C CZ  1 
ATOM   7357  N  NH1 . ARG C 1 82  ? -16.102 70.610  69.348  1.00 8.40   ? 82  ARG C NH1 1 
ATOM   7358  N  NH2 . ARG C 1 82  ? -17.733 69.041  69.685  1.00 11.17  ? 82  ARG C NH2 1 
ATOM   7359  N  N   . GLU C 1 83  ? -12.551 63.962  66.517  1.00 11.77  ? 83  GLU C N   1 
ATOM   7360  C  CA  . GLU C 1 83  ? -12.882 63.041  65.424  1.00 9.37   ? 83  GLU C CA  1 
ATOM   7361  C  C   . GLU C 1 83  ? -11.711 62.205  64.981  1.00 7.62   ? 83  GLU C C   1 
ATOM   7362  O  O   . GLU C 1 83  ? -10.583 62.669  64.964  1.00 11.34  ? 83  GLU C O   1 
ATOM   7363  C  CB  . GLU C 1 83  ? -13.381 63.794  64.200  1.00 8.48   ? 83  GLU C CB  1 
ATOM   7364  C  CG  . GLU C 1 83  ? -14.648 64.514  64.398  1.00 11.41  ? 83  GLU C CG  1 
ATOM   7365  C  CD  . GLU C 1 83  ? -15.123 65.153  63.128  1.00 12.64  ? 83  GLU C CD  1 
ATOM   7366  O  OE1 . GLU C 1 83  ? -14.659 66.262  62.816  1.00 15.15  ? 83  GLU C OE1 1 
ATOM   7367  O  OE2 . GLU C 1 83  ? -15.969 64.551  62.450  1.00 15.53  ? 83  GLU C OE2 1 
ATOM   7368  N  N   . ALA C 1 84  ? -12.009 60.992  64.549  1.00 8.58   ? 84  ALA C N   1 
ATOM   7369  C  CA  . ALA C 1 84  ? -11.013 60.049  64.052  1.00 10.14  ? 84  ALA C CA  1 
ATOM   7370  C  C   . ALA C 1 84  ? -11.897 58.912  63.587  1.00 13.02  ? 84  ALA C C   1 
ATOM   7371  O  O   . ALA C 1 84  ? -12.334 58.097  64.402  1.00 17.17  ? 84  ALA C O   1 
ATOM   7372  C  CB  . ALA C 1 84  ? -10.066 59.586  65.174  1.00 5.70   ? 84  ALA C CB  1 
ATOM   7373  N  N   . ASN C 1 85  ? -12.265 58.934  62.307  1.00 13.44  ? 85  ASN C N   1 
ATOM   7374  C  CA  . ASN C 1 85  ? -13.135 57.900  61.762  1.00 13.85  ? 85  ASN C CA  1 
ATOM   7375  C  C   . ASN C 1 85  ? -12.797 57.583  60.323  1.00 15.28  ? 85  ASN C C   1 
ATOM   7376  O  O   . ASN C 1 85  ? -12.021 58.307  59.682  1.00 16.87  ? 85  ASN C O   1 
ATOM   7377  C  CB  . ASN C 1 85  ? -14.602 58.320  61.854  1.00 13.75  ? 85  ASN C CB  1 
ATOM   7378  C  CG  . ASN C 1 85  ? -14.914 59.542  61.018  1.00 14.01  ? 85  ASN C CG  1 
ATOM   7379  O  OD1 . ASN C 1 85  ? -15.217 59.439  59.835  1.00 19.66  ? 85  ASN C OD1 1 
ATOM   7380  N  ND2 . ASN C 1 85  ? -14.865 60.702  61.635  1.00 11.04  ? 85  ASN C ND2 1 
ATOM   7381  N  N   . VAL C 1 86  ? -13.363 56.479  59.840  1.00 13.13  ? 86  VAL C N   1 
ATOM   7382  C  CA  . VAL C 1 86  ? -13.168 56.010  58.474  1.00 12.86  ? 86  VAL C CA  1 
ATOM   7383  C  C   . VAL C 1 86  ? -14.553 55.797  57.887  1.00 12.43  ? 86  VAL C C   1 
ATOM   7384  O  O   . VAL C 1 86  ? -15.450 55.310  58.570  1.00 11.82  ? 86  VAL C O   1 
ATOM   7385  C  CB  . VAL C 1 86  ? -12.366 54.668  58.400  1.00 11.22  ? 86  VAL C CB  1 
ATOM   7386  C  CG1 . VAL C 1 86  ? -12.394 54.123  56.991  1.00 13.34  ? 86  VAL C CG1 1 
ATOM   7387  C  CG2 . VAL C 1 86  ? -10.913 54.885  58.796  1.00 6.41   ? 86  VAL C CG2 1 
ATOM   7388  N  N   . GLN C 1 87  ? -14.734 56.254  56.655  1.00 13.38  ? 87  GLN C N   1 
ATOM   7389  C  CA  . GLN C 1 87  ? -15.986 56.118  55.945  1.00 14.22  ? 87  GLN C CA  1 
ATOM   7390  C  C   . GLN C 1 87  ? -15.716 55.351  54.659  1.00 14.28  ? 87  GLN C C   1 
ATOM   7391  O  O   . GLN C 1 87  ? -14.836 55.731  53.883  1.00 18.70  ? 87  GLN C O   1 
ATOM   7392  C  CB  . GLN C 1 87  ? -16.541 57.500  55.617  1.00 15.94  ? 87  GLN C CB  1 
ATOM   7393  C  CG  . GLN C 1 87  ? -16.885 58.310  56.838  1.00 22.78  ? 87  GLN C CG  1 
ATOM   7394  C  CD  . GLN C 1 87  ? -16.982 59.778  56.544  1.00 25.84  ? 87  GLN C CD  1 
ATOM   7395  O  OE1 . GLN C 1 87  ? -17.591 60.178  55.556  1.00 31.46  ? 87  GLN C OE1 1 
ATOM   7396  N  NE2 . GLN C 1 87  ? -16.383 60.598  57.401  1.00 29.59  ? 87  GLN C NE2 1 
ATOM   7397  N  N   . GLY C 1 88  ? -16.419 54.241  54.467  1.00 14.23  ? 88  GLY C N   1 
ATOM   7398  C  CA  . GLY C 1 88  ? -16.246 53.453  53.259  1.00 14.68  ? 88  GLY C CA  1 
ATOM   7399  C  C   . GLY C 1 88  ? -17.494 53.636  52.419  1.00 18.44  ? 88  GLY C C   1 
ATOM   7400  O  O   . GLY C 1 88  ? -18.582 53.298  52.887  1.00 17.88  ? 88  GLY C O   1 
ATOM   7401  N  N   . LYS C 1 89  ? -17.366 54.219  51.226  1.00 20.31  ? 89  LYS C N   1 
ATOM   7402  C  CA  . LYS C 1 89  ? -18.524 54.452  50.353  1.00 22.47  ? 89  LYS C CA  1 
ATOM   7403  C  C   . LYS C 1 89  ? -18.683 53.336  49.350  1.00 20.99  ? 89  LYS C C   1 
ATOM   7404  O  O   . LYS C 1 89  ? -17.694 52.872  48.787  1.00 19.83  ? 89  LYS C O   1 
ATOM   7405  C  CB  . LYS C 1 89  ? -18.382 55.757  49.566  1.00 29.20  ? 89  LYS C CB  1 
ATOM   7406  C  CG  . LYS C 1 89  ? -18.244 57.034  50.393  1.00 42.67  ? 89  LYS C CG  1 
ATOM   7407  C  CD  . LYS C 1 89  ? -16.812 57.254  50.894  1.00 50.48  ? 89  LYS C CD  1 
ATOM   7408  C  CE  . LYS C 1 89  ? -16.688 58.540  51.718  1.00 55.14  ? 89  LYS C CE  1 
ATOM   7409  N  NZ  . LYS C 1 89  ? -16.889 59.771  50.909  1.00 59.92  ? 89  LYS C NZ  1 
ATOM   7410  N  N   . ASN C 1 90  ? -19.921 52.903  49.134  1.00 22.31  ? 90  ASN C N   1 
ATOM   7411  C  CA  . ASN C 1 90  ? -20.233 51.842  48.162  1.00 28.09  ? 90  ASN C CA  1 
ATOM   7412  C  C   . ASN C 1 90  ? -19.574 50.492  48.348  1.00 27.82  ? 90  ASN C C   1 
ATOM   7413  O  O   . ASN C 1 90  ? -19.242 49.836  47.364  1.00 33.00  ? 90  ASN C O   1 
ATOM   7414  C  CB  . ASN C 1 90  ? -19.919 52.298  46.742  1.00 34.37  ? 90  ASN C CB  1 
ATOM   7415  C  CG  . ASN C 1 90  ? -20.966 53.199  46.189  1.00 43.33  ? 90  ASN C CG  1 
ATOM   7416  O  OD1 . ASN C 1 90  ? -22.107 52.775  45.976  1.00 51.55  ? 90  ASN C OD1 1 
ATOM   7417  N  ND2 . ASN C 1 90  ? -20.604 54.461  45.953  1.00 46.81  ? 90  ASN C ND2 1 
ATOM   7418  N  N   . LEU C 1 91  ? -19.421 50.053  49.584  1.00 25.11  ? 91  LEU C N   1 
ATOM   7419  C  CA  . LEU C 1 91  ? -18.793 48.776  49.838  1.00 24.91  ? 91  LEU C CA  1 
ATOM   7420  C  C   . LEU C 1 91  ? -19.818 47.668  49.936  1.00 25.77  ? 91  LEU C C   1 
ATOM   7421  O  O   . LEU C 1 91  ? -19.484 46.493  49.751  1.00 27.88  ? 91  LEU C O   1 
ATOM   7422  C  CB  . LEU C 1 91  ? -17.973 48.842  51.123  1.00 25.19  ? 91  LEU C CB  1 
ATOM   7423  C  CG  . LEU C 1 91  ? -16.943 49.968  51.171  1.00 18.90  ? 91  LEU C CG  1 
ATOM   7424  C  CD1 . LEU C 1 91  ? -16.166 49.833  52.449  1.00 21.35  ? 91  LEU C CD1 1 
ATOM   7425  C  CD2 . LEU C 1 91  ? -16.019 49.910  49.970  1.00 19.89  ? 91  LEU C CD2 1 
ATOM   7426  N  N   . ILE C 1 92  ? -21.054 48.037  50.262  1.00 27.39  ? 92  ILE C N   1 
ATOM   7427  C  CA  . ILE C 1 92  ? -22.150 47.075  50.389  1.00 30.00  ? 92  ILE C CA  1 
ATOM   7428  C  C   . ILE C 1 92  ? -22.923 47.072  49.074  1.00 34.40  ? 92  ILE C C   1 
ATOM   7429  O  O   . ILE C 1 92  ? -23.754 47.949  48.824  1.00 34.37  ? 92  ILE C O   1 
ATOM   7430  C  CB  . ILE C 1 92  ? -23.133 47.460  51.526  1.00 29.00  ? 92  ILE C CB  1 
ATOM   7431  C  CG1 . ILE C 1 92  ? -22.371 47.781  52.809  1.00 26.78  ? 92  ILE C CG1 1 
ATOM   7432  C  CG2 . ILE C 1 92  ? -24.081 46.320  51.807  1.00 26.41  ? 92  ILE C CG2 1 
ATOM   7433  C  CD1 . ILE C 1 92  ? -21.519 46.659  53.291  1.00 27.57  ? 92  ILE C CD1 1 
ATOM   7434  N  N   . GLU C 1 93  ? -22.651 46.071  48.246  1.00 40.88  ? 93  GLU C N   1 
ATOM   7435  C  CA  . GLU C 1 93  ? -23.286 45.928  46.934  1.00 47.83  ? 93  GLU C CA  1 
ATOM   7436  C  C   . GLU C 1 93  ? -24.813 46.047  46.929  1.00 45.00  ? 93  GLU C C   1 
ATOM   7437  O  O   . GLU C 1 93  ? -25.384 46.746  46.098  1.00 45.72  ? 93  GLU C O   1 
ATOM   7438  C  CB  . GLU C 1 93  ? -22.883 44.588  46.290  1.00 58.01  ? 93  GLU C CB  1 
ATOM   7439  C  CG  . GLU C 1 93  ? -21.437 44.499  45.750  1.00 74.33  ? 93  GLU C CG  1 
ATOM   7440  C  CD  . GLU C 1 93  ? -20.397 44.117  46.806  1.00 84.26  ? 93  GLU C CD  1 
ATOM   7441  O  OE1 . GLU C 1 93  ? -20.690 43.245  47.663  1.00 88.83  ? 93  GLU C OE1 1 
ATOM   7442  O  OE2 . GLU C 1 93  ? -19.275 44.683  46.756  1.00 88.63  ? 93  GLU C OE2 1 
ATOM   7443  N  N   . TRP C 1 94  ? -25.472 45.362  47.858  1.00 43.93  ? 94  TRP C N   1 
ATOM   7444  C  CA  . TRP C 1 94  ? -26.929 45.382  47.921  1.00 41.49  ? 94  TRP C CA  1 
ATOM   7445  C  C   . TRP C 1 94  ? -27.535 46.632  48.532  1.00 38.88  ? 94  TRP C C   1 
ATOM   7446  O  O   . TRP C 1 94  ? -28.750 46.765  48.596  1.00 42.04  ? 94  TRP C O   1 
ATOM   7447  C  CB  . TRP C 1 94  ? -27.467 44.115  48.586  1.00 45.37  ? 94  TRP C CB  1 
ATOM   7448  C  CG  . TRP C 1 94  ? -26.779 43.746  49.837  1.00 51.11  ? 94  TRP C CG  1 
ATOM   7449  C  CD1 . TRP C 1 94  ? -25.548 43.157  49.960  1.00 54.21  ? 94  TRP C CD1 1 
ATOM   7450  C  CD2 . TRP C 1 94  ? -27.261 43.954  51.163  1.00 55.94  ? 94  TRP C CD2 1 
ATOM   7451  N  NE1 . TRP C 1 94  ? -25.234 42.993  51.288  1.00 59.22  ? 94  TRP C NE1 1 
ATOM   7452  C  CE2 . TRP C 1 94  ? -26.268 43.475  52.049  1.00 58.31  ? 94  TRP C CE2 1 
ATOM   7453  C  CE3 . TRP C 1 94  ? -28.438 44.499  51.692  1.00 59.28  ? 94  TRP C CE3 1 
ATOM   7454  C  CZ2 . TRP C 1 94  ? -26.416 43.529  53.441  1.00 61.45  ? 94  TRP C CZ2 1 
ATOM   7455  C  CZ3 . TRP C 1 94  ? -28.587 44.553  53.074  1.00 61.84  ? 94  TRP C CZ3 1 
ATOM   7456  C  CH2 . TRP C 1 94  ? -27.580 44.071  53.933  1.00 63.26  ? 94  TRP C CH2 1 
ATOM   7457  N  N   . LEU C 1 95  ? -26.683 47.540  48.991  1.00 34.29  ? 95  LEU C N   1 
ATOM   7458  C  CA  . LEU C 1 95  ? -27.120 48.809  49.547  1.00 31.25  ? 95  LEU C CA  1 
ATOM   7459  C  C   . LEU C 1 95  ? -26.265 49.830  48.820  1.00 33.82  ? 95  LEU C C   1 
ATOM   7460  O  O   . LEU C 1 95  ? -25.442 50.520  49.426  1.00 35.59  ? 95  LEU C O   1 
ATOM   7461  C  CB  . LEU C 1 95  ? -26.838 48.869  51.034  1.00 27.25  ? 95  LEU C CB  1 
ATOM   7462  C  CG  . LEU C 1 95  ? -27.701 47.941  51.862  1.00 24.86  ? 95  LEU C CG  1 
ATOM   7463  C  CD1 . LEU C 1 95  ? -27.308 48.050  53.310  1.00 24.16  ? 95  LEU C CD1 1 
ATOM   7464  C  CD2 . LEU C 1 95  ? -29.152 48.308  51.681  1.00 22.55  ? 95  LEU C CD2 1 
ATOM   7465  N  N   . PRO C 1 96  ? -26.426 49.918  47.489  1.00 35.70  ? 96  PRO C N   1 
ATOM   7466  C  CA  . PRO C 1 96  ? -25.657 50.854  46.663  1.00 32.97  ? 96  PRO C CA  1 
ATOM   7467  C  C   . PRO C 1 96  ? -25.771 52.294  47.118  1.00 31.11  ? 96  PRO C C   1 
ATOM   7468  O  O   . PRO C 1 96  ? -26.858 52.771  47.457  1.00 33.06  ? 96  PRO C O   1 
ATOM   7469  C  CB  . PRO C 1 96  ? -26.264 50.655  45.271  1.00 34.57  ? 96  PRO C CB  1 
ATOM   7470  C  CG  . PRO C 1 96  ? -27.679 50.284  45.570  1.00 34.99  ? 96  PRO C CG  1 
ATOM   7471  C  CD  . PRO C 1 96  ? -27.497 49.290  46.691  1.00 34.89  ? 96  PRO C CD  1 
ATOM   7472  N  N   . GLY C 1 97  ? -24.636 52.976  47.147  1.00 29.59  ? 97  GLY C N   1 
ATOM   7473  C  CA  . GLY C 1 97  ? -24.615 54.374  47.548  1.00 27.27  ? 97  GLY C CA  1 
ATOM   7474  C  C   . GLY C 1 97  ? -24.471 54.635  49.034  1.00 25.02  ? 97  GLY C C   1 
ATOM   7475  O  O   . GLY C 1 97  ? -24.135 55.757  49.431  1.00 29.43  ? 97  GLY C O   1 
ATOM   7476  N  N   . SER C 1 98  ? -24.703 53.618  49.858  1.00 23.21  ? 98  SER C N   1 
ATOM   7477  C  CA  . SER C 1 98  ? -24.601 53.787  51.307  1.00 23.00  ? 98  SER C CA  1 
ATOM   7478  C  C   . SER C 1 98  ? -23.152 53.866  51.760  1.00 21.34  ? 98  SER C C   1 
ATOM   7479  O  O   . SER C 1 98  ? -22.251 53.324  51.114  1.00 23.36  ? 98  SER C O   1 
ATOM   7480  C  CB  . SER C 1 98  ? -25.283 52.634  52.023  1.00 20.00  ? 98  SER C CB  1 
ATOM   7481  O  OG  . SER C 1 98  ? -24.592 51.432  51.749  1.00 24.46  ? 98  SER C OG  1 
ATOM   7482  N  N   . THR C 1 99  ? -22.947 54.527  52.889  1.00 20.07  ? 99  THR C N   1 
ATOM   7483  C  CA  . THR C 1 99  ? -21.627 54.687  53.478  1.00 18.25  ? 99  THR C CA  1 
ATOM   7484  C  C   . THR C 1 99  ? -21.634 54.035  54.865  1.00 19.68  ? 99  THR C C   1 
ATOM   7485  O  O   . THR C 1 99  ? -22.577 54.252  55.632  1.00 22.43  ? 99  THR C O   1 
ATOM   7486  C  CB  . THR C 1 99  ? -21.311 56.180  53.674  1.00 16.74  ? 99  THR C CB  1 
ATOM   7487  O  OG1 . THR C 1 99  ? -21.304 56.839  52.403  1.00 26.99  ? 99  THR C OG1 1 
ATOM   7488  C  CG2 . THR C 1 99  ? -19.979 56.356  54.355  1.00 17.58  ? 99  THR C CG2 1 
ATOM   7489  N  N   . ILE C 1 100 ? -20.658 53.169  55.144  1.00 17.17  ? 100 ILE C N   1 
ATOM   7490  C  CA  . ILE C 1 100 ? -20.538 52.551  56.470  1.00 15.30  ? 100 ILE C CA  1 
ATOM   7491  C  C   . ILE C 1 100 ? -19.377 53.265  57.153  1.00 14.63  ? 100 ILE C C   1 
ATOM   7492  O  O   . ILE C 1 100 ? -18.392 53.615  56.503  1.00 16.05  ? 100 ILE C O   1 
ATOM   7493  C  CB  . ILE C 1 100 ? -20.269 51.017  56.431  1.00 15.03  ? 100 ILE C CB  1 
ATOM   7494  C  CG1 . ILE C 1 100 ? -18.968 50.698  55.724  1.00 16.96  ? 100 ILE C CG1 1 
ATOM   7495  C  CG2 . ILE C 1 100 ? -21.356 50.319  55.678  1.00 19.79  ? 100 ILE C CG2 1 
ATOM   7496  C  CD1 . ILE C 1 100 ? -18.656 49.229  55.738  1.00 16.59  ? 100 ILE C CD1 1 
ATOM   7497  N  N   . TRP C 1 101 ? -19.486 53.510  58.448  1.00 15.67  ? 101 TRP C N   1 
ATOM   7498  C  CA  . TRP C 1 101 ? -18.417 54.216  59.129  1.00 13.99  ? 101 TRP C CA  1 
ATOM   7499  C  C   . TRP C 1 101 ? -18.306 53.800  60.575  1.00 13.20  ? 101 TRP C C   1 
ATOM   7500  O  O   . TRP C 1 101 ? -19.256 53.268  61.137  1.00 15.72  ? 101 TRP C O   1 
ATOM   7501  C  CB  . TRP C 1 101 ? -18.682 55.710  59.054  1.00 10.55  ? 101 TRP C CB  1 
ATOM   7502  C  CG  . TRP C 1 101 ? -19.955 56.092  59.710  1.00 11.54  ? 101 TRP C CG  1 
ATOM   7503  C  CD1 . TRP C 1 101 ? -21.214 56.034  59.178  1.00 10.24  ? 101 TRP C CD1 1 
ATOM   7504  C  CD2 . TRP C 1 101 ? -20.100 56.590  61.041  1.00 13.56  ? 101 TRP C CD2 1 
ATOM   7505  N  NE1 . TRP C 1 101 ? -22.136 56.466  60.104  1.00 11.42  ? 101 TRP C NE1 1 
ATOM   7506  C  CE2 . TRP C 1 101 ? -21.478 56.811  61.256  1.00 14.05  ? 101 TRP C CE2 1 
ATOM   7507  C  CE3 . TRP C 1 101 ? -19.196 56.866  62.080  1.00 10.05  ? 101 TRP C CE3 1 
ATOM   7508  C  CZ2 . TRP C 1 101 ? -21.975 57.296  62.473  1.00 18.23  ? 101 TRP C CZ2 1 
ATOM   7509  C  CZ3 . TRP C 1 101 ? -19.686 57.345  63.287  1.00 14.25  ? 101 TRP C CZ3 1 
ATOM   7510  C  CH2 . TRP C 1 101 ? -21.066 57.555  63.475  1.00 14.36  ? 101 TRP C CH2 1 
ATOM   7511  N  N   . ALA C 1 102 ? -17.140 54.042  61.161  1.00 12.03  ? 102 ALA C N   1 
ATOM   7512  C  CA  . ALA C 1 102 ? -16.883 53.732  62.553  1.00 8.81   ? 102 ALA C CA  1 
ATOM   7513  C  C   . ALA C 1 102 ? -15.808 54.691  63.037  1.00 10.99  ? 102 ALA C C   1 
ATOM   7514  O  O   . ALA C 1 102 ? -14.929 55.079  62.263  1.00 11.93  ? 102 ALA C O   1 
ATOM   7515  C  CB  . ALA C 1 102 ? -16.416 52.302  62.696  1.00 7.67   ? 102 ALA C CB  1 
ATOM   7516  N  N   . GLY C 1 103 ? -15.930 55.126  64.290  1.00 11.52  ? 103 GLY C N   1 
ATOM   7517  C  CA  . GLY C 1 103 ? -14.957 56.021  64.889  1.00 9.68   ? 103 GLY C CA  1 
ATOM   7518  C  C   . GLY C 1 103 ? -15.624 57.226  65.506  1.00 12.60  ? 103 GLY C C   1 
ATOM   7519  O  O   . GLY C 1 103 ? -16.853 57.315  65.534  1.00 16.75  ? 103 GLY C O   1 
ATOM   7520  N  N   . LYS C 1 104 ? -14.831 58.149  66.030  1.00 11.36  ? 104 LYS C N   1 
ATOM   7521  C  CA  . LYS C 1 104 ? -15.391 59.358  66.608  1.00 11.17  ? 104 LYS C CA  1 
ATOM   7522  C  C   . LYS C 1 104 ? -15.739 60.230  65.423  1.00 11.94  ? 104 LYS C C   1 
ATOM   7523  O  O   . LYS C 1 104 ? -14.889 60.463  64.563  1.00 11.72  ? 104 LYS C O   1 
ATOM   7524  C  CB  . LYS C 1 104 ? -14.374 60.068  67.516  1.00 9.33   ? 104 LYS C CB  1 
ATOM   7525  C  CG  . LYS C 1 104 ? -14.004 59.290  68.779  1.00 7.80   ? 104 LYS C CG  1 
ATOM   7526  C  CD  . LYS C 1 104 ? -13.277 60.163  69.812  1.00 2.65   ? 104 LYS C CD  1 
ATOM   7527  C  CE  . LYS C 1 104 ? -14.189 61.227  70.380  1.00 2.55   ? 104 LYS C CE  1 
ATOM   7528  N  NZ  . LYS C 1 104 ? -13.469 62.090  71.348  1.00 8.68   ? 104 LYS C NZ  1 
ATOM   7529  N  N   . ARG C 1 105 ? -16.962 60.751  65.391  1.00 12.34  ? 105 ARG C N   1 
ATOM   7530  C  CA  . ARG C 1 105 ? -17.378 61.565  64.264  1.00 10.14  ? 105 ARG C CA  1 
ATOM   7531  C  C   . ARG C 1 105 ? -18.474 62.560  64.555  1.00 12.45  ? 105 ARG C C   1 
ATOM   7532  O  O   . ARG C 1 105 ? -19.353 62.278  65.344  1.00 16.67  ? 105 ARG C O   1 
ATOM   7533  C  CB  . ARG C 1 105 ? -17.855 60.630  63.158  1.00 12.47  ? 105 ARG C CB  1 
ATOM   7534  C  CG  . ARG C 1 105 ? -18.511 61.306  62.005  1.00 11.52  ? 105 ARG C CG  1 
ATOM   7535  C  CD  . ARG C 1 105 ? -18.860 60.296  60.933  1.00 11.56  ? 105 ARG C CD  1 
ATOM   7536  N  NE  . ARG C 1 105 ? -19.470 60.980  59.801  1.00 17.40  ? 105 ARG C NE  1 
ATOM   7537  C  CZ  . ARG C 1 105 ? -20.222 60.403  58.872  1.00 16.39  ? 105 ARG C CZ  1 
ATOM   7538  N  NH1 . ARG C 1 105 ? -20.475 59.108  58.908  1.00 18.93  ? 105 ARG C NH1 1 
ATOM   7539  N  NH2 . ARG C 1 105 ? -20.772 61.145  57.932  1.00 18.31  ? 105 ARG C NH2 1 
ATOM   7540  N  N   . PHE C 1 106 ? -18.375 63.748  63.957  1.00 12.85  ? 106 PHE C N   1 
ATOM   7541  C  CA  . PHE C 1 106 ? -19.420 64.769  64.062  1.00 11.53  ? 106 PHE C CA  1 
ATOM   7542  C  C   . PHE C 1 106 ? -20.462 64.195  63.088  1.00 13.77  ? 106 PHE C C   1 
ATOM   7543  O  O   . PHE C 1 106 ? -20.277 64.239  61.874  1.00 17.99  ? 106 PHE C O   1 
ATOM   7544  C  CB  . PHE C 1 106 ? -18.932 66.110  63.515  1.00 8.07   ? 106 PHE C CB  1 
ATOM   7545  C  CG  . PHE C 1 106 ? -18.042 66.883  64.459  1.00 12.41  ? 106 PHE C CG  1 
ATOM   7546  C  CD1 . PHE C 1 106 ? -17.813 66.442  65.757  1.00 10.62  ? 106 PHE C CD1 1 
ATOM   7547  C  CD2 . PHE C 1 106 ? -17.450 68.077  64.049  1.00 6.85   ? 106 PHE C CD2 1 
ATOM   7548  C  CE1 . PHE C 1 106 ? -17.010 67.184  66.625  1.00 12.52  ? 106 PHE C CE1 1 
ATOM   7549  C  CE2 . PHE C 1 106 ? -16.650 68.818  64.912  1.00 8.90   ? 106 PHE C CE2 1 
ATOM   7550  C  CZ  . PHE C 1 106 ? -16.430 68.374  66.197  1.00 10.19  ? 106 PHE C CZ  1 
ATOM   7551  N  N   . TYR C 1 107 ? -21.529 63.615  63.618  1.00 13.69  ? 107 TYR C N   1 
ATOM   7552  C  CA  . TYR C 1 107 ? -22.538 62.986  62.784  1.00 11.04  ? 107 TYR C CA  1 
ATOM   7553  C  C   . TYR C 1 107 ? -23.753 63.838  62.494  1.00 13.58  ? 107 TYR C C   1 
ATOM   7554  O  O   . TYR C 1 107 ? -24.522 64.159  63.393  1.00 14.04  ? 107 TYR C O   1 
ATOM   7555  C  CB  . TYR C 1 107 ? -22.996 61.678  63.431  1.00 10.70  ? 107 TYR C CB  1 
ATOM   7556  C  CG  . TYR C 1 107 ? -23.982 60.928  62.593  1.00 12.70  ? 107 TYR C CG  1 
ATOM   7557  C  CD1 . TYR C 1 107 ? -23.557 60.239  61.465  1.00 11.98  ? 107 TYR C CD1 1 
ATOM   7558  C  CD2 . TYR C 1 107 ? -25.339 60.885  62.928  1.00 8.75   ? 107 TYR C CD2 1 
ATOM   7559  C  CE1 . TYR C 1 107 ? -24.437 59.522  60.688  1.00 11.92  ? 107 TYR C CE1 1 
ATOM   7560  C  CE2 . TYR C 1 107 ? -26.239 60.166  62.152  1.00 12.27  ? 107 TYR C CE2 1 
ATOM   7561  C  CZ  . TYR C 1 107 ? -25.771 59.480  61.026  1.00 13.44  ? 107 TYR C CZ  1 
ATOM   7562  O  OH  . TYR C 1 107 ? -26.598 58.721  60.236  1.00 13.97  ? 107 TYR C OH  1 
ATOM   7563  N  N   . GLN C 1 108 ? -23.935 64.176  61.222  1.00 13.44  ? 108 GLN C N   1 
ATOM   7564  C  CA  . GLN C 1 108 ? -25.083 64.962  60.758  1.00 9.40   ? 108 GLN C CA  1 
ATOM   7565  C  C   . GLN C 1 108 ? -25.654 65.991  61.730  1.00 12.93  ? 108 GLN C C   1 
ATOM   7566  O  O   . GLN C 1 108 ? -26.845 65.998  62.015  1.00 16.47  ? 108 GLN C O   1 
ATOM   7567  C  CB  . GLN C 1 108 ? -26.186 64.018  60.281  1.00 10.29  ? 108 GLN C CB  1 
ATOM   7568  C  CG  . GLN C 1 108 ? -25.720 63.050  59.192  1.00 11.01  ? 108 GLN C CG  1 
ATOM   7569  C  CD  . GLN C 1 108 ? -26.862 62.256  58.587  1.00 14.27  ? 108 GLN C CD  1 
ATOM   7570  O  OE1 . GLN C 1 108 ? -28.027 62.637  58.695  1.00 18.31  ? 108 GLN C OE1 1 
ATOM   7571  N  NE2 . GLN C 1 108 ? -26.535 61.150  57.950  1.00 13.05  ? 108 GLN C NE2 1 
ATOM   7572  N  N   . ARG C 1 109 ? -24.808 66.897  62.197  1.00 14.19  ? 109 ARG C N   1 
ATOM   7573  C  CA  . ARG C 1 109 ? -25.226 67.933  63.130  1.00 13.42  ? 109 ARG C CA  1 
ATOM   7574  C  C   . ARG C 1 109 ? -26.083 68.993  62.463  1.00 13.73  ? 109 ARG C C   1 
ATOM   7575  O  O   . ARG C 1 109 ? -25.861 69.330  61.310  1.00 18.53  ? 109 ARG C O   1 
ATOM   7576  C  CB  . ARG C 1 109 ? -23.997 68.592  63.751  1.00 10.13  ? 109 ARG C CB  1 
ATOM   7577  C  CG  . ARG C 1 109 ? -23.017 67.596  64.348  1.00 8.07   ? 109 ARG C CG  1 
ATOM   7578  C  CD  . ARG C 1 109 ? -21.898 68.305  65.044  1.00 9.87   ? 109 ARG C CD  1 
ATOM   7579  N  NE  . ARG C 1 109 ? -21.156 69.148  64.123  1.00 12.82  ? 109 ARG C NE  1 
ATOM   7580  C  CZ  . ARG C 1 109 ? -20.174 69.954  64.491  1.00 16.28  ? 109 ARG C CZ  1 
ATOM   7581  N  NH1 . ARG C 1 109 ? -19.827 70.018  65.760  1.00 18.06  ? 109 ARG C NH1 1 
ATOM   7582  N  NH2 . ARG C 1 109 ? -19.539 70.688  63.592  1.00 14.39  ? 109 ARG C NH2 1 
ATOM   7583  N  N   . HIS C 1 110 ? -27.068 69.501  63.195  1.00 12.66  ? 110 HIS C N   1 
ATOM   7584  C  CA  . HIS C 1 110 ? -27.966 70.547  62.714  1.00 7.95   ? 110 HIS C CA  1 
ATOM   7585  C  C   . HIS C 1 110 ? -27.824 71.696  63.709  1.00 12.16  ? 110 HIS C C   1 
ATOM   7586  O  O   . HIS C 1 110 ? -27.993 71.496  64.917  1.00 15.07  ? 110 HIS C O   1 
ATOM   7587  C  CB  . HIS C 1 110 ? -29.427 70.070  62.720  1.00 9.77   ? 110 HIS C CB  1 
ATOM   7588  C  CG  . HIS C 1 110 ? -29.750 69.025  61.692  1.00 8.38   ? 110 HIS C CG  1 
ATOM   7589  N  ND1 . HIS C 1 110 ? -30.847 69.115  60.867  1.00 10.23  ? 110 HIS C ND1 1 
ATOM   7590  C  CD2 . HIS C 1 110 ? -29.169 67.836  61.412  1.00 7.43   ? 110 HIS C CD2 1 
ATOM   7591  C  CE1 . HIS C 1 110 ? -30.934 68.025  60.129  1.00 12.34  ? 110 HIS C CE1 1 
ATOM   7592  N  NE2 . HIS C 1 110 ? -29.926 67.234  60.441  1.00 8.95   ? 110 HIS C NE2 1 
ATOM   7593  N  N   . ASP C 1 111 ? -27.562 72.903  63.219  1.00 12.84  ? 111 ASP C N   1 
ATOM   7594  C  CA  . ASP C 1 111 ? -27.389 74.053  64.096  1.00 11.89  ? 111 ASP C CA  1 
ATOM   7595  C  C   . ASP C 1 111 ? -27.916 75.319  63.466  1.00 11.73  ? 111 ASP C C   1 
ATOM   7596  O  O   . ASP C 1 111 ? -28.257 75.329  62.281  1.00 15.13  ? 111 ASP C O   1 
ATOM   7597  C  CB  . ASP C 1 111 ? -25.910 74.258  64.396  1.00 14.63  ? 111 ASP C CB  1 
ATOM   7598  C  CG  . ASP C 1 111 ? -25.126 74.745  63.188  1.00 18.17  ? 111 ASP C CG  1 
ATOM   7599  O  OD1 . ASP C 1 111 ? -25.093 74.054  62.145  1.00 20.91  ? 111 ASP C OD1 1 
ATOM   7600  O  OD2 . ASP C 1 111 ? -24.536 75.834  63.287  1.00 19.10  ? 111 ASP C OD2 1 
ATOM   7601  N  N   . VAL C 1 112 ? -27.983 76.381  64.269  1.00 11.56  ? 112 VAL C N   1 
ATOM   7602  C  CA  . VAL C 1 112 ? -28.415 77.700  63.824  1.00 10.69  ? 112 VAL C CA  1 
ATOM   7603  C  C   . VAL C 1 112 ? -27.176 78.551  64.037  1.00 13.29  ? 112 VAL C C   1 
ATOM   7604  O  O   . VAL C 1 112 ? -26.855 78.899  65.173  1.00 19.03  ? 112 VAL C O   1 
ATOM   7605  C  CB  . VAL C 1 112 ? -29.558 78.280  64.689  1.00 11.11  ? 112 VAL C CB  1 
ATOM   7606  C  CG1 . VAL C 1 112 ? -29.904 79.696  64.219  1.00 7.06   ? 112 VAL C CG1 1 
ATOM   7607  C  CG2 . VAL C 1 112 ? -30.789 77.380  64.621  1.00 11.96  ? 112 VAL C CG2 1 
ATOM   7608  N  N   . HIS C 1 113 ? -26.494 78.900  62.951  1.00 12.44  ? 113 HIS C N   1 
ATOM   7609  C  CA  . HIS C 1 113 ? -25.262 79.671  63.032  1.00 10.01  ? 113 HIS C CA  1 
ATOM   7610  C  C   . HIS C 1 113 ? -25.240 80.932  63.887  1.00 12.61  ? 113 HIS C C   1 
ATOM   7611  O  O   . HIS C 1 113 ? -24.337 81.082  64.715  1.00 12.28  ? 113 HIS C O   1 
ATOM   7612  C  CB  . HIS C 1 113 ? -24.721 80.025  61.641  1.00 8.48   ? 113 HIS C CB  1 
ATOM   7613  C  CG  . HIS C 1 113 ? -23.527 80.928  61.693  1.00 8.57   ? 113 HIS C CG  1 
ATOM   7614  N  ND1 . HIS C 1 113 ? -22.264 80.463  61.991  1.00 8.79   ? 113 HIS C ND1 1 
ATOM   7615  C  CD2 . HIS C 1 113 ? -23.419 82.277  61.596  1.00 5.36   ? 113 HIS C CD2 1 
ATOM   7616  C  CE1 . HIS C 1 113 ? -21.428 81.484  62.081  1.00 9.61   ? 113 HIS C CE1 1 
ATOM   7617  N  NE2 . HIS C 1 113 ? -22.104 82.598  61.846  1.00 8.74   ? 113 HIS C NE2 1 
ATOM   7618  N  N   . MET C 1 114 ? -26.203 81.839  63.699  1.00 12.36  ? 114 MET C N   1 
ATOM   7619  C  CA  . MET C 1 114 ? -26.179 83.094  64.449  1.00 11.59  ? 114 MET C CA  1 
ATOM   7620  C  C   . MET C 1 114 ? -26.243 83.000  65.966  1.00 14.46  ? 114 MET C C   1 
ATOM   7621  O  O   . MET C 1 114 ? -25.792 83.913  66.654  1.00 17.35  ? 114 MET C O   1 
ATOM   7622  C  CB  . MET C 1 114 ? -27.180 84.116  63.899  1.00 13.22  ? 114 MET C CB  1 
ATOM   7623  C  CG  . MET C 1 114 ? -28.631 83.686  63.906  1.00 11.89  ? 114 MET C CG  1 
ATOM   7624  S  SD  . MET C 1 114 ? -29.676 84.981  63.228  1.00 17.37  ? 114 MET C SD  1 
ATOM   7625  C  CE  . MET C 1 114 ? -29.168 86.369  64.145  1.00 10.59  ? 114 MET C CE  1 
ATOM   7626  N  N   . ILE C 1 115 ? -26.777 81.905  66.502  1.00 13.70  ? 115 ILE C N   1 
ATOM   7627  C  CA  . ILE C 1 115 ? -26.814 81.758  67.955  1.00 12.76  ? 115 ILE C CA  1 
ATOM   7628  C  C   . ILE C 1 115 ? -25.905 80.617  68.380  1.00 14.97  ? 115 ILE C C   1 
ATOM   7629  O  O   . ILE C 1 115 ? -25.867 80.254  69.546  1.00 18.58  ? 115 ILE C O   1 
ATOM   7630  C  CB  . ILE C 1 115 ? -28.241 81.536  68.504  1.00 10.22  ? 115 ILE C CB  1 
ATOM   7631  C  CG1 . ILE C 1 115 ? -28.984 80.476  67.706  1.00 10.24  ? 115 ILE C CG1 1 
ATOM   7632  C  CG2 . ILE C 1 115 ? -29.004 82.820  68.475  1.00 11.18  ? 115 ILE C CG2 1 
ATOM   7633  C  CD1 . ILE C 1 115 ? -30.338 80.126  68.292  1.00 8.10   ? 115 ILE C CD1 1 
ATOM   7634  N  N   . ASP C 1 116 ? -25.152 80.088  67.415  1.00 14.06  ? 116 ASP C N   1 
ATOM   7635  C  CA  . ASP C 1 116 ? -24.219 78.977  67.617  1.00 13.24  ? 116 ASP C CA  1 
ATOM   7636  C  C   . ASP C 1 116 ? -24.899 77.896  68.442  1.00 12.96  ? 116 ASP C C   1 
ATOM   7637  O  O   . ASP C 1 116 ? -24.336 77.368  69.389  1.00 16.03  ? 116 ASP C O   1 
ATOM   7638  C  CB  . ASP C 1 116 ? -22.949 79.479  68.309  1.00 9.26   ? 116 ASP C CB  1 
ATOM   7639  C  CG  . ASP C 1 116 ? -21.784 78.515  68.176  1.00 12.83  ? 116 ASP C CG  1 
ATOM   7640  O  OD1 . ASP C 1 116 ? -21.847 77.567  67.371  1.00 12.11  ? 116 ASP C OD1 1 
ATOM   7641  O  OD2 . ASP C 1 116 ? -20.790 78.703  68.890  1.00 13.14  ? 116 ASP C OD2 1 
ATOM   7642  N  N   . PHE C 1 117 ? -26.105 77.542  68.028  1.00 13.61  ? 117 PHE C N   1 
ATOM   7643  C  CA  . PHE C 1 117 ? -26.919 76.570  68.729  1.00 12.86  ? 117 PHE C CA  1 
ATOM   7644  C  C   . PHE C 1 117 ? -27.157 75.327  67.904  1.00 15.05  ? 117 PHE C C   1 
ATOM   7645  O  O   . PHE C 1 117 ? -27.711 75.409  66.809  1.00 17.90  ? 117 PHE C O   1 
ATOM   7646  C  CB  . PHE C 1 117 ? -28.268 77.219  69.064  1.00 13.16  ? 117 PHE C CB  1 
ATOM   7647  C  CG  . PHE C 1 117 ? -29.164 76.360  69.893  1.00 13.20  ? 117 PHE C CG  1 
ATOM   7648  C  CD1 . PHE C 1 117 ? -28.899 76.165  71.244  1.00 12.62  ? 117 PHE C CD1 1 
ATOM   7649  C  CD2 . PHE C 1 117 ? -30.277 75.749  69.330  1.00 15.15  ? 117 PHE C CD2 1 
ATOM   7650  C  CE1 . PHE C 1 117 ? -29.723 75.381  72.019  1.00 9.54   ? 117 PHE C CE1 1 
ATOM   7651  C  CE2 . PHE C 1 117 ? -31.113 74.957  70.100  1.00 17.11  ? 117 PHE C CE2 1 
ATOM   7652  C  CZ  . PHE C 1 117 ? -30.832 74.773  71.454  1.00 8.48   ? 117 PHE C CZ  1 
ATOM   7653  N  N   . TYR C 1 118 ? -26.761 74.182  68.447  1.00 15.17  ? 118 TYR C N   1 
ATOM   7654  C  CA  . TYR C 1 118 ? -26.951 72.894  67.801  1.00 13.25  ? 118 TYR C CA  1 
ATOM   7655  C  C   . TYR C 1 118 ? -28.228 72.307  68.374  1.00 16.76  ? 118 TYR C C   1 
ATOM   7656  O  O   . TYR C 1 118 ? -28.380 72.243  69.588  1.00 21.61  ? 118 TYR C O   1 
ATOM   7657  C  CB  . TYR C 1 118 ? -25.768 71.953  68.110  1.00 12.98  ? 118 TYR C CB  1 
ATOM   7658  C  CG  . TYR C 1 118 ? -24.532 72.254  67.297  1.00 13.64  ? 118 TYR C CG  1 
ATOM   7659  C  CD1 . TYR C 1 118 ? -23.740 73.358  67.588  1.00 14.33  ? 118 TYR C CD1 1 
ATOM   7660  C  CD2 . TYR C 1 118 ? -24.217 71.501  66.172  1.00 14.05  ? 118 TYR C CD2 1 
ATOM   7661  C  CE1 . TYR C 1 118 ? -22.673 73.721  66.771  1.00 15.38  ? 118 TYR C CE1 1 
ATOM   7662  C  CE2 . TYR C 1 118 ? -23.154 71.851  65.352  1.00 14.15  ? 118 TYR C CE2 1 
ATOM   7663  C  CZ  . TYR C 1 118 ? -22.390 72.969  65.653  1.00 16.08  ? 118 TYR C CZ  1 
ATOM   7664  O  OH  . TYR C 1 118 ? -21.371 73.364  64.810  1.00 18.33  ? 118 TYR C OH  1 
ATOM   7665  N  N   . TYR C 1 119 ? -29.150 71.875  67.525  1.00 16.18  ? 119 TYR C N   1 
ATOM   7666  C  CA  . TYR C 1 119 ? -30.385 71.295  68.031  1.00 14.15  ? 119 TYR C CA  1 
ATOM   7667  C  C   . TYR C 1 119 ? -30.517 69.808  67.722  1.00 15.34  ? 119 TYR C C   1 
ATOM   7668  O  O   . TYR C 1 119 ? -31.478 69.162  68.121  1.00 19.93  ? 119 TYR C O   1 
ATOM   7669  C  CB  . TYR C 1 119 ? -31.601 72.078  67.529  1.00 13.01  ? 119 TYR C CB  1 
ATOM   7670  C  CG  . TYR C 1 119 ? -31.671 72.264  66.030  1.00 12.50  ? 119 TYR C CG  1 
ATOM   7671  C  CD1 . TYR C 1 119 ? -32.338 71.344  65.216  1.00 15.46  ? 119 TYR C CD1 1 
ATOM   7672  C  CD2 . TYR C 1 119 ? -31.108 73.386  65.426  1.00 14.14  ? 119 TYR C CD2 1 
ATOM   7673  C  CE1 . TYR C 1 119 ? -32.449 71.546  63.842  1.00 12.35  ? 119 TYR C CE1 1 
ATOM   7674  C  CE2 . TYR C 1 119 ? -31.209 73.595  64.052  1.00 13.05  ? 119 TYR C CE2 1 
ATOM   7675  C  CZ  . TYR C 1 119 ? -31.882 72.679  63.270  1.00 16.96  ? 119 TYR C CZ  1 
ATOM   7676  O  OH  . TYR C 1 119 ? -32.007 72.920  61.924  1.00 17.06  ? 119 TYR C OH  1 
ATOM   7677  N  N   . TRP C 1 120 ? -29.565 69.267  66.980  1.00 12.02  ? 120 TRP C N   1 
ATOM   7678  C  CA  . TRP C 1 120 ? -29.599 67.859  66.664  1.00 10.49  ? 120 TRP C CA  1 
ATOM   7679  C  C   . TRP C 1 120 ? -28.134 67.516  66.515  1.00 14.43  ? 120 TRP C C   1 
ATOM   7680  O  O   . TRP C 1 120 ? -27.503 67.802  65.490  1.00 17.05  ? 120 TRP C O   1 
ATOM   7681  C  CB  . TRP C 1 120 ? -30.387 67.600  65.381  1.00 11.27  ? 120 TRP C CB  1 
ATOM   7682  C  CG  . TRP C 1 120 ? -30.912 66.177  65.272  1.00 14.91  ? 120 TRP C CG  1 
ATOM   7683  C  CD1 . TRP C 1 120 ? -30.768 65.181  66.188  1.00 13.63  ? 120 TRP C CD1 1 
ATOM   7684  C  CD2 . TRP C 1 120 ? -31.661 65.607  64.179  1.00 16.50  ? 120 TRP C CD2 1 
ATOM   7685  N  NE1 . TRP C 1 120 ? -31.375 64.030  65.740  1.00 15.51  ? 120 TRP C NE1 1 
ATOM   7686  C  CE2 . TRP C 1 120 ? -31.927 64.261  64.510  1.00 17.93  ? 120 TRP C CE2 1 
ATOM   7687  C  CE3 . TRP C 1 120 ? -32.131 66.107  62.956  1.00 17.98  ? 120 TRP C CE3 1 
ATOM   7688  C  CZ2 . TRP C 1 120 ? -32.640 63.400  63.659  1.00 18.32  ? 120 TRP C CZ2 1 
ATOM   7689  C  CZ3 . TRP C 1 120 ? -32.843 65.254  62.111  1.00 15.76  ? 120 TRP C CZ3 1 
ATOM   7690  C  CH2 . TRP C 1 120 ? -33.088 63.914  62.468  1.00 15.46  ? 120 TRP C CH2 1 
ATOM   7691  N  N   . ASP C 1 121 ? -27.577 66.971  67.593  1.00 14.84  ? 121 ASP C N   1 
ATOM   7692  C  CA  . ASP C 1 121 ? -26.164 66.623  67.651  1.00 11.88  ? 121 ASP C CA  1 
ATOM   7693  C  C   . ASP C 1 121 ? -25.866 65.402  68.537  1.00 13.50  ? 121 ASP C C   1 
ATOM   7694  O  O   . ASP C 1 121 ? -25.706 65.536  69.745  1.00 16.28  ? 121 ASP C O   1 
ATOM   7695  C  CB  . ASP C 1 121 ? -25.397 67.838  68.173  1.00 10.24  ? 121 ASP C CB  1 
ATOM   7696  C  CG  . ASP C 1 121 ? -23.919 67.596  68.273  1.00 15.71  ? 121 ASP C CG  1 
ATOM   7697  O  OD1 . ASP C 1 121 ? -23.427 66.567  67.751  1.00 16.07  ? 121 ASP C OD1 1 
ATOM   7698  O  OD2 . ASP C 1 121 ? -23.244 68.447  68.874  1.00 14.20  ? 121 ASP C OD2 1 
ATOM   7699  N  N   . ILE C 1 122 ? -25.745 64.226  67.931  1.00 13.02  ? 122 ILE C N   1 
ATOM   7700  C  CA  . ILE C 1 122 ? -25.450 63.007  68.678  1.00 7.15   ? 122 ILE C CA  1 
ATOM   7701  C  C   . ILE C 1 122 ? -23.992 62.583  68.441  1.00 11.38  ? 122 ILE C C   1 
ATOM   7702  O  O   . ILE C 1 122 ? -23.633 61.410  68.615  1.00 13.95  ? 122 ILE C O   1 
ATOM   7703  C  CB  . ILE C 1 122 ? -26.384 61.856  68.249  1.00 8.58   ? 122 ILE C CB  1 
ATOM   7704  C  CG1 . ILE C 1 122 ? -26.149 61.521  66.778  1.00 7.29   ? 122 ILE C CG1 1 
ATOM   7705  C  CG2 . ILE C 1 122 ? -27.857 62.246  68.441  1.00 6.05   ? 122 ILE C CG2 1 
ATOM   7706  C  CD1 . ILE C 1 122 ? -26.741 60.201  66.358  1.00 7.51   ? 122 ILE C CD1 1 
ATOM   7707  N  N   . SER C 1 123 ? -23.151 63.534  68.039  1.00 12.52  ? 123 SER C N   1 
ATOM   7708  C  CA  . SER C 1 123 ? -21.741 63.258  67.760  1.00 12.00  ? 123 SER C CA  1 
ATOM   7709  C  C   . SER C 1 123 ? -21.008 62.583  68.915  1.00 14.87  ? 123 SER C C   1 
ATOM   7710  O  O   . SER C 1 123 ? -21.338 62.788  70.082  1.00 18.89  ? 123 SER C O   1 
ATOM   7711  C  CB  . SER C 1 123 ? -21.013 64.559  67.426  1.00 12.59  ? 123 SER C CB  1 
ATOM   7712  O  OG  . SER C 1 123 ? -21.695 65.291  66.436  1.00 14.21  ? 123 SER C OG  1 
ATOM   7713  N  N   . GLY C 1 124 ? -19.965 61.838  68.584  1.00 12.93  ? 124 GLY C N   1 
ATOM   7714  C  CA  . GLY C 1 124 ? -19.174 61.162  69.596  1.00 13.00  ? 124 GLY C CA  1 
ATOM   7715  C  C   . GLY C 1 124 ? -18.692 59.863  69.002  1.00 12.10  ? 124 GLY C C   1 
ATOM   7716  O  O   . GLY C 1 124 ? -18.683 59.733  67.775  1.00 15.31  ? 124 GLY C O   1 
ATOM   7717  N  N   . PRO C 1 125 ? -18.213 58.914  69.823  1.00 10.86  ? 125 PRO C N   1 
ATOM   7718  C  CA  . PRO C 1 125 ? -17.740 57.619  69.307  1.00 10.11  ? 125 PRO C CA  1 
ATOM   7719  C  C   . PRO C 1 125 ? -18.966 56.894  68.752  1.00 11.87  ? 125 PRO C C   1 
ATOM   7720  O  O   . PRO C 1 125 ? -20.040 56.945  69.352  1.00 17.12  ? 125 PRO C O   1 
ATOM   7721  C  CB  . PRO C 1 125 ? -17.232 56.908  70.562  1.00 7.09   ? 125 PRO C CB  1 
ATOM   7722  C  CG  . PRO C 1 125 ? -16.903 58.038  71.501  1.00 13.00  ? 125 PRO C CG  1 
ATOM   7723  C  CD  . PRO C 1 125 ? -18.019 59.017  71.276  1.00 8.74   ? 125 PRO C CD  1 
ATOM   7724  N  N   . GLY C 1 126 ? -18.853 56.258  67.598  1.00 14.15  ? 126 GLY C N   1 
ATOM   7725  C  CA  . GLY C 1 126 ? -20.017 55.575  67.086  1.00 10.61  ? 126 GLY C CA  1 
ATOM   7726  C  C   . GLY C 1 126 ? -19.749 54.742  65.864  1.00 13.96  ? 126 GLY C C   1 
ATOM   7727  O  O   . GLY C 1 126 ? -18.606 54.433  65.530  1.00 13.26  ? 126 GLY C O   1 
ATOM   7728  N  N   . ALA C 1 127 ? -20.832 54.334  65.224  1.00 12.12  ? 127 ALA C N   1 
ATOM   7729  C  CA  . ALA C 1 127 ? -20.765 53.552  64.008  1.00 10.10  ? 127 ALA C CA  1 
ATOM   7730  C  C   . ALA C 1 127 ? -22.160 53.575  63.424  1.00 14.48  ? 127 ALA C C   1 
ATOM   7731  O  O   . ALA C 1 127 ? -23.137 53.839  64.140  1.00 17.43  ? 127 ALA C O   1 
ATOM   7732  C  CB  . ALA C 1 127 ? -20.334 52.137  64.304  1.00 9.27   ? 127 ALA C CB  1 
ATOM   7733  N  N   . GLY C 1 128 ? -22.249 53.395  62.113  1.00 16.41  ? 128 GLY C N   1 
ATOM   7734  C  CA  . GLY C 1 128 ? -23.550 53.378  61.478  1.00 16.51  ? 128 GLY C CA  1 
ATOM   7735  C  C   . GLY C 1 128 ? -23.429 53.216  59.985  1.00 15.83  ? 128 GLY C C   1 
ATOM   7736  O  O   . GLY C 1 128 ? -22.323 53.022  59.465  1.00 15.36  ? 128 GLY C O   1 
ATOM   7737  N  N   . ILE C 1 129 ? -24.583 53.203  59.320  1.00 16.72  ? 129 ILE C N   1 
ATOM   7738  C  CA  . ILE C 1 129 ? -24.653 53.116  57.870  1.00 15.63  ? 129 ILE C CA  1 
ATOM   7739  C  C   . ILE C 1 129 ? -25.608 54.203  57.423  1.00 15.50  ? 129 ILE C C   1 
ATOM   7740  O  O   . ILE C 1 129 ? -26.731 54.301  57.908  1.00 15.46  ? 129 ILE C O   1 
ATOM   7741  C  CB  . ILE C 1 129 ? -25.094 51.731  57.355  1.00 18.12  ? 129 ILE C CB  1 
ATOM   7742  C  CG1 . ILE C 1 129 ? -25.286 51.795  55.835  1.00 22.09  ? 129 ILE C CG1 1 
ATOM   7743  C  CG2 . ILE C 1 129 ? -26.340 51.250  58.074  1.00 19.57  ? 129 ILE C CG2 1 
ATOM   7744  C  CD1 . ILE C 1 129 ? -25.381 50.438  55.171  1.00 24.23  ? 129 ILE C CD1 1 
ATOM   7745  N  N   . GLU C 1 130 ? -25.118 55.089  56.575  1.00 15.03  ? 130 GLU C N   1 
ATOM   7746  C  CA  . GLU C 1 130 ? -25.949 56.169  56.118  1.00 18.28  ? 130 GLU C CA  1 
ATOM   7747  C  C   . GLU C 1 130 ? -26.172 56.145  54.631  1.00 21.09  ? 130 GLU C C   1 
ATOM   7748  O  O   . GLU C 1 130 ? -25.473 55.461  53.879  1.00 19.28  ? 130 GLU C O   1 
ATOM   7749  C  CB  . GLU C 1 130 ? -25.360 57.507  56.525  1.00 16.30  ? 130 GLU C CB  1 
ATOM   7750  C  CG  . GLU C 1 130 ? -23.932 57.662  56.151  1.00 13.09  ? 130 GLU C CG  1 
ATOM   7751  C  CD  . GLU C 1 130 ? -23.387 59.009  56.531  1.00 17.93  ? 130 GLU C CD  1 
ATOM   7752  O  OE1 . GLU C 1 130 ? -24.175 59.932  56.811  1.00 19.55  ? 130 GLU C OE1 1 
ATOM   7753  O  OE2 . GLU C 1 130 ? -22.154 59.146  56.548  1.00 24.62  ? 130 GLU C OE2 1 
ATOM   7754  N  N   . ASN C 1 131 ? -27.181 56.907  54.236  1.00 23.18  ? 131 ASN C N   1 
ATOM   7755  C  CA  . ASN C 1 131 ? -27.594 57.063  52.856  1.00 26.94  ? 131 ASN C CA  1 
ATOM   7756  C  C   . ASN C 1 131 ? -28.024 55.801  52.135  1.00 24.89  ? 131 ASN C C   1 
ATOM   7757  O  O   . ASN C 1 131 ? -27.574 55.510  51.031  1.00 28.43  ? 131 ASN C O   1 
ATOM   7758  C  CB  . ASN C 1 131 ? -26.548 57.837  52.059  1.00 33.76  ? 131 ASN C CB  1 
ATOM   7759  C  CG  . ASN C 1 131 ? -26.341 59.230  52.604  1.00 46.83  ? 131 ASN C CG  1 
ATOM   7760  O  OD1 . ASN C 1 131 ? -27.289 59.863  53.105  1.00 48.17  ? 131 ASN C OD1 1 
ATOM   7761  N  ND2 . ASN C 1 131 ? -25.095 59.709  52.556  1.00 50.01  ? 131 ASN C ND2 1 
ATOM   7762  N  N   . ILE C 1 132 ? -28.876 55.032  52.791  1.00 23.44  ? 132 ILE C N   1 
ATOM   7763  C  CA  . ILE C 1 132 ? -29.428 53.845  52.184  1.00 22.00  ? 132 ILE C CA  1 
ATOM   7764  C  C   . ILE C 1 132 ? -30.569 54.430  51.354  1.00 26.10  ? 132 ILE C C   1 
ATOM   7765  O  O   . ILE C 1 132 ? -31.420 55.171  51.881  1.00 24.61  ? 132 ILE C O   1 
ATOM   7766  C  CB  . ILE C 1 132 ? -29.969 52.908  53.242  1.00 18.53  ? 132 ILE C CB  1 
ATOM   7767  C  CG1 . ILE C 1 132 ? -28.813 52.379  54.081  1.00 16.18  ? 132 ILE C CG1 1 
ATOM   7768  C  CG2 . ILE C 1 132 ? -30.749 51.795  52.593  1.00 17.60  ? 132 ILE C CG2 1 
ATOM   7769  C  CD1 . ILE C 1 132 ? -29.256 51.537  55.241  1.00 16.85  ? 132 ILE C CD1 1 
ATOM   7770  N  N   . ASP C 1 133 ? -30.537 54.180  50.047  1.00 29.37  ? 133 ASP C N   1 
ATOM   7771  C  CA  . ASP C 1 133 ? -31.548 54.719  49.139  1.00 28.49  ? 133 ASP C CA  1 
ATOM   7772  C  C   . ASP C 1 133 ? -32.847 53.938  49.158  1.00 28.77  ? 133 ASP C C   1 
ATOM   7773  O  O   . ASP C 1 133 ? -32.875 52.759  48.810  1.00 28.52  ? 133 ASP C O   1 
ATOM   7774  C  CB  . ASP C 1 133 ? -30.999 54.773  47.713  1.00 33.92  ? 133 ASP C CB  1 
ATOM   7775  C  CG  . ASP C 1 133 ? -31.821 55.671  46.790  1.00 41.56  ? 133 ASP C CG  1 
ATOM   7776  O  OD1 . ASP C 1 133 ? -32.713 56.412  47.261  1.00 42.32  ? 133 ASP C OD1 1 
ATOM   7777  O  OD2 . ASP C 1 133 ? -31.557 55.645  45.573  1.00 51.89  ? 133 ASP C OD2 1 
ATOM   7778  N  N   . LEU C 1 134 ? -33.919 54.601  49.575  1.00 29.14  ? 134 LEU C N   1 
ATOM   7779  C  CA  . LEU C 1 134 ? -35.243 53.983  49.621  1.00 30.23  ? 134 LEU C CA  1 
ATOM   7780  C  C   . LEU C 1 134 ? -36.099 54.444  48.429  1.00 33.38  ? 134 LEU C C   1 
ATOM   7781  O  O   . LEU C 1 134 ? -37.288 54.143  48.341  1.00 35.88  ? 134 LEU C O   1 
ATOM   7782  C  CB  . LEU C 1 134 ? -35.953 54.336  50.928  1.00 26.75  ? 134 LEU C CB  1 
ATOM   7783  C  CG  . LEU C 1 134 ? -35.338 53.821  52.223  1.00 28.69  ? 134 LEU C CG  1 
ATOM   7784  C  CD1 . LEU C 1 134 ? -36.260 54.147  53.372  1.00 25.00  ? 134 LEU C CD1 1 
ATOM   7785  C  CD2 . LEU C 1 134 ? -35.121 52.329  52.134  1.00 26.64  ? 134 LEU C CD2 1 
ATOM   7786  N  N   . GLY C 1 135 ? -35.493 55.177  47.509  1.00 30.65  ? 135 GLY C N   1 
ATOM   7787  C  CA  . GLY C 1 135 ? -36.237 55.657  46.361  1.00 29.98  ? 135 GLY C CA  1 
ATOM   7788  C  C   . GLY C 1 135 ? -36.895 56.971  46.705  1.00 30.59  ? 135 GLY C C   1 
ATOM   7789  O  O   . GLY C 1 135 ? -36.537 58.014  46.157  1.00 34.59  ? 135 GLY C O   1 
ATOM   7790  N  N   . PHE C 1 136 ? -37.807 56.939  47.670  1.00 28.33  ? 136 PHE C N   1 
ATOM   7791  C  CA  . PHE C 1 136 ? -38.496 58.155  48.084  1.00 26.27  ? 136 PHE C CA  1 
ATOM   7792  C  C   . PHE C 1 136 ? -37.747 58.926  49.160  1.00 25.68  ? 136 PHE C C   1 
ATOM   7793  O  O   . PHE C 1 136 ? -38.240 59.935  49.652  1.00 26.65  ? 136 PHE C O   1 
ATOM   7794  C  CB  . PHE C 1 136 ? -39.890 57.821  48.594  1.00 25.91  ? 136 PHE C CB  1 
ATOM   7795  C  CG  . PHE C 1 136 ? -39.892 56.841  49.708  1.00 28.26  ? 136 PHE C CG  1 
ATOM   7796  C  CD1 . PHE C 1 136 ? -39.786 57.271  51.027  1.00 28.22  ? 136 PHE C CD1 1 
ATOM   7797  C  CD2 . PHE C 1 136 ? -39.965 55.479  49.439  1.00 28.09  ? 136 PHE C CD2 1 
ATOM   7798  C  CE1 . PHE C 1 136 ? -39.750 56.356  52.069  1.00 31.71  ? 136 PHE C CE1 1 
ATOM   7799  C  CE2 . PHE C 1 136 ? -39.928 54.542  50.478  1.00 30.23  ? 136 PHE C CE2 1 
ATOM   7800  C  CZ  . PHE C 1 136 ? -39.820 54.983  51.798  1.00 28.22  ? 136 PHE C CZ  1 
ATOM   7801  N  N   . GLY C 1 137 ? -36.592 58.418  49.569  1.00 25.93  ? 137 GLY C N   1 
ATOM   7802  C  CA  . GLY C 1 137 ? -35.814 59.089  50.589  1.00 22.32  ? 137 GLY C CA  1 
ATOM   7803  C  C   . GLY C 1 137 ? -34.586 58.296  50.960  1.00 20.52  ? 137 GLY C C   1 
ATOM   7804  O  O   . GLY C 1 137 ? -34.384 57.189  50.459  1.00 18.97  ? 137 GLY C O   1 
ATOM   7805  N  N   . LYS C 1 138 ? -33.764 58.870  51.834  1.00 18.78  ? 138 LYS C N   1 
ATOM   7806  C  CA  . LYS C 1 138 ? -32.538 58.230  52.290  1.00 18.16  ? 138 LYS C CA  1 
ATOM   7807  C  C   . LYS C 1 138 ? -32.667 57.850  53.750  1.00 19.78  ? 138 LYS C C   1 
ATOM   7808  O  O   . LYS C 1 138 ? -33.051 58.672  54.586  1.00 21.21  ? 138 LYS C O   1 
ATOM   7809  C  CB  . LYS C 1 138 ? -31.357 59.179  52.135  1.00 22.57  ? 138 LYS C CB  1 
ATOM   7810  C  CG  . LYS C 1 138 ? -31.112 59.619  50.714  1.00 27.80  ? 138 LYS C CG  1 
ATOM   7811  C  CD  . LYS C 1 138 ? -30.969 58.419  49.796  1.00 38.27  ? 138 LYS C CD  1 
ATOM   7812  C  CE  . LYS C 1 138 ? -30.716 58.853  48.360  1.00 46.62  ? 138 LYS C CE  1 
ATOM   7813  N  NZ  . LYS C 1 138 ? -29.407 59.562  48.223  1.00 54.99  ? 138 LYS C NZ  1 
ATOM   7814  N  N   . LEU C 1 139 ? -32.310 56.613  54.057  1.00 18.73  ? 139 LEU C N   1 
ATOM   7815  C  CA  . LEU C 1 139 ? -32.382 56.104  55.411  1.00 17.78  ? 139 LEU C CA  1 
ATOM   7816  C  C   . LEU C 1 139 ? -30.974 56.013  55.996  1.00 19.16  ? 139 LEU C C   1 
ATOM   7817  O  O   . LEU C 1 139 ? -30.040 55.612  55.308  1.00 20.95  ? 139 LEU C O   1 
ATOM   7818  C  CB  . LEU C 1 139 ? -33.029 54.729  55.388  1.00 16.91  ? 139 LEU C CB  1 
ATOM   7819  C  CG  . LEU C 1 139 ? -33.226 54.051  56.731  1.00 18.71  ? 139 LEU C CG  1 
ATOM   7820  C  CD1 . LEU C 1 139 ? -34.295 54.771  57.514  1.00 17.62  ? 139 LEU C CD1 1 
ATOM   7821  C  CD2 . LEU C 1 139 ? -33.625 52.609  56.480  1.00 19.12  ? 139 LEU C CD2 1 
ATOM   7822  N  N   . SER C 1 140 ? -30.827 56.413  57.253  1.00 19.66  ? 140 SER C N   1 
ATOM   7823  C  CA  . SER C 1 140 ? -29.545 56.366  57.943  1.00 18.80  ? 140 SER C CA  1 
ATOM   7824  C  C   . SER C 1 140 ? -29.749 55.814  59.345  1.00 17.63  ? 140 SER C C   1 
ATOM   7825  O  O   . SER C 1 140 ? -30.667 56.241  60.056  1.00 17.14  ? 140 SER C O   1 
ATOM   7826  C  CB  . SER C 1 140 ? -28.939 57.769  58.039  1.00 17.53  ? 140 SER C CB  1 
ATOM   7827  O  OG  . SER C 1 140 ? -28.613 58.268  56.754  1.00 23.16  ? 140 SER C OG  1 
ATOM   7828  N  N   . LEU C 1 141 ? -28.896 54.871  59.733  1.00 17.39  ? 141 LEU C N   1 
ATOM   7829  C  CA  . LEU C 1 141 ? -28.950 54.257  61.053  1.00 17.65  ? 141 LEU C CA  1 
ATOM   7830  C  C   . LEU C 1 141 ? -27.610 54.470  61.727  1.00 19.55  ? 141 LEU C C   1 
ATOM   7831  O  O   . LEU C 1 141 ? -26.560 54.290  61.092  1.00 19.70  ? 141 LEU C O   1 
ATOM   7832  C  CB  . LEU C 1 141 ? -29.161 52.763  60.918  1.00 19.65  ? 141 LEU C CB  1 
ATOM   7833  C  CG  . LEU C 1 141 ? -30.337 52.389  60.039  1.00 23.08  ? 141 LEU C CG  1 
ATOM   7834  C  CD1 . LEU C 1 141 ? -30.321 50.911  59.803  1.00 23.77  ? 141 LEU C CD1 1 
ATOM   7835  C  CD2 . LEU C 1 141 ? -31.617 52.820  60.710  1.00 23.25  ? 141 LEU C CD2 1 
ATOM   7836  N  N   . ALA C 1 142 ? -27.633 54.793  63.017  1.00 18.58  ? 142 ALA C N   1 
ATOM   7837  C  CA  . ALA C 1 142 ? -26.398 55.014  63.763  1.00 16.93  ? 142 ALA C CA  1 
ATOM   7838  C  C   . ALA C 1 142 ? -26.559 54.781  65.260  1.00 15.65  ? 142 ALA C C   1 
ATOM   7839  O  O   . ALA C 1 142 ? -27.661 54.879  65.802  1.00 16.68  ? 142 ALA C O   1 
ATOM   7840  C  CB  . ALA C 1 142 ? -25.879 56.435  63.525  1.00 12.40  ? 142 ALA C CB  1 
ATOM   7841  N  N   . ALA C 1 143 ? -25.443 54.481  65.913  1.00 17.31  ? 143 ALA C N   1 
ATOM   7842  C  CA  . ALA C 1 143 ? -25.387 54.278  67.357  1.00 15.13  ? 143 ALA C CA  1 
ATOM   7843  C  C   . ALA C 1 143 ? -24.165 55.059  67.829  1.00 14.53  ? 143 ALA C C   1 
ATOM   7844  O  O   . ALA C 1 143 ? -23.068 54.880  67.287  1.00 17.33  ? 143 ALA C O   1 
ATOM   7845  C  CB  . ALA C 1 143 ? -25.208 52.796  67.688  1.00 13.38  ? 143 ALA C CB  1 
ATOM   7846  N  N   . THR C 1 144 ? -24.362 56.003  68.737  1.00 12.32  ? 144 THR C N   1 
ATOM   7847  C  CA  . THR C 1 144 ? -23.229 56.742  69.267  1.00 13.67  ? 144 THR C CA  1 
ATOM   7848  C  C   . THR C 1 144 ? -23.253 56.653  70.792  1.00 16.13  ? 144 THR C C   1 
ATOM   7849  O  O   . THR C 1 144 ? -24.219 56.142  71.382  1.00 16.29  ? 144 THR C O   1 
ATOM   7850  C  CB  . THR C 1 144 ? -23.209 58.205  68.792  1.00 12.21  ? 144 THR C CB  1 
ATOM   7851  O  OG1 . THR C 1 144 ? -24.385 58.874  69.236  1.00 13.99  ? 144 THR C OG1 1 
ATOM   7852  C  CG2 . THR C 1 144 ? -23.150 58.274  67.272  1.00 12.71  ? 144 THR C CG2 1 
ATOM   7853  N  N   . ARG C 1 145 ? -22.167 57.093  71.421  1.00 16.81  ? 145 ARG C N   1 
ATOM   7854  C  CA  . ARG C 1 145 ? -22.047 57.078  72.874  1.00 14.28  ? 145 ARG C CA  1 
ATOM   7855  C  C   . ARG C 1 145 ? -21.645 58.398  73.521  1.00 14.58  ? 145 ARG C C   1 
ATOM   7856  O  O   . ARG C 1 145 ? -20.962 59.236  72.922  1.00 15.58  ? 145 ARG C O   1 
ATOM   7857  C  CB  . ARG C 1 145 ? -21.038 56.012  73.320  1.00 15.83  ? 145 ARG C CB  1 
ATOM   7858  C  CG  . ARG C 1 145 ? -20.756 56.044  74.818  1.00 18.34  ? 145 ARG C CG  1 
ATOM   7859  C  CD  . ARG C 1 145 ? -20.318 54.724  75.350  1.00 14.15  ? 145 ARG C CD  1 
ATOM   7860  N  NE  . ARG C 1 145 ? -21.222 53.662  74.943  1.00 8.51   ? 145 ARG C NE  1 
ATOM   7861  C  CZ  . ARG C 1 145 ? -20.805 52.435  74.645  1.00 14.87  ? 145 ARG C CZ  1 
ATOM   7862  N  NH1 . ARG C 1 145 ? -19.509 52.152  74.720  1.00 8.12   ? 145 ARG C NH1 1 
ATOM   7863  N  NH2 . ARG C 1 145 ? -21.660 51.498  74.256  1.00 14.52  ? 145 ARG C NH2 1 
ATOM   7864  N  N   . SER C 1 146 ? -22.103 58.566  74.756  1.00 15.19  ? 146 SER C N   1 
ATOM   7865  C  CA  . SER C 1 146 ? -21.762 59.703  75.594  1.00 14.70  ? 146 SER C CA  1 
ATOM   7866  C  C   . SER C 1 146 ? -21.606 59.081  76.984  1.00 15.64  ? 146 SER C C   1 
ATOM   7867  O  O   . SER C 1 146 ? -22.039 57.950  77.221  1.00 16.84  ? 146 SER C O   1 
ATOM   7868  C  CB  . SER C 1 146 ? -22.849 60.782  75.579  1.00 11.00  ? 146 SER C CB  1 
ATOM   7869  O  OG  . SER C 1 146 ? -24.009 60.382  76.276  1.00 21.84  ? 146 SER C OG  1 
ATOM   7870  N  N   . THR C 1 147 ? -20.963 59.791  77.892  1.00 16.74  ? 147 THR C N   1 
ATOM   7871  C  CA  . THR C 1 147 ? -20.744 59.266  79.215  1.00 13.41  ? 147 THR C CA  1 
ATOM   7872  C  C   . THR C 1 147 ? -20.924 60.345  80.257  1.00 16.84  ? 147 THR C C   1 
ATOM   7873  O  O   . THR C 1 147 ? -20.479 61.480  80.076  1.00 19.25  ? 147 THR C O   1 
ATOM   7874  C  CB  . THR C 1 147 ? -19.338 58.685  79.306  1.00 13.06  ? 147 THR C CB  1 
ATOM   7875  O  OG1 . THR C 1 147 ? -19.203 57.655  78.323  1.00 13.44  ? 147 THR C OG1 1 
ATOM   7876  C  CG2 . THR C 1 147 ? -19.079 58.094  80.670  1.00 12.70  ? 147 THR C CG2 1 
ATOM   7877  N  N   . GLU C 1 148 ? -21.654 60.003  81.310  1.00 17.95  ? 148 GLU C N   1 
ATOM   7878  C  CA  . GLU C 1 148 ? -21.884 60.913  82.414  1.00 16.88  ? 148 GLU C CA  1 
ATOM   7879  C  C   . GLU C 1 148 ? -20.906 60.557  83.532  1.00 17.91  ? 148 GLU C C   1 
ATOM   7880  O  O   . GLU C 1 148 ? -20.438 59.414  83.637  1.00 18.20  ? 148 GLU C O   1 
ATOM   7881  C  CB  . GLU C 1 148 ? -23.297 60.750  82.938  1.00 16.24  ? 148 GLU C CB  1 
ATOM   7882  C  CG  . GLU C 1 148 ? -24.372 61.200  81.995  1.00 18.84  ? 148 GLU C CG  1 
ATOM   7883  C  CD  . GLU C 1 148 ? -25.738 60.821  82.506  1.00 21.72  ? 148 GLU C CD  1 
ATOM   7884  O  OE1 . GLU C 1 148 ? -26.019 59.604  82.589  1.00 19.15  ? 148 GLU C OE1 1 
ATOM   7885  O  OE2 . GLU C 1 148 ? -26.515 61.736  82.842  1.00 20.19  ? 148 GLU C OE2 1 
ATOM   7886  N  N   . ALA C 1 149 ? -20.576 61.546  84.348  1.00 21.92  ? 149 ALA C N   1 
ATOM   7887  C  CA  . ALA C 1 149 ? -19.672 61.330  85.474  1.00 23.87  ? 149 ALA C CA  1 
ATOM   7888  C  C   . ALA C 1 149 ? -20.440 60.670  86.633  1.00 23.75  ? 149 ALA C C   1 
ATOM   7889  O  O   . ALA C 1 149 ? -21.498 61.155  87.050  1.00 25.15  ? 149 ALA C O   1 
ATOM   7890  C  CB  . ALA C 1 149 ? -19.080 62.654  85.918  1.00 21.25  ? 149 ALA C CB  1 
ATOM   7891  N  N   . GLY C 1 150 ? -19.917 59.555  87.132  1.00 23.71  ? 150 GLY C N   1 
ATOM   7892  C  CA  . GLY C 1 150 ? -20.572 58.858  88.218  1.00 21.51  ? 150 GLY C CA  1 
ATOM   7893  C  C   . GLY C 1 150 ? -21.908 58.320  87.775  1.00 22.04  ? 150 GLY C C   1 
ATOM   7894  O  O   . GLY C 1 150 ? -22.090 58.029  86.597  1.00 25.32  ? 150 GLY C O   1 
ATOM   7895  N  N   . GLY C 1 151 ? -22.826 58.158  88.728  1.00 23.36  ? 151 GLY C N   1 
ATOM   7896  C  CA  . GLY C 1 151 ? -24.157 57.658  88.431  1.00 18.81  ? 151 GLY C CA  1 
ATOM   7897  C  C   . GLY C 1 151 ? -24.334 56.158  88.525  1.00 20.22  ? 151 GLY C C   1 
ATOM   7898  O  O   . GLY C 1 151 ? -25.471 55.691  88.553  1.00 22.46  ? 151 GLY C O   1 
ATOM   7899  N  N   . SER C 1 152 ? -23.243 55.397  88.519  1.00 21.57  ? 152 SER C N   1 
ATOM   7900  C  CA  . SER C 1 152 ? -23.336 53.936  88.611  1.00 24.32  ? 152 SER C CA  1 
ATOM   7901  C  C   . SER C 1 152 ? -22.651 53.518  89.903  1.00 27.08  ? 152 SER C C   1 
ATOM   7902  O  O   . SER C 1 152 ? -21.480 53.851  90.124  1.00 26.77  ? 152 SER C O   1 
ATOM   7903  C  CB  . SER C 1 152 ? -22.661 53.267  87.405  1.00 27.62  ? 152 SER C CB  1 
ATOM   7904  O  OG  . SER C 1 152 ? -23.376 53.516  86.205  1.00 27.82  ? 152 SER C OG  1 
ATOM   7905  N  N   . TYR C 1 153 ? -23.371 52.775  90.746  1.00 28.43  ? 153 TYR C N   1 
ATOM   7906  C  CA  . TYR C 1 153 ? -22.851 52.359  92.050  1.00 26.35  ? 153 TYR C CA  1 
ATOM   7907  C  C   . TYR C 1 153 ? -22.985 50.869  92.330  1.00 29.01  ? 153 TYR C C   1 
ATOM   7908  O  O   . TYR C 1 153 ? -23.893 50.213  91.820  1.00 28.59  ? 153 TYR C O   1 
ATOM   7909  C  CB  . TYR C 1 153 ? -23.608 53.094  93.164  1.00 20.76  ? 153 TYR C CB  1 
ATOM   7910  C  CG  . TYR C 1 153 ? -23.847 54.563  92.928  1.00 17.81  ? 153 TYR C CG  1 
ATOM   7911  C  CD1 . TYR C 1 153 ? -24.992 54.999  92.269  1.00 16.52  ? 153 TYR C CD1 1 
ATOM   7912  C  CD2 . TYR C 1 153 ? -22.937 55.519  93.377  1.00 18.64  ? 153 TYR C CD2 1 
ATOM   7913  C  CE1 . TYR C 1 153 ? -25.228 56.362  92.066  1.00 19.63  ? 153 TYR C CE1 1 
ATOM   7914  C  CE2 . TYR C 1 153 ? -23.162 56.885  93.175  1.00 16.85  ? 153 TYR C CE2 1 
ATOM   7915  C  CZ  . TYR C 1 153 ? -24.308 57.295  92.520  1.00 17.98  ? 153 TYR C CZ  1 
ATOM   7916  O  OH  . TYR C 1 153 ? -24.524 58.641  92.296  1.00 25.85  ? 153 TYR C OH  1 
ATOM   7917  N  N   . THR C 1 154 ? -22.069 50.340  93.137  1.00 31.99  ? 154 THR C N   1 
ATOM   7918  C  CA  . THR C 1 154 ? -22.122 48.944  93.557  1.00 36.84  ? 154 THR C CA  1 
ATOM   7919  C  C   . THR C 1 154 ? -22.740 49.032  94.954  1.00 41.13  ? 154 THR C C   1 
ATOM   7920  O  O   . THR C 1 154 ? -22.046 49.306  95.941  1.00 41.49  ? 154 THR C O   1 
ATOM   7921  C  CB  . THR C 1 154 ? -20.718 48.317  93.649  1.00 35.13  ? 154 THR C CB  1 
ATOM   7922  O  OG1 . THR C 1 154 ? -19.761 49.329  93.992  1.00 39.83  ? 154 THR C OG1 1 
ATOM   7923  C  CG2 . THR C 1 154 ? -20.329 47.687  92.326  1.00 35.09  ? 154 THR C CG2 1 
ATOM   7924  N  N   . PHE C 1 155 ? -24.063 48.928  95.011  1.00 44.49  ? 155 PHE C N   1 
ATOM   7925  C  CA  . PHE C 1 155 ? -24.787 49.025  96.275  1.00 46.87  ? 155 PHE C CA  1 
ATOM   7926  C  C   . PHE C 1 155 ? -24.623 47.792  97.154  1.00 51.85  ? 155 PHE C C   1 
ATOM   7927  O  O   . PHE C 1 155 ? -24.848 46.665  96.700  1.00 52.58  ? 155 PHE C O   1 
ATOM   7928  C  CB  . PHE C 1 155 ? -26.271 49.300  96.016  1.00 38.74  ? 155 PHE C CB  1 
ATOM   7929  C  CG  . PHE C 1 155 ? -26.547 50.685  95.517  1.00 34.23  ? 155 PHE C CG  1 
ATOM   7930  C  CD1 . PHE C 1 155 ? -26.178 51.796  96.269  1.00 30.41  ? 155 PHE C CD1 1 
ATOM   7931  C  CD2 . PHE C 1 155 ? -27.182 50.880  94.302  1.00 32.56  ? 155 PHE C CD2 1 
ATOM   7932  C  CE1 . PHE C 1 155 ? -26.440 53.086  95.821  1.00 32.68  ? 155 PHE C CE1 1 
ATOM   7933  C  CE2 . PHE C 1 155 ? -27.448 52.161  93.846  1.00 32.57  ? 155 PHE C CE2 1 
ATOM   7934  C  CZ  . PHE C 1 155 ? -27.077 53.271  94.607  1.00 32.66  ? 155 PHE C CZ  1 
ATOM   7935  N  N   . SER C 1 156 ? -24.188 48.015  98.396  1.00 56.79  ? 156 SER C N   1 
ATOM   7936  C  CA  . SER C 1 156 ? -23.999 46.939  99.372  1.00 60.29  ? 156 SER C CA  1 
ATOM   7937  C  C   . SER C 1 156 ? -25.304 46.745  100.137 1.00 62.59  ? 156 SER C C   1 
ATOM   7938  O  O   . SER C 1 156 ? -25.864 45.644  100.197 1.00 63.71  ? 156 SER C O   1 
ATOM   7939  C  CB  . SER C 1 156 ? -22.869 47.293  100.348 1.00 58.28  ? 156 SER C CB  1 
ATOM   7940  O  OG  . SER C 1 156 ? -23.056 48.573  100.940 1.00 59.67  ? 156 SER C OG  1 
ATOM   7941  N  N   . SER C 1 157 ? -25.787 47.838  100.711 1.00 67.58  ? 157 SER C N   1 
ATOM   7942  C  CA  . SER C 1 157 ? -27.020 47.813  101.465 1.00 72.10  ? 157 SER C CA  1 
ATOM   7943  C  C   . SER C 1 157 ? -27.835 49.021  101.047 1.00 73.86  ? 157 SER C C   1 
ATOM   7944  O  O   . SER C 1 157 ? -27.437 50.172  101.287 1.00 71.92  ? 157 SER C O   1 
ATOM   7945  C  CB  . SER C 1 157 ? -26.735 47.859  102.971 1.00 75.36  ? 157 SER C CB  1 
ATOM   7946  O  OG  . SER C 1 157 ? -27.890 47.519  103.720 0.00 74.17  ? 157 SER C OG  1 
ATOM   7947  N  N   . GLN C 1 158 ? -28.934 48.742  100.349 1.00 73.98  ? 158 GLN C N   1 
ATOM   7948  C  CA  . GLN C 1 158 ? -29.856 49.768  99.882  1.00 74.18  ? 158 GLN C CA  1 
ATOM   7949  C  C   . GLN C 1 158 ? -29.176 50.887  99.078  1.00 70.16  ? 158 GLN C C   1 
ATOM   7950  O  O   . GLN C 1 158 ? -28.910 50.714  97.887  1.00 70.48  ? 158 GLN C O   1 
ATOM   7951  C  CB  . GLN C 1 158 ? -30.650 50.345  101.069 1.00 80.04  ? 158 GLN C CB  1 
ATOM   7952  C  CG  . GLN C 1 158 ? -31.461 49.312  101.886 1.00 86.10  ? 158 GLN C CG  1 
ATOM   7953  C  CD  . GLN C 1 158 ? -32.729 48.814  101.182 1.00 89.26  ? 158 GLN C CD  1 
ATOM   7954  O  OE1 . GLN C 1 158 ? -33.500 49.601  100.621 1.00 91.50  ? 158 GLN C OE1 1 
ATOM   7955  N  NE2 . GLN C 1 158 ? -32.962 47.504  101.239 1.00 88.54  ? 158 GLN C NE2 1 
ATOM   7956  N  N   . ASN C 1 159 ? -28.874 52.012  99.727  1.00 64.63  ? 159 ASN C N   1 
ATOM   7957  C  CA  . ASN C 1 159 ? -28.251 53.146  99.051  1.00 60.61  ? 159 ASN C CA  1 
ATOM   7958  C  C   . ASN C 1 159 ? -26.834 53.463  99.532  1.00 58.35  ? 159 ASN C C   1 
ATOM   7959  O  O   . ASN C 1 159 ? -26.337 54.590  99.389  1.00 59.88  ? 159 ASN C O   1 
ATOM   7960  C  CB  . ASN C 1 159 ? -29.136 54.381  99.166  1.00 63.16  ? 159 ASN C CB  1 
ATOM   7961  C  CG  . ASN C 1 159 ? -29.323 54.814  100.590 1.00 66.20  ? 159 ASN C CG  1 
ATOM   7962  O  OD1 . ASN C 1 159 ? -29.794 54.039  101.421 1.00 70.07  ? 159 ASN C OD1 1 
ATOM   7963  N  ND2 . ASN C 1 159 ? -28.927 56.045  100.898 1.00 70.50  ? 159 ASN C ND2 1 
ATOM   7964  N  N   . ILE C 1 160 ? -26.212 52.485  100.168 1.00 54.41  ? 160 ILE C N   1 
ATOM   7965  C  CA  . ILE C 1 160 ? -24.837 52.628  100.615 1.00 53.12  ? 160 ILE C CA  1 
ATOM   7966  C  C   . ILE C 1 160 ? -24.101 51.819  99.564  1.00 49.10  ? 160 ILE C C   1 
ATOM   7967  O  O   . ILE C 1 160 ? -24.516 50.702  99.232  1.00 45.64  ? 160 ILE C O   1 
ATOM   7968  C  CB  . ILE C 1 160 ? -24.629 52.024  102.008 1.00 56.40  ? 160 ILE C CB  1 
ATOM   7969  C  CG1 . ILE C 1 160 ? -25.452 52.817  103.029 1.00 58.17  ? 160 ILE C CG1 1 
ATOM   7970  C  CG2 . ILE C 1 160 ? -23.144 52.052  102.375 1.00 54.89  ? 160 ILE C CG2 1 
ATOM   7971  C  CD1 . ILE C 1 160 ? -25.677 52.096  104.338 1.00 62.82  ? 160 ILE C CD1 1 
ATOM   7972  N  N   . TYR C 1 161 ? -23.037 52.385  99.015  1.00 44.16  ? 161 TYR C N   1 
ATOM   7973  C  CA  . TYR C 1 161 ? -22.308 51.705  97.959  1.00 41.34  ? 161 TYR C CA  1 
ATOM   7974  C  C   . TYR C 1 161 ? -20.818 51.627  98.226  1.00 41.98  ? 161 TYR C C   1 
ATOM   7975  O  O   . TYR C 1 161 ? -20.278 52.400  99.018  1.00 41.15  ? 161 TYR C O   1 
ATOM   7976  C  CB  . TYR C 1 161 ? -22.562 52.417  96.624  1.00 32.91  ? 161 TYR C CB  1 
ATOM   7977  C  CG  . TYR C 1 161 ? -21.973 53.813  96.553  1.00 24.27  ? 161 TYR C CG  1 
ATOM   7978  C  CD1 . TYR C 1 161 ? -20.648 54.004  96.182  1.00 23.56  ? 161 TYR C CD1 1 
ATOM   7979  C  CD2 . TYR C 1 161 ? -22.730 54.936  96.873  1.00 21.10  ? 161 TYR C CD2 1 
ATOM   7980  C  CE1 . TYR C 1 161 ? -20.091 55.266  96.138  1.00 18.45  ? 161 TYR C CE1 1 
ATOM   7981  C  CE2 . TYR C 1 161 ? -22.175 56.218  96.824  1.00 18.71  ? 161 TYR C CE2 1 
ATOM   7982  C  CZ  . TYR C 1 161 ? -20.852 56.368  96.461  1.00 20.15  ? 161 TYR C CZ  1 
ATOM   7983  O  OH  . TYR C 1 161 ? -20.256 57.608  96.445  1.00 28.83  ? 161 TYR C OH  1 
ATOM   7984  N  N   . ASP C 1 162 ? -20.157 50.698  97.546  1.00 45.26  ? 162 ASP C N   1 
ATOM   7985  C  CA  . ASP C 1 162 ? -18.719 50.517  97.682  1.00 50.54  ? 162 ASP C CA  1 
ATOM   7986  C  C   . ASP C 1 162 ? -18.008 51.349  96.632  1.00 52.01  ? 162 ASP C C   1 
ATOM   7987  O  O   . ASP C 1 162 ? -17.155 52.170  96.960  1.00 54.14  ? 162 ASP C O   1 
ATOM   7988  C  CB  . ASP C 1 162 ? -18.321 49.051  97.490  1.00 57.93  ? 162 ASP C CB  1 
ATOM   7989  C  CG  . ASP C 1 162 ? -19.033 48.116  98.450  1.00 67.50  ? 162 ASP C CG  1 
ATOM   7990  O  OD1 . ASP C 1 162 ? -19.106 48.435  99.665  1.00 73.30  ? 162 ASP C OD1 1 
ATOM   7991  O  OD2 . ASP C 1 162 ? -19.515 47.055  97.984  1.00 70.96  ? 162 ASP C OD2 1 
ATOM   7992  N  N   . GLU C 1 163 ? -18.385 51.155  95.371  1.00 50.75  ? 163 GLU C N   1 
ATOM   7993  C  CA  . GLU C 1 163 ? -17.757 51.873  94.269  1.00 47.80  ? 163 GLU C CA  1 
ATOM   7994  C  C   . GLU C 1 163 ? -18.706 52.615  93.363  1.00 41.75  ? 163 GLU C C   1 
ATOM   7995  O  O   . GLU C 1 163 ? -19.858 52.226  93.207  1.00 39.10  ? 163 GLU C O   1 
ATOM   7996  C  CB  . GLU C 1 163 ? -16.955 50.904  93.417  1.00 53.34  ? 163 GLU C CB  1 
ATOM   7997  C  CG  . GLU C 1 163 ? -15.850 50.213  94.168  1.00 66.06  ? 163 GLU C CG  1 
ATOM   7998  C  CD  . GLU C 1 163 ? -15.691 48.777  93.740  1.00 75.71  ? 163 GLU C CD  1 
ATOM   7999  O  OE1 . GLU C 1 163 ? -16.578 47.952  94.080  1.00 78.17  ? 163 GLU C OE1 1 
ATOM   8000  O  OE2 . GLU C 1 163 ? -14.683 48.479  93.058  1.00 83.37  ? 163 GLU C OE2 1 
ATOM   8001  N  N   . VAL C 1 164 ? -18.191 53.686  92.769  1.00 37.62  ? 164 VAL C N   1 
ATOM   8002  C  CA  . VAL C 1 164 ? -18.930 54.506  91.811  1.00 37.89  ? 164 VAL C CA  1 
ATOM   8003  C  C   . VAL C 1 164 ? -18.229 54.281  90.482  1.00 37.84  ? 164 VAL C C   1 
ATOM   8004  O  O   . VAL C 1 164 ? -17.050 53.911  90.449  1.00 41.18  ? 164 VAL C O   1 
ATOM   8005  C  CB  . VAL C 1 164 ? -18.795 56.008  92.059  1.00 36.38  ? 164 VAL C CB  1 
ATOM   8006  C  CG1 . VAL C 1 164 ? -20.063 56.732  91.642  1.00 33.29  ? 164 VAL C CG1 1 
ATOM   8007  C  CG2 . VAL C 1 164 ? -18.426 56.281  93.481  1.00 44.99  ? 164 VAL C CG2 1 
ATOM   8008  N  N   . LYS C 1 165 ? -18.918 54.602  89.398  1.00 35.77  ? 165 LYS C N   1 
ATOM   8009  C  CA  . LYS C 1 165 ? -18.378 54.429  88.061  1.00 28.86  ? 165 LYS C CA  1 
ATOM   8010  C  C   . LYS C 1 165 ? -19.111 55.423  87.185  1.00 29.78  ? 165 LYS C C   1 
ATOM   8011  O  O   . LYS C 1 165 ? -20.202 55.888  87.550  1.00 28.37  ? 165 LYS C O   1 
ATOM   8012  C  CB  . LYS C 1 165 ? -18.712 53.026  87.570  1.00 27.50  ? 165 LYS C CB  1 
ATOM   8013  C  CG  . LYS C 1 165 ? -17.663 52.379  86.744  1.00 28.68  ? 165 LYS C CG  1 
ATOM   8014  C  CD  . LYS C 1 165 ? -18.207 51.106  86.165  1.00 31.44  ? 165 LYS C CD  1 
ATOM   8015  C  CE  . LYS C 1 165 ? -19.150 51.418  85.044  1.00 38.09  ? 165 LYS C CE  1 
ATOM   8016  N  NZ  . LYS C 1 165 ? -18.406 51.850  83.852  1.00 31.63  ? 165 LYS C NZ  1 
ATOM   8017  N  N   . ASP C 1 166 ? -18.498 55.773  86.054  1.00 27.78  ? 166 ASP C N   1 
ATOM   8018  C  CA  . ASP C 1 166 ? -19.113 56.670  85.081  1.00 23.26  ? 166 ASP C CA  1 
ATOM   8019  C  C   . ASP C 1 166 ? -20.165 55.865  84.319  1.00 21.52  ? 166 ASP C C   1 
ATOM   8020  O  O   . ASP C 1 166 ? -19.999 54.654  84.098  1.00 20.76  ? 166 ASP C O   1 
ATOM   8021  C  CB  . ASP C 1 166 ? -18.074 57.215  84.118  1.00 25.77  ? 166 ASP C CB  1 
ATOM   8022  C  CG  . ASP C 1 166 ? -17.146 58.207  84.767  1.00 31.68  ? 166 ASP C CG  1 
ATOM   8023  O  OD1 . ASP C 1 166 ? -17.528 58.826  85.788  1.00 33.44  ? 166 ASP C OD1 1 
ATOM   8024  O  OD2 . ASP C 1 166 ? -16.023 58.367  84.242  1.00 42.55  ? 166 ASP C OD2 1 
ATOM   8025  N  N   . THR C 1 167 ? -21.228 56.539  83.899  1.00 16.19  ? 167 THR C N   1 
ATOM   8026  C  CA  . THR C 1 167 ? -22.328 55.866  83.219  1.00 17.09  ? 167 THR C CA  1 
ATOM   8027  C  C   . THR C 1 167 ? -22.389 56.116  81.703  1.00 19.28  ? 167 THR C C   1 
ATOM   8028  O  O   . THR C 1 167 ? -22.525 57.257  81.240  1.00 20.18  ? 167 THR C O   1 
ATOM   8029  C  CB  . THR C 1 167 ? -23.663 56.285  83.882  1.00 16.32  ? 167 THR C CB  1 
ATOM   8030  O  OG1 . THR C 1 167 ? -23.521 56.210  85.306  1.00 14.73  ? 167 THR C OG1 1 
ATOM   8031  C  CG2 . THR C 1 167 ? -24.802 55.396  83.449  1.00 14.36  ? 167 THR C CG2 1 
ATOM   8032  N  N   . ALA C 1 168 ? -22.272 55.040  80.937  1.00 17.01  ? 168 ALA C N   1 
ATOM   8033  C  CA  . ALA C 1 168 ? -22.345 55.102  79.491  1.00 14.66  ? 168 ALA C CA  1 
ATOM   8034  C  C   . ALA C 1 168 ? -23.804 55.285  79.072  1.00 18.55  ? 168 ALA C C   1 
ATOM   8035  O  O   . ALA C 1 168 ? -24.695 54.645  79.630  1.00 24.51  ? 168 ALA C O   1 
ATOM   8036  C  CB  . ALA C 1 168 ? -21.815 53.819  78.909  1.00 10.34  ? 168 ALA C CB  1 
ATOM   8037  N  N   . ASN C 1 169 ? -24.058 56.189  78.131  1.00 19.02  ? 169 ASN C N   1 
ATOM   8038  C  CA  . ASN C 1 169 ? -25.411 56.400  77.611  1.00 18.48  ? 169 ASN C CA  1 
ATOM   8039  C  C   . ASN C 1 169 ? -25.369 56.110  76.119  1.00 20.49  ? 169 ASN C C   1 
ATOM   8040  O  O   . ASN C 1 169 ? -24.608 56.744  75.388  1.00 25.98  ? 169 ASN C O   1 
ATOM   8041  C  CB  . ASN C 1 169 ? -25.884 57.834  77.819  1.00 15.37  ? 169 ASN C CB  1 
ATOM   8042  C  CG  . ASN C 1 169 ? -26.248 58.124  79.247  1.00 18.99  ? 169 ASN C CG  1 
ATOM   8043  O  OD1 . ASN C 1 169 ? -27.423 58.235  79.591  1.00 21.30  ? 169 ASN C OD1 1 
ATOM   8044  N  ND2 . ASN C 1 169 ? -25.247 58.261  80.091  1.00 18.49  ? 169 ASN C ND2 1 
ATOM   8045  N  N   . ASP C 1 170 ? -26.126 55.111  75.680  1.00 19.54  ? 170 ASP C N   1 
ATOM   8046  C  CA  . ASP C 1 170 ? -26.171 54.751  74.269  1.00 16.85  ? 170 ASP C CA  1 
ATOM   8047  C  C   . ASP C 1 170 ? -27.332 55.450  73.568  1.00 17.99  ? 170 ASP C C   1 
ATOM   8048  O  O   . ASP C 1 170 ? -28.380 55.650  74.171  1.00 21.28  ? 170 ASP C O   1 
ATOM   8049  C  CB  . ASP C 1 170 ? -26.373 53.248  74.111  1.00 15.73  ? 170 ASP C CB  1 
ATOM   8050  C  CG  . ASP C 1 170 ? -25.178 52.439  74.551  1.00 20.23  ? 170 ASP C CG  1 
ATOM   8051  O  OD1 . ASP C 1 170 ? -24.048 52.958  74.526  1.00 22.48  ? 170 ASP C OD1 1 
ATOM   8052  O  OD2 . ASP C 1 170 ? -25.377 51.254  74.894  1.00 22.78  ? 170 ASP C OD2 1 
ATOM   8053  N  N   . VAL C 1 171 ? -27.136 55.830  72.309  1.00 18.84  ? 171 VAL C N   1 
ATOM   8054  C  CA  . VAL C 1 171 ? -28.184 56.456  71.513  1.00 18.07  ? 171 VAL C CA  1 
ATOM   8055  C  C   . VAL C 1 171 ? -28.288 55.669  70.214  1.00 19.14  ? 171 VAL C C   1 
ATOM   8056  O  O   . VAL C 1 171 ? -27.276 55.282  69.614  1.00 18.31  ? 171 VAL C O   1 
ATOM   8057  C  CB  . VAL C 1 171 ? -27.886 57.914  71.150  1.00 17.50  ? 171 VAL C CB  1 
ATOM   8058  C  CG1 . VAL C 1 171 ? -29.078 58.507  70.460  1.00 17.22  ? 171 VAL C CG1 1 
ATOM   8059  C  CG2 . VAL C 1 171 ? -27.596 58.713  72.375  1.00 26.40  ? 171 VAL C CG2 1 
ATOM   8060  N  N   . PHE C 1 172 ? -29.522 55.379  69.833  1.00 19.06  ? 172 PHE C N   1 
ATOM   8061  C  CA  . PHE C 1 172 ? -29.828 54.651  68.617  1.00 19.19  ? 172 PHE C CA  1 
ATOM   8062  C  C   . PHE C 1 172 ? -30.652 55.647  67.813  1.00 19.63  ? 172 PHE C C   1 
ATOM   8063  O  O   . PHE C 1 172 ? -31.687 56.150  68.257  1.00 16.61  ? 172 PHE C O   1 
ATOM   8064  C  CB  . PHE C 1 172 ? -30.559 53.363  68.962  1.00 22.57  ? 172 PHE C CB  1 
ATOM   8065  C  CG  . PHE C 1 172 ? -29.830 52.536  70.010  1.00 34.71  ? 172 PHE C CG  1 
ATOM   8066  C  CD1 . PHE C 1 172 ? -28.744 51.716  69.654  1.00 35.29  ? 172 PHE C CD1 1 
ATOM   8067  C  CD2 . PHE C 1 172 ? -30.190 52.625  71.365  1.00 36.51  ? 172 PHE C CD2 1 
ATOM   8068  C  CE1 . PHE C 1 172 ? -28.032 51.005  70.628  1.00 34.77  ? 172 PHE C CE1 1 
ATOM   8069  C  CE2 . PHE C 1 172 ? -29.485 51.919  72.346  1.00 35.14  ? 172 PHE C CE2 1 
ATOM   8070  C  CZ  . PHE C 1 172 ? -28.404 51.108  71.976  1.00 35.02  ? 172 PHE C CZ  1 
ATOM   8071  N  N   . ASP C 1 173 ? -30.101 55.978  66.654  1.00 20.24  ? 173 ASP C N   1 
ATOM   8072  C  CA  . ASP C 1 173 ? -30.615 57.003  65.766  1.00 18.65  ? 173 ASP C CA  1 
ATOM   8073  C  C   . ASP C 1 173 ? -31.063 56.501  64.391  1.00 18.35  ? 173 ASP C C   1 
ATOM   8074  O  O   . ASP C 1 173 ? -30.363 55.727  63.731  1.00 18.90  ? 173 ASP C O   1 
ATOM   8075  C  CB  . ASP C 1 173 ? -29.478 58.033  65.649  1.00 18.52  ? 173 ASP C CB  1 
ATOM   8076  C  CG  . ASP C 1 173 ? -29.812 59.201  64.785  1.00 20.20  ? 173 ASP C CG  1 
ATOM   8077  O  OD1 . ASP C 1 173 ? -29.615 59.102  63.561  1.00 23.35  ? 173 ASP C OD1 1 
ATOM   8078  O  OD2 . ASP C 1 173 ? -30.201 60.245  65.334  1.00 19.79  ? 173 ASP C OD2 1 
ATOM   8079  N  N   . VAL C 1 174 ? -32.247 56.937  63.975  1.00 16.66  ? 174 VAL C N   1 
ATOM   8080  C  CA  . VAL C 1 174 ? -32.798 56.564  62.681  1.00 15.91  ? 174 VAL C CA  1 
ATOM   8081  C  C   . VAL C 1 174 ? -33.305 57.829  62.013  1.00 17.19  ? 174 VAL C C   1 
ATOM   8082  O  O   . VAL C 1 174 ? -34.040 58.607  62.625  1.00 18.52  ? 174 VAL C O   1 
ATOM   8083  C  CB  . VAL C 1 174 ? -33.956 55.560  62.821  1.00 18.19  ? 174 VAL C CB  1 
ATOM   8084  C  CG1 . VAL C 1 174 ? -34.433 55.095  61.441  1.00 14.55  ? 174 VAL C CG1 1 
ATOM   8085  C  CG2 . VAL C 1 174 ? -33.499 54.360  63.640  1.00 18.92  ? 174 VAL C CG2 1 
ATOM   8086  N  N   . ARG C 1 175 ? -32.881 58.054  60.775  1.00 16.98  ? 175 ARG C N   1 
ATOM   8087  C  CA  . ARG C 1 175 ? -33.289 59.237  60.046  1.00 15.06  ? 175 ARG C CA  1 
ATOM   8088  C  C   . ARG C 1 175 ? -33.733 58.908  58.635  1.00 18.13  ? 175 ARG C C   1 
ATOM   8089  O  O   . ARG C 1 175 ? -33.165 58.026  57.986  1.00 17.08  ? 175 ARG C O   1 
ATOM   8090  C  CB  . ARG C 1 175 ? -32.127 60.224  59.996  1.00 16.30  ? 175 ARG C CB  1 
ATOM   8091  C  CG  . ARG C 1 175 ? -31.874 60.940  61.305  1.00 18.99  ? 175 ARG C CG  1 
ATOM   8092  C  CD  . ARG C 1 175 ? -30.411 60.999  61.638  1.00 15.97  ? 175 ARG C CD  1 
ATOM   8093  N  NE  . ARG C 1 175 ? -29.926 62.359  61.705  1.00 17.78  ? 175 ARG C NE  1 
ATOM   8094  C  CZ  . ARG C 1 175 ? -29.259 62.892  62.721  1.00 16.71  ? 175 ARG C CZ  1 
ATOM   8095  N  NH1 . ARG C 1 175 ? -28.983 62.207  63.814  1.00 10.92  ? 175 ARG C NH1 1 
ATOM   8096  N  NH2 . ARG C 1 175 ? -28.783 64.112  62.593  1.00 20.81  ? 175 ARG C NH2 1 
ATOM   8097  N  N   . LEU C 1 176 ? -34.777 59.593  58.182  1.00 19.23  ? 176 LEU C N   1 
ATOM   8098  C  CA  . LEU C 1 176 ? -35.302 59.432  56.834  1.00 17.31  ? 176 LEU C CA  1 
ATOM   8099  C  C   . LEU C 1 176 ? -35.310 60.851  56.294  1.00 17.42  ? 176 LEU C C   1 
ATOM   8100  O  O   . LEU C 1 176 ? -36.031 61.719  56.796  1.00 19.16  ? 176 LEU C O   1 
ATOM   8101  C  CB  . LEU C 1 176 ? -36.718 58.851  56.847  1.00 20.52  ? 176 LEU C CB  1 
ATOM   8102  C  CG  . LEU C 1 176 ? -37.341 58.505  55.491  1.00 22.60  ? 176 LEU C CG  1 
ATOM   8103  C  CD1 . LEU C 1 176 ? -36.479 57.514  54.771  1.00 21.90  ? 176 LEU C CD1 1 
ATOM   8104  C  CD2 . LEU C 1 176 ? -38.718 57.932  55.689  1.00 22.29  ? 176 LEU C CD2 1 
ATOM   8105  N  N   . ALA C 1 177 ? -34.463 61.105  55.309  1.00 18.22  ? 177 ALA C N   1 
ATOM   8106  C  CA  . ALA C 1 177 ? -34.358 62.436  54.745  1.00 18.74  ? 177 ALA C CA  1 
ATOM   8107  C  C   . ALA C 1 177 ? -34.704 62.461  53.278  1.00 19.76  ? 177 ALA C C   1 
ATOM   8108  O  O   . ALA C 1 177 ? -34.735 61.421  52.619  1.00 20.20  ? 177 ALA C O   1 
ATOM   8109  C  CB  . ALA C 1 177 ? -32.951 62.955  54.943  1.00 16.48  ? 177 ALA C CB  1 
ATOM   8110  N  N   . GLY C 1 178 ? -34.910 63.669  52.766  1.00 22.20  ? 178 GLY C N   1 
ATOM   8111  C  CA  . GLY C 1 178 ? -35.221 63.843  51.361  1.00 24.60  ? 178 GLY C CA  1 
ATOM   8112  C  C   . GLY C 1 178 ? -36.644 63.575  50.914  1.00 26.72  ? 178 GLY C C   1 
ATOM   8113  O  O   . GLY C 1 178 ? -36.865 63.278  49.747  1.00 32.51  ? 178 GLY C O   1 
ATOM   8114  N  N   . LEU C 1 179 ? -37.606 63.648  51.823  1.00 28.58  ? 179 LEU C N   1 
ATOM   8115  C  CA  . LEU C 1 179 ? -38.990 63.428  51.448  1.00 27.15  ? 179 LEU C CA  1 
ATOM   8116  C  C   . LEU C 1 179 ? -39.473 64.710  50.772  1.00 29.26  ? 179 LEU C C   1 
ATOM   8117  O  O   . LEU C 1 179 ? -39.501 65.781  51.391  1.00 29.12  ? 179 LEU C O   1 
ATOM   8118  C  CB  . LEU C 1 179 ? -39.838 63.119  52.679  1.00 24.29  ? 179 LEU C CB  1 
ATOM   8119  C  CG  . LEU C 1 179 ? -39.443 61.899  53.524  1.00 24.57  ? 179 LEU C CG  1 
ATOM   8120  C  CD1 . LEU C 1 179 ? -40.281 61.891  54.783  1.00 22.78  ? 179 LEU C CD1 1 
ATOM   8121  C  CD2 . LEU C 1 179 ? -39.617 60.576  52.775  1.00 22.90  ? 179 LEU C CD2 1 
ATOM   8122  N  N   . GLN C 1 180 ? -39.768 64.608  49.479  1.00 32.55  ? 180 GLN C N   1 
ATOM   8123  C  CA  . GLN C 1 180 ? -40.249 65.738  48.695  1.00 35.55  ? 180 GLN C CA  1 
ATOM   8124  C  C   . GLN C 1 180 ? -41.695 65.978  49.067  1.00 33.57  ? 180 GLN C C   1 
ATOM   8125  O  O   . GLN C 1 180 ? -42.573 65.234  48.663  1.00 34.57  ? 180 GLN C O   1 
ATOM   8126  C  CB  . GLN C 1 180 ? -40.136 65.432  47.203  1.00 42.98  ? 180 GLN C CB  1 
ATOM   8127  C  CG  . GLN C 1 180 ? -38.769 65.736  46.591  1.00 59.62  ? 180 GLN C CG  1 
ATOM   8128  C  CD  . GLN C 1 180 ? -38.434 67.234  46.581  1.00 71.98  ? 180 GLN C CD  1 
ATOM   8129  O  OE1 . GLN C 1 180 ? -37.260 67.613  46.572  1.00 78.92  ? 180 GLN C OE1 1 
ATOM   8130  N  NE2 . GLN C 1 180 ? -39.464 68.088  46.560  1.00 73.21  ? 180 GLN C NE2 1 
ATOM   8131  N  N   . THR C 1 181 ? -41.943 67.008  49.855  1.00 31.50  ? 181 THR C N   1 
ATOM   8132  C  CA  . THR C 1 181 ? -43.295 67.288  50.295  1.00 31.37  ? 181 THR C CA  1 
ATOM   8133  C  C   . THR C 1 181 ? -44.042 68.290  49.420  1.00 33.04  ? 181 THR C C   1 
ATOM   8134  O  O   . THR C 1 181 ? -45.261 68.249  49.291  1.00 36.17  ? 181 THR C O   1 
ATOM   8135  C  CB  . THR C 1 181 ? -43.277 67.771  51.757  1.00 27.74  ? 181 THR C CB  1 
ATOM   8136  O  OG1 . THR C 1 181 ? -42.316 68.824  51.903  1.00 31.87  ? 181 THR C OG1 1 
ATOM   8137  C  CG2 . THR C 1 181 ? -42.893 66.630  52.670  1.00 24.30  ? 181 THR C CG2 1 
ATOM   8138  N  N   . ASN C 1 182 ? -43.302 69.194  48.814  1.00 33.26  ? 182 ASN C N   1 
ATOM   8139  C  CA  . ASN C 1 182 ? -43.903 70.207  47.985  1.00 32.64  ? 182 ASN C CA  1 
ATOM   8140  C  C   . ASN C 1 182 ? -42.788 70.755  47.121  1.00 35.84  ? 182 ASN C C   1 
ATOM   8141  O  O   . ASN C 1 182 ? -41.615 70.436  47.339  1.00 39.47  ? 182 ASN C O   1 
ATOM   8142  C  CB  . ASN C 1 182 ? -44.496 71.315  48.866  1.00 30.48  ? 182 ASN C CB  1 
ATOM   8143  C  CG  . ASN C 1 182 ? -43.457 71.962  49.781  1.00 29.72  ? 182 ASN C CG  1 
ATOM   8144  O  OD1 . ASN C 1 182 ? -42.897 71.307  50.661  1.00 31.55  ? 182 ASN C OD1 1 
ATOM   8145  N  ND2 . ASN C 1 182 ? -43.192 73.245  49.569  1.00 31.23  ? 182 ASN C ND2 1 
ATOM   8146  N  N   . PRO C 1 183 ? -43.133 71.511  46.073  1.00 37.47  ? 183 PRO C N   1 
ATOM   8147  C  CA  . PRO C 1 183 ? -42.091 72.069  45.211  1.00 37.24  ? 183 PRO C CA  1 
ATOM   8148  C  C   . PRO C 1 183 ? -41.051 72.873  46.008  1.00 34.69  ? 183 PRO C C   1 
ATOM   8149  O  O   . PRO C 1 183 ? -41.397 73.802  46.750  1.00 34.29  ? 183 PRO C O   1 
ATOM   8150  C  CB  . PRO C 1 183 ? -42.895 72.947  44.243  1.00 38.44  ? 183 PRO C CB  1 
ATOM   8151  C  CG  . PRO C 1 183 ? -44.201 73.215  44.980  1.00 39.74  ? 183 PRO C CG  1 
ATOM   8152  C  CD  . PRO C 1 183 ? -44.469 71.882  45.582  1.00 36.25  ? 183 PRO C CD  1 
ATOM   8153  N  N   . ASP C 1 184 ? -39.786 72.484  45.877  1.00 32.51  ? 184 ASP C N   1 
ATOM   8154  C  CA  . ASP C 1 184 ? -38.687 73.145  46.584  1.00 32.37  ? 184 ASP C CA  1 
ATOM   8155  C  C   . ASP C 1 184 ? -38.733 72.943  48.102  1.00 29.66  ? 184 ASP C C   1 
ATOM   8156  O  O   . ASP C 1 184 ? -38.071 73.663  48.846  1.00 29.65  ? 184 ASP C O   1 
ATOM   8157  C  CB  . ASP C 1 184 ? -38.661 74.646  46.274  1.00 37.51  ? 184 ASP C CB  1 
ATOM   8158  C  CG  . ASP C 1 184 ? -38.323 74.948  44.820  1.00 41.91  ? 184 ASP C CG  1 
ATOM   8159  O  OD1 . ASP C 1 184 ? -37.499 74.213  44.221  1.00 37.69  ? 184 ASP C OD1 1 
ATOM   8160  O  OD2 . ASP C 1 184 ? -38.873 75.942  44.291  1.00 46.34  ? 184 ASP C OD2 1 
ATOM   8161  N  N   . GLY C 1 185 ? -39.525 71.973  48.547  1.00 25.98  ? 185 GLY C N   1 
ATOM   8162  C  CA  . GLY C 1 185 ? -39.649 71.688  49.962  1.00 22.92  ? 185 GLY C CA  1 
ATOM   8163  C  C   . GLY C 1 185 ? -39.292 70.238  50.211  1.00 22.46  ? 185 GLY C C   1 
ATOM   8164  O  O   . GLY C 1 185 ? -39.687 69.351  49.452  1.00 24.93  ? 185 GLY C O   1 
ATOM   8165  N  N   . VAL C 1 186 ? -38.525 69.989  51.262  1.00 22.60  ? 186 VAL C N   1 
ATOM   8166  C  CA  . VAL C 1 186 ? -38.106 68.630  51.601  1.00 21.56  ? 186 VAL C CA  1 
ATOM   8167  C  C   . VAL C 1 186 ? -38.314 68.436  53.090  1.00 20.62  ? 186 VAL C C   1 
ATOM   8168  O  O   . VAL C 1 186 ? -38.269 69.403  53.859  1.00 22.10  ? 186 VAL C O   1 
ATOM   8169  C  CB  . VAL C 1 186 ? -36.623 68.403  51.228  1.00 20.71  ? 186 VAL C CB  1 
ATOM   8170  C  CG1 . VAL C 1 186 ? -36.133 67.110  51.777  1.00 32.36  ? 186 VAL C CG1 1 
ATOM   8171  C  CG2 . VAL C 1 186 ? -36.485 68.350  49.735  1.00 27.81  ? 186 VAL C CG2 1 
ATOM   8172  N  N   . LEU C 1 187 ? -38.560 67.195  53.491  1.00 19.32  ? 187 LEU C N   1 
ATOM   8173  C  CA  . LEU C 1 187 ? -38.791 66.868  54.885  1.00 16.19  ? 187 LEU C CA  1 
ATOM   8174  C  C   . LEU C 1 187 ? -37.902 65.736  55.361  1.00 17.58  ? 187 LEU C C   1 
ATOM   8175  O  O   . LEU C 1 187 ? -37.685 64.753  54.642  1.00 19.23  ? 187 LEU C O   1 
ATOM   8176  C  CB  . LEU C 1 187 ? -40.236 66.459  55.081  1.00 15.17  ? 187 LEU C CB  1 
ATOM   8177  C  CG  . LEU C 1 187 ? -40.661 66.071  56.503  1.00 18.37  ? 187 LEU C CG  1 
ATOM   8178  C  CD1 . LEU C 1 187 ? -40.706 67.285  57.446  1.00 13.87  ? 187 LEU C CD1 1 
ATOM   8179  C  CD2 . LEU C 1 187 ? -42.033 65.443  56.407  1.00 18.59  ? 187 LEU C CD2 1 
ATOM   8180  N  N   . GLU C 1 188 ? -37.392 65.877  56.578  1.00 16.69  ? 188 GLU C N   1 
ATOM   8181  C  CA  . GLU C 1 188 ? -36.548 64.869  57.190  1.00 13.43  ? 188 GLU C CA  1 
ATOM   8182  C  C   . GLU C 1 188 ? -37.148 64.531  58.539  1.00 15.93  ? 188 GLU C C   1 
ATOM   8183  O  O   . GLU C 1 188 ? -37.526 65.422  59.297  1.00 12.68  ? 188 GLU C O   1 
ATOM   8184  C  CB  . GLU C 1 188 ? -35.132 65.391  57.397  1.00 13.81  ? 188 GLU C CB  1 
ATOM   8185  C  CG  . GLU C 1 188 ? -34.292 64.476  58.270  1.00 11.69  ? 188 GLU C CG  1 
ATOM   8186  C  CD  . GLU C 1 188 ? -32.833 64.844  58.277  1.00 15.80  ? 188 GLU C CD  1 
ATOM   8187  O  OE1 . GLU C 1 188 ? -32.505 66.045  58.171  1.00 16.92  ? 188 GLU C OE1 1 
ATOM   8188  O  OE2 . GLU C 1 188 ? -32.009 63.922  58.395  1.00 12.79  ? 188 GLU C OE2 1 
ATOM   8189  N  N   . LEU C 1 189 ? -37.252 63.237  58.811  1.00 17.89  ? 189 LEU C N   1 
ATOM   8190  C  CA  . LEU C 1 189 ? -37.792 62.718  60.059  1.00 18.21  ? 189 LEU C CA  1 
ATOM   8191  C  C   . LEU C 1 189 ? -36.699 61.943  60.794  1.00 19.45  ? 189 LEU C C   1 
ATOM   8192  O  O   . LEU C 1 189 ? -35.911 61.217  60.172  1.00 19.96  ? 189 LEU C O   1 
ATOM   8193  C  CB  . LEU C 1 189 ? -38.940 61.755  59.768  1.00 18.87  ? 189 LEU C CB  1 
ATOM   8194  C  CG  . LEU C 1 189 ? -40.398 62.193  59.628  1.00 21.05  ? 189 LEU C CG  1 
ATOM   8195  C  CD1 . LEU C 1 189 ? -40.557 63.684  59.648  1.00 19.79  ? 189 LEU C CD1 1 
ATOM   8196  C  CD2 . LEU C 1 189 ? -40.947 61.599  58.355  1.00 16.88  ? 189 LEU C CD2 1 
ATOM   8197  N  N   . GLY C 1 190 ? -36.671 62.061  62.114  1.00 17.78  ? 190 GLY C N   1 
ATOM   8198  C  CA  . GLY C 1 190 ? -35.669 61.339  62.873  1.00 18.69  ? 190 GLY C CA  1 
ATOM   8199  C  C   . GLY C 1 190 ? -36.183 60.934  64.239  1.00 20.58  ? 190 GLY C C   1 
ATOM   8200  O  O   . GLY C 1 190 ? -37.001 61.641  64.838  1.00 20.46  ? 190 GLY C O   1 
ATOM   8201  N  N   . VAL C 1 191 ? -35.730 59.777  64.709  1.00 20.90  ? 191 VAL C N   1 
ATOM   8202  C  CA  . VAL C 1 191 ? -36.106 59.262  66.014  1.00 22.04  ? 191 VAL C CA  1 
ATOM   8203  C  C   . VAL C 1 191 ? -34.834 58.877  66.734  1.00 22.73  ? 191 VAL C C   1 
ATOM   8204  O  O   . VAL C 1 191 ? -33.918 58.319  66.132  1.00 22.96  ? 191 VAL C O   1 
ATOM   8205  C  CB  . VAL C 1 191 ? -36.966 57.986  65.922  1.00 22.90  ? 191 VAL C CB  1 
ATOM   8206  C  CG1 . VAL C 1 191 ? -37.288 57.480  67.317  1.00 23.22  ? 191 VAL C CG1 1 
ATOM   8207  C  CG2 . VAL C 1 191 ? -38.250 58.272  65.207  1.00 25.60  ? 191 VAL C CG2 1 
ATOM   8208  N  N   . ASP C 1 192 ? -34.776 59.188  68.022  1.00 22.86  ? 192 ASP C N   1 
ATOM   8209  C  CA  . ASP C 1 192 ? -33.625 58.850  68.847  1.00 19.22  ? 192 ASP C CA  1 
ATOM   8210  C  C   . ASP C 1 192 ? -34.108 58.214  70.135  1.00 19.18  ? 192 ASP C C   1 
ATOM   8211  O  O   . ASP C 1 192 ? -35.018 58.735  70.806  1.00 19.90  ? 192 ASP C O   1 
ATOM   8212  C  CB  . ASP C 1 192 ? -32.825 60.094  69.231  1.00 18.24  ? 192 ASP C CB  1 
ATOM   8213  C  CG  . ASP C 1 192 ? -31.964 60.608  68.111  1.00 17.14  ? 192 ASP C CG  1 
ATOM   8214  O  OD1 . ASP C 1 192 ? -30.958 59.947  67.798  1.00 20.66  ? 192 ASP C OD1 1 
ATOM   8215  O  OD2 . ASP C 1 192 ? -32.271 61.692  67.574  1.00 15.24  ? 192 ASP C OD2 1 
ATOM   8216  N  N   . TYR C 1 193 ? -33.532 57.065  70.450  1.00 17.03  ? 193 TYR C N   1 
ATOM   8217  C  CA  . TYR C 1 193 ? -33.845 56.386  71.684  1.00 18.04  ? 193 TYR C CA  1 
ATOM   8218  C  C   . TYR C 1 193 ? -32.519 56.263  72.429  1.00 18.78  ? 193 TYR C C   1 
ATOM   8219  O  O   . TYR C 1 193 ? -31.566 55.671  71.917  1.00 17.14  ? 193 TYR C O   1 
ATOM   8220  C  CB  . TYR C 1 193 ? -34.443 54.999  71.445  1.00 17.78  ? 193 TYR C CB  1 
ATOM   8221  C  CG  . TYR C 1 193 ? -34.581 54.258  72.753  1.00 21.90  ? 193 TYR C CG  1 
ATOM   8222  C  CD1 . TYR C 1 193 ? -35.475 54.701  73.741  1.00 21.99  ? 193 TYR C CD1 1 
ATOM   8223  C  CD2 . TYR C 1 193 ? -33.753 53.175  73.055  1.00 22.17  ? 193 TYR C CD2 1 
ATOM   8224  C  CE1 . TYR C 1 193 ? -35.531 54.085  74.995  1.00 22.26  ? 193 TYR C CE1 1 
ATOM   8225  C  CE2 . TYR C 1 193 ? -33.809 52.554  74.300  1.00 20.71  ? 193 TYR C CE2 1 
ATOM   8226  C  CZ  . TYR C 1 193 ? -34.695 53.014  75.262  1.00 23.31  ? 193 TYR C CZ  1 
ATOM   8227  O  OH  . TYR C 1 193 ? -34.726 52.403  76.494  1.00 27.05  ? 193 TYR C OH  1 
ATOM   8228  N  N   . GLY C 1 194 ? -32.459 56.824  73.631  1.00 19.82  ? 194 GLY C N   1 
ATOM   8229  C  CA  . GLY C 1 194 ? -31.231 56.762  74.408  1.00 21.19  ? 194 GLY C CA  1 
ATOM   8230  C  C   . GLY C 1 194 ? -31.437 56.193  75.796  1.00 22.63  ? 194 GLY C C   1 
ATOM   8231  O  O   . GLY C 1 194 ? -32.506 56.364  76.378  1.00 25.10  ? 194 GLY C O   1 
ATOM   8232  N  N   . ARG C 1 195 ? -30.403 55.574  76.355  1.00 24.59  ? 195 ARG C N   1 
ATOM   8233  C  CA  . ARG C 1 195 ? -30.526 54.985  77.672  1.00 26.29  ? 195 ARG C CA  1 
ATOM   8234  C  C   . ARG C 1 195 ? -29.205 54.779  78.375  1.00 25.43  ? 195 ARG C C   1 
ATOM   8235  O  O   . ARG C 1 195 ? -28.178 54.565  77.731  1.00 29.71  ? 195 ARG C O   1 
ATOM   8236  C  CB  . ARG C 1 195 ? -31.215 53.635  77.556  1.00 27.95  ? 195 ARG C CB  1 
ATOM   8237  C  CG  . ARG C 1 195 ? -30.393 52.624  76.827  1.00 33.71  ? 195 ARG C CG  1 
ATOM   8238  C  CD  . ARG C 1 195 ? -31.197 51.388  76.578  1.00 46.45  ? 195 ARG C CD  1 
ATOM   8239  N  NE  . ARG C 1 195 ? -30.391 50.202  76.815  1.00 58.14  ? 195 ARG C NE  1 
ATOM   8240  C  CZ  . ARG C 1 195 ? -29.973 49.823  78.019  1.00 63.79  ? 195 ARG C CZ  1 
ATOM   8241  N  NH1 . ARG C 1 195 ? -30.292 50.538  79.092  1.00 66.05  ? 195 ARG C NH1 1 
ATOM   8242  N  NH2 . ARG C 1 195 ? -29.222 48.737  78.152  1.00 65.33  ? 195 ARG C NH2 1 
ATOM   8243  N  N   . ALA C 1 196 ? -29.246 54.835  79.704  1.00 25.84  ? 196 ALA C N   1 
ATOM   8244  C  CA  . ALA C 1 196 ? -28.067 54.591  80.521  1.00 22.15  ? 196 ALA C CA  1 
ATOM   8245  C  C   . ALA C 1 196 ? -27.849 53.088  80.409  1.00 17.49  ? 196 ALA C C   1 
ATOM   8246  O  O   . ALA C 1 196 ? -28.795 52.308  80.400  1.00 18.76  ? 196 ALA C O   1 
ATOM   8247  C  CB  . ALA C 1 196 ? -28.323 54.980  81.958  1.00 23.70  ? 196 ALA C CB  1 
ATOM   8248  N  N   . ASN C 1 197 ? -26.602 52.684  80.284  1.00 16.22  ? 197 ASN C N   1 
ATOM   8249  C  CA  . ASN C 1 197 ? -26.284 51.286  80.133  1.00 14.40  ? 197 ASN C CA  1 
ATOM   8250  C  C   . ASN C 1 197 ? -25.205 50.974  81.157  1.00 18.01  ? 197 ASN C C   1 
ATOM   8251  O  O   . ASN C 1 197 ? -24.019 51.212  80.931  1.00 20.24  ? 197 ASN C O   1 
ATOM   8252  C  CB  . ASN C 1 197 ? -25.793 51.056  78.712  1.00 16.50  ? 197 ASN C CB  1 
ATOM   8253  C  CG  . ASN C 1 197 ? -25.442 49.634  78.448  1.00 23.98  ? 197 ASN C CG  1 
ATOM   8254  O  OD1 . ASN C 1 197 ? -25.653 48.770  79.294  1.00 32.01  ? 197 ASN C OD1 1 
ATOM   8255  N  ND2 . ASN C 1 197 ? -24.894 49.366  77.269  1.00 28.40  ? 197 ASN C ND2 1 
ATOM   8256  N  N   . THR C 1 198 ? -25.638 50.447  82.295  1.00 22.92  ? 198 THR C N   1 
ATOM   8257  C  CA  . THR C 1 198 ? -24.759 50.124  83.414  1.00 20.51  ? 198 THR C CA  1 
ATOM   8258  C  C   . THR C 1 198 ? -23.979 48.823  83.334  1.00 18.07  ? 198 THR C C   1 
ATOM   8259  O  O   . THR C 1 198 ? -24.449 47.819  82.808  1.00 18.51  ? 198 THR C O   1 
ATOM   8260  C  CB  . THR C 1 198 ? -25.552 50.122  84.712  1.00 23.48  ? 198 THR C CB  1 
ATOM   8261  O  OG1 . THR C 1 198 ? -26.755 49.366  84.516  1.00 24.52  ? 198 THR C OG1 1 
ATOM   8262  C  CG2 . THR C 1 198 ? -25.910 51.549  85.119  1.00 21.56  ? 198 THR C CG2 1 
ATOM   8263  N  N   . THR C 1 199 ? -22.771 48.862  83.871  1.00 17.78  ? 199 THR C N   1 
ATOM   8264  C  CA  . THR C 1 199 ? -21.890 47.717  83.909  1.00 20.03  ? 199 THR C CA  1 
ATOM   8265  C  C   . THR C 1 199 ? -22.485 46.717  84.880  1.00 23.77  ? 199 THR C C   1 
ATOM   8266  O  O   . THR C 1 199 ? -23.108 47.103  85.861  1.00 29.91  ? 199 THR C O   1 
ATOM   8267  C  CB  . THR C 1 199 ? -20.546 48.165  84.440  1.00 19.29  ? 199 THR C CB  1 
ATOM   8268  O  OG1 . THR C 1 199 ? -20.060 49.236  83.628  1.00 22.45  ? 199 THR C OG1 1 
ATOM   8269  C  CG2 . THR C 1 199 ? -19.559 47.029  84.432  1.00 13.25  ? 199 THR C CG2 1 
ATOM   8270  N  N   . ASP C 1 200 ? -22.292 45.437  84.625  1.00 29.76  ? 200 ASP C N   1 
ATOM   8271  C  CA  . ASP C 1 200 ? -22.829 44.426  85.512  1.00 34.00  ? 200 ASP C CA  1 
ATOM   8272  C  C   . ASP C 1 200 ? -22.351 44.660  86.938  1.00 35.29  ? 200 ASP C C   1 
ATOM   8273  O  O   . ASP C 1 200 ? -21.179 44.950  87.177  1.00 35.70  ? 200 ASP C O   1 
ATOM   8274  C  CB  . ASP C 1 200 ? -22.422 43.035  85.051  1.00 40.01  ? 200 ASP C CB  1 
ATOM   8275  C  CG  . ASP C 1 200 ? -23.100 41.937  85.845  1.00 44.38  ? 200 ASP C CG  1 
ATOM   8276  O  OD1 . ASP C 1 200 ? -24.340 42.007  86.038  1.00 46.60  ? 200 ASP C OD1 1 
ATOM   8277  O  OD2 . ASP C 1 200 ? -22.385 41.000  86.267  1.00 51.23  ? 200 ASP C OD2 1 
ATOM   8278  N  N   . GLY C 1 201 ? -23.290 44.588  87.874  1.00 38.14  ? 201 GLY C N   1 
ATOM   8279  C  CA  . GLY C 1 201 ? -22.970 44.792  89.272  1.00 36.16  ? 201 GLY C CA  1 
ATOM   8280  C  C   . GLY C 1 201 ? -23.288 46.198  89.732  1.00 36.97  ? 201 GLY C C   1 
ATOM   8281  O  O   . GLY C 1 201 ? -23.578 46.430  90.916  1.00 43.20  ? 201 GLY C O   1 
ATOM   8282  N  N   . TYR C 1 202 ? -23.199 47.149  88.810  1.00 33.66  ? 202 TYR C N   1 
ATOM   8283  C  CA  . TYR C 1 202 ? -23.488 48.530  89.138  1.00 27.32  ? 202 TYR C CA  1 
ATOM   8284  C  C   . TYR C 1 202 ? -24.949 48.823  88.858  1.00 27.31  ? 202 TYR C C   1 
ATOM   8285  O  O   . TYR C 1 202 ? -25.586 48.128  88.060  1.00 26.41  ? 202 TYR C O   1 
ATOM   8286  C  CB  . TYR C 1 202 ? -22.601 49.462  88.331  1.00 23.80  ? 202 TYR C CB  1 
ATOM   8287  C  CG  . TYR C 1 202 ? -21.154 49.410  88.731  1.00 19.10  ? 202 TYR C CG  1 
ATOM   8288  C  CD1 . TYR C 1 202 ? -20.346 48.348  88.349  1.00 17.87  ? 202 TYR C CD1 1 
ATOM   8289  C  CD2 . TYR C 1 202 ? -20.587 50.438  89.471  1.00 20.17  ? 202 TYR C CD2 1 
ATOM   8290  C  CE1 . TYR C 1 202 ? -19.001 48.314  88.687  1.00 15.05  ? 202 TYR C CE1 1 
ATOM   8291  C  CE2 . TYR C 1 202 ? -19.243 50.414  89.820  1.00 20.32  ? 202 TYR C CE2 1 
ATOM   8292  C  CZ  . TYR C 1 202 ? -18.460 49.351  89.419  1.00 18.69  ? 202 TYR C CZ  1 
ATOM   8293  O  OH  . TYR C 1 202 ? -17.126 49.359  89.737  1.00 30.44  ? 202 TYR C OH  1 
ATOM   8294  N  N   . LYS C 1 203 ? -25.474 49.845  89.526  1.00 28.56  ? 203 LYS C N   1 
ATOM   8295  C  CA  . LYS C 1 203 ? -26.862 50.251  89.372  1.00 30.28  ? 203 LYS C CA  1 
ATOM   8296  C  C   . LYS C 1 203 ? -26.955 51.753  89.504  1.00 28.03  ? 203 LYS C C   1 
ATOM   8297  O  O   . LYS C 1 203 ? -26.053 52.392  90.045  1.00 26.47  ? 203 LYS C O   1 
ATOM   8298  C  CB  . LYS C 1 203 ? -27.742 49.601  90.447  1.00 39.18  ? 203 LYS C CB  1 
ATOM   8299  C  CG  . LYS C 1 203 ? -27.895 48.094  90.327  1.00 51.00  ? 203 LYS C CG  1 
ATOM   8300  C  CD  . LYS C 1 203 ? -28.721 47.518  91.464  1.00 61.60  ? 203 LYS C CD  1 
ATOM   8301  C  CE  . LYS C 1 203 ? -28.821 45.999  91.329  1.00 70.03  ? 203 LYS C CE  1 
ATOM   8302  N  NZ  . LYS C 1 203 ? -29.650 45.365  92.398  1.00 77.61  ? 203 LYS C NZ  1 
ATOM   8303  N  N   . LEU C 1 204 ? -28.032 52.314  88.970  1.00 28.67  ? 204 LEU C N   1 
ATOM   8304  C  CA  . LEU C 1 204 ? -28.272 53.752  89.042  1.00 30.98  ? 204 LEU C CA  1 
ATOM   8305  C  C   . LEU C 1 204 ? -28.954 54.007  90.379  1.00 33.54  ? 204 LEU C C   1 
ATOM   8306  O  O   . LEU C 1 204 ? -29.682 53.149  90.878  1.00 35.37  ? 204 LEU C O   1 
ATOM   8307  C  CB  . LEU C 1 204 ? -29.205 54.200  87.902  1.00 29.28  ? 204 LEU C CB  1 
ATOM   8308  C  CG  . LEU C 1 204 ? -28.830 53.879  86.445  1.00 27.88  ? 204 LEU C CG  1 
ATOM   8309  C  CD1 . LEU C 1 204 ? -29.993 54.246  85.533  1.00 24.90  ? 204 LEU C CD1 1 
ATOM   8310  C  CD2 . LEU C 1 204 ? -27.552 54.618  86.026  1.00 23.44  ? 204 LEU C CD2 1 
ATOM   8311  N  N   . ALA C 1 205 ? -28.721 55.176  90.958  1.00 35.36  ? 205 ALA C N   1 
ATOM   8312  C  CA  . ALA C 1 205 ? -29.338 55.525  92.219  1.00 34.12  ? 205 ALA C CA  1 
ATOM   8313  C  C   . ALA C 1 205 ? -30.854 55.562  92.016  1.00 37.69  ? 205 ALA C C   1 
ATOM   8314  O  O   . ALA C 1 205 ? -31.342 55.504  90.878  1.00 40.13  ? 205 ALA C O   1 
ATOM   8315  C  CB  . ALA C 1 205 ? -28.823 56.869  92.700  1.00 29.40  ? 205 ALA C CB  1 
ATOM   8316  N  N   . ASP C 1 206 ? -31.597 55.637  93.119  1.00 42.95  ? 206 ASP C N   1 
ATOM   8317  C  CA  . ASP C 1 206 ? -33.062 55.669  93.078  1.00 39.98  ? 206 ASP C CA  1 
ATOM   8318  C  C   . ASP C 1 206 ? -33.562 56.928  92.401  1.00 35.33  ? 206 ASP C C   1 
ATOM   8319  O  O   . ASP C 1 206 ? -33.140 58.030  92.749  1.00 35.03  ? 206 ASP C O   1 
ATOM   8320  C  CB  . ASP C 1 206 ? -33.651 55.653  94.496  1.00 52.54  ? 206 ASP C CB  1 
ATOM   8321  C  CG  . ASP C 1 206 ? -33.251 54.430  95.296  1.00 57.91  ? 206 ASP C CG  1 
ATOM   8322  O  OD1 . ASP C 1 206 ? -33.526 53.297  94.831  1.00 61.40  ? 206 ASP C OD1 1 
ATOM   8323  O  OD2 . ASP C 1 206 ? -32.687 54.616  96.403  1.00 64.51  ? 206 ASP C OD2 1 
ATOM   8324  N  N   . GLY C 1 207 ? -34.477 56.763  91.453  1.00 33.52  ? 207 GLY C N   1 
ATOM   8325  C  CA  . GLY C 1 207 ? -35.045 57.912  90.771  1.00 32.11  ? 207 GLY C CA  1 
ATOM   8326  C  C   . GLY C 1 207 ? -34.415 58.376  89.466  1.00 33.26  ? 207 GLY C C   1 
ATOM   8327  O  O   . GLY C 1 207 ? -34.899 59.348  88.883  1.00 36.44  ? 207 GLY C O   1 
ATOM   8328  N  N   . ALA C 1 208 ? -33.345 57.726  89.008  1.00 31.00  ? 208 ALA C N   1 
ATOM   8329  C  CA  . ALA C 1 208 ? -32.704 58.107  87.749  1.00 26.49  ? 208 ALA C CA  1 
ATOM   8330  C  C   . ALA C 1 208 ? -33.727 57.894  86.632  1.00 26.33  ? 208 ALA C C   1 
ATOM   8331  O  O   . ALA C 1 208 ? -34.500 56.936  86.680  1.00 24.94  ? 208 ALA C O   1 
ATOM   8332  C  CB  . ALA C 1 208 ? -31.473 57.252  87.508  1.00 18.35  ? 208 ALA C CB  1 
ATOM   8333  N  N   . SER C 1 209 ? -33.764 58.804  85.658  1.00 25.61  ? 209 SER C N   1 
ATOM   8334  C  CA  . SER C 1 209 ? -34.707 58.699  84.539  1.00 24.04  ? 209 SER C CA  1 
ATOM   8335  C  C   . SER C 1 209 ? -34.447 57.474  83.677  1.00 21.30  ? 209 SER C C   1 
ATOM   8336  O  O   . SER C 1 209 ? -35.369 56.932  83.074  1.00 23.63  ? 209 SER C O   1 
ATOM   8337  C  CB  . SER C 1 209 ? -34.643 59.939  83.665  1.00 22.94  ? 209 SER C CB  1 
ATOM   8338  O  OG  . SER C 1 209 ? -33.322 60.140  83.218  1.00 23.89  ? 209 SER C OG  1 
ATOM   8339  N  N   . LYS C 1 210 ? -33.182 57.085  83.571  1.00 21.81  ? 210 LYS C N   1 
ATOM   8340  C  CA  . LYS C 1 210 ? -32.776 55.908  82.813  1.00 26.13  ? 210 LYS C CA  1 
ATOM   8341  C  C   . LYS C 1 210 ? -32.772 56.060  81.284  1.00 25.29  ? 210 LYS C C   1 
ATOM   8342  O  O   . LYS C 1 210 ? -31.732 55.877  80.649  1.00 22.96  ? 210 LYS C O   1 
ATOM   8343  C  CB  . LYS C 1 210 ? -33.623 54.692  83.228  1.00 34.89  ? 210 LYS C CB  1 
ATOM   8344  C  CG  . LYS C 1 210 ? -32.893 53.337  83.215  1.00 47.84  ? 210 LYS C CG  1 
ATOM   8345  C  CD  . LYS C 1 210 ? -32.404 52.916  81.823  1.00 53.49  ? 210 LYS C CD  1 
ATOM   8346  C  CE  . LYS C 1 210 ? -31.644 51.592  81.872  1.00 59.60  ? 210 LYS C CE  1 
ATOM   8347  N  NZ  . LYS C 1 210 ? -30.387 51.645  82.691  1.00 63.79  ? 210 LYS C NZ  1 
ATOM   8348  N  N   . ASP C 1 211 ? -33.927 56.342  80.690  1.00 23.06  ? 211 ASP C N   1 
ATOM   8349  C  CA  . ASP C 1 211 ? -34.001 56.484  79.244  1.00 21.73  ? 211 ASP C CA  1 
ATOM   8350  C  C   . ASP C 1 211 ? -34.925 57.585  78.713  1.00 20.82  ? 211 ASP C C   1 
ATOM   8351  O  O   . ASP C 1 211 ? -35.472 58.396  79.475  1.00 21.34  ? 211 ASP C O   1 
ATOM   8352  C  CB  . ASP C 1 211 ? -34.314 55.130  78.585  1.00 19.84  ? 211 ASP C CB  1 
ATOM   8353  C  CG  . ASP C 1 211 ? -35.627 54.523  79.038  1.00 22.65  ? 211 ASP C CG  1 
ATOM   8354  O  OD1 . ASP C 1 211 ? -36.418 55.182  79.738  1.00 27.99  ? 211 ASP C OD1 1 
ATOM   8355  O  OD2 . ASP C 1 211 ? -35.876 53.356  78.677  1.00 27.79  ? 211 ASP C OD2 1 
ATOM   8356  N  N   . GLY C 1 212 ? -35.027 57.669  77.394  1.00 17.86  ? 212 GLY C N   1 
ATOM   8357  C  CA  . GLY C 1 212 ? -35.874 58.678  76.799  1.00 16.50  ? 212 GLY C CA  1 
ATOM   8358  C  C   . GLY C 1 212 ? -35.917 58.576  75.298  1.00 17.57  ? 212 GLY C C   1 
ATOM   8359  O  O   . GLY C 1 212 ? -35.165 57.801  74.700  1.00 20.66  ? 212 GLY C O   1 
ATOM   8360  N  N   . TRP C 1 213 ? -36.785 59.386  74.701  1.00 19.44  ? 213 TRP C N   1 
ATOM   8361  C  CA  . TRP C 1 213 ? -36.976 59.419  73.263  1.00 18.53  ? 213 TRP C CA  1 
ATOM   8362  C  C   . TRP C 1 213 ? -36.916 60.842  72.779  1.00 19.09  ? 213 TRP C C   1 
ATOM   8363  O  O   . TRP C 1 213 ? -37.170 61.771  73.546  1.00 18.88  ? 213 TRP C O   1 
ATOM   8364  C  CB  . TRP C 1 213 ? -38.364 58.909  72.908  1.00 19.88  ? 213 TRP C CB  1 
ATOM   8365  C  CG  . TRP C 1 213 ? -38.559 57.468  73.111  1.00 25.49  ? 213 TRP C CG  1 
ATOM   8366  C  CD1 . TRP C 1 213 ? -38.917 56.851  74.267  1.00 26.29  ? 213 TRP C CD1 1 
ATOM   8367  C  CD2 . TRP C 1 213 ? -38.430 56.433  72.123  1.00 27.50  ? 213 TRP C CD2 1 
ATOM   8368  N  NE1 . TRP C 1 213 ? -39.020 55.490  74.069  1.00 28.45  ? 213 TRP C NE1 1 
ATOM   8369  C  CE2 . TRP C 1 213 ? -38.729 55.207  72.762  1.00 28.62  ? 213 TRP C CE2 1 
ATOM   8370  C  CE3 . TRP C 1 213 ? -38.091 56.423  70.764  1.00 26.45  ? 213 TRP C CE3 1 
ATOM   8371  C  CZ2 . TRP C 1 213 ? -38.702 53.982  72.089  1.00 26.17  ? 213 TRP C CZ2 1 
ATOM   8372  C  CZ3 . TRP C 1 213 ? -38.062 55.202  70.091  1.00 26.81  ? 213 TRP C CZ3 1 
ATOM   8373  C  CH2 . TRP C 1 213 ? -38.368 53.999  70.757  1.00 26.85  ? 213 TRP C CH2 1 
ATOM   8374  N  N   . MET C 1 214 ? -36.567 61.020  71.513  1.00 18.65  ? 214 MET C N   1 
ATOM   8375  C  CA  . MET C 1 214 ? -36.570 62.343  70.922  1.00 17.28  ? 214 MET C CA  1 
ATOM   8376  C  C   . MET C 1 214 ? -37.034 62.175  69.500  1.00 17.41  ? 214 MET C C   1 
ATOM   8377  O  O   . MET C 1 214 ? -36.627 61.232  68.815  1.00 16.43  ? 214 MET C O   1 
ATOM   8378  C  CB  . MET C 1 214 ? -35.206 63.012  70.938  1.00 15.62  ? 214 MET C CB  1 
ATOM   8379  C  CG  . MET C 1 214 ? -35.303 64.456  70.494  1.00 18.54  ? 214 MET C CG  1 
ATOM   8380  S  SD  . MET C 1 214 ? -33.737 65.273  70.489  1.00 27.40  ? 214 MET C SD  1 
ATOM   8381  C  CE  . MET C 1 214 ? -34.069 66.602  71.480  1.00 29.45  ? 214 MET C CE  1 
ATOM   8382  N  N   . PHE C 1 215 ? -37.924 63.059  69.075  1.00 16.74  ? 215 PHE C N   1 
ATOM   8383  C  CA  . PHE C 1 215 ? -38.455 62.999  67.727  1.00 19.79  ? 215 PHE C CA  1 
ATOM   8384  C  C   . PHE C 1 215 ? -38.201 64.333  67.053  1.00 20.58  ? 215 PHE C C   1 
ATOM   8385  O  O   . PHE C 1 215 ? -38.447 65.398  67.643  1.00 19.75  ? 215 PHE C O   1 
ATOM   8386  C  CB  . PHE C 1 215 ? -39.954 62.711  67.763  1.00 25.03  ? 215 PHE C CB  1 
ATOM   8387  C  CG  . PHE C 1 215 ? -40.324 61.480  68.557  1.00 31.02  ? 215 PHE C CG  1 
ATOM   8388  C  CD1 . PHE C 1 215 ? -40.297 60.219  67.968  1.00 31.84  ? 215 PHE C CD1 1 
ATOM   8389  C  CD2 . PHE C 1 215 ? -40.706 61.588  69.897  1.00 31.15  ? 215 PHE C CD2 1 
ATOM   8390  C  CE1 . PHE C 1 215 ? -40.645 59.085  68.700  1.00 32.95  ? 215 PHE C CE1 1 
ATOM   8391  C  CE2 . PHE C 1 215 ? -41.055 60.464  70.634  1.00 30.07  ? 215 PHE C CE2 1 
ATOM   8392  C  CZ  . PHE C 1 215 ? -41.023 59.212  70.037  1.00 29.80  ? 215 PHE C CZ  1 
ATOM   8393  N  N   . THR C 1 216 ? -37.696 64.270  65.826  1.00 19.70  ? 216 THR C N   1 
ATOM   8394  C  CA  . THR C 1 216 ? -37.381 65.465  65.059  1.00 17.14  ? 216 THR C CA  1 
ATOM   8395  C  C   . THR C 1 216 ? -38.026 65.443  63.681  1.00 16.33  ? 216 THR C C   1 
ATOM   8396  O  O   . THR C 1 216 ? -38.093 64.398  63.033  1.00 17.52  ? 216 THR C O   1 
ATOM   8397  C  CB  . THR C 1 216 ? -35.859 65.585  64.863  1.00 14.83  ? 216 THR C CB  1 
ATOM   8398  O  OG1 . THR C 1 216 ? -35.229 65.719  66.136  1.00 16.74  ? 216 THR C OG1 1 
ATOM   8399  C  CG2 . THR C 1 216 ? -35.505 66.794  64.022  1.00 14.08  ? 216 THR C CG2 1 
ATOM   8400  N  N   . ALA C 1 217 ? -38.517 66.605  63.261  1.00 16.97  ? 217 ALA C N   1 
ATOM   8401  C  CA  . ALA C 1 217 ? -39.109 66.794  61.938  1.00 17.23  ? 217 ALA C CA  1 
ATOM   8402  C  C   . ALA C 1 217 ? -38.546 68.135  61.486  1.00 19.02  ? 217 ALA C C   1 
ATOM   8403  O  O   . ALA C 1 217 ? -38.683 69.139  62.199  1.00 19.93  ? 217 ALA C O   1 
ATOM   8404  C  CB  . ALA C 1 217 ? -40.629 66.858  62.011  1.00 14.21  ? 217 ALA C CB  1 
ATOM   8405  N  N   . GLU C 1 218 ? -37.848 68.139  60.355  1.00 20.96  ? 218 GLU C N   1 
ATOM   8406  C  CA  . GLU C 1 218 ? -37.261 69.366  59.830  1.00 18.73  ? 218 GLU C CA  1 
ATOM   8407  C  C   . GLU C 1 218 ? -37.643 69.533  58.366  1.00 20.36  ? 218 GLU C C   1 
ATOM   8408  O  O   . GLU C 1 218 ? -37.459 68.617  57.554  1.00 21.24  ? 218 GLU C O   1 
ATOM   8409  C  CB  . GLU C 1 218 ? -35.744 69.326  59.967  1.00 18.12  ? 218 GLU C CB  1 
ATOM   8410  C  CG  . GLU C 1 218 ? -35.063 70.553  59.429  1.00 17.85  ? 218 GLU C CG  1 
ATOM   8411  C  CD  . GLU C 1 218 ? -33.569 70.536  59.664  1.00 24.14  ? 218 GLU C CD  1 
ATOM   8412  O  OE1 . GLU C 1 218 ? -33.134 70.906  60.775  1.00 26.32  ? 218 GLU C OE1 1 
ATOM   8413  O  OE2 . GLU C 1 218 ? -32.821 70.160  58.740  1.00 27.19  ? 218 GLU C OE2 1 
ATOM   8414  N  N   . HIS C 1 219 ? -38.224 70.678  58.046  1.00 17.19  ? 219 HIS C N   1 
ATOM   8415  C  CA  . HIS C 1 219 ? -38.621 70.949  56.683  1.00 19.24  ? 219 HIS C CA  1 
ATOM   8416  C  C   . HIS C 1 219 ? -37.760 72.060  56.104  1.00 21.54  ? 219 HIS C C   1 
ATOM   8417  O  O   . HIS C 1 219 ? -37.634 73.143  56.704  1.00 19.97  ? 219 HIS C O   1 
ATOM   8418  C  CB  . HIS C 1 219 ? -40.096 71.354  56.606  1.00 21.75  ? 219 HIS C CB  1 
ATOM   8419  C  CG  . HIS C 1 219 ? -40.553 71.693  55.218  1.00 23.36  ? 219 HIS C CG  1 
ATOM   8420  N  ND1 . HIS C 1 219 ? -40.556 72.984  54.726  1.00 21.41  ? 219 HIS C ND1 1 
ATOM   8421  C  CD2 . HIS C 1 219 ? -40.984 70.903  54.204  1.00 20.54  ? 219 HIS C CD2 1 
ATOM   8422  C  CE1 . HIS C 1 219 ? -40.964 72.973  53.471  1.00 18.60  ? 219 HIS C CE1 1 
ATOM   8423  N  NE2 . HIS C 1 219 ? -41.230 71.723  53.131  1.00 20.76  ? 219 HIS C NE2 1 
ATOM   8424  N  N   . THR C 1 220 ? -37.162 71.787  54.946  1.00 21.66  ? 220 THR C N   1 
ATOM   8425  C  CA  . THR C 1 220 ? -36.320 72.769  54.284  1.00 20.56  ? 220 THR C CA  1 
ATOM   8426  C  C   . THR C 1 220 ? -36.982 73.274  53.015  1.00 21.02  ? 220 THR C C   1 
ATOM   8427  O  O   . THR C 1 220 ? -37.399 72.486  52.169  1.00 23.67  ? 220 THR C O   1 
ATOM   8428  C  CB  . THR C 1 220 ? -34.970 72.182  53.938  1.00 19.38  ? 220 THR C CB  1 
ATOM   8429  O  OG1 . THR C 1 220 ? -34.462 71.488  55.082  1.00 20.48  ? 220 THR C OG1 1 
ATOM   8430  C  CG2 . THR C 1 220 ? -33.998 73.301  53.543  1.00 15.51  ? 220 THR C CG2 1 
ATOM   8431  N  N   . GLN C 1 221 ? -37.131 74.586  52.921  1.00 19.11  ? 221 GLN C N   1 
ATOM   8432  C  CA  . GLN C 1 221 ? -37.740 75.189  51.759  1.00 20.11  ? 221 GLN C CA  1 
ATOM   8433  C  C   . GLN C 1 221 ? -36.720 76.080  51.103  1.00 20.76  ? 221 GLN C C   1 
ATOM   8434  O  O   . GLN C 1 221 ? -36.190 76.976  51.748  1.00 22.86  ? 221 GLN C O   1 
ATOM   8435  C  CB  . GLN C 1 221 ? -38.941 76.031  52.169  1.00 20.67  ? 221 GLN C CB  1 
ATOM   8436  C  CG  . GLN C 1 221 ? -39.718 76.620  51.002  1.00 21.07  ? 221 GLN C CG  1 
ATOM   8437  C  CD  . GLN C 1 221 ? -40.312 75.563  50.092  1.00 26.90  ? 221 GLN C CD  1 
ATOM   8438  O  OE1 . GLN C 1 221 ? -40.932 74.603  50.549  1.00 29.29  ? 221 GLN C OE1 1 
ATOM   8439  N  NE2 . GLN C 1 221 ? -40.119 75.730  48.797  1.00 31.35  ? 221 GLN C NE2 1 
ATOM   8440  N  N   . SER C 1 222 ? -36.414 75.810  49.840  1.00 22.27  ? 222 SER C N   1 
ATOM   8441  C  CA  . SER C 1 222 ? -35.463 76.627  49.090  1.00 23.21  ? 222 SER C CA  1 
ATOM   8442  C  C   . SER C 1 222 ? -36.192 77.830  48.540  1.00 21.79  ? 222 SER C C   1 
ATOM   8443  O  O   . SER C 1 222 ? -37.274 77.706  47.971  1.00 25.89  ? 222 SER C O   1 
ATOM   8444  C  CB  . SER C 1 222 ? -34.855 75.833  47.953  1.00 23.41  ? 222 SER C CB  1 
ATOM   8445  O  OG  . SER C 1 222 ? -34.197 74.693  48.468  1.00 34.79  ? 222 SER C OG  1 
ATOM   8446  N  N   . MET C 1 223 ? -35.599 78.999  48.717  1.00 23.40  ? 223 MET C N   1 
ATOM   8447  C  CA  . MET C 1 223 ? -36.219 80.234  48.277  1.00 23.11  ? 223 MET C CA  1 
ATOM   8448  C  C   . MET C 1 223 ? -35.248 81.385  48.440  1.00 25.85  ? 223 MET C C   1 
ATOM   8449  O  O   . MET C 1 223 ? -34.293 81.281  49.198  1.00 26.14  ? 223 MET C O   1 
ATOM   8450  C  CB  . MET C 1 223 ? -37.429 80.515  49.160  1.00 28.68  ? 223 MET C CB  1 
ATOM   8451  C  CG  . MET C 1 223 ? -37.087 80.587  50.645  1.00 28.12  ? 223 MET C CG  1 
ATOM   8452  S  SD  . MET C 1 223 ? -38.512 80.903  51.650  1.00 33.74  ? 223 MET C SD  1 
ATOM   8453  C  CE  . MET C 1 223 ? -38.074 82.431  52.361  1.00 34.89  ? 223 MET C CE  1 
ATOM   8454  N  N   . LEU C 1 224 ? -35.542 82.500  47.774  1.00 24.31  ? 224 LEU C N   1 
ATOM   8455  C  CA  . LEU C 1 224 ? -34.716 83.701  47.839  1.00 23.74  ? 224 LEU C CA  1 
ATOM   8456  C  C   . LEU C 1 224 ? -33.219 83.424  47.877  1.00 26.13  ? 224 LEU C C   1 
ATOM   8457  O  O   . LEU C 1 224 ? -32.481 84.058  48.629  1.00 26.32  ? 224 LEU C O   1 
ATOM   8458  C  CB  . LEU C 1 224 ? -35.127 84.566  49.028  1.00 27.21  ? 224 LEU C CB  1 
ATOM   8459  C  CG  . LEU C 1 224 ? -36.354 85.471  48.881  1.00 29.42  ? 224 LEU C CG  1 
ATOM   8460  C  CD1 . LEU C 1 224 ? -37.052 85.241  47.556  1.00 27.61  ? 224 LEU C CD1 1 
ATOM   8461  C  CD2 . LEU C 1 224 ? -37.297 85.234  50.050  1.00 30.73  ? 224 LEU C CD2 1 
ATOM   8462  N  N   . LYS C 1 225 ? -32.787 82.474  47.053  1.00 29.84  ? 225 LYS C N   1 
ATOM   8463  C  CA  . LYS C 1 225 ? -31.381 82.082  46.949  1.00 35.43  ? 225 LYS C CA  1 
ATOM   8464  C  C   . LYS C 1 225 ? -30.804 81.671  48.289  1.00 33.88  ? 225 LYS C C   1 
ATOM   8465  O  O   . LYS C 1 225 ? -29.620 81.864  48.565  1.00 37.41  ? 225 LYS C O   1 
ATOM   8466  C  CB  . LYS C 1 225 ? -30.549 83.192  46.275  1.00 41.25  ? 225 LYS C CB  1 
ATOM   8467  C  CG  . LYS C 1 225 ? -30.728 83.225  44.751  1.00 51.24  ? 225 LYS C CG  1 
ATOM   8468  C  CD  . LYS C 1 225 ? -30.273 84.532  44.120  1.00 59.19  ? 225 LYS C CD  1 
ATOM   8469  C  CE  . LYS C 1 225 ? -30.556 84.557  42.608  1.00 64.15  ? 225 LYS C CE  1 
ATOM   8470  N  NZ  . LYS C 1 225 ? -29.751 83.557  41.833  1.00 62.27  ? 225 LYS C NZ  1 
ATOM   8471  N  N   . GLY C 1 226 ? -31.654 81.049  49.094  1.00 30.58  ? 226 GLY C N   1 
ATOM   8472  C  CA  . GLY C 1 226 ? -31.266 80.586  50.407  1.00 24.39  ? 226 GLY C CA  1 
ATOM   8473  C  C   . GLY C 1 226 ? -32.253 79.521  50.836  1.00 22.76  ? 226 GLY C C   1 
ATOM   8474  O  O   . GLY C 1 226 ? -32.724 78.731  50.012  1.00 22.68  ? 226 GLY C O   1 
ATOM   8475  N  N   . TYR C 1 227 ? -32.608 79.526  52.114  1.00 21.40  ? 227 TYR C N   1 
ATOM   8476  C  CA  . TYR C 1 227 ? -33.552 78.553  52.638  1.00 19.96  ? 227 TYR C CA  1 
ATOM   8477  C  C   . TYR C 1 227 ? -34.228 79.035  53.897  1.00 19.11  ? 227 TYR C C   1 
ATOM   8478  O  O   . TYR C 1 227 ? -33.871 80.064  54.491  1.00 18.10  ? 227 TYR C O   1 
ATOM   8479  C  CB  . TYR C 1 227 ? -32.836 77.246  52.988  1.00 18.18  ? 227 TYR C CB  1 
ATOM   8480  C  CG  . TYR C 1 227 ? -31.820 77.406  54.096  1.00 19.67  ? 227 TYR C CG  1 
ATOM   8481  C  CD1 . TYR C 1 227 ? -32.212 77.409  55.435  1.00 21.49  ? 227 TYR C CD1 1 
ATOM   8482  C  CD2 . TYR C 1 227 ? -30.474 77.595  53.806  1.00 25.82  ? 227 TYR C CD2 1 
ATOM   8483  C  CE1 . TYR C 1 227 ? -31.290 77.602  56.456  1.00 22.01  ? 227 TYR C CE1 1 
ATOM   8484  C  CE2 . TYR C 1 227 ? -29.544 77.786  54.822  1.00 25.12  ? 227 TYR C CE2 1 
ATOM   8485  C  CZ  . TYR C 1 227 ? -29.960 77.791  56.141  1.00 25.83  ? 227 TYR C CZ  1 
ATOM   8486  O  OH  . TYR C 1 227 ? -29.044 77.991  57.140  1.00 27.50  ? 227 TYR C OH  1 
ATOM   8487  N  N   . ASN C 1 228 ? -35.177 78.226  54.322  1.00 18.38  ? 228 ASN C N   1 
ATOM   8488  C  CA  . ASN C 1 228 ? -35.891 78.448  55.548  1.00 20.06  ? 228 ASN C CA  1 
ATOM   8489  C  C   . ASN C 1 228 ? -36.087 77.052  56.081  1.00 20.10  ? 228 ASN C C   1 
ATOM   8490  O  O   . ASN C 1 228 ? -36.496 76.158  55.331  1.00 22.47  ? 228 ASN C O   1 
ATOM   8491  C  CB  . ASN C 1 228 ? -37.241 79.072  55.303  1.00 17.66  ? 228 ASN C CB  1 
ATOM   8492  C  CG  . ASN C 1 228 ? -38.106 79.042  56.538  1.00 22.97  ? 228 ASN C CG  1 
ATOM   8493  O  OD1 . ASN C 1 228 ? -38.862 78.091  56.768  1.00 24.90  ? 228 ASN C OD1 1 
ATOM   8494  N  ND2 . ASN C 1 228 ? -37.968 80.053  57.365  1.00 15.63  ? 228 ASN C ND2 1 
ATOM   8495  N  N   . LYS C 1 229 ? -35.736 76.847  57.343  1.00 18.26  ? 229 LYS C N   1 
ATOM   8496  C  CA  . LYS C 1 229 ? -35.898 75.547  57.965  1.00 16.46  ? 229 LYS C CA  1 
ATOM   8497  C  C   . LYS C 1 229 ? -36.873 75.682  59.099  1.00 18.44  ? 229 LYS C C   1 
ATOM   8498  O  O   . LYS C 1 229 ? -36.807 76.641  59.877  1.00 19.27  ? 229 LYS C O   1 
ATOM   8499  C  CB  . LYS C 1 229 ? -34.568 75.010  58.472  1.00 14.97  ? 229 LYS C CB  1 
ATOM   8500  C  CG  . LYS C 1 229 ? -33.699 74.434  57.382  1.00 15.94  ? 229 LYS C CG  1 
ATOM   8501  C  CD  . LYS C 1 229 ? -32.323 74.112  57.909  1.00 22.14  ? 229 LYS C CD  1 
ATOM   8502  C  CE  . LYS C 1 229 ? -31.393 73.559  56.844  1.00 22.65  ? 229 LYS C CE  1 
ATOM   8503  N  NZ  . LYS C 1 229 ? -31.818 72.219  56.392  1.00 27.98  ? 229 LYS C NZ  1 
ATOM   8504  N  N   . PHE C 1 230 ? -37.836 74.772  59.125  1.00 18.98  ? 230 PHE C N   1 
ATOM   8505  C  CA  . PHE C 1 230 ? -38.839 74.751  60.162  1.00 18.64  ? 230 PHE C CA  1 
ATOM   8506  C  C   . PHE C 1 230 ? -38.652 73.445  60.902  1.00 19.28  ? 230 PHE C C   1 
ATOM   8507  O  O   . PHE C 1 230 ? -38.763 72.367  60.312  1.00 17.96  ? 230 PHE C O   1 
ATOM   8508  C  CB  . PHE C 1 230 ? -40.232 74.818  59.577  1.00 22.13  ? 230 PHE C CB  1 
ATOM   8509  C  CG  . PHE C 1 230 ? -41.304 74.803  60.618  1.00 25.83  ? 230 PHE C CG  1 
ATOM   8510  C  CD1 . PHE C 1 230 ? -41.492 75.904  61.446  1.00 25.15  ? 230 PHE C CD1 1 
ATOM   8511  C  CD2 . PHE C 1 230 ? -42.100 73.671  60.808  1.00 28.51  ? 230 PHE C CD2 1 
ATOM   8512  C  CE1 . PHE C 1 230 ? -42.451 75.881  62.446  1.00 25.41  ? 230 PHE C CE1 1 
ATOM   8513  C  CE2 . PHE C 1 230 ? -43.065 73.638  61.806  1.00 25.78  ? 230 PHE C CE2 1 
ATOM   8514  C  CZ  . PHE C 1 230 ? -43.239 74.745  62.627  1.00 24.69  ? 230 PHE C CZ  1 
ATOM   8515  N  N   . VAL C 1 231 ? -38.369 73.552  62.199  1.00 20.31  ? 231 VAL C N   1 
ATOM   8516  C  CA  . VAL C 1 231 ? -38.099 72.395  63.046  1.00 18.02  ? 231 VAL C CA  1 
ATOM   8517  C  C   . VAL C 1 231 ? -39.064 72.246  64.228  1.00 19.56  ? 231 VAL C C   1 
ATOM   8518  O  O   . VAL C 1 231 ? -39.448 73.231  64.878  1.00 19.33  ? 231 VAL C O   1 
ATOM   8519  C  CB  . VAL C 1 231 ? -36.659 72.477  63.622  1.00 15.18  ? 231 VAL C CB  1 
ATOM   8520  C  CG1 . VAL C 1 231 ? -36.262 71.158  64.251  1.00 14.10  ? 231 VAL C CG1 1 
ATOM   8521  C  CG2 . VAL C 1 231 ? -35.675 72.857  62.536  1.00 11.87  ? 231 VAL C CG2 1 
ATOM   8522  N  N   . VAL C 1 232 ? -39.468 71.004  64.470  1.00 17.88  ? 232 VAL C N   1 
ATOM   8523  C  CA  . VAL C 1 232 ? -40.331 70.641  65.585  1.00 19.56  ? 232 VAL C CA  1 
ATOM   8524  C  C   . VAL C 1 232 ? -39.671 69.421  66.250  1.00 18.88  ? 232 VAL C C   1 
ATOM   8525  O  O   . VAL C 1 232 ? -39.364 68.426  65.583  1.00 19.75  ? 232 VAL C O   1 
ATOM   8526  C  CB  . VAL C 1 232 ? -41.761 70.258  65.132  1.00 23.31  ? 232 VAL C CB  1 
ATOM   8527  C  CG1 . VAL C 1 232 ? -42.563 69.765  66.321  1.00 22.53  ? 232 VAL C CG1 1 
ATOM   8528  C  CG2 . VAL C 1 232 ? -42.463 71.459  64.540  1.00 23.61  ? 232 VAL C CG2 1 
ATOM   8529  N  N   . GLN C 1 233 ? -39.388 69.529  67.545  1.00 17.79  ? 233 GLN C N   1 
ATOM   8530  C  CA  . GLN C 1 233 ? -38.777 68.436  68.284  1.00 15.28  ? 233 GLN C CA  1 
ATOM   8531  C  C   . GLN C 1 233 ? -39.462 68.249  69.623  1.00 18.64  ? 233 GLN C C   1 
ATOM   8532  O  O   . GLN C 1 233 ? -39.886 69.218  70.283  1.00 17.47  ? 233 GLN C O   1 
ATOM   8533  C  CB  . GLN C 1 233 ? -37.296 68.688  68.498  1.00 13.14  ? 233 GLN C CB  1 
ATOM   8534  C  CG  . GLN C 1 233 ? -36.488 68.603  67.237  1.00 14.67  ? 233 GLN C CG  1 
ATOM   8535  C  CD  . GLN C 1 233 ? -35.057 69.005  67.467  1.00 15.29  ? 233 GLN C CD  1 
ATOM   8536  O  OE1 . GLN C 1 233 ? -34.787 70.102  67.964  1.00 16.41  ? 233 GLN C OE1 1 
ATOM   8537  N  NE2 . GLN C 1 233 ? -34.126 68.126  67.113  1.00 10.88  ? 233 GLN C NE2 1 
ATOM   8538  N  N   . TYR C 1 234 ? -39.592 66.984  69.997  1.00 17.48  ? 234 TYR C N   1 
ATOM   8539  C  CA  . TYR C 1 234 ? -40.210 66.606  71.247  1.00 16.91  ? 234 TYR C CA  1 
ATOM   8540  C  C   . TYR C 1 234 ? -39.286 65.594  71.902  1.00 16.51  ? 234 TYR C C   1 
ATOM   8541  O  O   . TYR C 1 234 ? -38.939 64.578  71.300  1.00 16.47  ? 234 TYR C O   1 
ATOM   8542  C  CB  . TYR C 1 234 ? -41.564 65.978  70.978  1.00 20.08  ? 234 TYR C CB  1 
ATOM   8543  C  CG  . TYR C 1 234 ? -42.225 65.460  72.222  1.00 23.83  ? 234 TYR C CG  1 
ATOM   8544  C  CD1 . TYR C 1 234 ? -42.681 66.339  73.205  1.00 25.79  ? 234 TYR C CD1 1 
ATOM   8545  C  CD2 . TYR C 1 234 ? -42.389 64.094  72.426  1.00 24.63  ? 234 TYR C CD2 1 
ATOM   8546  C  CE1 . TYR C 1 234 ? -43.286 65.872  74.358  1.00 24.78  ? 234 TYR C CE1 1 
ATOM   8547  C  CE2 . TYR C 1 234 ? -43.000 63.612  73.585  1.00 28.42  ? 234 TYR C CE2 1 
ATOM   8548  C  CZ  . TYR C 1 234 ? -43.447 64.512  74.543  1.00 27.46  ? 234 TYR C CZ  1 
ATOM   8549  O  OH  . TYR C 1 234 ? -44.087 64.051  75.669  1.00 38.04  ? 234 TYR C OH  1 
ATOM   8550  N  N   . ALA C 1 235 ? -38.850 65.890  73.118  1.00 17.68  ? 235 ALA C N   1 
ATOM   8551  C  CA  . ALA C 1 235 ? -37.941 64.989  73.820  1.00 17.38  ? 235 ALA C CA  1 
ATOM   8552  C  C   . ALA C 1 235 ? -38.600 64.531  75.087  1.00 19.16  ? 235 ALA C C   1 
ATOM   8553  O  O   . ALA C 1 235 ? -39.373 65.270  75.697  1.00 23.44  ? 235 ALA C O   1 
ATOM   8554  C  CB  . ALA C 1 235 ? -36.633 65.691  74.141  1.00 16.27  ? 235 ALA C CB  1 
ATOM   8555  N  N   . THR C 1 236 ? -38.172 63.370  75.551  1.00 23.03  ? 236 THR C N   1 
ATOM   8556  C  CA  . THR C 1 236 ? -38.730 62.753  76.732  1.00 19.75  ? 236 THR C CA  1 
ATOM   8557  C  C   . THR C 1 236 ? -37.672 62.334  77.749  1.00 21.73  ? 236 THR C C   1 
ATOM   8558  O  O   . THR C 1 236 ? -36.622 61.804  77.369  1.00 23.98  ? 236 THR C O   1 
ATOM   8559  C  CB  . THR C 1 236 ? -39.555 61.530  76.262  1.00 18.84  ? 236 THR C CB  1 
ATOM   8560  O  OG1 . THR C 1 236 ? -40.939 61.761  76.519  1.00 29.73  ? 236 THR C OG1 1 
ATOM   8561  C  CG2 . THR C 1 236 ? -39.110 60.244  76.898  1.00 18.13  ? 236 THR C CG2 1 
ATOM   8562  N  N   . ASP C 1 237 ? -37.940 62.607  79.028  1.00 21.97  ? 237 ASP C N   1 
ATOM   8563  C  CA  . ASP C 1 237 ? -37.074 62.198  80.145  1.00 18.60  ? 237 ASP C CA  1 
ATOM   8564  C  C   . ASP C 1 237 ? -35.576 62.361  79.945  1.00 20.04  ? 237 ASP C C   1 
ATOM   8565  O  O   . ASP C 1 237 ? -35.086 63.482  79.807  1.00 22.84  ? 237 ASP C O   1 
ATOM   8566  C  CB  . ASP C 1 237 ? -37.356 60.731  80.530  1.00 14.86  ? 237 ASP C CB  1 
ATOM   8567  C  CG  . ASP C 1 237 ? -38.802 60.488  80.952  1.00 17.50  ? 237 ASP C CG  1 
ATOM   8568  O  OD1 . ASP C 1 237 ? -39.483 61.446  81.380  1.00 23.67  ? 237 ASP C OD1 1 
ATOM   8569  O  OD2 . ASP C 1 237 ? -39.259 59.328  80.860  1.00 22.81  ? 237 ASP C OD2 1 
ATOM   8570  N  N   . ALA C 1 238 ? -34.858 61.239  79.862  1.00 14.34  ? 238 ALA C N   1 
ATOM   8571  C  CA  . ALA C 1 238 ? -33.404 61.273  79.718  1.00 17.14  ? 238 ALA C CA  1 
ATOM   8572  C  C   . ALA C 1 238 ? -32.860 62.145  78.590  1.00 20.17  ? 238 ALA C C   1 
ATOM   8573  O  O   . ALA C 1 238 ? -31.700 62.547  78.631  1.00 22.97  ? 238 ALA C O   1 
ATOM   8574  C  CB  . ALA C 1 238 ? -32.847 59.862  79.598  1.00 7.63   ? 238 ALA C CB  1 
ATOM   8575  N  N   . MET C 1 239 ? -33.685 62.432  77.588  1.00 19.83  ? 239 MET C N   1 
ATOM   8576  C  CA  . MET C 1 239 ? -33.271 63.236  76.442  1.00 17.78  ? 239 MET C CA  1 
ATOM   8577  C  C   . MET C 1 239 ? -33.495 64.738  76.611  1.00 20.36  ? 239 MET C C   1 
ATOM   8578  O  O   . MET C 1 239 ? -33.163 65.517  75.719  1.00 25.64  ? 239 MET C O   1 
ATOM   8579  C  CB  . MET C 1 239 ? -34.007 62.769  75.183  1.00 16.31  ? 239 MET C CB  1 
ATOM   8580  C  CG  . MET C 1 239 ? -33.841 61.307  74.853  1.00 18.98  ? 239 MET C CG  1 
ATOM   8581  S  SD  . MET C 1 239 ? -32.189 60.870  74.352  1.00 24.94  ? 239 MET C SD  1 
ATOM   8582  C  CE  . MET C 1 239 ? -32.361 60.751  72.661  1.00 25.01  ? 239 MET C CE  1 
ATOM   8583  N  N   . THR C 1 240 ? -34.002 65.156  77.762  1.00 19.51  ? 240 THR C N   1 
ATOM   8584  C  CA  . THR C 1 240 ? -34.286 66.563  77.982  1.00 15.68  ? 240 THR C CA  1 
ATOM   8585  C  C   . THR C 1 240 ? -33.121 67.403  78.475  1.00 17.49  ? 240 THR C C   1 
ATOM   8586  O  O   . THR C 1 240 ? -33.081 68.612  78.246  1.00 18.55  ? 240 THR C O   1 
ATOM   8587  C  CB  . THR C 1 240 ? -35.453 66.739  78.962  1.00 16.07  ? 240 THR C CB  1 
ATOM   8588  O  OG1 . THR C 1 240 ? -35.106 66.158  80.226  1.00 18.62  ? 240 THR C OG1 1 
ATOM   8589  C  CG2 . THR C 1 240 ? -36.697 66.056  78.423  1.00 14.56  ? 240 THR C CG2 1 
ATOM   8590  N  N   . THR C 1 241 ? -32.185 66.787  79.179  1.00 18.07  ? 241 THR C N   1 
ATOM   8591  C  CA  . THR C 1 241 ? -31.053 67.538  79.701  1.00 17.81  ? 241 THR C CA  1 
ATOM   8592  C  C   . THR C 1 241 ? -30.148 68.112  78.615  1.00 17.05  ? 241 THR C C   1 
ATOM   8593  O  O   . THR C 1 241 ? -29.949 69.326  78.560  1.00 18.48  ? 241 THR C O   1 
ATOM   8594  C  CB  . THR C 1 241 ? -30.273 66.702  80.705  1.00 17.95  ? 241 THR C CB  1 
ATOM   8595  O  OG1 . THR C 1 241 ? -31.138 66.381  81.800  1.00 22.40  ? 241 THR C OG1 1 
ATOM   8596  C  CG2 . THR C 1 241 ? -29.087 67.470  81.227  1.00 13.89  ? 241 THR C CG2 1 
ATOM   8597  N  N   . GLN C 1 242 ? -29.560 67.252  77.790  1.00 17.90  ? 242 GLN C N   1 
ATOM   8598  C  CA  . GLN C 1 242 ? -28.713 67.720  76.701  1.00 16.22  ? 242 GLN C CA  1 
ATOM   8599  C  C   . GLN C 1 242 ? -29.632 68.347  75.636  1.00 16.64  ? 242 GLN C C   1 
ATOM   8600  O  O   . GLN C 1 242 ? -29.335 69.418  75.118  1.00 18.49  ? 242 GLN C O   1 
ATOM   8601  C  CB  . GLN C 1 242 ? -27.880 66.591  76.127  1.00 13.71  ? 242 GLN C CB  1 
ATOM   8602  C  CG  . GLN C 1 242 ? -26.777 67.101  75.236  1.00 16.67  ? 242 GLN C CG  1 
ATOM   8603  C  CD  . GLN C 1 242 ? -26.911 66.642  73.810  1.00 17.66  ? 242 GLN C CD  1 
ATOM   8604  O  OE1 . GLN C 1 242 ? -27.971 66.188  73.381  1.00 21.53  ? 242 GLN C OE1 1 
ATOM   8605  N  NE2 . GLN C 1 242 ? -25.824 66.739  73.067  1.00 16.47  ? 242 GLN C NE2 1 
ATOM   8606  N  N   . GLY C 1 243 ? -30.755 67.691  75.338  1.00 15.19  ? 243 GLY C N   1 
ATOM   8607  C  CA  . GLY C 1 243 ? -31.726 68.238  74.404  1.00 14.63  ? 243 GLY C CA  1 
ATOM   8608  C  C   . GLY C 1 243 ? -31.359 68.359  72.940  1.00 17.44  ? 243 GLY C C   1 
ATOM   8609  O  O   . GLY C 1 243 ? -31.947 69.170  72.218  1.00 17.33  ? 243 GLY C O   1 
ATOM   8610  N  N   . LYS C 1 244 ? -30.433 67.524  72.483  1.00 15.65  ? 244 LYS C N   1 
ATOM   8611  C  CA  . LYS C 1 244 ? -29.992 67.541  71.098  1.00 14.18  ? 244 LYS C CA  1 
ATOM   8612  C  C   . LYS C 1 244 ? -29.902 66.116  70.555  1.00 16.67  ? 244 LYS C C   1 
ATOM   8613  O  O   . LYS C 1 244 ? -29.452 65.907  69.435  1.00 16.61  ? 244 LYS C O   1 
ATOM   8614  C  CB  . LYS C 1 244 ? -28.621 68.220  70.978  1.00 14.14  ? 244 LYS C CB  1 
ATOM   8615  C  CG  . LYS C 1 244 ? -28.528 69.590  71.633  1.00 13.99  ? 244 LYS C CG  1 
ATOM   8616  C  CD  . LYS C 1 244 ? -27.120 70.143  71.541  1.00 12.11  ? 244 LYS C CD  1 
ATOM   8617  C  CE  . LYS C 1 244 ? -26.914 71.315  72.488  1.00 12.61  ? 244 LYS C CE  1 
ATOM   8618  N  NZ  . LYS C 1 244 ? -27.816 72.469  72.272  1.00 13.54  ? 244 LYS C NZ  1 
ATOM   8619  N  N   . GLY C 1 245 ? -30.296 65.132  71.357  1.00 15.84  ? 245 GLY C N   1 
ATOM   8620  C  CA  . GLY C 1 245 ? -30.258 63.759  70.893  1.00 13.87  ? 245 GLY C CA  1 
ATOM   8621  C  C   . GLY C 1 245 ? -29.394 62.822  71.718  1.00 18.75  ? 245 GLY C C   1 
ATOM   8622  O  O   . GLY C 1 245 ? -29.396 61.618  71.481  1.00 17.68  ? 245 GLY C O   1 
ATOM   8623  N  N   . GLN C 1 246 ? -28.583 63.368  72.618  1.00 18.16  ? 246 GLN C N   1 
ATOM   8624  C  CA  . GLN C 1 246 ? -27.746 62.536  73.472  1.00 19.96  ? 246 GLN C CA  1 
ATOM   8625  C  C   . GLN C 1 246 ? -28.511 62.291  74.770  1.00 20.72  ? 246 GLN C C   1 
ATOM   8626  O  O   . GLN C 1 246 ? -29.215 63.178  75.252  1.00 21.46  ? 246 GLN C O   1 
ATOM   8627  C  CB  . GLN C 1 246 ? -26.416 63.232  73.764  1.00 18.56  ? 246 GLN C CB  1 
ATOM   8628  C  CG  . GLN C 1 246 ? -25.469 63.221  72.587  1.00 24.54  ? 246 GLN C CG  1 
ATOM   8629  C  CD  . GLN C 1 246 ? -24.186 63.962  72.864  1.00 25.47  ? 246 GLN C CD  1 
ATOM   8630  O  OE1 . GLN C 1 246 ? -23.722 64.009  73.991  1.00 31.36  ? 246 GLN C OE1 1 
ATOM   8631  N  NE2 . GLN C 1 246 ? -23.614 64.561  71.837  1.00 28.16  ? 246 GLN C NE2 1 
ATOM   8632  N  N   . ALA C 1 247 ? -28.360 61.104  75.342  1.00 20.77  ? 247 ALA C N   1 
ATOM   8633  C  CA  . ALA C 1 247 ? -29.048 60.748  76.577  1.00 17.99  ? 247 ALA C CA  1 
ATOM   8634  C  C   . ALA C 1 247 ? -28.257 61.028  77.848  1.00 20.22  ? 247 ALA C C   1 
ATOM   8635  O  O   . ALA C 1 247 ? -27.043 60.791  77.902  1.00 20.52  ? 247 ALA C O   1 
ATOM   8636  C  CB  . ALA C 1 247 ? -29.444 59.281  76.541  1.00 19.54  ? 247 ALA C CB  1 
ATOM   8637  N  N   . ARG C 1 248 ? -28.964 61.529  78.863  1.00 21.72  ? 248 ARG C N   1 
ATOM   8638  C  CA  . ARG C 1 248 ? -28.403 61.810  80.188  1.00 22.18  ? 248 ARG C CA  1 
ATOM   8639  C  C   . ARG C 1 248 ? -29.306 61.029  81.160  1.00 22.35  ? 248 ARG C C   1 
ATOM   8640  O  O   . ARG C 1 248 ? -30.095 61.615  81.900  1.00 23.20  ? 248 ARG C O   1 
ATOM   8641  C  CB  . ARG C 1 248 ? -28.490 63.298  80.505  1.00 22.37  ? 248 ARG C CB  1 
ATOM   8642  C  CG  . ARG C 1 248 ? -27.838 64.236  79.499  1.00 27.42  ? 248 ARG C CG  1 
ATOM   8643  C  CD  . ARG C 1 248 ? -26.328 64.350  79.655  1.00 25.41  ? 248 ARG C CD  1 
ATOM   8644  N  NE  . ARG C 1 248 ? -25.652 63.499  78.691  1.00 36.38  ? 248 ARG C NE  1 
ATOM   8645  C  CZ  . ARG C 1 248 ? -24.903 63.947  77.690  1.00 33.64  ? 248 ARG C CZ  1 
ATOM   8646  N  NH1 . ARG C 1 248 ? -24.713 65.247  77.515  1.00 31.23  ? 248 ARG C NH1 1 
ATOM   8647  N  NH2 . ARG C 1 248 ? -24.379 63.086  76.837  1.00 36.21  ? 248 ARG C NH2 1 
ATOM   8648  N  N   . GLY C 1 249 ? -29.206 59.706  81.132  1.00 19.78  ? 249 GLY C N   1 
ATOM   8649  C  CA  . GLY C 1 249 ? -30.052 58.869  81.965  1.00 19.63  ? 249 GLY C CA  1 
ATOM   8650  C  C   . GLY C 1 249 ? -29.816 58.816  83.467  1.00 23.32  ? 249 GLY C C   1 
ATOM   8651  O  O   . GLY C 1 249 ? -30.667 58.299  84.195  1.00 23.18  ? 249 GLY C O   1 
ATOM   8652  N  N   . SER C 1 250 ? -28.661 59.275  83.939  1.00 21.91  ? 250 SER C N   1 
ATOM   8653  C  CA  . SER C 1 250 ? -28.370 59.257  85.371  1.00 21.99  ? 250 SER C CA  1 
ATOM   8654  C  C   . SER C 1 250 ? -28.209 60.683  85.862  1.00 24.10  ? 250 SER C C   1 
ATOM   8655  O  O   . SER C 1 250 ? -27.689 60.927  86.952  1.00 24.85  ? 250 SER C O   1 
ATOM   8656  C  CB  . SER C 1 250 ? -27.095 58.458  85.660  1.00 22.42  ? 250 SER C CB  1 
ATOM   8657  O  OG  . SER C 1 250 ? -25.930 59.184  85.301  1.00 23.81  ? 250 SER C OG  1 
ATOM   8658  N  N   . ASP C 1 251 ? -28.643 61.625  85.029  1.00 25.52  ? 251 ASP C N   1 
ATOM   8659  C  CA  . ASP C 1 251 ? -28.549 63.043  85.347  1.00 25.52  ? 251 ASP C CA  1 
ATOM   8660  C  C   . ASP C 1 251 ? -29.239 63.324  86.684  1.00 27.47  ? 251 ASP C C   1 
ATOM   8661  O  O   . ASP C 1 251 ? -30.360 62.860  86.932  1.00 28.33  ? 251 ASP C O   1 
ATOM   8662  C  CB  . ASP C 1 251 ? -29.186 63.874  84.215  1.00 26.54  ? 251 ASP C CB  1 
ATOM   8663  C  CG  . ASP C 1 251 ? -29.073 65.385  84.437  1.00 28.55  ? 251 ASP C CG  1 
ATOM   8664  O  OD1 . ASP C 1 251 ? -27.940 65.907  84.562  1.00 28.42  ? 251 ASP C OD1 1 
ATOM   8665  O  OD2 . ASP C 1 251 ? -30.126 66.061  84.463  1.00 36.88  ? 251 ASP C OD2 1 
ATOM   8666  N  N   . GLY C 1 252 ? -28.544 64.055  87.551  1.00 27.88  ? 252 GLY C N   1 
ATOM   8667  C  CA  . GLY C 1 252 ? -29.095 64.413  88.849  1.00 31.20  ? 252 GLY C CA  1 
ATOM   8668  C  C   . GLY C 1 252 ? -28.567 63.592  90.016  1.00 31.84  ? 252 GLY C C   1 
ATOM   8669  O  O   . GLY C 1 252 ? -28.951 63.833  91.167  1.00 31.52  ? 252 GLY C O   1 
ATOM   8670  N  N   . SER C 1 253 ? -27.716 62.610  89.723  1.00 31.14  ? 253 SER C N   1 
ATOM   8671  C  CA  . SER C 1 253 ? -27.140 61.753  90.751  1.00 31.94  ? 253 SER C CA  1 
ATOM   8672  C  C   . SER C 1 253 ? -26.094 62.483  91.586  1.00 37.88  ? 253 SER C C   1 
ATOM   8673  O  O   . SER C 1 253 ? -25.449 63.427  91.111  1.00 40.80  ? 253 SER C O   1 
ATOM   8674  C  CB  . SER C 1 253 ? -26.509 60.532  90.105  1.00 25.64  ? 253 SER C CB  1 
ATOM   8675  O  OG  . SER C 1 253 ? -27.474 59.823  89.361  1.00 21.22  ? 253 SER C OG  1 
ATOM   8676  N  N   . SER C 1 254 ? -25.950 62.062  92.839  1.00 44.76  ? 254 SER C N   1 
ATOM   8677  C  CA  . SER C 1 254 ? -24.969 62.647  93.753  1.00 48.56  ? 254 SER C CA  1 
ATOM   8678  C  C   . SER C 1 254 ? -24.796 61.706  94.933  1.00 52.67  ? 254 SER C C   1 
ATOM   8679  O  O   . SER C 1 254 ? -25.645 60.849  95.184  1.00 51.88  ? 254 SER C O   1 
ATOM   8680  C  CB  . SER C 1 254 ? -25.419 64.018  94.259  1.00 45.65  ? 254 SER C CB  1 
ATOM   8681  O  OG  . SER C 1 254 ? -26.515 63.893  95.145  1.00 43.84  ? 254 SER C OG  1 
ATOM   8682  N  N   . SER C 1 255 ? -23.697 61.866  95.655  1.00 60.28  ? 255 SER C N   1 
ATOM   8683  C  CA  . SER C 1 255 ? -23.427 61.023  96.802  1.00 68.90  ? 255 SER C CA  1 
ATOM   8684  C  C   . SER C 1 255 ? -22.602 61.782  97.817  1.00 75.13  ? 255 SER C C   1 
ATOM   8685  O  O   . SER C 1 255 ? -22.053 62.847  97.517  1.00 76.57  ? 255 SER C O   1 
ATOM   8686  C  CB  . SER C 1 255 ? -22.675 59.761  96.365  1.00 66.91  ? 255 SER C CB  1 
ATOM   8687  O  OG  . SER C 1 255 ? -21.464 60.079  95.699  1.00 66.01  ? 255 SER C OG  1 
ATOM   8688  N  N   . PHE C 1 256 ? -22.560 61.253  99.032  1.00 82.15  ? 256 PHE C N   1 
ATOM   8689  C  CA  . PHE C 1 256 ? -21.765 61.847  100.094 1.00 87.17  ? 256 PHE C CA  1 
ATOM   8690  C  C   . PHE C 1 256 ? -21.199 60.718  100.941 1.00 89.26  ? 256 PHE C C   1 
ATOM   8691  O  O   . PHE C 1 256 ? -21.853 59.687  101.152 1.00 85.74  ? 256 PHE C O   1 
ATOM   8692  C  CB  . PHE C 1 256 ? -22.575 62.846  100.930 1.00 89.68  ? 256 PHE C CB  1 
ATOM   8693  C  CG  . PHE C 1 256 ? -23.551 62.213  101.872 1.00 92.80  ? 256 PHE C CG  1 
ATOM   8694  C  CD1 . PHE C 1 256 ? -24.763 61.718  101.410 1.00 94.68  ? 256 PHE C CD1 1 
ATOM   8695  C  CD2 . PHE C 1 256 ? -23.271 62.146  103.234 1.00 94.98  ? 256 PHE C CD2 1 
ATOM   8696  C  CE1 . PHE C 1 256 ? -25.688 61.165  102.293 1.00 97.31  ? 256 PHE C CE1 1 
ATOM   8697  C  CE2 . PHE C 1 256 ? -24.186 61.596  104.125 1.00 97.15  ? 256 PHE C CE2 1 
ATOM   8698  C  CZ  . PHE C 1 256 ? -25.399 61.104  103.653 1.00 97.53  ? 256 PHE C CZ  1 
ATOM   8699  N  N   . THR C 1 257 ? -19.956 60.898  101.365 1.00 94.06  ? 257 THR C N   1 
ATOM   8700  C  CA  . THR C 1 257 ? -19.267 59.905  102.161 1.00 99.63  ? 257 THR C CA  1 
ATOM   8701  C  C   . THR C 1 257 ? -18.940 60.451  103.539 1.00 103.94 ? 257 THR C C   1 
ATOM   8702  O  O   . THR C 1 257 ? -18.594 61.629  103.685 1.00 104.77 ? 257 THR C O   1 
ATOM   8703  C  CB  . THR C 1 257 ? -17.972 59.485  101.470 1.00 99.15  ? 257 THR C CB  1 
ATOM   8704  O  OG1 . THR C 1 257 ? -18.267 59.105  100.121 1.00 99.89  ? 257 THR C OG1 1 
ATOM   8705  C  CG2 . THR C 1 257 ? -17.330 58.324  102.200 1.00 101.03 ? 257 THR C CG2 1 
ATOM   8706  N  N   . GLU C 1 258 ? -19.085 59.592  104.542 1.00 108.89 ? 258 GLU C N   1 
ATOM   8707  C  CA  . GLU C 1 258 ? -18.796 59.945  105.925 1.00 113.79 ? 258 GLU C CA  1 
ATOM   8708  C  C   . GLU C 1 258 ? -18.150 58.756  106.641 1.00 115.24 ? 258 GLU C C   1 
ATOM   8709  O  O   . GLU C 1 258 ? -16.979 58.883  107.062 1.00 118.04 ? 258 GLU C O   1 
ATOM   8710  C  CB  . GLU C 1 258 ? -20.073 60.387  106.652 1.00 115.61 ? 258 GLU C CB  1 
ATOM   8711  C  CG  . GLU C 1 258 ? -21.246 59.421  106.527 1.00 119.53 ? 258 GLU C CG  1 
ATOM   8712  C  CD  . GLU C 1 258 ? -22.347 59.707  107.528 1.00 122.56 ? 258 GLU C CD  1 
ATOM   8713  O  OE1 . GLU C 1 258 ? -22.865 60.847  107.547 1.00 124.79 ? 258 GLU C OE1 1 
ATOM   8714  O  OE2 . GLU C 1 258 ? -22.690 58.786  108.301 1.00 123.96 ? 258 GLU C OE2 1 
ATOM   8715  N  N   . LYS C 1 265 ? -16.023 56.225  106.702 1.00 98.01  ? 265 LYS C N   1 
ATOM   8716  C  CA  . LYS C 1 265 ? -16.304 56.289  105.242 1.00 94.23  ? 265 LYS C CA  1 
ATOM   8717  C  C   . LYS C 1 265 ? -17.368 55.303  104.787 1.00 89.81  ? 265 LYS C C   1 
ATOM   8718  O  O   . LYS C 1 265 ? -17.092 54.124  104.540 1.00 88.96  ? 265 LYS C O   1 
ATOM   8719  C  CB  . LYS C 1 265 ? -15.023 56.140  104.414 1.00 99.18  ? 265 LYS C CB  1 
ATOM   8720  C  CG  . LYS C 1 265 ? -14.127 57.374  104.473 1.00 106.66 ? 265 LYS C CG  1 
ATOM   8721  C  CD  . LYS C 1 265 ? -13.075 57.371  103.370 1.00 112.72 ? 265 LYS C CD  1 
ATOM   8722  C  CE  . LYS C 1 265 ? -12.159 58.597  103.457 1.00 115.95 ? 265 LYS C CE  1 
ATOM   8723  N  NZ  . LYS C 1 265 ? -12.894 59.892  103.342 1.00 117.04 ? 265 LYS C NZ  1 
ATOM   8724  N  N   . ILE C 1 266 ? -18.602 55.796  104.777 1.00 83.95  ? 266 ILE C N   1 
ATOM   8725  C  CA  . ILE C 1 266 ? -19.769 55.052  104.335 1.00 77.85  ? 266 ILE C CA  1 
ATOM   8726  C  C   . ILE C 1 266 ? -20.267 55.942  103.214 1.00 74.21  ? 266 ILE C C   1 
ATOM   8727  O  O   . ILE C 1 266 ? -20.471 57.147  103.409 1.00 73.85  ? 266 ILE C O   1 
ATOM   8728  C  CB  . ILE C 1 266 ? -20.842 54.964  105.417 1.00 77.79  ? 266 ILE C CB  1 
ATOM   8729  C  CG1 . ILE C 1 266 ? -20.299 54.205  106.622 1.00 80.95  ? 266 ILE C CG1 1 
ATOM   8730  C  CG2 . ILE C 1 266 ? -22.059 54.246  104.876 1.00 76.05  ? 266 ILE C CG2 1 
ATOM   8731  C  CD1 . ILE C 1 266 ? -21.222 54.218  107.809 1.00 86.65  ? 266 ILE C CD1 1 
ATOM   8732  N  N   . ASN C 1 267 ? -20.395 55.364  102.030 1.00 67.66  ? 267 ASN C N   1 
ATOM   8733  C  CA  . ASN C 1 267 ? -20.815 56.113  100.863 1.00 59.72  ? 267 ASN C CA  1 
ATOM   8734  C  C   . ASN C 1 267 ? -22.308 56.023  100.649 1.00 54.83  ? 267 ASN C C   1 
ATOM   8735  O  O   . ASN C 1 267 ? -22.878 54.926  100.572 1.00 51.48  ? 267 ASN C O   1 
ATOM   8736  C  CB  . ASN C 1 267 ? -20.076 55.591  99.641  1.00 61.85  ? 267 ASN C CB  1 
ATOM   8737  C  CG  . ASN C 1 267 ? -18.582 55.510  99.861  1.00 61.37  ? 267 ASN C CG  1 
ATOM   8738  O  OD1 . ASN C 1 267 ? -17.893 56.528  99.909  1.00 60.37  ? 267 ASN C OD1 1 
ATOM   8739  N  ND2 . ASN C 1 267 ? -18.074 54.296  100.024 1.00 62.62  ? 267 ASN C ND2 1 
ATOM   8740  N  N   . TYR C 1 268 ? -22.938 57.184  100.549 1.00 51.66  ? 268 TYR C N   1 
ATOM   8741  C  CA  . TYR C 1 268 ? -24.377 57.243  100.344 1.00 53.27  ? 268 TYR C CA  1 
ATOM   8742  C  C   . TYR C 1 268 ? -24.722 57.873  99.015  1.00 50.41  ? 268 TYR C C   1 
ATOM   8743  O  O   . TYR C 1 268 ? -24.294 58.993  98.710  1.00 49.59  ? 268 TYR C O   1 
ATOM   8744  C  CB  . TYR C 1 268 ? -25.052 58.059  101.442 1.00 60.31  ? 268 TYR C CB  1 
ATOM   8745  C  CG  . TYR C 1 268 ? -24.903 57.496  102.827 1.00 69.79  ? 268 TYR C CG  1 
ATOM   8746  C  CD1 . TYR C 1 268 ? -25.762 56.499  103.289 1.00 73.44  ? 268 TYR C CD1 1 
ATOM   8747  C  CD2 . TYR C 1 268 ? -23.908 57.971  103.686 1.00 73.83  ? 268 TYR C CD2 1 
ATOM   8748  C  CE1 . TYR C 1 268 ? -25.639 55.988  104.574 1.00 78.33  ? 268 TYR C CE1 1 
ATOM   8749  C  CE2 . TYR C 1 268 ? -23.773 57.468  104.973 1.00 78.29  ? 268 TYR C CE2 1 
ATOM   8750  C  CZ  . TYR C 1 268 ? -24.642 56.477  105.412 1.00 80.68  ? 268 TYR C CZ  1 
ATOM   8751  O  OH  . TYR C 1 268 ? -24.521 55.984  106.692 1.00 86.84  ? 268 TYR C OH  1 
ATOM   8752  N  N   . ALA C 1 269 ? -25.506 57.151  98.230  1.00 46.83  ? 269 ALA C N   1 
ATOM   8753  C  CA  . ALA C 1 269 ? -25.954 57.648  96.940  1.00 42.54  ? 269 ALA C CA  1 
ATOM   8754  C  C   . ALA C 1 269 ? -27.289 58.356  97.167  1.00 42.00  ? 269 ALA C C   1 
ATOM   8755  O  O   . ALA C 1 269 ? -28.292 57.715  97.499  1.00 41.63  ? 269 ALA C O   1 
ATOM   8756  C  CB  . ALA C 1 269 ? -26.133 56.495  95.967  1.00 42.21  ? 269 ALA C CB  1 
ATOM   8757  N  N   . ASN C 1 270 ? -27.292 59.678  97.051  1.00 41.33  ? 270 ASN C N   1 
ATOM   8758  C  CA  . ASN C 1 270 ? -28.516 60.445  97.228  1.00 42.12  ? 270 ASN C CA  1 
ATOM   8759  C  C   . ASN C 1 270 ? -29.573 60.074  96.201  1.00 43.30  ? 270 ASN C C   1 
ATOM   8760  O  O   . ASN C 1 270 ? -29.286 59.414  95.204  1.00 44.31  ? 270 ASN C O   1 
ATOM   8761  C  CB  . ASN C 1 270 ? -28.226 61.933  97.115  1.00 46.22  ? 270 ASN C CB  1 
ATOM   8762  C  CG  . ASN C 1 270 ? -27.571 62.478  98.342  1.00 51.62  ? 270 ASN C CG  1 
ATOM   8763  O  OD1 . ASN C 1 270 ? -27.866 62.036  99.455  1.00 58.48  ? 270 ASN C OD1 1 
ATOM   8764  N  ND2 . ASN C 1 270 ? -26.671 63.440  98.163  1.00 54.06  ? 270 ASN C ND2 1 
ATOM   8765  N  N   . LYS C 1 271 ? -30.810 60.480  96.456  1.00 42.93  ? 271 LYS C N   1 
ATOM   8766  C  CA  . LYS C 1 271 ? -31.886 60.190  95.526  1.00 39.85  ? 271 LYS C CA  1 
ATOM   8767  C  C   . LYS C 1 271 ? -31.645 61.120  94.331  1.00 39.14  ? 271 LYS C C   1 
ATOM   8768  O  O   . LYS C 1 271 ? -31.302 62.301  94.507  1.00 39.10  ? 271 LYS C O   1 
ATOM   8769  C  CB  . LYS C 1 271 ? -33.246 60.427  96.194  1.00 36.15  ? 271 LYS C CB  1 
ATOM   8770  C  CG  . LYS C 1 271 ? -34.371 59.647  95.542  1.00 34.74  ? 271 LYS C CG  1 
ATOM   8771  C  CD  . LYS C 1 271 ? -35.574 59.470  96.442  1.00 32.00  ? 271 LYS C CD  1 
ATOM   8772  C  CE  . LYS C 1 271 ? -36.182 60.794  96.848  1.00 35.35  ? 271 LYS C CE  1 
ATOM   8773  N  NZ  . LYS C 1 271 ? -37.515 60.589  97.481  1.00 32.92  ? 271 LYS C NZ  1 
ATOM   8774  N  N   . VAL C 1 272 ? -31.740 60.562  93.127  1.00 36.88  ? 272 VAL C N   1 
ATOM   8775  C  CA  . VAL C 1 272 ? -31.499 61.310  91.897  1.00 33.32  ? 272 VAL C CA  1 
ATOM   8776  C  C   . VAL C 1 272 ? -32.545 62.398  91.675  1.00 33.27  ? 272 VAL C C   1 
ATOM   8777  O  O   . VAL C 1 272 ? -33.740 62.127  91.711  1.00 36.16  ? 272 VAL C O   1 
ATOM   8778  C  CB  . VAL C 1 272 ? -31.505 60.362  90.654  1.00 28.03  ? 272 VAL C CB  1 
ATOM   8779  C  CG1 . VAL C 1 272 ? -31.217 61.141  89.392  1.00 28.57  ? 272 VAL C CG1 1 
ATOM   8780  C  CG2 . VAL C 1 272 ? -30.496 59.247  90.814  1.00 28.47  ? 272 VAL C CG2 1 
ATOM   8781  N  N   . ILE C 1 273 ? -32.105 63.640  91.510  1.00 34.19  ? 273 ILE C N   1 
ATOM   8782  C  CA  . ILE C 1 273 ? -33.026 64.736  91.215  1.00 35.44  ? 273 ILE C CA  1 
ATOM   8783  C  C   . ILE C 1 273 ? -33.059 64.719  89.672  1.00 34.75  ? 273 ILE C C   1 
ATOM   8784  O  O   . ILE C 1 273 ? -32.351 65.457  88.976  1.00 35.84  ? 273 ILE C O   1 
ATOM   8785  C  CB  . ILE C 1 273 ? -32.548 66.075  91.845  1.00 37.51  ? 273 ILE C CB  1 
ATOM   8786  C  CG1 . ILE C 1 273 ? -33.197 67.266  91.147  1.00 41.82  ? 273 ILE C CG1 1 
ATOM   8787  C  CG2 . ILE C 1 273 ? -31.027 66.160  91.879  1.00 44.33  ? 273 ILE C CG2 1 
ATOM   8788  C  CD1 . ILE C 1 273 ? -32.689 68.598  91.636  1.00 47.94  ? 273 ILE C CD1 1 
ATOM   8789  N  N   . ASN C 1 274 ? -33.835 63.766  89.171  1.00 32.01  ? 274 ASN C N   1 
ATOM   8790  C  CA  . ASN C 1 274 ? -33.971 63.471  87.755  1.00 28.69  ? 274 ASN C CA  1 
ATOM   8791  C  C   . ASN C 1 274 ? -34.493 64.495  86.752  1.00 29.30  ? 274 ASN C C   1 
ATOM   8792  O  O   . ASN C 1 274 ? -35.017 65.557  87.105  1.00 27.75  ? 274 ASN C O   1 
ATOM   8793  C  CB  . ASN C 1 274 ? -34.756 62.176  87.597  1.00 27.73  ? 274 ASN C CB  1 
ATOM   8794  C  CG  . ASN C 1 274 ? -36.215 62.334  87.951  1.00 28.48  ? 274 ASN C CG  1 
ATOM   8795  O  OD1 . ASN C 1 274 ? -36.885 63.256  87.481  1.00 29.36  ? 274 ASN C OD1 1 
ATOM   8796  N  ND2 . ASN C 1 274 ? -36.722 61.430  88.768  1.00 31.16  ? 274 ASN C ND2 1 
ATOM   8797  N  N   . ASN C 1 275 ? -34.386 64.112  85.479  1.00 27.74  ? 275 ASN C N   1 
ATOM   8798  C  CA  . ASN C 1 275 ? -34.826 64.935  84.364  1.00 24.38  ? 275 ASN C CA  1 
ATOM   8799  C  C   . ASN C 1 275 ? -36.119 64.411  83.739  1.00 24.73  ? 275 ASN C C   1 
ATOM   8800  O  O   . ASN C 1 275 ? -36.370 64.606  82.555  1.00 26.93  ? 275 ASN C O   1 
ATOM   8801  C  CB  . ASN C 1 275 ? -33.709 65.068  83.323  1.00 19.97  ? 275 ASN C CB  1 
ATOM   8802  C  CG  . ASN C 1 275 ? -33.101 63.737  82.941  1.00 21.77  ? 275 ASN C CG  1 
ATOM   8803  O  OD1 . ASN C 1 275 ? -33.690 62.681  83.175  1.00 21.71  ? 275 ASN C OD1 1 
ATOM   8804  N  ND2 . ASN C 1 275 ? -31.901 63.774  82.375  1.00 19.11  ? 275 ASN C ND2 1 
ATOM   8805  N  N   . ASN C 1 276 ? -36.946 63.748  84.543  1.00 25.22  ? 276 ASN C N   1 
ATOM   8806  C  CA  . ASN C 1 276 ? -38.223 63.235  84.058  1.00 23.02  ? 276 ASN C CA  1 
ATOM   8807  C  C   . ASN C 1 276 ? -39.059 64.442  83.678  1.00 20.90  ? 276 ASN C C   1 
ATOM   8808  O  O   . ASN C 1 276 ? -39.129 65.431  84.418  1.00 17.40  ? 276 ASN C O   1 
ATOM   8809  C  CB  . ASN C 1 276 ? -38.966 62.427  85.130  1.00 25.40  ? 276 ASN C CB  1 
ATOM   8810  C  CG  . ASN C 1 276 ? -38.579 60.947  85.150  1.00 27.21  ? 276 ASN C CG  1 
ATOM   8811  O  OD1 . ASN C 1 276 ? -38.002 60.421  84.205  1.00 25.55  ? 276 ASN C OD1 1 
ATOM   8812  N  ND2 . ASN C 1 276 ? -38.928 60.269  86.234  1.00 27.31  ? 276 ASN C ND2 1 
ATOM   8813  N  N   . GLY C 1 277 ? -39.683 64.353  82.512  1.00 21.22  ? 277 GLY C N   1 
ATOM   8814  C  CA  . GLY C 1 277 ? -40.512 65.429  82.008  1.00 18.95  ? 277 GLY C CA  1 
ATOM   8815  C  C   . GLY C 1 277 ? -40.445 65.367  80.497  1.00 22.14  ? 277 GLY C C   1 
ATOM   8816  O  O   . GLY C 1 277 ? -40.128 64.310  79.929  1.00 19.61  ? 277 GLY C O   1 
ATOM   8817  N  N   . ASN C 1 278 ? -40.679 66.493  79.838  1.00 20.51  ? 278 ASN C N   1 
ATOM   8818  C  CA  . ASN C 1 278 ? -40.628 66.520  78.388  1.00 23.92  ? 278 ASN C CA  1 
ATOM   8819  C  C   . ASN C 1 278 ? -40.143 67.862  77.869  1.00 22.88  ? 278 ASN C C   1 
ATOM   8820  O  O   . ASN C 1 278 ? -40.182 68.870  78.591  1.00 21.65  ? 278 ASN C O   1 
ATOM   8821  C  CB  . ASN C 1 278 ? -42.009 66.236  77.820  1.00 26.27  ? 278 ASN C CB  1 
ATOM   8822  C  CG  . ASN C 1 278 ? -43.030 67.246  78.269  1.00 32.24  ? 278 ASN C CG  1 
ATOM   8823  O  OD1 . ASN C 1 278 ? -43.823 66.969  79.155  1.00 41.74  ? 278 ASN C OD1 1 
ATOM   8824  N  ND2 . ASN C 1 278 ? -43.014 68.425  77.668  1.00 33.35  ? 278 ASN C ND2 1 
ATOM   8825  N  N   . MET C 1 279 ? -39.702 67.875  76.612  1.00 20.88  ? 279 MET C N   1 
ATOM   8826  C  CA  . MET C 1 279 ? -39.245 69.105  75.986  1.00 19.33  ? 279 MET C CA  1 
ATOM   8827  C  C   . MET C 1 279 ? -39.896 69.290  74.627  1.00 18.58  ? 279 MET C C   1 
ATOM   8828  O  O   . MET C 1 279 ? -40.076 68.331  73.863  1.00 20.12  ? 279 MET C O   1 
ATOM   8829  C  CB  . MET C 1 279 ? -37.733 69.123  75.819  1.00 19.98  ? 279 MET C CB  1 
ATOM   8830  C  CG  . MET C 1 279 ? -37.228 70.398  75.162  1.00 22.35  ? 279 MET C CG  1 
ATOM   8831  S  SD  . MET C 1 279 ? -35.512 70.296  74.664  1.00 27.90  ? 279 MET C SD  1 
ATOM   8832  C  CE  . MET C 1 279 ? -35.624 69.151  73.288  1.00 16.25  ? 279 MET C CE  1 
ATOM   8833  N  N   . TRP C 1 280 ? -40.274 70.530  74.357  1.00 18.30  ? 280 TRP C N   1 
ATOM   8834  C  CA  . TRP C 1 280 ? -40.876 70.916  73.099  1.00 17.46  ? 280 TRP C CA  1 
ATOM   8835  C  C   . TRP C 1 280 ? -40.020 72.026  72.549  1.00 18.88  ? 280 TRP C C   1 
ATOM   8836  O  O   . TRP C 1 280 ? -39.756 73.010  73.241  1.00 18.28  ? 280 TRP C O   1 
ATOM   8837  C  CB  . TRP C 1 280 ? -42.268 71.491  73.314  1.00 23.96  ? 280 TRP C CB  1 
ATOM   8838  C  CG  . TRP C 1 280 ? -43.325 70.486  73.257  1.00 33.80  ? 280 TRP C CG  1 
ATOM   8839  C  CD1 . TRP C 1 280 ? -44.049 69.995  74.303  1.00 36.25  ? 280 TRP C CD1 1 
ATOM   8840  C  CD2 . TRP C 1 280 ? -43.799 69.816  72.086  1.00 37.28  ? 280 TRP C CD2 1 
ATOM   8841  N  NE1 . TRP C 1 280 ? -44.946 69.055  73.855  1.00 37.96  ? 280 TRP C NE1 1 
ATOM   8842  C  CE2 . TRP C 1 280 ? -44.814 68.926  72.498  1.00 37.74  ? 280 TRP C CE2 1 
ATOM   8843  C  CE3 . TRP C 1 280 ? -43.464 69.880  70.725  1.00 37.63  ? 280 TRP C CE3 1 
ATOM   8844  C  CZ2 . TRP C 1 280 ? -45.499 68.104  71.597  1.00 38.61  ? 280 TRP C CZ2 1 
ATOM   8845  C  CZ3 . TRP C 1 280 ? -44.149 69.060  69.828  1.00 37.11  ? 280 TRP C CZ3 1 
ATOM   8846  C  CH2 . TRP C 1 280 ? -45.152 68.187  70.270  1.00 38.59  ? 280 TRP C CH2 1 
ATOM   8847  N  N   . ARG C 1 281 ? -39.595 71.875  71.306  1.00 19.91  ? 281 ARG C N   1 
ATOM   8848  C  CA  . ARG C 1 281 ? -38.801 72.900  70.643  1.00 18.40  ? 281 ARG C CA  1 
ATOM   8849  C  C   . ARG C 1 281 ? -39.419 73.149  69.270  1.00 19.95  ? 281 ARG C C   1 
ATOM   8850  O  O   . ARG C 1 281 ? -39.612 72.203  68.488  1.00 20.85  ? 281 ARG C O   1 
ATOM   8851  C  CB  . ARG C 1 281 ? -37.348 72.442  70.469  1.00 16.48  ? 281 ARG C CB  1 
ATOM   8852  C  CG  . ARG C 1 281 ? -36.450 73.496  69.875  1.00 14.23  ? 281 ARG C CG  1 
ATOM   8853  C  CD  . ARG C 1 281 ? -35.080 72.948  69.623  1.00 14.35  ? 281 ARG C CD  1 
ATOM   8854  N  NE  . ARG C 1 281 ? -34.300 72.897  70.848  1.00 16.28  ? 281 ARG C NE  1 
ATOM   8855  C  CZ  . ARG C 1 281 ? -33.528 71.876  71.204  1.00 17.19  ? 281 ARG C CZ  1 
ATOM   8856  N  NH1 . ARG C 1 281 ? -33.432 70.803  70.429  1.00 15.86  ? 281 ARG C NH1 1 
ATOM   8857  N  NH2 . ARG C 1 281 ? -32.824 71.940  72.329  1.00 15.60  ? 281 ARG C NH2 1 
ATOM   8858  N  N   . ILE C 1 282 ? -39.807 74.392  69.008  1.00 18.13  ? 282 ILE C N   1 
ATOM   8859  C  CA  . ILE C 1 282 ? -40.379 74.770  67.721  1.00 18.59  ? 282 ILE C CA  1 
ATOM   8860  C  C   . ILE C 1 282 ? -39.421 75.839  67.278  1.00 20.38  ? 282 ILE C C   1 
ATOM   8861  O  O   . ILE C 1 282 ? -39.253 76.867  67.946  1.00 17.94  ? 282 ILE C O   1 
ATOM   8862  C  CB  . ILE C 1 282 ? -41.799 75.307  67.856  1.00 21.08  ? 282 ILE C CB  1 
ATOM   8863  C  CG1 . ILE C 1 282 ? -42.679 74.221  68.491  1.00 21.35  ? 282 ILE C CG1 1 
ATOM   8864  C  CG2 . ILE C 1 282 ? -42.344 75.674  66.475  1.00 15.46  ? 282 ILE C CG2 1 
ATOM   8865  C  CD1 . ILE C 1 282 ? -43.995 74.715  68.967  1.00 29.91  ? 282 ILE C CD1 1 
ATOM   8866  N  N   . LEU C 1 283 ? -38.739 75.546  66.183  1.00 17.14  ? 283 LEU C N   1 
ATOM   8867  C  CA  . LEU C 1 283 ? -37.703 76.419  65.671  1.00 18.37  ? 283 LEU C CA  1 
ATOM   8868  C  C   . LEU C 1 283 ? -37.913 76.751  64.221  1.00 19.81  ? 283 LEU C C   1 
ATOM   8869  O  O   . LEU C 1 283 ? -38.355 75.907  63.437  1.00 19.20  ? 283 LEU C O   1 
ATOM   8870  C  CB  . LEU C 1 283 ? -36.368 75.674  65.759  1.00 13.23  ? 283 LEU C CB  1 
ATOM   8871  C  CG  . LEU C 1 283 ? -35.011 76.328  65.957  1.00 16.95  ? 283 LEU C CG  1 
ATOM   8872  C  CD1 . LEU C 1 283 ? -34.009 75.328  65.496  1.00 14.60  ? 283 LEU C CD1 1 
ATOM   8873  C  CD2 . LEU C 1 283 ? -34.831 77.626  65.228  1.00 14.36  ? 283 LEU C CD2 1 
ATOM   8874  N  N   . ASP C 1 284 ? -37.557 77.976  63.867  1.00 16.89  ? 284 ASP C N   1 
ATOM   8875  C  CA  . ASP C 1 284 ? -37.600 78.401  62.485  1.00 18.24  ? 284 ASP C CA  1 
ATOM   8876  C  C   . ASP C 1 284 ? -36.453 79.364  62.247  1.00 17.55  ? 284 ASP C C   1 
ATOM   8877  O  O   . ASP C 1 284 ? -36.332 80.390  62.932  1.00 18.68  ? 284 ASP C O   1 
ATOM   8878  C  CB  . ASP C 1 284 ? -38.929 79.038  62.104  1.00 20.66  ? 284 ASP C CB  1 
ATOM   8879  C  CG  . ASP C 1 284 ? -39.049 79.241  60.606  1.00 23.24  ? 284 ASP C CG  1 
ATOM   8880  O  OD1 . ASP C 1 284 ? -38.480 80.223  60.099  1.00 22.55  ? 284 ASP C OD1 1 
ATOM   8881  O  OD2 . ASP C 1 284 ? -39.667 78.394  59.936  1.00 22.80  ? 284 ASP C OD2 1 
ATOM   8882  N  N   . HIS C 1 285 ? -35.574 78.988  61.322  1.00 16.00  ? 285 HIS C N   1 
ATOM   8883  C  CA  . HIS C 1 285 ? -34.414 79.809  60.976  1.00 15.89  ? 285 HIS C CA  1 
ATOM   8884  C  C   . HIS C 1 285 ? -34.129 79.766  59.483  1.00 14.54  ? 285 HIS C C   1 
ATOM   8885  O  O   . HIS C 1 285 ? -34.582 78.871  58.777  1.00 18.29  ? 285 HIS C O   1 
ATOM   8886  C  CB  . HIS C 1 285 ? -33.170 79.367  61.756  1.00 14.60  ? 285 HIS C CB  1 
ATOM   8887  C  CG  . HIS C 1 285 ? -32.729 77.962  61.470  1.00 12.01  ? 285 HIS C CG  1 
ATOM   8888  N  ND1 . HIS C 1 285 ? -31.546 77.677  60.823  1.00 8.87   ? 285 HIS C ND1 1 
ATOM   8889  C  CD2 . HIS C 1 285 ? -33.282 76.763  61.790  1.00 12.44  ? 285 HIS C CD2 1 
ATOM   8890  C  CE1 . HIS C 1 285 ? -31.385 76.364  60.761  1.00 13.15  ? 285 HIS C CE1 1 
ATOM   8891  N  NE2 . HIS C 1 285 ? -32.424 75.786  61.339  1.00 10.90  ? 285 HIS C NE2 1 
ATOM   8892  N  N   . GLY C 1 286 ? -33.388 80.743  58.998  1.00 15.24  ? 286 GLY C N   1 
ATOM   8893  C  CA  . GLY C 1 286 ? -33.083 80.754  57.591  1.00 15.69  ? 286 GLY C CA  1 
ATOM   8894  C  C   . GLY C 1 286 ? -32.051 81.789  57.222  1.00 16.88  ? 286 GLY C C   1 
ATOM   8895  O  O   . GLY C 1 286 ? -31.607 82.577  58.065  1.00 16.14  ? 286 GLY C O   1 
ATOM   8896  N  N   . ALA C 1 287 ? -31.687 81.783  55.944  1.00 15.61  ? 287 ALA C N   1 
ATOM   8897  C  CA  . ALA C 1 287 ? -30.707 82.699  55.386  1.00 16.51  ? 287 ALA C CA  1 
ATOM   8898  C  C   . ALA C 1 287 ? -31.192 82.911  53.966  1.00 18.43  ? 287 ALA C C   1 
ATOM   8899  O  O   . ALA C 1 287 ? -31.389 81.946  53.238  1.00 20.96  ? 287 ALA C O   1 
ATOM   8900  C  CB  . ALA C 1 287 ? -29.341 82.052  55.388  1.00 13.46  ? 287 ALA C CB  1 
ATOM   8901  N  N   . ILE C 1 288 ? -31.460 84.159  53.600  1.00 18.43  ? 288 ILE C N   1 
ATOM   8902  C  CA  . ILE C 1 288 ? -31.969 84.463  52.280  1.00 17.00  ? 288 ILE C CA  1 
ATOM   8903  C  C   . ILE C 1 288 ? -31.346 85.751  51.740  1.00 20.67  ? 288 ILE C C   1 
ATOM   8904  O  O   . ILE C 1 288 ? -30.723 86.506  52.493  1.00 21.23  ? 288 ILE C O   1 
ATOM   8905  C  CB  . ILE C 1 288 ? -33.523 84.627  52.313  1.00 15.72  ? 288 ILE C CB  1 
ATOM   8906  C  CG1 . ILE C 1 288 ? -33.927 85.754  53.248  1.00 14.29  ? 288 ILE C CG1 1 
ATOM   8907  C  CG2 . ILE C 1 288 ? -34.204 83.339  52.751  1.00 14.82  ? 288 ILE C CG2 1 
ATOM   8908  C  CD1 . ILE C 1 288 ? -35.408 86.033  53.232  1.00 19.12  ? 288 ILE C CD1 1 
ATOM   8909  N  N   . SER C 1 289 ? -31.495 85.983  50.436  1.00 22.76  ? 289 SER C N   1 
ATOM   8910  C  CA  . SER C 1 289 ? -30.991 87.199  49.793  1.00 23.77  ? 289 SER C CA  1 
ATOM   8911  C  C   . SER C 1 289 ? -32.166 88.061  49.377  1.00 23.75  ? 289 SER C C   1 
ATOM   8912  O  O   . SER C 1 289 ? -33.088 87.578  48.717  1.00 26.95  ? 289 SER C O   1 
ATOM   8913  C  CB  . SER C 1 289 ? -30.172 86.870  48.548  1.00 21.19  ? 289 SER C CB  1 
ATOM   8914  O  OG  . SER C 1 289 ? -28.925 86.296  48.883  1.00 33.31  ? 289 SER C OG  1 
ATOM   8915  N  N   . LEU C 1 290 ? -32.163 89.312  49.811  1.00 25.64  ? 290 LEU C N   1 
ATOM   8916  C  CA  . LEU C 1 290 ? -33.216 90.254  49.454  1.00 30.47  ? 290 LEU C CA  1 
ATOM   8917  C  C   . LEU C 1 290 ? -32.642 91.210  48.412  1.00 33.52  ? 290 LEU C C   1 
ATOM   8918  O  O   . LEU C 1 290 ? -32.257 92.339  48.723  1.00 38.96  ? 290 LEU C O   1 
ATOM   8919  C  CB  . LEU C 1 290 ? -33.692 91.063  50.673  1.00 32.64  ? 290 LEU C CB  1 
ATOM   8920  C  CG  . LEU C 1 290 ? -34.549 90.444  51.782  1.00 31.79  ? 290 LEU C CG  1 
ATOM   8921  C  CD1 . LEU C 1 290 ? -35.584 89.526  51.174  1.00 29.26  ? 290 LEU C CD1 1 
ATOM   8922  C  CD2 . LEU C 1 290 ? -33.681 89.676  52.741  1.00 37.59  ? 290 LEU C CD2 1 
ATOM   8923  N  N   . GLY C 1 291 ? -32.542 90.751  47.176  1.00 35.94  ? 291 GLY C N   1 
ATOM   8924  C  CA  . GLY C 1 291 ? -31.998 91.610  46.142  1.00 35.02  ? 291 GLY C CA  1 
ATOM   8925  C  C   . GLY C 1 291 ? -30.494 91.501  46.000  1.00 34.30  ? 291 GLY C C   1 
ATOM   8926  O  O   . GLY C 1 291 ? -29.884 90.524  46.424  1.00 36.43  ? 291 GLY C O   1 
ATOM   8927  N  N   . ASP C 1 292 ? -29.894 92.531  45.427  1.00 31.71  ? 292 ASP C N   1 
ATOM   8928  C  CA  . ASP C 1 292 ? -28.462 92.546  45.190  1.00 32.95  ? 292 ASP C CA  1 
ATOM   8929  C  C   . ASP C 1 292 ? -27.618 92.995  46.358  1.00 30.49  ? 292 ASP C C   1 
ATOM   8930  O  O   . ASP C 1 292 ? -26.480 92.568  46.493  1.00 35.14  ? 292 ASP C O   1 
ATOM   8931  C  CB  . ASP C 1 292 ? -28.132 93.470  44.012  1.00 41.35  ? 292 ASP C CB  1 
ATOM   8932  C  CG  . ASP C 1 292 ? -28.760 93.018  42.702  1.00 47.68  ? 292 ASP C CG  1 
ATOM   8933  O  OD1 . ASP C 1 292 ? -29.174 91.834  42.582  1.00 50.13  ? 292 ASP C OD1 1 
ATOM   8934  O  OD2 . ASP C 1 292 ? -28.832 93.871  41.787  1.00 50.29  ? 292 ASP C OD2 1 
ATOM   8935  N  N   . LYS C 1 293 ? -28.162 93.878  47.182  1.00 25.04  ? 293 LYS C N   1 
ATOM   8936  C  CA  . LYS C 1 293 ? -27.411 94.437  48.282  1.00 20.32  ? 293 LYS C CA  1 
ATOM   8937  C  C   . LYS C 1 293 ? -27.684 93.902  49.674  1.00 21.07  ? 293 LYS C C   1 
ATOM   8938  O  O   . LYS C 1 293 ? -26.959 94.239  50.606  1.00 21.69  ? 293 LYS C O   1 
ATOM   8939  C  CB  . LYS C 1 293 ? -27.655 95.937  48.303  1.00 24.02  ? 293 LYS C CB  1 
ATOM   8940  C  CG  . LYS C 1 293 ? -27.325 96.656  47.010  1.00 27.87  ? 293 LYS C CG  1 
ATOM   8941  C  CD  . LYS C 1 293 ? -25.840 96.842  46.863  1.00 38.01  ? 293 LYS C CD  1 
ATOM   8942  C  CE  . LYS C 1 293 ? -25.505 97.753  45.703  1.00 39.56  ? 293 LYS C CE  1 
ATOM   8943  N  NZ  . LYS C 1 293 ? -24.089 98.199  45.833  1.00 48.85  ? 293 LYS C NZ  1 
ATOM   8944  N  N   . TRP C 1 294 ? -28.694 93.054  49.818  1.00 19.47  ? 294 TRP C N   1 
ATOM   8945  C  CA  . TRP C 1 294 ? -29.068 92.552  51.126  1.00 18.89  ? 294 TRP C CA  1 
ATOM   8946  C  C   . TRP C 1 294 ? -29.118 91.072  51.306  1.00 18.56  ? 294 TRP C C   1 
ATOM   8947  O  O   . TRP C 1 294 ? -29.741 90.366  50.519  1.00 20.74  ? 294 TRP C O   1 
ATOM   8948  C  CB  . TRP C 1 294 ? -30.461 93.047  51.499  1.00 20.41  ? 294 TRP C CB  1 
ATOM   8949  C  CG  . TRP C 1 294 ? -30.566 94.511  51.666  1.00 25.80  ? 294 TRP C CG  1 
ATOM   8950  C  CD1 . TRP C 1 294 ? -30.947 95.418  50.724  1.00 23.79  ? 294 TRP C CD1 1 
ATOM   8951  C  CD2 . TRP C 1 294 ? -30.276 95.256  52.850  1.00 26.98  ? 294 TRP C CD2 1 
ATOM   8952  N  NE1 . TRP C 1 294 ? -30.904 96.687  51.246  1.00 25.63  ? 294 TRP C NE1 1 
ATOM   8953  C  CE2 . TRP C 1 294 ? -30.495 96.618  52.549  1.00 25.97  ? 294 TRP C CE2 1 
ATOM   8954  C  CE3 . TRP C 1 294 ? -29.850 94.906  54.136  1.00 29.67  ? 294 TRP C CE3 1 
ATOM   8955  C  CZ2 . TRP C 1 294 ? -30.302 97.629  53.482  1.00 26.75  ? 294 TRP C CZ2 1 
ATOM   8956  C  CZ3 . TRP C 1 294 ? -29.657 95.911  55.063  1.00 29.32  ? 294 TRP C CZ3 1 
ATOM   8957  C  CH2 . TRP C 1 294 ? -29.883 97.262  54.731  1.00 29.13  ? 294 TRP C CH2 1 
ATOM   8958  N  N   . ASP C 1 295 ? -28.554 90.623  52.415  1.00 17.58  ? 295 ASP C N   1 
ATOM   8959  C  CA  . ASP C 1 295 ? -28.616 89.219  52.800  1.00 18.92  ? 295 ASP C CA  1 
ATOM   8960  C  C   . ASP C 1 295 ? -29.230 89.262  54.187  1.00 20.34  ? 295 ASP C C   1 
ATOM   8961  O  O   . ASP C 1 295 ? -29.114 90.282  54.891  1.00 20.53  ? 295 ASP C O   1 
ATOM   8962  C  CB  . ASP C 1 295 ? -27.238 88.573  52.836  1.00 20.87  ? 295 ASP C CB  1 
ATOM   8963  C  CG  . ASP C 1 295 ? -26.885 87.889  51.533  1.00 22.72  ? 295 ASP C CG  1 
ATOM   8964  O  OD1 . ASP C 1 295 ? -27.536 88.176  50.506  1.00 22.63  ? 295 ASP C OD1 1 
ATOM   8965  O  OD2 . ASP C 1 295 ? -25.958 87.057  51.536  1.00 24.63  ? 295 ASP C OD2 1 
ATOM   8966  N  N   . LEU C 1 296 ? -29.900 88.186  54.576  1.00 19.89  ? 296 LEU C N   1 
ATOM   8967  C  CA  . LEU C 1 296 ? -30.552 88.149  55.872  1.00 18.71  ? 296 LEU C CA  1 
ATOM   8968  C  C   . LEU C 1 296 ? -30.576 86.785  56.545  1.00 18.51  ? 296 LEU C C   1 
ATOM   8969  O  O   . LEU C 1 296 ? -30.941 85.790  55.924  1.00 21.75  ? 296 LEU C O   1 
ATOM   8970  C  CB  . LEU C 1 296 ? -31.991 88.642  55.727  1.00 18.39  ? 296 LEU C CB  1 
ATOM   8971  C  CG  . LEU C 1 296 ? -32.853 88.652  56.988  1.00 19.78  ? 296 LEU C CG  1 
ATOM   8972  C  CD1 . LEU C 1 296 ? -32.418 89.770  57.917  1.00 20.43  ? 296 LEU C CD1 1 
ATOM   8973  C  CD2 . LEU C 1 296 ? -34.283 88.841  56.615  1.00 18.26  ? 296 LEU C CD2 1 
ATOM   8974  N  N   . MET C 1 297 ? -30.148 86.743  57.804  1.00 18.60  ? 297 MET C N   1 
ATOM   8975  C  CA  . MET C 1 297 ? -30.190 85.522  58.623  1.00 16.46  ? 297 MET C CA  1 
ATOM   8976  C  C   . MET C 1 297 ? -31.219 85.833  59.715  1.00 18.09  ? 297 MET C C   1 
ATOM   8977  O  O   . MET C 1 297 ? -31.306 86.983  60.191  1.00 17.92  ? 297 MET C O   1 
ATOM   8978  C  CB  . MET C 1 297 ? -28.847 85.258  59.301  1.00 17.48  ? 297 MET C CB  1 
ATOM   8979  C  CG  . MET C 1 297 ? -27.890 84.367  58.554  1.00 16.49  ? 297 MET C CG  1 
ATOM   8980  S  SD  . MET C 1 297 ? -26.366 84.225  59.486  1.00 20.53  ? 297 MET C SD  1 
ATOM   8981  C  CE  . MET C 1 297 ? -25.496 83.108  58.458  1.00 17.56  ? 297 MET C CE  1 
ATOM   8982  N  N   . TYR C 1 298 ? -31.994 84.839  60.121  1.00 17.02  ? 298 TYR C N   1 
ATOM   8983  C  CA  . TYR C 1 298 ? -32.994 85.061  61.155  1.00 16.57  ? 298 TYR C CA  1 
ATOM   8984  C  C   . TYR C 1 298 ? -33.270 83.789  61.937  1.00 18.05  ? 298 TYR C C   1 
ATOM   8985  O  O   . TYR C 1 298 ? -32.983 82.688  61.454  1.00 18.75  ? 298 TYR C O   1 
ATOM   8986  C  CB  . TYR C 1 298 ? -34.288 85.610  60.548  1.00 15.25  ? 298 TYR C CB  1 
ATOM   8987  C  CG  . TYR C 1 298 ? -34.886 84.729  59.472  1.00 15.51  ? 298 TYR C CG  1 
ATOM   8988  C  CD1 . TYR C 1 298 ? -34.508 84.864  58.130  1.00 15.39  ? 298 TYR C CD1 1 
ATOM   8989  C  CD2 . TYR C 1 298 ? -35.782 83.720  59.799  1.00 13.72  ? 298 TYR C CD2 1 
ATOM   8990  C  CE1 . TYR C 1 298 ? -35.005 83.996  57.143  1.00 15.59  ? 298 TYR C CE1 1 
ATOM   8991  C  CE2 . TYR C 1 298 ? -36.288 82.851  58.823  1.00 17.96  ? 298 TYR C CE2 1 
ATOM   8992  C  CZ  . TYR C 1 298 ? -35.892 82.989  57.502  1.00 18.15  ? 298 TYR C CZ  1 
ATOM   8993  O  OH  . TYR C 1 298 ? -36.359 82.088  56.569  1.00 18.77  ? 298 TYR C OH  1 
ATOM   8994  N  N   . VAL C 1 299 ? -33.749 83.959  63.172  1.00 19.06  ? 299 VAL C N   1 
ATOM   8995  C  CA  . VAL C 1 299 ? -34.093 82.849  64.067  1.00 14.80  ? 299 VAL C CA  1 
ATOM   8996  C  C   . VAL C 1 299 ? -35.319 83.220  64.859  1.00 15.55  ? 299 VAL C C   1 
ATOM   8997  O  O   . VAL C 1 299 ? -35.486 84.362  65.275  1.00 17.16  ? 299 VAL C O   1 
ATOM   8998  C  CB  . VAL C 1 299 ? -33.086 82.584  65.208  1.00 14.09  ? 299 VAL C CB  1 
ATOM   8999  C  CG1 . VAL C 1 299 ? -32.878 81.086  65.386  1.00 14.10  ? 299 VAL C CG1 1 
ATOM   9000  C  CG2 . VAL C 1 299 ? -31.825 83.371  65.053  1.00 17.95  ? 299 VAL C CG2 1 
ATOM   9001  N  N   . GLY C 1 300 ? -36.091 82.201  65.183  1.00 16.68  ? 300 GLY C N   1 
ATOM   9002  C  CA  . GLY C 1 300 ? -37.271 82.368  65.993  1.00 14.02  ? 300 GLY C CA  1 
ATOM   9003  C  C   . GLY C 1 300 ? -37.396 81.015  66.652  1.00 16.66  ? 300 GLY C C   1 
ATOM   9004  O  O   . GLY C 1 300 ? -37.478 80.008  65.942  1.00 16.53  ? 300 GLY C O   1 
ATOM   9005  N  N   . MET C 1 301 ? -37.311 80.967  67.980  1.00 16.12  ? 301 MET C N   1 
ATOM   9006  C  CA  . MET C 1 301 ? -37.421 79.695  68.693  1.00 16.53  ? 301 MET C CA  1 
ATOM   9007  C  C   . MET C 1 301 ? -38.144 79.745  70.030  1.00 18.63  ? 301 MET C C   1 
ATOM   9008  O  O   . MET C 1 301 ? -38.018 80.716  70.802  1.00 18.39  ? 301 MET C O   1 
ATOM   9009  C  CB  . MET C 1 301 ? -36.046 79.061  68.928  1.00 14.16  ? 301 MET C CB  1 
ATOM   9010  C  CG  . MET C 1 301 ? -36.138 77.715  69.652  1.00 13.55  ? 301 MET C CG  1 
ATOM   9011  S  SD  . MET C 1 301 ? -34.610 76.820  69.729  1.00 20.91  ? 301 MET C SD  1 
ATOM   9012  C  CE  . MET C 1 301 ? -33.679 77.993  70.641  1.00 13.68  ? 301 MET C CE  1 
ATOM   9013  N  N   . TYR C 1 302 ? -38.915 78.689  70.278  1.00 17.13  ? 302 TYR C N   1 
ATOM   9014  C  CA  . TYR C 1 302 ? -39.642 78.516  71.521  1.00 16.10  ? 302 TYR C CA  1 
ATOM   9015  C  C   . TYR C 1 302 ? -39.221 77.153  72.027  1.00 14.70  ? 302 TYR C C   1 
ATOM   9016  O  O   . TYR C 1 302 ? -39.352 76.163  71.312  1.00 14.45  ? 302 TYR C O   1 
ATOM   9017  C  CB  . TYR C 1 302 ? -41.147 78.519  71.297  1.00 17.96  ? 302 TYR C CB  1 
ATOM   9018  C  CG  . TYR C 1 302 ? -41.914 78.086  72.527  1.00 20.41  ? 302 TYR C CG  1 
ATOM   9019  C  CD1 . TYR C 1 302 ? -42.127 78.975  73.584  1.00 21.60  ? 302 TYR C CD1 1 
ATOM   9020  C  CD2 . TYR C 1 302 ? -42.398 76.774  72.651  1.00 21.94  ? 302 TYR C CD2 1 
ATOM   9021  C  CE1 . TYR C 1 302 ? -42.801 78.576  74.728  1.00 20.98  ? 302 TYR C CE1 1 
ATOM   9022  C  CE2 . TYR C 1 302 ? -43.068 76.366  73.795  1.00 21.20  ? 302 TYR C CE2 1 
ATOM   9023  C  CZ  . TYR C 1 302 ? -43.266 77.275  74.827  1.00 23.20  ? 302 TYR C CZ  1 
ATOM   9024  O  OH  . TYR C 1 302 ? -43.936 76.879  75.954  1.00 31.81  ? 302 TYR C OH  1 
ATOM   9025  N  N   . GLN C 1 303 ? -38.665 77.111  73.228  1.00 14.46  ? 303 GLN C N   1 
ATOM   9026  C  CA  . GLN C 1 303 ? -38.241 75.857  73.814  1.00 16.65  ? 303 GLN C CA  1 
ATOM   9027  C  C   . GLN C 1 303 ? -38.800 75.792  75.220  1.00 20.00  ? 303 GLN C C   1 
ATOM   9028  O  O   . GLN C 1 303 ? -38.666 76.750  75.991  1.00 21.32  ? 303 GLN C O   1 
ATOM   9029  C  CB  . GLN C 1 303 ? -36.723 75.771  73.855  1.00 14.20  ? 303 GLN C CB  1 
ATOM   9030  C  CG  . GLN C 1 303 ? -36.223 74.494  74.490  1.00 12.51  ? 303 GLN C CG  1 
ATOM   9031  C  CD  . GLN C 1 303 ? -34.727 74.359  74.416  1.00 16.83  ? 303 GLN C CD  1 
ATOM   9032  O  OE1 . GLN C 1 303 ? -34.184 74.007  73.382  1.00 19.05  ? 303 GLN C OE1 1 
ATOM   9033  N  NE2 . GLN C 1 303 ? -34.053 74.634  75.511  1.00 15.94  ? 303 GLN C NE2 1 
ATOM   9034  N  N   . ASN C 1 304 ? -39.435 74.671  75.547  1.00 19.97  ? 304 ASN C N   1 
ATOM   9035  C  CA  . ASN C 1 304 ? -40.025 74.490  76.856  1.00 18.31  ? 304 ASN C CA  1 
ATOM   9036  C  C   . ASN C 1 304 ? -39.599 73.181  77.467  1.00 18.67  ? 304 ASN C C   1 
ATOM   9037  O  O   . ASN C 1 304 ? -39.937 72.109  76.949  1.00 20.10  ? 304 ASN C O   1 
ATOM   9038  C  CB  . ASN C 1 304 ? -41.546 74.523  76.761  1.00 24.47  ? 304 ASN C CB  1 
ATOM   9039  C  CG  . ASN C 1 304 ? -42.219 74.437  78.115  1.00 27.60  ? 304 ASN C CG  1 
ATOM   9040  O  OD1 . ASN C 1 304 ? -41.861 75.149  79.046  1.00 30.52  ? 304 ASN C OD1 1 
ATOM   9041  N  ND2 . ASN C 1 304 ? -43.205 73.565  78.228  1.00 34.10  ? 304 ASN C ND2 1 
ATOM   9042  N  N   . ILE C 1 305 ? -38.787 73.265  78.517  1.00 19.68  ? 305 ILE C N   1 
ATOM   9043  C  CA  . ILE C 1 305 ? -38.346 72.073  79.239  1.00 20.94  ? 305 ILE C CA  1 
ATOM   9044  C  C   . ILE C 1 305 ? -39.247 71.991  80.476  1.00 23.74  ? 305 ILE C C   1 
ATOM   9045  O  O   . ILE C 1 305 ? -39.145 72.802  81.410  1.00 22.58  ? 305 ILE C O   1 
ATOM   9046  C  CB  . ILE C 1 305 ? -36.857 72.134  79.644  1.00 18.37  ? 305 ILE C CB  1 
ATOM   9047  C  CG1 . ILE C 1 305 ? -35.983 72.273  78.399  1.00 18.15  ? 305 ILE C CG1 1 
ATOM   9048  C  CG2 . ILE C 1 305 ? -36.466 70.857  80.342  1.00 18.04  ? 305 ILE C CG2 1 
ATOM   9049  C  CD1 . ILE C 1 305 ? -34.498 72.296  78.673  1.00 17.04  ? 305 ILE C CD1 1 
ATOM   9050  N  N   . ASP C 1 306 ? -40.198 71.071  80.410  1.00 24.45  ? 306 ASP C N   1 
ATOM   9051  C  CA  . ASP C 1 306 ? -41.166 70.858  81.472  1.00 24.71  ? 306 ASP C CA  1 
ATOM   9052  C  C   . ASP C 1 306 ? -40.767 69.642  82.305  1.00 23.12  ? 306 ASP C C   1 
ATOM   9053  O  O   . ASP C 1 306 ? -41.072 68.495  81.954  1.00 22.68  ? 306 ASP C O   1 
ATOM   9054  C  CB  . ASP C 1 306 ? -42.545 70.644  80.845  1.00 29.78  ? 306 ASP C CB  1 
ATOM   9055  C  CG  . ASP C 1 306 ? -43.652 70.481  81.863  1.00 33.38  ? 306 ASP C CG  1 
ATOM   9056  O  OD1 . ASP C 1 306 ? -43.413 70.454  83.088  1.00 42.00  ? 306 ASP C OD1 1 
ATOM   9057  O  OD2 . ASP C 1 306 ? -44.802 70.378  81.413  1.00 44.40  ? 306 ASP C OD2 1 
ATOM   9058  N  N   . TRP C 1 307 ? -40.100 69.899  83.422  1.00 22.98  ? 307 TRP C N   1 
ATOM   9059  C  CA  . TRP C 1 307 ? -39.685 68.822  84.290  1.00 22.50  ? 307 TRP C CA  1 
ATOM   9060  C  C   . TRP C 1 307 ? -40.726 68.595  85.360  1.00 23.83  ? 307 TRP C C   1 
ATOM   9061  O  O   . TRP C 1 307 ? -41.322 69.542  85.872  1.00 21.19  ? 307 TRP C O   1 
ATOM   9062  C  CB  . TRP C 1 307 ? -38.331 69.130  84.885  1.00 19.06  ? 307 TRP C CB  1 
ATOM   9063  C  CG  . TRP C 1 307 ? -37.247 68.748  83.950  1.00 20.96  ? 307 TRP C CG  1 
ATOM   9064  C  CD1 . TRP C 1 307 ? -37.246 67.693  83.084  1.00 20.66  ? 307 TRP C CD1 1 
ATOM   9065  C  CD2 . TRP C 1 307 ? -35.966 69.366  83.829  1.00 20.97  ? 307 TRP C CD2 1 
ATOM   9066  N  NE1 . TRP C 1 307 ? -36.034 67.605  82.443  1.00 20.10  ? 307 TRP C NE1 1 
ATOM   9067  C  CE2 . TRP C 1 307 ? -35.230 68.621  82.883  1.00 19.73  ? 307 TRP C CE2 1 
ATOM   9068  C  CE3 . TRP C 1 307 ? -35.364 70.477  84.435  1.00 25.92  ? 307 TRP C CE3 1 
ATOM   9069  C  CZ2 . TRP C 1 307 ? -33.925 68.949  82.531  1.00 22.39  ? 307 TRP C CZ2 1 
ATOM   9070  C  CZ3 . TRP C 1 307 ? -34.068 70.803  84.083  1.00 28.02  ? 307 TRP C CZ3 1 
ATOM   9071  C  CH2 . TRP C 1 307 ? -33.361 70.041  83.140  1.00 24.55  ? 307 TRP C CH2 1 
ATOM   9072  N  N   . ASP C 1 308 ? -41.012 67.328  85.624  1.00 21.27  ? 308 ASP C N   1 
ATOM   9073  C  CA  . ASP C 1 308 ? -41.996 66.972  86.629  1.00 19.50  ? 308 ASP C CA  1 
ATOM   9074  C  C   . ASP C 1 308 ? -41.683 67.663  87.938  1.00 17.94  ? 308 ASP C C   1 
ATOM   9075  O  O   . ASP C 1 308 ? -42.572 68.142  88.632  1.00 22.71  ? 308 ASP C O   1 
ATOM   9076  C  CB  . ASP C 1 308 ? -41.986 65.478  86.833  1.00 13.47  ? 308 ASP C CB  1 
ATOM   9077  C  CG  . ASP C 1 308 ? -42.420 64.729  85.604  1.00 18.09  ? 308 ASP C CG  1 
ATOM   9078  O  OD1 . ASP C 1 308 ? -43.104 65.314  84.748  1.00 25.11  ? 308 ASP C OD1 1 
ATOM   9079  O  OD2 . ASP C 1 308 ? -42.085 63.545  85.493  1.00 22.88  ? 308 ASP C OD2 1 
ATOM   9080  N  N   . ASN C 1 309 ? -40.400 67.744  88.250  1.00 20.45  ? 309 ASN C N   1 
ATOM   9081  C  CA  . ASN C 1 309 ? -39.951 68.381  89.477  1.00 19.99  ? 309 ASN C CA  1 
ATOM   9082  C  C   . ASN C 1 309 ? -40.064 69.900  89.457  1.00 20.41  ? 309 ASN C C   1 
ATOM   9083  O  O   . ASN C 1 309 ? -39.702 70.563  90.424  1.00 24.63  ? 309 ASN C O   1 
ATOM   9084  C  CB  . ASN C 1 309 ? -38.515 67.952  89.806  1.00 21.84  ? 309 ASN C CB  1 
ATOM   9085  C  CG  . ASN C 1 309 ? -37.491 68.448  88.797  1.00 28.93  ? 309 ASN C CG  1 
ATOM   9086  O  OD1 . ASN C 1 309 ? -37.686 69.465  88.128  1.00 33.97  ? 309 ASN C OD1 1 
ATOM   9087  N  ND2 . ASN C 1 309 ? -36.370 67.748  88.714  1.00 33.04  ? 309 ASN C ND2 1 
ATOM   9088  N  N   . ASN C 1 310 ? -40.510 70.449  88.334  1.00 20.15  ? 310 ASN C N   1 
ATOM   9089  C  CA  . ASN C 1 310 ? -40.668 71.885  88.170  1.00 20.98  ? 310 ASN C CA  1 
ATOM   9090  C  C   . ASN C 1 310 ? -39.404 72.755  88.195  1.00 21.31  ? 310 ASN C C   1 
ATOM   9091  O  O   . ASN C 1 310 ? -39.500 73.948  88.476  1.00 20.88  ? 310 ASN C O   1 
ATOM   9092  C  CB  . ASN C 1 310 ? -41.692 72.417  89.174  1.00 25.60  ? 310 ASN C CB  1 
ATOM   9093  C  CG  . ASN C 1 310 ? -43.006 71.675  89.099  1.00 30.48  ? 310 ASN C CG  1 
ATOM   9094  O  OD1 . ASN C 1 310 ? -43.525 71.401  88.012  1.00 37.63  ? 310 ASN C OD1 1 
ATOM   9095  N  ND2 . ASN C 1 310 ? -43.538 71.311  90.251  1.00 37.08  ? 310 ASN C ND2 1 
ATOM   9096  N  N   . LEU C 1 311 ? -38.242 72.183  87.858  1.00 24.43  ? 311 LEU C N   1 
ATOM   9097  C  CA  . LEU C 1 311 ? -36.975 72.930  87.828  1.00 23.32  ? 311 LEU C CA  1 
ATOM   9098  C  C   . LEU C 1 311 ? -36.576 73.388  86.398  1.00 23.82  ? 311 LEU C C   1 
ATOM   9099  O  O   . LEU C 1 311 ? -35.491 73.940  86.193  1.00 25.56  ? 311 LEU C O   1 
ATOM   9100  C  CB  . LEU C 1 311 ? -35.849 72.086  88.445  1.00 19.71  ? 311 LEU C CB  1 
ATOM   9101  C  CG  . LEU C 1 311 ? -36.046 71.629  89.897  1.00 20.11  ? 311 LEU C CG  1 
ATOM   9102  C  CD1 . LEU C 1 311 ? -34.888 70.795  90.363  1.00 13.64  ? 311 LEU C CD1 1 
ATOM   9103  C  CD2 . LEU C 1 311 ? -36.208 72.816  90.784  1.00 16.26  ? 311 LEU C CD2 1 
ATOM   9104  N  N   . GLY C 1 312 ? -37.481 73.208  85.434  1.00 25.19  ? 312 GLY C N   1 
ATOM   9105  C  CA  . GLY C 1 312 ? -37.220 73.567  84.047  1.00 22.14  ? 312 GLY C CA  1 
ATOM   9106  C  C   . GLY C 1 312 ? -37.254 75.040  83.686  1.00 23.54  ? 312 GLY C C   1 
ATOM   9107  O  O   . GLY C 1 312 ? -37.196 75.907  84.567  1.00 23.65  ? 312 GLY C O   1 
ATOM   9108  N  N   . THR C 1 313 ? -37.345 75.317  82.383  1.00 23.09  ? 313 THR C N   1 
ATOM   9109  C  CA  . THR C 1 313 ? -37.377 76.685  81.849  1.00 20.63  ? 313 THR C CA  1 
ATOM   9110  C  C   . THR C 1 313 ? -38.212 76.768  80.568  1.00 20.22  ? 313 THR C C   1 
ATOM   9111  O  O   . THR C 1 313 ? -38.368 75.768  79.855  1.00 22.19  ? 313 THR C O   1 
ATOM   9112  C  CB  . THR C 1 313 ? -35.961 77.183  81.473  1.00 20.86  ? 313 THR C CB  1 
ATOM   9113  O  OG1 . THR C 1 313 ? -35.334 76.222  80.621  1.00 22.64  ? 313 THR C OG1 1 
ATOM   9114  C  CG2 . THR C 1 313 ? -35.109 77.402  82.694  1.00 19.91  ? 313 THR C CG2 1 
ATOM   9115  N  N   . GLU C 1 314 ? -38.757 77.956  80.304  1.00 19.65  ? 314 GLU C N   1 
ATOM   9116  C  CA  . GLU C 1 314 ? -39.536 78.233  79.099  1.00 21.52  ? 314 GLU C CA  1 
ATOM   9117  C  C   . GLU C 1 314 ? -38.769 79.375  78.429  1.00 22.73  ? 314 GLU C C   1 
ATOM   9118  O  O   . GLU C 1 314 ? -38.678 80.477  78.973  1.00 25.20  ? 314 GLU C O   1 
ATOM   9119  C  CB  . GLU C 1 314 ? -40.949 78.674  79.443  1.00 24.42  ? 314 GLU C CB  1 
ATOM   9120  C  CG  . GLU C 1 314 ? -41.746 78.996  78.213  1.00 35.67  ? 314 GLU C CG  1 
ATOM   9121  C  CD  . GLU C 1 314 ? -43.117 79.526  78.524  1.00 41.24  ? 314 GLU C CD  1 
ATOM   9122  O  OE1 . GLU C 1 314 ? -43.261 80.763  78.658  1.00 48.74  ? 314 GLU C OE1 1 
ATOM   9123  O  OE2 . GLU C 1 314 ? -44.051 78.706  78.614  1.00 45.43  ? 314 GLU C OE2 1 
ATOM   9124  N  N   . TRP C 1 315 ? -38.256 79.119  77.234  1.00 22.30  ? 315 TRP C N   1 
ATOM   9125  C  CA  . TRP C 1 315 ? -37.405 80.074  76.538  1.00 20.03  ? 315 TRP C CA  1 
ATOM   9126  C  C   . TRP C 1 315 ? -37.898 80.502  75.156  1.00 20.26  ? 315 TRP C C   1 
ATOM   9127  O  O   . TRP C 1 315 ? -38.351 79.672  74.360  1.00 21.22  ? 315 TRP C O   1 
ATOM   9128  C  CB  . TRP C 1 315 ? -36.007 79.437  76.465  1.00 19.75  ? 315 TRP C CB  1 
ATOM   9129  C  CG  . TRP C 1 315 ? -34.893 80.209  75.815  1.00 18.93  ? 315 TRP C CG  1 
ATOM   9130  C  CD1 . TRP C 1 315 ? -34.723 81.565  75.789  1.00 18.58  ? 315 TRP C CD1 1 
ATOM   9131  C  CD2 . TRP C 1 315 ? -33.789 79.650  75.091  1.00 16.43  ? 315 TRP C CD2 1 
ATOM   9132  N  NE1 . TRP C 1 315 ? -33.587 81.878  75.085  1.00 19.14  ? 315 TRP C NE1 1 
ATOM   9133  C  CE2 . TRP C 1 315 ? -32.997 80.723  74.642  1.00 19.16  ? 315 TRP C CE2 1 
ATOM   9134  C  CE3 . TRP C 1 315 ? -33.395 78.344  74.777  1.00 15.62  ? 315 TRP C CE3 1 
ATOM   9135  C  CZ2 . TRP C 1 315 ? -31.836 80.533  73.890  1.00 18.94  ? 315 TRP C CZ2 1 
ATOM   9136  C  CZ3 . TRP C 1 315 ? -32.242 78.156  74.033  1.00 14.71  ? 315 TRP C CZ3 1 
ATOM   9137  C  CH2 . TRP C 1 315 ? -31.477 79.243  73.597  1.00 16.34  ? 315 TRP C CH2 1 
ATOM   9138  N  N   . TRP C 1 316 ? -37.849 81.817  74.927  1.00 19.86  ? 316 TRP C N   1 
ATOM   9139  C  CA  . TRP C 1 316 ? -38.237 82.476  73.684  1.00 21.03  ? 316 TRP C CA  1 
ATOM   9140  C  C   . TRP C 1 316 ? -37.015 83.234  73.226  1.00 21.75  ? 316 TRP C C   1 
ATOM   9141  O  O   . TRP C 1 316 ? -36.429 83.993  74.007  1.00 19.94  ? 316 TRP C O   1 
ATOM   9142  C  CB  . TRP C 1 316 ? -39.293 83.549  73.929  1.00 26.34  ? 316 TRP C CB  1 
ATOM   9143  C  CG  . TRP C 1 316 ? -40.571 83.051  74.374  1.00 37.82  ? 316 TRP C CG  1 
ATOM   9144  C  CD1 . TRP C 1 316 ? -40.993 82.892  75.665  1.00 41.60  ? 316 TRP C CD1 1 
ATOM   9145  C  CD2 . TRP C 1 316 ? -41.653 82.647  73.542  1.00 43.59  ? 316 TRP C CD2 1 
ATOM   9146  N  NE1 . TRP C 1 316 ? -42.281 82.411  75.685  1.00 45.33  ? 316 TRP C NE1 1 
ATOM   9147  C  CE2 . TRP C 1 316 ? -42.712 82.253  74.393  1.00 44.79  ? 316 TRP C CE2 1 
ATOM   9148  C  CE3 . TRP C 1 316 ? -41.835 82.579  72.153  1.00 47.17  ? 316 TRP C CE3 1 
ATOM   9149  C  CZ2 . TRP C 1 316 ? -43.938 81.801  73.901  1.00 48.03  ? 316 TRP C CZ2 1 
ATOM   9150  C  CZ3 . TRP C 1 316 ? -43.055 82.128  71.661  1.00 49.18  ? 316 TRP C CZ3 1 
ATOM   9151  C  CH2 . TRP C 1 316 ? -44.091 81.745  72.535  1.00 50.18  ? 316 TRP C CH2 1 
ATOM   9152  N  N   . THR C 1 317 ? -36.650 83.073  71.963  1.00 21.26  ? 317 THR C N   1 
ATOM   9153  C  CA  . THR C 1 317 ? -35.514 83.797  71.424  1.00 20.57  ? 317 THR C CA  1 
ATOM   9154  C  C   . THR C 1 317 ? -35.830 84.188  69.987  1.00 20.99  ? 317 THR C C   1 
ATOM   9155  O  O   . THR C 1 317 ? -36.414 83.402  69.231  1.00 23.34  ? 317 THR C O   1 
ATOM   9156  C  CB  . THR C 1 317 ? -34.215 82.977  71.520  1.00 17.78  ? 317 THR C CB  1 
ATOM   9157  O  OG1 . THR C 1 317 ? -33.097 83.835  71.286  1.00 24.03  ? 317 THR C OG1 1 
ATOM   9158  C  CG2 . THR C 1 317 ? -34.200 81.849  70.519  1.00 16.18  ? 317 THR C CG2 1 
ATOM   9159  N  N   . VAL C 1 318 ? -35.548 85.439  69.649  1.00 19.78  ? 318 VAL C N   1 
ATOM   9160  C  CA  . VAL C 1 318 ? -35.803 85.951  68.309  1.00 20.55  ? 318 VAL C CA  1 
ATOM   9161  C  C   . VAL C 1 318 ? -34.670 86.863  67.911  1.00 20.66  ? 318 VAL C C   1 
ATOM   9162  O  O   . VAL C 1 318 ? -34.245 87.717  68.692  1.00 19.48  ? 318 VAL C O   1 
ATOM   9163  C  CB  . VAL C 1 318 ? -37.060 86.809  68.230  1.00 23.03  ? 318 VAL C CB  1 
ATOM   9164  C  CG1 . VAL C 1 318 ? -37.619 86.737  66.828  1.00 26.30  ? 318 VAL C CG1 1 
ATOM   9165  C  CG2 . VAL C 1 318 ? -38.070 86.362  69.225  1.00 32.10  ? 318 VAL C CG2 1 
ATOM   9166  N  N   . GLY C 1 319 ? -34.226 86.730  66.673  1.00 18.87  ? 319 GLY C N   1 
ATOM   9167  C  CA  . GLY C 1 319 ? -33.131 87.561  66.238  1.00 18.78  ? 319 GLY C CA  1 
ATOM   9168  C  C   . GLY C 1 319 ? -33.099 87.707  64.747  1.00 17.91  ? 319 GLY C C   1 
ATOM   9169  O  O   . GLY C 1 319 ? -33.656 86.890  64.000  1.00 16.35  ? 319 GLY C O   1 
ATOM   9170  N  N   . VAL C 1 320 ? -32.383 88.728  64.312  1.00 17.74  ? 320 VAL C N   1 
ATOM   9171  C  CA  . VAL C 1 320 ? -32.286 89.013  62.905  1.00 18.07  ? 320 VAL C CA  1 
ATOM   9172  C  C   . VAL C 1 320 ? -30.903 89.598  62.613  1.00 17.56  ? 320 VAL C C   1 
ATOM   9173  O  O   . VAL C 1 320 ? -30.346 90.341  63.427  1.00 13.74  ? 320 VAL C O   1 
ATOM   9174  C  CB  . VAL C 1 320 ? -33.453 89.952  62.522  1.00 18.52  ? 320 VAL C CB  1 
ATOM   9175  C  CG1 . VAL C 1 320 ? -33.015 91.399  62.449  1.00 19.56  ? 320 VAL C CG1 1 
ATOM   9176  C  CG2 . VAL C 1 320 ? -34.121 89.468  61.276  1.00 24.55  ? 320 VAL C CG2 1 
ATOM   9177  N  N   . ARG C 1 321 ? -30.333 89.230  61.471  1.00 19.32  ? 321 ARG C N   1 
ATOM   9178  C  CA  . ARG C 1 321 ? -29.005 89.712  61.099  1.00 18.49  ? 321 ARG C CA  1 
ATOM   9179  C  C   . ARG C 1 321 ? -28.930 90.099  59.627  1.00 20.20  ? 321 ARG C C   1 
ATOM   9180  O  O   . ARG C 1 321 ? -28.697 89.246  58.758  1.00 19.94  ? 321 ARG C O   1 
ATOM   9181  C  CB  . ARG C 1 321 ? -27.962 88.634  61.427  1.00 17.53  ? 321 ARG C CB  1 
ATOM   9182  C  CG  . ARG C 1 321 ? -26.542 88.914  60.974  1.00 13.89  ? 321 ARG C CG  1 
ATOM   9183  C  CD  . ARG C 1 321 ? -25.589 88.384  62.004  1.00 17.76  ? 321 ARG C CD  1 
ATOM   9184  N  NE  . ARG C 1 321 ? -24.666 87.377  61.511  1.00 16.78  ? 321 ARG C NE  1 
ATOM   9185  C  CZ  . ARG C 1 321 ? -24.018 86.519  62.296  1.00 19.96  ? 321 ARG C CZ  1 
ATOM   9186  N  NH1 . ARG C 1 321 ? -24.192 86.525  63.606  1.00 12.59  ? 321 ARG C NH1 1 
ATOM   9187  N  NH2 . ARG C 1 321 ? -23.137 85.687  61.775  1.00 26.57  ? 321 ARG C NH2 1 
ATOM   9188  N  N   . PRO C 1 322 ? -29.264 91.361  59.314  1.00 19.53  ? 322 PRO C N   1 
ATOM   9189  C  CA  . PRO C 1 322 ? -29.207 91.809  57.924  1.00 18.62  ? 322 PRO C CA  1 
ATOM   9190  C  C   . PRO C 1 322 ? -27.790 92.211  57.528  1.00 19.10  ? 322 PRO C C   1 
ATOM   9191  O  O   . PRO C 1 322 ? -27.002 92.704  58.348  1.00 18.80  ? 322 PRO C O   1 
ATOM   9192  C  CB  . PRO C 1 322 ? -30.159 92.998  57.920  1.00 17.83  ? 322 PRO C CB  1 
ATOM   9193  C  CG  . PRO C 1 322 ? -29.969 93.573  59.281  1.00 18.91  ? 322 PRO C CG  1 
ATOM   9194  C  CD  . PRO C 1 322 ? -29.975 92.344  60.150  1.00 18.29  ? 322 PRO C CD  1 
ATOM   9195  N  N   . MET C 1 323 ? -27.463 91.980  56.263  1.00 20.00  ? 323 MET C N   1 
ATOM   9196  C  CA  . MET C 1 323 ? -26.146 92.326  55.738  1.00 19.04  ? 323 MET C CA  1 
ATOM   9197  C  C   . MET C 1 323 ? -26.338 93.212  54.515  1.00 19.41  ? 323 MET C C   1 
ATOM   9198  O  O   . MET C 1 323 ? -27.094 92.864  53.608  1.00 19.04  ? 323 MET C O   1 
ATOM   9199  C  CB  . MET C 1 323 ? -25.384 91.064  55.335  1.00 18.70  ? 323 MET C CB  1 
ATOM   9200  C  CG  . MET C 1 323 ? -24.010 91.315  54.728  1.00 18.26  ? 323 MET C CG  1 
ATOM   9201  S  SD  . MET C 1 323 ? -23.335 89.806  54.009  1.00 24.96  ? 323 MET C SD  1 
ATOM   9202  C  CE  . MET C 1 323 ? -21.751 90.339  53.391  1.00 24.17  ? 323 MET C CE  1 
ATOM   9203  N  N   . TYR C 1 324 ? -25.694 94.373  54.531  1.00 18.09  ? 324 TYR C N   1 
ATOM   9204  C  CA  . TYR C 1 324 ? -25.755 95.304  53.420  1.00 17.90  ? 324 TYR C CA  1 
ATOM   9205  C  C   . TYR C 1 324 ? -24.410 95.264  52.721  1.00 20.17  ? 324 TYR C C   1 
ATOM   9206  O  O   . TYR C 1 324 ? -23.382 95.538  53.337  1.00 19.10  ? 324 TYR C O   1 
ATOM   9207  C  CB  . TYR C 1 324 ? -26.017 96.720  53.888  1.00 19.71  ? 324 TYR C CB  1 
ATOM   9208  C  CG  . TYR C 1 324 ? -26.096 97.663  52.724  1.00 24.86  ? 324 TYR C CG  1 
ATOM   9209  C  CD1 . TYR C 1 324 ? -27.214 97.667  51.895  1.00 26.70  ? 324 TYR C CD1 1 
ATOM   9210  C  CD2 . TYR C 1 324 ? -25.036 98.509  52.413  1.00 27.42  ? 324 TYR C CD2 1 
ATOM   9211  C  CE1 . TYR C 1 324 ? -27.281 98.487  50.779  1.00 31.54  ? 324 TYR C CE1 1 
ATOM   9212  C  CE2 . TYR C 1 324 ? -25.086 99.334  51.297  1.00 32.15  ? 324 TYR C CE2 1 
ATOM   9213  C  CZ  . TYR C 1 324 ? -26.214 99.318  50.480  1.00 33.76  ? 324 TYR C CZ  1 
ATOM   9214  O  OH  . TYR C 1 324 ? -26.281 100.107 49.350  1.00 41.54  ? 324 TYR C OH  1 
ATOM   9215  N  N   . LYS C 1 325 ? -24.430 95.011  51.419  1.00 18.96  ? 325 LYS C N   1 
ATOM   9216  C  CA  . LYS C 1 325 ? -23.209 94.887  50.650  1.00 17.70  ? 325 LYS C CA  1 
ATOM   9217  C  C   . LYS C 1 325 ? -22.771 96.160  49.975  1.00 17.71  ? 325 LYS C C   1 
ATOM   9218  O  O   . LYS C 1 325 ? -23.292 96.513  48.925  1.00 23.11  ? 325 LYS C O   1 
ATOM   9219  C  CB  . LYS C 1 325 ? -23.388 93.777  49.629  1.00 12.81  ? 325 LYS C CB  1 
ATOM   9220  C  CG  . LYS C 1 325 ? -24.075 92.572  50.218  1.00 12.93  ? 325 LYS C CG  1 
ATOM   9221  C  CD  . LYS C 1 325 ? -24.345 91.509  49.183  1.00 13.31  ? 325 LYS C CD  1 
ATOM   9222  C  CE  . LYS C 1 325 ? -25.168 90.396  49.762  1.00 15.16  ? 325 LYS C CE  1 
ATOM   9223  N  NZ  . LYS C 1 325 ? -25.416 89.325  48.759  1.00 20.17  ? 325 LYS C NZ  1 
ATOM   9224  N  N   . TRP C 1 326 ? -21.814 96.857  50.572  1.00 20.47  ? 326 TRP C N   1 
ATOM   9225  C  CA  . TRP C 1 326 ? -21.317 98.091  49.982  1.00 22.53  ? 326 TRP C CA  1 
ATOM   9226  C  C   . TRP C 1 326 ? -20.608 97.768  48.689  1.00 27.25  ? 326 TRP C C   1 
ATOM   9227  O  O   . TRP C 1 326 ? -20.806 98.440  47.686  1.00 32.76  ? 326 TRP C O   1 
ATOM   9228  C  CB  . TRP C 1 326 ? -20.349 98.784  50.913  1.00 21.71  ? 326 TRP C CB  1 
ATOM   9229  C  CG  . TRP C 1 326 ? -21.008 99.291  52.102  1.00 29.53  ? 326 TRP C CG  1 
ATOM   9230  C  CD1 . TRP C 1 326 ? -21.020 98.716  53.332  1.00 28.63  ? 326 TRP C CD1 1 
ATOM   9231  C  CD2 . TRP C 1 326 ? -21.813 100.468 52.193  1.00 33.86  ? 326 TRP C CD2 1 
ATOM   9232  N  NE1 . TRP C 1 326 ? -21.786 99.457  54.188  1.00 31.44  ? 326 TRP C NE1 1 
ATOM   9233  C  CE2 . TRP C 1 326 ? -22.287 100.541 53.517  1.00 34.73  ? 326 TRP C CE2 1 
ATOM   9234  C  CE3 . TRP C 1 326 ? -22.184 101.469 51.282  1.00 34.61  ? 326 TRP C CE3 1 
ATOM   9235  C  CZ2 . TRP C 1 326 ? -23.119 101.578 53.960  1.00 37.92  ? 326 TRP C CZ2 1 
ATOM   9236  C  CZ3 . TRP C 1 326 ? -23.010 102.495 51.718  1.00 36.16  ? 326 TRP C CZ3 1 
ATOM   9237  C  CH2 . TRP C 1 326 ? -23.469 102.541 53.048  1.00 38.58  ? 326 TRP C CH2 1 
ATOM   9238  N  N   . THR C 1 327 ? -19.745 96.763  48.740  1.00 26.06  ? 327 THR C N   1 
ATOM   9239  C  CA  . THR C 1 327 ? -18.998 96.304  47.585  1.00 23.13  ? 327 THR C CA  1 
ATOM   9240  C  C   . THR C 1 327 ? -19.017 94.799  47.758  1.00 25.14  ? 327 THR C C   1 
ATOM   9241  O  O   . THR C 1 327 ? -19.516 94.299  48.763  1.00 31.39  ? 327 THR C O   1 
ATOM   9242  C  CB  . THR C 1 327 ? -17.533 96.804  47.600  1.00 22.67  ? 327 THR C CB  1 
ATOM   9243  O  OG1 . THR C 1 327 ? -16.782 96.095  48.593  1.00 26.61  ? 327 THR C OG1 1 
ATOM   9244  C  CG2 . THR C 1 327 ? -17.474 98.275  47.904  1.00 19.82  ? 327 THR C CG2 1 
ATOM   9245  N  N   . PRO C 1 328 ? -18.464 94.049  46.802  1.00 26.91  ? 328 PRO C N   1 
ATOM   9246  C  CA  . PRO C 1 328 ? -18.459 92.588  46.920  1.00 27.04  ? 328 PRO C CA  1 
ATOM   9247  C  C   . PRO C 1 328 ? -17.683 92.044  48.119  1.00 27.46  ? 328 PRO C C   1 
ATOM   9248  O  O   . PRO C 1 328 ? -17.978 90.944  48.589  1.00 30.29  ? 328 PRO C O   1 
ATOM   9249  C  CB  . PRO C 1 328 ? -17.812 92.141  45.614  1.00 28.93  ? 328 PRO C CB  1 
ATOM   9250  C  CG  . PRO C 1 328 ? -18.185 93.228  44.676  1.00 29.43  ? 328 PRO C CG  1 
ATOM   9251  C  CD  . PRO C 1 328 ? -17.963 94.469  45.486  1.00 25.59  ? 328 PRO C CD  1 
ATOM   9252  N  N   . ILE C 1 329 ? -16.689 92.790  48.602  1.00 24.38  ? 329 ILE C N   1 
ATOM   9253  C  CA  . ILE C 1 329 ? -15.900 92.327  49.743  1.00 22.87  ? 329 ILE C CA  1 
ATOM   9254  C  C   . ILE C 1 329 ? -16.091 93.137  51.021  1.00 20.89  ? 329 ILE C C   1 
ATOM   9255  O  O   . ILE C 1 329 ? -15.467 92.835  52.034  1.00 25.73  ? 329 ILE C O   1 
ATOM   9256  C  CB  . ILE C 1 329 ? -14.382 92.290  49.436  1.00 21.65  ? 329 ILE C CB  1 
ATOM   9257  C  CG1 . ILE C 1 329 ? -13.884 93.698  49.121  1.00 20.50  ? 329 ILE C CG1 1 
ATOM   9258  C  CG2 . ILE C 1 329 ? -14.088 91.309  48.304  1.00 17.34  ? 329 ILE C CG2 1 
ATOM   9259  C  CD1 . ILE C 1 329 ? -12.393 93.814  49.043  1.00 27.71  ? 329 ILE C CD1 1 
ATOM   9260  N  N   . MET C 1 330 ? -16.907 94.183  50.983  1.00 17.33  ? 330 MET C N   1 
ATOM   9261  C  CA  . MET C 1 330 ? -17.106 94.972  52.189  1.00 17.64  ? 330 MET C CA  1 
ATOM   9262  C  C   . MET C 1 330 ? -18.580 95.153  52.470  1.00 18.49  ? 330 MET C C   1 
ATOM   9263  O  O   . MET C 1 330 ? -19.371 95.408  51.558  1.00 20.14  ? 330 MET C O   1 
ATOM   9264  C  CB  . MET C 1 330 ? -16.416 96.318  52.079  1.00 15.33  ? 330 MET C CB  1 
ATOM   9265  C  CG  . MET C 1 330 ? -16.544 97.160  53.319  1.00 20.39  ? 330 MET C CG  1 
ATOM   9266  S  SD  . MET C 1 330 ? -16.137 98.876  53.001  1.00 29.27  ? 330 MET C SD  1 
ATOM   9267  C  CE  . MET C 1 330 ? -15.266 99.231  54.347  1.00 27.49  ? 330 MET C CE  1 
ATOM   9268  N  N   . SER C 1 331 ? -18.955 95.014  53.732  1.00 17.94  ? 331 SER C N   1 
ATOM   9269  C  CA  . SER C 1 331 ? -20.346 95.150  54.101  1.00 16.61  ? 331 SER C CA  1 
ATOM   9270  C  C   . SER C 1 331 ? -20.511 95.624  55.518  1.00 17.49  ? 331 SER C C   1 
ATOM   9271  O  O   . SER C 1 331 ? -19.546 95.736  56.271  1.00 19.84  ? 331 SER C O   1 
ATOM   9272  C  CB  . SER C 1 331 ? -21.041 93.810  53.965  1.00 16.05  ? 331 SER C CB  1 
ATOM   9273  O  OG  . SER C 1 331 ? -20.400 92.864  54.790  1.00 17.32  ? 331 SER C OG  1 
ATOM   9274  N  N   . THR C 1 332 ? -21.748 95.938  55.860  1.00 18.01  ? 332 THR C N   1 
ATOM   9275  C  CA  . THR C 1 332 ? -22.089 96.367  57.202  1.00 19.49  ? 332 THR C CA  1 
ATOM   9276  C  C   . THR C 1 332 ? -23.116 95.364  57.690  1.00 20.18  ? 332 THR C C   1 
ATOM   9277  O  O   . THR C 1 332 ? -24.017 94.989  56.941  1.00 19.66  ? 332 THR C O   1 
ATOM   9278  C  CB  . THR C 1 332 ? -22.692 97.763  57.208  1.00 18.15  ? 332 THR C CB  1 
ATOM   9279  O  OG1 . THR C 1 332 ? -21.673 98.697  56.873  1.00 20.47  ? 332 THR C OG1 1 
ATOM   9280  C  CG2 . THR C 1 332 ? -23.223 98.106  58.561  1.00 16.59  ? 332 THR C CG2 1 
ATOM   9281  N  N   . LEU C 1 333 ? -22.913 94.851  58.897  1.00 21.69  ? 333 LEU C N   1 
ATOM   9282  C  CA  . LEU C 1 333 ? -23.835 93.888  59.481  1.00 21.32  ? 333 LEU C CA  1 
ATOM   9283  C  C   . LEU C 1 333 ? -24.460 94.436  60.730  1.00 20.58  ? 333 LEU C C   1 
ATOM   9284  O  O   . LEU C 1 333 ? -23.839 95.194  61.473  1.00 20.55  ? 333 LEU C O   1 
ATOM   9285  C  CB  . LEU C 1 333 ? -23.125 92.592  59.841  1.00 18.03  ? 333 LEU C CB  1 
ATOM   9286  C  CG  . LEU C 1 333 ? -22.704 91.722  58.674  1.00 17.34  ? 333 LEU C CG  1 
ATOM   9287  C  CD1 . LEU C 1 333 ? -21.216 91.854  58.495  1.00 23.54  ? 333 LEU C CD1 1 
ATOM   9288  C  CD2 . LEU C 1 333 ? -23.068 90.298  58.965  1.00 21.85  ? 333 LEU C CD2 1 
ATOM   9289  N  N   . LEU C 1 334 ? -25.702 94.060  60.955  1.00 20.36  ? 334 LEU C N   1 
ATOM   9290  C  CA  . LEU C 1 334 ? -26.399 94.476  62.153  1.00 22.95  ? 334 LEU C CA  1 
ATOM   9291  C  C   . LEU C 1 334 ? -27.023 93.216  62.678  1.00 23.25  ? 334 LEU C C   1 
ATOM   9292  O  O   . LEU C 1 334 ? -27.509 92.393  61.903  1.00 24.24  ? 334 LEU C O   1 
ATOM   9293  C  CB  . LEU C 1 334 ? -27.511 95.478  61.848  1.00 24.63  ? 334 LEU C CB  1 
ATOM   9294  C  CG  . LEU C 1 334 ? -28.462 95.777  63.015  1.00 26.16  ? 334 LEU C CG  1 
ATOM   9295  C  CD1 . LEU C 1 334 ? -27.849 96.833  63.912  1.00 24.67  ? 334 LEU C CD1 1 
ATOM   9296  C  CD2 . LEU C 1 334 ? -29.803 96.260  62.480  1.00 28.13  ? 334 LEU C CD2 1 
ATOM   9297  N  N   . GLU C 1 335 ? -26.967 93.032  63.987  1.00 21.28  ? 335 GLU C N   1 
ATOM   9298  C  CA  . GLU C 1 335 ? -27.585 91.864  64.582  1.00 19.27  ? 335 GLU C CA  1 
ATOM   9299  C  C   . GLU C 1 335 ? -28.368 92.299  65.794  1.00 19.40  ? 335 GLU C C   1 
ATOM   9300  O  O   . GLU C 1 335 ? -27.851 93.016  66.652  1.00 18.76  ? 335 GLU C O   1 
ATOM   9301  C  CB  . GLU C 1 335 ? -26.547 90.830  64.995  1.00 18.50  ? 335 GLU C CB  1 
ATOM   9302  C  CG  . GLU C 1 335 ? -27.179 89.635  65.671  1.00 17.34  ? 335 GLU C CG  1 
ATOM   9303  C  CD  . GLU C 1 335 ? -26.223 88.501  65.840  1.00 19.48  ? 335 GLU C CD  1 
ATOM   9304  O  OE1 . GLU C 1 335 ? -25.460 88.488  66.827  1.00 22.77  ? 335 GLU C OE1 1 
ATOM   9305  O  OE2 . GLU C 1 335 ? -26.247 87.611  64.985  1.00 19.72  ? 335 GLU C OE2 1 
ATOM   9306  N  N   . VAL C 1 336 ? -29.636 91.927  65.827  1.00 18.02  ? 336 VAL C N   1 
ATOM   9307  C  CA  . VAL C 1 336 ? -30.476 92.264  66.960  1.00 17.67  ? 336 VAL C CA  1 
ATOM   9308  C  C   . VAL C 1 336 ? -31.080 90.958  67.463  1.00 17.83  ? 336 VAL C C   1 
ATOM   9309  O  O   . VAL C 1 336 ? -31.685 90.212  66.695  1.00 17.41  ? 336 VAL C O   1 
ATOM   9310  C  CB  . VAL C 1 336 ? -31.575 93.269  66.571  1.00 19.68  ? 336 VAL C CB  1 
ATOM   9311  C  CG1 . VAL C 1 336 ? -32.416 93.613  67.783  1.00 21.44  ? 336 VAL C CG1 1 
ATOM   9312  C  CG2 . VAL C 1 336 ? -30.946 94.521  66.006  1.00 20.30  ? 336 VAL C CG2 1 
ATOM   9313  N  N   . GLY C 1 337 ? -30.867 90.663  68.739  1.00 17.47  ? 337 GLY C N   1 
ATOM   9314  C  CA  . GLY C 1 337 ? -31.386 89.436  69.310  1.00 17.50  ? 337 GLY C CA  1 
ATOM   9315  C  C   . GLY C 1 337 ? -32.041 89.672  70.660  1.00 22.00  ? 337 GLY C C   1 
ATOM   9316  O  O   . GLY C 1 337 ? -31.585 90.507  71.455  1.00 18.72  ? 337 GLY C O   1 
ATOM   9317  N  N   . TYR C 1 338 ? -33.098 88.907  70.922  1.00 21.63  ? 338 TYR C N   1 
ATOM   9318  C  CA  . TYR C 1 338 ? -33.857 89.017  72.149  1.00 21.31  ? 338 TYR C CA  1 
ATOM   9319  C  C   . TYR C 1 338 ? -34.108 87.657  72.759  1.00 21.40  ? 338 TYR C C   1 
ATOM   9320  O  O   . TYR C 1 338 ? -34.540 86.725  72.076  1.00 20.59  ? 338 TYR C O   1 
ATOM   9321  C  CB  . TYR C 1 338 ? -35.194 89.709  71.872  1.00 24.10  ? 338 TYR C CB  1 
ATOM   9322  C  CG  . TYR C 1 338 ? -36.149 89.726  73.050  1.00 31.42  ? 338 TYR C CG  1 
ATOM   9323  C  CD1 . TYR C 1 338 ? -36.006 90.668  74.077  1.00 31.93  ? 338 TYR C CD1 1 
ATOM   9324  C  CD2 . TYR C 1 338 ? -37.198 88.801  73.142  1.00 34.01  ? 338 TYR C CD2 1 
ATOM   9325  C  CE1 . TYR C 1 338 ? -36.881 90.688  75.168  1.00 32.90  ? 338 TYR C CE1 1 
ATOM   9326  C  CE2 . TYR C 1 338 ? -38.082 88.816  74.230  1.00 37.70  ? 338 TYR C CE2 1 
ATOM   9327  C  CZ  . TYR C 1 338 ? -37.914 89.761  75.239  1.00 37.83  ? 338 TYR C CZ  1 
ATOM   9328  O  OH  . TYR C 1 338 ? -38.774 89.778  76.314  1.00 43.82  ? 338 TYR C OH  1 
ATOM   9329  N  N   . ASP C 1 339 ? -33.863 87.569  74.058  1.00 20.79  ? 339 ASP C N   1 
ATOM   9330  C  CA  . ASP C 1 339 ? -34.062 86.343  74.819  1.00 20.34  ? 339 ASP C CA  1 
ATOM   9331  C  C   . ASP C 1 339 ? -34.975 86.595  75.987  1.00 19.78  ? 339 ASP C C   1 
ATOM   9332  O  O   . ASP C 1 339 ? -34.852 87.606  76.674  1.00 19.19  ? 339 ASP C O   1 
ATOM   9333  C  CB  . ASP C 1 339 ? -32.749 85.851  75.405  1.00 19.96  ? 339 ASP C CB  1 
ATOM   9334  C  CG  . ASP C 1 339 ? -31.847 85.271  74.378  1.00 19.93  ? 339 ASP C CG  1 
ATOM   9335  O  OD1 . ASP C 1 339 ? -32.194 84.209  73.830  1.00 17.77  ? 339 ASP C OD1 1 
ATOM   9336  O  OD2 . ASP C 1 339 ? -30.785 85.873  74.139  1.00 18.64  ? 339 ASP C OD2 1 
ATOM   9337  N  N   . ASN C 1 340 ? -35.876 85.663  76.232  1.00 20.81  ? 340 ASN C N   1 
ATOM   9338  C  CA  . ASN C 1 340 ? -36.758 85.770  77.369  1.00 19.15  ? 340 ASN C CA  1 
ATOM   9339  C  C   . ASN C 1 340 ? -36.877 84.373  77.953  1.00 21.24  ? 340 ASN C C   1 
ATOM   9340  O  O   . ASN C 1 340 ? -37.341 83.459  77.268  1.00 23.24  ? 340 ASN C O   1 
ATOM   9341  C  CB  . ASN C 1 340 ? -38.123 86.297  76.960  1.00 21.34  ? 340 ASN C CB  1 
ATOM   9342  C  CG  . ASN C 1 340 ? -39.027 86.527  78.159  1.00 26.07  ? 340 ASN C CG  1 
ATOM   9343  O  OD1 . ASN C 1 340 ? -39.583 85.583  78.719  1.00 25.33  ? 340 ASN C OD1 1 
ATOM   9344  N  ND2 . ASN C 1 340 ? -39.145 87.780  78.583  1.00 23.19  ? 340 ASN C ND2 1 
ATOM   9345  N  N   . VAL C 1 341 ? -36.375 84.194  79.176  1.00 21.79  ? 341 VAL C N   1 
ATOM   9346  C  CA  . VAL C 1 341 ? -36.418 82.899  79.866  1.00 22.00  ? 341 VAL C CA  1 
ATOM   9347  C  C   . VAL C 1 341 ? -37.239 82.958  81.168  1.00 25.68  ? 341 VAL C C   1 
ATOM   9348  O  O   . VAL C 1 341 ? -36.986 83.798  82.047  1.00 24.66  ? 341 VAL C O   1 
ATOM   9349  C  CB  . VAL C 1 341 ? -35.000 82.394  80.247  1.00 18.57  ? 341 VAL C CB  1 
ATOM   9350  C  CG1 . VAL C 1 341 ? -35.016 80.890  80.405  1.00 17.44  ? 341 VAL C CG1 1 
ATOM   9351  C  CG2 . VAL C 1 341 ? -33.972 82.821  79.236  1.00 17.43  ? 341 VAL C CG2 1 
ATOM   9352  N  N   . LYS C 1 342 ? -38.199 82.049  81.297  1.00 26.26  ? 342 LYS C N   1 
ATOM   9353  C  CA  . LYS C 1 342 ? -39.043 81.970  82.486  1.00 26.94  ? 342 LYS C CA  1 
ATOM   9354  C  C   . LYS C 1 342 ? -38.653 80.726  83.299  1.00 25.37  ? 342 LYS C C   1 
ATOM   9355  O  O   . LYS C 1 342 ? -38.547 79.623  82.756  1.00 26.20  ? 342 LYS C O   1 
ATOM   9356  C  CB  . LYS C 1 342 ? -40.518 81.892  82.067  1.00 28.40  ? 342 LYS C CB  1 
ATOM   9357  C  CG  . LYS C 1 342 ? -41.515 82.096  83.186  1.00 32.54  ? 342 LYS C CG  1 
ATOM   9358  C  CD  . LYS C 1 342 ? -42.143 80.789  83.636  1.00 43.39  ? 342 LYS C CD  1 
ATOM   9359  C  CE  . LYS C 1 342 ? -43.195 80.299  82.663  1.00 48.49  ? 342 LYS C CE  1 
ATOM   9360  N  NZ  . LYS C 1 342 ? -43.755 78.978  83.077  1.00 55.02  ? 342 LYS C NZ  1 
ATOM   9361  N  N   . SER C 1 343 ? -38.392 80.913  84.586  1.00 24.93  ? 343 SER C N   1 
ATOM   9362  C  CA  . SER C 1 343 ? -38.037 79.805  85.468  1.00 23.74  ? 343 SER C CA  1 
ATOM   9363  C  C   . SER C 1 343 ? -39.293 78.990  85.764  1.00 22.64  ? 343 SER C C   1 
ATOM   9364  O  O   . SER C 1 343 ? -40.280 79.526  86.237  1.00 22.55  ? 343 SER C O   1 
ATOM   9365  C  CB  . SER C 1 343 ? -37.454 80.345  86.780  1.00 23.12  ? 343 SER C CB  1 
ATOM   9366  O  OG  . SER C 1 343 ? -37.183 79.303  87.703  1.00 23.12  ? 343 SER C OG  1 
ATOM   9367  N  N   . GLN C 1 344 ? -39.266 77.699  85.492  1.00 23.48  ? 344 GLN C N   1 
ATOM   9368  C  CA  . GLN C 1 344 ? -40.440 76.883  85.764  1.00 25.12  ? 344 GLN C CA  1 
ATOM   9369  C  C   . GLN C 1 344 ? -40.687 76.860  87.263  1.00 28.58  ? 344 GLN C C   1 
ATOM   9370  O  O   . GLN C 1 344 ? -41.829 76.881  87.716  1.00 30.59  ? 344 GLN C O   1 
ATOM   9371  C  CB  . GLN C 1 344 ? -40.246 75.451  85.270  1.00 22.90  ? 344 GLN C CB  1 
ATOM   9372  C  CG  . GLN C 1 344 ? -41.480 74.599  85.418  1.00 18.97  ? 344 GLN C CG  1 
ATOM   9373  C  CD  . GLN C 1 344 ? -41.287 73.162  84.974  1.00 19.57  ? 344 GLN C CD  1 
ATOM   9374  O  OE1 . GLN C 1 344 ? -40.170 72.647  84.927  1.00 23.32  ? 344 GLN C OE1 1 
ATOM   9375  N  NE2 . GLN C 1 344 ? -42.381 72.495  84.679  1.00 18.48  ? 344 GLN C NE2 1 
ATOM   9376  N  N   . GLN C 1 345 ? -39.596 76.855  88.021  1.00 30.45  ? 345 GLN C N   1 
ATOM   9377  C  CA  . GLN C 1 345 ? -39.635 76.821  89.473  1.00 30.07  ? 345 GLN C CA  1 
ATOM   9378  C  C   . GLN C 1 345 ? -40.231 78.065  90.127  1.00 31.26  ? 345 GLN C C   1 
ATOM   9379  O  O   . GLN C 1 345 ? -41.195 77.968  90.879  1.00 34.18  ? 345 GLN C O   1 
ATOM   9380  C  CB  . GLN C 1 345 ? -38.224 76.601  90.026  1.00 30.49  ? 345 GLN C CB  1 
ATOM   9381  C  CG  . GLN C 1 345 ? -38.193 76.151  91.480  1.00 32.97  ? 345 GLN C CG  1 
ATOM   9382  C  CD  . GLN C 1 345 ? -36.819 76.257  92.111  1.00 35.91  ? 345 GLN C CD  1 
ATOM   9383  O  OE1 . GLN C 1 345 ? -35.810 75.847  91.536  1.00 37.10  ? 345 GLN C OE1 1 
ATOM   9384  N  NE2 . GLN C 1 345 ? -36.776 76.812  93.304  1.00 41.51  ? 345 GLN C NE2 1 
ATOM   9385  N  N   . THR C 1 346 ? -39.642 79.228  89.875  1.00 31.02  ? 346 THR C N   1 
ATOM   9386  C  CA  . THR C 1 346 ? -40.131 80.450  90.506  1.00 28.21  ? 346 THR C CA  1 
ATOM   9387  C  C   . THR C 1 346 ? -41.146 81.243  89.700  1.00 28.97  ? 346 THR C C   1 
ATOM   9388  O  O   . THR C 1 346 ? -41.797 82.130  90.241  1.00 35.26  ? 346 THR C O   1 
ATOM   9389  C  CB  . THR C 1 346 ? -38.985 81.410  90.872  1.00 27.74  ? 346 THR C CB  1 
ATOM   9390  O  OG1 . THR C 1 346 ? -38.654 82.196  89.721  1.00 29.08  ? 346 THR C OG1 1 
ATOM   9391  C  CG2 . THR C 1 346 ? -37.739 80.634  91.361  1.00 29.17  ? 346 THR C CG2 1 
ATOM   9392  N  N   . GLY C 1 347 ? -41.235 80.982  88.402  1.00 30.76  ? 347 GLY C N   1 
ATOM   9393  C  CA  . GLY C 1 347 ? -42.179 81.714  87.575  1.00 26.12  ? 347 GLY C CA  1 
ATOM   9394  C  C   . GLY C 1 347 ? -41.694 83.080  87.116  1.00 27.75  ? 347 GLY C C   1 
ATOM   9395  O  O   . GLY C 1 347 ? -42.391 83.772  86.382  1.00 30.50  ? 347 GLY C O   1 
ATOM   9396  N  N   . ASP C 1 348 ? -40.517 83.488  87.565  1.00 28.06  ? 348 ASP C N   1 
ATOM   9397  C  CA  . ASP C 1 348 ? -39.963 84.770  87.165  1.00 31.50  ? 348 ASP C CA  1 
ATOM   9398  C  C   . ASP C 1 348 ? -39.368 84.721  85.756  1.00 32.07  ? 348 ASP C C   1 
ATOM   9399  O  O   . ASP C 1 348 ? -39.055 83.649  85.231  1.00 32.41  ? 348 ASP C O   1 
ATOM   9400  C  CB  . ASP C 1 348 ? -38.892 85.205  88.159  1.00 35.97  ? 348 ASP C CB  1 
ATOM   9401  C  CG  . ASP C 1 348 ? -39.461 85.558  89.508  1.00 39.59  ? 348 ASP C CG  1 
ATOM   9402  O  OD1 . ASP C 1 348 ? -40.246 86.525  89.582  1.00 42.21  ? 348 ASP C OD1 1 
ATOM   9403  O  OD2 . ASP C 1 348 ? -39.108 84.879  90.493  1.00 40.39  ? 348 ASP C OD2 1 
ATOM   9404  N  N   . ARG C 1 349 ? -39.167 85.890  85.164  1.00 30.26  ? 349 ARG C N   1 
ATOM   9405  C  CA  . ARG C 1 349 ? -38.611 85.960  83.824  1.00 29.56  ? 349 ARG C CA  1 
ATOM   9406  C  C   . ARG C 1 349 ? -37.350 86.787  83.724  1.00 27.94  ? 349 ARG C C   1 
ATOM   9407  O  O   . ARG C 1 349 ? -37.191 87.792  84.410  1.00 29.32  ? 349 ARG C O   1 
ATOM   9408  C  CB  . ARG C 1 349 ? -39.649 86.500  82.846  1.00 29.69  ? 349 ARG C CB  1 
ATOM   9409  C  CG  . ARG C 1 349 ? -40.780 85.533  82.559  1.00 37.20  ? 349 ARG C CG  1 
ATOM   9410  C  CD  . ARG C 1 349 ? -41.788 86.132  81.597  1.00 45.01  ? 349 ARG C CD  1 
ATOM   9411  N  NE  . ARG C 1 349 ? -42.878 85.212  81.274  1.00 54.83  ? 349 ARG C NE  1 
ATOM   9412  C  CZ  . ARG C 1 349 ? -42.801 84.220  80.382  1.00 62.37  ? 349 ARG C CZ  1 
ATOM   9413  N  NH1 . ARG C 1 349 ? -41.673 83.990  79.705  1.00 64.59  ? 349 ARG C NH1 1 
ATOM   9414  N  NH2 . ARG C 1 349 ? -43.870 83.461  80.146  1.00 67.59  ? 349 ARG C NH2 1 
ATOM   9415  N  N   . ASN C 1 350 ? -36.435 86.325  82.887  1.00 27.23  ? 350 ASN C N   1 
ATOM   9416  C  CA  . ASN C 1 350 ? -35.184 87.019  82.638  1.00 24.53  ? 350 ASN C CA  1 
ATOM   9417  C  C   . ASN C 1 350 ? -35.237 87.403  81.173  1.00 25.83  ? 350 ASN C C   1 
ATOM   9418  O  O   . ASN C 1 350 ? -35.755 86.647  80.341  1.00 26.85  ? 350 ASN C O   1 
ATOM   9419  C  CB  . ASN C 1 350 ? -33.998 86.082  82.829  1.00 22.13  ? 350 ASN C CB  1 
ATOM   9420  C  CG  . ASN C 1 350 ? -33.682 85.834  84.271  1.00 23.64  ? 350 ASN C CG  1 
ATOM   9421  O  OD1 . ASN C 1 350 ? -34.071 86.610  85.141  1.00 29.26  ? 350 ASN C OD1 1 
ATOM   9422  N  ND2 . ASN C 1 350 ? -32.972 84.754  84.544  1.00 21.01  ? 350 ASN C ND2 1 
ATOM   9423  N  N   . ASN C 1 351 ? -34.742 88.582  80.846  1.00 25.13  ? 351 ASN C N   1 
ATOM   9424  C  CA  . ASN C 1 351 ? -34.715 88.982  79.456  1.00 28.90  ? 351 ASN C CA  1 
ATOM   9425  C  C   . ASN C 1 351 ? -33.511 89.837  79.127  1.00 27.92  ? 351 ASN C C   1 
ATOM   9426  O  O   . ASN C 1 351 ? -32.884 90.431  80.012  1.00 26.95  ? 351 ASN C O   1 
ATOM   9427  C  CB  . ASN C 1 351 ? -36.036 89.625  78.999  1.00 34.50  ? 351 ASN C CB  1 
ATOM   9428  C  CG  . ASN C 1 351 ? -36.303 90.958  79.641  1.00 41.85  ? 351 ASN C CG  1 
ATOM   9429  O  OD1 . ASN C 1 351 ? -35.551 91.920  79.464  1.00 45.22  ? 351 ASN C OD1 1 
ATOM   9430  N  ND2 . ASN C 1 351 ? -37.413 91.041  80.356  1.00 50.87  ? 351 ASN C ND2 1 
ATOM   9431  N  N   . GLN C 1 352 ? -33.131 89.793  77.856  1.00 26.46  ? 352 GLN C N   1 
ATOM   9432  C  CA  . GLN C 1 352 ? -31.990 90.536  77.351  1.00 23.52  ? 352 GLN C CA  1 
ATOM   9433  C  C   . GLN C 1 352 ? -32.180 90.786  75.883  1.00 22.83  ? 352 GLN C C   1 
ATOM   9434  O  O   . GLN C 1 352 ? -32.822 89.996  75.186  1.00 21.81  ? 352 GLN C O   1 
ATOM   9435  C  CB  . GLN C 1 352 ? -30.698 89.724  77.504  1.00 20.10  ? 352 GLN C CB  1 
ATOM   9436  C  CG  . GLN C 1 352 ? -29.467 90.404  76.897  1.00 20.54  ? 352 GLN C CG  1 
ATOM   9437  C  CD  . GLN C 1 352 ? -28.208 89.588  77.040  1.00 22.56  ? 352 GLN C CD  1 
ATOM   9438  O  OE1 . GLN C 1 352 ? -27.531 89.659  78.058  1.00 23.35  ? 352 GLN C OE1 1 
ATOM   9439  N  NE2 . GLN C 1 352 ? -27.879 88.811  76.020  1.00 23.09  ? 352 GLN C NE2 1 
ATOM   9440  N  N   . TYR C 1 353 ? -31.688 91.929  75.432  1.00 24.45  ? 353 TYR C N   1 
ATOM   9441  C  CA  . TYR C 1 353 ? -31.708 92.234  74.025  1.00 28.51  ? 353 TYR C CA  1 
ATOM   9442  C  C   . TYR C 1 353 ? -30.350 92.824  73.748  1.00 26.56  ? 353 TYR C C   1 
ATOM   9443  O  O   . TYR C 1 353 ? -29.761 93.494  74.609  1.00 23.82  ? 353 TYR C O   1 
ATOM   9444  C  CB  . TYR C 1 353 ? -32.859 93.151  73.630  1.00 38.86  ? 353 TYR C CB  1 
ATOM   9445  C  CG  . TYR C 1 353 ? -32.749 94.576  74.049  1.00 51.47  ? 353 TYR C CG  1 
ATOM   9446  C  CD1 . TYR C 1 353 ? -31.997 95.484  73.297  1.00 59.73  ? 353 TYR C CD1 1 
ATOM   9447  C  CD2 . TYR C 1 353 ? -33.464 95.052  75.146  1.00 60.09  ? 353 TYR C CD2 1 
ATOM   9448  C  CE1 . TYR C 1 353 ? -31.962 96.846  73.622  1.00 69.33  ? 353 TYR C CE1 1 
ATOM   9449  C  CE2 . TYR C 1 353 ? -33.442 96.413  75.487  1.00 70.31  ? 353 TYR C CE2 1 
ATOM   9450  C  CZ  . TYR C 1 353 ? -32.691 97.309  74.719  1.00 72.10  ? 353 TYR C CZ  1 
ATOM   9451  O  OH  . TYR C 1 353 ? -32.684 98.657  75.035  1.00 75.55  ? 353 TYR C OH  1 
ATOM   9452  N  N   . LYS C 1 354 ? -29.776 92.435  72.623  1.00 24.84  ? 354 LYS C N   1 
ATOM   9453  C  CA  . LYS C 1 354 ? -28.470 92.948  72.272  1.00 25.12  ? 354 LYS C CA  1 
ATOM   9454  C  C   . LYS C 1 354 ? -28.502 93.433  70.826  1.00 23.90  ? 354 LYS C C   1 
ATOM   9455  O  O   . LYS C 1 354 ? -29.237 92.884  69.994  1.00 24.20  ? 354 LYS C O   1 
ATOM   9456  C  CB  . LYS C 1 354 ? -27.385 91.889  72.525  1.00 22.29  ? 354 LYS C CB  1 
ATOM   9457  C  CG  . LYS C 1 354 ? -26.940 91.082  71.329  1.00 27.54  ? 354 LYS C CG  1 
ATOM   9458  C  CD  . LYS C 1 354 ? -25.431 90.980  71.354  1.00 21.86  ? 354 LYS C CD  1 
ATOM   9459  C  CE  . LYS C 1 354 ? -24.903 90.130  70.223  1.00 23.84  ? 354 LYS C CE  1 
ATOM   9460  N  NZ  . LYS C 1 354 ? -25.228 90.635  68.888  1.00 18.22  ? 354 LYS C NZ  1 
ATOM   9461  N  N   . ILE C 1 355 ? -27.786 94.521  70.567  1.00 18.93  ? 355 ILE C N   1 
ATOM   9462  C  CA  . ILE C 1 355 ? -27.715 95.119  69.243  1.00 19.54  ? 355 ILE C CA  1 
ATOM   9463  C  C   . ILE C 1 355 ? -26.233 95.193  68.884  1.00 20.48  ? 355 ILE C C   1 
ATOM   9464  O  O   . ILE C 1 355 ? -25.446 95.758  69.649  1.00 18.31  ? 355 ILE C O   1 
ATOM   9465  C  CB  . ILE C 1 355 ? -28.216 96.589  69.244  1.00 23.02  ? 355 ILE C CB  1 
ATOM   9466  C  CG1 . ILE C 1 355 ? -29.363 96.784  70.232  1.00 30.12  ? 355 ILE C CG1 1 
ATOM   9467  C  CG2 . ILE C 1 355 ? -28.662 97.002  67.838  1.00 22.19  ? 355 ILE C CG2 1 
ATOM   9468  C  CD1 . ILE C 1 355 ? -30.647 96.116  69.821  1.00 41.57  ? 355 ILE C CD1 1 
ATOM   9469  N  N   . THR C 1 356 ? -25.852 94.639  67.735  1.00 18.29  ? 356 THR C N   1 
ATOM   9470  C  CA  . THR C 1 356 ? -24.468 94.695  67.290  1.00 18.71  ? 356 THR C CA  1 
ATOM   9471  C  C   . THR C 1 356 ? -24.377 95.297  65.898  1.00 19.65  ? 356 THR C C   1 
ATOM   9472  O  O   . THR C 1 356 ? -25.194 95.004  65.015  1.00 18.65  ? 356 THR C O   1 
ATOM   9473  C  CB  . THR C 1 356 ? -23.796 93.317  67.303  1.00 17.83  ? 356 THR C CB  1 
ATOM   9474  O  OG1 . THR C 1 356 ? -23.719 92.837  68.655  1.00 17.83  ? 356 THR C OG1 1 
ATOM   9475  C  CG2 . THR C 1 356 ? -22.384 93.412  66.727  1.00 10.92  ? 356 THR C CG2 1 
ATOM   9476  N  N   . LEU C 1 357 ? -23.409 96.185  65.731  1.00 21.33  ? 357 LEU C N   1 
ATOM   9477  C  CA  . LEU C 1 357 ? -23.177 96.848  64.459  1.00 20.74  ? 357 LEU C CA  1 
ATOM   9478  C  C   . LEU C 1 357 ? -21.722 96.500  64.119  1.00 20.76  ? 357 LEU C C   1 
ATOM   9479  O  O   . LEU C 1 357 ? -20.827 96.656  64.957  1.00 17.49  ? 357 LEU C O   1 
ATOM   9480  C  CB  . LEU C 1 357 ? -23.386 98.357  64.645  1.00 26.52  ? 357 LEU C CB  1 
ATOM   9481  C  CG  . LEU C 1 357 ? -23.630 99.358  63.509  1.00 31.56  ? 357 LEU C CG  1 
ATOM   9482  C  CD1 . LEU C 1 357 ? -22.318 99.919  62.993  1.00 38.69  ? 357 LEU C CD1 1 
ATOM   9483  C  CD2 . LEU C 1 357 ? -24.457 98.717  62.400  1.00 33.56  ? 357 LEU C CD2 1 
ATOM   9484  N  N   . ALA C 1 358 ? -21.493 95.953  62.931  1.00 18.40  ? 358 ALA C N   1 
ATOM   9485  C  CA  . ALA C 1 358 ? -20.145 95.579  62.526  1.00 16.91  ? 358 ALA C CA  1 
ATOM   9486  C  C   . ALA C 1 358 ? -19.834 95.928  61.074  1.00 19.22  ? 358 ALA C C   1 
ATOM   9487  O  O   . ALA C 1 358 ? -20.697 95.850  60.205  1.00 21.54  ? 358 ALA C O   1 
ATOM   9488  C  CB  . ALA C 1 358 ? -19.937 94.089  62.740  1.00 15.11  ? 358 ALA C CB  1 
ATOM   9489  N  N   . GLN C 1 359 ? -18.602 96.360  60.836  1.00 18.96  ? 359 GLN C N   1 
ATOM   9490  C  CA  . GLN C 1 359 ? -18.126 96.669  59.498  1.00 17.88  ? 359 GLN C CA  1 
ATOM   9491  C  C   . GLN C 1 359 ? -17.286 95.441  59.166  1.00 17.70  ? 359 GLN C C   1 
ATOM   9492  O  O   . GLN C 1 359 ? -16.435 95.023  59.958  1.00 16.90  ? 359 GLN C O   1 
ATOM   9493  C  CB  . GLN C 1 359 ? -17.270 97.929  59.491  1.00 19.29  ? 359 GLN C CB  1 
ATOM   9494  C  CG  . GLN C 1 359 ? -17.072 98.494  58.090  1.00 26.81  ? 359 GLN C CG  1 
ATOM   9495  C  CD  . GLN C 1 359 ? -18.394 98.863  57.407  1.00 34.46  ? 359 GLN C CD  1 
ATOM   9496  O  OE1 . GLN C 1 359 ? -19.414 99.104  58.068  1.00 32.32  ? 359 GLN C OE1 1 
ATOM   9497  N  NE2 . GLN C 1 359 ? -18.377 98.910  56.079  1.00 37.23  ? 359 GLN C NE2 1 
ATOM   9498  N  N   . GLN C 1 360 ? -17.483 94.885  57.983  1.00 14.76  ? 360 GLN C N   1 
ATOM   9499  C  CA  . GLN C 1 360 ? -16.788 93.661  57.652  1.00 14.85  ? 360 GLN C CA  1 
ATOM   9500  C  C   . GLN C 1 360 ? -16.196 93.584  56.251  1.00 17.05  ? 360 GLN C C   1 
ATOM   9501  O  O   . GLN C 1 360 ? -16.699 94.213  55.317  1.00 19.06  ? 360 GLN C O   1 
ATOM   9502  C  CB  . GLN C 1 360 ? -17.782 92.502  57.869  1.00 11.09  ? 360 GLN C CB  1 
ATOM   9503  C  CG  . GLN C 1 360 ? -17.293 91.129  57.462  1.00 12.06  ? 360 GLN C CG  1 
ATOM   9504  C  CD  . GLN C 1 360 ? -18.362 90.065  57.585  1.00 15.94  ? 360 GLN C CD  1 
ATOM   9505  O  OE1 . GLN C 1 360 ? -18.561 89.489  58.653  1.00 18.34  ? 360 GLN C OE1 1 
ATOM   9506  N  NE2 . GLN C 1 360 ? -19.051 89.791  56.488  1.00 20.03  ? 360 GLN C NE2 1 
ATOM   9507  N  N   . TRP C 1 361 ? -15.105 92.826  56.136  1.00 17.29  ? 361 TRP C N   1 
ATOM   9508  C  CA  . TRP C 1 361 ? -14.424 92.546  54.867  1.00 14.42  ? 361 TRP C CA  1 
ATOM   9509  C  C   . TRP C 1 361 ? -14.438 91.031  54.799  1.00 15.80  ? 361 TRP C C   1 
ATOM   9510  O  O   . TRP C 1 361 ? -13.939 90.369  55.716  1.00 19.72  ? 361 TRP C O   1 
ATOM   9511  C  CB  . TRP C 1 361 ? -12.987 93.046  54.892  1.00 14.28  ? 361 TRP C CB  1 
ATOM   9512  C  CG  . TRP C 1 361 ? -12.909 94.533  54.880  1.00 21.00  ? 361 TRP C CG  1 
ATOM   9513  C  CD1 . TRP C 1 361 ? -12.783 95.338  53.788  1.00 18.27  ? 361 TRP C CD1 1 
ATOM   9514  C  CD2 . TRP C 1 361 ? -13.027 95.408  56.014  1.00 25.60  ? 361 TRP C CD2 1 
ATOM   9515  N  NE1 . TRP C 1 361 ? -12.823 96.660  54.167  1.00 21.59  ? 361 TRP C NE1 1 
ATOM   9516  C  CE2 . TRP C 1 361 ? -12.974 96.732  55.526  1.00 23.58  ? 361 TRP C CE2 1 
ATOM   9517  C  CE3 . TRP C 1 361 ? -13.179 95.201  57.396  1.00 24.80  ? 361 TRP C CE3 1 
ATOM   9518  C  CZ2 . TRP C 1 361 ? -13.069 97.845  56.368  1.00 21.43  ? 361 TRP C CZ2 1 
ATOM   9519  C  CZ3 . TRP C 1 361 ? -13.274 96.313  58.234  1.00 22.51  ? 361 TRP C CZ3 1 
ATOM   9520  C  CH2 . TRP C 1 361 ? -13.219 97.616  57.713  1.00 22.78  ? 361 TRP C CH2 1 
ATOM   9521  N  N   . GLN C 1 362 ? -15.063 90.467  53.772  1.00 14.60  ? 362 GLN C N   1 
ATOM   9522  C  CA  . GLN C 1 362 ? -15.142 89.020  53.669  1.00 13.64  ? 362 GLN C CA  1 
ATOM   9523  C  C   . GLN C 1 362 ? -14.791 88.501  52.286  1.00 17.53  ? 362 GLN C C   1 
ATOM   9524  O  O   . GLN C 1 362 ? -14.907 89.220  51.287  1.00 20.02  ? 362 GLN C O   1 
ATOM   9525  C  CB  . GLN C 1 362 ? -16.527 88.517  54.093  1.00 15.45  ? 362 GLN C CB  1 
ATOM   9526  C  CG  . GLN C 1 362 ? -17.660 88.784  53.108  1.00 14.18  ? 362 GLN C CG  1 
ATOM   9527  C  CD  . GLN C 1 362 ? -18.064 90.238  53.047  1.00 16.38  ? 362 GLN C CD  1 
ATOM   9528  O  OE1 . GLN C 1 362 ? -18.099 90.926  54.066  1.00 22.69  ? 362 GLN C OE1 1 
ATOM   9529  N  NE2 . GLN C 1 362 ? -18.385 90.716  51.850  1.00 16.47  ? 362 GLN C NE2 1 
ATOM   9530  N  N   . ALA C 1 363 ? -14.367 87.242  52.241  1.00 14.64  ? 363 ALA C N   1 
ATOM   9531  C  CA  . ALA C 1 363 ? -13.965 86.584  51.007  1.00 11.77  ? 363 ALA C CA  1 
ATOM   9532  C  C   . ALA C 1 363 ? -15.178 86.136  50.210  1.00 12.38  ? 363 ALA C C   1 
ATOM   9533  O  O   . ALA C 1 363 ? -15.448 84.944  50.090  1.00 17.29  ? 363 ALA C O   1 
ATOM   9534  C  CB  . ALA C 1 363 ? -13.077 85.387  51.338  1.00 7.94   ? 363 ALA C CB  1 
ATOM   9535  N  N   . GLY C 1 364 ? -15.918 87.092  49.674  1.00 13.21  ? 364 GLY C N   1 
ATOM   9536  C  CA  . GLY C 1 364 ? -17.103 86.765  48.909  1.00 14.18  ? 364 GLY C CA  1 
ATOM   9537  C  C   . GLY C 1 364 ? -18.190 87.767  49.226  1.00 17.60  ? 364 GLY C C   1 
ATOM   9538  O  O   . GLY C 1 364 ? -18.013 88.620  50.084  1.00 20.74  ? 364 GLY C O   1 
ATOM   9539  N  N   . ASP C 1 365 ? -19.335 87.646  48.570  1.00 21.25  ? 365 ASP C N   1 
ATOM   9540  C  CA  . ASP C 1 365 ? -20.441 88.572  48.784  1.00 25.22  ? 365 ASP C CA  1 
ATOM   9541  C  C   . ASP C 1 365 ? -21.651 87.927  49.478  1.00 23.52  ? 365 ASP C C   1 
ATOM   9542  O  O   . ASP C 1 365 ? -22.780 88.392  49.341  1.00 25.79  ? 365 ASP C O   1 
ATOM   9543  C  CB  . ASP C 1 365 ? -20.875 89.165  47.441  1.00 31.84  ? 365 ASP C CB  1 
ATOM   9544  C  CG  . ASP C 1 365 ? -21.497 88.118  46.490  1.00 41.76  ? 365 ASP C CG  1 
ATOM   9545  O  OD1 . ASP C 1 365 ? -21.342 86.890  46.711  1.00 45.77  ? 365 ASP C OD1 1 
ATOM   9546  O  OD2 . ASP C 1 365 ? -22.156 88.534  45.506  1.00 53.39  ? 365 ASP C OD2 1 
ATOM   9547  N  N   . SER C 1 366 ? -21.427 86.846  50.200  1.00 20.14  ? 366 SER C N   1 
ATOM   9548  C  CA  . SER C 1 366 ? -22.518 86.185  50.864  1.00 17.09  ? 366 SER C CA  1 
ATOM   9549  C  C   . SER C 1 366 ? -22.427 86.394  52.368  1.00 20.41  ? 366 SER C C   1 
ATOM   9550  O  O   . SER C 1 366 ? -21.343 86.624  52.932  1.00 19.52  ? 366 SER C O   1 
ATOM   9551  C  CB  . SER C 1 366 ? -22.471 84.698  50.539  1.00 16.20  ? 366 SER C CB  1 
ATOM   9552  O  OG  . SER C 1 366 ? -23.504 84.001  51.201  1.00 20.67  ? 366 SER C OG  1 
ATOM   9553  N  N   . ILE C 1 367 ? -23.571 86.281  53.025  1.00 19.89  ? 367 ILE C N   1 
ATOM   9554  C  CA  . ILE C 1 367 ? -23.605 86.415  54.469  1.00 18.88  ? 367 ILE C CA  1 
ATOM   9555  C  C   . ILE C 1 367 ? -22.875 85.189  55.026  1.00 18.78  ? 367 ILE C C   1 
ATOM   9556  O  O   . ILE C 1 367 ? -22.458 85.173  56.177  1.00 21.78  ? 367 ILE C O   1 
ATOM   9557  C  CB  . ILE C 1 367 ? -25.061 86.499  54.989  1.00 17.75  ? 367 ILE C CB  1 
ATOM   9558  C  CG1 . ILE C 1 367 ? -25.069 86.858  56.471  1.00 16.60  ? 367 ILE C CG1 1 
ATOM   9559  C  CG2 . ILE C 1 367 ? -25.807 85.198  54.740  1.00 10.85  ? 367 ILE C CG2 1 
ATOM   9560  C  CD1 . ILE C 1 367 ? -26.332 87.554  56.903  1.00 14.66  ? 367 ILE C CD1 1 
ATOM   9561  N  N   . TRP C 1 368 ? -22.682 84.189  54.166  1.00 17.96  ? 368 TRP C N   1 
ATOM   9562  C  CA  . TRP C 1 368 ? -21.987 82.957  54.514  1.00 14.07  ? 368 TRP C CA  1 
ATOM   9563  C  C   . TRP C 1 368 ? -20.518 82.941  54.105  1.00 14.19  ? 368 TRP C C   1 
ATOM   9564  O  O   . TRP C 1 368 ? -19.829 81.975  54.393  1.00 16.34  ? 368 TRP C O   1 
ATOM   9565  C  CB  . TRP C 1 368 ? -22.664 81.764  53.856  1.00 13.70  ? 368 TRP C CB  1 
ATOM   9566  C  CG  . TRP C 1 368 ? -24.028 81.438  54.368  1.00 20.33  ? 368 TRP C CG  1 
ATOM   9567  C  CD1 . TRP C 1 368 ? -25.202 81.574  53.694  1.00 18.70  ? 368 TRP C CD1 1 
ATOM   9568  C  CD2 . TRP C 1 368 ? -24.358 80.864  55.638  1.00 22.31  ? 368 TRP C CD2 1 
ATOM   9569  N  NE1 . TRP C 1 368 ? -26.241 81.115  54.455  1.00 23.56  ? 368 TRP C NE1 1 
ATOM   9570  C  CE2 . TRP C 1 368 ? -25.755 80.672  55.657  1.00 25.92  ? 368 TRP C CE2 1 
ATOM   9571  C  CE3 . TRP C 1 368 ? -23.608 80.491  56.765  1.00 21.45  ? 368 TRP C CE3 1 
ATOM   9572  C  CZ2 . TRP C 1 368 ? -26.427 80.119  56.765  1.00 27.82  ? 368 TRP C CZ2 1 
ATOM   9573  C  CZ3 . TRP C 1 368 ? -24.275 79.942  57.865  1.00 24.37  ? 368 TRP C CZ3 1 
ATOM   9574  C  CH2 . TRP C 1 368 ? -25.671 79.762  57.852  1.00 24.31  ? 368 TRP C CH2 1 
ATOM   9575  N  N   . SER C 1 369 ? -20.034 83.984  53.428  1.00 16.26  ? 369 SER C N   1 
ATOM   9576  C  CA  . SER C 1 369 ? -18.636 84.012  52.993  1.00 13.58  ? 369 SER C CA  1 
ATOM   9577  C  C   . SER C 1 369 ? -17.660 84.159  54.149  1.00 15.25  ? 369 SER C C   1 
ATOM   9578  O  O   . SER C 1 369 ? -17.818 85.049  54.985  1.00 17.26  ? 369 SER C O   1 
ATOM   9579  C  CB  . SER C 1 369 ? -18.383 85.154  51.999  1.00 15.47  ? 369 SER C CB  1 
ATOM   9580  O  OG  . SER C 1 369 ? -19.204 85.069  50.844  1.00 18.79  ? 369 SER C OG  1 
ATOM   9581  N  N   . ARG C 1 370 ? -16.644 83.303  54.168  1.00 14.60  ? 370 ARG C N   1 
ATOM   9582  C  CA  . ARG C 1 370 ? -15.589 83.318  55.183  1.00 16.93  ? 370 ARG C CA  1 
ATOM   9583  C  C   . ARG C 1 370 ? -14.289 83.096  54.418  1.00 16.87  ? 370 ARG C C   1 
ATOM   9584  O  O   . ARG C 1 370 ? -14.286 82.397  53.405  1.00 20.38  ? 370 ARG C O   1 
ATOM   9585  C  CB  . ARG C 1 370 ? -15.776 82.187  56.203  1.00 12.29  ? 370 ARG C CB  1 
ATOM   9586  C  CG  . ARG C 1 370 ? -16.980 82.342  57.112  1.00 11.90  ? 370 ARG C CG  1 
ATOM   9587  C  CD  . ARG C 1 370 ? -16.973 83.642  57.878  1.00 11.85  ? 370 ARG C CD  1 
ATOM   9588  N  NE  . ARG C 1 370 ? -18.092 83.676  58.821  1.00 16.52  ? 370 ARG C NE  1 
ATOM   9589  C  CZ  . ARG C 1 370 ? -19.357 83.946  58.509  1.00 16.71  ? 370 ARG C CZ  1 
ATOM   9590  N  NH1 . ARG C 1 370 ? -19.704 84.231  57.264  1.00 20.87  ? 370 ARG C NH1 1 
ATOM   9591  N  NH2 . ARG C 1 370 ? -20.295 83.862  59.440  1.00 18.24  ? 370 ARG C NH2 1 
ATOM   9592  N  N   . PRO C 1 371 ? -13.156 83.618  54.922  1.00 15.67  ? 371 PRO C N   1 
ATOM   9593  C  CA  . PRO C 1 371 ? -12.954 84.400  56.147  1.00 15.05  ? 371 PRO C CA  1 
ATOM   9594  C  C   . PRO C 1 371 ? -13.632 85.762  56.156  1.00 17.66  ? 371 PRO C C   1 
ATOM   9595  O  O   . PRO C 1 371 ? -14.035 86.268  55.109  1.00 20.64  ? 371 PRO C O   1 
ATOM   9596  C  CB  . PRO C 1 371 ? -11.432 84.548  56.207  1.00 13.87  ? 371 PRO C CB  1 
ATOM   9597  C  CG  . PRO C 1 371 ? -11.041 84.538  54.790  1.00 15.02  ? 371 PRO C CG  1 
ATOM   9598  C  CD  . PRO C 1 371 ? -11.871 83.410  54.235  1.00 10.27  ? 371 PRO C CD  1 
ATOM   9599  N  N   . ALA C 1 372 ? -13.757 86.336  57.350  1.00 15.10  ? 372 ALA C N   1 
ATOM   9600  C  CA  . ALA C 1 372 ? -14.363 87.633  57.538  1.00 11.59  ? 372 ALA C CA  1 
ATOM   9601  C  C   . ALA C 1 372 ? -13.575 88.322  58.627  1.00 13.82  ? 372 ALA C C   1 
ATOM   9602  O  O   . ALA C 1 372 ? -13.124 87.671  59.564  1.00 18.18  ? 372 ALA C O   1 
ATOM   9603  C  CB  . ALA C 1 372 ? -15.775 87.468  57.961  1.00 8.09   ? 372 ALA C CB  1 
ATOM   9604  N  N   . ILE C 1 373 ? -13.324 89.612  58.454  1.00 11.71  ? 373 ILE C N   1 
ATOM   9605  C  CA  . ILE C 1 373 ? -12.605 90.408  59.433  1.00 10.38  ? 373 ILE C CA  1 
ATOM   9606  C  C   . ILE C 1 373 ? -13.595 91.482  59.803  1.00 13.50  ? 373 ILE C C   1 
ATOM   9607  O  O   . ILE C 1 373 ? -14.072 92.227  58.941  1.00 16.95  ? 373 ILE C O   1 
ATOM   9608  C  CB  . ILE C 1 373 ? -11.335 91.042  58.853  1.00 10.87  ? 373 ILE C CB  1 
ATOM   9609  C  CG1 . ILE C 1 373 ? -10.350 89.944  58.485  1.00 11.40  ? 373 ILE C CG1 1 
ATOM   9610  C  CG2 . ILE C 1 373 ? -10.696 91.936  59.877  1.00 10.48  ? 373 ILE C CG2 1 
ATOM   9611  C  CD1 . ILE C 1 373 ? -9.030  90.452  58.031  1.00 13.32  ? 373 ILE C CD1 1 
ATOM   9612  N  N   . ARG C 1 374 ? -13.912 91.550  61.087  1.00 13.79  ? 374 ARG C N   1 
ATOM   9613  C  CA  . ARG C 1 374 ? -14.899 92.485  61.578  1.00 12.27  ? 374 ARG C CA  1 
ATOM   9614  C  C   . ARG C 1 374 ? -14.396 93.458  62.594  1.00 12.72  ? 374 ARG C C   1 
ATOM   9615  O  O   . ARG C 1 374 ? -13.470 93.164  63.343  1.00 18.15  ? 374 ARG C O   1 
ATOM   9616  C  CB  . ARG C 1 374 ? -16.018 91.704  62.268  1.00 10.36  ? 374 ARG C CB  1 
ATOM   9617  C  CG  . ARG C 1 374 ? -16.634 90.624  61.444  1.00 12.14  ? 374 ARG C CG  1 
ATOM   9618  C  CD  . ARG C 1 374 ? -16.987 89.444  62.314  1.00 13.63  ? 374 ARG C CD  1 
ATOM   9619  N  NE  . ARG C 1 374 ? -17.774 88.461  61.572  1.00 12.03  ? 374 ARG C NE  1 
ATOM   9620  C  CZ  . ARG C 1 374 ? -18.106 87.265  62.031  1.00 14.52  ? 374 ARG C CZ  1 
ATOM   9621  N  NH1 . ARG C 1 374 ? -17.710 86.906  63.232  1.00 13.29  ? 374 ARG C NH1 1 
ATOM   9622  N  NH2 . ARG C 1 374 ? -18.839 86.439  61.297  1.00 10.81  ? 374 ARG C NH2 1 
ATOM   9623  N  N   . ILE C 1 375 ? -15.019 94.627  62.604  1.00 11.41  ? 375 ILE C N   1 
ATOM   9624  C  CA  . ILE C 1 375 ? -14.762 95.639  63.613  1.00 15.54  ? 375 ILE C CA  1 
ATOM   9625  C  C   . ILE C 1 375 ? -16.197 95.913  64.057  1.00 16.44  ? 375 ILE C C   1 
ATOM   9626  O  O   . ILE C 1 375 ? -17.077 96.131  63.224  1.00 15.92  ? 375 ILE C O   1 
ATOM   9627  C  CB  . ILE C 1 375 ? -14.024 96.865  63.097  1.00 15.70  ? 375 ILE C CB  1 
ATOM   9628  C  CG1 . ILE C 1 375 ? -14.738 97.481  61.916  1.00 27.08  ? 375 ILE C CG1 1 
ATOM   9629  C  CG2 . ILE C 1 375 ? -12.630 96.474  62.718  1.00 15.79  ? 375 ILE C CG2 1 
ATOM   9630  C  CD1 . ILE C 1 375 ? -14.009 98.679  61.375  1.00 34.27  ? 375 ILE C CD1 1 
ATOM   9631  N  N   . PHE C 1 376 ? -16.460 95.802  65.354  1.00 16.56  ? 376 PHE C N   1 
ATOM   9632  C  CA  . PHE C 1 376 ? -17.826 95.931  65.840  1.00 14.67  ? 376 PHE C CA  1 
ATOM   9633  C  C   . PHE C 1 376 ? -17.993 96.745  67.110  1.00 17.44  ? 376 PHE C C   1 
ATOM   9634  O  O   . PHE C 1 376 ? -17.016 97.081  67.788  1.00 17.68  ? 376 PHE C O   1 
ATOM   9635  C  CB  . PHE C 1 376 ? -18.365 94.524  66.116  1.00 12.15  ? 376 PHE C CB  1 
ATOM   9636  C  CG  . PHE C 1 376 ? -17.629 93.807  67.231  1.00 16.54  ? 376 PHE C CG  1 
ATOM   9637  C  CD1 . PHE C 1 376 ? -17.984 94.009  68.567  1.00 12.25  ? 376 PHE C CD1 1 
ATOM   9638  C  CD2 . PHE C 1 376 ? -16.536 92.991  66.948  1.00 16.38  ? 376 PHE C CD2 1 
ATOM   9639  C  CE1 . PHE C 1 376 ? -17.261 93.422  69.590  1.00 15.73  ? 376 PHE C CE1 1 
ATOM   9640  C  CE2 . PHE C 1 376 ? -15.808 92.396  67.976  1.00 16.00  ? 376 PHE C CE2 1 
ATOM   9641  C  CZ  . PHE C 1 376 ? -16.168 92.612  69.293  1.00 16.00  ? 376 PHE C CZ  1 
ATOM   9642  N  N   . ALA C 1 377 ? -19.263 96.955  67.457  1.00 16.99  ? 377 ALA C N   1 
ATOM   9643  C  CA  . ALA C 1 377 ? -19.685 97.662  68.661  1.00 17.09  ? 377 ALA C CA  1 
ATOM   9644  C  C   . ALA C 1 377 ? -20.965 96.935  69.056  1.00 18.35  ? 377 ALA C C   1 
ATOM   9645  O  O   . ALA C 1 377 ? -21.853 96.739  68.212  1.00 18.19  ? 377 ALA C O   1 
ATOM   9646  C  CB  . ALA C 1 377 ? -19.973 99.106  68.358  1.00 12.93  ? 377 ALA C CB  1 
ATOM   9647  N  N   . THR C 1 378 ? -21.016 96.475  70.304  1.00 19.25  ? 378 THR C N   1 
ATOM   9648  C  CA  . THR C 1 378 ? -22.159 95.742  70.837  1.00 20.42  ? 378 THR C CA  1 
ATOM   9649  C  C   . THR C 1 378 ? -22.720 96.404  72.083  1.00 21.54  ? 378 THR C C   1 
ATOM   9650  O  O   . THR C 1 378 ? -21.981 96.920  72.922  1.00 21.43  ? 378 THR C O   1 
ATOM   9651  C  CB  . THR C 1 378 ? -21.762 94.293  71.198  1.00 19.47  ? 378 THR C CB  1 
ATOM   9652  O  OG1 . THR C 1 378 ? -21.467 93.584  69.997  1.00 20.31  ? 378 THR C OG1 1 
ATOM   9653  C  CG2 . THR C 1 378 ? -22.892 93.569  71.920  1.00 18.44  ? 378 THR C CG2 1 
ATOM   9654  N  N   . TYR C 1 379 ? -24.040 96.408  72.180  1.00 19.43  ? 379 TYR C N   1 
ATOM   9655  C  CA  . TYR C 1 379 ? -24.725 96.964  73.323  1.00 20.00  ? 379 TYR C CA  1 
ATOM   9656  C  C   . TYR C 1 379 ? -25.701 95.897  73.792  1.00 20.26  ? 379 TYR C C   1 
ATOM   9657  O  O   . TYR C 1 379 ? -26.417 95.308  72.978  1.00 21.05  ? 379 TYR C O   1 
ATOM   9658  C  CB  . TYR C 1 379 ? -25.490 98.219  72.928  1.00 20.48  ? 379 TYR C CB  1 
ATOM   9659  C  CG  . TYR C 1 379 ? -26.397 98.717  74.020  1.00 22.98  ? 379 TYR C CG  1 
ATOM   9660  C  CD1 . TYR C 1 379 ? -25.876 99.372  75.128  1.00 22.83  ? 379 TYR C CD1 1 
ATOM   9661  C  CD2 . TYR C 1 379 ? -27.775 98.504  73.967  1.00 25.96  ? 379 TYR C CD2 1 
ATOM   9662  C  CE1 . TYR C 1 379 ? -26.695 99.801  76.162  1.00 24.12  ? 379 TYR C CE1 1 
ATOM   9663  C  CE2 . TYR C 1 379 ? -28.605 98.930  75.000  1.00 23.79  ? 379 TYR C CE2 1 
ATOM   9664  C  CZ  . TYR C 1 379 ? -28.050 99.574  76.092  1.00 25.24  ? 379 TYR C CZ  1 
ATOM   9665  O  OH  . TYR C 1 379 ? -28.832 99.964  77.141  1.00 30.21  ? 379 TYR C OH  1 
ATOM   9666  N  N   . ALA C 1 380 ? -25.705 95.618  75.089  1.00 20.95  ? 380 ALA C N   1 
ATOM   9667  C  CA  . ALA C 1 380 ? -26.616 94.627  75.651  1.00 21.72  ? 380 ALA C CA  1 
ATOM   9668  C  C   . ALA C 1 380 ? -27.270 95.248  76.877  1.00 24.34  ? 380 ALA C C   1 
ATOM   9669  O  O   . ALA C 1 380 ? -26.604 95.945  77.647  1.00 23.50  ? 380 ALA C O   1 
ATOM   9670  C  CB  . ALA C 1 380 ? -25.857 93.376  76.047  1.00 17.83  ? 380 ALA C CB  1 
ATOM   9671  N  N   . LYS C 1 381 ? -28.572 95.026  77.029  1.00 23.59  ? 381 LYS C N   1 
ATOM   9672  C  CA  . LYS C 1 381 ? -29.342 95.533  78.160  1.00 21.41  ? 381 LYS C CA  1 
ATOM   9673  C  C   . LYS C 1 381 ? -30.125 94.333  78.656  1.00 23.08  ? 381 LYS C C   1 
ATOM   9674  O  O   . LYS C 1 381 ? -30.742 93.609  77.862  1.00 23.15  ? 381 LYS C O   1 
ATOM   9675  C  CB  . LYS C 1 381 ? -30.312 96.631  77.708  1.00 25.00  ? 381 LYS C CB  1 
ATOM   9676  C  CG  . LYS C 1 381 ? -31.367 97.028  78.747  1.00 30.85  ? 381 LYS C CG  1 
ATOM   9677  C  CD  . LYS C 1 381 ? -30.745 97.816  79.894  1.00 45.03  ? 381 LYS C CD  1 
ATOM   9678  C  CE  . LYS C 1 381 ? -31.685 97.980  81.085  1.00 45.14  ? 381 LYS C CE  1 
ATOM   9679  N  NZ  . LYS C 1 381 ? -31.857 96.709  81.851  1.00 43.11  ? 381 LYS C NZ  1 
ATOM   9680  N  N   . TRP C 1 382 ? -30.090 94.098  79.958  1.00 23.21  ? 382 TRP C N   1 
ATOM   9681  C  CA  . TRP C 1 382 ? -30.795 92.962  80.514  1.00 23.19  ? 382 TRP C CA  1 
ATOM   9682  C  C   . TRP C 1 382 ? -31.477 93.282  81.818  1.00 25.09  ? 382 TRP C C   1 
ATOM   9683  O  O   . TRP C 1 382 ? -31.055 94.172  82.565  1.00 22.43  ? 382 TRP C O   1 
ATOM   9684  C  CB  . TRP C 1 382 ? -29.830 91.802  80.739  1.00 22.33  ? 382 TRP C CB  1 
ATOM   9685  C  CG  . TRP C 1 382 ? -28.694 92.145  81.626  1.00 21.40  ? 382 TRP C CG  1 
ATOM   9686  C  CD1 . TRP C 1 382 ? -28.654 92.026  82.981  1.00 19.64  ? 382 TRP C CD1 1 
ATOM   9687  C  CD2 . TRP C 1 382 ? -27.412 92.660  81.225  1.00 22.42  ? 382 TRP C CD2 1 
ATOM   9688  N  NE1 . TRP C 1 382 ? -27.429 92.431  83.452  1.00 23.56  ? 382 TRP C NE1 1 
ATOM   9689  C  CE2 . TRP C 1 382 ? -26.647 92.825  82.395  1.00 23.20  ? 382 TRP C CE2 1 
ATOM   9690  C  CE3 . TRP C 1 382 ? -26.836 92.995  79.985  1.00 20.29  ? 382 TRP C CE3 1 
ATOM   9691  C  CZ2 . TRP C 1 382 ? -25.330 93.313  82.366  1.00 21.62  ? 382 TRP C CZ2 1 
ATOM   9692  C  CZ3 . TRP C 1 382 ? -25.530 93.480  79.958  1.00 18.00  ? 382 TRP C CZ3 1 
ATOM   9693  C  CH2 . TRP C 1 382 ? -24.794 93.633  81.139  1.00 21.35  ? 382 TRP C CH2 1 
ATOM   9694  N  N   . ASP C 1 383 ? -32.493 92.485  82.109  1.00 26.47  ? 383 ASP C N   1 
ATOM   9695  C  CA  . ASP C 1 383 ? -33.277 92.604  83.321  1.00 28.48  ? 383 ASP C CA  1 
ATOM   9696  C  C   . ASP C 1 383 ? -33.567 91.173  83.796  1.00 26.21  ? 383 ASP C C   1 
ATOM   9697  O  O   . ASP C 1 383 ? -34.496 90.516  83.324  1.00 24.03  ? 383 ASP C O   1 
ATOM   9698  C  CB  . ASP C 1 383 ? -34.574 93.360  83.015  1.00 37.40  ? 383 ASP C CB  1 
ATOM   9699  C  CG  . ASP C 1 383 ? -35.503 93.452  84.212  1.00 43.66  ? 383 ASP C CG  1 
ATOM   9700  O  OD1 . ASP C 1 383 ? -35.013 93.419  85.362  1.00 45.10  ? 383 ASP C OD1 1 
ATOM   9701  O  OD2 . ASP C 1 383 ? -36.732 93.562  83.993  1.00 52.03  ? 383 ASP C OD2 1 
ATOM   9702  N  N   . GLU C 1 384 ? -32.742 90.677  84.708  1.00 26.29  ? 384 GLU C N   1 
ATOM   9703  C  CA  . GLU C 1 384 ? -32.905 89.324  85.213  1.00 26.67  ? 384 GLU C CA  1 
ATOM   9704  C  C   . GLU C 1 384 ? -33.522 89.298  86.613  1.00 29.68  ? 384 GLU C C   1 
ATOM   9705  O  O   . GLU C 1 384 ? -32.934 89.784  87.583  1.00 30.75  ? 384 GLU C O   1 
ATOM   9706  C  CB  . GLU C 1 384 ? -31.565 88.595  85.183  1.00 23.56  ? 384 GLU C CB  1 
ATOM   9707  C  CG  . GLU C 1 384 ? -30.864 88.721  83.844  1.00 22.74  ? 384 GLU C CG  1 
ATOM   9708  C  CD  . GLU C 1 384 ? -29.739 87.732  83.646  1.00 27.14  ? 384 GLU C CD  1 
ATOM   9709  O  OE1 . GLU C 1 384 ? -29.115 87.284  84.631  1.00 25.95  ? 384 GLU C OE1 1 
ATOM   9710  O  OE2 . GLU C 1 384 ? -29.478 87.394  82.477  1.00 31.13  ? 384 GLU C OE2 1 
ATOM   9711  N  N   . LYS C 1 385 ? -34.722 88.734  86.698  1.00 29.09  ? 385 LYS C N   1 
ATOM   9712  C  CA  . LYS C 1 385 ? -35.464 88.637  87.951  1.00 27.46  ? 385 LYS C CA  1 
ATOM   9713  C  C   . LYS C 1 385 ? -35.144 87.383  88.748  1.00 27.87  ? 385 LYS C C   1 
ATOM   9714  O  O   . LYS C 1 385 ? -35.574 87.259  89.893  1.00 33.66  ? 385 LYS C O   1 
ATOM   9715  C  CB  . LYS C 1 385 ? -36.975 88.671  87.691  1.00 28.22  ? 385 LYS C CB  1 
ATOM   9716  C  CG  . LYS C 1 385 ? -37.500 89.926  87.011  1.00 31.86  ? 385 LYS C CG  1 
ATOM   9717  C  CD  . LYS C 1 385 ? -37.193 91.165  87.822  1.00 37.77  ? 385 LYS C CD  1 
ATOM   9718  C  CE  . LYS C 1 385 ? -37.819 92.410  87.194  1.00 43.35  ? 385 LYS C CE  1 
ATOM   9719  N  NZ  . LYS C 1 385 ? -37.298 93.657  87.838  1.00 48.62  ? 385 LYS C NZ  1 
ATOM   9720  N  N   . TRP C 1 386 ? -34.422 86.446  88.146  1.00 26.05  ? 386 TRP C N   1 
ATOM   9721  C  CA  . TRP C 1 386 ? -34.063 85.216  88.834  1.00 24.23  ? 386 TRP C CA  1 
ATOM   9722  C  C   . TRP C 1 386 ? -32.694 84.713  88.379  1.00 24.61  ? 386 TRP C C   1 
ATOM   9723  O  O   . TRP C 1 386 ? -32.162 85.166  87.370  1.00 29.03  ? 386 TRP C O   1 
ATOM   9724  C  CB  . TRP C 1 386 ? -35.121 84.148  88.587  1.00 19.31  ? 386 TRP C CB  1 
ATOM   9725  C  CG  . TRP C 1 386 ? -35.170 83.658  87.166  1.00 22.87  ? 386 TRP C CG  1 
ATOM   9726  C  CD1 . TRP C 1 386 ? -35.878 84.207  86.136  1.00 21.69  ? 386 TRP C CD1 1 
ATOM   9727  C  CD2 . TRP C 1 386 ? -34.535 82.484  86.634  1.00 23.12  ? 386 TRP C CD2 1 
ATOM   9728  N  NE1 . TRP C 1 386 ? -35.732 83.445  85.005  1.00 22.19  ? 386 TRP C NE1 1 
ATOM   9729  C  CE2 . TRP C 1 386 ? -34.914 82.380  85.281  1.00 21.67  ? 386 TRP C CE2 1 
ATOM   9730  C  CE3 . TRP C 1 386 ? -33.685 81.507  87.172  1.00 25.22  ? 386 TRP C CE3 1 
ATOM   9731  C  CZ2 . TRP C 1 386 ? -34.476 81.333  84.454  1.00 22.07  ? 386 TRP C CZ2 1 
ATOM   9732  C  CZ3 . TRP C 1 386 ? -33.248 80.460  86.345  1.00 20.97  ? 386 TRP C CZ3 1 
ATOM   9733  C  CH2 . TRP C 1 386 ? -33.647 80.386  85.004  1.00 22.48  ? 386 TRP C CH2 1 
ATOM   9734  N  N   . GLY C 1 387 ? -32.120 83.793  89.141  1.00 23.21  ? 387 GLY C N   1 
ATOM   9735  C  CA  . GLY C 1 387 ? -30.837 83.219  88.802  1.00 22.50  ? 387 GLY C CA  1 
ATOM   9736  C  C   . GLY C 1 387 ? -30.753 81.886  89.519  1.00 23.72  ? 387 GLY C C   1 
ATOM   9737  O  O   . GLY C 1 387 ? -31.595 81.595  90.357  1.00 25.84  ? 387 GLY C O   1 
ATOM   9738  N  N   . TYR C 1 388 ? -29.791 81.047  89.158  1.00 25.92  ? 388 TYR C N   1 
ATOM   9739  C  CA  . TYR C 1 388 ? -29.628 79.768  89.828  1.00 28.00  ? 388 TYR C CA  1 
ATOM   9740  C  C   . TYR C 1 388 ? -28.879 80.017  91.119  1.00 32.08  ? 388 TYR C C   1 
ATOM   9741  O  O   . TYR C 1 388 ? -27.918 80.795  91.171  1.00 30.49  ? 388 TYR C O   1 
ATOM   9742  C  CB  . TYR C 1 388 ? -28.859 78.780  88.966  1.00 27.67  ? 388 TYR C CB  1 
ATOM   9743  C  CG  . TYR C 1 388 ? -29.639 78.336  87.771  1.00 29.72  ? 388 TYR C CG  1 
ATOM   9744  C  CD1 . TYR C 1 388 ? -30.634 77.364  87.886  1.00 27.81  ? 388 TYR C CD1 1 
ATOM   9745  C  CD2 . TYR C 1 388 ? -29.432 78.929  86.525  1.00 29.70  ? 388 TYR C CD2 1 
ATOM   9746  C  CE1 . TYR C 1 388 ? -31.414 76.996  86.781  1.00 27.95  ? 388 TYR C CE1 1 
ATOM   9747  C  CE2 . TYR C 1 388 ? -30.204 78.570  85.414  1.00 28.79  ? 388 TYR C CE2 1 
ATOM   9748  C  CZ  . TYR C 1 388 ? -31.190 77.609  85.550  1.00 27.69  ? 388 TYR C CZ  1 
ATOM   9749  O  OH  . TYR C 1 388 ? -31.948 77.284  84.454  1.00 31.44  ? 388 TYR C OH  1 
ATOM   9750  N  N   . ILE C 1 389 ? -29.345 79.376  92.175  1.00 36.63  ? 389 ILE C N   1 
ATOM   9751  C  CA  . ILE C 1 389 ? -28.738 79.530  93.477  1.00 39.37  ? 389 ILE C CA  1 
ATOM   9752  C  C   . ILE C 1 389 ? -27.279 79.137  93.421  1.00 41.04  ? 389 ILE C C   1 
ATOM   9753  O  O   . ILE C 1 389 ? -26.930 77.993  93.115  1.00 38.92  ? 389 ILE C O   1 
ATOM   9754  C  CB  . ILE C 1 389 ? -29.486 78.714  94.527  1.00 37.41  ? 389 ILE C CB  1 
ATOM   9755  C  CG1 . ILE C 1 389 ? -30.912 79.253  94.662  1.00 34.65  ? 389 ILE C CG1 1 
ATOM   9756  C  CG2 . ILE C 1 389 ? -28.765 78.802  95.854  1.00 38.77  ? 389 ILE C CG2 1 
ATOM   9757  C  CD1 . ILE C 1 389 ? -31.833 78.370  95.442  1.00 34.53  ? 389 ILE C CD1 1 
ATOM   9758  N  N   . LYS C 1 390 ? -26.439 80.138  93.628  1.00 48.76  ? 390 LYS C N   1 
ATOM   9759  C  CA  . LYS C 1 390 ? -25.006 79.962  93.619  1.00 59.19  ? 390 LYS C CA  1 
ATOM   9760  C  C   . LYS C 1 390 ? -24.614 79.419  94.974  1.00 64.77  ? 390 LYS C C   1 
ATOM   9761  O  O   . LYS C 1 390 ? -24.554 80.160  95.953  1.00 67.47  ? 390 LYS C O   1 
ATOM   9762  C  CB  . LYS C 1 390 ? -24.308 81.299  93.349  1.00 59.13  ? 390 LYS C CB  1 
ATOM   9763  C  CG  . LYS C 1 390 ? -22.803 81.183  93.148  1.00 66.45  ? 390 LYS C CG  1 
ATOM   9764  C  CD  . LYS C 1 390 ? -22.278 82.209  92.146  1.00 70.82  ? 390 LYS C CD  1 
ATOM   9765  C  CE  . LYS C 1 390 ? -22.474 83.640  92.622  1.00 74.12  ? 390 LYS C CE  1 
ATOM   9766  N  NZ  . LYS C 1 390 ? -21.564 83.980  93.745  1.00 79.40  ? 390 LYS C NZ  1 
ATOM   9767  N  N   . ASP C 1 391 ? -24.423 78.107  95.036  1.00 74.44  ? 391 ASP C N   1 
ATOM   9768  C  CA  . ASP C 1 391 ? -24.029 77.430  96.269  1.00 84.04  ? 391 ASP C CA  1 
ATOM   9769  C  C   . ASP C 1 391 ? -22.519 77.615  96.465  1.00 89.05  ? 391 ASP C C   1 
ATOM   9770  O  O   . ASP C 1 391 ? -21.713 76.714  96.178  1.00 90.99  ? 391 ASP C O   1 
ATOM   9771  C  CB  . ASP C 1 391 ? -24.391 75.938  96.200  1.00 84.38  ? 391 ASP C CB  1 
ATOM   9772  C  CG  . ASP C 1 391 ? -24.135 75.212  97.506  0.00 84.14  ? 391 ASP C CG  1 
ATOM   9773  O  OD1 . ASP C 1 391 ? -24.896 75.433  98.472  0.00 84.13  ? 391 ASP C OD1 1 
ATOM   9774  O  OD2 . ASP C 1 391 ? -23.175 74.415  97.565  0.00 84.13  ? 391 ASP C OD2 1 
ATOM   9775  N  N   . GLY C 1 392 ? -22.143 78.801  96.934  1.00 92.43  ? 392 GLY C N   1 
ATOM   9776  C  CA  . GLY C 1 392 ? -20.743 79.107  97.151  1.00 94.99  ? 392 GLY C CA  1 
ATOM   9777  C  C   . GLY C 1 392 ? -20.066 79.469  95.844  1.00 96.02  ? 392 GLY C C   1 
ATOM   9778  O  O   . GLY C 1 392 ? -20.001 80.641  95.471  1.00 98.08  ? 392 GLY C O   1 
ATOM   9779  N  N   . ASP C 1 393 ? -19.572 78.460  95.138  1.00 95.54  ? 393 ASP C N   1 
ATOM   9780  C  CA  . ASP C 1 393 ? -18.902 78.681  93.864  1.00 94.89  ? 393 ASP C CA  1 
ATOM   9781  C  C   . ASP C 1 393 ? -19.637 77.920  92.768  1.00 93.44  ? 393 ASP C C   1 
ATOM   9782  O  O   . ASP C 1 393 ? -19.703 78.368  91.620  1.00 94.46  ? 393 ASP C O   1 
ATOM   9783  C  CB  . ASP C 1 393 ? -17.444 78.220  93.946  1.00 96.70  ? 393 ASP C CB  1 
ATOM   9784  C  CG  . ASP C 1 393 ? -16.666 78.506  92.672  0.00 96.45  ? 393 ASP C CG  1 
ATOM   9785  O  OD1 . ASP C 1 393 ? -16.325 79.684  92.431  0.00 96.75  ? 393 ASP C OD1 1 
ATOM   9786  O  OD2 . ASP C 1 393 ? -16.398 77.552  91.912  0.00 96.75  ? 393 ASP C OD2 1 
ATOM   9787  N  N   . ASN C 1 394 ? -20.196 76.770  93.138  1.00 89.61  ? 394 ASN C N   1 
ATOM   9788  C  CA  . ASN C 1 394 ? -20.934 75.925  92.206  1.00 84.28  ? 394 ASN C CA  1 
ATOM   9789  C  C   . ASN C 1 394 ? -22.366 76.433  92.041  1.00 78.32  ? 394 ASN C C   1 
ATOM   9790  O  O   . ASN C 1 394 ? -22.953 76.961  92.989  1.00 78.04  ? 394 ASN C O   1 
ATOM   9791  C  CB  . ASN C 1 394 ? -20.952 74.477  92.708  1.00 86.20  ? 394 ASN C CB  1 
ATOM   9792  C  CG  . ASN C 1 394 ? -19.567 73.864  92.771  0.00 86.80  ? 394 ASN C CG  1 
ATOM   9793  O  OD1 . ASN C 1 394 ? -18.780 73.979  91.833  0.00 87.45  ? 394 ASN C OD1 1 
ATOM   9794  N  ND2 . ASN C 1 394 ? -19.261 73.209  93.881  0.00 87.45  ? 394 ASN C ND2 1 
ATOM   9795  N  N   . ILE C 1 395 ? -22.912 76.306  90.833  1.00 69.95  ? 395 ILE C N   1 
ATOM   9796  C  CA  . ILE C 1 395 ? -24.281 76.740  90.553  1.00 61.66  ? 395 ILE C CA  1 
ATOM   9797  C  C   . ILE C 1 395 ? -25.232 75.557  90.740  1.00 56.86  ? 395 ILE C C   1 
ATOM   9798  O  O   . ILE C 1 395 ? -24.956 74.445  90.286  1.00 57.56  ? 395 ILE C O   1 
ATOM   9799  C  CB  . ILE C 1 395 ? -24.405 77.353  89.131  1.00 59.63  ? 395 ILE C CB  1 
ATOM   9800  C  CG1 . ILE C 1 395 ? -23.979 78.818  89.159  1.00 61.35  ? 395 ILE C CG1 1 
ATOM   9801  C  CG2 . ILE C 1 395 ? -25.827 77.281  88.621  1.00 59.17  ? 395 ILE C CG2 1 
ATOM   9802  C  CD1 . ILE C 1 395 ? -22.539 79.048  89.569  1.00 65.54  ? 395 ILE C CD1 1 
ATOM   9803  N  N   . SER C 1 396 ? -26.331 75.807  91.438  1.00 51.55  ? 396 SER C N   1 
ATOM   9804  C  CA  . SER C 1 396 ? -27.331 74.790  91.737  1.00 46.01  ? 396 SER C CA  1 
ATOM   9805  C  C   . SER C 1 396 ? -28.404 74.655  90.651  1.00 43.66  ? 396 SER C C   1 
ATOM   9806  O  O   . SER C 1 396 ? -28.526 75.506  89.775  1.00 45.55  ? 396 SER C O   1 
ATOM   9807  C  CB  . SER C 1 396 ? -27.978 75.153  93.077  1.00 44.93  ? 396 SER C CB  1 
ATOM   9808  O  OG  . SER C 1 396 ? -28.957 74.219  93.479  1.00 51.42  ? 396 SER C OG  1 
ATOM   9809  N  N   . ARG C 1 397 ? -29.182 73.579  90.724  1.00 41.06  ? 397 ARG C N   1 
ATOM   9810  C  CA  . ARG C 1 397 ? -30.276 73.319  89.786  1.00 39.41  ? 397 ARG C CA  1 
ATOM   9811  C  C   . ARG C 1 397 ? -31.500 74.128  90.204  1.00 37.31  ? 397 ARG C C   1 
ATOM   9812  O  O   . ARG C 1 397 ? -32.464 74.270  89.452  1.00 37.78  ? 397 ARG C O   1 
ATOM   9813  C  CB  . ARG C 1 397 ? -30.645 71.834  89.804  1.00 44.17  ? 397 ARG C CB  1 
ATOM   9814  C  CG  . ARG C 1 397 ? -29.511 70.906  89.400  1.00 59.21  ? 397 ARG C CG  1 
ATOM   9815  C  CD  . ARG C 1 397 ? -29.872 69.437  89.595  1.00 69.01  ? 397 ARG C CD  1 
ATOM   9816  N  NE  . ARG C 1 397 ? -29.910 68.688  88.339  1.00 78.31  ? 397 ARG C NE  1 
ATOM   9817  C  CZ  . ARG C 1 397 ? -30.798 68.889  87.365  1.00 84.22  ? 397 ARG C CZ  1 
ATOM   9818  N  NH1 . ARG C 1 397 ? -31.736 69.828  87.480  1.00 83.25  ? 397 ARG C NH1 1 
ATOM   9819  N  NH2 . ARG C 1 397 ? -30.780 68.113  86.288  1.00 88.50  ? 397 ARG C NH2 1 
ATOM   9820  N  N   . TYR C 1 398 ? -31.452 74.640  91.426  1.00 34.53  ? 398 TYR C N   1 
ATOM   9821  C  CA  . TYR C 1 398 ? -32.527 75.423  92.004  1.00 31.46  ? 398 TYR C CA  1 
ATOM   9822  C  C   . TYR C 1 398 ? -32.361 76.905  91.733  1.00 31.35  ? 398 TYR C C   1 
ATOM   9823  O  O   . TYR C 1 398 ? -31.250 77.428  91.763  1.00 33.49  ? 398 TYR C O   1 
ATOM   9824  C  CB  . TYR C 1 398 ? -32.577 75.172  93.507  1.00 30.78  ? 398 TYR C CB  1 
ATOM   9825  C  CG  . TYR C 1 398 ? -32.934 73.753  93.836  1.00 29.85  ? 398 TYR C CG  1 
ATOM   9826  C  CD1 . TYR C 1 398 ? -34.251 73.312  93.729  1.00 34.36  ? 398 TYR C CD1 1 
ATOM   9827  C  CD2 . TYR C 1 398 ? -31.953 72.825  94.182  1.00 32.30  ? 398 TYR C CD2 1 
ATOM   9828  C  CE1 . TYR C 1 398 ? -34.588 71.979  93.950  1.00 35.56  ? 398 TYR C CE1 1 
ATOM   9829  C  CE2 . TYR C 1 398 ? -32.279 71.481  94.406  1.00 34.21  ? 398 TYR C CE2 1 
ATOM   9830  C  CZ  . TYR C 1 398 ? -33.603 71.071  94.285  1.00 36.52  ? 398 TYR C CZ  1 
ATOM   9831  O  OH  . TYR C 1 398 ? -33.960 69.756  94.485  1.00 43.55  ? 398 TYR C OH  1 
ATOM   9832  N  N   . ALA C 1 399 ? -33.478 77.588  91.524  1.00 30.97  ? 399 ALA C N   1 
ATOM   9833  C  CA  . ALA C 1 399 ? -33.470 79.010  91.225  1.00 32.86  ? 399 ALA C CA  1 
ATOM   9834  C  C   . ALA C 1 399 ? -34.052 79.787  92.383  1.00 35.38  ? 399 ALA C C   1 
ATOM   9835  O  O   . ALA C 1 399 ? -34.756 79.223  93.216  1.00 40.01  ? 399 ALA C O   1 
ATOM   9836  C  CB  . ALA C 1 399 ? -34.290 79.272  89.964  1.00 30.98  ? 399 ALA C CB  1 
ATOM   9837  N  N   . ALA C 1 400 ? -33.791 81.089  92.407  1.00 35.52  ? 400 ALA C N   1 
ATOM   9838  C  CA  . ALA C 1 400 ? -34.289 81.974  93.452  1.00 35.10  ? 400 ALA C CA  1 
ATOM   9839  C  C   . ALA C 1 400 ? -34.408 83.364  92.849  1.00 35.28  ? 400 ALA C C   1 
ATOM   9840  O  O   . ALA C 1 400 ? -33.613 83.730  91.988  1.00 36.66  ? 400 ALA C O   1 
ATOM   9841  C  CB  . ALA C 1 400 ? -33.326 81.995  94.625  1.00 35.38  ? 400 ALA C CB  1 
ATOM   9842  N  N   . ALA C 1 401 ? -35.424 84.116  93.251  1.00 34.97  ? 401 ALA C N   1 
ATOM   9843  C  CA  . ALA C 1 401 ? -35.603 85.459  92.724  1.00 36.30  ? 401 ALA C CA  1 
ATOM   9844  C  C   . ALA C 1 401 ? -34.418 86.311  93.131  1.00 38.27  ? 401 ALA C C   1 
ATOM   9845  O  O   . ALA C 1 401 ? -33.875 86.147  94.215  1.00 39.72  ? 401 ALA C O   1 
ATOM   9846  C  CB  . ALA C 1 401 ? -36.891 86.064  93.235  1.00 35.98  ? 401 ALA C CB  1 
ATOM   9847  N  N   . THR C 1 402 ? -34.007 87.200  92.242  1.00 44.87  ? 402 THR C N   1 
ATOM   9848  C  CA  . THR C 1 402 ? -32.880 88.082  92.489  1.00 51.66  ? 402 THR C CA  1 
ATOM   9849  C  C   . THR C 1 402 ? -33.025 88.786  93.833  1.00 57.42  ? 402 THR C C   1 
ATOM   9850  O  O   . THR C 1 402 ? -32.062 88.883  94.600  1.00 58.42  ? 402 THR C O   1 
ATOM   9851  C  CB  . THR C 1 402 ? -32.792 89.152  91.389  1.00 50.82  ? 402 THR C CB  1 
ATOM   9852  O  OG1 . THR C 1 402 ? -32.782 88.515  90.109  1.00 54.73  ? 402 THR C OG1 1 
ATOM   9853  C  CG2 . THR C 1 402 ? -31.529 89.977  91.532  1.00 53.82  ? 402 THR C CG2 1 
ATOM   9854  N  N   . ASN C 1 403 ? -34.242 89.259  94.110  1.00 64.17  ? 403 ASN C N   1 
ATOM   9855  C  CA  . ASN C 1 403 ? -34.541 89.985  95.347  1.00 69.80  ? 403 ASN C CA  1 
ATOM   9856  C  C   . ASN C 1 403 ? -34.489 89.164  96.637  1.00 69.92  ? 403 ASN C C   1 
ATOM   9857  O  O   . ASN C 1 403 ? -34.061 89.678  97.672  1.00 72.59  ? 403 ASN C O   1 
ATOM   9858  C  CB  . ASN C 1 403 ? -35.874 90.745  95.243  1.00 77.72  ? 403 ASN C CB  1 
ATOM   9859  C  CG  . ASN C 1 403 ? -37.075 89.826  95.042  1.00 85.69  ? 403 ASN C CG  1 
ATOM   9860  O  OD1 . ASN C 1 403 ? -37.235 88.821  95.734  1.00 90.87  ? 403 ASN C OD1 1 
ATOM   9861  N  ND2 . ASN C 1 403 ? -37.937 90.185  94.099  1.00 90.83  ? 403 ASN C ND2 1 
ATOM   9862  N  N   . SER C 1 404 ? -34.959 87.919  96.597  1.00 68.46  ? 404 SER C N   1 
ATOM   9863  C  CA  . SER C 1 404 ? -34.913 87.065  97.775  1.00 65.19  ? 404 SER C CA  1 
ATOM   9864  C  C   . SER C 1 404 ? -33.435 87.062  98.119  1.00 65.00  ? 404 SER C C   1 
ATOM   9865  O  O   . SER C 1 404 ? -32.606 86.778  97.259  1.00 70.02  ? 404 SER C O   1 
ATOM   9866  C  CB  . SER C 1 404 ? -35.374 85.652  97.424  1.00 66.18  ? 404 SER C CB  1 
ATOM   9867  O  OG  . SER C 1 404 ? -34.434 84.982  96.597  1.00 62.24  ? 404 SER C OG  1 
ATOM   9868  N  N   . GLY C 1 405 ? -33.103 87.412  99.352  1.00 60.77  ? 405 GLY C N   1 
ATOM   9869  C  CA  . GLY C 1 405 ? -31.709 87.483  99.756  1.00 59.52  ? 405 GLY C CA  1 
ATOM   9870  C  C   . GLY C 1 405 ? -30.780 86.333  99.415  1.00 58.73  ? 405 GLY C C   1 
ATOM   9871  O  O   . GLY C 1 405 ? -29.619 86.357  99.810  1.00 61.18  ? 405 GLY C O   1 
ATOM   9872  N  N   . ILE C 1 406 ? -31.273 85.321  98.710  1.00 57.02  ? 406 ILE C N   1 
ATOM   9873  C  CA  . ILE C 1 406 ? -30.458 84.175  98.341  1.00 53.85  ? 406 ILE C CA  1 
ATOM   9874  C  C   . ILE C 1 406 ? -29.458 84.519  97.239  1.00 52.22  ? 406 ILE C C   1 
ATOM   9875  O  O   . ILE C 1 406 ? -29.762 85.270  96.312  1.00 50.33  ? 406 ILE C O   1 
ATOM   9876  C  CB  . ILE C 1 406 ? -31.340 83.004  97.899  1.00 53.88  ? 406 ILE C CB  1 
ATOM   9877  C  CG1 . ILE C 1 406 ? -32.478 82.820  98.905  1.00 54.84  ? 406 ILE C CG1 1 
ATOM   9878  C  CG2 . ILE C 1 406 ? -30.512 81.722  97.821  1.00 53.23  ? 406 ILE C CG2 1 
ATOM   9879  C  CD1 . ILE C 1 406 ? -33.494 81.790  98.503  1.00 57.26  ? 406 ILE C CD1 1 
ATOM   9880  N  N   . SER C 1 407 ? -28.257 83.966  97.369  1.00 52.23  ? 407 SER C N   1 
ATOM   9881  C  CA  . SER C 1 407 ? -27.180 84.181  96.416  1.00 53.42  ? 407 SER C CA  1 
ATOM   9882  C  C   . SER C 1 407 ? -27.387 83.348  95.148  1.00 51.64  ? 407 SER C C   1 
ATOM   9883  O  O   . SER C 1 407 ? -27.305 82.117  95.171  1.00 52.05  ? 407 SER C O   1 
ATOM   9884  C  CB  . SER C 1 407 ? -25.843 83.832  97.069  1.00 56.04  ? 407 SER C CB  1 
ATOM   9885  O  OG  . SER C 1 407 ? -24.755 84.250  96.269  1.00 64.82  ? 407 SER C OG  1 
ATOM   9886  N  N   . THR C 1 408 ? -27.669 84.034  94.047  1.00 49.26  ? 408 THR C N   1 
ATOM   9887  C  CA  . THR C 1 408 ? -27.896 83.400  92.754  1.00 43.95  ? 408 THR C CA  1 
ATOM   9888  C  C   . THR C 1 408 ? -26.888 83.959  91.755  1.00 41.76  ? 408 THR C C   1 
ATOM   9889  O  O   . THR C 1 408 ? -26.129 84.874  92.078  1.00 41.95  ? 408 THR C O   1 
ATOM   9890  C  CB  . THR C 1 408 ? -29.312 83.705  92.252  1.00 43.22  ? 408 THR C CB  1 
ATOM   9891  O  OG1 . THR C 1 408 ? -29.486 85.123  92.148  1.00 42.69  ? 408 THR C OG1 1 
ATOM   9892  C  CG2 . THR C 1 408 ? -30.348 83.161  93.227  1.00 44.65  ? 408 THR C CG2 1 
ATOM   9893  N  N   . ASN C 1 409 ? -26.874 83.416  90.546  1.00 39.72  ? 409 ASN C N   1 
ATOM   9894  C  CA  . ASN C 1 409 ? -25.956 83.902  89.526  1.00 33.58  ? 409 ASN C CA  1 
ATOM   9895  C  C   . ASN C 1 409 ? -26.620 84.915  88.599  1.00 31.66  ? 409 ASN C C   1 
ATOM   9896  O  O   . ASN C 1 409 ? -26.162 85.137  87.485  1.00 36.23  ? 409 ASN C O   1 
ATOM   9897  C  CB  . ASN C 1 409 ? -25.375 82.745  88.721  1.00 31.37  ? 409 ASN C CB  1 
ATOM   9898  C  CG  . ASN C 1 409 ? -26.402 82.060  87.866  1.00 33.70  ? 409 ASN C CG  1 
ATOM   9899  O  OD1 . ASN C 1 409 ? -27.597 82.288  88.015  1.00 36.24  ? 409 ASN C OD1 1 
ATOM   9900  N  ND2 . ASN C 1 409 ? -25.945 81.206  86.968  1.00 36.88  ? 409 ASN C ND2 1 
ATOM   9901  N  N   . SER C 1 410 ? -27.711 85.511  89.063  1.00 29.17  ? 410 SER C N   1 
ATOM   9902  C  CA  . SER C 1 410 ? -28.443 86.519  88.312  1.00 27.33  ? 410 SER C CA  1 
ATOM   9903  C  C   . SER C 1 410 ? -27.560 87.755  88.072  1.00 29.64  ? 410 SER C C   1 
ATOM   9904  O  O   . SER C 1 410 ? -26.795 88.168  88.947  1.00 31.24  ? 410 SER C O   1 
ATOM   9905  C  CB  . SER C 1 410 ? -29.705 86.899  89.088  1.00 24.88  ? 410 SER C CB  1 
ATOM   9906  O  OG  . SER C 1 410 ? -30.344 88.034  88.539  1.00 25.98  ? 410 SER C OG  1 
ATOM   9907  N  N   . ARG C 1 411 ? -27.661 88.327  86.874  1.00 31.29  ? 411 ARG C N   1 
ATOM   9908  C  CA  . ARG C 1 411 ? -26.881 89.504  86.495  1.00 30.13  ? 411 ARG C CA  1 
ATOM   9909  C  C   . ARG C 1 411 ? -27.599 90.809  86.828  1.00 30.30  ? 411 ARG C C   1 
ATOM   9910  O  O   . ARG C 1 411 ? -27.088 91.893  86.557  1.00 32.73  ? 411 ARG C O   1 
ATOM   9911  C  CB  . ARG C 1 411 ? -26.538 89.458  85.003  1.00 28.11  ? 411 ARG C CB  1 
ATOM   9912  C  CG  . ARG C 1 411 ? -25.702 88.260  84.616  1.00 26.35  ? 411 ARG C CG  1 
ATOM   9913  C  CD  . ARG C 1 411 ? -26.039 87.765  83.215  1.00 25.61  ? 411 ARG C CD  1 
ATOM   9914  N  NE  . ARG C 1 411 ? -25.595 88.691  82.185  1.00 23.77  ? 411 ARG C NE  1 
ATOM   9915  C  CZ  . ARG C 1 411 ? -26.333 89.088  81.155  1.00 22.61  ? 411 ARG C CZ  1 
ATOM   9916  N  NH1 . ARG C 1 411 ? -27.567 88.642  81.001  1.00 17.79  ? 411 ARG C NH1 1 
ATOM   9917  N  NH2 . ARG C 1 411 ? -25.840 89.967  80.294  1.00 28.25  ? 411 ARG C NH2 1 
ATOM   9918  N  N   . GLY C 1 412 ? -28.797 90.702  87.388  1.00 29.80  ? 412 GLY C N   1 
ATOM   9919  C  CA  . GLY C 1 412 ? -29.546 91.885  87.755  1.00 27.54  ? 412 GLY C CA  1 
ATOM   9920  C  C   . GLY C 1 412 ? -30.150 92.660  86.608  1.00 29.79  ? 412 GLY C C   1 
ATOM   9921  O  O   . GLY C 1 412 ? -30.580 92.096  85.604  1.00 31.58  ? 412 GLY C O   1 
ATOM   9922  N  N   . ASP C 1 413 ? -30.229 93.968  86.795  1.00 31.70  ? 413 ASP C N   1 
ATOM   9923  C  CA  . ASP C 1 413 ? -30.783 94.864  85.804  1.00 34.38  ? 413 ASP C CA  1 
ATOM   9924  C  C   . ASP C 1 413 ? -29.637 95.787  85.446  1.00 34.21  ? 413 ASP C C   1 
ATOM   9925  O  O   . ASP C 1 413 ? -29.182 96.564  86.283  1.00 35.33  ? 413 ASP C O   1 
ATOM   9926  C  CB  . ASP C 1 413 ? -31.932 95.663  86.422  1.00 41.21  ? 413 ASP C CB  1 
ATOM   9927  C  CG  . ASP C 1 413 ? -32.585 96.630  85.438  1.00 51.93  ? 413 ASP C CG  1 
ATOM   9928  O  OD1 . ASP C 1 413 ? -31.876 97.473  84.839  1.00 60.65  ? 413 ASP C OD1 1 
ATOM   9929  O  OD2 . ASP C 1 413 ? -33.824 96.561  85.273  1.00 61.83  ? 413 ASP C OD2 1 
ATOM   9930  N  N   . SER C 1 414 ? -29.184 95.727  84.204  1.00 32.71  ? 414 SER C N   1 
ATOM   9931  C  CA  . SER C 1 414 ? -28.079 96.566  83.802  1.00 29.14  ? 414 SER C CA  1 
ATOM   9932  C  C   . SER C 1 414 ? -27.906 96.506  82.295  1.00 27.84  ? 414 SER C C   1 
ATOM   9933  O  O   . SER C 1 414 ? -28.743 95.939  81.586  1.00 28.52  ? 414 SER C O   1 
ATOM   9934  C  CB  . SER C 1 414 ? -26.806 96.078  84.499  1.00 27.57  ? 414 SER C CB  1 
ATOM   9935  O  OG  . SER C 1 414 ? -25.775 97.050  84.471  1.00 37.19  ? 414 SER C OG  1 
ATOM   9936  N  N   . ASP C 1 415 ? -26.839 97.140  81.820  1.00 25.95  ? 415 ASP C N   1 
ATOM   9937  C  CA  . ASP C 1 415 ? -26.482 97.160  80.410  1.00 28.85  ? 415 ASP C CA  1 
ATOM   9938  C  C   . ASP C 1 415 ? -24.970 97.358  80.274  1.00 28.00  ? 415 ASP C C   1 
ATOM   9939  O  O   . ASP C 1 415 ? -24.278 97.655  81.256  1.00 28.66  ? 415 ASP C O   1 
ATOM   9940  C  CB  . ASP C 1 415 ? -27.264 98.239  79.634  1.00 30.72  ? 415 ASP C CB  1 
ATOM   9941  C  CG  . ASP C 1 415 ? -26.975 99.665  80.111  1.00 33.68  ? 415 ASP C CG  1 
ATOM   9942  O  OD1 . ASP C 1 415 ? -26.137 99.879  81.014  1.00 39.73  ? 415 ASP C OD1 1 
ATOM   9943  O  OD2 . ASP C 1 415 ? -27.601 100.593 79.563  1.00 34.18  ? 415 ASP C OD2 1 
ATOM   9944  N  N   . GLU C 1 416 ? -24.450 97.173  79.068  1.00 26.48  ? 416 GLU C N   1 
ATOM   9945  C  CA  . GLU C 1 416 ? -23.023 97.327  78.833  1.00 21.92  ? 416 GLU C CA  1 
ATOM   9946  C  C   . GLU C 1 416 ? -22.830 97.385  77.342  1.00 19.90  ? 416 GLU C C   1 
ATOM   9947  O  O   . GLU C 1 416 ? -23.742 97.069  76.580  1.00 19.47  ? 416 GLU C O   1 
ATOM   9948  C  CB  . GLU C 1 416 ? -22.261 96.117  79.404  1.00 22.55  ? 416 GLU C CB  1 
ATOM   9949  C  CG  . GLU C 1 416 ? -20.743 96.222  79.377  1.00 25.36  ? 416 GLU C CG  1 
ATOM   9950  C  CD  . GLU C 1 416 ? -20.224 97.381  80.205  1.00 28.91  ? 416 GLU C CD  1 
ATOM   9951  O  OE1 . GLU C 1 416 ? -20.128 97.218  81.438  1.00 33.26  ? 416 GLU C OE1 1 
ATOM   9952  O  OE2 . GLU C 1 416 ? -19.902 98.448  79.631  1.00 31.89  ? 416 GLU C OE2 1 
ATOM   9953  N  N   . TRP C 1 417 ? -21.664 97.849  76.924  1.00 20.42  ? 417 TRP C N   1 
ATOM   9954  C  CA  . TRP C 1 417 ? -21.349 97.907  75.513  1.00 22.68  ? 417 TRP C CA  1 
ATOM   9955  C  C   . TRP C 1 417 ? -19.882 97.514  75.356  1.00 21.24  ? 417 TRP C C   1 
ATOM   9956  O  O   . TRP C 1 417 ? -19.083 97.740  76.257  1.00 19.41  ? 417 TRP C O   1 
ATOM   9957  C  CB  . TRP C 1 417 ? -21.669 99.287  74.927  1.00 29.72  ? 417 TRP C CB  1 
ATOM   9958  C  CG  . TRP C 1 417 ? -20.770 100.380 75.342  1.00 40.00  ? 417 TRP C CG  1 
ATOM   9959  C  CD1 . TRP C 1 417 ? -20.793 101.056 76.521  1.00 47.12  ? 417 TRP C CD1 1 
ATOM   9960  C  CD2 . TRP C 1 417 ? -19.696 100.936 74.576  1.00 50.08  ? 417 TRP C CD2 1 
ATOM   9961  N  NE1 . TRP C 1 417 ? -19.792 102.000 76.544  1.00 53.36  ? 417 TRP C NE1 1 
ATOM   9962  C  CE2 . TRP C 1 417 ? -19.103 101.945 75.360  1.00 53.16  ? 417 TRP C CE2 1 
ATOM   9963  C  CE3 . TRP C 1 417 ? -19.176 100.678 73.299  1.00 53.24  ? 417 TRP C CE3 1 
ATOM   9964  C  CZ2 . TRP C 1 417 ? -18.009 102.698 74.912  1.00 55.45  ? 417 TRP C CZ2 1 
ATOM   9965  C  CZ3 . TRP C 1 417 ? -18.093 101.428 72.852  1.00 53.06  ? 417 TRP C CZ3 1 
ATOM   9966  C  CH2 . TRP C 1 417 ? -17.522 102.424 73.657  1.00 55.22  ? 417 TRP C CH2 1 
ATOM   9967  N  N   . THR C 1 418 ? -19.550 96.842  74.261  1.00 17.64  ? 418 THR C N   1 
ATOM   9968  C  CA  . THR C 1 418 ? -18.190 96.397  74.023  1.00 17.11  ? 418 THR C CA  1 
ATOM   9969  C  C   . THR C 1 418 ? -17.878 96.698  72.590  1.00 16.16  ? 418 THR C C   1 
ATOM   9970  O  O   . THR C 1 418 ? -18.769 96.990  71.820  1.00 16.85  ? 418 THR C O   1 
ATOM   9971  C  CB  . THR C 1 418 ? -18.083 94.886  74.185  1.00 15.96  ? 418 THR C CB  1 
ATOM   9972  O  OG1 . THR C 1 418 ? -19.067 94.262  73.359  1.00 19.86  ? 418 THR C OG1 1 
ATOM   9973  C  CG2 . THR C 1 418 ? -18.317 94.474  75.616  1.00 17.33  ? 418 THR C CG2 1 
ATOM   9974  N  N   . PHE C 1 419 ? -16.614 96.603  72.225  1.00 17.10  ? 419 PHE C N   1 
ATOM   9975  C  CA  . PHE C 1 419 ? -16.203 96.855  70.855  1.00 18.52  ? 419 PHE C CA  1 
ATOM   9976  C  C   . PHE C 1 419 ? -14.860 96.196  70.633  1.00 17.97  ? 419 PHE C C   1 
ATOM   9977  O  O   . PHE C 1 419 ? -14.153 95.902  71.597  1.00 17.56  ? 419 PHE C O   1 
ATOM   9978  C  CB  . PHE C 1 419 ? -16.107 98.355  70.585  1.00 21.53  ? 419 PHE C CB  1 
ATOM   9979  C  CG  . PHE C 1 419 ? -15.169 99.074  71.500  1.00 28.55  ? 419 PHE C CG  1 
ATOM   9980  C  CD1 . PHE C 1 419 ? -15.605 99.520  72.740  1.00 31.08  ? 419 PHE C CD1 1 
ATOM   9981  C  CD2 . PHE C 1 419 ? -13.845 99.300  71.131  1.00 31.55  ? 419 PHE C CD2 1 
ATOM   9982  C  CE1 . PHE C 1 419 ? -14.738 100.183 73.607  1.00 32.60  ? 419 PHE C CE1 1 
ATOM   9983  C  CE2 . PHE C 1 419 ? -12.967 99.963  71.991  1.00 32.65  ? 419 PHE C CE2 1 
ATOM   9984  C  CZ  . PHE C 1 419 ? -13.415 100.404 73.230  1.00 31.56  ? 419 PHE C CZ  1 
ATOM   9985  N  N   . GLY C 1 420 ? -14.518 95.945  69.374  1.00 18.81  ? 420 GLY C N   1 
ATOM   9986  C  CA  . GLY C 1 420 ? -13.248 95.311  69.060  1.00 16.03  ? 420 GLY C CA  1 
ATOM   9987  C  C   . GLY C 1 420 ? -13.159 94.824  67.622  1.00 14.75  ? 420 GLY C C   1 
ATOM   9988  O  O   . GLY C 1 420 ? -13.955 95.241  66.773  1.00 14.70  ? 420 GLY C O   1 
ATOM   9989  N  N   . ALA C 1 421 ? -12.194 93.943  67.361  1.00 12.56  ? 421 ALA C N   1 
ATOM   9990  C  CA  . ALA C 1 421 ? -11.956 93.363  66.041  1.00 10.73  ? 421 ALA C CA  1 
ATOM   9991  C  C   . ALA C 1 421 ? -11.947 91.851  66.163  1.00 11.34  ? 421 ALA C C   1 
ATOM   9992  O  O   . ALA C 1 421 ? -11.519 91.311  67.178  1.00 14.75  ? 421 ALA C O   1 
ATOM   9993  C  CB  . ALA C 1 421 ? -10.625 93.822  65.522  1.00 14.60  ? 421 ALA C CB  1 
ATOM   9994  N  N   . GLN C 1 422 ? -12.334 91.155  65.110  1.00 11.13  ? 422 GLN C N   1 
ATOM   9995  C  CA  . GLN C 1 422 ? -12.358 89.702  65.166  1.00 11.49  ? 422 GLN C CA  1 
ATOM   9996  C  C   . GLN C 1 422 ? -12.328 89.099  63.764  1.00 13.68  ? 422 GLN C C   1 
ATOM   9997  O  O   . GLN C 1 422 ? -12.726 89.736  62.799  1.00 15.60  ? 422 GLN C O   1 
ATOM   9998  C  CB  . GLN C 1 422 ? -13.643 89.235  65.883  1.00 7.83   ? 422 GLN C CB  1 
ATOM   9999  C  CG  . GLN C 1 422 ? -13.720 87.726  66.179  1.00 7.04   ? 422 GLN C CG  1 
ATOM   10000 C  CD  . GLN C 1 422 ? -15.139 87.167  66.138  1.00 10.33  ? 422 GLN C CD  1 
ATOM   10001 O  OE1 . GLN C 1 422 ? -16.015 87.691  65.449  1.00 15.94  ? 422 GLN C OE1 1 
ATOM   10002 N  NE2 . GLN C 1 422 ? -15.365 86.097  66.865  1.00 9.17   ? 422 GLN C NE2 1 
ATOM   10003 N  N   . MET C 1 423 ? -11.826 87.879  63.654  1.00 12.06  ? 423 MET C N   1 
ATOM   10004 C  CA  . MET C 1 423 ? -11.817 87.176  62.387  1.00 12.62  ? 423 MET C CA  1 
ATOM   10005 C  C   . MET C 1 423 ? -12.557 85.868  62.625  1.00 12.92  ? 423 MET C C   1 
ATOM   10006 O  O   . MET C 1 423 ? -12.588 85.366  63.751  1.00 17.71  ? 423 MET C O   1 
ATOM   10007 C  CB  . MET C 1 423 ? -10.381 86.882  61.917  1.00 8.77   ? 423 MET C CB  1 
ATOM   10008 C  CG  . MET C 1 423 ? -9.629  85.814  62.702  1.00 6.30   ? 423 MET C CG  1 
ATOM   10009 S  SD  . MET C 1 423 ? -10.060 84.083  62.335  1.00 13.32  ? 423 MET C SD  1 
ATOM   10010 C  CE  . MET C 1 423 ? -8.696  83.279  62.919  1.00 2.00   ? 423 MET C CE  1 
ATOM   10011 N  N   . GLU C 1 424 ? -13.239 85.369  61.603  1.00 14.88  ? 424 GLU C N   1 
ATOM   10012 C  CA  . GLU C 1 424 ? -13.921 84.078  61.703  1.00 12.11  ? 424 GLU C CA  1 
ATOM   10013 C  C   . GLU C 1 424 ? -13.709 83.399  60.357  1.00 13.77  ? 424 GLU C C   1 
ATOM   10014 O  O   . GLU C 1 424 ? -13.764 84.059  59.323  1.00 15.75  ? 424 GLU C O   1 
ATOM   10015 C  CB  . GLU C 1 424 ? -15.415 84.211  61.986  1.00 10.83  ? 424 GLU C CB  1 
ATOM   10016 C  CG  . GLU C 1 424 ? -16.097 82.838  62.009  1.00 9.64   ? 424 GLU C CG  1 
ATOM   10017 C  CD  . GLU C 1 424 ? -17.561 82.888  62.363  1.00 15.24  ? 424 GLU C CD  1 
ATOM   10018 O  OE1 . GLU C 1 424 ? -18.330 83.559  61.643  1.00 13.37  ? 424 GLU C OE1 1 
ATOM   10019 O  OE2 . GLU C 1 424 ? -17.951 82.233  63.355  1.00 14.71  ? 424 GLU C OE2 1 
ATOM   10020 N  N   . ILE C 1 425 ? -13.476 82.094  60.354  1.00 12.43  ? 425 ILE C N   1 
ATOM   10021 C  CA  . ILE C 1 425 ? -13.246 81.411  59.100  1.00 10.68  ? 425 ILE C CA  1 
ATOM   10022 C  C   . ILE C 1 425 ? -13.516 79.925  59.185  1.00 13.16  ? 425 ILE C C   1 
ATOM   10023 O  O   . ILE C 1 425 ? -13.380 79.330  60.250  1.00 18.23  ? 425 ILE C O   1 
ATOM   10024 C  CB  . ILE C 1 425 ? -11.759 81.572  58.673  1.00 9.13   ? 425 ILE C CB  1 
ATOM   10025 C  CG1 . ILE C 1 425 ? -11.497 80.937  57.300  1.00 10.55  ? 425 ILE C CG1 1 
ATOM   10026 C  CG2 . ILE C 1 425 ? -10.867 80.916  59.694  1.00 6.95   ? 425 ILE C CG2 1 
ATOM   10027 C  CD1 . ILE C 1 425 ? -9.999  80.906  56.876  1.00 5.75   ? 425 ILE C CD1 1 
ATOM   10028 N  N   . TRP C 1 426 ? -14.015 79.350  58.096  1.00 12.01  ? 426 TRP C N   1 
ATOM   10029 C  CA  . TRP C 1 426 ? -14.180 77.902  58.018  1.00 14.42  ? 426 TRP C CA  1 
ATOM   10030 C  C   . TRP C 1 426 ? -13.604 77.606  56.645  1.00 16.76  ? 426 TRP C C   1 
ATOM   10031 O  O   . TRP C 1 426 ? -13.690 78.433  55.731  1.00 17.62  ? 426 TRP C O   1 
ATOM   10032 C  CB  . TRP C 1 426 ? -15.618 77.398  58.217  1.00 14.54  ? 426 TRP C CB  1 
ATOM   10033 C  CG  . TRP C 1 426 ? -16.700 78.115  57.506  1.00 21.36  ? 426 TRP C CG  1 
ATOM   10034 C  CD1 . TRP C 1 426 ? -16.909 78.151  56.163  1.00 24.89  ? 426 TRP C CD1 1 
ATOM   10035 C  CD2 . TRP C 1 426 ? -17.778 78.860  58.104  1.00 24.30  ? 426 TRP C CD2 1 
ATOM   10036 N  NE1 . TRP C 1 426 ? -18.048 78.871  55.882  1.00 29.16  ? 426 TRP C NE1 1 
ATOM   10037 C  CE2 . TRP C 1 426 ? -18.602 79.316  57.053  1.00 24.44  ? 426 TRP C CE2 1 
ATOM   10038 C  CE3 . TRP C 1 426 ? -18.124 79.184  59.421  1.00 16.53  ? 426 TRP C CE3 1 
ATOM   10039 C  CZ2 . TRP C 1 426 ? -19.753 80.080  57.276  1.00 23.10  ? 426 TRP C CZ2 1 
ATOM   10040 C  CZ3 . TRP C 1 426 ? -19.269 79.946  59.642  1.00 18.38  ? 426 TRP C CZ3 1 
ATOM   10041 C  CH2 . TRP C 1 426 ? -20.070 80.386  58.569  1.00 22.07  ? 426 TRP C CH2 1 
ATOM   10042 N  N   . TRP C 1 427 ? -12.889 76.506  56.527  1.00 13.72  ? 427 TRP C N   1 
ATOM   10043 C  CA  . TRP C 1 427 ? -12.258 76.189  55.273  1.00 11.35  ? 427 TRP C CA  1 
ATOM   10044 C  C   . TRP C 1 427 ? -12.249 74.684  55.096  1.00 15.92  ? 427 TRP C C   1 
ATOM   10045 O  O   . TRP C 1 427 ? -11.738 74.242  54.051  1.00 20.77  ? 427 TRP C O   1 
ATOM   10046 C  CB  . TRP C 1 427 ? -10.820 76.736  55.266  1.00 8.95   ? 427 TRP C CB  1 
ATOM   10047 C  CG  . TRP C 1 427 ? -9.894  76.029  56.243  1.00 11.88  ? 427 TRP C CG  1 
ATOM   10048 C  CD1 . TRP C 1 427 ? -9.027  75.009  55.958  1.00 13.79  ? 427 TRP C CD1 1 
ATOM   10049 C  CD2 . TRP C 1 427 ? -9.797  76.248  57.657  1.00 14.46  ? 427 TRP C CD2 1 
ATOM   10050 N  NE1 . TRP C 1 427 ? -8.409  74.577  57.103  1.00 16.72  ? 427 TRP C NE1 1 
ATOM   10051 C  CE2 . TRP C 1 427 ? -8.860  75.322  58.160  1.00 16.36  ? 427 TRP C CE2 1 
ATOM   10052 C  CE3 . TRP C 1 427 ? -10.412 77.133  58.549  1.00 12.90  ? 427 TRP C CE3 1 
ATOM   10053 C  CZ2 . TRP C 1 427 ? -8.525  75.259  59.512  1.00 18.96  ? 427 TRP C CZ2 1 
ATOM   10054 C  CZ3 . TRP C 1 427 ? -10.076 77.069  59.892  1.00 13.28  ? 427 TRP C CZ3 1 
ATOM   10055 C  CH2 . TRP C 1 427 ? -9.141  76.139  60.359  1.00 15.79  ? 427 TRP C CH2 1 
ATOM   10056 O  OXT . TRP C 1 427 ? -12.751 73.968  55.996  1.00 19.06  ? 427 TRP C OXT 1 
HETATM 10057 C  C2  . BGC D 2 .   ? 1.668   53.117  73.030  1.00 55.88  ? 1   BGC D C2  1 
HETATM 10058 C  C3  . BGC D 2 .   ? 1.131   52.210  71.929  1.00 50.91  ? 1   BGC D C3  1 
HETATM 10059 C  C4  . BGC D 2 .   ? 1.926   52.498  70.668  1.00 45.93  ? 1   BGC D C4  1 
HETATM 10060 C  C5  . BGC D 2 .   ? 3.423   52.270  70.923  1.00 51.18  ? 1   BGC D C5  1 
HETATM 10061 C  C6  . BGC D 2 .   ? 4.273   52.671  69.738  1.00 50.69  ? 1   BGC D C6  1 
HETATM 10062 C  C1  . BGC D 2 .   ? 3.131   52.754  73.250  1.00 58.99  ? 1   BGC D C1  1 
HETATM 10063 O  O1  . BGC D 2 .   ? 3.652   53.491  74.304  1.00 58.50  ? 1   BGC D O1  1 
HETATM 10064 O  O2  . BGC D 2 .   ? 0.930   52.945  74.233  1.00 65.99  ? 1   BGC D O2  1 
HETATM 10065 O  O3  . BGC D 2 .   ? -0.258  52.435  71.711  1.00 45.82  ? 1   BGC D O3  1 
HETATM 10066 O  O4  . BGC D 2 .   ? 1.465   51.633  69.612  1.00 39.93  ? 1   BGC D O4  1 
HETATM 10067 O  O5  . BGC D 2 .   ? 3.876   53.049  72.058  1.00 59.19  ? 1   BGC D O5  1 
HETATM 10068 O  O6  . BGC D 2 .   ? 3.804   53.875  69.155  1.00 41.93  ? 1   BGC D O6  1 
HETATM 10069 C  C1  . GLC D 2 .   ? 0.533   52.222  68.763  1.00 36.11  ? 2   GLC D C1  1 
HETATM 10070 C  C2  . GLC D 2 .   ? -0.474  51.190  68.319  1.00 33.41  ? 2   GLC D C2  1 
HETATM 10071 C  C3  . GLC D 2 .   ? 0.198   50.212  67.369  1.00 32.93  ? 2   GLC D C3  1 
HETATM 10072 C  C4  . GLC D 2 .   ? 0.819   50.978  66.213  1.00 31.47  ? 2   GLC D C4  1 
HETATM 10073 C  C5  . GLC D 2 .   ? 1.797   52.002  66.727  1.00 31.69  ? 2   GLC D C5  1 
HETATM 10074 C  C6  . GLC D 2 .   ? 2.364   52.866  65.611  1.00 30.59  ? 2   GLC D C6  1 
HETATM 10075 O  O2  . GLC D 2 .   ? -0.976  50.512  69.460  1.00 28.75  ? 2   GLC D O2  1 
HETATM 10076 O  O3  . GLC D 2 .   ? -0.753  49.278  66.872  1.00 30.71  ? 2   GLC D O3  1 
HETATM 10077 O  O4  . GLC D 2 .   ? 1.518   50.056  65.383  1.00 37.17  ? 2   GLC D O4  1 
HETATM 10078 O  O5  . GLC D 2 .   ? 1.140   52.872  67.651  1.00 38.55  ? 2   GLC D O5  1 
HETATM 10079 O  O6  . GLC D 2 .   ? 3.333   53.779  66.110  1.00 31.54  ? 2   GLC D O6  1 
HETATM 10080 C  C1  . GLC D 2 .   ? 0.977   49.831  64.132  1.00 43.02  ? 3   GLC D C1  1 
HETATM 10081 C  C2  . GLC D 2 .   ? 1.011   48.334  63.860  1.00 45.83  ? 3   GLC D C2  1 
HETATM 10082 C  C3  . GLC D 2 .   ? 2.452   47.857  63.691  1.00 50.89  ? 3   GLC D C3  1 
HETATM 10083 C  C4  . GLC D 2 .   ? 3.139   48.690  62.603  1.00 51.63  ? 3   GLC D C4  1 
HETATM 10084 C  C5  . GLC D 2 .   ? 3.045   50.182  62.937  1.00 50.69  ? 3   GLC D C5  1 
HETATM 10085 C  C6  . GLC D 2 .   ? 3.597   51.067  61.832  1.00 55.54  ? 3   GLC D C6  1 
HETATM 10086 O  O2  . GLC D 2 .   ? 0.415   47.658  64.952  1.00 40.25  ? 3   GLC D O2  1 
HETATM 10087 O  O3  . GLC D 2 .   ? 2.473   46.470  63.346  1.00 52.62  ? 3   GLC D O3  1 
HETATM 10088 O  O4  . GLC D 2 .   ? 4.505   48.309  62.494  1.00 61.53  ? 3   GLC D O4  1 
HETATM 10089 O  O5  . GLC D 2 .   ? 1.667   50.563  63.127  1.00 48.22  ? 3   GLC D O5  1 
HETATM 10090 O  O6  . GLC D 2 .   ? 3.012   52.364  61.874  1.00 65.13  ? 3   GLC D O6  1 
HETATM 10091 C  C2  . BGC E 2 .   ? 9.593   80.542  73.657  1.00 55.81  ? 1   BGC E C2  1 
HETATM 10092 C  C3  . BGC E 2 .   ? 10.790  80.469  72.727  1.00 50.93  ? 1   BGC E C3  1 
HETATM 10093 C  C4  . BGC E 2 .   ? 10.329  80.938  71.359  1.00 45.87  ? 1   BGC E C4  1 
HETATM 10094 C  C5  . BGC E 2 .   ? 9.770   82.362  71.432  1.00 51.18  ? 1   BGC E C5  1 
HETATM 10095 C  C6  . BGC E 2 .   ? 9.157   82.815  70.111  1.00 50.83  ? 1   BGC E C6  1 
HETATM 10096 C  C1  . BGC E 2 .   ? 9.187   82.008  73.737  1.00 58.96  ? 1   BGC E C1  1 
HETATM 10097 O  O1  . BGC E 2 .   ? 8.156   82.161  74.649  1.00 58.71  ? 1   BGC E O1  1 
HETATM 10098 O  O2  . BGC E 2 .   ? 9.926   80.045  74.943  1.00 65.80  ? 1   BGC E O2  1 
HETATM 10099 O  O3  . BGC E 2 .   ? 11.314  79.145  72.664  1.00 45.74  ? 1   BGC E O3  1 
HETATM 10100 O  O4  . BGC E 2 .   ? 11.438  80.893  70.452  1.00 39.93  ? 1   BGC E O4  1 
HETATM 10101 O  O5  . BGC E 2 .   ? 8.735   82.452  72.446  1.00 59.33  ? 1   BGC E O5  1 
HETATM 10102 O  O6  . BGC E 2 .   ? 8.452   81.762  69.461  1.00 42.22  ? 1   BGC E O6  1 
HETATM 10103 C  C1  . GLC E 2 .   ? 11.456  79.744  69.675  1.00 35.95  ? 2   GLC E C1  1 
HETATM 10104 C  C2  . GLC E 2 .   ? 12.881  79.328  69.418  1.00 33.54  ? 2   GLC E C2  1 
HETATM 10105 C  C3  . GLC E 2 .   ? 13.532  80.322  68.459  1.00 32.75  ? 2   GLC E C3  1 
HETATM 10106 C  C4  . GLC E 2 .   ? 12.689  80.422  67.200  1.00 31.52  ? 2   GLC E C4  1 
HETATM 10107 C  C5  . GLC E 2 .   ? 11.269  80.826  67.534  1.00 31.96  ? 2   GLC E C5  1 
HETATM 10108 C  C6  . GLC E 2 .   ? 10.369  80.822  66.301  1.00 30.59  ? 2   GLC E C6  1 
HETATM 10109 O  O2  . GLC E 2 .   ? 13.574  79.281  70.660  1.00 28.94  ? 2   GLC E O2  1 
HETATM 10110 O  O3  . GLC E 2 .   ? 14.849  79.899  68.116  1.00 30.76  ? 2   GLC E O3  1 
HETATM 10111 O  O4  . GLC E 2 .   ? 13.257  81.415  66.347  1.00 37.38  ? 2   GLC E O4  1 
HETATM 10112 O  O5  . GLC E 2 .   ? 10.718  79.896  68.471  1.00 38.46  ? 2   GLC E O5  1 
HETATM 10113 O  O6  . GLC E 2 .   ? 9.051   81.242  66.618  1.00 31.39  ? 2   GLC E O6  1 
HETATM 10114 C  C1  . GLC E 2 .   ? 13.862  80.951  65.194  1.00 43.07  ? 3   GLC E C1  1 
HETATM 10115 C  C2  . GLC E 2 .   ? 15.185  81.677  65.024  1.00 45.89  ? 3   GLC E C2  1 
HETATM 10116 C  C3  . GLC E 2 .   ? 14.926  83.150  64.708  1.00 50.78  ? 3   GLC E C3  1 
HETATM 10117 C  C4  . GLC E 2 .   ? 14.005  83.257  63.490  1.00 51.72  ? 3   GLC E C4  1 
HETATM 10118 C  C5  . GLC E 2 .   ? 12.719  82.493  63.742  1.00 50.53  ? 3   GLC E C5  1 
HETATM 10119 C  C6  . GLC E 2 .   ? 11.826  82.468  62.518  1.00 55.62  ? 3   GLC E C6  1 
HETATM 10120 O  O2  . GLC E 2 .   ? 15.925  81.562  66.230  1.00 40.26  ? 3   GLC E O2  1 
HETATM 10121 O  O3  . GLC E 2 .   ? 16.159  83.812  64.448  1.00 52.67  ? 3   GLC E O3  1 
HETATM 10122 O  O4  . GLC E 2 .   ? 13.699  84.616  63.229  1.00 61.80  ? 3   GLC E O4  1 
HETATM 10123 O  O5  . GLC E 2 .   ? 13.022  81.126  64.063  1.00 48.16  ? 3   GLC E O5  1 
HETATM 10124 O  O6  . GLC E 2 .   ? 11.003  81.306  62.514  1.00 65.19  ? 3   GLC E O6  1 
HETATM 10125 C  C2  . BGC F 2 .   ? -18.082 73.734  71.364  1.00 55.84  ? 1   BGC F C2  1 
HETATM 10126 C  C3  . BGC F 2 .   ? -18.467 74.733  70.285  1.00 50.87  ? 1   BGC F C3  1 
HETATM 10127 C  C4  . BGC F 2 .   ? -18.446 73.988  68.959  1.00 45.84  ? 1   BGC F C4  1 
HETATM 10128 C  C5  . BGC F 2 .   ? -19.422 72.801  68.995  1.00 51.24  ? 1   BGC F C5  1 
HETATM 10129 C  C6  . BGC F 2 .   ? -19.344 71.941  67.741  1.00 50.85  ? 1   BGC F C6  1 
HETATM 10130 C  C1  . BGC F 2 .   ? -19.161 72.649  71.380  1.00 59.01  ? 1   BGC F C1  1 
HETATM 10131 O  O1  . BGC F 2 .   ? -18.929 71.752  72.411  1.00 58.54  ? 1   BGC F O1  1 
HETATM 10132 O  O2  . BGC F 2 .   ? -17.996 74.372  72.628  1.00 65.88  ? 1   BGC F O2  1 
HETATM 10133 O  O3  . BGC F 2 .   ? -17.577 75.848  70.271  1.00 45.70  ? 1   BGC F O3  1 
HETATM 10134 O  O4  . BGC F 2 .   ? -18.821 74.886  67.907  1.00 39.78  ? 1   BGC F O4  1 
HETATM 10135 O  O5  . BGC F 2 .   ? -19.146 71.937  70.129  1.00 59.32  ? 1   BGC F O5  1 
HETATM 10136 O  O6  . BGC F 2 .   ? -18.011 71.831  67.255  1.00 42.31  ? 1   BGC F O6  1 
HETATM 10137 C  C1  . GLC F 2 .   ? -17.747 75.454  67.231  1.00 36.04  ? 2   GLC F C1  1 
HETATM 10138 C  C2  . GLC F 2 .   ? -18.094 76.872  66.837  1.00 33.67  ? 2   GLC F C2  1 
HETATM 10139 C  C3  . GLC F 2 .   ? -19.123 76.851  65.708  1.00 32.72  ? 2   GLC F C3  1 
HETATM 10140 C  C4  . GLC F 2 .   ? -18.616 75.999  64.564  1.00 31.29  ? 2   GLC F C4  1 
HETATM 10141 C  C5  . GLC F 2 .   ? -18.284 74.616  65.044  1.00 31.82  ? 2   GLC F C5  1 
HETATM 10142 C  C6  . GLC F 2 .   ? -17.666 73.763  63.956  1.00 30.62  ? 2   GLC F C6  1 
HETATM 10143 O  O2  . GLC F 2 .   ? -18.604 77.558  67.980  1.00 28.88  ? 2   GLC F O2  1 
HETATM 10144 O  O3  . GLC F 2 .   ? -19.354 78.173  65.237  1.00 31.05  ? 2   GLC F O3  1 
HETATM 10145 O  O4  . GLC F 2 .   ? -19.646 75.900  63.581  1.00 37.42  ? 2   GLC F O4  1 
HETATM 10146 O  O5  . GLC F 2 .   ? -17.334 74.685  66.109  1.00 38.57  ? 2   GLC F O5  1 
HETATM 10147 O  O6  . GLC F 2 .   ? -17.364 72.466  64.452  1.00 31.49  ? 2   GLC F O6  1 
HETATM 10148 C  C1  . GLC F 2 .   ? -19.426 76.590  62.401  1.00 43.05  ? 3   GLC F C1  1 
HETATM 10149 C  C2  . GLC F 2 .   ? -20.692 77.335  62.041  1.00 45.82  ? 3   GLC F C2  1 
HETATM 10150 C  C3  . GLC F 2 .   ? -21.783 76.356  61.631  1.00 50.71  ? 3   GLC F C3  1 
HETATM 10151 C  C4  . GLC F 2 .   ? -21.278 75.454  60.520  1.00 51.60  ? 3   GLC F C4  1 
HETATM 10152 C  C5  . GLC F 2 .   ? -20.012 74.749  60.970  1.00 50.69  ? 3   GLC F C5  1 
HETATM 10153 C  C6  . GLC F 2 .   ? -19.400 73.910  59.859  1.00 55.66  ? 3   GLC F C6  1 
HETATM 10154 O  O2  . GLC F 2 .   ? -21.116 78.067  63.176  1.00 40.25  ? 3   GLC F O2  1 
HETATM 10155 O  O3  . GLC F 2 .   ? -22.930 77.069  61.183  1.00 52.78  ? 3   GLC F O3  1 
HETATM 10156 O  O4  . GLC F 2 .   ? -22.273 74.494  60.212  1.00 61.77  ? 3   GLC F O4  1 
HETATM 10157 O  O5  . GLC F 2 .   ? -19.025 75.722  61.356  1.00 48.18  ? 3   GLC F O5  1 
HETATM 10158 O  O6  . GLC F 2 .   ? -17.997 73.757  60.045  1.00 65.26  ? 3   GLC F O6  1 
HETATM 10159 CA CA  . CA  G 3 .   ? -3.062  69.124  80.674  1.00 64.68  ? 431 CA  A CA  1 
HETATM 10160 O  O   . HOH H 4 .   ? -6.550  46.509  65.592  1.00 8.67   ? 432 HOH A O   1 
HETATM 10161 O  O   . HOH H 4 .   ? -1.442  69.063  62.784  1.00 27.18  ? 433 HOH A O   1 
HETATM 10162 O  O   . HOH H 4 .   ? -5.409  44.238  64.534  1.00 16.80  ? 434 HOH A O   1 
HETATM 10163 O  O   . HOH H 4 .   ? -0.842  38.515  74.746  1.00 17.41  ? 435 HOH A O   1 
HETATM 10164 O  O   . HOH H 4 .   ? 2.481   66.112  63.581  1.00 13.82  ? 436 HOH A O   1 
HETATM 10165 O  O   . HOH H 4 .   ? 21.445  54.858  63.910  1.00 14.17  ? 437 HOH A O   1 
HETATM 10166 O  O   . HOH H 4 .   ? -3.720  47.470  70.935  1.00 17.92  ? 438 HOH A O   1 
HETATM 10167 O  O   . HOH H 4 .   ? 19.426  47.214  61.438  1.00 19.88  ? 439 HOH A O   1 
HETATM 10168 O  O   . HOH H 4 .   ? 0.785   40.129  63.828  1.00 24.52  ? 440 HOH A O   1 
HETATM 10169 O  O   . HOH H 4 .   ? 21.732  51.025  65.654  1.00 12.89  ? 441 HOH A O   1 
HETATM 10170 O  O   . HOH H 4 .   ? 16.623  46.738  63.477  1.00 16.54  ? 442 HOH A O   1 
HETATM 10171 O  O   . HOH H 4 .   ? 20.491  55.006  54.803  1.00 36.94  ? 443 HOH A O   1 
HETATM 10172 O  O   . HOH H 4 .   ? -5.186  48.276  73.059  1.00 20.92  ? 444 HOH A O   1 
HETATM 10173 O  O   . HOH H 4 .   ? 8.909   43.790  77.232  1.00 19.68  ? 445 HOH A O   1 
HETATM 10174 O  O   . HOH H 4 .   ? -5.571  35.854  75.854  1.00 22.91  ? 446 HOH A O   1 
HETATM 10175 O  O   . HOH H 4 .   ? 8.022   53.375  70.576  1.00 19.39  ? 447 HOH A O   1 
HETATM 10176 O  O   . HOH H 4 .   ? 6.147   43.822  87.481  1.00 53.34  ? 448 HOH A O   1 
HETATM 10177 O  O   . HOH H 4 .   ? 14.534  49.638  68.520  1.00 17.26  ? 449 HOH A O   1 
HETATM 10178 O  O   . HOH H 4 .   ? -5.284  42.079  60.157  1.00 21.32  ? 450 HOH A O   1 
HETATM 10179 O  O   . HOH H 4 .   ? -1.305  44.327  73.687  1.00 20.06  ? 451 HOH A O   1 
HETATM 10180 O  O   . HOH H 4 .   ? -12.752 50.064  70.157  1.00 15.84  ? 452 HOH A O   1 
HETATM 10181 O  O   . HOH H 4 .   ? 5.445   55.877  59.123  1.00 45.91  ? 453 HOH A O   1 
HETATM 10182 O  O   . HOH H 4 .   ? 0.356   67.660  64.220  1.00 17.47  ? 454 HOH A O   1 
HETATM 10183 O  O   . HOH H 4 .   ? -3.324  38.766  77.677  1.00 21.46  ? 455 HOH A O   1 
HETATM 10184 O  O   . HOH H 4 .   ? -7.009  43.705  56.368  1.00 19.34  ? 456 HOH A O   1 
HETATM 10185 O  O   . HOH H 4 .   ? 10.441  58.851  70.528  1.00 16.86  ? 457 HOH A O   1 
HETATM 10186 O  O   . HOH H 4 .   ? 11.715  44.897  61.300  1.00 53.75  ? 458 HOH A O   1 
HETATM 10187 O  O   . HOH H 4 .   ? 17.261  53.845  78.103  1.00 16.04  ? 459 HOH A O   1 
HETATM 10188 O  O   . HOH H 4 .   ? 26.784  57.315  86.334  1.00 51.47  ? 460 HOH A O   1 
HETATM 10189 O  O   . HOH H 4 .   ? 10.151  42.870  80.496  1.00 28.46  ? 461 HOH A O   1 
HETATM 10190 O  O   . HOH H 4 .   ? 27.323  61.216  90.243  1.00 39.74  ? 462 HOH A O   1 
HETATM 10191 O  O   . HOH H 4 .   ? 18.233  54.544  93.038  1.00 19.07  ? 463 HOH A O   1 
HETATM 10192 O  O   . HOH H 4 .   ? 19.558  43.727  71.587  1.00 24.28  ? 464 HOH A O   1 
HETATM 10193 O  O   . HOH H 4 .   ? 4.989   41.410  83.881  1.00 49.58  ? 465 HOH A O   1 
HETATM 10194 O  O   . HOH H 4 .   ? 12.621  32.679  60.164  1.00 21.86  ? 466 HOH A O   1 
HETATM 10195 O  O   . HOH H 4 .   ? 9.368   61.326  51.005  1.00 69.05  ? 467 HOH A O   1 
HETATM 10196 O  O   . HOH H 4 .   ? -12.023 46.431  70.076  1.00 20.05  ? 468 HOH A O   1 
HETATM 10197 O  O   . HOH H 4 .   ? -7.366  48.314  75.039  1.00 23.27  ? 469 HOH A O   1 
HETATM 10198 O  O   . HOH H 4 .   ? 15.745  28.242  52.556  1.00 48.05  ? 470 HOH A O   1 
HETATM 10199 O  O   . HOH H 4 .   ? 7.769   57.031  62.731  1.00 29.62  ? 471 HOH A O   1 
HETATM 10200 O  O   . HOH H 4 .   ? -5.435  42.100  83.829  1.00 43.30  ? 472 HOH A O   1 
HETATM 10201 O  O   . HOH H 4 .   ? 17.512  48.321  89.943  1.00 21.35  ? 473 HOH A O   1 
HETATM 10202 O  O   . HOH H 4 .   ? 16.304  54.384  75.444  1.00 22.13  ? 474 HOH A O   1 
HETATM 10203 O  O   . HOH H 4 .   ? -14.397 41.434  83.003  1.00 51.87  ? 475 HOH A O   1 
HETATM 10204 O  O   . HOH H 4 .   ? -7.442  43.747  59.553  1.00 24.14  ? 476 HOH A O   1 
HETATM 10205 O  O   . HOH H 4 .   ? 20.500  34.654  91.026  1.00 57.75  ? 477 HOH A O   1 
HETATM 10206 O  O   . HOH H 4 .   ? -10.858 40.261  51.521  1.00 22.15  ? 478 HOH A O   1 
HETATM 10207 O  O   . HOH H 4 .   ? 7.716   37.410  81.326  1.00 25.59  ? 479 HOH A O   1 
HETATM 10208 O  O   . HOH H 4 .   ? -16.973 51.569  73.545  1.00 20.26  ? 480 HOH A O   1 
HETATM 10209 O  O   . HOH H 4 .   ? -14.750 48.455  69.650  1.00 25.49  ? 481 HOH A O   1 
HETATM 10210 O  O   . HOH H 4 .   ? 12.252  57.014  61.628  1.00 23.43  ? 482 HOH A O   1 
HETATM 10211 O  O   . HOH H 4 .   ? 6.842   46.970  60.701  1.00 54.28  ? 483 HOH A O   1 
HETATM 10212 O  O   . HOH H 4 .   ? 4.888   46.293  73.704  1.00 29.11  ? 484 HOH A O   1 
HETATM 10213 O  O   . HOH H 4 .   ? -17.231 41.392  83.315  1.00 51.99  ? 485 HOH A O   1 
HETATM 10214 O  O   . HOH H 4 .   ? 21.304  61.750  88.357  1.00 21.51  ? 486 HOH A O   1 
HETATM 10215 O  O   . HOH H 4 .   ? 15.631  41.811  61.002  1.00 24.63  ? 487 HOH A O   1 
HETATM 10216 O  O   . HOH H 4 .   ? 27.799  45.212  83.516  1.00 53.79  ? 488 HOH A O   1 
HETATM 10217 O  O   . HOH H 4 .   ? -2.989  61.869  74.523  1.00 24.52  ? 489 HOH A O   1 
HETATM 10218 O  O   . HOH H 4 .   ? 10.679  33.548  86.373  1.00 24.35  ? 490 HOH A O   1 
HETATM 10219 O  O   . HOH H 4 .   ? -10.300 51.152  69.003  1.00 18.61  ? 491 HOH A O   1 
HETATM 10220 O  O   . HOH H 4 .   ? 16.953  62.685  81.396  1.00 21.42  ? 492 HOH A O   1 
HETATM 10221 O  O   . HOH H 4 .   ? 8.629   56.761  59.449  1.00 65.01  ? 493 HOH A O   1 
HETATM 10222 O  O   . HOH H 4 .   ? 8.635   51.779  76.466  1.00 41.68  ? 494 HOH A O   1 
HETATM 10223 O  O   . HOH H 4 .   ? -5.847  38.800  75.216  1.00 28.21  ? 495 HOH A O   1 
HETATM 10224 O  O   . HOH H 4 .   ? -16.935 39.057  85.020  1.00 67.71  ? 496 HOH A O   1 
HETATM 10225 O  O   . HOH H 4 .   ? 4.054   42.490  63.096  1.00 27.45  ? 497 HOH A O   1 
HETATM 10226 O  O   . HOH H 4 .   ? 14.599  47.693  81.342  1.00 20.81  ? 498 HOH A O   1 
HETATM 10227 O  O   . HOH H 4 .   ? -14.649 50.814  76.123  1.00 33.36  ? 499 HOH A O   1 
HETATM 10228 O  O   . HOH H 4 .   ? 15.055  62.552  52.209  1.00 40.99  ? 500 HOH A O   1 
HETATM 10229 O  O   . HOH H 4 .   ? 16.102  39.279  59.791  1.00 23.33  ? 501 HOH A O   1 
HETATM 10230 O  O   . HOH H 4 .   ? 23.466  44.903  89.482  1.00 48.68  ? 502 HOH A O   1 
HETATM 10231 O  O   . HOH H 4 .   ? 6.374   40.780  87.811  1.00 28.56  ? 503 HOH A O   1 
HETATM 10232 O  O   . HOH H 4 .   ? 21.880  47.910  60.391  1.00 25.00  ? 504 HOH A O   1 
HETATM 10233 O  O   . HOH H 4 .   ? 13.476  53.833  61.869  1.00 30.93  ? 505 HOH A O   1 
HETATM 10234 O  O   . HOH H 4 .   ? -3.818  45.232  72.603  1.00 21.22  ? 506 HOH A O   1 
HETATM 10235 O  O   . HOH H 4 .   ? 10.999  59.686  62.278  1.00 20.31  ? 507 HOH A O   1 
HETATM 10236 O  O   . HOH H 4 .   ? 13.906  55.876  75.391  1.00 17.82  ? 508 HOH A O   1 
HETATM 10237 O  O   . HOH H 4 .   ? -12.655 66.037  78.576  1.00 54.11  ? 509 HOH A O   1 
HETATM 10238 O  O   . HOH H 4 .   ? 6.824   50.254  72.904  1.00 35.72  ? 510 HOH A O   1 
HETATM 10239 O  O   . HOH H 4 .   ? 5.993   36.921  90.716  1.00 21.69  ? 511 HOH A O   1 
HETATM 10240 O  O   . HOH H 4 .   ? -1.867  67.167  65.569  1.00 20.66  ? 512 HOH A O   1 
HETATM 10241 O  O   . HOH H 4 .   ? 15.160  46.567  78.016  1.00 18.37  ? 513 HOH A O   1 
HETATM 10242 O  O   . HOH H 4 .   ? 19.504  43.750  103.943 1.00 56.55  ? 514 HOH A O   1 
HETATM 10243 O  O   . HOH H 4 .   ? 4.676   45.700  77.035  1.00 41.77  ? 515 HOH A O   1 
HETATM 10244 O  O   . HOH H 4 .   ? 24.682  60.794  55.711  1.00 26.00  ? 516 HOH A O   1 
HETATM 10245 O  O   . HOH H 4 .   ? 9.242   58.988  83.953  1.00 40.32  ? 517 HOH A O   1 
HETATM 10246 O  O   . HOH H 4 .   ? 7.736   39.920  85.446  1.00 38.16  ? 518 HOH A O   1 
HETATM 10247 O  O   . HOH H 4 .   ? -17.159 54.444  81.075  1.00 46.15  ? 519 HOH A O   1 
HETATM 10248 O  O   . HOH H 4 .   ? 16.225  40.928  91.540  1.00 30.41  ? 520 HOH A O   1 
HETATM 10249 O  O   . HOH H 4 .   ? 1.431   62.591  52.082  1.00 51.37  ? 521 HOH A O   1 
HETATM 10250 O  O   . HOH H 4 .   ? -14.422 50.517  73.434  1.00 26.21  ? 522 HOH A O   1 
HETATM 10251 O  O   . HOH H 4 .   ? 17.874  41.434  94.355  1.00 30.12  ? 523 HOH A O   1 
HETATM 10252 O  O   . HOH H 4 .   ? 1.896   46.642  66.927  1.00 18.45  ? 524 HOH A O   1 
HETATM 10253 O  O   . HOH H 4 .   ? -9.235  31.856  90.404  1.00 50.81  ? 525 HOH A O   1 
HETATM 10254 O  O   . HOH H 4 .   ? 8.530   65.314  51.153  1.00 33.91  ? 526 HOH A O   1 
HETATM 10255 O  O   . HOH H 4 .   ? 8.384   45.478  62.660  1.00 63.10  ? 527 HOH A O   1 
HETATM 10256 O  O   . HOH H 4 .   ? 5.647   55.461  62.736  1.00 39.84  ? 528 HOH A O   1 
HETATM 10257 O  O   . HOH H 4 .   ? -4.386  34.917  49.992  1.00 25.10  ? 529 HOH A O   1 
HETATM 10258 O  O   . HOH H 4 .   ? 13.992  37.483  54.002  1.00 36.61  ? 530 HOH A O   1 
HETATM 10259 O  O   . HOH H 4 .   ? 16.490  56.355  57.541  1.00 42.34  ? 531 HOH A O   1 
HETATM 10260 O  O   . HOH H 4 .   ? 6.201   61.576  57.689  1.00 25.73  ? 532 HOH A O   1 
HETATM 10261 O  O   . HOH H 4 .   ? 13.658  55.160  89.888  1.00 28.31  ? 533 HOH A O   1 
HETATM 10262 O  O   . HOH H 4 .   ? 12.040  52.423  86.694  1.00 31.71  ? 534 HOH A O   1 
HETATM 10263 O  O   . HOH H 4 .   ? 8.727   42.898  63.017  1.00 41.36  ? 535 HOH A O   1 
HETATM 10264 O  O   . HOH H 4 .   ? -10.612 62.997  78.757  1.00 55.34  ? 536 HOH A O   1 
HETATM 10265 O  O   . HOH H 4 .   ? -13.441 49.788  79.547  1.00 45.66  ? 537 HOH A O   1 
HETATM 10266 O  O   . HOH H 4 .   ? 6.147   47.168  95.377  1.00 62.37  ? 538 HOH A O   1 
HETATM 10267 O  O   . HOH H 4 .   ? 5.874   38.988  92.379  1.00 29.42  ? 539 HOH A O   1 
HETATM 10268 O  O   . HOH H 4 .   ? 30.311  49.714  50.057  1.00 63.99  ? 540 HOH A O   1 
HETATM 10269 O  O   . HOH H 4 .   ? -13.504 53.049  79.038  1.00 58.32  ? 541 HOH A O   1 
HETATM 10270 O  O   . HOH H 4 .   ? 4.142   39.778  62.382  1.00 26.40  ? 542 HOH A O   1 
HETATM 10271 O  O   . HOH H 4 .   ? 4.611   45.371  61.830  1.00 54.51  ? 543 HOH A O   1 
HETATM 10272 O  O   . HOH H 4 .   ? -13.489 43.498  74.145  1.00 23.35  ? 544 HOH A O   1 
HETATM 10273 O  O   . HOH H 4 .   ? 0.981   37.662  53.376  1.00 57.89  ? 545 HOH A O   1 
HETATM 10274 O  O   . HOH H 4 .   ? -20.673 44.464  82.422  1.00 26.25  ? 546 HOH A O   1 
HETATM 10275 O  O   . HOH H 4 .   ? 17.609  33.902  89.821  1.00 71.17  ? 547 HOH A O   1 
HETATM 10276 O  O   . HOH H 4 .   ? -7.699  48.310  78.093  1.00 34.58  ? 548 HOH A O   1 
HETATM 10277 O  O   . HOH H 4 .   ? -9.019  40.565  93.553  1.00 64.24  ? 549 HOH A O   1 
HETATM 10278 O  O   . HOH H 4 .   ? -9.908  45.532  67.629  1.00 30.19  ? 550 HOH A O   1 
HETATM 10279 O  O   . HOH H 4 .   ? 15.639  45.597  60.374  1.00 57.65  ? 551 HOH A O   1 
HETATM 10280 O  O   . HOH H 4 .   ? 3.005   55.845  63.037  1.00 43.06  ? 552 HOH A O   1 
HETATM 10281 O  O   . HOH H 4 .   ? -2.960  43.124  83.465  1.00 65.20  ? 553 HOH A O   1 
HETATM 10282 O  O   . HOH H 4 .   ? 2.501   39.136  55.102  1.00 39.39  ? 554 HOH A O   1 
HETATM 10283 O  O   . HOH H 4 .   ? -1.332  45.662  77.574  1.00 56.00  ? 555 HOH A O   1 
HETATM 10284 O  O   . HOH H 4 .   ? 20.661  41.303  93.829  1.00 38.20  ? 556 HOH A O   1 
HETATM 10285 O  O   . HOH H 4 .   ? -7.588  28.920  49.187  1.00 68.74  ? 557 HOH A O   1 
HETATM 10286 O  O   . HOH H 4 .   ? -10.308 60.642  77.365  1.00 43.88  ? 558 HOH A O   1 
HETATM 10287 O  O   . HOH H 4 .   ? 10.420  61.365  84.224  1.00 36.09  ? 559 HOH A O   1 
HETATM 10288 O  O   . HOH H 4 .   ? 12.193  43.574  90.419  1.00 40.41  ? 560 HOH A O   1 
HETATM 10289 O  O   . HOH H 4 .   ? 10.832  58.828  58.875  1.00 51.84  ? 561 HOH A O   1 
HETATM 10290 O  O   . HOH H 4 .   ? -11.482 41.649  82.885  1.00 51.15  ? 562 HOH A O   1 
HETATM 10291 O  O   . HOH H 4 .   ? -11.397 47.389  79.929  1.00 57.19  ? 563 HOH A O   1 
HETATM 10292 O  O   . HOH H 4 .   ? -0.430  60.335  52.867  1.00 35.64  ? 564 HOH A O   1 
HETATM 10293 O  O   . HOH H 4 .   ? -1.181  39.188  52.372  1.00 39.70  ? 565 HOH A O   1 
HETATM 10294 O  O   . HOH H 4 .   ? -3.252  46.396  50.549  1.00 46.92  ? 566 HOH A O   1 
HETATM 10295 O  O   . HOH H 4 .   ? 4.561   48.970  73.505  1.00 42.91  ? 567 HOH A O   1 
HETATM 10296 O  O   . HOH H 4 .   ? -6.498  45.808  79.315  1.00 43.89  ? 568 HOH A O   1 
HETATM 10297 O  O   . HOH H 4 .   ? -3.132  48.572  75.128  1.00 61.37  ? 569 HOH A O   1 
HETATM 10298 O  O   . HOH H 4 .   ? 26.902  59.129  53.884  1.00 31.84  ? 570 HOH A O   1 
HETATM 10299 O  O   . HOH H 4 .   ? 25.704  38.749  53.749  1.00 43.21  ? 571 HOH A O   1 
HETATM 10300 O  O   . HOH H 4 .   ? -4.735  29.019  86.212  1.00 35.08  ? 572 HOH A O   1 
HETATM 10301 O  O   . HOH H 4 .   ? 7.508   42.122  90.436  1.00 43.76  ? 573 HOH A O   1 
HETATM 10302 O  O   . HOH H 4 .   ? -0.399  42.461  83.375  1.00 49.82  ? 574 HOH A O   1 
HETATM 10303 O  O   . HOH H 4 .   ? 17.915  41.805  58.260  1.00 45.51  ? 575 HOH A O   1 
HETATM 10304 O  O   . HOH H 4 .   ? -1.040  43.665  86.266  1.00 48.49  ? 576 HOH A O   1 
HETATM 10305 O  O   . HOH H 4 .   ? 23.414  45.692  92.389  1.00 50.08  ? 577 HOH A O   1 
HETATM 10306 O  O   . HOH H 4 .   ? 4.228   71.391  52.373  1.00 45.36  ? 578 HOH A O   1 
HETATM 10307 O  O   . HOH H 4 .   ? 9.047   52.144  63.647  1.00 49.05  ? 579 HOH A O   1 
HETATM 10308 O  O   . HOH H 4 .   ? 7.491   58.804  57.867  1.00 57.62  ? 580 HOH A O   1 
HETATM 10309 O  O   . HOH H 4 .   ? 0.267   33.514  98.215  1.00 54.03  ? 581 HOH A O   1 
HETATM 10310 O  O   . HOH H 4 .   ? 13.018  57.995  94.609  1.00 45.79  ? 582 HOH A O   1 
HETATM 10311 O  O   . HOH H 4 .   ? -2.600  48.788  53.629  1.00 44.44  ? 583 HOH A O   1 
HETATM 10312 O  O   . HOH H 4 .   ? 19.344  53.131  100.103 1.00 44.78  ? 584 HOH A O   1 
HETATM 10313 O  O   . HOH H 4 .   ? 12.540  50.432  97.436  1.00 36.48  ? 585 HOH A O   1 
HETATM 10314 O  O   . HOH H 4 .   ? 2.165   48.669  72.059  1.00 40.89  ? 586 HOH A O   1 
HETATM 10315 O  O   . HOH H 4 .   ? 15.695  53.135  59.609  1.00 49.68  ? 587 HOH A O   1 
HETATM 10316 O  O   . HOH H 4 .   ? 2.292   38.206  63.068  1.00 34.85  ? 588 HOH A O   1 
HETATM 10317 O  O   . HOH H 4 .   ? 1.666   68.668  50.260  1.00 57.58  ? 589 HOH A O   1 
HETATM 10318 O  O   . HOH H 4 .   ? 5.373   39.160  82.099  1.00 41.04  ? 590 HOH A O   1 
HETATM 10319 O  O   . HOH H 4 .   ? 30.630  65.022  55.037  1.00 45.09  ? 591 HOH A O   1 
HETATM 10320 O  O   . HOH H 4 .   ? -7.873  43.264  81.391  1.00 50.21  ? 592 HOH A O   1 
HETATM 10321 O  O   . HOH H 4 .   ? 6.662   60.173  52.732  1.00 60.65  ? 593 HOH A O   1 
HETATM 10322 O  O   . HOH H 4 .   ? 28.437  53.144  54.220  1.00 40.02  ? 594 HOH A O   1 
HETATM 10323 O  O   . HOH H 4 .   ? 6.037   53.744  75.558  1.00 57.58  ? 595 HOH A O   1 
HETATM 10324 O  O   . HOH H 4 .   ? 30.641  51.701  53.343  1.00 48.82  ? 596 HOH A O   1 
HETATM 10325 O  O   . HOH H 4 .   ? 18.504  60.474  49.280  1.00 58.44  ? 597 HOH A O   1 
HETATM 10326 O  O   . HOH H 4 .   ? 2.179   54.698  59.803  1.00 53.60  ? 598 HOH A O   1 
HETATM 10327 O  O   . HOH H 4 .   ? -17.561 43.106  48.669  1.00 42.55  ? 599 HOH A O   1 
HETATM 10328 O  O   . HOH H 4 .   ? 6.124   49.822  64.430  1.00 53.83  ? 600 HOH A O   1 
HETATM 10329 O  O   . HOH H 4 .   ? -2.469  26.783  84.042  1.00 61.37  ? 601 HOH A O   1 
HETATM 10330 O  O   . HOH H 4 .   ? 10.085  55.259  62.138  1.00 48.89  ? 602 HOH A O   1 
HETATM 10331 O  O   . HOH H 4 .   ? 14.674  65.465  87.681  1.00 66.81  ? 603 HOH A O   1 
HETATM 10332 O  O   . HOH H 4 .   ? 2.218   45.266  74.754  1.00 48.76  ? 604 HOH A O   1 
HETATM 10333 O  O   . HOH H 4 .   ? -4.120  49.546  51.226  1.00 55.32  ? 605 HOH A O   1 
HETATM 10334 O  O   . HOH H 4 .   ? 16.314  71.183  47.385  1.00 60.80  ? 606 HOH A O   1 
HETATM 10335 O  O   . HOH H 4 .   ? 24.769  52.079  52.401  1.00 52.03  ? 607 HOH A O   1 
HETATM 10336 O  O   . HOH H 4 .   ? -15.603 62.373  78.673  1.00 44.55  ? 608 HOH A O   1 
HETATM 10337 O  O   . HOH H 4 .   ? 16.925  64.510  105.005 1.00 51.88  ? 609 HOH A O   1 
HETATM 10338 O  O   . HOH H 4 .   ? 15.601  53.830  96.551  1.00 41.14  ? 610 HOH A O   1 
HETATM 10339 O  O   . HOH H 4 .   ? -14.575 53.383  76.627  1.00 47.25  ? 611 HOH A O   1 
HETATM 10340 O  O   . HOH H 4 .   ? 13.673  42.246  58.469  1.00 70.60  ? 612 HOH A O   1 
HETATM 10341 O  O   . HOH H 4 .   ? 20.040  65.310  76.721  1.00 20.09  ? 613 HOH A O   1 
HETATM 10342 O  O   . HOH H 4 .   ? 23.372  65.842  85.009  1.00 23.56  ? 614 HOH A O   1 
HETATM 10343 O  O   . HOH H 4 .   ? -17.130 54.012  76.131  1.00 20.09  ? 615 HOH A O   1 
HETATM 10344 O  O   . HOH H 4 .   ? -20.464 63.256  73.925  1.00 18.47  ? 616 HOH A O   1 
HETATM 10345 O  O   . HOH H 4 .   ? -21.644 66.674  71.284  1.00 29.66  ? 617 HOH A O   1 
HETATM 10346 O  O   . HOH H 4 .   ? -21.865 52.480  81.925  1.00 16.85  ? 618 HOH A O   1 
HETATM 10347 O  O   . HOH H 4 .   ? -19.264 65.814  74.439  1.00 29.98  ? 619 HOH A O   1 
HETATM 10348 O  O   . HOH H 4 .   ? -16.508 54.026  72.452  1.00 25.24  ? 620 HOH A O   1 
HETATM 10349 O  O   . HOH H 4 .   ? -24.084 46.330  76.852  1.00 38.06  ? 621 HOH A O   1 
HETATM 10350 O  O   . HOH H 4 .   ? -13.312 61.001  78.318  1.00 36.11  ? 622 HOH A O   1 
HETATM 10351 O  O   . HOH H 4 .   ? -2.030  69.065  69.465  1.00 4.23   ? 623 HOH A O   1 
HETATM 10352 O  O   . HOH I 4 .   ? 17.557  64.137  79.075  1.00 20.18  ? 431 HOH B O   1 
HETATM 10353 O  O   . HOH I 4 .   ? 10.579  72.203  78.495  1.00 42.01  ? 432 HOH B O   1 
HETATM 10354 O  O   . HOH I 4 .   ? -6.919  101.257 88.749  1.00 41.76  ? 433 HOH B O   1 
HETATM 10355 O  O   . HOH I 4 .   ? -6.095  100.598 77.125  1.00 31.39  ? 434 HOH B O   1 
HETATM 10356 O  O   . HOH I 4 .   ? 11.547  56.515  76.689  1.00 18.61  ? 435 HOH B O   1 
HETATM 10357 O  O   . HOH I 4 .   ? 14.466  74.101  55.261  1.00 44.84  ? 436 HOH B O   1 
HETATM 10358 O  O   . HOH I 4 .   ? 15.283  104.950 88.214  1.00 35.40  ? 437 HOH B O   1 
HETATM 10359 O  O   . HOH I 4 .   ? 17.788  105.996 88.956  1.00 40.57  ? 438 HOH B O   1 
HETATM 10360 O  O   . HOH I 4 .   ? 0.704   104.931 99.025  1.00 53.08  ? 439 HOH B O   1 
HETATM 10361 O  O   . HOH I 4 .   ? 9.470   53.565  73.948  1.00 29.77  ? 440 HOH B O   1 
HETATM 10362 O  O   . HOH I 4 .   ? 3.754   99.179  48.108  1.00 70.29  ? 441 HOH B O   1 
HETATM 10363 O  O   . HOH I 4 .   ? 20.500  61.320  85.549  1.00 16.82  ? 442 HOH B O   1 
HETATM 10364 O  O   . HOH I 4 .   ? 8.455   99.902  94.866  1.00 62.13  ? 443 HOH B O   1 
HETATM 10365 O  O   . HOH I 4 .   ? 8.639   56.270  76.801  1.00 30.48  ? 444 HOH B O   1 
HETATM 10366 O  O   . HOH I 4 .   ? -10.286 77.828  51.317  1.00 55.81  ? 445 HOH B O   1 
HETATM 10367 O  O   . HOH I 4 .   ? 27.114  81.480  52.038  1.00 53.31  ? 446 HOH B O   1 
HETATM 10368 O  O   . HOH I 4 .   ? 17.806  64.417  75.262  1.00 25.15  ? 447 HOH B O   1 
HETATM 10369 O  O   . HOH I 4 .   ? -0.789  88.107  91.682  1.00 57.86  ? 448 HOH B O   1 
HETATM 10370 O  O   . HOH I 4 .   ? 4.993   104.581 93.035  1.00 64.01  ? 449 HOH B O   1 
HETATM 10371 O  O   . HOH I 4 .   ? 3.381   105.404 86.921  1.00 48.29  ? 450 HOH B O   1 
HETATM 10372 O  O   . HOH I 4 .   ? -6.657  94.599  43.167  1.00 51.01  ? 451 HOH B O   1 
HETATM 10373 O  O   . HOH I 4 .   ? 3.964   74.040  52.496  1.00 46.55  ? 452 HOH B O   1 
HETATM 10374 O  O   . HOH I 4 .   ? 14.225  104.325 96.263  1.00 53.52  ? 453 HOH B O   1 
HETATM 10375 O  O   . HOH I 4 .   ? 29.901  88.844  97.184  1.00 54.87  ? 454 HOH B O   1 
HETATM 10376 O  O   . HOH I 4 .   ? 21.046  81.163  85.765  1.00 54.99  ? 455 HOH B O   1 
HETATM 10377 O  O   . HOH I 4 .   ? 14.818  93.194  62.210  1.00 66.54  ? 456 HOH B O   1 
HETATM 10378 O  O   . HOH I 4 .   ? -15.070 85.921  45.432  1.00 61.55  ? 457 HOH B O   1 
HETATM 10379 O  O   . HOH I 4 .   ? 15.881  104.972 93.621  1.00 30.47  ? 458 HOH B O   1 
HETATM 10380 O  O   . HOH I 4 .   ? 27.673  61.948  81.193  1.00 37.95  ? 459 HOH B O   1 
HETATM 10381 O  O   . HOH I 4 .   ? 9.478   64.104  80.158  1.00 36.12  ? 460 HOH B O   1 
HETATM 10382 O  O   . HOH I 4 .   ? 17.402  104.490 91.198  1.00 45.48  ? 461 HOH B O   1 
HETATM 10383 O  O   . HOH I 4 .   ? 20.555  79.891  88.835  1.00 65.25  ? 462 HOH B O   1 
HETATM 10384 O  O   . HOH I 4 .   ? 14.700  77.027  55.271  1.00 54.88  ? 463 HOH B O   1 
HETATM 10385 O  O   . HOH I 4 .   ? 4.108   76.514  51.012  1.00 62.39  ? 464 HOH B O   1 
HETATM 10386 O  O   . HOH I 4 .   ? 19.048  99.672  51.344  1.00 58.70  ? 465 HOH B O   1 
HETATM 10387 O  O   . HOH I 4 .   ? 20.181  76.191  67.751  1.00 9.17   ? 466 HOH B O   1 
HETATM 10388 O  O   . HOH I 4 .   ? 21.698  78.265  66.787  1.00 16.95  ? 467 HOH B O   1 
HETATM 10389 O  O   . HOH I 4 .   ? 23.375  85.812  76.648  1.00 16.81  ? 468 HOH B O   1 
HETATM 10390 O  O   . HOH I 4 .   ? -0.889  74.137  63.322  1.00 13.67  ? 469 HOH B O   1 
HETATM 10391 O  O   . HOH I 4 .   ? -0.516  96.066  61.973  1.00 14.29  ? 470 HOH B O   1 
HETATM 10392 O  O   . HOH I 4 .   ? 17.439  78.575  72.656  1.00 18.22  ? 471 HOH B O   1 
HETATM 10393 O  O   . HOH I 4 .   ? 7.416   97.951  60.328  1.00 20.18  ? 472 HOH B O   1 
HETATM 10394 O  O   . HOH I 4 .   ? 22.405  85.538  65.591  1.00 24.04  ? 473 HOH B O   1 
HETATM 10395 O  O   . HOH I 4 .   ? 2.552   98.493  64.006  1.00 13.25  ? 474 HOH B O   1 
HETATM 10396 O  O   . HOH I 4 .   ? 8.984   95.900  62.712  1.00 16.02  ? 475 HOH B O   1 
HETATM 10397 O  O   . HOH I 4 .   ? 17.141  77.075  74.948  1.00 20.76  ? 476 HOH B O   1 
HETATM 10398 O  O   . HOH I 4 .   ? 13.602  91.849  77.636  1.00 19.39  ? 477 HOH B O   1 
HETATM 10399 O  O   . HOH I 4 .   ? 27.699  83.149  78.610  1.00 22.90  ? 478 HOH B O   1 
HETATM 10400 O  O   . HOH I 4 .   ? 6.651   85.730  70.368  1.00 19.13  ? 479 HOH B O   1 
HETATM 10401 O  O   . HOH I 4 .   ? 6.861   92.926  67.748  1.00 16.76  ? 480 HOH B O   1 
HETATM 10402 O  O   . HOH I 4 .   ? 24.240  79.095  62.717  1.00 21.40  ? 481 HOH B O   1 
HETATM 10403 O  O   . HOH I 4 .   ? 18.511  82.369  75.291  1.00 19.80  ? 482 HOH B O   1 
HETATM 10404 O  O   . HOH I 4 .   ? 19.535  69.552  73.016  1.00 15.52  ? 483 HOH B O   1 
HETATM 10405 O  O   . HOH I 4 .   ? -1.253  71.618  64.112  1.00 17.44  ? 484 HOH B O   1 
HETATM 10406 O  O   . HOH I 4 .   ? 23.970  83.725  79.812  1.00 21.42  ? 485 HOH B O   1 
HETATM 10407 O  O   . HOH I 4 .   ? 23.922  76.543  59.027  1.00 19.14  ? 486 HOH B O   1 
HETATM 10408 O  O   . HOH I 4 .   ? 0.845   85.134  69.735  1.00 16.50  ? 487 HOH B O   1 
HETATM 10409 O  O   . HOH I 4 .   ? 0.650   94.110  76.689  1.00 15.48  ? 488 HOH B O   1 
HETATM 10410 O  O   . HOH I 4 .   ? 13.367  93.482  80.698  1.00 28.38  ? 489 HOH B O   1 
HETATM 10411 O  O   . HOH I 4 .   ? -2.219  95.803  91.328  1.00 19.21  ? 490 HOH B O   1 
HETATM 10412 O  O   . HOH I 4 .   ? 9.294   100.734 70.647  1.00 23.97  ? 491 HOH B O   1 
HETATM 10413 O  O   . HOH I 4 .   ? 23.660  99.126  61.020  1.00 21.85  ? 492 HOH B O   1 
HETATM 10414 O  O   . HOH I 4 .   ? 22.461  71.784  72.826  1.00 19.96  ? 493 HOH B O   1 
HETATM 10415 O  O   . HOH I 4 .   ? 17.891  75.326  77.197  1.00 23.21  ? 494 HOH B O   1 
HETATM 10416 O  O   . HOH I 4 .   ? 4.539   83.147  62.379  1.00 29.41  ? 495 HOH B O   1 
HETATM 10417 O  O   . HOH I 4 .   ? 3.876   97.910  88.683  1.00 21.40  ? 496 HOH B O   1 
HETATM 10418 O  O   . HOH I 4 .   ? 0.981   92.836  74.154  1.00 21.51  ? 497 HOH B O   1 
HETATM 10419 O  O   . HOH I 4 .   ? 23.787  76.335  62.139  1.00 24.11  ? 498 HOH B O   1 
HETATM 10420 O  O   . HOH I 4 .   ? 29.481  74.466  54.926  1.00 22.16  ? 499 HOH B O   1 
HETATM 10421 O  O   . HOH I 4 .   ? 19.265  94.360  82.154  1.00 25.15  ? 500 HOH B O   1 
HETATM 10422 O  O   . HOH I 4 .   ? 22.108  68.461  72.645  1.00 25.50  ? 501 HOH B O   1 
HETATM 10423 O  O   . HOH I 4 .   ? 2.436   86.934  60.692  1.00 23.09  ? 502 HOH B O   1 
HETATM 10424 O  O   . HOH I 4 .   ? 13.806  86.806  74.437  1.00 29.21  ? 503 HOH B O   1 
HETATM 10425 O  O   . HOH I 4 .   ? -9.325  94.431  85.741  1.00 21.48  ? 504 HOH B O   1 
HETATM 10426 O  O   . HOH I 4 .   ? 14.093  97.307  60.770  1.00 24.11  ? 505 HOH B O   1 
HETATM 10427 O  O   . HOH I 4 .   ? 4.131   72.357  75.173  1.00 24.79  ? 506 HOH B O   1 
HETATM 10428 O  O   . HOH I 4 .   ? 20.602  99.154  87.022  1.00 24.25  ? 507 HOH B O   1 
HETATM 10429 O  O   . HOH I 4 .   ? 17.642  70.905  71.456  1.00 18.61  ? 508 HOH B O   1 
HETATM 10430 O  O   . HOH I 4 .   ? -7.269  89.629  79.461  1.00 21.73  ? 509 HOH B O   1 
HETATM 10431 O  O   . HOH I 4 .   ? 6.945   87.613  76.318  1.00 41.60  ? 510 HOH B O   1 
HETATM 10432 O  O   . HOH I 4 .   ? 25.477  81.475  77.724  1.00 28.01  ? 511 HOH B O   1 
HETATM 10433 O  O   . HOH I 4 .   ? 18.838  87.161  64.330  1.00 27.39  ? 512 HOH B O   1 
HETATM 10434 O  O   . HOH I 4 .   ? 7.005   95.086  80.549  1.00 20.76  ? 513 HOH B O   1 
HETATM 10435 O  O   . HOH I 4 .   ? 19.211  67.990  78.938  1.00 33.26  ? 514 HOH B O   1 
HETATM 10436 O  O   . HOH I 4 .   ? 16.044  98.901  59.732  1.00 23.50  ? 515 HOH B O   1 
HETATM 10437 O  O   . HOH I 4 .   ? 16.212  91.984  88.689  1.00 28.83  ? 516 HOH B O   1 
HETATM 10438 O  O   . HOH I 4 .   ? 5.729   99.693  59.084  1.00 24.94  ? 517 HOH B O   1 
HETATM 10439 O  O   . HOH I 4 .   ? 4.578   89.497  61.166  1.00 30.76  ? 518 HOH B O   1 
HETATM 10440 O  O   . HOH I 4 .   ? 19.180  79.707  74.509  1.00 21.51  ? 519 HOH B O   1 
HETATM 10441 O  O   . HOH I 4 .   ? 0.603   84.581  61.501  1.00 19.90  ? 520 HOH B O   1 
HETATM 10442 O  O   . HOH I 4 .   ? 0.894   89.999  74.243  1.00 18.19  ? 521 HOH B O   1 
HETATM 10443 O  O   . HOH I 4 .   ? 9.568   86.459  73.112  1.00 35.57  ? 522 HOH B O   1 
HETATM 10444 O  O   . HOH I 4 .   ? 19.354  93.751  91.807  1.00 21.76  ? 523 HOH B O   1 
HETATM 10445 O  O   . HOH I 4 .   ? 0.163   69.868  65.727  1.00 20.88  ? 524 HOH B O   1 
HETATM 10446 O  O   . HOH I 4 .   ? 8.053   95.904  77.406  1.00 18.26  ? 525 HOH B O   1 
HETATM 10447 O  O   . HOH I 4 .   ? 14.047  87.304  77.821  1.00 41.46  ? 526 HOH B O   1 
HETATM 10448 O  O   . HOH I 4 .   ? -6.126  95.225  53.105  1.00 25.96  ? 527 HOH B O   1 
HETATM 10449 O  O   . HOH I 4 .   ? -0.575  85.211  83.035  1.00 40.53  ? 528 HOH B O   1 
HETATM 10450 O  O   . HOH I 4 .   ? 16.374  93.323  86.027  1.00 38.36  ? 529 HOH B O   1 
HETATM 10451 O  O   . HOH I 4 .   ? 10.803  100.576 90.897  1.00 30.35  ? 530 HOH B O   1 
HETATM 10452 O  O   . HOH I 4 .   ? 19.641  68.076  76.227  1.00 26.28  ? 531 HOH B O   1 
HETATM 10453 O  O   . HOH I 4 .   ? 9.230   102.049 93.400  1.00 30.27  ? 532 HOH B O   1 
HETATM 10454 O  O   . HOH I 4 .   ? 15.835  83.496  68.072  1.00 18.25  ? 533 HOH B O   1 
HETATM 10455 O  O   . HOH I 4 .   ? -1.562  78.618  50.200  1.00 33.52  ? 534 HOH B O   1 
HETATM 10456 O  O   . HOH I 4 .   ? 6.968   82.056  62.923  1.00 40.10  ? 535 HOH B O   1 
HETATM 10457 O  O   . HOH I 4 .   ? 31.197  82.635  52.989  1.00 24.70  ? 536 HOH B O   1 
HETATM 10458 O  O   . HOH I 4 .   ? 19.415  97.569  54.397  1.00 36.68  ? 537 HOH B O   1 
HETATM 10459 O  O   . HOH I 4 .   ? 1.572   90.675  56.256  1.00 42.44  ? 538 HOH B O   1 
HETATM 10460 O  O   . HOH I 4 .   ? 2.110   79.295  57.268  1.00 25.51  ? 539 HOH B O   1 
HETATM 10461 O  O   . HOH I 4 .   ? 0.053   91.264  88.658  1.00 28.64  ? 540 HOH B O   1 
HETATM 10462 O  O   . HOH I 4 .   ? 3.492   91.064  85.868  1.00 31.47  ? 541 HOH B O   1 
HETATM 10463 O  O   . HOH I 4 .   ? 16.201  90.919  63.694  1.00 41.26  ? 542 HOH B O   1 
HETATM 10464 O  O   . HOH I 4 .   ? 19.130  69.672  82.283  1.00 45.51  ? 543 HOH B O   1 
HETATM 10465 O  O   . HOH I 4 .   ? 17.234  92.772  93.281  1.00 29.40  ? 544 HOH B O   1 
HETATM 10466 O  O   . HOH I 4 .   ? 21.218  88.477  63.799  1.00 26.37  ? 545 HOH B O   1 
HETATM 10467 O  O   . HOH I 4 .   ? 25.222  72.478  77.298  1.00 23.26  ? 546 HOH B O   1 
HETATM 10468 O  O   . HOH I 4 .   ? 26.895  66.345  86.399  1.00 25.78  ? 547 HOH B O   1 
HETATM 10469 O  O   . HOH I 4 .   ? 17.681  75.232  80.186  1.00 34.40  ? 548 HOH B O   1 
HETATM 10470 O  O   . HOH I 4 .   ? 22.467  73.990  70.403  1.00 30.38  ? 549 HOH B O   1 
HETATM 10471 O  O   . HOH I 4 .   ? 10.892  95.463  59.897  1.00 57.74  ? 550 HOH B O   1 
HETATM 10472 O  O   . HOH I 4 .   ? 7.940   79.658  63.483  1.00 42.86  ? 551 HOH B O   1 
HETATM 10473 O  O   . HOH I 4 .   ? 23.484  86.912  56.776  1.00 39.32  ? 552 HOH B O   1 
HETATM 10474 O  O   . HOH I 4 .   ? 7.810   104.433 92.719  1.00 38.45  ? 553 HOH B O   1 
HETATM 10475 O  O   . HOH I 4 .   ? 8.211   66.778  78.937  1.00 43.90  ? 554 HOH B O   1 
HETATM 10476 O  O   . HOH I 4 .   ? -3.247  84.967  83.122  1.00 35.94  ? 555 HOH B O   1 
HETATM 10477 O  O   . HOH I 4 .   ? 10.559  95.735  90.149  1.00 40.34  ? 556 HOH B O   1 
HETATM 10478 O  O   . HOH I 4 .   ? 2.069   84.621  58.096  1.00 51.84  ? 557 HOH B O   1 
HETATM 10479 O  O   . HOH I 4 .   ? 24.721  75.741  85.896  1.00 51.35  ? 558 HOH B O   1 
HETATM 10480 O  O   . HOH I 4 .   ? 6.823   73.718  53.511  1.00 35.76  ? 559 HOH B O   1 
HETATM 10481 O  O   . HOH I 4 .   ? 25.546  83.518  54.650  1.00 39.56  ? 560 HOH B O   1 
HETATM 10482 O  O   . HOH I 4 .   ? 20.549  77.864  52.596  1.00 46.77  ? 561 HOH B O   1 
HETATM 10483 O  O   . HOH I 4 .   ? 11.744  85.106  74.043  1.00 42.75  ? 562 HOH B O   1 
HETATM 10484 O  O   . HOH I 4 .   ? 19.185  77.647  81.427  1.00 43.73  ? 563 HOH B O   1 
HETATM 10485 O  O   . HOH I 4 .   ? 15.697  78.935  76.753  1.00 61.59  ? 564 HOH B O   1 
HETATM 10486 O  O   . HOH I 4 .   ? -5.543  97.889  51.207  1.00 31.87  ? 565 HOH B O   1 
HETATM 10487 O  O   . HOH I 4 .   ? 12.714  107.171 52.564  1.00 43.18  ? 566 HOH B O   1 
HETATM 10488 O  O   . HOH I 4 .   ? 31.912  88.110  89.211  1.00 34.84  ? 567 HOH B O   1 
HETATM 10489 O  O   . HOH I 4 .   ? 14.172  92.344  90.877  1.00 43.68  ? 568 HOH B O   1 
HETATM 10490 O  O   . HOH I 4 .   ? 18.565  84.920  84.998  1.00 49.84  ? 569 HOH B O   1 
HETATM 10491 O  O   . HOH I 4 .   ? 13.288  99.127  57.832  1.00 45.53  ? 570 HOH B O   1 
HETATM 10492 O  O   . HOH I 4 .   ? 17.616  84.014  87.810  1.00 48.85  ? 571 HOH B O   1 
HETATM 10493 O  O   . HOH I 4 .   ? 2.977   104.473 90.442  1.00 50.15  ? 572 HOH B O   1 
HETATM 10494 O  O   . HOH I 4 .   ? -4.883  72.147  51.576  1.00 45.10  ? 573 HOH B O   1 
HETATM 10495 O  O   . HOH I 4 .   ? 8.161   86.666  63.491  1.00 48.96  ? 574 HOH B O   1 
HETATM 10496 O  O   . HOH I 4 .   ? 3.727   81.700  57.566  1.00 57.55  ? 575 HOH B O   1 
HETATM 10497 O  O   . HOH I 4 .   ? 24.123  91.066  100.140 1.00 54.21  ? 576 HOH B O   1 
HETATM 10498 O  O   . HOH I 4 .   ? -2.856  89.616  93.273  1.00 45.74  ? 577 HOH B O   1 
HETATM 10499 O  O   . HOH I 4 .   ? 17.804  77.460  55.311  1.00 44.70  ? 578 HOH B O   1 
HETATM 10500 O  O   . HOH I 4 .   ? -2.345  98.058  98.240  1.00 44.87  ? 579 HOH B O   1 
HETATM 10501 O  O   . HOH I 4 .   ? 3.551   93.424  96.630  1.00 36.36  ? 580 HOH B O   1 
HETATM 10502 O  O   . HOH I 4 .   ? 13.288  83.223  72.990  1.00 41.02  ? 581 HOH B O   1 
HETATM 10503 O  O   . HOH I 4 .   ? 4.420   91.748  58.544  1.00 49.82  ? 582 HOH B O   1 
HETATM 10504 O  O   . HOH I 4 .   ? 23.429  87.760  64.777  1.00 35.09  ? 583 HOH B O   1 
HETATM 10505 O  O   . HOH I 4 .   ? -1.238  71.013  50.215  1.00 57.51  ? 584 HOH B O   1 
HETATM 10506 O  O   . HOH I 4 .   ? 18.779  91.381  83.101  1.00 40.88  ? 585 HOH B O   1 
HETATM 10507 O  O   . HOH I 4 .   ? -12.610 98.321  51.406  1.00 45.23  ? 586 HOH B O   1 
HETATM 10508 O  O   . HOH I 4 .   ? 21.869  77.931  83.846  1.00 50.29  ? 587 HOH B O   1 
HETATM 10509 O  O   . HOH I 4 .   ? 3.640   79.767  52.494  1.00 60.82  ? 588 HOH B O   1 
HETATM 10510 O  O   . HOH I 4 .   ? -1.025  102.164 51.573  1.00 40.34  ? 589 HOH B O   1 
HETATM 10511 O  O   . HOH I 4 .   ? 6.640   84.251  75.572  1.00 57.54  ? 590 HOH B O   1 
HETATM 10512 O  O   . HOH I 4 .   ? -0.949  104.688 50.523  1.00 48.83  ? 591 HOH B O   1 
HETATM 10513 O  O   . HOH I 4 .   ? -2.024  89.496  47.540  1.00 58.51  ? 592 HOH B O   1 
HETATM 10514 O  O   . HOH I 4 .   ? 9.545   79.242  60.512  1.00 53.85  ? 593 HOH B O   1 
HETATM 10515 O  O   . HOH I 4 .   ? 30.584  67.092  52.660  1.00 42.86  ? 594 HOH B O   1 
HETATM 10516 O  O   . HOH I 4 .   ? 11.346  85.312  64.796  1.00 53.71  ? 595 HOH B O   1 
HETATM 10517 O  O   . HOH I 4 .   ? 33.014  91.002  86.894  1.00 61.43  ? 596 HOH B O   1 
HETATM 10518 O  O   . HOH I 4 .   ? 4.979   85.972  61.676  1.00 48.84  ? 597 HOH B O   1 
HETATM 10519 O  O   . HOH I 4 .   ? -9.162  86.937  85.651  1.00 66.91  ? 598 HOH B O   1 
HETATM 10520 O  O   . HOH I 4 .   ? 15.867  85.061  76.017  1.00 48.77  ? 599 HOH B O   1 
HETATM 10521 O  O   . HOH I 4 .   ? 18.238  75.753  53.228  1.00 55.17  ? 600 HOH B O   1 
HETATM 10522 O  O   . HOH I 4 .   ? -9.934  82.310  45.175  1.00 60.83  ? 601 HOH B O   1 
HETATM 10523 O  O   . HOH I 4 .   ? 1.785   99.473  50.450  1.00 52.20  ? 602 HOH B O   1 
HETATM 10524 O  O   . HOH I 4 .   ? 9.432   61.537  80.812  1.00 44.66  ? 603 HOH B O   1 
HETATM 10525 O  O   . HOH I 4 .   ? -11.639 90.571  102.545 1.00 52.05  ? 604 HOH B O   1 
HETATM 10526 O  O   . HOH I 4 .   ? -0.757  94.199  95.175  1.00 41.23  ? 605 HOH B O   1 
HETATM 10527 O  O   . HOH I 4 .   ? 16.778  66.726  79.362  1.00 47.43  ? 606 HOH B O   1 
HETATM 10528 O  O   . HOH I 4 .   ? 14.943  95.315  58.509  1.00 70.71  ? 607 HOH B O   1 
HETATM 10529 O  O   . HOH I 4 .   ? -10.453 90.667  74.198  1.00 20.36  ? 608 HOH B O   1 
HETATM 10530 O  O   . HOH I 4 .   ? -13.541 93.812  81.887  1.00 23.29  ? 609 HOH B O   1 
HETATM 10531 O  O   . HOH J 4 .   ? -42.060 61.365  87.262  1.00 23.34  ? 431 HOH C O   1 
HETATM 10532 O  O   . HOH J 4 .   ? -37.024 79.410  95.834  1.00 50.10  ? 432 HOH C O   1 
HETATM 10533 O  O   . HOH J 4 .   ? -44.677 64.441  82.837  1.00 42.88  ? 433 HOH C O   1 
HETATM 10534 O  O   . HOH J 4 .   ? -22.301 95.358  46.251  1.00 40.48  ? 434 HOH C O   1 
HETATM 10535 O  O   . HOH J 4 .   ? -28.539 83.454  51.043  1.00 35.87  ? 435 HOH C O   1 
HETATM 10536 O  O   . HOH J 4 .   ? -27.970 50.133  75.036  1.00 32.58  ? 436 HOH C O   1 
HETATM 10537 O  O   . HOH J 4 .   ? -25.377 90.066  45.632  1.00 43.35  ? 437 HOH C O   1 
HETATM 10538 O  O   . HOH J 4 .   ? -44.573 69.334  85.650  1.00 43.83  ? 438 HOH C O   1 
HETATM 10539 O  O   . HOH J 4 .   ? -15.242 78.551  52.916  1.00 45.87  ? 439 HOH C O   1 
HETATM 10540 O  O   . HOH J 4 .   ? -30.503 80.880  41.532  1.00 41.40  ? 440 HOH C O   1 
HETATM 10541 O  O   . HOH J 4 .   ? -8.442  84.297  83.283  1.00 42.41  ? 441 HOH C O   1 
HETATM 10542 O  O   . HOH J 4 .   ? -44.189 64.230  79.751  1.00 49.04  ? 442 HOH C O   1 
HETATM 10543 O  O   . HOH J 4 .   ? -44.762 66.891  88.080  1.00 36.55  ? 443 HOH C O   1 
HETATM 10544 O  O   . HOH J 4 .   ? -38.588 56.090  80.976  1.00 53.18  ? 444 HOH C O   1 
HETATM 10545 O  O   . HOH J 4 .   ? -28.080 71.259  92.467  1.00 55.83  ? 445 HOH C O   1 
HETATM 10546 O  O   . HOH J 4 .   ? -6.738  57.414  46.406  1.00 45.37  ? 446 HOH C O   1 
HETATM 10547 O  O   . HOH J 4 .   ? -43.763 67.648  83.476  1.00 40.18  ? 447 HOH C O   1 
HETATM 10548 O  O   . HOH J 4 .   ? -24.962 76.099  59.077  1.00 63.43  ? 448 HOH C O   1 
HETATM 10549 O  O   . HOH J 4 .   ? -18.837 63.667  56.241  1.00 61.15  ? 449 HOH C O   1 
HETATM 10550 O  O   . HOH J 4 .   ? -11.475 74.757  51.352  1.00 55.48  ? 450 HOH C O   1 
HETATM 10551 O  O   . HOH J 4 .   ? -12.033 79.928  53.825  1.00 53.70  ? 451 HOH C O   1 
HETATM 10552 O  O   . HOH J 4 .   ? -14.691 90.416  82.404  1.00 49.54  ? 452 HOH C O   1 
HETATM 10553 O  O   . HOH J 4 .   ? -40.609 88.581  85.865  1.00 65.52  ? 453 HOH C O   1 
HETATM 10554 O  O   . HOH J 4 .   ? -43.703 75.879  47.145  1.00 54.96  ? 454 HOH C O   1 
HETATM 10555 O  O   . HOH J 4 .   ? -43.148 71.033  77.572  1.00 41.38  ? 455 HOH C O   1 
HETATM 10556 O  O   . HOH J 4 .   ? -29.692 50.255  86.448  1.00 70.66  ? 456 HOH C O   1 
HETATM 10557 O  O   . HOH J 4 .   ? -6.996  67.004  79.965  1.00 59.79  ? 457 HOH C O   1 
HETATM 10558 O  O   . HOH J 4 .   ? -19.267 47.791  81.290  1.00 23.32  ? 458 HOH C O   1 
HETATM 10559 O  O   . HOH J 4 .   ? -7.331  77.049  77.682  1.00 66.93  ? 459 HOH C O   1 
HETATM 10560 O  O   . HOH J 4 .   ? -27.087 96.344  41.721  1.00 62.28  ? 460 HOH C O   1 
HETATM 10561 O  O   . HOH J 4 .   ? -9.608  71.703  77.126  1.00 57.86  ? 461 HOH C O   1 
HETATM 10562 O  O   . HOH J 4 .   ? -22.878 64.829  81.581  1.00 69.08  ? 462 HOH C O   1 
HETATM 10563 O  O   . HOH J 4 .   ? -24.499 77.612  76.516  1.00 60.90  ? 463 HOH C O   1 
HETATM 10564 O  O   . HOH J 4 .   ? -33.963 94.094  79.186  1.00 51.98  ? 464 HOH C O   1 
HETATM 10565 O  O   . HOH J 4 .   ? -30.488 76.595  81.303  1.00 58.09  ? 465 HOH C O   1 
HETATM 10566 O  O   . HOH J 4 .   ? -19.272 79.628  53.181  1.00 48.05  ? 466 HOH C O   1 
HETATM 10567 O  O   . HOH J 4 .   ? -20.971 63.679  54.360  1.00 63.59  ? 467 HOH C O   1 
HETATM 10568 O  O   . HOH J 4 .   ? -21.287 64.049  79.297  1.00 58.66  ? 468 HOH C O   1 
HETATM 10569 O  O   . HOH J 4 .   ? -8.866  88.734  81.636  1.00 52.78  ? 469 HOH C O   1 
HETATM 10570 O  O   . HOH J 4 .   ? -8.446  89.320  76.884  1.00 19.96  ? 470 HOH C O   1 
HETATM 10571 O  O   . HOH J 4 .   ? 1.495   87.690  75.831  1.00 18.18  ? 471 HOH C O   1 
HETATM 10572 O  O   . HOH J 4 .   ? 5.418   87.235  73.471  1.00 29.70  ? 472 HOH C O   1 
HETATM 10573 O  O   . HOH J 4 .   ? -8.231  93.740  83.058  1.00 16.37  ? 473 HOH C O   1 
HETATM 10574 O  O   . HOH J 4 .   ? 2.941   85.240  76.381  1.00 30.08  ? 474 HOH C O   1 
HETATM 10575 O  O   . HOH J 4 .   ? -8.289  88.949  73.045  1.00 25.48  ? 475 HOH C O   1 
HETATM 10576 O  O   . HOH J 4 .   ? -11.787 99.194  77.781  1.00 38.22  ? 476 HOH C O   1 
HETATM 10577 O  O   . HOH J 4 .   ? -4.657  82.424  79.003  1.00 36.37  ? 477 HOH C O   1 
HETATM 10578 O  O   . HOH J 4 .   ? -18.753 84.606  64.442  1.00 8.99   ? 478 HOH C O   1 
HETATM 10579 O  O   . HOH J 4 .   ? -21.196 84.864  63.142  1.00 16.77  ? 479 HOH C O   1 
HETATM 10580 O  O   . HOH J 4 .   ? -29.664 83.074  72.249  1.00 16.93  ? 480 HOH C O   1 
HETATM 10581 O  O   . HOH J 4 .   ? -6.035  67.151  62.936  1.00 13.71  ? 481 HOH C O   1 
HETATM 10582 O  O   . HOH J 4 .   ? -24.993 56.390  59.952  1.00 14.21  ? 482 HOH C O   1 
HETATM 10583 O  O   . HOH J 4 .   ? -20.050 81.419  69.514  1.00 17.98  ? 483 HOH C O   1 
HETATM 10584 O  O   . HOH J 4 .   ? -30.361 62.135  57.185  1.00 19.55  ? 484 HOH C O   1 
HETATM 10585 O  O   . HOH J 4 .   ? -27.742 81.700  61.303  1.00 24.15  ? 485 HOH C O   1 
HETATM 10586 O  O   . HOH J 4 .   ? -28.845 57.954  61.376  1.00 12.81  ? 486 HOH C O   1 
HETATM 10587 O  O   . HOH J 4 .   ? -29.559 64.657  59.483  1.00 16.37  ? 487 HOH C O   1 
HETATM 10588 O  O   . HOH J 4 .   ? -18.911 82.053  71.860  1.00 20.89  ? 488 HOH C O   1 
HETATM 10589 O  O   . HOH J 4 .   ? -30.185 71.834  73.816  1.00 19.35  ? 489 HOH C O   1 
HETATM 10590 O  O   . HOH J 4 .   ? -29.823 88.396  73.773  1.00 22.78  ? 490 HOH C O   1 
HETATM 10591 O  O   . HOH J 4 .   ? -20.623 68.323  68.048  1.00 19.18  ? 491 HOH C O   1 
HETATM 10592 O  O   . HOH J 4 .   ? -26.724 64.665  64.963  1.00 17.12  ? 492 HOH C O   1 
HETATM 10593 O  O   . HOH J 4 .   ? -22.470 86.217  58.737  1.00 21.19  ? 493 HOH C O   1 
HETATM 10594 O  O   . HOH J 4 .   ? -24.247 80.697  71.716  1.00 19.87  ? 494 HOH C O   1 
HETATM 10595 O  O   . HOH J 4 .   ? -13.269 87.869  70.165  1.00 15.75  ? 495 HOH C O   1 
HETATM 10596 O  O   . HOH J 4 .   ? -3.787  68.088  63.883  1.00 18.01  ? 496 HOH C O   1 
HETATM 10597 O  O   . HOH J 4 .   ? -28.579 84.880  75.458  1.00 21.61  ? 497 HOH C O   1 
HETATM 10598 O  O   . HOH J 4 .   ? -19.726 87.052  55.250  1.00 19.40  ? 498 HOH C O   1 
HETATM 10599 O  O   . HOH J 4 .   ? -17.054 63.390  68.257  1.00 17.12  ? 499 HOH C O   1 
HETATM 10600 O  O   . HOH J 4 .   ? -25.834 59.504  74.537  1.00 15.32  ? 500 HOH C O   1 
HETATM 10601 O  O   . HOH J 4 .   ? -32.045 70.932  76.923  1.00 28.25  ? 501 HOH C O   1 
HETATM 10602 O  O   . HOH J 4 .   ? -27.652 57.176  89.254  1.00 19.02  ? 502 HOH C O   1 
HETATM 10603 O  O   . HOH J 4 .   ? -34.873 63.127  66.904  1.00 24.39  ? 503 HOH C O   1 
HETATM 10604 O  O   . HOH J 4 .   ? -39.304 75.529  55.716  1.00 21.97  ? 504 HOH C O   1 
HETATM 10605 O  O   . HOH J 4 .   ? -16.782 89.087  69.538  1.00 20.05  ? 505 HOH C O   1 
HETATM 10606 O  O   . HOH J 4 .   ? -18.166 83.741  74.175  1.00 23.33  ? 506 HOH C O   1 
HETATM 10607 O  O   . HOH J 4 .   ? -16.317 67.163  60.601  1.00 29.83  ? 507 HOH C O   1 
HETATM 10608 O  O   . HOH J 4 .   ? -32.159 61.139  85.784  1.00 21.20  ? 508 HOH C O   1 
HETATM 10609 O  O   . HOH J 4 .   ? -24.564 60.201  71.954  1.00 21.77  ? 509 HOH C O   1 
HETATM 10610 O  O   . HOH J 4 .   ? -19.983 87.302  58.527  1.00 23.75  ? 510 HOH C O   1 
HETATM 10611 O  O   . HOH J 4 .   ? -20.242 92.612  50.798  1.00 22.69  ? 511 HOH C O   1 
HETATM 10612 O  O   . HOH J 4 .   ? -35.736 75.700  77.630  1.00 25.41  ? 512 HOH C O   1 
HETATM 10613 O  O   . HOH J 4 .   ? -13.637 90.502  69.684  1.00 25.45  ? 513 HOH C O   1 
HETATM 10614 O  O   . HOH J 4 .   ? -18.361 63.465  58.967  1.00 23.20  ? 514 HOH C O   1 
HETATM 10615 O  O   . HOH J 4 .   ? -25.558 74.378  71.154  1.00 28.83  ? 515 HOH C O   1 
HETATM 10616 O  O   . HOH J 4 .   ? -22.262 51.343  84.685  1.00 21.00  ? 516 HOH C O   1 
HETATM 10617 O  O   . HOH J 4 .   ? -33.102 68.234  56.884  1.00 24.60  ? 517 HOH C O   1 
HETATM 10618 O  O   . HOH J 4 .   ? -8.405  73.229  74.176  1.00 24.71  ? 518 HOH C O   1 
HETATM 10619 O  O   . HOH J 4 .   ? -41.104 74.742  81.791  1.00 24.30  ? 519 HOH C O   1 
HETATM 10620 O  O   . HOH J 4 .   ? -13.345 85.336  68.761  1.00 18.78  ? 520 HOH C O   1 
HETATM 10621 O  O   . HOH J 4 .   ? -18.376 55.105  78.490  1.00 21.56  ? 521 HOH C O   1 
HETATM 10622 O  O   . HOH J 4 .   ? -23.149 68.082  73.803  1.00 42.00  ? 522 HOH C O   1 
HETATM 10623 O  O   . HOH J 4 .   ? -27.146 87.185  73.293  1.00 28.60  ? 523 HOH C O   1 
HETATM 10624 O  O   . HOH J 4 .   ? -27.115 77.623  60.460  1.00 27.28  ? 524 HOH C O   1 
HETATM 10625 O  O   . HOH J 4 .   ? -30.211 64.753  77.472  1.00 20.60  ? 525 HOH C O   1 
HETATM 10626 O  O   . HOH J 4 .   ? -12.466 88.885  76.370  1.00 33.37  ? 526 HOH C O   1 
HETATM 10627 O  O   . HOH J 4 .   ? -35.261 69.055  55.367  1.00 22.85  ? 527 HOH C O   1 
HETATM 10628 O  O   . HOH J 4 .   ? -33.092 74.803  84.526  1.00 28.54  ? 528 HOH C O   1 
HETATM 10629 O  O   . HOH J 4 .   ? -30.849 59.654  56.011  1.00 24.91  ? 529 HOH C O   1 
HETATM 10630 O  O   . HOH J 4 .   ? -21.728 64.065  58.911  1.00 30.58  ? 530 HOH C O   1 
HETATM 10631 O  O   . HOH J 4 .   ? -22.166 82.507  71.053  1.00 21.87  ? 531 HOH C O   1 
HETATM 10632 O  O   . HOH J 4 .   ? -15.556 63.150  60.136  1.00 19.68  ? 532 HOH C O   1 
HETATM 10633 O  O   . HOH J 4 .   ? -22.014 61.582  72.322  1.00 18.05  ? 533 HOH C O   1 
HETATM 10634 O  O   . HOH J 4 .   ? -22.976 70.734  70.360  1.00 35.66  ? 534 HOH C O   1 
HETATM 10635 O  O   . HOH J 4 .   ? -36.457 76.854  87.021  1.00 21.41  ? 535 HOH C O   1 
HETATM 10636 O  O   . HOH J 4 .   ? -3.222  70.300  65.425  1.00 20.90  ? 536 HOH C O   1 
HETATM 10637 O  O   . HOH J 4 .   ? -31.016 64.950  74.123  1.00 17.71  ? 537 HOH C O   1 
HETATM 10638 O  O   . HOH J 4 .   ? -26.554 74.485  74.366  1.00 41.59  ? 538 HOH C O   1 
HETATM 10639 O  O   . HOH J 4 .   ? -20.495 51.245  51.819  1.00 25.85  ? 539 HOH C O   1 
HETATM 10640 O  O   . HOH J 4 .   ? -18.146 63.425  81.644  1.00 40.51  ? 540 HOH C O   1 
HETATM 10641 O  O   . HOH J 4 .   ? -34.028 74.120  81.791  1.00 38.33  ? 541 HOH C O   1 
HETATM 10642 O  O   . HOH J 4 .   ? -38.161 65.929  86.856  1.00 30.37  ? 542 HOH C O   1 
HETATM 10643 O  O   . HOH J 4 .   ? -12.559 88.827  73.601  1.00 25.93  ? 543 HOH C O   1 
HETATM 10644 O  O   . HOH J 4 .   ? -38.962 64.050  89.443  1.00 30.16  ? 544 HOH C O   1 
HETATM 10645 O  O   . HOH J 4 .   ? -22.999 77.255  64.865  1.00 18.38  ? 545 HOH C O   1 
HETATM 10646 O  O   . HOH J 4 .   ? -8.001  63.307  49.761  1.00 33.80  ? 546 HOH C O   1 
HETATM 10647 O  O   . HOH J 4 .   ? -16.726 69.848  60.897  1.00 40.06  ? 547 HOH C O   1 
HETATM 10648 O  O   . HOH J 4 .   ? -27.895 89.719  47.987  1.00 25.07  ? 548 HOH C O   1 
HETATM 10649 O  O   . HOH J 4 .   ? -35.139 72.290  49.804  1.00 36.68  ? 549 HOH C O   1 
HETATM 10650 O  O   . HOH J 4 .   ? -20.511 60.288  54.465  1.00 42.13  ? 550 HOH C O   1 
HETATM 10651 O  O   . HOH J 4 .   ? -11.072 66.696  56.234  1.00 25.56  ? 551 HOH C O   1 
HETATM 10652 O  O   . HOH J 4 .   ? -24.449 61.163  86.679  1.00 28.40  ? 552 HOH C O   1 
HETATM 10653 O  O   . HOH J 4 .   ? -25.626 64.094  83.366  1.00 31.60  ? 553 HOH C O   1 
HETATM 10654 O  O   . HOH J 4 .   ? -29.044 73.551  59.811  1.00 41.17  ? 554 HOH C O   1 
HETATM 10655 O  O   . HOH J 4 .   ? -14.501 88.033  79.518  1.00 45.58  ? 555 HOH C O   1 
HETATM 10656 O  O   . HOH J 4 .   ? -34.882 75.649  88.895  1.00 29.38  ? 556 HOH C O   1 
HETATM 10657 O  O   . HOH J 4 .   ? -29.375 79.152  59.536  1.00 26.71  ? 557 HOH C O   1 
HETATM 10658 O  O   . HOH J 4 .   ? -19.145 91.468  73.645  1.00 22.83  ? 558 HOH C O   1 
HETATM 10659 O  O   . HOH J 4 .   ? -15.931 96.641  82.780  1.00 25.56  ? 559 HOH C O   1 
HETATM 10660 O  O   . HOH J 4 .   ? -18.375 83.875  77.152  1.00 34.50  ? 560 HOH C O   1 
HETATM 10661 O  O   . HOH J 4 .   ? -18.285 87.859  66.964  1.00 30.44  ? 561 HOH C O   1 
HETATM 10662 O  O   . HOH J 4 .   ? -29.810 66.348  56.476  1.00 57.80  ? 562 HOH C O   1 
HETATM 10663 O  O   . HOH J 4 .   ? -15.054 71.989  61.536  1.00 42.88  ? 563 HOH C O   1 
HETATM 10664 O  O   . HOH J 4 .   ? -28.223 81.258  52.490  1.00 39.57  ? 564 HOH C O   1 
HETATM 10665 O  O   . HOH J 4 .   ? -40.091 61.599  88.853  1.00 38.06  ? 565 HOH C O   1 
HETATM 10666 O  O   . HOH J 4 .   ? -6.218  79.936  77.730  1.00 43.84  ? 566 HOH C O   1 
HETATM 10667 O  O   . HOH J 4 .   ? -16.675 61.237  81.891  1.00 36.20  ? 567 HOH C O   1 
HETATM 10668 O  O   . HOH J 4 .   ? -33.694 68.194  86.536  1.00 40.28  ? 568 HOH C O   1 
HETATM 10669 O  O   . HOH J 4 .   ? -15.865 64.038  56.724  1.00 51.70  ? 569 HOH C O   1 
HETATM 10670 O  O   . HOH J 4 .   ? -22.822 90.041  81.828  1.00 51.35  ? 570 HOH C O   1 
HETATM 10671 O  O   . HOH J 4 .   ? -8.376  73.375  52.209  1.00 35.84  ? 571 HOH C O   1 
HETATM 10672 O  O   . HOH J 4 .   ? -26.070 84.714  50.303  1.00 39.39  ? 572 HOH C O   1 
HETATM 10673 O  O   . HOH J 4 .   ? -18.514 82.933  49.348  1.00 46.80  ? 573 HOH C O   1 
HETATM 10674 O  O   . HOH J 4 .   ? -23.112 73.316  71.128  1.00 42.86  ? 574 HOH C O   1 
HETATM 10675 O  O   . HOH J 4 .   ? -21.175 83.939  78.128  1.00 43.87  ? 575 HOH C O   1 
HETATM 10676 O  O   . HOH J 4 .   ? -19.944 79.947  73.747  1.00 61.25  ? 576 HOH C O   1 
HETATM 10677 O  O   . HOH J 4 .   ? -22.766 50.387  49.757  1.00 31.72  ? 577 HOH C O   1 
HETATM 10678 O  O   . HOH J 4 .   ? -39.840 61.597  48.198  1.00 43.19  ? 578 HOH C O   1 
HETATM 10679 O  O   . HOH J 4 .   ? -37.527 90.318  83.494  1.00 35.17  ? 579 HOH C O   1 
HETATM 10680 O  O   . HOH J 4 .   ? -32.737 72.967  87.079  1.00 43.88  ? 580 HOH C O   1 
HETATM 10681 O  O   . HOH J 4 .   ? -27.557 80.097  81.006  1.00 49.72  ? 581 HOH C O   1 
HETATM 10682 O  O   . HOH J 4 .   ? -33.848 66.464  53.842  1.00 45.41  ? 582 HOH C O   1 
HETATM 10683 O  O   . HOH J 4 .   ? -26.598 79.904  84.050  1.00 48.66  ? 583 HOH C O   1 
HETATM 10684 O  O   . HOH J 4 .   ? -37.585 57.200  87.031  1.00 50.29  ? 584 HOH C O   1 
HETATM 10685 O  O   . HOH J 4 .   ? -0.889  63.906  51.958  1.00 45.13  ? 585 HOH C O   1 
HETATM 10686 O  O   . HOH J 4 .   ? -21.273 68.673  61.104  1.00 49.08  ? 586 HOH C O   1 
HETATM 10687 O  O   . HOH J 4 .   ? -14.120 66.927  56.130  1.00 57.85  ? 587 HOH C O   1 
HETATM 10688 O  O   . HOH J 4 .   ? -37.640 82.891  94.858  1.00 54.10  ? 588 HOH C O   1 
HETATM 10689 O  O   . HOH J 4 .   ? -22.246 60.013  91.657  1.00 45.86  ? 589 HOH C O   1 
HETATM 10690 O  O   . HOH J 4 .   ? -17.141 81.044  52.305  1.00 44.60  ? 590 HOH C O   1 
HETATM 10691 O  O   . HOH J 4 .   ? -30.331 56.451  95.926  1.00 45.10  ? 591 HOH C O   1 
HETATM 10692 O  O   . HOH J 4 .   ? -29.047 63.918  93.943  1.00 36.21  ? 592 HOH C O   1 
HETATM 10693 O  O   . HOH J 4 .   ? -22.093 75.592  70.040  1.00 40.84  ? 593 HOH C O   1 
HETATM 10694 O  O   . HOH J 4 .   ? -23.184 62.599  56.310  1.00 49.68  ? 594 HOH C O   1 
HETATM 10695 O  O   . HOH J 4 .   ? -30.037 81.405  60.357  1.00 34.98  ? 595 HOH C O   1 
HETATM 10696 O  O   . HOH J 4 .   ? -1.398  67.473  50.216  1.00 57.34  ? 596 HOH C O   1 
HETATM 10697 O  O   . HOH J 4 .   ? -33.076 76.864  78.908  1.00 41.07  ? 597 HOH C O   1 
HETATM 10698 O  O   . HOH J 4 .   ? -19.597 44.021  50.844  1.00 45.15  ? 598 HOH C O   1 
HETATM 10699 O  O   . HOH J 4 .   ? -23.012 86.314  80.004  1.00 50.10  ? 599 HOH C O   1 
HETATM 10700 O  O   . HOH J 4 .   ? -11.767 67.392  51.214  1.00 60.95  ? 600 HOH C O   1 
HETATM 10701 O  O   . HOH J 4 .   ? -28.738 51.985  49.333  1.00 40.36  ? 601 HOH C O   1 
HETATM 10702 O  O   . HOH J 4 .   ? -20.048 69.479  73.233  1.00 57.54  ? 602 HOH C O   1 
HETATM 10703 O  O   . HOH J 4 .   ? -30.826 50.872  48.176  1.00 48.78  ? 603 HOH C O   1 
HETATM 10704 O  O   . HOH J 4 .   ? -16.830 57.334  46.268  1.00 58.43  ? 604 HOH C O   1 
HETATM 10705 O  O   . HOH J 4 .   ? -15.214 73.409  58.369  1.00 53.75  ? 605 HOH C O   1 
HETATM 10706 O  O   . HOH J 4 .   ? -14.205 97.035  48.911  1.00 42.70  ? 606 HOH C O   1 
HETATM 10707 O  O   . HOH J 4 .   ? -21.960 72.179  61.999  1.00 53.84  ? 607 HOH C O   1 
HETATM 10708 O  O   . HOH J 4 .   ? -40.268 89.616  80.714  1.00 61.20  ? 608 HOH C O   1 
HETATM 10709 O  O   . HOH J 4 .   ? -18.907 66.076  59.704  1.00 48.72  ? 609 HOH C O   1 
HETATM 10710 O  O   . HOH J 4 .   ? -15.737 55.236  85.166  1.00 66.75  ? 610 HOH C O   1 
HETATM 10711 O  O   . HOH J 4 .   ? -25.292 76.960  72.393  1.00 48.74  ? 611 HOH C O   1 
HETATM 10712 O  O   . HOH J 4 .   ? -15.633 82.114  50.314  1.00 55.17  ? 612 HOH C O   1 
HETATM 10713 O  O   . HOH J 4 .   ? -6.320  53.971  45.555  1.00 60.82  ? 613 HOH C O   1 
HETATM 10714 O  O   . HOH J 4 .   ? -27.622 55.787  47.998  1.00 52.02  ? 614 HOH C O   1 
HETATM 10715 O  O   . HOH J 4 .   ? -2.388  83.614  79.772  1.00 44.57  ? 615 HOH C O   1 
HETATM 10716 O  O   . HOH J 4 .   ? -19.836 52.418  101.921 1.00 52.08  ? 616 HOH C O   1 
HETATM 10717 O  O   . HOH J 4 .   ? -27.324 59.574  92.988  1.00 41.09  ? 617 HOH C O   1 
HETATM 10718 O  O   . HOH J 4 .   ? -10.358 87.335  77.094  1.00 47.38  ? 618 HOH C O   1 
HETATM 10719 O  O   . HOH J 4 .   ? -31.507 69.804  54.615  1.00 70.56  ? 619 HOH C O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   VAL 1   1   1   VAL VAL A . n 
A 1 2   ASP 2   2   2   ASP ASP A . n 
A 1 3   PHE 3   3   3   PHE PHE A . n 
A 1 4   HIS 4   4   4   HIS HIS A . n 
A 1 5   GLY 5   5   5   GLY GLY A . n 
A 1 6   TYR 6   6   6   TYR TYR A . n 
A 1 7   ALA 7   7   7   ALA ALA A . n 
A 1 8   ARG 8   8   8   ARG ARG A . n 
A 1 9   SER 9   9   9   SER SER A . n 
A 1 10  GLY 10  10  10  GLY GLY A . n 
A 1 11  ILE 11  11  11  ILE ILE A . n 
A 1 12  GLY 12  12  12  GLY GLY A . n 
A 1 13  TRP 13  13  13  TRP TRP A . n 
A 1 14  THR 14  14  14  THR THR A . n 
A 1 15  GLY 15  15  15  GLY GLY A . n 
A 1 16  SER 16  16  16  SER SER A . n 
A 1 17  GLY 17  17  17  GLY GLY A . n 
A 1 18  GLY 18  18  18  GLY GLY A . n 
A 1 19  GLU 19  19  19  GLU GLU A . n 
A 1 20  GLN 20  20  20  GLN GLN A . n 
A 1 21  GLN 21  21  21  GLN GLN A . n 
A 1 22  CYS 22  22  22  CYS CYS A . n 
A 1 23  PHE 23  23  23  PHE PHE A . n 
A 1 24  GLN 24  24  24  GLN GLN A . n 
A 1 25  ALA 25  25  25  ALA ALA A . n 
A 1 26  THR 26  26  26  THR THR A . n 
A 1 27  GLY 27  27  27  GLY GLY A . n 
A 1 28  ALA 28  28  28  ALA ALA A . n 
A 1 29  GLN 29  29  29  GLN GLN A . n 
A 1 30  SER 30  30  30  SER SER A . n 
A 1 31  LYS 31  31  31  LYS LYS A . n 
A 1 32  TYR 32  32  32  TYR TYR A . n 
A 1 33  ARG 33  33  33  ARG ARG A . n 
A 1 34  LEU 34  34  34  LEU LEU A . n 
A 1 35  GLY 35  35  35  GLY GLY A . n 
A 1 36  ASN 36  36  36  ASN ASN A . n 
A 1 37  GLU 37  37  37  GLU GLU A . n 
A 1 38  CYS 38  38  38  CYS CYS A . n 
A 1 39  GLU 39  39  39  GLU GLU A . n 
A 1 40  THR 40  40  40  THR THR A . n 
A 1 41  TYR 41  41  41  TYR TYR A . n 
A 1 42  ALA 42  42  42  ALA ALA A . n 
A 1 43  GLU 43  43  43  GLU GLU A . n 
A 1 44  LEU 44  44  44  LEU LEU A . n 
A 1 45  LYS 45  45  45  LYS LYS A . n 
A 1 46  LEU 46  46  46  LEU LEU A . n 
A 1 47  GLY 47  47  47  GLY GLY A . n 
A 1 48  GLN 48  48  48  GLN GLN A . n 
A 1 49  GLU 49  49  49  GLU GLU A . n 
A 1 50  VAL 50  50  50  VAL VAL A . n 
A 1 51  TRP 51  51  51  TRP TRP A . n 
A 1 52  LYS 52  52  52  LYS LYS A . n 
A 1 53  GLU 53  53  53  GLU GLU A . n 
A 1 54  GLY 54  54  54  GLY GLY A . n 
A 1 55  ASP 55  55  55  ASP ASP A . n 
A 1 56  LYS 56  56  56  LYS LYS A . n 
A 1 57  SER 57  57  57  SER SER A . n 
A 1 58  PHE 58  58  58  PHE PHE A . n 
A 1 59  TYR 59  59  59  TYR TYR A . n 
A 1 60  PHE 60  60  60  PHE PHE A . n 
A 1 61  ASP 61  61  61  ASP ASP A . n 
A 1 62  THR 62  62  62  THR THR A . n 
A 1 63  ASN 63  63  63  ASN ASN A . n 
A 1 64  VAL 64  64  64  VAL VAL A . n 
A 1 65  ALA 65  65  65  ALA ALA A . n 
A 1 66  TYR 66  66  66  TYR TYR A . n 
A 1 67  SER 67  67  67  SER SER A . n 
A 1 68  VAL 68  68  68  VAL VAL A . n 
A 1 69  ASN 69  69  69  ASN ASN A . n 
A 1 70  GLN 70  70  70  GLN GLN A . n 
A 1 71  GLN 71  71  71  GLN GLN A . n 
A 1 72  ASN 72  72  72  ASN ASN A . n 
A 1 73  ASP 73  73  73  ASP ASP A . n 
A 1 74  TRP 74  74  74  TRP TRP A . n 
A 1 75  GLU 75  75  75  GLU GLU A . n 
A 1 76  SER 76  76  76  SER SER A . n 
A 1 77  THR 77  77  77  THR THR A . n 
A 1 78  ASP 78  78  78  ASP ASP A . n 
A 1 79  PRO 79  79  79  PRO PRO A . n 
A 1 80  ALA 80  80  80  ALA ALA A . n 
A 1 81  PHE 81  81  81  PHE PHE A . n 
A 1 82  ARG 82  82  82  ARG ARG A . n 
A 1 83  GLU 83  83  83  GLU GLU A . n 
A 1 84  ALA 84  84  84  ALA ALA A . n 
A 1 85  ASN 85  85  85  ASN ASN A . n 
A 1 86  VAL 86  86  86  VAL VAL A . n 
A 1 87  GLN 87  87  87  GLN GLN A . n 
A 1 88  GLY 88  88  88  GLY GLY A . n 
A 1 89  LYS 89  89  89  LYS LYS A . n 
A 1 90  ASN 90  90  90  ASN ASN A . n 
A 1 91  LEU 91  91  91  LEU LEU A . n 
A 1 92  ILE 92  92  92  ILE ILE A . n 
A 1 93  GLU 93  93  93  GLU GLU A . n 
A 1 94  TRP 94  94  94  TRP TRP A . n 
A 1 95  LEU 95  95  95  LEU LEU A . n 
A 1 96  PRO 96  96  96  PRO PRO A . n 
A 1 97  GLY 97  97  97  GLY GLY A . n 
A 1 98  SER 98  98  98  SER SER A . n 
A 1 99  THR 99  99  99  THR THR A . n 
A 1 100 ILE 100 100 100 ILE ILE A . n 
A 1 101 TRP 101 101 101 TRP TRP A . n 
A 1 102 ALA 102 102 102 ALA ALA A . n 
A 1 103 GLY 103 103 103 GLY GLY A . n 
A 1 104 LYS 104 104 104 LYS LYS A . n 
A 1 105 ARG 105 105 105 ARG ARG A . n 
A 1 106 PHE 106 106 106 PHE PHE A . n 
A 1 107 TYR 107 107 107 TYR TYR A . n 
A 1 108 GLN 108 108 108 GLN GLN A . n 
A 1 109 ARG 109 109 109 ARG ARG A . n 
A 1 110 HIS 110 110 110 HIS HIS A . n 
A 1 111 ASP 111 111 111 ASP ASP A . n 
A 1 112 VAL 112 112 112 VAL VAL A . n 
A 1 113 HIS 113 113 113 HIS HIS A . n 
A 1 114 MET 114 114 114 MET MET A . n 
A 1 115 ILE 115 115 115 ILE ILE A . n 
A 1 116 ASP 116 116 116 ASP ASP A . n 
A 1 117 PHE 117 117 117 PHE PHE A . n 
A 1 118 TYR 118 118 118 TYR TYR A . n 
A 1 119 TYR 119 119 119 TYR TYR A . n 
A 1 120 TRP 120 120 120 TRP TRP A . n 
A 1 121 ASP 121 121 121 ASP ASP A . n 
A 1 122 ILE 122 122 122 ILE ILE A . n 
A 1 123 SER 123 123 123 SER SER A . n 
A 1 124 GLY 124 124 124 GLY GLY A . n 
A 1 125 PRO 125 125 125 PRO PRO A . n 
A 1 126 GLY 126 126 126 GLY GLY A . n 
A 1 127 ALA 127 127 127 ALA ALA A . n 
A 1 128 GLY 128 128 128 GLY GLY A . n 
A 1 129 ILE 129 129 129 ILE ILE A . n 
A 1 130 GLU 130 130 130 GLU GLU A . n 
A 1 131 ASN 131 131 131 ASN ASN A . n 
A 1 132 ILE 132 132 132 ILE ILE A . n 
A 1 133 ASP 133 133 133 ASP ASP A . n 
A 1 134 LEU 134 134 134 LEU LEU A . n 
A 1 135 GLY 135 135 135 GLY GLY A . n 
A 1 136 PHE 136 136 136 PHE PHE A . n 
A 1 137 GLY 137 137 137 GLY GLY A . n 
A 1 138 LYS 138 138 138 LYS LYS A . n 
A 1 139 LEU 139 139 139 LEU LEU A . n 
A 1 140 SER 140 140 140 SER SER A . n 
A 1 141 LEU 141 141 141 LEU LEU A . n 
A 1 142 ALA 142 142 142 ALA ALA A . n 
A 1 143 ALA 143 143 143 ALA ALA A . n 
A 1 144 THR 144 144 144 THR THR A . n 
A 1 145 ARG 145 145 145 ARG ARG A . n 
A 1 146 SER 146 146 146 SER SER A . n 
A 1 147 THR 147 147 147 THR THR A . n 
A 1 148 GLU 148 148 148 GLU GLU A . n 
A 1 149 ALA 149 149 149 ALA ALA A . n 
A 1 150 GLY 150 150 150 GLY GLY A . n 
A 1 151 GLY 151 151 151 GLY GLY A . n 
A 1 152 SER 152 152 152 SER SER A . n 
A 1 153 TYR 153 153 153 TYR TYR A . n 
A 1 154 THR 154 154 154 THR THR A . n 
A 1 155 PHE 155 155 155 PHE PHE A . n 
A 1 156 SER 156 156 156 SER SER A . n 
A 1 157 SER 157 157 157 SER SER A . n 
A 1 158 GLN 158 158 158 GLN GLN A . n 
A 1 159 ASN 159 159 159 ASN ASN A . n 
A 1 160 ILE 160 160 160 ILE ILE A . n 
A 1 161 TYR 161 161 161 TYR TYR A . n 
A 1 162 ASP 162 162 162 ASP ASP A . n 
A 1 163 GLU 163 163 163 GLU GLU A . n 
A 1 164 VAL 164 164 164 VAL VAL A . n 
A 1 165 LYS 165 165 165 LYS LYS A . n 
A 1 166 ASP 166 166 166 ASP ASP A . n 
A 1 167 THR 167 167 167 THR THR A . n 
A 1 168 ALA 168 168 168 ALA ALA A . n 
A 1 169 ASN 169 169 169 ASN ASN A . n 
A 1 170 ASP 170 170 170 ASP ASP A . n 
A 1 171 VAL 171 171 171 VAL VAL A . n 
A 1 172 PHE 172 172 172 PHE PHE A . n 
A 1 173 ASP 173 173 173 ASP ASP A . n 
A 1 174 VAL 174 174 174 VAL VAL A . n 
A 1 175 ARG 175 175 175 ARG ARG A . n 
A 1 176 LEU 176 176 176 LEU LEU A . n 
A 1 177 ALA 177 177 177 ALA ALA A . n 
A 1 178 GLY 178 178 178 GLY GLY A . n 
A 1 179 LEU 179 179 179 LEU LEU A . n 
A 1 180 GLN 180 180 180 GLN GLN A . n 
A 1 181 THR 181 181 181 THR THR A . n 
A 1 182 ASN 182 182 182 ASN ASN A . n 
A 1 183 PRO 183 183 183 PRO PRO A . n 
A 1 184 ASP 184 184 184 ASP ASP A . n 
A 1 185 GLY 185 185 185 GLY GLY A . n 
A 1 186 VAL 186 186 186 VAL VAL A . n 
A 1 187 LEU 187 187 187 LEU LEU A . n 
A 1 188 GLU 188 188 188 GLU GLU A . n 
A 1 189 LEU 189 189 189 LEU LEU A . n 
A 1 190 GLY 190 190 190 GLY GLY A . n 
A 1 191 VAL 191 191 191 VAL VAL A . n 
A 1 192 ASP 192 192 192 ASP ASP A . n 
A 1 193 TYR 193 193 193 TYR TYR A . n 
A 1 194 GLY 194 194 194 GLY GLY A . n 
A 1 195 ARG 195 195 195 ARG ARG A . n 
A 1 196 ALA 196 196 196 ALA ALA A . n 
A 1 197 ASN 197 197 197 ASN ASN A . n 
A 1 198 THR 198 198 198 THR THR A . n 
A 1 199 THR 199 199 199 THR THR A . n 
A 1 200 ASP 200 200 200 ASP ASP A . n 
A 1 201 GLY 201 201 201 GLY GLY A . n 
A 1 202 TYR 202 202 202 TYR TYR A . n 
A 1 203 LYS 203 203 203 LYS LYS A . n 
A 1 204 LEU 204 204 204 LEU LEU A . n 
A 1 205 ALA 205 205 205 ALA ALA A . n 
A 1 206 ASP 206 206 206 ASP ASP A . n 
A 1 207 GLY 207 207 207 GLY GLY A . n 
A 1 208 ALA 208 208 208 ALA ALA A . n 
A 1 209 SER 209 209 209 SER SER A . n 
A 1 210 LYS 210 210 210 LYS LYS A . n 
A 1 211 ASP 211 211 211 ASP ASP A . n 
A 1 212 GLY 212 212 212 GLY GLY A . n 
A 1 213 TRP 213 213 213 TRP TRP A . n 
A 1 214 MET 214 214 214 MET MET A . n 
A 1 215 PHE 215 215 215 PHE PHE A . n 
A 1 216 THR 216 216 216 THR THR A . n 
A 1 217 ALA 217 217 217 ALA ALA A . n 
A 1 218 GLU 218 218 218 GLU GLU A . n 
A 1 219 HIS 219 219 219 HIS HIS A . n 
A 1 220 THR 220 220 220 THR THR A . n 
A 1 221 GLN 221 221 221 GLN GLN A . n 
A 1 222 SER 222 222 222 SER SER A . n 
A 1 223 MET 223 223 223 MET MET A . n 
A 1 224 LEU 224 224 224 LEU LEU A . n 
A 1 225 LYS 225 225 225 LYS LYS A . n 
A 1 226 GLY 226 226 226 GLY GLY A . n 
A 1 227 TYR 227 227 227 TYR TYR A . n 
A 1 228 ASN 228 228 228 ASN ASN A . n 
A 1 229 LYS 229 229 229 LYS LYS A . n 
A 1 230 PHE 230 230 230 PHE PHE A . n 
A 1 231 VAL 231 231 231 VAL VAL A . n 
A 1 232 VAL 232 232 232 VAL VAL A . n 
A 1 233 GLN 233 233 233 GLN GLN A . n 
A 1 234 TYR 234 234 234 TYR TYR A . n 
A 1 235 ALA 235 235 235 ALA ALA A . n 
A 1 236 THR 236 236 236 THR THR A . n 
A 1 237 ASP 237 237 237 ASP ASP A . n 
A 1 238 ALA 238 238 238 ALA ALA A . n 
A 1 239 MET 239 239 239 MET MET A . n 
A 1 240 THR 240 240 240 THR THR A . n 
A 1 241 THR 241 241 241 THR THR A . n 
A 1 242 GLN 242 242 242 GLN GLN A . n 
A 1 243 GLY 243 243 243 GLY GLY A . n 
A 1 244 LYS 244 244 244 LYS LYS A . n 
A 1 245 GLY 245 245 245 GLY GLY A . n 
A 1 246 GLN 246 246 246 GLN GLN A . n 
A 1 247 ALA 247 247 247 ALA ALA A . n 
A 1 248 ARG 248 248 248 ARG ARG A . n 
A 1 249 GLY 249 249 249 GLY GLY A . n 
A 1 250 SER 250 250 250 SER SER A . n 
A 1 251 ASP 251 251 251 ASP ASP A . n 
A 1 252 GLY 252 252 252 GLY GLY A . n 
A 1 253 SER 253 253 253 SER SER A . n 
A 1 254 SER 254 254 254 SER SER A . n 
A 1 255 SER 255 255 255 SER SER A . n 
A 1 256 PHE 256 256 256 PHE PHE A . n 
A 1 257 THR 257 257 257 THR THR A . n 
A 1 258 GLU 258 258 258 GLU GLU A . n 
A 1 259 GLU 259 259 ?   ?   ?   A . n 
A 1 260 LEU 260 260 ?   ?   ?   A . n 
A 1 261 SER 261 261 ?   ?   ?   A . n 
A 1 262 ASP 262 262 ?   ?   ?   A . n 
A 1 263 GLY 263 263 ?   ?   ?   A . n 
A 1 264 THR 264 264 ?   ?   ?   A . n 
A 1 265 LYS 265 265 265 LYS LYS A . n 
A 1 266 ILE 266 266 266 ILE ILE A . n 
A 1 267 ASN 267 267 267 ASN ASN A . n 
A 1 268 TYR 268 268 268 TYR TYR A . n 
A 1 269 ALA 269 269 269 ALA ALA A . n 
A 1 270 ASN 270 270 270 ASN ASN A . n 
A 1 271 LYS 271 271 271 LYS LYS A . n 
A 1 272 VAL 272 272 272 VAL VAL A . n 
A 1 273 ILE 273 273 273 ILE ILE A . n 
A 1 274 ASN 274 274 274 ASN ASN A . n 
A 1 275 ASN 275 275 275 ASN ASN A . n 
A 1 276 ASN 276 276 276 ASN ASN A . n 
A 1 277 GLY 277 277 277 GLY GLY A . n 
A 1 278 ASN 278 278 278 ASN ASN A . n 
A 1 279 MET 279 279 279 MET MET A . n 
A 1 280 TRP 280 280 280 TRP TRP A . n 
A 1 281 ARG 281 281 281 ARG ARG A . n 
A 1 282 ILE 282 282 282 ILE ILE A . n 
A 1 283 LEU 283 283 283 LEU LEU A . n 
A 1 284 ASP 284 284 284 ASP ASP A . n 
A 1 285 HIS 285 285 285 HIS HIS A . n 
A 1 286 GLY 286 286 286 GLY GLY A . n 
A 1 287 ALA 287 287 287 ALA ALA A . n 
A 1 288 ILE 288 288 288 ILE ILE A . n 
A 1 289 SER 289 289 289 SER SER A . n 
A 1 290 LEU 290 290 290 LEU LEU A . n 
A 1 291 GLY 291 291 291 GLY GLY A . n 
A 1 292 ASP 292 292 292 ASP ASP A . n 
A 1 293 LYS 293 293 293 LYS LYS A . n 
A 1 294 TRP 294 294 294 TRP TRP A . n 
A 1 295 ASP 295 295 295 ASP ASP A . n 
A 1 296 LEU 296 296 296 LEU LEU A . n 
A 1 297 MET 297 297 297 MET MET A . n 
A 1 298 TYR 298 298 298 TYR TYR A . n 
A 1 299 VAL 299 299 299 VAL VAL A . n 
A 1 300 GLY 300 300 300 GLY GLY A . n 
A 1 301 MET 301 301 301 MET MET A . n 
A 1 302 TYR 302 302 302 TYR TYR A . n 
A 1 303 GLN 303 303 303 GLN GLN A . n 
A 1 304 ASN 304 304 304 ASN ASN A . n 
A 1 305 ILE 305 305 305 ILE ILE A . n 
A 1 306 ASP 306 306 306 ASP ASP A . n 
A 1 307 TRP 307 307 307 TRP TRP A . n 
A 1 308 ASP 308 308 308 ASP ASP A . n 
A 1 309 ASN 309 309 309 ASN ASN A . n 
A 1 310 ASN 310 310 310 ASN ASN A . n 
A 1 311 LEU 311 311 311 LEU LEU A . n 
A 1 312 GLY 312 312 312 GLY GLY A . n 
A 1 313 THR 313 313 313 THR THR A . n 
A 1 314 GLU 314 314 314 GLU GLU A . n 
A 1 315 TRP 315 315 315 TRP TRP A . n 
A 1 316 TRP 316 316 316 TRP TRP A . n 
A 1 317 THR 317 317 317 THR THR A . n 
A 1 318 VAL 318 318 318 VAL VAL A . n 
A 1 319 GLY 319 319 319 GLY GLY A . n 
A 1 320 VAL 320 320 320 VAL VAL A . n 
A 1 321 ARG 321 321 321 ARG ARG A . n 
A 1 322 PRO 322 322 322 PRO PRO A . n 
A 1 323 MET 323 323 323 MET MET A . n 
A 1 324 TYR 324 324 324 TYR TYR A . n 
A 1 325 LYS 325 325 325 LYS LYS A . n 
A 1 326 TRP 326 326 326 TRP TRP A . n 
A 1 327 THR 327 327 327 THR THR A . n 
A 1 328 PRO 328 328 328 PRO PRO A . n 
A 1 329 ILE 329 329 329 ILE ILE A . n 
A 1 330 MET 330 330 330 MET MET A . n 
A 1 331 SER 331 331 331 SER SER A . n 
A 1 332 THR 332 332 332 THR THR A . n 
A 1 333 LEU 333 333 333 LEU LEU A . n 
A 1 334 LEU 334 334 334 LEU LEU A . n 
A 1 335 GLU 335 335 335 GLU GLU A . n 
A 1 336 VAL 336 336 336 VAL VAL A . n 
A 1 337 GLY 337 337 337 GLY GLY A . n 
A 1 338 TYR 338 338 338 TYR TYR A . n 
A 1 339 ASP 339 339 339 ASP ASP A . n 
A 1 340 ASN 340 340 340 ASN ASN A . n 
A 1 341 VAL 341 341 341 VAL VAL A . n 
A 1 342 LYS 342 342 342 LYS LYS A . n 
A 1 343 SER 343 343 343 SER SER A . n 
A 1 344 GLN 344 344 344 GLN GLN A . n 
A 1 345 GLN 345 345 345 GLN GLN A . n 
A 1 346 THR 346 346 346 THR THR A . n 
A 1 347 GLY 347 347 347 GLY GLY A . n 
A 1 348 ASP 348 348 348 ASP ASP A . n 
A 1 349 ARG 349 349 349 ARG ARG A . n 
A 1 350 ASN 350 350 350 ASN ASN A . n 
A 1 351 ASN 351 351 351 ASN ASN A . n 
A 1 352 GLN 352 352 352 GLN GLN A . n 
A 1 353 TYR 353 353 353 TYR TYR A . n 
A 1 354 LYS 354 354 354 LYS LYS A . n 
A 1 355 ILE 355 355 355 ILE ILE A . n 
A 1 356 THR 356 356 356 THR THR A . n 
A 1 357 LEU 357 357 357 LEU LEU A . n 
A 1 358 ALA 358 358 358 ALA ALA A . n 
A 1 359 GLN 359 359 359 GLN GLN A . n 
A 1 360 GLN 360 360 360 GLN GLN A . n 
A 1 361 TRP 361 361 361 TRP TRP A . n 
A 1 362 GLN 362 362 362 GLN GLN A . n 
A 1 363 ALA 363 363 363 ALA ALA A . n 
A 1 364 GLY 364 364 364 GLY GLY A . n 
A 1 365 ASP 365 365 365 ASP ASP A . n 
A 1 366 SER 366 366 366 SER SER A . n 
A 1 367 ILE 367 367 367 ILE ILE A . n 
A 1 368 TRP 368 368 368 TRP TRP A . n 
A 1 369 SER 369 369 369 SER SER A . n 
A 1 370 ARG 370 370 370 ARG ARG A . n 
A 1 371 PRO 371 371 371 PRO PRO A . n 
A 1 372 ALA 372 372 372 ALA ALA A . n 
A 1 373 ILE 373 373 373 ILE ILE A . n 
A 1 374 ARG 374 374 374 ARG ARG A . n 
A 1 375 ILE 375 375 375 ILE ILE A . n 
A 1 376 PHE 376 376 376 PHE PHE A . n 
A 1 377 ALA 377 377 377 ALA ALA A . n 
A 1 378 THR 378 378 378 THR THR A . n 
A 1 379 TYR 379 379 379 TYR TYR A . n 
A 1 380 ALA 380 380 380 ALA ALA A . n 
A 1 381 LYS 381 381 381 LYS LYS A . n 
A 1 382 TRP 382 382 382 TRP TRP A . n 
A 1 383 ASP 383 383 383 ASP ASP A . n 
A 1 384 GLU 384 384 384 GLU GLU A . n 
A 1 385 LYS 385 385 385 LYS LYS A . n 
A 1 386 TRP 386 386 386 TRP TRP A . n 
A 1 387 GLY 387 387 387 GLY GLY A . n 
A 1 388 TYR 388 388 388 TYR TYR A . n 
A 1 389 ILE 389 389 389 ILE ILE A . n 
A 1 390 LYS 390 390 390 LYS LYS A . n 
A 1 391 ASP 391 391 391 ASP ASP A . n 
A 1 392 GLY 392 392 392 GLY GLY A . n 
A 1 393 ASP 393 393 393 ASP ASP A . n 
A 1 394 ASN 394 394 394 ASN ASN A . n 
A 1 395 ILE 395 395 395 ILE ILE A . n 
A 1 396 SER 396 396 396 SER SER A . n 
A 1 397 ARG 397 397 397 ARG ARG A . n 
A 1 398 TYR 398 398 398 TYR TYR A . n 
A 1 399 ALA 399 399 399 ALA ALA A . n 
A 1 400 ALA 400 400 400 ALA ALA A . n 
A 1 401 ALA 401 401 401 ALA ALA A . n 
A 1 402 THR 402 402 402 THR THR A . n 
A 1 403 ASN 403 403 403 ASN ASN A . n 
A 1 404 SER 404 404 404 SER SER A . n 
A 1 405 GLY 405 405 405 GLY GLY A . n 
A 1 406 ILE 406 406 406 ILE ILE A . n 
A 1 407 SER 407 407 407 SER SER A . n 
A 1 408 THR 408 408 408 THR THR A . n 
A 1 409 ASN 409 409 409 ASN ASN A . n 
A 1 410 SER 410 410 410 SER SER A . n 
A 1 411 ARG 411 411 411 ARG ARG A . n 
A 1 412 GLY 412 412 412 GLY GLY A . n 
A 1 413 ASP 413 413 413 ASP ASP A . n 
A 1 414 SER 414 414 414 SER SER A . n 
A 1 415 ASP 415 415 415 ASP ASP A . n 
A 1 416 GLU 416 416 416 GLU GLU A . n 
A 1 417 TRP 417 417 417 TRP TRP A . n 
A 1 418 THR 418 418 418 THR THR A . n 
A 1 419 PHE 419 419 419 PHE PHE A . n 
A 1 420 GLY 420 420 420 GLY GLY A . n 
A 1 421 ALA 421 421 421 ALA ALA A . n 
A 1 422 GLN 422 422 422 GLN GLN A . n 
A 1 423 MET 423 423 423 MET MET A . n 
A 1 424 GLU 424 424 424 GLU GLU A . n 
A 1 425 ILE 425 425 425 ILE ILE A . n 
A 1 426 TRP 426 426 426 TRP TRP A . n 
A 1 427 TRP 427 427 427 TRP TRP A . n 
B 1 1   VAL 1   1   1   VAL VAL B . n 
B 1 2   ASP 2   2   2   ASP ASP B . n 
B 1 3   PHE 3   3   3   PHE PHE B . n 
B 1 4   HIS 4   4   4   HIS HIS B . n 
B 1 5   GLY 5   5   5   GLY GLY B . n 
B 1 6   TYR 6   6   6   TYR TYR B . n 
B 1 7   ALA 7   7   7   ALA ALA B . n 
B 1 8   ARG 8   8   8   ARG ARG B . n 
B 1 9   SER 9   9   9   SER SER B . n 
B 1 10  GLY 10  10  10  GLY GLY B . n 
B 1 11  ILE 11  11  11  ILE ILE B . n 
B 1 12  GLY 12  12  12  GLY GLY B . n 
B 1 13  TRP 13  13  13  TRP TRP B . n 
B 1 14  THR 14  14  14  THR THR B . n 
B 1 15  GLY 15  15  15  GLY GLY B . n 
B 1 16  SER 16  16  16  SER SER B . n 
B 1 17  GLY 17  17  17  GLY GLY B . n 
B 1 18  GLY 18  18  18  GLY GLY B . n 
B 1 19  GLU 19  19  19  GLU GLU B . n 
B 1 20  GLN 20  20  20  GLN GLN B . n 
B 1 21  GLN 21  21  21  GLN GLN B . n 
B 1 22  CYS 22  22  22  CYS CYS B . n 
B 1 23  PHE 23  23  23  PHE PHE B . n 
B 1 24  GLN 24  24  24  GLN GLN B . n 
B 1 25  ALA 25  25  25  ALA ALA B . n 
B 1 26  THR 26  26  26  THR THR B . n 
B 1 27  GLY 27  27  27  GLY GLY B . n 
B 1 28  ALA 28  28  28  ALA ALA B . n 
B 1 29  GLN 29  29  29  GLN GLN B . n 
B 1 30  SER 30  30  30  SER SER B . n 
B 1 31  LYS 31  31  31  LYS LYS B . n 
B 1 32  TYR 32  32  32  TYR TYR B . n 
B 1 33  ARG 33  33  33  ARG ARG B . n 
B 1 34  LEU 34  34  34  LEU LEU B . n 
B 1 35  GLY 35  35  35  GLY GLY B . n 
B 1 36  ASN 36  36  36  ASN ASN B . n 
B 1 37  GLU 37  37  37  GLU GLU B . n 
B 1 38  CYS 38  38  38  CYS CYS B . n 
B 1 39  GLU 39  39  39  GLU GLU B . n 
B 1 40  THR 40  40  40  THR THR B . n 
B 1 41  TYR 41  41  41  TYR TYR B . n 
B 1 42  ALA 42  42  42  ALA ALA B . n 
B 1 43  GLU 43  43  43  GLU GLU B . n 
B 1 44  LEU 44  44  44  LEU LEU B . n 
B 1 45  LYS 45  45  45  LYS LYS B . n 
B 1 46  LEU 46  46  46  LEU LEU B . n 
B 1 47  GLY 47  47  47  GLY GLY B . n 
B 1 48  GLN 48  48  48  GLN GLN B . n 
B 1 49  GLU 49  49  49  GLU GLU B . n 
B 1 50  VAL 50  50  50  VAL VAL B . n 
B 1 51  TRP 51  51  51  TRP TRP B . n 
B 1 52  LYS 52  52  52  LYS LYS B . n 
B 1 53  GLU 53  53  53  GLU GLU B . n 
B 1 54  GLY 54  54  54  GLY GLY B . n 
B 1 55  ASP 55  55  55  ASP ASP B . n 
B 1 56  LYS 56  56  56  LYS LYS B . n 
B 1 57  SER 57  57  57  SER SER B . n 
B 1 58  PHE 58  58  58  PHE PHE B . n 
B 1 59  TYR 59  59  59  TYR TYR B . n 
B 1 60  PHE 60  60  60  PHE PHE B . n 
B 1 61  ASP 61  61  61  ASP ASP B . n 
B 1 62  THR 62  62  62  THR THR B . n 
B 1 63  ASN 63  63  63  ASN ASN B . n 
B 1 64  VAL 64  64  64  VAL VAL B . n 
B 1 65  ALA 65  65  65  ALA ALA B . n 
B 1 66  TYR 66  66  66  TYR TYR B . n 
B 1 67  SER 67  67  67  SER SER B . n 
B 1 68  VAL 68  68  68  VAL VAL B . n 
B 1 69  ASN 69  69  69  ASN ASN B . n 
B 1 70  GLN 70  70  70  GLN GLN B . n 
B 1 71  GLN 71  71  71  GLN GLN B . n 
B 1 72  ASN 72  72  72  ASN ASN B . n 
B 1 73  ASP 73  73  73  ASP ASP B . n 
B 1 74  TRP 74  74  74  TRP TRP B . n 
B 1 75  GLU 75  75  75  GLU GLU B . n 
B 1 76  SER 76  76  76  SER SER B . n 
B 1 77  THR 77  77  77  THR THR B . n 
B 1 78  ASP 78  78  78  ASP ASP B . n 
B 1 79  PRO 79  79  79  PRO PRO B . n 
B 1 80  ALA 80  80  80  ALA ALA B . n 
B 1 81  PHE 81  81  81  PHE PHE B . n 
B 1 82  ARG 82  82  82  ARG ARG B . n 
B 1 83  GLU 83  83  83  GLU GLU B . n 
B 1 84  ALA 84  84  84  ALA ALA B . n 
B 1 85  ASN 85  85  85  ASN ASN B . n 
B 1 86  VAL 86  86  86  VAL VAL B . n 
B 1 87  GLN 87  87  87  GLN GLN B . n 
B 1 88  GLY 88  88  88  GLY GLY B . n 
B 1 89  LYS 89  89  89  LYS LYS B . n 
B 1 90  ASN 90  90  90  ASN ASN B . n 
B 1 91  LEU 91  91  91  LEU LEU B . n 
B 1 92  ILE 92  92  92  ILE ILE B . n 
B 1 93  GLU 93  93  93  GLU GLU B . n 
B 1 94  TRP 94  94  94  TRP TRP B . n 
B 1 95  LEU 95  95  95  LEU LEU B . n 
B 1 96  PRO 96  96  96  PRO PRO B . n 
B 1 97  GLY 97  97  97  GLY GLY B . n 
B 1 98  SER 98  98  98  SER SER B . n 
B 1 99  THR 99  99  99  THR THR B . n 
B 1 100 ILE 100 100 100 ILE ILE B . n 
B 1 101 TRP 101 101 101 TRP TRP B . n 
B 1 102 ALA 102 102 102 ALA ALA B . n 
B 1 103 GLY 103 103 103 GLY GLY B . n 
B 1 104 LYS 104 104 104 LYS LYS B . n 
B 1 105 ARG 105 105 105 ARG ARG B . n 
B 1 106 PHE 106 106 106 PHE PHE B . n 
B 1 107 TYR 107 107 107 TYR TYR B . n 
B 1 108 GLN 108 108 108 GLN GLN B . n 
B 1 109 ARG 109 109 109 ARG ARG B . n 
B 1 110 HIS 110 110 110 HIS HIS B . n 
B 1 111 ASP 111 111 111 ASP ASP B . n 
B 1 112 VAL 112 112 112 VAL VAL B . n 
B 1 113 HIS 113 113 113 HIS HIS B . n 
B 1 114 MET 114 114 114 MET MET B . n 
B 1 115 ILE 115 115 115 ILE ILE B . n 
B 1 116 ASP 116 116 116 ASP ASP B . n 
B 1 117 PHE 117 117 117 PHE PHE B . n 
B 1 118 TYR 118 118 118 TYR TYR B . n 
B 1 119 TYR 119 119 119 TYR TYR B . n 
B 1 120 TRP 120 120 120 TRP TRP B . n 
B 1 121 ASP 121 121 121 ASP ASP B . n 
B 1 122 ILE 122 122 122 ILE ILE B . n 
B 1 123 SER 123 123 123 SER SER B . n 
B 1 124 GLY 124 124 124 GLY GLY B . n 
B 1 125 PRO 125 125 125 PRO PRO B . n 
B 1 126 GLY 126 126 126 GLY GLY B . n 
B 1 127 ALA 127 127 127 ALA ALA B . n 
B 1 128 GLY 128 128 128 GLY GLY B . n 
B 1 129 ILE 129 129 129 ILE ILE B . n 
B 1 130 GLU 130 130 130 GLU GLU B . n 
B 1 131 ASN 131 131 131 ASN ASN B . n 
B 1 132 ILE 132 132 132 ILE ILE B . n 
B 1 133 ASP 133 133 133 ASP ASP B . n 
B 1 134 LEU 134 134 134 LEU LEU B . n 
B 1 135 GLY 135 135 135 GLY GLY B . n 
B 1 136 PHE 136 136 136 PHE PHE B . n 
B 1 137 GLY 137 137 137 GLY GLY B . n 
B 1 138 LYS 138 138 138 LYS LYS B . n 
B 1 139 LEU 139 139 139 LEU LEU B . n 
B 1 140 SER 140 140 140 SER SER B . n 
B 1 141 LEU 141 141 141 LEU LEU B . n 
B 1 142 ALA 142 142 142 ALA ALA B . n 
B 1 143 ALA 143 143 143 ALA ALA B . n 
B 1 144 THR 144 144 144 THR THR B . n 
B 1 145 ARG 145 145 145 ARG ARG B . n 
B 1 146 SER 146 146 146 SER SER B . n 
B 1 147 THR 147 147 147 THR THR B . n 
B 1 148 GLU 148 148 148 GLU GLU B . n 
B 1 149 ALA 149 149 149 ALA ALA B . n 
B 1 150 GLY 150 150 150 GLY GLY B . n 
B 1 151 GLY 151 151 151 GLY GLY B . n 
B 1 152 SER 152 152 152 SER SER B . n 
B 1 153 TYR 153 153 153 TYR TYR B . n 
B 1 154 THR 154 154 154 THR THR B . n 
B 1 155 PHE 155 155 155 PHE PHE B . n 
B 1 156 SER 156 156 156 SER SER B . n 
B 1 157 SER 157 157 157 SER SER B . n 
B 1 158 GLN 158 158 158 GLN GLN B . n 
B 1 159 ASN 159 159 159 ASN ASN B . n 
B 1 160 ILE 160 160 160 ILE ILE B . n 
B 1 161 TYR 161 161 161 TYR TYR B . n 
B 1 162 ASP 162 162 162 ASP ASP B . n 
B 1 163 GLU 163 163 163 GLU GLU B . n 
B 1 164 VAL 164 164 164 VAL VAL B . n 
B 1 165 LYS 165 165 165 LYS LYS B . n 
B 1 166 ASP 166 166 166 ASP ASP B . n 
B 1 167 THR 167 167 167 THR THR B . n 
B 1 168 ALA 168 168 168 ALA ALA B . n 
B 1 169 ASN 169 169 169 ASN ASN B . n 
B 1 170 ASP 170 170 170 ASP ASP B . n 
B 1 171 VAL 171 171 171 VAL VAL B . n 
B 1 172 PHE 172 172 172 PHE PHE B . n 
B 1 173 ASP 173 173 173 ASP ASP B . n 
B 1 174 VAL 174 174 174 VAL VAL B . n 
B 1 175 ARG 175 175 175 ARG ARG B . n 
B 1 176 LEU 176 176 176 LEU LEU B . n 
B 1 177 ALA 177 177 177 ALA ALA B . n 
B 1 178 GLY 178 178 178 GLY GLY B . n 
B 1 179 LEU 179 179 179 LEU LEU B . n 
B 1 180 GLN 180 180 180 GLN GLN B . n 
B 1 181 THR 181 181 181 THR THR B . n 
B 1 182 ASN 182 182 182 ASN ASN B . n 
B 1 183 PRO 183 183 183 PRO PRO B . n 
B 1 184 ASP 184 184 184 ASP ASP B . n 
B 1 185 GLY 185 185 185 GLY GLY B . n 
B 1 186 VAL 186 186 186 VAL VAL B . n 
B 1 187 LEU 187 187 187 LEU LEU B . n 
B 1 188 GLU 188 188 188 GLU GLU B . n 
B 1 189 LEU 189 189 189 LEU LEU B . n 
B 1 190 GLY 190 190 190 GLY GLY B . n 
B 1 191 VAL 191 191 191 VAL VAL B . n 
B 1 192 ASP 192 192 192 ASP ASP B . n