data_2MPT
# 
_entry.id   2MPT 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2MPT         
RCSB  RCSB103905   
BMRB  25000        
WWPDB D_1000103905 
# 
_pdbx_database_related.db_id          25000 
_pdbx_database_related.db_name        BMRB 
_pdbx_database_related.content_type   unspecified 
_pdbx_database_related.details        . 
# 
_pdbx_database_status.deposit_site                    BMRB 
_pdbx_database_status.entry_id                        2MPT 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.recvd_initial_deposition_date   2014-06-02 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  REL 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Escobedo, A.'          1 
'Macias, M.J.'          2 
'Gomes, T.'             3 
'Aragon, E.'            4 
'Martin-Malpartida, P.' 5 
'Ruiz, L.'              6 
# 
_citation.id                        primary 
_citation.title                     
'Structural Basis of the Activation and Degradation Mechanisms of the E3 Ubiquitin Ligase Nedd4L.' 
_citation.journal_abbrev            Structure 
_citation.journal_volume            22 
_citation.page_first                1446 
_citation.page_last                 1457 
_citation.year                      2014 
_citation.journal_id_ASTM           STRUE6 
_citation.country                   UK 
_citation.journal_id_ISSN           0969-2126 
_citation.journal_id_CSD            2005 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   25295397 
_citation.pdbx_database_id_DOI      10.1016/j.str.2014.08.016 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Escobedo, A.'          1 
primary 'Gomes, T.'             2 
primary 'Aragon, E.'            3 
primary 'Martin-Malpartida, P.' 4 
primary 'Ruiz, L.'              5 
primary 'Macias, M.J.'          6 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'E3 ubiquitin-protein ligase NEDD4-like' 5665.508 1 6.3.2.- ? 'WW3 domain, UNP RESIDUES 496-539'           ? 
2 polymer syn 'E3 ubiquitin-protein ligase NEDD4-like' 1606.774 1 6.3.2.- ? 'HECT domain PY motif, UNP RESIDUES 945-957' ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'NEDD4.2, Nedd4-2' 
2 'NEDD4.2, Nedd4-2' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no  GAMEQSFLPPGWEMRIAPNGRPFFIDHNTKTTTWEDPRLKFPVHMRSK GAMEQSFLPPGWEMRIAPNGRPFFIDHNTKTTTWEDPRLKFPVHMRSK A ? 
2 'polypeptide(L)' no yes 'RLDLPPYETFEDL(NH2)'                             RLDLPPYETFEDLX                                   B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  GLY n 
1 2  ALA n 
1 3  MET n 
1 4  GLU n 
1 5  GLN n 
1 6  SER n 
1 7  PHE n 
1 8  LEU n 
1 9  PRO n 
1 10 PRO n 
1 11 GLY n 
1 12 TRP n 
1 13 GLU n 
1 14 MET n 
1 15 ARG n 
1 16 ILE n 
1 17 ALA n 
1 18 PRO n 
1 19 ASN n 
1 20 GLY n 
1 21 ARG n 
1 22 PRO n 
1 23 PHE n 
1 24 PHE n 
1 25 ILE n 
1 26 ASP n 
1 27 HIS n 
1 28 ASN n 
1 29 THR n 
1 30 LYS n 
1 31 THR n 
1 32 THR n 
1 33 THR n 
1 34 TRP n 
1 35 GLU n 
1 36 ASP n 
1 37 PRO n 
1 38 ARG n 
1 39 LEU n 
1 40 LYS n 
1 41 PHE n 
1 42 PRO n 
1 43 VAL n 
1 44 HIS n 
1 45 MET n 
1 46 ARG n 
1 47 SER n 
1 48 LYS n 
2 1  ARG n 
2 2  LEU n 
2 3  ASP n 
2 4  LEU n 
2 5  PRO n 
2 6  PRO n 
2 7  TYR n 
2 8  GLU n 
2 9  THR n 
2 10 PHE n 
2 11 GLU n 
2 12 ASP n 
2 13 LEU n 
2 14 NH2 n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'NEDD4L, KIAA0439, NEDL3' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21 DE3' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          vector 
_entity_src_gen.pdbx_host_org_vector               pETM11 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    'Homo sapiens' 
_pdbx_entity_src_syn.organism_common_name   human 
_pdbx_entity_src_syn.ncbi_taxonomy_id       9606 
_pdbx_entity_src_syn.details                ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP NED4L_HUMAN Q96PU5 1 QSFLPPGWEMRIAPNGRPFFIDHNTKTTTWEDPRLKFPVHMRSK 496 ? 
2 UNP NED4L_HUMAN Q96PU5 2 RLDLPPYETFEDL                                945 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2MPT A 5 ? 48 ? Q96PU5 496 ? 539 ? 476 519 
2 2 2MPT B 1 ? 13 ? Q96PU5 945 ? 957 ? 925 937 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2MPT GLY A 1  ? UNP Q96PU5 ? ? 'EXPRESSION TAG' 472 1 
1 2MPT ALA A 2  ? UNP Q96PU5 ? ? 'EXPRESSION TAG' 473 2 
1 2MPT MET A 3  ? UNP Q96PU5 ? ? 'EXPRESSION TAG' 474 3 
1 2MPT GLU A 4  ? UNP Q96PU5 ? ? 'EXPRESSION TAG' 475 4 
2 2MPT NH2 B 14 ? UNP Q96PU5 ? ? AMIDATION        938 5 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
NH2 non-polymer         . 'AMINO GROUP'   ? 'H2 N'           16.023  
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.type 
1 1 1 '2D 1H-1H NOESY'  
1 2 1 '2D 1H-1H TOCSY'  
1 3 2 '3D 1H-15N NOESY' 
1 4 2 '3D 1H-15N TOCSY' 
1 5 3 '3D HNCACB'       
1 6 3 '3D CBCA(CO)NH'   
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      ? 
_pdbx_nmr_exptl_sample_conditions.pH                  7 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature         298 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
loop_
_pdbx_nmr_sample_details.contents 
_pdbx_nmr_sample_details.solution_id 
_pdbx_nmr_sample_details.solvent_system 
'0.7 mM WW3-1, 1.4 mM HECT_PY-2, 150 mM sodium chloride-3, 20 mM sodium phosphate-4, 90% H2O/10% D2O'                             
1 '90% H2O/10% D2O' 
'1 mM [U-100% 15N] WW3-5, 2 mM HECT_PY-6, 150 mM sodium chloride-7, 20 mM sodium phosphate-8, 90% H2O/10% D2O'                    
2 '90% H2O/10% D2O' 
'0.8 mM [U-100% 13C; U-100% 15N] WW3-9, 1.6 mM HECT_PY-10, 150 mM sodium chloride-11, 20 mM sodium phosphate-12, 90% H2O/10% D2O' 
3 '90% H2O/10% D2O' 
# 
_pdbx_nmr_spectrometer.field_strength    600 
_pdbx_nmr_spectrometer.manufacturer      Bruker 
_pdbx_nmr_spectrometer.model             Avance 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.type              'Bruker Avance' 
# 
_pdbx_nmr_refine.entry_id           2MPT 
_pdbx_nmr_refine.method             'DGSA-distance geometry simulated annealing' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy' 
_pdbx_nmr_ensemble.conformers_calculated_total_number            300 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.entry_id                                      2MPT 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   2 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   6.5 
_pdbx_nmr_ensemble.representative_conformer                      1 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.entry_id             2MPT 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.authors 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.ordinal 
_pdbx_nmr_software.version 
'Brunger, Adams, Clore, Gros, Nilges and Read'      refinement                  CNSSOLVE 1 ? 
'Brunger, Adams, Clore, Gros, Nilges and Read'      'structure solution'        CNSSOLVE 2 ? 
'Keller and Wuthrich'                               'chemical shift assignment' CARA     3 ? 
'Keller and Wuthrich'                               'peak picking'              CARA     4 ? 
'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing                  NMRPipe  5 ? 
'Bruker Biospin'                                    collection                  TOPSPIN  6 ? 
'Cornilescu, Delaglio and Bax'                      'geometry optimization'     TALOS    7 ? 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.entry_id                   2MPT 
_exptl.method                     'SOLUTION NMR' 
_exptl.method_details             ? 
# 
_struct.entry_id                  2MPT 
_struct.title                     'WW3 domain of Nedd4L in complex with its HECT domain PY motif' 
_struct.pdbx_descriptor           'E3 ubiquitin-protein ligase NEDD4-like (E.C.6.3.2.-)' 
_struct.pdbx_model_details        'lowest energy, model1' 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2MPT 
_struct_keywords.pdbx_keywords   LIGASE 
_struct_keywords.text            
'WW, Nedd4L, Nedd4.2, HECT, PY, WW3, Auto-ubiquitination, Proteasomal degradation, Ubiquitin ligase, LIGASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
_struct_conn.id                            covale1 
_struct_conn.conn_type_id                  covale 
_struct_conn.pdbx_leaving_atom_flag        ? 
_struct_conn.pdbx_PDB_id                   ? 
_struct_conn.ptnr1_label_asym_id           B 
_struct_conn.ptnr1_label_comp_id           LEU 
_struct_conn.ptnr1_label_seq_id            13 
_struct_conn.ptnr1_label_atom_id           C 
_struct_conn.pdbx_ptnr1_label_alt_id       ? 
_struct_conn.pdbx_ptnr1_PDB_ins_code       ? 
_struct_conn.pdbx_ptnr1_standard_comp_id   ? 
_struct_conn.ptnr1_symmetry                1_555 
_struct_conn.ptnr2_label_asym_id           B 
_struct_conn.ptnr2_label_comp_id           NH2 
_struct_conn.ptnr2_label_seq_id            14 
_struct_conn.ptnr2_label_atom_id           N 
_struct_conn.pdbx_ptnr2_label_alt_id       ? 
_struct_conn.pdbx_ptnr2_PDB_ins_code       ? 
_struct_conn.ptnr1_auth_asym_id            B 
_struct_conn.ptnr1_auth_comp_id            LEU 
_struct_conn.ptnr1_auth_seq_id             937 
_struct_conn.ptnr2_auth_asym_id            B 
_struct_conn.ptnr2_auth_comp_id            NH2 
_struct_conn.ptnr2_auth_seq_id             938 
_struct_conn.ptnr2_symmetry                1_555 
_struct_conn.pdbx_ptnr3_label_atom_id      ? 
_struct_conn.pdbx_ptnr3_label_seq_id       ? 
_struct_conn.pdbx_ptnr3_label_comp_id      ? 
_struct_conn.pdbx_ptnr3_label_asym_id      ? 
_struct_conn.pdbx_ptnr3_label_alt_id       ? 
_struct_conn.pdbx_ptnr3_PDB_ins_code       ? 
_struct_conn.details                       ? 
_struct_conn.pdbx_dist_value               1.323 
_struct_conn.pdbx_value_order              ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   3 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 TRP A 12 ? ILE A 16 ? TRP A 483 ILE A 487 
A 2 PRO A 22 ? ASP A 26 ? PRO A 493 ASP A 497 
A 3 THR A 31 ? THR A 33 ? THR A 502 THR A 504 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ARG A 15 ? N ARG A 486 O PHE A 23 ? O PHE A 494 
A 2 3 N PHE A 24 ? N PHE A 495 O THR A 33 ? O THR A 504 
# 
_atom_sites.entry_id                    2MPT 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N    . PHE A 1 7  ? -11.257 11.261  0.122   1.00 15.00 ?  478 PHE A N    1  
ATOM   2     C CA   . PHE A 1 7  ? -11.758 9.887   -0.122  1.00 15.00 ?  478 PHE A CA   1  
ATOM   3     C C    . PHE A 1 7  ? -10.743 8.857   0.351   1.00 15.00 ?  478 PHE A C    1  
ATOM   4     O O    . PHE A 1 7  ? -11.106 7.821   0.912   1.00 15.00 ?  478 PHE A O    1  
ATOM   5     C CB   . PHE A 1 7  ? -12.054 9.667   -1.610  1.00 15.00 ?  478 PHE A CB   1  
ATOM   6     C CG   . PHE A 1 7  ? -13.115 10.579  -2.163  1.00 15.00 ?  478 PHE A CG   1  
ATOM   7     C CD1  . PHE A 1 7  ? -14.445 10.409  -1.814  1.00 15.00 ?  478 PHE A CD1  1  
ATOM   8     C CD2  . PHE A 1 7  ? -12.780 11.607  -3.030  1.00 15.00 ?  478 PHE A CD2  1  
ATOM   9     C CE1  . PHE A 1 7  ? -15.421 11.246  -2.319  1.00 15.00 ?  478 PHE A CE1  1  
ATOM   10    C CE2  . PHE A 1 7  ? -13.753 12.446  -3.538  1.00 15.00 ?  478 PHE A CE2  1  
ATOM   11    C CZ   . PHE A 1 7  ? -15.074 12.265  -3.183  1.00 15.00 ?  478 PHE A CZ   1  
ATOM   12    H H    . PHE A 1 7  ? -10.392 11.433  -0.432  1.00 15.00 ?  478 PHE A H    1  
ATOM   13    H HA   . PHE A 1 7  ? -12.670 9.756   0.441   1.00 15.00 ?  478 PHE A HA   1  
ATOM   14    H HB2  . PHE A 1 7  ? -11.150 9.834   -2.176  1.00 15.00 ?  478 PHE A HB2  1  
ATOM   15    H HB3  . PHE A 1 7  ? -12.380 8.647   -1.758  1.00 15.00 ?  478 PHE A HB3  1  
ATOM   16    H HD1  . PHE A 1 7  ? -14.717 9.612   -1.139  1.00 15.00 ?  478 PHE A HD1  1  
ATOM   17    H HD2  . PHE A 1 7  ? -11.747 11.750  -3.309  1.00 15.00 ?  478 PHE A HD2  1  
ATOM   18    H HE1  . PHE A 1 7  ? -16.454 11.102  -2.040  1.00 15.00 ?  478 PHE A HE1  1  
ATOM   19    H HE2  . PHE A 1 7  ? -13.480 13.245  -4.214  1.00 15.00 ?  478 PHE A HE2  1  
ATOM   20    H HZ   . PHE A 1 7  ? -15.835 12.921  -3.580  1.00 15.00 ?  478 PHE A HZ   1  
ATOM   21    N N    . LEU A 1 8  ? -9.474  9.123   0.085   1.00 15.00 ?  479 LEU A N    1  
ATOM   22    C CA   . LEU A 1 8  ? -8.404  8.248   0.526   1.00 15.00 ?  479 LEU A CA   1  
ATOM   23    C C    . LEU A 1 8  ? -7.592  8.953   1.607   1.00 15.00 ?  479 LEU A C    1  
ATOM   24    O O    . LEU A 1 8  ? -7.072  10.047  1.375   1.00 15.00 ?  479 LEU A O    1  
ATOM   25    C CB   . LEU A 1 8  ? -7.525  7.859   -0.668  1.00 15.00 ?  479 LEU A CB   1  
ATOM   26    C CG   . LEU A 1 8  ? -6.525  6.724   -0.422  1.00 15.00 ?  479 LEU A CG   1  
ATOM   27    C CD1  . LEU A 1 8  ? -7.238  5.470   0.067   1.00 15.00 ?  479 LEU A CD1  1  
ATOM   28    C CD2  . LEU A 1 8  ? -5.756  6.427   -1.699  1.00 15.00 ?  479 LEU A CD2  1  
ATOM   29    H H    . LEU A 1 8  ? -9.246  9.937   -0.418  1.00 15.00 ?  479 LEU A H    1  
ATOM   30    H HA   . LEU A 1 8  ? -8.850  7.358   0.945   1.00 15.00 ?  479 LEU A HA   1  
ATOM   31    H HB2  . LEU A 1 8  ? -8.173  7.564   -1.481  1.00 15.00 ?  479 LEU A HB2  1  
ATOM   32    H HB3  . LEU A 1 8  ? -6.970  8.733   -0.975  1.00 15.00 ?  479 LEU A HB3  1  
ATOM   33    H HG   . LEU A 1 8  ? -5.818  7.027   0.336   1.00 15.00 ?  479 LEU A HG   1  
ATOM   34    H HD11 . LEU A 1 8  ? -7.939  5.138   -0.685  1.00 15.00 ?  479 LEU A HD11 1  
ATOM   35    H HD12 . LEU A 1 8  ? -7.768  5.690   0.982   1.00 15.00 ?  479 LEU A HD12 1  
ATOM   36    H HD13 . LEU A 1 8  ? -6.511  4.690   0.252   1.00 15.00 ?  479 LEU A HD13 1  
ATOM   37    H HD21 . LEU A 1 8  ? -5.049  5.631   -1.517  1.00 15.00 ?  479 LEU A HD21 1  
ATOM   38    H HD22 . LEU A 1 8  ? -5.226  7.314   -2.015  1.00 15.00 ?  479 LEU A HD22 1  
ATOM   39    H HD23 . LEU A 1 8  ? -6.446  6.126   -2.473  1.00 15.00 ?  479 LEU A HD23 1  
ATOM   40    N N    . PRO A 1 9  ? -7.505  8.354   2.808   1.00 15.00 ?  480 PRO A N    1  
ATOM   41    C CA   . PRO A 1 9  ? -6.812  8.949   3.961   1.00 15.00 ?  480 PRO A CA   1  
ATOM   42    C C    . PRO A 1 9  ? -5.395  9.411   3.631   1.00 15.00 ?  480 PRO A C    1  
ATOM   43    O O    . PRO A 1 9  ? -4.673  8.745   2.886   1.00 15.00 ?  480 PRO A O    1  
ATOM   44    C CB   . PRO A 1 9  ? -6.782  7.793   4.961   1.00 15.00 ?  480 PRO A CB   1  
ATOM   45    C CG   . PRO A 1 9  ? -7.999  7.015   4.646   1.00 15.00 ?  480 PRO A CG   1  
ATOM   46    C CD   . PRO A 1 9  ? -8.077  7.036   3.150   1.00 15.00 ?  480 PRO A CD   1  
ATOM   47    H HA   . PRO A 1 9  ? -7.371  9.773   4.377   1.00 15.00 ?  480 PRO A HA   1  
ATOM   48    H HB2  . PRO A 1 9  ? -5.899  7.204   4.800   1.00 15.00 ?  480 PRO A HB2  1  
ATOM   49    H HB3  . PRO A 1 9  ? -6.795  8.170   5.969   1.00 15.00 ?  480 PRO A HB3  1  
ATOM   50    H HG2  . PRO A 1 9  ? -7.897  6.002   5.009   1.00 15.00 ?  480 PRO A HG2  1  
ATOM   51    H HG3  . PRO A 1 9  ? -8.868  7.489   5.077   1.00 15.00 ?  480 PRO A HG3  1  
ATOM   52    H HD2  . PRO A 1 9  ? -7.486  6.237   2.729   1.00 15.00 ?  480 PRO A HD2  1  
ATOM   53    H HD3  . PRO A 1 9  ? -9.094  6.965   2.828   1.00 15.00 ?  480 PRO A HD3  1  
ATOM   54    N N    . PRO A 1 10 ? -4.984  10.559  4.192   1.00 15.00 ?  481 PRO A N    1  
ATOM   55    C CA   . PRO A 1 10 ? -3.647  11.117  3.989   1.00 15.00 ?  481 PRO A CA   1  
ATOM   56    C C    . PRO A 1 10 ? -2.551  10.108  4.308   1.00 15.00 ?  481 PRO A C    1  
ATOM   57    O O    . PRO A 1 10 ? -2.447  9.609   5.430   1.00 15.00 ?  481 PRO A O    1  
ATOM   58    C CB   . PRO A 1 10 ? -3.582  12.304  4.960   1.00 15.00 ?  481 PRO A CB   1  
ATOM   59    C CG   . PRO A 1 10 ? -4.757  12.145  5.866   1.00 15.00 ?  481 PRO A CG   1  
ATOM   60    C CD   . PRO A 1 10 ? -5.794  11.409  5.071   1.00 15.00 ?  481 PRO A CD   1  
ATOM   61    H HA   . PRO A 1 10 ? -3.520  11.472  2.976   1.00 15.00 ?  481 PRO A HA   1  
ATOM   62    H HB2  . PRO A 1 10 ? -2.652  12.268  5.509   1.00 15.00 ?  481 PRO A HB2  1  
ATOM   63    H HB3  . PRO A 1 10 ? -3.638  13.228  4.404   1.00 15.00 ?  481 PRO A HB3  1  
ATOM   64    H HG2  . PRO A 1 10 ? -4.474  11.570  6.736   1.00 15.00 ?  481 PRO A HG2  1  
ATOM   65    H HG3  . PRO A 1 10 ? -5.128  13.115  6.161   1.00 15.00 ?  481 PRO A HG3  1  
ATOM   66    H HD2  . PRO A 1 10 ? -6.417  10.812  5.722   1.00 15.00 ?  481 PRO A HD2  1  
ATOM   67    H HD3  . PRO A 1 10 ? -6.393  12.099  4.497   1.00 15.00 ?  481 PRO A HD3  1  
ATOM   68    N N    . GLY A 1 11 ? -1.750  9.802   3.308   1.00 15.00 ?  482 GLY A N    1  
ATOM   69    C CA   . GLY A 1 11 ? -0.694  8.835   3.471   1.00 15.00 ?  482 GLY A CA   1  
ATOM   70    C C    . GLY A 1 11 ? -1.056  7.480   2.921   1.00 15.00 ?  482 GLY A C    1  
ATOM   71    O O    . GLY A 1 11 ? -0.183  6.661   2.691   1.00 15.00 ?  482 GLY A O    1  
ATOM   72    H H    . GLY A 1 11 ? -1.872  10.251  2.438   1.00 15.00 ?  482 GLY A H    1  
ATOM   73    H HA2  . GLY A 1 11 ? 0.180   9.191   2.956   1.00 15.00 ?  482 GLY A HA2  1  
ATOM   74    H HA3  . GLY A 1 11 ? -0.461  8.732   4.515   1.00 15.00 ?  482 GLY A HA3  1  
ATOM   75    N N    . TRP A 1 12 ? -2.330  7.233   2.698   1.00 15.00 ?  483 TRP A N    1  
ATOM   76    C CA   . TRP A 1 12 ? -2.750  5.948   2.169   1.00 15.00 ?  483 TRP A CA   1  
ATOM   77    C C    . TRP A 1 12 ? -2.763  5.994   0.660   1.00 15.00 ?  483 TRP A C    1  
ATOM   78    O O    . TRP A 1 12 ? -3.314  6.912   0.060   1.00 15.00 ?  483 TRP A O    1  
ATOM   79    C CB   . TRP A 1 12 ? -4.119  5.554   2.716   1.00 15.00 ?  483 TRP A CB   1  
ATOM   80    C CG   . TRP A 1 12 ? -4.060  5.162   4.157   1.00 15.00 ?  483 TRP A CG   1  
ATOM   81    C CD1  . TRP A 1 12 ? -4.063  6.003   5.231   1.00 15.00 ?  483 TRP A CD1  1  
ATOM   82    C CD2  . TRP A 1 12 ? -3.966  3.831   4.684   1.00 15.00 ?  483 TRP A CD2  1  
ATOM   83    N NE1  . TRP A 1 12 ? -3.980  5.281   6.396   1.00 15.00 ?  483 TRP A NE1  1  
ATOM   84    C CE2  . TRP A 1 12 ? -3.921  3.943   6.087   1.00 15.00 ?  483 TRP A CE2  1  
ATOM   85    C CE3  . TRP A 1 12 ? -3.918  2.554   4.107   1.00 15.00 ?  483 TRP A CE3  1  
ATOM   86    C CZ2  . TRP A 1 12 ? -3.831  2.829   6.919   1.00 15.00 ?  483 TRP A CZ2  1  
ATOM   87    C CZ3  . TRP A 1 12 ? -3.827  1.455   4.934   1.00 15.00 ?  483 TRP A CZ3  1  
ATOM   88    C CH2  . TRP A 1 12 ? -3.785  1.597   6.327   1.00 15.00 ?  483 TRP A CH2  1  
ATOM   89    H H    . TRP A 1 12 ? -3.002  7.930   2.875   1.00 15.00 ?  483 TRP A H    1  
ATOM   90    H HA   . TRP A 1 12 ? -2.025  5.212   2.483   1.00 15.00 ?  483 TRP A HA   1  
ATOM   91    H HB2  . TRP A 1 12 ? -4.794  6.393   2.620   1.00 15.00 ?  483 TRP A HB2  1  
ATOM   92    H HB3  . TRP A 1 12 ? -4.501  4.718   2.151   1.00 15.00 ?  483 TRP A HB3  1  
ATOM   93    H HD1  . TRP A 1 12 ? -4.125  7.081   5.158   1.00 15.00 ?  483 TRP A HD1  1  
ATOM   94    H HE1  . TRP A 1 12 ? -3.964  5.662   7.307   1.00 15.00 ?  483 TRP A HE1  1  
ATOM   95    H HE3  . TRP A 1 12 ? -3.951  2.416   3.035   1.00 15.00 ?  483 TRP A HE3  1  
ATOM   96    H HZ2  . TRP A 1 12 ? -3.803  2.919   7.995   1.00 15.00 ?  483 TRP A HZ2  1  
ATOM   97    H HZ3  . TRP A 1 12 ? -3.789  0.466   4.505   1.00 15.00 ?  483 TRP A HZ3  1  
ATOM   98    H HH2  . TRP A 1 12 ? -3.713  0.707   6.934   1.00 15.00 ?  483 TRP A HH2  1  
ATOM   99    N N    . GLU A 1 13 ? -2.134  5.005   0.061   1.00 15.00 ?  484 GLU A N    1  
ATOM   100   C CA   . GLU A 1 13 ? -1.969  4.968   -1.372  1.00 15.00 ?  484 GLU A CA   1  
ATOM   101   C C    . GLU A 1 13 ? -2.326  3.600   -1.926  1.00 15.00 ?  484 GLU A C    1  
ATOM   102   O O    . GLU A 1 13 ? -1.917  2.573   -1.383  1.00 15.00 ?  484 GLU A O    1  
ATOM   103   C CB   . GLU A 1 13 ? -0.526  5.303   -1.717  1.00 15.00 ?  484 GLU A CB   1  
ATOM   104   C CG   . GLU A 1 13 ? -0.379  6.573   -2.523  1.00 15.00 ?  484 GLU A CG   1  
ATOM   105   C CD   . GLU A 1 13 ? -1.184  6.546   -3.806  1.00 15.00 ?  484 GLU A CD   1  
ATOM   106   O OE1  . GLU A 1 13 ? -0.738  5.904   -4.777  1.00 15.00 -1 484 GLU A OE1  1  
ATOM   107   O OE2  . GLU A 1 13 ? -2.271  7.156   -3.845  1.00 15.00 ?  484 GLU A OE2  1  
ATOM   108   H H    . GLU A 1 13 ? -1.764  4.276   0.602   1.00 15.00 ?  484 GLU A H    1  
ATOM   109   H HA   . GLU A 1 13 ? -2.618  5.710   -1.809  1.00 15.00 ?  484 GLU A HA   1  
ATOM   110   H HB2  . GLU A 1 13 ? 0.031   5.420   -0.799  1.00 15.00 ?  484 GLU A HB2  1  
ATOM   111   H HB3  . GLU A 1 13 ? -0.107  4.493   -2.279  1.00 15.00 ?  484 GLU A HB3  1  
ATOM   112   H HG2  . GLU A 1 13 ? -0.711  7.400   -1.920  1.00 15.00 ?  484 GLU A HG2  1  
ATOM   113   H HG3  . GLU A 1 13 ? 0.664   6.707   -2.772  1.00 15.00 ?  484 GLU A HG3  1  
ATOM   114   N N    . MET A 1 14 ? -3.068  3.600   -3.017  1.00 15.00 ?  485 MET A N    1  
ATOM   115   C CA   . MET A 1 14 ? -3.454  2.370   -3.688  1.00 15.00 ?  485 MET A CA   1  
ATOM   116   C C    . MET A 1 14 ? -2.550  2.134   -4.882  1.00 15.00 ?  485 MET A C    1  
ATOM   117   O O    . MET A 1 14 ? -2.661  2.802   -5.910  1.00 15.00 ?  485 MET A O    1  
ATOM   118   C CB   . MET A 1 14 ? -4.918  2.421   -4.128  1.00 15.00 ?  485 MET A CB   1  
ATOM   119   C CG   . MET A 1 14 ? -5.872  2.474   -2.968  1.00 15.00 ?  485 MET A CG   1  
ATOM   120   S SD   . MET A 1 14 ? -7.604  2.551   -3.470  1.00 15.00 ?  485 MET A SD   1  
ATOM   121   C CE   . MET A 1 14 ? -7.645  4.133   -4.310  1.00 15.00 ?  485 MET A CE   1  
ATOM   122   H H    . MET A 1 14 ? -3.345  4.461   -3.403  1.00 15.00 ?  485 MET A H    1  
ATOM   123   H HA   . MET A 1 14 ? -3.323  1.552   -2.984  1.00 15.00 ?  485 MET A HA   1  
ATOM   124   H HB2  . MET A 1 14 ? -5.079  3.294   -4.729  1.00 15.00 ?  485 MET A HB2  1  
ATOM   125   H HB3  . MET A 1 14 ? -5.142  1.541   -4.712  1.00 15.00 ?  485 MET A HB3  1  
ATOM   126   H HG2  . MET A 1 14 ? -5.715  1.588   -2.380  1.00 15.00 ?  485 MET A HG2  1  
ATOM   127   H HG3  . MET A 1 14 ? -5.644  3.345   -2.371  1.00 15.00 ?  485 MET A HG3  1  
ATOM   128   H HE1  . MET A 1 14 ? -7.356  4.913   -3.622  1.00 15.00 ?  485 MET A HE1  1  
ATOM   129   H HE2  . MET A 1 14 ? -8.646  4.325   -4.671  1.00 15.00 ?  485 MET A HE2  1  
ATOM   130   H HE3  . MET A 1 14 ? -6.959  4.116   -5.144  1.00 15.00 ?  485 MET A HE3  1  
ATOM   131   N N    . ARG A 1 15 ? -1.643  1.197   -4.727  1.00 15.00 ?  486 ARG A N    1  
ATOM   132   C CA   . ARG A 1 15 ? -0.600  0.973   -5.714  1.00 15.00 ?  486 ARG A CA   1  
ATOM   133   C C    . ARG A 1 15 ? -0.474  -0.501  -6.028  1.00 15.00 ?  486 ARG A C    1  
ATOM   134   O O    . ARG A 1 15 ? -0.729  -1.346  -5.175  1.00 15.00 ?  486 ARG A O    1  
ATOM   135   C CB   . ARG A 1 15 ? 0.726   1.520   -5.192  1.00 15.00 ?  486 ARG A CB   1  
ATOM   136   C CG   . ARG A 1 15 ? 0.747   3.033   -5.095  1.00 15.00 ?  486 ARG A CG   1  
ATOM   137   C CD   . ARG A 1 15 ? 0.810   3.673   -6.472  1.00 15.00 ?  486 ARG A CD   1  
ATOM   138   N NE   . ARG A 1 15 ? 2.075   3.375   -7.141  1.00 15.00 ?  486 ARG A NE   1  
ATOM   139   C CZ   . ARG A 1 15 ? 2.290   3.531   -8.445  1.00 15.00 ?  486 ARG A CZ   1  
ATOM   140   N NH1  . ARG A 1 15 ? 1.344   4.022   -9.234  1.00 15.00 1  486 ARG A NH1  1  
ATOM   141   N NH2  . ARG A 1 15 ? 3.467   3.223   -8.960  1.00 15.00 ?  486 ARG A NH2  1  
ATOM   142   H H    . ARG A 1 15 ? -1.682  0.624   -3.925  1.00 15.00 ?  486 ARG A H    1  
ATOM   143   H HA   . ARG A 1 15 ? -0.871  1.504   -6.614  1.00 15.00 ?  486 ARG A HA   1  
ATOM   144   H HB2  . ARG A 1 15 ? 0.910   1.113   -4.207  1.00 15.00 ?  486 ARG A HB2  1  
ATOM   145   H HB3  . ARG A 1 15 ? 1.520   1.209   -5.855  1.00 15.00 ?  486 ARG A HB3  1  
ATOM   146   H HG2  . ARG A 1 15 ? -0.149  3.366   -4.594  1.00 15.00 ?  486 ARG A HG2  1  
ATOM   147   H HG3  . ARG A 1 15 ? 1.615   3.336   -4.527  1.00 15.00 ?  486 ARG A HG3  1  
ATOM   148   H HD2  . ARG A 1 15 ? -0.005  3.294   -7.071  1.00 15.00 ?  486 ARG A HD2  1  
ATOM   149   H HD3  . ARG A 1 15 ? 0.712   4.744   -6.365  1.00 15.00 ?  486 ARG A HD3  1  
ATOM   150   H HE   . ARG A 1 15 ? 2.806   3.037   -6.581  1.00 15.00 ?  486 ARG A HE   1  
ATOM   151   H HH11 . ARG A 1 15 ? 0.447   4.289   -8.854  1.00 15.00 ?  486 ARG A HH11 1  
ATOM   152   H HH12 . ARG A 1 15 ? 1.519   4.134   -10.215 1.00 15.00 ?  486 ARG A HH12 1  
ATOM   153   H HH21 . ARG A 1 15 ? 4.209   2.876   -8.377  1.00 15.00 ?  486 ARG A HH21 1  
ATOM   154   H HH22 . ARG A 1 15 ? 3.624   3.330   -9.946  1.00 15.00 ?  486 ARG A HH22 1  
ATOM   155   N N    . ILE A 1 16 ? -0.067  -0.812  -7.247  1.00 15.00 ?  487 ILE A N    1  
ATOM   156   C CA   . ILE A 1 16 ? 0.037   -2.196  -7.665  1.00 15.00 ?  487 ILE A CA   1  
ATOM   157   C C    . ILE A 1 16 ? 1.488   -2.589  -7.888  1.00 15.00 ?  487 ILE A C    1  
ATOM   158   O O    . ILE A 1 16 ? 2.323   -1.760  -8.261  1.00 15.00 ?  487 ILE A O    1  
ATOM   159   C CB   . ILE A 1 16 ? -0.794  -2.483  -8.945  1.00 15.00 ?  487 ILE A CB   1  
ATOM   160   C CG1  . ILE A 1 16 ? -0.334  -1.623  -10.130 1.00 15.00 ?  487 ILE A CG1  1  
ATOM   161   C CG2  . ILE A 1 16 ? -2.273  -2.261  -8.679  1.00 15.00 ?  487 ILE A CG2  1  
ATOM   162   C CD1  . ILE A 1 16 ? 0.724   -2.281  -10.993 1.00 15.00 ?  487 ILE A CD1  1  
ATOM   163   H H    . ILE A 1 16 ? 0.191   -0.098  -7.870  1.00 15.00 ?  487 ILE A H    1  
ATOM   164   H HA   . ILE A 1 16 ? -0.362  -2.807  -6.867  1.00 15.00 ?  487 ILE A HA   1  
ATOM   165   H HB   . ILE A 1 16 ? -0.660  -3.525  -9.199  1.00 15.00 ?  487 ILE A HB   1  
ATOM   166   H HG12 . ILE A 1 16 ? -1.185  -1.407  -10.759 1.00 15.00 ?  487 ILE A HG12 1  
ATOM   167   H HG13 . ILE A 1 16 ? 0.072   -0.696  -9.753  1.00 15.00 ?  487 ILE A HG13 1  
ATOM   168   H HG21 . ILE A 1 16 ? -2.599  -2.922  -7.892  1.00 15.00 ?  487 ILE A HG21 1  
ATOM   169   H HG22 . ILE A 1 16 ? -2.835  -2.465  -9.579  1.00 15.00 ?  487 ILE A HG22 1  
ATOM   170   H HG23 . ILE A 1 16 ? -2.434  -1.236  -8.379  1.00 15.00 ?  487 ILE A HG23 1  
ATOM   171   H HD11 . ILE A 1 16 ? 0.340   -3.212  -11.387 1.00 15.00 ?  487 ILE A HD11 1  
ATOM   172   H HD12 . ILE A 1 16 ? 1.602   -2.478  -10.397 1.00 15.00 ?  487 ILE A HD12 1  
ATOM   173   H HD13 . ILE A 1 16 ? 0.983   -1.624  -11.810 1.00 15.00 ?  487 ILE A HD13 1  
ATOM   174   N N    . ALA A 1 17 ? 1.785   -3.843  -7.619  1.00 15.00 ?  488 ALA A N    1  
ATOM   175   C CA   . ALA A 1 17 ? 3.079   -4.410  -7.937  1.00 15.00 ?  488 ALA A CA   1  
ATOM   176   C C    . ALA A 1 17 ? 3.034   -4.999  -9.341  1.00 15.00 ?  488 ALA A C    1  
ATOM   177   O O    . ALA A 1 17 ? 1.971   -5.430  -9.789  1.00 15.00 ?  488 ALA A O    1  
ATOM   178   C CB   . ALA A 1 17 ? 3.463   -5.465  -6.913  1.00 15.00 ?  488 ALA A CB   1  
ATOM   179   H H    . ALA A 1 17 ? 1.107   -4.409  -7.184  1.00 15.00 ?  488 ALA A H    1  
ATOM   180   H HA   . ALA A 1 17 ? 3.813   -3.618  -7.909  1.00 15.00 ?  488 ALA A HA   1  
ATOM   181   H HB1  . ALA A 1 17 ? 2.735   -6.263  -6.927  1.00 15.00 ?  488 ALA A HB1  1  
ATOM   182   H HB2  . ALA A 1 17 ? 3.490   -5.019  -5.929  1.00 15.00 ?  488 ALA A HB2  1  
ATOM   183   H HB3  . ALA A 1 17 ? 4.437   -5.863  -7.155  1.00 15.00 ?  488 ALA A HB3  1  
ATOM   184   N N    . PRO A 1 18 ? 4.172   -5.016  -10.061 1.00 15.00 ?  489 PRO A N    1  
ATOM   185   C CA   . PRO A 1 18 ? 4.240   -5.498  -11.455 1.00 15.00 ?  489 PRO A CA   1  
ATOM   186   C C    . PRO A 1 18 ? 3.781   -6.951  -11.632 1.00 15.00 ?  489 PRO A C    1  
ATOM   187   O O    . PRO A 1 18 ? 3.737   -7.466  -12.749 1.00 15.00 ?  489 PRO A O    1  
ATOM   188   C CB   . PRO A 1 18 ? 5.725   -5.364  -11.813 1.00 15.00 ?  489 PRO A CB   1  
ATOM   189   C CG   . PRO A 1 18 ? 6.265   -4.362  -10.853 1.00 15.00 ?  489 PRO A CG   1  
ATOM   190   C CD   . PRO A 1 18 ? 5.485   -4.544  -9.584  1.00 15.00 ?  489 PRO A CD   1  
ATOM   191   H HA   . PRO A 1 18 ? 3.660   -4.865  -12.109 1.00 15.00 ?  489 PRO A HA   1  
ATOM   192   H HB2  . PRO A 1 18 ? 6.214   -6.321  -11.701 1.00 15.00 ?  489 PRO A HB2  1  
ATOM   193   H HB3  . PRO A 1 18 ? 5.821   -5.022  -12.833 1.00 15.00 ?  489 PRO A HB3  1  
ATOM   194   H HG2  . PRO A 1 18 ? 7.315   -4.548  -10.679 1.00 15.00 ?  489 PRO A HG2  1  
ATOM   195   H HG3  . PRO A 1 18 ? 6.120   -3.366  -11.243 1.00 15.00 ?  489 PRO A HG3  1  
ATOM   196   H HD2  . PRO A 1 18 ? 5.955   -5.284  -8.953  1.00 15.00 ?  489 PRO A HD2  1  
ATOM   197   H HD3  . PRO A 1 18 ? 5.389   -3.604  -9.060  1.00 15.00 ?  489 PRO A HD3  1  
ATOM   198   N N    . ASN A 1 19 ? 3.447   -7.608  -10.531 1.00 15.00 ?  490 ASN A N    1  
ATOM   199   C CA   . ASN A 1 19 ? 2.938   -8.972  -10.577 1.00 15.00 ?  490 ASN A CA   1  
ATOM   200   C C    . ASN A 1 19 ? 1.406   -8.970  -10.584 1.00 15.00 ?  490 ASN A C    1  
ATOM   201   O O    . ASN A 1 19 ? 0.767   -10.013 -10.704 1.00 15.00 ?  490 ASN A O    1  
ATOM   202   C CB   . ASN A 1 19 ? 3.491   -9.780  -9.395  1.00 15.00 ?  490 ASN A CB   1  
ATOM   203   C CG   . ASN A 1 19 ? 3.054   -11.235 -9.409  1.00 15.00 ?  490 ASN A CG   1  
ATOM   204   O OD1  . ASN A 1 19 ? 2.132   -11.626 -8.692  1.00 15.00 ?  490 ASN A OD1  1  
ATOM   205   N ND2  . ASN A 1 19 ? 3.699   -12.040 -10.238 1.00 15.00 ?  490 ASN A ND2  1  
ATOM   206   H H    . ASN A 1 19 ? 3.545   -7.162  -9.665  1.00 15.00 ?  490 ASN A H    1  
ATOM   207   H HA   . ASN A 1 19 ? 3.285   -9.419  -11.497 1.00 15.00 ?  490 ASN A HA   1  
ATOM   208   H HB2  . ASN A 1 19 ? 4.570   -9.750  -9.421  1.00 15.00 ?  490 ASN A HB2  1  
ATOM   209   H HB3  . ASN A 1 19 ? 3.148   -9.331  -8.474  1.00 15.00 ?  490 ASN A HB3  1  
ATOM   210   H HD21 . ASN A 1 19 ? 4.416   -11.659 -10.794 1.00 15.00 ?  490 ASN A HD21 1  
ATOM   211   H HD22 . ASN A 1 19 ? 3.424   -12.986 -10.275 1.00 15.00 ?  490 ASN A HD22 1  
ATOM   212   N N    . GLY A 1 20 ? 0.820   -7.784  -10.473 1.00 15.00 ?  491 GLY A N    1  
ATOM   213   C CA   . GLY A 1 20 ? -0.625  -7.658  -10.539 1.00 15.00 ?  491 GLY A CA   1  
ATOM   214   C C    . GLY A 1 20 ? -1.278  -7.632  -9.171  1.00 15.00 ?  491 GLY A C    1  
ATOM   215   O O    . GLY A 1 20 ? -2.498  -7.747  -9.056  1.00 15.00 ?  491 GLY A O    1  
ATOM   216   H H    . GLY A 1 20 ? 1.374   -6.981  -10.354 1.00 15.00 ?  491 GLY A H    1  
ATOM   217   H HA2  . GLY A 1 20 ? -0.872  -6.744  -11.060 1.00 15.00 ?  491 GLY A HA2  1  
ATOM   218   H HA3  . GLY A 1 20 ? -1.020  -8.491  -11.098 1.00 15.00 ?  491 GLY A HA3  1  
ATOM   219   N N    . ARG A 1 21 ? -0.468  -7.474  -8.134  1.00 15.00 ?  492 ARG A N    1  
ATOM   220   C CA   . ARG A 1 21 ? -0.977  -7.432  -6.768  1.00 15.00 ?  492 ARG A CA   1  
ATOM   221   C C    . ARG A 1 21 ? -1.116  -5.993  -6.271  1.00 15.00 ?  492 ARG A C    1  
ATOM   222   O O    . ARG A 1 21 ? -0.140  -5.244  -6.236  1.00 15.00 ?  492 ARG A O    1  
ATOM   223   C CB   . ARG A 1 21 ? -0.079  -8.234  -5.817  1.00 15.00 ?  492 ARG A CB   1  
ATOM   224   C CG   . ARG A 1 21 ? 1.411   -8.151  -6.124  1.00 15.00 ?  492 ARG A CG   1  
ATOM   225   C CD   . ARG A 1 21 ? 2.222   -9.051  -5.198  1.00 15.00 ?  492 ARG A CD   1  
ATOM   226   N NE   . ARG A 1 21 ? 3.644   -9.083  -5.553  1.00 15.00 ?  492 ARG A NE   1  
ATOM   227   C CZ   . ARG A 1 21 ? 4.583   -9.714  -4.839  1.00 15.00 ?  492 ARG A CZ   1  
ATOM   228   N NH1  . ARG A 1 21 ? 4.271   -10.319 -3.701  1.00 15.00 1  492 ARG A NH1  1  
ATOM   229   N NH2  . ARG A 1 21 ? 5.841   -9.726  -5.262  1.00 15.00 ?  492 ARG A NH2  1  
ATOM   230   H H    . ARG A 1 21 ? 0.491   -7.377  -8.291  1.00 15.00 ?  492 ARG A H    1  
ATOM   231   H HA   . ARG A 1 21 ? -1.958  -7.884  -6.778  1.00 15.00 ?  492 ARG A HA   1  
ATOM   232   H HB2  . ARG A 1 21 ? -0.234  -7.856  -4.824  1.00 15.00 ?  492 ARG A HB2  1  
ATOM   233   H HB3  . ARG A 1 21 ? -0.372  -9.269  -5.837  1.00 15.00 ?  492 ARG A HB3  1  
ATOM   234   H HG2  . ARG A 1 21 ? 1.576   -8.462  -7.146  1.00 15.00 ?  492 ARG A HG2  1  
ATOM   235   H HG3  . ARG A 1 21 ? 1.737   -7.130  -5.998  1.00 15.00 ?  492 ARG A HG3  1  
ATOM   236   H HD2  . ARG A 1 21 ? 2.123   -8.685  -4.187  1.00 15.00 ?  492 ARG A HD2  1  
ATOM   237   H HD3  . ARG A 1 21 ? 1.824   -10.054 -5.256  1.00 15.00 ?  492 ARG A HD3  1  
ATOM   238   H HE   . ARG A 1 21 ? 3.914   -8.619  -6.378  1.00 15.00 ?  492 ARG A HE   1  
ATOM   239   H HH11 . ARG A 1 21 ? 3.329   -10.310 -3.362  1.00 15.00 ?  492 ARG A HH11 1  
ATOM   240   H HH12 . ARG A 1 21 ? 4.989   -10.793 -3.162  1.00 15.00 ?  492 ARG A HH12 1  
ATOM   241   H HH21 . ARG A 1 21 ? 6.090   -9.259  -6.118  1.00 15.00 ?  492 ARG A HH21 1  
ATOM   242   H HH22 . ARG A 1 21 ? 6.547   -10.204 -4.732  1.00 15.00 ?  492 ARG A HH22 1  
ATOM   243   N N    . PRO A 1 22 ? -2.340  -5.596  -5.887  1.00 15.00 ?  493 PRO A N    1  
ATOM   244   C CA   . PRO A 1 22 ? -2.622  -4.265  -5.355  1.00 15.00 ?  493 PRO A CA   1  
ATOM   245   C C    . PRO A 1 22 ? -2.478  -4.198  -3.833  1.00 15.00 ?  493 PRO A C    1  
ATOM   246   O O    . PRO A 1 22 ? -2.906  -5.103  -3.117  1.00 15.00 ?  493 PRO A O    1  
ATOM   247   C CB   . PRO A 1 22 ? -4.079  -4.054  -5.761  1.00 15.00 ?  493 PRO A CB   1  
ATOM   248   C CG   . PRO A 1 22 ? -4.687  -5.423  -5.765  1.00 15.00 ?  493 PRO A CG   1  
ATOM   249   C CD   . PRO A 1 22 ? -3.562  -6.416  -5.965  1.00 15.00 ?  493 PRO A CD   1  
ATOM   250   H HA   . PRO A 1 22 ? -2.002  -3.510  -5.812  1.00 15.00 ?  493 PRO A HA   1  
ATOM   251   H HB2  . PRO A 1 22 ? -4.563  -3.408  -5.043  1.00 15.00 ?  493 PRO A HB2  1  
ATOM   252   H HB3  . PRO A 1 22 ? -4.121  -3.604  -6.741  1.00 15.00 ?  493 PRO A HB3  1  
ATOM   253   H HG2  . PRO A 1 22 ? -5.177  -5.606  -4.820  1.00 15.00 ?  493 PRO A HG2  1  
ATOM   254   H HG3  . PRO A 1 22 ? -5.399  -5.501  -6.574  1.00 15.00 ?  493 PRO A HG3  1  
ATOM   255   H HD2  . PRO A 1 22 ? -3.574  -7.159  -5.182  1.00 15.00 ?  493 PRO A HD2  1  
ATOM   256   H HD3  . PRO A 1 22 ? -3.646  -6.888  -6.933  1.00 15.00 ?  493 PRO A HD3  1  
ATOM   257   N N    . PHE A 1 23 ? -1.891  -3.113  -3.346  1.00 15.00 ?  494 PHE A N    1  
ATOM   258   C CA   . PHE A 1 23 ? -1.685  -2.934  -1.918  1.00 15.00 ?  494 PHE A CA   1  
ATOM   259   C C    . PHE A 1 23 ? -1.900  -1.479  -1.497  1.00 15.00 ?  494 PHE A C    1  
ATOM   260   O O    . PHE A 1 23 ? -1.680  -0.550  -2.281  1.00 15.00 ?  494 PHE A O    1  
ATOM   261   C CB   . PHE A 1 23 ? -0.279  -3.408  -1.512  1.00 15.00 ?  494 PHE A CB   1  
ATOM   262   C CG   . PHE A 1 23 ? 0.864   -2.793  -2.293  1.00 15.00 ?  494 PHE A CG   1  
ATOM   263   C CD1  . PHE A 1 23 ? 1.112   -1.425  -2.264  1.00 15.00 ?  494 PHE A CD1  1  
ATOM   264   C CD2  . PHE A 1 23 ? 1.706   -3.599  -3.041  1.00 15.00 ?  494 PHE A CD2  1  
ATOM   265   C CE1  . PHE A 1 23 ? 2.172   -0.875  -2.968  1.00 15.00 ?  494 PHE A CE1  1  
ATOM   266   C CE2  . PHE A 1 23 ? 2.763   -3.058  -3.746  1.00 15.00 ?  494 PHE A CE2  1  
ATOM   267   C CZ   . PHE A 1 23 ? 2.998   -1.697  -3.710  1.00 15.00 ?  494 PHE A CZ   1  
ATOM   268   H H    . PHE A 1 23 ? -1.585  -2.411  -3.965  1.00 15.00 ?  494 PHE A H    1  
ATOM   269   H HA   . PHE A 1 23 ? -2.413  -3.545  -1.408  1.00 15.00 ?  494 PHE A HA   1  
ATOM   270   H HB2  . PHE A 1 23 ? -0.124  -3.182  -0.470  1.00 15.00 ?  494 PHE A HB2  1  
ATOM   271   H HB3  . PHE A 1 23 ? -0.225  -4.479  -1.643  1.00 15.00 ?  494 PHE A HB3  1  
ATOM   272   H HD1  . PHE A 1 23 ? 0.461   -0.786  -1.687  1.00 15.00 ?  494 PHE A HD1  1  
ATOM   273   H HD2  . PHE A 1 23 ? 1.528   -4.665  -3.073  1.00 15.00 ?  494 PHE A HD2  1  
ATOM   274   H HE1  . PHE A 1 23 ? 2.356   0.200   -2.934  1.00 15.00 ?  494 PHE A HE1  1  
ATOM   275   H HE2  . PHE A 1 23 ? 3.410   -3.701  -4.322  1.00 15.00 ?  494 PHE A HE2  1  
ATOM   276   H HZ   . PHE A 1 23 ? 3.826   -1.276  -4.262  1.00 15.00 ?  494 PHE A HZ   1  
ATOM   277   N N    . PHE A 1 24 ? -2.343  -1.294  -0.260  1.00 15.00 ?  495 PHE A N    1  
ATOM   278   C CA   . PHE A 1 24 ? -2.447  0.030   0.335   1.00 15.00 ?  495 PHE A CA   1  
ATOM   279   C C    . PHE A 1 24 ? -1.196  0.320   1.153   1.00 15.00 ?  495 PHE A C    1  
ATOM   280   O O    . PHE A 1 24 ? -0.911  -0.372  2.127   1.00 15.00 ?  495 PHE A O    1  
ATOM   281   C CB   . PHE A 1 24 ? -3.676  0.148   1.249   1.00 15.00 ?  495 PHE A CB   1  
ATOM   282   C CG   . PHE A 1 24 ? -4.963  -0.280  0.608   1.00 15.00 ?  495 PHE A CG   1  
ATOM   283   C CD1  . PHE A 1 24 ? -5.576  0.531   -0.322  1.00 15.00 ?  495 PHE A CD1  1  
ATOM   284   C CD2  . PHE A 1 24 ? -5.555  -1.489  0.936   1.00 15.00 ?  495 PHE A CD2  1  
ATOM   285   C CE1  . PHE A 1 24 ? -6.760  0.151   -0.925  1.00 15.00 ?  495 PHE A CE1  1  
ATOM   286   C CE2  . PHE A 1 24 ? -6.740  -1.877  0.339   1.00 15.00 ?  495 PHE A CE2  1  
ATOM   287   C CZ   . PHE A 1 24 ? -7.344  -1.055  -0.593  1.00 15.00 ?  495 PHE A CZ   1  
ATOM   288   H H    . PHE A 1 24 ? -2.600  -2.073  0.272   1.00 15.00 ?  495 PHE A H    1  
ATOM   289   H HA   . PHE A 1 24 ? -2.522  0.753   -0.464  1.00 15.00 ?  495 PHE A HA   1  
ATOM   290   H HB2  . PHE A 1 24 ? -3.526  -0.454  2.130   1.00 15.00 ?  495 PHE A HB2  1  
ATOM   291   H HB3  . PHE A 1 24 ? -3.787  1.180   1.548   1.00 15.00 ?  495 PHE A HB3  1  
ATOM   292   H HD1  . PHE A 1 24 ? -5.118  1.476   -0.577  1.00 15.00 ?  495 PHE A HD1  1  
ATOM   293   H HD2  . PHE A 1 24 ? -5.085  -2.129  1.667   1.00 15.00 ?  495 PHE A HD2  1  
ATOM   294   H HE1  . PHE A 1 24 ? -7.226  0.800   -1.659  1.00 15.00 ?  495 PHE A HE1  1  
ATOM   295   H HE2  . PHE A 1 24 ? -7.193  -2.822  0.603   1.00 15.00 ?  495 PHE A HE2  1  
ATOM   296   H HZ   . PHE A 1 24 ? -8.269  -1.355  -1.061  1.00 15.00 ?  495 PHE A HZ   1  
ATOM   297   N N    . ILE A 1 25 ? -0.446  1.328   0.755   1.00 15.00 ?  496 ILE A N    1  
ATOM   298   C CA   . ILE A 1 25 ? 0.722   1.735   1.514   1.00 15.00 ?  496 ILE A CA   1  
ATOM   299   C C    . ILE A 1 25 ? 0.394   2.956   2.336   1.00 15.00 ?  496 ILE A C    1  
ATOM   300   O O    . ILE A 1 25 ? -0.020  3.980   1.793   1.00 15.00 ?  496 ILE A O    1  
ATOM   301   C CB   . ILE A 1 25 ? 1.948   2.045   0.622   1.00 15.00 ?  496 ILE A CB   1  
ATOM   302   C CG1  . ILE A 1 25 ? 2.524   0.749   0.051   1.00 15.00 ?  496 ILE A CG1  1  
ATOM   303   C CG2  . ILE A 1 25 ? 3.017   2.797   1.412   1.00 15.00 ?  496 ILE A CG2  1  
ATOM   304   C CD1  . ILE A 1 25 ? 3.834   0.930   -0.688  1.00 15.00 ?  496 ILE A CD1  1  
ATOM   305   H H    . ILE A 1 25 ? -0.699  1.827   -0.049  1.00 15.00 ?  496 ILE A H    1  
ATOM   306   H HA   . ILE A 1 25 ? 0.982   0.927   2.181   1.00 15.00 ?  496 ILE A HA   1  
ATOM   307   H HB   . ILE A 1 25 ? 1.623   2.681   -0.192  1.00 15.00 ?  496 ILE A HB   1  
ATOM   308   H HG12 . ILE A 1 25 ? 2.694   0.053   0.857   1.00 15.00 ?  496 ILE A HG12 1  
ATOM   309   H HG13 . ILE A 1 25 ? 1.813   0.325   -0.638  1.00 15.00 ?  496 ILE A HG13 1  
ATOM   310   H HG21 . ILE A 1 25 ? 2.607   3.729   1.774   1.00 15.00 ?  496 ILE A HG21 1  
ATOM   311   H HG22 . ILE A 1 25 ? 3.862   3.001   0.770   1.00 15.00 ?  496 ILE A HG22 1  
ATOM   312   H HG23 . ILE A 1 25 ? 3.337   2.196   2.249   1.00 15.00 ?  496 ILE A HG23 1  
ATOM   313   H HD11 . ILE A 1 25 ? 4.576   1.333   -0.014  1.00 15.00 ?  496 ILE A HD11 1  
ATOM   314   H HD12 . ILE A 1 25 ? 3.691   1.610   -1.515  1.00 15.00 ?  496 ILE A HD12 1  
ATOM   315   H HD13 . ILE A 1 25 ? 4.170   -0.026  -1.063  1.00 15.00 ?  496 ILE A HD13 1  
ATOM   316   N N    . ASP A 1 26 ? 0.565   2.844   3.636   1.00 15.00 ?  497 ASP A N    1  
ATOM   317   C CA   . ASP A 1 26 ? 0.410   3.986   4.505   1.00 15.00 ?  497 ASP A CA   1  
ATOM   318   C C    . ASP A 1 26 ? 1.742   4.687   4.651   1.00 15.00 ?  497 ASP A C    1  
ATOM   319   O O    . ASP A 1 26 ? 2.726   4.122   5.097   1.00 15.00 ?  497 ASP A O    1  
ATOM   320   C CB   . ASP A 1 26 ? -0.154  3.596   5.859   1.00 15.00 ?  497 ASP A CB   1  
ATOM   321   C CG   . ASP A 1 26 ? 0.550   2.406   6.491   1.00 15.00 ?  497 ASP A CG   1  
ATOM   322   O OD1  . ASP A 1 26 ? 1.689   2.564   6.979   1.00 15.00 ?  497 ASP A OD1  1  
ATOM   323   O OD2  . ASP A 1 26 ? -0.042  1.309   6.512   1.00 15.00 -1 497 ASP A OD2  1  
ATOM   324   H H    . ASP A 1 26 ? 0.813   1.972   4.021   1.00 15.00 ?  497 ASP A H    1  
ATOM   325   H HA   . ASP A 1 26 ? -0.278  4.667   4.024   1.00 15.00 ?  497 ASP A HA   1  
ATOM   326   H HB2  . ASP A 1 26 ? -0.057  4.447   6.517   1.00 15.00 ?  497 ASP A HB2  1  
ATOM   327   H HB3  . ASP A 1 26 ? -1.201  3.352   5.738   1.00 15.00 ?  497 ASP A HB3  1  
ATOM   328   N N    . HIS A 1 27 ? 1.768   5.911   4.202   1.00 15.00 ?  498 HIS A N    1  
ATOM   329   C CA   . HIS A 1 27 ? 3.003   6.659   4.076   1.00 15.00 ?  498 HIS A CA   1  
ATOM   330   C C    . HIS A 1 27 ? 3.478   7.269   5.387   1.00 15.00 ?  498 HIS A C    1  
ATOM   331   O O    . HIS A 1 27 ? 4.645   7.638   5.500   1.00 15.00 ?  498 HIS A O    1  
ATOM   332   C CB   . HIS A 1 27 ? 2.896   7.712   2.970   1.00 15.00 ?  498 HIS A CB   1  
ATOM   333   C CG   . HIS A 1 27 ? 2.979   7.102   1.601   1.00 15.00 ?  498 HIS A CG   1  
ATOM   334   N ND1  . HIS A 1 27 ? 4.176   6.898   0.950   1.00 15.00 ?  498 HIS A ND1  1  
ATOM   335   C CD2  . HIS A 1 27 ? 2.022   6.577   0.795   1.00 15.00 ?  498 HIS A CD2  1  
ATOM   336   C CE1  . HIS A 1 27 ? 3.957   6.265   -0.185  1.00 15.00 ?  498 HIS A CE1  1  
ATOM   337   N NE2  . HIS A 1 27 ? 2.657   6.061   -0.307  1.00 15.00 ?  498 HIS A NE2  1  
ATOM   338   H H    . HIS A 1 27 ? 0.916   6.332   3.962   1.00 15.00 ?  498 HIS A H    1  
ATOM   339   H HA   . HIS A 1 27 ? 3.755   5.946   3.772   1.00 15.00 ?  498 HIS A HA   1  
ATOM   340   H HB2  . HIS A 1 27 ? 1.950   8.226   3.054   1.00 15.00 ?  498 HIS A HB2  1  
ATOM   341   H HB3  . HIS A 1 27 ? 3.703   8.423   3.072   1.00 15.00 ?  498 HIS A HB3  1  
ATOM   342   H HD1  . HIS A 1 27 ? 5.063   7.221   1.257   1.00 15.00 ?  498 HIS A HD1  1  
ATOM   343   H HD2  . HIS A 1 27 ? 0.952   6.566   0.983   1.00 15.00 ?  498 HIS A HD2  1  
ATOM   344   H HE1  . HIS A 1 27 ? 4.716   5.926   -0.875  1.00 15.00 ?  498 HIS A HE1  1  
ATOM   345   H HE2  . HIS A 1 27 ? 2.208   5.778   -1.132  1.00 15.00 ?  498 HIS A HE2  1  
ATOM   346   N N    . ASN A 1 28 ? 2.595   7.403   6.372   1.00 15.00 ?  499 ASN A N    1  
ATOM   347   C CA   . ASN A 1 28 ? 3.017   7.996   7.636   1.00 15.00 ?  499 ASN A CA   1  
ATOM   348   C C    . ASN A 1 28 ? 3.744   6.969   8.495   1.00 15.00 ?  499 ASN A C    1  
ATOM   349   O O    . ASN A 1 28 ? 4.833   7.227   9.004   1.00 15.00 ?  499 ASN A O    1  
ATOM   350   C CB   . ASN A 1 28 ? 1.823   8.592   8.411   1.00 15.00 ?  499 ASN A CB   1  
ATOM   351   C CG   . ASN A 1 28 ? 0.694   7.602   8.665   1.00 15.00 ?  499 ASN A CG   1  
ATOM   352   O OD1  . ASN A 1 28 ? 0.707   6.871   9.650   1.00 15.00 ?  499 ASN A OD1  1  
ATOM   353   N ND2  . ASN A 1 28 ? -0.311  7.597   7.797   1.00 15.00 ?  499 ASN A ND2  1  
ATOM   354   H H    . ASN A 1 28 ? 1.674   7.096   6.254   1.00 15.00 ?  499 ASN A H    1  
ATOM   355   H HA   . ASN A 1 28 ? 3.708   8.793   7.403   1.00 15.00 ?  499 ASN A HA   1  
ATOM   356   H HB2  . ASN A 1 28 ? 2.173   8.950   9.366   1.00 15.00 ?  499 ASN A HB2  1  
ATOM   357   H HB3  . ASN A 1 28 ? 1.425   9.418   7.855   1.00 15.00 ?  499 ASN A HB3  1  
ATOM   358   H HD21 . ASN A 1 28 ? -0.286  8.224   7.046   1.00 15.00 ?  499 ASN A HD21 1  
ATOM   359   H HD22 . ASN A 1 28 ? -1.047  6.968   7.953   1.00 15.00 ?  499 ASN A HD22 1  
ATOM   360   N N    . THR A 1 29 ? 3.126   5.814   8.666   1.00 15.00 ?  500 THR A N    1  
ATOM   361   C CA   . THR A 1 29 ? 3.749   4.685   9.325   1.00 15.00 ?  500 THR A CA   1  
ATOM   362   C C    . THR A 1 29 ? 4.674   3.897   8.384   1.00 15.00 ?  500 THR A C    1  
ATOM   363   O O    . THR A 1 29 ? 5.402   3.004   8.823   1.00 15.00 ?  500 THR A O    1  
ATOM   364   C CB   . THR A 1 29 ? 2.674   3.796   9.976   1.00 15.00 ?  500 THR A CB   1  
ATOM   365   O OG1  . THR A 1 29 ? 1.499   3.755   9.157   1.00 15.00 ?  500 THR A OG1  1  
ATOM   366   C CG2  . THR A 1 29 ? 2.304   4.354   11.339  1.00 15.00 ?  500 THR A CG2  1  
ATOM   367   H H    . THR A 1 29 ? 2.202   5.721   8.353   1.00 15.00 ?  500 THR A H    1  
ATOM   368   H HA   . THR A 1 29 ? 4.356   5.087   10.122  1.00 15.00 ?  500 THR A HA   1  
ATOM   369   H HB   . THR A 1 29 ? 3.066   2.797   10.099  1.00 15.00 ?  500 THR A HB   1  
ATOM   370   H HG1  . THR A 1 29 ? 1.668   3.211   8.364   1.00 15.00 ?  500 THR A HG1  1  
ATOM   371   H HG21 . THR A 1 29 ? 3.172   4.343   11.980  1.00 15.00 ?  500 THR A HG21 1  
ATOM   372   H HG22 . THR A 1 29 ? 1.523   3.751   11.776  1.00 15.00 ?  500 THR A HG22 1  
ATOM   373   H HG23 . THR A 1 29 ? 1.954   5.374   11.223  1.00 15.00 ?  500 THR A HG23 1  
ATOM   374   N N    . LYS A 1 30 ? 4.609   4.239   7.089   1.00 15.00 ?  501 LYS A N    1  
ATOM   375   C CA   . LYS A 1 30 ? 5.372   3.579   6.011   1.00 15.00 ?  501 LYS A CA   1  
ATOM   376   C C    . LYS A 1 30 ? 5.288   2.051   6.077   1.00 15.00 ?  501 LYS A C    1  
ATOM   377   O O    . LYS A 1 30 ? 6.300   1.351   6.038   1.00 15.00 ?  501 LYS A O    1  
ATOM   378   C CB   . LYS A 1 30 ? 6.837   4.064   5.916   1.00 15.00 ?  501 LYS A CB   1  
ATOM   379   C CG   . LYS A 1 30 ? 7.699   3.858   7.154   1.00 15.00 ?  501 LYS A CG   1  
ATOM   380   C CD   . LYS A 1 30 ? 9.176   4.065   6.838   1.00 15.00 ?  501 LYS A CD   1  
ATOM   381   C CE   . LYS A 1 30 ? 9.443   5.428   6.208   1.00 15.00 ?  501 LYS A CE   1  
ATOM   382   N NZ   . LYS A 1 30 ? 9.334   6.538   7.191   1.00 15.00 1  501 LYS A NZ   1  
ATOM   383   H H    . LYS A 1 30 ? 4.002   4.965   6.840   1.00 15.00 ?  501 LYS A H    1  
ATOM   384   H HA   . LYS A 1 30 ? 4.879   3.871   5.092   1.00 15.00 ?  501 LYS A HA   1  
ATOM   385   H HB2  . LYS A 1 30 ? 7.313   3.547   5.099   1.00 15.00 ?  501 LYS A HB2  1  
ATOM   386   H HB3  . LYS A 1 30 ? 6.828   5.121   5.691   1.00 15.00 ?  501 LYS A HB3  1  
ATOM   387   H HG2  . LYS A 1 30 ? 7.400   4.566   7.913   1.00 15.00 ?  501 LYS A HG2  1  
ATOM   388   H HG3  . LYS A 1 30 ? 7.556   2.852   7.520   1.00 15.00 ?  501 LYS A HG3  1  
ATOM   389   H HD2  . LYS A 1 30 ? 9.743   3.989   7.754   1.00 15.00 ?  501 LYS A HD2  1  
ATOM   390   H HD3  . LYS A 1 30 ? 9.496   3.294   6.152   1.00 15.00 ?  501 LYS A HD3  1  
ATOM   391   H HE2  . LYS A 1 30 ? 10.439  5.428   5.793   1.00 15.00 ?  501 LYS A HE2  1  
ATOM   392   H HE3  . LYS A 1 30 ? 8.725   5.588   5.417   1.00 15.00 ?  501 LYS A HE3  1  
ATOM   393   H HZ1  . LYS A 1 30 ? 9.368   7.459   6.699   1.00 15.00 ?  501 LYS A HZ1  1  
ATOM   394   H HZ2  . LYS A 1 30 ? 10.125  6.495   7.870   1.00 15.00 ?  501 LYS A HZ2  1  
ATOM   395   H HZ3  . LYS A 1 30 ? 8.437   6.471   7.720   1.00 15.00 ?  501 LYS A HZ3  1  
ATOM   396   N N    . THR A 1 31 ? 4.071   1.542   6.182   1.00 15.00 ?  502 THR A N    1  
ATOM   397   C CA   . THR A 1 31 ? 3.841   0.109   6.231   1.00 15.00 ?  502 THR A CA   1  
ATOM   398   C C    . THR A 1 31 ? 3.002   -0.351  5.031   1.00 15.00 ?  502 THR A C    1  
ATOM   399   O O    . THR A 1 31 ? 2.204   0.415   4.485   1.00 15.00 ?  502 THR A O    1  
ATOM   400   C CB   . THR A 1 31 ? 3.137   -0.269  7.547   1.00 15.00 ?  502 THR A CB   1  
ATOM   401   O OG1  . THR A 1 31 ? 3.843   0.321   8.649   1.00 15.00 ?  502 THR A OG1  1  
ATOM   402   C CG2  . THR A 1 31 ? 3.077   -1.777  7.733   1.00 15.00 ?  502 THR A CG2  1  
ATOM   403   H H    . THR A 1 31 ? 3.291   2.150   6.227   1.00 15.00 ?  502 THR A H    1  
ATOM   404   H HA   . THR A 1 31 ? 4.802   -0.388  6.202   1.00 15.00 ?  502 THR A HA   1  
ATOM   405   H HB   . THR A 1 31 ? 2.128   0.119   7.523   1.00 15.00 ?  502 THR A HB   1  
ATOM   406   H HG1  . THR A 1 31 ? 4.208   1.172   8.370   1.00 15.00 ?  502 THR A HG1  1  
ATOM   407   H HG21 . THR A 1 31 ? 2.582   -2.005  8.665   1.00 15.00 ?  502 THR A HG21 1  
ATOM   408   H HG22 . THR A 1 31 ? 4.079   -2.177  7.750   1.00 15.00 ?  502 THR A HG22 1  
ATOM   409   H HG23 . THR A 1 31 ? 2.527   -2.219  6.915   1.00 15.00 ?  502 THR A HG23 1  
ATOM   410   N N    . THR A 1 32 ? 3.217   -1.589  4.601   1.00 15.00 ?  503 THR A N    1  
ATOM   411   C CA   . THR A 1 32 ? 2.452   -2.173  3.512   1.00 15.00 ?  503 THR A CA   1  
ATOM   412   C C    . THR A 1 32 ? 1.240   -2.939  4.042   1.00 15.00 ?  503 THR A C    1  
ATOM   413   O O    . THR A 1 32 ? 1.383   -3.887  4.819   1.00 15.00 ?  503 THR A O    1  
ATOM   414   C CB   . THR A 1 32 ? 3.334   -3.124  2.685   1.00 15.00 ?  503 THR A CB   1  
ATOM   415   O OG1  . THR A 1 32 ? 4.098   -3.957  3.567   1.00 15.00 ?  503 THR A OG1  1  
ATOM   416   C CG2  . THR A 1 32 ? 4.265   -2.346  1.768   1.00 15.00 ?  503 THR A CG2  1  
ATOM   417   H H    . THR A 1 32 ? 3.916   -2.127  5.026   1.00 15.00 ?  503 THR A H    1  
ATOM   418   H HA   . THR A 1 32 ? 2.114   -1.374  2.870   1.00 15.00 ?  503 THR A HA   1  
ATOM   419   H HB   . THR A 1 32 ? 2.692   -3.749  2.079   1.00 15.00 ?  503 THR A HB   1  
ATOM   420   H HG1  . THR A 1 32 ? 3.498   -4.497  4.094   1.00 15.00 ?  503 THR A HG1  1  
ATOM   421   H HG21 . THR A 1 32 ? 4.893   -3.035  1.221   1.00 15.00 ?  503 THR A HG21 1  
ATOM   422   H HG22 . THR A 1 32 ? 4.883   -1.687  2.358   1.00 15.00 ?  503 THR A HG22 1  
ATOM   423   H HG23 . THR A 1 32 ? 3.680   -1.762  1.071   1.00 15.00 ?  503 THR A HG23 1  
ATOM   424   N N    . THR A 1 33 ? 0.055   -2.524  3.625   1.00 15.00 ?  504 THR A N    1  
ATOM   425   C CA   . THR A 1 33 ? -1.180  -3.160  4.054   1.00 15.00 ?  504 THR A CA   1  
ATOM   426   C C    . THR A 1 33 ? -1.898  -3.795  2.860   1.00 15.00 ?  504 THR A C    1  
ATOM   427   O O    . THR A 1 33 ? -2.120  -3.141  1.842   1.00 15.00 ?  504 THR A O    1  
ATOM   428   C CB   . THR A 1 33 ? -2.104  -2.129  4.734   1.00 15.00 ?  504 THR A CB   1  
ATOM   429   O OG1  . THR A 1 33 ? -1.369  -1.415  5.740   1.00 15.00 ?  504 THR A OG1  1  
ATOM   430   C CG2  . THR A 1 33 ? -3.303  -2.806  5.378   1.00 15.00 ?  504 THR A CG2  1  
ATOM   431   H H    . THR A 1 33 ? 0.002   -1.759  3.008   1.00 15.00 ?  504 THR A H    1  
ATOM   432   H HA   . THR A 1 33 ? -0.935  -3.929  4.773   1.00 15.00 ?  504 THR A HA   1  
ATOM   433   H HB   . THR A 1 33 ? -2.457  -1.432  3.987   1.00 15.00 ?  504 THR A HB   1  
ATOM   434   H HG1  . THR A 1 33 ? -1.047  -0.578  5.377   1.00 15.00 ?  504 THR A HG1  1  
ATOM   435   H HG21 . THR A 1 33 ? -2.960  -3.511  6.122   1.00 15.00 ?  504 THR A HG21 1  
ATOM   436   H HG22 . THR A 1 33 ? -3.870  -3.327  4.622   1.00 15.00 ?  504 THR A HG22 1  
ATOM   437   H HG23 . THR A 1 33 ? -3.929  -2.061  5.848   1.00 15.00 ?  504 THR A HG23 1  
ATOM   438   N N    . TRP A 1 34 ? -2.247  -5.071  2.981   1.00 15.00 ?  505 TRP A N    1  
ATOM   439   C CA   . TRP A 1 34 ? -2.885  -5.794  1.883   1.00 15.00 ?  505 TRP A CA   1  
ATOM   440   C C    . TRP A 1 34 ? -4.403  -5.665  1.926   1.00 15.00 ?  505 TRP A C    1  
ATOM   441   O O    . TRP A 1 34 ? -5.060  -5.583  0.889   1.00 15.00 ?  505 TRP A O    1  
ATOM   442   C CB   . TRP A 1 34 ? -2.517  -7.276  1.920   1.00 15.00 ?  505 TRP A CB   1  
ATOM   443   C CG   . TRP A 1 34 ? -1.156  -7.594  1.384   1.00 15.00 ?  505 TRP A CG   1  
ATOM   444   C CD1  . TRP A 1 34 ? -0.042  -7.915  2.102   1.00 15.00 ?  505 TRP A CD1  1  
ATOM   445   C CD2  . TRP A 1 34 ? -0.774  -7.649  0.006   1.00 15.00 ?  505 TRP A CD2  1  
ATOM   446   N NE1  . TRP A 1 34 ? 1.007   -8.171  1.252   1.00 15.00 ?  505 TRP A NE1  1  
ATOM   447   C CE2  . TRP A 1 34 ? 0.583   -8.015  -0.038  1.00 15.00 ?  505 TRP A CE2  1  
ATOM   448   C CE3  . TRP A 1 34 ? -1.450  -7.427  -1.194  1.00 15.00 ?  505 TRP A CE3  1  
ATOM   449   C CZ2  . TRP A 1 34 ? 1.276   -8.165  -1.234  1.00 15.00 ?  505 TRP A CZ2  1  
ATOM   450   C CZ3  . TRP A 1 34 ? -0.763  -7.578  -2.381  1.00 15.00 ?  505 TRP A CZ3  1  
ATOM   451   C CH2  . TRP A 1 34 ? 0.588   -7.947  -2.394  1.00 15.00 ?  505 TRP A CH2  1  
ATOM   452   H H    . TRP A 1 34 ? -2.081  -5.534  3.829   1.00 15.00 ?  505 TRP A H    1  
ATOM   453   H HA   . TRP A 1 34 ? -2.526  -5.369  0.957   1.00 15.00 ?  505 TRP A HA   1  
ATOM   454   H HB2  . TRP A 1 34 ? -2.555  -7.620  2.941   1.00 15.00 ?  505 TRP A HB2  1  
ATOM   455   H HB3  . TRP A 1 34 ? -3.240  -7.828  1.336   1.00 15.00 ?  505 TRP A HB3  1  
ATOM   456   H HD1  . TRP A 1 34 ? -0.004  -7.960  3.181   1.00 15.00 ?  505 TRP A HD1  1  
ATOM   457   H HE1  . TRP A 1 34 ? 1.910   -8.426  1.523   1.00 15.00 ?  505 TRP A HE1  1  
ATOM   458   H HE3  . TRP A 1 34 ? -2.488  -7.137  -1.203  1.00 15.00 ?  505 TRP A HE3  1  
ATOM   459   H HZ2  . TRP A 1 34 ? 2.317   -8.450  -1.260  1.00 15.00 ?  505 TRP A HZ2  1  
ATOM   460   H HZ3  . TRP A 1 34 ? -1.272  -7.413  -3.318  1.00 15.00 ?  505 TRP A HZ3  1  
ATOM   461   H HH2  . TRP A 1 34 ? 1.087   -8.059  -3.348  1.00 15.00 ?  505 TRP A HH2  1  
ATOM   462   N N    . GLU A 1 35 ? -4.955  -5.686  3.126   1.00 15.00 ?  506 GLU A N    1  
ATOM   463   C CA   . GLU A 1 35 ? -6.398  -5.680  3.303   1.00 15.00 ?  506 GLU A CA   1  
ATOM   464   C C    . GLU A 1 35 ? -6.894  -4.315  3.696   1.00 15.00 ?  506 GLU A C    1  
ATOM   465   O O    . GLU A 1 35 ? -6.205  -3.555  4.375   1.00 15.00 ?  506 GLU A O    1  
ATOM   466   C CB   . GLU A 1 35 ? -6.825  -6.726  4.343   1.00 15.00 ?  506 GLU A CB   1  
ATOM   467   C CG   . GLU A 1 35 ? -6.100  -6.625  5.682   1.00 15.00 ?  506 GLU A CG   1  
ATOM   468   C CD   . GLU A 1 35 ? -4.696  -7.201  5.645   1.00 15.00 ?  506 GLU A CD   1  
ATOM   469   O OE1  . GLU A 1 35 ? -4.557  -8.435  5.778   1.00 15.00 -1 506 GLU A OE1  1  
ATOM   470   O OE2  . GLU A 1 35 ? -3.727  -6.426  5.478   1.00 15.00 ?  506 GLU A OE2  1  
ATOM   471   H H    . GLU A 1 35 ? -4.375  -5.703  3.923   1.00 15.00 ?  506 GLU A H    1  
ATOM   472   H HA   . GLU A 1 35 ? -6.849  -5.921  2.357   1.00 15.00 ?  506 GLU A HA   1  
ATOM   473   H HB2  . GLU A 1 35 ? -7.884  -6.615  4.529   1.00 15.00 ?  506 GLU A HB2  1  
ATOM   474   H HB3  . GLU A 1 35 ? -6.646  -7.710  3.937   1.00 15.00 ?  506 GLU A HB3  1  
ATOM   475   H HG2  . GLU A 1 35 ? -6.035  -5.584  5.962   1.00 15.00 ?  506 GLU A HG2  1  
ATOM   476   H HG3  . GLU A 1 35 ? -6.671  -7.160  6.425   1.00 15.00 ?  506 GLU A HG3  1  
ATOM   477   N N    . ASP A 1 36 ? -8.107  -4.017  3.272   1.00 15.00 ?  507 ASP A N    1  
ATOM   478   C CA   . ASP A 1 36 ? -8.690  -2.728  3.532   1.00 15.00 ?  507 ASP A CA   1  
ATOM   479   C C    . ASP A 1 36 ? -9.014  -2.588  5.017   1.00 15.00 ?  507 ASP A C    1  
ATOM   480   O O    . ASP A 1 36 ? -9.761  -3.391  5.581   1.00 15.00 ?  507 ASP A O    1  
ATOM   481   C CB   . ASP A 1 36 ? -9.940  -2.502  2.670   1.00 15.00 ?  507 ASP A CB   1  
ATOM   482   C CG   . ASP A 1 36 ? -11.066 -3.470  2.980   1.00 15.00 ?  507 ASP A CG   1  
ATOM   483   O OD1  . ASP A 1 36 ? -10.945 -4.666  2.629   1.00 15.00 ?  507 ASP A OD1  1  
ATOM   484   O OD2  . ASP A 1 36 ? -12.084 -3.040  3.559   1.00 15.00 -1 507 ASP A OD2  1  
ATOM   485   H H    . ASP A 1 36 ? -8.625  -4.687  2.778   1.00 15.00 ?  507 ASP A H    1  
ATOM   486   H HA   . ASP A 1 36 ? -7.944  -2.002  3.266   1.00 15.00 ?  507 ASP A HA   1  
ATOM   487   H HB2  . ASP A 1 36 ? -10.302 -1.500  2.835   1.00 15.00 ?  507 ASP A HB2  1  
ATOM   488   H HB3  . ASP A 1 36 ? -9.672  -2.614  1.631   1.00 15.00 ?  507 ASP A HB3  1  
ATOM   489   N N    . PRO A 1 37 ? -8.431  -1.574  5.674   1.00 15.00 ?  508 PRO A N    1  
ATOM   490   C CA   . PRO A 1 37 ? -8.598  -1.361  7.114   1.00 15.00 ?  508 PRO A CA   1  
ATOM   491   C C    . PRO A 1 37 ? -9.999  -0.881  7.479   1.00 15.00 ?  508 PRO A C    1  
ATOM   492   O O    . PRO A 1 37 ? -10.417 -0.998  8.633   1.00 15.00 ?  508 PRO A O    1  
ATOM   493   C CB   . PRO A 1 37 ? -7.557  -0.283  7.460   1.00 15.00 ?  508 PRO A CB   1  
ATOM   494   C CG   . PRO A 1 37 ? -6.715  -0.115  6.236   1.00 15.00 ?  508 PRO A CG   1  
ATOM   495   C CD   . PRO A 1 37 ? -7.545  -0.570  5.072   1.00 15.00 ?  508 PRO A CD   1  
ATOM   496   H HA   . PRO A 1 37 ? -8.377  -2.261  7.670   1.00 15.00 ?  508 PRO A HA   1  
ATOM   497   H HB2  . PRO A 1 37 ? -8.061  0.638   7.715   1.00 15.00 ?  508 PRO A HB2  1  
ATOM   498   H HB3  . PRO A 1 37 ? -6.965  -0.613  8.300   1.00 15.00 ?  508 PRO A HB3  1  
ATOM   499   H HG2  . PRO A 1 37 ? -6.449  0.924   6.117   1.00 15.00 ?  508 PRO A HG2  1  
ATOM   500   H HG3  . PRO A 1 37 ? -5.823  -0.720  6.319   1.00 15.00 ?  508 PRO A HG3  1  
ATOM   501   H HD2  . PRO A 1 37 ? -8.109  0.255   4.663   1.00 15.00 ?  508 PRO A HD2  1  
ATOM   502   H HD3  . PRO A 1 37 ? -6.919  -1.014  4.312   1.00 15.00 ?  508 PRO A HD3  1  
ATOM   503   N N    . ARG A 1 38 ? -10.701 -0.341  6.480   1.00 15.00 ?  509 ARG A N    1  
ATOM   504   C CA   . ARG A 1 38 ? -12.051 0.200   6.648   1.00 15.00 ?  509 ARG A CA   1  
ATOM   505   C C    . ARG A 1 38 ? -12.055 1.422   7.569   1.00 15.00 ?  509 ARG A C    1  
ATOM   506   O O    . ARG A 1 38 ? -11.936 1.260   8.799   1.00 15.00 ?  509 ARG A O    1  
ATOM   507   C CB   . ARG A 1 38 ? -13.024 -0.873  7.157   1.00 15.00 ?  509 ARG A CB   1  
ATOM   508   C CG   . ARG A 1 38 ? -14.459 -0.384  7.355   1.00 15.00 ?  509 ARG A CG   1  
ATOM   509   C CD   . ARG A 1 38 ? -15.052 0.224   6.086   1.00 15.00 ?  509 ARG A CD   1  
ATOM   510   N NE   . ARG A 1 38 ? -14.586 1.594   5.855   1.00 15.00 ?  509 ARG A NE   1  
ATOM   511   C CZ   . ARG A 1 38 ? -15.196 2.470   5.061   1.00 15.00 ?  509 ARG A CZ   1  
ATOM   512   N NH1  . ARG A 1 38 ? -16.273 2.122   4.369   1.00 15.00 1  509 ARG A NH1  1  
ATOM   513   N NH2  . ARG A 1 38 ? -14.717 3.700   4.949   1.00 15.00 ?  509 ARG A NH2  1  
ATOM   514   H H    . ARG A 1 38 ? -10.295 -0.311  5.591   1.00 15.00 ?  509 ARG A H    1  
ATOM   515   H HA   . ARG A 1 38 ? -12.383 0.523   5.671   1.00 15.00 ?  509 ARG A HA   1  
ATOM   516   H HB2  . ARG A 1 38 ? -13.042 -1.688  6.449   1.00 15.00 ?  509 ARG A HB2  1  
ATOM   517   H HB3  . ARG A 1 38 ? -12.663 -1.245  8.105   1.00 15.00 ?  509 ARG A HB3  1  
ATOM   518   H HG2  . ARG A 1 38 ? -15.072 -1.220  7.655   1.00 15.00 ?  509 ARG A HG2  1  
ATOM   519   H HG3  . ARG A 1 38 ? -14.465 0.363   8.136   1.00 15.00 ?  509 ARG A HG3  1  
ATOM   520   H HD2  . ARG A 1 38 ? -14.768 -0.388  5.243   1.00 15.00 ?  509 ARG A HD2  1  
ATOM   521   H HD3  . ARG A 1 38 ? -16.129 0.232   6.176   1.00 15.00 ?  509 ARG A HD3  1  
ATOM   522   H HE   . ARG A 1 38 ? -13.770 1.881   6.337   1.00 15.00 ?  509 ARG A HE   1  
ATOM   523   H HH11 . ARG A 1 38 ? -16.644 1.184   4.436   1.00 15.00 ?  509 ARG A HH11 1  
ATOM   524   H HH12 . ARG A 1 38 ? -16.729 2.793   3.774   1.00 15.00 ?  509 ARG A HH12 1  
ATOM   525   H HH21 . ARG A 1 38 ? -13.896 3.969   5.458   1.00 15.00 ?  509 ARG A HH21 1  
ATOM   526   H HH22 . ARG A 1 38 ? -15.184 4.369   4.362   1.00 15.00 ?  509 ARG A HH22 1  
ATOM   527   N N    . ARG B 2 1  ? -0.871  -17.518 2.215   1.00 15.00 ?  925 ARG B N    1  
ATOM   528   C CA   . ARG B 2 1  ? -0.828  -16.055 2.400   1.00 15.00 ?  925 ARG B CA   1  
ATOM   529   C C    . ARG B 2 1  ? -0.046  -15.417 1.266   1.00 15.00 ?  925 ARG B C    1  
ATOM   530   O O    . ARG B 2 1  ? 1.048   -15.869 0.931   1.00 15.00 ?  925 ARG B O    1  
ATOM   531   C CB   . ARG B 2 1  ? -0.170  -15.718 3.739   1.00 15.00 ?  925 ARG B CB   1  
ATOM   532   C CG   . ARG B 2 1  ? -0.250  -14.246 4.110   1.00 15.00 ?  925 ARG B CG   1  
ATOM   533   C CD   . ARG B 2 1  ? -1.693  -13.776 4.194   1.00 15.00 ?  925 ARG B CD   1  
ATOM   534   N NE   . ARG B 2 1  ? -1.800  -12.402 4.677   1.00 15.00 ?  925 ARG B NE   1  
ATOM   535   C CZ   . ARG B 2 1  ? -2.886  -11.643 4.538   1.00 15.00 ?  925 ARG B CZ   1  
ATOM   536   N NH1  . ARG B 2 1  ? -3.927  -12.080 3.838   1.00 15.00 1  925 ARG B NH1  1  
ATOM   537   N NH2  . ARG B 2 1  ? -2.907  -10.432 5.076   1.00 15.00 ?  925 ARG B NH2  1  
ATOM   538   H H1   . ARG B 2 1  ? -1.434  -17.960 2.967   1.00 15.00 ?  925 ARG B H1   1  
ATOM   539   H H2   . ARG B 2 1  ? 0.096   -17.907 2.248   1.00 15.00 ?  925 ARG B H2   1  
ATOM   540   H H3   . ARG B 2 1  ? -1.293  -17.751 1.290   1.00 15.00 ?  925 ARG B H3   1  
ATOM   541   H HA   . ARG B 2 1  ? -1.840  -15.675 2.389   1.00 15.00 ?  925 ARG B HA   1  
ATOM   542   H HB2  . ARG B 2 1  ? -0.653  -16.291 4.516   1.00 15.00 ?  925 ARG B HB2  1  
ATOM   543   H HB3  . ARG B 2 1  ? 0.872   -16.000 3.693   1.00 15.00 ?  925 ARG B HB3  1  
ATOM   544   H HG2  . ARG B 2 1  ? 0.223   -14.099 5.071   1.00 15.00 ?  925 ARG B HG2  1  
ATOM   545   H HG3  . ARG B 2 1  ? 0.266   -13.666 3.358   1.00 15.00 ?  925 ARG B HG3  1  
ATOM   546   H HD2  . ARG B 2 1  ? -2.132  -13.834 3.209   1.00 15.00 ?  925 ARG B HD2  1  
ATOM   547   H HD3  . ARG B 2 1  ? -2.232  -14.428 4.866   1.00 15.00 ?  925 ARG B HD3  1  
ATOM   548   H HE   . ARG B 2 1  ? -1.026  -12.033 5.161   1.00 15.00 ?  925 ARG B HE   1  
ATOM   549   H HH11 . ARG B 2 1  ? -3.900  -12.986 3.401   1.00 15.00 ?  925 ARG B HH11 1  
ATOM   550   H HH12 . ARG B 2 1  ? -4.754  -11.508 3.745   1.00 15.00 ?  925 ARG B HH12 1  
ATOM   551   H HH21 . ARG B 2 1  ? -2.103  -10.096 5.581   1.00 15.00 ?  925 ARG B HH21 1  
ATOM   552   H HH22 . ARG B 2 1  ? -3.724  -9.845  4.994   1.00 15.00 ?  925 ARG B HH22 1  
ATOM   553   N N    . LEU B 2 2  ? -0.614  -14.374 0.675   1.00 15.00 ?  926 LEU B N    1  
ATOM   554   C CA   . LEU B 2 2  ? 0.054   -13.645 -0.394  1.00 15.00 ?  926 LEU B CA   1  
ATOM   555   C C    . LEU B 2 2  ? 1.390   -13.067 0.079   1.00 15.00 ?  926 LEU B C    1  
ATOM   556   O O    . LEU B 2 2  ? 1.467   -12.407 1.116   1.00 15.00 ?  926 LEU B O    1  
ATOM   557   C CB   . LEU B 2 2  ? -0.859  -12.543 -0.955  1.00 15.00 ?  926 LEU B CB   1  
ATOM   558   C CG   . LEU B 2 2  ? -1.925  -11.989 0.000   1.00 15.00 ?  926 LEU B CG   1  
ATOM   559   C CD1  . LEU B 2 2  ? -1.298  -11.192 1.132   1.00 15.00 ?  926 LEU B CD1  1  
ATOM   560   C CD2  . LEU B 2 2  ? -2.918  -11.127 -0.763  1.00 15.00 ?  926 LEU B CD2  1  
ATOM   561   H H    . LEU B 2 2  ? -1.508  -14.086 0.965   1.00 15.00 ?  926 LEU B H    1  
ATOM   562   H HA   . LEU B 2 2  ? 0.258   -14.355 -1.183  1.00 15.00 ?  926 LEU B HA   1  
ATOM   563   H HB2  . LEU B 2 2  ? -0.235  -11.720 -1.270  1.00 15.00 ?  926 LEU B HB2  1  
ATOM   564   H HB3  . LEU B 2 2  ? -1.363  -12.937 -1.825  1.00 15.00 ?  926 LEU B HB3  1  
ATOM   565   H HG   . LEU B 2 2  ? -2.469  -12.815 0.437   1.00 15.00 ?  926 LEU B HG   1  
ATOM   566   H HD11 . LEU B 2 2  ? -0.628  -11.827 1.692   1.00 15.00 ?  926 LEU B HD11 1  
ATOM   567   H HD12 . LEU B 2 2  ? -2.073  -10.820 1.786   1.00 15.00 ?  926 LEU B HD12 1  
ATOM   568   H HD13 . LEU B 2 2  ? -0.744  -10.361 0.721   1.00 15.00 ?  926 LEU B HD13 1  
ATOM   569   H HD21 . LEU B 2 2  ? -3.406  -11.724 -1.520  1.00 15.00 ?  926 LEU B HD21 1  
ATOM   570   H HD22 . LEU B 2 2  ? -2.394  -10.308 -1.233  1.00 15.00 ?  926 LEU B HD22 1  
ATOM   571   H HD23 . LEU B 2 2  ? -3.657  -10.738 -0.079  1.00 15.00 ?  926 LEU B HD23 1  
ATOM   572   N N    . ASP B 2 3  ? 2.433   -13.344 -0.694  1.00 15.00 ?  927 ASP B N    1  
ATOM   573   C CA   . ASP B 2 3  ? 3.788   -12.876 -0.398  1.00 15.00 ?  927 ASP B CA   1  
ATOM   574   C C    . ASP B 2 3  ? 3.835   -11.363 -0.205  1.00 15.00 ?  927 ASP B C    1  
ATOM   575   O O    . ASP B 2 3  ? 3.400   -10.602 -1.073  1.00 15.00 ?  927 ASP B O    1  
ATOM   576   C CB   . ASP B 2 3  ? 4.726   -13.286 -1.540  1.00 15.00 ?  927 ASP B CB   1  
ATOM   577   C CG   . ASP B 2 3  ? 6.048   -12.538 -1.534  1.00 15.00 ?  927 ASP B CG   1  
ATOM   578   O OD1  . ASP B 2 3  ? 6.941   -12.888 -0.734  1.00 15.00 ?  927 ASP B OD1  1  
ATOM   579   O OD2  . ASP B 2 3  ? 6.211   -11.613 -2.364  1.00 15.00 -1 927 ASP B OD2  1  
ATOM   580   H H    . ASP B 2 3  ? 2.290   -13.889 -1.496  1.00 15.00 ?  927 ASP B H    1  
ATOM   581   H HA   . ASP B 2 3  ? 4.113   -13.356 0.512   1.00 15.00 ?  927 ASP B HA   1  
ATOM   582   H HB2  . ASP B 2 3  ? 4.936   -14.341 -1.461  1.00 15.00 ?  927 ASP B HB2  1  
ATOM   583   H HB3  . ASP B 2 3  ? 4.232   -13.094 -2.482  1.00 15.00 ?  927 ASP B HB3  1  
ATOM   584   N N    . LEU B 2 4  ? 4.360   -10.935 0.937   1.00 15.00 ?  928 LEU B N    1  
ATOM   585   C CA   . LEU B 2 4  ? 4.561   -9.520  1.198   1.00 15.00 ?  928 LEU B CA   1  
ATOM   586   C C    . LEU B 2 4  ? 6.034   -9.172  1.021   1.00 15.00 ?  928 LEU B C    1  
ATOM   587   O O    . LEU B 2 4  ? 6.897   -9.724  1.705   1.00 15.00 ?  928 LEU B O    1  
ATOM   588   C CB   . LEU B 2 4  ? 4.090   -9.154  2.619   1.00 15.00 ?  928 LEU B CB   1  
ATOM   589   C CG   . LEU B 2 4  ? 4.225   -7.669  2.997   1.00 15.00 ?  928 LEU B CG   1  
ATOM   590   C CD1  . LEU B 2 4  ? 3.071   -7.226  3.882   1.00 15.00 ?  928 LEU B CD1  1  
ATOM   591   C CD2  . LEU B 2 4  ? 5.545   -7.413  3.712   1.00 15.00 ?  928 LEU B CD2  1  
ATOM   592   H H    . LEU B 2 4  ? 4.629   -11.591 1.618   1.00 15.00 ?  928 LEU B H    1  
ATOM   593   H HA   . LEU B 2 4  ? 3.980   -8.963  0.478   1.00 15.00 ?  928 LEU B HA   1  
ATOM   594   H HB2  . LEU B 2 4  ? 3.054   -9.439  2.720   1.00 15.00 ?  928 LEU B HB2  1  
ATOM   595   H HB3  . LEU B 2 4  ? 4.672   -9.731  3.323   1.00 15.00 ?  928 LEU B HB3  1  
ATOM   596   H HG   . LEU B 2 4  ? 4.208   -7.071  2.098   1.00 15.00 ?  928 LEU B HG   1  
ATOM   597   H HD11 . LEU B 2 4  ? 3.039   -7.843  4.768   1.00 15.00 ?  928 LEU B HD11 1  
ATOM   598   H HD12 . LEU B 2 4  ? 2.142   -7.321  3.340   1.00 15.00 ?  928 LEU B HD12 1  
ATOM   599   H HD13 . LEU B 2 4  ? 3.216   -6.195  4.168   1.00 15.00 ?  928 LEU B HD13 1  
ATOM   600   H HD21 . LEU B 2 4  ? 5.618   -6.366  3.968   1.00 15.00 ?  928 LEU B HD21 1  
ATOM   601   H HD22 . LEU B 2 4  ? 6.365   -7.683  3.062   1.00 15.00 ?  928 LEU B HD22 1  
ATOM   602   H HD23 . LEU B 2 4  ? 5.587   -8.008  4.611   1.00 15.00 ?  928 LEU B HD23 1  
ATOM   603   N N    . PRO B 2 5  ? 6.339   -8.263  0.092   1.00 15.00 ?  929 PRO B N    1  
ATOM   604   C CA   . PRO B 2 5  ? 7.691   -7.770  -0.126  1.00 15.00 ?  929 PRO B CA   1  
ATOM   605   C C    . PRO B 2 5  ? 8.024   -6.623  0.825   1.00 15.00 ?  929 PRO B C    1  
ATOM   606   O O    . PRO B 2 5  ? 7.204   -5.722  1.020   1.00 15.00 ?  929 PRO B O    1  
ATOM   607   C CB   . PRO B 2 5  ? 7.666   -7.270  -1.581  1.00 15.00 ?  929 PRO B CB   1  
ATOM   608   C CG   . PRO B 2 5  ? 6.247   -7.400  -2.054  1.00 15.00 ?  929 PRO B CG   1  
ATOM   609   C CD   . PRO B 2 5  ? 5.396   -7.649  -0.840  1.00 15.00 ?  929 PRO B CD   1  
ATOM   610   H HA   . PRO B 2 5  ? 8.426   -8.555  -0.019  1.00 15.00 ?  929 PRO B HA   1  
ATOM   611   H HB2  . PRO B 2 5  ? 7.994   -6.241  -1.611  1.00 15.00 ?  929 PRO B HB2  1  
ATOM   612   H HB3  . PRO B 2 5  ? 8.333   -7.876  -2.177  1.00 15.00 ?  929 PRO B HB3  1  
ATOM   613   H HG2  . PRO B 2 5  ? 5.939   -6.486  -2.539  1.00 15.00 ?  929 PRO B HG2  1  
ATOM   614   H HG3  . PRO B 2 5  ? 6.167   -8.230  -2.740  1.00 15.00 ?  929 PRO B HG3  1  
ATOM   615   H HD2  . PRO B 2 5  ? 5.013   -6.719  -0.448  1.00 15.00 ?  929 PRO B HD2  1  
ATOM   616   H HD3  . PRO B 2 5  ? 4.589   -8.327  -1.075  1.00 15.00 ?  929 PRO B HD3  1  
ATOM   617   N N    . PRO B 2 6  ? 9.224   -6.648  1.433   1.00 15.00 ?  930 PRO B N    1  
ATOM   618   C CA   . PRO B 2 6  ? 9.689   -5.578  2.321   1.00 15.00 ?  930 PRO B CA   1  
ATOM   619   C C    . PRO B 2 6  ? 9.513   -4.206  1.679   1.00 15.00 ?  930 PRO B C    1  
ATOM   620   O O    . PRO B 2 6  ? 9.967   -3.980  0.553   1.00 15.00 ?  930 PRO B O    1  
ATOM   621   C CB   . PRO B 2 6  ? 11.180  -5.893  2.534   1.00 15.00 ?  930 PRO B CB   1  
ATOM   622   C CG   . PRO B 2 6  ? 11.508  -6.989  1.572   1.00 15.00 ?  930 PRO B CG   1  
ATOM   623   C CD   . PRO B 2 6  ? 10.222  -7.713  1.305   1.00 15.00 ?  930 PRO B CD   1  
ATOM   624   H HA   . PRO B 2 6  ? 9.171   -5.600  3.268   1.00 15.00 ?  930 PRO B HA   1  
ATOM   625   H HB2  . PRO B 2 6  ? 11.765  -5.008  2.335   1.00 15.00 ?  930 PRO B HB2  1  
ATOM   626   H HB3  . PRO B 2 6  ? 11.338  -6.208  3.555   1.00 15.00 ?  930 PRO B HB3  1  
ATOM   627   H HG2  . PRO B 2 6  ? 11.897  -6.568  0.657   1.00 15.00 ?  930 PRO B HG2  1  
ATOM   628   H HG3  . PRO B 2 6  ? 12.230  -7.659  2.014   1.00 15.00 ?  930 PRO B HG3  1  
ATOM   629   H HD2  . PRO B 2 6  ? 10.221  -8.130  0.309   1.00 15.00 ?  930 PRO B HD2  1  
ATOM   630   H HD3  . PRO B 2 6  ? 10.060  -8.485  2.044   1.00 15.00 ?  930 PRO B HD3  1  
ATOM   631   N N    . TYR B 2 7  ? 8.860   -3.300  2.405   1.00 15.00 ?  931 TYR B N    1  
ATOM   632   C CA   . TYR B 2 7  ? 8.448   -2.013  1.854   1.00 15.00 ?  931 TYR B CA   1  
ATOM   633   C C    . TYR B 2 7  ? 9.608   -1.272  1.194   1.00 15.00 ?  931 TYR B C    1  
ATOM   634   O O    . TYR B 2 7  ? 10.617  -0.958  1.828   1.00 15.00 ?  931 TYR B O    1  
ATOM   635   C CB   . TYR B 2 7  ? 7.823   -1.154  2.968   1.00 15.00 ?  931 TYR B CB   1  
ATOM   636   C CG   . TYR B 2 7  ? 7.715   0.330   2.656   1.00 15.00 ?  931 TYR B CG   1  
ATOM   637   C CD1  . TYR B 2 7  ? 6.719   0.836   1.822   1.00 15.00 ?  931 TYR B CD1  1  
ATOM   638   C CD2  . TYR B 2 7  ? 8.617   1.230   3.213   1.00 15.00 ?  931 TYR B CD2  1  
ATOM   639   C CE1  . TYR B 2 7  ? 6.635   2.188   1.557   1.00 15.00 ?  931 TYR B CE1  1  
ATOM   640   C CE2  . TYR B 2 7  ? 8.534   2.581   2.951   1.00 15.00 ?  931 TYR B CE2  1  
ATOM   641   C CZ   . TYR B 2 7  ? 7.543   3.054   2.124   1.00 15.00 ?  931 TYR B CZ   1  
ATOM   642   O OH   . TYR B 2 7  ? 7.460   4.402   1.859   1.00 15.00 ?  931 TYR B OH   1  
ATOM   643   H H    . TYR B 2 7  ? 8.653   -3.506  3.345   1.00 15.00 ?  931 TYR B H    1  
ATOM   644   H HA   . TYR B 2 7  ? 7.695   -2.205  1.105   1.00 15.00 ?  931 TYR B HA   1  
ATOM   645   H HB2  . TYR B 2 7  ? 6.827   -1.517  3.169   1.00 15.00 ?  931 TYR B HB2  1  
ATOM   646   H HB3  . TYR B 2 7  ? 8.421   -1.260  3.862   1.00 15.00 ?  931 TYR B HB3  1  
ATOM   647   H HD1  . TYR B 2 7  ? 6.007   0.162   1.375   1.00 15.00 ?  931 TYR B HD1  1  
ATOM   648   H HD2  . TYR B 2 7  ? 9.396   0.858   3.862   1.00 15.00 ?  931 TYR B HD2  1  
ATOM   649   H HE1  . TYR B 2 7  ? 5.856   2.562   0.909   1.00 15.00 ?  931 TYR B HE1  1  
ATOM   650   H HE2  . TYR B 2 7  ? 9.246   3.261   3.394   1.00 15.00 ?  931 TYR B HE2  1  
ATOM   651   H HH   . TYR B 2 7  ? 6.555   4.696   1.982   1.00 15.00 ?  931 TYR B HH   1  
ATOM   652   N N    . GLU B 2 8  ? 9.439   -1.020  -0.092  1.00 15.00 ?  932 GLU B N    1  
ATOM   653   C CA   . GLU B 2 8  ? 10.305  -0.137  -0.848  1.00 15.00 ?  932 GLU B CA   1  
ATOM   654   C C    . GLU B 2 8  ? 9.508   1.113   -1.171  1.00 15.00 ?  932 GLU B C    1  
ATOM   655   O O    . GLU B 2 8  ? 8.328   1.012   -1.510  1.00 15.00 ?  932 GLU B O    1  
ATOM   656   C CB   . GLU B 2 8  ? 10.754  -0.824  -2.140  1.00 15.00 ?  932 GLU B CB   1  
ATOM   657   C CG   . GLU B 2 8  ? 11.701  0.015   -2.980  1.00 15.00 ?  932 GLU B CG   1  
ATOM   658   C CD   . GLU B 2 8  ? 11.983  -0.607  -4.329  1.00 15.00 ?  932 GLU B CD   1  
ATOM   659   O OE1  . GLU B 2 8  ? 12.838  -1.515  -4.405  1.00 15.00 -1 932 GLU B OE1  1  
ATOM   660   O OE2  . GLU B 2 8  ? 11.356  -0.185  -5.321  1.00 15.00 ?  932 GLU B OE2  1  
ATOM   661   H H    . GLU B 2 8  ? 8.694   -1.451  -0.558  1.00 15.00 ?  932 GLU B H    1  
ATOM   662   H HA   . GLU B 2 8  ? 11.162  0.119   -0.245  1.00 15.00 ?  932 GLU B HA   1  
ATOM   663   H HB2  . GLU B 2 8  ? 11.255  -1.747  -1.887  1.00 15.00 ?  932 GLU B HB2  1  
ATOM   664   H HB3  . GLU B 2 8  ? 9.883   -1.049  -2.736  1.00 15.00 ?  932 GLU B HB3  1  
ATOM   665   H HG2  . GLU B 2 8  ? 11.260  0.988   -3.134  1.00 15.00 ?  932 GLU B HG2  1  
ATOM   666   H HG3  . GLU B 2 8  ? 12.634  0.123   -2.447  1.00 15.00 ?  932 GLU B HG3  1  
ATOM   667   N N    . THR B 2 9  ? 10.109  2.284   -1.078  1.00 15.00 ?  933 THR B N    1  
ATOM   668   C CA   . THR B 2 9  ? 9.351   3.480   -1.357  1.00 15.00 ?  933 THR B CA   1  
ATOM   669   C C    . THR B 2 9  ? 9.281   3.746   -2.854  1.00 15.00 ?  933 THR B C    1  
ATOM   670   O O    . THR B 2 9  ? 10.291  3.923   -3.538  1.00 15.00 ?  933 THR B O    1  
ATOM   671   C CB   . THR B 2 9  ? 9.900   4.721   -0.632  1.00 15.00 ?  933 THR B CB   1  
ATOM   672   O OG1  . THR B 2 9  ? 10.090  4.429   0.760   1.00 15.00 ?  933 THR B OG1  1  
ATOM   673   C CG2  . THR B 2 9  ? 8.924   5.888   -0.776  1.00 15.00 ?  933 THR B CG2  1  
ATOM   674   H H    . THR B 2 9  ? 11.062  2.342   -0.835  1.00 15.00 ?  933 THR B H    1  
ATOM   675   H HA   . THR B 2 9  ? 8.344   3.308   -0.999  1.00 15.00 ?  933 THR B HA   1  
ATOM   676   H HB   . THR B 2 9  ? 10.847  4.999   -1.074  1.00 15.00 ?  933 THR B HB   1  
ATOM   677   H HG1  . THR B 2 9  ? 9.223   4.356   1.189   1.00 15.00 ?  933 THR B HG1  1  
ATOM   678   H HG21 . THR B 2 9  ? 7.949   5.591   -0.408  1.00 15.00 ?  933 THR B HG21 1  
ATOM   679   H HG22 . THR B 2 9  ? 8.841   6.165   -1.817  1.00 15.00 ?  933 THR B HG22 1  
ATOM   680   H HG23 . THR B 2 9  ? 9.283   6.731   -0.206  1.00 15.00 ?  933 THR B HG23 1  
ATOM   681   N N    . PHE B 2 10 ? 8.059   3.756   -3.329  1.00 15.00 ?  934 PHE B N    1  
ATOM   682   C CA   . PHE B 2 10 ? 7.715   4.169   -4.672  1.00 15.00 ?  934 PHE B CA   1  
ATOM   683   C C    . PHE B 2 10 ? 7.444   5.677   -4.629  1.00 15.00 ?  934 PHE B C    1  
ATOM   684   O O    . PHE B 2 10 ? 7.582   6.280   -3.564  1.00 15.00 ?  934 PHE B O    1  
ATOM   685   C CB   . PHE B 2 10 ? 6.498   3.379   -5.176  1.00 15.00 ?  934 PHE B CB   1  
ATOM   686   C CG   . PHE B 2 10 ? 5.227   3.809   -4.529  1.00 15.00 ?  934 PHE B CG   1  
ATOM   687   C CD1  . PHE B 2 10 ? 4.823   3.287   -3.315  1.00 15.00 ?  934 PHE B CD1  1  
ATOM   688   C CD2  . PHE B 2 10 ? 4.464   4.785   -5.123  1.00 15.00 ?  934 PHE B CD2  1  
ATOM   689   C CE1  . PHE B 2 10 ? 3.680   3.747   -2.709  1.00 15.00 ?  934 PHE B CE1  1  
ATOM   690   C CE2  . PHE B 2 10 ? 3.319   5.241   -4.531  1.00 15.00 ?  934 PHE B CE2  1  
ATOM   691   C CZ   . PHE B 2 10 ? 2.931   4.726   -3.323  1.00 15.00 ?  934 PHE B CZ   1  
ATOM   692   H H    . PHE B 2 10 ? 7.337   3.466   -2.739  1.00 15.00 ?  934 PHE B H    1  
ATOM   693   H HA   . PHE B 2 10 ? 8.565   3.978   -5.312  1.00 15.00 ?  934 PHE B HA   1  
ATOM   694   H HB2  . PHE B 2 10 ? 6.397   3.520   -6.242  1.00 15.00 ?  934 PHE B HB2  1  
ATOM   695   H HB3  . PHE B 2 10 ? 6.642   2.329   -4.966  1.00 15.00 ?  934 PHE B HB3  1  
ATOM   696   H HD1  . PHE B 2 10 ? 5.409   2.513   -2.842  1.00 15.00 ?  934 PHE B HD1  1  
ATOM   697   H HD2  . PHE B 2 10 ? 4.772   5.178   -6.075  1.00 15.00 ?  934 PHE B HD2  1  
ATOM   698   H HE1  . PHE B 2 10 ? 3.365   3.337   -1.761  1.00 15.00 ?  934 PHE B HE1  1  
ATOM   699   H HE2  . PHE B 2 10 ? 2.728   6.008   -5.008  1.00 15.00 ?  934 PHE B HE2  1  
ATOM   700   H HZ   . PHE B 2 10 ? 2.052   5.093   -2.858  1.00 15.00 ?  934 PHE B HZ   1  
ATOM   701   N N    . GLU B 2 11 ? 7.083   6.285   -5.757  1.00 15.00 ?  935 GLU B N    1  
ATOM   702   C CA   . GLU B 2 11 ? 6.949   7.743   -5.849  1.00 15.00 ?  935 GLU B CA   1  
ATOM   703   C C    . GLU B 2 11 ? 6.130   8.319   -4.688  1.00 15.00 ?  935 GLU B C    1  
ATOM   704   O O    . GLU B 2 11 ? 5.001   7.903   -4.421  1.00 15.00 ?  935 GLU B O    1  
ATOM   705   C CB   . GLU B 2 11 ? 6.268   8.131   -7.171  1.00 15.00 ?  935 GLU B CB   1  
ATOM   706   C CG   . GLU B 2 11 ? 4.969   7.376   -7.465  1.00 15.00 ?  935 GLU B CG   1  
ATOM   707   C CD   . GLU B 2 11 ? 5.200   6.142   -8.320  1.00 15.00 ?  935 GLU B CD   1  
ATOM   708   O OE1  . GLU B 2 11 ? 5.867   5.192   -7.851  1.00 15.00 -1 935 GLU B OE1  1  
ATOM   709   O OE2  . GLU B 2 11 ? 4.746   6.133   -9.482  1.00 15.00 ?  935 GLU B OE2  1  
ATOM   710   H H    . GLU B 2 11 ? 6.874   5.737   -6.550  1.00 15.00 ?  935 GLU B H    1  
ATOM   711   H HA   . GLU B 2 11 ? 7.940   8.172   -5.828  1.00 15.00 ?  935 GLU B HA   1  
ATOM   712   H HB2  . GLU B 2 11 ? 6.043   9.187   -7.146  1.00 15.00 ?  935 GLU B HB2  1  
ATOM   713   H HB3  . GLU B 2 11 ? 6.956   7.941   -7.981  1.00 15.00 ?  935 GLU B HB3  1  
ATOM   714   H HG2  . GLU B 2 11 ? 4.505   7.071   -6.525  1.00 15.00 ?  935 GLU B HG2  1  
ATOM   715   H HG3  . GLU B 2 11 ? 4.298   8.039   -7.992  1.00 15.00 ?  935 GLU B HG3  1  
ATOM   716   N N    . ASP B 2 12 ? 6.729   9.289   -4.008  1.00 15.00 ?  936 ASP B N    1  
ATOM   717   C CA   . ASP B 2 12 ? 6.151   9.872   -2.804  1.00 15.00 ?  936 ASP B CA   1  
ATOM   718   C C    . ASP B 2 12 ? 4.994   10.809  -3.135  1.00 15.00 ?  936 ASP B C    1  
ATOM   719   O O    . ASP B 2 12 ? 4.965   11.438  -4.195  1.00 15.00 ?  936 ASP B O    1  
ATOM   720   C CB   . ASP B 2 12 ? 7.227   10.623  -2.013  1.00 15.00 ?  936 ASP B CB   1  
ATOM   721   C CG   . ASP B 2 12 ? 6.666   11.312  -0.784  1.00 15.00 ?  936 ASP B CG   1  
ATOM   722   O OD1  . ASP B 2 12 ? 6.035   10.630  0.053   1.00 15.00 ?  936 ASP B OD1  1  
ATOM   723   O OD2  . ASP B 2 12 ? 6.852   12.541  -0.652  1.00 15.00 -1 936 ASP B OD2  1  
ATOM   724   H H    . ASP B 2 12 ? 7.588   9.630   -4.334  1.00 15.00 ?  936 ASP B H    1  
ATOM   725   H HA   . ASP B 2 12 ? 5.777   9.063   -2.196  1.00 15.00 ?  936 ASP B HA   1  
ATOM   726   H HB2  . ASP B 2 12 ? 7.985   9.923   -1.694  1.00 15.00 ?  936 ASP B HB2  1  
ATOM   727   H HB3  . ASP B 2 12 ? 7.678   11.370  -2.649  1.00 15.00 ?  936 ASP B HB3  1  
ATOM   728   N N    . LEU B 2 13 ? 4.066   10.917  -2.198  1.00 15.00 ?  937 LEU B N    1  
ATOM   729   C CA   . LEU B 2 13 ? 2.851   11.694  -2.387  1.00 15.00 ?  937 LEU B CA   1  
ATOM   730   C C    . LEU B 2 13 ? 2.973   13.050  -1.702  1.00 15.00 ?  937 LEU B C    1  
ATOM   731   O O    . LEU B 2 13 ? 2.682   13.186  -0.514  1.00 15.00 ?  937 LEU B O    1  
ATOM   732   C CB   . LEU B 2 13 ? 1.637   10.936  -1.827  1.00 15.00 ?  937 LEU B CB   1  
ATOM   733   C CG   . LEU B 2 13 ? 1.222   9.663   -2.582  1.00 15.00 ?  937 LEU B CG   1  
ATOM   734   C CD1  . LEU B 2 13 ? 0.940   9.965   -4.045  1.00 15.00 ?  937 LEU B CD1  1  
ATOM   735   C CD2  . LEU B 2 13 ? 2.283   8.579   -2.457  1.00 15.00 ?  937 LEU B CD2  1  
ATOM   736   H H    . LEU B 2 13 ? 4.214   10.471  -1.335  1.00 15.00 ?  937 LEU B H    1  
ATOM   737   H HA   . LEU B 2 13 ? 2.713   11.846  -3.448  1.00 15.00 ?  937 LEU B HA   1  
ATOM   738   H HB2  . LEU B 2 13 ? 1.859   10.660  -0.806  1.00 15.00 ?  937 LEU B HB2  1  
ATOM   739   H HB3  . LEU B 2 13 ? 0.795   11.610  -1.821  1.00 15.00 ?  937 LEU B HB3  1  
ATOM   740   H HG   . LEU B 2 13 ? 0.310   9.283   -2.146  1.00 15.00 ?  937 LEU B HG   1  
ATOM   741   H HD11 . LEU B 2 13 ? 1.828   10.369  -4.508  1.00 15.00 ?  937 LEU B HD11 1  
ATOM   742   H HD12 . LEU B 2 13 ? 0.138   10.685  -4.116  1.00 15.00 ?  937 LEU B HD12 1  
ATOM   743   H HD13 . LEU B 2 13 ? 0.652   9.055   -4.551  1.00 15.00 ?  937 LEU B HD13 1  
ATOM   744   H HD21 . LEU B 2 13 ? 3.215   8.936   -2.870  1.00 15.00 ?  937 LEU B HD21 1  
ATOM   745   H HD22 . LEU B 2 13 ? 1.964   7.699   -2.995  1.00 15.00 ?  937 LEU B HD22 1  
ATOM   746   H HD23 . LEU B 2 13 ? 2.423   8.332   -1.414  1.00 15.00 ?  937 LEU B HD23 1  
HETATM 747   N N    . NH2 B 2 14 ? 3.410   14.051  -2.449  1.00 15.00 ?  938 NH2 B N    1  
HETATM 748   H HN1  . NH2 B 2 14 ? 3.623   13.869  -3.390  1.00 15.00 ?  938 NH2 B HN1  1  
HETATM 749   H HN2  . NH2 B 2 14 ? 3.501   14.934  -2.032  1.00 15.00 ?  938 NH2 B HN2  1  
ATOM   750   N N    . PHE A 1 7  ? -12.016 8.361   -1.087  1.00 15.00 ?  478 PHE A N    2  
ATOM   751   C CA   . PHE A 1 7  ? -10.542 8.294   -1.206  1.00 15.00 ?  478 PHE A CA   2  
ATOM   752   C C    . PHE A 1 7  ? -9.960  7.569   0.003   1.00 15.00 ?  478 PHE A C    2  
ATOM   753   O O    . PHE A 1 7  ? -10.702 6.989   0.795   1.00 15.00 ?  478 PHE A O    2  
ATOM   754   C CB   . PHE A 1 7  ? -9.948  9.703   -1.335  1.00 15.00 ?  478 PHE A CB   2  
ATOM   755   C CG   . PHE A 1 7  ? -10.265 10.376  -2.642  1.00 15.00 ?  478 PHE A CG   2  
ATOM   756   C CD1  . PHE A 1 7  ? -9.599  10.010  -3.801  1.00 15.00 ?  478 PHE A CD1  2  
ATOM   757   C CD2  . PHE A 1 7  ? -11.225 11.372  -2.713  1.00 15.00 ?  478 PHE A CD2  2  
ATOM   758   C CE1  . PHE A 1 7  ? -9.885  10.625  -5.005  1.00 15.00 ?  478 PHE A CE1  2  
ATOM   759   C CE2  . PHE A 1 7  ? -11.516 11.989  -3.915  1.00 15.00 ?  478 PHE A CE2  2  
ATOM   760   C CZ   . PHE A 1 7  ? -10.845 11.615  -5.063  1.00 15.00 ?  478 PHE A CZ   2  
ATOM   761   H H    . PHE A 1 7  ? -12.430 8.832   -1.919  1.00 15.00 ?  478 PHE A H    2  
ATOM   762   H HA   . PHE A 1 7  ? -10.304 7.726   -2.095  1.00 15.00 ?  478 PHE A HA   2  
ATOM   763   H HB2  . PHE A 1 7  ? -10.337 10.323  -0.544  1.00 15.00 ?  478 PHE A HB2  2  
ATOM   764   H HB3  . PHE A 1 7  ? -8.875  9.649   -1.245  1.00 15.00 ?  478 PHE A HB3  2  
ATOM   765   H HD1  . PHE A 1 7  ? -8.847  9.235   -3.759  1.00 15.00 ?  478 PHE A HD1  2  
ATOM   766   H HD2  . PHE A 1 7  ? -11.749 11.667  -1.817  1.00 15.00 ?  478 PHE A HD2  2  
ATOM   767   H HE1  . PHE A 1 7  ? -9.359  10.329  -5.902  1.00 15.00 ?  478 PHE A HE1  2  
ATOM   768   H HE2  . PHE A 1 7  ? -12.267 12.764  -3.957  1.00 15.00 ?  478 PHE A HE2  2  
ATOM   769   H HZ   . PHE A 1 7  ? -11.070 12.096  -6.002  1.00 15.00 ?  478 PHE A HZ   2  
ATOM   770   N N    . LEU A 1 8  ? -8.640  7.566   0.127   1.00 15.00 ?  479 LEU A N    2  
ATOM   771   C CA   . LEU A 1 8  ? -7.987  6.937   1.263   1.00 15.00 ?  479 LEU A CA   2  
ATOM   772   C C    . LEU A 1 8  ? -7.811  7.908   2.413   1.00 15.00 ?  479 LEU A C    2  
ATOM   773   O O    . LEU A 1 8  ? -7.605  9.106   2.200   1.00 15.00 ?  479 LEU A O    2  
ATOM   774   C CB   . LEU A 1 8  ? -6.589  6.441   0.906   1.00 15.00 ?  479 LEU A CB   2  
ATOM   775   C CG   . LEU A 1 8  ? -6.477  5.129   0.136   1.00 15.00 ?  479 LEU A CG   2  
ATOM   776   C CD1  . LEU A 1 8  ? -7.506  4.113   0.597   1.00 15.00 ?  479 LEU A CD1  2  
ATOM   777   C CD2  . LEU A 1 8  ? -6.576  5.365   -1.361  1.00 15.00 ?  479 LEU A CD2  2  
ATOM   778   H H    . LEU A 1 8  ? -8.090  7.996   -0.557  1.00 15.00 ?  479 LEU A H    2  
ATOM   779   H HA   . LEU A 1 8  ? -8.592  6.102   1.585   1.00 15.00 ?  479 LEU A HA   2  
ATOM   780   H HB2  . LEU A 1 8  ? -6.109  7.207   0.317   1.00 15.00 ?  479 LEU A HB2  2  
ATOM   781   H HB3  . LEU A 1 8  ? -6.035  6.332   1.827   1.00 15.00 ?  479 LEU A HB3  2  
ATOM   782   H HG   . LEU A 1 8  ? -5.499  4.713   0.345   1.00 15.00 ?  479 LEU A HG   2  
ATOM   783   H HD11 . LEU A 1 8  ? -7.403  3.212   0.011   1.00 15.00 ?  479 LEU A HD11 2  
ATOM   784   H HD12 . LEU A 1 8  ? -8.497  4.519   0.466   1.00 15.00 ?  479 LEU A HD12 2  
ATOM   785   H HD13 . LEU A 1 8  ? -7.343  3.885   1.640   1.00 15.00 ?  479 LEU A HD13 2  
ATOM   786   H HD21 . LEU A 1 8  ? -7.529  5.817   -1.592  1.00 15.00 ?  479 LEU A HD21 2  
ATOM   787   H HD22 . LEU A 1 8  ? -6.488  4.421   -1.879  1.00 15.00 ?  479 LEU A HD22 2  
ATOM   788   H HD23 . LEU A 1 8  ? -5.779  6.023   -1.674  1.00 15.00 ?  479 LEU A HD23 2  
ATOM   789   N N    . PRO A 1 9  ? -7.892  7.386   3.643   1.00 15.00 ?  480 PRO A N    2  
ATOM   790   C CA   . PRO A 1 9  ? -7.282  8.007   4.817   1.00 15.00 ?  480 PRO A CA   2  
ATOM   791   C C    . PRO A 1 9  ? -5.905  8.596   4.495   1.00 15.00 ?  480 PRO A C    2  
ATOM   792   O O    . PRO A 1 9  ? -5.125  7.989   3.756   1.00 15.00 ?  480 PRO A O    2  
ATOM   793   C CB   . PRO A 1 9  ? -7.146  6.795   5.731   1.00 15.00 ?  480 PRO A CB   2  
ATOM   794   C CG   . PRO A 1 9  ? -8.405  6.052   5.497   1.00 15.00 ?  480 PRO A CG   2  
ATOM   795   C CD   . PRO A 1 9  ? -8.637  6.160   4.010   1.00 15.00 ?  480 PRO A CD   2  
ATOM   796   H HA   . PRO A 1 9  ? -7.917  8.751   5.270   1.00 15.00 ?  480 PRO A HA   2  
ATOM   797   H HB2  . PRO A 1 9  ? -6.298  6.211   5.429   1.00 15.00 ?  480 PRO A HB2  2  
ATOM   798   H HB3  . PRO A 1 9  ? -7.030  7.100   6.752   1.00 15.00 ?  480 PRO A HB3  2  
ATOM   799   H HG2  . PRO A 1 9  ? -8.288  5.019   5.791   1.00 15.00 ?  480 PRO A HG2  2  
ATOM   800   H HG3  . PRO A 1 9  ? -9.217  6.514   6.039   1.00 15.00 ?  480 PRO A HG3  2  
ATOM   801   H HD2  . PRO A 1 9  ? -8.237  5.295   3.499   1.00 15.00 ?  480 PRO A HD2  2  
ATOM   802   H HD3  . PRO A 1 9  ? -9.691  6.270   3.799   1.00 15.00 ?  480 PRO A HD3  2  
ATOM   803   N N    . PRO A 1 10 ? -5.585  9.772   5.056   1.00 15.00 ?  481 PRO A N    2  
ATOM   804   C CA   . PRO A 1 10 ? -4.340  10.487  4.758   1.00 15.00 ?  481 PRO A CA   2  
ATOM   805   C C    . PRO A 1 10 ? -3.091  9.617   4.914   1.00 15.00 ?  481 PRO A C    2  
ATOM   806   O O    . PRO A 1 10 ? -2.705  9.244   6.025   1.00 15.00 ?  481 PRO A O    2  
ATOM   807   C CB   . PRO A 1 10 ? -4.322  11.642  5.771   1.00 15.00 ?  481 PRO A CB   2  
ATOM   808   C CG   . PRO A 1 10 ? -5.379  11.307  6.774   1.00 15.00 ?  481 PRO A CG   2  
ATOM   809   C CD   . PRO A 1 10 ? -6.403  10.499  6.035   1.00 15.00 ?  481 PRO A CD   2  
ATOM   810   H HA   . PRO A 1 10 ? -4.359  10.892  3.756   1.00 15.00 ?  481 PRO A HA   2  
ATOM   811   H HB2  . PRO A 1 10 ? -3.348  11.704  6.232   1.00 15.00 ?  481 PRO A HB2  2  
ATOM   812   H HB3  . PRO A 1 10 ? -4.544  12.568  5.263   1.00 15.00 ?  481 PRO A HB3  2  
ATOM   813   H HG2  . PRO A 1 10 ? -4.950  10.724  7.578   1.00 15.00 ?  481 PRO A HG2  2  
ATOM   814   H HG3  . PRO A 1 10 ? -5.821  12.213  7.161   1.00 15.00 ?  481 PRO A HG3  2  
ATOM   815   H HD2  . PRO A 1 10 ? -6.908  9.818   6.706   1.00 15.00 ?  481 PRO A HD2  2  
ATOM   816   H HD3  . PRO A 1 10 ? -7.113  11.145  5.541   1.00 15.00 ?  481 PRO A HD3  2  
ATOM   817   N N    . GLY A 1 11 ? -2.488  9.265   3.786   1.00 15.00 ?  482 GLY A N    2  
ATOM   818   C CA   . GLY A 1 11 ? -1.264  8.492   3.802   1.00 15.00 ?  482 GLY A CA   2  
ATOM   819   C C    . GLY A 1 11 ? -1.448  7.086   3.296   1.00 15.00 ?  482 GLY A C    2  
ATOM   820   O O    . GLY A 1 11 ? -0.470  6.368   3.128   1.00 15.00 ?  482 GLY A O    2  
ATOM   821   H H    . GLY A 1 11 ? -2.885  9.527   2.925   1.00 15.00 ?  482 GLY A H    2  
ATOM   822   H HA2  . GLY A 1 11 ? -0.540  8.986   3.179   1.00 15.00 ?  482 GLY A HA2  2  
ATOM   823   H HA3  . GLY A 1 11 ? -0.878  8.448   4.804   1.00 15.00 ?  482 GLY A HA3  2  
ATOM   824   N N    . TRP A 1 12 ? -2.677  6.688   3.031   1.00 15.00 ?  483 TRP A N    2  
ATOM   825   C CA   . TRP A 1 12 ? -2.917  5.371   2.473   1.00 15.00 ?  483 TRP A CA   2  
ATOM   826   C C    . TRP A 1 12 ? -2.877  5.473   0.973   1.00 15.00 ?  483 TRP A C    2  
ATOM   827   O O    . TRP A 1 12 ? -3.622  6.236   0.367   1.00 15.00 ?  483 TRP A O    2  
ATOM   828   C CB   . TRP A 1 12 ? -4.262  4.797   2.913   1.00 15.00 ?  483 TRP A CB   2  
ATOM   829   C CG   . TRP A 1 12 ? -4.292  4.370   4.342   1.00 15.00 ?  483 TRP A CG   2  
ATOM   830   C CD1  . TRP A 1 12 ? -4.405  5.180   5.425   1.00 15.00 ?  483 TRP A CD1  2  
ATOM   831   C CD2  . TRP A 1 12 ? -4.216  3.028   4.838   1.00 15.00 ?  483 TRP A CD2  2  
ATOM   832   N NE1  . TRP A 1 12 ? -4.409  4.430   6.577   1.00 15.00 ?  483 TRP A NE1  2  
ATOM   833   C CE2  . TRP A 1 12 ? -4.291  3.103   6.242   1.00 15.00 ?  483 TRP A CE2  2  
ATOM   834   C CE3  . TRP A 1 12 ? -4.093  1.769   4.233   1.00 15.00 ?  483 TRP A CE3  2  
ATOM   835   C CZ2  . TRP A 1 12 ? -4.248  1.969   7.049   1.00 15.00 ?  483 TRP A CZ2  2  
ATOM   836   C CZ3  . TRP A 1 12 ? -4.048  0.647   5.040   1.00 15.00 ?  483 TRP A CZ3  2  
ATOM   837   C CH2  . TRP A 1 12 ? -4.127  0.755   6.434   1.00 15.00 ?  483 TRP A CH2  2  
ATOM   838   H H    . TRP A 1 12 ? -3.435  7.288   3.208   1.00 15.00 ?  483 TRP A H    2  
ATOM   839   H HA   . TRP A 1 12 ? -2.121  4.717   2.802   1.00 15.00 ?  483 TRP A HA   2  
ATOM   840   H HB2  . TRP A 1 12 ? -5.028  5.545   2.774   1.00 15.00 ?  483 TRP A HB2  2  
ATOM   841   H HB3  . TRP A 1 12 ? -4.494  3.936   2.303   1.00 15.00 ?  483 TRP A HB3  2  
ATOM   842   H HD1  . TRP A 1 12 ? -4.487  6.258   5.367   1.00 15.00 ?  483 TRP A HD1  2  
ATOM   843   H HE1  . TRP A 1 12 ? -4.481  4.786   7.490   1.00 15.00 ?  483 TRP A HE1  2  
ATOM   844   H HE3  . TRP A 1 12 ? -4.029  1.664   3.157   1.00 15.00 ?  483 TRP A HE3  2  
ATOM   845   H HZ2  . TRP A 1 12 ? -4.313  2.030   8.123   1.00 15.00 ?  483 TRP A HZ2  2  
ATOM   846   H HZ3  . TRP A 1 12 ? -3.952  -0.333  4.594   1.00 15.00 ?  483 TRP A HZ3  2  
ATOM   847   H HH2  . TRP A 1 12 ? -4.085  -0.148  7.024   1.00 15.00 ?  483 TRP A HH2  2  
ATOM   848   N N    . GLU A 1 13 ? -1.984  4.725   0.381   1.00 15.00 ?  484 GLU A N    2  
ATOM   849   C CA   . GLU A 1 13 ? -1.754  4.824   -1.033  1.00 15.00 ?  484 GLU A CA   2  
ATOM   850   C C    . GLU A 1 13 ? -2.004  3.504   -1.733  1.00 15.00 ?  484 GLU A C    2  
ATOM   851   O O    . GLU A 1 13 ? -1.442  2.471   -1.368  1.00 15.00 ?  484 GLU A O    2  
ATOM   852   C CB   . GLU A 1 13 ? -0.336  5.314   -1.279  1.00 15.00 ?  484 GLU A CB   2  
ATOM   853   C CG   . GLU A 1 13 ? -0.253  6.814   -1.468  1.00 15.00 ?  484 GLU A CG   2  
ATOM   854   C CD   . GLU A 1 13 ? -1.215  7.307   -2.531  1.00 15.00 ?  484 GLU A CD   2  
ATOM   855   O OE1  . GLU A 1 13 ? -1.158  6.796   -3.669  1.00 15.00 ?  484 GLU A OE1  2  
ATOM   856   O OE2  . GLU A 1 13 ? -2.026  8.205   -2.230  1.00 15.00 -1 484 GLU A OE2  2  
ATOM   857   H H    . GLU A 1 13 ? -1.455  4.092   0.914   1.00 15.00 ?  484 GLU A H    2  
ATOM   858   H HA   . GLU A 1 13 ? -2.445  5.556   -1.426  1.00 15.00 ?  484 GLU A HA   2  
ATOM   859   H HB2  . GLU A 1 13 ? 0.277   5.045   -0.431  1.00 15.00 ?  484 GLU A HB2  2  
ATOM   860   H HB3  . GLU A 1 13 ? 0.052   4.839   -2.151  1.00 15.00 ?  484 GLU A HB3  2  
ATOM   861   H HG2  . GLU A 1 13 ? -0.487  7.299   -0.534  1.00 15.00 ?  484 GLU A HG2  2  
ATOM   862   H HG3  . GLU A 1 13 ? 0.749   7.067   -1.768  1.00 15.00 ?  484 GLU A HG3  2  
ATOM   863   N N    . MET A 1 14 ? -2.850  3.563   -2.747  1.00 15.00 ?  485 MET A N    2  
ATOM   864   C CA   . MET A 1 14 ? -3.167  2.399   -3.567  1.00 15.00 ?  485 MET A CA   2  
ATOM   865   C C    . MET A 1 14 ? -2.280  2.384   -4.793  1.00 15.00 ?  485 MET A C    2  
ATOM   866   O O    . MET A 1 14 ? -2.463  3.186   -5.707  1.00 15.00 ?  485 MET A O    2  
ATOM   867   C CB   . MET A 1 14 ? -4.632  2.399   -4.015  1.00 15.00 ?  485 MET A CB   2  
ATOM   868   C CG   . MET A 1 14 ? -5.616  2.128   -2.911  1.00 15.00 ?  485 MET A CG   2  
ATOM   869   S SD   . MET A 1 14 ? -7.307  1.961   -3.522  1.00 15.00 ?  485 MET A SD   2  
ATOM   870   C CE   . MET A 1 14 ? -7.558  3.555   -4.302  1.00 15.00 ?  485 MET A CE   2  
ATOM   871   H H    . MET A 1 14 ? -3.254  4.429   -2.964  1.00 15.00 ?  485 MET A H    2  
ATOM   872   H HA   . MET A 1 14 ? -2.973  1.511   -2.979  1.00 15.00 ?  485 MET A HA   2  
ATOM   873   H HB2  . MET A 1 14 ? -4.869  3.360   -4.430  1.00 15.00 ?  485 MET A HB2  2  
ATOM   874   H HB3  . MET A 1 14 ? -4.764  1.644   -4.777  1.00 15.00 ?  485 MET A HB3  2  
ATOM   875   H HG2  . MET A 1 14 ? -5.329  1.208   -2.423  1.00 15.00 ?  485 MET A HG2  2  
ATOM   876   H HG3  . MET A 1 14 ? -5.579  2.941   -2.201  1.00 15.00 ?  485 MET A HG3  2  
ATOM   877   H HE1  . MET A 1 14 ? -7.441  4.338   -3.567  1.00 15.00 ?  485 MET A HE1  2  
ATOM   878   H HE2  . MET A 1 14 ? -8.553  3.599   -4.720  1.00 15.00 ?  485 MET A HE2  2  
ATOM   879   H HE3  . MET A 1 14 ? -6.831  3.690   -5.090  1.00 15.00 ?  485 MET A HE3  2  
ATOM   880   N N    . ARG A 1 15 ? -1.311  1.492   -4.804  1.00 15.00 ?  486 ARG A N    2  
ATOM   881   C CA   . ARG A 1 15 ? -0.364  1.415   -5.908  1.00 15.00 ?  486 ARG A CA   2  
ATOM   882   C C    . ARG A 1 15 ? -0.173  -0.030  -6.331  1.00 15.00 ?  486 ARG A C    2  
ATOM   883   O O    . ARG A 1 15 ? -0.097  -0.927  -5.489  1.00 15.00 ?  486 ARG A O    2  
ATOM   884   C CB   . ARG A 1 15 ? 0.976   2.039   -5.510  1.00 15.00 ?  486 ARG A CB   2  
ATOM   885   C CG   . ARG A 1 15 ? 0.868   3.504   -5.114  1.00 15.00 ?  486 ARG A CG   2  
ATOM   886   C CD   . ARG A 1 15 ? 0.345   4.368   -6.255  1.00 15.00 ?  486 ARG A CD   2  
ATOM   887   N NE   . ARG A 1 15 ? 1.291   4.456   -7.368  1.00 15.00 ?  486 ARG A NE   2  
ATOM   888   C CZ   . ARG A 1 15 ? 0.931   4.645   -8.637  1.00 15.00 ?  486 ARG A CZ   2  
ATOM   889   N NH1  . ARG A 1 15 ? -0.354  4.715   -8.966  1.00 15.00 1  486 ARG A NH1  2  
ATOM   890   N NH2  . ARG A 1 15 ? 1.859   4.764   -9.575  1.00 15.00 ?  486 ARG A NH2  2  
ATOM   891   H H    . ARG A 1 15 ? -1.236  0.858   -4.053  1.00 15.00 ?  486 ARG A H    2  
ATOM   892   H HA   . ARG A 1 15 ? -0.777  1.968   -6.739  1.00 15.00 ?  486 ARG A HA   2  
ATOM   893   H HB2  . ARG A 1 15 ? 1.382   1.490   -4.673  1.00 15.00 ?  486 ARG A HB2  2  
ATOM   894   H HB3  . ARG A 1 15 ? 1.657   1.963   -6.344  1.00 15.00 ?  486 ARG A HB3  2  
ATOM   895   H HG2  . ARG A 1 15 ? 0.194   3.589   -4.276  1.00 15.00 ?  486 ARG A HG2  2  
ATOM   896   H HG3  . ARG A 1 15 ? 1.847   3.860   -4.826  1.00 15.00 ?  486 ARG A HG3  2  
ATOM   897   H HD2  . ARG A 1 15 ? -0.579  3.940   -6.618  1.00 15.00 ?  486 ARG A HD2  2  
ATOM   898   H HD3  . ARG A 1 15 ? 0.155   5.361   -5.877  1.00 15.00 ?  486 ARG A HD3  2  
ATOM   899   H HE   . ARG A 1 15 ? 2.250   4.393   -7.153  1.00 15.00 ?  486 ARG A HE   2  
ATOM   900   H HH11 . ARG A 1 15 ? -1.066  4.630   -8.261  1.00 15.00 ?  486 ARG A HH11 2  
ATOM   901   H HH12 . ARG A 1 15 ? -0.625  4.844   -9.927  1.00 15.00 ?  486 ARG A HH12 2  
ATOM   902   H HH21 . ARG A 1 15 ? 2.842   4.713   -9.329  1.00 15.00 ?  486 ARG A HH21 2  
ATOM   903   H HH22 . ARG A 1 15 ? 1.600   4.924   -10.534 1.00 15.00 ?  486 ARG A HH22 2  
ATOM   904   N N    . ILE A 1 16 ? -0.096  -0.254  -7.632  1.00 15.00 ?  487 ILE A N    2  
ATOM   905   C CA   . ILE A 1 16 ? -0.016  -1.604  -8.159  1.00 15.00 ?  487 ILE A CA   2  
ATOM   906   C C    . ILE A 1 16 ? 1.394   -1.975  -8.598  1.00 15.00 ?  487 ILE A C    2  
ATOM   907   O O    . ILE A 1 16 ? 2.118   -1.175  -9.197  1.00 15.00 ?  487 ILE A O    2  
ATOM   908   C CB   . ILE A 1 16 ? -1.028  -1.818  -9.314  1.00 15.00 ?  487 ILE A CB   2  
ATOM   909   C CG1  . ILE A 1 16 ? -0.926  -3.235  -9.881  1.00 15.00 ?  487 ILE A CG1  2  
ATOM   910   C CG2  . ILE A 1 16 ? -0.826  -0.788  -10.411 1.00 15.00 ?  487 ILE A CG2  2  
ATOM   911   C CD1  . ILE A 1 16 ? -1.972  -3.547  -10.926 1.00 15.00 ?  487 ILE A CD1  2  
ATOM   912   H H    . ILE A 1 16 ? -0.091  0.506   -8.253  1.00 15.00 ?  487 ILE A H    2  
ATOM   913   H HA   . ILE A 1 16 ? -0.281  -2.274  -7.366  1.00 15.00 ?  487 ILE A HA   2  
ATOM   914   H HB   . ILE A 1 16 ? -2.019  -1.677  -8.911  1.00 15.00 ?  487 ILE A HB   2  
ATOM   915   H HG12 . ILE A 1 16 ? 0.044   -3.364  -10.337 1.00 15.00 ?  487 ILE A HG12 2  
ATOM   916   H HG13 . ILE A 1 16 ? -1.038  -3.947  -9.076  1.00 15.00 ?  487 ILE A HG13 2  
ATOM   917   H HG21 . ILE A 1 16 ? -1.542  -0.963  -11.200 1.00 15.00 ?  487 ILE A HG21 2  
ATOM   918   H HG22 . ILE A 1 16 ? 0.174   -0.872  -10.806 1.00 15.00 ?  487 ILE A HG22 2  
ATOM   919   H HG23 . ILE A 1 16 ? -0.974  0.201   -10.005 1.00 15.00 ?  487 ILE A HG23 2  
ATOM   920   H HD11 . ILE A 1 16 ? -1.870  -2.861  -11.754 1.00 15.00 ?  487 ILE A HD11 2  
ATOM   921   H HD12 . ILE A 1 16 ? -2.957  -3.444  -10.491 1.00 15.00 ?  487 ILE A HD12 2  
ATOM   922   H HD13 . ILE A 1 16 ? -1.838  -4.558  -11.279 1.00 15.00 ?  487 ILE A HD13 2  
ATOM   923   N N    . ALA A 1 17 ? 1.760   -3.207  -8.278  1.00 15.00 ?  488 ALA A N    2  
ATOM   924   C CA   . ALA A 1 17 ? 3.046   -3.763  -8.640  1.00 15.00 ?  488 ALA A CA   2  
ATOM   925   C C    . ALA A 1 17 ? 2.933   -4.433  -10.001 1.00 15.00 ?  488 ALA A C    2  
ATOM   926   O O    . ALA A 1 17 ? 1.858   -4.918  -10.356 1.00 15.00 ?  488 ALA A O    2  
ATOM   927   C CB   . ALA A 1 17 ? 3.490   -4.777  -7.594  1.00 15.00 ?  488 ALA A CB   2  
ATOM   928   H H    . ALA A 1 17 ? 1.128   -3.768  -7.775  1.00 15.00 ?  488 ALA A H    2  
ATOM   929   H HA   . ALA A 1 17 ? 3.768   -2.964  -8.676  1.00 15.00 ?  488 ALA A HA   2  
ATOM   930   H HB1  . ALA A 1 17 ? 3.618   -4.284  -6.646  1.00 15.00 ?  488 ALA A HB1  2  
ATOM   931   H HB2  . ALA A 1 17 ? 4.427   -5.221  -7.896  1.00 15.00 ?  488 ALA A HB2  2  
ATOM   932   H HB3  . ALA A 1 17 ? 2.741   -5.549  -7.498  1.00 15.00 ?  488 ALA A HB3  2  
ATOM   933   N N    . PRO A 1 18 ? 4.026   -4.465  -10.783 1.00 15.00 ?  489 PRO A N    2  
ATOM   934   C CA   . PRO A 1 18 ? 4.032   -5.047  -12.137 1.00 15.00 ?  489 PRO A CA   2  
ATOM   935   C C    . PRO A 1 18 ? 3.596   -6.518  -12.179 1.00 15.00 ?  489 PRO A C    2  
ATOM   936   O O    . PRO A 1 18 ? 3.473   -7.103  -13.254 1.00 15.00 ?  489 PRO A O    2  
ATOM   937   C CB   . PRO A 1 18 ? 5.491   -4.916  -12.590 1.00 15.00 ?  489 PRO A CB   2  
ATOM   938   C CG   . PRO A 1 18 ? 6.272   -4.646  -11.347 1.00 15.00 ?  489 PRO A CG   2  
ATOM   939   C CD   . PRO A 1 18 ? 5.344   -3.919  -10.421 1.00 15.00 ?  489 PRO A CD   2  
ATOM   940   H HA   . PRO A 1 18 ? 3.400   -4.478  -12.804 1.00 15.00 ?  489 PRO A HA   2  
ATOM   941   H HB2  . PRO A 1 18 ? 5.805   -5.836  -13.061 1.00 15.00 ?  489 PRO A HB2  2  
ATOM   942   H HB3  . PRO A 1 18 ? 5.576   -4.101  -13.294 1.00 15.00 ?  489 PRO A HB3  2  
ATOM   943   H HG2  . PRO A 1 18 ? 6.588   -5.578  -10.904 1.00 15.00 ?  489 PRO A HG2  2  
ATOM   944   H HG3  . PRO A 1 18 ? 7.129   -4.030  -11.579 1.00 15.00 ?  489 PRO A HG3  2  
ATOM   945   H HD2  . PRO A 1 18 ? 5.585   -4.143  -9.391  1.00 15.00 ?  489 PRO A HD2  2  
ATOM   946   H HD3  . PRO A 1 18 ? 5.384   -2.856  -10.599 1.00 15.00 ?  489 PRO A HD3  2  
ATOM   947   N N    . ASN A 1 19 ? 3.385   -7.114  -11.009 1.00 15.00 ?  490 ASN A N    2  
ATOM   948   C CA   . ASN A 1 19 ? 2.873   -8.479  -10.913 1.00 15.00 ?  490 ASN A CA   2  
ATOM   949   C C    . ASN A 1 19 ? 1.348   -8.489  -11.074 1.00 15.00 ?  490 ASN A C    2  
ATOM   950   O O    . ASN A 1 19 ? 0.733   -9.539  -11.244 1.00 15.00 ?  490 ASN A O    2  
ATOM   951   C CB   . ASN A 1 19 ? 3.271   -9.101  -9.567  1.00 15.00 ?  490 ASN A CB   2  
ATOM   952   C CG   . ASN A 1 19 ? 2.866   -10.561 -9.429  1.00 15.00 ?  490 ASN A CG   2  
ATOM   953   O OD1  . ASN A 1 19 ? 2.517   -11.016 -8.339  1.00 15.00 ?  490 ASN A OD1  2  
ATOM   954   N ND2  . ASN A 1 19 ? 2.933   -11.312 -10.519 1.00 15.00 ?  490 ASN A ND2  2  
ATOM   955   H H    . ASN A 1 19 ? 3.590   -6.623  -10.186 1.00 15.00 ?  490 ASN A H    2  
ATOM   956   H HA   . ASN A 1 19 ? 3.312   -9.057  -11.714 1.00 15.00 ?  490 ASN A HA   2  
ATOM   957   H HB2  . ASN A 1 19 ? 4.343   -9.040  -9.457  1.00 15.00 ?  490 ASN A HB2  2  
ATOM   958   H HB3  . ASN A 1 19 ? 2.804   -8.542  -8.768  1.00 15.00 ?  490 ASN A HB3  2  
ATOM   959   H HD21 . ASN A 1 19 ? 3.239   -10.897 -11.354 1.00 15.00 ?  490 ASN A HD21 2  
ATOM   960   H HD22 . ASN A 1 19 ? 2.661   -12.253 -10.448 1.00 15.00 ?  490 ASN A HD22 2  
ATOM   961   N N    . GLY A 1 20 ? 0.743   -7.308  -11.020 1.00 15.00 ?  491 GLY A N    2  
ATOM   962   C CA   . GLY A 1 20 ? -0.697  -7.203  -11.173 1.00 15.00 ?  491 GLY A CA   2  
ATOM   963   C C    . GLY A 1 20 ? -1.422  -7.162  -9.841  1.00 15.00 ?  491 GLY A C    2  
ATOM   964   O O    . GLY A 1 20 ? -2.516  -7.708  -9.705  1.00 15.00 ?  491 GLY A O    2  
ATOM   965   H H    . GLY A 1 20 ? 1.281   -6.496  -10.884 1.00 15.00 ?  491 GLY A H    2  
ATOM   966   H HA2  . GLY A 1 20 ? -0.925  -6.305  -11.723 1.00 15.00 ?  491 GLY A HA2  2  
ATOM   967   H HA3  . GLY A 1 20 ? -1.050  -8.057  -11.734 1.00 15.00 ?  491 GLY A HA3  2  
ATOM   968   N N    . ARG A 1 21 ? -0.820  -6.511  -8.854  1.00 15.00 ?  492 ARG A N    2  
ATOM   969   C CA   . ARG A 1 21 ? -1.413  -6.437  -7.524  1.00 15.00 ?  492 ARG A CA   2  
ATOM   970   C C    . ARG A 1 21 ? -1.362  -5.013  -6.956  1.00 15.00 ?  492 ARG A C    2  
ATOM   971   O O    . ARG A 1 21 ? -0.280  -4.445  -6.804  1.00 15.00 ?  492 ARG A O    2  
ATOM   972   C CB   . ARG A 1 21 ? -0.709  -7.412  -6.572  1.00 15.00 ?  492 ARG A CB   2  
ATOM   973   C CG   . ARG A 1 21 ? 0.812   -7.363  -6.628  1.00 15.00 ?  492 ARG A CG   2  
ATOM   974   C CD   . ARG A 1 21 ? 1.424   -8.567  -5.926  1.00 15.00 ?  492 ARG A CD   2  
ATOM   975   N NE   . ARG A 1 21 ? 2.879   -8.472  -5.807  1.00 15.00 ?  492 ARG A NE   2  
ATOM   976   C CZ   . ARG A 1 21 ? 3.661   -9.474  -5.398  1.00 15.00 ?  492 ARG A CZ   2  
ATOM   977   N NH1  . ARG A 1 21 ? 3.143   -10.672 -5.153  1.00 15.00 1  492 ARG A NH1  2  
ATOM   978   N NH2  . ARG A 1 21 ? 4.963   -9.282  -5.256  1.00 15.00 ?  492 ARG A NH2  2  
ATOM   979   H H    . ARG A 1 21 ? 0.037   -6.070  -9.025  1.00 15.00 ?  492 ARG A H    2  
ATOM   980   H HA   . ARG A 1 21 ? -2.442  -6.738  -7.613  1.00 15.00 ?  492 ARG A HA   2  
ATOM   981   H HB2  . ARG A 1 21 ? -1.014  -7.173  -5.567  1.00 15.00 ?  492 ARG A HB2  2  
ATOM   982   H HB3  . ARG A 1 21 ? -1.024  -8.415  -6.794  1.00 15.00 ?  492 ARG A HB3  2  
ATOM   983   H HG2  . ARG A 1 21 ? 1.125   -7.362  -7.661  1.00 15.00 ?  492 ARG A HG2  2  
ATOM   984   H HG3  . ARG A 1 21 ? 1.154   -6.462  -6.144  1.00 15.00 ?  492 ARG A HG3  2  
ATOM   985   H HD2  . ARG A 1 21 ? 1.000   -8.641  -4.936  1.00 15.00 ?  492 ARG A HD2  2  
ATOM   986   H HD3  . ARG A 1 21 ? 1.176   -9.457  -6.488  1.00 15.00 ?  492 ARG A HD3  2  
ATOM   987   H HE   . ARG A 1 21 ? 3.295   -7.607  -6.020  1.00 15.00 ?  492 ARG A HE   2  
ATOM   988   H HH11 . ARG A 1 21 ? 2.159   -10.835 -5.275  1.00 15.00 ?  492 ARG A HH11 2  
ATOM   989   H HH12 . ARG A 1 21 ? 3.736   -11.427 -4.852  1.00 15.00 ?  492 ARG A HH12 2  
ATOM   990   H HH21 . ARG A 1 21 ? 5.366   -8.378  -5.456  1.00 15.00 ?  492 ARG A HH21 2  
ATOM   991   H HH22 . ARG A 1 21 ? 5.557   -10.039 -4.940  1.00 15.00 ?  492 ARG A HH22 2  
ATOM   992   N N    . PRO A 1 22 ? -2.534  -4.413  -6.645  1.00 15.00 ?  493 PRO A N    2  
ATOM   993   C CA   . PRO A 1 22 ? -2.616  -3.119  -5.967  1.00 15.00 ?  493 PRO A CA   2  
ATOM   994   C C    . PRO A 1 22 ? -2.639  -3.262  -4.452  1.00 15.00 ?  493 PRO A C    2  
ATOM   995   O O    . PRO A 1 22 ? -3.526  -3.901  -3.883  1.00 15.00 ?  493 PRO A O    2  
ATOM   996   C CB   . PRO A 1 22 ? -3.944  -2.527  -6.463  1.00 15.00 ?  493 PRO A CB   2  
ATOM   997   C CG   . PRO A 1 22 ? -4.636  -3.613  -7.231  1.00 15.00 ?  493 PRO A CG   2  
ATOM   998   C CD   . PRO A 1 22 ? -3.872  -4.891  -6.999  1.00 15.00 ?  493 PRO A CD   2  
ATOM   999   H HA   . PRO A 1 22 ? -1.813  -2.470  -6.242  1.00 15.00 ?  493 PRO A HA   2  
ATOM   1000  H HB2  . PRO A 1 22 ? -4.534  -2.216  -5.614  1.00 15.00 ?  493 PRO A HB2  2  
ATOM   1001  H HB3  . PRO A 1 22 ? -3.742  -1.673  -7.091  1.00 15.00 ?  493 PRO A HB3  2  
ATOM   1002  H HG2  . PRO A 1 22 ? -5.649  -3.718  -6.876  1.00 15.00 ?  493 PRO A HG2  2  
ATOM   1003  H HG3  . PRO A 1 22 ? -4.636  -3.366  -8.283  1.00 15.00 ?  493 PRO A HG3  2  
ATOM   1004  H HD2  . PRO A 1 22 ? -4.309  -5.447  -6.191  1.00 15.00 ?  493 PRO A HD2  2  
ATOM   1005  H HD3  . PRO A 1 22 ? -3.852  -5.478  -7.902  1.00 15.00 ?  493 PRO A HD3  2  
ATOM   1006  N N    . PHE A 1 23 ? -1.644  -2.662  -3.813  1.00 15.00 ?  494 PHE A N    2  
ATOM   1007  C CA   . PHE A 1 23 ? -1.452  -2.785  -2.378  1.00 15.00 ?  494 PHE A CA   2  
ATOM   1008  C C    . PHE A 1 23 ? -1.640  -1.442  -1.671  1.00 15.00 ?  494 PHE A C    2  
ATOM   1009  O O    . PHE A 1 23 ? -1.395  -0.385  -2.257  1.00 15.00 ?  494 PHE A O    2  
ATOM   1010  C CB   . PHE A 1 23 ? -0.065  -3.375  -2.073  1.00 15.00 ?  494 PHE A CB   2  
ATOM   1011  C CG   . PHE A 1 23 ? 1.109   -2.692  -2.748  1.00 15.00 ?  494 PHE A CG   2  
ATOM   1012  C CD1  . PHE A 1 23 ? 1.389   -1.347  -2.534  1.00 15.00 ?  494 PHE A CD1  2  
ATOM   1013  C CD2  . PHE A 1 23 ? 1.957   -3.413  -3.578  1.00 15.00 ?  494 PHE A CD2  2  
ATOM   1014  C CE1  . PHE A 1 23 ? 2.479   -0.741  -3.137  1.00 15.00 ?  494 PHE A CE1  2  
ATOM   1015  C CE2  . PHE A 1 23 ? 3.048   -2.812  -4.175  1.00 15.00 ?  494 PHE A CE2  2  
ATOM   1016  C CZ   . PHE A 1 23 ? 3.308   -1.476  -3.956  1.00 15.00 ?  494 PHE A CZ   2  
ATOM   1017  H H    . PHE A 1 23 ? -1.013  -2.111  -4.328  1.00 15.00 ?  494 PHE A H    2  
ATOM   1018  H HA   . PHE A 1 23 ? -2.203  -3.469  -2.010  1.00 15.00 ?  494 PHE A HA   2  
ATOM   1019  H HB2  . PHE A 1 23 ? 0.101   -3.329  -1.009  1.00 15.00 ?  494 PHE A HB2  2  
ATOM   1020  H HB3  . PHE A 1 23 ? -0.059  -4.412  -2.380  1.00 15.00 ?  494 PHE A HB3  2  
ATOM   1021  H HD1  . PHE A 1 23 ? 0.740   -0.769  -1.892  1.00 15.00 ?  494 PHE A HD1  2  
ATOM   1022  H HD2  . PHE A 1 23 ? 1.757   -4.457  -3.766  1.00 15.00 ?  494 PHE A HD2  2  
ATOM   1023  H HE1  . PHE A 1 23 ? 2.686   0.312   -2.961  1.00 15.00 ?  494 PHE A HE1  2  
ATOM   1024  H HE2  . PHE A 1 23 ? 3.700   -3.390  -4.809  1.00 15.00 ?  494 PHE A HE2  2  
ATOM   1025  H HZ   . PHE A 1 23 ? 4.161   -1.008  -4.424  1.00 15.00 ?  494 PHE A HZ   2  
ATOM   1026  N N    . PHE A 1 24 ? -2.093  -1.488  -0.421  1.00 15.00 ?  495 PHE A N    2  
ATOM   1027  C CA   . PHE A 1 24 ? -2.280  -0.279  0.370   1.00 15.00 ?  495 PHE A CA   2  
ATOM   1028  C C    . PHE A 1 24 ? -1.067  -0.025  1.257   1.00 15.00 ?  495 PHE A C    2  
ATOM   1029  O O    . PHE A 1 24 ? -0.787  -0.786  2.180   1.00 15.00 ?  495 PHE A O    2  
ATOM   1030  C CB   . PHE A 1 24 ? -3.532  -0.376  1.253   1.00 15.00 ?  495 PHE A CB   2  
ATOM   1031  C CG   . PHE A 1 24 ? -4.763  -0.805  0.514   1.00 15.00 ?  495 PHE A CG   2  
ATOM   1032  C CD1  . PHE A 1 24 ? -5.351  0.040   -0.401  1.00 15.00 ?  495 PHE A CD1  2  
ATOM   1033  C CD2  . PHE A 1 24 ? -5.328  -2.052  0.732   1.00 15.00 ?  495 PHE A CD2  2  
ATOM   1034  C CE1  . PHE A 1 24 ? -6.484  -0.337  -1.092  1.00 15.00 ?  495 PHE A CE1  2  
ATOM   1035  C CE2  . PHE A 1 24 ? -6.464  -2.440  0.045   1.00 15.00 ?  495 PHE A CE2  2  
ATOM   1036  C CZ   . PHE A 1 24 ? -7.043  -1.580  -0.870  1.00 15.00 ?  495 PHE A CZ   2  
ATOM   1037  H H    . PHE A 1 24 ? -2.292  -2.358  -0.017  1.00 15.00 ?  495 PHE A H    2  
ATOM   1038  H HA   . PHE A 1 24 ? -2.393  0.550   -0.311  1.00 15.00 ?  495 PHE A HA   2  
ATOM   1039  H HB2  . PHE A 1 24 ? -3.356  -1.081  2.048   1.00 15.00 ?  495 PHE A HB2  2  
ATOM   1040  H HB3  . PHE A 1 24 ? -3.730  0.595   1.684   1.00 15.00 ?  495 PHE A HB3  2  
ATOM   1041  H HD1  . PHE A 1 24 ? -4.916  1.014   -0.574  1.00 15.00 ?  495 PHE A HD1  2  
ATOM   1042  H HD2  . PHE A 1 24 ? -4.875  -2.723  1.446   1.00 15.00 ?  495 PHE A HD2  2  
ATOM   1043  H HE1  . PHE A 1 24 ? -6.927  0.343   -1.813  1.00 15.00 ?  495 PHE A HE1  2  
ATOM   1044  H HE2  . PHE A 1 24 ? -6.898  -3.413  0.222   1.00 15.00 ?  495 PHE A HE2  2  
ATOM   1045  H HZ   . PHE A 1 24 ? -7.929  -1.879  -1.409  1.00 15.00 ?  495 PHE A HZ   2  
ATOM   1046  N N    . ILE A 1 25 ? -0.334  1.029   0.959   1.00 15.00 ?  496 ILE A N    2  
ATOM   1047  C CA   . ILE A 1 25 ? 0.755   1.447   1.821   1.00 15.00 ?  496 ILE A CA   2  
ATOM   1048  C C    . ILE A 1 25 ? 0.346   2.675   2.600   1.00 15.00 ?  496 ILE A C    2  
ATOM   1049  O O    . ILE A 1 25 ? 0.073   3.719   2.008   1.00 15.00 ?  496 ILE A O    2  
ATOM   1050  C CB   . ILE A 1 25 ? 2.048   1.762   1.038   1.00 15.00 ?  496 ILE A CB   2  
ATOM   1051  C CG1  . ILE A 1 25 ? 2.526   0.530   0.270   1.00 15.00 ?  496 ILE A CG1  2  
ATOM   1052  C CG2  . ILE A 1 25 ? 3.140   2.258   1.981   1.00 15.00 ?  496 ILE A CG2  2  
ATOM   1053  C CD1  . ILE A 1 25 ? 3.818   0.753   -0.481  1.00 15.00 ?  496 ILE A CD1  2  
ATOM   1054  H H    . ILE A 1 25 ? -0.535  1.543   0.144   1.00 15.00 ?  496 ILE A H    2  
ATOM   1055  H HA   . ILE A 1 25 ? 0.962   0.652   2.514   1.00 15.00 ?  496 ILE A HA   2  
ATOM   1056  H HB   . ILE A 1 25 ? 1.831   2.552   0.335   1.00 15.00 ?  496 ILE A HB   2  
ATOM   1057  H HG12 . ILE A 1 25 ? 2.682   -0.282  0.964   1.00 15.00 ?  496 ILE A HG12 2  
ATOM   1058  H HG13 . ILE A 1 25 ? 1.772   0.247   -0.447  1.00 15.00 ?  496 ILE A HG13 2  
ATOM   1059  H HG21 . ILE A 1 25 ? 3.356   1.496   2.716   1.00 15.00 ?  496 ILE A HG21 2  
ATOM   1060  H HG22 . ILE A 1 25 ? 2.805   3.155   2.479   1.00 15.00 ?  496 ILE A HG22 2  
ATOM   1061  H HG23 . ILE A 1 25 ? 4.035   2.475   1.414   1.00 15.00 ?  496 ILE A HG23 2  
ATOM   1062  H HD11 . ILE A 1 25 ? 4.094   -0.153  -0.999  1.00 15.00 ?  496 ILE A HD11 2  
ATOM   1063  H HD12 . ILE A 1 25 ? 4.597   1.023   0.216   1.00 15.00 ?  496 ILE A HD12 2  
ATOM   1064  H HD13 . ILE A 1 25 ? 3.683   1.552   -1.197  1.00 15.00 ?  496 ILE A HD13 2  
ATOM   1065  N N    . ASP A 1 26 ? 0.294   2.562   3.917   1.00 15.00 ?  497 ASP A N    2  
ATOM   1066  C CA   . ASP A 1 26 ? 0.046   3.732   4.729   1.00 15.00 ?  497 ASP A CA   2  
ATOM   1067  C C    . ASP A 1 26 ? 1.383   4.355   5.060   1.00 15.00 ?  497 ASP A C    2  
ATOM   1068  O O    . ASP A 1 26 ? 2.280   3.726   5.617   1.00 15.00 ?  497 ASP A O    2  
ATOM   1069  C CB   . ASP A 1 26 ? -0.769  3.433   5.992   1.00 15.00 ?  497 ASP A CB   2  
ATOM   1070  C CG   . ASP A 1 26 ? 0.049   2.914   7.154   1.00 15.00 ?  497 ASP A CG   2  
ATOM   1071  O OD1  . ASP A 1 26 ? 0.590   3.747   7.923   1.00 15.00 ?  497 ASP A OD1  2  
ATOM   1072  O OD2  . ASP A 1 26 ? 0.141   1.685   7.315   1.00 15.00 -1 497 ASP A OD2  2  
ATOM   1073  H H    . ASP A 1 26 ? 0.441   1.686   4.346   1.00 15.00 ?  497 ASP A H    2  
ATOM   1074  H HA   . ASP A 1 26 ? -0.505  4.433   4.115   1.00 15.00 ?  497 ASP A HA   2  
ATOM   1075  H HB2  . ASP A 1 26 ? -1.253  4.344   6.306   1.00 15.00 ?  497 ASP A HB2  2  
ATOM   1076  H HB3  . ASP A 1 26 ? -1.525  2.699   5.752   1.00 15.00 ?  497 ASP A HB3  2  
ATOM   1077  N N    . HIS A 1 27 ? 1.520   5.588   4.651   1.00 15.00 ?  498 HIS A N    2  
ATOM   1078  C CA   . HIS A 1 27 ? 2.793   6.267   4.694   1.00 15.00 ?  498 HIS A CA   2  
ATOM   1079  C C    . HIS A 1 27 ? 3.117   6.806   6.082   1.00 15.00 ?  498 HIS A C    2  
ATOM   1080  O O    . HIS A 1 27 ? 4.238   7.257   6.322   1.00 15.00 ?  498 HIS A O    2  
ATOM   1081  C CB   . HIS A 1 27 ? 2.831   7.374   3.637   1.00 15.00 ?  498 HIS A CB   2  
ATOM   1082  C CG   . HIS A 1 27 ? 2.996   6.839   2.243   1.00 15.00 ?  498 HIS A CG   2  
ATOM   1083  N ND1  . HIS A 1 27 ? 4.227   6.700   1.644   1.00 15.00 ?  498 HIS A ND1  2  
ATOM   1084  C CD2  . HIS A 1 27 ? 2.087   6.383   1.332   1.00 15.00 ?  498 HIS A CD2  2  
ATOM   1085  C CE1  . HIS A 1 27 ? 4.079   6.187   0.440   1.00 15.00 ?  498 HIS A CE1  2  
ATOM   1086  N NE2  . HIS A 1 27 ? 2.792   5.985   0.223   1.00 15.00 ?  498 HIS A NE2  2  
ATOM   1087  H H    . HIS A 1 27 ? 0.731   6.054   4.295   1.00 15.00 ?  498 HIS A H    2  
ATOM   1088  H HA   . HIS A 1 27 ? 3.546   5.538   4.439   1.00 15.00 ?  498 HIS A HA   2  
ATOM   1089  H HB2  . HIS A 1 27 ? 1.908   7.934   3.674   1.00 15.00 ?  498 HIS A HB2  2  
ATOM   1090  H HB3  . HIS A 1 27 ? 3.660   8.036   3.844   1.00 15.00 ?  498 HIS A HB3  2  
ATOM   1091  H HD1  . HIS A 1 27 ? 5.099   6.953   2.048   1.00 15.00 ?  498 HIS A HD1  2  
ATOM   1092  H HD2  . HIS A 1 27 ? 1.007   6.332   1.456   1.00 15.00 ?  498 HIS A HD2  2  
ATOM   1093  H HE1  . HIS A 1 27 ? 4.880   5.947   -0.245  1.00 15.00 ?  498 HIS A HE1  2  
ATOM   1094  H HE2  . HIS A 1 27 ? 2.397   5.814   -0.659  1.00 15.00 ?  498 HIS A HE2  2  
ATOM   1095  N N    . ASN A 1 28 ? 2.150   6.772   6.997   1.00 15.00 ?  499 ASN A N    2  
ATOM   1096  C CA   . ASN A 1 28 ? 2.397   7.303   8.330   1.00 15.00 ?  499 ASN A CA   2  
ATOM   1097  C C    . ASN A 1 28 ? 3.163   6.298   9.195   1.00 15.00 ?  499 ASN A C    2  
ATOM   1098  O O    . ASN A 1 28 ? 4.161   6.659   9.815   1.00 15.00 ?  499 ASN A O    2  
ATOM   1099  C CB   . ASN A 1 28 ? 1.090   7.749   9.014   1.00 15.00 ?  499 ASN A CB   2  
ATOM   1100  C CG   . ASN A 1 28 ? 0.069   6.637   9.186   1.00 15.00 ?  499 ASN A CG   2  
ATOM   1101  O OD1  . ASN A 1 28 ? 0.066   5.930   10.191  1.00 15.00 ?  499 ASN A OD1  2  
ATOM   1102  N ND2  . ASN A 1 28 ? -0.824  6.492   8.218   1.00 15.00 ?  499 ASN A ND2  2  
ATOM   1103  H H    . ASN A 1 28 ? 1.286   6.365   6.781   1.00 15.00 ?  499 ASN A H    2  
ATOM   1104  H HA   . ASN A 1 28 ? 3.025   8.175   8.206   1.00 15.00 ?  499 ASN A HA   2  
ATOM   1105  H HB2  . ASN A 1 28 ? 1.325   8.139   9.993   1.00 15.00 ?  499 ASN A HB2  2  
ATOM   1106  H HB3  . ASN A 1 28 ? 0.639   8.534   8.425   1.00 15.00 ?  499 ASN A HB3  2  
ATOM   1107  H HD21 . ASN A 1 28 ? -0.788  7.106   7.457   1.00 15.00 ?  499 ASN A HD21 2  
ATOM   1108  H HD22 . ASN A 1 28 ? -1.484  5.772   8.306   1.00 15.00 ?  499 ASN A HD22 2  
ATOM   1109  N N    . THR A 1 29 ? 2.699   5.047   9.266   1.00 15.00 ?  500 THR A N    2  
ATOM   1110  C CA   . THR A 1 29 ? 3.499   3.990   9.879   1.00 15.00 ?  500 THR A CA   2  
ATOM   1111  C C    . THR A 1 29 ? 4.538   3.463   8.892   1.00 15.00 ?  500 THR A C    2  
ATOM   1112  O O    . THR A 1 29 ? 5.410   2.674   9.258   1.00 15.00 ?  500 THR A O    2  
ATOM   1113  C CB   . THR A 1 29 ? 2.650   2.831   10.446  1.00 15.00 ?  500 THR A CB   2  
ATOM   1114  O OG1  . THR A 1 29 ? 1.953   2.143   9.407   1.00 15.00 ?  500 THR A OG1  2  
ATOM   1115  C CG2  . THR A 1 29 ? 1.659   3.342   11.480  1.00 15.00 ?  500 THR A CG2  2  
ATOM   1116  H H    . THR A 1 29 ? 1.813   4.828   8.887   1.00 15.00 ?  500 THR A H    2  
ATOM   1117  H HA   . THR A 1 29 ? 4.031   4.442   10.707  1.00 15.00 ?  500 THR A HA   2  
ATOM   1118  H HB   . THR A 1 29 ? 3.316   2.135   10.934  1.00 15.00 ?  500 THR A HB   2  
ATOM   1119  H HG1  . THR A 1 29 ? 1.437   2.778   8.871   1.00 15.00 ?  500 THR A HG1  2  
ATOM   1120  H HG21 . THR A 1 29 ? 2.198   3.808   12.293  1.00 15.00 ?  500 THR A HG21 2  
ATOM   1121  H HG22 . THR A 1 29 ? 1.079   2.516   11.861  1.00 15.00 ?  500 THR A HG22 2  
ATOM   1122  H HG23 . THR A 1 29 ? 1.001   4.066   11.022  1.00 15.00 ?  500 THR A HG23 2  
ATOM   1123  N N    . LYS A 1 30 ? 4.392   3.897   7.631   1.00 15.00 ?  501 LYS A N    2  
ATOM   1124  C CA   . LYS A 1 30 ? 5.223   3.464   6.494   1.00 15.00 ?  501 LYS A CA   2  
ATOM   1125  C C    . LYS A 1 30 ? 5.330   1.944   6.410   1.00 15.00 ?  501 LYS A C    2  
ATOM   1126  O O    . LYS A 1 30 ? 6.413   1.393   6.200   1.00 15.00 ?  501 LYS A O    2  
ATOM   1127  C CB   . LYS A 1 30 ? 6.623   4.117   6.487   1.00 15.00 ?  501 LYS A CB   2  
ATOM   1128  C CG   . LYS A 1 30 ? 7.493   3.828   7.700   1.00 15.00 ?  501 LYS A CG   2  
ATOM   1129  C CD   . LYS A 1 30 ? 8.957   4.105   7.413   1.00 15.00 ?  501 LYS A CD   2  
ATOM   1130  C CE   . LYS A 1 30 ? 9.543   3.055   6.482   1.00 15.00 ?  501 LYS A CE   2  
ATOM   1131  N NZ   . LYS A 1 30 ? 9.605   1.716   7.126   1.00 15.00 1  501 LYS A NZ   2  
ATOM   1132  H H    . LYS A 1 30 ? 3.671   4.532   7.452   1.00 15.00 ?  501 LYS A H    2  
ATOM   1133  H HA   . LYS A 1 30 ? 4.704   3.793   5.604   1.00 15.00 ?  501 LYS A HA   2  
ATOM   1134  H HB2  . LYS A 1 30 ? 7.153   3.770   5.613   1.00 15.00 ?  501 LYS A HB2  2  
ATOM   1135  H HB3  . LYS A 1 30 ? 6.498   5.187   6.409   1.00 15.00 ?  501 LYS A HB3  2  
ATOM   1136  H HG2  . LYS A 1 30 ? 7.172   4.453   8.517   1.00 15.00 ?  501 LYS A HG2  2  
ATOM   1137  H HG3  . LYS A 1 30 ? 7.380   2.789   7.971   1.00 15.00 ?  501 LYS A HG3  2  
ATOM   1138  H HD2  . LYS A 1 30 ? 9.043   5.075   6.945   1.00 15.00 ?  501 LYS A HD2  2  
ATOM   1139  H HD3  . LYS A 1 30 ? 9.507   4.100   8.342   1.00 15.00 ?  501 LYS A HD3  2  
ATOM   1140  H HE2  . LYS A 1 30 ? 8.925   2.990   5.598   1.00 15.00 ?  501 LYS A HE2  2  
ATOM   1141  H HE3  . LYS A 1 30 ? 10.542  3.358   6.202   1.00 15.00 ?  501 LYS A HE3  2  
ATOM   1142  H HZ1  . LYS A 1 30 ? 8.671   1.453   7.507   1.00 15.00 ?  501 LYS A HZ1  2  
ATOM   1143  H HZ2  . LYS A 1 30 ? 10.296  1.722   7.906   1.00 15.00 ?  501 LYS A HZ2  2  
ATOM   1144  H HZ3  . LYS A 1 30 ? 9.895   0.992   6.432   1.00 15.00 ?  501 LYS A HZ3  2  
ATOM   1145  N N    . THR A 1 31 ? 4.196   1.273   6.527   1.00 15.00 ?  502 THR A N    2  
ATOM   1146  C CA   . THR A 1 31 ? 4.163   -0.172  6.420   1.00 15.00 ?  502 THR A CA   2  
ATOM   1147  C C    . THR A 1 31 ? 3.225   -0.612  5.306   1.00 15.00 ?  502 THR A C    2  
ATOM   1148  O O    . THR A 1 31 ? 2.261   0.078   4.954   1.00 15.00 ?  502 THR A O    2  
ATOM   1149  C CB   . THR A 1 31 ? 3.778   -0.863  7.742   1.00 15.00 ?  502 THR A CB   2  
ATOM   1150  O OG1  . THR A 1 31 ? 4.054   -2.268  7.657   1.00 15.00 ?  502 THR A OG1  2  
ATOM   1151  C CG2  . THR A 1 31 ? 2.308   -0.659  8.075   1.00 15.00 ?  502 THR A CG2  2  
ATOM   1152  H H    . THR A 1 31 ? 3.356   1.762   6.675   1.00 15.00 ?  502 THR A H    2  
ATOM   1153  H HA   . THR A 1 31 ? 5.163   -0.492  6.161   1.00 15.00 ?  502 THR A HA   2  
ATOM   1154  H HB   . THR A 1 31 ? 4.373   -0.442  8.529   1.00 15.00 ?  502 THR A HB   2  
ATOM   1155  H HG1  . THR A 1 31 ? 3.223   -2.752  7.583   1.00 15.00 ?  502 THR A HG1  2  
ATOM   1156  H HG21 . THR A 1 31 ? 1.698   -1.075  7.285   1.00 15.00 ?  502 THR A HG21 2  
ATOM   1157  H HG22 . THR A 1 31 ? 2.102   0.397   8.169   1.00 15.00 ?  502 THR A HG22 2  
ATOM   1158  H HG23 . THR A 1 31 ? 2.075   -1.155  9.006   1.00 15.00 ?  502 THR A HG23 2  
ATOM   1159  N N    . THR A 1 32 ? 3.554   -1.744  4.726   1.00 15.00 ?  503 THR A N    2  
ATOM   1160  C CA   . THR A 1 32 ? 2.812   -2.289  3.610   1.00 15.00 ?  503 THR A CA   2  
ATOM   1161  C C    . THR A 1 32 ? 1.682   -3.209  4.086   1.00 15.00 ?  503 THR A C    2  
ATOM   1162  O O    . THR A 1 32 ? 1.902   -4.116  4.891   1.00 15.00 ?  503 THR A O    2  
ATOM   1163  C CB   . THR A 1 32 ? 3.772   -3.049  2.683   1.00 15.00 ?  503 THR A CB   2  
ATOM   1164  O OG1  . THR A 1 32 ? 4.607   -3.922  3.458   1.00 15.00 ?  503 THR A OG1  2  
ATOM   1165  C CG2  . THR A 1 32 ? 4.642   -2.076  1.902   1.00 15.00 ?  503 THR A CG2  2  
ATOM   1166  H H    . THR A 1 32 ? 4.318   -2.247  5.079   1.00 15.00 ?  503 THR A H    2  
ATOM   1167  H HA   . THR A 1 32 ? 2.385   -1.467  3.057   1.00 15.00 ?  503 THR A HA   2  
ATOM   1168  H HB   . THR A 1 32 ? 3.192   -3.635  1.986   1.00 15.00 ?  503 THR A HB   2  
ATOM   1169  H HG1  . THR A 1 32 ? 4.999   -4.584  2.883   1.00 15.00 ?  503 THR A HG1  2  
ATOM   1170  H HG21 . THR A 1 32 ? 4.014   -1.430  1.306   1.00 15.00 ?  503 THR A HG21 2  
ATOM   1171  H HG22 . THR A 1 32 ? 5.306   -2.629  1.254   1.00 15.00 ?  503 THR A HG22 2  
ATOM   1172  H HG23 . THR A 1 32 ? 5.224   -1.480  2.590   1.00 15.00 ?  503 THR A HG23 2  
ATOM   1173  N N    . THR A 1 33 ? 0.471   -2.966  3.592   1.00 15.00 ?  504 THR A N    2  
ATOM   1174  C CA   . THR A 1 33 ? -0.702  -3.704  4.040   1.00 15.00 ?  504 THR A CA   2  
ATOM   1175  C C    . THR A 1 33 ? -1.579  -4.136  2.854   1.00 15.00 ?  504 THR A C    2  
ATOM   1176  O O    . THR A 1 33 ? -1.800  -3.367  1.919   1.00 15.00 ?  504 THR A O    2  
ATOM   1177  C CB   . THR A 1 33 ? -1.522  -2.831  5.016   1.00 15.00 ?  504 THR A CB   2  
ATOM   1178  O OG1  . THR A 1 33 ? -0.684  -2.408  6.103   1.00 15.00 ?  504 THR A OG1  2  
ATOM   1179  C CG2  . THR A 1 33 ? -2.721  -3.579  5.573   1.00 15.00 ?  504 THR A CG2  2  
ATOM   1180  H H    . THR A 1 33 ? 0.357   -2.262  2.917   1.00 15.00 ?  504 THR A H    2  
ATOM   1181  H HA   . THR A 1 33 ? -0.364  -4.583  4.569   1.00 15.00 ?  504 THR A HA   2  
ATOM   1182  H HB   . THR A 1 33 ? -1.874  -1.958  4.485   1.00 15.00 ?  504 THR A HB   2  
ATOM   1183  H HG1  . THR A 1 33 ? -0.463  -1.476  5.996   1.00 15.00 ?  504 THR A HG1  2  
ATOM   1184  H HG21 . THR A 1 33 ? -2.386  -4.469  6.087   1.00 15.00 ?  504 THR A HG21 2  
ATOM   1185  H HG22 . THR A 1 33 ? -3.378  -3.857  4.762   1.00 15.00 ?  504 THR A HG22 2  
ATOM   1186  H HG23 . THR A 1 33 ? -3.254  -2.942  6.266   1.00 15.00 ?  504 THR A HG23 2  
ATOM   1187  N N    . TRP A 1 34 ? -2.049  -5.381  2.885   1.00 15.00 ?  505 TRP A N    2  
ATOM   1188  C CA   . TRP A 1 34 ? -2.970  -5.877  1.859   1.00 15.00 ?  505 TRP A CA   2  
ATOM   1189  C C    . TRP A 1 34 ? -4.418  -5.746  2.316   1.00 15.00 ?  505 TRP A C    2  
ATOM   1190  O O    . TRP A 1 34 ? -5.339  -5.724  1.499   1.00 15.00 ?  505 TRP A O    2  
ATOM   1191  C CB   . TRP A 1 34 ? -2.708  -7.348  1.535   1.00 15.00 ?  505 TRP A CB   2  
ATOM   1192  C CG   . TRP A 1 34 ? -1.424  -7.622  0.817   1.00 15.00 ?  505 TRP A CG   2  
ATOM   1193  C CD1  . TRP A 1 34 ? -0.260  -8.064  1.371   1.00 15.00 ?  505 TRP A CD1  2  
ATOM   1194  C CD2  . TRP A 1 34 ? -1.181  -7.500  -0.590  1.00 15.00 ?  505 TRP A CD2  2  
ATOM   1195  N NE1  . TRP A 1 34 ? 0.688   -8.238  0.394   1.00 15.00 ?  505 TRP A NE1  2  
ATOM   1196  C CE2  . TRP A 1 34 ? 0.151   -7.893  -0.815  1.00 15.00 ?  505 TRP A CE2  2  
ATOM   1197  C CE3  . TRP A 1 34 ? -1.958  -7.100  -1.681  1.00 15.00 ?  505 TRP A CE3  2  
ATOM   1198  C CZ2  . TRP A 1 34 ? 0.721   -7.900  -2.083  1.00 15.00 ?  505 TRP A CZ2  2  
ATOM   1199  C CZ3  . TRP A 1 34 ? -1.389  -7.107  -2.941  1.00 15.00 ?  505 TRP A CZ3  2  
ATOM   1200  C CH2  . TRP A 1 34 ? -0.062  -7.505  -3.131  1.00 15.00 ?  505 TRP A CH2  2  
ATOM   1201  H H    . TRP A 1 34 ? -1.768  -5.982  3.603   1.00 15.00 ?  505 TRP A H    2  
ATOM   1202  H HA   . TRP A 1 34 ? -2.827  -5.288  0.966   1.00 15.00 ?  505 TRP A HA   2  
ATOM   1203  H HB2  . TRP A 1 34 ? -2.695  -7.908  2.456   1.00 15.00 ?  505 TRP A HB2  2  
ATOM   1204  H HB3  . TRP A 1 34 ? -3.517  -7.712  0.917   1.00 15.00 ?  505 TRP A HB3  2  
ATOM   1205  H HD1  . TRP A 1 34 ? -0.120  -8.257  2.424   1.00 15.00 ?  505 TRP A HD1  2  
ATOM   1206  H HE1  . TRP A 1 34 ? 1.606   -8.555  0.542   1.00 15.00 ?  505 TRP A HE1  2  
ATOM   1207  H HE3  . TRP A 1 34 ? -2.982  -6.786  -1.550  1.00 15.00 ?  505 TRP A HE3  2  
ATOM   1208  H HZ2  . TRP A 1 34 ? 1.744   -8.205  -2.248  1.00 15.00 ?  505 TRP A HZ2  2  
ATOM   1209  H HZ3  . TRP A 1 34 ? -1.973  -6.806  -3.799  1.00 15.00 ?  505 TRP A HZ3  2  
ATOM   1210  H HH2  . TRP A 1 34 ? 0.340   -7.499  -4.135  1.00 15.00 ?  505 TRP A HH2  2  
ATOM   1211  N N    . GLU A 1 35 ? -4.611  -5.705  3.627   1.00 15.00 ?  506 GLU A N    2  
ATOM   1212  C CA   . GLU A 1 35 ? -5.948  -5.689  4.206   1.00 15.00 ?  506 GLU A CA   2  
ATOM   1213  C C    . GLU A 1 35 ? -6.567  -4.319  4.105   1.00 15.00 ?  506 GLU A C    2  
ATOM   1214  O O    . GLU A 1 35 ? -5.930  -3.302  4.381   1.00 15.00 ?  506 GLU A O    2  
ATOM   1215  C CB   . GLU A 1 35 ? -5.903  -6.155  5.662   1.00 15.00 ?  506 GLU A CB   2  
ATOM   1216  C CG   . GLU A 1 35 ? -7.278  -6.375  6.275   1.00 15.00 ?  506 GLU A CG   2  
ATOM   1217  C CD   . GLU A 1 35 ? -7.212  -6.799  7.727   1.00 15.00 ?  506 GLU A CD   2  
ATOM   1218  O OE1  . GLU A 1 35 ? -7.082  -8.013  7.994   1.00 15.00 -1 506 GLU A OE1  2  
ATOM   1219  O OE2  . GLU A 1 35 ? -7.295  -5.921  8.608   1.00 15.00 ?  506 GLU A OE2  2  
ATOM   1220  H H    . GLU A 1 35 ? -3.835  -5.685  4.219   1.00 15.00 ?  506 GLU A H    2  
ATOM   1221  H HA   . GLU A 1 35 ? -6.567  -6.356  3.637   1.00 15.00 ?  506 GLU A HA   2  
ATOM   1222  H HB2  . GLU A 1 35 ? -5.357  -7.084  5.713   1.00 15.00 ?  506 GLU A HB2  2  
ATOM   1223  H HB3  . GLU A 1 35 ? -5.386  -5.411  6.251   1.00 15.00 ?  506 GLU A HB3  2  
ATOM   1224  H HG2  . GLU A 1 35 ? -7.838  -5.453  6.213   1.00 15.00 ?  506 GLU A HG2  2  
ATOM   1225  H HG3  . GLU A 1 35 ? -7.789  -7.144  5.713   1.00 15.00 ?  506 GLU A HG3  2  
ATOM   1226  N N    . ASP A 1 36 ? -7.828  -4.317  3.718   1.00 15.00 ?  507 ASP A N    2  
ATOM   1227  C CA   . ASP A 1 36 ? -8.544  -3.091  3.490   1.00 15.00 ?  507 ASP A CA   2  
ATOM   1228  C C    . ASP A 1 36 ? -8.898  -2.435  4.827   1.00 15.00 ?  507 ASP A C    2  
ATOM   1229  O O    . ASP A 1 36 ? -9.446  -3.089  5.719   1.00 15.00 ?  507 ASP A O    2  
ATOM   1230  C CB   . ASP A 1 36 ? -9.806  -3.363  2.658   1.00 15.00 ?  507 ASP A CB   2  
ATOM   1231  C CG   . ASP A 1 36 ? -10.521 -2.097  2.217   1.00 15.00 ?  507 ASP A CG   2  
ATOM   1232  O OD1  . ASP A 1 36 ? -11.232 -1.494  3.039   1.00 15.00 ?  507 ASP A OD1  2  
ATOM   1233  O OD2  . ASP A 1 36 ? -10.402 -1.717  1.030   1.00 15.00 -1 507 ASP A OD2  2  
ATOM   1234  H H    . ASP A 1 36 ? -8.291  -5.171  3.589   1.00 15.00 ?  507 ASP A H    2  
ATOM   1235  H HA   . ASP A 1 36 ? -7.883  -2.452  2.941   1.00 15.00 ?  507 ASP A HA   2  
ATOM   1236  H HB2  . ASP A 1 36 ? -9.530  -3.919  1.774   1.00 15.00 ?  507 ASP A HB2  2  
ATOM   1237  H HB3  . ASP A 1 36 ? -10.492 -3.954  3.246   1.00 15.00 ?  507 ASP A HB3  2  
ATOM   1238  N N    . PRO A 1 37 ? -8.582  -1.135  4.986   1.00 15.00 ?  508 PRO A N    2  
ATOM   1239  C CA   . PRO A 1 37 ? -8.849  -0.378  6.226   1.00 15.00 ?  508 PRO A CA   2  
ATOM   1240  C C    . PRO A 1 37 ? -10.328 -0.019  6.393   1.00 15.00 ?  508 PRO A C    2  
ATOM   1241  O O    . PRO A 1 37 ? -10.670 1.057   6.892   1.00 15.00 ?  508 PRO A O    2  
ATOM   1242  C CB   . PRO A 1 37 ? -8.016  0.890   6.028   1.00 15.00 ?  508 PRO A CB   2  
ATOM   1243  C CG   . PRO A 1 37 ? -7.986  1.082   4.556   1.00 15.00 ?  508 PRO A CG   2  
ATOM   1244  C CD   . PRO A 1 37 ? -7.923  -0.298  3.966   1.00 15.00 ?  508 PRO A CD   2  
ATOM   1245  H HA   . PRO A 1 37 ? -8.504  -0.909  7.100   1.00 15.00 ?  508 PRO A HA   2  
ATOM   1246  H HB2  . PRO A 1 37 ? -8.494  1.720   6.528   1.00 15.00 ?  508 PRO A HB2  2  
ATOM   1247  H HB3  . PRO A 1 37 ? -7.024  0.743   6.427   1.00 15.00 ?  508 PRO A HB3  2  
ATOM   1248  H HG2  . PRO A 1 37 ? -8.881  1.591   4.237   1.00 15.00 ?  508 PRO A HG2  2  
ATOM   1249  H HG3  . PRO A 1 37 ? -7.111  1.648   4.279   1.00 15.00 ?  508 PRO A HG3  2  
ATOM   1250  H HD2  . PRO A 1 37 ? -8.458  -0.333  3.029   1.00 15.00 ?  508 PRO A HD2  2  
ATOM   1251  H HD3  . PRO A 1 37 ? -6.896  -0.601  3.825   1.00 15.00 ?  508 PRO A HD3  2  
ATOM   1252  N N    . ARG A 1 38 ? -11.191 -0.944  6.005   1.00 15.00 ?  509 ARG A N    2  
ATOM   1253  C CA   . ARG A 1 38 ? -12.630 -0.753  6.083   1.00 15.00 ?  509 ARG A CA   2  
ATOM   1254  C C    . ARG A 1 38 ? -13.090 -0.689  7.535   1.00 15.00 ?  509 ARG A C    2  
ATOM   1255  O O    . ARG A 1 38 ? -13.970 0.138   7.841   1.00 15.00 ?  509 ARG A O    2  
ATOM   1256  C CB   . ARG A 1 38 ? -13.348 -1.889  5.354   1.00 15.00 ?  509 ARG A CB   2  
ATOM   1257  C CG   . ARG A 1 38 ? -14.741 -1.522  4.871   1.00 15.00 ?  509 ARG A CG   2  
ATOM   1258  C CD   . ARG A 1 38 ? -14.702 -0.331  3.923   1.00 15.00 ?  509 ARG A CD   2  
ATOM   1259  N NE   . ARG A 1 38 ? -13.666 -0.473  2.901   1.00 15.00 ?  509 ARG A NE   2  
ATOM   1260  C CZ   . ARG A 1 38 ? -13.765 -0.007  1.660   1.00 15.00 ?  509 ARG A CZ   2  
ATOM   1261  N NH1  . ARG A 1 38 ? -14.888 0.564   1.239   1.00 15.00 1  509 ARG A NH1  2  
ATOM   1262  N NH2  . ARG A 1 38 ? -12.741 -0.136  0.831   1.00 15.00 ?  509 ARG A NH2  2  
ATOM   1263  H H    . ARG A 1 38 ? -10.842 -1.789  5.650   1.00 15.00 ?  509 ARG A H    2  
ATOM   1264  H HA   . ARG A 1 38 ? -12.868 0.182   5.599   1.00 15.00 ?  509 ARG A HA   2  
ATOM   1265  H HB2  . ARG A 1 38 ? -12.759 -2.183  4.498   1.00 15.00 ?  509 ARG A HB2  2  
ATOM   1266  H HB3  . ARG A 1 38 ? -13.435 -2.732  6.025   1.00 15.00 ?  509 ARG A HB3  2  
ATOM   1267  H HG2  . ARG A 1 38 ? -15.169 -2.369  4.356   1.00 15.00 ?  509 ARG A HG2  2  
ATOM   1268  H HG3  . ARG A 1 38 ? -15.352 -1.270  5.726   1.00 15.00 ?  509 ARG A HG3  2  
ATOM   1269  H HD2  . ARG A 1 38 ? -15.663 -0.244  3.438   1.00 15.00 ?  509 ARG A HD2  2  
ATOM   1270  H HD3  . ARG A 1 38 ? -14.508 0.562   4.497   1.00 15.00 ?  509 ARG A HD3  2  
ATOM   1271  H HE   . ARG A 1 38 ? -12.823 -0.929  3.168   1.00 15.00 ?  509 ARG A HE   2  
ATOM   1272  H HH11 . ARG A 1 38 ? -15.678 0.648   1.857   1.00 15.00 ?  509 ARG A HH11 2  
ATOM   1273  H HH12 . ARG A 1 38 ? -14.951 0.920   0.299   1.00 15.00 ?  509 ARG A HH12 2  
ATOM   1274  H HH21 . ARG A 1 38 ? -11.889 -0.587  1.142   1.00 15.00 ?  509 ARG A HH21 2  
ATOM   1275  H HH22 . ARG A 1 38 ? -12.802 0.213   -0.108  1.00 15.00 ?  509 ARG A HH22 2  
ATOM   1276  N N    . ARG B 2 1  ? -2.978  -15.911 3.543   1.00 15.00 ?  925 ARG B N    2  
ATOM   1277  C CA   . ARG B 2 1  ? -2.171  -14.726 3.913   1.00 15.00 ?  925 ARG B CA   2  
ATOM   1278  C C    . ARG B 2 1  ? -1.133  -14.410 2.843   1.00 15.00 ?  925 ARG B C    2  
ATOM   1279  O O    . ARG B 2 1  ? -0.259  -15.228 2.540   1.00 15.00 ?  925 ARG B O    2  
ATOM   1280  C CB   . ARG B 2 1  ? -1.465  -14.943 5.257   1.00 15.00 ?  925 ARG B CB   2  
ATOM   1281  C CG   . ARG B 2 1  ? -0.482  -13.835 5.600   1.00 15.00 ?  925 ARG B CG   2  
ATOM   1282  C CD   . ARG B 2 1  ? 0.266   -14.111 6.892   1.00 15.00 ?  925 ARG B CD   2  
ATOM   1283  N NE   . ARG B 2 1  ? 1.378   -13.178 7.071   1.00 15.00 ?  925 ARG B NE   2  
ATOM   1284  C CZ   . ARG B 2 1  ? 1.854   -12.790 8.251   1.00 15.00 ?  925 ARG B CZ   2  
ATOM   1285  N NH1  . ARG B 2 1  ? 1.363   -13.292 9.375   1.00 15.00 1  925 ARG B NH1  2  
ATOM   1286  N NH2  . ARG B 2 1  ? 2.857   -11.924 8.294   1.00 15.00 ?  925 ARG B NH2  2  
ATOM   1287  H H1   . ARG B 2 1  ? -2.363  -16.749 3.456   1.00 15.00 ?  925 ARG B H1   2  
ATOM   1288  H H2   . ARG B 2 1  ? -3.453  -15.751 2.628   1.00 15.00 ?  925 ARG B H2   2  
ATOM   1289  H H3   . ARG B 2 1  ? -3.700  -16.097 4.270   1.00 15.00 ?  925 ARG B H3   2  
ATOM   1290  H HA   . ARG B 2 1  ? -2.839  -13.881 4.000   1.00 15.00 ?  925 ARG B HA   2  
ATOM   1291  H HB2  . ARG B 2 1  ? -2.208  -14.990 6.038   1.00 15.00 ?  925 ARG B HB2  2  
ATOM   1292  H HB3  . ARG B 2 1  ? -0.926  -15.878 5.225   1.00 15.00 ?  925 ARG B HB3  2  
ATOM   1293  H HG2  . ARG B 2 1  ? 0.235   -13.745 4.797   1.00 15.00 ?  925 ARG B HG2  2  
ATOM   1294  H HG3  . ARG B 2 1  ? -1.026  -12.908 5.701   1.00 15.00 ?  925 ARG B HG3  2  
ATOM   1295  H HD2  . ARG B 2 1  ? -0.419  -14.008 7.721   1.00 15.00 ?  925 ARG B HD2  2  
ATOM   1296  H HD3  . ARG B 2 1  ? 0.653   -15.119 6.866   1.00 15.00 ?  925 ARG B HD3  2  
ATOM   1297  H HE   . ARG B 2 1  ? 1.795   -12.814 6.253   1.00 15.00 ?  925 ARG B HE   2  
ATOM   1298  H HH11 . ARG B 2 1  ? 0.627   -13.979 9.346   1.00 15.00 ?  925 ARG B HH11 2  
ATOM   1299  H HH12 . ARG B 2 1  ? 1.723   -12.986 10.269  1.00 15.00 ?  925 ARG B HH12 2  
ATOM   1300  H HH21 . ARG B 2 1  ? 3.251   -11.572 7.435   1.00 15.00 ?  925 ARG B HH21 2  
ATOM   1301  H HH22 . ARG B 2 1  ? 3.226   -11.614 9.179   1.00 15.00 ?  925 ARG B HH22 2  
ATOM   1302  N N    . LEU B 2 2  ? -1.230  -13.216 2.280   1.00 15.00 ?  926 LEU B N    2  
ATOM   1303  C CA   . LEU B 2 2  ? -0.229  -12.731 1.347   1.00 15.00 ?  926 LEU B CA   2  
ATOM   1304  C C    . LEU B 2 2  ? 0.701   -11.755 2.050   1.00 15.00 ?  926 LEU B C    2  
ATOM   1305  O O    . LEU B 2 2  ? 0.254   -10.765 2.629   1.00 15.00 ?  926 LEU B O    2  
ATOM   1306  C CB   . LEU B 2 2  ? -0.893  -12.054 0.146   1.00 15.00 ?  926 LEU B CB   2  
ATOM   1307  C CG   . LEU B 2 2  ? -1.717  -12.984 -0.745  1.00 15.00 ?  926 LEU B CG   2  
ATOM   1308  C CD1  . LEU B 2 2  ? -2.333  -12.204 -1.894  1.00 15.00 ?  926 LEU B CD1  2  
ATOM   1309  C CD2  . LEU B 2 2  ? -0.852  -14.118 -1.272  1.00 15.00 ?  926 LEU B CD2  2  
ATOM   1310  H H    . LEU B 2 2  ? -1.997  -12.643 2.498   1.00 15.00 ?  926 LEU B H    2  
ATOM   1311  H HA   . LEU B 2 2  ? 0.345   -13.578 1.003   1.00 15.00 ?  926 LEU B HA   2  
ATOM   1312  H HB2  . LEU B 2 2  ? -1.541  -11.271 0.513   1.00 15.00 ?  926 LEU B HB2  2  
ATOM   1313  H HB3  . LEU B 2 2  ? -0.121  -11.605 -0.458  1.00 15.00 ?  926 LEU B HB3  2  
ATOM   1314  H HG   . LEU B 2 2  ? -2.519  -13.416 -0.163  1.00 15.00 ?  926 LEU B HG   2  
ATOM   1315  H HD11 . LEU B 2 2  ? -1.549  -11.745 -2.476  1.00 15.00 ?  926 LEU B HD11 2  
ATOM   1316  H HD12 . LEU B 2 2  ? -2.985  -11.440 -1.500  1.00 15.00 ?  926 LEU B HD12 2  
ATOM   1317  H HD13 . LEU B 2 2  ? -2.901  -12.876 -2.520  1.00 15.00 ?  926 LEU B HD13 2  
ATOM   1318  H HD21 . LEU B 2 2  ? -1.450  -14.769 -1.891  1.00 15.00 ?  926 LEU B HD21 2  
ATOM   1319  H HD22 . LEU B 2 2  ? -0.451  -14.681 -0.442  1.00 15.00 ?  926 LEU B HD22 2  
ATOM   1320  H HD23 . LEU B 2 2  ? -0.041  -13.712 -1.856  1.00 15.00 ?  926 LEU B HD23 2  
ATOM   1321  N N    . ASP B 2 3  ? 1.989   -12.046 2.023   1.00 15.00 ?  927 ASP B N    2  
ATOM   1322  C CA   . ASP B 2 3  ? 2.976   -11.157 2.617   1.00 15.00 ?  927 ASP B CA   2  
ATOM   1323  C C    . ASP B 2 3  ? 3.536   -10.221 1.561   1.00 15.00 ?  927 ASP B C    2  
ATOM   1324  O O    . ASP B 2 3  ? 4.038   -10.660 0.527   1.00 15.00 ?  927 ASP B O    2  
ATOM   1325  C CB   . ASP B 2 3  ? 4.105   -11.951 3.281   1.00 15.00 ?  927 ASP B CB   2  
ATOM   1326  C CG   . ASP B 2 3  ? 3.657   -12.639 4.556   1.00 15.00 ?  927 ASP B CG   2  
ATOM   1327  O OD1  . ASP B 2 3  ? 3.637   -11.981 5.618   1.00 15.00 -1 927 ASP B OD1  2  
ATOM   1328  O OD2  . ASP B 2 3  ? 3.324   -13.841 4.505   1.00 15.00 ?  927 ASP B OD2  2  
ATOM   1329  H H    . ASP B 2 3  ? 2.287   -12.873 1.591   1.00 15.00 ?  927 ASP B H    2  
ATOM   1330  H HA   . ASP B 2 3  ? 2.473   -10.568 3.370   1.00 15.00 ?  927 ASP B HA   2  
ATOM   1331  H HB2  . ASP B 2 3  ? 4.460   -12.703 2.592   1.00 15.00 ?  927 ASP B HB2  2  
ATOM   1332  H HB3  . ASP B 2 3  ? 4.914   -11.278 3.522   1.00 15.00 ?  927 ASP B HB3  2  
ATOM   1333  N N    . LEU B 2 4  ? 3.430   -8.927  1.821   1.00 15.00 ?  928 LEU B N    2  
ATOM   1334  C CA   . LEU B 2 4  ? 3.880   -7.912  0.880   1.00 15.00 ?  928 LEU B CA   2  
ATOM   1335  C C    . LEU B 2 4  ? 5.403   -7.826  0.918   1.00 15.00 ?  928 LEU B C    2  
ATOM   1336  O O    . LEU B 2 4  ? 5.996   -7.853  2.000   1.00 15.00 ?  928 LEU B O    2  
ATOM   1337  C CB   . LEU B 2 4  ? 3.242   -6.567  1.255   1.00 15.00 ?  928 LEU B CB   2  
ATOM   1338  C CG   . LEU B 2 4  ? 2.985   -5.598  0.096   1.00 15.00 ?  928 LEU B CG   2  
ATOM   1339  C CD1  . LEU B 2 4  ? 1.864   -4.640  0.459   1.00 15.00 ?  928 LEU B CD1  2  
ATOM   1340  C CD2  . LEU B 2 4  ? 4.239   -4.816  -0.261  1.00 15.00 ?  928 LEU B CD2  2  
ATOM   1341  H H    . LEU B 2 4  ? 3.049   -8.646  2.678   1.00 15.00 ?  928 LEU B H    2  
ATOM   1342  H HA   . LEU B 2 4  ? 3.563   -8.200  -0.111  1.00 15.00 ?  928 LEU B HA   2  
ATOM   1343  H HB2  . LEU B 2 4  ? 2.300   -6.766  1.742   1.00 15.00 ?  928 LEU B HB2  2  
ATOM   1344  H HB3  . LEU B 2 4  ? 3.893   -6.075  1.964   1.00 15.00 ?  928 LEU B HB3  2  
ATOM   1345  H HG   . LEU B 2 4  ? 2.677   -6.160  -0.775  1.00 15.00 ?  928 LEU B HG   2  
ATOM   1346  H HD11 . LEU B 2 4  ? 0.964   -5.200  0.662   1.00 15.00 ?  928 LEU B HD11 2  
ATOM   1347  H HD12 . LEU B 2 4  ? 1.689   -3.962  -0.363  1.00 15.00 ?  928 LEU B HD12 2  
ATOM   1348  H HD13 . LEU B 2 4  ? 2.142   -4.076  1.338   1.00 15.00 ?  928 LEU B HD13 2  
ATOM   1349  H HD21 . LEU B 2 4  ? 5.024   -5.503  -0.541  1.00 15.00 ?  928 LEU B HD21 2  
ATOM   1350  H HD22 . LEU B 2 4  ? 4.555   -4.236  0.592   1.00 15.00 ?  928 LEU B HD22 2  
ATOM   1351  H HD23 . LEU B 2 4  ? 4.028   -4.155  -1.089  1.00 15.00 ?  928 LEU B HD23 2  
ATOM   1352  N N    . PRO B 2 5  ? 6.057   -7.718  -0.253  1.00 15.00 ?  929 PRO B N    2  
ATOM   1353  C CA   . PRO B 2 5  ? 7.520   -7.641  -0.326  1.00 15.00 ?  929 PRO B CA   2  
ATOM   1354  C C    . PRO B 2 5  ? 8.062   -6.468  0.494   1.00 15.00 ?  929 PRO B C    2  
ATOM   1355  O O    . PRO B 2 5  ? 7.389   -5.443  0.632   1.00 15.00 ?  929 PRO B O    2  
ATOM   1356  C CB   . PRO B 2 5  ? 7.802   -7.435  -1.821  1.00 15.00 ?  929 PRO B CB   2  
ATOM   1357  C CG   . PRO B 2 5  ? 6.511   -6.993  -2.419  1.00 15.00 ?  929 PRO B CG   2  
ATOM   1358  C CD   . PRO B 2 5  ? 5.433   -7.620  -1.586  1.00 15.00 ?  929 PRO B CD   2  
ATOM   1359  H HA   . PRO B 2 5  ? 7.982   -8.559  0.011   1.00 15.00 ?  929 PRO B HA   2  
ATOM   1360  H HB2  . PRO B 2 5  ? 8.567   -6.683  -1.943  1.00 15.00 ?  929 PRO B HB2  2  
ATOM   1361  H HB3  . PRO B 2 5  ? 8.137   -8.366  -2.257  1.00 15.00 ?  929 PRO B HB3  2  
ATOM   1362  H HG2  . PRO B 2 5  ? 6.437   -5.916  -2.378  1.00 15.00 ?  929 PRO B HG2  2  
ATOM   1363  H HG3  . PRO B 2 5  ? 6.443   -7.336  -3.440  1.00 15.00 ?  929 PRO B HG3  2  
ATOM   1364  H HD2  . PRO B 2 5  ? 4.562   -6.981  -1.559  1.00 15.00 ?  929 PRO B HD2  2  
ATOM   1365  H HD3  . PRO B 2 5  ? 5.177   -8.590  -1.975  1.00 15.00 ?  929 PRO B HD3  2  
ATOM   1366  N N    . PRO B 2 6  ? 9.290   -6.601  1.033   1.00 15.00 ?  930 PRO B N    2  
ATOM   1367  C CA   . PRO B 2 6  ? 9.936   -5.551  1.833   1.00 15.00 ?  930 PRO B CA   2  
ATOM   1368  C C    . PRO B 2 6  ? 9.862   -4.204  1.131   1.00 15.00 ?  930 PRO B C    2  
ATOM   1369  O O    . PRO B 2 6  ? 10.131  -4.107  -0.071  1.00 15.00 ?  930 PRO B O    2  
ATOM   1370  C CB   . PRO B 2 6  ? 11.396  -6.021  1.947   1.00 15.00 ?  930 PRO B CB   2  
ATOM   1371  C CG   . PRO B 2 6  ? 11.524  -7.174  1.008   1.00 15.00 ?  930 PRO B CG   2  
ATOM   1372  C CD   . PRO B 2 6  ? 10.155  -7.774  0.899   1.00 15.00 ?  930 PRO B CD   2  
ATOM   1373  H HA   . PRO B 2 6  ? 9.496   -5.474  2.818   1.00 15.00 ?  930 PRO B HA   2  
ATOM   1374  H HB2  . PRO B 2 6  ? 12.056  -5.212  1.668   1.00 15.00 ?  930 PRO B HB2  2  
ATOM   1375  H HB3  . PRO B 2 6  ? 11.601  -6.319  2.965   1.00 15.00 ?  930 PRO B HB3  2  
ATOM   1376  H HG2  . PRO B 2 6  ? 11.857  -6.825  0.041   1.00 15.00 ?  930 PRO B HG2  2  
ATOM   1377  H HG3  . PRO B 2 6  ? 12.219  -7.897  1.407   1.00 15.00 ?  930 PRO B HG3  2  
ATOM   1378  H HD2  . PRO B 2 6  ? 10.020  -8.249  -0.062  1.00 15.00 ?  930 PRO B HD2  2  
ATOM   1379  H HD3  . PRO B 2 6  ? 9.980   -8.475  1.702   1.00 15.00 ?  930 PRO B HD3  2  
ATOM   1380  N N    . TYR B 2 7  ? 9.499   -3.167  1.874   1.00 15.00 ?  931 TYR B N    2  
ATOM   1381  C CA   . TYR B 2 7  ? 9.153   -1.901  1.259   1.00 15.00 ?  931 TYR B CA   2  
ATOM   1382  C C    . TYR B 2 7  ? 10.374  -1.244  0.619   1.00 15.00 ?  931 TYR B C    2  
ATOM   1383  O O    . TYR B 2 7  ? 11.367  -0.934  1.282   1.00 15.00 ?  931 TYR B O    2  
ATOM   1384  C CB   . TYR B 2 7  ? 8.536   -0.976  2.322   1.00 15.00 ?  931 TYR B CB   2  
ATOM   1385  C CG   . TYR B 2 7  ? 7.960   0.326   1.795   1.00 15.00 ?  931 TYR B CG   2  
ATOM   1386  C CD1  . TYR B 2 7  ? 7.591   0.465   0.463   1.00 15.00 ?  931 TYR B CD1  2  
ATOM   1387  C CD2  . TYR B 2 7  ? 7.777   1.418   2.641   1.00 15.00 ?  931 TYR B CD2  2  
ATOM   1388  C CE1  . TYR B 2 7  ? 7.061   1.647   -0.012  1.00 15.00 ?  931 TYR B CE1  2  
ATOM   1389  C CE2  . TYR B 2 7  ? 7.244   2.604   2.171   1.00 15.00 ?  931 TYR B CE2  2  
ATOM   1390  C CZ   . TYR B 2 7  ? 6.890   2.711   0.844   1.00 15.00 ?  931 TYR B CZ   2  
ATOM   1391  O OH   . TYR B 2 7  ? 6.353   3.885   0.370   1.00 15.00 ?  931 TYR B OH   2  
ATOM   1392  H H    . TYR B 2 7  ? 9.477   -3.253  2.853   1.00 15.00 ?  931 TYR B H    2  
ATOM   1393  H HA   . TYR B 2 7  ? 8.418   -2.091  0.493   1.00 15.00 ?  931 TYR B HA   2  
ATOM   1394  H HB2  . TYR B 2 7  ? 7.735   -1.503  2.819   1.00 15.00 ?  931 TYR B HB2  2  
ATOM   1395  H HB3  . TYR B 2 7  ? 9.295   -0.730  3.049   1.00 15.00 ?  931 TYR B HB3  2  
ATOM   1396  H HD1  . TYR B 2 7  ? 7.723   -0.370  -0.208  1.00 15.00 ?  931 TYR B HD1  2  
ATOM   1397  H HD2  . TYR B 2 7  ? 8.058   1.332   3.683   1.00 15.00 ?  931 TYR B HD2  2  
ATOM   1398  H HE1  . TYR B 2 7  ? 6.781   1.735   -1.052  1.00 15.00 ?  931 TYR B HE1  2  
ATOM   1399  H HE2  . TYR B 2 7  ? 7.109   3.442   2.843   1.00 15.00 ?  931 TYR B HE2  2  
ATOM   1400  H HH   . TYR B 2 7  ? 5.614   3.684   -0.208  1.00 15.00 ?  931 TYR B HH   2  
ATOM   1401  N N    . GLU B 2 8  ? 10.278  -1.054  -0.685  1.00 15.00 ?  932 GLU B N    2  
ATOM   1402  C CA   . GLU B 2 8  ? 11.171  -0.187  -1.422  1.00 15.00 ?  932 GLU B CA   2  
ATOM   1403  C C    . GLU B 2 8  ? 10.367  1.025   -1.840  1.00 15.00 ?  932 GLU B C    2  
ATOM   1404  O O    . GLU B 2 8  ? 9.282   0.863   -2.408  1.00 15.00 ?  932 GLU B O    2  
ATOM   1405  C CB   . GLU B 2 8  ? 11.736  -0.909  -2.647  1.00 15.00 ?  932 GLU B CB   2  
ATOM   1406  C CG   . GLU B 2 8  ? 12.898  -0.172  -3.292  1.00 15.00 ?  932 GLU B CG   2  
ATOM   1407  C CD   . GLU B 2 8  ? 14.036  0.044   -2.318  1.00 15.00 ?  932 GLU B CD   2  
ATOM   1408  O OE1  . GLU B 2 8  ? 14.881  -0.865  -2.178  1.00 15.00 -1 932 GLU B OE1  2  
ATOM   1409  O OE2  . GLU B 2 8  ? 14.076  1.109   -1.672  1.00 15.00 ?  932 GLU B OE2  2  
ATOM   1410  H H    . GLU B 2 8  ? 9.566   -1.518  -1.176  1.00 15.00 ?  932 GLU B H    2  
ATOM   1411  H HA   . GLU B 2 8  ? 11.975  0.117   -0.768  1.00 15.00 ?  932 GLU B HA   2  
ATOM   1412  H HB2  . GLU B 2 8  ? 12.076  -1.890  -2.350  1.00 15.00 ?  932 GLU B HB2  2  
ATOM   1413  H HB3  . GLU B 2 8  ? 10.952  -1.015  -3.382  1.00 15.00 ?  932 GLU B HB3  2  
ATOM   1414  H HG2  . GLU B 2 8  ? 13.260  -0.750  -4.130  1.00 15.00 ?  932 GLU B HG2  2  
ATOM   1415  H HG3  . GLU B 2 8  ? 12.550  0.790   -3.637  1.00 15.00 ?  932 GLU B HG3  2  
ATOM   1416  N N    . THR B 2 9  ? 10.848  2.225   -1.566  1.00 15.00 ?  933 THR B N    2  
ATOM   1417  C CA   . THR B 2 9  ? 10.042  3.398   -1.844  1.00 15.00 ?  933 THR B CA   2  
ATOM   1418  C C    . THR B 2 9  ? 9.787   3.548   -3.340  1.00 15.00 ?  933 THR B C    2  
ATOM   1419  O O    . THR B 2 9  ? 10.712  3.669   -4.147  1.00 15.00 ?  933 THR B O    2  
ATOM   1420  C CB   . THR B 2 9  ? 10.669  4.692   -1.297  1.00 15.00 ?  933 THR B CB   2  
ATOM   1421  O OG1  . THR B 2 9  ? 11.132  4.481   0.047   1.00 15.00 ?  933 THR B OG1  2  
ATOM   1422  C CG2  . THR B 2 9  ? 9.637   5.817   -1.308  1.00 15.00 ?  933 THR B CG2  2  
ATOM   1423  H H    . THR B 2 9  ? 11.747  2.324   -1.184  1.00 15.00 ?  933 THR B H    2  
ATOM   1424  H HA   . THR B 2 9  ? 9.090   3.257   -1.353  1.00 15.00 ?  933 THR B HA   2  
ATOM   1425  H HB   . THR B 2 9  ? 11.502  4.975   -1.924  1.00 15.00 ?  933 THR B HB   2  
ATOM   1426  H HG1  . THR B 2 9  ? 10.423  4.700   0.664   1.00 15.00 ?  933 THR B HG1  2  
ATOM   1427  H HG21 . THR B 2 9  ? 10.073  6.714   -0.898  1.00 15.00 ?  933 THR B HG21 2  
ATOM   1428  H HG22 . THR B 2 9  ? 8.779   5.527   -0.714  1.00 15.00 ?  933 THR B HG22 2  
ATOM   1429  H HG23 . THR B 2 9  ? 9.319   6.004   -2.324  1.00 15.00 ?  933 THR B HG23 2  
ATOM   1430  N N    . PHE B 2 10 ? 8.515   3.522   -3.679  1.00 15.00 ?  934 PHE B N    2  
ATOM   1431  C CA   . PHE B 2 10 ? 8.039   3.775   -5.023  1.00 15.00 ?  934 PHE B CA   2  
ATOM   1432  C C    . PHE B 2 10 ? 7.838   5.287   -5.176  1.00 15.00 ?  934 PHE B C    2  
ATOM   1433  O O    . PHE B 2 10 ? 8.132   6.035   -4.241  1.00 15.00 ?  934 PHE B O    2  
ATOM   1434  C CB   . PHE B 2 10 ? 6.746   2.992   -5.303  1.00 15.00 ?  934 PHE B CB   2  
ATOM   1435  C CG   . PHE B 2 10 ? 5.559   3.562   -4.601  1.00 15.00 ?  934 PHE B CG   2  
ATOM   1436  C CD1  . PHE B 2 10 ? 5.262   3.220   -3.291  1.00 15.00 ?  934 PHE B CD1  2  
ATOM   1437  C CD2  . PHE B 2 10 ? 4.771   4.487   -5.246  1.00 15.00 ?  934 PHE B CD2  2  
ATOM   1438  C CE1  . PHE B 2 10 ? 4.193   3.797   -2.649  1.00 15.00 ?  934 PHE B CE1  2  
ATOM   1439  C CE2  . PHE B 2 10 ? 3.714   5.075   -4.607  1.00 15.00 ?  934 PHE B CE2  2  
ATOM   1440  C CZ   . PHE B 2 10 ? 3.426   4.731   -3.311  1.00 15.00 ?  934 PHE B CZ   2  
ATOM   1441  H H    . PHE B 2 10 ? 7.856   3.322   -2.984  1.00 15.00 ?  934 PHE B H    2  
ATOM   1442  H HA   . PHE B 2 10 ? 8.809   3.454   -5.711  1.00 15.00 ?  934 PHE B HA   2  
ATOM   1443  H HB2  . PHE B 2 10 ? 6.545   3.007   -6.364  1.00 15.00 ?  934 PHE B HB2  2  
ATOM   1444  H HB3  . PHE B 2 10 ? 6.871   1.969   -4.978  1.00 15.00 ?  934 PHE B HB3  2  
ATOM   1445  H HD1  . PHE B 2 10 ? 5.860   2.479   -2.781  1.00 15.00 ?  934 PHE B HD1  2  
ATOM   1446  H HD2  . PHE B 2 10 ? 4.997   4.748   -6.265  1.00 15.00 ?  934 PHE B HD2  2  
ATOM   1447  H HE1  . PHE B 2 10 ? 3.963   3.529   -1.629  1.00 15.00 ?  934 PHE B HE1  2  
ATOM   1448  H HE2  . PHE B 2 10 ? 3.102   5.800   -5.125  1.00 15.00 ?  934 PHE B HE2  2  
ATOM   1449  H HZ   . PHE B 2 10 ? 2.611   5.202   -2.813  1.00 15.00 ?  934 PHE B HZ   2  
ATOM   1450  N N    . GLU B 2 11 ? 7.385   5.735   -6.345  1.00 15.00 ?  935 GLU B N    2  
ATOM   1451  C CA   . GLU B 2 11 ? 7.291   7.167   -6.657  1.00 15.00 ?  935 GLU B CA   2  
ATOM   1452  C C    . GLU B 2 11 ? 6.615   7.964   -5.531  1.00 15.00 ?  935 GLU B C    2  
ATOM   1453  O O    . GLU B 2 11 ? 5.626   7.529   -4.938  1.00 15.00 ?  935 GLU B O    2  
ATOM   1454  C CB   . GLU B 2 11 ? 6.501   7.355   -7.959  1.00 15.00 ?  935 GLU B CB   2  
ATOM   1455  C CG   . GLU B 2 11 ? 5.003   7.100   -7.824  1.00 15.00 ?  935 GLU B CG   2  
ATOM   1456  C CD   . GLU B 2 11 ? 4.460   6.245   -8.948  1.00 15.00 ?  935 GLU B CD   2  
ATOM   1457  O OE1  . GLU B 2 11 ? 4.077   6.809   -9.994  1.00 15.00 -1 935 GLU B OE1  2  
ATOM   1458  O OE2  . GLU B 2 11 ? 4.404   5.006   -8.789  1.00 15.00 ?  935 GLU B OE2  2  
ATOM   1459  H H    . GLU B 2 11 ? 7.085   5.084   -7.016  1.00 15.00 ?  935 GLU B H    2  
ATOM   1460  H HA   . GLU B 2 11 ? 8.294   7.542   -6.799  1.00 15.00 ?  935 GLU B HA   2  
ATOM   1461  H HB2  . GLU B 2 11 ? 6.640   8.369   -8.303  1.00 15.00 ?  935 GLU B HB2  2  
ATOM   1462  H HB3  . GLU B 2 11 ? 6.894   6.677   -8.703  1.00 15.00 ?  935 GLU B HB3  2  
ATOM   1463  H HG2  . GLU B 2 11 ? 4.800   6.608   -6.878  1.00 15.00 ?  935 GLU B HG2  2  
ATOM   1464  H HG3  . GLU B 2 11 ? 4.492   8.052   -7.844  1.00 15.00 ?  935 GLU B HG3  2  
ATOM   1465  N N    . ASP B 2 12 ? 7.163   9.144   -5.261  1.00 15.00 ?  936 ASP B N    2  
ATOM   1466  C CA   . ASP B 2 12 ? 6.708   9.990   -4.163  1.00 15.00 ?  936 ASP B CA   2  
ATOM   1467  C C    . ASP B 2 12 ? 5.318   10.555  -4.443  1.00 15.00 ?  936 ASP B C    2  
ATOM   1468  O O    . ASP B 2 12 ? 5.017   10.958  -5.570  1.00 15.00 ?  936 ASP B O    2  
ATOM   1469  C CB   . ASP B 2 12 ? 7.704   11.131  -3.948  1.00 15.00 ?  936 ASP B CB   2  
ATOM   1470  C CG   . ASP B 2 12 ? 7.349   12.002  -2.760  1.00 15.00 ?  936 ASP B CG   2  
ATOM   1471  O OD1  . ASP B 2 12 ? 7.546   11.552  -1.610  1.00 15.00 -1 936 ASP B OD1  2  
ATOM   1472  O OD2  . ASP B 2 12 ? 6.879   13.141  -2.967  1.00 15.00 ?  936 ASP B OD2  2  
ATOM   1473  H H    . ASP B 2 12 ? 7.898   9.464   -5.831  1.00 15.00 ?  936 ASP B H    2  
ATOM   1474  H HA   . ASP B 2 12 ? 6.667   9.386   -3.269  1.00 15.00 ?  936 ASP B HA   2  
ATOM   1475  H HB2  . ASP B 2 12 ? 8.688   10.716  -3.783  1.00 15.00 ?  936 ASP B HB2  2  
ATOM   1476  H HB3  . ASP B 2 12 ? 7.724   11.751  -4.830  1.00 15.00 ?  936 ASP B HB3  2  
ATOM   1477  N N    . LEU B 2 13 ? 4.484   10.600  -3.412  1.00 15.00 ?  937 LEU B N    2  
ATOM   1478  C CA   . LEU B 2 13 ? 3.119   11.094  -3.548  1.00 15.00 ?  937 LEU B CA   2  
ATOM   1479  C C    . LEU B 2 13 ? 3.037   12.554  -3.117  1.00 15.00 ?  937 LEU B C    2  
ATOM   1480  O O    . LEU B 2 13 ? 2.889   12.859  -1.933  1.00 15.00 ?  937 LEU B O    2  
ATOM   1481  C CB   . LEU B 2 13 ? 2.132   10.247  -2.721  1.00 15.00 ?  937 LEU B CB   2  
ATOM   1482  C CG   . LEU B 2 13 ? 2.036   8.762   -3.096  1.00 15.00 ?  937 LEU B CG   2  
ATOM   1483  C CD1  . LEU B 2 13 ? 1.900   8.585   -4.601  1.00 15.00 ?  937 LEU B CD1  2  
ATOM   1484  C CD2  . LEU B 2 13 ? 3.234   7.993   -2.562  1.00 15.00 ?  937 LEU B CD2  2  
ATOM   1485  H H    . LEU B 2 13 ? 4.797   10.296  -2.529  1.00 15.00 ?  937 LEU B H    2  
ATOM   1486  H HA   . LEU B 2 13 ? 2.848   11.026  -4.591  1.00 15.00 ?  937 LEU B HA   2  
ATOM   1487  H HB2  . LEU B 2 13 ? 2.422   10.310  -1.681  1.00 15.00 ?  937 LEU B HB2  2  
ATOM   1488  H HB3  . LEU B 2 13 ? 1.150   10.682  -2.826  1.00 15.00 ?  937 LEU B HB3  2  
ATOM   1489  H HG   . LEU B 2 13 ? 1.149   8.348   -2.638  1.00 15.00 ?  937 LEU B HG   2  
ATOM   1490  H HD11 . LEU B 2 13 ? 1.011   9.092   -4.944  1.00 15.00 ?  937 LEU B HD11 2  
ATOM   1491  H HD12 . LEU B 2 13 ? 1.827   7.532   -4.833  1.00 15.00 ?  937 LEU B HD12 2  
ATOM   1492  H HD13 . LEU B 2 13 ? 2.765   9.003   -5.093  1.00 15.00 ?  937 LEU B HD13 2  
ATOM   1493  H HD21 . LEU B 2 13 ? 4.142   8.408   -2.975  1.00 15.00 ?  937 LEU B HD21 2  
ATOM   1494  H HD22 . LEU B 2 13 ? 3.151   6.954   -2.847  1.00 15.00 ?  937 LEU B HD22 2  
ATOM   1495  H HD23 . LEU B 2 13 ? 3.260   8.068   -1.484  1.00 15.00 ?  937 LEU B HD23 2  
HETATM 1496  N N    . NH2 B 2 14 ? 3.146   13.454  -4.079  1.00 15.00 ?  938 NH2 B N    2  
HETATM 1497  H HN1  . NH2 B 2 14 ? 3.264   13.137  -4.999  1.00 15.00 ?  938 NH2 B HN1  2  
HETATM 1498  H HN2  . NH2 B 2 14 ? 3.103   14.401  -3.832  1.00 15.00 ?  938 NH2 B HN2  2  
ATOM   1499  N N    . PHE A 1 7  ? -10.231 9.106   -1.243  1.00 15.00 ?  478 PHE A N    3  
ATOM   1500  C CA   . PHE A 1 7  ? -11.014 7.933   -0.787  1.00 15.00 ?  478 PHE A CA   3  
ATOM   1501  C C    . PHE A 1 7  ? -10.246 7.162   0.278   1.00 15.00 ?  478 PHE A C    3  
ATOM   1502  O O    . PHE A 1 7  ? -10.818 6.714   1.272   1.00 15.00 ?  478 PHE A O    3  
ATOM   1503  C CB   . PHE A 1 7  ? -11.349 7.015   -1.969  1.00 15.00 ?  478 PHE A CB   3  
ATOM   1504  C CG   . PHE A 1 7  ? -12.212 5.837   -1.604  1.00 15.00 ?  478 PHE A CG   3  
ATOM   1505  C CD1  . PHE A 1 7  ? -13.571 6.000   -1.378  1.00 15.00 ?  478 PHE A CD1  3  
ATOM   1506  C CD2  . PHE A 1 7  ? -11.666 4.568   -1.486  1.00 15.00 ?  478 PHE A CD2  3  
ATOM   1507  C CE1  . PHE A 1 7  ? -14.365 4.919   -1.040  1.00 15.00 ?  478 PHE A CE1  3  
ATOM   1508  C CE2  . PHE A 1 7  ? -12.457 3.485   -1.147  1.00 15.00 ?  478 PHE A CE2  3  
ATOM   1509  C CZ   . PHE A 1 7  ? -13.807 3.662   -0.924  1.00 15.00 ?  478 PHE A CZ   3  
ATOM   1510  H H    . PHE A 1 7  ? -9.304  8.805   -1.613  1.00 15.00 ?  478 PHE A H    3  
ATOM   1511  H HA   . PHE A 1 7  ? -11.934 8.296   -0.352  1.00 15.00 ?  478 PHE A HA   3  
ATOM   1512  H HB2  . PHE A 1 7  ? -11.872 7.587   -2.721  1.00 15.00 ?  478 PHE A HB2  3  
ATOM   1513  H HB3  . PHE A 1 7  ? -10.428 6.636   -2.390  1.00 15.00 ?  478 PHE A HB3  3  
ATOM   1514  H HD1  . PHE A 1 7  ? -14.008 6.983   -1.469  1.00 15.00 ?  478 PHE A HD1  3  
ATOM   1515  H HD2  . PHE A 1 7  ? -10.609 4.428   -1.658  1.00 15.00 ?  478 PHE A HD2  3  
ATOM   1516  H HE1  . PHE A 1 7  ? -15.423 5.059   -0.865  1.00 15.00 ?  478 PHE A HE1  3  
ATOM   1517  H HE2  . PHE A 1 7  ? -12.018 2.504   -1.061  1.00 15.00 ?  478 PHE A HE2  3  
ATOM   1518  H HZ   . PHE A 1 7  ? -14.428 2.815   -0.661  1.00 15.00 ?  478 PHE A HZ   3  
ATOM   1519  N N    . LEU A 1 8  ? -8.950  6.995   0.059   1.00 15.00 ?  479 LEU A N    3  
ATOM   1520  C CA   . LEU A 1 8  ? -8.102  6.307   1.015   1.00 15.00 ?  479 LEU A CA   3  
ATOM   1521  C C    . LEU A 1 8  ? -7.622  7.304   2.072   1.00 15.00 ?  479 LEU A C    3  
ATOM   1522  O O    . LEU A 1 8  ? -7.280  8.443   1.742   1.00 15.00 ?  479 LEU A O    3  
ATOM   1523  C CB   . LEU A 1 8  ? -6.908  5.665   0.294   1.00 15.00 ?  479 LEU A CB   3  
ATOM   1524  C CG   . LEU A 1 8  ? -6.668  4.181   0.613   1.00 15.00 ?  479 LEU A CG   3  
ATOM   1525  C CD1  . LEU A 1 8  ? -7.755  3.311   0.001   1.00 15.00 ?  479 LEU A CD1  3  
ATOM   1526  C CD2  . LEU A 1 8  ? -5.313  3.730   0.104   1.00 15.00 ?  479 LEU A CD2  3  
ATOM   1527  H H    . LEU A 1 8  ? -8.550  7.351   -0.767  1.00 15.00 ?  479 LEU A H    3  
ATOM   1528  H HA   . LEU A 1 8  ? -8.688  5.537   1.493   1.00 15.00 ?  479 LEU A HA   3  
ATOM   1529  H HB2  . LEU A 1 8  ? -7.062  5.761   -0.772  1.00 15.00 ?  479 LEU A HB2  3  
ATOM   1530  H HB3  . LEU A 1 8  ? -6.018  6.214   0.561   1.00 15.00 ?  479 LEU A HB3  3  
ATOM   1531  H HG   . LEU A 1 8  ? -6.685  4.046   1.689   1.00 15.00 ?  479 LEU A HG   3  
ATOM   1532  H HD11 . LEU A 1 8  ? -7.659  2.302   0.376   1.00 15.00 ?  479 LEU A HD11 3  
ATOM   1533  H HD12 . LEU A 1 8  ? -7.641  3.305   -1.081  1.00 15.00 ?  479 LEU A HD12 3  
ATOM   1534  H HD13 . LEU A 1 8  ? -8.726  3.706   0.261   1.00 15.00 ?  479 LEU A HD13 3  
ATOM   1535  H HD21 . LEU A 1 8  ? -4.540  4.340   0.549   1.00 15.00 ?  479 LEU A HD21 3  
ATOM   1536  H HD22 . LEU A 1 8  ? -5.279  3.830   -0.970  1.00 15.00 ?  479 LEU A HD22 3  
ATOM   1537  H HD23 . LEU A 1 8  ? -5.155  2.696   0.372   1.00 15.00 ?  479 LEU A HD23 3  
ATOM   1538  N N    . PRO A 1 9  ? -7.615  6.887   3.353   1.00 15.00 ?  480 PRO A N    3  
ATOM   1539  C CA   . PRO A 1 9  ? -7.174  7.714   4.498   1.00 15.00 ?  480 PRO A CA   3  
ATOM   1540  C C    . PRO A 1 9  ? -5.882  8.498   4.245   1.00 15.00 ?  480 PRO A C    3  
ATOM   1541  O O    . PRO A 1 9  ? -5.075  8.126   3.395   1.00 15.00 ?  480 PRO A O    3  
ATOM   1542  C CB   . PRO A 1 9  ? -6.939  6.654   5.567   1.00 15.00 ?  480 PRO A CB   3  
ATOM   1543  C CG   . PRO A 1 9  ? -8.002  5.662   5.307   1.00 15.00 ?  480 PRO A CG   3  
ATOM   1544  C CD   . PRO A 1 9  ? -8.053  5.549   3.809   1.00 15.00 ?  480 PRO A CD   3  
ATOM   1545  H HA   . PRO A 1 9  ? -7.950  8.389   4.825   1.00 15.00 ?  480 PRO A HA   3  
ATOM   1546  H HB2  . PRO A 1 9  ? -5.962  6.221   5.430   1.00 15.00 ?  480 PRO A HB2  3  
ATOM   1547  H HB3  . PRO A 1 9  ? -7.013  7.086   6.549   1.00 15.00 ?  480 PRO A HB3  3  
ATOM   1548  H HG2  . PRO A 1 9  ? -7.741  4.712   5.752   1.00 15.00 ?  480 PRO A HG2  3  
ATOM   1549  H HG3  . PRO A 1 9  ? -8.944  6.018   5.691   1.00 15.00 ?  480 PRO A HG3  3  
ATOM   1550  H HD2  . PRO A 1 9  ? -7.374  4.782   3.465   1.00 15.00 ?  480 PRO A HD2  3  
ATOM   1551  H HD3  . PRO A 1 9  ? -9.054  5.340   3.480   1.00 15.00 ?  480 PRO A HD3  3  
ATOM   1552  N N    . PRO A 1 10 ? -5.662  9.584   5.013   1.00 15.00 ?  481 PRO A N    3  
ATOM   1553  C CA   . PRO A 1 10 ? -4.462  10.422  4.887   1.00 15.00 ?  481 PRO A CA   3  
ATOM   1554  C C    . PRO A 1 10 ? -3.172  9.613   4.986   1.00 15.00 ?  481 PRO A C    3  
ATOM   1555  O O    . PRO A 1 10 ? -2.881  8.998   6.011   1.00 15.00 ?  481 PRO A O    3  
ATOM   1556  C CB   . PRO A 1 10 ? -4.578  11.394  6.063   1.00 15.00 ?  481 PRO A CB   3  
ATOM   1557  C CG   . PRO A 1 10 ? -6.035  11.460  6.348   1.00 15.00 ?  481 PRO A CG   3  
ATOM   1558  C CD   . PRO A 1 10 ? -6.566  10.082  6.068   1.00 15.00 ?  481 PRO A CD   3  
ATOM   1559  H HA   . PRO A 1 10 ? -4.465  10.974  3.960   1.00 15.00 ?  481 PRO A HA   3  
ATOM   1560  H HB2  . PRO A 1 10 ? -4.026  11.006  6.908   1.00 15.00 ?  481 PRO A HB2  3  
ATOM   1561  H HB3  . PRO A 1 10 ? -4.186  12.359  5.781   1.00 15.00 ?  481 PRO A HB3  3  
ATOM   1562  H HG2  . PRO A 1 10 ? -6.197  11.723  7.384   1.00 15.00 ?  481 PRO A HG2  3  
ATOM   1563  H HG3  . PRO A 1 10 ? -6.506  12.181  5.698   1.00 15.00 ?  481 PRO A HG3  3  
ATOM   1564  H HD2  . PRO A 1 10 ? -6.503  9.464   6.953   1.00 15.00 ?  481 PRO A HD2  3  
ATOM   1565  H HD3  . PRO A 1 10 ? -7.584  10.131  5.711   1.00 15.00 ?  481 PRO A HD3  3  
ATOM   1566  N N    . GLY A 1 11 ? -2.427  9.592   3.894   1.00 15.00 ?  482 GLY A N    3  
ATOM   1567  C CA   . GLY A 1 11 ? -1.185  8.854   3.844   1.00 15.00 ?  482 GLY A CA   3  
ATOM   1568  C C    . GLY A 1 11 ? -1.369  7.464   3.301   1.00 15.00 ?  482 GLY A C    3  
ATOM   1569  O O    . GLY A 1 11 ? -0.398  6.789   2.985   1.00 15.00 ?  482 GLY A O    3  
ATOM   1570  H H    . GLY A 1 11 ? -2.733  10.084  3.095   1.00 15.00 ?  482 GLY A H    3  
ATOM   1571  H HA2  . GLY A 1 11 ? -0.501  9.381   3.208   1.00 15.00 ?  482 GLY A HA2  3  
ATOM   1572  H HA3  . GLY A 1 11 ? -0.759  8.788   4.827   1.00 15.00 ?  482 GLY A HA3  3  
ATOM   1573  N N    . TRP A 1 12 ? -2.610  7.042   3.170   1.00 15.00 ?  483 TRP A N    3  
ATOM   1574  C CA   . TRP A 1 12 ? -2.900  5.749   2.598   1.00 15.00 ?  483 TRP A CA   3  
ATOM   1575  C C    . TRP A 1 12 ? -3.051  5.908   1.109   1.00 15.00 ?  483 TRP A C    3  
ATOM   1576  O O    . TRP A 1 12 ? -3.962  6.580   0.626   1.00 15.00 ?  483 TRP A O    3  
ATOM   1577  C CB   . TRP A 1 12 ? -4.168  5.137   3.192   1.00 15.00 ?  483 TRP A CB   3  
ATOM   1578  C CG   . TRP A 1 12 ? -3.997  4.683   4.602   1.00 15.00 ?  483 TRP A CG   3  
ATOM   1579  C CD1  . TRP A 1 12 ? -4.024  5.464   5.715   1.00 15.00 ?  483 TRP A CD1  3  
ATOM   1580  C CD2  . TRP A 1 12 ? -3.776  3.342   5.051   1.00 15.00 ?  483 TRP A CD2  3  
ATOM   1581  N NE1  . TRP A 1 12 ? -3.819  4.696   6.837   1.00 15.00 ?  483 TRP A NE1  3  
ATOM   1582  C CE2  . TRP A 1 12 ? -3.665  3.387   6.455   1.00 15.00 ?  483 TRP A CE2  3  
ATOM   1583  C CE3  . TRP A 1 12 ? -3.657  2.108   4.400   1.00 15.00 ?  483 TRP A CE3  3  
ATOM   1584  C CZ2  . TRP A 1 12 ? -3.439  2.242   7.217   1.00 15.00 ?  483 TRP A CZ2  3  
ATOM   1585  C CZ3  . TRP A 1 12 ? -3.436  0.976   5.158   1.00 15.00 ?  483 TRP A CZ3  3  
ATOM   1586  C CH2  . TRP A 1 12 ? -3.330  1.047   6.553   1.00 15.00 ?  483 TRP A CH2  3  
ATOM   1587  H H    . TRP A 1 12 ? -3.352  7.622   3.452   1.00 15.00 ?  483 TRP A H    3  
ATOM   1588  H HA   . TRP A 1 12 ? -2.061  5.099   2.800   1.00 15.00 ?  483 TRP A HA   3  
ATOM   1589  H HB2  . TRP A 1 12 ? -4.958  5.873   3.172   1.00 15.00 ?  483 TRP A HB2  3  
ATOM   1590  H HB3  . TRP A 1 12 ? -4.462  4.284   2.595   1.00 15.00 ?  483 TRP A HB3  3  
ATOM   1591  H HD1  . TRP A 1 12 ? -4.186  6.534   5.695   1.00 15.00 ?  483 TRP A HD1  3  
ATOM   1592  H HE1  . TRP A 1 12 ? -3.786  5.030   7.765   1.00 15.00 ?  483 TRP A HE1  3  
ATOM   1593  H HE3  . TRP A 1 12 ? -3.734  2.028   3.325   1.00 15.00 ?  483 TRP A HE3  3  
ATOM   1594  H HZ2  . TRP A 1 12 ? -3.353  2.280   8.294   1.00 15.00 ?  483 TRP A HZ2  3  
ATOM   1595  H HZ3  . TRP A 1 12 ? -3.350  0.014   4.673   1.00 15.00 ?  483 TRP A HZ3  3  
ATOM   1596  H HH2  . TRP A 1 12 ? -3.157  0.135   7.105   1.00 15.00 ?  483 TRP A HH2  3  
ATOM   1597  N N    . GLU A 1 13 ? -2.128  5.320   0.389   1.00 15.00 ?  484 GLU A N    3  
ATOM   1598  C CA   . GLU A 1 13 ? -2.101  5.442   -1.038  1.00 15.00 ?  484 GLU A CA   3  
ATOM   1599  C C    . GLU A 1 13 ? -2.157  4.082   -1.697  1.00 15.00 ?  484 GLU A C    3  
ATOM   1600  O O    . GLU A 1 13 ? -1.324  3.215   -1.450  1.00 15.00 ?  484 GLU A O    3  
ATOM   1601  C CB   . GLU A 1 13 ? -0.865  6.219   -1.454  1.00 15.00 ?  484 GLU A CB   3  
ATOM   1602  C CG   . GLU A 1 13 ? -1.136  7.700   -1.590  1.00 15.00 ?  484 GLU A CG   3  
ATOM   1603  C CD   . GLU A 1 13 ? -2.337  7.988   -2.467  1.00 15.00 ?  484 GLU A CD   3  
ATOM   1604  O OE1  . GLU A 1 13 ? -2.364  7.514   -3.622  1.00 15.00 ?  484 GLU A OE1  3  
ATOM   1605  O OE2  . GLU A 1 13 ? -3.255  8.703   -2.008  1.00 15.00 -1 484 GLU A OE2  3  
ATOM   1606  H H    . GLU A 1 13 ? -1.437  4.785   0.841   1.00 15.00 ?  484 GLU A H    3  
ATOM   1607  H HA   . GLU A 1 13 ? -2.976  6.003   -1.333  1.00 15.00 ?  484 GLU A HA   3  
ATOM   1608  H HB2  . GLU A 1 13 ? -0.101  6.083   -0.701  1.00 15.00 ?  484 GLU A HB2  3  
ATOM   1609  H HB3  . GLU A 1 13 ? -0.503  5.846   -2.388  1.00 15.00 ?  484 GLU A HB3  3  
ATOM   1610  H HG2  . GLU A 1 13 ? -1.319  8.108   -0.610  1.00 15.00 ?  484 GLU A HG2  3  
ATOM   1611  H HG3  . GLU A 1 13 ? -0.269  8.169   -2.024  1.00 15.00 ?  484 GLU A HG3  3  
ATOM   1612  N N    . MET A 1 14 ? -3.146  3.921   -2.546  1.00 15.00 ?  485 MET A N    3  
ATOM   1613  C CA   . MET A 1 14 ? -3.417  2.647   -3.188  1.00 15.00 ?  485 MET A CA   3  
ATOM   1614  C C    . MET A 1 14 ? -2.768  2.600   -4.569  1.00 15.00 ?  485 MET A C    3  
ATOM   1615  O O    . MET A 1 14 ? -3.079  3.404   -5.448  1.00 15.00 ?  485 MET A O    3  
ATOM   1616  C CB   . MET A 1 14 ? -4.936  2.411   -3.245  1.00 15.00 ?  485 MET A CB   3  
ATOM   1617  C CG   . MET A 1 14 ? -5.384  1.409   -4.293  1.00 15.00 ?  485 MET A CG   3  
ATOM   1618  S SD   . MET A 1 14 ? -6.721  0.331   -3.746  1.00 15.00 ?  485 MET A SD   3  
ATOM   1619  C CE   . MET A 1 14 ? -8.029  1.519   -3.454  1.00 15.00 ?  485 MET A CE   3  
ATOM   1620  H H    . MET A 1 14 ? -3.701  4.699   -2.772  1.00 15.00 ?  485 MET A H    3  
ATOM   1621  H HA   . MET A 1 14 ? -2.969  1.875   -2.579  1.00 15.00 ?  485 MET A HA   3  
ATOM   1622  H HB2  . MET A 1 14 ? -5.265  2.054   -2.280  1.00 15.00 ?  485 MET A HB2  3  
ATOM   1623  H HB3  . MET A 1 14 ? -5.422  3.354   -3.449  1.00 15.00 ?  485 MET A HB3  3  
ATOM   1624  H HG2  . MET A 1 14 ? -5.739  1.966   -5.134  1.00 15.00 ?  485 MET A HG2  3  
ATOM   1625  H HG3  . MET A 1 14 ? -4.539  0.803   -4.587  1.00 15.00 ?  485 MET A HG3  3  
ATOM   1626  H HE1  . MET A 1 14 ? -7.712  2.223   -2.697  1.00 15.00 ?  485 MET A HE1  3  
ATOM   1627  H HE2  . MET A 1 14 ? -8.915  1.004   -3.117  1.00 15.00 ?  485 MET A HE2  3  
ATOM   1628  H HE3  . MET A 1 14 ? -8.249  2.047   -4.372  1.00 15.00 ?  485 MET A HE3  3  
ATOM   1629  N N    . ARG A 1 15 ? -1.846  1.661   -4.733  1.00 15.00 ?  486 ARG A N    3  
ATOM   1630  C CA   . ARG A 1 15 ? -1.041  1.553   -5.943  1.00 15.00 ?  486 ARG A CA   3  
ATOM   1631  C C    . ARG A 1 15 ? -0.889  0.102   -6.359  1.00 15.00 ?  486 ARG A C    3  
ATOM   1632  O O    . ARG A 1 15 ? -0.900  -0.798  -5.521  1.00 15.00 ?  486 ARG A O    3  
ATOM   1633  C CB   . ARG A 1 15 ? 0.341   2.161   -5.712  1.00 15.00 ?  486 ARG A CB   3  
ATOM   1634  C CG   . ARG A 1 15 ? 0.370   3.680   -5.772  1.00 15.00 ?  486 ARG A CG   3  
ATOM   1635  C CD   . ARG A 1 15 ? 0.337   4.176   -7.207  1.00 15.00 ?  486 ARG A CD   3  
ATOM   1636  N NE   . ARG A 1 15 ? 1.489   3.693   -7.976  1.00 15.00 ?  486 ARG A NE   3  
ATOM   1637  C CZ   . ARG A 1 15 ? 1.541   3.649   -9.309  1.00 15.00 ?  486 ARG A CZ   3  
ATOM   1638  N NH1  . ARG A 1 15 ? 0.522   4.081   -10.041 1.00 15.00 1  486 ARG A NH1  3  
ATOM   1639  N NH2  . ARG A 1 15 ? 2.619   3.176   -9.914  1.00 15.00 ?  486 ARG A NH2  3  
ATOM   1640  H H    . ARG A 1 15 ? -1.701  1.006   -4.011  1.00 15.00 ?  486 ARG A H    3  
ATOM   1641  H HA   . ARG A 1 15 ? -1.541  2.098   -6.729  1.00 15.00 ?  486 ARG A HA   3  
ATOM   1642  H HB2  . ARG A 1 15 ? 0.694   1.853   -4.743  1.00 15.00 ?  486 ARG A HB2  3  
ATOM   1643  H HB3  . ARG A 1 15 ? 1.016   1.781   -6.465  1.00 15.00 ?  486 ARG A HB3  3  
ATOM   1644  H HG2  . ARG A 1 15 ? -0.489  4.068   -5.246  1.00 15.00 ?  486 ARG A HG2  3  
ATOM   1645  H HG3  . ARG A 1 15 ? 1.274   4.030   -5.299  1.00 15.00 ?  486 ARG A HG3  3  
ATOM   1646  H HD2  . ARG A 1 15 ? -0.570  3.826   -7.677  1.00 15.00 ?  486 ARG A HD2  3  
ATOM   1647  H HD3  . ARG A 1 15 ? 0.346   5.257   -7.203  1.00 15.00 ?  486 ARG A HD3  3  
ATOM   1648  H HE   . ARG A 1 15 ? 2.268   3.377   -7.466  1.00 15.00 ?  486 ARG A HE   3  
ATOM   1649  H HH11 . ARG A 1 15 ? -0.302  4.446   -9.597  1.00 15.00 ?  486 ARG A HH11 3  
ATOM   1650  H HH12 . ARG A 1 15 ? 0.569   4.042   -11.044 1.00 15.00 ?  486 ARG A HH12 3  
ATOM   1651  H HH21 . ARG A 1 15 ? 3.408   2.846   -9.368  1.00 15.00 ?  486 ARG A HH21 3  
ATOM   1652  H HH22 . ARG A 1 15 ? 2.657   3.135   -10.916 1.00 15.00 ?  486 ARG A HH22 3  
ATOM   1653  N N    . ILE A 1 16 ? -0.750  -0.121  -7.651  1.00 15.00 ?  487 ILE A N    3  
ATOM   1654  C CA   . ILE A 1 16 ? -0.526  -1.462  -8.162  1.00 15.00 ?  487 ILE A CA   3  
ATOM   1655  C C    . ILE A 1 16 ? 0.965   -1.772  -8.232  1.00 15.00 ?  487 ILE A C    3  
ATOM   1656  O O    . ILE A 1 16 ? 1.772   -0.937  -8.644  1.00 15.00 ?  487 ILE A O    3  
ATOM   1657  C CB   . ILE A 1 16 ? -1.156  -1.658  -9.561  1.00 15.00 ?  487 ILE A CB   3  
ATOM   1658  C CG1  . ILE A 1 16 ? -2.679  -1.542  -9.485  1.00 15.00 ?  487 ILE A CG1  3  
ATOM   1659  C CG2  . ILE A 1 16 ? -0.764  -3.004  -10.157 1.00 15.00 ?  487 ILE A CG2  3  
ATOM   1660  C CD1  . ILE A 1 16 ? -3.372  -1.911  -10.780 1.00 15.00 ?  487 ILE A CD1  3  
ATOM   1661  H H    . ILE A 1 16 ? -0.793  0.636   -8.278  1.00 15.00 ?  487 ILE A H    3  
ATOM   1662  H HA   . ILE A 1 16 ? -0.990  -2.157  -7.483  1.00 15.00 ?  487 ILE A HA   3  
ATOM   1663  H HB   . ILE A 1 16 ? -0.777  -0.884  -10.209 1.00 15.00 ?  487 ILE A HB   3  
ATOM   1664  H HG12 . ILE A 1 16 ? -3.046  -2.200  -8.714  1.00 15.00 ?  487 ILE A HG12 3  
ATOM   1665  H HG13 . ILE A 1 16 ? -2.945  -0.523  -9.242  1.00 15.00 ?  487 ILE A HG13 3  
ATOM   1666  H HG21 . ILE A 1 16 ? 0.311   -3.059  -10.241 1.00 15.00 ?  487 ILE A HG21 3  
ATOM   1667  H HG22 . ILE A 1 16 ? -1.208  -3.106  -11.137 1.00 15.00 ?  487 ILE A HG22 3  
ATOM   1668  H HG23 . ILE A 1 16 ? -1.118  -3.798  -9.517  1.00 15.00 ?  487 ILE A HG23 3  
ATOM   1669  H HD11 . ILE A 1 16 ? -4.441  -1.859  -10.645 1.00 15.00 ?  487 ILE A HD11 3  
ATOM   1670  H HD12 . ILE A 1 16 ? -3.088  -2.917  -11.065 1.00 15.00 ?  487 ILE A HD12 3  
ATOM   1671  H HD13 . ILE A 1 16 ? -3.072  -1.221  -11.555 1.00 15.00 ?  487 ILE A HD13 3  
ATOM   1672  N N    . ALA A 1 17 ? 1.320   -2.976  -7.809  1.00 15.00 ?  488 ALA A N    3  
ATOM   1673  C CA   . ALA A 1 17 ? 2.674   -3.479  -7.959  1.00 15.00 ?  488 ALA A CA   3  
ATOM   1674  C C    . ALA A 1 17 ? 2.776   -4.194  -9.304  1.00 15.00 ?  488 ALA A C    3  
ATOM   1675  O O    . ALA A 1 17 ? 1.782   -4.750  -9.773  1.00 15.00 ?  488 ALA A O    3  
ATOM   1676  C CB   . ALA A 1 17 ? 3.023   -4.421  -6.811  1.00 15.00 ?  488 ALA A CB   3  
ATOM   1677  H H    . ALA A 1 17 ? 0.644   -3.549  -7.379  1.00 15.00 ?  488 ALA A H    3  
ATOM   1678  H HA   . ALA A 1 17 ? 3.355   -2.639  -7.945  1.00 15.00 ?  488 ALA A HA   3  
ATOM   1679  H HB1  . ALA A 1 17 ? 2.953   -3.890  -5.873  1.00 15.00 ?  488 ALA A HB1  3  
ATOM   1680  H HB2  . ALA A 1 17 ? 4.030   -4.788  -6.942  1.00 15.00 ?  488 ALA A HB2  3  
ATOM   1681  H HB3  . ALA A 1 17 ? 2.334   -5.253  -6.804  1.00 15.00 ?  488 ALA A HB3  3  
ATOM   1682  N N    . PRO A 1 18 ? 3.968   -4.197  -9.938  1.00 15.00 ?  489 PRO A N    3  
ATOM   1683  C CA   . PRO A 1 18 ? 4.158   -4.700  -11.318 1.00 15.00 ?  489 PRO A CA   3  
ATOM   1684  C C    . PRO A 1 18 ? 3.686   -6.141  -11.542 1.00 15.00 ?  489 PRO A C    3  
ATOM   1685  O O    . PRO A 1 18 ? 3.681   -6.630  -12.673 1.00 15.00 ?  489 PRO A O    3  
ATOM   1686  C CB   . PRO A 1 18 ? 5.670   -4.599  -11.532 1.00 15.00 ?  489 PRO A CB   3  
ATOM   1687  C CG   . PRO A 1 18 ? 6.118   -3.548  -10.577 1.00 15.00 ?  489 PRO A CG   3  
ATOM   1688  C CD   . PRO A 1 18 ? 5.235   -3.692  -9.370  1.00 15.00 ?  489 PRO A CD   3  
ATOM   1689  H HA   . PRO A 1 18 ? 3.659   -4.059  -12.031 1.00 15.00 ?  489 PRO A HA   3  
ATOM   1690  H HB2  . PRO A 1 18 ? 6.131   -5.554  -11.318 1.00 15.00 ?  489 PRO A HB2  3  
ATOM   1691  H HB3  . PRO A 1 18 ? 5.874   -4.315  -12.553 1.00 15.00 ?  489 PRO A HB3  3  
ATOM   1692  H HG2  . PRO A 1 18 ? 7.152   -3.710  -10.307 1.00 15.00 ?  489 PRO A HG2  3  
ATOM   1693  H HG3  . PRO A 1 18 ? 5.993   -2.572  -11.019 1.00 15.00 ?  489 PRO A HG3  3  
ATOM   1694  H HD2  . PRO A 1 18 ? 5.658   -4.401  -8.675  1.00 15.00 ?  489 PRO A HD2  3  
ATOM   1695  H HD3  . PRO A 1 18 ? 5.088   -2.734  -8.893  1.00 15.00 ?  489 PRO A HD3  3  
ATOM   1696  N N    . ASN A 1 19 ? 3.296   -6.817  -10.471 1.00 15.00 ?  490 ASN A N    3  
ATOM   1697  C CA   . ASN A 1 19 ? 2.796   -8.182  -10.566 1.00 15.00 ?  490 ASN A CA   3  
ATOM   1698  C C    . ASN A 1 19 ? 1.316   -8.186  -10.946 1.00 15.00 ?  490 ASN A C    3  
ATOM   1699  O O    . ASN A 1 19 ? 0.754   -9.231  -11.284 1.00 15.00 ?  490 ASN A O    3  
ATOM   1700  C CB   . ASN A 1 19 ? 2.974   -8.923  -9.237  1.00 15.00 ?  490 ASN A CB   3  
ATOM   1701  C CG   . ASN A 1 19 ? 4.323   -8.676  -8.591  1.00 15.00 ?  490 ASN A CG   3  
ATOM   1702  O OD1  . ASN A 1 19 ? 4.480   -7.746  -7.798  1.00 15.00 ?  490 ASN A OD1  3  
ATOM   1703  N ND2  . ASN A 1 19 ? 5.304   -9.495  -8.927  1.00 15.00 ?  490 ASN A ND2  3  
ATOM   1704  H H    . ASN A 1 19 ? 3.350   -6.386  -9.594  1.00 15.00 ?  490 ASN A H    3  
ATOM   1705  H HA   . ASN A 1 19 ? 3.358   -8.693  -11.335 1.00 15.00 ?  490 ASN A HA   3  
ATOM   1706  H HB2  . ASN A 1 19 ? 2.206   -8.603  -8.549  1.00 15.00 ?  490 ASN A HB2  3  
ATOM   1707  H HB3  . ASN A 1 19 ? 2.869   -9.984  -9.412  1.00 15.00 ?  490 ASN A HB3  3  
ATOM   1708  H HD21 . ASN A 1 19 ? 5.114   -10.205 -9.578  1.00 15.00 ?  490 ASN A HD21 3  
ATOM   1709  H HD22 . ASN A 1 19 ? 6.181   -9.369  -8.504  1.00 15.00 ?  490 ASN A HD22 3  
ATOM   1710  N N    . GLY A 1 20 ? 0.685   -7.016  -10.882 1.00 15.00 ?  491 GLY A N    3  
ATOM   1711  C CA   . GLY A 1 20 ? -0.737  -6.925  -11.138 1.00 15.00 ?  491 GLY A CA   3  
ATOM   1712  C C    . GLY A 1 20 ? -1.538  -6.986  -9.857  1.00 15.00 ?  491 GLY A C    3  
ATOM   1713  O O    . GLY A 1 20 ? -2.709  -7.365  -9.861  1.00 15.00 ?  491 GLY A O    3  
ATOM   1714  H H    . GLY A 1 20 ? 1.190   -6.201  -10.663 1.00 15.00 ?  491 GLY A H    3  
ATOM   1715  H HA2  . GLY A 1 20 ? -0.946  -5.992  -11.640 1.00 15.00 ?  491 GLY A HA2  3  
ATOM   1716  H HA3  . GLY A 1 20 ? -1.034  -7.743  -11.776 1.00 15.00 ?  491 GLY A HA3  3  
ATOM   1717  N N    . ARG A 1 21 ? -0.905  -6.611  -8.756  1.00 15.00 ?  492 ARG A N    3  
ATOM   1718  C CA   . ARG A 1 21 ? -1.550  -6.657  -7.452  1.00 15.00 ?  492 ARG A CA   3  
ATOM   1719  C C    . ARG A 1 21 ? -1.549  -5.283  -6.792  1.00 15.00 ?  492 ARG A C    3  
ATOM   1720  O O    . ARG A 1 21 ? -0.500  -4.651  -6.667  1.00 15.00 ?  492 ARG A O    3  
ATOM   1721  C CB   . ARG A 1 21 ? -0.867  -7.691  -6.544  1.00 15.00 ?  492 ARG A CB   3  
ATOM   1722  C CG   . ARG A 1 21 ? 0.657   -7.635  -6.529  1.00 15.00 ?  492 ARG A CG   3  
ATOM   1723  C CD   . ARG A 1 21 ? 1.229   -8.906  -5.912  1.00 15.00 ?  492 ARG A CD   3  
ATOM   1724  N NE   . ARG A 1 21 ? 2.638   -8.784  -5.532  1.00 15.00 ?  492 ARG A NE   3  
ATOM   1725  C CZ   . ARG A 1 21 ? 3.270   -9.679  -4.764  1.00 15.00 ?  492 ARG A CZ   3  
ATOM   1726  N NH1  . ARG A 1 21 ? 2.629   -10.761 -4.350  1.00 15.00 1  492 ARG A NH1  3  
ATOM   1727  N NH2  . ARG A 1 21 ? 4.537   -9.499  -4.412  1.00 15.00 ?  492 ARG A NH2  3  
ATOM   1728  H H    . ARG A 1 21 ? 0.015   -6.282  -8.824  1.00 15.00 ?  492 ARG A H    3  
ATOM   1729  H HA   . ARG A 1 21 ? -2.574  -6.958  -7.610  1.00 15.00 ?  492 ARG A HA   3  
ATOM   1730  H HB2  . ARG A 1 21 ? -1.211  -7.530  -5.533  1.00 15.00 ?  492 ARG A HB2  3  
ATOM   1731  H HB3  . ARG A 1 21 ? -1.164  -8.678  -6.848  1.00 15.00 ?  492 ARG A HB3  3  
ATOM   1732  H HG2  . ARG A 1 21 ? 1.018   -7.540  -7.543  1.00 15.00 ?  492 ARG A HG2  3  
ATOM   1733  H HG3  . ARG A 1 21 ? 0.972   -6.784  -5.945  1.00 15.00 ?  492 ARG A HG3  3  
ATOM   1734  H HD2  . ARG A 1 21 ? 0.654   -9.148  -5.032  1.00 15.00 ?  492 ARG A HD2  3  
ATOM   1735  H HD3  . ARG A 1 21 ? 1.129   -9.708  -6.631  1.00 15.00 ?  492 ARG A HD3  3  
ATOM   1736  H HE   . ARG A 1 21 ? 3.131   -7.995  -5.851  1.00 15.00 ?  492 ARG A HE   3  
ATOM   1737  H HH11 . ARG A 1 21 ? 1.677   -10.909 -4.606  1.00 15.00 ?  492 ARG A HH11 3  
ATOM   1738  H HH12 . ARG A 1 21 ? 3.112   -11.451 -3.783  1.00 15.00 ?  492 ARG A HH12 3  
ATOM   1739  H HH21 . ARG A 1 21 ? 5.043   -8.683  -4.718  1.00 15.00 ?  492 ARG A HH21 3  
ATOM   1740  H HH22 . ARG A 1 21 ? 5.000   -10.183 -3.824  1.00 15.00 ?  492 ARG A HH22 3  
ATOM   1741  N N    . PRO A 1 22 ? -2.727  -4.808  -6.361  1.00 15.00 ?  493 PRO A N    3  
ATOM   1742  C CA   . PRO A 1 22 ? -2.869  -3.515  -5.705  1.00 15.00 ?  493 PRO A CA   3  
ATOM   1743  C C    . PRO A 1 22 ? -2.706  -3.605  -4.193  1.00 15.00 ?  493 PRO A C    3  
ATOM   1744  O O    . PRO A 1 22 ? -3.379  -4.394  -3.526  1.00 15.00 ?  493 PRO A O    3  
ATOM   1745  C CB   . PRO A 1 22 ? -4.291  -3.108  -6.077  1.00 15.00 ?  493 PRO A CB   3  
ATOM   1746  C CG   . PRO A 1 22 ? -5.044  -4.392  -6.231  1.00 15.00 ?  493 PRO A CG   3  
ATOM   1747  C CD   . PRO A 1 22 ? -4.030  -5.483  -6.501  1.00 15.00 ?  493 PRO A CD   3  
ATOM   1748  H HA   . PRO A 1 22 ? -2.172  -2.792  -6.095  1.00 15.00 ?  493 PRO A HA   3  
ATOM   1749  H HB2  . PRO A 1 22 ? -4.709  -2.497  -5.289  1.00 15.00 ?  493 PRO A HB2  3  
ATOM   1750  H HB3  . PRO A 1 22 ? -4.277  -2.550  -7.000  1.00 15.00 ?  493 PRO A HB3  3  
ATOM   1751  H HG2  . PRO A 1 22 ? -5.583  -4.604  -5.322  1.00 15.00 ?  493 PRO A HG2  3  
ATOM   1752  H HG3  . PRO A 1 22 ? -5.731  -4.310  -7.060  1.00 15.00 ?  493 PRO A HG3  3  
ATOM   1753  H HD2  . PRO A 1 22 ? -4.130  -6.276  -5.775  1.00 15.00 ?  493 PRO A HD2  3  
ATOM   1754  H HD3  . PRO A 1 22 ? -4.157  -5.870  -7.503  1.00 15.00 ?  493 PRO A HD3  3  
ATOM   1755  N N    . PHE A 1 23 ? -1.806  -2.801  -3.655  1.00 15.00 ?  494 PHE A N    3  
ATOM   1756  C CA   . PHE A 1 23 ? -1.546  -2.802  -2.226  1.00 15.00 ?  494 PHE A CA   3  
ATOM   1757  C C    . PHE A 1 23 ? -1.689  -1.398  -1.642  1.00 15.00 ?  494 PHE A C    3  
ATOM   1758  O O    . PHE A 1 23 ? -1.462  -0.397  -2.328  1.00 15.00 ?  494 PHE A O    3  
ATOM   1759  C CB   . PHE A 1 23 ? -0.164  -3.411  -1.908  1.00 15.00 ?  494 PHE A CB   3  
ATOM   1760  C CG   . PHE A 1 23 ? 1.043   -2.800  -2.607  1.00 15.00 ?  494 PHE A CG   3  
ATOM   1761  C CD1  . PHE A 1 23 ? 0.972   -1.605  -3.315  1.00 15.00 ?  494 PHE A CD1  3  
ATOM   1762  C CD2  . PHE A 1 23 ? 2.266   -3.453  -2.547  1.00 15.00 ?  494 PHE A CD2  3  
ATOM   1763  C CE1  . PHE A 1 23 ? 2.093   -1.078  -3.943  1.00 15.00 ?  494 PHE A CE1  3  
ATOM   1764  C CE2  . PHE A 1 23 ? 3.385   -2.933  -3.173  1.00 15.00 ?  494 PHE A CE2  3  
ATOM   1765  C CZ   . PHE A 1 23 ? 3.298   -1.745  -3.869  1.00 15.00 ?  494 PHE A CZ   3  
ATOM   1766  H H    . PHE A 1 23 ? -1.309  -2.177  -4.234  1.00 15.00 ?  494 PHE A H    3  
ATOM   1767  H HA   . PHE A 1 23 ? -2.302  -3.427  -1.775  1.00 15.00 ?  494 PHE A HA   3  
ATOM   1768  H HB2  . PHE A 1 23 ? 0.006   -3.333  -0.847  1.00 15.00 ?  494 PHE A HB2  3  
ATOM   1769  H HB3  . PHE A 1 23 ? -0.191  -4.459  -2.168  1.00 15.00 ?  494 PHE A HB3  3  
ATOM   1770  H HD1  . PHE A 1 23 ? 0.029   -1.082  -3.373  1.00 15.00 ?  494 PHE A HD1  3  
ATOM   1771  H HD2  . PHE A 1 23 ? 2.343   -4.380  -1.999  1.00 15.00 ?  494 PHE A HD2  3  
ATOM   1772  H HE1  . PHE A 1 23 ? 2.027   -0.141  -4.488  1.00 15.00 ?  494 PHE A HE1  3  
ATOM   1773  H HE2  . PHE A 1 23 ? 4.329   -3.456  -3.114  1.00 15.00 ?  494 PHE A HE2  3  
ATOM   1774  H HZ   . PHE A 1 23 ? 4.171   -1.338  -4.356  1.00 15.00 ?  494 PHE A HZ   3  
ATOM   1775  N N    . PHE A 1 24 ? -2.085  -1.323  -0.380  1.00 15.00 ?  495 PHE A N    3  
ATOM   1776  C CA   . PHE A 1 24 ? -2.252  -0.039  0.278   1.00 15.00 ?  495 PHE A CA   3  
ATOM   1777  C C    . PHE A 1 24 ? -0.959  0.363   0.966   1.00 15.00 ?  495 PHE A C    3  
ATOM   1778  O O    . PHE A 1 24 ? -0.466  -0.347  1.845   1.00 15.00 ?  495 PHE A O    3  
ATOM   1779  C CB   . PHE A 1 24 ? -3.395  -0.084  1.294   1.00 15.00 ?  495 PHE A CB   3  
ATOM   1780  C CG   . PHE A 1 24 ? -4.669  -0.651  0.738   1.00 15.00 ?  495 PHE A CG   3  
ATOM   1781  C CD1  . PHE A 1 24 ? -5.367  0.013   -0.258  1.00 15.00 ?  495 PHE A CD1  3  
ATOM   1782  C CD2  . PHE A 1 24 ? -5.167  -1.855  1.209   1.00 15.00 ?  495 PHE A CD2  3  
ATOM   1783  C CE1  . PHE A 1 24 ? -6.533  -0.514  -0.773  1.00 15.00 ?  495 PHE A CE1  3  
ATOM   1784  C CE2  . PHE A 1 24 ? -6.335  -2.387  0.696   1.00 15.00 ?  495 PHE A CE2  3  
ATOM   1785  C CZ   . PHE A 1 24 ? -7.019  -1.714  -0.295  1.00 15.00 ?  495 PHE A CZ   3  
ATOM   1786  H H    . PHE A 1 24 ? -2.262  -2.148  0.124   1.00 15.00 ?  495 PHE A H    3  
ATOM   1787  H HA   . PHE A 1 24 ? -2.483  0.694   -0.483  1.00 15.00 ?  495 PHE A HA   3  
ATOM   1788  H HB2  . PHE A 1 24 ? -3.099  -0.689  2.136   1.00 15.00 ?  495 PHE A HB2  3  
ATOM   1789  H HB3  . PHE A 1 24 ? -3.600  0.921   1.636   1.00 15.00 ?  495 PHE A HB3  3  
ATOM   1790  H HD1  . PHE A 1 24 ? -4.991  0.955   -0.640  1.00 15.00 ?  495 PHE A HD1  3  
ATOM   1791  H HD2  . PHE A 1 24 ? -4.633  -2.381  1.983   1.00 15.00 ?  495 PHE A HD2  3  
ATOM   1792  H HE1  . PHE A 1 24 ? -7.068  0.016   -1.553  1.00 15.00 ?  495 PHE A HE1  3  
ATOM   1793  H HE2  . PHE A 1 24 ? -6.712  -3.326  1.072   1.00 15.00 ?  495 PHE A HE2  3  
ATOM   1794  H HZ   . PHE A 1 24 ? -7.933  -2.127  -0.699  1.00 15.00 ?  495 PHE A HZ   3  
ATOM   1795  N N    . ILE A 1 25 ? -0.400  1.479   0.540   1.00 15.00 ?  496 ILE A N    3  
ATOM   1796  C CA   . ILE A 1 25 ? 0.807   2.007   1.152   1.00 15.00 ?  496 ILE A CA   3  
ATOM   1797  C C    . ILE A 1 25 ? 0.449   3.124   2.111   1.00 15.00 ?  496 ILE A C    3  
ATOM   1798  O O    . ILE A 1 25 ? 0.099   4.216   1.667   1.00 15.00 ?  496 ILE A O    3  
ATOM   1799  C CB   . ILE A 1 25 ? 1.778   2.612   0.115   1.00 15.00 ?  496 ILE A CB   3  
ATOM   1800  C CG1  . ILE A 1 25 ? 1.859   1.770   -1.164  1.00 15.00 ?  496 ILE A CG1  3  
ATOM   1801  C CG2  . ILE A 1 25 ? 3.156   2.762   0.743   1.00 15.00 ?  496 ILE A CG2  3  
ATOM   1802  C CD1  . ILE A 1 25 ? 2.587   0.458   -0.999  1.00 15.00 ?  496 ILE A CD1  3  
ATOM   1803  H H    . ILE A 1 25 ? -0.810  1.966   -0.209  1.00 15.00 ?  496 ILE A H    3  
ATOM   1804  H HA   . ILE A 1 25 ? 1.308   1.217   1.685   1.00 15.00 ?  496 ILE A HA   3  
ATOM   1805  H HB   . ILE A 1 25 ? 1.422   3.603   -0.137  1.00 15.00 ?  496 ILE A HB   3  
ATOM   1806  H HG12 . ILE A 1 25 ? 0.857   1.549   -1.503  1.00 15.00 ?  496 ILE A HG12 3  
ATOM   1807  H HG13 . ILE A 1 25 ? 2.371   2.340   -1.927  1.00 15.00 ?  496 ILE A HG13 3  
ATOM   1808  H HG21 . ILE A 1 25 ? 3.110   3.488   1.541   1.00 15.00 ?  496 ILE A HG21 3  
ATOM   1809  H HG22 . ILE A 1 25 ? 3.861   3.092   -0.002  1.00 15.00 ?  496 ILE A HG22 3  
ATOM   1810  H HG23 . ILE A 1 25 ? 3.479   1.810   1.142   1.00 15.00 ?  496 ILE A HG23 3  
ATOM   1811  H HD11 . ILE A 1 25 ? 3.557   0.637   -0.562  1.00 15.00 ?  496 ILE A HD11 3  
ATOM   1812  H HD12 . ILE A 1 25 ? 2.710   -0.007  -1.968  1.00 15.00 ?  496 ILE A HD12 3  
ATOM   1813  H HD13 . ILE A 1 25 ? 2.012   -0.194  -0.359  1.00 15.00 ?  496 ILE A HD13 3  
ATOM   1814  N N    . ASP A 1 26 ? 0.519   2.885   3.409   1.00 15.00 ?  497 ASP A N    3  
ATOM   1815  C CA   . ASP A 1 26 ? 0.327   3.983   4.332   1.00 15.00 ?  497 ASP A CA   3  
ATOM   1816  C C    . ASP A 1 26 ? 1.663   4.631   4.620   1.00 15.00 ?  497 ASP A C    3  
ATOM   1817  O O    . ASP A 1 26 ? 2.615   4.013   5.102   1.00 15.00 ?  497 ASP A O    3  
ATOM   1818  C CB   . ASP A 1 26 ? -0.409  3.598   5.616   1.00 15.00 ?  497 ASP A CB   3  
ATOM   1819  C CG   . ASP A 1 26 ? 0.485   3.159   6.758   1.00 15.00 ?  497 ASP A CG   3  
ATOM   1820  O OD1  . ASP A 1 26 ? 1.058   4.040   7.434   1.00 15.00 ?  497 ASP A OD1  3  
ATOM   1821  O OD2  . ASP A 1 26 ? 0.589   1.943   7.013   1.00 15.00 -1 497 ASP A OD2  3  
ATOM   1822  H H    . ASP A 1 26 ? 0.716   1.981   3.745   1.00 15.00 ?  497 ASP A H    3  
ATOM   1823  H HA   . ASP A 1 26 ? -0.275  4.714   3.808   1.00 15.00 ?  497 ASP A HA   3  
ATOM   1824  H HB2  . ASP A 1 26 ? -0.958  4.464   5.945   1.00 15.00 ?  497 ASP A HB2  3  
ATOM   1825  H HB3  . ASP A 1 26 ? -1.104  2.800   5.397   1.00 15.00 ?  497 ASP A HB3  3  
ATOM   1826  N N    . HIS A 1 27 ? 1.736   5.876   4.243   1.00 15.00 ?  498 HIS A N    3  
ATOM   1827  C CA   . HIS A 1 27 ? 2.972   6.620   4.304   1.00 15.00 ?  498 HIS A CA   3  
ATOM   1828  C C    . HIS A 1 27 ? 3.252   7.133   5.711   1.00 15.00 ?  498 HIS A C    3  
ATOM   1829  O O    . HIS A 1 27 ? 4.381   7.514   6.024   1.00 15.00 ?  498 HIS A O    3  
ATOM   1830  C CB   . HIS A 1 27 ? 2.960   7.750   3.266   1.00 15.00 ?  498 HIS A CB   3  
ATOM   1831  C CG   . HIS A 1 27 ? 2.973   7.232   1.854   1.00 15.00 ?  498 HIS A CG   3  
ATOM   1832  N ND1  . HIS A 1 27 ? 4.140   6.961   1.172   1.00 15.00 ?  498 HIS A ND1  3  
ATOM   1833  C CD2  . HIS A 1 27 ? 1.959   6.870   1.014   1.00 15.00 ?  498 HIS A CD2  3  
ATOM   1834  C CE1  . HIS A 1 27 ? 3.856   6.451   -0.009  1.00 15.00 ?  498 HIS A CE1  3  
ATOM   1835  N NE2  . HIS A 1 27 ? 2.542   6.386   -0.134  1.00 15.00 ?  498 HIS A NE2  3  
ATOM   1836  H H    . HIS A 1 27 ? 0.913   6.318   3.931   1.00 15.00 ?  498 HIS A H    3  
ATOM   1837  H HA   . HIS A 1 27 ? 3.763   5.933   4.041   1.00 15.00 ?  498 HIS A HA   3  
ATOM   1838  H HB2  . HIS A 1 27 ? 2.072   8.349   3.398   1.00 15.00 ?  498 HIS A HB2  3  
ATOM   1839  H HB3  . HIS A 1 27 ? 3.835   8.370   3.403   1.00 15.00 ?  498 HIS A HB3  3  
ATOM   1840  H HD1  . HIS A 1 27 ? 5.057   7.158   1.491   1.00 15.00 ?  498 HIS A HD1  3  
ATOM   1841  H HD2  . HIS A 1 27 ? 0.890   6.952   1.206   1.00 15.00 ?  498 HIS A HD2  3  
ATOM   1842  H HE1  . HIS A 1 27 ? 4.579   6.108   -0.738  1.00 15.00 ?  498 HIS A HE1  3  
ATOM   1843  H HE2  . HIS A 1 27 ? 2.070   5.919   -0.854  1.00 15.00 ?  498 HIS A HE2  3  
ATOM   1844  N N    . ASN A 1 28 ? 2.229   7.131   6.566   1.00 15.00 ?  499 ASN A N    3  
ATOM   1845  C CA   . ASN A 1 28 ? 2.368   7.704   7.903   1.00 15.00 ?  499 ASN A CA   3  
ATOM   1846  C C    . ASN A 1 28 ? 3.067   6.750   8.878   1.00 15.00 ?  499 ASN A C    3  
ATOM   1847  O O    . ASN A 1 28 ? 3.992   7.161   9.581   1.00 15.00 ?  499 ASN A O    3  
ATOM   1848  C CB   . ASN A 1 28 ? 1.013   8.173   8.459   1.00 15.00 ?  499 ASN A CB   3  
ATOM   1849  C CG   . ASN A 1 28 ? -0.071  7.110   8.400   1.00 15.00 ?  499 ASN A CG   3  
ATOM   1850  O OD1  . ASN A 1 28 ? -0.221  6.306   9.317   1.00 15.00 ?  499 ASN A OD1  3  
ATOM   1851  N ND2  . ASN A 1 28 ? -0.859  7.127   7.333   1.00 15.00 ?  499 ASN A ND2  3  
ATOM   1852  H H    . ASN A 1 28 ? 1.376   6.726   6.300   1.00 15.00 ?  499 ASN A H    3  
ATOM   1853  H HA   . ASN A 1 28 ? 2.998   8.574   7.796   1.00 15.00 ?  499 ASN A HA   3  
ATOM   1854  H HB2  . ASN A 1 28 ? 1.142   8.464   9.489   1.00 15.00 ?  499 ASN A HB2  3  
ATOM   1855  H HB3  . ASN A 1 28 ? 0.679   9.029   7.892   1.00 15.00 ?  499 ASN A HB3  3  
ATOM   1856  H HD21 . ASN A 1 28 ? -0.706  7.816   6.651   1.00 15.00 ?  499 ASN A HD21 3  
ATOM   1857  H HD22 . ASN A 1 28 ? -1.566  6.448   7.268   1.00 15.00 ?  499 ASN A HD22 3  
ATOM   1858  N N    . THR A 1 29 ? 2.619   5.498   8.971   1.00 15.00 ?  500 THR A N    3  
ATOM   1859  C CA   . THR A 1 29 ? 3.347   4.508   9.760   1.00 15.00 ?  500 THR A CA   3  
ATOM   1860  C C    . THR A 1 29 ? 4.517   3.968   8.951   1.00 15.00 ?  500 THR A C    3  
ATOM   1861  O O    . THR A 1 29 ? 5.409   3.315   9.494   1.00 15.00 ?  500 THR A O    3  
ATOM   1862  C CB   . THR A 1 29 ? 2.467   3.331   10.248  1.00 15.00 ?  500 THR A CB   3  
ATOM   1863  O OG1  . THR A 1 29 ? 2.196   2.420   9.179   1.00 15.00 ?  500 THR A OG1  3  
ATOM   1864  C CG2  . THR A 1 29 ? 1.157   3.830   10.838  1.00 15.00 ?  500 THR A CG2  3  
ATOM   1865  H H    . THR A 1 29 ? 1.800   5.226   8.488   1.00 15.00 ?  500 THR A H    3  
ATOM   1866  H HA   . THR A 1 29 ? 3.741   5.015   10.633  1.00 15.00 ?  500 THR A HA   3  
ATOM   1867  H HB   . THR A 1 29 ? 3.007   2.804   11.019  1.00 15.00 ?  500 THR A HB   3  
ATOM   1868  H HG1  . THR A 1 29 ? 1.663   2.867   8.494   1.00 15.00 ?  500 THR A HG1  3  
ATOM   1869  H HG21 . THR A 1 29 ? 1.363   4.497   11.661  1.00 15.00 ?  500 THR A HG21 3  
ATOM   1870  H HG22 . THR A 1 29 ? 0.577   2.990   11.192  1.00 15.00 ?  500 THR A HG22 3  
ATOM   1871  H HG23 . THR A 1 29 ? 0.599   4.359   10.080  1.00 15.00 ?  500 THR A HG23 3  
ATOM   1872  N N    . LYS A 1 30 ? 4.473   4.232   7.636   1.00 15.00 ?  501 LYS A N    3  
ATOM   1873  C CA   . LYS A 1 30 ? 5.504   3.791   6.694   1.00 15.00 ?  501 LYS A CA   3  
ATOM   1874  C C    . LYS A 1 30 ? 5.394   2.279   6.481   1.00 15.00 ?  501 LYS A C    3  
ATOM   1875  O O    . LYS A 1 30 ? 6.392   1.577   6.310   1.00 15.00 ?  501 LYS A O    3  
ATOM   1876  C CB   . LYS A 1 30 ? 6.899   4.195   7.201   1.00 15.00 ?  501 LYS A CB   3  
ATOM   1877  C CG   . LYS A 1 30 ? 7.994   4.151   6.146   1.00 15.00 ?  501 LYS A CG   3  
ATOM   1878  C CD   . LYS A 1 30 ? 7.767   5.176   5.039   1.00 15.00 ?  501 LYS A CD   3  
ATOM   1879  C CE   . LYS A 1 30 ? 8.100   6.606   5.467   1.00 15.00 ?  501 LYS A CE   3  
ATOM   1880  N NZ   . LYS A 1 30 ? 7.160   7.152   6.487   1.00 15.00 1  501 LYS A NZ   3  
ATOM   1881  H H    . LYS A 1 30 ? 3.701   4.728   7.287   1.00 15.00 ?  501 LYS A H    3  
ATOM   1882  H HA   . LYS A 1 30 ? 5.316   4.283   5.750   1.00 15.00 ?  501 LYS A HA   3  
ATOM   1883  H HB2  . LYS A 1 30 ? 6.846   5.204   7.571   1.00 15.00 ?  501 LYS A HB2  3  
ATOM   1884  H HB3  . LYS A 1 30 ? 7.181   3.537   8.013   1.00 15.00 ?  501 LYS A HB3  3  
ATOM   1885  H HG2  . LYS A 1 30 ? 8.942   4.354   6.618   1.00 15.00 ?  501 LYS A HG2  3  
ATOM   1886  H HG3  . LYS A 1 30 ? 8.015   3.163   5.709   1.00 15.00 ?  501 LYS A HG3  3  
ATOM   1887  H HD2  . LYS A 1 30 ? 8.396   4.920   4.199   1.00 15.00 ?  501 LYS A HD2  3  
ATOM   1888  H HD3  . LYS A 1 30 ? 6.732   5.136   4.736   1.00 15.00 ?  501 LYS A HD3  3  
ATOM   1889  H HE2  . LYS A 1 30 ? 9.098   6.616   5.878   1.00 15.00 ?  501 LYS A HE2  3  
ATOM   1890  H HE3  . LYS A 1 30 ? 8.072   7.241   4.591   1.00 15.00 ?  501 LYS A HE3  3  
ATOM   1891  H HZ1  . LYS A 1 30 ? 6.175   7.001   6.193   1.00 15.00 ?  501 LYS A HZ1  3  
ATOM   1892  H HZ2  . LYS A 1 30 ? 7.317   8.179   6.599   1.00 15.00 ?  501 LYS A HZ2  3  
ATOM   1893  H HZ3  . LYS A 1 30 ? 7.314   6.689   7.410   1.00 15.00 ?  501 LYS A HZ3  3  
ATOM   1894  N N    . THR A 1 31 ? 4.159   1.797   6.442   1.00 15.00 ?  502 THR A N    3  
ATOM   1895  C CA   . THR A 1 31 ? 3.878   0.382   6.264   1.00 15.00 ?  502 THR A CA   3  
ATOM   1896  C C    . THR A 1 31 ? 2.953   0.165   5.065   1.00 15.00 ?  502 THR A C    3  
ATOM   1897  O O    . THR A 1 31 ? 2.166   1.039   4.717   1.00 15.00 ?  502 THR A O    3  
ATOM   1898  C CB   . THR A 1 31 ? 3.215   -0.211  7.526   1.00 15.00 ?  502 THR A CB   3  
ATOM   1899  O OG1  . THR A 1 31 ? 3.936   0.198   8.692   1.00 15.00 ?  502 THR A OG1  3  
ATOM   1900  C CG2  . THR A 1 31 ? 3.173   -1.734  7.473   1.00 15.00 ?  502 THR A CG2  3  
ATOM   1901  H H    . THR A 1 31 ? 3.401   2.419   6.528   1.00 15.00 ?  502 THR A H    3  
ATOM   1902  H HA   . THR A 1 31 ? 4.813   -0.131  6.090   1.00 15.00 ?  502 THR A HA   3  
ATOM   1903  H HB   . THR A 1 31 ? 2.203   0.162   7.589   1.00 15.00 ?  502 THR A HB   3  
ATOM   1904  H HG1  . THR A 1 31 ? 3.587   1.053   8.990   1.00 15.00 ?  502 THR A HG1  3  
ATOM   1905  H HG21 . THR A 1 31 ? 4.178   -2.121  7.387   1.00 15.00 ?  502 THR A HG21 3  
ATOM   1906  H HG22 . THR A 1 31 ? 2.594   -2.048  6.617   1.00 15.00 ?  502 THR A HG22 3  
ATOM   1907  H HG23 . THR A 1 31 ? 2.718   -2.114  8.377   1.00 15.00 ?  502 THR A HG23 3  
ATOM   1908  N N    . THR A 1 32 ? 3.079   -0.975  4.407   1.00 15.00 ?  503 THR A N    3  
ATOM   1909  C CA   . THR A 1 32 ? 2.140   -1.340  3.363   1.00 15.00 ?  503 THR A CA   3  
ATOM   1910  C C    . THR A 1 32 ? 1.520   -2.700  3.669   1.00 15.00 ?  503 THR A C    3  
ATOM   1911  O O    . THR A 1 32 ? 2.195   -3.598  4.170   1.00 15.00 ?  503 THR A O    3  
ATOM   1912  C CB   . THR A 1 32 ? 2.797   -1.340  1.962   1.00 15.00 ?  503 THR A CB   3  
ATOM   1913  O OG1  . THR A 1 32 ? 1.873   -1.833  0.983   1.00 15.00 ?  503 THR A OG1  3  
ATOM   1914  C CG2  . THR A 1 32 ? 4.071   -2.171  1.924   1.00 15.00 ?  503 THR A CG2  3  
ATOM   1915  H H    . THR A 1 32 ? 3.805   -1.587  4.635   1.00 15.00 ?  503 THR A H    3  
ATOM   1916  H HA   . THR A 1 32 ? 1.355   -0.598  3.362   1.00 15.00 ?  503 THR A HA   3  
ATOM   1917  H HB   . THR A 1 32 ? 3.052   -0.321  1.716   1.00 15.00 ?  503 THR A HB   3  
ATOM   1918  H HG1  . THR A 1 32 ? 1.044   -1.343  1.050   1.00 15.00 ?  503 THR A HG1  3  
ATOM   1919  H HG21 . THR A 1 32 ? 4.571   -2.016  0.976   1.00 15.00 ?  503 THR A HG21 3  
ATOM   1920  H HG22 . THR A 1 32 ? 3.824   -3.218  2.035   1.00 15.00 ?  503 THR A HG22 3  
ATOM   1921  H HG23 . THR A 1 32 ? 4.724   -1.868  2.728   1.00 15.00 ?  503 THR A HG23 3  
ATOM   1922  N N    . THR A 1 33 ? 0.230   -2.831  3.395   1.00 15.00 ?  504 THR A N    3  
ATOM   1923  C CA   . THR A 1 33 ? -0.500  -4.043  3.720   1.00 15.00 ?  504 THR A CA   3  
ATOM   1924  C C    . THR A 1 33 ? -1.629  -4.289  2.726   1.00 15.00 ?  504 THR A C    3  
ATOM   1925  O O    . THR A 1 33 ? -2.165  -3.352  2.126   1.00 15.00 ?  504 THR A O    3  
ATOM   1926  C CB   . THR A 1 33 ? -1.069  -4.002  5.159   1.00 15.00 ?  504 THR A CB   3  
ATOM   1927  O OG1  . THR A 1 33 ? -1.843  -5.182  5.422   1.00 15.00 ?  504 THR A OG1  3  
ATOM   1928  C CG2  . THR A 1 33 ? -1.930  -2.764  5.376   1.00 15.00 ?  504 THR A CG2  3  
ATOM   1929  H H    . THR A 1 33 ? -0.245  -2.090  2.957   1.00 15.00 ?  504 THR A H    3  
ATOM   1930  H HA   . THR A 1 33 ? 0.195   -4.866  3.658   1.00 15.00 ?  504 THR A HA   3  
ATOM   1931  H HB   . THR A 1 33 ? -0.240  -3.969  5.853   1.00 15.00 ?  504 THR A HB   3  
ATOM   1932  H HG1  . THR A 1 33 ? -1.834  -5.371  6.377   1.00 15.00 ?  504 THR A HG1  3  
ATOM   1933  H HG21 . THR A 1 33 ? -1.334  -1.878  5.212   1.00 15.00 ?  504 THR A HG21 3  
ATOM   1934  H HG22 . THR A 1 33 ? -2.311  -2.761  6.387   1.00 15.00 ?  504 THR A HG22 3  
ATOM   1935  H HG23 . THR A 1 33 ? -2.757  -2.775  4.681   1.00 15.00 ?  504 THR A HG23 3  
ATOM   1936  N N    . TRP A 1 34 ? -1.949  -5.562  2.523   1.00 15.00 ?  505 TRP A N    3  
ATOM   1937  C CA   . TRP A 1 34 ? -3.050  -5.953  1.658   1.00 15.00 ?  505 TRP A CA   3  
ATOM   1938  C C    . TRP A 1 34 ? -4.394  -5.663  2.327   1.00 15.00 ?  505 TRP A C    3  
ATOM   1939  O O    . TRP A 1 34 ? -5.439  -5.671  1.674   1.00 15.00 ?  505 TRP A O    3  
ATOM   1940  C CB   . TRP A 1 34 ? -2.977  -7.447  1.334   1.00 15.00 ?  505 TRP A CB   3  
ATOM   1941  C CG   . TRP A 1 34 ? -1.706  -7.876  0.666   1.00 15.00 ?  505 TRP A CG   3  
ATOM   1942  C CD1  . TRP A 1 34 ? -0.635  -8.495  1.251   1.00 15.00 ?  505 TRP A CD1  3  
ATOM   1943  C CD2  . TRP A 1 34 ? -1.384  -7.743  -0.721  1.00 15.00 ?  505 TRP A CD2  3  
ATOM   1944  N NE1  . TRP A 1 34 ? 0.332   -8.751  0.308   1.00 15.00 ?  505 TRP A NE1  3  
ATOM   1945  C CE2  . TRP A 1 34 ? -0.106  -8.299  -0.909  1.00 15.00 ?  505 TRP A CE2  3  
ATOM   1946  C CE3  . TRP A 1 34 ? -2.054  -7.205  -1.825  1.00 15.00 ?  505 TRP A CE3  3  
ATOM   1947  C CZ2  . TRP A 1 34 ? 0.512   -8.335  -2.154  1.00 15.00 ?  505 TRP A CZ2  3  
ATOM   1948  C CZ3  . TRP A 1 34 ? -1.439  -7.245  -3.061  1.00 15.00 ?  505 TRP A CZ3  3  
ATOM   1949  C CH2  . TRP A 1 34 ? -0.171  -7.806  -3.215  1.00 15.00 ?  505 TRP A CH2  3  
ATOM   1950  H H    . TRP A 1 34 ? -1.428  -6.259  2.974   1.00 15.00 ?  505 TRP A H    3  
ATOM   1951  H HA   . TRP A 1 34 ? -2.979  -5.386  0.743   1.00 15.00 ?  505 TRP A HA   3  
ATOM   1952  H HB2  . TRP A 1 34 ? -3.070  -8.008  2.250   1.00 15.00 ?  505 TRP A HB2  3  
ATOM   1953  H HB3  . TRP A 1 34 ? -3.797  -7.702  0.679   1.00 15.00 ?  505 TRP A HB3  3  
ATOM   1954  H HD1  . TRP A 1 34 ? -0.571  -8.741  2.301   1.00 15.00 ?  505 TRP A HD1  3  
ATOM   1955  H HE1  . TRP A 1 34 ? 1.195   -9.188  0.480   1.00 15.00 ?  505 TRP A HE1  3  
ATOM   1956  H HE3  . TRP A 1 34 ? -3.032  -6.764  -1.719  1.00 15.00 ?  505 TRP A HE3  3  
ATOM   1957  H HZ2  . TRP A 1 34 ? 1.493   -8.764  -2.294  1.00 15.00 ?  505 TRP A HZ2  3  
ATOM   1958  H HZ3  . TRP A 1 34 ? -1.942  -6.843  -3.929  1.00 15.00 ?  505 TRP A HZ3  3  
ATOM   1959  H HH2  . TRP A 1 34 ? 0.268   -7.817  -4.207  1.00 15.00 ?  505 TRP A HH2  3  
ATOM   1960  N N    . GLU A 1 35 ? -4.364  -5.430  3.636   1.00 15.00 ?  506 GLU A N    3  
ATOM   1961  C CA   . GLU A 1 35 ? -5.586  -5.224  4.399   1.00 15.00 ?  506 GLU A CA   3  
ATOM   1962  C C    . GLU A 1 35 ? -5.985  -3.773  4.416   1.00 15.00 ?  506 GLU A C    3  
ATOM   1963  O O    . GLU A 1 35 ? -5.193  -2.890  4.751   1.00 15.00 ?  506 GLU A O    3  
ATOM   1964  C CB   . GLU A 1 35 ? -5.422  -5.759  5.822   1.00 15.00 ?  506 GLU A CB   3  
ATOM   1965  C CG   . GLU A 1 35 ? -5.197  -7.263  5.876   1.00 15.00 ?  506 GLU A CG   3  
ATOM   1966  C CD   . GLU A 1 35 ? -4.954  -7.769  7.282   1.00 15.00 ?  506 GLU A CD   3  
ATOM   1967  O OE1  . GLU A 1 35 ? -5.928  -7.903  8.050   1.00 15.00 -1 506 GLU A OE1  3  
ATOM   1968  O OE2  . GLU A 1 35 ? -3.786  -8.040  7.628   1.00 15.00 ?  506 GLU A OE2  3  
ATOM   1969  H H    . GLU A 1 35 ? -3.498  -5.384  4.098   1.00 15.00 ?  506 GLU A H    3  
ATOM   1970  H HA   . GLU A 1 35 ? -6.377  -5.758  3.910   1.00 15.00 ?  506 GLU A HA   3  
ATOM   1971  H HB2  . GLU A 1 35 ? -4.578  -5.270  6.282   1.00 15.00 ?  506 GLU A HB2  3  
ATOM   1972  H HB3  . GLU A 1 35 ? -6.313  -5.530  6.387   1.00 15.00 ?  506 GLU A HB3  3  
ATOM   1973  H HG2  . GLU A 1 35 ? -6.070  -7.761  5.481   1.00 15.00 ?  506 GLU A HG2  3  
ATOM   1974  H HG3  . GLU A 1 35 ? -4.339  -7.507  5.268   1.00 15.00 ?  506 GLU A HG3  3  
ATOM   1975  N N    . ASP A 1 36 ? -7.237  -3.543  4.072   1.00 15.00 ?  507 ASP A N    3  
ATOM   1976  C CA   . ASP A 1 36 ? -7.741  -2.205  3.930   1.00 15.00 ?  507 ASP A CA   3  
ATOM   1977  C C    . ASP A 1 36 ? -7.925  -1.555  5.299   1.00 15.00 ?  507 ASP A C    3  
ATOM   1978  O O    . ASP A 1 36 ? -8.310  -2.219  6.265   1.00 15.00 ?  507 ASP A O    3  
ATOM   1979  C CB   . ASP A 1 36 ? -9.057  -2.202  3.146   1.00 15.00 ?  507 ASP A CB   3  
ATOM   1980  C CG   . ASP A 1 36 ? -10.176 -2.899  3.888   1.00 15.00 ?  507 ASP A CG   3  
ATOM   1981  O OD1  . ASP A 1 36 ? -10.154 -4.146  3.976   1.00 15.00 -1 507 ASP A OD1  3  
ATOM   1982  O OD2  . ASP A 1 36 ? -11.072 -2.201  4.401   1.00 15.00 ?  507 ASP A OD2  3  
ATOM   1983  H H    . ASP A 1 36 ? -7.840  -4.299  3.922   1.00 15.00 ?  507 ASP A H    3  
ATOM   1984  H HA   . ASP A 1 36 ? -7.000  -1.664  3.379   1.00 15.00 ?  507 ASP A HA   3  
ATOM   1985  H HB2  . ASP A 1 36 ? -9.355  -1.181  2.958   1.00 15.00 ?  507 ASP A HB2  3  
ATOM   1986  H HB3  . ASP A 1 36 ? -8.907  -2.707  2.201   1.00 15.00 ?  507 ASP A HB3  3  
ATOM   1987  N N    . PRO A 1 37 ? -7.648  -0.247  5.400   1.00 15.00 ?  508 PRO A N    3  
ATOM   1988  C CA   . PRO A 1 37 ? -7.719  0.492   6.669   1.00 15.00 ?  508 PRO A CA   3  
ATOM   1989  C C    . PRO A 1 37 ? -9.147  0.791   7.124   1.00 15.00 ?  508 PRO A C    3  
ATOM   1990  O O    . PRO A 1 37 ? -9.340  1.427   8.161   1.00 15.00 ?  508 PRO A O    3  
ATOM   1991  C CB   . PRO A 1 37 ? -6.995  1.795   6.348   1.00 15.00 ?  508 PRO A CB   3  
ATOM   1992  C CG   . PRO A 1 37 ? -7.223  1.996   4.891   1.00 15.00 ?  508 PRO A CG   3  
ATOM   1993  C CD   . PRO A 1 37 ? -7.227  0.621   4.283   1.00 15.00 ?  508 PRO A CD   3  
ATOM   1994  H HA   . PRO A 1 37 ? -7.194  -0.027  7.457   1.00 15.00 ?  508 PRO A HA   3  
ATOM   1995  H HB2  . PRO A 1 37 ? -7.419  2.599   6.931   1.00 15.00 ?  508 PRO A HB2  3  
ATOM   1996  H HB3  . PRO A 1 37 ? -5.943  1.694   6.573   1.00 15.00 ?  508 PRO A HB3  3  
ATOM   1997  H HG2  . PRO A 1 37 ? -8.177  2.479   4.730   1.00 15.00 ?  508 PRO A HG2  3  
ATOM   1998  H HG3  . PRO A 1 37 ? -6.425  2.588   4.473   1.00 15.00 ?  508 PRO A HG3  3  
ATOM   1999  H HD2  . PRO A 1 37 ? -7.932  0.569   3.469   1.00 15.00 ?  508 PRO A HD2  3  
ATOM   2000  H HD3  . PRO A 1 37 ? -6.237  0.358   3.944   1.00 15.00 ?  508 PRO A HD3  3  
ATOM   2001  N N    . ARG A 1 38 ? -10.124 0.323   6.340   1.00 15.00 ?  509 ARG A N    3  
ATOM   2002  C CA   . ARG A 1 38 ? -11.554 0.562   6.585   1.00 15.00 ?  509 ARG A CA   3  
ATOM   2003  C C    . ARG A 1 38 ? -11.818 1.990   7.079   1.00 15.00 ?  509 ARG A C    3  
ATOM   2004  O O    . ARG A 1 38 ? -11.473 2.940   6.346   1.00 15.00 ?  509 ARG A O    3  
ATOM   2005  C CB   . ARG A 1 38 ? -12.138 -0.488  7.553   1.00 15.00 ?  509 ARG A CB   3  
ATOM   2006  C CG   . ARG A 1 38 ? -11.505 -0.508  8.938   1.00 15.00 ?  509 ARG A CG   3  
ATOM   2007  C CD   . ARG A 1 38 ? -12.093 -1.600  9.817   1.00 15.00 ?  509 ARG A CD   3  
ATOM   2008  N NE   . ARG A 1 38 ? -11.683 -1.445  11.212  1.00 15.00 ?  509 ARG A NE   3  
ATOM   2009  C CZ   . ARG A 1 38 ? -11.782 -2.398  12.137  1.00 15.00 ?  509 ARG A CZ   3  
ATOM   2010  N NH1  . ARG A 1 38 ? -12.207 -3.613  11.811  1.00 15.00 1  509 ARG A NH1  3  
ATOM   2011  N NH2  . ARG A 1 38 ? -11.433 -2.138  13.390  1.00 15.00 ?  509 ARG A NH2  3  
ATOM   2012  H H    . ARG A 1 38 ? -9.875  -0.213  5.560   1.00 15.00 ?  509 ARG A H    3  
ATOM   2013  H HA   . ARG A 1 38 ? -12.052 0.453   5.632   1.00 15.00 ?  509 ARG A HA   3  
ATOM   2014  H HB2  . ARG A 1 38 ? -13.193 -0.295  7.672   1.00 15.00 ?  509 ARG A HB2  3  
ATOM   2015  H HB3  . ARG A 1 38 ? -12.014 -1.466  7.113   1.00 15.00 ?  509 ARG A HB3  3  
ATOM   2016  H HG2  . ARG A 1 38 ? -10.444 -0.680  8.835   1.00 15.00 ?  509 ARG A HG2  3  
ATOM   2017  H HG3  . ARG A 1 38 ? -11.670 0.450   9.410   1.00 15.00 ?  509 ARG A HG3  3  
ATOM   2018  H HD2  . ARG A 1 38 ? -13.170 -1.550  9.759   1.00 15.00 ?  509 ARG A HD2  3  
ATOM   2019  H HD3  . ARG A 1 38 ? -11.756 -2.560  9.454   1.00 15.00 ?  509 ARG A HD3  3  
ATOM   2020  H HE   . ARG A 1 38 ? -11.334 -0.557  11.479  1.00 15.00 ?  509 ARG A HE   3  
ATOM   2021  H HH11 . ARG A 1 38 ? -12.452 -3.831  10.857  1.00 15.00 ?  509 ARG A HH11 3  
ATOM   2022  H HH12 . ARG A 1 38 ? -12.303 -4.320  12.520  1.00 15.00 ?  509 ARG A HH12 3  
ATOM   2023  H HH21 . ARG A 1 38 ? -11.095 -1.227  13.643  1.00 15.00 ?  509 ARG A HH21 3  
ATOM   2024  H HH22 . ARG A 1 38 ? -11.512 -2.851  14.100  1.00 15.00 ?  509 ARG A HH22 3  
ATOM   2025  N N    . ARG B 2 1  ? -1.417  -17.597 0.268   1.00 15.00 ?  925 ARG B N    3  
ATOM   2026  C CA   . ARG B 2 1  ? -1.064  -16.429 1.097   1.00 15.00 ?  925 ARG B CA   3  
ATOM   2027  C C    . ARG B 2 1  ? -0.220  -15.456 0.284   1.00 15.00 ?  925 ARG B C    3  
ATOM   2028  O O    . ARG B 2 1  ? 0.762   -15.849 -0.345  1.00 15.00 ?  925 ARG B O    3  
ATOM   2029  C CB   . ARG B 2 1  ? -0.297  -16.894 2.335   1.00 15.00 ?  925 ARG B CB   3  
ATOM   2030  C CG   . ARG B 2 1  ? -0.165  -15.829 3.409   1.00 15.00 ?  925 ARG B CG   3  
ATOM   2031  C CD   . ARG B 2 1  ? 0.562   -16.368 4.630   1.00 15.00 ?  925 ARG B CD   3  
ATOM   2032  N NE   . ARG B 2 1  ? 0.542   -15.425 5.745   1.00 15.00 ?  925 ARG B NE   3  
ATOM   2033  C CZ   . ARG B 2 1  ? 1.369   -15.489 6.787   1.00 15.00 ?  925 ARG B CZ   3  
ATOM   2034  N NH1  . ARG B 2 1  ? 2.306   -16.426 6.832   1.00 15.00 1  925 ARG B NH1  3  
ATOM   2035  N NH2  . ARG B 2 1  ? 1.264   -14.615 7.780   1.00 15.00 ?  925 ARG B NH2  3  
ATOM   2036  H H1   . ARG B 2 1  ? -2.107  -18.196 0.770   1.00 15.00 ?  925 ARG B H1   3  
ATOM   2037  H H2   . ARG B 2 1  ? -0.565  -18.164 0.073   1.00 15.00 ?  925 ARG B H2   3  
ATOM   2038  H H3   . ARG B 2 1  ? -1.831  -17.285 -0.637  1.00 15.00 ?  925 ARG B H3   3  
ATOM   2039  H HA   . ARG B 2 1  ? -1.975  -15.936 1.402   1.00 15.00 ?  925 ARG B HA   3  
ATOM   2040  H HB2  . ARG B 2 1  ? -0.809  -17.744 2.762   1.00 15.00 ?  925 ARG B HB2  3  
ATOM   2041  H HB3  . ARG B 2 1  ? 0.696   -17.197 2.036   1.00 15.00 ?  925 ARG B HB3  3  
ATOM   2042  H HG2  . ARG B 2 1  ? 0.392   -14.994 3.009   1.00 15.00 ?  925 ARG B HG2  3  
ATOM   2043  H HG3  . ARG B 2 1  ? -1.152  -15.502 3.702   1.00 15.00 ?  925 ARG B HG3  3  
ATOM   2044  H HD2  . ARG B 2 1  ? 0.085   -17.286 4.940   1.00 15.00 ?  925 ARG B HD2  3  
ATOM   2045  H HD3  . ARG B 2 1  ? 1.588   -16.571 4.362   1.00 15.00 ?  925 ARG B HD3  3  
ATOM   2046  H HE   . ARG B 2 1  ? -0.141  -14.710 5.719   1.00 15.00 ?  925 ARG B HE   3  
ATOM   2047  H HH11 . ARG B 2 1  ? 2.397   -17.083 6.083   1.00 15.00 ?  925 ARG B HH11 3  
ATOM   2048  H HH12 . ARG B 2 1  ? 2.935   -16.483 7.621   1.00 15.00 ?  925 ARG B HH12 3  
ATOM   2049  H HH21 . ARG B 2 1  ? 0.558   -13.894 7.753   1.00 15.00 ?  925 ARG B HH21 3  
ATOM   2050  H HH22 . ARG B 2 1  ? 1.894   -14.662 8.569   1.00 15.00 ?  925 ARG B HH22 3  
ATOM   2051  N N    . LEU B 2 2  ? -0.603  -14.187 0.307   1.00 15.00 ?  926 LEU B N    3  
ATOM   2052  C CA   . LEU B 2 2  ? 0.058   -13.171 -0.500  1.00 15.00 ?  926 LEU B CA   3  
ATOM   2053  C C    . LEU B 2 2  ? 1.333   -12.689 0.178   1.00 15.00 ?  926 LEU B C    3  
ATOM   2054  O O    . LEU B 2 2  ? 1.310   -12.271 1.337   1.00 15.00 ?  926 LEU B O    3  
ATOM   2055  C CB   . LEU B 2 2  ? -0.888  -11.993 -0.738  1.00 15.00 ?  926 LEU B CB   3  
ATOM   2056  C CG   . LEU B 2 2  ? -2.196  -12.345 -1.447  1.00 15.00 ?  926 LEU B CG   3  
ATOM   2057  C CD1  . LEU B 2 2  ? -3.079  -11.119 -1.576  1.00 15.00 ?  926 LEU B CD1  3  
ATOM   2058  C CD2  . LEU B 2 2  ? -1.926  -12.944 -2.819  1.00 15.00 ?  926 LEU B CD2  3  
ATOM   2059  H H    . LEU B 2 2  ? -1.339  -13.919 0.904   1.00 15.00 ?  926 LEU B H    3  
ATOM   2060  H HA   . LEU B 2 2  ? 0.313   -13.615 -1.448  1.00 15.00 ?  926 LEU B HA   3  
ATOM   2061  H HB2  . LEU B 2 2  ? -1.128  -11.551 0.219   1.00 15.00 ?  926 LEU B HB2  3  
ATOM   2062  H HB3  . LEU B 2 2  ? -0.368  -11.257 -1.333  1.00 15.00 ?  926 LEU B HB3  3  
ATOM   2063  H HG   . LEU B 2 2  ? -2.727  -13.080 -0.860  1.00 15.00 ?  926 LEU B HG   3  
ATOM   2064  H HD11 . LEU B 2 2  ? -3.996  -11.388 -2.078  1.00 15.00 ?  926 LEU B HD11 3  
ATOM   2065  H HD12 . LEU B 2 2  ? -2.563  -10.362 -2.149  1.00 15.00 ?  926 LEU B HD12 3  
ATOM   2066  H HD13 . LEU B 2 2  ? -3.306  -10.733 -0.592  1.00 15.00 ?  926 LEU B HD13 3  
ATOM   2067  H HD21 . LEU B 2 2  ? -2.866  -13.191 -3.293  1.00 15.00 ?  926 LEU B HD21 3  
ATOM   2068  H HD22 . LEU B 2 2  ? -1.331  -13.838 -2.712  1.00 15.00 ?  926 LEU B HD22 3  
ATOM   2069  H HD23 . LEU B 2 2  ? -1.394  -12.226 -3.427  1.00 15.00 ?  926 LEU B HD23 3  
ATOM   2070  N N    . ASP B 2 3  ? 2.441   -12.745 -0.550  1.00 15.00 ?  927 ASP B N    3  
ATOM   2071  C CA   . ASP B 2 3  ? 3.723   -12.294 -0.024  1.00 15.00 ?  927 ASP B CA   3  
ATOM   2072  C C    . ASP B 2 3  ? 3.757   -10.775 0.100   1.00 15.00 ?  927 ASP B C    3  
ATOM   2073  O O    . ASP B 2 3  ? 3.558   -10.047 -0.873  1.00 15.00 ?  927 ASP B O    3  
ATOM   2074  C CB   . ASP B 2 3  ? 4.883   -12.789 -0.904  1.00 15.00 ?  927 ASP B CB   3  
ATOM   2075  C CG   . ASP B 2 3  ? 4.818   -12.280 -2.334  1.00 15.00 ?  927 ASP B CG   3  
ATOM   2076  O OD1  . ASP B 2 3  ? 3.886   -12.674 -3.066  1.00 15.00 ?  927 ASP B OD1  3  
ATOM   2077  O OD2  . ASP B 2 3  ? 5.711   -11.502 -2.743  1.00 15.00 -1 927 ASP B OD2  3  
ATOM   2078  H H    . ASP B 2 3  ? 2.397   -13.096 -1.464  1.00 15.00 ?  927 ASP B H    3  
ATOM   2079  H HA   . ASP B 2 3  ? 3.833   -12.716 0.963   1.00 15.00 ?  927 ASP B HA   3  
ATOM   2080  H HB2  . ASP B 2 3  ? 5.814   -12.458 -0.472  1.00 15.00 ?  927 ASP B HB2  3  
ATOM   2081  H HB3  . ASP B 2 3  ? 4.868   -13.869 -0.925  1.00 15.00 ?  927 ASP B HB3  3  
ATOM   2082  N N    . LEU B 2 4  ? 3.987   -10.303 1.315   1.00 15.00 ?  928 LEU B N    3  
ATOM   2083  C CA   . LEU B 2 4  ? 4.082   -8.875  1.575   1.00 15.00 ?  928 LEU B CA   3  
ATOM   2084  C C    . LEU B 2 4  ? 5.553   -8.497  1.723   1.00 15.00 ?  928 LEU B C    3  
ATOM   2085  O O    . LEU B 2 4  ? 6.251   -9.024  2.593   1.00 15.00 ?  928 LEU B O    3  
ATOM   2086  C CB   . LEU B 2 4  ? 3.283   -8.531  2.848   1.00 15.00 ?  928 LEU B CB   3  
ATOM   2087  C CG   . LEU B 2 4  ? 2.993   -7.039  3.108   1.00 15.00 ?  928 LEU B CG   3  
ATOM   2088  C CD1  . LEU B 2 4  ? 4.239   -6.294  3.564   1.00 15.00 ?  928 LEU B CD1  3  
ATOM   2089  C CD2  . LEU B 2 4  ? 2.404   -6.381  1.869   1.00 15.00 ?  928 LEU B CD2  3  
ATOM   2090  H H    . LEU B 2 4  ? 4.105   -10.933 2.058   1.00 15.00 ?  928 LEU B H    3  
ATOM   2091  H HA   . LEU B 2 4  ? 3.661   -8.347  0.731   1.00 15.00 ?  928 LEU B HA   3  
ATOM   2092  H HB2  . LEU B 2 4  ? 2.335   -9.047  2.796   1.00 15.00 ?  928 LEU B HB2  3  
ATOM   2093  H HB3  . LEU B 2 4  ? 3.830   -8.915  3.696   1.00 15.00 ?  928 LEU B HB3  3  
ATOM   2094  H HG   . LEU B 2 4  ? 2.262   -6.963  3.897   1.00 15.00 ?  928 LEU B HG   3  
ATOM   2095  H HD11 . LEU B 2 4  ? 4.593   -6.720  4.491   1.00 15.00 ?  928 LEU B HD11 3  
ATOM   2096  H HD12 . LEU B 2 4  ? 4.000   -5.253  3.713   1.00 15.00 ?  928 LEU B HD12 3  
ATOM   2097  H HD13 . LEU B 2 4  ? 5.009   -6.383  2.810   1.00 15.00 ?  928 LEU B HD13 3  
ATOM   2098  H HD21 . LEU B 2 4  ? 2.198   -5.341  2.077   1.00 15.00 ?  928 LEU B HD21 3  
ATOM   2099  H HD22 . LEU B 2 4  ? 1.486   -6.882  1.600   1.00 15.00 ?  928 LEU B HD22 3  
ATOM   2100  H HD23 . LEU B 2 4  ? 3.107   -6.453  1.053   1.00 15.00 ?  928 LEU B HD23 3  
ATOM   2101  N N    . PRO B 2 5  ? 6.053   -7.601  0.866   1.00 15.00 ?  929 PRO B N    3  
ATOM   2102  C CA   . PRO B 2 5  ? 7.443   -7.166  0.917   1.00 15.00 ?  929 PRO B CA   3  
ATOM   2103  C C    . PRO B 2 5  ? 7.665   -6.033  1.920   1.00 15.00 ?  929 PRO B C    3  
ATOM   2104  O O    . PRO B 2 5  ? 6.895   -5.069  1.958   1.00 15.00 ?  929 PRO B O    3  
ATOM   2105  C CB   . PRO B 2 5  ? 7.694   -6.681  -0.509  1.00 15.00 ?  929 PRO B CB   3  
ATOM   2106  C CG   . PRO B 2 5  ? 6.371   -6.162  -0.972  1.00 15.00 ?  929 PRO B CG   3  
ATOM   2107  C CD   . PRO B 2 5  ? 5.311   -6.942  -0.230  1.00 15.00 ?  929 PRO B CD   3  
ATOM   2108  H HA   . PRO B 2 5  ? 8.108   -7.987  1.145   1.00 15.00 ?  929 PRO B HA   3  
ATOM   2109  H HB2  . PRO B 2 5  ? 8.444   -5.903  -0.499  1.00 15.00 ?  929 PRO B HB2  3  
ATOM   2110  H HB3  . PRO B 2 5  ? 8.030   -7.505  -1.120  1.00 15.00 ?  929 PRO B HB3  3  
ATOM   2111  H HG2  . PRO B 2 5  ? 6.291   -5.110  -0.739  1.00 15.00 ?  929 PRO B HG2  3  
ATOM   2112  H HG3  . PRO B 2 5  ? 6.273   -6.317  -2.036  1.00 15.00 ?  929 PRO B HG3  3  
ATOM   2113  H HD2  . PRO B 2 5  ? 4.562   -6.270  0.163   1.00 15.00 ?  929 PRO B HD2  3  
ATOM   2114  H HD3  . PRO B 2 5  ? 4.855   -7.670  -0.887  1.00 15.00 ?  929 PRO B HD3  3  
ATOM   2115  N N    . PRO B 2 6  ? 8.716   -6.141  2.757   1.00 15.00 ?  930 PRO B N    3  
ATOM   2116  C CA   . PRO B 2 6  ? 9.130   -5.055  3.644   1.00 15.00 ?  930 PRO B CA   3  
ATOM   2117  C C    . PRO B 2 6  ? 9.300   -3.772  2.844   1.00 15.00 ?  930 PRO B C    3  
ATOM   2118  O O    . PRO B 2 6  ? 10.039  -3.751  1.858   1.00 15.00 ?  930 PRO B O    3  
ATOM   2119  C CB   . PRO B 2 6  ? 10.473  -5.528  4.222   1.00 15.00 ?  930 PRO B CB   3  
ATOM   2120  C CG   . PRO B 2 6  ? 10.856  -6.731  3.423   1.00 15.00 ?  930 PRO B CG   3  
ATOM   2121  C CD   . PRO B 2 6  ? 9.577   -7.317  2.900   1.00 15.00 ?  930 PRO B CD   3  
ATOM   2122  H HA   . PRO B 2 6  ? 8.416   -4.896  4.440   1.00 15.00 ?  930 PRO B HA   3  
ATOM   2123  H HB2  . PRO B 2 6  ? 11.205  -4.741  4.118   1.00 15.00 ?  930 PRO B HB2  3  
ATOM   2124  H HB3  . PRO B 2 6  ? 10.350  -5.772  5.267   1.00 15.00 ?  930 PRO B HB3  3  
ATOM   2125  H HG2  . PRO B 2 6  ? 11.495  -6.437  2.604   1.00 15.00 ?  930 PRO B HG2  3  
ATOM   2126  H HG3  . PRO B 2 6  ? 11.363  -7.445  4.057   1.00 15.00 ?  930 PRO B HG3  3  
ATOM   2127  H HD2  . PRO B 2 6  ? 9.740   -7.794  1.945   1.00 15.00 ?  930 PRO B HD2  3  
ATOM   2128  H HD3  . PRO B 2 6  ? 9.161   -8.016  3.609   1.00 15.00 ?  930 PRO B HD3  3  
ATOM   2129  N N    . TYR B 2 7  ? 8.607   -2.716  3.259   1.00 15.00 ?  931 TYR B N    3  
ATOM   2130  C CA   . TYR B 2 7  ? 8.419   -1.561  2.395   1.00 15.00 ?  931 TYR B CA   3  
ATOM   2131  C C    . TYR B 2 7  ? 9.741   -0.911  1.997   1.00 15.00 ?  931 TYR B C    3  
ATOM   2132  O O    . TYR B 2 7  ? 10.514  -0.432  2.833   1.00 15.00 ?  931 TYR B O    3  
ATOM   2133  C CB   . TYR B 2 7  ? 7.513   -0.545  3.107   1.00 15.00 ?  931 TYR B CB   3  
ATOM   2134  C CG   . TYR B 2 7  ? 7.246   0.739   2.338   1.00 15.00 ?  931 TYR B CG   3  
ATOM   2135  C CD1  . TYR B 2 7  ? 6.830   0.723   1.012   1.00 15.00 ?  931 TYR B CD1  3  
ATOM   2136  C CD2  . TYR B 2 7  ? 7.395   1.972   2.959   1.00 15.00 ?  931 TYR B CD2  3  
ATOM   2137  C CE1  . TYR B 2 7  ? 6.574   1.899   0.331   1.00 15.00 ?  931 TYR B CE1  3  
ATOM   2138  C CE2  . TYR B 2 7  ? 7.143   3.149   2.286   1.00 15.00 ?  931 TYR B CE2  3  
ATOM   2139  C CZ   . TYR B 2 7  ? 6.733   3.110   0.974   1.00 15.00 ?  931 TYR B CZ   3  
ATOM   2140  O OH   . TYR B 2 7  ? 6.478   4.284   0.302   1.00 15.00 ?  931 TYR B OH   3  
ATOM   2141  H H    . TYR B 2 7  ? 8.221   -2.716  4.157   1.00 15.00 ?  931 TYR B H    3  
ATOM   2142  H HA   . TYR B 2 7  ? 7.919   -1.900  1.501   1.00 15.00 ?  931 TYR B HA   3  
ATOM   2143  H HB2  . TYR B 2 7  ? 6.560   -1.010  3.307   1.00 15.00 ?  931 TYR B HB2  3  
ATOM   2144  H HB3  . TYR B 2 7  ? 7.972   -0.273  4.047   1.00 15.00 ?  931 TYR B HB3  3  
ATOM   2145  H HD1  . TYR B 2 7  ? 6.706   -0.222  0.509   1.00 15.00 ?  931 TYR B HD1  3  
ATOM   2146  H HD2  . TYR B 2 7  ? 7.715   2.005   3.987   1.00 15.00 ?  931 TYR B HD2  3  
ATOM   2147  H HE1  . TYR B 2 7  ? 6.251   1.868   -0.698  1.00 15.00 ?  931 TYR B HE1  3  
ATOM   2148  H HE2  . TYR B 2 7  ? 7.265   4.095   2.793   1.00 15.00 ?  931 TYR B HE2  3  
ATOM   2149  H HH   . TYR B 2 7  ? 7.197   4.904   0.459   1.00 15.00 ?  931 TYR B HH   3  
ATOM   2150  N N    . GLU B 2 8  ? 9.967   -0.909  0.696   1.00 15.00 ?  932 GLU B N    3  
ATOM   2151  C CA   . GLU B 2 8  ? 10.997  -0.118  0.056   1.00 15.00 ?  932 GLU B CA   3  
ATOM   2152  C C    . GLU B 2 8  ? 10.283  0.969   -0.717  1.00 15.00 ?  932 GLU B C    3  
ATOM   2153  O O    . GLU B 2 8  ? 9.201   0.709   -1.249  1.00 15.00 ?  932 GLU B O    3  
ATOM   2154  C CB   . GLU B 2 8  ? 11.832  -0.992  -0.882  1.00 15.00 ?  932 GLU B CB   3  
ATOM   2155  C CG   . GLU B 2 8  ? 12.994  -0.257  -1.525  1.00 15.00 ?  932 GLU B CG   3  
ATOM   2156  C CD   . GLU B 2 8  ? 13.972  0.277   -0.502  1.00 15.00 ?  932 GLU B CD   3  
ATOM   2157  O OE1  . GLU B 2 8  ? 13.700  1.346   0.086   1.00 15.00 -1 932 GLU B OE1  3  
ATOM   2158  O OE2  . GLU B 2 8  ? 15.012  -0.373  -0.276  1.00 15.00 ?  932 GLU B OE2  3  
ATOM   2159  H H    . GLU B 2 8  ? 9.394   -1.466  0.128   1.00 15.00 ?  932 GLU B H    3  
ATOM   2160  H HA   . GLU B 2 8  ? 11.626  0.324   0.815   1.00 15.00 ?  932 GLU B HA   3  
ATOM   2161  H HB2  . GLU B 2 8  ? 12.228  -1.827  -0.322  1.00 15.00 ?  932 GLU B HB2  3  
ATOM   2162  H HB3  . GLU B 2 8  ? 11.193  -1.367  -1.667  1.00 15.00 ?  932 GLU B HB3  3  
ATOM   2163  H HG2  . GLU B 2 8  ? 13.516  -0.938  -2.182  1.00 15.00 ?  932 GLU B HG2  3  
ATOM   2164  H HG3  . GLU B 2 8  ? 12.604  0.570   -2.100  1.00 15.00 ?  932 GLU B HG3  3  
ATOM   2165  N N    . THR B 2 9  ? 10.840  2.165   -0.806  1.00 15.00 ?  933 THR B N    3  
ATOM   2166  C CA   . THR B 2 9  ? 10.106  3.220   -1.472  1.00 15.00 ?  933 THR B CA   3  
ATOM   2167  C C    . THR B 2 9  ? 9.945   2.917   -2.957  1.00 15.00 ?  933 THR B C    3  
ATOM   2168  O O    . THR B 2 9  ? 10.915  2.761   -3.703  1.00 15.00 ?  933 THR B O    3  
ATOM   2169  C CB   . THR B 2 9  ? 10.747  4.605   -1.308  1.00 15.00 ?  933 THR B CB   3  
ATOM   2170  O OG1  . THR B 2 9  ? 11.269  4.757   0.021   1.00 15.00 ?  933 THR B OG1  3  
ATOM   2171  C CG2  . THR B 2 9  ? 9.702   5.687   -1.576  1.00 15.00 ?  933 THR B CG2  3  
ATOM   2172  H H    . THR B 2 9  ? 11.730  2.336   -0.428  1.00 15.00 ?  933 THR B H    3  
ATOM   2173  H HA   . THR B 2 9  ? 9.123   3.255   -1.027  1.00 15.00 ?  933 THR B HA   3  
ATOM   2174  H HB   . THR B 2 9  ? 11.550  4.712   -2.023  1.00 15.00 ?  933 THR B HB   3  
ATOM   2175  H HG1  . THR B 2 9  ? 12.010  5.381   0.002   1.00 15.00 ?  933 THR B HG1  3  
ATOM   2176  H HG21 . THR B 2 9  ? 8.881   5.575   -0.879  1.00 15.00 ?  933 THR B HG21 3  
ATOM   2177  H HG22 . THR B 2 9  ? 9.325   5.584   -2.586  1.00 15.00 ?  933 THR B HG22 3  
ATOM   2178  H HG23 . THR B 2 9  ? 10.147  6.661   -1.453  1.00 15.00 ?  933 THR B HG23 3  
ATOM   2179  N N    . PHE B 2 10 ? 8.693   2.824   -3.339  1.00 15.00 ?  934 PHE B N    3  
ATOM   2180  C CA   . PHE B 2 10 ? 8.263   2.742   -4.719  1.00 15.00 ?  934 PHE B CA   3  
ATOM   2181  C C    . PHE B 2 10 ? 7.993   4.174   -5.176  1.00 15.00 ?  934 PHE B C    3  
ATOM   2182  O O    . PHE B 2 10 ? 8.227   5.101   -4.398  1.00 15.00 ?  934 PHE B O    3  
ATOM   2183  C CB   . PHE B 2 10 ? 7.000   1.869   -4.826  1.00 15.00 ?  934 PHE B CB   3  
ATOM   2184  C CG   . PHE B 2 10 ? 5.779   2.557   -4.300  1.00 15.00 ?  934 PHE B CG   3  
ATOM   2185  C CD1  . PHE B 2 10 ? 5.780   3.123   -3.036  1.00 15.00 ?  934 PHE B CD1  3  
ATOM   2186  C CD2  . PHE B 2 10 ? 4.655   2.690   -5.090  1.00 15.00 ?  934 PHE B CD2  3  
ATOM   2187  C CE1  . PHE B 2 10 ? 4.692   3.816   -2.578  1.00 15.00 ?  934 PHE B CE1  3  
ATOM   2188  C CE2  . PHE B 2 10 ? 3.555   3.371   -4.627  1.00 15.00 ?  934 PHE B CE2  3  
ATOM   2189  C CZ   . PHE B 2 10 ? 3.578   3.939   -3.373  1.00 15.00 ?  934 PHE B CZ   3  
ATOM   2190  H H    . PHE B 2 10 ? 8.004   2.811   -2.642  1.00 15.00 ?  934 PHE B H    3  
ATOM   2191  H HA   . PHE B 2 10 ? 9.061   2.315   -5.308  1.00 15.00 ?  934 PHE B HA   3  
ATOM   2192  H HB2  . PHE B 2 10 ? 6.826   1.623   -5.864  1.00 15.00 ?  934 PHE B HB2  3  
ATOM   2193  H HB3  . PHE B 2 10 ? 7.145   0.960   -4.262  1.00 15.00 ?  934 PHE B HB3  3  
ATOM   2194  H HD1  . PHE B 2 10 ? 6.652   3.014   -2.405  1.00 15.00 ?  934 PHE B HD1  3  
ATOM   2195  H HD2  . PHE B 2 10 ? 4.633   2.235   -6.069  1.00 15.00 ?  934 PHE B HD2  3  
ATOM   2196  H HE1  . PHE B 2 10 ? 4.706   4.258   -1.597  1.00 15.00 ?  934 PHE B HE1  3  
ATOM   2197  H HE2  . PHE B 2 10 ? 2.679   3.469   -5.250  1.00 15.00 ?  934 PHE B HE2  3  
ATOM   2198  H HZ   . PHE B 2 10 ? 2.736   4.490   -3.018  1.00 15.00 ?  934 PHE B HZ   3  
ATOM   2199  N N    . GLU B 2 11 ? 7.561   4.375   -6.417  1.00 15.00 ?  935 GLU B N    3  
ATOM   2200  C CA   . GLU B 2 11 ? 7.250   5.722   -6.891  1.00 15.00 ?  935 GLU B CA   3  
ATOM   2201  C C    . GLU B 2 11 ? 6.354   6.448   -5.884  1.00 15.00 ?  935 GLU B C    3  
ATOM   2202  O O    . GLU B 2 11 ? 5.249   6.001   -5.569  1.00 15.00 ?  935 GLU B O    3  
ATOM   2203  C CB   . GLU B 2 11 ? 6.550   5.670   -8.257  1.00 15.00 ?  935 GLU B CB   3  
ATOM   2204  C CG   . GLU B 2 11 ? 5.305   4.782   -8.302  1.00 15.00 ?  935 GLU B CG   3  
ATOM   2205  C CD   . GLU B 2 11 ? 5.629   3.313   -8.502  1.00 15.00 ?  935 GLU B CD   3  
ATOM   2206  O OE1  . GLU B 2 11 ? 6.812   2.987   -8.740  1.00 15.00 ?  935 GLU B OE1  3  
ATOM   2207  O OE2  . GLU B 2 11 ? 4.699   2.481   -8.445  1.00 15.00 -1 935 GLU B OE2  3  
ATOM   2208  H H    . GLU B 2 11 ? 7.452   3.610   -7.026  1.00 15.00 ?  935 GLU B H    3  
ATOM   2209  H HA   . GLU B 2 11 ? 8.176   6.265   -6.989  1.00 15.00 ?  935 GLU B HA   3  
ATOM   2210  H HB2  . GLU B 2 11 ? 6.256   6.672   -8.531  1.00 15.00 ?  935 GLU B HB2  3  
ATOM   2211  H HB3  . GLU B 2 11 ? 7.253   5.302   -8.988  1.00 15.00 ?  935 GLU B HB3  3  
ATOM   2212  H HG2  . GLU B 2 11 ? 4.766   4.887   -7.364  1.00 15.00 ?  935 GLU B HG2  3  
ATOM   2213  H HG3  . GLU B 2 11 ? 4.675   5.111   -9.116  1.00 15.00 ?  935 GLU B HG3  3  
ATOM   2214  N N    . ASP B 2 12 ? 6.848   7.566   -5.373  1.00 15.00 ?  936 ASP B N    3  
ATOM   2215  C CA   . ASP B 2 12 ? 6.177   8.257   -4.284  1.00 15.00 ?  936 ASP B CA   3  
ATOM   2216  C C    . ASP B 2 12 ? 5.109   9.195   -4.814  1.00 15.00 ?  936 ASP B C    3  
ATOM   2217  O O    . ASP B 2 12 ? 5.324   9.929   -5.784  1.00 15.00 ?  936 ASP B O    3  
ATOM   2218  C CB   . ASP B 2 12 ? 7.179   9.027   -3.424  1.00 15.00 ?  936 ASP B CB   3  
ATOM   2219  C CG   . ASP B 2 12 ? 6.522   9.647   -2.205  1.00 15.00 ?  936 ASP B CG   3  
ATOM   2220  O OD1  . ASP B 2 12 ? 6.011   8.890   -1.350  1.00 15.00 ?  936 ASP B OD1  3  
ATOM   2221  O OD2  . ASP B 2 12 ? 6.519   10.890  -2.094  1.00 15.00 -1 936 ASP B OD2  3  
ATOM   2222  H H    . ASP B 2 12 ? 7.675   7.935   -5.738  1.00 15.00 ?  936 ASP B H    3  
ATOM   2223  H HA   . ASP B 2 12 ? 5.700   7.506   -3.670  1.00 15.00 ?  936 ASP B HA   3  
ATOM   2224  H HB2  . ASP B 2 12 ? 7.953   8.352   -3.092  1.00 15.00 ?  936 ASP B HB2  3  
ATOM   2225  H HB3  . ASP B 2 12 ? 7.620   9.816   -4.014  1.00 15.00 ?  936 ASP B HB3  3  
ATOM   2226  N N    . LEU B 2 13 ? 3.969   9.172   -4.149  1.00 15.00 ?  937 LEU B N    3  
ATOM   2227  C CA   . LEU B 2 13 ? 2.811   9.959   -4.541  1.00 15.00 ?  937 LEU B CA   3  
ATOM   2228  C C    . LEU B 2 13 ? 3.068   11.444  -4.307  1.00 15.00 ?  937 LEU B C    3  
ATOM   2229  O O    . LEU B 2 13 ? 3.173   12.223  -5.252  1.00 15.00 ?  937 LEU B O    3  
ATOM   2230  C CB   . LEU B 2 13 ? 1.564   9.508   -3.761  1.00 15.00 ?  937 LEU B CB   3  
ATOM   2231  C CG   . LEU B 2 13 ? 1.064   8.077   -4.036  1.00 15.00 ?  937 LEU B CG   3  
ATOM   2232  C CD1  . LEU B 2 13 ? 0.797   7.870   -5.518  1.00 15.00 ?  937 LEU B CD1  3  
ATOM   2233  C CD2  . LEU B 2 13 ? 2.043   7.034   -3.522  1.00 15.00 ?  937 LEU B CD2  3  
ATOM   2234  H H    . LEU B 2 13 ? 3.908   8.608   -3.351  1.00 15.00 ?  937 LEU B H    3  
ATOM   2235  H HA   . LEU B 2 13 ? 2.643   9.799   -5.595  1.00 15.00 ?  937 LEU B HA   3  
ATOM   2236  H HB2  . LEU B 2 13 ? 1.783   9.587   -2.707  1.00 15.00 ?  937 LEU B HB2  3  
ATOM   2237  H HB3  . LEU B 2 13 ? 0.762   10.192  -3.992  1.00 15.00 ?  937 LEU B HB3  3  
ATOM   2238  H HG   . LEU B 2 13 ? 0.129   7.933   -3.513  1.00 15.00 ?  937 LEU B HG   3  
ATOM   2239  H HD11 . LEU B 2 13 ? 1.713   8.009   -6.071  1.00 15.00 ?  937 LEU B HD11 3  
ATOM   2240  H HD12 . LEU B 2 13 ? 0.062   8.586   -5.853  1.00 15.00 ?  937 LEU B HD12 3  
ATOM   2241  H HD13 . LEU B 2 13 ? 0.425   6.868   -5.681  1.00 15.00 ?  937 LEU B HD13 3  
ATOM   2242  H HD21 . LEU B 2 13 ? 1.661   6.046   -3.735  1.00 15.00 ?  937 LEU B HD21 3  
ATOM   2243  H HD22 . LEU B 2 13 ? 2.166   7.149   -2.455  1.00 15.00 ?  937 LEU B HD22 3  
ATOM   2244  H HD23 . LEU B 2 13 ? 2.997   7.164   -4.011  1.00 15.00 ?  937 LEU B HD23 3  
HETATM 2245  N N    . NH2 B 2 14 ? 3.167   11.834  -3.047  1.00 15.00 ?  938 NH2 B N    3  
HETATM 2246  H HN1  . NH2 B 2 14 ? 3.074   11.158  -2.345  1.00 15.00 ?  938 NH2 B HN1  3  
HETATM 2247  H HN2  . NH2 B 2 14 ? 3.330   12.783  -2.869  1.00 15.00 ?  938 NH2 B HN2  3  
ATOM   2248  N N    . PHE A 1 7  ? -11.142 7.852   -2.264  1.00 15.00 ?  478 PHE A N    4  
ATOM   2249  C CA   . PHE A 1 7  ? -9.766  7.326   -2.413  1.00 15.00 ?  478 PHE A CA   4  
ATOM   2250  C C    . PHE A 1 7  ? -9.118  7.216   -1.038  1.00 15.00 ?  478 PHE A C    4  
ATOM   2251  O O    . PHE A 1 7  ? -9.597  7.817   -0.076  1.00 15.00 ?  478 PHE A O    4  
ATOM   2252  C CB   . PHE A 1 7  ? -8.951  8.256   -3.330  1.00 15.00 ?  478 PHE A CB   4  
ATOM   2253  C CG   . PHE A 1 7  ? -7.558  7.774   -3.644  1.00 15.00 ?  478 PHE A CG   4  
ATOM   2254  C CD1  . PHE A 1 7  ? -7.352  6.777   -4.583  1.00 15.00 ?  478 PHE A CD1  4  
ATOM   2255  C CD2  . PHE A 1 7  ? -6.456  8.324   -3.005  1.00 15.00 ?  478 PHE A CD2  4  
ATOM   2256  C CE1  . PHE A 1 7  ? -6.076  6.336   -4.879  1.00 15.00 ?  478 PHE A CE1  4  
ATOM   2257  C CE2  . PHE A 1 7  ? -5.177  7.887   -3.297  1.00 15.00 ?  478 PHE A CE2  4  
ATOM   2258  C CZ   . PHE A 1 7  ? -4.987  6.891   -4.236  1.00 15.00 ?  478 PHE A CZ   4  
ATOM   2259  H H    . PHE A 1 7  ? -11.112 8.855   -1.982  1.00 15.00 ?  478 PHE A H    4  
ATOM   2260  H HA   . PHE A 1 7  ? -9.820  6.342   -2.856  1.00 15.00 ?  478 PHE A HA   4  
ATOM   2261  H HB2  . PHE A 1 7  ? -9.473  8.371   -4.267  1.00 15.00 ?  478 PHE A HB2  4  
ATOM   2262  H HB3  . PHE A 1 7  ? -8.864  9.221   -2.857  1.00 15.00 ?  478 PHE A HB3  4  
ATOM   2263  H HD1  . PHE A 1 7  ? -8.202  6.342   -5.087  1.00 15.00 ?  478 PHE A HD1  4  
ATOM   2264  H HD2  . PHE A 1 7  ? -6.603  9.100   -2.270  1.00 15.00 ?  478 PHE A HD2  4  
ATOM   2265  H HE1  . PHE A 1 7  ? -5.931  5.558   -5.612  1.00 15.00 ?  478 PHE A HE1  4  
ATOM   2266  H HE2  . PHE A 1 7  ? -4.327  8.323   -2.792  1.00 15.00 ?  478 PHE A HE2  4  
ATOM   2267  H HZ   . PHE A 1 7  ? -3.990  6.548   -4.466  1.00 15.00 ?  478 PHE A HZ   4  
ATOM   2268  N N    . LEU A 1 8  ? -8.043  6.444   -0.959  1.00 15.00 ?  479 LEU A N    4  
ATOM   2269  C CA   . LEU A 1 8  ? -7.319  6.226   0.287   1.00 15.00 ?  479 LEU A CA   4  
ATOM   2270  C C    . LEU A 1 8  ? -6.968  7.542   0.986   1.00 15.00 ?  479 LEU A C    4  
ATOM   2271  O O    . LEU A 1 8  ? -6.597  8.522   0.337   1.00 15.00 ?  479 LEU A O    4  
ATOM   2272  C CB   . LEU A 1 8  ? -6.043  5.427   0.003   1.00 15.00 ?  479 LEU A CB   4  
ATOM   2273  C CG   . LEU A 1 8  ? -6.067  3.963   0.454   1.00 15.00 ?  479 LEU A CG   4  
ATOM   2274  C CD1  . LEU A 1 8  ? -7.198  3.204   -0.225  1.00 15.00 ?  479 LEU A CD1  4  
ATOM   2275  C CD2  . LEU A 1 8  ? -4.740  3.293   0.149   1.00 15.00 ?  479 LEU A CD2  4  
ATOM   2276  H H    . LEU A 1 8  ? -7.715  6.007   -1.771  1.00 15.00 ?  479 LEU A H    4  
ATOM   2277  H HA   . LEU A 1 8  ? -7.953  5.644   0.939   1.00 15.00 ?  479 LEU A HA   4  
ATOM   2278  H HB2  . LEU A 1 8  ? -5.860  5.450   -1.061  1.00 15.00 ?  479 LEU A HB2  4  
ATOM   2279  H HB3  . LEU A 1 8  ? -5.220  5.919   0.501   1.00 15.00 ?  479 LEU A HB3  4  
ATOM   2280  H HG   . LEU A 1 8  ? -6.224  3.926   1.525   1.00 15.00 ?  479 LEU A HG   4  
ATOM   2281  H HD11 . LEU A 1 8  ? -7.254  2.207   0.184   1.00 15.00 ?  479 LEU A HD11 4  
ATOM   2282  H HD12 . LEU A 1 8  ? -7.001  3.143   -1.290  1.00 15.00 ?  479 LEU A HD12 4  
ATOM   2283  H HD13 . LEU A 1 8  ? -8.131  3.718   -0.058  1.00 15.00 ?  479 LEU A HD13 4  
ATOM   2284  H HD21 . LEU A 1 8  ? -4.694  2.340   0.656   1.00 15.00 ?  479 LEU A HD21 4  
ATOM   2285  H HD22 . LEU A 1 8  ? -3.930  3.922   0.483   1.00 15.00 ?  479 LEU A HD22 4  
ATOM   2286  H HD23 . LEU A 1 8  ? -4.656  3.136   -0.916  1.00 15.00 ?  479 LEU A HD23 4  
ATOM   2287  N N    . PRO A 1 9  ? -7.113  7.559   2.330   1.00 15.00 ?  480 PRO A N    4  
ATOM   2288  C CA   . PRO A 1 9  ? -6.712  8.676   3.208   1.00 15.00 ?  480 PRO A CA   4  
ATOM   2289  C C    . PRO A 1 9  ? -5.413  9.375   2.771   1.00 15.00 ?  480 PRO A C    4  
ATOM   2290  O O    . PRO A 1 9  ? -4.571  8.774   2.118   1.00 15.00 ?  480 PRO A O    4  
ATOM   2291  C CB   . PRO A 1 9  ? -6.494  7.940   4.522   1.00 15.00 ?  480 PRO A CB   4  
ATOM   2292  C CG   . PRO A 1 9  ? -7.576  6.925   4.541   1.00 15.00 ?  480 PRO A CG   4  
ATOM   2293  C CD   . PRO A 1 9  ? -7.715  6.459   3.116   1.00 15.00 ?  480 PRO A CD   4  
ATOM   2294  H HA   . PRO A 1 9  ? -7.501  9.403   3.321   1.00 15.00 ?  480 PRO A HA   4  
ATOM   2295  H HB2  . PRO A 1 9  ? -5.524  7.480   4.507   1.00 15.00 ?  480 PRO A HB2  4  
ATOM   2296  H HB3  . PRO A 1 9  ? -6.566  8.619   5.356   1.00 15.00 ?  480 PRO A HB3  4  
ATOM   2297  H HG2  . PRO A 1 9  ? -7.298  6.101   5.184   1.00 15.00 ?  480 PRO A HG2  4  
ATOM   2298  H HG3  . PRO A 1 9  ? -8.499  7.374   4.881   1.00 15.00 ?  480 PRO A HG3  4  
ATOM   2299  H HD2  . PRO A 1 9  ? -7.173  5.536   2.965   1.00 15.00 ?  480 PRO A HD2  4  
ATOM   2300  H HD3  . PRO A 1 9  ? -8.756  6.332   2.860   1.00 15.00 ?  480 PRO A HD3  4  
ATOM   2301  N N    . PRO A 1 10 ? -5.215  10.638  3.198   1.00 15.00 ?  481 PRO A N    4  
ATOM   2302  C CA   . PRO A 1 10 ? -4.093  11.489  2.742   1.00 15.00 ?  481 PRO A CA   4  
ATOM   2303  C C    . PRO A 1 10 ? -2.696  10.891  2.964   1.00 15.00 ?  481 PRO A C    4  
ATOM   2304  O O    . PRO A 1 10 ? -1.718  11.367  2.389   1.00 15.00 ?  481 PRO A O    4  
ATOM   2305  C CB   . PRO A 1 10 ? -4.248  12.767  3.569   1.00 15.00 ?  481 PRO A CB   4  
ATOM   2306  C CG   . PRO A 1 10 ? -5.677  12.782  3.991   1.00 15.00 ?  481 PRO A CG   4  
ATOM   2307  C CD   . PRO A 1 10 ? -6.076  11.346  4.162   1.00 15.00 ?  481 PRO A CD   4  
ATOM   2308  H HA   . PRO A 1 10 ? -4.200  11.735  1.695   1.00 15.00 ?  481 PRO A HA   4  
ATOM   2309  H HB2  . PRO A 1 10 ? -3.585  12.728  4.421   1.00 15.00 ?  481 PRO A HB2  4  
ATOM   2310  H HB3  . PRO A 1 10 ? -4.008  13.624  2.959   1.00 15.00 ?  481 PRO A HB3  4  
ATOM   2311  H HG2  . PRO A 1 10 ? -5.777  13.313  4.926   1.00 15.00 ?  481 PRO A HG2  4  
ATOM   2312  H HG3  . PRO A 1 10 ? -6.280  13.249  3.227   1.00 15.00 ?  481 PRO A HG3  4  
ATOM   2313  H HD2  . PRO A 1 10 ? -5.880  11.016  5.173   1.00 15.00 ?  481 PRO A HD2  4  
ATOM   2314  H HD3  . PRO A 1 10 ? -7.119  11.213  3.916   1.00 15.00 ?  481 PRO A HD3  4  
ATOM   2315  N N    . GLY A 1 11 ? -2.592  9.882   3.823   1.00 15.00 ?  482 GLY A N    4  
ATOM   2316  C CA   . GLY A 1 11 ? -1.315  9.215   4.017   1.00 15.00 ?  482 GLY A CA   4  
ATOM   2317  C C    . GLY A 1 11 ? -1.365  7.773   3.586   1.00 15.00 ?  482 GLY A C    4  
ATOM   2318  O O    . GLY A 1 11 ? -0.370  7.057   3.674   1.00 15.00 ?  482 GLY A O    4  
ATOM   2319  H H    . GLY A 1 11 ? -3.381  9.591   4.320   1.00 15.00 ?  482 GLY A H    4  
ATOM   2320  H HA2  . GLY A 1 11 ? -0.563  9.726   3.434   1.00 15.00 ?  482 GLY A HA2  4  
ATOM   2321  H HA3  . GLY A 1 11 ? -1.034  9.255   5.053   1.00 15.00 ?  482 GLY A HA3  4  
ATOM   2322  N N    . TRP A 1 12 ? -2.525  7.348   3.130   1.00 15.00 ?  483 TRP A N    4  
ATOM   2323  C CA   . TRP A 1 12 ? -2.695  6.013   2.605   1.00 15.00 ?  483 TRP A CA   4  
ATOM   2324  C C    . TRP A 1 12 ? -2.578  6.059   1.096   1.00 15.00 ?  483 TRP A C    4  
ATOM   2325  O O    . TRP A 1 12 ? -3.322  6.770   0.425   1.00 15.00 ?  483 TRP A O    4  
ATOM   2326  C CB   . TRP A 1 12 ? -4.050  5.431   3.009   1.00 15.00 ?  483 TRP A CB   4  
ATOM   2327  C CG   . TRP A 1 12 ? -4.116  4.954   4.425   1.00 15.00 ?  483 TRP A CG   4  
ATOM   2328  C CD1  . TRP A 1 12 ? -4.187  5.725   5.544   1.00 15.00 ?  483 TRP A CD1  4  
ATOM   2329  C CD2  . TRP A 1 12 ? -4.128  3.593   4.871   1.00 15.00 ?  483 TRP A CD2  4  
ATOM   2330  N NE1  . TRP A 1 12 ? -4.260  4.933   6.659   1.00 15.00 ?  483 TRP A NE1  4  
ATOM   2331  C CE2  . TRP A 1 12 ? -4.217  3.618   6.274   1.00 15.00 ?  483 TRP A CE2  4  
ATOM   2332  C CE3  . TRP A 1 12 ? -4.071  2.355   4.221   1.00 15.00 ?  483 TRP A CE3  4  
ATOM   2333  C CZ2  . TRP A 1 12 ? -4.258  2.456   7.038   1.00 15.00 ?  483 TRP A CZ2  4  
ATOM   2334  C CZ3  . TRP A 1 12 ? -4.108  1.201   4.982   1.00 15.00 ?  483 TRP A CZ3  4  
ATOM   2335  C CH2  . TRP A 1 12 ? -4.202  1.259   6.378   1.00 15.00 ?  483 TRP A CH2  4  
ATOM   2336  H H    . TRP A 1 12 ? -3.286  7.968   3.105   1.00 15.00 ?  483 TRP A H    4  
ATOM   2337  H HA   . TRP A 1 12 ? -1.905  5.393   3.003   1.00 15.00 ?  483 TRP A HA   4  
ATOM   2338  H HB2  . TRP A 1 12 ? -4.809  6.187   2.882   1.00 15.00 ?  483 TRP A HB2  4  
ATOM   2339  H HB3  . TRP A 1 12 ? -4.279  4.594   2.370   1.00 15.00 ?  483 TRP A HB3  4  
ATOM   2340  H HD1  . TRP A 1 12 ? -4.194  6.801   5.539   1.00 15.00 ?  483 TRP A HD1  4  
ATOM   2341  H HE1  . TRP A 1 12 ? -4.322  5.261   7.586   1.00 15.00 ?  483 TRP A HE1  4  
ATOM   2342  H HE3  . TRP A 1 12 ? -3.998  2.290   3.145   1.00 15.00 ?  483 TRP A HE3  4  
ATOM   2343  H HZ2  . TRP A 1 12 ? -4.335  2.483   8.112   1.00 15.00 ?  483 TRP A HZ2  4  
ATOM   2344  H HZ3  . TRP A 1 12 ? -4.067  0.237   4.497   1.00 15.00 ?  483 TRP A HZ3  4  
ATOM   2345  H HH2  . TRP A 1 12 ? -4.228  0.333   6.933   1.00 15.00 ?  483 TRP A HH2  4  
ATOM   2346  N N    . GLU A 1 13 ? -1.634  5.318   0.569   1.00 15.00 ?  484 GLU A N    4  
ATOM   2347  C CA   . GLU A 1 13 ? -1.399  5.300   -0.856  1.00 15.00 ?  484 GLU A CA   4  
ATOM   2348  C C    . GLU A 1 13 ? -1.701  3.913   -1.398  1.00 15.00 ?  484 GLU A C    4  
ATOM   2349  O O    . GLU A 1 13 ? -1.335  2.913   -0.800  1.00 15.00 ?  484 GLU A O    4  
ATOM   2350  C CB   . GLU A 1 13 ? 0.044   5.704   -1.135  1.00 15.00 ?  484 GLU A CB   4  
ATOM   2351  C CG   . GLU A 1 13 ? 0.191   6.797   -2.184  1.00 15.00 ?  484 GLU A CG   4  
ATOM   2352  C CD   . GLU A 1 13 ? -0.315  6.407   -3.563  1.00 15.00 ?  484 GLU A CD   4  
ATOM   2353  O OE1  . GLU A 1 13 ? -1.521  6.118   -3.709  1.00 15.00 ?  484 GLU A OE1  4  
ATOM   2354  O OE2  . GLU A 1 13 ? 0.491   6.412   -4.512  1.00 15.00 -1 484 GLU A OE2  4  
ATOM   2355  H H    . GLU A 1 13 ? -1.078  4.757   1.157   1.00 15.00 ?  484 GLU A H    4  
ATOM   2356  H HA   . GLU A 1 13 ? -2.066  6.013   -1.317  1.00 15.00 ?  484 GLU A HA   4  
ATOM   2357  H HB2  . GLU A 1 13 ? 0.483   6.066   -0.216  1.00 15.00 ?  484 GLU A HB2  4  
ATOM   2358  H HB3  . GLU A 1 13 ? 0.588   4.843   -1.458  1.00 15.00 ?  484 GLU A HB3  4  
ATOM   2359  H HG2  . GLU A 1 13 ? -0.359  7.659   -1.852  1.00 15.00 ?  484 GLU A HG2  4  
ATOM   2360  H HG3  . GLU A 1 13 ? 1.239   7.056   -2.265  1.00 15.00 ?  484 GLU A HG3  4  
ATOM   2361  N N    . MET A 1 14 ? -2.341  3.859   -2.538  1.00 15.00 ?  485 MET A N    4  
ATOM   2362  C CA   . MET A 1 14 ? -2.840  2.602   -3.077  1.00 15.00 ?  485 MET A CA   4  
ATOM   2363  C C    . MET A 1 14 ? -2.102  2.266   -4.362  1.00 15.00 ?  485 MET A C    4  
ATOM   2364  O O    . MET A 1 14 ? -2.308  2.906   -5.392  1.00 15.00 ?  485 MET A O    4  
ATOM   2365  C CB   . MET A 1 14 ? -4.348  2.706   -3.323  1.00 15.00 ?  485 MET A CB   4  
ATOM   2366  C CG   . MET A 1 14 ? -4.991  1.419   -3.802  1.00 15.00 ?  485 MET A CG   4  
ATOM   2367  S SD   . MET A 1 14 ? -6.776  1.579   -4.013  1.00 15.00 ?  485 MET A SD   4  
ATOM   2368  C CE   . MET A 1 14 ? -6.858  2.892   -5.232  1.00 15.00 ?  485 MET A CE   4  
ATOM   2369  H H    . MET A 1 14 ? -2.441  4.688   -3.063  1.00 15.00 ?  485 MET A H    4  
ATOM   2370  H HA   . MET A 1 14 ? -2.650  1.819   -2.344  1.00 15.00 ?  485 MET A HA   4  
ATOM   2371  H HB2  . MET A 1 14 ? -4.829  3.000   -2.402  1.00 15.00 ?  485 MET A HB2  4  
ATOM   2372  H HB3  . MET A 1 14 ? -4.526  3.468   -4.068  1.00 15.00 ?  485 MET A HB3  4  
ATOM   2373  H HG2  . MET A 1 14 ? -4.556  1.148   -4.747  1.00 15.00 ?  485 MET A HG2  4  
ATOM   2374  H HG3  . MET A 1 14 ? -4.796  0.643   -3.078  1.00 15.00 ?  485 MET A HG3  4  
ATOM   2375  H HE1  . MET A 1 14 ? -6.412  3.789   -4.826  1.00 15.00 ?  485 MET A HE1  4  
ATOM   2376  H HE2  . MET A 1 14 ? -7.891  3.085   -5.482  1.00 15.00 ?  485 MET A HE2  4  
ATOM   2377  H HE3  . MET A 1 14 ? -6.322  2.594   -6.121  1.00 15.00 ?  485 MET A HE3  4  
ATOM   2378  N N    . ARG A 1 15 ? -1.224  1.281   -4.292  1.00 15.00 ?  486 ARG A N    4  
ATOM   2379  C CA   . ARG A 1 15 ? -0.340  0.977   -5.406  1.00 15.00 ?  486 ARG A CA   4  
ATOM   2380  C C    . ARG A 1 15 ? -0.481  -0.466  -5.843  1.00 15.00 ?  486 ARG A C    4  
ATOM   2381  O O    . ARG A 1 15 ? -0.766  -1.348  -5.030  1.00 15.00 ?  486 ARG A O    4  
ATOM   2382  C CB   . ARG A 1 15 ? 1.108   1.256   -5.014  1.00 15.00 ?  486 ARG A CB   4  
ATOM   2383  C CG   . ARG A 1 15 ? 1.345   2.683   -4.565  1.00 15.00 ?  486 ARG A CG   4  
ATOM   2384  C CD   . ARG A 1 15 ? 0.966   3.669   -5.651  1.00 15.00 ?  486 ARG A CD   4  
ATOM   2385  N NE   . ARG A 1 15 ? 1.758   3.475   -6.859  1.00 15.00 ?  486 ARG A NE   4  
ATOM   2386  C CZ   . ARG A 1 15 ? 1.525   4.098   -8.004  1.00 15.00 ?  486 ARG A CZ   4  
ATOM   2387  N NH1  . ARG A 1 15 ? 0.525   4.969   -8.108  1.00 15.00 1  486 ARG A NH1  4  
ATOM   2388  N NH2  . ARG A 1 15 ? 2.303   3.852   -9.045  1.00 15.00 ?  486 ARG A NH2  4  
ATOM   2389  H H    . ARG A 1 15 ? -1.171  0.735   -3.474  1.00 15.00 ?  486 ARG A H    4  
ATOM   2390  H HA   . ARG A 1 15 ? -0.610  1.619   -6.230  1.00 15.00 ?  486 ARG A HA   4  
ATOM   2391  H HB2  . ARG A 1 15 ? 1.383   0.596   -4.206  1.00 15.00 ?  486 ARG A HB2  4  
ATOM   2392  H HB3  . ARG A 1 15 ? 1.744   1.058   -5.864  1.00 15.00 ?  486 ARG A HB3  4  
ATOM   2393  H HG2  . ARG A 1 15 ? 0.747   2.880   -3.688  1.00 15.00 ?  486 ARG A HG2  4  
ATOM   2394  H HG3  . ARG A 1 15 ? 2.391   2.807   -4.328  1.00 15.00 ?  486 ARG A HG3  4  
ATOM   2395  H HD2  . ARG A 1 15 ? -0.078  3.536   -5.892  1.00 15.00 ?  486 ARG A HD2  4  
ATOM   2396  H HD3  . ARG A 1 15 ? 1.126   4.672   -5.284  1.00 15.00 ?  486 ARG A HD3  4  
ATOM   2397  H HE   . ARG A 1 15 ? 2.516   2.844   -6.808  1.00 15.00 ?  486 ARG A HE   4  
ATOM   2398  H HH11 . ARG A 1 15 ? -0.068  5.160   -7.314  1.00 15.00 ?  486 ARG A HH11 4  
ATOM   2399  H HH12 . ARG A 1 15 ? 0.364   5.452   -8.971  1.00 15.00 ?  486 ARG A HH12 4  
ATOM   2400  H HH21 . ARG A 1 15 ? 3.062   3.196   -8.964  1.00 15.00 ?  486 ARG A HH21 4  
ATOM   2401  H HH22 . ARG A 1 15 ? 2.150   4.330   -9.908  1.00 15.00 ?  486 ARG A HH22 4  
ATOM   2402  N N    . ILE A 1 16 ? -0.252  -0.706  -7.124  1.00 15.00 ?  487 ILE A N    4  
ATOM   2403  C CA   . ILE A 1 16 ? -0.363  -2.045  -7.672  1.00 15.00 ?  487 ILE A CA   4  
ATOM   2404  C C    . ILE A 1 16 ? 0.968   -2.517  -8.240  1.00 15.00 ?  487 ILE A C    4  
ATOM   2405  O O    . ILE A 1 16 ? 1.630   -1.787  -8.980  1.00 15.00 ?  487 ILE A O    4  
ATOM   2406  C CB   . ILE A 1 16 ? -1.448  -2.124  -8.768  1.00 15.00 ?  487 ILE A CB   4  
ATOM   2407  C CG1  . ILE A 1 16 ? -2.821  -1.787  -8.178  1.00 15.00 ?  487 ILE A CG1  4  
ATOM   2408  C CG2  . ILE A 1 16 ? -1.469  -3.506  -9.413  1.00 15.00 ?  487 ILE A CG2  4  
ATOM   2409  C CD1  . ILE A 1 16 ? -3.957  -1.940  -9.164  1.00 15.00 ?  487 ILE A CD1  4  
ATOM   2410  H H    . ILE A 1 16 ? 0.008   0.035   -7.717  1.00 15.00 ?  487 ILE A H    4  
ATOM   2411  H HA   . ILE A 1 16 ? -0.649  -2.705  -6.866  1.00 15.00 ?  487 ILE A HA   4  
ATOM   2412  H HB   . ILE A 1 16 ? -1.207  -1.403  -9.531  1.00 15.00 ?  487 ILE A HB   4  
ATOM   2413  H HG12 . ILE A 1 16 ? -3.018  -2.443  -7.344  1.00 15.00 ?  487 ILE A HG12 4  
ATOM   2414  H HG13 . ILE A 1 16 ? -2.815  -0.763  -7.832  1.00 15.00 ?  487 ILE A HG13 4  
ATOM   2415  H HG21 . ILE A 1 16 ? -2.231  -3.534  -10.178 1.00 15.00 ?  487 ILE A HG21 4  
ATOM   2416  H HG22 . ILE A 1 16 ? -1.684  -4.251  -8.663  1.00 15.00 ?  487 ILE A HG22 4  
ATOM   2417  H HG23 . ILE A 1 16 ? -0.505  -3.710  -9.855  1.00 15.00 ?  487 ILE A HG23 4  
ATOM   2418  H HD11 . ILE A 1 16 ? -3.807  -1.266  -9.993  1.00 15.00 ?  487 ILE A HD11 4  
ATOM   2419  H HD12 . ILE A 1 16 ? -4.891  -1.711  -8.674  1.00 15.00 ?  487 ILE A HD12 4  
ATOM   2420  H HD13 . ILE A 1 16 ? -3.979  -2.958  -9.524  1.00 15.00 ?  487 ILE A HD13 4  
ATOM   2421  N N    . ALA A 1 17 ? 1.358   -3.740  -7.888  1.00 15.00 ?  488 ALA A N    4  
ATOM   2422  C CA   . ALA A 1 17 ? 2.529   -4.353  -8.477  1.00 15.00 ?  488 ALA A CA   4  
ATOM   2423  C C    . ALA A 1 17 ? 2.102   -5.123  -9.725  1.00 15.00 ?  488 ALA A C    4  
ATOM   2424  O O    . ALA A 1 17 ? 1.117   -5.862  -9.680  1.00 15.00 ?  488 ALA A O    4  
ATOM   2425  C CB   . ALA A 1 17 ? 3.243   -5.242  -7.476  1.00 15.00 ?  488 ALA A CB   4  
ATOM   2426  H H    . ALA A 1 17 ? 0.836   -4.240  -7.218  1.00 15.00 ?  488 ALA A H    4  
ATOM   2427  H HA   . ALA A 1 17 ? 3.200   -3.574  -8.754  1.00 15.00 ?  488 ALA A HA   4  
ATOM   2428  H HB1  . ALA A 1 17 ? 3.529   -4.657  -6.614  1.00 15.00 ?  488 ALA A HB1  4  
ATOM   2429  H HB2  . ALA A 1 17 ? 4.125   -5.663  -7.934  1.00 15.00 ?  488 ALA A HB2  4  
ATOM   2430  H HB3  . ALA A 1 17 ? 2.583   -6.038  -7.167  1.00 15.00 ?  488 ALA A HB3  4  
ATOM   2431  N N    . PRO A 1 18 ? 2.866   -4.976  -10.830 1.00 15.00 ?  489 PRO A N    4  
ATOM   2432  C CA   . PRO A 1 18 ? 2.495   -5.350  -12.201 1.00 15.00 ?  489 PRO A CA   4  
ATOM   2433  C C    . PRO A 1 18 ? 1.307   -6.316  -12.366 1.00 15.00 ?  489 PRO A C    4  
ATOM   2434  O O    . PRO A 1 18 ? 0.240   -5.899  -12.811 1.00 15.00 ?  489 PRO A O    4  
ATOM   2435  C CB   . PRO A 1 18 ? 3.797   -5.961  -12.700 1.00 15.00 ?  489 PRO A CB   4  
ATOM   2436  C CG   . PRO A 1 18 ? 4.873   -5.159  -12.024 1.00 15.00 ?  489 PRO A CG   4  
ATOM   2437  C CD   . PRO A 1 18 ? 4.238   -4.453  -10.838 1.00 15.00 ?  489 PRO A CD   4  
ATOM   2438  H HA   . PRO A 1 18 ? 2.290   -4.468  -12.786 1.00 15.00 ?  489 PRO A HA   4  
ATOM   2439  H HB2  . PRO A 1 18 ? 3.843   -7.002  -12.419 1.00 15.00 ?  489 PRO A HB2  4  
ATOM   2440  H HB3  . PRO A 1 18 ? 3.854   -5.866  -13.774 1.00 15.00 ?  489 PRO A HB3  4  
ATOM   2441  H HG2  . PRO A 1 18 ? 5.659   -5.819  -11.684 1.00 15.00 ?  489 PRO A HG2  4  
ATOM   2442  H HG3  . PRO A 1 18 ? 5.273   -4.435  -12.717 1.00 15.00 ?  489 PRO A HG3  4  
ATOM   2443  H HD2  . PRO A 1 18 ? 4.754   -4.708  -9.925  1.00 15.00 ?  489 PRO A HD2  4  
ATOM   2444  H HD3  . PRO A 1 18 ? 4.241   -3.383  -10.988 1.00 15.00 ?  489 PRO A HD3  4  
ATOM   2445  N N    . ASN A 1 19 ? 1.467   -7.585  -11.985 1.00 15.00 ?  490 ASN A N    4  
ATOM   2446  C CA   . ASN A 1 19 ? 0.452   -8.601  -12.300 1.00 15.00 ?  490 ASN A CA   4  
ATOM   2447  C C    . ASN A 1 19 ? -0.796  -8.512  -11.413 1.00 15.00 ?  490 ASN A C    4  
ATOM   2448  O O    . ASN A 1 19 ? -1.632  -9.416  -11.440 1.00 15.00 ?  490 ASN A O    4  
ATOM   2449  C CB   . ASN A 1 19 ? 1.044   -10.016 -12.225 1.00 15.00 ?  490 ASN A CB   4  
ATOM   2450  C CG   . ASN A 1 19 ? 1.348   -10.481 -10.812 1.00 15.00 ?  490 ASN A CG   4  
ATOM   2451  O OD1  . ASN A 1 19 ? 2.446   -10.273 -10.307 1.00 15.00 ?  490 ASN A OD1  4  
ATOM   2452  N ND2  . ASN A 1 19 ? 0.384   -11.122 -10.169 1.00 15.00 ?  490 ASN A ND2  4  
ATOM   2453  H H    . ASN A 1 19 ? 2.274   -7.848  -11.502 1.00 15.00 ?  490 ASN A H    4  
ATOM   2454  H HA   . ASN A 1 19 ? 0.143   -8.424  -13.320 1.00 15.00 ?  490 ASN A HA   4  
ATOM   2455  H HB2  . ASN A 1 19 ? 0.341   -10.710 -12.662 1.00 15.00 ?  490 ASN A HB2  4  
ATOM   2456  H HB3  . ASN A 1 19 ? 1.961   -10.042 -12.795 1.00 15.00 ?  490 ASN A HB3  4  
ATOM   2457  H HD21 . ASN A 1 19 ? -0.474  -11.257 -10.633 1.00 15.00 ?  490 ASN A HD21 4  
ATOM   2458  H HD22 . ASN A 1 19 ? 0.567   -11.446 -9.261  1.00 15.00 ?  490 ASN A HD22 4  
ATOM   2459  N N    . GLY A 1 20 ? -0.960  -7.428  -10.663 1.00 15.00 ?  491 GLY A N    4  
ATOM   2460  C CA   . GLY A 1 20 ? -2.187  -7.266  -9.905  1.00 15.00 ?  491 GLY A CA   4  
ATOM   2461  C C    . GLY A 1 20 ? -2.015  -7.319  -8.398  1.00 15.00 ?  491 GLY A C    4  
ATOM   2462  O O    . GLY A 1 20 ? -2.866  -7.868  -7.704  1.00 15.00 ?  491 GLY A O    4  
ATOM   2463  H H    . GLY A 1 20 ? -0.263  -6.736  -10.636 1.00 15.00 ?  491 GLY A H    4  
ATOM   2464  H HA2  . GLY A 1 20 ? -2.623  -6.313  -10.162 1.00 15.00 ?  491 GLY A HA2  4  
ATOM   2465  H HA3  . GLY A 1 20 ? -2.874  -8.045  -10.201 1.00 15.00 ?  491 GLY A HA3  4  
ATOM   2466  N N    . ARG A 1 21 ? -0.916  -6.782  -7.884  1.00 15.00 ?  492 ARG A N    4  
ATOM   2467  C CA   . ARG A 1 21 ? -0.735  -6.686  -6.434  1.00 15.00 ?  492 ARG A CA   4  
ATOM   2468  C C    . ARG A 1 21 ? -1.296  -5.370  -5.915  1.00 15.00 ?  492 ARG A C    4  
ATOM   2469  O O    . ARG A 1 21 ? -0.680  -4.335  -6.118  1.00 15.00 ?  492 ARG A O    4  
ATOM   2470  C CB   . ARG A 1 21 ? 0.737   -6.705  -6.033  1.00 15.00 ?  492 ARG A CB   4  
ATOM   2471  C CG   . ARG A 1 21 ? 1.476   -8.016  -6.192  1.00 15.00 ?  492 ARG A CG   4  
ATOM   2472  C CD   . ARG A 1 21 ? 1.943   -8.274  -7.610  1.00 15.00 ?  492 ARG A CD   4  
ATOM   2473  N NE   . ARG A 1 21 ? 3.357   -8.637  -7.594  1.00 15.00 ?  492 ARG A NE   4  
ATOM   2474  C CZ   . ARG A 1 21 ? 4.216   -8.438  -8.588  1.00 15.00 ?  492 ARG A CZ   4  
ATOM   2475  N NH1  . ARG A 1 21 ? 3.823   -7.878  -9.721  1.00 15.00 1  492 ARG A NH1  4  
ATOM   2476  N NH2  . ARG A 1 21 ? 5.485   -8.788  -8.433  1.00 15.00 ?  492 ARG A NH2  4  
ATOM   2477  H H    . ARG A 1 21 ? -0.225  -6.429  -8.485  1.00 15.00 ?  492 ARG A H    4  
ATOM   2478  H HA   . ARG A 1 21 ? -1.251  -7.509  -5.966  1.00 15.00 ?  492 ARG A HA   4  
ATOM   2479  H HB2  . ARG A 1 21 ? 1.254   -5.970  -6.626  1.00 15.00 ?  492 ARG A HB2  4  
ATOM   2480  H HB3  . ARG A 1 21 ? 0.803   -6.411  -4.994  1.00 15.00 ?  492 ARG A HB3  4  
ATOM   2481  H HG2  . ARG A 1 21 ? 2.354   -7.964  -5.569  1.00 15.00 ?  492 ARG A HG2  4  
ATOM   2482  H HG3  . ARG A 1 21 ? 0.842   -8.827  -5.868  1.00 15.00 ?  492 ARG A HG3  4  
ATOM   2483  H HD2  . ARG A 1 21 ? 1.366   -9.084  -8.035  1.00 15.00 ?  492 ARG A HD2  4  
ATOM   2484  H HD3  . ARG A 1 21 ? 1.811   -7.378  -8.199  1.00 15.00 ?  492 ARG A HD3  4  
ATOM   2485  H HE   . ARG A 1 21 ? 3.694   -9.046  -6.765  1.00 15.00 ?  492 ARG A HE   4  
ATOM   2486  H HH11 . ARG A 1 21 ? 2.873   -7.594  -9.834  1.00 15.00 ?  492 ARG A HH11 4  
ATOM   2487  H HH12 . ARG A 1 21 ? 4.479   -7.763  -10.481 1.00 15.00 ?  492 ARG A HH12 4  
ATOM   2488  H HH21 . ARG A 1 21 ? 5.786   -9.208  -7.568  1.00 15.00 ?  492 ARG A HH21 4  
ATOM   2489  H HH22 . ARG A 1 21 ? 6.157   -8.618  -9.166  1.00 15.00 ?  492 ARG A HH22 4  
ATOM   2490  N N    . PRO A 1 22 ? -2.452  -5.369  -5.252  1.00 15.00 ?  493 PRO A N    4  
ATOM   2491  C CA   . PRO A 1 22 ? -3.006  -4.164  -4.669  1.00 15.00 ?  493 PRO A CA   4  
ATOM   2492  C C    . PRO A 1 22 ? -2.572  -3.986  -3.217  1.00 15.00 ?  493 PRO A C    4  
ATOM   2493  O O    . PRO A 1 22 ? -3.053  -4.692  -2.329  1.00 15.00 ?  493 PRO A O    4  
ATOM   2494  C CB   . PRO A 1 22 ? -4.517  -4.397  -4.765  1.00 15.00 ?  493 PRO A CB   4  
ATOM   2495  C CG   . PRO A 1 22 ? -4.702  -5.884  -4.928  1.00 15.00 ?  493 PRO A CG   4  
ATOM   2496  C CD   . PRO A 1 22 ? -3.329  -6.514  -5.012  1.00 15.00 ?  493 PRO A CD   4  
ATOM   2497  H HA   . PRO A 1 22 ? -2.733  -3.287  -5.237  1.00 15.00 ?  493 PRO A HA   4  
ATOM   2498  H HB2  . PRO A 1 22 ? -4.992  -4.040  -3.864  1.00 15.00 ?  493 PRO A HB2  4  
ATOM   2499  H HB3  . PRO A 1 22 ? -4.911  -3.861  -5.616  1.00 15.00 ?  493 PRO A HB3  4  
ATOM   2500  H HG2  . PRO A 1 22 ? -5.234  -6.278  -4.076  1.00 15.00 ?  493 PRO A HG2  4  
ATOM   2501  H HG3  . PRO A 1 22 ? -5.256  -6.082  -5.835  1.00 15.00 ?  493 PRO A HG3  4  
ATOM   2502  H HD2  . PRO A 1 22 ? -3.079  -7.002  -4.082  1.00 15.00 ?  493 PRO A HD2  4  
ATOM   2503  H HD3  . PRO A 1 22 ? -3.282  -7.215  -5.832  1.00 15.00 ?  493 PRO A HD3  4  
ATOM   2504  N N    . PHE A 1 23 ? -1.631  -3.082  -2.975  1.00 15.00 ?  494 PHE A N    4  
ATOM   2505  C CA   . PHE A 1 23 ? -1.153  -2.859  -1.621  1.00 15.00 ?  494 PHE A CA   4  
ATOM   2506  C C    . PHE A 1 23 ? -1.360  -1.411  -1.190  1.00 15.00 ?  494 PHE A C    4  
ATOM   2507  O O    . PHE A 1 23 ? -1.167  -0.471  -1.968  1.00 15.00 ?  494 PHE A O    4  
ATOM   2508  C CB   . PHE A 1 23 ? 0.315   -3.303  -1.455  1.00 15.00 ?  494 PHE A CB   4  
ATOM   2509  C CG   . PHE A 1 23 ? 1.337   -2.640  -2.353  1.00 15.00 ?  494 PHE A CG   4  
ATOM   2510  C CD1  . PHE A 1 23 ? 1.730   -1.325  -2.142  1.00 15.00 ?  494 PHE A CD1  4  
ATOM   2511  C CD2  . PHE A 1 23 ? 1.939   -3.351  -3.380  1.00 15.00 ?  494 PHE A CD2  4  
ATOM   2512  C CE1  . PHE A 1 23 ? 2.699   -0.733  -2.933  1.00 15.00 ?  494 PHE A CE1  4  
ATOM   2513  C CE2  . PHE A 1 23 ? 2.902   -2.768  -4.175  1.00 15.00 ?  494 PHE A CE2  4  
ATOM   2514  C CZ   . PHE A 1 23 ? 3.286   -1.457  -3.953  1.00 15.00 ?  494 PHE A CZ   4  
ATOM   2515  H H    . PHE A 1 23 ? -1.262  -2.549  -3.716  1.00 15.00 ?  494 PHE A H    4  
ATOM   2516  H HA   . PHE A 1 23 ? -1.762  -3.478  -0.976  1.00 15.00 ?  494 PHE A HA   4  
ATOM   2517  H HB2  . PHE A 1 23 ? 0.617   -3.110  -0.437  1.00 15.00 ?  494 PHE A HB2  4  
ATOM   2518  H HB3  . PHE A 1 23 ? 0.369   -4.368  -1.632  1.00 15.00 ?  494 PHE A HB3  4  
ATOM   2519  H HD1  . PHE A 1 23 ? 1.269   -0.758  -1.347  1.00 15.00 ?  494 PHE A HD1  4  
ATOM   2520  H HD2  . PHE A 1 23 ? 1.645   -4.373  -3.564  1.00 15.00 ?  494 PHE A HD2  4  
ATOM   2521  H HE1  . PHE A 1 23 ? 2.993   0.306   -2.755  1.00 15.00 ?  494 PHE A HE1  4  
ATOM   2522  H HE2  . PHE A 1 23 ? 3.364   -3.341  -4.965  1.00 15.00 ?  494 PHE A HE2  4  
ATOM   2523  H HZ   . PHE A 1 23 ? 4.043   -1.003  -4.574  1.00 15.00 ?  494 PHE A HZ   4  
ATOM   2524  N N    . PHE A 1 24 ? -1.765  -1.252  0.060   1.00 15.00 ?  495 PHE A N    4  
ATOM   2525  C CA   . PHE A 1 24 ? -2.052  0.050   0.632   1.00 15.00 ?  495 PHE A CA   4  
ATOM   2526  C C    . PHE A 1 24 ? -0.959  0.433   1.627   1.00 15.00 ?  495 PHE A C    4  
ATOM   2527  O O    . PHE A 1 24 ? -0.763  -0.236  2.636   1.00 15.00 ?  495 PHE A O    4  
ATOM   2528  C CB   . PHE A 1 24 ? -3.411  0.020   1.341   1.00 15.00 ?  495 PHE A CB   4  
ATOM   2529  C CG   . PHE A 1 24 ? -4.472  -0.739  0.588   1.00 15.00 ?  495 PHE A CG   4  
ATOM   2530  C CD1  . PHE A 1 24 ? -5.136  -0.164  -0.482  1.00 15.00 ?  495 PHE A CD1  4  
ATOM   2531  C CD2  . PHE A 1 24 ? -4.801  -2.036  0.955   1.00 15.00 ?  495 PHE A CD2  4  
ATOM   2532  C CE1  . PHE A 1 24 ? -6.106  -0.864  -1.172  1.00 15.00 ?  495 PHE A CE1  4  
ATOM   2533  C CE2  . PHE A 1 24 ? -5.768  -2.742  0.267   1.00 15.00 ?  495 PHE A CE2  4  
ATOM   2534  C CZ   . PHE A 1 24 ? -6.423  -2.155  -0.797  1.00 15.00 ?  495 PHE A CZ   4  
ATOM   2535  H H    . PHE A 1 24 ? -1.877  -2.043  0.621   1.00 15.00 ?  495 PHE A H    4  
ATOM   2536  H HA   . PHE A 1 24 ? -2.079  0.774   -0.168  1.00 15.00 ?  495 PHE A HA   4  
ATOM   2537  H HB2  . PHE A 1 24 ? -3.293  -0.446  2.307   1.00 15.00 ?  495 PHE A HB2  4  
ATOM   2538  H HB3  . PHE A 1 24 ? -3.758  1.034   1.476   1.00 15.00 ?  495 PHE A HB3  4  
ATOM   2539  H HD1  . PHE A 1 24 ? -4.891  0.845   -0.777  1.00 15.00 ?  495 PHE A HD1  4  
ATOM   2540  H HD2  . PHE A 1 24 ? -4.289  -2.496  1.787   1.00 15.00 ?  495 PHE A HD2  4  
ATOM   2541  H HE1  . PHE A 1 24 ? -6.617  -0.402  -2.005  1.00 15.00 ?  495 PHE A HE1  4  
ATOM   2542  H HE2  . PHE A 1 24 ? -6.014  -3.752  0.562   1.00 15.00 ?  495 PHE A HE2  4  
ATOM   2543  H HZ   . PHE A 1 24 ? -7.180  -2.705  -1.338  1.00 15.00 ?  495 PHE A HZ   4  
ATOM   2544  N N    . ILE A 1 25 ? -0.245  1.498   1.330   1.00 15.00 ?  496 ILE A N    4  
ATOM   2545  C CA   . ILE A 1 25 ? 0.839   1.956   2.180   1.00 15.00 ?  496 ILE A CA   4  
ATOM   2546  C C    . ILE A 1 25 ? 0.378   3.122   3.028   1.00 15.00 ?  496 ILE A C    4  
ATOM   2547  O O    . ILE A 1 25 ? 0.046   4.177   2.489   1.00 15.00 ?  496 ILE A O    4  
ATOM   2548  C CB   . ILE A 1 25 ? 2.069   2.449   1.375   1.00 15.00 ?  496 ILE A CB   4  
ATOM   2549  C CG1  . ILE A 1 25 ? 2.403   1.518   0.209   1.00 15.00 ?  496 ILE A CG1  4  
ATOM   2550  C CG2  . ILE A 1 25 ? 3.275   2.593   2.291   1.00 15.00 ?  496 ILE A CG2  4  
ATOM   2551  C CD1  . ILE A 1 25 ? 1.610   1.813   -1.044  1.00 15.00 ?  496 ILE A CD1  4  
ATOM   2552  H H    . ILE A 1 25 ? -0.460  2.002   0.513   1.00 15.00 ?  496 ILE A H    4  
ATOM   2553  H HA   . ILE A 1 25 ? 1.145   1.144   2.821   1.00 15.00 ?  496 ILE A HA   4  
ATOM   2554  H HB   . ILE A 1 25 ? 1.833   3.431   0.981   1.00 15.00 ?  496 ILE A HB   4  
ATOM   2555  H HG12 . ILE A 1 25 ? 3.452   1.616   -0.032  1.00 15.00 ?  496 ILE A HG12 4  
ATOM   2556  H HG13 . ILE A 1 25 ? 2.199   0.501   0.500   1.00 15.00 ?  496 ILE A HG13 4  
ATOM   2557  H HG21 . ILE A 1 25 ? 3.054   3.309   3.070   1.00 15.00 ?  496 ILE A HG21 4  
ATOM   2558  H HG22 . ILE A 1 25 ? 4.123   2.933   1.719   1.00 15.00 ?  496 ILE A HG22 4  
ATOM   2559  H HG23 . ILE A 1 25 ? 3.501   1.636   2.737   1.00 15.00 ?  496 ILE A HG23 4  
ATOM   2560  H HD11 . ILE A 1 25 ? 0.554   1.720   -0.834  1.00 15.00 ?  496 ILE A HD11 4  
ATOM   2561  H HD12 . ILE A 1 25 ? 1.886   1.111   -1.817  1.00 15.00 ?  496 ILE A HD12 4  
ATOM   2562  H HD13 . ILE A 1 25 ? 1.824   2.817   -1.379  1.00 15.00 ?  496 ILE A HD13 4  
ATOM   2563  N N    . ASP A 1 26 ? 0.366   2.963   4.338   1.00 15.00 ?  497 ASP A N    4  
ATOM   2564  C CA   . ASP A 1 26 ? 0.167   4.120   5.179   1.00 15.00 ?  497 ASP A CA   4  
ATOM   2565  C C    . ASP A 1 26 ? 1.531   4.705   5.485   1.00 15.00 ?  497 ASP A C    4  
ATOM   2566  O O    . ASP A 1 26 ? 2.426   4.046   6.016   1.00 15.00 ?  497 ASP A O    4  
ATOM   2567  C CB   . ASP A 1 26 ? -0.627  3.826   6.458   1.00 15.00 ?  497 ASP A CB   4  
ATOM   2568  C CG   . ASP A 1 26 ? 0.198   3.263   7.596   1.00 15.00 ?  497 ASP A CG   4  
ATOM   2569  O OD1  . ASP A 1 26 ? 0.840   4.059   8.318   1.00 15.00 ?  497 ASP A OD1  4  
ATOM   2570  O OD2  . ASP A 1 26 ? 0.189   2.034   7.791   1.00 15.00 -1 497 ASP A OD2  4  
ATOM   2571  H H    . ASP A 1 26 ? 0.499   2.071   4.735   1.00 15.00 ?  497 ASP A H    4  
ATOM   2572  H HA   . ASP A 1 26 ? -0.379  4.846   4.592   1.00 15.00 ?  497 ASP A HA   4  
ATOM   2573  H HB2  . ASP A 1 26 ? -1.069  4.748   6.795   1.00 15.00 ?  497 ASP A HB2  4  
ATOM   2574  H HB3  . ASP A 1 26 ? -1.413  3.122   6.227   1.00 15.00 ?  497 ASP A HB3  4  
ATOM   2575  N N    . HIS A 1 27 ? 1.693   5.936   5.074   1.00 15.00 ?  498 HIS A N    4  
ATOM   2576  C CA   . HIS A 1 27 ? 2.991   6.585   5.089   1.00 15.00 ?  498 HIS A CA   4  
ATOM   2577  C C    . HIS A 1 27 ? 3.365   7.104   6.470   1.00 15.00 ?  498 HIS A C    4  
ATOM   2578  O O    . HIS A 1 27 ? 4.500   7.524   6.688   1.00 15.00 ?  498 HIS A O    4  
ATOM   2579  C CB   . HIS A 1 27 ? 3.044   7.692   4.035   1.00 15.00 ?  498 HIS A CB   4  
ATOM   2580  C CG   . HIS A 1 27 ? 3.068   7.166   2.632   1.00 15.00 ?  498 HIS A CG   4  
ATOM   2581  N ND1  . HIS A 1 27 ? 4.239   6.925   1.946   1.00 15.00 ?  498 HIS A ND1  4  
ATOM   2582  C CD2  . HIS A 1 27 ? 2.063   6.802   1.792   1.00 15.00 ?  498 HIS A CD2  4  
ATOM   2583  C CE1  . HIS A 1 27 ? 3.958   6.436   0.753   1.00 15.00 ?  498 HIS A CE1  4  
ATOM   2584  N NE2  . HIS A 1 27 ? 2.647   6.353   0.633   1.00 15.00 ?  498 HIS A NE2  4  
ATOM   2585  H H    . HIS A 1 27 ? 0.906   6.434   4.753   1.00 15.00 ?  498 HIS A H    4  
ATOM   2586  H HA   . HIS A 1 27 ? 3.716   5.831   4.816   1.00 15.00 ?  498 HIS A HA   4  
ATOM   2587  H HB2  . HIS A 1 27 ? 2.173   8.324   4.141   1.00 15.00 ?  498 HIS A HB2  4  
ATOM   2588  H HB3  . HIS A 1 27 ? 3.935   8.283   4.187   1.00 15.00 ?  498 HIS A HB3  4  
ATOM   2589  H HD1  . HIS A 1 27 ? 5.155   7.101   2.284   1.00 15.00 ?  498 HIS A HD1  4  
ATOM   2590  H HD2  . HIS A 1 27 ? 0.994   6.853   1.994   1.00 15.00 ?  498 HIS A HD2  4  
ATOM   2591  H HE1  . HIS A 1 27 ? 4.680   6.129   0.008   1.00 15.00 ?  498 HIS A HE1  4  
ATOM   2592  H HE2  . HIS A 1 27 ? 2.172   6.202   -0.212  1.00 15.00 ?  498 HIS A HE2  4  
ATOM   2593  N N    . ASN A 1 28 ? 2.417   7.087   7.402   1.00 15.00 ?  499 ASN A N    4  
ATOM   2594  C CA   . ASN A 1 28 ? 2.695   7.588   8.742   1.00 15.00 ?  499 ASN A CA   4  
ATOM   2595  C C    . ASN A 1 28 ? 3.456   6.551   9.571   1.00 15.00 ?  499 ASN A C    4  
ATOM   2596  O O    . ASN A 1 28 ? 4.471   6.880   10.185  1.00 15.00 ?  499 ASN A O    4  
ATOM   2597  C CB   . ASN A 1 28 ? 1.415   8.051   9.461   1.00 15.00 ?  499 ASN A CB   4  
ATOM   2598  C CG   . ASN A 1 28 ? 0.347   6.979   9.575   1.00 15.00 ?  499 ASN A CG   4  
ATOM   2599  O OD1  . ASN A 1 28 ? 0.323   6.207   10.531  1.00 15.00 ?  499 ASN A OD1  4  
ATOM   2600  N ND2  . ASN A 1 28 ? -0.565  6.944   8.614   1.00 15.00 ?  499 ASN A ND2  4  
ATOM   2601  H H    . ASN A 1 28 ? 1.536   6.713   7.193   1.00 15.00 ?  499 ASN A H    4  
ATOM   2602  H HA   . ASN A 1 28 ? 3.342   8.446   8.619   1.00 15.00 ?  499 ASN A HA   4  
ATOM   2603  H HB2  . ASN A 1 28 ? 1.674   8.369   10.460  1.00 15.00 ?  499 ASN A HB2  4  
ATOM   2604  H HB3  . ASN A 1 28 ? 0.997   8.890   8.926   1.00 15.00 ?  499 ASN A HB3  4  
ATOM   2605  H HD21 . ASN A 1 28 ? -0.508  7.601   7.896   1.00 15.00 ?  499 ASN A HD21 4  
ATOM   2606  H HD22 . ASN A 1 28 ? -1.272  6.255   8.669   1.00 15.00 ?  499 ASN A HD22 4  
ATOM   2607  N N    . THR A 1 29 ? 2.977   5.307   9.616   1.00 15.00 ?  500 THR A N    4  
ATOM   2608  C CA   . THR A 1 29 ? 3.742   4.240   10.252  1.00 15.00 ?  500 THR A CA   4  
ATOM   2609  C C    . THR A 1 29 ? 4.816   3.720   9.300   1.00 15.00 ?  500 THR A C    4  
ATOM   2610  O O    . THR A 1 29 ? 5.803   3.112   9.731   1.00 15.00 ?  500 THR A O    4  
ATOM   2611  C CB   . THR A 1 29 ? 2.859   3.065   10.728  1.00 15.00 ?  500 THR A CB   4  
ATOM   2612  O OG1  . THR A 1 29 ? 2.294   2.372   9.612   1.00 15.00 ?  500 THR A OG1  4  
ATOM   2613  C CG2  . THR A 1 29 ? 1.749   3.554   11.644  1.00 15.00 ?  500 THR A CG2  4  
ATOM   2614  H H    . THR A 1 29 ? 2.096   5.105   9.217   1.00 15.00 ?  500 THR A H    4  
ATOM   2615  H HA   . THR A 1 29 ? 4.230   4.664   11.118  1.00 15.00 ?  500 THR A HA   4  
ATOM   2616  H HB   . THR A 1 29 ? 3.482   2.378   11.285  1.00 15.00 ?  500 THR A HB   4  
ATOM   2617  H HG1  . THR A 1 29 ? 1.644   2.948   9.163   1.00 15.00 ?  500 THR A HG1  4  
ATOM   2618  H HG21 . THR A 1 29 ? 1.134   4.265   11.115  1.00 15.00 ?  500 THR A HG21 4  
ATOM   2619  H HG22 . THR A 1 29 ? 2.183   4.027   12.511  1.00 15.00 ?  500 THR A HG22 4  
ATOM   2620  H HG23 . THR A 1 29 ? 1.144   2.715   11.956  1.00 15.00 ?  500 THR A HG23 4  
ATOM   2621  N N    . LYS A 1 30 ? 4.591   3.964   8.002   1.00 15.00 ?  501 LYS A N    4  
ATOM   2622  C CA   . LYS A 1 30 ? 5.480   3.511   6.931   1.00 15.00 ?  501 LYS A CA   4  
ATOM   2623  C C    . LYS A 1 30 ? 5.390   1.991   6.775   1.00 15.00 ?  501 LYS A C    4  
ATOM   2624  O O    . LYS A 1 30 ? 6.398   1.285   6.747   1.00 15.00 ?  501 LYS A O    4  
ATOM   2625  C CB   . LYS A 1 30 ? 6.927   3.961   7.188   1.00 15.00 ?  501 LYS A CB   4  
ATOM   2626  C CG   . LYS A 1 30 ? 7.870   3.714   6.015   1.00 15.00 ?  501 LYS A CG   4  
ATOM   2627  C CD   . LYS A 1 30 ? 9.288   4.151   6.337   1.00 15.00 ?  501 LYS A CD   4  
ATOM   2628  C CE   . LYS A 1 30 ? 9.384   5.657   6.502   1.00 15.00 ?  501 LYS A CE   4  
ATOM   2629  N NZ   . LYS A 1 30 ? 10.735  6.080   6.949   1.00 15.00 1  501 LYS A NZ   4  
ATOM   2630  H H    . LYS A 1 30 ? 3.780   4.460   7.756   1.00 15.00 ?  501 LYS A H    4  
ATOM   2631  H HA   . LYS A 1 30 ? 5.134   3.965   6.014   1.00 15.00 ?  501 LYS A HA   4  
ATOM   2632  H HB2  . LYS A 1 30 ? 6.926   5.019   7.404   1.00 15.00 ?  501 LYS A HB2  4  
ATOM   2633  H HB3  . LYS A 1 30 ? 7.309   3.426   8.047   1.00 15.00 ?  501 LYS A HB3  4  
ATOM   2634  H HG2  . LYS A 1 30 ? 7.873   2.659   5.786   1.00 15.00 ?  501 LYS A HG2  4  
ATOM   2635  H HG3  . LYS A 1 30 ? 7.517   4.270   5.159   1.00 15.00 ?  501 LYS A HG3  4  
ATOM   2636  H HD2  . LYS A 1 30 ? 9.600   3.677   7.257   1.00 15.00 ?  501 LYS A HD2  4  
ATOM   2637  H HD3  . LYS A 1 30 ? 9.941   3.843   5.533   1.00 15.00 ?  501 LYS A HD3  4  
ATOM   2638  H HE2  . LYS A 1 30 ? 9.166   6.123   5.553   1.00 15.00 ?  501 LYS A HE2  4  
ATOM   2639  H HE3  . LYS A 1 30 ? 8.656   5.973   7.235   1.00 15.00 ?  501 LYS A HE3  4  
ATOM   2640  H HZ1  . LYS A 1 30 ? 11.464  5.719   6.296   1.00 15.00 ?  501 LYS A HZ1  4  
ATOM   2641  H HZ2  . LYS A 1 30 ? 10.929  5.715   7.906   1.00 15.00 ?  501 LYS A HZ2  4  
ATOM   2642  H HZ3  . LYS A 1 30 ? 10.795  7.121   6.974   1.00 15.00 ?  501 LYS A HZ3  4  
ATOM   2643  N N    . THR A 1 31 ? 4.167   1.492   6.676   1.00 15.00 ?  502 THR A N    4  
ATOM   2644  C CA   . THR A 1 31 ? 3.942   0.061   6.521   1.00 15.00 ?  502 THR A CA   4  
ATOM   2645  C C    . THR A 1 31 ? 2.997   -0.214  5.357   1.00 15.00 ?  502 THR A C    4  
ATOM   2646  O O    . THR A 1 31 ? 2.151   0.616   5.020   1.00 15.00 ?  502 THR A O    4  
ATOM   2647  C CB   . THR A 1 31 ? 3.380   -0.590  7.804   1.00 15.00 ?  502 THR A CB   4  
ATOM   2648  O OG1  . THR A 1 31 ? 2.144   0.024   8.185   1.00 15.00 ?  502 THR A OG1  4  
ATOM   2649  C CG2  . THR A 1 31 ? 4.373   -0.488  8.950   1.00 15.00 ?  502 THR A CG2  4  
ATOM   2650  H H    . THR A 1 31 ? 3.397   2.101   6.685   1.00 15.00 ?  502 THR A H    4  
ATOM   2651  H HA   . THR A 1 31 ? 4.895   -0.398  6.304   1.00 15.00 ?  502 THR A HA   4  
ATOM   2652  H HB   . THR A 1 31 ? 3.199   -1.637  7.603   1.00 15.00 ?  502 THR A HB   4  
ATOM   2653  H HG1  . THR A 1 31 ? 2.238   0.987   8.163   1.00 15.00 ?  502 THR A HG1  4  
ATOM   2654  H HG21 . THR A 1 31 ? 3.955   -0.949  9.832   1.00 15.00 ?  502 THR A HG21 4  
ATOM   2655  H HG22 . THR A 1 31 ? 4.582   0.552   9.151   1.00 15.00 ?  502 THR A HG22 4  
ATOM   2656  H HG23 . THR A 1 31 ? 5.290   -0.994  8.679   1.00 15.00 ?  502 THR A HG23 4  
ATOM   2657  N N    . THR A 1 32 ? 3.171   -1.363  4.729   1.00 15.00 ?  503 THR A N    4  
ATOM   2658  C CA   . THR A 1 32 ? 2.347   -1.748  3.599   1.00 15.00 ?  503 THR A CA   4  
ATOM   2659  C C    . THR A 1 32 ? 1.374   -2.858  3.997   1.00 15.00 ?  503 THR A C    4  
ATOM   2660  O O    . THR A 1 32 ? 1.792   -3.926  4.441   1.00 15.00 ?  503 THR A O    4  
ATOM   2661  C CB   . THR A 1 32 ? 3.235   -2.218  2.433   1.00 15.00 ?  503 THR A CB   4  
ATOM   2662  O OG1  . THR A 1 32 ? 4.281   -1.263  2.214   1.00 15.00 ?  503 THR A OG1  4  
ATOM   2663  C CG2  . THR A 1 32 ? 2.426   -2.390  1.160   1.00 15.00 ?  503 THR A CG2  4  
ATOM   2664  H H    . THR A 1 32 ? 3.867   -1.978  5.038   1.00 15.00 ?  503 THR A H    4  
ATOM   2665  H HA   . THR A 1 32 ? 1.786   -0.883  3.279   1.00 15.00 ?  503 THR A HA   4  
ATOM   2666  H HB   . THR A 1 32 ? 3.675   -3.169  2.695   1.00 15.00 ?  503 THR A HB   4  
ATOM   2667  H HG1  . THR A 1 32 ? 4.092   -0.466  2.718   1.00 15.00 ?  503 THR A HG1  4  
ATOM   2668  H HG21 . THR A 1 32 ? 1.867   -1.490  0.965   1.00 15.00 ?  503 THR A HG21 4  
ATOM   2669  H HG22 . THR A 1 32 ? 1.745   -3.221  1.276   1.00 15.00 ?  503 THR A HG22 4  
ATOM   2670  H HG23 . THR A 1 32 ? 3.096   -2.585  0.334   1.00 15.00 ?  503 THR A HG23 4  
ATOM   2671  N N    . THR A 1 33 ? 0.084   -2.597  3.857   1.00 15.00 ?  504 THR A N    4  
ATOM   2672  C CA   . THR A 1 33 ? -0.935  -3.564  4.228   1.00 15.00 ?  504 THR A CA   4  
ATOM   2673  C C    . THR A 1 33 ? -1.584  -4.184  2.995   1.00 15.00 ?  504 THR A C    4  
ATOM   2674  O O    . THR A 1 33 ? -1.671  -3.554  1.937   1.00 15.00 ?  504 THR A O    4  
ATOM   2675  C CB   . THR A 1 33 ? -2.033  -2.914  5.100   1.00 15.00 ?  504 THR A CB   4  
ATOM   2676  O OG1  . THR A 1 33 ? -2.676  -1.855  4.380   1.00 15.00 ?  504 THR A OG1  4  
ATOM   2677  C CG2  . THR A 1 33 ? -1.453  -2.357  6.388   1.00 15.00 ?  504 THR A CG2  4  
ATOM   2678  H H    . THR A 1 33 ? -0.199  -1.726  3.493   1.00 15.00 ?  504 THR A H    4  
ATOM   2679  H HA   . THR A 1 33 ? -0.460  -4.343  4.805   1.00 15.00 ?  504 THR A HA   4  
ATOM   2680  H HB   . THR A 1 33 ? -2.766  -3.668  5.349   1.00 15.00 ?  504 THR A HB   4  
ATOM   2681  H HG1  . THR A 1 33 ? -3.571  -2.124  4.143   1.00 15.00 ?  504 THR A HG1  4  
ATOM   2682  H HG21 . THR A 1 33 ? -2.242  -1.903  6.970   1.00 15.00 ?  504 THR A HG21 4  
ATOM   2683  H HG22 . THR A 1 33 ? -0.706  -1.612  6.154   1.00 15.00 ?  504 THR A HG22 4  
ATOM   2684  H HG23 . THR A 1 33 ? -0.999  -3.157  6.955   1.00 15.00 ?  504 THR A HG23 4  
ATOM   2685  N N    . TRP A 1 34 ? -2.026  -5.425  3.135   1.00 15.00 ?  505 TRP A N    4  
ATOM   2686  C CA   . TRP A 1 34 ? -2.798  -6.083  2.093   1.00 15.00 ?  505 TRP A CA   4  
ATOM   2687  C C    . TRP A 1 34 ? -4.283  -5.946  2.390   1.00 15.00 ?  505 TRP A C    4  
ATOM   2688  O O    . TRP A 1 34 ? -5.133  -6.283  1.563   1.00 15.00 ?  505 TRP A O    4  
ATOM   2689  C CB   . TRP A 1 34 ? -2.439  -7.567  1.982   1.00 15.00 ?  505 TRP A CB   4  
ATOM   2690  C CG   . TRP A 1 34 ? -1.072  -7.828  1.428   1.00 15.00 ?  505 TRP A CG   4  
ATOM   2691  C CD1  . TRP A 1 34 ? -0.007  -8.365  2.090   1.00 15.00 ?  505 TRP A CD1  4  
ATOM   2692  C CD2  . TRP A 1 34 ? -0.626  -7.568  0.092   1.00 15.00 ?  505 TRP A CD2  4  
ATOM   2693  N NE1  . TRP A 1 34 ? 1.071   -8.462  1.244   1.00 15.00 ?  505 TRP A NE1  4  
ATOM   2694  C CE2  . TRP A 1 34 ? 0.716   -7.977  0.013   1.00 15.00 ?  505 TRP A CE2  4  
ATOM   2695  C CE3  . TRP A 1 34 ? -1.235  -7.033  -1.048  1.00 15.00 ?  505 TRP A CE3  4  
ATOM   2696  C CZ2  . TRP A 1 34 ? 1.463   -7.865  -1.157  1.00 15.00 ?  505 TRP A CZ2  4  
ATOM   2697  C CZ3  . TRP A 1 34 ? -0.492  -6.923  -2.209  1.00 15.00 ?  505 TRP A CZ3  4  
ATOM   2698  C CH2  . TRP A 1 34 ? 0.843   -7.339  -2.256  1.00 15.00 ?  505 TRP A CH2  4  
ATOM   2699  H H    . TRP A 1 34 ? -1.832  -5.912  3.970   1.00 15.00 ?  505 TRP A H    4  
ATOM   2700  H HA   . TRP A 1 34 ? -2.581  -5.593  1.155   1.00 15.00 ?  505 TRP A HA   4  
ATOM   2701  H HB2  . TRP A 1 34 ? -2.487  -8.015  2.964   1.00 15.00 ?  505 TRP A HB2  4  
ATOM   2702  H HB3  . TRP A 1 34 ? -3.158  -8.052  1.338   1.00 15.00 ?  505 TRP A HB3  4  
ATOM   2703  H HD1  . TRP A 1 34 ? -0.024  -8.669  3.127   1.00 15.00 ?  505 TRP A HD1  4  
ATOM   2704  H HE1  . TRP A 1 34 ? 1.951   -8.820  1.483   1.00 15.00 ?  505 TRP A HE1  4  
ATOM   2705  H HE3  . TRP A 1 34 ? -2.263  -6.708  -1.030  1.00 15.00 ?  505 TRP A HE3  4  
ATOM   2706  H HZ2  . TRP A 1 34 ? 2.495   -8.183  -1.210  1.00 15.00 ?  505 TRP A HZ2  4  
ATOM   2707  H HZ3  . TRP A 1 34 ? -0.945  -6.512  -3.099  1.00 15.00 ?  505 TRP A HZ3  4  
ATOM   2708  H HH2  . TRP A 1 34 ? 1.385   -7.233  -3.185  1.00 15.00 ?  505 TRP A HH2  4  
ATOM   2709  N N    . GLU A 1 35 ? -4.587  -5.469  3.588   1.00 15.00 ?  506 GLU A N    4  
ATOM   2710  C CA   . GLU A 1 35 ? -5.964  -5.306  4.021   1.00 15.00 ?  506 GLU A CA   4  
ATOM   2711  C C    . GLU A 1 35 ? -6.427  -3.891  3.817   1.00 15.00 ?  506 GLU A C    4  
ATOM   2712  O O    . GLU A 1 35 ? -5.696  -2.928  4.071   1.00 15.00 ?  506 GLU A O    4  
ATOM   2713  C CB   . GLU A 1 35 ? -6.120  -5.719  5.491   1.00 15.00 ?  506 GLU A CB   4  
ATOM   2714  C CG   . GLU A 1 35 ? -7.543  -5.592  6.020   1.00 15.00 ?  506 GLU A CG   4  
ATOM   2715  C CD   . GLU A 1 35 ? -8.530  -6.481  5.287   1.00 15.00 ?  506 GLU A CD   4  
ATOM   2716  O OE1  . GLU A 1 35 ? -8.809  -6.220  4.097   1.00 15.00 -1 506 GLU A OE1  4  
ATOM   2717  O OE2  . GLU A 1 35 ? -9.028  -7.451  5.899   1.00 15.00 ?  506 GLU A OE2  4  
ATOM   2718  H H    . GLU A 1 35 ? -3.863  -5.215  4.197   1.00 15.00 ?  506 GLU A H    4  
ATOM   2719  H HA   . GLU A 1 35 ? -6.585  -5.928  3.407   1.00 15.00 ?  506 GLU A HA   4  
ATOM   2720  H HB2  . GLU A 1 35 ? -5.813  -6.749  5.595   1.00 15.00 ?  506 GLU A HB2  4  
ATOM   2721  H HB3  . GLU A 1 35 ? -5.476  -5.100  6.098   1.00 15.00 ?  506 GLU A HB3  4  
ATOM   2722  H HG2  . GLU A 1 35 ? -7.550  -5.861  7.064   1.00 15.00 ?  506 GLU A HG2  4  
ATOM   2723  H HG3  . GLU A 1 35 ? -7.861  -4.563  5.914   1.00 15.00 ?  506 GLU A HG3  4  
ATOM   2724  N N    . ASP A 1 36 ? -7.663  -3.786  3.377   1.00 15.00 ?  507 ASP A N    4  
ATOM   2725  C CA   . ASP A 1 36 ? -8.247  -2.515  3.061   1.00 15.00 ?  507 ASP A CA   4  
ATOM   2726  C C    . ASP A 1 36 ? -8.783  -1.873  4.338   1.00 15.00 ?  507 ASP A C    4  
ATOM   2727  O O    . ASP A 1 36 ? -9.468  -2.533  5.121   1.00 15.00 ?  507 ASP A O    4  
ATOM   2728  C CB   . ASP A 1 36 ? -9.370  -2.693  2.033   1.00 15.00 ?  507 ASP A CB   4  
ATOM   2729  C CG   . ASP A 1 36 ? -9.841  -1.384  1.423   1.00 15.00 ?  507 ASP A CG   4  
ATOM   2730  O OD1  . ASP A 1 36 ? -10.487 -0.583  2.131   1.00 15.00 -1 507 ASP A OD1  4  
ATOM   2731  O OD2  . ASP A 1 36 ? -9.583  -1.161  0.220   1.00 15.00 ?  507 ASP A OD2  4  
ATOM   2732  H H    . ASP A 1 36 ? -8.209  -4.601  3.290   1.00 15.00 ?  507 ASP A H    4  
ATOM   2733  H HA   . ASP A 1 36 ? -7.467  -1.913  2.646   1.00 15.00 ?  507 ASP A HA   4  
ATOM   2734  H HB2  . ASP A 1 36 ? -9.015  -3.328  1.236   1.00 15.00 ?  507 ASP A HB2  4  
ATOM   2735  H HB3  . ASP A 1 36 ? -10.213 -3.168  2.514   1.00 15.00 ?  507 ASP A HB3  4  
ATOM   2736  N N    . PRO A 1 37 ? -8.498  -0.586  4.569   1.00 15.00 ?  508 PRO A N    4  
ATOM   2737  C CA   . PRO A 1 37 ? -8.916  0.107   5.793   1.00 15.00 ?  508 PRO A CA   4  
ATOM   2738  C C    . PRO A 1 37 ? -10.416 0.430   5.832   1.00 15.00 ?  508 PRO A C    4  
ATOM   2739  O O    . PRO A 1 37 ? -10.841 1.314   6.578   1.00 15.00 ?  508 PRO A O    4  
ATOM   2740  C CB   . PRO A 1 37 ? -8.092  1.394   5.765   1.00 15.00 ?  508 PRO A CB   4  
ATOM   2741  C CG   . PRO A 1 37 ? -7.813  1.645   4.325   1.00 15.00 ?  508 PRO A CG   4  
ATOM   2742  C CD   . PRO A 1 37 ? -7.736  0.294   3.663   1.00 15.00 ?  508 PRO A CD   4  
ATOM   2743  H HA   . PRO A 1 37 ? -8.656  -0.465  6.673   1.00 15.00 ?  508 PRO A HA   4  
ATOM   2744  H HB2  . PRO A 1 37 ? -8.667  2.198   6.203   1.00 15.00 ?  508 PRO A HB2  4  
ATOM   2745  H HB3  . PRO A 1 37 ? -7.180  1.252   6.324   1.00 15.00 ?  508 PRO A HB3  4  
ATOM   2746  H HG2  . PRO A 1 37 ? -8.609  2.229   3.895   1.00 15.00 ?  508 PRO A HG2  4  
ATOM   2747  H HG3  . PRO A 1 37 ? -6.871  2.163   4.221   1.00 15.00 ?  508 PRO A HG3  4  
ATOM   2748  H HD2  . PRO A 1 37 ? -8.194  0.326   2.686   1.00 15.00 ?  508 PRO A HD2  4  
ATOM   2749  H HD3  . PRO A 1 37 ? -6.709  -0.031  3.588   1.00 15.00 ?  508 PRO A HD3  4  
ATOM   2750  N N    . ARG A 1 38 ? -11.213 -0.296  5.046   1.00 15.00 ?  509 ARG A N    4  
ATOM   2751  C CA   . ARG A 1 38 ? -12.663 -0.124  5.058   1.00 15.00 ?  509 ARG A CA   4  
ATOM   2752  C C    . ARG A 1 38 ? -13.250 -0.428  6.434   1.00 15.00 ?  509 ARG A C    4  
ATOM   2753  O O    . ARG A 1 38 ? -12.898 -1.468  7.023   1.00 15.00 ?  509 ARG A O    4  
ATOM   2754  C CB   . ARG A 1 38 ? -13.357 -0.957  3.957   1.00 15.00 ?  509 ARG A CB   4  
ATOM   2755  C CG   . ARG A 1 38 ? -12.685 -2.279  3.579   1.00 15.00 ?  509 ARG A CG   4  
ATOM   2756  C CD   . ARG A 1 38 ? -13.103 -3.451  4.462   1.00 15.00 ?  509 ARG A CD   4  
ATOM   2757  N NE   . ARG A 1 38 ? -12.303 -3.543  5.678   1.00 15.00 ?  509 ARG A NE   4  
ATOM   2758  C CZ   . ARG A 1 38 ? -11.691 -4.653  6.094   1.00 15.00 ?  509 ARG A CZ   4  
ATOM   2759  N NH1  . ARG A 1 38 ? -11.860 -5.801  5.445   1.00 15.00 1  509 ARG A NH1  4  
ATOM   2760  N NH2  . ARG A 1 38 ? -10.931 -4.615  7.182   1.00 15.00 ?  509 ARG A NH2  4  
ATOM   2761  H H    . ARG A 1 38 ? -10.812 -0.961  4.445   1.00 15.00 ?  509 ARG A H    4  
ATOM   2762  H HA   . ARG A 1 38 ? -12.847 0.921   4.852   1.00 15.00 ?  509 ARG A HA   4  
ATOM   2763  H HB2  . ARG A 1 38 ? -14.360 -1.184  4.285   1.00 15.00 ?  509 ARG A HB2  4  
ATOM   2764  H HB3  . ARG A 1 38 ? -13.420 -0.350  3.064   1.00 15.00 ?  509 ARG A HB3  4  
ATOM   2765  H HG2  . ARG A 1 38 ? -12.940 -2.514  2.557   1.00 15.00 ?  509 ARG A HG2  4  
ATOM   2766  H HG3  . ARG A 1 38 ? -11.615 -2.150  3.655   1.00 15.00 ?  509 ARG A HG3  4  
ATOM   2767  H HD2  . ARG A 1 38 ? -14.140 -3.325  4.735   1.00 15.00 ?  509 ARG A HD2  4  
ATOM   2768  H HD3  . ARG A 1 38 ? -12.990 -4.364  3.897   1.00 15.00 ?  509 ARG A HD3  4  
ATOM   2769  H HE   . ARG A 1 38 ? -12.206 -2.714  6.214   1.00 15.00 ?  509 ARG A HE   4  
ATOM   2770  H HH11 . ARG A 1 38 ? -12.461 -5.844  4.638   1.00 15.00 ?  509 ARG A HH11 4  
ATOM   2771  H HH12 . ARG A 1 38 ? -11.378 -6.627  5.747   1.00 15.00 ?  509 ARG A HH12 4  
ATOM   2772  H HH21 . ARG A 1 38 ? -10.814 -3.757  7.681   1.00 15.00 ?  509 ARG A HH21 4  
ATOM   2773  H HH22 . ARG A 1 38 ? -10.472 -5.448  7.509   1.00 15.00 ?  509 ARG A HH22 4  
ATOM   2774  N N    . ARG B 2 1  ? -1.075  -18.476 0.711   1.00 15.00 ?  925 ARG B N    4  
ATOM   2775  C CA   . ARG B 2 1  ? -0.153  -17.578 1.444   1.00 15.00 ?  925 ARG B CA   4  
ATOM   2776  C C    . ARG B 2 1  ? 0.186   -16.361 0.596   1.00 15.00 ?  925 ARG B C    4  
ATOM   2777  O O    . ARG B 2 1  ? 0.732   -16.492 -0.498  1.00 15.00 ?  925 ARG B O    4  
ATOM   2778  C CB   . ARG B 2 1  ? 1.137   -18.312 1.811   1.00 15.00 ?  925 ARG B CB   4  
ATOM   2779  C CG   . ARG B 2 1  ? 2.054   -17.509 2.723   1.00 15.00 ?  925 ARG B CG   4  
ATOM   2780  C CD   . ARG B 2 1  ? 3.425   -18.154 2.840   1.00 15.00 ?  925 ARG B CD   4  
ATOM   2781  N NE   . ARG B 2 1  ? 4.172   -18.084 1.583   1.00 15.00 ?  925 ARG B NE   4  
ATOM   2782  C CZ   . ARG B 2 1  ? 4.598   -19.149 0.906   1.00 15.00 ?  925 ARG B CZ   4  
ATOM   2783  N NH1  . ARG B 2 1  ? 4.309   -20.376 1.328   1.00 15.00 1  925 ARG B NH1  4  
ATOM   2784  N NH2  . ARG B 2 1  ? 5.305   -18.990 -0.205  1.00 15.00 ?  925 ARG B NH2  4  
ATOM   2785  H H1   . ARG B 2 1  ? -1.247  -19.344 1.261   1.00 15.00 ?  925 ARG B H1   4  
ATOM   2786  H H2   . ARG B 2 1  ? -0.668  -18.735 -0.217  1.00 15.00 ?  925 ARG B H2   4  
ATOM   2787  H H3   . ARG B 2 1  ? -1.985  -17.993 0.552   1.00 15.00 ?  925 ARG B H3   4  
ATOM   2788  H HA   . ARG B 2 1  ? -0.646  -17.249 2.347   1.00 15.00 ?  925 ARG B HA   4  
ATOM   2789  H HB2  . ARG B 2 1  ? 0.882   -19.234 2.315   1.00 15.00 ?  925 ARG B HB2  4  
ATOM   2790  H HB3  . ARG B 2 1  ? 1.677   -18.544 0.905   1.00 15.00 ?  925 ARG B HB3  4  
ATOM   2791  H HG2  . ARG B 2 1  ? 2.169   -16.515 2.318   1.00 15.00 ?  925 ARG B HG2  4  
ATOM   2792  H HG3  . ARG B 2 1  ? 1.609   -17.451 3.705   1.00 15.00 ?  925 ARG B HG3  4  
ATOM   2793  H HD2  . ARG B 2 1  ? 3.985   -17.644 3.610   1.00 15.00 ?  925 ARG B HD2  4  
ATOM   2794  H HD3  . ARG B 2 1  ? 3.298   -19.191 3.115   1.00 15.00 ?  925 ARG B HD3  4  
ATOM   2795  H HE   . ARG B 2 1  ? 4.383   -17.176 1.233   1.00 15.00 ?  925 ARG B HE   4  
ATOM   2796  H HH11 . ARG B 2 1  ? 3.766   -20.511 2.164   1.00 15.00 ?  925 ARG B HH11 4  
ATOM   2797  H HH12 . ARG B 2 1  ? 4.629   -21.174 0.810   1.00 15.00 ?  925 ARG B HH12 4  
ATOM   2798  H HH21 . ARG B 2 1  ? 5.526   -18.066 -0.539  1.00 15.00 ?  925 ARG B HH21 4  
ATOM   2799  H HH22 . ARG B 2 1  ? 5.623   -19.793 -0.719  1.00 15.00 ?  925 ARG B HH22 4  
ATOM   2800  N N    . LEU B 2 2  ? -0.142  -15.184 1.100   1.00 15.00 ?  926 LEU B N    4  
ATOM   2801  C CA   . LEU B 2 2  ? 0.213   -13.949 0.422   1.00 15.00 ?  926 LEU B CA   4  
ATOM   2802  C C    . LEU B 2 2  ? 1.384   -13.286 1.143   1.00 15.00 ?  926 LEU B C    4  
ATOM   2803  O O    . LEU B 2 2  ? 1.291   -12.959 2.326   1.00 15.00 ?  926 LEU B O    4  
ATOM   2804  C CB   . LEU B 2 2  ? -0.997  -13.010 0.365   1.00 15.00 ?  926 LEU B CB   4  
ATOM   2805  C CG   . LEU B 2 2  ? -0.785  -11.709 -0.413  1.00 15.00 ?  926 LEU B CG   4  
ATOM   2806  C CD1  . LEU B 2 2  ? -0.351  -11.999 -1.843  1.00 15.00 ?  926 LEU B CD1  4  
ATOM   2807  C CD2  . LEU B 2 2  ? -2.059  -10.882 -0.407  1.00 15.00 ?  926 LEU B CD2  4  
ATOM   2808  H H    . LEU B 2 2  ? -0.635  -15.143 1.951   1.00 15.00 ?  926 LEU B H    4  
ATOM   2809  H HA   . LEU B 2 2  ? 0.518   -14.197 -0.582  1.00 15.00 ?  926 LEU B HA   4  
ATOM   2810  H HB2  . LEU B 2 2  ? -1.818  -13.546 -0.091  1.00 15.00 ?  926 LEU B HB2  4  
ATOM   2811  H HB3  . LEU B 2 2  ? -1.276  -12.756 1.377   1.00 15.00 ?  926 LEU B HB3  4  
ATOM   2812  H HG   . LEU B 2 2  ? -0.006  -11.132 0.065   1.00 15.00 ?  926 LEU B HG   4  
ATOM   2813  H HD11 . LEU B 2 2  ? 0.574   -12.556 -1.834  1.00 15.00 ?  926 LEU B HD11 4  
ATOM   2814  H HD12 . LEU B 2 2  ? -0.204  -11.067 -2.370  1.00 15.00 ?  926 LEU B HD12 4  
ATOM   2815  H HD13 . LEU B 2 2  ? -1.115  -12.577 -2.341  1.00 15.00 ?  926 LEU B HD13 4  
ATOM   2816  H HD21 . LEU B 2 2  ? -1.895  -9.964  -0.951  1.00 15.00 ?  926 LEU B HD21 4  
ATOM   2817  H HD22 . LEU B 2 2  ? -2.335  -10.653 0.613   1.00 15.00 ?  926 LEU B HD22 4  
ATOM   2818  H HD23 . LEU B 2 2  ? -2.854  -11.442 -0.878  1.00 15.00 ?  926 LEU B HD23 4  
ATOM   2819  N N    . ASP B 2 3  ? 2.485   -13.105 0.429   1.00 15.00 ?  927 ASP B N    4  
ATOM   2820  C CA   . ASP B 2 3  ? 3.699   -12.559 1.022   1.00 15.00 ?  927 ASP B CA   4  
ATOM   2821  C C    . ASP B 2 3  ? 3.836   -11.072 0.733   1.00 15.00 ?  927 ASP B C    4  
ATOM   2822  O O    . ASP B 2 3  ? 3.740   -10.638 -0.415  1.00 15.00 ?  927 ASP B O    4  
ATOM   2823  C CB   . ASP B 2 3  ? 4.939   -13.302 0.509   1.00 15.00 ?  927 ASP B CB   4  
ATOM   2824  C CG   . ASP B 2 3  ? 5.101   -14.676 1.128   1.00 15.00 ?  927 ASP B CG   4  
ATOM   2825  O OD1  . ASP B 2 3  ? 5.589   -14.758 2.274   1.00 15.00 -1 927 ASP B OD1  4  
ATOM   2826  O OD2  . ASP B 2 3  ? 4.756   -15.680 0.467   1.00 15.00 ?  927 ASP B OD2  4  
ATOM   2827  H H    . ASP B 2 3  ? 2.482   -13.335 -0.523  1.00 15.00 ?  927 ASP B H    4  
ATOM   2828  H HA   . ASP B 2 3  ? 3.631   -12.697 2.092   1.00 15.00 ?  927 ASP B HA   4  
ATOM   2829  H HB2  . ASP B 2 3  ? 4.860   -13.419 -0.561  1.00 15.00 ?  927 ASP B HB2  4  
ATOM   2830  H HB3  . ASP B 2 3  ? 5.818   -12.717 0.738   1.00 15.00 ?  927 ASP B HB3  4  
ATOM   2831  N N    . LEU B 2 4  ? 4.063   -10.299 1.784   1.00 15.00 ?  928 LEU B N    4  
ATOM   2832  C CA   . LEU B 2 4  ? 4.297   -8.867  1.658   1.00 15.00 ?  928 LEU B CA   4  
ATOM   2833  C C    . LEU B 2 4  ? 5.736   -8.601  1.228   1.00 15.00 ?  928 LEU B C    4  
ATOM   2834  O O    . LEU B 2 4  ? 6.673   -9.050  1.890   1.00 15.00 ?  928 LEU B O    4  
ATOM   2835  C CB   . LEU B 2 4  ? 4.026   -8.178  2.998   1.00 15.00 ?  928 LEU B CB   4  
ATOM   2836  C CG   . LEU B 2 4  ? 4.265   -6.666  3.019   1.00 15.00 ?  928 LEU B CG   4  
ATOM   2837  C CD1  . LEU B 2 4  ? 3.253   -5.945  2.142   1.00 15.00 ?  928 LEU B CD1  4  
ATOM   2838  C CD2  . LEU B 2 4  ? 4.211   -6.140  4.446   1.00 15.00 ?  928 LEU B CD2  4  
ATOM   2839  H H    . LEU B 2 4  ? 4.078   -10.706 2.676   1.00 15.00 ?  928 LEU B H    4  
ATOM   2840  H HA   . LEU B 2 4  ? 3.624   -8.476  0.911   1.00 15.00 ?  928 LEU B HA   4  
ATOM   2841  H HB2  . LEU B 2 4  ? 2.998   -8.362  3.271   1.00 15.00 ?  928 LEU B HB2  4  
ATOM   2842  H HB3  . LEU B 2 4  ? 4.664   -8.628  3.743   1.00 15.00 ?  928 LEU B HB3  4  
ATOM   2843  H HG   . LEU B 2 4  ? 5.250   -6.459  2.624   1.00 15.00 ?  928 LEU B HG   4  
ATOM   2844  H HD11 . LEU B 2 4  ? 3.343   -6.296  1.125   1.00 15.00 ?  928 LEU B HD11 4  
ATOM   2845  H HD12 . LEU B 2 4  ? 3.440   -4.882  2.175   1.00 15.00 ?  928 LEU B HD12 4  
ATOM   2846  H HD13 . LEU B 2 4  ? 2.256   -6.147  2.504   1.00 15.00 ?  928 LEU B HD13 4  
ATOM   2847  H HD21 . LEU B 2 4  ? 4.974   -6.624  5.037   1.00 15.00 ?  928 LEU B HD21 4  
ATOM   2848  H HD22 . LEU B 2 4  ? 3.239   -6.348  4.870   1.00 15.00 ?  928 LEU B HD22 4  
ATOM   2849  H HD23 . LEU B 2 4  ? 4.384   -5.074  4.443   1.00 15.00 ?  928 LEU B HD23 4  
ATOM   2850  N N    . PRO B 2 5  ? 5.938   -7.876  0.117   1.00 15.00 ?  929 PRO B N    4  
ATOM   2851  C CA   . PRO B 2 5  ? 7.277   -7.528  -0.341  1.00 15.00 ?  929 PRO B CA   4  
ATOM   2852  C C    . PRO B 2 5  ? 7.880   -6.398  0.489   1.00 15.00 ?  929 PRO B C    4  
ATOM   2853  O O    . PRO B 2 5  ? 7.185   -5.437  0.832   1.00 15.00 ?  929 PRO B O    4  
ATOM   2854  C CB   . PRO B 2 5  ? 7.051   -7.073  -1.783  1.00 15.00 ?  929 PRO B CB   4  
ATOM   2855  C CG   . PRO B 2 5  ? 5.654   -6.560  -1.814  1.00 15.00 ?  929 PRO B CG   4  
ATOM   2856  C CD   . PRO B 2 5  ? 4.887   -7.338  -0.777  1.00 15.00 ?  929 PRO B CD   4  
ATOM   2857  H HA   . PRO B 2 5  ? 7.938   -8.382  -0.326  1.00 15.00 ?  929 PRO B HA   4  
ATOM   2858  H HB2  . PRO B 2 5  ? 7.762   -6.299  -2.031  1.00 15.00 ?  929 PRO B HB2  4  
ATOM   2859  H HB3  . PRO B 2 5  ? 7.177   -7.912  -2.452  1.00 15.00 ?  929 PRO B HB3  4  
ATOM   2860  H HG2  . PRO B 2 5  ? 5.646   -5.507  -1.572  1.00 15.00 ?  929 PRO B HG2  4  
ATOM   2861  H HG3  . PRO B 2 5  ? 5.227   -6.721  -2.792  1.00 15.00 ?  929 PRO B HG3  4  
ATOM   2862  H HD2  . PRO B 2 5  ? 4.219   -6.678  -0.241  1.00 15.00 ?  929 PRO B HD2  4  
ATOM   2863  H HD3  . PRO B 2 5  ? 4.329   -8.136  -1.246  1.00 15.00 ?  929 PRO B HD3  4  
ATOM   2864  N N    . PRO B 2 6  ? 9.177   -6.506  0.829   1.00 15.00 ?  930 PRO B N    4  
ATOM   2865  C CA   . PRO B 2 6  ? 9.903   -5.460  1.555   1.00 15.00 ?  930 PRO B CA   4  
ATOM   2866  C C    . PRO B 2 6  ? 9.692   -4.095  0.911   1.00 15.00 ?  930 PRO B C    4  
ATOM   2867  O O    . PRO B 2 6  ? 9.833   -3.944  -0.302  1.00 15.00 ?  930 PRO B O    4  
ATOM   2868  C CB   . PRO B 2 6  ? 11.377  -5.889  1.452   1.00 15.00 ?  930 PRO B CB   4  
ATOM   2869  C CG   . PRO B 2 6  ? 11.402  -7.029  0.484   1.00 15.00 ?  930 PRO B CG   4  
ATOM   2870  C CD   . PRO B 2 6  ? 10.038  -7.652  0.532   1.00 15.00 ?  930 PRO B CD   4  
ATOM   2871  H HA   . PRO B 2 6  ? 9.605   -5.418  2.592   1.00 15.00 ?  930 PRO B HA   4  
ATOM   2872  H HB2  . PRO B 2 6  ? 11.969  -5.059  1.094   1.00 15.00 ?  930 PRO B HB2  4  
ATOM   2873  H HB3  . PRO B 2 6  ? 11.731  -6.193  2.424   1.00 15.00 ?  930 PRO B HB3  4  
ATOM   2874  H HG2  . PRO B 2 6  ? 11.609  -6.661  -0.510  1.00 15.00 ?  930 PRO B HG2  4  
ATOM   2875  H HG3  . PRO B 2 6  ? 12.152  -7.746  0.782   1.00 15.00 ?  930 PRO B HG3  4  
ATOM   2876  H HD2  . PRO B 2 6  ? 9.785   -8.092  -0.422  1.00 15.00 ?  930 PRO B HD2  4  
ATOM   2877  H HD3  . PRO B 2 6  ? 9.985   -8.389  1.320   1.00 15.00 ?  930 PRO B HD3  4  
ATOM   2878  N N    . TYR B 2 7  ? 9.341   -3.108  1.719   1.00 15.00 ?  931 TYR B N    4  
ATOM   2879  C CA   . TYR B 2 7  ? 8.958   -1.813  1.189   1.00 15.00 ?  931 TYR B CA   4  
ATOM   2880  C C    . TYR B 2 7  ? 10.180  -0.952  0.884   1.00 15.00 ?  931 TYR B C    4  
ATOM   2881  O O    . TYR B 2 7  ? 10.980  -0.636  1.768   1.00 15.00 ?  931 TYR B O    4  
ATOM   2882  C CB   . TYR B 2 7  ? 8.031   -1.108  2.196   1.00 15.00 ?  931 TYR B CB   4  
ATOM   2883  C CG   . TYR B 2 7  ? 7.618   0.308   1.827   1.00 15.00 ?  931 TYR B CG   4  
ATOM   2884  C CD1  . TYR B 2 7  ? 7.016   0.599   0.605   1.00 15.00 ?  931 TYR B CD1  4  
ATOM   2885  C CD2  . TYR B 2 7  ? 7.820   1.358   2.719   1.00 15.00 ?  931 TYR B CD2  4  
ATOM   2886  C CE1  . TYR B 2 7  ? 6.635   1.889   0.286   1.00 15.00 ?  931 TYR B CE1  4  
ATOM   2887  C CE2  . TYR B 2 7  ? 7.439   2.647   2.406   1.00 15.00 ?  931 TYR B CE2  4  
ATOM   2888  C CZ   . TYR B 2 7  ? 6.849   2.908   1.189   1.00 15.00 ?  931 TYR B CZ   4  
ATOM   2889  O OH   . TYR B 2 7  ? 6.471   4.195   0.877   1.00 15.00 ?  931 TYR B OH   4  
ATOM   2890  H H    . TYR B 2 7  ? 9.347   -3.251  2.686   1.00 15.00 ?  931 TYR B H    4  
ATOM   2891  H HA   . TYR B 2 7  ? 8.412   -1.980  0.273   1.00 15.00 ?  931 TYR B HA   4  
ATOM   2892  H HB2  . TYR B 2 7  ? 7.128   -1.691  2.301   1.00 15.00 ?  931 TYR B HB2  4  
ATOM   2893  H HB3  . TYR B 2 7  ? 8.530   -1.066  3.153   1.00 15.00 ?  931 TYR B HB3  4  
ATOM   2894  H HD1  . TYR B 2 7  ? 6.847   -0.197  -0.101  1.00 15.00 ?  931 TYR B HD1  4  
ATOM   2895  H HD2  . TYR B 2 7  ? 8.284   1.155   3.670   1.00 15.00 ?  931 TYR B HD2  4  
ATOM   2896  H HE1  . TYR B 2 7  ? 6.171   2.096   -0.668  1.00 15.00 ?  931 TYR B HE1  4  
ATOM   2897  H HE2  . TYR B 2 7  ? 7.600   3.444   3.117   1.00 15.00 ?  931 TYR B HE2  4  
ATOM   2898  H HH   . TYR B 2 7  ? 7.187   4.798   1.097   1.00 15.00 ?  931 TYR B HH   4  
ATOM   2899  N N    . GLU B 2 8  ? 10.299  -0.587  -0.383  1.00 15.00 ?  932 GLU B N    4  
ATOM   2900  C CA   . GLU B 2 8  ? 11.199  0.463   -0.820  1.00 15.00 ?  932 GLU B CA   4  
ATOM   2901  C C    . GLU B 2 8  ? 10.332  1.636   -1.216  1.00 15.00 ?  932 GLU B C    4  
ATOM   2902  O O    . GLU B 2 8  ? 9.248   1.430   -1.763  1.00 15.00 ?  932 GLU B O    4  
ATOM   2903  C CB   . GLU B 2 8  ? 12.048  0.029   -2.024  1.00 15.00 ?  932 GLU B CB   4  
ATOM   2904  C CG   . GLU B 2 8  ? 13.052  -1.077  -1.737  1.00 15.00 ?  932 GLU B CG   4  
ATOM   2905  C CD   . GLU B 2 8  ? 12.480  -2.465  -1.927  1.00 15.00 ?  932 GLU B CD   4  
ATOM   2906  O OE1  . GLU B 2 8  ? 11.947  -2.749  -3.022  1.00 15.00 -1 932 GLU B OE1  4  
ATOM   2907  O OE2  . GLU B 2 8  ? 12.581  -3.286  -0.992  1.00 15.00 ?  932 GLU B OE2  4  
ATOM   2908  H H    . GLU B 2 8  ? 9.755   -1.047  -1.056  1.00 15.00 ?  932 GLU B H    4  
ATOM   2909  H HA   . GLU B 2 8  ? 11.837  0.742   0.005   1.00 15.00 ?  932 GLU B HA   4  
ATOM   2910  H HB2  . GLU B 2 8  ? 11.386  -0.317  -2.803  1.00 15.00 ?  932 GLU B HB2  4  
ATOM   2911  H HB3  . GLU B 2 8  ? 12.591  0.888   -2.388  1.00 15.00 ?  932 GLU B HB3  4  
ATOM   2912  H HG2  . GLU B 2 8  ? 13.892  -0.961  -2.404  1.00 15.00 ?  932 GLU B HG2  4  
ATOM   2913  H HG3  . GLU B 2 8  ? 13.390  -0.979  -0.715  1.00 15.00 ?  932 GLU B HG3  4  
ATOM   2914  N N    . THR B 2 9  ? 10.775  2.853   -0.971  1.00 15.00 ?  933 THR B N    4  
ATOM   2915  C CA   . THR B 2 9  ? 9.917   3.982   -1.240  1.00 15.00 ?  933 THR B CA   4  
ATOM   2916  C C    . THR B 2 9  ? 9.696   4.150   -2.737  1.00 15.00 ?  933 THR B C    4  
ATOM   2917  O O    . THR B 2 9  ? 10.631  4.334   -3.521  1.00 15.00 ?  933 THR B O    4  
ATOM   2918  C CB   . THR B 2 9  ? 10.455  5.292   -0.641  1.00 15.00 ?  933 THR B CB   4  
ATOM   2919  O OG1  . THR B 2 9  ? 10.869  5.072   0.715   1.00 15.00 ?  933 THR B OG1  4  
ATOM   2920  C CG2  . THR B 2 9  ? 9.371   6.367   -0.673  1.00 15.00 ?  933 THR B CG2  4  
ATOM   2921  H H    . THR B 2 9  ? 11.686  2.993   -0.624  1.00 15.00 ?  933 THR B H    4  
ATOM   2922  H HA   . THR B 2 9  ? 8.962   3.776   -0.779  1.00 15.00 ?  933 THR B HA   4  
ATOM   2923  H HB   . THR B 2 9  ? 11.298  5.627   -1.226  1.00 15.00 ?  933 THR B HB   4  
ATOM   2924  H HG1  . THR B 2 9  ? 11.828  5.009   0.749   1.00 15.00 ?  933 THR B HG1  4  
ATOM   2925  H HG21 . THR B 2 9  ? 9.742   7.268   -0.211  1.00 15.00 ?  933 THR B HG21 4  
ATOM   2926  H HG22 . THR B 2 9  ? 8.497   6.017   -0.137  1.00 15.00 ?  933 THR B HG22 4  
ATOM   2927  H HG23 . THR B 2 9  ? 9.097   6.573   -1.698  1.00 15.00 ?  933 THR B HG23 4  
ATOM   2928  N N    . PHE B 2 10 ? 8.437   4.059   -3.098  1.00 15.00 ?  934 PHE B N    4  
ATOM   2929  C CA   . PHE B 2 10 ? 7.952   4.317   -4.435  1.00 15.00 ?  934 PHE B CA   4  
ATOM   2930  C C    . PHE B 2 10 ? 7.634   5.812   -4.533  1.00 15.00 ?  934 PHE B C    4  
ATOM   2931  O O    . PHE B 2 10 ? 7.891   6.548   -3.578  1.00 15.00 ?  934 PHE B O    4  
ATOM   2932  C CB   . PHE B 2 10 ? 6.733   3.441   -4.744  1.00 15.00 ?  934 PHE B CB   4  
ATOM   2933  C CG   . PHE B 2 10 ? 5.509   3.878   -4.021  1.00 15.00 ?  934 PHE B CG   4  
ATOM   2934  C CD1  . PHE B 2 10 ? 5.244   3.452   -2.731  1.00 15.00 ?  934 PHE B CD1  4  
ATOM   2935  C CD2  . PHE B 2 10 ? 4.642   4.756   -4.628  1.00 15.00 ?  934 PHE B CD2  4  
ATOM   2936  C CE1  . PHE B 2 10 ? 4.128   3.904   -2.072  1.00 15.00 ?  934 PHE B CE1  4  
ATOM   2937  C CE2  . PHE B 2 10 ? 3.537   5.217   -3.974  1.00 15.00 ?  934 PHE B CE2  4  
ATOM   2938  C CZ   . PHE B 2 10 ? 3.280   4.792   -2.698  1.00 15.00 ?  934 PHE B CZ   4  
ATOM   2939  H H    . PHE B 2 10 ? 7.784   3.799   -2.415  1.00 15.00 ?  934 PHE B H    4  
ATOM   2940  H HA   . PHE B 2 10 ? 8.748   4.085   -5.128  1.00 15.00 ?  934 PHE B HA   4  
ATOM   2941  H HB2  . PHE B 2 10 ? 6.529   3.479   -5.804  1.00 15.00 ?  934 PHE B HB2  4  
ATOM   2942  H HB3  . PHE B 2 10 ? 6.947   2.421   -4.458  1.00 15.00 ?  934 PHE B HB3  4  
ATOM   2943  H HD1  . PHE B 2 10 ? 5.908   2.750   -2.249  1.00 15.00 ?  934 PHE B HD1  4  
ATOM   2944  H HD2  . PHE B 2 10 ? 4.847   5.081   -5.633  1.00 15.00 ?  934 PHE B HD2  4  
ATOM   2945  H HE1  . PHE B 2 10 ? 3.919   3.572   -1.064  1.00 15.00 ?  934 PHE B HE1  4  
ATOM   2946  H HE2  . PHE B 2 10 ? 2.864   5.907   -4.462  1.00 15.00 ?  934 PHE B HE2  4  
ATOM   2947  H HZ   . PHE B 2 10 ? 2.425   5.152   -2.193  1.00 15.00 ?  934 PHE B HZ   4  
ATOM   2948  N N    . GLU B 2 11 ? 7.141   6.267   -5.681  1.00 15.00 ?  935 GLU B N    4  
ATOM   2949  C CA   . GLU B 2 11 ? 6.986   7.699   -5.953  1.00 15.00 ?  935 GLU B CA   4  
ATOM   2950  C C    . GLU B 2 11 ? 6.300   8.451   -4.808  1.00 15.00 ?  935 GLU B C    4  
ATOM   2951  O O    . GLU B 2 11 ? 5.343   7.968   -4.197  1.00 15.00 ?  935 GLU B O    4  
ATOM   2952  C CB   . GLU B 2 11 ? 6.148   7.903   -7.219  1.00 15.00 ?  935 GLU B CB   4  
ATOM   2953  C CG   . GLU B 2 11 ? 4.794   7.192   -7.198  1.00 15.00 ?  935 GLU B CG   4  
ATOM   2954  C CD   . GLU B 2 11 ? 4.816   5.917   -8.010  1.00 15.00 ?  935 GLU B CD   4  
ATOM   2955  O OE1  . GLU B 2 11 ? 5.380   4.907   -7.539  1.00 15.00 ?  935 GLU B OE1  4  
ATOM   2956  O OE2  . GLU B 2 11 ? 4.277   5.922   -9.138  1.00 15.00 -1 935 GLU B OE2  4  
ATOM   2957  H H    . GLU B 2 11 ? 6.845   5.621   -6.363  1.00 15.00 ?  935 GLU B H    4  
ATOM   2958  H HA   . GLU B 2 11 ? 7.966   8.119   -6.112  1.00 15.00 ?  935 GLU B HA   4  
ATOM   2959  H HB2  . GLU B 2 11 ? 5.970   8.960   -7.348  1.00 15.00 ?  935 GLU B HB2  4  
ATOM   2960  H HB3  . GLU B 2 11 ? 6.707   7.537   -8.065  1.00 15.00 ?  935 GLU B HB3  4  
ATOM   2961  H HG2  . GLU B 2 11 ? 4.519   6.950   -6.167  1.00 15.00 ?  935 GLU B HG2  4  
ATOM   2962  H HG3  . GLU B 2 11 ? 4.051   7.855   -7.618  1.00 15.00 ?  935 GLU B HG3  4  
ATOM   2963  N N    . ASP B 2 12 ? 6.821   9.647   -4.540  1.00 15.00 ?  936 ASP B N    4  
ATOM   2964  C CA   . ASP B 2 12 ? 6.294   10.537  -3.509  1.00 15.00 ?  936 ASP B CA   4  
ATOM   2965  C C    . ASP B 2 12 ? 4.797   10.763  -3.682  1.00 15.00 ?  936 ASP B C    4  
ATOM   2966  O O    . ASP B 2 12 ? 4.330   11.078  -4.779  1.00 15.00 ?  936 ASP B O    4  
ATOM   2967  C CB   . ASP B 2 12 ? 7.034   11.877  -3.560  1.00 15.00 ?  936 ASP B CB   4  
ATOM   2968  C CG   . ASP B 2 12 ? 6.337   12.971  -2.773  1.00 15.00 ?  936 ASP B CG   4  
ATOM   2969  O OD1  . ASP B 2 12 ? 6.296   12.890  -1.527  1.00 15.00 ?  936 ASP B OD1  4  
ATOM   2970  O OD2  . ASP B 2 12 ? 5.841   13.934  -3.401  1.00 15.00 -1 936 ASP B OD2  4  
ATOM   2971  H H    . ASP B 2 12 ? 7.593   9.946   -5.064  1.00 15.00 ?  936 ASP B H    4  
ATOM   2972  H HA   . ASP B 2 12 ? 6.470   10.076  -2.549  1.00 15.00 ?  936 ASP B HA   4  
ATOM   2973  H HB2  . ASP B 2 12 ? 8.026   11.746  -3.154  1.00 15.00 ?  936 ASP B HB2  4  
ATOM   2974  H HB3  . ASP B 2 12 ? 7.112   12.195  -4.590  1.00 15.00 ?  936 ASP B HB3  4  
ATOM   2975  N N    . LEU B 2 13 ? 4.067   10.621  -2.581  1.00 15.00 ?  937 LEU B N    4  
ATOM   2976  C CA   . LEU B 2 13 ? 2.616   10.755  -2.576  1.00 15.00 ?  937 LEU B CA   4  
ATOM   2977  C C    . LEU B 2 13 ? 2.211   12.150  -3.052  1.00 15.00 ?  937 LEU B C    4  
ATOM   2978  O O    . LEU B 2 13 ? 1.781   12.332  -4.191  1.00 15.00 ?  937 LEU B O    4  
ATOM   2979  C CB   . LEU B 2 13 ? 2.088   10.492  -1.158  1.00 15.00 ?  937 LEU B CB   4  
ATOM   2980  C CG   . LEU B 2 13 ? 0.681   9.890   -1.053  1.00 15.00 ?  937 LEU B CG   4  
ATOM   2981  C CD1  . LEU B 2 13 ? 0.331   9.629   0.403   1.00 15.00 ?  937 LEU B CD1  4  
ATOM   2982  C CD2  . LEU B 2 13 ? -0.361  10.796  -1.687  1.00 15.00 ?  937 LEU B CD2  4  
ATOM   2983  H H    . LEU B 2 13 ? 4.524   10.430  -1.735  1.00 15.00 ?  937 LEU B H    4  
ATOM   2984  H HA   . LEU B 2 13 ? 2.207   10.018  -3.251  1.00 15.00 ?  937 LEU B HA   4  
ATOM   2985  H HB2  . LEU B 2 13 ? 2.775   9.820   -0.667  1.00 15.00 ?  937 LEU B HB2  4  
ATOM   2986  H HB3  . LEU B 2 13 ? 2.091   11.431  -0.622  1.00 15.00 ?  937 LEU B HB3  4  
ATOM   2987  H HG   . LEU B 2 13 ? 0.665   8.943   -1.574  1.00 15.00 ?  937 LEU B HG   4  
ATOM   2988  H HD11 . LEU B 2 13 ? 0.359   10.559  0.951   1.00 15.00 ?  937 LEU B HD11 4  
ATOM   2989  H HD12 . LEU B 2 13 ? 1.047   8.939   0.826   1.00 15.00 ?  937 LEU B HD12 4  
ATOM   2990  H HD13 . LEU B 2 13 ? -0.660  9.203   0.466   1.00 15.00 ?  937 LEU B HD13 4  
ATOM   2991  H HD21 . LEU B 2 13 ? -0.125  10.935  -2.731  1.00 15.00 ?  937 LEU B HD21 4  
ATOM   2992  H HD22 . LEU B 2 13 ? -0.358  11.754  -1.186  1.00 15.00 ?  937 LEU B HD22 4  
ATOM   2993  H HD23 . LEU B 2 13 ? -1.335  10.343  -1.593  1.00 15.00 ?  937 LEU B HD23 4  
HETATM 2994  N N    . NH2 B 2 14 ? 2.349   13.134  -2.176  1.00 15.00 ?  938 NH2 B N    4  
HETATM 2995  H HN1  . NH2 B 2 14 ? 2.699   12.916  -1.286  1.00 15.00 ?  938 NH2 B HN1  4  
HETATM 2996  H HN2  . NH2 B 2 14 ? 2.090   14.037  -2.450  1.00 15.00 ?  938 NH2 B HN2  4  
ATOM   2997  N N    . PHE A 1 7  ? -12.894 8.531   0.977   1.00 15.00 ?  478 PHE A N    5  
ATOM   2998  C CA   . PHE A 1 7  ? -11.872 7.476   0.820   1.00 15.00 ?  478 PHE A CA   5  
ATOM   2999  C C    . PHE A 1 7  ? -11.002 7.380   2.059   1.00 15.00 ?  478 PHE A C    5  
ATOM   3000  O O    . PHE A 1 7  ? -11.129 8.173   2.994   1.00 15.00 ?  478 PHE A O    5  
ATOM   3001  C CB   . PHE A 1 7  ? -10.993 7.722   -0.420  1.00 15.00 ?  478 PHE A CB   5  
ATOM   3002  C CG   . PHE A 1 7  ? -10.373 9.095   -0.490  1.00 15.00 ?  478 PHE A CG   5  
ATOM   3003  C CD1  . PHE A 1 7  ? -11.126 10.200  -0.856  1.00 15.00 ?  478 PHE A CD1  5  
ATOM   3004  C CD2  . PHE A 1 7  ? -9.032  9.276   -0.193  1.00 15.00 ?  478 PHE A CD2  5  
ATOM   3005  C CE1  . PHE A 1 7  ? -10.554 11.455  -0.921  1.00 15.00 ?  478 PHE A CE1  5  
ATOM   3006  C CE2  . PHE A 1 7  ? -8.454  10.529  -0.257  1.00 15.00 ?  478 PHE A CE2  5  
ATOM   3007  C CZ   . PHE A 1 7  ? -9.216  11.620  -0.621  1.00 15.00 ?  478 PHE A CZ   5  
ATOM   3008  H H    . PHE A 1 7  ? -13.518 8.297   1.779   1.00 15.00 ?  478 PHE A H    5  
ATOM   3009  H HA   . PHE A 1 7  ? -12.389 6.534   0.697   1.00 15.00 ?  478 PHE A HA   5  
ATOM   3010  H HB2  . PHE A 1 7  ? -10.186 7.005   -0.414  1.00 15.00 ?  478 PHE A HB2  5  
ATOM   3011  H HB3  . PHE A 1 7  ? -11.582 7.571   -1.308  1.00 15.00 ?  478 PHE A HB3  5  
ATOM   3012  H HD1  . PHE A 1 7  ? -12.173 10.073  -1.089  1.00 15.00 ?  478 PHE A HD1  5  
ATOM   3013  H HD2  . PHE A 1 7  ? -8.434  8.424   0.091   1.00 15.00 ?  478 PHE A HD2  5  
ATOM   3014  H HE1  . PHE A 1 7  ? -11.151 12.308  -1.206  1.00 15.00 ?  478 PHE A HE1  5  
ATOM   3015  H HE2  . PHE A 1 7  ? -7.407  10.655  -0.022  1.00 15.00 ?  478 PHE A HE2  5  
ATOM   3016  H HZ   . PHE A 1 7  ? -8.766  12.602  -0.672  1.00 15.00 ?  478 PHE A HZ   5  
ATOM   3017  N N    . LEU A 1 8  ? -10.132 6.389   2.044   1.00 15.00 ?  479 LEU A N    5  
ATOM   3018  C CA   . LEU A 1 8  ? -9.161  6.150   3.100   1.00 15.00 ?  479 LEU A CA   5  
ATOM   3019  C C    . LEU A 1 8  ? -8.294  7.389   3.381   1.00 15.00 ?  479 LEU A C    5  
ATOM   3020  O O    . LEU A 1 8  ? -8.166  8.270   2.532   1.00 15.00 ?  479 LEU A O    5  
ATOM   3021  C CB   . LEU A 1 8  ? -8.282  4.953   2.695   1.00 15.00 ?  479 LEU A CB   5  
ATOM   3022  C CG   . LEU A 1 8  ? -7.248  5.181   1.572   1.00 15.00 ?  479 LEU A CG   5  
ATOM   3023  C CD1  . LEU A 1 8  ? -6.622  3.861   1.177   1.00 15.00 ?  479 LEU A CD1  5  
ATOM   3024  C CD2  . LEU A 1 8  ? -7.851  5.834   0.336   1.00 15.00 ?  479 LEU A CD2  5  
ATOM   3025  H H    . LEU A 1 8  ? -10.149 5.768   1.283   1.00 15.00 ?  479 LEU A H    5  
ATOM   3026  H HA   . LEU A 1 8  ? -9.704  5.895   3.997   1.00 15.00 ?  479 LEU A HA   5  
ATOM   3027  H HB2  . LEU A 1 8  ? -7.748  4.626   3.574   1.00 15.00 ?  479 LEU A HB2  5  
ATOM   3028  H HB3  . LEU A 1 8  ? -8.938  4.154   2.385   1.00 15.00 ?  479 LEU A HB3  5  
ATOM   3029  H HG   . LEU A 1 8  ? -6.461  5.825   1.943   1.00 15.00 ?  479 LEU A HG   5  
ATOM   3030  H HD11 . LEU A 1 8  ? -5.876  4.032   0.417   1.00 15.00 ?  479 LEU A HD11 5  
ATOM   3031  H HD12 . LEU A 1 8  ? -7.390  3.209   0.786   1.00 15.00 ?  479 LEU A HD12 5  
ATOM   3032  H HD13 . LEU A 1 8  ? -6.164  3.403   2.040   1.00 15.00 ?  479 LEU A HD13 5  
ATOM   3033  H HD21 . LEU A 1 8  ? -7.089  5.945   -0.420  1.00 15.00 ?  479 LEU A HD21 5  
ATOM   3034  H HD22 . LEU A 1 8  ? -8.244  6.806   0.598   1.00 15.00 ?  479 LEU A HD22 5  
ATOM   3035  H HD23 . LEU A 1 8  ? -8.648  5.214   -0.045  1.00 15.00 ?  479 LEU A HD23 5  
ATOM   3036  N N    . PRO A 1 9  ? -7.721  7.470   4.598   1.00 15.00 ?  480 PRO A N    5  
ATOM   3037  C CA   . PRO A 1 9  ? -6.766  8.518   4.996   1.00 15.00 ?  480 PRO A CA   5  
ATOM   3038  C C    . PRO A 1 9  ? -5.790  8.919   3.884   1.00 15.00 ?  480 PRO A C    5  
ATOM   3039  O O    . PRO A 1 9  ? -5.269  8.062   3.177   1.00 15.00 ?  480 PRO A O    5  
ATOM   3040  C CB   . PRO A 1 9  ? -6.008  7.817   6.113   1.00 15.00 ?  480 PRO A CB   5  
ATOM   3041  C CG   . PRO A 1 9  ? -7.052  7.016   6.803   1.00 15.00 ?  480 PRO A CG   5  
ATOM   3042  C CD   . PRO A 1 9  ? -7.979  6.536   5.716   1.00 15.00 ?  480 PRO A CD   5  
ATOM   3043  H HA   . PRO A 1 9  ? -7.262  9.393   5.386   1.00 15.00 ?  480 PRO A HA   5  
ATOM   3044  H HB2  . PRO A 1 9  ? -5.251  7.189   5.681   1.00 15.00 ?  480 PRO A HB2  5  
ATOM   3045  H HB3  . PRO A 1 9  ? -5.552  8.538   6.771   1.00 15.00 ?  480 PRO A HB3  5  
ATOM   3046  H HG2  . PRO A 1 9  ? -6.599  6.176   7.308   1.00 15.00 ?  480 PRO A HG2  5  
ATOM   3047  H HG3  . PRO A 1 9  ? -7.588  7.636   7.506   1.00 15.00 ?  480 PRO A HG3  5  
ATOM   3048  H HD2  . PRO A 1 9  ? -7.737  5.522   5.435   1.00 15.00 ?  480 PRO A HD2  5  
ATOM   3049  H HD3  . PRO A 1 9  ? -9.007  6.602   6.042   1.00 15.00 ?  480 PRO A HD3  5  
ATOM   3050  N N    . PRO A 1 10 ? -5.491  10.226  3.759   1.00 15.00 ?  481 PRO A N    5  
ATOM   3051  C CA   . PRO A 1 10 ? -4.618  10.755  2.695   1.00 15.00 ?  481 PRO A CA   5  
ATOM   3052  C C    . PRO A 1 10 ? -3.181  10.228  2.759   1.00 15.00 ?  481 PRO A C    5  
ATOM   3053  O O    . PRO A 1 10 ? -2.397  10.431  1.829   1.00 15.00 ?  481 PRO A O    5  
ATOM   3054  C CB   . PRO A 1 10 ? -4.631  12.270  2.930   1.00 15.00 ?  481 PRO A CB   5  
ATOM   3055  C CG   . PRO A 1 10 ? -5.831  12.523  3.778   1.00 15.00 ?  481 PRO A CG   5  
ATOM   3056  C CD   . PRO A 1 10 ? -5.991  11.300  4.632   1.00 15.00 ?  481 PRO A CD   5  
ATOM   3057  H HA   . PRO A 1 10 ? -5.024  10.542  1.719   1.00 15.00 ?  481 PRO A HA   5  
ATOM   3058  H HB2  . PRO A 1 10 ? -3.722  12.565  3.434   1.00 15.00 ?  481 PRO A HB2  5  
ATOM   3059  H HB3  . PRO A 1 10 ? -4.704  12.783  1.983   1.00 15.00 ?  481 PRO A HB3  5  
ATOM   3060  H HG2  . PRO A 1 10 ? -5.667  13.393  4.397   1.00 15.00 ?  481 PRO A HG2  5  
ATOM   3061  H HG3  . PRO A 1 10 ? -6.702  12.664  3.155   1.00 15.00 ?  481 PRO A HG3  5  
ATOM   3062  H HD2  . PRO A 1 10 ? -5.392  11.383  5.526   1.00 15.00 ?  481 PRO A HD2  5  
ATOM   3063  H HD3  . PRO A 1 10 ? -7.030  11.144  4.880   1.00 15.00 ?  481 PRO A HD3  5  
ATOM   3064  N N    . GLY A 1 11 ? -2.826  9.581   3.864   1.00 15.00 ?  482 GLY A N    5  
ATOM   3065  C CA   . GLY A 1 11 ? -1.511  8.975   3.974   1.00 15.00 ?  482 GLY A CA   5  
ATOM   3066  C C    . GLY A 1 11 ? -1.533  7.532   3.540   1.00 15.00 ?  482 GLY A C    5  
ATOM   3067  O O    . GLY A 1 11 ? -0.488  6.891   3.441   1.00 15.00 ?  482 GLY A O    5  
ATOM   3068  H H    . GLY A 1 11 ? -3.463  9.511   4.604   1.00 15.00 ?  482 GLY A H    5  
ATOM   3069  H HA2  . GLY A 1 11 ? -0.819  9.518   3.349   1.00 15.00 ?  482 GLY A HA2  5  
ATOM   3070  H HA3  . GLY A 1 11 ? -1.170  9.024   4.990   1.00 15.00 ?  482 GLY A HA3  5  
ATOM   3071  N N    . TRP A 1 12 ? -2.729  7.023   3.300   1.00 15.00 ?  483 TRP A N    5  
ATOM   3072  C CA   . TRP A 1 12 ? -2.908  5.678   2.794   1.00 15.00 ?  483 TRP A CA   5  
ATOM   3073  C C    . TRP A 1 12 ? -3.071  5.730   1.285   1.00 15.00 ?  483 TRP A C    5  
ATOM   3074  O O    . TRP A 1 12 ? -4.071  6.223   0.769   1.00 15.00 ?  483 TRP A O    5  
ATOM   3075  C CB   . TRP A 1 12 ? -4.120  5.009   3.440   1.00 15.00 ?  483 TRP A CB   5  
ATOM   3076  C CG   . TRP A 1 12 ? -3.872  4.503   4.828   1.00 15.00 ?  483 TRP A CG   5  
ATOM   3077  C CD1  . TRP A 1 12 ? -3.686  5.242   5.965   1.00 15.00 ?  483 TRP A CD1  5  
ATOM   3078  C CD2  . TRP A 1 12 ? -3.800  3.132   5.223   1.00 15.00 ?  483 TRP A CD2  5  
ATOM   3079  N NE1  . TRP A 1 12 ? -3.504  4.407   7.041   1.00 15.00 ?  483 TRP A NE1  5  
ATOM   3080  C CE2  . TRP A 1 12 ? -3.571  3.107   6.611   1.00 15.00 ?  483 TRP A CE2  5  
ATOM   3081  C CE3  . TRP A 1 12 ? -3.907  1.919   4.534   1.00 15.00 ?  483 TRP A CE3  5  
ATOM   3082  C CZ2  . TRP A 1 12 ? -3.451  1.916   7.323   1.00 15.00 ?  483 TRP A CZ2  5  
ATOM   3083  C CZ3  . TRP A 1 12 ? -3.786  0.740   5.242   1.00 15.00 ?  483 TRP A CZ3  5  
ATOM   3084  C CH2  . TRP A 1 12 ? -3.562  0.745   6.624   1.00 15.00 ?  483 TRP A CH2  5  
ATOM   3085  H H    . TRP A 1 12 ? -3.525  7.583   3.443   1.00 15.00 ?  483 TRP A H    5  
ATOM   3086  H HA   . TRP A 1 12 ? -2.020  5.110   3.031   1.00 15.00 ?  483 TRP A HA   5  
ATOM   3087  H HB2  . TRP A 1 12 ? -4.930  5.721   3.490   1.00 15.00 ?  483 TRP A HB2  5  
ATOM   3088  H HB3  . TRP A 1 12 ? -4.425  4.170   2.832   1.00 15.00 ?  483 TRP A HB3  5  
ATOM   3089  H HD1  . TRP A 1 12 ? -3.682  6.324   6.001   1.00 15.00 ?  483 TRP A HD1  5  
ATOM   3090  H HE1  . TRP A 1 12 ? -3.349  4.695   7.972   1.00 15.00 ?  483 TRP A HE1  5  
ATOM   3091  H HE3  . TRP A 1 12 ? -4.078  1.894   3.465   1.00 15.00 ?  483 TRP A HE3  5  
ATOM   3092  H HZ2  . TRP A 1 12 ? -3.280  1.902   8.389   1.00 15.00 ?  483 TRP A HZ2  5  
ATOM   3093  H HZ3  . TRP A 1 12 ? -3.867  -0.206  4.726   1.00 15.00 ?  483 TRP A HZ3  5  
ATOM   3094  H HH2  . TRP A 1 12 ? -3.475  -0.202  7.137   1.00 15.00 ?  483 TRP A HH2  5  
ATOM   3095  N N    . GLU A 1 13 ? -2.065  5.249   0.592   1.00 15.00 ?  484 GLU A N    5  
ATOM   3096  C CA   . GLU A 1 13 ? -2.015  5.349   -0.854  1.00 15.00 ?  484 GLU A CA   5  
ATOM   3097  C C    . GLU A 1 13 ? -2.318  3.995   -1.488  1.00 15.00 ?  484 GLU A C    5  
ATOM   3098  O O    . GLU A 1 13 ? -1.883  2.956   -0.993  1.00 15.00 ?  484 GLU A O    5  
ATOM   3099  C CB   . GLU A 1 13 ? -0.628  5.851   -1.263  1.00 15.00 ?  484 GLU A CB   5  
ATOM   3100  C CG   . GLU A 1 13 ? -0.647  7.074   -2.172  1.00 15.00 ?  484 GLU A CG   5  
ATOM   3101  C CD   . GLU A 1 13 ? -1.184  6.791   -3.561  1.00 15.00 ?  484 GLU A CD   5  
ATOM   3102  O OE1  . GLU A 1 13 ? -2.377  6.460   -3.691  1.00 15.00 -1 484 GLU A OE1  5  
ATOM   3103  O OE2  . GLU A 1 13 ? -0.408  6.904   -4.533  1.00 15.00 ?  484 GLU A OE2  5  
ATOM   3104  H H    . GLU A 1 13 ? -1.329  4.802   1.068   1.00 15.00 ?  484 GLU A H    5  
ATOM   3105  H HA   . GLU A 1 13 ? -2.760  6.063   -1.167  1.00 15.00 ?  484 GLU A HA   5  
ATOM   3106  H HB2  . GLU A 1 13 ? -0.080  6.111   -0.369  1.00 15.00 ?  484 GLU A HB2  5  
ATOM   3107  H HB3  . GLU A 1 13 ? -0.105  5.061   -1.767  1.00 15.00 ?  484 GLU A HB3  5  
ATOM   3108  H HG2  . GLU A 1 13 ? -1.264  7.833   -1.717  1.00 15.00 ?  484 GLU A HG2  5  
ATOM   3109  H HG3  . GLU A 1 13 ? 0.364   7.448   -2.265  1.00 15.00 ?  484 GLU A HG3  5  
ATOM   3110  N N    . MET A 1 14 ? -3.046  4.017   -2.591  1.00 15.00 ?  485 MET A N    5  
ATOM   3111  C CA   . MET A 1 14 ? -3.429  2.794   -3.286  1.00 15.00 ?  485 MET A CA   5  
ATOM   3112  C C    . MET A 1 14 ? -2.615  2.652   -4.552  1.00 15.00 ?  485 MET A C    5  
ATOM   3113  O O    . MET A 1 14 ? -2.795  3.407   -5.509  1.00 15.00 ?  485 MET A O    5  
ATOM   3114  C CB   . MET A 1 14 ? -4.916  2.803   -3.637  1.00 15.00 ?  485 MET A CB   5  
ATOM   3115  C CG   . MET A 1 14 ? -5.812  2.774   -2.428  1.00 15.00 ?  485 MET A CG   5  
ATOM   3116  S SD   . MET A 1 14 ? -7.566  2.828   -2.853  1.00 15.00 ?  485 MET A SD   5  
ATOM   3117  C CE   . MET A 1 14 ? -7.660  4.391   -3.725  1.00 15.00 ?  485 MET A CE   5  
ATOM   3118  H H    . MET A 1 14 ? -3.302  4.889   -2.973  1.00 15.00 ?  485 MET A H    5  
ATOM   3119  H HA   . MET A 1 14 ? -3.219  1.949   -2.628  1.00 15.00 ?  485 MET A HA   5  
ATOM   3120  H HB2  . MET A 1 14 ? -5.142  3.693   -4.197  1.00 15.00 ?  485 MET A HB2  5  
ATOM   3121  H HB3  . MET A 1 14 ? -5.138  1.939   -4.244  1.00 15.00 ?  485 MET A HB3  5  
ATOM   3122  H HG2  . MET A 1 14 ? -5.611  1.858   -1.895  1.00 15.00 ?  485 MET A HG2  5  
ATOM   3123  H HG3  . MET A 1 14 ? -5.577  3.618   -1.798  1.00 15.00 ?  485 MET A HG3  5  
ATOM   3124  H HE1  . MET A 1 14 ? -8.673  4.555   -4.062  1.00 15.00 ?  485 MET A HE1  5  
ATOM   3125  H HE2  . MET A 1 14 ? -6.997  4.368   -4.578  1.00 15.00 ?  485 MET A HE2  5  
ATOM   3126  H HE3  . MET A 1 14 ? -7.366  5.190   -3.062  1.00 15.00 ?  485 MET A HE3  5  
ATOM   3127  N N    . ARG A 1 15 ? -1.720  1.688   -4.554  1.00 15.00 ?  486 ARG A N    5  
ATOM   3128  C CA   . ARG A 1 15 ? -0.790  1.524   -5.664  1.00 15.00 ?  486 ARG A CA   5  
ATOM   3129  C C    . ARG A 1 15 ? -0.611  0.059   -6.018  1.00 15.00 ?  486 ARG A C    5  
ATOM   3130  O O    . ARG A 1 15 ? -0.661  -0.813  -5.151  1.00 15.00 ?  486 ARG A O    5  
ATOM   3131  C CB   . ARG A 1 15 ? 0.566   2.141   -5.313  1.00 15.00 ?  486 ARG A CB   5  
ATOM   3132  C CG   . ARG A 1 15 ? 0.526   3.653   -5.151  1.00 15.00 ?  486 ARG A CG   5  
ATOM   3133  C CD   . ARG A 1 15 ? 0.157   4.347   -6.454  1.00 15.00 ?  486 ARG A CD   5  
ATOM   3134  N NE   . ARG A 1 15 ? 1.110   4.055   -7.524  1.00 15.00 ?  486 ARG A NE   5  
ATOM   3135  C CZ   . ARG A 1 15 ? 0.880   4.301   -8.811  1.00 15.00 ?  486 ARG A CZ   5  
ATOM   3136  N NH1  . ARG A 1 15 ? -0.242  4.903   -9.193  1.00 15.00 1  486 ARG A NH1  5  
ATOM   3137  N NH2  . ARG A 1 15 ? 1.787   3.964   -9.712  1.00 15.00 ?  486 ARG A NH2  5  
ATOM   3138  H H    . ARG A 1 15 ? -1.692  1.060   -3.795  1.00 15.00 ?  486 ARG A H    5  
ATOM   3139  H HA   . ARG A 1 15 ? -1.198  2.040   -6.518  1.00 15.00 ?  486 ARG A HA   5  
ATOM   3140  H HB2  . ARG A 1 15 ? 0.917   1.709   -4.388  1.00 15.00 ?  486 ARG A HB2  5  
ATOM   3141  H HB3  . ARG A 1 15 ? 1.268   1.905   -6.099  1.00 15.00 ?  486 ARG A HB3  5  
ATOM   3142  H HG2  . ARG A 1 15 ? -0.212  3.904   -4.403  1.00 15.00 ?  486 ARG A HG2  5  
ATOM   3143  H HG3  . ARG A 1 15 ? 1.498   3.997   -4.831  1.00 15.00 ?  486 ARG A HG3  5  
ATOM   3144  H HD2  . ARG A 1 15 ? -0.822  4.011   -6.759  1.00 15.00 ?  486 ARG A HD2  5  
ATOM   3145  H HD3  . ARG A 1 15 ? 0.136   5.415   -6.286  1.00 15.00 ?  486 ARG A HD3  5  
ATOM   3146  H HE   . ARG A 1 15 ? 1.968   3.641   -7.267  1.00 15.00 ?  486 ARG A HE   5  
ATOM   3147  H HH11 . ARG A 1 15 ? -0.924  5.174   -8.512  1.00 15.00 ?  486 ARG A HH11 5  
ATOM   3148  H HH12 . ARG A 1 15 ? -0.405  5.095   -10.166 1.00 15.00 ?  486 ARG A HH12 5  
ATOM   3149  H HH21 . ARG A 1 15 ? 2.649   3.524   -9.418  1.00 15.00 ?  486 ARG A HH21 5  
ATOM   3150  H HH22 . ARG A 1 15 ? 1.621   4.134   -10.695 1.00 15.00 ?  486 ARG A HH22 5  
ATOM   3151  N N    . ILE A 1 16 ? -0.383  -0.200  -7.294  1.00 15.00 ?  487 ILE A N    5  
ATOM   3152  C CA   . ILE A 1 16 ? -0.152  -1.552  -7.770  1.00 15.00 ?  487 ILE A CA   5  
ATOM   3153  C C    . ILE A 1 16 ? 1.337   -1.802  -7.966  1.00 15.00 ?  487 ILE A C    5  
ATOM   3154  O O    . ILE A 1 16 ? 2.102   -0.875  -8.237  1.00 15.00 ?  487 ILE A O    5  
ATOM   3155  C CB   . ILE A 1 16 ? -0.920  -1.844  -9.089  1.00 15.00 ?  487 ILE A CB   5  
ATOM   3156  C CG1  . ILE A 1 16 ? -0.553  -0.845  -10.197 1.00 15.00 ?  487 ILE A CG1  5  
ATOM   3157  C CG2  . ILE A 1 16 ? -2.420  -1.829  -8.844  1.00 15.00 ?  487 ILE A CG2  5  
ATOM   3158  C CD1  . ILE A 1 16 ? 0.596   -1.299  -11.075 1.00 15.00 ?  487 ILE A CD1  5  
ATOM   3159  H H    . ILE A 1 16 ? -0.357  0.540   -7.934  1.00 15.00 ?  487 ILE A H    5  
ATOM   3160  H HA   . ILE A 1 16 ? -0.516  -2.233  -7.013  1.00 15.00 ?  487 ILE A HA   5  
ATOM   3161  H HB   . ILE A 1 16 ? -0.651  -2.838  -9.414  1.00 15.00 ?  487 ILE A HB   5  
ATOM   3162  H HG12 . ILE A 1 16 ? -1.411  -0.694  -10.833 1.00 15.00 ?  487 ILE A HG12 5  
ATOM   3163  H HG13 . ILE A 1 16 ? -0.274  0.096   -9.746  1.00 15.00 ?  487 ILE A HG13 5  
ATOM   3164  H HG21 . ILE A 1 16 ? -2.938  -1.973  -9.781  1.00 15.00 ?  487 ILE A HG21 5  
ATOM   3165  H HG22 . ILE A 1 16 ? -2.705  -0.880  -8.416  1.00 15.00 ?  487 ILE A HG22 5  
ATOM   3166  H HG23 . ILE A 1 16 ? -2.678  -2.624  -8.164  1.00 15.00 ?  487 ILE A HG23 5  
ATOM   3167  H HD11 . ILE A 1 16 ? 0.334   -2.230  -11.555 1.00 15.00 ?  487 ILE A HD11 5  
ATOM   3168  H HD12 . ILE A 1 16 ? 1.477   -1.445  -10.467 1.00 15.00 ?  487 ILE A HD12 5  
ATOM   3169  H HD13 . ILE A 1 16 ? 0.796   -0.550  -11.826 1.00 15.00 ?  487 ILE A HD13 5  
ATOM   3170  N N    . ALA A 1 17 ? 1.741   -3.046  -7.793  1.00 15.00 ?  488 ALA A N    5  
ATOM   3171  C CA   . ALA A 1 17 ? 3.108   -3.454  -8.059  1.00 15.00 ?  488 ALA A CA   5  
ATOM   3172  C C    . ALA A 1 17 ? 3.229   -3.895  -9.511  1.00 15.00 ?  488 ALA A C    5  
ATOM   3173  O O    . ALA A 1 17 ? 2.251   -4.373  -10.089 1.00 15.00 ?  488 ALA A O    5  
ATOM   3174  C CB   . ALA A 1 17 ? 3.519   -4.580  -7.122  1.00 15.00 ?  488 ALA A CB   5  
ATOM   3175  H H    . ALA A 1 17 ? 1.100   -3.712  -7.458  1.00 15.00 ?  488 ALA A H    5  
ATOM   3176  H HA   . ALA A 1 17 ? 3.755   -2.607  -7.887  1.00 15.00 ?  488 ALA A HA   5  
ATOM   3177  H HB1  . ALA A 1 17 ? 3.265   -4.316  -6.108  1.00 15.00 ?  488 ALA A HB1  5  
ATOM   3178  H HB2  . ALA A 1 17 ? 4.585   -4.740  -7.195  1.00 15.00 ?  488 ALA A HB2  5  
ATOM   3179  H HB3  . ALA A 1 17 ? 3.001   -5.487  -7.396  1.00 15.00 ?  488 ALA A HB3  5  
ATOM   3180  N N    . PRO A 1 18 ? 4.417   -3.729  -10.123 1.00 15.00 ?  489 PRO A N    5  
ATOM   3181  C CA   . PRO A 1 18 ? 4.644   -4.012  -11.555 1.00 15.00 ?  489 PRO A CA   5  
ATOM   3182  C C    . PRO A 1 18 ? 4.331   -5.455  -11.978 1.00 15.00 ?  489 PRO A C    5  
ATOM   3183  O O    . PRO A 1 18 ? 4.436   -5.790  -13.156 1.00 15.00 ?  489 PRO A O    5  
ATOM   3184  C CB   . PRO A 1 18 ? 6.138   -3.725  -11.749 1.00 15.00 ?  489 PRO A CB   5  
ATOM   3185  C CG   . PRO A 1 18 ? 6.504   -2.818  -10.629 1.00 15.00 ?  489 PRO A CG   5  
ATOM   3186  C CD   . PRO A 1 18 ? 5.642   -3.230  -9.470  1.00 15.00 ?  489 PRO A CD   5  
ATOM   3187  H HA   . PRO A 1 18 ? 4.073   -3.339  -12.175 1.00 15.00 ?  489 PRO A HA   5  
ATOM   3188  H HB2  . PRO A 1 18 ? 6.694   -4.651  -11.706 1.00 15.00 ?  489 PRO A HB2  5  
ATOM   3189  H HB3  . PRO A 1 18 ? 6.294   -3.250  -12.707 1.00 15.00 ?  489 PRO A HB3  5  
ATOM   3190  H HG2  . PRO A 1 18 ? 7.548   -2.941  -10.383 1.00 15.00 ?  489 PRO A HG2  5  
ATOM   3191  H HG3  . PRO A 1 18 ? 6.298   -1.795  -10.904 1.00 15.00 ?  489 PRO A HG3  5  
ATOM   3192  H HD2  . PRO A 1 18 ? 6.122   -4.012  -8.900  1.00 15.00 ?  489 PRO A HD2  5  
ATOM   3193  H HD3  . PRO A 1 18 ? 5.423   -2.381  -8.842  1.00 15.00 ?  489 PRO A HD3  5  
ATOM   3194  N N    . ASN A 1 19 ? 3.966   -6.307  -11.030 1.00 15.00 ?  490 ASN A N    5  
ATOM   3195  C CA   . ASN A 1 19 ? 3.591   -7.681  -11.349 1.00 15.00 ?  490 ASN A CA   5  
ATOM   3196  C C    . ASN A 1 19 ? 2.073   -7.868  -11.248 1.00 15.00 ?  490 ASN A C    5  
ATOM   3197  O O    . ASN A 1 19 ? 1.541   -8.912  -11.621 1.00 15.00 ?  490 ASN A O    5  
ATOM   3198  C CB   . ASN A 1 19 ? 4.316   -8.680  -10.439 1.00 15.00 ?  490 ASN A CB   5  
ATOM   3199  C CG   . ASN A 1 19 ? 3.913   -8.558  -8.983  1.00 15.00 ?  490 ASN A CG   5  
ATOM   3200  O OD1  . ASN A 1 19 ? 3.545   -7.481  -8.514  1.00 15.00 ?  490 ASN A OD1  5  
ATOM   3201  N ND2  . ASN A 1 19 ? 3.997   -9.658  -8.252  1.00 15.00 ?  490 ASN A ND2  5  
ATOM   3202  H H    . ASN A 1 19 ? 3.949   -6.008  -10.097 1.00 15.00 ?  490 ASN A H    5  
ATOM   3203  H HA   . ASN A 1 19 ? 3.888   -7.866  -12.371 1.00 15.00 ?  490 ASN A HA   5  
ATOM   3204  H HB2  . ASN A 1 19 ? 4.091   -9.684  -10.767 1.00 15.00 ?  490 ASN A HB2  5  
ATOM   3205  H HB3  . ASN A 1 19 ? 5.382   -8.516  -10.511 1.00 15.00 ?  490 ASN A HB3  5  
ATOM   3206  H HD21 . ASN A 1 19 ? 4.317   -10.483 -8.687  1.00 15.00 ?  490 ASN A HD21 5  
ATOM   3207  H HD22 . ASN A 1 19 ? 3.747   -9.608  -7.309  1.00 15.00 ?  490 ASN A HD22 5  
ATOM   3208  N N    . GLY A 1 20 ? 1.382   -6.851  -10.742 1.00 15.00 ?  491 GLY A N    5  
ATOM   3209  C CA   . GLY A 1 20 ? -0.071  -6.882  -10.711 1.00 15.00 ?  491 GLY A CA   5  
ATOM   3210  C C    . GLY A 1 20 ? -0.661  -7.165  -9.340  1.00 15.00 ?  491 GLY A C    5  
ATOM   3211  O O    . GLY A 1 20 ? -1.709  -7.797  -9.235  1.00 15.00 ?  491 GLY A O    5  
ATOM   3212  H H    . GLY A 1 20 ? 1.860   -6.062  -10.404 1.00 15.00 ?  491 GLY A H    5  
ATOM   3213  H HA2  . GLY A 1 20 ? -0.439  -5.925  -11.049 1.00 15.00 ?  491 GLY A HA2  5  
ATOM   3214  H HA3  . GLY A 1 20 ? -0.412  -7.643  -11.399 1.00 15.00 ?  491 GLY A HA3  5  
ATOM   3215  N N    . ARG A 1 21 ? 0.001   -6.709  -8.286  1.00 15.00 ?  492 ARG A N    5  
ATOM   3216  C CA   . ARG A 1 21 ? -0.567  -6.805  -6.942  1.00 15.00 ?  492 ARG A CA   5  
ATOM   3217  C C    . ARG A 1 21 ? -0.798  -5.413  -6.361  1.00 15.00 ?  492 ARG A C    5  
ATOM   3218  O O    . ARG A 1 21 ? 0.126   -4.609  -6.279  1.00 15.00 ?  492 ARG A O    5  
ATOM   3219  C CB   . ARG A 1 21 ? 0.327   -7.636  -6.008  1.00 15.00 ?  492 ARG A CB   5  
ATOM   3220  C CG   . ARG A 1 21 ? 1.805   -7.309  -6.101  1.00 15.00 ?  492 ARG A CG   5  
ATOM   3221  C CD   . ARG A 1 21 ? 2.652   -8.273  -5.282  1.00 15.00 ?  492 ARG A CD   5  
ATOM   3222  N NE   . ARG A 1 21 ? 4.084   -8.066  -5.508  1.00 15.00 ?  492 ARG A NE   5  
ATOM   3223  C CZ   . ARG A 1 21 ? 5.047   -8.689  -4.828  1.00 15.00 ?  492 ARG A CZ   5  
ATOM   3224  N NH1  . ARG A 1 21 ? 4.745   -9.579  -3.892  1.00 15.00 1  492 ARG A NH1  5  
ATOM   3225  N NH2  . ARG A 1 21 ? 6.320   -8.439  -5.106  1.00 15.00 ?  492 ARG A NH2  5  
ATOM   3226  H H    . ARG A 1 21 ? 0.883   -6.306  -8.410  1.00 15.00 ?  492 ARG A H    5  
ATOM   3227  H HA   . ARG A 1 21 ? -1.524  -7.297  -7.033  1.00 15.00 ?  492 ARG A HA   5  
ATOM   3228  H HB2  . ARG A 1 21 ? 0.010   -7.458  -4.993  1.00 15.00 ?  492 ARG A HB2  5  
ATOM   3229  H HB3  . ARG A 1 21 ? 0.196   -8.680  -6.228  1.00 15.00 ?  492 ARG A HB3  5  
ATOM   3230  H HG2  . ARG A 1 21 ? 2.111   -7.368  -7.135  1.00 15.00 ?  492 ARG A HG2  5  
ATOM   3231  H HG3  . ARG A 1 21 ? 1.965   -6.305  -5.735  1.00 15.00 ?  492 ARG A HG3  5  
ATOM   3232  H HD2  . ARG A 1 21 ? 2.435   -8.125  -4.235  1.00 15.00 ?  492 ARG A HD2  5  
ATOM   3233  H HD3  . ARG A 1 21 ? 2.394   -9.285  -5.563  1.00 15.00 ?  492 ARG A HD3  5  
ATOM   3234  H HE   . ARG A 1 21 ? 4.340   -7.427  -6.212  1.00 15.00 ?  492 ARG A HE   5  
ATOM   3235  H HH11 . ARG A 1 21 ? 3.781   -9.798  -3.686  1.00 15.00 ?  492 ARG A HH11 5  
ATOM   3236  H HH12 . ARG A 1 21 ? 5.476   -10.039 -3.382  1.00 15.00 ?  492 ARG A HH12 5  
ATOM   3237  H HH21 . ARG A 1 21 ? 6.562   -7.782  -5.835  1.00 15.00 ?  492 ARG A HH21 5  
ATOM   3238  H HH22 . ARG A 1 21 ? 7.053   -8.903  -4.589  1.00 15.00 ?  492 ARG A HH22 5  
ATOM   3239  N N    . PRO A 1 22 ? -2.040  -5.116  -5.953  1.00 15.00 ?  493 PRO A N    5  
ATOM   3240  C CA   . PRO A 1 22 ? -2.400  -3.822  -5.382  1.00 15.00 ?  493 PRO A CA   5  
ATOM   3241  C C    . PRO A 1 22 ? -2.233  -3.788  -3.864  1.00 15.00 ?  493 PRO A C    5  
ATOM   3242  O O    . PRO A 1 22 ? -2.758  -4.643  -3.154  1.00 15.00 ?  493 PRO A O    5  
ATOM   3243  C CB   . PRO A 1 22 ? -3.877  -3.698  -5.755  1.00 15.00 ?  493 PRO A CB   5  
ATOM   3244  C CG   . PRO A 1 22 ? -4.392  -5.104  -5.810  1.00 15.00 ?  493 PRO A CG   5  
ATOM   3245  C CD   . PRO A 1 22 ? -3.205  -6.013  -6.033  1.00 15.00 ?  493 PRO A CD   5  
ATOM   3246  H HA   . PRO A 1 22 ? -1.840  -3.015  -5.829  1.00 15.00 ?  493 PRO A HA   5  
ATOM   3247  H HB2  . PRO A 1 22 ? -4.392  -3.120  -5.001  1.00 15.00 ?  493 PRO A HB2  5  
ATOM   3248  H HB3  . PRO A 1 22 ? -3.969  -3.210  -6.712  1.00 15.00 ?  493 PRO A HB3  5  
ATOM   3249  H HG2  . PRO A 1 22 ? -4.874  -5.349  -4.877  1.00 15.00 ?  493 PRO A HG2  5  
ATOM   3250  H HG3  . PRO A 1 22 ? -5.092  -5.201  -6.627  1.00 15.00 ?  493 PRO A HG3  5  
ATOM   3251  H HD2  . PRO A 1 22 ? -3.161  -6.767  -5.262  1.00 15.00 ?  493 PRO A HD2  5  
ATOM   3252  H HD3  . PRO A 1 22 ? -3.267  -6.477  -7.006  1.00 15.00 ?  493 PRO A HD3  5  
ATOM   3253  N N    . PHE A 1 23 ? -1.504  -2.799  -3.370  1.00 15.00 ?  494 PHE A N    5  
ATOM   3254  C CA   . PHE A 1 23 ? -1.280  -2.676  -1.943  1.00 15.00 ?  494 PHE A CA   5  
ATOM   3255  C C    . PHE A 1 23 ? -1.545  -1.253  -1.450  1.00 15.00 ?  494 PHE A C    5  
ATOM   3256  O O    . PHE A 1 23 ? -1.315  -0.270  -2.161  1.00 15.00 ?  494 PHE A O    5  
ATOM   3257  C CB   . PHE A 1 23 ? 0.143   -3.140  -1.564  1.00 15.00 ?  494 PHE A CB   5  
ATOM   3258  C CG   . PHE A 1 23 ? 1.277   -2.499  -2.338  1.00 15.00 ?  494 PHE A CG   5  
ATOM   3259  C CD1  . PHE A 1 23 ? 1.515   -1.133  -2.275  1.00 15.00 ?  494 PHE A CD1  5  
ATOM   3260  C CD2  . PHE A 1 23 ? 2.121   -3.279  -3.112  1.00 15.00 ?  494 PHE A CD2  5  
ATOM   3261  C CE1  . PHE A 1 23 ? 2.565   -0.558  -2.971  1.00 15.00 ?  494 PHE A CE1  5  
ATOM   3262  C CE2  . PHE A 1 23 ? 3.174   -2.709  -3.806  1.00 15.00 ?  494 PHE A CE2  5  
ATOM   3263  C CZ   . PHE A 1 23 ? 3.395   -1.348  -3.737  1.00 15.00 ?  494 PHE A CZ   5  
ATOM   3264  H H    . PHE A 1 23 ? -1.117  -2.128  -3.978  1.00 15.00 ?  494 PHE A H    5  
ATOM   3265  H HA   . PHE A 1 23 ? -1.987  -3.331  -1.457  1.00 15.00 ?  494 PHE A HA   5  
ATOM   3266  H HB2  . PHE A 1 23 ? 0.305   -2.934  -0.520  1.00 15.00 ?  494 PHE A HB2  5  
ATOM   3267  H HB3  . PHE A 1 23 ? 0.207   -4.208  -1.719  1.00 15.00 ?  494 PHE A HB3  5  
ATOM   3268  H HD1  . PHE A 1 23 ? 0.867   -0.511  -1.675  1.00 15.00 ?  494 PHE A HD1  5  
ATOM   3269  H HD2  . PHE A 1 23 ? 1.949   -4.343  -3.174  1.00 15.00 ?  494 PHE A HD2  5  
ATOM   3270  H HE1  . PHE A 1 23 ? 2.735   0.514   -2.913  1.00 15.00 ?  494 PHE A HE1  5  
ATOM   3271  H HE2  . PHE A 1 23 ? 3.827   -3.329  -4.399  1.00 15.00 ?  494 PHE A HE2  5  
ATOM   3272  H HZ   . PHE A 1 23 ? 4.218   -0.904  -4.279  1.00 15.00 ?  494 PHE A HZ   5  
ATOM   3273  N N    . PHE A 1 24 ? -2.052  -1.166  -0.231  1.00 15.00 ?  495 PHE A N    5  
ATOM   3274  C CA   . PHE A 1 24 ? -2.245  0.099   0.454   1.00 15.00 ?  495 PHE A CA   5  
ATOM   3275  C C    . PHE A 1 24 ? -0.994  0.442   1.247   1.00 15.00 ?  495 PHE A C    5  
ATOM   3276  O O    . PHE A 1 24 ? -0.559  -0.333  2.100   1.00 15.00 ?  495 PHE A O    5  
ATOM   3277  C CB   . PHE A 1 24 ? -3.445  0.012   1.403   1.00 15.00 ?  495 PHE A CB   5  
ATOM   3278  C CG   . PHE A 1 24 ? -4.720  -0.383  0.719   1.00 15.00 ?  495 PHE A CG   5  
ATOM   3279  C CD1  . PHE A 1 24 ? -5.419  0.537   -0.030  1.00 15.00 ?  495 PHE A CD1  5  
ATOM   3280  C CD2  . PHE A 1 24 ? -5.209  -1.675  0.817   1.00 15.00 ?  495 PHE A CD2  5  
ATOM   3281  C CE1  . PHE A 1 24 ? -6.588  0.187   -0.676  1.00 15.00 ?  495 PHE A CE1  5  
ATOM   3282  C CE2  . PHE A 1 24 ? -6.377  -2.036  0.175   1.00 15.00 ?  495 PHE A CE2  5  
ATOM   3283  C CZ   . PHE A 1 24 ? -7.068  -1.103  -0.574  1.00 15.00 ?  495 PHE A CZ   5  
ATOM   3284  H H    . PHE A 1 24 ? -2.319  -1.984  0.221   1.00 15.00 ?  495 PHE A H    5  
ATOM   3285  H HA   . PHE A 1 24 ? -2.423  0.865   -0.284  1.00 15.00 ?  495 PHE A HA   5  
ATOM   3286  H HB2  . PHE A 1 24 ? -3.239  -0.717  2.171   1.00 15.00 ?  495 PHE A HB2  5  
ATOM   3287  H HB3  . PHE A 1 24 ? -3.600  0.975   1.864   1.00 15.00 ?  495 PHE A HB3  5  
ATOM   3288  H HD1  . PHE A 1 24 ? -5.044  1.546   -0.104  1.00 15.00 ?  495 PHE A HD1  5  
ATOM   3289  H HD2  . PHE A 1 24 ? -4.672  -2.404  1.403   1.00 15.00 ?  495 PHE A HD2  5  
ATOM   3290  H HE1  . PHE A 1 24 ? -7.118  0.923   -1.266  1.00 15.00 ?  495 PHE A HE1  5  
ATOM   3291  H HE2  . PHE A 1 24 ? -6.752  -3.046  0.258   1.00 15.00 ?  495 PHE A HE2  5  
ATOM   3292  H HZ   . PHE A 1 24 ? -7.980  -1.381  -1.079  1.00 15.00 ?  495 PHE A HZ   5  
ATOM   3293  N N    . ILE A 1 25 ? -0.410  1.589   0.951   1.00 15.00 ?  496 ILE A N    5  
ATOM   3294  C CA   . ILE A 1 25 ? 0.778   2.047   1.656   1.00 15.00 ?  496 ILE A CA   5  
ATOM   3295  C C    . ILE A 1 25 ? 0.417   3.162   2.603   1.00 15.00 ?  496 ILE A C    5  
ATOM   3296  O O    . ILE A 1 25 ? 0.017   4.238   2.160   1.00 15.00 ?  496 ILE A O    5  
ATOM   3297  C CB   . ILE A 1 25 ? 1.872   2.604   0.711   1.00 15.00 ?  496 ILE A CB   5  
ATOM   3298  C CG1  . ILE A 1 25 ? 2.012   1.764   -0.554  1.00 15.00 ?  496 ILE A CG1  5  
ATOM   3299  C CG2  . ILE A 1 25 ? 3.202   2.680   1.442   1.00 15.00 ?  496 ILE A CG2  5  
ATOM   3300  C CD1  . ILE A 1 25 ? 1.108   2.220   -1.679  1.00 15.00 ?  496 ILE A CD1  5  
ATOM   3301  H H    . ILE A 1 25 ? -0.794  2.149   0.239   1.00 15.00 ?  496 ILE A H    5  
ATOM   3302  H HA   . ILE A 1 25 ? 1.189   1.225   2.213   1.00 15.00 ?  496 ILE A HA   5  
ATOM   3303  H HB   . ILE A 1 25 ? 1.591   3.611   0.434   1.00 15.00 ?  496 ILE A HB   5  
ATOM   3304  H HG12 . ILE A 1 25 ? 3.033   1.817   -0.905  1.00 15.00 ?  496 ILE A HG12 5  
ATOM   3305  H HG13 . ILE A 1 25 ? 1.766   0.737   -0.326  1.00 15.00 ?  496 ILE A HG13 5  
ATOM   3306  H HG21 . ILE A 1 25 ? 3.488   1.693   1.773   1.00 15.00 ?  496 ILE A HG21 5  
ATOM   3307  H HG22 . ILE A 1 25 ? 3.106   3.334   2.297   1.00 15.00 ?  496 ILE A HG22 5  
ATOM   3308  H HG23 . ILE A 1 25 ? 3.958   3.068   0.775   1.00 15.00 ?  496 ILE A HG23 5  
ATOM   3309  H HD11 . ILE A 1 25 ? 1.346   3.242   -1.939  1.00 15.00 ?  496 ILE A HD11 5  
ATOM   3310  H HD12 . ILE A 1 25 ? 0.078   2.161   -1.359  1.00 15.00 ?  496 ILE A HD12 5  
ATOM   3311  H HD13 . ILE A 1 25 ? 1.255   1.586   -2.540  1.00 15.00 ?  496 ILE A HD13 5  
ATOM   3312  N N    . ASP A 1 26 ? 0.554   2.942   3.897   1.00 15.00 ?  497 ASP A N    5  
ATOM   3313  C CA   . ASP A 1 26 ? 0.423   4.050   4.810   1.00 15.00 ?  497 ASP A CA   5  
ATOM   3314  C C    . ASP A 1 26 ? 1.774   4.680   5.010   1.00 15.00 ?  497 ASP A C    5  
ATOM   3315  O O    . ASP A 1 26 ? 2.750   4.048   5.422   1.00 15.00 ?  497 ASP A O    5  
ATOM   3316  C CB   . ASP A 1 26 ? -0.234  3.696   6.136   1.00 15.00 ?  497 ASP A CB   5  
ATOM   3317  C CG   . ASP A 1 26 ? 0.701   3.762   7.323   1.00 15.00 ?  497 ASP A CG   5  
ATOM   3318  O OD1  . ASP A 1 26 ? 0.923   4.880   7.849   1.00 15.00 ?  497 ASP A OD1  5  
ATOM   3319  O OD2  . ASP A 1 26 ? 1.209   2.706   7.747   1.00 15.00 -1 497 ASP A OD2  5  
ATOM   3320  H H    . ASP A 1 26 ? 0.766   2.039   4.233   1.00 15.00 ?  497 ASP A H    5  
ATOM   3321  H HA   . ASP A 1 26 ? -0.201  4.782   4.310   1.00 15.00 ?  497 ASP A HA   5  
ATOM   3322  H HB2  . ASP A 1 26 ? -1.017  4.418   6.299   1.00 15.00 ?  497 ASP A HB2  5  
ATOM   3323  H HB3  . ASP A 1 26 ? -0.660  2.706   6.076   1.00 15.00 ?  497 ASP A HB3  5  
ATOM   3324  N N    . HIS A 1 27 ? 1.816   5.926   4.653   1.00 15.00 ?  498 HIS A N    5  
ATOM   3325  C CA   . HIS A 1 27 ? 3.060   6.659   4.569   1.00 15.00 ?  498 HIS A CA   5  
ATOM   3326  C C    . HIS A 1 27 ? 3.536   7.145   5.928   1.00 15.00 ?  498 HIS A C    5  
ATOM   3327  O O    . HIS A 1 27 ? 4.661   7.620   6.058   1.00 15.00 ?  498 HIS A O    5  
ATOM   3328  C CB   . HIS A 1 27 ? 2.940   7.795   3.559   1.00 15.00 ?  498 HIS A CB   5  
ATOM   3329  C CG   . HIS A 1 27 ? 2.878   7.285   2.150   1.00 15.00 ?  498 HIS A CG   5  
ATOM   3330  N ND1  . HIS A 1 27 ? 4.006   7.034   1.397   1.00 15.00 ?  498 HIS A ND1  5  
ATOM   3331  C CD2  . HIS A 1 27 ? 1.823   6.905   1.382   1.00 15.00 ?  498 HIS A CD2  5  
ATOM   3332  C CE1  . HIS A 1 27 ? 3.654   6.519   0.235   1.00 15.00 ?  498 HIS A CE1  5  
ATOM   3333  N NE2  . HIS A 1 27 ? 2.336   6.433   0.197   1.00 15.00 ?  498 HIS A NE2  5  
ATOM   3334  H H    . HIS A 1 27 ? 0.959   6.382   4.472   1.00 15.00 ?  498 HIS A H    5  
ATOM   3335  H HA   . HIS A 1 27 ? 3.801   5.965   4.198   1.00 15.00 ?  498 HIS A HA   5  
ATOM   3336  H HB2  . HIS A 1 27 ? 2.038   8.357   3.757   1.00 15.00 ?  498 HIS A HB2  5  
ATOM   3337  H HB3  . HIS A 1 27 ? 3.798   8.447   3.645   1.00 15.00 ?  498 HIS A HB3  5  
ATOM   3338  H HD1  . HIS A 1 27 ? 4.940   7.229   1.668   1.00 15.00 ?  498 HIS A HD1  5  
ATOM   3339  H HD2  . HIS A 1 27 ? 0.772   6.955   1.651   1.00 15.00 ?  498 HIS A HD2  5  
ATOM   3340  H HE1  . HIS A 1 27 ? 4.331   6.188   -0.540  1.00 15.00 ?  498 HIS A HE1  5  
ATOM   3341  H HE2  . HIS A 1 27 ? 1.808   6.244   -0.609  1.00 15.00 ?  498 HIS A HE2  5  
ATOM   3342  N N    . ASN A 1 28 ? 2.685   7.028   6.943   1.00 15.00 ?  499 ASN A N    5  
ATOM   3343  C CA   . ASN A 1 28 ? 3.038   7.543   8.253   1.00 15.00 ?  499 ASN A CA   5  
ATOM   3344  C C    . ASN A 1 28 ? 3.948   6.565   8.969   1.00 15.00 ?  499 ASN A C    5  
ATOM   3345  O O    . ASN A 1 28 ? 5.006   6.937   9.476   1.00 15.00 ?  499 ASN A O    5  
ATOM   3346  C CB   . ASN A 1 28 ? 1.780   7.748   9.104   1.00 15.00 ?  499 ASN A CB   5  
ATOM   3347  C CG   . ASN A 1 28 ? 0.739   8.627   8.439   1.00 15.00 ?  499 ASN A CG   5  
ATOM   3348  O OD1  . ASN A 1 28 ? 0.743   9.844   8.601   1.00 15.00 ?  499 ASN A OD1  5  
ATOM   3349  N ND2  . ASN A 1 28 ? -0.172  8.009   7.696   1.00 15.00 ?  499 ASN A ND2  5  
ATOM   3350  H H    . ASN A 1 28 ? 1.838   6.551   6.819   1.00 15.00 ?  499 ASN A H    5  
ATOM   3351  H HA   . ASN A 1 28 ? 3.546   8.487   8.130   1.00 15.00 ?  499 ASN A HA   5  
ATOM   3352  H HB2  . ASN A 1 28 ? 1.330   6.785   9.299   1.00 15.00 ?  499 ASN A HB2  5  
ATOM   3353  H HB3  . ASN A 1 28 ? 2.061   8.199   10.044  1.00 15.00 ?  499 ASN A HB3  5  
ATOM   3354  H HD21 . ASN A 1 28 ? -0.121  7.033   7.615   1.00 15.00 ?  499 ASN A HD21 5  
ATOM   3355  H HD22 . ASN A 1 28 ? -0.864  8.554   7.270   1.00 15.00 ?  499 ASN A HD22 5  
ATOM   3356  N N    . THR A 1 29 ? 3.522   5.311   9.011   1.00 15.00 ?  500 THR A N    5  
ATOM   3357  C CA   . THR A 1 29 ? 4.343   4.236   9.540   1.00 15.00 ?  500 THR A CA   5  
ATOM   3358  C C    . THR A 1 29 ? 5.357   3.737   8.515   1.00 15.00 ?  500 THR A C    5  
ATOM   3359  O O    . THR A 1 29 ? 6.314   3.043   8.868   1.00 15.00 ?  500 THR A O    5  
ATOM   3360  C CB   . THR A 1 29 ? 3.486   3.072   10.049  1.00 15.00 ?  500 THR A CB   5  
ATOM   3361  O OG1  . THR A 1 29 ? 2.106   3.449   10.044  1.00 15.00 ?  500 THR A OG1  5  
ATOM   3362  C CG2  . THR A 1 29 ? 3.893   2.705   11.461  1.00 15.00 ?  500 THR A CG2  5  
ATOM   3363  H H    . THR A 1 29 ? 2.619   5.098   8.679   1.00 15.00 ?  500 THR A H    5  
ATOM   3364  H HA   . THR A 1 29 ? 4.886   4.638   10.385  1.00 15.00 ?  500 THR A HA   5  
ATOM   3365  H HB   . THR A 1 29 ? 3.630   2.215   9.406   1.00 15.00 ?  500 THR A HB   5  
ATOM   3366  H HG1  . THR A 1 29 ? 1.710   3.188   9.192   1.00 15.00 ?  500 THR A HG1  5  
ATOM   3367  H HG21 . THR A 1 29 ? 4.933   2.416   11.472  1.00 15.00 ?  500 THR A HG21 5  
ATOM   3368  H HG22 . THR A 1 29 ? 3.284   1.885   11.808  1.00 15.00 ?  500 THR A HG22 5  
ATOM   3369  H HG23 . THR A 1 29 ? 3.750   3.562   12.103  1.00 15.00 ?  500 THR A HG23 5  
ATOM   3370  N N    . LYS A 1 30 ? 5.116   4.080   7.241   1.00 15.00 ?  501 LYS A N    5  
ATOM   3371  C CA   . LYS A 1 30 ? 5.919   3.585   6.114   1.00 15.00 ?  501 LYS A CA   5  
ATOM   3372  C C    . LYS A 1 30 ? 5.679   2.087   5.932   1.00 15.00 ?  501 LYS A C    5  
ATOM   3373  O O    . LYS A 1 30 ? 6.604   1.326   5.661   1.00 15.00 ?  501 LYS A O    5  
ATOM   3374  C CB   . LYS A 1 30 ? 7.417   3.851   6.335   1.00 15.00 ?  501 LYS A CB   5  
ATOM   3375  C CG   . LYS A 1 30 ? 7.748   5.299   6.661   1.00 15.00 ?  501 LYS A CG   5  
ATOM   3376  C CD   . LYS A 1 30 ? 7.569   6.224   5.468   1.00 15.00 ?  501 LYS A CD   5  
ATOM   3377  C CE   . LYS A 1 30 ? 8.651   6.001   4.427   1.00 15.00 ?  501 LYS A CE   5  
ATOM   3378  N NZ   . LYS A 1 30 ? 8.626   7.044   3.369   1.00 15.00 1  501 LYS A NZ   5  
ATOM   3379  H H    . LYS A 1 30 ? 4.363   4.680   7.054   1.00 15.00 ?  501 LYS A H    5  
ATOM   3380  H HA   . LYS A 1 30 ? 5.594   4.102   5.222   1.00 15.00 ?  501 LYS A HA   5  
ATOM   3381  H HB2  . LYS A 1 30 ? 7.762   3.235   7.151   1.00 15.00 ?  501 LYS A HB2  5  
ATOM   3382  H HB3  . LYS A 1 30 ? 7.953   3.576   5.438   1.00 15.00 ?  501 LYS A HB3  5  
ATOM   3383  H HG2  . LYS A 1 30 ? 7.098   5.628   7.451   1.00 15.00 ?  501 LYS A HG2  5  
ATOM   3384  H HG3  . LYS A 1 30 ? 8.773   5.353   6.993   1.00 15.00 ?  501 LYS A HG3  5  
ATOM   3385  H HD2  . LYS A 1 30 ? 6.606   6.035   5.018   1.00 15.00 ?  501 LYS A HD2  5  
ATOM   3386  H HD3  . LYS A 1 30 ? 7.615   7.248   5.809   1.00 15.00 ?  501 LYS A HD3  5  
ATOM   3387  H HE2  . LYS A 1 30 ? 9.612   6.021   4.918   1.00 15.00 ?  501 LYS A HE2  5  
ATOM   3388  H HE3  . LYS A 1 30 ? 8.499   5.033   3.972   1.00 15.00 ?  501 LYS A HE3  5  
ATOM   3389  H HZ1  . LYS A 1 30 ? 8.844   7.977   3.782   1.00 15.00 ?  501 LYS A HZ1  5  
ATOM   3390  H HZ2  . LYS A 1 30 ? 7.687   7.088   2.923   1.00 15.00 ?  501 LYS A HZ2  5  
ATOM   3391  H HZ3  . LYS A 1 30 ? 9.336   6.830   2.634   1.00 15.00 ?  501 LYS A HZ3  5  
ATOM   3392  N N    . THR A 1 31 ? 4.419   1.677   6.051   1.00 15.00 ?  502 THR A N    5  
ATOM   3393  C CA   . THR A 1 31 ? 4.067   0.261   6.038   1.00 15.00 ?  502 THR A CA   5  
ATOM   3394  C C    . THR A 1 31 ? 3.065   -0.059  4.923   1.00 15.00 ?  502 THR A C    5  
ATOM   3395  O O    . THR A 1 31 ? 2.195   0.752   4.599   1.00 15.00 ?  502 THR A O    5  
ATOM   3396  C CB   . THR A 1 31 ? 3.470   -0.157  7.398   1.00 15.00 ?  502 THR A CB   5  
ATOM   3397  O OG1  . THR A 1 31 ? 4.309   0.321   8.459   1.00 15.00 ?  502 THR A OG1  5  
ATOM   3398  C CG2  . THR A 1 31 ? 3.340   -1.673  7.504   1.00 15.00 ?  502 THR A CG2  5  
ATOM   3399  H H    . THR A 1 31 ? 3.703   2.346   6.132   1.00 15.00 ?  502 THR A H    5  
ATOM   3400  H HA   . THR A 1 31 ? 4.969   -0.307  5.873   1.00 15.00 ?  502 THR A HA   5  
ATOM   3401  H HB   . THR A 1 31 ? 2.488   0.283   7.497   1.00 15.00 ?  502 THR A HB   5  
ATOM   3402  H HG1  . THR A 1 31 ? 5.076   0.764   8.081   1.00 15.00 ?  502 THR A HG1  5  
ATOM   3403  H HG21 . THR A 1 31 ? 4.315   -2.127  7.416   1.00 15.00 ?  502 THR A HG21 5  
ATOM   3404  H HG22 . THR A 1 31 ? 2.702   -2.037  6.713   1.00 15.00 ?  502 THR A HG22 5  
ATOM   3405  H HG23 . THR A 1 31 ? 2.907   -1.932  8.460   1.00 15.00 ?  502 THR A HG23 5  
ATOM   3406  N N    . THR A 1 32 ? 3.209   -1.237  4.331   1.00 15.00 ?  503 THR A N    5  
ATOM   3407  C CA   . THR A 1 32 ? 2.290   -1.712  3.311   1.00 15.00 ?  503 THR A CA   5  
ATOM   3408  C C    . THR A 1 32 ? 1.324   -2.747  3.894   1.00 15.00 ?  503 THR A C    5  
ATOM   3409  O O    . THR A 1 32 ? 1.663   -3.464  4.836   1.00 15.00 ?  503 THR A O    5  
ATOM   3410  C CB   . THR A 1 32 ? 3.074   -2.334  2.140   1.00 15.00 ?  503 THR A CB   5  
ATOM   3411  O OG1  . THR A 1 32 ? 4.165   -3.113  2.652   1.00 15.00 ?  503 THR A OG1  5  
ATOM   3412  C CG2  . THR A 1 32 ? 3.611   -1.260  1.206   1.00 15.00 ?  503 THR A CG2  5  
ATOM   3413  H H    . THR A 1 32 ? 3.964   -1.811  4.582   1.00 15.00 ?  503 THR A H    5  
ATOM   3414  H HA   . THR A 1 32 ? 1.728   -0.868  2.941   1.00 15.00 ?  503 THR A HA   5  
ATOM   3415  H HB   . THR A 1 32 ? 2.410   -2.979  1.582   1.00 15.00 ?  503 THR A HB   5  
ATOM   3416  H HG1  . THR A 1 32 ? 4.572   -3.612  1.936   1.00 15.00 ?  503 THR A HG1  5  
ATOM   3417  H HG21 . THR A 1 32 ? 2.787   -0.692  0.797   1.00 15.00 ?  503 THR A HG21 5  
ATOM   3418  H HG22 . THR A 1 32 ? 4.161   -1.724  0.402   1.00 15.00 ?  503 THR A HG22 5  
ATOM   3419  H HG23 . THR A 1 32 ? 4.265   -0.599  1.756   1.00 15.00 ?  503 THR A HG23 5  
ATOM   3420  N N    . THR A 1 33 ? 0.117   -2.807  3.347   1.00 15.00 ?  504 THR A N    5  
ATOM   3421  C CA   . THR A 1 33 ? -0.872  -3.780  3.784   1.00 15.00 ?  504 THR A CA   5  
ATOM   3422  C C    . THR A 1 33 ? -1.780  -4.158  2.609   1.00 15.00 ?  504 THR A C    5  
ATOM   3423  O O    . THR A 1 33 ? -1.982  -3.355  1.691   1.00 15.00 ?  504 THR A O    5  
ATOM   3424  C CB   . THR A 1 33 ? -1.703  -3.239  4.979   1.00 15.00 ?  504 THR A CB   5  
ATOM   3425  O OG1  . THR A 1 33 ? -2.101  -4.314  5.843   1.00 15.00 ?  504 THR A OG1  5  
ATOM   3426  C CG2  . THR A 1 33 ? -2.938  -2.486  4.510   1.00 15.00 ?  504 THR A CG2  5  
ATOM   3427  H H    . THR A 1 33 ? -0.120  -2.172  2.633   1.00 15.00 ?  504 THR A H    5  
ATOM   3428  H HA   . THR A 1 33 ? -0.341  -4.663  4.112   1.00 15.00 ?  504 THR A HA   5  
ATOM   3429  H HB   . THR A 1 33 ? -1.082  -2.556  5.542   1.00 15.00 ?  504 THR A HB   5  
ATOM   3430  H HG1  . THR A 1 33 ? -2.709  -4.909  5.369   1.00 15.00 ?  504 THR A HG1  5  
ATOM   3431  H HG21 . THR A 1 33 ? -3.567  -3.150  3.934   1.00 15.00 ?  504 THR A HG21 5  
ATOM   3432  H HG22 . THR A 1 33 ? -2.639  -1.652  3.894   1.00 15.00 ?  504 THR A HG22 5  
ATOM   3433  H HG23 . THR A 1 33 ? -3.487  -2.123  5.367   1.00 15.00 ?  504 THR A HG23 5  
ATOM   3434  N N    . TRP A 1 34 ? -2.290  -5.385  2.618   1.00 15.00 ?  505 TRP A N    5  
ATOM   3435  C CA   . TRP A 1 34 ? -3.111  -5.878  1.514   1.00 15.00 ?  505 TRP A CA   5  
ATOM   3436  C C    . TRP A 1 34 ? -4.590  -5.555  1.710   1.00 15.00 ?  505 TRP A C    5  
ATOM   3437  O O    . TRP A 1 34 ? -5.308  -5.277  0.749   1.00 15.00 ?  505 TRP A O    5  
ATOM   3438  C CB   . TRP A 1 34 ? -2.963  -7.392  1.356   1.00 15.00 ?  505 TRP A CB   5  
ATOM   3439  C CG   . TRP A 1 34 ? -1.604  -7.850  0.923   1.00 15.00 ?  505 TRP A CG   5  
ATOM   3440  C CD1  . TRP A 1 34 ? -0.693  -8.535  1.672   1.00 15.00 ?  505 TRP A CD1  5  
ATOM   3441  C CD2  . TRP A 1 34 ? -1.013  -7.678  -0.369  1.00 15.00 ?  505 TRP A CD2  5  
ATOM   3442  N NE1  . TRP A 1 34 ? 0.423   -8.810  0.921   1.00 15.00 ?  505 TRP A NE1  5  
ATOM   3443  C CE2  . TRP A 1 34 ? 0.252   -8.289  -0.334  1.00 15.00 ?  505 TRP A CE2  5  
ATOM   3444  C CE3  . TRP A 1 34 ? -1.431  -7.066  -1.552  1.00 15.00 ?  505 TRP A CE3  5  
ATOM   3445  C CZ2  . TRP A 1 34 ? 1.101   -8.308  -1.437  1.00 15.00 ?  505 TRP A CZ2  5  
ATOM   3446  C CZ3  . TRP A 1 34 ? -0.589  -7.088  -2.646  1.00 15.00 ?  505 TRP A CZ3  5  
ATOM   3447  C CH2  . TRP A 1 34 ? 0.662   -7.707  -2.582  1.00 15.00 ?  505 TRP A CH2  5  
ATOM   3448  H H    . TRP A 1 34 ? -2.114  -5.972  3.384   1.00 15.00 ?  505 TRP A H    5  
ATOM   3449  H HA   . TRP A 1 34 ? -2.768  -5.399  0.609   1.00 15.00 ?  505 TRP A HA   5  
ATOM   3450  H HB2  . TRP A 1 34 ? -3.180  -7.865  2.300   1.00 15.00 ?  505 TRP A HB2  5  
ATOM   3451  H HB3  . TRP A 1 34 ? -3.677  -7.736  0.620   1.00 15.00 ?  505 TRP A HB3  5  
ATOM   3452  H HD1  . TRP A 1 34 ? -0.845  -8.820  2.703   1.00 15.00 ?  505 TRP A HD1  5  
ATOM   3453  H HE1  . TRP A 1 34 ? 1.215   -9.299  1.235   1.00 15.00 ?  505 TRP A HE1  5  
ATOM   3454  H HE3  . TRP A 1 34 ? -2.391  -6.578  -1.619  1.00 15.00 ?  505 TRP A HE3  5  
ATOM   3455  H HZ2  . TRP A 1 34 ? 2.071   -8.781  -1.404  1.00 15.00 ?  505 TRP A HZ2  5  
ATOM   3456  H HZ3  . TRP A 1 34 ? -0.899  -6.626  -3.572  1.00 15.00 ?  505 TRP A HZ3  5  
ATOM   3457  H HH2  . TRP A 1 34 ? 1.284   -7.703  -3.467  1.00 15.00 ?  505 TRP A HH2  5  
ATOM   3458  N N    . GLU A 1 35 ? -5.046  -5.627  2.951   1.00 15.00 ?  506 GLU A N    5  
ATOM   3459  C CA   . GLU A 1 35 ? -6.465  -5.503  3.254   1.00 15.00 ?  506 GLU A CA   5  
ATOM   3460  C C    . GLU A 1 35 ? -6.901  -4.063  3.344   1.00 15.00 ?  506 GLU A C    5  
ATOM   3461  O O    . GLU A 1 35 ? -6.199  -3.206  3.881   1.00 15.00 ?  506 GLU A O    5  
ATOM   3462  C CB   . GLU A 1 35 ? -6.821  -6.255  4.546   1.00 15.00 ?  506 GLU A CB   5  
ATOM   3463  C CG   . GLU A 1 35 ? -5.954  -5.903  5.749   1.00 15.00 ?  506 GLU A CG   5  
ATOM   3464  C CD   . GLU A 1 35 ? -4.645  -6.667  5.778   1.00 15.00 ?  506 GLU A CD   5  
ATOM   3465  O OE1  . GLU A 1 35 ? -3.671  -6.223  5.133   1.00 15.00 ?  506 GLU A OE1  5  
ATOM   3466  O OE2  . GLU A 1 35 ? -4.581  -7.713  6.452   1.00 15.00 -1 506 GLU A OE2  5  
ATOM   3467  H H    . GLU A 1 35 ? -4.408  -5.763  3.689   1.00 15.00 ?  506 GLU A H    5  
ATOM   3468  H HA   . GLU A 1 35 ? -7.012  -5.938  2.439   1.00 15.00 ?  506 GLU A HA   5  
ATOM   3469  H HB2  . GLU A 1 35 ? -7.847  -6.035  4.800   1.00 15.00 ?  506 GLU A HB2  5  
ATOM   3470  H HB3  . GLU A 1 35 ? -6.728  -7.315  4.363   1.00 15.00 ?  506 GLU A HB3  5  
ATOM   3471  H HG2  . GLU A 1 35 ? -5.734  -4.847  5.720   1.00 15.00 ?  506 GLU A HG2  5  
ATOM   3472  H HG3  . GLU A 1 35 ? -6.505  -6.129  6.650   1.00 15.00 ?  506 GLU A HG3  5  
ATOM   3473  N N    . ASP A 1 36 ? -8.090  -3.821  2.818   1.00 15.00 ?  507 ASP A N    5  
ATOM   3474  C CA   . ASP A 1 36 ? -8.647  -2.493  2.783   1.00 15.00 ?  507 ASP A CA   5  
ATOM   3475  C C    . ASP A 1 36 ? -9.082  -2.056  4.181   1.00 15.00 ?  507 ASP A C    5  
ATOM   3476  O O    . ASP A 1 36 ? -9.872  -2.735  4.842   1.00 15.00 ?  507 ASP A O    5  
ATOM   3477  C CB   . ASP A 1 36 ? -9.815  -2.418  1.790   1.00 15.00 ?  507 ASP A CB   5  
ATOM   3478  C CG   . ASP A 1 36 ? -10.882 -3.469  2.044   1.00 15.00 ?  507 ASP A CG   5  
ATOM   3479  O OD1  . ASP A 1 36 ? -10.640 -4.651  1.718   1.00 15.00 ?  507 ASP A OD1  5  
ATOM   3480  O OD2  . ASP A 1 36 ? -11.971 -3.119  2.552   1.00 15.00 -1 507 ASP A OD2  5  
ATOM   3481  H H    . ASP A 1 36 ? -8.609  -4.566  2.443   1.00 15.00 ?  507 ASP A H    5  
ATOM   3482  H HA   . ASP A 1 36 ? -7.859  -1.851  2.446   1.00 15.00 ?  507 ASP A HA   5  
ATOM   3483  H HB2  . ASP A 1 36 ? -10.269 -1.444  1.857   1.00 15.00 ?  507 ASP A HB2  5  
ATOM   3484  H HB3  . ASP A 1 36 ? -9.432  -2.559  0.790   1.00 15.00 ?  507 ASP A HB3  5  
ATOM   3485  N N    . PRO A 1 37 ? -8.558  -0.913  4.650   1.00 15.00 ?  508 PRO A N    5  
ATOM   3486  C CA   . PRO A 1 37 ? -8.786  -0.433  6.012   1.00 15.00 ?  508 PRO A CA   5  
ATOM   3487  C C    . PRO A 1 37 ? -10.098 0.333   6.185   1.00 15.00 ?  508 PRO A C    5  
ATOM   3488  O O    . PRO A 1 37 ? -10.502 0.625   7.311   1.00 15.00 ?  508 PRO A O    5  
ATOM   3489  C CB   . PRO A 1 37 ? -7.593  0.493   6.237   1.00 15.00 ?  508 PRO A CB   5  
ATOM   3490  C CG   . PRO A 1 37 ? -7.318  1.068   4.889   1.00 15.00 ?  508 PRO A CG   5  
ATOM   3491  C CD   . PRO A 1 37 ? -7.674  -0.007  3.890   1.00 15.00 ?  508 PRO A CD   5  
ATOM   3492  H HA   . PRO A 1 37 ? -8.749  -1.242  6.726   1.00 15.00 ?  508 PRO A HA   5  
ATOM   3493  H HB2  . PRO A 1 37 ? -7.854  1.261   6.952   1.00 15.00 ?  508 PRO A HB2  5  
ATOM   3494  H HB3  . PRO A 1 37 ? -6.752  -0.078  6.600   1.00 15.00 ?  508 PRO A HB3  5  
ATOM   3495  H HG2  . PRO A 1 37 ? -7.932  1.942   4.732   1.00 15.00 ?  508 PRO A HG2  5  
ATOM   3496  H HG3  . PRO A 1 37 ? -6.273  1.324   4.804   1.00 15.00 ?  508 PRO A HG3  5  
ATOM   3497  H HD2  . PRO A 1 37 ? -8.196  0.422   3.047   1.00 15.00 ?  508 PRO A HD2  5  
ATOM   3498  H HD3  . PRO A 1 37 ? -6.786  -0.524  3.560   1.00 15.00 ?  508 PRO A HD3  5  
ATOM   3499  N N    . ARG A 1 38 ? -10.747 0.674   5.077   1.00 15.00 ?  509 ARG A N    5  
ATOM   3500  C CA   . ARG A 1 38 ? -11.985 1.446   5.118   1.00 15.00 ?  509 ARG A CA   5  
ATOM   3501  C C    . ARG A 1 38 ? -12.596 1.543   3.724   1.00 15.00 ?  509 ARG A C    5  
ATOM   3502  O O    . ARG A 1 38 ? -13.444 0.690   3.390   1.00 15.00 ?  509 ARG A O    5  
ATOM   3503  C CB   . ARG A 1 38 ? -11.729 2.848   5.684   1.00 15.00 ?  509 ARG A CB   5  
ATOM   3504  C CG   . ARG A 1 38 ? -12.988 3.683   5.856   1.00 15.00 ?  509 ARG A CG   5  
ATOM   3505  C CD   . ARG A 1 38 ? -12.683 5.026   6.499   1.00 15.00 ?  509 ARG A CD   5  
ATOM   3506  N NE   . ARG A 1 38 ? -13.867 5.879   6.597   1.00 15.00 ?  509 ARG A NE   5  
ATOM   3507  C CZ   . ARG A 1 38 ? -14.088 6.737   7.591   1.00 15.00 ?  509 ARG A CZ   5  
ATOM   3508  N NH1  . ARG A 1 38 ? -13.257 6.791   8.627   1.00 15.00 1  509 ARG A NH1  5  
ATOM   3509  N NH2  . ARG A 1 38 ? -15.159 7.523   7.562   1.00 15.00 ?  509 ARG A NH2  5  
ATOM   3510  H H    . ARG A 1 38 ? -10.391 0.391   4.209   1.00 15.00 ?  509 ARG A H    5  
ATOM   3511  H HA   . ARG A 1 38 ? -12.678 0.926   5.764   1.00 15.00 ?  509 ARG A HA   5  
ATOM   3512  H HB2  . ARG A 1 38 ? -11.253 2.752   6.650   1.00 15.00 ?  509 ARG A HB2  5  
ATOM   3513  H HB3  . ARG A 1 38 ? -11.063 3.375   5.017   1.00 15.00 ?  509 ARG A HB3  5  
ATOM   3514  H HG2  . ARG A 1 38 ? -13.431 3.852   4.885   1.00 15.00 ?  509 ARG A HG2  5  
ATOM   3515  H HG3  . ARG A 1 38 ? -13.686 3.144   6.481   1.00 15.00 ?  509 ARG A HG3  5  
ATOM   3516  H HD2  . ARG A 1 38 ? -12.293 4.854   7.492   1.00 15.00 ?  509 ARG A HD2  5  
ATOM   3517  H HD3  . ARG A 1 38 ? -11.936 5.533   5.905   1.00 15.00 ?  509 ARG A HD3  5  
ATOM   3518  H HE   . ARG A 1 38 ? -14.527 5.826   5.860   1.00 15.00 ?  509 ARG A HE   5  
ATOM   3519  H HH11 . ARG A 1 38 ? -12.457 6.183   8.669   1.00 15.00 ?  509 ARG A HH11 5  
ATOM   3520  H HH12 . ARG A 1 38 ? -13.428 7.439   9.378   1.00 15.00 ?  509 ARG A HH12 5  
ATOM   3521  H HH21 . ARG A 1 38 ? -15.805 7.470   6.792   1.00 15.00 ?  509 ARG A HH21 5  
ATOM   3522  H HH22 . ARG A 1 38 ? -15.323 8.181   8.303   1.00 15.00 ?  509 ARG A HH22 5  
ATOM   3523  N N    . ARG B 2 1  ? -0.994  -17.839 3.042   1.00 15.00 ?  925 ARG B N    5  
ATOM   3524  C CA   . ARG B 2 1  ? -0.673  -16.426 3.344   1.00 15.00 ?  925 ARG B CA   5  
ATOM   3525  C C    . ARG B 2 1  ? -0.147  -15.715 2.101   1.00 15.00 ?  925 ARG B C    5  
ATOM   3526  O O    . ARG B 2 1  ? 0.800   -16.182 1.464   1.00 15.00 ?  925 ARG B O    5  
ATOM   3527  C CB   . ARG B 2 1  ? 0.377   -16.355 4.455   1.00 15.00 ?  925 ARG B CB   5  
ATOM   3528  C CG   . ARG B 2 1  ? 0.747   -14.940 4.867   1.00 15.00 ?  925 ARG B CG   5  
ATOM   3529  C CD   . ARG B 2 1  ? 1.898   -14.949 5.856   1.00 15.00 ?  925 ARG B CD   5  
ATOM   3530  N NE   . ARG B 2 1  ? 3.079   -15.604 5.296   1.00 15.00 ?  925 ARG B NE   5  
ATOM   3531  C CZ   . ARG B 2 1  ? 3.911   -16.372 5.996   1.00 15.00 ?  925 ARG B CZ   5  
ATOM   3532  N NH1  . ARG B 2 1  ? 3.695   -16.585 7.289   1.00 15.00 1  925 ARG B NH1  5  
ATOM   3533  N NH2  . ARG B 2 1  ? 4.954   -16.936 5.397   1.00 15.00 ?  925 ARG B NH2  5  
ATOM   3534  H H1   . ARG B 2 1  ? -1.731  -17.894 2.305   1.00 15.00 ?  925 ARG B H1   5  
ATOM   3535  H H2   . ARG B 2 1  ? -1.336  -18.320 3.900   1.00 15.00 ?  925 ARG B H2   5  
ATOM   3536  H H3   . ARG B 2 1  ? -0.141  -18.333 2.699   1.00 15.00 ?  925 ARG B H3   5  
ATOM   3537  H HA   . ARG B 2 1  ? -1.575  -15.933 3.677   1.00 15.00 ?  925 ARG B HA   5  
ATOM   3538  H HB2  . ARG B 2 1  ? -0.001  -16.872 5.324   1.00 15.00 ?  925 ARG B HB2  5  
ATOM   3539  H HB3  . ARG B 2 1  ? 1.273   -16.854 4.115   1.00 15.00 ?  925 ARG B HB3  5  
ATOM   3540  H HG2  . ARG B 2 1  ? 1.042   -14.384 3.990   1.00 15.00 ?  925 ARG B HG2  5  
ATOM   3541  H HG3  . ARG B 2 1  ? -0.111  -14.471 5.327   1.00 15.00 ?  925 ARG B HG3  5  
ATOM   3542  H HD2  . ARG B 2 1  ? 2.147   -13.929 6.112   1.00 15.00 ?  925 ARG B HD2  5  
ATOM   3543  H HD3  . ARG B 2 1  ? 1.589   -15.479 6.745   1.00 15.00 ?  925 ARG B HD3  5  
ATOM   3544  H HE   . ARG B 2 1  ? 3.257   -15.468 4.329   1.00 15.00 ?  925 ARG B HE   5  
ATOM   3545  H HH11 . ARG B 2 1  ? 2.908   -16.166 7.745   1.00 15.00 ?  925 ARG B HH11 5  
ATOM   3546  H HH12 . ARG B 2 1  ? 4.313   -17.185 7.814   1.00 15.00 ?  925 ARG B HH12 5  
ATOM   3547  H HH21 . ARG B 2 1  ? 5.116   -16.787 4.418   1.00 15.00 ?  925 ARG B HH21 5  
ATOM   3548  H HH22 . ARG B 2 1  ? 5.590   -17.517 5.925   1.00 15.00 ?  925 ARG B HH22 5  
ATOM   3549  N N    . LEU B 2 2  ? -0.751  -14.583 1.769   1.00 15.00 ?  926 LEU B N    5  
ATOM   3550  C CA   . LEU B 2 2  ? -0.300  -13.776 0.644   1.00 15.00 ?  926 LEU B CA   5  
ATOM   3551  C C    . LEU B 2 2  ? 0.978   -13.044 1.035   1.00 15.00 ?  926 LEU B C    5  
ATOM   3552  O O    . LEU B 2 2  ? 1.009   -12.335 2.040   1.00 15.00 ?  926 LEU B O    5  
ATOM   3553  C CB   . LEU B 2 2  ? -1.388  -12.777 0.239   1.00 15.00 ?  926 LEU B CB   5  
ATOM   3554  C CG   . LEU B 2 2  ? -1.104  -11.974 -1.032  1.00 15.00 ?  926 LEU B CG   5  
ATOM   3555  C CD1  . LEU B 2 2  ? -0.916  -12.900 -2.224  1.00 15.00 ?  926 LEU B CD1  5  
ATOM   3556  C CD2  . LEU B 2 2  ? -2.234  -10.993 -1.297  1.00 15.00 ?  926 LEU B CD2  5  
ATOM   3557  H H    . LEU B 2 2  ? -1.514  -14.269 2.309   1.00 15.00 ?  926 LEU B H    5  
ATOM   3558  H HA   . LEU B 2 2  ? -0.092  -14.437 -0.183  1.00 15.00 ?  926 LEU B HA   5  
ATOM   3559  H HB2  . LEU B 2 2  ? -2.311  -13.322 0.096   1.00 15.00 ?  926 LEU B HB2  5  
ATOM   3560  H HB3  . LEU B 2 2  ? -1.526  -12.082 1.054   1.00 15.00 ?  926 LEU B HB3  5  
ATOM   3561  H HG   . LEU B 2 2  ? -0.194  -11.408 -0.899  1.00 15.00 ?  926 LEU B HG   5  
ATOM   3562  H HD11 . LEU B 2 2  ? -0.710  -12.312 -3.106  1.00 15.00 ?  926 LEU B HD11 5  
ATOM   3563  H HD12 . LEU B 2 2  ? -1.816  -13.477 -2.377  1.00 15.00 ?  926 LEU B HD12 5  
ATOM   3564  H HD13 . LEU B 2 2  ? -0.088  -13.567 -2.033  1.00 15.00 ?  926 LEU B HD13 5  
ATOM   3565  H HD21 . LEU B 2 2  ? -2.315  -10.307 -0.468  1.00 15.00 ?  926 LEU B HD21 5  
ATOM   3566  H HD22 . LEU B 2 2  ? -3.161  -11.534 -1.409  1.00 15.00 ?  926 LEU B HD22 5  
ATOM   3567  H HD23 . LEU B 2 2  ? -2.027  -10.442 -2.202  1.00 15.00 ?  926 LEU B HD23 5  
ATOM   3568  N N    . ASP B 2 3  ? 2.029   -13.219 0.244   1.00 15.00 ?  927 ASP B N    5  
ATOM   3569  C CA   . ASP B 2 3  ? 3.337   -12.677 0.590   1.00 15.00 ?  927 ASP B CA   5  
ATOM   3570  C C    . ASP B 2 3  ? 3.344   -11.161 0.488   1.00 15.00 ?  927 ASP B C    5  
ATOM   3571  O O    . ASP B 2 3  ? 3.103   -10.596 -0.579  1.00 15.00 ?  927 ASP B O    5  
ATOM   3572  C CB   . ASP B 2 3  ? 4.425   -13.262 -0.320  1.00 15.00 ?  927 ASP B CB   5  
ATOM   3573  C CG   . ASP B 2 3  ? 4.493   -14.773 -0.254  1.00 15.00 ?  927 ASP B CG   5  
ATOM   3574  O OD1  . ASP B 2 3  ? 5.175   -15.309 0.647   1.00 15.00 ?  927 ASP B OD1  5  
ATOM   3575  O OD2  . ASP B 2 3  ? 3.862   -15.436 -1.105  1.00 15.00 -1 927 ASP B OD2  5  
ATOM   3576  H H    . ASP B 2 3  ? 1.920   -13.712 -0.598  1.00 15.00 ?  927 ASP B H    5  
ATOM   3577  H HA   . ASP B 2 3  ? 3.549   -12.956 1.611   1.00 15.00 ?  927 ASP B HA   5  
ATOM   3578  H HB2  . ASP B 2 3  ? 4.222   -12.976 -1.341  1.00 15.00 ?  927 ASP B HB2  5  
ATOM   3579  H HB3  . ASP B 2 3  ? 5.384   -12.862 -0.024  1.00 15.00 ?  927 ASP B HB3  5  
ATOM   3580  N N    . LEU B 2 4  ? 3.625   -10.509 1.601   1.00 15.00 ?  928 LEU B N    5  
ATOM   3581  C CA   . LEU B 2 4  ? 3.741   -9.062  1.634   1.00 15.00 ?  928 LEU B CA   5  
ATOM   3582  C C    . LEU B 2 4  ? 5.204   -8.663  1.516   1.00 15.00 ?  928 LEU B C    5  
ATOM   3583  O O    . LEU B 2 4  ? 6.023   -9.052  2.349   1.00 15.00 ?  928 LEU B O    5  
ATOM   3584  C CB   . LEU B 2 4  ? 3.152   -8.514  2.939   1.00 15.00 ?  928 LEU B CB   5  
ATOM   3585  C CG   . LEU B 2 4  ? 3.252   -6.996  3.130   1.00 15.00 ?  928 LEU B CG   5  
ATOM   3586  C CD1  . LEU B 2 4  ? 2.420   -6.260  2.089   1.00 15.00 ?  928 LEU B CD1  5  
ATOM   3587  C CD2  . LEU B 2 4  ? 2.812   -6.611  4.535   1.00 15.00 ?  928 LEU B CD2  5  
ATOM   3588  H H    . LEU B 2 4  ? 3.757   -11.016 2.430   1.00 15.00 ?  928 LEU B H    5  
ATOM   3589  H HA   . LEU B 2 4  ? 3.192   -8.659  0.796   1.00 15.00 ?  928 LEU B HA   5  
ATOM   3590  H HB2  . LEU B 2 4  ? 2.108   -8.789  2.979   1.00 15.00 ?  928 LEU B HB2  5  
ATOM   3591  H HB3  . LEU B 2 4  ? 3.661   -8.990  3.764   1.00 15.00 ?  928 LEU B HB3  5  
ATOM   3592  H HG   . LEU B 2 4  ? 4.281   -6.694  3.007   1.00 15.00 ?  928 LEU B HG   5  
ATOM   3593  H HD11 . LEU B 2 4  ? 2.506   -5.195  2.246   1.00 15.00 ?  928 LEU B HD11 5  
ATOM   3594  H HD12 . LEU B 2 4  ? 1.386   -6.555  2.183   1.00 15.00 ?  928 LEU B HD12 5  
ATOM   3595  H HD13 . LEU B 2 4  ? 2.778   -6.509  1.101   1.00 15.00 ?  928 LEU B HD13 5  
ATOM   3596  H HD21 . LEU B 2 4  ? 1.798   -6.944  4.699   1.00 15.00 ?  928 LEU B HD21 5  
ATOM   3597  H HD22 . LEU B 2 4  ? 2.861   -5.538  4.646   1.00 15.00 ?  928 LEU B HD22 5  
ATOM   3598  H HD23 . LEU B 2 4  ? 3.465   -7.078  5.259   1.00 15.00 ?  928 LEU B HD23 5  
ATOM   3599  N N    . PRO B 2 5  ? 5.558   -7.900  0.473   1.00 15.00 ?  929 PRO B N    5  
ATOM   3600  C CA   . PRO B 2 5  ? 6.925   -7.423  0.293   1.00 15.00 ?  929 PRO B CA   5  
ATOM   3601  C C    . PRO B 2 5  ? 7.265   -6.299  1.267   1.00 15.00 ?  929 PRO B C    5  
ATOM   3602  O O    . PRO B 2 5  ? 6.504   -5.335  1.397   1.00 15.00 ?  929 PRO B O    5  
ATOM   3603  C CB   . PRO B 2 5  ? 6.932   -6.911  -1.149  1.00 15.00 ?  929 PRO B CB   5  
ATOM   3604  C CG   . PRO B 2 5  ? 5.525   -6.499  -1.407  1.00 15.00 ?  929 PRO B CG   5  
ATOM   3605  C CD   . PRO B 2 5  ? 4.662   -7.443  -0.611  1.00 15.00 ?  929 PRO B CD   5  
ATOM   3606  H HA   . PRO B 2 5  ? 7.643   -8.223  0.400   1.00 15.00 ?  929 PRO B HA   5  
ATOM   3607  H HB2  . PRO B 2 5  ? 7.612   -6.075  -1.234  1.00 15.00 ?  929 PRO B HB2  5  
ATOM   3608  H HB3  . PRO B 2 5  ? 7.239   -7.703  -1.814  1.00 15.00 ?  929 PRO B HB3  5  
ATOM   3609  H HG2  . PRO B 2 5  ? 5.373   -5.482  -1.076  1.00 15.00 ?  929 PRO B HG2  5  
ATOM   3610  H HG3  . PRO B 2 5  ? 5.304   -6.589  -2.461  1.00 15.00 ?  929 PRO B HG3  5  
ATOM   3611  H HD2  . PRO B 2 5  ? 3.804   -6.922  -0.212  1.00 15.00 ?  929 PRO B HD2  5  
ATOM   3612  H HD3  . PRO B 2 5  ? 4.347   -8.272  -1.227  1.00 15.00 ?  929 PRO B HD3  5  
ATOM   3613  N N    . PRO B 2 6  ? 8.402   -6.421  1.979   1.00 15.00 ?  930 PRO B N    5  
ATOM   3614  C CA   . PRO B 2 6  ? 8.901   -5.362  2.859   1.00 15.00 ?  930 PRO B CA   5  
ATOM   3615  C C    . PRO B 2 6  ? 8.965   -4.036  2.117   1.00 15.00 ?  930 PRO B C    5  
ATOM   3616  O O    . PRO B 2 6  ? 9.417   -3.990  0.968   1.00 15.00 ?  930 PRO B O    5  
ATOM   3617  C CB   . PRO B 2 6  ? 10.304  -5.843  3.232   1.00 15.00 ?  930 PRO B CB   5  
ATOM   3618  C CG   . PRO B 2 6  ? 10.244  -7.325  3.100   1.00 15.00 ?  930 PRO B CG   5  
ATOM   3619  C CD   . PRO B 2 6  ? 9.285   -7.601  1.975   1.00 15.00 ?  930 PRO B CD   5  
ATOM   3620  H HA   . PRO B 2 6  ? 8.296   -5.255  3.747   1.00 15.00 ?  930 PRO B HA   5  
ATOM   3621  H HB2  . PRO B 2 6  ? 11.027  -5.415  2.554   1.00 15.00 ?  930 PRO B HB2  5  
ATOM   3622  H HB3  . PRO B 2 6  ? 10.532  -5.548  4.245   1.00 15.00 ?  930 PRO B HB3  5  
ATOM   3623  H HG2  . PRO B 2 6  ? 11.223  -7.712  2.862   1.00 15.00 ?  930 PRO B HG2  5  
ATOM   3624  H HG3  . PRO B 2 6  ? 9.879   -7.761  4.018   1.00 15.00 ?  930 PRO B HG3  5  
ATOM   3625  H HD2  . PRO B 2 6  ? 9.817   -7.682  1.037   1.00 15.00 ?  930 PRO B HD2  5  
ATOM   3626  H HD3  . PRO B 2 6  ? 8.725   -8.504  2.169   1.00 15.00 ?  930 PRO B HD3  5  
ATOM   3627  N N    . TYR B 2 7  ? 8.522   -2.968  2.771   1.00 15.00 ?  931 TYR B N    5  
ATOM   3628  C CA   . TYR B 2 7  ? 8.312   -1.691  2.101   1.00 15.00 ?  931 TYR B CA   5  
ATOM   3629  C C    . TYR B 2 7  ? 9.559   -1.221  1.353   1.00 15.00 ?  931 TYR B C    5  
ATOM   3630  O O    . TYR B 2 7  ? 10.630  -1.014  1.932   1.00 15.00 ?  931 TYR B O    5  
ATOM   3631  C CB   . TYR B 2 7  ? 7.871   -0.645  3.138   1.00 15.00 ?  931 TYR B CB   5  
ATOM   3632  C CG   . TYR B 2 7  ? 7.743   0.776   2.616   1.00 15.00 ?  931 TYR B CG   5  
ATOM   3633  C CD1  . TYR B 2 7  ? 6.773   1.129   1.681   1.00 15.00 ?  931 TYR B CD1  5  
ATOM   3634  C CD2  . TYR B 2 7  ? 8.587   1.776   3.085   1.00 15.00 ?  931 TYR B CD2  5  
ATOM   3635  C CE1  . TYR B 2 7  ? 6.657   2.432   1.230   1.00 15.00 ?  931 TYR B CE1  5  
ATOM   3636  C CE2  . TYR B 2 7  ? 8.477   3.074   2.637   1.00 15.00 ?  931 TYR B CE2  5  
ATOM   3637  C CZ   . TYR B 2 7  ? 7.513   3.399   1.712   1.00 15.00 ?  931 TYR B CZ   5  
ATOM   3638  O OH   . TYR B 2 7  ? 7.400   4.699   1.272   1.00 15.00 ?  931 TYR B OH   5  
ATOM   3639  H H    . TYR B 2 7  ? 8.331   -3.043  3.736   1.00 15.00 ?  931 TYR B H    5  
ATOM   3640  H HA   . TYR B 2 7  ? 7.516   -1.825  1.387   1.00 15.00 ?  931 TYR B HA   5  
ATOM   3641  H HB2  . TYR B 2 7  ? 6.909   -0.934  3.533   1.00 15.00 ?  931 TYR B HB2  5  
ATOM   3642  H HB3  . TYR B 2 7  ? 8.590   -0.634  3.946   1.00 15.00 ?  931 TYR B HB3  5  
ATOM   3643  H HD1  . TYR B 2 7  ? 6.103   0.372   1.303   1.00 15.00 ?  931 TYR B HD1  5  
ATOM   3644  H HD2  . TYR B 2 7  ? 9.341   1.525   3.816   1.00 15.00 ?  931 TYR B HD2  5  
ATOM   3645  H HE1  . TYR B 2 7  ? 5.899   2.687   0.506   1.00 15.00 ?  931 TYR B HE1  5  
ATOM   3646  H HE2  . TYR B 2 7  ? 9.146   3.832   3.014   1.00 15.00 ?  931 TYR B HE2  5  
ATOM   3647  H HH   . TYR B 2 7  ? 8.286   5.049   1.088   1.00 15.00 ?  931 TYR B HH   5  
ATOM   3648  N N    . GLU B 2 8  ? 9.382   -1.081  0.050   1.00 15.00 ?  932 GLU B N    5  
ATOM   3649  C CA   . GLU B 2 8  ? 10.342  -0.439  -0.829  1.00 15.00 ?  932 GLU B CA   5  
ATOM   3650  C C    . GLU B 2 8  ? 9.741   0.878   -1.263  1.00 15.00 ?  932 GLU B C    5  
ATOM   3651  O O    . GLU B 2 8  ? 8.514   1.008   -1.274  1.00 15.00 ?  932 GLU B O    5  
ATOM   3652  C CB   . GLU B 2 8  ? 10.606  -1.312  -2.061  1.00 15.00 ?  932 GLU B CB   5  
ATOM   3653  C CG   . GLU B 2 8  ? 11.200  -2.675  -1.745  1.00 15.00 ?  932 GLU B CG   5  
ATOM   3654  C CD   . GLU B 2 8  ? 12.628  -2.592  -1.253  1.00 15.00 ?  932 GLU B CD   5  
ATOM   3655  O OE1  . GLU B 2 8  ? 13.543  -2.464  -2.096  1.00 15.00 ?  932 GLU B OE1  5  
ATOM   3656  O OE2  . GLU B 2 8  ? 12.847  -2.662  -0.025  1.00 15.00 -1 932 GLU B OE2  5  
ATOM   3657  H H    . GLU B 2 8  ? 8.549   -1.414  -0.342  1.00 15.00 ?  932 GLU B H    5  
ATOM   3658  H HA   . GLU B 2 8  ? 11.260  -0.267  -0.288  1.00 15.00 ?  932 GLU B HA   5  
ATOM   3659  H HB2  . GLU B 2 8  ? 9.674   -1.465  -2.583  1.00 15.00 ?  932 GLU B HB2  5  
ATOM   3660  H HB3  . GLU B 2 8  ? 11.290  -0.791  -2.713  1.00 15.00 ?  932 GLU B HB3  5  
ATOM   3661  H HG2  . GLU B 2 8  ? 10.601  -3.146  -0.979  1.00 15.00 ?  932 GLU B HG2  5  
ATOM   3662  H HG3  . GLU B 2 8  ? 11.177  -3.280  -2.639  1.00 15.00 ?  932 GLU B HG3  5  
ATOM   3663  N N    . THR B 2 9  ? 10.541  1.848   -1.654  1.00 15.00 ?  933 THR B N    5  
ATOM   3664  C CA   . THR B 2 9  ? 9.940   3.060   -2.147  1.00 15.00 ?  933 THR B CA   5  
ATOM   3665  C C    . THR B 2 9  ? 9.603   2.915   -3.623  1.00 15.00 ?  933 THR B C    5  
ATOM   3666  O O    . THR B 2 9  ? 10.462  2.675   -4.471  1.00 15.00 ?  933 THR B O    5  
ATOM   3667  C CB   . THR B 2 9  ? 10.803  4.313   -1.928  1.00 15.00 ?  933 THR B CB   5  
ATOM   3668  O OG1  . THR B 2 9  ? 11.274  4.356   -0.574  1.00 15.00 ?  933 THR B OG1  5  
ATOM   3669  C CG2  . THR B 2 9  ? 9.972   5.563   -2.218  1.00 15.00 ?  933 THR B CG2  5  
ATOM   3670  H H    . THR B 2 9  ? 11.516  1.745   -1.628  1.00 15.00 ?  933 THR B H    5  
ATOM   3671  H HA   . THR B 2 9  ? 9.016   3.199   -1.605  1.00 15.00 ?  933 THR B HA   5  
ATOM   3672  H HB   . THR B 2 9  ? 11.645  4.289   -2.604  1.00 15.00 ?  933 THR B HB   5  
ATOM   3673  H HG1  . THR B 2 9  ? 12.247  4.435   -0.574  1.00 15.00 ?  933 THR B HG1  5  
ATOM   3674  H HG21 . THR B 2 9  ? 9.073   5.552   -1.611  1.00 15.00 ?  933 THR B HG21 5  
ATOM   3675  H HG22 . THR B 2 9  ? 9.693   5.575   -3.263  1.00 15.00 ?  933 THR B HG22 5  
ATOM   3676  H HG23 . THR B 2 9  ? 10.550  6.445   -1.989  1.00 15.00 ?  933 THR B HG23 5  
ATOM   3677  N N    . PHE B 2 10 ? 8.326   3.052   -3.881  1.00 15.00 ?  934 PHE B N    5  
ATOM   3678  C CA   . PHE B 2 10 ? 7.755   3.088   -5.207  1.00 15.00 ?  934 PHE B CA   5  
ATOM   3679  C C    . PHE B 2 10 ? 7.628   4.555   -5.602  1.00 15.00 ?  934 PHE B C    5  
ATOM   3680  O O    . PHE B 2 10 ? 8.043   5.425   -4.835  1.00 15.00 ?  934 PHE B O    5  
ATOM   3681  C CB   . PHE B 2 10 ? 6.391   2.389   -5.221  1.00 15.00 ?  934 PHE B CB   5  
ATOM   3682  C CG   . PHE B 2 10 ? 5.345   3.192   -4.526  1.00 15.00 ?  934 PHE B CG   5  
ATOM   3683  C CD1  . PHE B 2 10 ? 5.297   3.254   -3.145  1.00 15.00 ?  934 PHE B CD1  5  
ATOM   3684  C CD2  . PHE B 2 10 ? 4.450   3.936   -5.260  1.00 15.00 ?  934 PHE B CD2  5  
ATOM   3685  C CE1  . PHE B 2 10 ? 4.361   4.041   -2.517  1.00 15.00 ?  934 PHE B CE1  5  
ATOM   3686  C CE2  . PHE B 2 10 ? 3.526   4.731   -4.642  1.00 15.00 ?  934 PHE B CE2  5  
ATOM   3687  C CZ   . PHE B 2 10 ? 3.480   4.784   -3.272  1.00 15.00 ?  934 PHE B CZ   5  
ATOM   3688  H H    . PHE B 2 10 ? 7.715   3.140   -3.121  1.00 15.00 ?  934 PHE B H    5  
ATOM   3689  H HA   . PHE B 2 10 ? 8.431   2.590   -5.889  1.00 15.00 ?  934 PHE B HA   5  
ATOM   3690  H HB2  . PHE B 2 10 ? 6.076   2.233   -6.243  1.00 15.00 ?  934 PHE B HB2  5  
ATOM   3691  H HB3  . PHE B 2 10 ? 6.472   1.436   -4.720  1.00 15.00 ?  934 PHE B HB3  5  
ATOM   3692  H HD1  . PHE B 2 10 ? 5.990   2.666   -2.561  1.00 15.00 ?  934 PHE B HD1  5  
ATOM   3693  H HD2  . PHE B 2 10 ? 4.484   3.887   -6.337  1.00 15.00 ?  934 PHE B HD2  5  
ATOM   3694  H HE1  . PHE B 2 10 ? 4.322   4.084   -1.439  1.00 15.00 ?  934 PHE B HE1  5  
ATOM   3695  H HE2  . PHE B 2 10 ? 2.829   5.311   -5.230  1.00 15.00 ?  934 PHE B HE2  5  
ATOM   3696  H HZ   . PHE B 2 10 ? 2.771   5.412   -2.799  1.00 15.00 ?  934 PHE B HZ   5  
ATOM   3697  N N    . GLU B 2 11 ? 7.096   4.827   -6.785  1.00 15.00 ?  935 GLU B N    5  
ATOM   3698  C CA   . GLU B 2 11 ? 6.991   6.192   -7.294  1.00 15.00 ?  935 GLU B CA   5  
ATOM   3699  C C    . GLU B 2 11 ? 6.406   7.136   -6.235  1.00 15.00 ?  935 GLU B C    5  
ATOM   3700  O O    . GLU B 2 11 ? 5.300   6.936   -5.730  1.00 15.00 ?  935 GLU B O    5  
ATOM   3701  C CB   . GLU B 2 11 ? 6.088   6.210   -8.534  1.00 15.00 ?  935 GLU B CB   5  
ATOM   3702  C CG   . GLU B 2 11 ? 4.775   5.444   -8.357  1.00 15.00 ?  935 GLU B CG   5  
ATOM   3703  C CD   . GLU B 2 11 ? 4.922   3.946   -8.602  1.00 15.00 ?  935 GLU B CD   5  
ATOM   3704  O OE1  . GLU B 2 11 ? 6.019   3.507   -9.013  1.00 15.00 ?  935 GLU B OE1  5  
ATOM   3705  O OE2  . GLU B 2 11 ? 3.939   3.202   -8.386  1.00 15.00 -1 935 GLU B OE2  5  
ATOM   3706  H H    . GLU B 2 11 ? 6.758   4.086   -7.339  1.00 15.00 ?  935 GLU B H    5  
ATOM   3707  H HA   . GLU B 2 11 ? 7.978   6.531   -7.567  1.00 15.00 ?  935 GLU B HA   5  
ATOM   3708  H HB2  . GLU B 2 11 ? 5.850   7.235   -8.776  1.00 15.00 ?  935 GLU B HB2  5  
ATOM   3709  H HB3  . GLU B 2 11 ? 6.627   5.770   -9.359  1.00 15.00 ?  935 GLU B HB3  5  
ATOM   3710  H HG2  . GLU B 2 11 ? 4.417   5.592   -7.336  1.00 15.00 ?  935 GLU B HG2  5  
ATOM   3711  H HG3  . GLU B 2 11 ? 4.047   5.838   -9.051  1.00 15.00 ?  935 GLU B HG3  5  
ATOM   3712  N N    . ASP B 2 12 ? 7.188   8.160   -5.911  1.00 15.00 ?  936 ASP B N    5  
ATOM   3713  C CA   . ASP B 2 12 ? 6.914   9.038   -4.776  1.00 15.00 ?  936 ASP B CA   5  
ATOM   3714  C C    . ASP B 2 12 ? 5.557   9.722   -4.884  1.00 15.00 ?  936 ASP B C    5  
ATOM   3715  O O    . ASP B 2 12 ? 5.165   10.200  -5.953  1.00 15.00 ?  936 ASP B O    5  
ATOM   3716  C CB   . ASP B 2 12 ? 8.020   10.084  -4.657  1.00 15.00 ?  936 ASP B CB   5  
ATOM   3717  C CG   . ASP B 2 12 ? 7.836   11.000  -3.464  1.00 15.00 ?  936 ASP B CG   5  
ATOM   3718  O OD1  . ASP B 2 12 ? 7.987   10.530  -2.314  1.00 15.00 ?  936 ASP B OD1  5  
ATOM   3719  O OD2  . ASP B 2 12 ? 7.578   12.205  -3.674  1.00 15.00 -1 936 ASP B OD2  5  
ATOM   3720  H H    . ASP B 2 12 ? 7.981   8.340   -6.465  1.00 15.00 ?  936 ASP B H    5  
ATOM   3721  H HA   . ASP B 2 12 ? 6.920   8.428   -3.885  1.00 15.00 ?  936 ASP B HA   5  
ATOM   3722  H HB2  . ASP B 2 12 ? 8.971   9.583   -4.557  1.00 15.00 ?  936 ASP B HB2  5  
ATOM   3723  H HB3  . ASP B 2 12 ? 8.030   10.686  -5.554  1.00 15.00 ?  936 ASP B HB3  5  
ATOM   3724  N N    . LEU B 2 13 ? 4.867   9.787   -3.750  1.00 15.00 ?  937 LEU B N    5  
ATOM   3725  C CA   . LEU B 2 13 ? 3.544   10.392  -3.663  1.00 15.00 ?  937 LEU B CA   5  
ATOM   3726  C C    . LEU B 2 13 ? 3.625   11.877  -4.015  1.00 15.00 ?  937 LEU B C    5  
ATOM   3727  O O    . LEU B 2 13 ? 3.182   12.303  -5.080  1.00 15.00 ?  937 LEU B O    5  
ATOM   3728  C CB   . LEU B 2 13 ? 2.990   10.209  -2.240  1.00 15.00 ?  937 LEU B CB   5  
ATOM   3729  C CG   . LEU B 2 13 ? 1.463   10.082  -2.114  1.00 15.00 ?  937 LEU B CG   5  
ATOM   3730  C CD1  . LEU B 2 13 ? 1.071   9.883   -0.659  1.00 15.00 ?  937 LEU B CD1  5  
ATOM   3731  C CD2  . LEU B 2 13 ? 0.748   11.300  -2.689  1.00 15.00 ?  937 LEU B CD2  5  
ATOM   3732  H H    . LEU B 2 13 ? 5.272   9.423   -2.937  1.00 15.00 ?  937 LEU B H    5  
ATOM   3733  H HA   . LEU B 2 13 ? 2.896   9.894   -4.367  1.00 15.00 ?  937 LEU B HA   5  
ATOM   3734  H HB2  . LEU B 2 13 ? 3.434   9.318   -1.823  1.00 15.00 ?  937 LEU B HB2  5  
ATOM   3735  H HB3  . LEU B 2 13 ? 3.305   11.054  -1.646  1.00 15.00 ?  937 LEU B HB3  5  
ATOM   3736  H HG   . LEU B 2 13 ? 1.138   9.210   -2.663  1.00 15.00 ?  937 LEU B HG   5  
ATOM   3737  H HD11 . LEU B 2 13 ? 1.412   10.725  -0.075  1.00 15.00 ?  937 LEU B HD11 5  
ATOM   3738  H HD12 . LEU B 2 13 ? 1.524   8.978   -0.283  1.00 15.00 ?  937 LEU B HD12 5  
ATOM   3739  H HD13 . LEU B 2 13 ? -0.004  9.805   -0.583  1.00 15.00 ?  937 LEU B HD13 5  
ATOM   3740  H HD21 . LEU B 2 13 ? -0.319  11.176  -2.578  1.00 15.00 ?  937 LEU B HD21 5  
ATOM   3741  H HD22 . LEU B 2 13 ? 0.992   11.401  -3.737  1.00 15.00 ?  937 LEU B HD22 5  
ATOM   3742  H HD23 . LEU B 2 13 ? 1.063   12.187  -2.160  1.00 15.00 ?  937 LEU B HD23 5  
HETATM 3743  N N    . NH2 B 2 14 ? 4.183   12.663  -3.107  1.00 15.00 ?  938 NH2 B N    5  
HETATM 3744  H HN1  . NH2 B 2 14 ? 4.514   12.253  -2.282  1.00 15.00 ?  938 NH2 B HN1  5  
HETATM 3745  H HN2  . NH2 B 2 14 ? 4.242   13.622  -3.298  1.00 15.00 ?  938 NH2 B HN2  5  
ATOM   3746  N N    . PHE A 1 7  ? -11.223 10.362  -1.441  1.00 15.00 ?  478 PHE A N    6  
ATOM   3747  C CA   . PHE A 1 7  ? -11.924 9.112   -1.074  1.00 15.00 ?  478 PHE A CA   6  
ATOM   3748  C C    . PHE A 1 7  ? -11.011 8.196   -0.264  1.00 15.00 ?  478 PHE A C    6  
ATOM   3749  O O    . PHE A 1 7  ? -11.474 7.419   0.575   1.00 15.00 ?  478 PHE A O    6  
ATOM   3750  C CB   . PHE A 1 7  ? -12.410 8.385   -2.334  1.00 15.00 ?  478 PHE A CB   6  
ATOM   3751  C CG   . PHE A 1 7  ? -13.453 9.148   -3.102  1.00 15.00 ?  478 PHE A CG   6  
ATOM   3752  C CD1  . PHE A 1 7  ? -14.716 9.358   -2.568  1.00 15.00 ?  478 PHE A CD1  6  
ATOM   3753  C CD2  . PHE A 1 7  ? -13.171 9.658   -4.360  1.00 15.00 ?  478 PHE A CD2  6  
ATOM   3754  C CE1  . PHE A 1 7  ? -15.675 10.062  -3.273  1.00 15.00 ?  478 PHE A CE1  6  
ATOM   3755  C CE2  . PHE A 1 7  ? -14.127 10.362  -5.068  1.00 15.00 ?  478 PHE A CE2  6  
ATOM   3756  C CZ   . PHE A 1 7  ? -15.380 10.565  -4.523  1.00 15.00 ?  478 PHE A CZ   6  
ATOM   3757  H H    . PHE A 1 7  ? -10.391 10.148  -2.036  1.00 15.00 ?  478 PHE A H    6  
ATOM   3758  H HA   . PHE A 1 7  ? -12.780 9.372   -0.467  1.00 15.00 ?  478 PHE A HA   6  
ATOM   3759  H HB2  . PHE A 1 7  ? -11.568 8.227   -2.991  1.00 15.00 ?  478 PHE A HB2  6  
ATOM   3760  H HB3  . PHE A 1 7  ? -12.825 7.428   -2.055  1.00 15.00 ?  478 PHE A HB3  6  
ATOM   3761  H HD1  . PHE A 1 7  ? -14.949 8.964   -1.588  1.00 15.00 ?  478 PHE A HD1  6  
ATOM   3762  H HD2  . PHE A 1 7  ? -12.192 9.502   -4.788  1.00 15.00 ?  478 PHE A HD2  6  
ATOM   3763  H HE1  . PHE A 1 7  ? -16.652 10.217  -2.845  1.00 15.00 ?  478 PHE A HE1  6  
ATOM   3764  H HE2  . PHE A 1 7  ? -13.893 10.755  -6.046  1.00 15.00 ?  478 PHE A HE2  6  
ATOM   3765  H HZ   . PHE A 1 7  ? -16.129 11.116  -5.075  1.00 15.00 ?  478 PHE A HZ   6  
ATOM   3766  N N    . LEU A 1 8  ? -9.718  8.283   -0.531  1.00 15.00 ?  479 LEU A N    6  
ATOM   3767  C CA   . LEU A 1 8  ? -8.728  7.464   0.148   1.00 15.00 ?  479 LEU A CA   6  
ATOM   3768  C C    . LEU A 1 8  ? -7.869  8.346   1.054   1.00 15.00 ?  479 LEU A C    6  
ATOM   3769  O O    . LEU A 1 8  ? -7.419  9.411   0.624   1.00 15.00 ?  479 LEU A O    6  
ATOM   3770  C CB   . LEU A 1 8  ? -7.859  6.762   -0.901  1.00 15.00 ?  479 LEU A CB   6  
ATOM   3771  C CG   . LEU A 1 8  ? -6.936  5.658   -0.385  1.00 15.00 ?  479 LEU A CG   6  
ATOM   3772  C CD1  . LEU A 1 8  ? -7.739  4.490   0.169   1.00 15.00 ?  479 LEU A CD1  6  
ATOM   3773  C CD2  . LEU A 1 8  ? -6.017  5.190   -1.500  1.00 15.00 ?  479 LEU A CD2  6  
ATOM   3774  H H    . LEU A 1 8  ? -9.410  8.922   -1.215  1.00 15.00 ?  479 LEU A H    6  
ATOM   3775  H HA   . LEU A 1 8  ? -9.241  6.727   0.745   1.00 15.00 ?  479 LEU A HA   6  
ATOM   3776  H HB2  . LEU A 1 8  ? -8.514  6.330   -1.644  1.00 15.00 ?  479 LEU A HB2  6  
ATOM   3777  H HB3  . LEU A 1 8  ? -7.247  7.510   -1.385  1.00 15.00 ?  479 LEU A HB3  6  
ATOM   3778  H HG   . LEU A 1 8  ? -6.323  6.050   0.412   1.00 15.00 ?  479 LEU A HG   6  
ATOM   3779  H HD11 . LEU A 1 8  ? -7.062  3.724   0.520   1.00 15.00 ?  479 LEU A HD11 6  
ATOM   3780  H HD12 . LEU A 1 8  ? -8.369  4.083   -0.608  1.00 15.00 ?  479 LEU A HD12 6  
ATOM   3781  H HD13 . LEU A 1 8  ? -8.352  4.831   0.989   1.00 15.00 ?  479 LEU A HD13 6  
ATOM   3782  H HD21 . LEU A 1 8  ? -6.608  4.798   -2.316  1.00 15.00 ?  479 LEU A HD21 6  
ATOM   3783  H HD22 . LEU A 1 8  ? -5.362  4.414   -1.125  1.00 15.00 ?  479 LEU A HD22 6  
ATOM   3784  H HD23 . LEU A 1 8  ? -5.424  6.022   -1.851  1.00 15.00 ?  479 LEU A HD23 6  
ATOM   3785  N N    . PRO A 1 9  ? -7.648  7.926   2.321   1.00 15.00 ?  480 PRO A N    6  
ATOM   3786  C CA   . PRO A 1 9  ? -6.799  8.665   3.267   1.00 15.00 ?  480 PRO A CA   6  
ATOM   3787  C C    . PRO A 1 9  ? -5.449  9.040   2.655   1.00 15.00 ?  480 PRO A C    6  
ATOM   3788  O O    . PRO A 1 9  ? -4.806  8.211   2.017   1.00 15.00 ?  480 PRO A O    6  
ATOM   3789  C CB   . PRO A 1 9  ? -6.611  7.675   4.417   1.00 15.00 ?  480 PRO A CB   6  
ATOM   3790  C CG   . PRO A 1 9  ? -7.825  6.817   4.377   1.00 15.00 ?  480 PRO A CG   6  
ATOM   3791  C CD   . PRO A 1 9  ? -8.211  6.706   2.928   1.00 15.00 ?  480 PRO A CD   6  
ATOM   3792  H HA   . PRO A 1 9  ? -7.291  9.556   3.630   1.00 15.00 ?  480 PRO A HA   6  
ATOM   3793  H HB2  . PRO A 1 9  ? -5.712  7.097   4.254   1.00 15.00 ?  480 PRO A HB2  6  
ATOM   3794  H HB3  . PRO A 1 9  ? -6.538  8.210   5.350   1.00 15.00 ?  480 PRO A HB3  6  
ATOM   3795  H HG2  . PRO A 1 9  ? -7.599  5.842   4.780   1.00 15.00 ?  480 PRO A HG2  6  
ATOM   3796  H HG3  . PRO A 1 9  ? -8.621  7.282   4.940   1.00 15.00 ?  480 PRO A HG3  6  
ATOM   3797  H HD2  . PRO A 1 9  ? -7.775  5.821   2.489   1.00 15.00 ?  480 PRO A HD2  6  
ATOM   3798  H HD3  . PRO A 1 9  ? -9.283  6.687   2.828   1.00 15.00 ?  480 PRO A HD3  6  
ATOM   3799  N N    . PRO A 1 10 ? -4.995  10.287  2.875   1.00 15.00 ?  481 PRO A N    6  
ATOM   3800  C CA   . PRO A 1 10 ? -3.814  10.850  2.198   1.00 15.00 ?  481 PRO A CA   6  
ATOM   3801  C C    . PRO A 1 10 ? -2.530  10.045  2.397   1.00 15.00 ?  481 PRO A C    6  
ATOM   3802  O O    . PRO A 1 10 ? -1.584  10.180  1.619   1.00 15.00 ?  481 PRO A O    6  
ATOM   3803  C CB   . PRO A 1 10 ? -3.663  12.241  2.821   1.00 15.00 ?  481 PRO A CB   6  
ATOM   3804  C CG   . PRO A 1 10 ? -5.012  12.566  3.366   1.00 15.00 ?  481 PRO A CG   6  
ATOM   3805  C CD   . PRO A 1 10 ? -5.609  11.257  3.797   1.00 15.00 ?  481 PRO A CD   6  
ATOM   3806  H HA   . PRO A 1 10 ? -3.994  10.957  1.138   1.00 15.00 ?  481 PRO A HA   6  
ATOM   3807  H HB2  . PRO A 1 10 ? -2.919  12.208  3.602   1.00 15.00 ?  481 PRO A HB2  6  
ATOM   3808  H HB3  . PRO A 1 10 ? -3.364  12.949  2.062   1.00 15.00 ?  481 PRO A HB3  6  
ATOM   3809  H HG2  . PRO A 1 10 ? -4.916  13.230  4.212   1.00 15.00 ?  481 PRO A HG2  6  
ATOM   3810  H HG3  . PRO A 1 10 ? -5.620  13.021  2.598   1.00 15.00 ?  481 PRO A HG3  6  
ATOM   3811  H HD2  . PRO A 1 10 ? -5.343  11.039  4.822   1.00 15.00 ?  481 PRO A HD2  6  
ATOM   3812  H HD3  . PRO A 1 10 ? -6.682  11.274  3.680   1.00 15.00 ?  481 PRO A HD3  6  
ATOM   3813  N N    . GLY A 1 11 ? -2.475  9.236   3.446   1.00 15.00 ?  482 GLY A N    6  
ATOM   3814  C CA   . GLY A 1 11 ? -1.291  8.431   3.678   1.00 15.00 ?  482 GLY A CA   6  
ATOM   3815  C C    . GLY A 1 11 ? -1.466  7.001   3.240   1.00 15.00 ?  482 GLY A C    6  
ATOM   3816  O O    . GLY A 1 11 ? -0.493  6.261   3.160   1.00 15.00 ?  482 GLY A O    6  
ATOM   3817  H H    . GLY A 1 11 ? -3.234  9.192   4.064   1.00 15.00 ?  482 GLY A H    6  
ATOM   3818  H HA2  . GLY A 1 11 ? -0.472  8.858   3.127   1.00 15.00 ?  482 GLY A HA2  6  
ATOM   3819  H HA3  . GLY A 1 11 ? -1.042  8.441   4.720   1.00 15.00 ?  482 GLY A HA3  6  
ATOM   3820  N N    . TRP A 1 12 ? -2.697  6.609   2.956   1.00 15.00 ?  483 TRP A N    6  
ATOM   3821  C CA   . TRP A 1 12 ? -2.959  5.278   2.443   1.00 15.00 ?  483 TRP A CA   6  
ATOM   3822  C C    . TRP A 1 12 ? -2.893  5.315   0.940   1.00 15.00 ?  483 TRP A C    6  
ATOM   3823  O O    . TRP A 1 12 ? -3.726  5.925   0.283   1.00 15.00 ?  483 TRP A O    6  
ATOM   3824  C CB   . TRP A 1 12 ? -4.319  4.745   2.887   1.00 15.00 ?  483 TRP A CB   6  
ATOM   3825  C CG   . TRP A 1 12 ? -4.351  4.318   4.318   1.00 15.00 ?  483 TRP A CG   6  
ATOM   3826  C CD1  . TRP A 1 12 ? -4.420  5.132   5.407   1.00 15.00 ?  483 TRP A CD1  6  
ATOM   3827  C CD2  . TRP A 1 12 ? -4.317  2.971   4.817   1.00 15.00 ?  483 TRP A CD2  6  
ATOM   3828  N NE1  . TRP A 1 12 ? -4.438  4.382   6.555   1.00 15.00 ?  483 TRP A NE1  6  
ATOM   3829  C CE2  . TRP A 1 12 ? -4.379  3.055   6.220   1.00 15.00 ?  483 TRP A CE2  6  
ATOM   3830  C CE3  . TRP A 1 12 ? -4.245  1.701   4.223   1.00 15.00 ?  483 TRP A CE3  6  
ATOM   3831  C CZ2  . TRP A 1 12 ? -4.375  1.928   7.035   1.00 15.00 ?  483 TRP A CZ2  6  
ATOM   3832  C CZ3  . TRP A 1 12 ? -4.241  0.586   5.038   1.00 15.00 ?  483 TRP A CZ3  6  
ATOM   3833  C CH2  . TRP A 1 12 ? -4.308  0.705   6.429   1.00 15.00 ?  483 TRP A CH2  6  
ATOM   3834  H H    . TRP A 1 12 ? -3.440  7.243   3.053   1.00 15.00 ?  483 TRP A H    6  
ATOM   3835  H HA   . TRP A 1 12 ? -2.183  4.622   2.809   1.00 15.00 ?  483 TRP A HA   6  
ATOM   3836  H HB2  . TRP A 1 12 ? -5.062  5.515   2.753   1.00 15.00 ?  483 TRP A HB2  6  
ATOM   3837  H HB3  . TRP A 1 12 ? -4.578  3.892   2.278   1.00 15.00 ?  483 TRP A HB3  6  
ATOM   3838  H HD1  . TRP A 1 12 ? -4.453  6.212   5.356   1.00 15.00 ?  483 TRP A HD1  6  
ATOM   3839  H HE1  . TRP A 1 12 ? -4.488  4.738   7.473   1.00 15.00 ?  483 TRP A HE1  6  
ATOM   3840  H HE3  . TRP A 1 12 ? -4.187  1.578   3.149   1.00 15.00 ?  483 TRP A HE3  6  
ATOM   3841  H HZ2  . TRP A 1 12 ? -4.430  2.003   8.110   1.00 15.00 ?  483 TRP A HZ2  6  
ATOM   3842  H HZ3  . TRP A 1 12 ? -4.194  -0.398  4.600   1.00 15.00 ?  483 TRP A HZ3  6  
ATOM   3843  H HH2  . TRP A 1 12 ? -4.301  -0.197  7.026   1.00 15.00 ?  483 TRP A HH2  6  
ATOM   3844  N N    . GLU A 1 13 ? -1.874  4.698   0.405   1.00 15.00 ?  484 GLU A N    6  
ATOM   3845  C CA   . GLU A 1 13 ? -1.657  4.709   -1.016  1.00 15.00 ?  484 GLU A CA   6  
ATOM   3846  C C    . GLU A 1 13 ? -1.904  3.338   -1.629  1.00 15.00 ?  484 GLU A C    6  
ATOM   3847  O O    . GLU A 1 13 ? -1.344  2.336   -1.186  1.00 15.00 ?  484 GLU A O    6  
ATOM   3848  C CB   . GLU A 1 13 ? -0.240  5.170   -1.300  1.00 15.00 ?  484 GLU A CB   6  
ATOM   3849  C CG   . GLU A 1 13 ? -0.151  6.609   -1.765  1.00 15.00 ?  484 GLU A CG   6  
ATOM   3850  C CD   . GLU A 1 13 ? 1.061   6.843   -2.632  1.00 15.00 ?  484 GLU A CD   6  
ATOM   3851  O OE1  . GLU A 1 13 ? 2.147   7.073   -2.076  1.00 15.00 ?  484 GLU A OE1  6  
ATOM   3852  O OE2  . GLU A 1 13 ? 0.935   6.771   -3.872  1.00 15.00 -1 484 GLU A OE2  6  
ATOM   3853  H H    . GLU A 1 13 ? -1.234  4.230   0.988   1.00 15.00 ?  484 GLU A H    6  
ATOM   3854  H HA   . GLU A 1 13 ? -2.347  5.416   -1.450  1.00 15.00 ?  484 GLU A HA   6  
ATOM   3855  H HB2  . GLU A 1 13 ? 0.346   5.070   -0.398  1.00 15.00 ?  484 GLU A HB2  6  
ATOM   3856  H HB3  . GLU A 1 13 ? 0.179   4.547   -2.053  1.00 15.00 ?  484 GLU A HB3  6  
ATOM   3857  H HG2  . GLU A 1 13 ? -1.037  6.850   -2.330  1.00 15.00 ?  484 GLU A HG2  6  
ATOM   3858  H HG3  . GLU A 1 13 ? -0.088  7.253   -0.901  1.00 15.00 ?  484 GLU A HG3  6  
ATOM   3859  N N    . MET A 1 14 ? -2.727  3.312   -2.665  1.00 15.00 ?  485 MET A N    6  
ATOM   3860  C CA   . MET A 1 14 ? -3.042  2.073   -3.376  1.00 15.00 ?  485 MET A CA   6  
ATOM   3861  C C    . MET A 1 14 ? -2.098  1.909   -4.555  1.00 15.00 ?  485 MET A C    6  
ATOM   3862  O O    . MET A 1 14 ? -2.211  2.614   -5.556  1.00 15.00 ?  485 MET A O    6  
ATOM   3863  C CB   . MET A 1 14 ? -4.499  2.046   -3.866  1.00 15.00 ?  485 MET A CB   6  
ATOM   3864  C CG   . MET A 1 14 ? -5.515  1.940   -2.754  1.00 15.00 ?  485 MET A CG   6  
ATOM   3865  S SD   . MET A 1 14 ? -7.209  1.733   -3.353  1.00 15.00 ?  485 MET A SD   6  
ATOM   3866  C CE   . MET A 1 14 ? -7.503  3.312   -4.152  1.00 15.00 ?  485 MET A CE   6  
ATOM   3867  H H    . MET A 1 14 ? -3.106  4.156   -2.980  1.00 15.00 ?  485 MET A H    6  
ATOM   3868  H HA   . MET A 1 14 ? -2.885  1.252   -2.691  1.00 15.00 ?  485 MET A HA   6  
ATOM   3869  H HB2  . MET A 1 14 ? -4.705  2.947   -4.407  1.00 15.00 ?  485 MET A HB2  6  
ATOM   3870  H HB3  . MET A 1 14 ? -4.629  1.201   -4.525  1.00 15.00 ?  485 MET A HB3  6  
ATOM   3871  H HG2  . MET A 1 14 ? -5.258  1.090   -2.147  1.00 15.00 ?  485 MET A HG2  6  
ATOM   3872  H HG3  . MET A 1 14 ? -5.469  2.836   -2.154  1.00 15.00 ?  485 MET A HG3  6  
ATOM   3873  H HE1  . MET A 1 14 ? -7.408  4.105   -3.425  1.00 15.00 ?  485 MET A HE1  6  
ATOM   3874  H HE2  . MET A 1 14 ? -8.502  3.325   -4.567  1.00 15.00 ?  485 MET A HE2  6  
ATOM   3875  H HE3  . MET A 1 14 ? -6.782  3.455   -4.942  1.00 15.00 ?  485 MET A HE3  6  
ATOM   3876  N N    . ARG A 1 15 ? -1.151  0.997   -4.421  1.00 15.00 ?  486 ARG A N    6  
ATOM   3877  C CA   . ARG A 1 15 ? -0.096  0.852   -5.415  1.00 15.00 ?  486 ARG A CA   6  
ATOM   3878  C C    . ARG A 1 15 ? -0.217  -0.463  -6.164  1.00 15.00 ?  486 ARG A C    6  
ATOM   3879  O O    . ARG A 1 15 ? -0.450  -1.508  -5.563  1.00 15.00 ?  486 ARG A O    6  
ATOM   3880  C CB   . ARG A 1 15 ? 1.270   0.954   -4.742  1.00 15.00 ?  486 ARG A CB   6  
ATOM   3881  C CG   . ARG A 1 15 ? 1.455   2.228   -3.933  1.00 15.00 ?  486 ARG A CG   6  
ATOM   3882  C CD   . ARG A 1 15 ? 1.043   3.459   -4.725  1.00 15.00 ?  486 ARG A CD   6  
ATOM   3883  N NE   . ARG A 1 15 ? 1.575   3.424   -6.081  1.00 15.00 ?  486 ARG A NE   6  
ATOM   3884  C CZ   . ARG A 1 15 ? 1.915   4.497   -6.783  1.00 15.00 ?  486 ARG A CZ   6  
ATOM   3885  N NH1  . ARG A 1 15 ? 1.819   5.718   -6.257  1.00 15.00 1  486 ARG A NH1  6  
ATOM   3886  N NH2  . ARG A 1 15 ? 2.355   4.336   -8.021  1.00 15.00 ?  486 ARG A NH2  6  
ATOM   3887  H H    . ARG A 1 15 ? -1.160  0.403   -3.635  1.00 15.00 ?  486 ARG A H    6  
ATOM   3888  H HA   . ARG A 1 15 ? -0.198  1.663   -6.119  1.00 15.00 ?  486 ARG A HA   6  
ATOM   3889  H HB2  . ARG A 1 15 ? 1.396   0.110   -4.080  1.00 15.00 ?  486 ARG A HB2  6  
ATOM   3890  H HB3  . ARG A 1 15 ? 2.036   0.922   -5.503  1.00 15.00 ?  486 ARG A HB3  6  
ATOM   3891  H HG2  . ARG A 1 15 ? 0.850   2.170   -3.040  1.00 15.00 ?  486 ARG A HG2  6  
ATOM   3892  H HG3  . ARG A 1 15 ? 2.496   2.320   -3.659  1.00 15.00 ?  486 ARG A HG3  6  
ATOM   3893  H HD2  . ARG A 1 15 ? -0.035  3.498   -4.771  1.00 15.00 ?  486 ARG A HD2  6  
ATOM   3894  H HD3  . ARG A 1 15 ? 1.416   4.339   -4.222  1.00 15.00 ?  486 ARG A HD3  6  
ATOM   3895  H HE   . ARG A 1 15 ? 1.676   2.541   -6.499  1.00 15.00 ?  486 ARG A HE   6  
ATOM   3896  H HH11 . ARG A 1 15 ? 1.484   5.844   -5.310  1.00 15.00 ?  486 ARG A HH11 6  
ATOM   3897  H HH12 . ARG A 1 15 ? 2.085   6.519   -6.793  1.00 15.00 ?  486 ARG A HH12 6  
ATOM   3898  H HH21 . ARG A 1 15 ? 2.424   3.414   -8.415  1.00 15.00 ?  486 ARG A HH21 6  
ATOM   3899  H HH22 . ARG A 1 15 ? 2.636   5.123   -8.566  1.00 15.00 ?  486 ARG A HH22 6  
ATOM   3900  N N    . ILE A 1 16 ? -0.017  -0.410  -7.474  1.00 15.00 ?  487 ILE A N    6  
ATOM   3901  C CA   . ILE A 1 16 ? -0.208  -1.583  -8.318  1.00 15.00 ?  487 ILE A CA   6  
ATOM   3902  C C    . ILE A 1 16 ? 1.114   -2.292  -8.602  1.00 15.00 ?  487 ILE A C    6  
ATOM   3903  O O    . ILE A 1 16 ? 2.051   -1.694  -9.126  1.00 15.00 ?  487 ILE A O    6  
ATOM   3904  C CB   . ILE A 1 16 ? -0.877  -1.204  -9.663  1.00 15.00 ?  487 ILE A CB   6  
ATOM   3905  C CG1  . ILE A 1 16 ? -2.308  -0.705  -9.435  1.00 15.00 ?  487 ILE A CG1  6  
ATOM   3906  C CG2  . ILE A 1 16 ? -0.883  -2.391  -10.623 1.00 15.00 ?  487 ILE A CG2  6  
ATOM   3907  C CD1  . ILE A 1 16 ? -3.258  -1.778  -8.938  1.00 15.00 ?  487 ILE A CD1  6  
ATOM   3908  H H    . ILE A 1 16 ? 0.284   0.439   -7.885  1.00 15.00 ?  487 ILE A H    6  
ATOM   3909  H HA   . ILE A 1 16 ? -0.862  -2.263  -7.796  1.00 15.00 ?  487 ILE A HA   6  
ATOM   3910  H HB   . ILE A 1 16 ? -0.297  -0.414  -10.114 1.00 15.00 ?  487 ILE A HB   6  
ATOM   3911  H HG12 . ILE A 1 16 ? -2.294  0.089   -8.704  1.00 15.00 ?  487 ILE A HG12 6  
ATOM   3912  H HG13 . ILE A 1 16 ? -2.700  -0.323  -10.367 1.00 15.00 ?  487 ILE A HG13 6  
ATOM   3913  H HG21 . ILE A 1 16 ? 0.131   -2.718  -10.800 1.00 15.00 ?  487 ILE A HG21 6  
ATOM   3914  H HG22 . ILE A 1 16 ? -1.335  -2.095  -11.557 1.00 15.00 ?  487 ILE A HG22 6  
ATOM   3915  H HG23 . ILE A 1 16 ? -1.452  -3.201  -10.188 1.00 15.00 ?  487 ILE A HG23 6  
ATOM   3916  H HD11 . ILE A 1 16 ? -4.252  -1.368  -8.841  1.00 15.00 ?  487 ILE A HD11 6  
ATOM   3917  H HD12 . ILE A 1 16 ? -2.922  -2.139  -7.976  1.00 15.00 ?  487 ILE A HD12 6  
ATOM   3918  H HD13 . ILE A 1 16 ? -3.273  -2.599  -9.643  1.00 15.00 ?  487 ILE A HD13 6  
ATOM   3919  N N    . ALA A 1 17 ? 1.189   -3.563  -8.236  1.00 15.00 ?  488 ALA A N    6  
ATOM   3920  C CA   . ALA A 1 17 ? 2.304   -4.404  -8.640  1.00 15.00 ?  488 ALA A CA   6  
ATOM   3921  C C    . ALA A 1 17 ? 1.933   -5.130  -9.934  1.00 15.00 ?  488 ALA A C    6  
ATOM   3922  O O    . ALA A 1 17 ? 0.758   -5.420  -10.154 1.00 15.00 ?  488 ALA A O    6  
ATOM   3923  C CB   . ALA A 1 17 ? 2.658   -5.392  -7.534  1.00 15.00 ?  488 ALA A CB   6  
ATOM   3924  H H    . ALA A 1 17 ? 0.478   -3.945  -7.676  1.00 15.00 ?  488 ALA A H    6  
ATOM   3925  H HA   . ALA A 1 17 ? 3.158   -3.767  -8.823  1.00 15.00 ?  488 ALA A HA   6  
ATOM   3926  H HB1  . ALA A 1 17 ? 1.808   -6.025  -7.331  1.00 15.00 ?  488 ALA A HB1  6  
ATOM   3927  H HB2  . ALA A 1 17 ? 2.925   -4.850  -6.638  1.00 15.00 ?  488 ALA A HB2  6  
ATOM   3928  H HB3  . ALA A 1 17 ? 3.493   -6.000  -7.847  1.00 15.00 ?  488 ALA A HB3  6  
ATOM   3929  N N    . PRO A 1 18 ? 2.918   -5.430  -10.804 1.00 15.00 ?  489 PRO A N    6  
ATOM   3930  C CA   . PRO A 1 18 ? 2.673   -6.033  -12.129 1.00 15.00 ?  489 PRO A CA   6  
ATOM   3931  C C    . PRO A 1 18 ? 1.922   -7.370  -12.083 1.00 15.00 ?  489 PRO A C    6  
ATOM   3932  O O    . PRO A 1 18 ? 1.467   -7.870  -13.112 1.00 15.00 ?  489 PRO A O    6  
ATOM   3933  C CB   . PRO A 1 18 ? 4.078   -6.233  -12.714 1.00 15.00 ?  489 PRO A CB   6  
ATOM   3934  C CG   . PRO A 1 18 ? 5.011   -6.114  -11.558 1.00 15.00 ?  489 PRO A CG   6  
ATOM   3935  C CD   . PRO A 1 18 ? 4.353   -5.179  -10.586 1.00 15.00 ?  489 PRO A CD   6  
ATOM   3936  H HA   . PRO A 1 18 ? 2.124   -5.351  -12.760 1.00 15.00 ?  489 PRO A HA   6  
ATOM   3937  H HB2  . PRO A 1 18 ? 4.142   -7.209  -13.173 1.00 15.00 ?  489 PRO A HB2  6  
ATOM   3938  H HB3  . PRO A 1 18 ? 4.271   -5.471  -13.455 1.00 15.00 ?  489 PRO A HB3  6  
ATOM   3939  H HG2  . PRO A 1 18 ? 5.160   -7.083  -11.106 1.00 15.00 ?  489 PRO A HG2  6  
ATOM   3940  H HG3  . PRO A 1 18 ? 5.955   -5.706  -11.890 1.00 15.00 ?  489 PRO A HG3  6  
ATOM   3941  H HD2  . PRO A 1 18 ? 4.641   -5.420  -9.573  1.00 15.00 ?  489 PRO A HD2  6  
ATOM   3942  H HD3  . PRO A 1 18 ? 4.603   -4.155  -10.819 1.00 15.00 ?  489 PRO A HD3  6  
ATOM   3943  N N    . ASN A 1 19 ? 1.814   -7.954  -10.897 1.00 15.00 ?  490 ASN A N    6  
ATOM   3944  C CA   . ASN A 1 19 ? 1.030   -9.175  -10.700 1.00 15.00 ?  490 ASN A CA   6  
ATOM   3945  C C    . ASN A 1 19 ? -0.468  -8.853  -10.711 1.00 15.00 ?  490 ASN A C    6  
ATOM   3946  O O    . ASN A 1 19 ? -1.313  -9.746  -10.724 1.00 15.00 ?  490 ASN A O    6  
ATOM   3947  C CB   . ASN A 1 19 ? 1.432   -9.831  -9.371  1.00 15.00 ?  490 ASN A CB   6  
ATOM   3948  C CG   . ASN A 1 19 ? 0.684   -11.120 -9.045  1.00 15.00 ?  490 ASN A CG   6  
ATOM   3949  O OD1  . ASN A 1 19 ? 0.418   -11.403 -7.878  1.00 15.00 ?  490 ASN A OD1  6  
ATOM   3950  N ND2  . ASN A 1 19 ? 0.378   -11.928 -10.050 1.00 15.00 ?  490 ASN A ND2  6  
ATOM   3951  H H    . ASN A 1 19 ? 2.293   -7.564  -10.133 1.00 15.00 ?  490 ASN A H    6  
ATOM   3952  H HA   . ASN A 1 19 ? 1.250   -9.849  -11.511 1.00 15.00 ?  490 ASN A HA   6  
ATOM   3953  H HB2  . ASN A 1 19 ? 2.485   -10.061 -9.404  1.00 15.00 ?  490 ASN A HB2  6  
ATOM   3954  H HB3  . ASN A 1 19 ? 1.256   -9.127  -8.569  1.00 15.00 ?  490 ASN A HB3  6  
ATOM   3955  H HD21 . ASN A 1 19 ? 0.643   -11.669 -10.959 1.00 15.00 ?  490 ASN A HD21 6  
ATOM   3956  H HD22 . ASN A 1 19 ? -0.111  -12.754 -9.844  1.00 15.00 ?  490 ASN A HD22 6  
ATOM   3957  N N    . GLY A 1 20 ? -0.786  -7.569  -10.716 1.00 15.00 ?  491 GLY A N    6  
ATOM   3958  C CA   . GLY A 1 20 ? -2.169  -7.145  -10.649 1.00 15.00 ?  491 GLY A CA   6  
ATOM   3959  C C    . GLY A 1 20 ? -2.637  -7.046  -9.219  1.00 15.00 ?  491 GLY A C    6  
ATOM   3960  O O    . GLY A 1 20 ? -3.837  -7.017  -8.939  1.00 15.00 ?  491 GLY A O    6  
ATOM   3961  H H    . GLY A 1 20 ? -0.072  -6.895  -10.768 1.00 15.00 ?  491 GLY A H    6  
ATOM   3962  H HA2  . GLY A 1 20 ? -2.262  -6.177  -11.119 1.00 15.00 ?  491 GLY A HA2  6  
ATOM   3963  H HA3  . GLY A 1 20 ? -2.787  -7.855  -11.174 1.00 15.00 ?  491 GLY A HA3  6  
ATOM   3964  N N    . ARG A 1 21 ? -1.677  -6.999  -8.312  1.00 15.00 ?  492 ARG A N    6  
ATOM   3965  C CA   . ARG A 1 21 ? -1.965  -6.892  -6.895  1.00 15.00 ?  492 ARG A CA   6  
ATOM   3966  C C    . ARG A 1 21 ? -1.758  -5.459  -6.417  1.00 15.00 ?  492 ARG A C    6  
ATOM   3967  O O    . ARG A 1 21 ? -0.642  -4.938  -6.470  1.00 15.00 ?  492 ARG A O    6  
ATOM   3968  C CB   . ARG A 1 21 ? -1.084  -7.854  -6.087  1.00 15.00 ?  492 ARG A CB   6  
ATOM   3969  C CG   . ARG A 1 21 ? 0.394   -7.806  -6.451  1.00 15.00 ?  492 ARG A CG   6  
ATOM   3970  C CD   . ARG A 1 21 ? 1.179   -8.919  -5.773  1.00 15.00 ?  492 ARG A CD   6  
ATOM   3971  N NE   . ARG A 1 21 ? 2.610   -8.855  -6.087  1.00 15.00 ?  492 ARG A NE   6  
ATOM   3972  C CZ   . ARG A 1 21 ? 3.422   -9.915  -6.105  1.00 15.00 ?  492 ARG A CZ   6  
ATOM   3973  N NH1  . ARG A 1 21 ? 2.940   -11.134 -5.887  1.00 15.00 1  492 ARG A NH1  6  
ATOM   3974  N NH2  . ARG A 1 21 ? 4.717   -9.756  -6.357  1.00 15.00 ?  492 ARG A NH2  6  
ATOM   3975  H H    . ARG A 1 21 ? -0.745  -7.019  -8.610  1.00 15.00 ?  492 ARG A H    6  
ATOM   3976  H HA   . ARG A 1 21 ? -2.995  -7.165  -6.749  1.00 15.00 ?  492 ARG A HA   6  
ATOM   3977  H HB2  . ARG A 1 21 ? -1.182  -7.599  -5.046  1.00 15.00 ?  492 ARG A HB2  6  
ATOM   3978  H HB3  . ARG A 1 21 ? -1.436  -8.861  -6.228  1.00 15.00 ?  492 ARG A HB3  6  
ATOM   3979  H HG2  . ARG A 1 21 ? 0.493   -7.912  -7.520  1.00 15.00 ?  492 ARG A HG2  6  
ATOM   3980  H HG3  . ARG A 1 21 ? 0.799   -6.853  -6.142  1.00 15.00 ?  492 ARG A HG3  6  
ATOM   3981  H HD2  . ARG A 1 21 ? 1.051   -8.833  -4.705  1.00 15.00 ?  492 ARG A HD2  6  
ATOM   3982  H HD3  . ARG A 1 21 ? 0.791   -9.870  -6.106  1.00 15.00 ?  492 ARG A HD3  6  
ATOM   3983  H HE   . ARG A 1 21 ? 2.988   -7.969  -6.282  1.00 15.00 ?  492 ARG A HE   6  
ATOM   3984  H HH11 . ARG A 1 21 ? 1.963   -11.267 -5.708  1.00 15.00 ?  492 ARG A HH11 6  
ATOM   3985  H HH12 . ARG A 1 21 ? 3.560   -11.932 -5.901  1.00 15.00 ?  492 ARG A HH12 6  
ATOM   3986  H HH21 . ARG A 1 21 ? 5.092   -8.833  -6.533  1.00 15.00 ?  492 ARG A HH21 6  
ATOM   3987  H HH22 . ARG A 1 21 ? 5.332   -10.551 -6.378  1.00 15.00 ?  492 ARG A HH22 6  
ATOM   3988  N N    . PRO A 1 22 ? -2.830  -4.787  -5.976  1.00 15.00 ?  493 PRO A N    6  
ATOM   3989  C CA   . PRO A 1 22 ? -2.731  -3.465  -5.385  1.00 15.00 ?  493 PRO A CA   6  
ATOM   3990  C C    . PRO A 1 22 ? -2.530  -3.539  -3.878  1.00 15.00 ?  493 PRO A C    6  
ATOM   3991  O O    . PRO A 1 22 ? -3.374  -4.064  -3.151  1.00 15.00 ?  493 PRO A O    6  
ATOM   3992  C CB   . PRO A 1 22 ? -4.085  -2.817  -5.708  1.00 15.00 ?  493 PRO A CB   6  
ATOM   3993  C CG   . PRO A 1 22 ? -4.954  -3.907  -6.267  1.00 15.00 ?  493 PRO A CG   6  
ATOM   3994  C CD   . PRO A 1 22 ? -4.227  -5.211  -6.065  1.00 15.00 ?  493 PRO A CD   6  
ATOM   3995  H HA   . PRO A 1 22 ? -1.936  -2.888  -5.827  1.00 15.00 ?  493 PRO A HA   6  
ATOM   3996  H HB2  . PRO A 1 22 ? -4.508  -2.406  -4.804  1.00 15.00 ?  493 PRO A HB2  6  
ATOM   3997  H HB3  . PRO A 1 22 ? -3.938  -2.026  -6.428  1.00 15.00 ?  493 PRO A HB3  6  
ATOM   3998  H HG2  . PRO A 1 22 ? -5.895  -3.923  -5.745  1.00 15.00 ?  493 PRO A HG2  6  
ATOM   3999  H HG3  . PRO A 1 22 ? -5.118  -3.733  -7.321  1.00 15.00 ?  493 PRO A HG3  6  
ATOM   4000  H HD2  . PRO A 1 22 ? -4.549  -5.689  -5.151  1.00 15.00 ?  493 PRO A HD2  6  
ATOM   4001  H HD3  . PRO A 1 22 ? -4.385  -5.860  -6.912  1.00 15.00 ?  493 PRO A HD3  6  
ATOM   4002  N N    . PHE A 1 23 ? -1.397  -3.034  -3.419  1.00 15.00 ?  494 PHE A N    6  
ATOM   4003  C CA   . PHE A 1 23 ? -1.075  -3.066  -2.004  1.00 15.00 ?  494 PHE A CA   6  
ATOM   4004  C C    . PHE A 1 23 ? -1.236  -1.684  -1.379  1.00 15.00 ?  494 PHE A C    6  
ATOM   4005  O O    . PHE A 1 23 ? -0.891  -0.669  -1.991  1.00 15.00 ?  494 PHE A O    6  
ATOM   4006  C CB   . PHE A 1 23 ? 0.339   -3.628  -1.771  1.00 15.00 ?  494 PHE A CB   6  
ATOM   4007  C CG   . PHE A 1 23 ? 1.471   -2.974  -2.547  1.00 15.00 ?  494 PHE A CG   6  
ATOM   4008  C CD1  . PHE A 1 23 ? 1.971   -1.730  -2.186  1.00 15.00 ?  494 PHE A CD1  6  
ATOM   4009  C CD2  . PHE A 1 23 ? 2.060   -3.634  -3.615  1.00 15.00 ?  494 PHE A CD2  6  
ATOM   4010  C CE1  . PHE A 1 23 ? 3.030   -1.146  -2.882  1.00 15.00 ?  494 PHE A CE1  6  
ATOM   4011  C CE2  . PHE A 1 23 ? 3.116   -3.069  -4.307  1.00 15.00 ?  494 PHE A CE2  6  
ATOM   4012  C CZ   . PHE A 1 23 ? 3.599   -1.824  -3.944  1.00 15.00 ?  494 PHE A CZ   6  
ATOM   4013  H H    . PHE A 1 23 ? -0.766  -2.620  -4.048  1.00 15.00 ?  494 PHE A H    6  
ATOM   4014  H HA   . PHE A 1 23 ? -1.786  -3.731  -1.533  1.00 15.00 ?  494 PHE A HA   6  
ATOM   4015  H HB2  . PHE A 1 23 ? 0.574   -3.538  -0.722  1.00 15.00 ?  494 PHE A HB2  6  
ATOM   4016  H HB3  . PHE A 1 23 ? 0.332   -4.679  -2.031  1.00 15.00 ?  494 PHE A HB3  6  
ATOM   4017  H HD1  . PHE A 1 23 ? 1.525   -1.215  -1.355  1.00 15.00 ?  494 PHE A HD1  6  
ATOM   4018  H HD2  . PHE A 1 23 ? 1.684   -4.604  -3.908  1.00 15.00 ?  494 PHE A HD2  6  
ATOM   4019  H HE1  . PHE A 1 23 ? 3.413   -0.155  -2.594  1.00 15.00 ?  494 PHE A HE1  6  
ATOM   4020  H HE2  . PHE A 1 23 ? 3.567   -3.605  -5.130  1.00 15.00 ?  494 PHE A HE2  6  
ATOM   4021  H HZ   . PHE A 1 23 ? 4.424   -1.385  -4.487  1.00 15.00 ?  494 PHE A HZ   6  
ATOM   4022  N N    . PHE A 1 24 ? -1.760  -1.652  -0.158  1.00 15.00 ?  495 PHE A N    6  
ATOM   4023  C CA   . PHE A 1 24 ? -1.981  -0.395  0.536   1.00 15.00 ?  495 PHE A CA   6  
ATOM   4024  C C    . PHE A 1 24 ? -0.765  -0.034  1.362   1.00 15.00 ?  495 PHE A C    6  
ATOM   4025  O O    . PHE A 1 24 ? -0.341  -0.782  2.247   1.00 15.00 ?  495 PHE A O    6  
ATOM   4026  C CB   . PHE A 1 24 ? -3.224  -0.453  1.433   1.00 15.00 ?  495 PHE A CB   6  
ATOM   4027  C CG   . PHE A 1 24 ? -4.445  -0.943  0.716   1.00 15.00 ?  495 PHE A CG   6  
ATOM   4028  C CD1  . PHE A 1 24 ? -5.099  -0.119  -0.174  1.00 15.00 ?  495 PHE A CD1  6  
ATOM   4029  C CD2  . PHE A 1 24 ? -4.926  -2.225  0.920   1.00 15.00 ?  495 PHE A CD2  6  
ATOM   4030  C CE1  . PHE A 1 24 ? -6.217  -0.556  -0.856  1.00 15.00 ?  495 PHE A CE1  6  
ATOM   4031  C CE2  . PHE A 1 24 ? -6.043  -2.674  0.241   1.00 15.00 ?  495 PHE A CE2  6  
ATOM   4032  C CZ   . PHE A 1 24 ? -6.689  -1.838  -0.650  1.00 15.00 ?  495 PHE A CZ   6  
ATOM   4033  H H    . PHE A 1 24 ? -1.986  -2.494  0.292   1.00 15.00 ?  495 PHE A H    6  
ATOM   4034  H HA   . PHE A 1 24 ? -2.127  0.371   -0.212  1.00 15.00 ?  495 PHE A HA   6  
ATOM   4035  H HB2  . PHE A 1 24 ? -3.040  -1.102  2.273   1.00 15.00 ?  495 PHE A HB2  6  
ATOM   4036  H HB3  . PHE A 1 24 ? -3.435  0.542   1.798   1.00 15.00 ?  495 PHE A HB3  6  
ATOM   4037  H HD1  . PHE A 1 24 ? -4.729  0.885   -0.330  1.00 15.00 ?  495 PHE A HD1  6  
ATOM   4038  H HD2  . PHE A 1 24 ? -4.421  -2.878  1.619   1.00 15.00 ?  495 PHE A HD2  6  
ATOM   4039  H HE1  . PHE A 1 24 ? -6.714  0.104   -1.559  1.00 15.00 ?  495 PHE A HE1  6  
ATOM   4040  H HE2  . PHE A 1 24 ? -6.410  -3.676  0.406   1.00 15.00 ?  495 PHE A HE2  6  
ATOM   4041  H HZ   . PHE A 1 24 ? -7.562  -2.184  -1.183  1.00 15.00 ?  495 PHE A HZ   6  
ATOM   4042  N N    . ILE A 1 25 ? -0.193  1.100   1.046   1.00 15.00 ?  496 ILE A N    6  
ATOM   4043  C CA   . ILE A 1 25 ? 0.940   1.607   1.784   1.00 15.00 ?  496 ILE A CA   6  
ATOM   4044  C C    . ILE A 1 25 ? 0.501   2.740   2.665   1.00 15.00 ?  496 ILE A C    6  
ATOM   4045  O O    . ILE A 1 25 ? 0.105   3.789   2.159   1.00 15.00 ?  496 ILE A O    6  
ATOM   4046  C CB   . ILE A 1 25 ? 2.041   2.119   0.837   1.00 15.00 ?  496 ILE A CB   6  
ATOM   4047  C CG1  . ILE A 1 25 ? 2.426   1.015   -0.132  1.00 15.00 ?  496 ILE A CG1  6  
ATOM   4048  C CG2  . ILE A 1 25 ? 3.256   2.599   1.625   1.00 15.00 ?  496 ILE A CG2  6  
ATOM   4049  C CD1  . ILE A 1 25 ? 2.992   -0.209  0.548   1.00 15.00 ?  496 ILE A CD1  6  
ATOM   4050  H H    . ILE A 1 25 ? -0.544  1.616   0.287   1.00 15.00 ?  496 ILE A H    6  
ATOM   4051  H HA   . ILE A 1 25 ? 1.343   0.817   2.392   1.00 15.00 ?  496 ILE A HA   6  
ATOM   4052  H HB   . ILE A 1 25 ? 1.648   2.957   0.282   1.00 15.00 ?  496 ILE A HB   6  
ATOM   4053  H HG12 . ILE A 1 25 ? 1.550   0.720   -0.681  1.00 15.00 ?  496 ILE A HG12 6  
ATOM   4054  H HG13 . ILE A 1 25 ? 3.163   1.381   -0.820  1.00 15.00 ?  496 ILE A HG13 6  
ATOM   4055  H HG21 . ILE A 1 25 ? 4.013   2.950   0.940   1.00 15.00 ?  496 ILE A HG21 6  
ATOM   4056  H HG22 . ILE A 1 25 ? 3.650   1.781   2.210   1.00 15.00 ?  496 ILE A HG22 6  
ATOM   4057  H HG23 . ILE A 1 25 ? 2.964   3.404   2.283   1.00 15.00 ?  496 ILE A HG23 6  
ATOM   4058  H HD11 . ILE A 1 25 ? 2.254   -0.619  1.222   1.00 15.00 ?  496 ILE A HD11 6  
ATOM   4059  H HD12 . ILE A 1 25 ? 3.874   0.072   1.104   1.00 15.00 ?  496 ILE A HD12 6  
ATOM   4060  H HD13 . ILE A 1 25 ? 3.252   -0.946  -0.199  1.00 15.00 ?  496 ILE A HD13 6  
ATOM   4061  N N    . ASP A 1 26 ? 0.553   2.550   3.966   1.00 15.00 ?  497 ASP A N    6  
ATOM   4062  C CA   . ASP A 1 26 ? 0.307   3.667   4.836   1.00 15.00 ?  497 ASP A CA   6  
ATOM   4063  C C    . ASP A 1 26 ? 1.611   4.351   5.113   1.00 15.00 ?  497 ASP A C    6  
ATOM   4064  O O    . ASP A 1 26 ? 2.588   3.769   5.599   1.00 15.00 ?  497 ASP A O    6  
ATOM   4065  C CB   . ASP A 1 26 ? -0.416  3.310   6.122   1.00 15.00 ?  497 ASP A CB   6  
ATOM   4066  C CG   . ASP A 1 26 ? 0.447   3.454   7.356   1.00 15.00 ?  497 ASP A CG   6  
ATOM   4067  O OD1  . ASP A 1 26 ? 0.502   4.572   7.916   1.00 15.00 ?  497 ASP A OD1  6  
ATOM   4068  O OD2  . ASP A 1 26 ? 1.081   2.465   7.767   1.00 15.00 -1 497 ASP A OD2  6  
ATOM   4069  H H    . ASP A 1 26 ? 0.770   1.664   4.338   1.00 15.00 ?  497 ASP A H    6  
ATOM   4070  H HA   . ASP A 1 26 ? -0.310  4.359   4.281   1.00 15.00 ?  497 ASP A HA   6  
ATOM   4071  H HB2  . ASP A 1 26 ? -1.241  3.996   6.219   1.00 15.00 ?  497 ASP A HB2  6  
ATOM   4072  H HB3  . ASP A 1 26 ? -0.786  2.298   6.065   1.00 15.00 ?  497 ASP A HB3  6  
ATOM   4073  N N    . HIS A 1 27 ? 1.619   5.584   4.725   1.00 15.00 ?  498 HIS A N    6  
ATOM   4074  C CA   . HIS A 1 27 ? 2.821   6.377   4.736   1.00 15.00 ?  498 HIS A CA   6  
ATOM   4075  C C    . HIS A 1 27 ? 3.135   6.925   6.121   1.00 15.00 ?  498 HIS A C    6  
ATOM   4076  O O    . HIS A 1 27 ? 4.212   7.473   6.338   1.00 15.00 ?  498 HIS A O    6  
ATOM   4077  C CB   . HIS A 1 27 ? 2.726   7.484   3.687   1.00 15.00 ?  498 HIS A CB   6  
ATOM   4078  C CG   . HIS A 1 27 ? 2.965   6.975   2.292   1.00 15.00 ?  498 HIS A CG   6  
ATOM   4079  N ND1  . HIS A 1 27 ? 4.228   6.839   1.765   1.00 15.00 ?  498 HIS A ND1  6  
ATOM   4080  C CD2  . HIS A 1 27 ? 2.109   6.555   1.314   1.00 15.00 ?  498 HIS A CD2  6  
ATOM   4081  C CE1  . HIS A 1 27 ? 4.148   6.366   0.542   1.00 15.00 ?  498 HIS A CE1  6  
ATOM   4082  N NE2  . HIS A 1 27 ? 2.877   6.188   0.234   1.00 15.00 ?  498 HIS A NE2  6  
ATOM   4083  H H    . HIS A 1 27 ? 0.763   5.983   4.442   1.00 15.00 ?  498 HIS A H    6  
ATOM   4084  H HA   . HIS A 1 27 ? 3.628   5.721   4.453   1.00 15.00 ?  498 HIS A HA   6  
ATOM   4085  H HB2  . HIS A 1 27 ? 1.740   7.923   3.720   1.00 15.00 ?  498 HIS A HB2  6  
ATOM   4086  H HB3  . HIS A 1 27 ? 3.465   8.241   3.900   1.00 15.00 ?  498 HIS A HB3  6  
ATOM   4087  H HD1  . HIS A 1 27 ? 5.075   7.063   2.226   1.00 15.00 ?  498 HIS A HD1  6  
ATOM   4088  H HD2  . HIS A 1 27 ? 1.021   6.492   1.374   1.00 15.00 ?  498 HIS A HD2  6  
ATOM   4089  H HE1  . HIS A 1 27 ? 4.989   6.128   -0.095  1.00 15.00 ?  498 HIS A HE1  6  
ATOM   4090  H HE2  . HIS A 1 27 ? 2.543   6.198   -0.702  1.00 15.00 ?  498 HIS A HE2  6  
ATOM   4091  N N    . ASN A 1 28 ? 2.197   6.791   7.060   1.00 15.00 ?  499 ASN A N    6  
ATOM   4092  C CA   . ASN A 1 28 ? 2.410   7.334   8.392   1.00 15.00 ?  499 ASN A CA   6  
ATOM   4093  C C    . ASN A 1 28 ? 3.273   6.401   9.212   1.00 15.00 ?  499 ASN A C    6  
ATOM   4094  O O    . ASN A 1 28 ? 4.251   6.814   9.833   1.00 15.00 ?  499 ASN A O    6  
ATOM   4095  C CB   . ASN A 1 28 ? 1.080   7.521   9.124   1.00 15.00 ?  499 ASN A CB   6  
ATOM   4096  C CG   . ASN A 1 28 ? 0.092   8.377   8.362   1.00 15.00 ?  499 ASN A CG   6  
ATOM   4097  O OD1  . ASN A 1 28 ? 0.122   9.605   8.439   1.00 15.00 ?  499 ASN A OD1  6  
ATOM   4098  N ND2  . ASN A 1 28 ? -0.808  7.729   7.632   1.00 15.00 ?  499 ASN A ND2  6  
ATOM   4099  H H    . ASN A 1 28 ? 1.385   6.274   6.873   1.00 15.00 ?  499 ASN A H    6  
ATOM   4100  H HA   . ASN A 1 28 ? 2.904   8.290   8.296   1.00 15.00 ?  499 ASN A HA   6  
ATOM   4101  H HB2  . ASN A 1 28 ? 0.630   6.551   9.280   1.00 15.00 ?  499 ASN A HB2  6  
ATOM   4102  H HB3  . ASN A 1 28 ? 1.267   7.978   10.084  1.00 15.00 ?  499 ASN A HB3  6  
ATOM   4103  H HD21 . ASN A 1 28 ? -0.782  6.746   7.628   1.00 15.00 ?  499 ASN A HD21 6  
ATOM   4104  H HD22 . ASN A 1 28 ? -1.475  8.258   7.138   1.00 15.00 ?  499 ASN A HD22 6  
ATOM   4105  N N    . THR A 1 29 ? 2.875   5.142   9.234   1.00 15.00 ?  500 THR A N    6  
ATOM   4106  C CA   . THR A 1 29 ? 3.630   4.115   9.922   1.00 15.00 ?  500 THR A CA   6  
ATOM   4107  C C    . THR A 1 29 ? 4.802   3.616   9.082   1.00 15.00 ?  500 THR A C    6  
ATOM   4108  O O    . THR A 1 29 ? 5.740   3.019   9.617   1.00 15.00 ?  500 THR A O    6  
ATOM   4109  C CB   . THR A 1 29 ? 2.726   2.951   10.342  1.00 15.00 ?  500 THR A CB   6  
ATOM   4110  O OG1  . THR A 1 29 ? 1.350   3.346   10.256  1.00 15.00 ?  500 THR A OG1  6  
ATOM   4111  C CG2  . THR A 1 29 ? 3.029   2.559   11.769  1.00 15.00 ?  500 THR A CG2  6  
ATOM   4112  H H    . THR A 1 29 ? 2.032   4.895   8.779   1.00 15.00 ?  500 THR A H    6  
ATOM   4113  H HA   . THR A 1 29 ? 4.028   4.562   10.823  1.00 15.00 ?  500 THR A HA   6  
ATOM   4114  H HB   . THR A 1 29 ? 2.907   2.105   9.695   1.00 15.00 ?  500 THR A HB   6  
ATOM   4115  H HG1  . THR A 1 29 ? 1.038   3.209   9.342   1.00 15.00 ?  500 THR A HG1  6  
ATOM   4116  H HG21 . THR A 1 29 ? 4.057   2.244   11.848  1.00 15.00 ?  500 THR A HG21 6  
ATOM   4117  H HG22 . THR A 1 29 ? 2.376   1.752   12.065  1.00 15.00 ?  500 THR A HG22 6  
ATOM   4118  H HG23 . THR A 1 29 ? 2.862   3.414   12.408  1.00 15.00 ?  500 THR A HG23 6  
ATOM   4119  N N    . LYS A 1 30 ? 4.719   3.852   7.763   1.00 15.00 ?  501 LYS A N    6  
ATOM   4120  C CA   . LYS A 1 30 ? 5.731   3.395   6.805   1.00 15.00 ?  501 LYS A CA   6  
ATOM   4121  C C    . LYS A 1 30 ? 5.626   1.875   6.624   1.00 15.00 ?  501 LYS A C    6  
ATOM   4122  O O    . LYS A 1 30 ? 6.593   1.204   6.260   1.00 15.00 ?  501 LYS A O    6  
ATOM   4123  C CB   . LYS A 1 30 ? 7.138   3.794   7.286   1.00 15.00 ?  501 LYS A CB   6  
ATOM   4124  C CG   . LYS A 1 30 ? 8.225   3.672   6.228   1.00 15.00 ?  501 LYS A CG   6  
ATOM   4125  C CD   . LYS A 1 30 ? 9.609   3.765   6.852   1.00 15.00 ?  501 LYS A CD   6  
ATOM   4126  C CE   . LYS A 1 30 ? 10.705  3.751   5.798   1.00 15.00 ?  501 LYS A CE   6  
ATOM   4127  N NZ   . LYS A 1 30 ? 10.722  5.004   4.999   1.00 15.00 1  501 LYS A NZ   6  
ATOM   4128  H H    . LYS A 1 30 ? 3.941   4.345   7.426   1.00 15.00 ?  501 LYS A H    6  
ATOM   4129  H HA   . LYS A 1 30 ? 5.530   3.873   5.857   1.00 15.00 ?  501 LYS A HA   6  
ATOM   4130  H HB2  . LYS A 1 30 ? 7.111   4.819   7.621   1.00 15.00 ?  501 LYS A HB2  6  
ATOM   4131  H HB3  . LYS A 1 30 ? 7.409   3.163   8.121   1.00 15.00 ?  501 LYS A HB3  6  
ATOM   4132  H HG2  . LYS A 1 30 ? 8.128   2.718   5.730   1.00 15.00 ?  501 LYS A HG2  6  
ATOM   4133  H HG3  . LYS A 1 30 ? 8.109   4.470   5.510   1.00 15.00 ?  501 LYS A HG3  6  
ATOM   4134  H HD2  . LYS A 1 30 ? 9.678   4.684   7.412   1.00 15.00 ?  501 LYS A HD2  6  
ATOM   4135  H HD3  . LYS A 1 30 ? 9.751   2.925   7.516   1.00 15.00 ?  501 LYS A HD3  6  
ATOM   4136  H HE2  . LYS A 1 30 ? 11.658  3.636   6.290   1.00 15.00 ?  501 LYS A HE2  6  
ATOM   4137  H HE3  . LYS A 1 30 ? 10.539  2.913   5.136   1.00 15.00 ?  501 LYS A HE3  6  
ATOM   4138  H HZ1  . LYS A 1 30 ? 11.491  4.969   4.295   1.00 15.00 ?  501 LYS A HZ1  6  
ATOM   4139  H HZ2  . LYS A 1 30 ? 10.876  5.826   5.622   1.00 15.00 ?  501 LYS A HZ2  6  
ATOM   4140  H HZ3  . LYS A 1 30 ? 9.819   5.125   4.499   1.00 15.00 ?  501 LYS A HZ3  6  
ATOM   4141  N N    . THR A 1 31 ? 4.424   1.344   6.816   1.00 15.00 ?  502 THR A N    6  
ATOM   4142  C CA   . THR A 1 31 ? 4.233   -0.100  6.805   1.00 15.00 ?  502 THR A CA   6  
ATOM   4143  C C    . THR A 1 31 ? 3.471   -0.581  5.570   1.00 15.00 ?  502 THR A C    6  
ATOM   4144  O O    . THR A 1 31 ? 2.641   0.139   5.005   1.00 15.00 ?  502 THR A O    6  
ATOM   4145  C CB   . THR A 1 31 ? 3.525   -0.599  8.084   1.00 15.00 ?  502 THR A CB   6  
ATOM   4146  O OG1  . THR A 1 31 ? 2.345   0.170   8.357   1.00 15.00 ?  502 THR A OG1  6  
ATOM   4147  C CG2  . THR A 1 31 ? 4.462   -0.532  9.277   1.00 15.00 ?  502 THR A CG2  6  
ATOM   4148  H H    . THR A 1 31 ? 3.650   1.935   6.932   1.00 15.00 ?  502 THR A H    6  
ATOM   4149  H HA   . THR A 1 31 ? 5.218   -0.548  6.784   1.00 15.00 ?  502 THR A HA   6  
ATOM   4150  H HB   . THR A 1 31 ? 3.240   -1.630  7.934   1.00 15.00 ?  502 THR A HB   6  
ATOM   4151  H HG1  . THR A 1 31 ? 2.207   0.830   7.661   1.00 15.00 ?  502 THR A HG1  6  
ATOM   4152  H HG21 . THR A 1 31 ? 5.327   -1.154  9.093   1.00 15.00 ?  502 THR A HG21 6  
ATOM   4153  H HG22 . THR A 1 31 ? 3.948   -0.884  10.159  1.00 15.00 ?  502 THR A HG22 6  
ATOM   4154  H HG23 . THR A 1 31 ? 4.780   0.490   9.430   1.00 15.00 ?  502 THR A HG23 6  
ATOM   4155  N N    . THR A 1 32 ? 3.779   -1.808  5.163   1.00 15.00 ?  503 THR A N    6  
ATOM   4156  C CA   . THR A 1 32 ? 3.176   -2.434  3.996   1.00 15.00 ?  503 THR A CA   6  
ATOM   4157  C C    . THR A 1 32 ? 1.957   -3.272  4.396   1.00 15.00 ?  503 THR A C    6  
ATOM   4158  O O    . THR A 1 32 ? 2.083   -4.226  5.167   1.00 15.00 ?  503 THR A O    6  
ATOM   4159  C CB   . THR A 1 32 ? 4.213   -3.342  3.302   1.00 15.00 ?  503 THR A CB   6  
ATOM   4160  O OG1  . THR A 1 32 ? 4.856   -4.179  4.275   1.00 15.00 ?  503 THR A OG1  6  
ATOM   4161  C CG2  . THR A 1 32 ? 5.267   -2.526  2.572   1.00 15.00 ?  503 THR A CG2  6  
ATOM   4162  H H    . THR A 1 32 ? 4.441   -2.320  5.670   1.00 15.00 ?  503 THR A H    6  
ATOM   4163  H HA   . THR A 1 32 ? 2.874   -1.661  3.306   1.00 15.00 ?  503 THR A HA   6  
ATOM   4164  H HB   . THR A 1 32 ? 3.699   -3.965  2.582   1.00 15.00 ?  503 THR A HB   6  
ATOM   4165  H HG1  . THR A 1 32 ? 4.257   -4.897  4.525   1.00 15.00 ?  503 THR A HG1  6  
ATOM   4166  H HG21 . THR A 1 32 ? 5.574   -1.699  3.193   1.00 15.00 ?  503 THR A HG21 6  
ATOM   4167  H HG22 . THR A 1 32 ? 4.861   -2.156  1.645   1.00 15.00 ?  503 THR A HG22 6  
ATOM   4168  H HG23 . THR A 1 32 ? 6.122   -3.152  2.363   1.00 15.00 ?  503 THR A HG23 6  
ATOM   4169  N N    . THR A 1 33 ? 0.779   -2.930  3.879   1.00 15.00 ?  504 THR A N    6  
ATOM   4170  C CA   . THR A 1 33 ? -0.437  -3.651  4.244   1.00 15.00 ?  504 THR A CA   6  
ATOM   4171  C C    . THR A 1 33 ? -1.193  -4.170  3.018   1.00 15.00 ?  504 THR A C    6  
ATOM   4172  O O    . THR A 1 33 ? -1.215  -3.529  1.969   1.00 15.00 ?  504 THR A O    6  
ATOM   4173  C CB   . THR A 1 33 ? -1.395  -2.763  5.073   1.00 15.00 ?  504 THR A CB   6  
ATOM   4174  O OG1  . THR A 1 33 ? -1.749  -1.587  4.340   1.00 15.00 ?  504 THR A OG1  6  
ATOM   4175  C CG2  . THR A 1 33 ? -0.770  -2.354  6.396   1.00 15.00 ?  504 THR A CG2  6  
ATOM   4176  H H    . THR A 1 33 ? 0.724   -2.184  3.241   1.00 15.00 ?  504 THR A H    6  
ATOM   4177  H HA   . THR A 1 33 ? -0.150  -4.491  4.855   1.00 15.00 ?  504 THR A HA   6  
ATOM   4178  H HB   . THR A 1 33 ? -2.293  -3.329  5.280   1.00 15.00 ?  504 THR A HB   6  
ATOM   4179  H HG1  . THR A 1 33 ? -1.156  -1.483  3.585   1.00 15.00 ?  504 THR A HG1  6  
ATOM   4180  H HG21 . THR A 1 33 ? -0.563  -3.234  6.985   1.00 15.00 ?  504 THR A HG21 6  
ATOM   4181  H HG22 . THR A 1 33 ? -1.455  -1.712  6.932   1.00 15.00 ?  504 THR A HG22 6  
ATOM   4182  H HG23 . THR A 1 33 ? 0.149   -1.821  6.209   1.00 15.00 ?  504 THR A HG23 6  
ATOM   4183  N N    . TRP A 1 34 ? -1.788  -5.350  3.156   1.00 15.00 ?  505 TRP A N    6  
ATOM   4184  C CA   . TRP A 1 34 ? -2.760  -5.838  2.179   1.00 15.00 ?  505 TRP A CA   6  
ATOM   4185  C C    . TRP A 1 34 ? -4.166  -5.504  2.665   1.00 15.00 ?  505 TRP A C    6  
ATOM   4186  O O    . TRP A 1 34 ? -5.154  -5.679  1.949   1.00 15.00 ?  505 TRP A O    6  
ATOM   4187  C CB   . TRP A 1 34 ? -2.669  -7.356  2.003   1.00 15.00 ?  505 TRP A CB   6  
ATOM   4188  C CG   . TRP A 1 34 ? -1.467  -7.866  1.262   1.00 15.00 ?  505 TRP A CG   6  
ATOM   4189  C CD1  . TRP A 1 34 ? -0.409  -8.546  1.792   1.00 15.00 ?  505 TRP A CD1  6  
ATOM   4190  C CD2  . TRP A 1 34 ? -1.219  -7.778  -0.148  1.00 15.00 ?  505 TRP A CD2  6  
ATOM   4191  N NE1  . TRP A 1 34 ? 0.470   -8.900  0.800   1.00 15.00 ?  505 TRP A NE1  6  
ATOM   4192  C CE2  . TRP A 1 34 ? 0.002   -8.435  -0.397  1.00 15.00 ?  505 TRP A CE2  6  
ATOM   4193  C CE3  . TRP A 1 34 ? -1.908  -7.212  -1.224  1.00 15.00 ?  505 TRP A CE3  6  
ATOM   4194  C CZ2  . TRP A 1 34 ? 0.544   -8.545  -1.674  1.00 15.00 ?  505 TRP A CZ2  6  
ATOM   4195  C CZ3  . TRP A 1 34 ? -1.367  -7.320  -2.492  1.00 15.00 ?  505 TRP A CZ3  6  
ATOM   4196  C CH2  . TRP A 1 34 ? -0.152  -7.984  -2.706  1.00 15.00 ?  505 TRP A CH2  6  
ATOM   4197  H H    . TRP A 1 34 ? -1.565  -5.913  3.929   1.00 15.00 ?  505 TRP A H    6  
ATOM   4198  H HA   . TRP A 1 34 ? -2.577  -5.347  1.235   1.00 15.00 ?  505 TRP A HA   6  
ATOM   4199  H HB2  . TRP A 1 34 ? -2.661  -7.815  2.979   1.00 15.00 ?  505 TRP A HB2  6  
ATOM   4200  H HB3  . TRP A 1 34 ? -3.548  -7.692  1.472   1.00 15.00 ?  505 TRP A HB3  6  
ATOM   4201  H HD1  . TRP A 1 34 ? -0.298  -8.777  2.842   1.00 15.00 ?  505 TRP A HD1  6  
ATOM   4202  H HE1  . TRP A 1 34 ? 1.304   -9.405  0.927   1.00 15.00 ?  505 TRP A HE1  6  
ATOM   4203  H HE3  . TRP A 1 34 ? -2.842  -6.692  -1.077  1.00 15.00 ?  505 TRP A HE3  6  
ATOM   4204  H HZ2  . TRP A 1 34 ? 1.478   -9.053  -1.856  1.00 15.00 ?  505 TRP A HZ2  6  
ATOM   4205  H HZ3  . TRP A 1 34 ? -1.886  -6.889  -3.337  1.00 15.00 ?  505 TRP A HZ3  6  
ATOM   4206  H HH2  . TRP A 1 34 ? 0.235   -8.049  -3.716  1.00 15.00 ?  505 TRP A HH2  6  
ATOM   4207  N N    . GLU A 1 35 ? -4.237  -5.036  3.903   1.00 15.00 ?  506 GLU A N    6  
ATOM   4208  C CA   . GLU A 1 35 ? -5.505  -4.838  4.585   1.00 15.00 ?  506 GLU A CA   6  
ATOM   4209  C C    . GLU A 1 35 ? -6.153  -3.554  4.164   1.00 15.00 ?  506 GLU A C    6  
ATOM   4210  O O    . GLU A 1 35 ? -5.538  -2.489  4.184   1.00 15.00 ?  506 GLU A O    6  
ATOM   4211  C CB   . GLU A 1 35 ? -5.305  -4.849  6.104   1.00 15.00 ?  506 GLU A CB   6  
ATOM   4212  C CG   . GLU A 1 35 ? -4.324  -5.907  6.596   1.00 15.00 ?  506 GLU A CG   6  
ATOM   4213  C CD   . GLU A 1 35 ? -4.724  -7.316  6.214   1.00 15.00 ?  506 GLU A CD   6  
ATOM   4214  O OE1  . GLU A 1 35 ? -5.614  -7.887  6.872   1.00 15.00 ?  506 GLU A OE1  6  
ATOM   4215  O OE2  . GLU A 1 35 ? -4.128  -7.866  5.269   1.00 15.00 -1 506 GLU A OE2  6  
ATOM   4216  H H    . GLU A 1 35 ? -3.409  -4.808  4.368   1.00 15.00 ?  506 GLU A H    6  
ATOM   4217  H HA   . GLU A 1 35 ? -6.169  -5.625  4.302   1.00 15.00 ?  506 GLU A HA   6  
ATOM   4218  H HB2  . GLU A 1 35 ? -4.937  -3.882  6.414   1.00 15.00 ?  506 GLU A HB2  6  
ATOM   4219  H HB3  . GLU A 1 35 ? -6.258  -5.029  6.576   1.00 15.00 ?  506 GLU A HB3  6  
ATOM   4220  H HG2  . GLU A 1 35 ? -3.354  -5.700  6.172   1.00 15.00 ?  506 GLU A HG2  6  
ATOM   4221  H HG3  . GLU A 1 35 ? -4.264  -5.845  7.673   1.00 15.00 ?  506 GLU A HG3  6  
ATOM   4222  N N    . ASP A 1 36 ? -7.413  -3.660  3.796   1.00 15.00 ?  507 ASP A N    6  
ATOM   4223  C CA   . ASP A 1 36 ? -8.135  -2.502  3.375   1.00 15.00 ?  507 ASP A CA   6  
ATOM   4224  C C    . ASP A 1 36 ? -8.708  -1.791  4.594   1.00 15.00 ?  507 ASP A C    6  
ATOM   4225  O O    . ASP A 1 36 ? -9.358  -2.411  5.441   1.00 15.00 ?  507 ASP A O    6  
ATOM   4226  C CB   . ASP A 1 36 ? -9.234  -2.852  2.357   1.00 15.00 ?  507 ASP A CB   6  
ATOM   4227  C CG   . ASP A 1 36 ? -10.356 -3.685  2.944   1.00 15.00 ?  507 ASP A CG   6  
ATOM   4228  O OD1  . ASP A 1 36 ? -10.179 -4.912  3.090   1.00 15.00 -1 507 ASP A OD1  6  
ATOM   4229  O OD2  . ASP A 1 36 ? -11.430 -3.117  3.249   1.00 15.00 ?  507 ASP A OD2  6  
ATOM   4230  H H    . ASP A 1 36 ? -7.861  -4.531  3.824   1.00 15.00 ?  507 ASP A H    6  
ATOM   4231  H HA   . ASP A 1 36 ? -7.410  -1.871  2.911   1.00 15.00 ?  507 ASP A HA   6  
ATOM   4232  H HB2  . ASP A 1 36 ? -9.659  -1.938  1.971   1.00 15.00 ?  507 ASP A HB2  6  
ATOM   4233  H HB3  . ASP A 1 36 ? -8.790  -3.405  1.543   1.00 15.00 ?  507 ASP A HB3  6  
ATOM   4234  N N    . PRO A 1 37 ? -8.476  -0.478  4.702   1.00 15.00 ?  508 PRO A N    6  
ATOM   4235  C CA   . PRO A 1 37 ? -8.866  0.309   5.877   1.00 15.00 ?  508 PRO A CA   6  
ATOM   4236  C C    . PRO A 1 37 ? -10.357 0.653   5.903   1.00 15.00 ?  508 PRO A C    6  
ATOM   4237  O O    . PRO A 1 37 ? -10.768 1.595   6.584   1.00 15.00 ?  508 PRO A O    6  
ATOM   4238  C CB   . PRO A 1 37 ? -8.017  1.569   5.730   1.00 15.00 ?  508 PRO A CB   6  
ATOM   4239  C CG   . PRO A 1 37 ? -7.836  1.737   4.262   1.00 15.00 ?  508 PRO A CG   6  
ATOM   4240  C CD   . PRO A 1 37 ? -7.803  0.349   3.681   1.00 15.00 ?  508 PRO A CD   6  
ATOM   4241  H HA   . PRO A 1 37 ? -8.603  -0.198  6.792   1.00 15.00 ?  508 PRO A HA   6  
ATOM   4242  H HB2  . PRO A 1 37 ? -8.533  2.407   6.164   1.00 15.00 ?  508 PRO A HB2  6  
ATOM   4243  H HB3  . PRO A 1 37 ? -7.070  1.425   6.228   1.00 15.00 ?  508 PRO A HB3  6  
ATOM   4244  H HG2  . PRO A 1 37 ? -8.663  2.296   3.855   1.00 15.00 ?  508 PRO A HG2  6  
ATOM   4245  H HG3  . PRO A 1 37 ? -6.906  2.248   4.064   1.00 15.00 ?  508 PRO A HG3  6  
ATOM   4246  H HD2  . PRO A 1 37 ? -8.342  0.321   2.746   1.00 15.00 ?  508 PRO A HD2  6  
ATOM   4247  H HD3  . PRO A 1 37 ? -6.784  0.026   3.539   1.00 15.00 ?  508 PRO A HD3  6  
ATOM   4248  N N    . ARG A 1 38 ? -11.155 -0.149  5.197   1.00 15.00 ?  509 ARG A N    6  
ATOM   4249  C CA   . ARG A 1 38 ? -12.606 0.033   5.121   1.00 15.00 ?  509 ARG A CA   6  
ATOM   4250  C C    . ARG A 1 38 ? -12.963 1.343   4.425   1.00 15.00 ?  509 ARG A C    6  
ATOM   4251  O O    . ARG A 1 38 ? -13.091 1.332   3.183   1.00 15.00 ?  509 ARG A O    6  
ATOM   4252  C CB   . ARG A 1 38 ? -13.264 -0.041  6.510   1.00 15.00 ?  509 ARG A CB   6  
ATOM   4253  C CG   . ARG A 1 38 ? -13.394 -1.460  7.065   1.00 15.00 ?  509 ARG A CG   6  
ATOM   4254  C CD   . ARG A 1 38 ? -12.054 -2.054  7.475   1.00 15.00 ?  509 ARG A CD   6  
ATOM   4255  N NE   . ARG A 1 38 ? -11.487 -1.382  8.644   1.00 15.00 ?  509 ARG A NE   6  
ATOM   4256  C CZ   . ARG A 1 38 ? -10.197 -1.406  8.969   1.00 15.00 ?  509 ARG A CZ   6  
ATOM   4257  N NH1  . ARG A 1 38 ? -9.320  -2.023  8.186   1.00 15.00 1  509 ARG A NH1  6  
ATOM   4258  N NH2  . ARG A 1 38 ? -9.787  -0.799  10.073  1.00 15.00 ?  509 ARG A NH2  6  
ATOM   4259  H H    . ARG A 1 38 ? -10.753 -0.900  4.712   1.00 15.00 ?  509 ARG A H    6  
ATOM   4260  H HA   . ARG A 1 38 ? -12.993 -0.778  4.520   1.00 15.00 ?  509 ARG A HA   6  
ATOM   4261  H HB2  . ARG A 1 38 ? -12.674 0.538   7.204   1.00 15.00 ?  509 ARG A HB2  6  
ATOM   4262  H HB3  . ARG A 1 38 ? -14.255 0.390   6.450   1.00 15.00 ?  509 ARG A HB3  6  
ATOM   4263  H HG2  . ARG A 1 38 ? -14.038 -1.436  7.929   1.00 15.00 ?  509 ARG A HG2  6  
ATOM   4264  H HG3  . ARG A 1 38 ? -13.837 -2.088  6.305   1.00 15.00 ?  509 ARG A HG3  6  
ATOM   4265  H HD2  . ARG A 1 38 ? -12.193 -3.098  7.708   1.00 15.00 ?  509 ARG A HD2  6  
ATOM   4266  H HD3  . ARG A 1 38 ? -11.364 -1.958  6.649   1.00 15.00 ?  509 ARG A HD3  6  
ATOM   4267  H HE   . ARG A 1 38 ? -12.113 -0.897  9.233   1.00 15.00 ?  509 ARG A HE   6  
ATOM   4268  H HH11 . ARG A 1 38 ? -9.626  -2.470  7.338   1.00 15.00 ?  509 ARG A HH11 6  
ATOM   4269  H HH12 . ARG A 1 38 ? -8.344  -2.056  8.441   1.00 15.00 ?  509 ARG A HH12 6  
ATOM   4270  H HH21 . ARG A 1 38 ? -10.448 -0.328  10.665  1.00 15.00 ?  509 ARG A HH21 6  
ATOM   4271  H HH22 . ARG A 1 38 ? -8.809  -0.799  10.322  1.00 15.00 ?  509 ARG A HH22 6  
ATOM   4272  N N    . ARG B 2 1  ? -1.440  -16.564 1.276   1.00 15.00 ?  925 ARG B N    6  
ATOM   4273  C CA   . ARG B 2 1  ? -1.113  -15.201 0.808   1.00 15.00 ?  925 ARG B CA   6  
ATOM   4274  C C    . ARG B 2 1  ? 0.376   -14.919 0.964   1.00 15.00 ?  925 ARG B C    6  
ATOM   4275  O O    . ARG B 2 1  ? 0.954   -15.151 2.026   1.00 15.00 ?  925 ARG B O    6  
ATOM   4276  C CB   . ARG B 2 1  ? -1.902  -14.160 1.607   1.00 15.00 ?  925 ARG B CB   6  
ATOM   4277  C CG   . ARG B 2 1  ? -1.630  -12.732 1.160   1.00 15.00 ?  925 ARG B CG   6  
ATOM   4278  C CD   . ARG B 2 1  ? -2.099  -11.720 2.190   1.00 15.00 ?  925 ARG B CD   6  
ATOM   4279  N NE   . ARG B 2 1  ? -3.552  -11.700 2.349   1.00 15.00 ?  925 ARG B NE   6  
ATOM   4280  C CZ   . ARG B 2 1  ? -4.191  -10.821 3.119   1.00 15.00 ?  925 ARG B CZ   6  
ATOM   4281  N NH1  . ARG B 2 1  ? -3.494  -9.965  3.857   1.00 15.00 1  925 ARG B NH1  6  
ATOM   4282  N NH2  . ARG B 2 1  ? -5.517  -10.814 3.171   1.00 15.00 ?  925 ARG B NH2  6  
ATOM   4283  H H1   . ARG B 2 1  ? -2.435  -16.789 1.064   1.00 15.00 ?  925 ARG B H1   6  
ATOM   4284  H H2   . ARG B 2 1  ? -1.297  -16.632 2.308   1.00 15.00 ?  925 ARG B H2   6  
ATOM   4285  H H3   . ARG B 2 1  ? -0.826  -17.266 0.808   1.00 15.00 ?  925 ARG B H3   6  
ATOM   4286  H HA   . ARG B 2 1  ? -1.378  -15.125 -0.235  1.00 15.00 ?  925 ARG B HA   6  
ATOM   4287  H HB2  . ARG B 2 1  ? -2.959  -14.357 1.497   1.00 15.00 ?  925 ARG B HB2  6  
ATOM   4288  H HB3  . ARG B 2 1  ? -1.635  -14.244 2.650   1.00 15.00 ?  925 ARG B HB3  6  
ATOM   4289  H HG2  . ARG B 2 1  ? -0.568  -12.608 1.011   1.00 15.00 ?  925 ARG B HG2  6  
ATOM   4290  H HG3  . ARG B 2 1  ? -2.149  -12.551 0.230   1.00 15.00 ?  925 ARG B HG3  6  
ATOM   4291  H HD2  . ARG B 2 1  ? -1.652  -11.965 3.142   1.00 15.00 ?  925 ARG B HD2  6  
ATOM   4292  H HD3  . ARG B 2 1  ? -1.769  -10.739 1.883   1.00 15.00 ?  925 ARG B HD3  6  
ATOM   4293  H HE   . ARG B 2 1  ? -4.079  -12.365 1.840   1.00 15.00 ?  925 ARG B HE   6  
ATOM   4294  H HH11 . ARG B 2 1  ? -2.488  -9.986  3.837   1.00 15.00 ?  925 ARG B HH11 6  
ATOM   4295  H HH12 . ARG B 2 1  ? -3.967  -9.279  4.435   1.00 15.00 ?  925 ARG B HH12 6  
ATOM   4296  H HH21 . ARG B 2 1  ? -6.052  -11.471 2.628   1.00 15.00 ?  925 ARG B HH21 6  
ATOM   4297  H HH22 . ARG B 2 1  ? -5.996  -10.149 3.753   1.00 15.00 ?  925 ARG B HH22 6  
ATOM   4298  N N    . LEU B 2 2  ? 0.984   -14.407 -0.097  1.00 15.00 ?  926 LEU B N    6  
ATOM   4299  C CA   . LEU B 2 2  ? 2.376   -13.987 -0.064  1.00 15.00 ?  926 LEU B CA   6  
ATOM   4300  C C    . LEU B 2 2  ? 2.486   -12.650 0.676   1.00 15.00 ?  926 LEU B C    6  
ATOM   4301  O O    . LEU B 2 2  ? 1.840   -11.667 0.302   1.00 15.00 ?  926 LEU B O    6  
ATOM   4302  C CB   . LEU B 2 2  ? 2.906   -13.882 -1.508  1.00 15.00 ?  926 LEU B CB   6  
ATOM   4303  C CG   . LEU B 2 2  ? 4.423   -13.703 -1.684  1.00 15.00 ?  926 LEU B CG   6  
ATOM   4304  C CD1  . LEU B 2 2  ? 4.832   -12.254 -1.480  1.00 15.00 ?  926 LEU B CD1  6  
ATOM   4305  C CD2  . LEU B 2 2  ? 5.189   -14.615 -0.737  1.00 15.00 ?  926 LEU B CD2  6  
ATOM   4306  H H    . LEU B 2 2  ? 0.475   -14.309 -0.936  1.00 15.00 ?  926 LEU B H    6  
ATOM   4307  H HA   . LEU B 2 2  ? 2.942   -14.734 0.472   1.00 15.00 ?  926 LEU B HA   6  
ATOM   4308  H HB2  . LEU B 2 2  ? 2.617   -14.779 -2.035  1.00 15.00 ?  926 LEU B HB2  6  
ATOM   4309  H HB3  . LEU B 2 2  ? 2.417   -13.043 -1.979  1.00 15.00 ?  926 LEU B HB3  6  
ATOM   4310  H HG   . LEU B 2 2  ? 4.689   -13.980 -2.695  1.00 15.00 ?  926 LEU B HG   6  
ATOM   4311  H HD11 . LEU B 2 2  ? 4.341   -11.633 -2.214  1.00 15.00 ?  926 LEU B HD11 6  
ATOM   4312  H HD12 . LEU B 2 2  ? 5.902   -12.163 -1.589  1.00 15.00 ?  926 LEU B HD12 6  
ATOM   4313  H HD13 . LEU B 2 2  ? 4.542   -11.935 -0.488  1.00 15.00 ?  926 LEU B HD13 6  
ATOM   4314  H HD21 . LEU B 2 2  ? 6.250   -14.472 -0.878  1.00 15.00 ?  926 LEU B HD21 6  
ATOM   4315  H HD22 . LEU B 2 2  ? 4.934   -15.645 -0.943  1.00 15.00 ?  926 LEU B HD22 6  
ATOM   4316  H HD23 . LEU B 2 2  ? 4.927   -14.378 0.284   1.00 15.00 ?  926 LEU B HD23 6  
ATOM   4317  N N    . ASP B 2 3  ? 3.288   -12.629 1.740   1.00 15.00 ?  927 ASP B N    6  
ATOM   4318  C CA   . ASP B 2 3  ? 3.461   -11.428 2.555   1.00 15.00 ?  927 ASP B CA   6  
ATOM   4319  C C    . ASP B 2 3  ? 4.087   -10.318 1.722   1.00 15.00 ?  927 ASP B C    6  
ATOM   4320  O O    . ASP B 2 3  ? 5.100   -10.535 1.059   1.00 15.00 ?  927 ASP B O    6  
ATOM   4321  C CB   . ASP B 2 3  ? 4.332   -11.731 3.780   1.00 15.00 ?  927 ASP B CB   6  
ATOM   4322  C CG   . ASP B 2 3  ? 4.366   -10.584 4.776   1.00 15.00 ?  927 ASP B CG   6  
ATOM   4323  O OD1  . ASP B 2 3  ? 3.450   -10.497 5.622   1.00 15.00 -1 927 ASP B OD1  6  
ATOM   4324  O OD2  . ASP B 2 3  ? 5.314   -9.772  4.734   1.00 15.00 ?  927 ASP B OD2  6  
ATOM   4325  H H    . ASP B 2 3  ? 3.784   -13.438 1.977   1.00 15.00 ?  927 ASP B H    6  
ATOM   4326  H HA   . ASP B 2 3  ? 2.483   -11.107 2.887   1.00 15.00 ?  927 ASP B HA   6  
ATOM   4327  H HB2  . ASP B 2 3  ? 3.945   -12.604 4.281   1.00 15.00 ?  927 ASP B HB2  6  
ATOM   4328  H HB3  . ASP B 2 3  ? 5.344   -11.929 3.453   1.00 15.00 ?  927 ASP B HB3  6  
ATOM   4329  N N    . LEU B 2 4  ? 3.474   -9.138  1.771   1.00 15.00 ?  928 LEU B N    6  
ATOM   4330  C CA   . LEU B 2 4  ? 3.875   -7.998  0.944   1.00 15.00 ?  928 LEU B CA   6  
ATOM   4331  C C    . LEU B 2 4  ? 5.382   -7.741  1.048   1.00 15.00 ?  928 LEU B C    6  
ATOM   4332  O O    . LEU B 2 4  ? 5.918   -7.634  2.151   1.00 15.00 ?  928 LEU B O    6  
ATOM   4333  C CB   . LEU B 2 4  ? 3.086   -6.759  1.387   1.00 15.00 ?  928 LEU B CB   6  
ATOM   4334  C CG   . LEU B 2 4  ? 3.131   -5.563  0.432   1.00 15.00 ?  928 LEU B CG   6  
ATOM   4335  C CD1  . LEU B 2 4  ? 2.666   -5.963  -0.957  1.00 15.00 ?  928 LEU B CD1  6  
ATOM   4336  C CD2  . LEU B 2 4  ? 2.269   -4.430  0.965   1.00 15.00 ?  928 LEU B CD2  6  
ATOM   4337  H H    . LEU B 2 4  ? 2.730   -9.024  2.395   1.00 15.00 ?  928 LEU B H    6  
ATOM   4338  H HA   . LEU B 2 4  ? 3.628   -8.226  -0.081  1.00 15.00 ?  928 LEU B HA   6  
ATOM   4339  H HB2  . LEU B 2 4  ? 2.052   -7.048  1.516   1.00 15.00 ?  928 LEU B HB2  6  
ATOM   4340  H HB3  . LEU B 2 4  ? 3.472   -6.439  2.345   1.00 15.00 ?  928 LEU B HB3  6  
ATOM   4341  H HG   . LEU B 2 4  ? 4.147   -5.205  0.356   1.00 15.00 ?  928 LEU B HG   6  
ATOM   4342  H HD11 . LEU B 2 4  ? 2.703   -5.104  -1.609  1.00 15.00 ?  928 LEU B HD11 6  
ATOM   4343  H HD12 . LEU B 2 4  ? 1.654   -6.334  -0.907  1.00 15.00 ?  928 LEU B HD12 6  
ATOM   4344  H HD13 . LEU B 2 4  ? 3.314   -6.735  -1.344  1.00 15.00 ?  928 LEU B HD13 6  
ATOM   4345  H HD21 . LEU B 2 4  ? 2.628   -4.132  1.938   1.00 15.00 ?  928 LEU B HD21 6  
ATOM   4346  H HD22 . LEU B 2 4  ? 1.244   -4.763  1.044   1.00 15.00 ?  928 LEU B HD22 6  
ATOM   4347  H HD23 . LEU B 2 4  ? 2.323   -3.588  0.291   1.00 15.00 ?  928 LEU B HD23 6  
ATOM   4348  N N    . PRO B 2 5  ? 6.074   -7.621  -0.106  1.00 15.00 ?  929 PRO B N    6  
ATOM   4349  C CA   . PRO B 2 5  ? 7.540   -7.505  -0.152  1.00 15.00 ?  929 PRO B CA   6  
ATOM   4350  C C    . PRO B 2 5  ? 8.066   -6.350  0.700   1.00 15.00 ?  929 PRO B C    6  
ATOM   4351  O O    . PRO B 2 5  ? 7.371   -5.348  0.892   1.00 15.00 ?  929 PRO B O    6  
ATOM   4352  C CB   . PRO B 2 5  ? 7.844   -7.251  -1.639  1.00 15.00 ?  929 PRO B CB   6  
ATOM   4353  C CG   . PRO B 2 5  ? 6.547   -6.848  -2.250  1.00 15.00 ?  929 PRO B CG   6  
ATOM   4354  C CD   . PRO B 2 5  ? 5.485   -7.545  -1.455  1.00 15.00 ?  929 PRO B CD   6  
ATOM   4355  H HA   . PRO B 2 5  ? 8.016   -8.421  0.163   1.00 15.00 ?  929 PRO B HA   6  
ATOM   4356  H HB2  . PRO B 2 5  ? 8.580   -6.467  -1.727  1.00 15.00 ?  929 PRO B HB2  6  
ATOM   4357  H HB3  . PRO B 2 5  ? 8.223   -8.157  -2.088  1.00 15.00 ?  929 PRO B HB3  6  
ATOM   4358  H HG2  . PRO B 2 5  ? 6.424   -5.776  -2.182  1.00 15.00 ?  929 PRO B HG2  6  
ATOM   4359  H HG3  . PRO B 2 5  ? 6.513   -7.165  -3.282  1.00 15.00 ?  929 PRO B HG3  6  
ATOM   4360  H HD2  . PRO B 2 5  ? 4.579   -6.958  -1.448  1.00 15.00 ?  929 PRO B HD2  6  
ATOM   4361  H HD3  . PRO B 2 5  ? 5.295   -8.525  -1.859  1.00 15.00 ?  929 PRO B HD3  6  
ATOM   4362  N N    . PRO B 2 6  ? 9.307   -6.481  1.209   1.00 15.00 ?  930 PRO B N    6  
ATOM   4363  C CA   . PRO B 2 6  ? 9.963   -5.434  1.997   1.00 15.00 ?  930 PRO B CA   6  
ATOM   4364  C C    . PRO B 2 6  ? 9.868   -4.084  1.302   1.00 15.00 ?  930 PRO B C    6  
ATOM   4365  O O    . PRO B 2 6  ? 10.187  -3.966  0.117   1.00 15.00 ?  930 PRO B O    6  
ATOM   4366  C CB   . PRO B 2 6  ? 11.428  -5.895  2.084   1.00 15.00 ?  930 PRO B CB   6  
ATOM   4367  C CG   . PRO B 2 6  ? 11.546  -7.062  1.155   1.00 15.00 ?  930 PRO B CG   6  
ATOM   4368  C CD   . PRO B 2 6  ? 10.172  -7.655  1.052   1.00 15.00 ?  930 PRO B CD   6  
ATOM   4369  H HA   . PRO B 2 6  ? 9.541   -5.360  2.990   1.00 15.00 ?  930 PRO B HA   6  
ATOM   4370  H HB2  . PRO B 2 6  ? 12.077  -5.085  1.781   1.00 15.00 ?  930 PRO B HB2  6  
ATOM   4371  H HB3  . PRO B 2 6  ? 11.655  -6.179  3.100   1.00 15.00 ?  930 PRO B HB3  6  
ATOM   4372  H HG2  . PRO B 2 6  ? 11.884  -6.727  0.185   1.00 15.00 ?  930 PRO B HG2  6  
ATOM   4373  H HG3  . PRO B 2 6  ? 12.236  -7.786  1.564   1.00 15.00 ?  930 PRO B HG3  6  
ATOM   4374  H HD2  . PRO B 2 6  ? 10.029  -8.116  0.086   1.00 15.00 ?  930 PRO B HD2  6  
ATOM   4375  H HD3  . PRO B 2 6  ? 10.006  -8.368  1.844   1.00 15.00 ?  930 PRO B HD3  6  
ATOM   4376  N N    . TYR B 2 7  ? 9.421   -3.075  2.038   1.00 15.00 ?  931 TYR B N    6  
ATOM   4377  C CA   . TYR B 2 7  ? 9.101   -1.786  1.446   1.00 15.00 ?  931 TYR B CA   6  
ATOM   4378  C C    . TYR B 2 7  ? 10.320  -1.156  0.778   1.00 15.00 ?  931 TYR B C    6  
ATOM   4379  O O    . TYR B 2 7  ? 11.334  -0.877  1.423   1.00 15.00 ?  931 TYR B O    6  
ATOM   4380  C CB   . TYR B 2 7  ? 8.546   -0.849  2.529   1.00 15.00 ?  931 TYR B CB   6  
ATOM   4381  C CG   . TYR B 2 7  ? 7.961   0.456   2.014   1.00 15.00 ?  931 TYR B CG   6  
ATOM   4382  C CD1  . TYR B 2 7  ? 7.443   0.563   0.728   1.00 15.00 ?  931 TYR B CD1  6  
ATOM   4383  C CD2  . TYR B 2 7  ? 7.920   1.583   2.828   1.00 15.00 ?  931 TYR B CD2  6  
ATOM   4384  C CE1  . TYR B 2 7  ? 6.906   1.751   0.271   1.00 15.00 ?  931 TYR B CE1  6  
ATOM   4385  C CE2  . TYR B 2 7  ? 7.384   2.773   2.377   1.00 15.00 ?  931 TYR B CE2  6  
ATOM   4386  C CZ   . TYR B 2 7  ? 6.879   2.851   1.096   1.00 15.00 ?  931 TYR B CZ   6  
ATOM   4387  O OH   . TYR B 2 7  ? 6.346   4.033   0.636   1.00 15.00 ?  931 TYR B OH   6  
ATOM   4388  H H    . TYR B 2 7  ? 9.301   -3.201  3.002   1.00 15.00 ?  931 TYR B H    6  
ATOM   4389  H HA   . TYR B 2 7  ? 8.340   -1.944  0.699   1.00 15.00 ?  931 TYR B HA   6  
ATOM   4390  H HB2  . TYR B 2 7  ? 7.769   -1.363  3.069   1.00 15.00 ?  931 TYR B HB2  6  
ATOM   4391  H HB3  . TYR B 2 7  ? 9.342   -0.603  3.215   1.00 15.00 ?  931 TYR B HB3  6  
ATOM   4392  H HD1  . TYR B 2 7  ? 7.460   -0.298  0.080   1.00 15.00 ?  931 TYR B HD1  6  
ATOM   4393  H HD2  . TYR B 2 7  ? 8.316   1.524   3.828   1.00 15.00 ?  931 TYR B HD2  6  
ATOM   4394  H HE1  . TYR B 2 7  ? 6.512   1.811   -0.733  1.00 15.00 ?  931 TYR B HE1  6  
ATOM   4395  H HE2  . TYR B 2 7  ? 7.359   3.633   3.030   1.00 15.00 ?  931 TYR B HE2  6  
ATOM   4396  H HH   . TYR B 2 7  ? 5.562   3.845   0.111   1.00 15.00 ?  931 TYR B HH   6  
ATOM   4397  N N    . GLU B 2 8  ? 10.190  -0.931  -0.518  1.00 15.00 ?  932 GLU B N    6  
ATOM   4398  C CA   . GLU B 2 8  ? 11.119  -0.115  -1.278  1.00 15.00 ?  932 GLU B CA   6  
ATOM   4399  C C    . GLU B 2 8  ? 10.397  1.178   -1.586  1.00 15.00 ?  932 GLU B C    6  
ATOM   4400  O O    . GLU B 2 8  ? 9.274   1.134   -2.090  1.00 15.00 ?  932 GLU B O    6  
ATOM   4401  C CB   . GLU B 2 8  ? 11.506  -0.796  -2.596  1.00 15.00 ?  932 GLU B CB   6  
ATOM   4402  C CG   . GLU B 2 8  ? 12.074  -2.196  -2.445  1.00 15.00 ?  932 GLU B CG   6  
ATOM   4403  C CD   . GLU B 2 8  ? 12.377  -2.833  -3.788  1.00 15.00 ?  932 GLU B CD   6  
ATOM   4404  O OE1  . GLU B 2 8  ? 11.465  -3.440  -4.387  1.00 15.00 -1 932 GLU B OE1  6  
ATOM   4405  O OE2  . GLU B 2 8  ? 13.525  -2.711  -4.267  1.00 15.00 ?  932 GLU B OE2  6  
ATOM   4406  H H    . GLU B 2 8  ? 9.434   -1.337  -0.989  1.00 15.00 ?  932 GLU B H    6  
ATOM   4407  H HA   . GLU B 2 8  ? 11.997  0.079   -0.679  1.00 15.00 ?  932 GLU B HA   6  
ATOM   4408  H HB2  . GLU B 2 8  ? 10.629  -0.859  -3.221  1.00 15.00 ?  932 GLU B HB2  6  
ATOM   4409  H HB3  . GLU B 2 8  ? 12.244  -0.185  -3.096  1.00 15.00 ?  932 GLU B HB3  6  
ATOM   4410  H HG2  . GLU B 2 8  ? 12.988  -2.145  -1.871  1.00 15.00 ?  932 GLU B HG2  6  
ATOM   4411  H HG3  . GLU B 2 8  ? 11.354  -2.811  -1.927  1.00 15.00 ?  932 GLU B HG3  6  
ATOM   4412  N N    . THR B 2 9  ? 10.986  2.321   -1.289  1.00 15.00 ?  933 THR B N    6  
ATOM   4413  C CA   . THR B 2 9  ? 10.238  3.542   -1.459  1.00 15.00 ?  933 THR B CA   6  
ATOM   4414  C C    . THR B 2 9  ? 10.049  3.866   -2.934  1.00 15.00 ?  933 THR B C    6  
ATOM   4415  O O    . THR B 2 9  ? 10.998  4.044   -3.700  1.00 15.00 ?  933 THR B O    6  
ATOM   4416  C CB   . THR B 2 9  ? 10.861  4.743   -0.727  1.00 15.00 ?  933 THR B CB   6  
ATOM   4417  O OG1  . THR B 2 9  ? 11.132  4.395   0.640   1.00 15.00 ?  933 THR B OG1  6  
ATOM   4418  C CG2  . THR B 2 9  ? 9.901   5.929   -0.767  1.00 15.00 ?  933 THR B CG2  6  
ATOM   4419  H H    . THR B 2 9  ? 11.918  2.340   -0.977  1.00 15.00 ?  933 THR B H    6  
ATOM   4420  H HA   . THR B 2 9  ? 9.261   3.371   -1.030  1.00 15.00 ?  933 THR B HA   6  
ATOM   4421  H HB   . THR B 2 9  ? 11.783  5.022   -1.218  1.00 15.00 ?  933 THR B HB   6  
ATOM   4422  H HG1  . THR B 2 9  ? 11.057  3.433   0.750   1.00 15.00 ?  933 THR B HG1  6  
ATOM   4423  H HG21 . THR B 2 9  ? 8.928   5.622   -0.392  1.00 15.00 ?  933 THR B HG21 6  
ATOM   4424  H HG22 . THR B 2 9  ? 9.794   6.275   -1.784  1.00 15.00 ?  933 THR B HG22 6  
ATOM   4425  H HG23 . THR B 2 9  ? 10.286  6.729   -0.153  1.00 15.00 ?  933 THR B HG23 6  
ATOM   4426  N N    . PHE B 2 10 ? 8.789   3.919   -3.286  1.00 15.00 ?  934 PHE B N    6  
ATOM   4427  C CA   . PHE B 2 10 ? 8.314   4.326   -4.587  1.00 15.00 ?  934 PHE B CA   6  
ATOM   4428  C C    . PHE B 2 10 ? 7.927   5.804   -4.471  1.00 15.00 ?  934 PHE B C    6  
ATOM   4429  O O    . PHE B 2 10 ? 8.118   6.393   -3.406  1.00 15.00 ?  934 PHE B O    6  
ATOM   4430  C CB   . PHE B 2 10 ? 7.128   3.443   -5.014  1.00 15.00 ?  934 PHE B CB   6  
ATOM   4431  C CG   . PHE B 2 10 ? 5.908   3.724   -4.210  1.00 15.00 ?  934 PHE B CG   6  
ATOM   4432  C CD1  . PHE B 2 10 ? 5.681   3.104   -2.991  1.00 15.00 ?  934 PHE B CD1  6  
ATOM   4433  C CD2  . PHE B 2 10 ? 5.030   4.686   -4.644  1.00 15.00 ?  934 PHE B CD2  6  
ATOM   4434  C CE1  . PHE B 2 10 ? 4.598   3.459   -2.234  1.00 15.00 ?  934 PHE B CE1  6  
ATOM   4435  C CE2  . PHE B 2 10 ? 3.942   5.027   -3.901  1.00 15.00 ?  934 PHE B CE2  6  
ATOM   4436  C CZ   . PHE B 2 10 ? 3.730   4.421   -2.695  1.00 15.00 ?  934 PHE B CZ   6  
ATOM   4437  H H    . PHE B 2 10 ? 8.121   3.669   -2.617  1.00 15.00 ?  934 PHE B H    6  
ATOM   4438  H HA   . PHE B 2 10 ? 9.123   4.222   -5.293  1.00 15.00 ?  934 PHE B HA   6  
ATOM   4439  H HB2  . PHE B 2 10 ? 6.897   3.630   -6.053  1.00 15.00 ?  934 PHE B HB2  6  
ATOM   4440  H HB3  . PHE B 2 10 ? 7.388   2.404   -4.883  1.00 15.00 ?  934 PHE B HB3  6  
ATOM   4441  H HD1  . PHE B 2 10 ? 6.348   2.328   -2.640  1.00 15.00 ?  934 PHE B HD1  6  
ATOM   4442  H HD2  . PHE B 2 10 ? 5.200   5.157   -5.597  1.00 15.00 ?  934 PHE B HD2  6  
ATOM   4443  H HE1  . PHE B 2 10 ? 4.427   2.988   -1.284  1.00 15.00 ?  934 PHE B HE1  6  
ATOM   4444  H HE2  . PHE B 2 10 ? 3.255   5.781   -4.258  1.00 15.00 ?  934 PHE B HE2  6  
ATOM   4445  H HZ   . PHE B 2 10 ? 2.897   4.705   -2.111  1.00 15.00 ?  934 PHE B HZ   6  
ATOM   4446  N N    . GLU B 2 11 ? 7.426   6.405   -5.545  1.00 15.00 ?  935 GLU B N    6  
ATOM   4447  C CA   . GLU B 2 11 ? 7.164   7.851   -5.581  1.00 15.00 ?  935 GLU B CA   6  
ATOM   4448  C C    . GLU B 2 11 ? 6.393   8.335   -4.346  1.00 15.00 ?  935 GLU B C    6  
ATOM   4449  O O    . GLU B 2 11 ? 5.444   7.699   -3.890  1.00 15.00 ?  935 GLU B O    6  
ATOM   4450  C CB   . GLU B 2 11 ? 6.328   8.188   -6.821  1.00 15.00 ?  935 GLU B CB   6  
ATOM   4451  C CG   . GLU B 2 11 ? 5.025   7.390   -6.930  1.00 15.00 ?  935 GLU B CG   6  
ATOM   4452  C CD   . GLU B 2 11 ? 5.164   6.189   -7.846  1.00 15.00 ?  935 GLU B CD   6  
ATOM   4453  O OE1  . GLU B 2 11 ? 6.006   5.312   -7.567  1.00 15.00 -1 935 GLU B OE1  6  
ATOM   4454  O OE2  . GLU B 2 11 ? 4.450   6.133   -8.872  1.00 15.00 ?  935 GLU B OE2  6  
ATOM   4455  H H    . GLU B 2 11 ? 7.197   5.861   -6.332  1.00 15.00 ?  935 GLU B H    6  
ATOM   4456  H HA   . GLU B 2 11 ? 8.108   8.367   -5.640  1.00 15.00 ?  935 GLU B HA   6  
ATOM   4457  H HB2  . GLU B 2 11 ? 6.079   9.239   -6.797  1.00 15.00 ?  935 GLU B HB2  6  
ATOM   4458  H HB3  . GLU B 2 11 ? 6.919   7.989   -7.703  1.00 15.00 ?  935 GLU B HB3  6  
ATOM   4459  H HG2  . GLU B 2 11 ? 4.728   7.041   -5.934  1.00 15.00 ?  935 GLU B HG2  6  
ATOM   4460  H HG3  . GLU B 2 11 ? 4.256   8.038   -7.326  1.00 15.00 ?  935 GLU B HG3  6  
ATOM   4461  N N    . ASP B 2 12 ? 6.810   9.486   -3.827  1.00 15.00 ?  936 ASP B N    6  
ATOM   4462  C CA   . ASP B 2 12 ? 6.240   10.042  -2.605  1.00 15.00 ?  936 ASP B CA   6  
ATOM   4463  C C    . ASP B 2 12 ? 4.757   10.356  -2.782  1.00 15.00 ?  936 ASP B C    6  
ATOM   4464  O O    . ASP B 2 12 ? 4.322   10.792  -3.852  1.00 15.00 ?  936 ASP B O    6  
ATOM   4465  C CB   . ASP B 2 12 ? 7.005   11.303  -2.180  1.00 15.00 ?  936 ASP B CB   6  
ATOM   4466  C CG   . ASP B 2 12 ? 6.879   12.445  -3.170  1.00 15.00 ?  936 ASP B CG   6  
ATOM   4467  O OD1  . ASP B 2 12 ? 7.544   12.402  -4.228  1.00 15.00 ?  936 ASP B OD1  6  
ATOM   4468  O OD2  . ASP B 2 12 ? 6.138   13.410  -2.886  1.00 15.00 -1 936 ASP B OD2  6  
ATOM   4469  H H    . ASP B 2 12 ? 7.517   9.984   -4.288  1.00 15.00 ?  936 ASP B H    6  
ATOM   4470  H HA   . ASP B 2 12 ? 6.343   9.296   -1.830  1.00 15.00 ?  936 ASP B HA   6  
ATOM   4471  H HB2  . ASP B 2 12 ? 6.624   11.639  -1.229  1.00 15.00 ?  936 ASP B HB2  6  
ATOM   4472  H HB3  . ASP B 2 12 ? 8.052   11.058  -2.074  1.00 15.00 ?  936 ASP B HB3  6  
ATOM   4473  N N    . LEU B 2 13 ? 3.999   10.137  -1.713  1.00 15.00 ?  937 LEU B N    6  
ATOM   4474  C CA   . LEU B 2 13 ? 2.553   10.318  -1.724  1.00 15.00 ?  937 LEU B CA   6  
ATOM   4475  C C    . LEU B 2 13 ? 2.171   11.776  -1.989  1.00 15.00 ?  937 LEU B C    6  
ATOM   4476  O O    . LEU B 2 13 ? 2.705   12.704  -1.377  1.00 15.00 ?  937 LEU B O    6  
ATOM   4477  C CB   . LEU B 2 13 ? 1.912   9.767   -0.419  1.00 15.00 ?  937 LEU B CB   6  
ATOM   4478  C CG   . LEU B 2 13 ? 2.192   10.477  0.930   1.00 15.00 ?  937 LEU B CG   6  
ATOM   4479  C CD1  . LEU B 2 13 ? 3.660   10.836  1.115   1.00 15.00 ?  937 LEU B CD1  6  
ATOM   4480  C CD2  . LEU B 2 13 ? 1.303   11.703  1.106   1.00 15.00 ?  937 LEU B CD2  6  
ATOM   4481  H H    . LEU B 2 13 ? 4.430   9.844   -0.886  1.00 15.00 ?  937 LEU B H    6  
ATOM   4482  H HA   . LEU B 2 13 ? 2.177   9.733   -2.550  1.00 15.00 ?  937 LEU B HA   6  
ATOM   4483  H HB2  . LEU B 2 13 ? 0.844   9.761   -0.562  1.00 15.00 ?  937 LEU B HB2  6  
ATOM   4484  H HB3  . LEU B 2 13 ? 2.232   8.739   -0.318  1.00 15.00 ?  937 LEU B HB3  6  
ATOM   4485  H HG   . LEU B 2 13 ? 1.940   9.786   1.722   1.00 15.00 ?  937 LEU B HG   6  
ATOM   4486  H HD11 . LEU B 2 13 ? 3.793   11.326  2.068   1.00 15.00 ?  937 LEU B HD11 6  
ATOM   4487  H HD12 . LEU B 2 13 ? 3.969   11.501  0.322   1.00 15.00 ?  937 LEU B HD12 6  
ATOM   4488  H HD13 . LEU B 2 13 ? 4.258   9.937   1.086   1.00 15.00 ?  937 LEU B HD13 6  
ATOM   4489  H HD21 . LEU B 2 13 ? 1.488   12.401  0.302   1.00 15.00 ?  937 LEU B HD21 6  
ATOM   4490  H HD22 . LEU B 2 13 ? 1.527   12.176  2.050   1.00 15.00 ?  937 LEU B HD22 6  
ATOM   4491  H HD23 . LEU B 2 13 ? 0.268   11.401  1.090   1.00 15.00 ?  937 LEU B HD23 6  
HETATM 4492  N N    . NH2 B 2 14 ? 1.275   11.977  -2.944  1.00 15.00 ?  938 NH2 B N    6  
HETATM 4493  H HN1  . NH2 B 2 14 ? 0.892   11.193  -3.390  1.00 15.00 ?  938 NH2 B HN1  6  
HETATM 4494  H HN2  . NH2 B 2 14 ? 1.033   12.900  -3.166  1.00 15.00 ?  938 NH2 B HN2  6  
ATOM   4495  N N    . PHE A 1 7  ? -12.912 6.557   1.737   1.00 15.00 ?  478 PHE A N    7  
ATOM   4496  C CA   . PHE A 1 7  ? -12.026 6.414   0.558   1.00 15.00 ?  478 PHE A CA   7  
ATOM   4497  C C    . PHE A 1 7  ? -10.599 6.110   1.014   1.00 15.00 ?  478 PHE A C    7  
ATOM   4498  O O    . PHE A 1 7  ? -10.387 5.242   1.857   1.00 15.00 ?  478 PHE A O    7  
ATOM   4499  C CB   . PHE A 1 7  ? -12.049 7.690   -0.300  1.00 15.00 ?  478 PHE A CB   7  
ATOM   4500  C CG   . PHE A 1 7  ? -13.425 8.141   -0.703  1.00 15.00 ?  478 PHE A CG   7  
ATOM   4501  C CD1  . PHE A 1 7  ? -14.087 7.527   -1.755  1.00 15.00 ?  478 PHE A CD1  7  
ATOM   4502  C CD2  . PHE A 1 7  ? -14.050 9.188   -0.044  1.00 15.00 ?  478 PHE A CD2  7  
ATOM   4503  C CE1  . PHE A 1 7  ? -15.347 7.946   -2.139  1.00 15.00 ?  478 PHE A CE1  7  
ATOM   4504  C CE2  . PHE A 1 7  ? -15.311 9.610   -0.424  1.00 15.00 ?  478 PHE A CE2  7  
ATOM   4505  C CZ   . PHE A 1 7  ? -15.958 8.988   -1.473  1.00 15.00 ?  478 PHE A CZ   7  
ATOM   4506  H H    . PHE A 1 7  ? -12.840 5.712   2.342   1.00 15.00 ?  478 PHE A H    7  
ATOM   4507  H HA   . PHE A 1 7  ? -12.385 5.582   -0.033  1.00 15.00 ?  478 PHE A HA   7  
ATOM   4508  H HB2  . PHE A 1 7  ? -11.584 8.492   0.249   1.00 15.00 ?  478 PHE A HB2  7  
ATOM   4509  H HB3  . PHE A 1 7  ? -11.489 7.509   -1.206  1.00 15.00 ?  478 PHE A HB3  7  
ATOM   4510  H HD1  . PHE A 1 7  ? -13.611 6.710   -2.276  1.00 15.00 ?  478 PHE A HD1  7  
ATOM   4511  H HD2  . PHE A 1 7  ? -13.546 9.674   0.776   1.00 15.00 ?  478 PHE A HD2  7  
ATOM   4512  H HE1  . PHE A 1 7  ? -15.851 7.460   -2.962  1.00 15.00 ?  478 PHE A HE1  7  
ATOM   4513  H HE2  . PHE A 1 7  ? -15.788 10.426  0.098   1.00 15.00 ?  478 PHE A HE2  7  
ATOM   4514  H HZ   . PHE A 1 7  ? -16.941 9.317   -1.772  1.00 15.00 ?  478 PHE A HZ   7  
ATOM   4515  N N    . LEU A 1 8  ? -9.622  6.821   0.462   1.00 15.00 ?  479 LEU A N    7  
ATOM   4516  C CA   . LEU A 1 8  ? -8.228  6.577   0.782   1.00 15.00 ?  479 LEU A CA   7  
ATOM   4517  C C    . LEU A 1 8  ? -7.669  7.749   1.582   1.00 15.00 ?  479 LEU A C    7  
ATOM   4518  O O    . LEU A 1 8  ? -7.611  8.875   1.085   1.00 15.00 ?  479 LEU A O    7  
ATOM   4519  C CB   . LEU A 1 8  ? -7.425  6.384   -0.507  1.00 15.00 ?  479 LEU A CB   7  
ATOM   4520  C CG   . LEU A 1 8  ? -6.039  5.753   -0.342  1.00 15.00 ?  479 LEU A CG   7  
ATOM   4521  C CD1  . LEU A 1 8  ? -6.155  4.255   -0.079  1.00 15.00 ?  479 LEU A CD1  7  
ATOM   4522  C CD2  . LEU A 1 8  ? -5.205  6.007   -1.589  1.00 15.00 ?  479 LEU A CD2  7  
ATOM   4523  H H    . LEU A 1 8  ? -9.841  7.543   -0.158  1.00 15.00 ?  479 LEU A H    7  
ATOM   4524  H HA   . LEU A 1 8  ? -8.170  5.678   1.378   1.00 15.00 ?  479 LEU A HA   7  
ATOM   4525  H HB2  . LEU A 1 8  ? -8.002  5.759   -1.171  1.00 15.00 ?  479 LEU A HB2  7  
ATOM   4526  H HB3  . LEU A 1 8  ? -7.300  7.351   -0.973  1.00 15.00 ?  479 LEU A HB3  7  
ATOM   4527  H HG   . LEU A 1 8  ? -5.532  6.206   0.511   1.00 15.00 ?  479 LEU A HG   7  
ATOM   4528  H HD11 . LEU A 1 8  ? -6.845  4.083   0.731   1.00 15.00 ?  479 LEU A HD11 7  
ATOM   4529  H HD12 . LEU A 1 8  ? -5.184  3.862   0.184   1.00 15.00 ?  479 LEU A HD12 7  
ATOM   4530  H HD13 . LEU A 1 8  ? -6.510  3.755   -0.973  1.00 15.00 ?  479 LEU A HD13 7  
ATOM   4531  H HD21 . LEU A 1 8  ? -4.227  5.563   -1.465  1.00 15.00 ?  479 LEU A HD21 7  
ATOM   4532  H HD22 . LEU A 1 8  ? -5.101  7.070   -1.743  1.00 15.00 ?  479 LEU A HD22 7  
ATOM   4533  H HD23 . LEU A 1 8  ? -5.694  5.565   -2.445  1.00 15.00 ?  479 LEU A HD23 7  
ATOM   4534  N N    . PRO A 1 9  ? -7.307  7.499   2.849   1.00 15.00 ?  480 PRO A N    7  
ATOM   4535  C CA   . PRO A 1 9  ? -6.691  8.507   3.734   1.00 15.00 ?  480 PRO A CA   7  
ATOM   4536  C C    . PRO A 1 9  ? -5.473  9.194   3.101   1.00 15.00 ?  480 PRO A C    7  
ATOM   4537  O O    . PRO A 1 9  ? -4.751  8.585   2.318   1.00 15.00 ?  480 PRO A O    7  
ATOM   4538  C CB   . PRO A 1 9  ? -6.255  7.667   4.928   1.00 15.00 ?  480 PRO A CB   7  
ATOM   4539  C CG   . PRO A 1 9  ? -7.239  6.558   4.977   1.00 15.00 ?  480 PRO A CG   7  
ATOM   4540  C CD   . PRO A 1 9  ? -7.496  6.207   3.541   1.00 15.00 ?  480 PRO A CD   7  
ATOM   4541  H HA   . PRO A 1 9  ? -7.406  9.251   4.052   1.00 15.00 ?  480 PRO A HA   7  
ATOM   4542  H HB2  . PRO A 1 9  ? -5.264  7.299   4.751   1.00 15.00 ?  480 PRO A HB2  7  
ATOM   4543  H HB3  . PRO A 1 9  ? -6.274  8.258   5.829   1.00 15.00 ?  480 PRO A HB3  7  
ATOM   4544  H HG2  . PRO A 1 9  ? -6.820  5.714   5.506   1.00 15.00 ?  480 PRO A HG2  7  
ATOM   4545  H HG3  . PRO A 1 9  ? -8.149  6.892   5.452   1.00 15.00 ?  480 PRO A HG3  7  
ATOM   4546  H HD2  . PRO A 1 9  ? -6.779  5.475   3.197   1.00 15.00 ?  480 PRO A HD2  7  
ATOM   4547  H HD3  . PRO A 1 9  ? -8.504  5.843   3.413   1.00 15.00 ?  480 PRO A HD3  7  
ATOM   4548  N N    . PRO A 1 10 ? -5.195  10.454  3.498   1.00 15.00 ?  481 PRO A N    7  
ATOM   4549  C CA   . PRO A 1 10 ? -4.155  11.295  2.869   1.00 15.00 ?  481 PRO A CA   7  
ATOM   4550  C C    . PRO A 1 10 ? -2.721  10.761  3.003   1.00 15.00 ?  481 PRO A C    7  
ATOM   4551  O O    . PRO A 1 10 ? -1.793  11.317  2.410   1.00 15.00 ?  481 PRO A O    7  
ATOM   4552  C CB   . PRO A 1 10 ? -4.286  12.635  3.602   1.00 15.00 ?  481 PRO A CB   7  
ATOM   4553  C CG   . PRO A 1 10 ? -4.955  12.308  4.892   1.00 15.00 ?  481 PRO A CG   7  
ATOM   4554  C CD   . PRO A 1 10 ? -5.878  11.162  4.593   1.00 15.00 ?  481 PRO A CD   7  
ATOM   4555  H HA   . PRO A 1 10 ? -4.370  11.448  1.822   1.00 15.00 ?  481 PRO A HA   7  
ATOM   4556  H HB2  . PRO A 1 10 ? -3.304  13.058  3.763   1.00 15.00 ?  481 PRO A HB2  7  
ATOM   4557  H HB3  . PRO A 1 10 ? -4.882  13.315  3.010   1.00 15.00 ?  481 PRO A HB3  7  
ATOM   4558  H HG2  . PRO A 1 10 ? -4.219  12.016  5.627   1.00 15.00 ?  481 PRO A HG2  7  
ATOM   4559  H HG3  . PRO A 1 10 ? -5.517  13.161  5.241   1.00 15.00 ?  481 PRO A HG3  7  
ATOM   4560  H HD2  . PRO A 1 10 ? -5.984  10.524  5.459   1.00 15.00 ?  481 PRO A HD2  7  
ATOM   4561  H HD3  . PRO A 1 10 ? -6.843  11.528  4.272   1.00 15.00 ?  481 PRO A HD3  7  
ATOM   4562  N N    . GLY A 1 11 ? -2.527  9.716   3.797   1.00 15.00 ?  482 GLY A N    7  
ATOM   4563  C CA   . GLY A 1 11 ? -1.211  9.105   3.892   1.00 15.00 ?  482 GLY A CA   7  
ATOM   4564  C C    . GLY A 1 11 ? -1.221  7.667   3.456   1.00 15.00 ?  482 GLY A C    7  
ATOM   4565  O O    . GLY A 1 11 ? -0.177  7.031   3.379   1.00 15.00 ?  482 GLY A O    7  
ATOM   4566  H H    . GLY A 1 11 ? -3.276  9.361   4.316   1.00 15.00 ?  482 GLY A H    7  
ATOM   4567  H HA2  . GLY A 1 11 ? -0.528  9.651   3.260   1.00 15.00 ?  482 GLY A HA2  7  
ATOM   4568  H HA3  . GLY A 1 11 ? -0.856  9.150   4.902   1.00 15.00 ?  482 GLY A HA3  7  
ATOM   4569  N N    . TRP A 1 12 ? -2.396  7.149   3.183   1.00 15.00 ?  483 TRP A N    7  
ATOM   4570  C CA   . TRP A 1 12 ? -2.514  5.811   2.655   1.00 15.00 ?  483 TRP A CA   7  
ATOM   4571  C C    . TRP A 1 12 ? -2.470  5.889   1.157   1.00 15.00 ?  483 TRP A C    7  
ATOM   4572  O O    . TRP A 1 12 ? -3.226  6.635   0.549   1.00 15.00 ?  483 TRP A O    7  
ATOM   4573  C CB   . TRP A 1 12 ? -3.807  5.142   3.105   1.00 15.00 ?  483 TRP A CB   7  
ATOM   4574  C CG   . TRP A 1 12 ? -3.791  4.742   4.543   1.00 15.00 ?  483 TRP A CG   7  
ATOM   4575  C CD1  . TRP A 1 12 ? -3.775  5.576   5.617   1.00 15.00 ?  483 TRP A CD1  7  
ATOM   4576  C CD2  . TRP A 1 12 ? -3.787  3.409   5.063   1.00 15.00 ?  483 TRP A CD2  7  
ATOM   4577  N NE1  . TRP A 1 12 ? -3.766  4.851   6.782   1.00 15.00 ?  483 TRP A NE1  7  
ATOM   4578  C CE2  . TRP A 1 12 ? -3.775  3.513   6.469   1.00 15.00 ?  483 TRP A CE2  7  
ATOM   4579  C CE3  . TRP A 1 12 ? -3.795  2.138   4.478   1.00 15.00 ?  483 TRP A CE3  7  
ATOM   4580  C CZ2  . TRP A 1 12 ? -3.773  2.395   7.294   1.00 15.00 ?  483 TRP A CZ2  7  
ATOM   4581  C CZ3  . TRP A 1 12 ? -3.789  1.029   5.300   1.00 15.00 ?  483 TRP A CZ3  7  
ATOM   4582  C CH2  . TRP A 1 12 ? -3.781  1.163   6.697   1.00 15.00 ?  483 TRP A CH2  7  
ATOM   4583  H H    . TRP A 1 12 ? -3.202  7.691   3.299   1.00 15.00 ?  483 TRP A H    7  
ATOM   4584  H HA   . TRP A 1 12 ? -1.668  5.235   3.004   1.00 15.00 ?  483 TRP A HA   7  
ATOM   4585  H HB2  . TRP A 1 12 ? -4.631  5.823   2.954   1.00 15.00 ?  483 TRP A HB2  7  
ATOM   4586  H HB3  . TRP A 1 12 ? -3.969  4.253   2.512   1.00 15.00 ?  483 TRP A HB3  7  
ATOM   4587  H HD1  . TRP A 1 12 ? -3.767  6.651   5.541   1.00 15.00 ?  483 TRP A HD1  7  
ATOM   4588  H HE1  . TRP A 1 12 ? -3.751  5.229   7.689   1.00 15.00 ?  483 TRP A HE1  7  
ATOM   4589  H HE3  . TRP A 1 12 ? -3.801  2.012   3.403   1.00 15.00 ?  483 TRP A HE3  7  
ATOM   4590  H HZ2  . TRP A 1 12 ? -3.771  2.479   8.369   1.00 15.00 ?  483 TRP A HZ2  7  
ATOM   4591  H HZ3  . TRP A 1 12 ? -3.792  0.039   4.866   1.00 15.00 ?  483 TRP A HZ3  7  
ATOM   4592  H HH2  . TRP A 1 12 ? -3.776  0.267   7.301   1.00 15.00 ?  483 TRP A HH2  7  
ATOM   4593  N N    . GLU A 1 13 ? -1.569  5.152   0.565   1.00 15.00 ?  484 GLU A N    7  
ATOM   4594  C CA   . GLU A 1 13 ? -1.439  5.168   -0.864  1.00 15.00 ?  484 GLU A CA   7  
ATOM   4595  C C    . GLU A 1 13 ? -1.793  3.806   -1.433  1.00 15.00 ?  484 GLU A C    7  
ATOM   4596  O O    . GLU A 1 13 ? -1.351  2.774   -0.941  1.00 15.00 ?  484 GLU A O    7  
ATOM   4597  C CB   . GLU A 1 13 ? -0.030  5.585   -1.249  1.00 15.00 ?  484 GLU A CB   7  
ATOM   4598  C CG   . GLU A 1 13 ? 0.014   6.777   -2.191  1.00 15.00 ?  484 GLU A CG   7  
ATOM   4599  C CD   . GLU A 1 13 ? -0.754  6.559   -3.485  1.00 15.00 ?  484 GLU A CD   7  
ATOM   4600  O OE1  . GLU A 1 13 ? -1.995  6.413   -3.437  1.00 15.00 ?  484 GLU A OE1  7  
ATOM   4601  O OE2  . GLU A 1 13 ? -0.122  6.548   -4.559  1.00 15.00 -1 484 GLU A OE2  7  
ATOM   4602  H H    . GLU A 1 13 ? -0.978  4.581   1.102   1.00 15.00 ?  484 GLU A H    7  
ATOM   4603  H HA   . GLU A 1 13 ? -2.138  5.895   -1.250  1.00 15.00 ?  484 GLU A HA   7  
ATOM   4604  H HB2  . GLU A 1 13 ? 0.510   5.847   -0.351  1.00 15.00 ?  484 GLU A HB2  7  
ATOM   4605  H HB3  . GLU A 1 13 ? 0.459   4.762   -1.716  1.00 15.00 ?  484 GLU A HB3  7  
ATOM   4606  H HG2  . GLU A 1 13 ? -0.408  7.627   -1.681  1.00 15.00 ?  484 GLU A HG2  7  
ATOM   4607  H HG3  . GLU A 1 13 ? 1.047   6.983   -2.433  1.00 15.00 ?  484 GLU A HG3  7  
ATOM   4608  N N    . MET A 1 14 ? -2.571  3.827   -2.484  1.00 15.00 ?  485 MET A N    7  
ATOM   4609  C CA   . MET A 1 14 ? -3.105  2.614   -3.079  1.00 15.00 ?  485 MET A CA   7  
ATOM   4610  C C    . MET A 1 14 ? -2.446  2.389   -4.433  1.00 15.00 ?  485 MET A C    7  
ATOM   4611  O O    . MET A 1 14 ? -2.768  3.060   -5.413  1.00 15.00 ?  485 MET A O    7  
ATOM   4612  C CB   . MET A 1 14 ? -4.627  2.733   -3.238  1.00 15.00 ?  485 MET A CB   7  
ATOM   4613  C CG   . MET A 1 14 ? -5.306  1.443   -3.655  1.00 15.00 ?  485 MET A CG   7  
ATOM   4614  S SD   . MET A 1 14 ? -7.007  1.687   -4.213  1.00 15.00 ?  485 MET A SD   7  
ATOM   4615  C CE   . MET A 1 14 ? -7.771  2.367   -2.744  1.00 15.00 ?  485 MET A CE   7  
ATOM   4616  H H    . MET A 1 14 ? -2.766  4.695   -2.898  1.00 15.00 ?  485 MET A H    7  
ATOM   4617  H HA   . MET A 1 14 ? -2.874  1.778   -2.421  1.00 15.00 ?  485 MET A HA   7  
ATOM   4618  H HB2  . MET A 1 14 ? -5.050  3.046   -2.296  1.00 15.00 ?  485 MET A HB2  7  
ATOM   4619  H HB3  . MET A 1 14 ? -4.841  3.484   -3.984  1.00 15.00 ?  485 MET A HB3  7  
ATOM   4620  H HG2  . MET A 1 14 ? -4.742  1.007   -4.454  1.00 15.00 ?  485 MET A HG2  7  
ATOM   4621  H HG3  . MET A 1 14 ? -5.313  0.769   -2.810  1.00 15.00 ?  485 MET A HG3  7  
ATOM   4622  H HE1  . MET A 1 14 ? -8.819  2.555   -2.937  1.00 15.00 ?  485 MET A HE1  7  
ATOM   4623  H HE2  . MET A 1 14 ? -7.283  3.293   -2.479  1.00 15.00 ?  485 MET A HE2  7  
ATOM   4624  H HE3  . MET A 1 14 ? -7.676  1.664   -1.929  1.00 15.00 ?  485 MET A HE3  7  
ATOM   4625  N N    . ARG A 1 15 ? -1.491  1.479   -4.473  1.00 15.00 ?  486 ARG A N    7  
ATOM   4626  C CA   . ARG A 1 15 ? -0.679  1.262   -5.664  1.00 15.00 ?  486 ARG A CA   7  
ATOM   4627  C C    . ARG A 1 15 ? -0.617  -0.216  -5.994  1.00 15.00 ?  486 ARG A C    7  
ATOM   4628  O O    . ARG A 1 15 ? -0.717  -1.047  -5.101  1.00 15.00 ?  486 ARG A O    7  
ATOM   4629  C CB   . ARG A 1 15 ? 0.738   1.791   -5.437  1.00 15.00 ?  486 ARG A CB   7  
ATOM   4630  C CG   . ARG A 1 15 ? 0.798   3.272   -5.114  1.00 15.00 ?  486 ARG A CG   7  
ATOM   4631  C CD   . ARG A 1 15 ? 0.388   4.123   -6.300  1.00 15.00 ?  486 ARG A CD   7  
ATOM   4632  N NE   . ARG A 1 15 ? 1.297   3.971   -7.435  1.00 15.00 ?  486 ARG A NE   7  
ATOM   4633  C CZ   . ARG A 1 15 ? 0.948   4.215   -8.696  1.00 15.00 ?  486 ARG A CZ   7  
ATOM   4634  N NH1  . ARG A 1 15 ? -0.261  4.686   -8.964  1.00 15.00 1  486 ARG A NH1  7  
ATOM   4635  N NH2  . ARG A 1 15 ? 1.821   4.031   -9.677  1.00 15.00 ?  486 ARG A NH2  7  
ATOM   4636  H H    . ARG A 1 15 ? -1.323  0.925   -3.676  1.00 15.00 ?  486 ARG A H    7  
ATOM   4637  H HA   . ARG A 1 15 ? -1.133  1.794   -6.486  1.00 15.00 ?  486 ARG A HA   7  
ATOM   4638  H HB2  . ARG A 1 15 ? 1.184   1.248   -4.618  1.00 15.00 ?  486 ARG A HB2  7  
ATOM   4639  H HB3  . ARG A 1 15 ? 1.319   1.617   -6.331  1.00 15.00 ?  486 ARG A HB3  7  
ATOM   4640  H HG2  . ARG A 1 15 ? 0.134   3.480   -4.289  1.00 15.00 ?  486 ARG A HG2  7  
ATOM   4641  H HG3  . ARG A 1 15 ? 1.811   3.528   -4.833  1.00 15.00 ?  486 ARG A HG3  7  
ATOM   4642  H HD2  . ARG A 1 15 ? -0.607  3.832   -6.606  1.00 15.00 ?  486 ARG A HD2  7  
ATOM   4643  H HD3  . ARG A 1 15 ? 0.379   5.158   -5.995  1.00 15.00 ?  486 ARG A HD3  7  
ATOM   4644  H HE   . ARG A 1 15 ? 2.211   3.664   -7.244  1.00 15.00 ?  486 ARG A HE   7  
ATOM   4645  H HH11 . ARG A 1 15 ? -0.909  4.863   -8.218  1.00 15.00 ?  486 ARG A HH11 7  
ATOM   4646  H HH12 . ARG A 1 15 ? -0.541  4.869   -9.915  1.00 15.00 ?  486 ARG A HH12 7  
ATOM   4647  H HH21 . ARG A 1 15 ? 2.760   3.713   -9.474  1.00 15.00 ?  486 ARG A HH21 7  
ATOM   4648  H HH22 . ARG A 1 15 ? 1.548   4.182   -10.637 1.00 15.00 ?  486 ARG A HH22 7  
ATOM   4649  N N    . ILE A 1 16 ? -0.478  -0.553  -7.264  1.00 15.00 ?  487 ILE A N    7  
ATOM   4650  C CA   . ILE A 1 16 ? -0.268  -1.942  -7.634  1.00 15.00 ?  487 ILE A CA   7  
ATOM   4651  C C    . ILE A 1 16 ? 1.195   -2.186  -7.988  1.00 15.00 ?  487 ILE A C    7  
ATOM   4652  O O    . ILE A 1 16 ? 1.891   -1.280  -8.446  1.00 15.00 ?  487 ILE A O    7  
ATOM   4653  C CB   . ILE A 1 16 ? -1.167  -2.438  -8.801  1.00 15.00 ?  487 ILE A CB   7  
ATOM   4654  C CG1  . ILE A 1 16 ? -0.715  -1.872  -10.157 1.00 15.00 ?  487 ILE A CG1  7  
ATOM   4655  C CG2  . ILE A 1 16 ? -2.626  -2.094  -8.530  1.00 15.00 ?  487 ILE A CG2  7  
ATOM   4656  C CD1  . ILE A 1 16 ? -1.220  -0.481  -10.454 1.00 15.00 ?  487 ILE A CD1  7  
ATOM   4657  H H    . ILE A 1 16 ? -0.498  0.135   -7.957  1.00 15.00 ?  487 ILE A H    7  
ATOM   4658  H HA   . ILE A 1 16 ? -0.503  -2.538  -6.762  1.00 15.00 ?  487 ILE A HA   7  
ATOM   4659  H HB   . ILE A 1 16 ? -1.090  -3.515  -8.836  1.00 15.00 ?  487 ILE A HB   7  
ATOM   4660  H HG12 . ILE A 1 16 ? 0.365   -1.839  -10.180 1.00 15.00 ?  487 ILE A HG12 7  
ATOM   4661  H HG13 . ILE A 1 16 ? -1.064  -2.528  -10.942 1.00 15.00 ?  487 ILE A HG13 7  
ATOM   4662  H HG21 . ILE A 1 16 ? -2.949  -2.584  -7.623  1.00 15.00 ?  487 ILE A HG21 7  
ATOM   4663  H HG22 . ILE A 1 16 ? -3.235  -2.428  -9.358  1.00 15.00 ?  487 ILE A HG22 7  
ATOM   4664  H HG23 . ILE A 1 16 ? -2.728  -1.025  -8.416  1.00 15.00 ?  487 ILE A HG23 7  
ATOM   4665  H HD11 . ILE A 1 16 ? -0.892  0.195   -9.679  1.00 15.00 ?  487 ILE A HD11 7  
ATOM   4666  H HD12 . ILE A 1 16 ? -2.299  -0.496  -10.490 1.00 15.00 ?  487 ILE A HD12 7  
ATOM   4667  H HD13 . ILE A 1 16 ? -0.832  -0.155  -11.407 1.00 15.00 ?  487 ILE A HD13 7  
ATOM   4668  N N    . ALA A 1 17 ? 1.649   -3.404  -7.751  1.00 15.00 ?  488 ALA A N    7  
ATOM   4669  C CA   . ALA A 1 17 ? 2.972   -3.827  -8.172  1.00 15.00 ?  488 ALA A CA   7  
ATOM   4670  C C    . ALA A 1 17 ? 2.833   -4.398  -9.574  1.00 15.00 ?  488 ALA A C    7  
ATOM   4671  O O    . ALA A 1 17 ? 1.758   -4.856  -9.908  1.00 15.00 ?  488 ALA A O    7  
ATOM   4672  C CB   . ALA A 1 17 ? 3.554   -4.851  -7.202  1.00 15.00 ?  488 ALA A CB   7  
ATOM   4673  H H    . ALA A 1 17 ? 1.069   -4.043  -7.275  1.00 15.00 ?  488 ALA A H    7  
ATOM   4674  H HA   . ALA A 1 17 ? 3.618   -2.959  -8.200  1.00 15.00 ?  488 ALA A HA   7  
ATOM   4675  H HB1  . ALA A 1 17 ? 4.548   -5.129  -7.524  1.00 15.00 ?  488 ALA A HB1  7  
ATOM   4676  H HB2  . ALA A 1 17 ? 2.925   -5.728  -7.181  1.00 15.00 ?  488 ALA A HB2  7  
ATOM   4677  H HB3  . ALA A 1 17 ? 3.604   -4.422  -6.212  1.00 15.00 ?  488 ALA A HB3  7  
ATOM   4678  N N    . PRO A 1 18 ? 3.884   -4.308  -10.415 1.00 15.00 ?  489 PRO A N    7  
ATOM   4679  C CA   . PRO A 1 18 ? 3.826   -4.548  -11.886 1.00 15.00 ?  489 PRO A CA   7  
ATOM   4680  C C    . PRO A 1 18 ? 3.020   -5.772  -12.393 1.00 15.00 ?  489 PRO A C    7  
ATOM   4681  O O    . PRO A 1 18 ? 2.861   -5.930  -13.604 1.00 15.00 ?  489 PRO A O    7  
ATOM   4682  C CB   . PRO A 1 18 ? 5.297   -4.705  -12.257 1.00 15.00 ?  489 PRO A CB   7  
ATOM   4683  C CG   . PRO A 1 18 ? 6.012   -3.832  -11.291 1.00 15.00 ?  489 PRO A CG   7  
ATOM   4684  C CD   . PRO A 1 18 ? 5.256   -3.947  -9.995  1.00 15.00 ?  489 PRO A CD   7  
ATOM   4685  H HA   . PRO A 1 18 ? 3.447   -3.671  -12.387 1.00 15.00 ?  489 PRO A HA   7  
ATOM   4686  H HB2  . PRO A 1 18 ? 5.591   -5.740  -12.152 1.00 15.00 ?  489 PRO A HB2  7  
ATOM   4687  H HB3  . PRO A 1 18 ? 5.454   -4.380  -13.275 1.00 15.00 ?  489 PRO A HB3  7  
ATOM   4688  H HG2  . PRO A 1 18 ? 7.028   -4.178  -11.165 1.00 15.00 ?  489 PRO A HG2  7  
ATOM   4689  H HG3  . PRO A 1 18 ? 6.003   -2.810  -11.639 1.00 15.00 ?  489 PRO A HG3  7  
ATOM   4690  H HD2  . PRO A 1 18 ? 5.687   -4.722  -9.377  1.00 15.00 ?  489 PRO A HD2  7  
ATOM   4691  H HD3  . PRO A 1 18 ? 5.262   -3.002  -9.472  1.00 15.00 ?  489 PRO A HD3  7  
ATOM   4692  N N    . ASN A 1 19 ? 2.537   -6.644  -11.515 1.00 15.00 ?  490 ASN A N    7  
ATOM   4693  C CA   . ASN A 1 19 ? 1.662   -7.740  -11.946 1.00 15.00 ?  490 ASN A CA   7  
ATOM   4694  C C    . ASN A 1 19 ? 0.192   -7.404  -11.660 1.00 15.00 ?  490 ASN A C    7  
ATOM   4695  O O    . ASN A 1 19 ? -0.712  -8.162  -12.007 1.00 15.00 ?  490 ASN A O    7  
ATOM   4696  C CB   . ASN A 1 19 ? 2.032   -9.060  -11.260 1.00 15.00 ?  490 ASN A CB   7  
ATOM   4697  C CG   . ASN A 1 19 ? 1.649   -9.088  -9.795  1.00 15.00 ?  490 ASN A CG   7  
ATOM   4698  O OD1  . ASN A 1 19 ? 1.736   -8.080  -9.093  1.00 15.00 ?  490 ASN A OD1  7  
ATOM   4699  N ND2  . ASN A 1 19 ? 1.198   -10.239 -9.336  1.00 15.00 ?  490 ASN A ND2  7  
ATOM   4700  H H    . ASN A 1 19 ? 2.762   -6.547  -10.567 1.00 15.00 ?  490 ASN A H    7  
ATOM   4701  H HA   . ASN A 1 19 ? 1.787   -7.855  -13.012 1.00 15.00 ?  490 ASN A HA   7  
ATOM   4702  H HB2  . ASN A 1 19 ? 1.521   -9.870  -11.758 1.00 15.00 ?  490 ASN A HB2  7  
ATOM   4703  H HB3  . ASN A 1 19 ? 3.099   -9.213  -11.335 1.00 15.00 ?  490 ASN A HB3  7  
ATOM   4704  H HD21 . ASN A 1 19 ? 1.144   -11.001 -9.961  1.00 15.00 ?  490 ASN A HD21 7  
ATOM   4705  H HD22 . ASN A 1 19 ? 0.915   -10.288 -8.398  1.00 15.00 ?  490 ASN A HD22 7  
ATOM   4706  N N    . GLY A 1 20 ? -0.023  -6.271  -11.007 1.00 15.00 ?  491 GLY A N    7  
ATOM   4707  C CA   . GLY A 1 20 ? -1.360  -5.786  -10.725 1.00 15.00 ?  491 GLY A CA   7  
ATOM   4708  C C    . GLY A 1 20 ? -1.853  -6.139  -9.330  1.00 15.00 ?  491 GLY A C    7  
ATOM   4709  O O    . GLY A 1 20 ? -3.058  -6.249  -9.109  1.00 15.00 ?  491 GLY A O    7  
ATOM   4710  H H    . GLY A 1 20 ? 0.752   -5.743  -10.713 1.00 15.00 ?  491 GLY A H    7  
ATOM   4711  H HA2  . GLY A 1 20 ? -1.354  -4.710  -10.819 1.00 15.00 ?  491 GLY A HA2  7  
ATOM   4712  H HA3  . GLY A 1 20 ? -2.044  -6.187  -11.453 1.00 15.00 ?  491 GLY A HA3  7  
ATOM   4713  N N    . ARG A 1 21 ? -0.938  -6.318  -8.381  1.00 15.00 ?  492 ARG A N    7  
ATOM   4714  C CA   . ARG A 1 21 ? -1.336  -6.510  -6.983  1.00 15.00 ?  492 ARG A CA   7  
ATOM   4715  C C    . ARG A 1 21 ? -1.425  -5.167  -6.275  1.00 15.00 ?  492 ARG A C    7  
ATOM   4716  O O    . ARG A 1 21 ? -0.436  -4.443  -6.187  1.00 15.00 ?  492 ARG A O    7  
ATOM   4717  C CB   . ARG A 1 21 ? -0.364  -7.420  -6.216  1.00 15.00 ?  492 ARG A CB   7  
ATOM   4718  C CG   . ARG A 1 21 ? 1.094   -7.005  -6.312  1.00 15.00 ?  492 ARG A CG   7  
ATOM   4719  C CD   . ARG A 1 21 ? 2.006   -8.009  -5.627  1.00 15.00 ?  492 ARG A CD   7  
ATOM   4720  N NE   . ARG A 1 21 ? 1.787   -9.360  -6.130  1.00 15.00 ?  492 ARG A NE   7  
ATOM   4721  C CZ   . ARG A 1 21 ? 2.725   -10.303 -6.189  1.00 15.00 ?  492 ARG A CZ   7  
ATOM   4722  N NH1  . ARG A 1 21 ? 3.959   -10.056 -5.764  1.00 15.00 1  492 ARG A NH1  7  
ATOM   4723  N NH2  . ARG A 1 21 ? 2.429   -11.500 -6.664  1.00 15.00 ?  492 ARG A NH2  7  
ATOM   4724  H H    . ARG A 1 21 ? 0.013   -6.320  -8.621  1.00 15.00 ?  492 ARG A H    7  
ATOM   4725  H HA   . ARG A 1 21 ? -2.316  -6.966  -6.983  1.00 15.00 ?  492 ARG A HA   7  
ATOM   4726  H HB2  . ARG A 1 21 ? -0.643  -7.405  -5.175  1.00 15.00 ?  492 ARG A HB2  7  
ATOM   4727  H HB3  . ARG A 1 21 ? -0.454  -8.428  -6.574  1.00 15.00 ?  492 ARG A HB3  7  
ATOM   4728  H HG2  . ARG A 1 21 ? 1.371   -6.937  -7.353  1.00 15.00 ?  492 ARG A HG2  7  
ATOM   4729  H HG3  . ARG A 1 21 ? 1.216   -6.042  -5.840  1.00 15.00 ?  492 ARG A HG3  7  
ATOM   4730  H HD2  . ARG A 1 21 ? 3.032   -7.728  -5.808  1.00 15.00 ?  492 ARG A HD2  7  
ATOM   4731  H HD3  . ARG A 1 21 ? 1.808   -7.992  -4.565  1.00 15.00 ?  492 ARG A HD3  7  
ATOM   4732  H HE   . ARG A 1 21 ? 0.876   -9.577  -6.448  1.00 15.00 ?  492 ARG A HE   7  
ATOM   4733  H HH11 . ARG A 1 21 ? 4.196   -9.159  -5.393  1.00 15.00 ?  492 ARG A HH11 7  
ATOM   4734  H HH12 . ARG A 1 21 ? 4.659   -10.775 -5.818  1.00 15.00 ?  492 ARG A HH12 7  
ATOM   4735  H HH21 . ARG A 1 21 ? 1.496   -11.704 -6.974  1.00 15.00 ?  492 ARG A HH21 7  
ATOM   4736  H HH22 . ARG A 1 21 ? 3.143   -12.208 -6.733  1.00 15.00 ?  492 ARG A HH22 7  
ATOM   4737  N N    . PRO A 1 22 ? -2.603  -4.819  -5.746  1.00 15.00 ?  493 PRO A N    7  
ATOM   4738  C CA   . PRO A 1 22 ? -2.807  -3.548  -5.073  1.00 15.00 ?  493 PRO A CA   7  
ATOM   4739  C C    . PRO A 1 22 ? -2.506  -3.629  -3.581  1.00 15.00 ?  493 PRO A C    7  
ATOM   4740  O O    . PRO A 1 22 ? -3.167  -4.354  -2.833  1.00 15.00 ?  493 PRO A O    7  
ATOM   4741  C CB   . PRO A 1 22 ? -4.292  -3.275  -5.313  1.00 15.00 ?  493 PRO A CB   7  
ATOM   4742  C CG   . PRO A 1 22 ? -4.930  -4.624  -5.464  1.00 15.00 ?  493 PRO A CG   7  
ATOM   4743  C CD   . PRO A 1 22 ? -3.836  -5.618  -5.783  1.00 15.00 ?  493 PRO A CD   7  
ATOM   4744  H HA   . PRO A 1 22 ? -2.217  -2.762  -5.519  1.00 15.00 ?  493 PRO A HA   7  
ATOM   4745  H HB2  . PRO A 1 22 ? -4.700  -2.740  -4.469  1.00 15.00 ?  493 PRO A HB2  7  
ATOM   4746  H HB3  . PRO A 1 22 ? -4.408  -2.684  -6.209  1.00 15.00 ?  493 PRO A HB3  7  
ATOM   4747  H HG2  . PRO A 1 22 ? -5.420  -4.897  -4.542  1.00 15.00 ?  493 PRO A HG2  7  
ATOM   4748  H HG3  . PRO A 1 22 ? -5.651  -4.593  -6.271  1.00 15.00 ?  493 PRO A HG3  7  
ATOM   4749  H HD2  . PRO A 1 22 ? -3.808  -6.399  -5.037  1.00 15.00 ?  493 PRO A HD2  7  
ATOM   4750  H HD3  . PRO A 1 22 ? -3.990  -6.042  -6.764  1.00 15.00 ?  493 PRO A HD3  7  
ATOM   4751  N N    . PHE A 1 23 ? -1.485  -2.901  -3.161  1.00 15.00 ?  494 PHE A N    7  
ATOM   4752  C CA   . PHE A 1 23 ? -1.082  -2.882  -1.769  1.00 15.00 ?  494 PHE A CA   7  
ATOM   4753  C C    . PHE A 1 23 ? -1.224  -1.465  -1.211  1.00 15.00 ?  494 PHE A C    7  
ATOM   4754  O O    . PHE A 1 23 ? -0.864  -0.486  -1.867  1.00 15.00 ?  494 PHE A O    7  
ATOM   4755  C CB   . PHE A 1 23 ? 0.355   -3.441  -1.610  1.00 15.00 ?  494 PHE A CB   7  
ATOM   4756  C CG   . PHE A 1 23 ? 1.494   -2.579  -2.136  1.00 15.00 ?  494 PHE A CG   7  
ATOM   4757  C CD1  . PHE A 1 23 ? 1.373   -1.836  -3.302  1.00 15.00 ?  494 PHE A CD1  7  
ATOM   4758  C CD2  . PHE A 1 23 ? 2.705   -2.529  -1.452  1.00 15.00 ?  494 PHE A CD2  7  
ATOM   4759  C CE1  . PHE A 1 23 ? 2.423   -1.061  -3.770  1.00 15.00 ?  494 PHE A CE1  7  
ATOM   4760  C CE2  . PHE A 1 23 ? 3.758   -1.757  -1.921  1.00 15.00 ?  494 PHE A CE2  7  
ATOM   4761  C CZ   . PHE A 1 23 ? 3.613   -1.023  -3.077  1.00 15.00 ?  494 PHE A CZ   7  
ATOM   4762  H H    . PHE A 1 23 ? -0.991  -2.348  -3.809  1.00 15.00 ?  494 PHE A H    7  
ATOM   4763  H HA   . PHE A 1 23 ? -1.764  -3.525  -1.231  1.00 15.00 ?  494 PHE A HA   7  
ATOM   4764  H HB2  . PHE A 1 23 ? 0.538   -3.614  -0.564  1.00 15.00 ?  494 PHE A HB2  7  
ATOM   4765  H HB3  . PHE A 1 23 ? 0.403   -4.391  -2.125  1.00 15.00 ?  494 PHE A HB3  7  
ATOM   4766  H HD1  . PHE A 1 23 ? 0.442   -1.862  -3.850  1.00 15.00 ?  494 PHE A HD1  7  
ATOM   4767  H HD2  . PHE A 1 23 ? 2.821   -3.098  -0.542  1.00 15.00 ?  494 PHE A HD2  7  
ATOM   4768  H HE1  . PHE A 1 23 ? 2.310   -0.476  -4.672  1.00 15.00 ?  494 PHE A HE1  7  
ATOM   4769  H HE2  . PHE A 1 23 ? 4.692   -1.726  -1.379  1.00 15.00 ?  494 PHE A HE2  7  
ATOM   4770  H HZ   . PHE A 1 23 ? 4.433   -0.423  -3.442  1.00 15.00 ?  494 PHE A HZ   7  
ATOM   4771  N N    . PHE A 1 24 ? -1.792  -1.358  -0.019  1.00 15.00 ?  495 PHE A N    7  
ATOM   4772  C CA   . PHE A 1 24 ? -1.991  -0.068  0.624   1.00 15.00 ?  495 PHE A CA   7  
ATOM   4773  C C    . PHE A 1 24 ? -0.781  0.282   1.471   1.00 15.00 ?  495 PHE A C    7  
ATOM   4774  O O    . PHE A 1 24 ? -0.476  -0.398  2.447   1.00 15.00 ?  495 PHE A O    7  
ATOM   4775  C CB   . PHE A 1 24 ? -3.246  -0.084  1.501   1.00 15.00 ?  495 PHE A CB   7  
ATOM   4776  C CG   . PHE A 1 24 ? -4.476  -0.558  0.784   1.00 15.00 ?  495 PHE A CG   7  
ATOM   4777  C CD1  . PHE A 1 24 ? -5.251  0.325   0.053   1.00 15.00 ?  495 PHE A CD1  7  
ATOM   4778  C CD2  . PHE A 1 24 ? -4.855  -1.890  0.839   1.00 15.00 ?  495 PHE A CD2  7  
ATOM   4779  C CE1  . PHE A 1 24 ? -6.381  -0.112  -0.611  1.00 15.00 ?  495 PHE A CE1  7  
ATOM   4780  C CE2  . PHE A 1 24 ? -5.982  -2.333  0.177   1.00 15.00 ?  495 PHE A CE2  7  
ATOM   4781  C CZ   . PHE A 1 24 ? -6.747  -1.442  -0.549  1.00 15.00 ?  495 PHE A CZ   7  
ATOM   4782  H H    . PHE A 1 24 ? -2.096  -2.164  0.437   1.00 15.00 ?  495 PHE A H    7  
ATOM   4783  H HA   . PHE A 1 24 ? -2.108  0.677   -0.147  1.00 15.00 ?  495 PHE A HA   7  
ATOM   4784  H HB2  . PHE A 1 24 ? -3.080  -0.736  2.345   1.00 15.00 ?  495 PHE A HB2  7  
ATOM   4785  H HB3  . PHE A 1 24 ? -3.436  0.918   1.860   1.00 15.00 ?  495 PHE A HB3  7  
ATOM   4786  H HD1  . PHE A 1 24 ? -4.967  1.366   0.004   1.00 15.00 ?  495 PHE A HD1  7  
ATOM   4787  H HD2  . PHE A 1 24 ? -4.256  -2.588  1.408   1.00 15.00 ?  495 PHE A HD2  7  
ATOM   4788  H HE1  . PHE A 1 24 ? -6.977  0.586   -1.180  1.00 15.00 ?  495 PHE A HE1  7  
ATOM   4789  H HE2  . PHE A 1 24 ? -6.265  -3.374  0.229   1.00 15.00 ?  495 PHE A HE2  7  
ATOM   4790  H HZ   . PHE A 1 24 ? -7.629  -1.786  -1.068  1.00 15.00 ?  495 PHE A HZ   7  
ATOM   4791  N N    . ILE A 1 25 ? -0.082  1.326   1.076   1.00 15.00 ?  496 ILE A N    7  
ATOM   4792  C CA   . ILE A 1 25 ? 1.102   1.772   1.780   1.00 15.00 ?  496 ILE A CA   7  
ATOM   4793  C C    . ILE A 1 25 ? 0.768   2.994   2.590   1.00 15.00 ?  496 ILE A C    7  
ATOM   4794  O O    . ILE A 1 25 ? 0.564   4.070   2.024   1.00 15.00 ?  496 ILE A O    7  
ATOM   4795  C CB   . ILE A 1 25 ? 2.266   2.147   0.833   1.00 15.00 ?  496 ILE A CB   7  
ATOM   4796  C CG1  . ILE A 1 25 ? 2.439   1.117   -0.284  1.00 15.00 ?  496 ILE A CG1  7  
ATOM   4797  C CG2  . ILE A 1 25 ? 3.559   2.288   1.622   1.00 15.00 ?  496 ILE A CG2  7  
ATOM   4798  C CD1  . ILE A 1 25 ? 1.560   1.382   -1.488  1.00 15.00 ?  496 ILE A CD1  7  
ATOM   4799  H H    . ILE A 1 25 ? -0.386  1.830   0.287   1.00 15.00 ?  496 ILE A H    7  
ATOM   4800  H HA   . ILE A 1 25 ? 1.431   0.991   2.441   1.00 15.00 ?  496 ILE A HA   7  
ATOM   4801  H HB   . ILE A 1 25 ? 2.037   3.110   0.392   1.00 15.00 ?  496 ILE A HB   7  
ATOM   4802  H HG12 . ILE A 1 25 ? 3.467   1.124   -0.616  1.00 15.00 ?  496 ILE A HG12 7  
ATOM   4803  H HG13 . ILE A 1 25 ? 2.194   0.137   0.099   1.00 15.00 ?  496 ILE A HG13 7  
ATOM   4804  H HG21 . ILE A 1 25 ? 3.447   3.069   2.361   1.00 15.00 ?  496 ILE A HG21 7  
ATOM   4805  H HG22 . ILE A 1 25 ? 4.366   2.539   0.952   1.00 15.00 ?  496 ILE A HG22 7  
ATOM   4806  H HG23 . ILE A 1 25 ? 3.781   1.355   2.120   1.00 15.00 ?  496 ILE A HG23 7  
ATOM   4807  H HD11 . ILE A 1 25 ? 1.809   2.343   -1.913  1.00 15.00 ?  496 ILE A HD11 7  
ATOM   4808  H HD12 . ILE A 1 25 ? 0.525   1.379   -1.184  1.00 15.00 ?  496 ILE A HD12 7  
ATOM   4809  H HD13 . ILE A 1 25 ? 1.721   0.611   -2.227  1.00 15.00 ?  496 ILE A HD13 7  
ATOM   4810  N N    . ASP A 1 26 ? 0.698   2.857   3.898   1.00 15.00 ?  497 ASP A N    7  
ATOM   4811  C CA   . ASP A 1 26 ? 0.496   4.031   4.698   1.00 15.00 ?  497 ASP A CA   7  
ATOM   4812  C C    . ASP A 1 26 ? 1.792   4.644   5.092   1.00 15.00 ?  497 ASP A C    7  
ATOM   4813  O O    . ASP A 1 26 ? 2.699   4.028   5.658   1.00 15.00 ?  497 ASP A O    7  
ATOM   4814  C CB   . ASP A 1 26 ? -0.394  3.830   5.896   1.00 15.00 ?  497 ASP A CB   7  
ATOM   4815  C CG   . ASP A 1 26 ? -0.029  4.725   7.061   1.00 15.00 ?  497 ASP A CG   7  
ATOM   4816  O OD1  . ASP A 1 26 ? -0.328  5.932   6.991   1.00 15.00 -1 497 ASP A OD1  7  
ATOM   4817  O OD2  . ASP A 1 26 ? 0.578   4.241   8.031   1.00 15.00 ?  497 ASP A OD2  7  
ATOM   4818  H H    . ASP A 1 26 ? 0.796   1.974   4.317   1.00 15.00 ?  497 ASP A H    7  
ATOM   4819  H HA   . ASP A 1 26 ? 0.002   4.741   4.049   1.00 15.00 ?  497 ASP A HA   7  
ATOM   4820  H HB2  . ASP A 1 26 ? -1.374  4.118   5.581   1.00 15.00 ?  497 ASP A HB2  7  
ATOM   4821  H HB3  . ASP A 1 26 ? -0.384  2.797   6.207   1.00 15.00 ?  497 ASP A HB3  7  
ATOM   4822  N N    . HIS A 1 27 ? 1.821   5.886   4.756   1.00 15.00 ?  498 HIS A N    7  
ATOM   4823  C CA   . HIS A 1 27 ? 3.018   6.693   4.823   1.00 15.00 ?  498 HIS A CA   7  
ATOM   4824  C C    . HIS A 1 27 ? 3.291   7.194   6.239   1.00 15.00 ?  498 HIS A C    7  
ATOM   4825  O O    . HIS A 1 27 ? 4.361   7.741   6.510   1.00 15.00 ?  498 HIS A O    7  
ATOM   4826  C CB   . HIS A 1 27 ? 2.950   7.821   3.789   1.00 15.00 ?  498 HIS A CB   7  
ATOM   4827  C CG   . HIS A 1 27 ? 3.029   7.304   2.373   1.00 15.00 ?  498 HIS A CG   7  
ATOM   4828  N ND1  . HIS A 1 27 ? 4.213   7.216   1.674   1.00 15.00 ?  498 HIS A ND1  7  
ATOM   4829  C CD2  . HIS A 1 27 ? 2.073   6.809   1.539   1.00 15.00 ?  498 HIS A CD2  7  
ATOM   4830  C CE1  . HIS A 1 27 ? 3.989   6.686   0.486   1.00 15.00 ?  498 HIS A CE1  7  
ATOM   4831  N NE2  . HIS A 1 27 ? 2.699   6.434   0.375   1.00 15.00 ?  498 HIS A NE2  7  
ATOM   4832  H H    . HIS A 1 27 ? 0.952   6.293   4.493   1.00 15.00 ?  498 HIS A H    7  
ATOM   4833  H HA   . HIS A 1 27 ? 3.838   6.045   4.549   1.00 15.00 ?  498 HIS A HA   7  
ATOM   4834  H HB2  . HIS A 1 27 ? 2.017   8.355   3.904   1.00 15.00 ?  498 HIS A HB2  7  
ATOM   4835  H HB3  . HIS A 1 27 ? 3.775   8.499   3.946   1.00 15.00 ?  498 HIS A HB3  7  
ATOM   4836  H HD1  . HIS A 1 27 ? 5.099   7.527   1.996   1.00 15.00 ?  498 HIS A HD1  7  
ATOM   4837  H HD2  . HIS A 1 27 ? 1.010   6.715   1.751   1.00 15.00 ?  498 HIS A HD2  7  
ATOM   4838  H HE1  . HIS A 1 27 ? 4.739   6.462   -0.257  1.00 15.00 ?  498 HIS A HE1  7  
ATOM   4839  H HE2  . HIS A 1 27 ? 2.242   6.239   -0.471  1.00 15.00 ?  498 HIS A HE2  7  
ATOM   4840  N N    . ASN A 1 28 ? 2.329   7.009   7.137   1.00 15.00 ?  499 ASN A N    7  
ATOM   4841  C CA   . ASN A 1 28 ? 2.521   7.385   8.534   1.00 15.00 ?  499 ASN A CA   7  
ATOM   4842  C C    . ASN A 1 28 ? 3.330   6.313   9.256   1.00 15.00 ?  499 ASN A C    7  
ATOM   4843  O O    . ASN A 1 28 ? 4.298   6.618   9.952   1.00 15.00 ?  499 ASN A O    7  
ATOM   4844  C CB   . ASN A 1 28 ? 1.184   7.583   9.259   1.00 15.00 ?  499 ASN A CB   7  
ATOM   4845  C CG   . ASN A 1 28 ? 0.342   8.711   8.689   1.00 15.00 ?  499 ASN A CG   7  
ATOM   4846  O OD1  . ASN A 1 28 ? 0.499   9.872   9.069   1.00 15.00 ?  499 ASN A OD1  7  
ATOM   4847  N ND2  . ASN A 1 28 ? -0.571  8.374   7.788   1.00 15.00 ?  499 ASN A ND2  7  
ATOM   4848  H H    . ASN A 1 28 ? 1.474   6.603   6.861   1.00 15.00 ?  499 ASN A H    7  
ATOM   4849  H HA   . ASN A 1 28 ? 3.076   8.311   8.554   1.00 15.00 ?  499 ASN A HA   7  
ATOM   4850  H HB2  . ASN A 1 28 ? 0.611   6.670   9.190   1.00 15.00 ?  499 ASN A HB2  7  
ATOM   4851  H HB3  . ASN A 1 28 ? 1.379   7.797   10.299  1.00 15.00 ?  499 ASN A HB3  7  
ATOM   4852  H HD21 . ASN A 1 28 ? -0.642  7.414   7.536   1.00 15.00 ?  499 ASN A HD21 7  
ATOM   4853  H HD22 . ASN A 1 28 ? -1.145  9.073   7.418   1.00 15.00 ?  499 ASN A HD22 7  
ATOM   4854  N N    . THR A 1 29 ? 2.911   5.060   9.113   1.00 15.00 ?  500 THR A N    7  
ATOM   4855  C CA   . THR A 1 29 ? 3.618   3.939   9.725   1.00 15.00 ?  500 THR A CA   7  
ATOM   4856  C C    . THR A 1 29 ? 4.835   3.533   8.900   1.00 15.00 ?  500 THR A C    7  
ATOM   4857  O O    . THR A 1 29 ? 5.733   2.858   9.405   1.00 15.00 ?  500 THR A O    7  
ATOM   4858  C CB   . THR A 1 29 ? 2.702   2.710   9.892   1.00 15.00 ?  500 THR A CB   7  
ATOM   4859  O OG1  . THR A 1 29 ? 2.145   2.337   8.624   1.00 15.00 ?  500 THR A OG1  7  
ATOM   4860  C CG2  . THR A 1 29 ? 1.582   2.992   10.883  1.00 15.00 ?  500 THR A CG2  7  
ATOM   4861  H H    . THR A 1 29 ? 2.091   4.882   8.586   1.00 15.00 ?  500 THR A H    7  
ATOM   4862  H HA   . THR A 1 29 ? 3.949   4.250   10.705  1.00 15.00 ?  500 THR A HA   7  
ATOM   4863  H HB   . THR A 1 29 ? 3.297   1.890   10.270  1.00 15.00 ?  500 THR A HB   7  
ATOM   4864  H HG1  . THR A 1 29 ? 1.447   2.973   8.378   1.00 15.00 ?  500 THR A HG1  7  
ATOM   4865  H HG21 . THR A 1 29 ? 0.979   3.813   10.523  1.00 15.00 ?  500 THR A HG21 7  
ATOM   4866  H HG22 . THR A 1 29 ? 2.006   3.252   11.842  1.00 15.00 ?  500 THR A HG22 7  
ATOM   4867  H HG23 . THR A 1 29 ? 0.965   2.112   10.990  1.00 15.00 ?  500 THR A HG23 7  
ATOM   4868  N N    . LYS A 1 30 ? 4.840   3.944   7.627   1.00 15.00 ?  501 LYS A N    7  
ATOM   4869  C CA   . LYS A 1 30 ? 5.878   3.557   6.665   1.00 15.00 ?  501 LYS A CA   7  
ATOM   4870  C C    . LYS A 1 30 ? 5.741   2.079   6.319   1.00 15.00 ?  501 LYS A C    7  
ATOM   4871  O O    . LYS A 1 30 ? 6.680   1.454   5.824   1.00 15.00 ?  501 LYS A O    7  
ATOM   4872  C CB   . LYS A 1 30 ? 7.286   3.829   7.215   1.00 15.00 ?  501 LYS A CB   7  
ATOM   4873  C CG   . LYS A 1 30 ? 7.554   5.284   7.565   1.00 15.00 ?  501 LYS A CG   7  
ATOM   4874  C CD   . LYS A 1 30 ? 7.856   6.128   6.335   1.00 15.00 ?  501 LYS A CD   7  
ATOM   4875  C CE   . LYS A 1 30 ? 9.044   5.576   5.555   1.00 15.00 ?  501 LYS A CE   7  
ATOM   4876  N NZ   . LYS A 1 30 ? 9.706   6.618   4.726   1.00 15.00 1  501 LYS A NZ   7  
ATOM   4877  H H    . LYS A 1 30 ? 4.105   4.517   7.321   1.00 15.00 ?  501 LYS A H    7  
ATOM   4878  H HA   . LYS A 1 30 ? 5.730   4.139   5.767   1.00 15.00 ?  501 LYS A HA   7  
ATOM   4879  H HB2  . LYS A 1 30 ? 7.429   3.240   8.104   1.00 15.00 ?  501 LYS A HB2  7  
ATOM   4880  H HB3  . LYS A 1 30 ? 8.010   3.524   6.474   1.00 15.00 ?  501 LYS A HB3  7  
ATOM   4881  H HG2  . LYS A 1 30 ? 6.683   5.684   8.054   1.00 15.00 ?  501 LYS A HG2  7  
ATOM   4882  H HG3  . LYS A 1 30 ? 8.398   5.330   8.237   1.00 15.00 ?  501 LYS A HG3  7  
ATOM   4883  H HD2  . LYS A 1 30 ? 6.987   6.133   5.695   1.00 15.00 ?  501 LYS A HD2  7  
ATOM   4884  H HD3  . LYS A 1 30 ? 8.079   7.136   6.649   1.00 15.00 ?  501 LYS A HD3  7  
ATOM   4885  H HE2  . LYS A 1 30 ? 9.765   5.183   6.255   1.00 15.00 ?  501 LYS A HE2  7  
ATOM   4886  H HE3  . LYS A 1 30 ? 8.697   4.781   4.911   1.00 15.00 ?  501 LYS A HE3  7  
ATOM   4887  H HZ1  . LYS A 1 30 ? 10.282  7.241   5.332   1.00 15.00 ?  501 LYS A HZ1  7  
ATOM   4888  H HZ2  . LYS A 1 30 ? 8.998   7.197   4.229   1.00 15.00 ?  501 LYS A HZ2  7  
ATOM   4889  H HZ3  . LYS A 1 30 ? 10.330  6.173   4.016   1.00 15.00 ?  501 LYS A HZ3  7  
ATOM   4890  N N    . THR A 1 31 ? 4.551   1.534   6.536   1.00 15.00 ?  502 THR A N    7  
ATOM   4891  C CA   . THR A 1 31 ? 4.312   0.115   6.303   1.00 15.00 ?  502 THR A CA   7  
ATOM   4892  C C    . THR A 1 31 ? 3.133   -0.090  5.363   1.00 15.00 ?  502 THR A C    7  
ATOM   4893  O O    . THR A 1 31 ? 2.213   0.728   5.312   1.00 15.00 ?  502 THR A O    7  
ATOM   4894  C CB   . THR A 1 31 ? 4.066   -0.666  7.614   1.00 15.00 ?  502 THR A CB   7  
ATOM   4895  O OG1  . THR A 1 31 ? 2.919   -0.153  8.308   1.00 15.00 ?  502 THR A OG1  7  
ATOM   4896  C CG2  . THR A 1 31 ? 5.282   -0.602  8.523   1.00 15.00 ?  502 THR A CG2  7  
ATOM   4897  H H    . THR A 1 31 ? 3.808   2.106   6.831   1.00 15.00 ?  502 THR A H    7  
ATOM   4898  H HA   . THR A 1 31 ? 5.198   -0.292  5.833   1.00 15.00 ?  502 THR A HA   7  
ATOM   4899  H HB   . THR A 1 31 ? 3.884   -1.702  7.365   1.00 15.00 ?  502 THR A HB   7  
ATOM   4900  H HG1  . THR A 1 31 ? 2.856   0.807   8.171   1.00 15.00 ?  502 THR A HG1  7  
ATOM   4901  H HG21 . THR A 1 31 ? 5.080   -1.146  9.433   1.00 15.00 ?  502 THR A HG21 7  
ATOM   4902  H HG22 . THR A 1 31 ? 5.503   0.429   8.759   1.00 15.00 ?  502 THR A HG22 7  
ATOM   4903  H HG23 . THR A 1 31 ? 6.129   -1.044  8.020   1.00 15.00 ?  502 THR A HG23 7  
ATOM   4904  N N    . THR A 1 32 ? 3.176   -1.172  4.606   1.00 15.00 ?  503 THR A N    7  
ATOM   4905  C CA   . THR A 1 32 ? 2.117   -1.482  3.669   1.00 15.00 ?  503 THR A CA   7  
ATOM   4906  C C    . THR A 1 32 ? 1.370   -2.741  4.102   1.00 15.00 ?  503 THR A C    7  
ATOM   4907  O O    . THR A 1 32 ? 1.933   -3.615  4.760   1.00 15.00 ?  503 THR A O    7  
ATOM   4908  C CB   . THR A 1 32 ? 2.665   -1.643  2.233   1.00 15.00 ?  503 THR A CB   7  
ATOM   4909  O OG1  . THR A 1 32 ? 1.604   -1.985  1.341   1.00 15.00 ?  503 THR A OG1  7  
ATOM   4910  C CG2  . THR A 1 32 ? 3.757   -2.700  2.162   1.00 15.00 ?  503 THR A CG2  7  
ATOM   4911  H H    . THR A 1 32 ? 3.932   -1.788  4.685   1.00 15.00 ?  503 THR A H    7  
ATOM   4912  H HA   . THR A 1 32 ? 1.425   -0.653  3.674   1.00 15.00 ?  503 THR A HA   7  
ATOM   4913  H HB   . THR A 1 32 ? 3.085   -0.699  1.923   1.00 15.00 ?  503 THR A HB   7  
ATOM   4914  H HG1  . THR A 1 32 ? 0.849   -1.412  1.509   1.00 15.00 ?  503 THR A HG1  7  
ATOM   4915  H HG21 . THR A 1 32 ? 3.360   -3.651  2.484   1.00 15.00 ?  503 THR A HG21 7  
ATOM   4916  H HG22 . THR A 1 32 ? 4.578   -2.415  2.803   1.00 15.00 ?  503 THR A HG22 7  
ATOM   4917  H HG23 . THR A 1 32 ? 4.108   -2.782  1.144   1.00 15.00 ?  503 THR A HG23 7  
ATOM   4918  N N    . THR A 1 33 ? 0.091   -2.802  3.756   1.00 15.00 ?  504 THR A N    7  
ATOM   4919  C CA   . THR A 1 33 ? -0.758  -3.924  4.110   1.00 15.00 ?  504 THR A CA   7  
ATOM   4920  C C    . THR A 1 33 ? -1.765  -4.190  2.995   1.00 15.00 ?  504 THR A C    7  
ATOM   4921  O O    . THR A 1 33 ? -2.138  -3.280  2.252   1.00 15.00 ?  504 THR A O    7  
ATOM   4922  C CB   . THR A 1 33 ? -1.504  -3.669  5.443   1.00 15.00 ?  504 THR A CB   7  
ATOM   4923  O OG1  . THR A 1 33 ? -2.344  -4.785  5.763   1.00 15.00 ?  504 THR A OG1  7  
ATOM   4924  C CG2  . THR A 1 33 ? -2.342  -2.401  5.374   1.00 15.00 ?  504 THR A CG2  7  
ATOM   4925  H H    . THR A 1 33 ? -0.298  -2.063  3.239   1.00 15.00 ?  504 THR A H    7  
ATOM   4926  H HA   . THR A 1 33 ? -0.130  -4.795  4.229   1.00 15.00 ?  504 THR A HA   7  
ATOM   4927  H HB   . THR A 1 33 ? -0.768  -3.550  6.226   1.00 15.00 ?  504 THR A HB   7  
ATOM   4928  H HG1  . THR A 1 33 ? -2.627  -4.718  6.690   1.00 15.00 ?  504 THR A HG1  7  
ATOM   4929  H HG21 . THR A 1 33 ? -3.077  -2.497  4.588   1.00 15.00 ?  504 THR A HG21 7  
ATOM   4930  H HG22 . THR A 1 33 ? -1.701  -1.556  5.165   1.00 15.00 ?  504 THR A HG22 7  
ATOM   4931  H HG23 . THR A 1 33 ? -2.842  -2.248  6.319   1.00 15.00 ?  504 THR A HG23 7  
ATOM   4932  N N    . TRP A 1 34 ? -2.169  -5.447  2.851   1.00 15.00 ?  505 TRP A N    7  
ATOM   4933  C CA   . TRP A 1 34 ? -3.174  -5.818  1.862   1.00 15.00 ?  505 TRP A CA   7  
ATOM   4934  C C    . TRP A 1 34 ? -4.579  -5.508  2.381   1.00 15.00 ?  505 TRP A C    7  
ATOM   4935  O O    . TRP A 1 34 ? -5.567  -5.657  1.659   1.00 15.00 ?  505 TRP A O    7  
ATOM   4936  C CB   . TRP A 1 34 ? -3.087  -7.311  1.530   1.00 15.00 ?  505 TRP A CB   7  
ATOM   4937  C CG   . TRP A 1 34 ? -1.766  -7.762  0.979   1.00 15.00 ?  505 TRP A CG   7  
ATOM   4938  C CD1  . TRP A 1 34 ? -0.763  -8.380  1.667   1.00 15.00 ?  505 TRP A CD1  7  
ATOM   4939  C CD2  . TRP A 1 34 ? -1.317  -7.659  -0.380  1.00 15.00 ?  505 TRP A CD2  7  
ATOM   4940  N NE1  . TRP A 1 34 ? 0.281   -8.671  0.821   1.00 15.00 ?  505 TRP A NE1  7  
ATOM   4941  C CE2  . TRP A 1 34 ? -0.035  -8.236  -0.441  1.00 15.00 ?  505 TRP A CE2  7  
ATOM   4942  C CE3  . TRP A 1 34 ? -1.873  -7.132  -1.550  1.00 15.00 ?  505 TRP A CE3  7  
ATOM   4943  C CZ2  . TRP A 1 34 ? 0.694   -8.307  -1.627  1.00 15.00 ?  505 TRP A CZ2  7  
ATOM   4944  C CZ3  . TRP A 1 34 ? -1.149  -7.204  -2.727  1.00 15.00 ?  505 TRP A CZ3  7  
ATOM   4945  C CH2  . TRP A 1 34 ? 0.121   -7.790  -2.758  1.00 15.00 ?  505 TRP A CH2  7  
ATOM   4946  H H    . TRP A 1 34 ? -1.786  -6.140  3.427   1.00 15.00 ?  505 TRP A H    7  
ATOM   4947  H HA   . TRP A 1 34 ? -2.996  -5.244  0.967   1.00 15.00 ?  505 TRP A HA   7  
ATOM   4948  H HB2  . TRP A 1 34 ? -3.276  -7.879  2.428   1.00 15.00 ?  505 TRP A HB2  7  
ATOM   4949  H HB3  . TRP A 1 34 ? -3.849  -7.548  0.800   1.00 15.00 ?  505 TRP A HB3  7  
ATOM   4950  H HD1  . TRP A 1 34 ? -0.797  -8.606  2.722   1.00 15.00 ?  505 TRP A HD1  7  
ATOM   4951  H HE1  . TRP A 1 34 ? 1.115   -9.118  1.078   1.00 15.00 ?  505 TRP A HE1  7  
ATOM   4952  H HE3  . TRP A 1 34 ? -2.847  -6.670  -1.545  1.00 15.00 ?  505 TRP A HE3  7  
ATOM   4953  H HZ2  . TRP A 1 34 ? 1.675   -8.756  -1.669  1.00 15.00 ?  505 TRP A HZ2  7  
ATOM   4954  H HZ3  . TRP A 1 34 ? -1.565  -6.808  -3.642  1.00 15.00 ?  505 TRP A HZ3  7  
ATOM   4955  H HH2  . TRP A 1 34 ? 0.649   -7.829  -3.707  1.00 15.00 ?  505 TRP A HH2  7  
ATOM   4956  N N    . GLU A 1 35 ? -4.659  -5.098  3.641   1.00 15.00 ?  506 GLU A N    7  
ATOM   4957  C CA   . GLU A 1 35 ? -5.940  -4.839  4.287   1.00 15.00 ?  506 GLU A CA   7  
ATOM   4958  C C    . GLU A 1 35 ? -6.411  -3.436  4.021   1.00 15.00 ?  506 GLU A C    7  
ATOM   4959  O O    . GLU A 1 35 ? -5.676  -2.464  4.199   1.00 15.00 ?  506 GLU A O    7  
ATOM   4960  C CB   . GLU A 1 35 ? -5.838  -5.095  5.794   1.00 15.00 ?  506 GLU A CB   7  
ATOM   4961  C CG   . GLU A 1 35 ? -7.169  -5.030  6.528   1.00 15.00 ?  506 GLU A CG   7  
ATOM   4962  C CD   . GLU A 1 35 ? -8.099  -6.164  6.150   1.00 15.00 ?  506 GLU A CD   7  
ATOM   4963  O OE1  . GLU A 1 35 ? -7.868  -7.301  6.610   1.00 15.00 ?  506 GLU A OE1  7  
ATOM   4964  O OE2  . GLU A 1 35 ? -9.070  -5.925  5.401   1.00 15.00 -1 506 GLU A OE2  7  
ATOM   4965  H H    . GLU A 1 35 ? -3.833  -4.957  4.150   1.00 15.00 ?  506 GLU A H    7  
ATOM   4966  H HA   . GLU A 1 35 ? -6.670  -5.494  3.862   1.00 15.00 ?  506 GLU A HA   7  
ATOM   4967  H HB2  . GLU A 1 35 ? -5.417  -6.077  5.949   1.00 15.00 ?  506 GLU A HB2  7  
ATOM   4968  H HB3  . GLU A 1 35 ? -5.176  -4.359  6.227   1.00 15.00 ?  506 GLU A HB3  7  
ATOM   4969  H HG2  . GLU A 1 35 ? -6.984  -5.077  7.591   1.00 15.00 ?  506 GLU A HG2  7  
ATOM   4970  H HG3  . GLU A 1 35 ? -7.651  -4.093  6.289   1.00 15.00 ?  506 GLU A HG3  7  
ATOM   4971  N N    . ASP A 1 36 ? -7.661  -3.345  3.613   1.00 15.00 ?  507 ASP A N    7  
ATOM   4972  C CA   . ASP A 1 36 ? -8.228  -2.080  3.244   1.00 15.00 ?  507 ASP A CA   7  
ATOM   4973  C C    . ASP A 1 36 ? -8.736  -1.350  4.486   1.00 15.00 ?  507 ASP A C    7  
ATOM   4974  O O    . ASP A 1 36 ? -9.520  -1.907  5.259   1.00 15.00 ?  507 ASP A O    7  
ATOM   4975  C CB   . ASP A 1 36 ? -9.356  -2.273  2.226   1.00 15.00 ?  507 ASP A CB   7  
ATOM   4976  C CG   . ASP A 1 36 ? -10.008 -0.965  1.811   1.00 15.00 ?  507 ASP A CG   7  
ATOM   4977  O OD1  . ASP A 1 36 ? -9.450  -0.260  0.944   1.00 15.00 -1 507 ASP A OD1  7  
ATOM   4978  O OD2  . ASP A 1 36 ? -11.091 -0.646  2.336   1.00 15.00 ?  507 ASP A OD2  7  
ATOM   4979  H H    . ASP A 1 36 ? -8.213  -4.151  3.573   1.00 15.00 ?  507 ASP A H    7  
ATOM   4980  H HA   . ASP A 1 36 ? -7.435  -1.520  2.797   1.00 15.00 ?  507 ASP A HA   7  
ATOM   4981  H HB2  . ASP A 1 36 ? -8.953  -2.746  1.342   1.00 15.00 ?  507 ASP A HB2  7  
ATOM   4982  H HB3  . ASP A 1 36 ? -10.113 -2.911  2.656   1.00 15.00 ?  507 ASP A HB3  7  
ATOM   4983  N N    . PRO A 1 37 ? -8.299  -0.100  4.702   1.00 15.00 ?  508 PRO A N    7  
ATOM   4984  C CA   . PRO A 1 37 ? -8.653  0.663   5.900   1.00 15.00 ?  508 PRO A CA   7  
ATOM   4985  C C    . PRO A 1 37 ? -10.079 1.209   5.866   1.00 15.00 ?  508 PRO A C    7  
ATOM   4986  O O    . PRO A 1 37 ? -10.518 1.854   6.818   1.00 15.00 ?  508 PRO A O    7  
ATOM   4987  C CB   . PRO A 1 37 ? -7.638  1.804   5.909   1.00 15.00 ?  508 PRO A CB   7  
ATOM   4988  C CG   . PRO A 1 37 ? -7.266  2.003   4.479   1.00 15.00 ?  508 PRO A CG   7  
ATOM   4989  C CD   . PRO A 1 37 ? -7.417  0.665   3.798   1.00 15.00 ?  508 PRO A CD   7  
ATOM   4990  H HA   . PRO A 1 37 ? -8.526  0.067   6.794   1.00 15.00 ?  508 PRO A HA   7  
ATOM   4991  H HB2  . PRO A 1 37 ? -8.094  2.692   6.326   1.00 15.00 ?  508 PRO A HB2  7  
ATOM   4992  H HB3  . PRO A 1 37 ? -6.781  1.522   6.503   1.00 15.00 ?  508 PRO A HB3  7  
ATOM   4993  H HG2  . PRO A 1 37 ? -7.923  2.728   4.030   1.00 15.00 ?  508 PRO A HG2  7  
ATOM   4994  H HG3  . PRO A 1 37 ? -6.241  2.339   4.414   1.00 15.00 ?  508 PRO A HG3  7  
ATOM   4995  H HD2  . PRO A 1 37 ? -7.875  0.788   2.829   1.00 15.00 ?  508 PRO A HD2  7  
ATOM   4996  H HD3  . PRO A 1 37 ? -6.455  0.183   3.703   1.00 15.00 ?  508 PRO A HD3  7  
ATOM   4997  N N    . ARG A 1 38 ? -10.781 0.947   4.762   1.00 15.00 ?  509 ARG A N    7  
ATOM   4998  C CA   . ARG A 1 38 ? -12.185 1.331   4.590   1.00 15.00 ?  509 ARG A CA   7  
ATOM   4999  C C    . ARG A 1 38 ? -12.357 2.846   4.627   1.00 15.00 ?  509 ARG A C    7  
ATOM   5000  O O    . ARG A 1 38 ? -12.635 3.397   5.711   1.00 15.00 ?  509 ARG A O    7  
ATOM   5001  C CB   . ARG A 1 38 ? -13.066 0.670   5.660   1.00 15.00 ?  509 ARG A CB   7  
ATOM   5002  C CG   . ARG A 1 38 ? -12.880 -0.836  5.763   1.00 15.00 ?  509 ARG A CG   7  
ATOM   5003  C CD   . ARG A 1 38 ? -13.157 -1.535  4.442   1.00 15.00 ?  509 ARG A CD   7  
ATOM   5004  N NE   . ARG A 1 38 ? -12.855 -2.965  4.507   1.00 15.00 ?  509 ARG A NE   7  
ATOM   5005  C CZ   . ARG A 1 38 ? -12.767 -3.761  3.444   1.00 15.00 ?  509 ARG A CZ   7  
ATOM   5006  N NH1  . ARG A 1 38 ? -12.925 -3.272  2.221   1.00 15.00 1  509 ARG A NH1  7  
ATOM   5007  N NH2  . ARG A 1 38 ? -12.488 -5.046  3.605   1.00 15.00 ?  509 ARG A NH2  7  
ATOM   5008  H H    . ARG A 1 38 ? -10.337 0.474   4.025   1.00 15.00 ?  509 ARG A H    7  
ATOM   5009  H HA   . ARG A 1 38 ? -12.500 0.978   3.620   1.00 15.00 ?  509 ARG A HA   7  
ATOM   5010  H HB2  . ARG A 1 38 ? -12.831 1.106   6.620   1.00 15.00 ?  509 ARG A HB2  7  
ATOM   5011  H HB3  . ARG A 1 38 ? -14.102 0.869   5.430   1.00 15.00 ?  509 ARG A HB3  7  
ATOM   5012  H HG2  . ARG A 1 38 ? -11.863 -1.042  6.060   1.00 15.00 ?  509 ARG A HG2  7  
ATOM   5013  H HG3  . ARG A 1 38 ? -13.557 -1.221  6.510   1.00 15.00 ?  509 ARG A HG3  7  
ATOM   5014  H HD2  . ARG A 1 38 ? -14.200 -1.409  4.193   1.00 15.00 ?  509 ARG A HD2  7  
ATOM   5015  H HD3  . ARG A 1 38 ? -12.547 -1.083  3.674   1.00 15.00 ?  509 ARG A HD3  7  
ATOM   5016  H HE   . ARG A 1 38 ? -12.710 -3.352  5.400   1.00 15.00 ?  509 ARG A HE   7  
ATOM   5017  H HH11 . ARG A 1 38 ? -13.109 -2.294  2.085   1.00 15.00 ?  509 ARG A HH11 7  
ATOM   5018  H HH12 . ARG A 1 38 ? -12.857 -3.880  1.419   1.00 15.00 ?  509 ARG A HH12 7  
ATOM   5019  H HH21 . ARG A 1 38 ? -12.339 -5.418  4.531   1.00 15.00 ?  509 ARG A HH21 7  
ATOM   5020  H HH22 . ARG A 1 38 ? -12.433 -5.651  2.809   1.00 15.00 ?  509 ARG A HH22 7  
ATOM   5021  N N    . ARG B 2 1  ? 0.300   -19.037 0.415   1.00 15.00 ?  925 ARG B N    7  
ATOM   5022  C CA   . ARG B 2 1  ? 0.520   -17.907 1.347   1.00 15.00 ?  925 ARG B CA   7  
ATOM   5023  C C    . ARG B 2 1  ? 0.977   -16.668 0.588   1.00 15.00 ?  925 ARG B C    7  
ATOM   5024  O O    . ARG B 2 1  ? 2.013   -16.684 -0.074  1.00 15.00 ?  925 ARG B O    7  
ATOM   5025  C CB   . ARG B 2 1  ? 1.571   -18.277 2.400   1.00 15.00 ?  925 ARG B CB   7  
ATOM   5026  C CG   . ARG B 2 1  ? 1.176   -19.459 3.267   1.00 15.00 ?  925 ARG B CG   7  
ATOM   5027  C CD   . ARG B 2 1  ? -0.097  -19.184 4.049   1.00 15.00 ?  925 ARG B CD   7  
ATOM   5028  N NE   . ARG B 2 1  ? -0.579  -20.382 4.727   1.00 15.00 ?  925 ARG B NE   7  
ATOM   5029  C CZ   . ARG B 2 1  ? -1.842  -20.567 5.104   1.00 15.00 ?  925 ARG B CZ   7  
ATOM   5030  N NH1  . ARG B 2 1  ? -2.742  -19.611 4.910   1.00 15.00 1  925 ARG B NH1  7  
ATOM   5031  N NH2  . ARG B 2 1  ? -2.205  -21.710 5.671   1.00 15.00 ?  925 ARG B NH2  7  
ATOM   5032  H H1   . ARG B 2 1  ? -0.447  -18.796 -0.269  1.00 15.00 ?  925 ARG B H1   7  
ATOM   5033  H H2   . ARG B 2 1  ? 0.010   -19.890 0.941   1.00 15.00 ?  925 ARG B H2   7  
ATOM   5034  H H3   . ARG B 2 1  ? 1.176   -19.247 -0.108  1.00 15.00 ?  925 ARG B H3   7  
ATOM   5035  H HA   . ARG B 2 1  ? -0.415  -17.687 1.841   1.00 15.00 ?  925 ARG B HA   7  
ATOM   5036  H HB2  . ARG B 2 1  ? 2.495   -18.520 1.898   1.00 15.00 ?  925 ARG B HB2  7  
ATOM   5037  H HB3  . ARG B 2 1  ? 1.734   -17.425 3.042   1.00 15.00 ?  925 ARG B HB3  7  
ATOM   5038  H HG2  . ARG B 2 1  ? 1.014   -20.318 2.634   1.00 15.00 ?  925 ARG B HG2  7  
ATOM   5039  H HG3  . ARG B 2 1  ? 1.978   -19.668 3.961   1.00 15.00 ?  925 ARG B HG3  7  
ATOM   5040  H HD2  . ARG B 2 1  ? 0.105   -18.420 4.787   1.00 15.00 ?  925 ARG B HD2  7  
ATOM   5041  H HD3  . ARG B 2 1  ? -0.857  -18.833 3.367   1.00 15.00 ?  925 ARG B HD3  7  
ATOM   5042  H HE   . ARG B 2 1  ? 0.079   -21.100 4.893   1.00 15.00 ?  925 ARG B HE   7  
ATOM   5043  H HH11 . ARG B 2 1  ? -2.476  -18.746 4.481   1.00 15.00 ?  925 ARG B HH11 7  
ATOM   5044  H HH12 . ARG B 2 1  ? -3.695  -19.752 5.191   1.00 15.00 ?  925 ARG B HH12 7  
ATOM   5045  H HH21 . ARG B 2 1  ? -1.530  -22.438 5.819   1.00 15.00 ?  925 ARG B HH21 7  
ATOM   5046  H HH22 . ARG B 2 1  ? -3.163  -21.860 5.937   1.00 15.00 ?  925 ARG B HH22 7  
ATOM   5047  N N    . LEU B 2 2  ? 0.201   -15.599 0.684   1.00 15.00 ?  926 LEU B N    7  
ATOM   5048  C CA   . LEU B 2 2  ? 0.554   -14.334 0.058   1.00 15.00 ?  926 LEU B CA   7  
ATOM   5049  C C    . LEU B 2 2  ? 1.489   -13.562 0.984   1.00 15.00 ?  926 LEU B C    7  
ATOM   5050  O O    . LEU B 2 2  ? 1.151   -13.309 2.143   1.00 15.00 ?  926 LEU B O    7  
ATOM   5051  C CB   . LEU B 2 2  ? -0.710  -13.509 -0.222  1.00 15.00 ?  926 LEU B CB   7  
ATOM   5052  C CG   . LEU B 2 2  ? -0.715  -12.720 -1.538  1.00 15.00 ?  926 LEU B CG   7  
ATOM   5053  C CD1  . LEU B 2 2  ? -1.995  -11.907 -1.657  1.00 15.00 ?  926 LEU B CD1  7  
ATOM   5054  C CD2  . LEU B 2 2  ? 0.504   -11.816 -1.646  1.00 15.00 ?  926 LEU B CD2  7  
ATOM   5055  H H    . LEU B 2 2  ? -0.637  -15.663 1.200   1.00 15.00 ?  926 LEU B H    7  
ATOM   5056  H HA   . LEU B 2 2  ? 1.063   -14.543 -0.871  1.00 15.00 ?  926 LEU B HA   7  
ATOM   5057  H HB2  . LEU B 2 2  ? -1.556  -14.178 -0.229  1.00 15.00 ?  926 LEU B HB2  7  
ATOM   5058  H HB3  . LEU B 2 2  ? -0.837  -12.808 0.588   1.00 15.00 ?  926 LEU B HB3  7  
ATOM   5059  H HG   . LEU B 2 2  ? -0.688  -13.417 -2.363  1.00 15.00 ?  926 LEU B HG   7  
ATOM   5060  H HD11 . LEU B 2 2  ? -1.988  -11.359 -2.588  1.00 15.00 ?  926 LEU B HD11 7  
ATOM   5061  H HD12 . LEU B 2 2  ? -2.061  -11.213 -0.832  1.00 15.00 ?  926 LEU B HD12 7  
ATOM   5062  H HD13 . LEU B 2 2  ? -2.847  -12.572 -1.636  1.00 15.00 ?  926 LEU B HD13 7  
ATOM   5063  H HD21 . LEU B 2 2  ? 0.505   -11.112 -0.828  1.00 15.00 ?  926 LEU B HD21 7  
ATOM   5064  H HD22 . LEU B 2 2  ? 0.475   -11.279 -2.582  1.00 15.00 ?  926 LEU B HD22 7  
ATOM   5065  H HD23 . LEU B 2 2  ? 1.400   -12.417 -1.604  1.00 15.00 ?  926 LEU B HD23 7  
ATOM   5066  N N    . ASP B 2 3  ? 2.660   -13.198 0.481   1.00 15.00 ?  927 ASP B N    7  
ATOM   5067  C CA   . ASP B 2 3  ? 3.657   -12.517 1.299   1.00 15.00 ?  927 ASP B CA   7  
ATOM   5068  C C    . ASP B 2 3  ? 3.695   -11.016 1.007   1.00 15.00 ?  927 ASP B C    7  
ATOM   5069  O O    . ASP B 2 3  ? 3.924   -10.595 -0.126  1.00 15.00 ?  927 ASP B O    7  
ATOM   5070  C CB   . ASP B 2 3  ? 5.041   -13.131 1.069   1.00 15.00 ?  927 ASP B CB   7  
ATOM   5071  C CG   . ASP B 2 3  ? 6.070   -12.616 2.055   1.00 15.00 ?  927 ASP B CG   7  
ATOM   5072  O OD1  . ASP B 2 3  ? 5.851   -12.762 3.278   1.00 15.00 ?  927 ASP B OD1  7  
ATOM   5073  O OD2  . ASP B 2 3  ? 7.117   -12.097 1.618   1.00 15.00 -1 927 ASP B OD2  7  
ATOM   5074  H H    . ASP B 2 3  ? 2.862   -13.391 -0.460  1.00 15.00 ?  927 ASP B H    7  
ATOM   5075  H HA   . ASP B 2 3  ? 3.383   -12.659 2.333   1.00 15.00 ?  927 ASP B HA   7  
ATOM   5076  H HB2  . ASP B 2 3  ? 4.976   -14.204 1.175   1.00 15.00 ?  927 ASP B HB2  7  
ATOM   5077  H HB3  . ASP B 2 3  ? 5.374   -12.891 0.069   1.00 15.00 ?  927 ASP B HB3  7  
ATOM   5078  N N    . LEU B 2 4  ? 3.441   -10.223 2.041   1.00 15.00 ?  928 LEU B N    7  
ATOM   5079  C CA   . LEU B 2 4  ? 3.547   -8.768  1.972   1.00 15.00 ?  928 LEU B CA   7  
ATOM   5080  C C    . LEU B 2 4  ? 5.018   -8.370  1.817   1.00 15.00 ?  928 LEU B C    7  
ATOM   5081  O O    . LEU B 2 4  ? 5.852   -8.750  2.640   1.00 15.00 ?  928 LEU B O    7  
ATOM   5082  C CB   . LEU B 2 4  ? 2.935   -8.176  3.261   1.00 15.00 ?  928 LEU B CB   7  
ATOM   5083  C CG   . LEU B 2 4  ? 2.758   -6.647  3.339   1.00 15.00 ?  928 LEU B CG   7  
ATOM   5084  C CD1  . LEU B 2 4  ? 4.081   -5.946  3.600   1.00 15.00 ?  928 LEU B CD1  7  
ATOM   5085  C CD2  . LEU B 2 4  ? 2.106   -6.108  2.072   1.00 15.00 ?  928 LEU B CD2  7  
ATOM   5086  H H    . LEU B 2 4  ? 3.164   -10.633 2.889   1.00 15.00 ?  928 LEU B H    7  
ATOM   5087  H HA   . LEU B 2 4  ? 2.990   -8.420  1.115   1.00 15.00 ?  928 LEU B HA   7  
ATOM   5088  H HB2  . LEU B 2 4  ? 1.964   -8.624  3.399   1.00 15.00 ?  928 LEU B HB2  7  
ATOM   5089  H HB3  . LEU B 2 4  ? 3.561   -8.476  4.090   1.00 15.00 ?  928 LEU B HB3  7  
ATOM   5090  H HG   . LEU B 2 4  ? 2.100   -6.421  4.166   1.00 15.00 ?  928 LEU B HG   7  
ATOM   5091  H HD11 . LEU B 2 4  ? 4.499   -6.299  4.532   1.00 15.00 ?  928 LEU B HD11 7  
ATOM   5092  H HD12 . LEU B 2 4  ? 3.918   -4.880  3.662   1.00 15.00 ?  928 LEU B HD12 7  
ATOM   5093  H HD13 . LEU B 2 4  ? 4.768   -6.158  2.794   1.00 15.00 ?  928 LEU B HD13 7  
ATOM   5094  H HD21 . LEU B 2 4  ? 2.716   -6.364  1.219   1.00 15.00 ?  928 LEU B HD21 7  
ATOM   5095  H HD22 . LEU B 2 4  ? 2.017   -5.034  2.142   1.00 15.00 ?  928 LEU B HD22 7  
ATOM   5096  H HD23 . LEU B 2 4  ? 1.125   -6.544  1.958   1.00 15.00 ?  928 LEU B HD23 7  
ATOM   5097  N N    . PRO B 2 5  ? 5.366   -7.609  0.763   1.00 15.00 ?  929 PRO B N    7  
ATOM   5098  C CA   . PRO B 2 5  ? 6.753   -7.216  0.512   1.00 15.00 ?  929 PRO B CA   7  
ATOM   5099  C C    . PRO B 2 5  ? 7.228   -6.117  1.459   1.00 15.00 ?  929 PRO B C    7  
ATOM   5100  O O    . PRO B 2 5  ? 6.544   -5.107  1.641   1.00 15.00 ?  929 PRO B O    7  
ATOM   5101  C CB   . PRO B 2 5  ? 6.714   -6.699  -0.926  1.00 15.00 ?  929 PRO B CB   7  
ATOM   5102  C CG   . PRO B 2 5  ? 5.330   -6.173  -1.095  1.00 15.00 ?  929 PRO B CG   7  
ATOM   5103  C CD   . PRO B 2 5  ? 4.445   -7.059  -0.259  1.00 15.00 ?  929 PRO B CD   7  
ATOM   5104  H HA   . PRO B 2 5  ? 7.422   -8.061  0.577   1.00 15.00 ?  929 PRO B HA   7  
ATOM   5105  H HB2  . PRO B 2 5  ? 7.451   -5.919  -1.051  1.00 15.00 ?  929 PRO B HB2  7  
ATOM   5106  H HB3  . PRO B 2 5  ? 6.916   -7.510  -1.612  1.00 15.00 ?  929 PRO B HB3  7  
ATOM   5107  H HG2  . PRO B 2 5  ? 5.279   -5.154  -0.741  1.00 15.00 ?  929 PRO B HG2  7  
ATOM   5108  H HG3  . PRO B 2 5  ? 5.041   -6.227  -2.133  1.00 15.00 ?  929 PRO B HG3  7  
ATOM   5109  H HD2  . PRO B 2 5  ? 3.658   -6.478  0.201   1.00 15.00 ?  929 PRO B HD2  7  
ATOM   5110  H HD3  . PRO B 2 5  ? 4.027   -7.840  -0.871  1.00 15.00 ?  929 PRO B HD3  7  
ATOM   5111  N N    . PRO B 2 6  ? 8.406   -6.303  2.082   1.00 15.00 ?  930 PRO B N    7  
ATOM   5112  C CA   . PRO B 2 6  ? 9.030   -5.267  2.904   1.00 15.00 ?  930 PRO B CA   7  
ATOM   5113  C C    . PRO B 2 6  ? 9.149   -3.963  2.121   1.00 15.00 ?  930 PRO B C    7  
ATOM   5114  O O    . PRO B 2 6  ? 9.731   -3.939  1.035   1.00 15.00 ?  930 PRO B O    7  
ATOM   5115  C CB   . PRO B 2 6  ? 10.417  -5.838  3.237   1.00 15.00 ?  930 PRO B CB   7  
ATOM   5116  C CG   . PRO B 2 6  ? 10.594  -7.020  2.341   1.00 15.00 ?  930 PRO B CG   7  
ATOM   5117  C CD   . PRO B 2 6  ? 9.215   -7.526  2.037   1.00 15.00 ?  930 PRO B CD   7  
ATOM   5118  H HA   . PRO B 2 6  ? 8.473   -5.094  3.814   1.00 15.00 ?  930 PRO B HA   7  
ATOM   5119  H HB2  . PRO B 2 6  ? 11.171  -5.085  3.051   1.00 15.00 ?  930 PRO B HB2  7  
ATOM   5120  H HB3  . PRO B 2 6  ? 10.445  -6.126  4.278   1.00 15.00 ?  930 PRO B HB3  7  
ATOM   5121  H HG2  . PRO B 2 6  ? 11.091  -6.719  1.430   1.00 15.00 ?  930 PRO B HG2  7  
ATOM   5122  H HG3  . PRO B 2 6  ? 11.169  -7.781  2.848   1.00 15.00 ?  930 PRO B HG3  7  
ATOM   5123  H HD2  . PRO B 2 6  ? 9.183   -7.978  1.057   1.00 15.00 ?  930 PRO B HD2  7  
ATOM   5124  H HD3  . PRO B 2 6  ? 8.892   -8.229  2.792   1.00 15.00 ?  930 PRO B HD3  7  
ATOM   5125  N N    . TYR B 2 7  ? 8.585   -2.890  2.661   1.00 15.00 ?  931 TYR B N    7  
ATOM   5126  C CA   . TYR B 2 7  ? 8.422   -1.663  1.893   1.00 15.00 ?  931 TYR B CA   7  
ATOM   5127  C C    . TYR B 2 7  ? 9.767   -1.047  1.512   1.00 15.00 ?  931 TYR B C    7  
ATOM   5128  O O    . TYR B 2 7  ? 10.583  -0.690  2.362   1.00 15.00 ?  931 TYR B O    7  
ATOM   5129  C CB   . TYR B 2 7  ? 7.572   -0.682  2.723   1.00 15.00 ?  931 TYR B CB   7  
ATOM   5130  C CG   . TYR B 2 7  ? 7.460   0.740   2.187   1.00 15.00 ?  931 TYR B CG   7  
ATOM   5131  C CD1  . TYR B 2 7  ? 7.087   1.008   0.873   1.00 15.00 ?  931 TYR B CD1  7  
ATOM   5132  C CD2  . TYR B 2 7  ? 7.707   1.825   3.025   1.00 15.00 ?  931 TYR B CD2  7  
ATOM   5133  C CE1  . TYR B 2 7  ? 6.970   2.308   0.414   1.00 15.00 ?  931 TYR B CE1  7  
ATOM   5134  C CE2  . TYR B 2 7  ? 7.591   3.122   2.574   1.00 15.00 ?  931 TYR B CE2  7  
ATOM   5135  C CZ   . TYR B 2 7  ? 7.223   3.360   1.267   1.00 15.00 ?  931 TYR B CZ   7  
ATOM   5136  O OH   . TYR B 2 7  ? 7.101   4.655   0.814   1.00 15.00 ?  931 TYR B OH   7  
ATOM   5137  H H    . TYR B 2 7  ? 8.272   -2.925  3.589   1.00 15.00 ?  931 TYR B H    7  
ATOM   5138  H HA   . TYR B 2 7  ? 7.885   -1.906  0.991   1.00 15.00 ?  931 TYR B HA   7  
ATOM   5139  H HB2  . TYR B 2 7  ? 6.571   -1.075  2.796   1.00 15.00 ?  931 TYR B HB2  7  
ATOM   5140  H HB3  . TYR B 2 7  ? 7.992   -0.624  3.718   1.00 15.00 ?  931 TYR B HB3  7  
ATOM   5141  H HD1  . TYR B 2 7  ? 6.889   0.188   0.204   1.00 15.00 ?  931 TYR B HD1  7  
ATOM   5142  H HD2  . TYR B 2 7  ? 7.991   1.644   4.050   1.00 15.00 ?  931 TYR B HD2  7  
ATOM   5143  H HE1  . TYR B 2 7  ? 6.680   2.494   -0.609  1.00 15.00 ?  931 TYR B HE1  7  
ATOM   5144  H HE2  . TYR B 2 7  ? 7.785   3.944   3.249   1.00 15.00 ?  931 TYR B HE2  7  
ATOM   5145  H HH   . TYR B 2 7  ? 6.430   4.691   0.131   1.00 15.00 ?  931 TYR B HH   7  
ATOM   5146  N N    . GLU B 2 8  ? 9.966   -0.953  0.207   1.00 15.00 ?  932 GLU B N    7  
ATOM   5147  C CA   . GLU B 2 8  ? 11.002  -0.139  -0.396  1.00 15.00 ?  932 GLU B CA   7  
ATOM   5148  C C    . GLU B 2 8  ? 10.294  1.018   -1.068  1.00 15.00 ?  932 GLU B C    7  
ATOM   5149  O O    . GLU B 2 8  ? 9.211   0.818   -1.621  1.00 15.00 ?  932 GLU B O    7  
ATOM   5150  C CB   . GLU B 2 8  ? 11.804  -0.966  -1.411  1.00 15.00 ?  932 GLU B CB   7  
ATOM   5151  C CG   . GLU B 2 8  ? 12.884  -0.180  -2.137  1.00 15.00 ?  932 GLU B CG   7  
ATOM   5152  C CD   . GLU B 2 8  ? 13.873  0.474   -1.195  1.00 15.00 ?  932 GLU B CD   7  
ATOM   5153  O OE1  . GLU B 2 8  ? 14.777  -0.227  -0.698  1.00 15.00 ?  932 GLU B OE1  7  
ATOM   5154  O OE2  . GLU B 2 8  ? 13.757  1.696   -0.960  1.00 15.00 -1 932 GLU B OE2  7  
ATOM   5155  H H    . GLU B 2 8  ? 9.373   -1.456  -0.387  1.00 15.00 ?  932 GLU B H    7  
ATOM   5156  H HA   . GLU B 2 8  ? 11.654  0.233   0.382   1.00 15.00 ?  932 GLU B HA   7  
ATOM   5157  H HB2  . GLU B 2 8  ? 12.276  -1.786  -0.893  1.00 15.00 ?  932 GLU B HB2  7  
ATOM   5158  H HB3  . GLU B 2 8  ? 11.124  -1.364  -2.149  1.00 15.00 ?  932 GLU B HB3  7  
ATOM   5159  H HG2  . GLU B 2 8  ? 13.423  -0.851  -2.788  1.00 15.00 ?  932 GLU B HG2  7  
ATOM   5160  H HG3  . GLU B 2 8  ? 12.411  0.590   -2.730  1.00 15.00 ?  932 GLU B HG3  7  
ATOM   5161  N N    . THR B 2 9  ? 10.857  2.209   -1.048  1.00 15.00 ?  933 THR B N    7  
ATOM   5162  C CA   . THR B 2 9  ? 10.105  3.334   -1.552  1.00 15.00 ?  933 THR B CA   7  
ATOM   5163  C C    . THR B 2 9  ? 9.973   3.285   -3.070  1.00 15.00 ?  933 THR B C    7  
ATOM   5164  O O    . THR B 2 9  ? 10.949  3.289   -3.823  1.00 15.00 ?  933 THR B O    7  
ATOM   5165  C CB   . THR B 2 9  ? 10.680  4.690   -1.122  1.00 15.00 ?  933 THR B CB   7  
ATOM   5166  O OG1  . THR B 2 9  ? 11.029  4.651   0.271   1.00 15.00 ?  933 THR B OG1  7  
ATOM   5167  C CG2  . THR B 2 9  ? 9.641   5.784   -1.358  1.00 15.00 ?  933 THR B CG2  7  
ATOM   5168  H H    . THR B 2 9  ? 11.772  2.324   -0.714  1.00 15.00 ?  933 THR B H    7  
ATOM   5169  H HA   . THR B 2 9  ? 9.112   3.255   -1.134  1.00 15.00 ?  933 THR B HA   7  
ATOM   5170  H HB   . THR B 2 9  ? 11.558  4.907   -1.711  1.00 15.00 ?  933 THR B HB   7  
ATOM   5171  H HG1  . THR B 2 9  ? 11.529  3.841   0.458   1.00 15.00 ?  933 THR B HG1  7  
ATOM   5172  H HG21 . THR B 2 9  ? 9.449   5.878   -2.417  1.00 15.00 ?  933 THR B HG21 7  
ATOM   5173  H HG22 . THR B 2 9  ? 10.008  6.724   -0.972  1.00 15.00 ?  933 THR B HG22 7  
ATOM   5174  H HG23 . THR B 2 9  ? 8.716   5.521   -0.852  1.00 15.00 ?  933 THR B HG23 7  
ATOM   5175  N N    . PHE B 2 10 ? 8.728   3.226   -3.473  1.00 15.00 ?  934 PHE B N    7  
ATOM   5176  C CA   . PHE B 2 10 ? 8.308   3.293   -4.854  1.00 15.00 ?  934 PHE B CA   7  
ATOM   5177  C C    . PHE B 2 10 ? 7.924   4.751   -5.138  1.00 15.00 ?  934 PHE B C    7  
ATOM   5178  O O    . PHE B 2 10 ? 8.071   5.594   -4.252  1.00 15.00 ?  934 PHE B O    7  
ATOM   5179  C CB   . PHE B 2 10 ? 7.139   2.325   -5.105  1.00 15.00 ?  934 PHE B CB   7  
ATOM   5180  C CG   . PHE B 2 10 ? 5.880   2.790   -4.462  1.00 15.00 ?  934 PHE B CG   7  
ATOM   5181  C CD1  . PHE B 2 10 ? 5.028   3.604   -5.170  1.00 15.00 ?  934 PHE B CD1  7  
ATOM   5182  C CD2  . PHE B 2 10 ? 5.579   2.475   -3.146  1.00 15.00 ?  934 PHE B CD2  7  
ATOM   5183  C CE1  . PHE B 2 10 ? 3.906   4.117   -4.591  1.00 15.00 ?  934 PHE B CE1  7  
ATOM   5184  C CE2  . PHE B 2 10 ? 4.439   2.978   -2.564  1.00 15.00 ?  934 PHE B CE2  7  
ATOM   5185  C CZ   . PHE B 2 10 ? 3.611   3.807   -3.293  1.00 15.00 ?  934 PHE B CZ   7  
ATOM   5186  H H    . PHE B 2 10 ? 8.034   3.138   -2.791  1.00 15.00 ?  934 PHE B H    7  
ATOM   5187  H HA   . PHE B 2 10 ? 9.149   3.020   -5.477  1.00 15.00 ?  934 PHE B HA   7  
ATOM   5188  H HB2  . PHE B 2 10 ? 6.964   2.243   -6.167  1.00 15.00 ?  934 PHE B HB2  7  
ATOM   5189  H HB3  . PHE B 2 10 ? 7.385   1.352   -4.703  1.00 15.00 ?  934 PHE B HB3  7  
ATOM   5190  H HD1  . PHE B 2 10 ? 5.260   3.841   -6.193  1.00 15.00 ?  934 PHE B HD1  7  
ATOM   5191  H HD2  . PHE B 2 10 ? 6.228   1.812   -2.585  1.00 15.00 ?  934 PHE B HD2  7  
ATOM   5192  H HE1  . PHE B 2 10 ? 3.248   4.755   -5.160  1.00 15.00 ?  934 PHE B HE1  7  
ATOM   5193  H HE2  . PHE B 2 10 ? 4.202   2.738   -1.539  1.00 15.00 ?  934 PHE B HE2  7  
ATOM   5194  H HZ   . PHE B 2 10 ? 2.743   4.221   -2.847  1.00 15.00 ?  934 PHE B HZ   7  
ATOM   5195  N N    . GLU B 2 11 ? 7.476   5.053   -6.353  1.00 15.00 ?  935 GLU B N    7  
ATOM   5196  C CA   . GLU B 2 11 ? 7.218   6.436   -6.778  1.00 15.00 ?  935 GLU B CA   7  
ATOM   5197  C C    . GLU B 2 11 ? 6.392   7.226   -5.755  1.00 15.00 ?  935 GLU B C    7  
ATOM   5198  O O    . GLU B 2 11 ? 5.485   6.697   -5.111  1.00 15.00 ?  935 GLU B O    7  
ATOM   5199  C CB   . GLU B 2 11 ? 6.446   6.430   -8.099  1.00 15.00 ?  935 GLU B CB   7  
ATOM   5200  C CG   . GLU B 2 11 ? 5.136   5.645   -8.045  1.00 15.00 ?  935 GLU B CG   7  
ATOM   5201  C CD   . GLU B 2 11 ? 5.279   4.242   -8.605  1.00 15.00 ?  935 GLU B CD   7  
ATOM   5202  O OE1  . GLU B 2 11 ? 6.196   3.511   -8.178  1.00 15.00 ?  935 GLU B OE1  7  
ATOM   5203  O OE2  . GLU B 2 11 ? 4.473   3.871   -9.486  1.00 15.00 -1 935 GLU B OE2  7  
ATOM   5204  H H    . GLU B 2 11 ? 7.288   4.323   -6.985  1.00 15.00 ?  935 GLU B H    7  
ATOM   5205  H HA   . GLU B 2 11 ? 8.166   6.928   -6.928  1.00 15.00 ?  935 GLU B HA   7  
ATOM   5206  H HB2  . GLU B 2 11 ? 6.216   7.449   -8.372  1.00 15.00 ?  935 GLU B HB2  7  
ATOM   5207  H HB3  . GLU B 2 11 ? 7.070   5.993   -8.863  1.00 15.00 ?  935 GLU B HB3  7  
ATOM   5208  H HG2  . GLU B 2 11 ? 4.799   5.576   -7.007  1.00 15.00 ?  935 GLU B HG2  7  
ATOM   5209  H HG3  . GLU B 2 11 ? 4.395   6.174   -8.627  1.00 15.00 ?  935 GLU B HG3  7  
ATOM   5210  N N    . ASP B 2 12 ? 6.715   8.513   -5.653  1.00 15.00 ?  936 ASP B N    7  
ATOM   5211  C CA   . ASP B 2 12 ? 6.098   9.419   -4.685  1.00 15.00 ?  936 ASP B CA   7  
ATOM   5212  C C    . ASP B 2 12 ? 4.574   9.426   -4.805  1.00 15.00 ?  936 ASP B C    7  
ATOM   5213  O O    . ASP B 2 12 ? 4.036   9.410   -5.914  1.00 15.00 ?  936 ASP B O    7  
ATOM   5214  C CB   . ASP B 2 12 ? 6.641   10.833  -4.899  1.00 15.00 ?  936 ASP B CB   7  
ATOM   5215  C CG   . ASP B 2 12 ? 6.143   11.815  -3.860  1.00 15.00 ?  936 ASP B CG   7  
ATOM   5216  O OD1  . ASP B 2 12 ? 6.607   11.746  -2.702  1.00 15.00 ?  936 ASP B OD1  7  
ATOM   5217  O OD2  . ASP B 2 12 ? 5.309   12.680  -4.200  1.00 15.00 -1 936 ASP B OD2  7  
ATOM   5218  H H    . ASP B 2 12 ? 7.394   8.871   -6.261  1.00 15.00 ?  936 ASP B H    7  
ATOM   5219  H HA   . ASP B 2 12 ? 6.371   9.086   -3.696  1.00 15.00 ?  936 ASP B HA   7  
ATOM   5220  H HB2  . ASP B 2 12 ? 7.721   10.808  -4.852  1.00 15.00 ?  936 ASP B HB2  7  
ATOM   5221  H HB3  . ASP B 2 12 ? 6.337   11.186  -5.875  1.00 15.00 ?  936 ASP B HB3  7  
ATOM   5222  N N    . LEU B 2 13 ? 3.895   9.467   -3.657  1.00 15.00 ?  937 LEU B N    7  
ATOM   5223  C CA   . LEU B 2 13 ? 2.431   9.463   -3.611  1.00 15.00 ?  937 LEU B CA   7  
ATOM   5224  C C    . LEU B 2 13 ? 1.821   10.587  -4.457  1.00 15.00 ?  937 LEU B C    7  
ATOM   5225  O O    . LEU B 2 13 ? 1.819   11.758  -4.076  1.00 15.00 ?  937 LEU B O    7  
ATOM   5226  C CB   . LEU B 2 13 ? 1.917   9.524   -2.157  1.00 15.00 ?  937 LEU B CB   7  
ATOM   5227  C CG   . LEU B 2 13 ? 2.828   10.182  -1.100  1.00 15.00 ?  937 LEU B CG   7  
ATOM   5228  C CD1  . LEU B 2 13 ? 3.149   11.630  -1.446  1.00 15.00 ?  937 LEU B CD1  7  
ATOM   5229  C CD2  . LEU B 2 13 ? 2.161   10.120  0.263   1.00 15.00 ?  937 LEU B CD2  7  
ATOM   5230  H H    . LEU B 2 13 ? 4.396   9.501   -2.813  1.00 15.00 ?  937 LEU B H    7  
ATOM   5231  H HA   . LEU B 2 13 ? 2.112   8.524   -4.039  1.00 15.00 ?  937 LEU B HA   7  
ATOM   5232  H HB2  . LEU B 2 13 ? 0.982   10.058  -2.161  1.00 15.00 ?  937 LEU B HB2  7  
ATOM   5233  H HB3  . LEU B 2 13 ? 1.720   8.511   -1.839  1.00 15.00 ?  937 LEU B HB3  7  
ATOM   5234  H HG   . LEU B 2 13 ? 3.756   9.634   -1.039  1.00 15.00 ?  937 LEU B HG   7  
ATOM   5235  H HD11 . LEU B 2 13 ? 2.234   12.199  -1.488  1.00 15.00 ?  937 LEU B HD11 7  
ATOM   5236  H HD12 . LEU B 2 13 ? 3.644   11.672  -2.405  1.00 15.00 ?  937 LEU B HD12 7  
ATOM   5237  H HD13 . LEU B 2 13 ? 3.796   12.047  -0.688  1.00 15.00 ?  937 LEU B HD13 7  
ATOM   5238  H HD21 . LEU B 2 13 ? 2.805   10.575  1.001   1.00 15.00 ?  937 LEU B HD21 7  
ATOM   5239  H HD22 . LEU B 2 13 ? 1.980   9.089   0.529   1.00 15.00 ?  937 LEU B HD22 7  
ATOM   5240  H HD23 . LEU B 2 13 ? 1.222   10.654  0.227   1.00 15.00 ?  937 LEU B HD23 7  
HETATM 5241  N N    . NH2 B 2 14 ? 1.312   10.226  -5.625  1.00 15.00 ?  938 NH2 B N    7  
HETATM 5242  H HN1  . NH2 B 2 14 ? 1.344   9.276   -5.870  1.00 15.00 ?  938 NH2 B HN1  7  
HETATM 5243  H HN2  . NH2 B 2 14 ? 0.928   10.924  -6.199  1.00 15.00 ?  938 NH2 B HN2  7  
ATOM   5244  N N    . PHE A 1 7  ? -9.095  11.136  -1.304  1.00 15.00 ?  478 PHE A N    8  
ATOM   5245  C CA   . PHE A 1 7  ? -10.118 10.062  -1.328  1.00 15.00 ?  478 PHE A CA   8  
ATOM   5246  C C    . PHE A 1 7  ? -10.193 9.376   0.030   1.00 15.00 ?  478 PHE A C    8  
ATOM   5247  O O    . PHE A 1 7  ? -11.167 9.531   0.766   1.00 15.00 ?  478 PHE A O    8  
ATOM   5248  C CB   . PHE A 1 7  ? -9.783  9.026   -2.412  1.00 15.00 ?  478 PHE A CB   8  
ATOM   5249  C CG   . PHE A 1 7  ? -10.862 7.997   -2.618  1.00 15.00 ?  478 PHE A CG   8  
ATOM   5250  C CD1  . PHE A 1 7  ? -12.010 8.310   -3.328  1.00 15.00 ?  478 PHE A CD1  8  
ATOM   5251  C CD2  . PHE A 1 7  ? -10.728 6.719   -2.098  1.00 15.00 ?  478 PHE A CD2  8  
ATOM   5252  C CE1  . PHE A 1 7  ? -13.003 7.368   -3.517  1.00 15.00 ?  478 PHE A CE1  8  
ATOM   5253  C CE2  . PHE A 1 7  ? -11.717 5.772   -2.284  1.00 15.00 ?  478 PHE A CE2  8  
ATOM   5254  C CZ   . PHE A 1 7  ? -12.857 6.097   -2.995  1.00 15.00 ?  478 PHE A CZ   8  
ATOM   5255  H H    . PHE A 1 7  ? -9.261  11.770  -0.492  1.00 15.00 ?  478 PHE A H    8  
ATOM   5256  H HA   . PHE A 1 7  ? -11.076 10.510  -1.547  1.00 15.00 ?  478 PHE A HA   8  
ATOM   5257  H HB2  . PHE A 1 7  ? -9.623  9.530   -3.347  1.00 15.00 ?  478 PHE A HB2  8  
ATOM   5258  H HB3  . PHE A 1 7  ? -8.879  8.506   -2.135  1.00 15.00 ?  478 PHE A HB3  8  
ATOM   5259  H HD1  . PHE A 1 7  ? -12.125 9.303   -3.737  1.00 15.00 ?  478 PHE A HD1  8  
ATOM   5260  H HD2  . PHE A 1 7  ? -9.837  6.464   -1.542  1.00 15.00 ?  478 PHE A HD2  8  
ATOM   5261  H HE1  . PHE A 1 7  ? -13.893 7.624   -4.073  1.00 15.00 ?  478 PHE A HE1  8  
ATOM   5262  H HE2  . PHE A 1 7  ? -11.601 4.780   -1.874  1.00 15.00 ?  478 PHE A HE2  8  
ATOM   5263  H HZ   . PHE A 1 7  ? -13.632 5.359   -3.141  1.00 15.00 ?  478 PHE A HZ   8  
ATOM   5264  N N    . LEU A 1 8  ? -9.150  8.638   0.361   1.00 15.00 ?  479 LEU A N    8  
ATOM   5265  C CA   . LEU A 1 8  ? -9.091  7.891   1.603   1.00 15.00 ?  479 LEU A CA   8  
ATOM   5266  C C    . LEU A 1 8  ? -8.064  8.540   2.527   1.00 15.00 ?  479 LEU A C    8  
ATOM   5267  O O    . LEU A 1 8  ? -7.237  9.318   2.045   1.00 15.00 ?  479 LEU A O    8  
ATOM   5268  C CB   . LEU A 1 8  ? -8.764  6.410   1.325   1.00 15.00 ?  479 LEU A CB   8  
ATOM   5269  C CG   . LEU A 1 8  ? -7.349  6.080   0.820   1.00 15.00 ?  479 LEU A CG   8  
ATOM   5270  C CD1  . LEU A 1 8  ? -7.197  4.580   0.678   1.00 15.00 ?  479 LEU A CD1  8  
ATOM   5271  C CD2  . LEU A 1 8  ? -7.048  6.740   -0.516  1.00 15.00 ?  479 LEU A CD2  8  
ATOM   5272  H H    . LEU A 1 8  ? -8.380  8.601   -0.242  1.00 15.00 ?  479 LEU A H    8  
ATOM   5273  H HA   . LEU A 1 8  ? -10.064 7.956   2.068   1.00 15.00 ?  479 LEU A HA   8  
ATOM   5274  H HB2  . LEU A 1 8  ? -8.923  5.860   2.241   1.00 15.00 ?  479 LEU A HB2  8  
ATOM   5275  H HB3  . LEU A 1 8  ? -9.470  6.048   0.592   1.00 15.00 ?  479 LEU A HB3  8  
ATOM   5276  H HG   . LEU A 1 8  ? -6.622  6.427   1.543   1.00 15.00 ?  479 LEU A HG   8  
ATOM   5277  H HD11 . LEU A 1 8  ? -6.196  4.350   0.346   1.00 15.00 ?  479 LEU A HD11 8  
ATOM   5278  H HD12 . LEU A 1 8  ? -7.910  4.219   -0.049  1.00 15.00 ?  479 LEU A HD12 8  
ATOM   5279  H HD13 . LEU A 1 8  ? -7.380  4.107   1.631   1.00 15.00 ?  479 LEU A HD13 8  
ATOM   5280  H HD21 . LEU A 1 8  ? -7.752  6.391   -1.257  1.00 15.00 ?  479 LEU A HD21 8  
ATOM   5281  H HD22 . LEU A 1 8  ? -6.045  6.478   -0.824  1.00 15.00 ?  479 LEU A HD22 8  
ATOM   5282  H HD23 . LEU A 1 8  ? -7.128  7.811   -0.417  1.00 15.00 ?  479 LEU A HD23 8  
ATOM   5283  N N    . PRO A 1 9  ? -8.126  8.252   3.852   1.00 15.00 ?  480 PRO A N    8  
ATOM   5284  C CA   . PRO A 1 9  ? -7.275  8.864   4.882   1.00 15.00 ?  480 PRO A CA   8  
ATOM   5285  C C    . PRO A 1 9  ? -5.903  9.308   4.383   1.00 15.00 ?  480 PRO A C    8  
ATOM   5286  O O    . PRO A 1 9  ? -5.193  8.546   3.723   1.00 15.00 ?  480 PRO A O    8  
ATOM   5287  C CB   . PRO A 1 9  ? -7.150  7.723   5.879   1.00 15.00 ?  480 PRO A CB   8  
ATOM   5288  C CG   . PRO A 1 9  ? -8.502  7.103   5.876   1.00 15.00 ?  480 PRO A CG   8  
ATOM   5289  C CD   . PRO A 1 9  ? -9.032  7.262   4.469   1.00 15.00 ?  480 PRO A CD   8  
ATOM   5290  H HA   . PRO A 1 9  ? -7.770  9.699   5.357   1.00 15.00 ?  480 PRO A HA   8  
ATOM   5291  H HB2  . PRO A 1 9  ? -6.399  7.027   5.542   1.00 15.00 ?  480 PRO A HB2  8  
ATOM   5292  H HB3  . PRO A 1 9  ? -6.886  8.106   6.849   1.00 15.00 ?  480 PRO A HB3  8  
ATOM   5293  H HG2  . PRO A 1 9  ? -8.427  6.055   6.132   1.00 15.00 ?  480 PRO A HG2  8  
ATOM   5294  H HG3  . PRO A 1 9  ? -9.144  7.615   6.577   1.00 15.00 ?  480 PRO A HG3  8  
ATOM   5295  H HD2  . PRO A 1 9  ? -8.990  6.322   3.940   1.00 15.00 ?  480 PRO A HD2  8  
ATOM   5296  H HD3  . PRO A 1 9  ? -10.037 7.634   4.493   1.00 15.00 ?  480 PRO A HD3  8  
ATOM   5297  N N    . PRO A 1 10 ? -5.525  10.558  4.702   1.00 15.00 ?  481 PRO A N    8  
ATOM   5298  C CA   . PRO A 1 10 ? -4.277  11.163  4.233   1.00 15.00 ?  481 PRO A CA   8  
ATOM   5299  C C    . PRO A 1 10 ? -3.070  10.253  4.418   1.00 15.00 ?  481 PRO A C    8  
ATOM   5300  O O    . PRO A 1 10 ? -2.705  9.894   5.541   1.00 15.00 ?  481 PRO A O    8  
ATOM   5301  C CB   . PRO A 1 10 ? -4.140  12.415  5.098   1.00 15.00 ?  481 PRO A CB   8  
ATOM   5302  C CG   . PRO A 1 10 ? -5.539  12.779  5.452   1.00 15.00 ?  481 PRO A CG   8  
ATOM   5303  C CD   . PRO A 1 10 ? -6.293  11.481  5.558   1.00 15.00 ?  481 PRO A CD   8  
ATOM   5304  H HA   . PRO A 1 10 ? -4.346  11.452  3.194   1.00 15.00 ?  481 PRO A HA   8  
ATOM   5305  H HB2  . PRO A 1 10 ? -3.556  12.184  5.977   1.00 15.00 ?  481 PRO A HB2  8  
ATOM   5306  H HB3  . PRO A 1 10 ? -3.658  13.199  4.532   1.00 15.00 ?  481 PRO A HB3  8  
ATOM   5307  H HG2  . PRO A 1 10 ? -5.554  13.299  6.398   1.00 15.00 ?  481 PRO A HG2  8  
ATOM   5308  H HG3  . PRO A 1 10 ? -5.967  13.398  4.676   1.00 15.00 ?  481 PRO A HG3  8  
ATOM   5309  H HD2  . PRO A 1 10 ? -6.304  11.136  6.581   1.00 15.00 ?  481 PRO A HD2  8  
ATOM   5310  H HD3  . PRO A 1 10 ? -7.301  11.600  5.190   1.00 15.00 ?  481 PRO A HD3  8  
ATOM   5311  N N    . GLY A 1 11 ? -2.480  9.854   3.306   1.00 15.00 ?  482 GLY A N    8  
ATOM   5312  C CA   . GLY A 1 11 ? -1.297  9.029   3.344   1.00 15.00 ?  482 GLY A CA   8  
ATOM   5313  C C    . GLY A 1 11 ? -1.551  7.609   2.915   1.00 15.00 ?  482 GLY A C    8  
ATOM   5314  O O    . GLY A 1 11 ? -0.611  6.838   2.770   1.00 15.00 ?  482 GLY A O    8  
ATOM   5315  H H    . GLY A 1 11 ? -2.854  10.127  2.439   1.00 15.00 ?  482 GLY A H    8  
ATOM   5316  H HA2  . GLY A 1 11 ? -0.571  9.452   2.686   1.00 15.00 ?  482 GLY A HA2  8  
ATOM   5317  H HA3  . GLY A 1 11 ? -0.895  9.021   4.341   1.00 15.00 ?  482 GLY A HA3  8  
ATOM   5318  N N    . TRP A 1 12 ? -2.804  7.259   2.700   1.00 15.00 ?  483 TRP A N    8  
ATOM   5319  C CA   . TRP A 1 12 ? -3.131  5.918   2.256   1.00 15.00 ?  483 TRP A CA   8  
ATOM   5320  C C    . TRP A 1 12 ? -3.130  5.861   0.751   1.00 15.00 ?  483 TRP A C    8  
ATOM   5321  O O    . TRP A 1 12 ? -4.019  6.391   0.089   1.00 15.00 ?  483 TRP A O    8  
ATOM   5322  C CB   . TRP A 1 12 ? -4.476  5.464   2.809   1.00 15.00 ?  483 TRP A CB   8  
ATOM   5323  C CG   . TRP A 1 12 ? -4.414  5.148   4.261   1.00 15.00 ?  483 TRP A CG   8  
ATOM   5324  C CD1  . TRP A 1 12 ? -4.485  6.034   5.294   1.00 15.00 ?  483 TRP A CD1  8  
ATOM   5325  C CD2  . TRP A 1 12 ? -4.237  3.854   4.841   1.00 15.00 ?  483 TRP A CD2  8  
ATOM   5326  N NE1  . TRP A 1 12 ? -4.383  5.365   6.491   1.00 15.00 ?  483 TRP A NE1  8  
ATOM   5327  C CE2  . TRP A 1 12 ? -4.226  4.026   6.238   1.00 15.00 ?  483 TRP A CE2  8  
ATOM   5328  C CE3  . TRP A 1 12 ? -4.092  2.560   4.314   1.00 15.00 ?  483 TRP A CE3  8  
ATOM   5329  C CZ2  . TRP A 1 12 ? -4.072  2.957   7.114   1.00 15.00 ?  483 TRP A CZ2  8  
ATOM   5330  C CZ3  . TRP A 1 12 ? -3.938  1.506   5.189   1.00 15.00 ?  483 TRP A CZ3  8  
ATOM   5331  C CH2  . TRP A 1 12 ? -3.928  1.711   6.575   1.00 15.00 ?  483 TRP A CH2  8  
ATOM   5332  H H    . TRP A 1 12 ? -3.523  7.913   2.843   1.00 15.00 ?  483 TRP A H    8  
ATOM   5333  H HA   . TRP A 1 12 ? -2.361  5.256   2.626   1.00 15.00 ?  483 TRP A HA   8  
ATOM   5334  H HB2  . TRP A 1 12 ? -5.205  6.247   2.665   1.00 15.00 ?  483 TRP A HB2  8  
ATOM   5335  H HB3  . TRP A 1 12 ? -4.795  4.575   2.284   1.00 15.00 ?  483 TRP A HB3  8  
ATOM   5336  H HD1  . TRP A 1 12 ? -4.615  7.110   5.170   1.00 15.00 ?  483 TRP A HD1  8  
ATOM   5337  H HE1  . TRP A 1 12 ? -4.413  5.777   7.380   1.00 15.00 ?  483 TRP A HE1  8  
ATOM   5338  H HE3  . TRP A 1 12 ? -4.095  2.377   3.246   1.00 15.00 ?  483 TRP A HE3  8  
ATOM   5339  H HZ2  . TRP A 1 12 ? -4.063  3.094   8.184   1.00 15.00 ?  483 TRP A HZ2  8  
ATOM   5340  H HZ3  . TRP A 1 12 ? -3.820  0.503   4.804   1.00 15.00 ?  483 TRP A HZ3  8  
ATOM   5341  H HH2  . TRP A 1 12 ? -3.805  0.854   7.222   1.00 15.00 ?  483 TRP A HH2  8  
ATOM   5342  N N    . GLU A 1 13 ? -2.098  5.249   0.221   1.00 15.00 ?  484 GLU A N    8  
ATOM   5343  C CA   . GLU A 1 13 ? -1.902  5.193   -1.203  1.00 15.00 ?  484 GLU A CA   8  
ATOM   5344  C C    . GLU A 1 13 ? -2.336  3.847   -1.760  1.00 15.00 ?  484 GLU A C    8  
ATOM   5345  O O    . GLU A 1 13 ? -1.955  2.794   -1.250  1.00 15.00 ?  484 GLU A O    8  
ATOM   5346  C CB   . GLU A 1 13 ? -0.440  5.455   -1.523  1.00 15.00 ?  484 GLU A CB   8  
ATOM   5347  C CG   . GLU A 1 13 ? -0.221  6.703   -2.353  1.00 15.00 ?  484 GLU A CG   8  
ATOM   5348  C CD   . GLU A 1 13 ? -0.848  7.927   -1.723  1.00 15.00 ?  484 GLU A CD   8  
ATOM   5349  O OE1  . GLU A 1 13 ? -0.253  8.482   -0.777  1.00 15.00 -1 484 GLU A OE1  8  
ATOM   5350  O OE2  . GLU A 1 13 ? -1.941  8.337   -2.173  1.00 15.00 ?  484 GLU A OE2  8  
ATOM   5351  H H    . GLU A 1 13 ? -1.439  4.824   0.812   1.00 15.00 ?  484 GLU A H    8  
ATOM   5352  H HA   . GLU A 1 13 ? -2.503  5.967   -1.655  1.00 15.00 ?  484 GLU A HA   8  
ATOM   5353  H HB2  . GLU A 1 13 ? 0.108   5.561   -0.597  1.00 15.00 ?  484 GLU A HB2  8  
ATOM   5354  H HB3  . GLU A 1 13 ? -0.054  4.619   -2.062  1.00 15.00 ?  484 GLU A HB3  8  
ATOM   5355  H HG2  . GLU A 1 13 ? 0.840   6.872   -2.458  1.00 15.00 ?  484 GLU A HG2  8  
ATOM   5356  H HG3  . GLU A 1 13 ? -0.659  6.554   -3.327  1.00 15.00 ?  484 GLU A HG3  8  
ATOM   5357  N N    . MET A 1 14 ? -3.103  3.905   -2.828  1.00 15.00 ?  485 MET A N    8  
ATOM   5358  C CA   . MET A 1 14 ? -3.626  2.712   -3.484  1.00 15.00 ?  485 MET A CA   8  
ATOM   5359  C C    . MET A 1 14 ? -2.885  2.492   -4.780  1.00 15.00 ?  485 MET A C    8  
ATOM   5360  O O    . MET A 1 14 ? -3.076  3.227   -5.751  1.00 15.00 ?  485 MET A O    8  
ATOM   5361  C CB   . MET A 1 14 ? -5.121  2.842   -3.783  1.00 15.00 ?  485 MET A CB   8  
ATOM   5362  C CG   . MET A 1 14 ? -5.987  2.836   -2.555  1.00 15.00 ?  485 MET A CG   8  
ATOM   5363  S SD   . MET A 1 14 ? -7.747  2.970   -2.936  1.00 15.00 ?  485 MET A SD   8  
ATOM   5364  C CE   . MET A 1 14 ? -7.783  4.515   -3.843  1.00 15.00 ?  485 MET A CE   8  
ATOM   5365  H H    . MET A 1 14 ? -3.288  4.789   -3.217  1.00 15.00 ?  485 MET A H    8  
ATOM   5366  H HA   . MET A 1 14 ? -3.460  1.858   -2.824  1.00 15.00 ?  485 MET A HA   8  
ATOM   5367  H HB2  . MET A 1 14 ? -5.296  3.764   -4.302  1.00 15.00 ?  485 MET A HB2  8  
ATOM   5368  H HB3  . MET A 1 14 ? -5.423  2.019   -4.413  1.00 15.00 ?  485 MET A HB3  8  
ATOM   5369  H HG2  . MET A 1 14 ? -5.812  1.907   -2.040  1.00 15.00 ?  485 MET A HG2  8  
ATOM   5370  H HG3  . MET A 1 14 ? -5.703  3.662   -1.919  1.00 15.00 ?  485 MET A HG3  8  
ATOM   5371  H HE1  . MET A 1 14 ? -7.416  5.311   -3.212  1.00 15.00 ?  485 MET A HE1  8  
ATOM   5372  H HE2  . MET A 1 14 ? -8.797  4.733   -4.147  1.00 15.00 ?  485 MET A HE2  8  
ATOM   5373  H HE3  . MET A 1 14 ? -7.155  4.434   -4.718  1.00 15.00 ?  485 MET A HE3  8  
ATOM   5374  N N    . ARG A 1 15 ? -2.020  1.503   -4.788  1.00 15.00 ?  486 ARG A N    8  
ATOM   5375  C CA   . ARG A 1 15 ? -1.138  1.277   -5.922  1.00 15.00 ?  486 ARG A CA   8  
ATOM   5376  C C    . ARG A 1 15 ? -0.853  -0.200  -6.099  1.00 15.00 ?  486 ARG A C    8  
ATOM   5377  O O    . ARG A 1 15 ? -0.850  -0.961  -5.138  1.00 15.00 ?  486 ARG A O    8  
ATOM   5378  C CB   . ARG A 1 15 ? 0.172   2.049   -5.743  1.00 15.00 ?  486 ARG A CB   8  
ATOM   5379  C CG   . ARG A 1 15 ? -0.014  3.555   -5.774  1.00 15.00 ?  486 ARG A CG   8  
ATOM   5380  C CD   . ARG A 1 15 ? 0.838   4.203   -6.847  1.00 15.00 ?  486 ARG A CD   8  
ATOM   5381  N NE   . ARG A 1 15 ? 0.567   3.675   -8.181  1.00 15.00 ?  486 ARG A NE   8  
ATOM   5382  C CZ   . ARG A 1 15 ? 1.526   3.312   -9.030  1.00 15.00 ?  486 ARG A CZ   8  
ATOM   5383  N NH1  . ARG A 1 15 ? 2.788   3.305   -8.633  1.00 15.00 1  486 ARG A NH1  8  
ATOM   5384  N NH2  . ARG A 1 15 ? 1.230   2.941   -10.263 1.00 15.00 ?  486 ARG A NH2  8  
ATOM   5385  H H    . ARG A 1 15 ? -1.982  0.895   -4.012  1.00 15.00 ?  486 ARG A H    8  
ATOM   5386  H HA   . ARG A 1 15 ? -1.639  1.641   -6.806  1.00 15.00 ?  486 ARG A HA   8  
ATOM   5387  H HB2  . ARG A 1 15 ? 0.609   1.778   -4.794  1.00 15.00 ?  486 ARG A HB2  8  
ATOM   5388  H HB3  . ARG A 1 15 ? 0.849   1.774   -6.537  1.00 15.00 ?  486 ARG A HB3  8  
ATOM   5389  H HG2  . ARG A 1 15 ? -1.053  3.776   -5.971  1.00 15.00 ?  486 ARG A HG2  8  
ATOM   5390  H HG3  . ARG A 1 15 ? 0.265   3.960   -4.811  1.00 15.00 ?  486 ARG A HG3  8  
ATOM   5391  H HD2  . ARG A 1 15 ? 0.634   5.260   -6.851  1.00 15.00 ?  486 ARG A HD2  8  
ATOM   5392  H HD3  . ARG A 1 15 ? 1.879   4.041   -6.610  1.00 15.00 ?  486 ARG A HD3  8  
ATOM   5393  H HE   . ARG A 1 15 ? -0.380  3.628   -8.468  1.00 15.00 ?  486 ARG A HE   8  
ATOM   5394  H HH11 . ARG A 1 15 ? 3.025   3.573   -7.698  1.00 15.00 ?  486 ARG A HH11 8  
ATOM   5395  H HH12 . ARG A 1 15 ? 3.518   3.033   -9.269  1.00 15.00 ?  486 ARG A HH12 8  
ATOM   5396  H HH21 . ARG A 1 15 ? 0.273   2.923   -10.577 1.00 15.00 ?  486 ARG A HH21 8  
ATOM   5397  H HH22 . ARG A 1 15 ? 1.969   2.686   -10.900 1.00 15.00 ?  486 ARG A HH22 8  
ATOM   5398  N N    . ILE A 1 16 ? -0.619  -0.601  -7.330  1.00 15.00 ?  487 ILE A N    8  
ATOM   5399  C CA   . ILE A 1 16 ? -0.320  -1.992  -7.625  1.00 15.00 ?  487 ILE A CA   8  
ATOM   5400  C C    . ILE A 1 16 ? 1.169   -2.179  -7.877  1.00 15.00 ?  487 ILE A C    8  
ATOM   5401  O O    . ILE A 1 16 ? 1.846   -1.260  -8.339  1.00 15.00 ?  487 ILE A O    8  
ATOM   5402  C CB   . ILE A 1 16 ? -1.108  -2.501  -8.855  1.00 15.00 ?  487 ILE A CB   8  
ATOM   5403  C CG1  . ILE A 1 16 ? -0.781  -1.658  -10.095 1.00 15.00 ?  487 ILE A CG1  8  
ATOM   5404  C CG2  . ILE A 1 16 ? -2.603  -2.482  -8.569  1.00 15.00 ?  487 ILE A CG2  8  
ATOM   5405  C CD1  . ILE A 1 16 ? -1.447  -2.152  -11.362 1.00 15.00 ?  487 ILE A CD1  8  
ATOM   5406  H H    . ILE A 1 16 ? -0.625  0.058   -8.058  1.00 15.00 ?  487 ILE A H    8  
ATOM   5407  H HA   . ILE A 1 16 ? -0.607  -2.584  -6.769  1.00 15.00 ?  487 ILE A HA   8  
ATOM   5408  H HB   . ILE A 1 16 ? -0.817  -3.525  -9.037  1.00 15.00 ?  487 ILE A HB   8  
ATOM   5409  H HG12 . ILE A 1 16 ? -1.108  -0.644  -9.926  1.00 15.00 ?  487 ILE A HG12 8  
ATOM   5410  H HG13 . ILE A 1 16 ? 0.287   -1.664  -10.257 1.00 15.00 ?  487 ILE A HG13 8  
ATOM   5411  H HG21 . ILE A 1 16 ? -3.141  -2.828  -9.440  1.00 15.00 ?  487 ILE A HG21 8  
ATOM   5412  H HG22 . ILE A 1 16 ? -2.911  -1.474  -8.334  1.00 15.00 ?  487 ILE A HG22 8  
ATOM   5413  H HG23 . ILE A 1 16 ? -2.818  -3.128  -7.732  1.00 15.00 ?  487 ILE A HG23 8  
ATOM   5414  H HD11 . ILE A 1 16 ? -2.519  -2.152  -11.230 1.00 15.00 ?  487 ILE A HD11 8  
ATOM   5415  H HD12 . ILE A 1 16 ? -1.112  -3.156  -11.578 1.00 15.00 ?  487 ILE A HD12 8  
ATOM   5416  H HD13 . ILE A 1 16 ? -1.187  -1.502  -12.185 1.00 15.00 ?  487 ILE A HD13 8  
ATOM   5417  N N    . ALA A 1 17 ? 1.683   -3.359  -7.554  1.00 15.00 ?  488 ALA A N    8  
ATOM   5418  C CA   . ALA A 1 17 ? 3.040   -3.703  -7.919  1.00 15.00 ?  488 ALA A CA   8  
ATOM   5419  C C    . ALA A 1 17 ? 3.004   -4.360  -9.292  1.00 15.00 ?  488 ALA A C    8  
ATOM   5420  O O    . ALA A 1 17 ? 2.000   -4.990  -9.633  1.00 15.00 ?  488 ALA A O    8  
ATOM   5421  C CB   . ALA A 1 17 ? 3.670   -4.631  -6.890  1.00 15.00 ?  488 ALA A CB   8  
ATOM   5422  H H    . ALA A 1 17 ? 1.130   -4.019  -7.069  1.00 15.00 ?  488 ALA A H    8  
ATOM   5423  H HA   . ALA A 1 17 ? 3.619   -2.793  -7.963  1.00 15.00 ?  488 ALA A HA   8  
ATOM   5424  H HB1  . ALA A 1 17 ? 4.701   -4.814  -7.152  1.00 15.00 ?  488 ALA A HB1  8  
ATOM   5425  H HB2  . ALA A 1 17 ? 3.134   -5.567  -6.872  1.00 15.00 ?  488 ALA A HB2  8  
ATOM   5426  H HB3  . ALA A 1 17 ? 3.622   -4.176  -5.914  1.00 15.00 ?  488 ALA A HB3  8  
ATOM   5427  N N    . PRO A 1 18 ? 4.073   -4.225  -10.097 1.00 15.00 ?  489 PRO A N    8  
ATOM   5428  C CA   . PRO A 1 18 ? 4.112   -4.759  -11.474 1.00 15.00 ?  489 PRO A CA   8  
ATOM   5429  C C    . PRO A 1 18 ? 3.815   -6.259  -11.555 1.00 15.00 ?  489 PRO A C    8  
ATOM   5430  O O    . PRO A 1 18 ? 3.576   -6.797  -12.635 1.00 15.00 ?  489 PRO A O    8  
ATOM   5431  C CB   . PRO A 1 18 ? 5.544   -4.472  -11.930 1.00 15.00 ?  489 PRO A CB   8  
ATOM   5432  C CG   . PRO A 1 18 ? 5.997   -3.337  -11.078 1.00 15.00 ?  489 PRO A CG   8  
ATOM   5433  C CD   . PRO A 1 18 ? 5.322   -3.525  -9.747  1.00 15.00 ?  489 PRO A CD   8  
ATOM   5434  H HA   . PRO A 1 18 ? 3.422   -4.231  -12.114 1.00 15.00 ?  489 PRO A HA   8  
ATOM   5435  H HB2  . PRO A 1 18 ? 6.155   -5.351  -11.781 1.00 15.00 ?  489 PRO A HB2  8  
ATOM   5436  H HB3  . PRO A 1 18 ? 5.541   -4.202  -12.975 1.00 15.00 ?  489 PRO A HB3  8  
ATOM   5437  H HG2  . PRO A 1 18 ? 7.070   -3.371  -10.961 1.00 15.00 ?  489 PRO A HG2  8  
ATOM   5438  H HG3  . PRO A 1 18 ? 5.695   -2.401  -11.522 1.00 15.00 ?  489 PRO A HG3  8  
ATOM   5439  H HD2  . PRO A 1 18 ? 5.933   -4.133  -9.097  1.00 15.00 ?  489 PRO A HD2  8  
ATOM   5440  H HD3  . PRO A 1 18 ? 5.114   -2.570  -9.291  1.00 15.00 ?  489 PRO A HD3  8  
ATOM   5441  N N    . ASN A 1 19 ? 3.837   -6.926  -10.407 1.00 15.00 ?  490 ASN A N    8  
ATOM   5442  C CA   . ASN A 1 19 ? 3.527   -8.349  -10.324 1.00 15.00 ?  490 ASN A CA   8  
ATOM   5443  C C    . ASN A 1 19 ? 2.015   -8.584  -10.426 1.00 15.00 ?  490 ASN A C    8  
ATOM   5444  O O    . ASN A 1 19 ? 1.555   -9.713  -10.584 1.00 15.00 ?  490 ASN A O    8  
ATOM   5445  C CB   . ASN A 1 19 ? 4.085   -8.923  -9.012  1.00 15.00 ?  490 ASN A CB   8  
ATOM   5446  C CG   . ASN A 1 19 ? 3.805   -10.404 -8.832  1.00 15.00 ?  490 ASN A CG   8  
ATOM   5447  O OD1  . ASN A 1 19 ? 2.822   -10.788 -8.194  1.00 15.00 ?  490 ASN A OD1  8  
ATOM   5448  N ND2  . ASN A 1 19 ? 4.670   -11.242 -9.380  1.00 15.00 ?  490 ASN A ND2  8  
ATOM   5449  H H    . ASN A 1 19 ? 4.072   -6.443  -9.589  1.00 15.00 ?  490 ASN A H    8  
ATOM   5450  H HA   . ASN A 1 19 ? 4.011   -8.841  -11.156 1.00 15.00 ?  490 ASN A HA   8  
ATOM   5451  H HB2  . ASN A 1 19 ? 5.155   -8.778  -8.992  1.00 15.00 ?  490 ASN A HB2  8  
ATOM   5452  H HB3  . ASN A 1 19 ? 3.643   -8.390  -8.183  1.00 15.00 ?  490 ASN A HB3  8  
ATOM   5453  H HD21 . ASN A 1 19 ? 5.444   -10.864 -9.864  1.00 15.00 ?  490 ASN A HD21 8  
ATOM   5454  H HD22 . ASN A 1 19 ? 4.501   -12.205 -9.297  1.00 15.00 ?  490 ASN A HD22 8  
ATOM   5455  N N    . GLY A 1 20 ? 1.245   -7.504  -10.340 1.00 15.00 ?  491 GLY A N    8  
ATOM   5456  C CA   . GLY A 1 20 ? -0.199  -7.617  -10.435 1.00 15.00 ?  491 GLY A CA   8  
ATOM   5457  C C    . GLY A 1 20 ? -0.859  -7.677  -9.073  1.00 15.00 ?  491 GLY A C    8  
ATOM   5458  O O    . GLY A 1 20 ? -1.857  -8.373  -8.886  1.00 15.00 ?  491 GLY A O    8  
ATOM   5459  H H    . GLY A 1 20 ? 1.662   -6.623  -10.218 1.00 15.00 ?  491 GLY A H    8  
ATOM   5460  H HA2  . GLY A 1 20 ? -0.583  -6.762  -10.973 1.00 15.00 ?  491 GLY A HA2  8  
ATOM   5461  H HA3  . GLY A 1 20 ? -0.442  -8.514  -10.983 1.00 15.00 ?  491 GLY A HA3  8  
ATOM   5462  N N    . ARG A 1 21 ? -0.302  -6.940  -8.123  1.00 15.00 ?  492 ARG A N    8  
ATOM   5463  C CA   . ARG A 1 21 ? -0.777  -6.965  -6.745  1.00 15.00 ?  492 ARG A CA   8  
ATOM   5464  C C    . ARG A 1 21 ? -1.110  -5.558  -6.250  1.00 15.00 ?  492 ARG A C    8  
ATOM   5465  O O    . ARG A 1 21 ? -0.252  -4.679  -6.267  1.00 15.00 ?  492 ARG A O    8  
ATOM   5466  C CB   . ARG A 1 21 ? 0.288   -7.581  -5.838  1.00 15.00 ?  492 ARG A CB   8  
ATOM   5467  C CG   . ARG A 1 21 ? 1.683   -7.030  -6.088  1.00 15.00 ?  492 ARG A CG   8  
ATOM   5468  C CD   . ARG A 1 21 ? 2.739   -7.731  -5.251  1.00 15.00 ?  492 ARG A CD   8  
ATOM   5469  N NE   . ARG A 1 21 ? 2.827   -9.146  -5.567  1.00 15.00 ?  492 ARG A NE   8  
ATOM   5470  C CZ   . ARG A 1 21 ? 3.460   -10.044 -4.804  1.00 15.00 ?  492 ARG A CZ   8  
ATOM   5471  N NH1  . ARG A 1 21 ? 4.083   -9.658  -3.696  1.00 15.00 1  492 ARG A NH1  8  
ATOM   5472  N NH2  . ARG A 1 21 ? 3.480   -11.324 -5.153  1.00 15.00 ?  492 ARG A NH2  8  
ATOM   5473  H H    . ARG A 1 21 ? 0.443   -6.348  -8.360  1.00 15.00 ?  492 ARG A H    8  
ATOM   5474  H HA   . ARG A 1 21 ? -1.668  -7.574  -6.708  1.00 15.00 ?  492 ARG A HA   8  
ATOM   5475  H HB2  . ARG A 1 21 ? 0.020   -7.376  -4.827  1.00 15.00 ?  492 ARG A HB2  8  
ATOM   5476  H HB3  . ARG A 1 21 ? 0.317   -8.639  -5.966  1.00 15.00 ?  492 ARG A HB3  8  
ATOM   5477  H HG2  . ARG A 1 21 ? 1.926   -7.161  -7.131  1.00 15.00 ?  492 ARG A HG2  8  
ATOM   5478  H HG3  . ARG A 1 21 ? 1.689   -5.978  -5.848  1.00 15.00 ?  492 ARG A HG3  8  
ATOM   5479  H HD2  . ARG A 1 21 ? 3.697   -7.269  -5.442  1.00 15.00 ?  492 ARG A HD2  8  
ATOM   5480  H HD3  . ARG A 1 21 ? 2.488   -7.618  -4.206  1.00 15.00 ?  492 ARG A HD3  8  
ATOM   5481  H HE   . ARG A 1 21 ? 2.385   -9.447  -6.395  1.00 15.00 ?  492 ARG A HE   8  
ATOM   5482  H HH11 . ARG A 1 21 ? 4.079   -8.698  -3.424  1.00 15.00 ?  492 ARG A HH11 8  
ATOM   5483  H HH12 . ARG A 1 21 ? 4.569   -10.338 -3.122  1.00 15.00 ?  492 ARG A HH12 8  
ATOM   5484  H HH21 . ARG A 1 21 ? 3.027   -11.626 -5.994  1.00 15.00 ?  492 ARG A HH21 8  
ATOM   5485  H HH22 . ARG A 1 21 ? 3.942   -12.004 -4.558  1.00 15.00 ?  492 ARG A HH22 8  
ATOM   5486  N N    . PRO A 1 22 ? -2.350  -5.325  -5.796  1.00 15.00 ?  493 PRO A N    8  
ATOM   5487  C CA   . PRO A 1 22 ? -2.770  -4.032  -5.262  1.00 15.00 ?  493 PRO A CA   8  
ATOM   5488  C C    . PRO A 1 22 ? -2.543  -3.909  -3.751  1.00 15.00 ?  493 PRO A C    8  
ATOM   5489  O O    . PRO A 1 22 ? -3.014  -4.742  -2.971  1.00 15.00 ?  493 PRO A O    8  
ATOM   5490  C CB   . PRO A 1 22 ? -4.265  -4.016  -5.580  1.00 15.00 ?  493 PRO A CB   8  
ATOM   5491  C CG   . PRO A 1 22 ? -4.688  -5.452  -5.558  1.00 15.00 ?  493 PRO A CG   8  
ATOM   5492  C CD   . PRO A 1 22 ? -3.456  -6.297  -5.793  1.00 15.00 ?  493 PRO A CD   8  
ATOM   5493  H HA   . PRO A 1 22 ? -2.282  -3.214  -5.769  1.00 15.00 ?  493 PRO A HA   8  
ATOM   5494  H HB2  . PRO A 1 22 ? -4.787  -3.440  -4.831  1.00 15.00 ?  493 PRO A HB2  8  
ATOM   5495  H HB3  . PRO A 1 22 ? -4.423  -3.575  -6.554  1.00 15.00 ?  493 PRO A HB3  8  
ATOM   5496  H HG2  . PRO A 1 22 ? -5.117  -5.688  -4.596  1.00 15.00 ?  493 PRO A HG2  8  
ATOM   5497  H HG3  . PRO A 1 22 ? -5.413  -5.628  -6.340  1.00 15.00 ?  493 PRO A HG3  8  
ATOM   5498  H HD2  . PRO A 1 22 ? -3.333  -7.011  -4.994  1.00 15.00 ?  493 PRO A HD2  8  
ATOM   5499  H HD3  . PRO A 1 22 ? -3.524  -6.804  -6.745  1.00 15.00 ?  493 PRO A HD3  8  
ATOM   5500  N N    . PHE A 1 23 ? -1.823  -2.869  -3.342  1.00 15.00 ?  494 PHE A N    8  
ATOM   5501  C CA   . PHE A 1 23 ? -1.527  -2.657  -1.930  1.00 15.00 ?  494 PHE A CA   8  
ATOM   5502  C C    . PHE A 1 23 ? -1.840  -1.226  -1.479  1.00 15.00 ?  494 PHE A C    8  
ATOM   5503  O O    . PHE A 1 23 ? -1.700  -0.268  -2.246  1.00 15.00 ?  494 PHE A O    8  
ATOM   5504  C CB   . PHE A 1 23 ? -0.060  -3.024  -1.612  1.00 15.00 ?  494 PHE A CB   8  
ATOM   5505  C CG   . PHE A 1 23 ? 1.016   -2.402  -2.491  1.00 15.00 ?  494 PHE A CG   8  
ATOM   5506  C CD1  . PHE A 1 23 ? 1.012   -1.052  -2.819  1.00 15.00 ?  494 PHE A CD1  8  
ATOM   5507  C CD2  . PHE A 1 23 ? 2.056   -3.187  -2.967  1.00 15.00 ?  494 PHE A CD2  8  
ATOM   5508  C CE1  . PHE A 1 23 ? 2.016   -0.504  -3.606  1.00 15.00 ?  494 PHE A CE1  8  
ATOM   5509  C CE2  . PHE A 1 23 ? 3.060   -2.644  -3.746  1.00 15.00 ?  494 PHE A CE2  8  
ATOM   5510  C CZ   . PHE A 1 23 ? 3.039   -1.304  -4.068  1.00 15.00 ?  494 PHE A CZ   8  
ATOM   5511  H H    . PHE A 1 23 ? -1.484  -2.223  -4.003  1.00 15.00 ?  494 PHE A H    8  
ATOM   5512  H HA   . PHE A 1 23 ? -2.166  -3.326  -1.375  1.00 15.00 ?  494 PHE A HA   8  
ATOM   5513  H HB2  . PHE A 1 23 ? 0.151   -2.729  -0.598  1.00 15.00 ?  494 PHE A HB2  8  
ATOM   5514  H HB3  . PHE A 1 23 ? 0.043   -4.098  -1.683  1.00 15.00 ?  494 PHE A HB3  8  
ATOM   5515  H HD1  . PHE A 1 23 ? 0.212   -0.424  -2.458  1.00 15.00 ?  494 PHE A HD1  8  
ATOM   5516  H HD2  . PHE A 1 23 ? 2.081   -4.235  -2.725  1.00 15.00 ?  494 PHE A HD2  8  
ATOM   5517  H HE1  . PHE A 1 23 ? 2.002   0.552   -3.860  1.00 15.00 ?  494 PHE A HE1  8  
ATOM   5518  H HE2  . PHE A 1 23 ? 3.864   -3.269  -4.100  1.00 15.00 ?  494 PHE A HE2  8  
ATOM   5519  H HZ   . PHE A 1 23 ? 3.824   -0.881  -4.677  1.00 15.00 ?  494 PHE A HZ   8  
ATOM   5520  N N    . PHE A 1 24 ? -2.295  -1.098  -0.237  1.00 15.00 ?  495 PHE A N    8  
ATOM   5521  C CA   . PHE A 1 24 ? -2.432  0.197   0.410   1.00 15.00 ?  495 PHE A CA   8  
ATOM   5522  C C    . PHE A 1 24 ? -1.174  0.512   1.195   1.00 15.00 ?  495 PHE A C    8  
ATOM   5523  O O    . PHE A 1 24 ? -0.846  -0.178  2.165   1.00 15.00 ?  495 PHE A O    8  
ATOM   5524  C CB   . PHE A 1 24 ? -3.634  0.239   1.366   1.00 15.00 ?  495 PHE A CB   8  
ATOM   5525  C CG   . PHE A 1 24 ? -4.926  -0.175  0.737   1.00 15.00 ?  495 PHE A CG   8  
ATOM   5526  C CD1  . PHE A 1 24 ? -5.597  0.700   -0.088  1.00 15.00 ?  495 PHE A CD1  8  
ATOM   5527  C CD2  . PHE A 1 24 ? -5.466  -1.429  0.966   1.00 15.00 ?  495 PHE A CD2  8  
ATOM   5528  C CE1  . PHE A 1 24 ? -6.790  0.342   -0.684  1.00 15.00 ?  495 PHE A CE1  8  
ATOM   5529  C CE2  . PHE A 1 24 ? -6.662  -1.799  0.377   1.00 15.00 ?  495 PHE A CE2  8  
ATOM   5530  C CZ   . PHE A 1 24 ? -7.326  -0.911  -0.451  1.00 15.00 ?  495 PHE A CZ   8  
ATOM   5531  H H    . PHE A 1 24 ? -2.553  -1.897  0.253   1.00 15.00 ?  495 PHE A H    8  
ATOM   5532  H HA   . PHE A 1 24 ? -2.564  0.946   -0.356  1.00 15.00 ?  495 PHE A HA   8  
ATOM   5533  H HB2  . PHE A 1 24 ? -3.446  -0.408  2.207   1.00 15.00 ?  495 PHE A HB2  8  
ATOM   5534  H HB3  . PHE A 1 24 ? -3.753  1.251   1.726   1.00 15.00 ?  495 PHE A HB3  8  
ATOM   5535  H HD1  . PHE A 1 24 ? -5.178  1.680   -0.264  1.00 15.00 ?  495 PHE A HD1  8  
ATOM   5536  H HD2  . PHE A 1 24 ? -4.947  -2.121  1.612   1.00 15.00 ?  495 PHE A HD2  8  
ATOM   5537  H HE1  . PHE A 1 24 ? -7.300  1.046   -1.335  1.00 15.00 ?  495 PHE A HE1  8  
ATOM   5538  H HE2  . PHE A 1 24 ? -7.076  -2.777  0.566   1.00 15.00 ?  495 PHE A HE2  8  
ATOM   5539  H HZ   . PHE A 1 24 ? -8.257  -1.197  -0.915  1.00 15.00 ?  495 PHE A HZ   8  
ATOM   5540  N N    . ILE A 1 25 ? -0.456  1.526   0.762   1.00 15.00 ?  496 ILE A N    8  
ATOM   5541  C CA   . ILE A 1 25 ? 0.698   1.995   1.495   1.00 15.00 ?  496 ILE A CA   8  
ATOM   5542  C C    . ILE A 1 25 ? 0.319   3.233   2.275   1.00 15.00 ?  496 ILE A C    8  
ATOM   5543  O O    . ILE A 1 25 ? 0.091   4.287   1.685   1.00 15.00 ?  496 ILE A O    8  
ATOM   5544  C CB   . ILE A 1 25 ? 1.886   2.348   0.574   1.00 15.00 ?  496 ILE A CB   8  
ATOM   5545  C CG1  . ILE A 1 25 ? 2.224   1.175   -0.346  1.00 15.00 ?  496 ILE A CG1  8  
ATOM   5546  C CG2  . ILE A 1 25 ? 3.097   2.738   1.413   1.00 15.00 ?  496 ILE A CG2  8  
ATOM   5547  C CD1  . ILE A 1 25 ? 3.456   1.399   -1.192  1.00 15.00 ?  496 ILE A CD1  8  
ATOM   5548  H H    . ILE A 1 25 ? -0.722  1.982   -0.069  1.00 15.00 ?  496 ILE A H    8  
ATOM   5549  H HA   . ILE A 1 25 ? 1.007   1.220   2.180   1.00 15.00 ?  496 ILE A HA   8  
ATOM   5550  H HB   . ILE A 1 25 ? 1.606   3.201   -0.027  1.00 15.00 ?  496 ILE A HB   8  
ATOM   5551  H HG12 . ILE A 1 25 ? 2.387   0.292   0.252   1.00 15.00 ?  496 ILE A HG12 8  
ATOM   5552  H HG13 . ILE A 1 25 ? 1.395   1.002   -1.015  1.00 15.00 ?  496 ILE A HG13 8  
ATOM   5553  H HG21 . ILE A 1 25 ? 3.924   2.981   0.762   1.00 15.00 ?  496 ILE A HG21 8  
ATOM   5554  H HG22 . ILE A 1 25 ? 3.372   1.911   2.052   1.00 15.00 ?  496 ILE A HG22 8  
ATOM   5555  H HG23 . ILE A 1 25 ? 2.853   3.597   2.020   1.00 15.00 ?  496 ILE A HG23 8  
ATOM   5556  H HD11 . ILE A 1 25 ? 4.313   1.539   -0.550  1.00 15.00 ?  496 ILE A HD11 8  
ATOM   5557  H HD12 . ILE A 1 25 ? 3.318   2.277   -1.806  1.00 15.00 ?  496 ILE A HD12 8  
ATOM   5558  H HD13 . ILE A 1 25 ? 3.618   0.539   -1.824  1.00 15.00 ?  496 ILE A HD13 8  
ATOM   5559  N N    . ASP A 1 26 ? 0.229   3.118   3.586   1.00 15.00 ?  497 ASP A N    8  
ATOM   5560  C CA   . ASP A 1 26 ? -0.054  4.282   4.393   1.00 15.00 ?  497 ASP A CA   8  
ATOM   5561  C C    . ASP A 1 26 ? 1.254   4.936   4.769   1.00 15.00 ?  497 ASP A C    8  
ATOM   5562  O O    . ASP A 1 26 ? 2.137   4.330   5.376   1.00 15.00 ?  497 ASP A O    8  
ATOM   5563  C CB   . ASP A 1 26 ? -0.905  3.967   5.622   1.00 15.00 ?  497 ASP A CB   8  
ATOM   5564  C CG   . ASP A 1 26 ? -0.118  3.435   6.796   1.00 15.00 ?  497 ASP A CG   8  
ATOM   5565  O OD1  . ASP A 1 26 ? 0.106   2.215   6.859   1.00 15.00 -1 497 ASP A OD1  8  
ATOM   5566  O OD2  . ASP A 1 26 ? 0.270   4.245   7.667   1.00 15.00 ?  497 ASP A OD2  8  
ATOM   5567  H H    . ASP A 1 26 ? 0.388   2.246   4.020   1.00 15.00 ?  497 ASP A H    8  
ATOM   5568  H HA   . ASP A 1 26 ? -0.601  4.976   3.762   1.00 15.00 ?  497 ASP A HA   8  
ATOM   5569  H HB2  . ASP A 1 26 ? -1.398  4.874   5.937   1.00 15.00 ?  497 ASP A HB2  8  
ATOM   5570  H HB3  . ASP A 1 26 ? -1.654  3.235   5.354   1.00 15.00 ?  497 ASP A HB3  8  
ATOM   5571  N N    . HIS A 1 27 ? 1.384   6.165   4.357   1.00 15.00 ?  498 HIS A N    8  
ATOM   5572  C CA   . HIS A 1 27 ? 2.637   6.874   4.447   1.00 15.00 ?  498 HIS A CA   8  
ATOM   5573  C C    . HIS A 1 27 ? 2.894   7.430   5.839   1.00 15.00 ?  498 HIS A C    8  
ATOM   5574  O O    . HIS A 1 27 ? 3.994   7.904   6.122   1.00 15.00 ?  498 HIS A O    8  
ATOM   5575  C CB   . HIS A 1 27 ? 2.696   7.962   3.374   1.00 15.00 ?  498 HIS A CB   8  
ATOM   5576  C CG   . HIS A 1 27 ? 2.979   7.388   2.017   1.00 15.00 ?  498 HIS A CG   8  
ATOM   5577  N ND1  . HIS A 1 27 ? 4.260   7.189   1.562   1.00 15.00 ?  498 HIS A ND1  8  
ATOM   5578  C CD2  . HIS A 1 27 ? 2.154   6.902   1.046   1.00 15.00 ?  498 HIS A CD2  8  
ATOM   5579  C CE1  . HIS A 1 27 ? 4.227   6.602   0.384   1.00 15.00 ?  498 HIS A CE1  8  
ATOM   5580  N NE2  . HIS A 1 27 ? 2.961   6.420   0.042   1.00 15.00 ?  498 HIS A NE2  8  
ATOM   5581  H H    . HIS A 1 27 ? 0.598   6.613   3.966   1.00 15.00 ?  498 HIS A H    8  
ATOM   5582  H HA   . HIS A 1 27 ? 3.414   6.159   4.232   1.00 15.00 ?  498 HIS A HA   8  
ATOM   5583  H HB2  . HIS A 1 27 ? 1.748   8.480   3.334   1.00 15.00 ?  498 HIS A HB2  8  
ATOM   5584  H HB3  . HIS A 1 27 ? 3.481   8.664   3.614   1.00 15.00 ?  498 HIS A HB3  8  
ATOM   5585  H HD1  . HIS A 1 27 ? 5.090   7.467   2.031   1.00 15.00 ?  498 HIS A HD1  8  
ATOM   5586  H HD2  . HIS A 1 27 ? 1.065   6.877   1.063   1.00 15.00 ?  498 HIS A HD2  8  
ATOM   5587  H HE1  . HIS A 1 27 ? 5.087   6.274   -0.181  1.00 15.00 ?  498 HIS A HE1  8  
ATOM   5588  H HE2  . HIS A 1 27 ? 2.654   6.221   -0.869  1.00 15.00 ?  498 HIS A HE2  8  
ATOM   5589  N N    . ASN A 1 28 ? 1.892   7.375   6.711   1.00 15.00 ?  499 ASN A N    8  
ATOM   5590  C CA   . ASN A 1 28 ? 2.066   7.894   8.058   1.00 15.00 ?  499 ASN A CA   8  
ATOM   5591  C C    . ASN A 1 28 ? 2.806   6.892   8.943   1.00 15.00 ?  499 ASN A C    8  
ATOM   5592  O O    . ASN A 1 28 ? 3.772   7.261   9.611   1.00 15.00 ?  499 ASN A O    8  
ATOM   5593  C CB   . ASN A 1 28 ? 0.719   8.308   8.684   1.00 15.00 ?  499 ASN A CB   8  
ATOM   5594  C CG   . ASN A 1 28 ? -0.311  7.192   8.710   1.00 15.00 ?  499 ASN A CG   8  
ATOM   5595  O OD1  . ASN A 1 28 ? -0.391  6.424   9.670   1.00 15.00 ?  499 ASN A OD1  8  
ATOM   5596  N ND2  . ASN A 1 28 ? -1.125  7.108   7.666   1.00 15.00 ?  499 ASN A ND2  8  
ATOM   5597  H H    . ASN A 1 28 ? 1.041   6.965   6.449   1.00 15.00 ?  499 ASN A H    8  
ATOM   5598  H HA   . ASN A 1 28 ? 2.683   8.779   7.974   1.00 15.00 ?  499 ASN A HA   8  
ATOM   5599  H HB2  . ASN A 1 28 ? 0.890   8.630   9.699   1.00 15.00 ?  499 ASN A HB2  8  
ATOM   5600  H HB3  . ASN A 1 28 ? 0.311   9.132   8.118   1.00 15.00 ?  499 ASN A HB3  8  
ATOM   5601  H HD21 . ASN A 1 28 ? -1.024  7.766   6.947   1.00 15.00 ?  499 ASN A HD21 8  
ATOM   5602  H HD22 . ASN A 1 28 ? -1.788  6.387   7.655   1.00 15.00 ?  499 ASN A HD22 8  
ATOM   5603  N N    . THR A 1 29 ? 2.366   5.632   8.975   1.00 15.00 ?  500 THR A N    8  
ATOM   5604  C CA   . THR A 1 29 ? 3.145   4.591   9.637   1.00 15.00 ?  500 THR A CA   8  
ATOM   5605  C C    . THR A 1 29 ? 4.265   4.099   8.724   1.00 15.00 ?  500 THR A C    8  
ATOM   5606  O O    . THR A 1 29 ? 5.284   3.596   9.200   1.00 15.00 ?  500 THR A O    8  
ATOM   5607  C CB   . THR A 1 29 ? 2.292   3.395   10.114  1.00 15.00 ?  500 THR A CB   8  
ATOM   5608  O OG1  . THR A 1 29 ? 1.795   2.652   9.002   1.00 15.00 ?  500 THR A OG1  8  
ATOM   5609  C CG2  . THR A 1 29 ? 1.132   3.863   10.977  1.00 15.00 ?  500 THR A CG2  8  
ATOM   5610  H H    . THR A 1 29 ? 1.506   5.399   8.547   1.00 15.00 ?  500 THR A H    8  
ATOM   5611  H HA   . THR A 1 29 ? 3.600   5.041   10.509  1.00 15.00 ?  500 THR A HA   8  
ATOM   5612  H HB   . THR A 1 29 ? 2.919   2.747   10.711  1.00 15.00 ?  500 THR A HB   8  
ATOM   5613  H HG1  . THR A 1 29 ? 1.140   3.186   8.514   1.00 15.00 ?  500 THR A HG1  8  
ATOM   5614  H HG21 . THR A 1 29 ? 1.512   4.378   11.846  1.00 15.00 ?  500 THR A HG21 8  
ATOM   5615  H HG22 . THR A 1 29 ? 0.549   3.009   11.292  1.00 15.00 ?  500 THR A HG22 8  
ATOM   5616  H HG23 . THR A 1 29 ? 0.506   4.534   10.406  1.00 15.00 ?  500 THR A HG23 8  
ATOM   5617  N N    . LYS A 1 30 ? 4.038   4.248   7.407   1.00 15.00 ?  501 LYS A N    8  
ATOM   5618  C CA   . LYS A 1 30 ? 4.966   3.802   6.361   1.00 15.00 ?  501 LYS A CA   8  
ATOM   5619  C C    . LYS A 1 30 ? 4.830   2.290   6.149   1.00 15.00 ?  501 LYS A C    8  
ATOM   5620  O O    . LYS A 1 30 ? 5.771   1.607   5.743   1.00 15.00 ?  501 LYS A O    8  
ATOM   5621  C CB   . LYS A 1 30 ? 6.408   4.197   6.708   1.00 15.00 ?  501 LYS A CB   8  
ATOM   5622  C CG   . LYS A 1 30 ? 7.388   4.061   5.554   1.00 15.00 ?  501 LYS A CG   8  
ATOM   5623  C CD   . LYS A 1 30 ? 8.777   4.518   5.956   1.00 15.00 ?  501 LYS A CD   8  
ATOM   5624  C CE   . LYS A 1 30 ? 9.328   3.686   7.103   1.00 15.00 ?  501 LYS A CE   8  
ATOM   5625  N NZ   . LYS A 1 30 ? 10.594  4.253   7.632   1.00 15.00 1  501 LYS A NZ   8  
ATOM   5626  H H    . LYS A 1 30 ? 3.194   4.663   7.129   1.00 15.00 ?  501 LYS A H    8  
ATOM   5627  H HA   . LYS A 1 30 ? 4.679   4.298   5.445   1.00 15.00 ?  501 LYS A HA   8  
ATOM   5628  H HB2  . LYS A 1 30 ? 6.414   5.227   7.033   1.00 15.00 ?  501 LYS A HB2  8  
ATOM   5629  H HB3  . LYS A 1 30 ? 6.753   3.574   7.520   1.00 15.00 ?  501 LYS A HB3  8  
ATOM   5630  H HG2  . LYS A 1 30 ? 7.433   3.026   5.252   1.00 15.00 ?  501 LYS A HG2  8  
ATOM   5631  H HG3  . LYS A 1 30 ? 7.043   4.665   4.727   1.00 15.00 ?  501 LYS A HG3  8  
ATOM   5632  H HD2  . LYS A 1 30 ? 9.437   4.426   5.108   1.00 15.00 ?  501 LYS A HD2  8  
ATOM   5633  H HD3  . LYS A 1 30 ? 8.728   5.552   6.266   1.00 15.00 ?  501 LYS A HD3  8  
ATOM   5634  H HE2  . LYS A 1 30 ? 8.596   3.661   7.897   1.00 15.00 ?  501 LYS A HE2  8  
ATOM   5635  H HE3  . LYS A 1 30 ? 9.511   2.681   6.750   1.00 15.00 ?  501 LYS A HE3  8  
ATOM   5636  H HZ1  . LYS A 1 30 ? 11.289  4.361   6.862   1.00 15.00 ?  501 LYS A HZ1  8  
ATOM   5637  H HZ2  . LYS A 1 30 ? 10.996  3.623   8.359   1.00 15.00 ?  501 LYS A HZ2  8  
ATOM   5638  H HZ3  . LYS A 1 30 ? 10.416  5.188   8.055   1.00 15.00 ?  501 LYS A HZ3  8  
ATOM   5639  N N    . THR A 1 31 ? 3.623   1.790   6.361   1.00 15.00 ?  502 THR A N    8  
ATOM   5640  C CA   . THR A 1 31 ? 3.345   0.369   6.229   1.00 15.00 ?  502 THR A CA   8  
ATOM   5641  C C    . THR A 1 31 ? 2.603   0.074   4.920   1.00 15.00 ?  502 THR A C    8  
ATOM   5642  O O    . THR A 1 31 ? 1.876   0.919   4.400   1.00 15.00 ?  502 THR A O    8  
ATOM   5643  C CB   . THR A 1 31 ? 2.503   -0.142  7.419   1.00 15.00 ?  502 THR A CB   8  
ATOM   5644  O OG1  . THR A 1 31 ? 3.045   0.359   8.649   1.00 15.00 ?  502 THR A OG1  8  
ATOM   5645  C CG2  . THR A 1 31 ? 2.483   -1.664  7.464   1.00 15.00 ?  502 THR A CG2  8  
ATOM   5646  H H    . THR A 1 31 ? 2.889   2.396   6.596   1.00 15.00 ?  502 THR A H    8  
ATOM   5647  H HA   . THR A 1 31 ? 4.289   -0.158  6.227   1.00 15.00 ?  502 THR A HA   8  
ATOM   5648  H HB   . THR A 1 31 ? 1.491   0.216   7.306   1.00 15.00 ?  502 THR A HB   8  
ATOM   5649  H HG1  . THR A 1 31 ? 2.700   1.256   8.800   1.00 15.00 ?  502 THR A HG1  8  
ATOM   5650  H HG21 . THR A 1 31 ? 1.884   -1.993  8.299   1.00 15.00 ?  502 THR A HG21 8  
ATOM   5651  H HG22 . THR A 1 31 ? 3.492   -2.034  7.577   1.00 15.00 ?  502 THR A HG22 8  
ATOM   5652  H HG23 . THR A 1 31 ? 2.062   -2.045  6.545   1.00 15.00 ?  502 THR A HG23 8  
ATOM   5653  N N    . THR A 1 32 ? 2.820   -1.117  4.378   1.00 15.00 ?  503 THR A N    8  
ATOM   5654  C CA   . THR A 1 32 ? 2.112   -1.562  3.189   1.00 15.00 ?  503 THR A CA   8  
ATOM   5655  C C    . THR A 1 32 ? 1.254   -2.780  3.527   1.00 15.00 ?  503 THR A C    8  
ATOM   5656  O O    . THR A 1 32 ? 1.780   -3.844  3.850   1.00 15.00 ?  503 THR A O    8  
ATOM   5657  C CB   . THR A 1 32 ? 3.104   -1.922  2.067   1.00 15.00 ?  503 THR A CB   8  
ATOM   5658  O OG1  . THR A 1 32 ? 4.119   -0.914  1.988   1.00 15.00 ?  503 THR A OG1  8  
ATOM   5659  C CG2  . THR A 1 32 ? 2.402   -2.032  0.728   1.00 15.00 ?  503 THR A CG2  8  
ATOM   5660  H H    . THR A 1 32 ? 3.470   -1.720  4.793   1.00 15.00 ?  503 THR A H    8  
ATOM   5661  H HA   . THR A 1 32 ? 1.475   -0.758  2.846   1.00 15.00 ?  503 THR A HA   8  
ATOM   5662  H HB   . THR A 1 32 ? 3.562   -2.875  2.292   1.00 15.00 ?  503 THR A HB   8  
ATOM   5663  H HG1  . THR A 1 32 ? 4.003   -0.292  2.713   1.00 15.00 ?  503 THR A HG1  8  
ATOM   5664  H HG21 . THR A 1 32 ? 1.642   -2.797  0.781   1.00 15.00 ?  503 THR A HG21 8  
ATOM   5665  H HG22 . THR A 1 32 ? 3.121   -2.289  -0.036  1.00 15.00 ?  503 THR A HG22 8  
ATOM   5666  H HG23 . THR A 1 32 ? 1.944   -1.084  0.484   1.00 15.00 ?  503 THR A HG23 8  
ATOM   5667  N N    . THR A 1 33 ? -0.061  -2.617  3.482   1.00 15.00 ?  504 THR A N    8  
ATOM   5668  C CA   . THR A 1 33 ? -0.966  -3.692  3.866   1.00 15.00 ?  504 THR A CA   8  
ATOM   5669  C C    . THR A 1 33 ? -1.764  -4.203  2.665   1.00 15.00 ?  504 THR A C    8  
ATOM   5670  O O    . THR A 1 33 ? -2.035  -3.460  1.716   1.00 15.00 ?  504 THR A O    8  
ATOM   5671  C CB   . THR A 1 33 ? -1.928  -3.250  4.995   1.00 15.00 ?  504 THR A CB   8  
ATOM   5672  O OG1  . THR A 1 33 ? -2.774  -4.344  5.378   1.00 15.00 ?  504 THR A OG1  8  
ATOM   5673  C CG2  . THR A 1 33 ? -2.783  -2.066  4.564   1.00 15.00 ?  504 THR A CG2  8  
ATOM   5674  H H    . THR A 1 33 ? -0.433  -1.759  3.175   1.00 15.00 ?  504 THR A H    8  
ATOM   5675  H HA   . THR A 1 33 ? -0.361  -4.503  4.243   1.00 15.00 ?  504 THR A HA   8  
ATOM   5676  H HB   . THR A 1 33 ? -1.337  -2.952  5.849   1.00 15.00 ?  504 THR A HB   8  
ATOM   5677  H HG1  . THR A 1 33 ? -3.152  -4.172  6.259   1.00 15.00 ?  504 THR A HG1  8  
ATOM   5678  H HG21 . THR A 1 33 ? -3.392  -2.350  3.719   1.00 15.00 ?  504 THR A HG21 8  
ATOM   5679  H HG22 . THR A 1 33 ? -2.141  -1.243  4.284   1.00 15.00 ?  504 THR A HG22 8  
ATOM   5680  H HG23 . THR A 1 33 ? -3.421  -1.763  5.383   1.00 15.00 ?  504 THR A HG23 8  
ATOM   5681  N N    . TRP A 1 34 ? -2.119  -5.482  2.712   1.00 15.00 ?  505 TRP A N    8  
ATOM   5682  C CA   . TRP A 1 34 ? -2.856  -6.121  1.628   1.00 15.00 ?  505 TRP A CA   8  
ATOM   5683  C C    . TRP A 1 34 ? -4.353  -6.101  1.890   1.00 15.00 ?  505 TRP A C    8  
ATOM   5684  O O    . TRP A 1 34 ? -5.160  -6.278  0.973   1.00 15.00 ?  505 TRP A O    8  
ATOM   5685  C CB   . TRP A 1 34 ? -2.416  -7.571  1.468   1.00 15.00 ?  505 TRP A CB   8  
ATOM   5686  C CG   . TRP A 1 34 ? -1.021  -7.738  0.963   1.00 15.00 ?  505 TRP A CG   8  
ATOM   5687  C CD1  . TRP A 1 34 ? 0.052   -8.218  1.652   1.00 15.00 ?  505 TRP A CD1  8  
ATOM   5688  C CD2  . TRP A 1 34 ? -0.557  -7.437  -0.352  1.00 15.00 ?  505 TRP A CD2  8  
ATOM   5689  N NE1  . TRP A 1 34 ? 1.155   -8.249  0.834   1.00 15.00 ?  505 TRP A NE1  8  
ATOM   5690  C CE2  . TRP A 1 34 ? 0.807   -7.771  -0.398  1.00 15.00 ?  505 TRP A CE2  8  
ATOM   5691  C CE3  . TRP A 1 34 ? -1.164  -6.922  -1.495  1.00 15.00 ?  505 TRP A CE3  8  
ATOM   5692  C CZ2  . TRP A 1 34 ? 1.574   -7.609  -1.546  1.00 15.00 ?  505 TRP A CZ2  8  
ATOM   5693  C CZ3  . TRP A 1 34 ? -0.407  -6.761  -2.633  1.00 15.00 ?  505 TRP A CZ3  8  
ATOM   5694  C CH2  . TRP A 1 34 ? 0.951   -7.106  -2.652  1.00 15.00 ?  505 TRP A CH2  8  
ATOM   5695  H H    . TRP A 1 34 ? -1.881  -6.014  3.503   1.00 15.00 ?  505 TRP A H    8  
ATOM   5696  H HA   . TRP A 1 34 ? -2.648  -5.585  0.715   1.00 15.00 ?  505 TRP A HA   8  
ATOM   5697  H HB2  . TRP A 1 34 ? -2.477  -8.063  2.426   1.00 15.00 ?  505 TRP A HB2  8  
ATOM   5698  H HB3  . TRP A 1 34 ? -3.082  -8.065  0.774   1.00 15.00 ?  505 TRP A HB3  8  
ATOM   5699  H HD1  . TRP A 1 34 ? 0.023   -8.532  2.685   1.00 15.00 ?  505 TRP A HD1  8  
ATOM   5700  H HE1  . TRP A 1 34 ? 2.045   -8.560  1.092   1.00 15.00 ?  505 TRP A HE1  8  
ATOM   5701  H HE3  . TRP A 1 34 ? -2.208  -6.649  -1.499  1.00 15.00 ?  505 TRP A HE3  8  
ATOM   5702  H HZ2  . TRP A 1 34 ? 2.621   -7.870  -1.577  1.00 15.00 ?  505 TRP A HZ2  8  
ATOM   5703  H HZ3  . TRP A 1 34 ? -0.864  -6.363  -3.527  1.00 15.00 ?  505 TRP A HZ3  8  
ATOM   5704  H HH2  . TRP A 1 34 ? 1.507   -6.976  -3.575  1.00 15.00 ?  505 TRP A HH2  8  
ATOM   5705  N N    . GLU A 1 35 ? -4.717  -5.915  3.146   1.00 15.00 ?  506 GLU A N    8  
ATOM   5706  C CA   . GLU A 1 35 ? -6.106  -6.011  3.556   1.00 15.00 ?  506 GLU A CA   8  
ATOM   5707  C C    . GLU A 1 35 ? -6.579  -4.693  4.104   1.00 15.00 ?  506 GLU A C    8  
ATOM   5708  O O    . GLU A 1 35 ? -5.888  -4.055  4.898   1.00 15.00 ?  506 GLU A O    8  
ATOM   5709  C CB   . GLU A 1 35 ? -6.272  -7.131  4.585   1.00 15.00 ?  506 GLU A CB   8  
ATOM   5710  C CG   . GLU A 1 35 ? -7.708  -7.355  5.027   1.00 15.00 ?  506 GLU A CG   8  
ATOM   5711  C CD   . GLU A 1 35 ? -7.856  -8.583  5.897   1.00 15.00 ?  506 GLU A CD   8  
ATOM   5712  O OE1  . GLU A 1 35 ? -7.661  -8.478  7.124   1.00 15.00 -1 506 GLU A OE1  8  
ATOM   5713  O OE2  . GLU A 1 35 ? -8.155  -9.668  5.353   1.00 15.00 ?  506 GLU A OE2  8  
ATOM   5714  H H    . GLU A 1 35 ? -4.035  -5.693  3.815   1.00 15.00 ?  506 GLU A H    8  
ATOM   5715  H HA   . GLU A 1 35 ? -6.697  -6.232  2.686   1.00 15.00 ?  506 GLU A HA   8  
ATOM   5716  H HB2  . GLU A 1 35 ? -5.903  -8.052  4.161   1.00 15.00 ?  506 GLU A HB2  8  
ATOM   5717  H HB3  . GLU A 1 35 ? -5.686  -6.889  5.460   1.00 15.00 ?  506 GLU A HB3  8  
ATOM   5718  H HG2  . GLU A 1 35 ? -8.042  -6.493  5.584   1.00 15.00 ?  506 GLU A HG2  8  
ATOM   5719  H HG3  . GLU A 1 35 ? -8.326  -7.478  4.149   1.00 15.00 ?  506 GLU A HG3  8  
ATOM   5720  N N    . ASP A 1 36 ? -7.768  -4.304  3.675   1.00 15.00 ?  507 ASP A N    8  
ATOM   5721  C CA   . ASP A 1 36 ? -8.312  -3.008  4.006   1.00 15.00 ?  507 ASP A CA   8  
ATOM   5722  C C    . ASP A 1 36 ? -8.527  -2.876  5.511   1.00 15.00 ?  507 ASP A C    8  
ATOM   5723  O O    . ASP A 1 36 ? -9.373  -3.558  6.093   1.00 15.00 ?  507 ASP A O    8  
ATOM   5724  C CB   . ASP A 1 36 ? -9.620  -2.763  3.254   1.00 15.00 ?  507 ASP A CB   8  
ATOM   5725  C CG   . ASP A 1 36 ? -10.203 -1.397  3.535   1.00 15.00 ?  507 ASP A CG   8  
ATOM   5726  O OD1  . ASP A 1 36 ? -9.864  -0.444  2.801   1.00 15.00 -1 507 ASP A OD1  8  
ATOM   5727  O OD2  . ASP A 1 36 ? -11.005 -1.272  4.485   1.00 15.00 ?  507 ASP A OD2  8  
ATOM   5728  H H    . ASP A 1 36 ? -8.296  -4.915  3.121   1.00 15.00 ?  507 ASP A H    8  
ATOM   5729  H HA   . ASP A 1 36 ? -7.586  -2.284  3.691   1.00 15.00 ?  507 ASP A HA   8  
ATOM   5730  H HB2  . ASP A 1 36 ? -9.438  -2.843  2.193   1.00 15.00 ?  507 ASP A HB2  8  
ATOM   5731  H HB3  . ASP A 1 36 ? -10.343 -3.511  3.548   1.00 15.00 ?  507 ASP A HB3  8  
ATOM   5732  N N    . PRO A 1 37 ? -7.729  -2.022  6.157   1.00 15.00 ?  508 PRO A N    8  
ATOM   5733  C CA   . PRO A 1 37 ? -7.729  -1.849  7.599   1.00 15.00 ?  508 PRO A CA   8  
ATOM   5734  C C    . PRO A 1 37 ? -8.466  -0.594  8.069   1.00 15.00 ?  508 PRO A C    8  
ATOM   5735  O O    . PRO A 1 37 ? -8.319  -0.181  9.219   1.00 15.00 ?  508 PRO A O    8  
ATOM   5736  C CB   . PRO A 1 37 ? -6.235  -1.707  7.863   1.00 15.00 ?  508 PRO A CB   8  
ATOM   5737  C CG   . PRO A 1 37 ? -5.713  -0.960  6.671   1.00 15.00 ?  508 PRO A CG   8  
ATOM   5738  C CD   . PRO A 1 37 ? -6.696  -1.180  5.540   1.00 15.00 ?  508 PRO A CD   8  
ATOM   5739  H HA   . PRO A 1 37 ? -8.110  -2.718  8.114   1.00 15.00 ?  508 PRO A HA   8  
ATOM   5740  H HB2  . PRO A 1 37 ? -6.078  -1.154  8.778   1.00 15.00 ?  508 PRO A HB2  8  
ATOM   5741  H HB3  . PRO A 1 37 ? -5.783  -2.685  7.943   1.00 15.00 ?  508 PRO A HB3  8  
ATOM   5742  H HG2  . PRO A 1 37 ? -5.648  0.093   6.903   1.00 15.00 ?  508 PRO A HG2  8  
ATOM   5743  H HG3  . PRO A 1 37 ? -4.741  -1.339  6.396   1.00 15.00 ?  508 PRO A HG3  8  
ATOM   5744  H HD2  . PRO A 1 37 ? -7.111  -0.241  5.206   1.00 15.00 ?  508 PRO A HD2  8  
ATOM   5745  H HD3  . PRO A 1 37 ? -6.219  -1.695  4.719   1.00 15.00 ?  508 PRO A HD3  8  
ATOM   5746  N N    . ARG A 1 38 ? -9.256  0.014   7.193   1.00 15.00 ?  509 ARG A N    8  
ATOM   5747  C CA   . ARG A 1 38 ? -9.960  1.242   7.548   1.00 15.00 ?  509 ARG A CA   8  
ATOM   5748  C C    . ARG A 1 38 ? -11.450 0.972   7.775   1.00 15.00 ?  509 ARG A C    8  
ATOM   5749  O O    . ARG A 1 38 ? -12.284 1.381   6.944   1.00 15.00 ?  509 ARG A O    8  
ATOM   5750  C CB   . ARG A 1 38 ? -9.720  2.329   6.482   1.00 15.00 ?  509 ARG A CB   8  
ATOM   5751  C CG   . ARG A 1 38 ? -9.903  1.859   5.045   1.00 15.00 ?  509 ARG A CG   8  
ATOM   5752  C CD   . ARG A 1 38 ? -11.246 2.287   4.470   1.00 15.00 ?  509 ARG A CD   8  
ATOM   5753  N NE   . ARG A 1 38 ? -11.554 1.586   3.229   1.00 15.00 ?  509 ARG A NE   8  
ATOM   5754  C CZ   . ARG A 1 38 ? -12.734 1.635   2.614   1.00 15.00 ?  509 ARG A CZ   8  
ATOM   5755  N NH1  . ARG A 1 38 ? -13.734 2.331   3.146   1.00 15.00 1  509 ARG A NH1  8  
ATOM   5756  N NH2  . ARG A 1 38 ? -12.921 0.967   1.481   1.00 15.00 ?  509 ARG A NH2  8  
ATOM   5757  H H    . ARG A 1 38 ? -9.380  -0.375  6.301   1.00 15.00 ?  509 ARG A H    8  
ATOM   5758  H HA   . ARG A 1 38 ? -9.541  1.585   8.483   1.00 15.00 ?  509 ARG A HA   8  
ATOM   5759  H HB2  . ARG A 1 38 ? -10.405 3.144   6.658   1.00 15.00 ?  509 ARG A HB2  8  
ATOM   5760  H HB3  . ARG A 1 38 ? -8.710  2.698   6.588   1.00 15.00 ?  509 ARG A HB3  8  
ATOM   5761  H HG2  . ARG A 1 38 ? -9.115  2.281   4.438   1.00 15.00 ?  509 ARG A HG2  8  
ATOM   5762  H HG3  . ARG A 1 38 ? -9.839  0.781   5.020   1.00 15.00 ?  509 ARG A HG3  8  
ATOM   5763  H HD2  . ARG A 1 38 ? -12.018 2.072   5.194   1.00 15.00 ?  509 ARG A HD2  8  
ATOM   5764  H HD3  . ARG A 1 38 ? -11.219 3.348   4.278   1.00 15.00 ?  509 ARG A HD3  8  
ATOM   5765  H HE   . ARG A 1 38 ? -10.831 1.032   2.835   1.00 15.00 ?  509 ARG A HE   8  
ATOM   5766  H HH11 . ARG A 1 38 ? -13.600 2.826   4.004   1.00 15.00 ?  509 ARG A HH11 8  
ATOM   5767  H HH12 . ARG A 1 38 ? -14.633 2.353   2.694   1.00 15.00 ?  509 ARG A HH12 8  
ATOM   5768  H HH21 . ARG A 1 38 ? -12.167 0.426   1.084   1.00 15.00 ?  509 ARG A HH21 8  
ATOM   5769  H HH22 . ARG A 1 38 ? -13.811 0.999   1.009   1.00 15.00 ?  509 ARG A HH22 8  
ATOM   5770  N N    . ARG B 2 1  ? -1.731  -17.925 -0.120  1.00 15.00 ?  925 ARG B N    8  
ATOM   5771  C CA   . ARG B 2 1  ? -1.596  -16.625 0.570   1.00 15.00 ?  925 ARG B CA   8  
ATOM   5772  C C    . ARG B 2 1  ? -0.466  -15.829 -0.075  1.00 15.00 ?  925 ARG B C    8  
ATOM   5773  O O    . ARG B 2 1  ? 0.665   -16.308 -0.151  1.00 15.00 ?  925 ARG B O    8  
ATOM   5774  C CB   . ARG B 2 1  ? -1.292  -16.860 2.054   1.00 15.00 ?  925 ARG B CB   8  
ATOM   5775  C CG   . ARG B 2 1  ? -1.649  -15.697 2.971   1.00 15.00 ?  925 ARG B CG   8  
ATOM   5776  C CD   . ARG B 2 1  ? -3.158  -15.546 3.138   1.00 15.00 ?  925 ARG B CD   8  
ATOM   5777  N NE   . ARG B 2 1  ? -3.779  -14.850 2.009   1.00 15.00 ?  925 ARG B NE   8  
ATOM   5778  C CZ   . ARG B 2 1  ? -4.783  -15.342 1.282   1.00 15.00 ?  925 ARG B CZ   8  
ATOM   5779  N NH1  . ARG B 2 1  ? -5.265  -16.551 1.536   1.00 15.00 1  925 ARG B NH1  8  
ATOM   5780  N NH2  . ARG B 2 1  ? -5.312  -14.618 0.304   1.00 15.00 ?  925 ARG B NH2  8  
ATOM   5781  H H1   . ARG B 2 1  ? -1.945  -17.775 -1.130  1.00 15.00 ?  925 ARG B H1   8  
ATOM   5782  H H2   . ARG B 2 1  ? -2.499  -18.486 0.306   1.00 15.00 ?  925 ARG B H2   8  
ATOM   5783  H H3   . ARG B 2 1  ? -0.839  -18.462 -0.045  1.00 15.00 ?  925 ARG B H3   8  
ATOM   5784  H HA   . ARG B 2 1  ? -2.522  -16.079 0.470   1.00 15.00 ?  925 ARG B HA   8  
ATOM   5785  H HB2  . ARG B 2 1  ? -1.845  -17.727 2.384   1.00 15.00 ?  925 ARG B HB2  8  
ATOM   5786  H HB3  . ARG B 2 1  ? -0.237  -17.061 2.161   1.00 15.00 ?  925 ARG B HB3  8  
ATOM   5787  H HG2  . ARG B 2 1  ? -1.206  -15.868 3.941   1.00 15.00 ?  925 ARG B HG2  8  
ATOM   5788  H HG3  . ARG B 2 1  ? -1.250  -14.785 2.549   1.00 15.00 ?  925 ARG B HG3  8  
ATOM   5789  H HD2  . ARG B 2 1  ? -3.595  -16.529 3.224   1.00 15.00 ?  925 ARG B HD2  8  
ATOM   5790  H HD3  . ARG B 2 1  ? -3.352  -14.988 4.043   1.00 15.00 ?  925 ARG B HD3  8  
ATOM   5791  H HE   . ARG B 2 1  ? -3.438  -13.942 1.802   1.00 15.00 ?  925 ARG B HE   8  
ATOM   5792  H HH11 . ARG B 2 1  ? -4.883  -17.104 2.279   1.00 15.00 ?  925 ARG B HH11 8  
ATOM   5793  H HH12 . ARG B 2 1  ? -6.030  -16.918 0.983   1.00 15.00 ?  925 ARG B HH12 8  
ATOM   5794  H HH21 . ARG B 2 1  ? -4.965  -13.689 0.108   1.00 15.00 ?  925 ARG B HH21 8  
ATOM   5795  H HH22 . ARG B 2 1  ? -6.065  -14.990 -0.246  1.00 15.00 ?  925 ARG B HH22 8  
ATOM   5796  N N    . LEU B 2 2  ? -0.769  -14.625 -0.547  1.00 15.00 ?  926 LEU B N    8  
ATOM   5797  C CA   . LEU B 2 2  ? 0.219   -13.821 -1.259  1.00 15.00 ?  926 LEU B CA   8  
ATOM   5798  C C    . LEU B 2 2  ? 1.285   -13.265 -0.312  1.00 15.00 ?  926 LEU B C    8  
ATOM   5799  O O    . LEU B 2 2  ? 1.047   -13.082 0.887   1.00 15.00 ?  926 LEU B O    8  
ATOM   5800  C CB   . LEU B 2 2  ? -0.463  -12.702 -2.065  1.00 15.00 ?  926 LEU B CB   8  
ATOM   5801  C CG   . LEU B 2 2  ? -1.582  -11.928 -1.356  1.00 15.00 ?  926 LEU B CG   8  
ATOM   5802  C CD1  . LEU B 2 2  ? -1.024  -11.008 -0.287  1.00 15.00 ?  926 LEU B CD1  8  
ATOM   5803  C CD2  . LEU B 2 2  ? -2.395  -11.133 -2.367  1.00 15.00 ?  926 LEU B CD2  8  
ATOM   5804  H H    . LEU B 2 2  ? -1.669  -14.264 -0.409  1.00 15.00 ?  926 LEU B H    8  
ATOM   5805  H HA   . LEU B 2 2  ? 0.715   -14.483 -1.956  1.00 15.00 ?  926 LEU B HA   8  
ATOM   5806  H HB2  . LEU B 2 2  ? 0.296   -11.993 -2.359  1.00 15.00 ?  926 LEU B HB2  8  
ATOM   5807  H HB3  . LEU B 2 2  ? -0.877  -13.142 -2.960  1.00 15.00 ?  926 LEU B HB3  8  
ATOM   5808  H HG   . LEU B 2 2  ? -2.247  -12.631 -0.875  1.00 15.00 ?  926 LEU B HG   8  
ATOM   5809  H HD11 . LEU B 2 2  ? -0.484  -11.592 0.444   1.00 15.00 ?  926 LEU B HD11 8  
ATOM   5810  H HD12 . LEU B 2 2  ? -1.837  -10.488 0.200   1.00 15.00 ?  926 LEU B HD12 8  
ATOM   5811  H HD13 . LEU B 2 2  ? -0.356  -10.289 -0.739  1.00 15.00 ?  926 LEU B HD13 8  
ATOM   5812  H HD21 . LEU B 2 2  ? -3.178  -10.594 -1.855  1.00 15.00 ?  926 LEU B HD21 8  
ATOM   5813  H HD22 . LEU B 2 2  ? -2.833  -11.809 -3.087  1.00 15.00 ?  926 LEU B HD22 8  
ATOM   5814  H HD23 . LEU B 2 2  ? -1.749  -10.434 -2.876  1.00 15.00 ?  926 LEU B HD23 8  
ATOM   5815  N N    . ASP B 2 3  ? 2.454   -12.990 -0.874  1.00 15.00 ?  927 ASP B N    8  
ATOM   5816  C CA   . ASP B 2 3  ? 3.615   -12.563 -0.102  1.00 15.00 ?  927 ASP B CA   8  
ATOM   5817  C C    . ASP B 2 3  ? 3.648   -11.048 0.077   1.00 15.00 ?  927 ASP B C    8  
ATOM   5818  O O    . ASP B 2 3  ? 3.263   -10.291 -0.816  1.00 15.00 ?  927 ASP B O    8  
ATOM   5819  C CB   . ASP B 2 3  ? 4.894   -13.012 -0.812  1.00 15.00 ?  927 ASP B CB   8  
ATOM   5820  C CG   . ASP B 2 3  ? 5.040   -12.389 -2.190  1.00 15.00 ?  927 ASP B CG   8  
ATOM   5821  O OD1  . ASP B 2 3  ? 4.388   -12.872 -3.136  1.00 15.00 -1 927 ASP B OD1  8  
ATOM   5822  O OD2  . ASP B 2 3  ? 5.802   -11.407 -2.332  1.00 15.00 ?  927 ASP B OD2  8  
ATOM   5823  H H    . ASP B 2 3  ? 2.541   -13.068 -1.848  1.00 15.00 ?  927 ASP B H    8  
ATOM   5824  H HA   . ASP B 2 3  ? 3.566   -13.032 0.867   1.00 15.00 ?  927 ASP B HA   8  
ATOM   5825  H HB2  . ASP B 2 3  ? 5.749   -12.727 -0.216  1.00 15.00 ?  927 ASP B HB2  8  
ATOM   5826  H HB3  . ASP B 2 3  ? 4.878   -14.086 -0.922  1.00 15.00 ?  927 ASP B HB3  8  
ATOM   5827  N N    . LEU B 2 4  ? 4.129   -10.615 1.233   1.00 15.00 ?  928 LEU B N    8  
ATOM   5828  C CA   . LEU B 2 4  ? 4.361   -9.203  1.488   1.00 15.00 ?  928 LEU B CA   8  
ATOM   5829  C C    . LEU B 2 4  ? 5.856   -8.914  1.432   1.00 15.00 ?  928 LEU B C    8  
ATOM   5830  O O    . LEU B 2 4  ? 6.631   -9.488  2.198   1.00 15.00 ?  928 LEU B O    8  
ATOM   5831  C CB   . LEU B 2 4  ? 3.807   -8.812  2.864   1.00 15.00 ?  928 LEU B CB   8  
ATOM   5832  C CG   . LEU B 2 4  ? 4.069   -7.365  3.298   1.00 15.00 ?  928 LEU B CG   8  
ATOM   5833  C CD1  . LEU B 2 4  ? 3.411   -6.383  2.341   1.00 15.00 ?  928 LEU B CD1  8  
ATOM   5834  C CD2  . LEU B 2 4  ? 3.570   -7.141  4.717   1.00 15.00 ?  928 LEU B CD2  8  
ATOM   5835  H H    . LEU B 2 4  ? 4.339   -11.265 1.935   1.00 15.00 ?  928 LEU B H    8  
ATOM   5836  H HA   . LEU B 2 4  ? 3.859   -8.633  0.722   1.00 15.00 ?  928 LEU B HA   8  
ATOM   5837  H HB2  . LEU B 2 4  ? 2.739   -8.975  2.860   1.00 15.00 ?  928 LEU B HB2  8  
ATOM   5838  H HB3  . LEU B 2 4  ? 4.247   -9.468  3.601   1.00 15.00 ?  928 LEU B HB3  8  
ATOM   5839  H HG   . LEU B 2 4  ? 5.133   -7.180  3.285   1.00 15.00 ?  928 LEU B HG   8  
ATOM   5840  H HD11 . LEU B 2 4  ? 2.344   -6.558  2.320   1.00 15.00 ?  928 LEU B HD11 8  
ATOM   5841  H HD12 . LEU B 2 4  ? 3.816   -6.519  1.350   1.00 15.00 ?  928 LEU B HD12 8  
ATOM   5842  H HD13 . LEU B 2 4  ? 3.602   -5.372  2.672   1.00 15.00 ?  928 LEU B HD13 8  
ATOM   5843  H HD21 . LEU B 2 4  ? 4.068   -7.826  5.387   1.00 15.00 ?  928 LEU B HD21 8  
ATOM   5844  H HD22 . LEU B 2 4  ? 2.504   -7.310  4.756   1.00 15.00 ?  928 LEU B HD22 8  
ATOM   5845  H HD23 . LEU B 2 4  ? 3.783   -6.126  5.018   1.00 15.00 ?  928 LEU B HD23 8  
ATOM   5846  N N    . PRO B 2 5  ? 6.290   -8.035  0.521   1.00 15.00 ?  929 PRO B N    8  
ATOM   5847  C CA   . PRO B 2 5  ? 7.683   -7.620  0.436   1.00 15.00 ?  929 PRO B CA   8  
ATOM   5848  C C    . PRO B 2 5  ? 7.988   -6.480  1.403   1.00 15.00 ?  929 PRO B C    8  
ATOM   5849  O O    . PRO B 2 5  ? 7.176   -5.567  1.561   1.00 15.00 ?  929 PRO B O    8  
ATOM   5850  C CB   . PRO B 2 5  ? 7.832   -7.140  -1.019  1.00 15.00 ?  929 PRO B CB   8  
ATOM   5851  C CG   . PRO B 2 5  ? 6.466   -7.205  -1.637  1.00 15.00 ?  929 PRO B CG   8  
ATOM   5852  C CD   . PRO B 2 5  ? 5.481   -7.385  -0.515  1.00 15.00 ?  929 PRO B CD   8  
ATOM   5853  H HA   . PRO B 2 5  ? 8.357   -8.444  0.622   1.00 15.00 ?  929 PRO B HA   8  
ATOM   5854  H HB2  . PRO B 2 5  ? 8.214   -6.131  -1.025  1.00 15.00 ?  929 PRO B HB2  8  
ATOM   5855  H HB3  . PRO B 2 5  ? 8.525   -7.788  -1.538  1.00 15.00 ?  929 PRO B HB3  8  
ATOM   5856  H HG2  . PRO B 2 5  ? 6.262   -6.285  -2.163  1.00 15.00 ?  929 PRO B HG2  8  
ATOM   5857  H HG3  . PRO B 2 5  ? 6.414   -8.043  -2.318  1.00 15.00 ?  929 PRO B HG3  8  
ATOM   5858  H HD2  . PRO B 2 5  ? 5.113   -6.427  -0.178  1.00 15.00 ?  929 PRO B HD2  8  
ATOM   5859  H HD3  . PRO B 2 5  ? 4.664   -8.018  -0.831  1.00 15.00 ?  929 PRO B HD3  8  
ATOM   5860  N N    . PRO B 2 6  ? 9.156   -6.520  2.070   1.00 15.00 ?  930 PRO B N    8  
ATOM   5861  C CA   . PRO B 2 6  ? 9.614   -5.422  2.923   1.00 15.00 ?  930 PRO B CA   8  
ATOM   5862  C C    . PRO B 2 6  ? 9.561   -4.102  2.165   1.00 15.00 ?  930 PRO B C    8  
ATOM   5863  O O    . PRO B 2 6  ? 10.108  -3.995  1.063   1.00 15.00 ?  930 PRO B O    8  
ATOM   5864  C CB   . PRO B 2 6  ? 11.064  -5.795  3.269   1.00 15.00 ?  930 PRO B CB   8  
ATOM   5865  C CG   . PRO B 2 6  ? 11.414  -6.936  2.369   1.00 15.00 ?  930 PRO B CG   8  
ATOM   5866  C CD   . PRO B 2 6  ? 10.121  -7.624  2.045   1.00 15.00 ?  930 PRO B CD   8  
ATOM   5867  H HA   . PRO B 2 6  ? 9.025   -5.346  3.826   1.00 15.00 ?  930 PRO B HA   8  
ATOM   5868  H HB2  . PRO B 2 6  ? 11.706  -4.945  3.094   1.00 15.00 ?  930 PRO B HB2  8  
ATOM   5869  H HB3  . PRO B 2 6  ? 11.122  -6.084  4.309   1.00 15.00 ?  930 PRO B HB3  8  
ATOM   5870  H HG2  . PRO B 2 6  ? 11.876  -6.562  1.466   1.00 15.00 ?  930 PRO B HG2  8  
ATOM   5871  H HG3  . PRO B 2 6  ? 12.083  -7.614  2.879   1.00 15.00 ?  930 PRO B HG3  8  
ATOM   5872  H HD2  . PRO B 2 6  ? 10.166  -8.080  1.068   1.00 15.00 ?  930 PRO B HD2  8  
ATOM   5873  H HD3  . PRO B 2 6  ? 9.885   -8.361  2.799   1.00 15.00 ?  930 PRO B HD3  8  
ATOM   5874  N N    . TYR B 2 7  ? 8.892   -3.109  2.738   1.00 15.00 ?  931 TYR B N    8  
ATOM   5875  C CA   . TYR B 2 7  ? 8.575   -1.902  1.993   1.00 15.00 ?  931 TYR B CA   8  
ATOM   5876  C C    . TYR B 2 7  ? 9.833   -1.135  1.607   1.00 15.00 ?  931 TYR B C    8  
ATOM   5877  O O    . TYR B 2 7  ? 10.612  -0.693  2.452   1.00 15.00 ?  931 TYR B O    8  
ATOM   5878  C CB   . TYR B 2 7  ? 7.625   -1.008  2.806   1.00 15.00 ?  931 TYR B CB   8  
ATOM   5879  C CG   . TYR B 2 7  ? 7.262   0.305   2.133   1.00 15.00 ?  931 TYR B CG   8  
ATOM   5880  C CD1  . TYR B 2 7  ? 6.934   0.360   0.783   1.00 15.00 ?  931 TYR B CD1  8  
ATOM   5881  C CD2  . TYR B 2 7  ? 7.246   1.495   2.853   1.00 15.00 ?  931 TYR B CD2  8  
ATOM   5882  C CE1  . TYR B 2 7  ? 6.607   1.555   0.175   1.00 15.00 ?  931 TYR B CE1  8  
ATOM   5883  C CE2  . TYR B 2 7  ? 6.919   2.692   2.251   1.00 15.00 ?  931 TYR B CE2  8  
ATOM   5884  C CZ   . TYR B 2 7  ? 6.601   2.718   0.912   1.00 15.00 ?  931 TYR B CZ   8  
ATOM   5885  O OH   . TYR B 2 7  ? 6.275   3.910   0.306   1.00 15.00 ?  931 TYR B OH   8  
ATOM   5886  H H    . TYR B 2 7  ? 8.615   -3.189  3.674   1.00 15.00 ?  931 TYR B H    8  
ATOM   5887  H HA   . TYR B 2 7  ? 8.070   -2.205  1.088   1.00 15.00 ?  931 TYR B HA   8  
ATOM   5888  H HB2  . TYR B 2 7  ? 6.707   -1.546  2.988   1.00 15.00 ?  931 TYR B HB2  8  
ATOM   5889  H HB3  . TYR B 2 7  ? 8.088   -0.776  3.752   1.00 15.00 ?  931 TYR B HB3  8  
ATOM   5890  H HD1  . TYR B 2 7  ? 6.937   -0.549  0.204   1.00 15.00 ?  931 TYR B HD1  8  
ATOM   5891  H HD2  . TYR B 2 7  ? 7.495   1.477   3.899   1.00 15.00 ?  931 TYR B HD2  8  
ATOM   5892  H HE1  . TYR B 2 7  ? 6.357   1.575   -0.876  1.00 15.00 ?  931 TYR B HE1  8  
ATOM   5893  H HE2  . TYR B 2 7  ? 6.909   3.603   2.833   1.00 15.00 ?  931 TYR B HE2  8  
ATOM   5894  H HH   . TYR B 2 7  ? 5.519   3.774   -0.272  1.00 15.00 ?  931 TYR B HH   8  
ATOM   5895  N N    . GLU B 2 8  ? 10.001  -0.992  0.306   1.00 15.00 ?  932 GLU B N    8  
ATOM   5896  C CA   . GLU B 2 8  ? 10.971  -0.091  -0.275  1.00 15.00 ?  932 GLU B CA   8  
ATOM   5897  C C    . GLU B 2 8  ? 10.179  1.041   -0.897  1.00 15.00 ?  932 GLU B C    8  
ATOM   5898  O O    . GLU B 2 8  ? 9.196   0.767   -1.584  1.00 15.00 ?  932 GLU B O    8  
ATOM   5899  C CB   . GLU B 2 8  ? 11.789  -0.819  -1.344  1.00 15.00 ?  932 GLU B CB   8  
ATOM   5900  C CG   . GLU B 2 8  ? 12.897  0.023   -1.949  1.00 15.00 ?  932 GLU B CG   8  
ATOM   5901  C CD   . GLU B 2 8  ? 13.503  -0.621  -3.178  1.00 15.00 ?  932 GLU B CD   8  
ATOM   5902  O OE1  . GLU B 2 8  ? 13.830  -1.824  -3.130  1.00 15.00 -1 932 GLU B OE1  8  
ATOM   5903  O OE2  . GLU B 2 8  ? 13.643  0.070   -4.207  1.00 15.00 ?  932 GLU B OE2  8  
ATOM   5904  H H    . GLU B 2 8  ? 9.439   -1.522  -0.297  1.00 15.00 ?  932 GLU B H    8  
ATOM   5905  H HA   . GLU B 2 8  ? 11.617  0.287   0.504   1.00 15.00 ?  932 GLU B HA   8  
ATOM   5906  H HB2  . GLU B 2 8  ? 12.236  -1.698  -0.902  1.00 15.00 ?  932 GLU B HB2  8  
ATOM   5907  H HB3  . GLU B 2 8  ? 11.125  -1.129  -2.141  1.00 15.00 ?  932 GLU B HB3  8  
ATOM   5908  H HG2  . GLU B 2 8  ? 12.490  0.983   -2.227  1.00 15.00 ?  932 GLU B HG2  8  
ATOM   5909  H HG3  . GLU B 2 8  ? 13.673  0.159   -1.211  1.00 15.00 ?  932 GLU B HG3  8  
ATOM   5910  N N    . THR B 2 9  ? 10.559  2.291   -0.667  1.00 15.00 ?  933 THR B N    8  
ATOM   5911  C CA   . THR B 2 9  ? 9.747   3.389   -1.159  1.00 15.00 ?  933 THR B CA   8  
ATOM   5912  C C    . THR B 2 9  ? 9.569   3.305   -2.673  1.00 15.00 ?  933 THR B C    8  
ATOM   5913  O O    . THR B 2 9  ? 10.531  3.313   -3.445  1.00 15.00 ?  933 THR B O    8  
ATOM   5914  C CB   . THR B 2 9  ? 10.318  4.765   -0.775  1.00 15.00 ?  933 THR B CB   8  
ATOM   5915  O OG1  . THR B 2 9  ? 10.592  4.795   0.632   1.00 15.00 ?  933 THR B OG1  8  
ATOM   5916  C CG2  . THR B 2 9  ? 9.316   5.865   -1.124  1.00 15.00 ?  933 THR B CG2  8  
ATOM   5917  H H    . THR B 2 9  ? 11.385  2.473   -0.173  1.00 15.00 ?  933 THR B H    8  
ATOM   5918  H HA   . THR B 2 9  ? 8.771   3.296   -0.699  1.00 15.00 ?  933 THR B HA   8  
ATOM   5919  H HB   . THR B 2 9  ? 11.231  4.935   -1.327  1.00 15.00 ?  933 THR B HB   8  
ATOM   5920  H HG1  . THR B 2 9  ? 9.807   4.520   1.113   1.00 15.00 ?  933 THR B HG1  8  
ATOM   5921  H HG21 . THR B 2 9  ? 8.379   5.675   -0.616  1.00 15.00 ?  933 THR B HG21 8  
ATOM   5922  H HG22 . THR B 2 9  ? 9.145   5.873   -2.191  1.00 15.00 ?  933 THR B HG22 8  
ATOM   5923  H HG23 . THR B 2 9  ? 9.706   6.821   -0.813  1.00 15.00 ?  933 THR B HG23 8  
ATOM   5924  N N    . PHE B 2 10 ? 8.312   3.195   -3.055  1.00 15.00 ?  934 PHE B N    8  
ATOM   5925  C CA   . PHE B 2 10 ? 7.894   3.151   -4.444  1.00 15.00 ?  934 PHE B CA   8  
ATOM   5926  C C    . PHE B 2 10 ? 7.741   4.585   -4.951  1.00 15.00 ?  934 PHE B C    8  
ATOM   5927  O O    . PHE B 2 10 ? 7.996   5.529   -4.196  1.00 15.00 ?  934 PHE B O    8  
ATOM   5928  C CB   . PHE B 2 10 ? 6.574   2.370   -4.563  1.00 15.00 ?  934 PHE B CB   8  
ATOM   5929  C CG   . PHE B 2 10 ? 5.378   3.172   -4.151  1.00 15.00 ?  934 PHE B CG   8  
ATOM   5930  C CD1  . PHE B 2 10 ? 5.341   3.799   -2.918  1.00 15.00 ?  934 PHE B CD1  8  
ATOM   5931  C CD2  . PHE B 2 10 ? 4.321   3.350   -5.020  1.00 15.00 ?  934 PHE B CD2  8  
ATOM   5932  C CE1  . PHE B 2 10 ? 4.271   4.580   -2.561  1.00 15.00 ?  934 PHE B CE1  8  
ATOM   5933  C CE2  . PHE B 2 10 ? 3.258   4.143   -4.672  1.00 15.00 ?  934 PHE B CE2  8  
ATOM   5934  C CZ   . PHE B 2 10 ? 3.233   4.757   -3.443  1.00 15.00 ?  934 PHE B CZ   8  
ATOM   5935  H H    . PHE B 2 10 ? 7.622   3.141   -2.365  1.00 15.00 ?  934 PHE B H    8  
ATOM   5936  H HA   . PHE B 2 10 ? 8.662   2.653   -5.013  1.00 15.00 ?  934 PHE B HA   8  
ATOM   5937  H HB2  . PHE B 2 10 ? 6.434   2.064   -5.588  1.00 15.00 ?  934 PHE B HB2  8  
ATOM   5938  H HB3  . PHE B 2 10 ? 6.623   1.496   -3.932  1.00 15.00 ?  934 PHE B HB3  8  
ATOM   5939  H HD1  . PHE B 2 10 ? 6.152   3.650   -2.225  1.00 15.00 ?  934 PHE B HD1  8  
ATOM   5940  H HD2  . PHE B 2 10 ? 4.330   2.855   -5.979  1.00 15.00 ?  934 PHE B HD2  8  
ATOM   5941  H HE1  . PHE B 2 10 ? 4.249   5.060   -1.596  1.00 15.00 ?  934 PHE B HE1  8  
ATOM   5942  H HE2  . PHE B 2 10 ? 2.434   4.277   -5.360  1.00 15.00 ?  934 PHE B HE2  8  
ATOM   5943  H HZ   . PHE B 2 10 ? 2.412   5.383   -3.180  1.00 15.00 ?  934 PHE B HZ   8  
ATOM   5944  N N    . GLU B 2 11 ? 7.346   4.753   -6.211  1.00 15.00 ?  935 GLU B N    8  
ATOM   5945  C CA   . GLU B 2 11 ? 7.234   6.084   -6.814  1.00 15.00 ?  935 GLU B CA   8  
ATOM   5946  C C    . GLU B 2 11 ? 6.464   7.047   -5.915  1.00 15.00 ?  935 GLU B C    8  
ATOM   5947  O O    . GLU B 2 11 ? 5.454   6.680   -5.304  1.00 15.00 ?  935 GLU B O    8  
ATOM   5948  C CB   . GLU B 2 11 ? 6.544   6.021   -8.181  1.00 15.00 ?  935 GLU B CB   8  
ATOM   5949  C CG   . GLU B 2 11 ? 5.382   5.039   -8.273  1.00 15.00 ?  935 GLU B CG   8  
ATOM   5950  C CD   . GLU B 2 11 ? 5.852   3.640   -8.611  1.00 15.00 ?  935 GLU B CD   8  
ATOM   5951  O OE1  . GLU B 2 11 ? 6.007   3.341   -9.810  1.00 15.00 ?  935 GLU B OE1  8  
ATOM   5952  O OE2  . GLU B 2 11 ? 6.076   2.844   -7.684  1.00 15.00 -1 935 GLU B OE2  8  
ATOM   5953  H H    . GLU B 2 11 ? 7.105   3.960   -6.748  1.00 15.00 ?  935 GLU B H    8  
ATOM   5954  H HA   . GLU B 2 11 ? 8.235   6.466   -6.949  1.00 15.00 ?  935 GLU B HA   8  
ATOM   5955  H HB2  . GLU B 2 11 ? 6.167   7.004   -8.421  1.00 15.00 ?  935 GLU B HB2  8  
ATOM   5956  H HB3  . GLU B 2 11 ? 7.278   5.743   -8.925  1.00 15.00 ?  935 GLU B HB3  8  
ATOM   5957  H HG2  . GLU B 2 11 ? 4.853   5.011   -7.322  1.00 15.00 ?  935 GLU B HG2  8  
ATOM   5958  H HG3  . GLU B 2 11 ? 4.708   5.372   -9.047  1.00 15.00 ?  935 GLU B HG3  8  
ATOM   5959  N N    . ASP B 2 12 ? 6.951   8.286   -5.862  1.00 15.00 ?  936 ASP B N    8  
ATOM   5960  C CA   . ASP B 2 12 ? 6.418   9.312   -4.964  1.00 15.00 ?  936 ASP B CA   8  
ATOM   5961  C C    . ASP B 2 12 ? 4.911   9.463   -5.088  1.00 15.00 ?  936 ASP B C    8  
ATOM   5962  O O    . ASP B 2 12 ? 4.363   9.568   -6.188  1.00 15.00 ?  936 ASP B O    8  
ATOM   5963  C CB   . ASP B 2 12 ? 7.089   10.663  -5.220  1.00 15.00 ?  936 ASP B CB   8  
ATOM   5964  C CG   . ASP B 2 12 ? 8.489   10.734  -4.652  1.00 15.00 ?  936 ASP B CG   8  
ATOM   5965  O OD1  . ASP B 2 12 ? 8.632   10.771  -3.414  1.00 15.00 -1 936 ASP B OD1  8  
ATOM   5966  O OD2  . ASP B 2 12 ? 9.459   10.764  -5.440  1.00 15.00 ?  936 ASP B OD2  8  
ATOM   5967  H H    . ASP B 2 12 ? 7.703   8.519   -6.453  1.00 15.00 ?  936 ASP B H    8  
ATOM   5968  H HA   . ASP B 2 12 ? 6.645   9.005   -3.954  1.00 15.00 ?  936 ASP B HA   8  
ATOM   5969  H HB2  . ASP B 2 12 ? 7.145   10.836  -6.285  1.00 15.00 ?  936 ASP B HB2  8  
ATOM   5970  H HB3  . ASP B 2 12 ? 6.496   11.443  -4.764  1.00 15.00 ?  936 ASP B HB3  8  
ATOM   5971  N N    . LEU B 2 13 ? 4.258   9.480   -3.939  1.00 15.00 ?  937 LEU B N    8  
ATOM   5972  C CA   . LEU B 2 13 ? 2.817   9.649   -3.858  1.00 15.00 ?  937 LEU B CA   8  
ATOM   5973  C C    . LEU B 2 13 ? 2.398   11.038  -4.338  1.00 15.00 ?  937 LEU B C    8  
ATOM   5974  O O    . LEU B 2 13 ? 3.060   12.037  -4.056  1.00 15.00 ?  937 LEU B O    8  
ATOM   5975  C CB   . LEU B 2 13 ? 2.294   9.344   -2.428  1.00 15.00 ?  937 LEU B CB   8  
ATOM   5976  C CG   . LEU B 2 13 ? 2.761   10.227  -1.236  1.00 15.00 ?  937 LEU B CG   8  
ATOM   5977  C CD1  . LEU B 2 13 ? 4.273   10.395  -1.184  1.00 15.00 ?  937 LEU B CD1  8  
ATOM   5978  C CD2  . LEU B 2 13 ? 2.065   11.582  -1.231  1.00 15.00 ?  937 LEU B CD2  8  
ATOM   5979  H H    . LEU B 2 13 ? 4.767   9.380   -3.108  1.00 15.00 ?  937 LEU B H    8  
ATOM   5980  H HA   . LEU B 2 13 ? 2.383   8.926   -4.535  1.00 15.00 ?  937 LEU B HA   8  
ATOM   5981  H HB2  . LEU B 2 13 ? 1.218   9.398   -2.462  1.00 15.00 ?  937 LEU B HB2  8  
ATOM   5982  H HB3  . LEU B 2 13 ? 2.563   8.322   -2.201  1.00 15.00 ?  937 LEU B HB3  8  
ATOM   5983  H HG   . LEU B 2 13 ? 2.475   9.723   -0.324  1.00 15.00 ?  937 LEU B HG   8  
ATOM   5984  H HD11 . LEU B 2 13 ? 4.535   11.028  -0.350  1.00 15.00 ?  937 LEU B HD11 8  
ATOM   5985  H HD12 . LEU B 2 13 ? 4.616   10.849  -2.102  1.00 15.00 ?  937 LEU B HD12 8  
ATOM   5986  H HD13 . LEU B 2 13 ? 4.739   9.429   -1.064  1.00 15.00 ?  937 LEU B HD13 8  
ATOM   5987  H HD21 . LEU B 2 13 ? 0.997   11.437  -1.161  1.00 15.00 ?  937 LEU B HD21 8  
ATOM   5988  H HD22 . LEU B 2 13 ? 2.298   12.109  -2.144  1.00 15.00 ?  937 LEU B HD22 8  
ATOM   5989  H HD23 . LEU B 2 13 ? 2.406   12.157  -0.384  1.00 15.00 ?  937 LEU B HD23 8  
HETATM 5990  N N    . NH2 B 2 14 ? 1.323   11.089  -5.111  1.00 15.00 ?  938 NH2 B N    8  
HETATM 5991  H HN1  . NH2 B 2 14 ? 0.846   10.254  -5.295  1.00 15.00 ?  938 NH2 B HN1  8  
HETATM 5992  H HN2  . NH2 B 2 14 ? 1.049   11.963  -5.466  1.00 15.00 ?  938 NH2 B HN2  8  
ATOM   5993  N N    . PHE A 1 7  ? -11.484 9.008   -2.229  1.00 15.00 ?  478 PHE A N    9  
ATOM   5994  C CA   . PHE A 1 7  ? -11.711 7.628   -1.737  1.00 15.00 ?  478 PHE A CA   9  
ATOM   5995  C C    . PHE A 1 7  ? -10.558 7.157   -0.859  1.00 15.00 ?  478 PHE A C    9  
ATOM   5996  O O    . PHE A 1 7  ? -10.704 6.216   -0.077  1.00 15.00 ?  478 PHE A O    9  
ATOM   5997  C CB   . PHE A 1 7  ? -11.901 6.649   -2.909  1.00 15.00 ?  478 PHE A CB   9  
ATOM   5998  C CG   . PHE A 1 7  ? -10.745 6.595   -3.880  1.00 15.00 ?  478 PHE A CG   9  
ATOM   5999  C CD1  . PHE A 1 7  ? -9.694  5.709   -3.685  1.00 15.00 ?  478 PHE A CD1  9  
ATOM   6000  C CD2  . PHE A 1 7  ? -10.714 7.426   -4.989  1.00 15.00 ?  478 PHE A CD2  9  
ATOM   6001  C CE1  . PHE A 1 7  ? -8.638  5.657   -4.577  1.00 15.00 ?  478 PHE A CE1  9  
ATOM   6002  C CE2  . PHE A 1 7  ? -9.661  7.377   -5.883  1.00 15.00 ?  478 PHE A CE2  9  
ATOM   6003  C CZ   . PHE A 1 7  ? -8.622  6.492   -5.677  1.00 15.00 ?  478 PHE A CZ   9  
ATOM   6004  H H    . PHE A 1 7  ? -12.229 9.273   -2.911  1.00 15.00 ?  478 PHE A H    9  
ATOM   6005  H HA   . PHE A 1 7  ? -12.612 7.633   -1.141  1.00 15.00 ?  478 PHE A HA   9  
ATOM   6006  H HB2  . PHE A 1 7  ? -12.042 5.655   -2.512  1.00 15.00 ?  478 PHE A HB2  9  
ATOM   6007  H HB3  . PHE A 1 7  ? -12.782 6.932   -3.460  1.00 15.00 ?  478 PHE A HB3  9  
ATOM   6008  H HD1  . PHE A 1 7  ? -9.706  5.055   -2.826  1.00 15.00 ?  478 PHE A HD1  9  
ATOM   6009  H HD2  . PHE A 1 7  ? -11.526 8.121   -5.153  1.00 15.00 ?  478 PHE A HD2  9  
ATOM   6010  H HE1  . PHE A 1 7  ? -7.826  4.964   -4.413  1.00 15.00 ?  478 PHE A HE1  9  
ATOM   6011  H HE2  . PHE A 1 7  ? -9.652  8.030   -6.743  1.00 15.00 ?  478 PHE A HE2  9  
ATOM   6012  H HZ   . PHE A 1 7  ? -7.798  6.453   -6.374  1.00 15.00 ?  478 PHE A HZ   9  
ATOM   6013  N N    . LEU A 1 8  ? -9.409  7.799   -0.996  1.00 15.00 ?  479 LEU A N    9  
ATOM   6014  C CA   . LEU A 1 8  ? -8.210  7.361   -0.306  1.00 15.00 ?  479 LEU A CA   9  
ATOM   6015  C C    . LEU A 1 8  ? -7.821  8.367   0.771   1.00 15.00 ?  479 LEU A C    9  
ATOM   6016  O O    . LEU A 1 8  ? -7.577  9.538   0.474   1.00 15.00 ?  479 LEU A O    9  
ATOM   6017  C CB   . LEU A 1 8  ? -7.076  7.199   -1.318  1.00 15.00 ?  479 LEU A CB   9  
ATOM   6018  C CG   . LEU A 1 8  ? -5.997  6.175   -0.961  1.00 15.00 ?  479 LEU A CG   9  
ATOM   6019  C CD1  . LEU A 1 8  ? -6.588  4.773   -0.916  1.00 15.00 ?  479 LEU A CD1  9  
ATOM   6020  C CD2  . LEU A 1 8  ? -4.877  6.235   -1.982  1.00 15.00 ?  479 LEU A CD2  9  
ATOM   6021  H H    . LEU A 1 8  ? -9.360  8.591   -1.577  1.00 15.00 ?  479 LEU A H    9  
ATOM   6022  H HA   . LEU A 1 8  ? -8.416  6.407   0.155   1.00 15.00 ?  479 LEU A HA   9  
ATOM   6023  H HB2  . LEU A 1 8  ? -7.509  6.910   -2.264  1.00 15.00 ?  479 LEU A HB2  9  
ATOM   6024  H HB3  . LEU A 1 8  ? -6.597  8.160   -1.444  1.00 15.00 ?  479 LEU A HB3  9  
ATOM   6025  H HG   . LEU A 1 8  ? -5.583  6.408   0.019   1.00 15.00 ?  479 LEU A HG   9  
ATOM   6026  H HD11 . LEU A 1 8  ? -7.114  4.577   -1.842  1.00 15.00 ?  479 LEU A HD11 9  
ATOM   6027  H HD12 . LEU A 1 8  ? -7.276  4.695   -0.086  1.00 15.00 ?  479 LEU A HD12 9  
ATOM   6028  H HD13 . LEU A 1 8  ? -5.792  4.045   -0.799  1.00 15.00 ?  479 LEU A HD13 9  
ATOM   6029  H HD21 . LEU A 1 8  ? -5.277  6.038   -2.964  1.00 15.00 ?  479 LEU A HD21 9  
ATOM   6030  H HD22 . LEU A 1 8  ? -4.132  5.491   -1.740  1.00 15.00 ?  479 LEU A HD22 9  
ATOM   6031  H HD23 . LEU A 1 8  ? -4.427  7.217   -1.965  1.00 15.00 ?  479 LEU A HD23 9  
ATOM   6032  N N    . PRO A 1 9  ? -7.787  7.925   2.035   1.00 15.00 ?  480 PRO A N    9  
ATOM   6033  C CA   . PRO A 1 9  ? -7.394  8.766   3.174   1.00 15.00 ?  480 PRO A CA   9  
ATOM   6034  C C    . PRO A 1 9  ? -6.032  9.437   2.970   1.00 15.00 ?  480 PRO A C    9  
ATOM   6035  O O    . PRO A 1 9  ? -5.154  8.876   2.315   1.00 15.00 ?  480 PRO A O    9  
ATOM   6036  C CB   . PRO A 1 9  ? -7.332  7.757   4.318   1.00 15.00 ?  480 PRO A CB   9  
ATOM   6037  C CG   . PRO A 1 9  ? -8.324  6.722   3.944   1.00 15.00 ?  480 PRO A CG   9  
ATOM   6038  C CD   . PRO A 1 9  ? -8.147  6.560   2.466   1.00 15.00 ?  480 PRO A CD   9  
ATOM   6039  H HA   . PRO A 1 9  ? -8.139  9.518   3.390   1.00 15.00 ?  480 PRO A HA   9  
ATOM   6040  H HB2  . PRO A 1 9  ? -6.343  7.344   4.369   1.00 15.00 ?  480 PRO A HB2  9  
ATOM   6041  H HB3  . PRO A 1 9  ? -7.580  8.233   5.251   1.00 15.00 ?  480 PRO A HB3  9  
ATOM   6042  H HG2  . PRO A 1 9  ? -8.109  5.797   4.458   1.00 15.00 ?  480 PRO A HG2  9  
ATOM   6043  H HG3  . PRO A 1 9  ? -9.325  7.062   4.170   1.00 15.00 ?  480 PRO A HG3  9  
ATOM   6044  H HD2  . PRO A 1 9  ? -7.349  5.862   2.253   1.00 15.00 ?  480 PRO A HD2  9  
ATOM   6045  H HD3  . PRO A 1 9  ? -9.064  6.240   2.008   1.00 15.00 ?  480 PRO A HD3  9  
ATOM   6046  N N    . PRO A 1 10 ? -5.850  10.633  3.571   1.00 15.00 ?  481 PRO A N    9  
ATOM   6047  C CA   . PRO A 1 10 ? -4.667  11.490  3.413   1.00 15.00 ?  481 PRO A CA   9  
ATOM   6048  C C    . PRO A 1 10 ? -3.346  10.743  3.184   1.00 15.00 ?  481 PRO A C    9  
ATOM   6049  O O    . PRO A 1 10 ? -2.797  10.779  2.083   1.00 15.00 ?  481 PRO A O    9  
ATOM   6050  C CB   . PRO A 1 10 ? -4.617  12.262  4.741   1.00 15.00 ?  481 PRO A CB   9  
ATOM   6051  C CG   . PRO A 1 10 ? -5.934  12.034  5.424   1.00 15.00 ?  481 PRO A CG   9  
ATOM   6052  C CD   . PRO A 1 10 ? -6.811  11.266  4.473   1.00 15.00 ?  481 PRO A CD   9  
ATOM   6053  H HA   . PRO A 1 10 ? -4.809  12.195  2.608   1.00 15.00 ?  481 PRO A HA   9  
ATOM   6054  H HB2  . PRO A 1 10 ? -3.800  11.889  5.340   1.00 15.00 ?  481 PRO A HB2  9  
ATOM   6055  H HB3  . PRO A 1 10 ? -4.461  13.312  4.537   1.00 15.00 ?  481 PRO A HB3  9  
ATOM   6056  H HG2  . PRO A 1 10 ? -5.779  11.461  6.327   1.00 15.00 ?  481 PRO A HG2  9  
ATOM   6057  H HG3  . PRO A 1 10 ? -6.388  12.984  5.663   1.00 15.00 ?  481 PRO A HG3  9  
ATOM   6058  H HD2  . PRO A 1 10 ? -7.388  10.523  5.003   1.00 15.00 ?  481 PRO A HD2  9  
ATOM   6059  H HD3  . PRO A 1 10 ? -7.462  11.938  3.933   1.00 15.00 ?  481 PRO A HD3  9  
ATOM   6060  N N    . GLY A 1 11 ? -2.847  10.054  4.208   1.00 15.00 ?  482 GLY A N    9  
ATOM   6061  C CA   . GLY A 1 11 ? -1.540  9.426   4.100   1.00 15.00 ?  482 GLY A CA   9  
ATOM   6062  C C    . GLY A 1 11 ? -1.606  7.997   3.625   1.00 15.00 ?  482 GLY A C    9  
ATOM   6063  O O    . GLY A 1 11 ? -0.606  7.283   3.665   1.00 15.00 ?  482 GLY A O    9  
ATOM   6064  H H    . GLY A 1 11 ? -3.372  9.961   5.036   1.00 15.00 ?  482 GLY A H    9  
ATOM   6065  H HA2  . GLY A 1 11 ? -0.943  9.992   3.404   1.00 15.00 ?  482 GLY A HA2  9  
ATOM   6066  H HA3  . GLY A 1 11 ? -1.052  9.445   5.060   1.00 15.00 ?  482 GLY A HA3  9  
ATOM   6067  N N    . TRP A 1 12 ? -2.769  7.570   3.177   1.00 15.00 ?  483 TRP A N    9  
ATOM   6068  C CA   . TRP A 1 12 ? -2.909  6.241   2.621   1.00 15.00 ?  483 TRP A CA   9  
ATOM   6069  C C    . TRP A 1 12 ? -2.648  6.294   1.135   1.00 15.00 ?  483 TRP A C    9  
ATOM   6070  O O    . TRP A 1 12 ? -3.316  7.017   0.405   1.00 15.00 ?  483 TRP A O    9  
ATOM   6071  C CB   . TRP A 1 12 ? -4.297  5.662   2.897   1.00 15.00 ?  483 TRP A CB   9  
ATOM   6072  C CG   . TRP A 1 12 ? -4.507  5.311   4.334   1.00 15.00 ?  483 TRP A CG   9  
ATOM   6073  C CD1  . TRP A 1 12 ? -4.711  6.182   5.356   1.00 15.00 ?  483 TRP A CD1  9  
ATOM   6074  C CD2  . TRP A 1 12 ? -4.528  4.000   4.907   1.00 15.00 ?  483 TRP A CD2  9  
ATOM   6075  N NE1  . TRP A 1 12 ? -4.863  5.498   6.537   1.00 15.00 ?  483 TRP A NE1  9  
ATOM   6076  C CE2  . TRP A 1 12 ? -4.754  4.154   6.287   1.00 15.00 ?  483 TRP A CE2  9  
ATOM   6077  C CE3  . TRP A 1 12 ? -4.381  2.711   4.390   1.00 15.00 ?  483 TRP A CE3  9  
ATOM   6078  C CZ2  . TRP A 1 12 ? -4.839  3.065   7.153   1.00 15.00 ?  483 TRP A CZ2  9  
ATOM   6079  C CZ3  . TRP A 1 12 ? -4.462  1.635   5.249   1.00 15.00 ?  483 TRP A CZ3  9  
ATOM   6080  C CH2  . TRP A 1 12 ? -4.691  1.818   6.618   1.00 15.00 ?  483 TRP A CH2  9  
ATOM   6081  H H    . TRP A 1 12 ? -3.545  8.172   3.194   1.00 15.00 ?  483 TRP A H    9  
ATOM   6082  H HA   . TRP A 1 12 ? -2.166  5.610   3.084   1.00 15.00 ?  483 TRP A HA   9  
ATOM   6083  H HB2  . TRP A 1 12 ? -5.047  6.386   2.616   1.00 15.00 ?  483 TRP A HB2  9  
ATOM   6084  H HB3  . TRP A 1 12 ? -4.429  4.764   2.311   1.00 15.00 ?  483 TRP A HB3  9  
ATOM   6085  H HD1  . TRP A 1 12 ? -4.750  7.255   5.232   1.00 15.00 ?  483 TRP A HD1  9  
ATOM   6086  H HE1  . TRP A 1 12 ? -5.020  5.906   7.421   1.00 15.00 ?  483 TRP A HE1  9  
ATOM   6087  H HE3  . TRP A 1 12 ? -4.206  2.549   3.340   1.00 15.00 ?  483 TRP A HE3  9  
ATOM   6088  H HZ2  . TRP A 1 12 ? -5.023  3.187   8.209   1.00 15.00 ?  483 TRP A HZ2  9  
ATOM   6089  H HZ3  . TRP A 1 12 ? -4.351  0.632   4.867   1.00 15.00 ?  483 TRP A HZ3  9  
ATOM   6090  H HH2  . TRP A 1 12 ? -4.747  0.947   7.252   1.00 15.00 ?  483 TRP A HH2  9  
ATOM   6091  N N    . GLU A 1 13 ? -1.646  5.558   0.710   1.00 15.00 ?  484 GLU A N    9  
ATOM   6092  C CA   . GLU A 1 13 ? -1.290  5.480   -0.686  1.00 15.00 ?  484 GLU A CA   9  
ATOM   6093  C C    . GLU A 1 13 ? -1.755  4.146   -1.244  1.00 15.00 ?  484 GLU A C    9  
ATOM   6094  O O    . GLU A 1 13 ? -1.643  3.124   -0.583  1.00 15.00 ?  484 GLU A O    9  
ATOM   6095  C CB   . GLU A 1 13 ? 0.220   5.612   -0.838  1.00 15.00 ?  484 GLU A CB   9  
ATOM   6096  C CG   . GLU A 1 13 ? 0.647   6.679   -1.826  1.00 15.00 ?  484 GLU A CG   9  
ATOM   6097  C CD   . GLU A 1 13 ? 0.177   8.062   -1.434  1.00 15.00 ?  484 GLU A CD   9  
ATOM   6098  O OE1  . GLU A 1 13 ? 0.824   8.684   -0.571  1.00 15.00 ?  484 GLU A OE1  9  
ATOM   6099  O OE2  . GLU A 1 13 ? -0.829  8.536   -2.006  1.00 15.00 -1 484 GLU A OE2  9  
ATOM   6100  H H    . GLU A 1 13 ? -1.118  5.051   1.363   1.00 15.00 ?  484 GLU A H    9  
ATOM   6101  H HA   . GLU A 1 13 ? -1.779  6.285   -1.214  1.00 15.00 ?  484 GLU A HA   9  
ATOM   6102  H HB2  . GLU A 1 13 ? 0.649   5.852   0.124   1.00 15.00 ?  484 GLU A HB2  9  
ATOM   6103  H HB3  . GLU A 1 13 ? 0.613   4.669   -1.172  1.00 15.00 ?  484 GLU A HB3  9  
ATOM   6104  H HG2  . GLU A 1 13 ? 1.725   6.685   -1.889  1.00 15.00 ?  484 GLU A HG2  9  
ATOM   6105  H HG3  . GLU A 1 13 ? 0.235   6.437   -2.784  1.00 15.00 ?  484 GLU A HG3  9  
ATOM   6106  N N    . MET A 1 14 ? -2.255  4.146   -2.457  1.00 15.00 ?  485 MET A N    9  
ATOM   6107  C CA   . MET A 1 14 ? -2.733  2.916   -3.072  1.00 15.00 ?  485 MET A CA   9  
ATOM   6108  C C    . MET A 1 14 ? -1.974  2.671   -4.371  1.00 15.00 ?  485 MET A C    9  
ATOM   6109  O O    . MET A 1 14 ? -2.162  3.392   -5.349  1.00 15.00 ?  485 MET A O    9  
ATOM   6110  C CB   . MET A 1 14 ? -4.241  3.000   -3.345  1.00 15.00 ?  485 MET A CB   9  
ATOM   6111  C CG   . MET A 1 14 ? -4.846  1.685   -3.808  1.00 15.00 ?  485 MET A CG   9  
ATOM   6112  S SD   . MET A 1 14 ? -6.468  1.865   -4.583  1.00 15.00 ?  485 MET A SD   9  
ATOM   6113  C CE   . MET A 1 14 ? -7.474  2.377   -3.197  1.00 15.00 ?  485 MET A CE   9  
ATOM   6114  H H    . MET A 1 14 ? -2.295  4.985   -2.957  1.00 15.00 ?  485 MET A H    9  
ATOM   6115  H HA   . MET A 1 14 ? -2.538  2.095   -2.386  1.00 15.00 ?  485 MET A HA   9  
ATOM   6116  H HB2  . MET A 1 14 ? -4.744  3.303   -2.439  1.00 15.00 ?  485 MET A HB2  9  
ATOM   6117  H HB3  . MET A 1 14 ? -4.417  3.742   -4.110  1.00 15.00 ?  485 MET A HB3  9  
ATOM   6118  H HG2  . MET A 1 14 ? -4.181  1.238   -4.514  1.00 15.00 ?  485 MET A HG2  9  
ATOM   6119  H HG3  . MET A 1 14 ? -4.946  1.034   -2.953  1.00 15.00 ?  485 MET A HG3  9  
ATOM   6120  H HE1  . MET A 1 14 ? -7.445  1.616   -2.431  1.00 15.00 ?  485 MET A HE1  9  
ATOM   6121  H HE2  . MET A 1 14 ? -8.493  2.521   -3.525  1.00 15.00 ?  485 MET A HE2  9  
ATOM   6122  H HE3  . MET A 1 14 ? -7.090  3.303   -2.797  1.00 15.00 ?  485 MET A HE3  9  
ATOM   6123  N N    . ARG A 1 15 ? -1.085  1.687   -4.360  1.00 15.00 ?  486 ARG A N    9  
ATOM   6124  C CA   . ARG A 1 15 ? -0.267  1.380   -5.531  1.00 15.00 ?  486 ARG A CA   9  
ATOM   6125  C C    . ARG A 1 15 ? -0.399  -0.087  -5.893  1.00 15.00 ?  486 ARG A C    9  
ATOM   6126  O O    . ARG A 1 15 ? -0.315  -0.956  -5.028  1.00 15.00 ?  486 ARG A O    9  
ATOM   6127  C CB   . ARG A 1 15 ? 1.203   1.707   -5.267  1.00 15.00 ?  486 ARG A CB   9  
ATOM   6128  C CG   . ARG A 1 15 ? 1.460   3.169   -4.933  1.00 15.00 ?  486 ARG A CG   9  
ATOM   6129  C CD   . ARG A 1 15 ? 1.173   4.074   -6.123  1.00 15.00 ?  486 ARG A CD   9  
ATOM   6130  N NE   . ARG A 1 15 ? 2.056   3.794   -7.255  1.00 15.00 ?  486 ARG A NE   9  
ATOM   6131  C CZ   . ARG A 1 15 ? 1.700   3.919   -8.533  1.00 15.00 ?  486 ARG A CZ   9  
ATOM   6132  N NH1  . ARG A 1 15 ? 0.486   4.359   -8.855  1.00 15.00 1  486 ARG A NH1  9  
ATOM   6133  N NH2  . ARG A 1 15 ? 2.567   3.623   -9.486  1.00 15.00 ?  486 ARG A NH2  9  
ATOM   6134  H H    . ARG A 1 15 ? -0.979  1.144   -3.548  1.00 15.00 ?  486 ARG A H    9  
ATOM   6135  H HA   . ARG A 1 15 ? -0.622  1.981   -6.354  1.00 15.00 ?  486 ARG A HA   9  
ATOM   6136  H HB2  . ARG A 1 15 ? 1.547   1.103   -4.445  1.00 15.00 ?  486 ARG A HB2  9  
ATOM   6137  H HB3  . ARG A 1 15 ? 1.775   1.457   -6.148  1.00 15.00 ?  486 ARG A HB3  9  
ATOM   6138  H HG2  . ARG A 1 15 ? 0.822   3.458   -4.113  1.00 15.00 ?  486 ARG A HG2  9  
ATOM   6139  H HG3  . ARG A 1 15 ? 2.496   3.283   -4.645  1.00 15.00 ?  486 ARG A HG3  9  
ATOM   6140  H HD2  . ARG A 1 15 ? 0.149   3.923   -6.432  1.00 15.00 ?  486 ARG A HD2  9  
ATOM   6141  H HD3  . ARG A 1 15 ? 1.309   5.100   -5.816  1.00 15.00 ?  486 ARG A HD3  9  
ATOM   6142  H HE   . ARG A 1 15 ? 2.970   3.491   -7.050  1.00 15.00 ?  486 ARG A HE   9  
ATOM   6143  H HH11 . ARG A 1 15 ? -0.176  4.607   -8.134  1.00 15.00 ?  486 ARG A HH11 9  
ATOM   6144  H HH12 . ARG A 1 15 ? 0.221   4.449   -9.819  1.00 15.00 ?  486 ARG A HH12 9  
ATOM   6145  H HH21 . ARG A 1 15 ? 3.500   3.306   -9.244  1.00 15.00 ?  486 ARG A HH21 9  
ATOM   6146  H HH22 . ARG A 1 15 ? 2.305   3.703   -10.456 1.00 15.00 ?  486 ARG A HH22 9  
ATOM   6147  N N    . ILE A 1 16 ? -0.571  -0.360  -7.173  1.00 15.00 ?  487 ILE A N    9  
ATOM   6148  C CA   . ILE A 1 16 ? -0.816  -1.718  -7.632  1.00 15.00 ?  487 ILE A CA   9  
ATOM   6149  C C    . ILE A 1 16 ? 0.407   -2.329  -8.303  1.00 15.00 ?  487 ILE A C    9  
ATOM   6150  O O    . ILE A 1 16 ? 1.029   -1.735  -9.187  1.00 15.00 ?  487 ILE A O    9  
ATOM   6151  C CB   . ILE A 1 16 ? -2.049  -1.795  -8.564  1.00 15.00 ?  487 ILE A CB   9  
ATOM   6152  C CG1  . ILE A 1 16 ? -2.216  -3.208  -9.135  1.00 15.00 ?  487 ILE A CG1  9  
ATOM   6153  C CG2  . ILE A 1 16 ? -1.957  -0.765  -9.679  1.00 15.00 ?  487 ILE A CG2  9  
ATOM   6154  C CD1  . ILE A 1 16 ? -3.463  -3.379  -9.977  1.00 15.00 ?  487 ILE A CD1  9  
ATOM   6155  H H    . ILE A 1 16 ? -0.513  0.365   -7.828  1.00 15.00 ?  487 ILE A H    9  
ATOM   6156  H HA   . ILE A 1 16 ? -1.032  -2.313  -6.761  1.00 15.00 ?  487 ILE A HA   9  
ATOM   6157  H HB   . ILE A 1 16 ? -2.920  -1.556  -7.973  1.00 15.00 ?  487 ILE A HB   9  
ATOM   6158  H HG12 . ILE A 1 16 ? -1.364  -3.444  -9.755  1.00 15.00 ?  487 ILE A HG12 9  
ATOM   6159  H HG13 . ILE A 1 16 ? -2.268  -3.915  -8.318  1.00 15.00 ?  487 ILE A HG13 9  
ATOM   6160  H HG21 . ILE A 1 16 ? -1.075  -0.952  -10.272 1.00 15.00 ?  487 ILE A HG21 9  
ATOM   6161  H HG22 . ILE A 1 16 ? -1.901  0.226   -9.249  1.00 15.00 ?  487 ILE A HG22 9  
ATOM   6162  H HG23 . ILE A 1 16 ? -2.834  -0.837  -10.303 1.00 15.00 ?  487 ILE A HG23 9  
ATOM   6163  H HD11 . ILE A 1 16 ? -4.334  -3.179  -9.373  1.00 15.00 ?  487 ILE A HD11 9  
ATOM   6164  H HD12 . ILE A 1 16 ? -3.509  -4.391  -10.351 1.00 15.00 ?  487 ILE A HD12 9  
ATOM   6165  H HD13 . ILE A 1 16 ? -3.435  -2.689  -10.808 1.00 15.00 ?  487 ILE A HD13 9  
ATOM   6166  N N    . ALA A 1 17 ? 0.740   -3.526  -7.845  1.00 15.00 ?  488 ALA A N    9  
ATOM   6167  C CA   . ALA A 1 17 ? 1.856   -4.291  -8.372  1.00 15.00 ?  488 ALA A CA   9  
ATOM   6168  C C    . ALA A 1 17 ? 1.382   -5.175  -9.523  1.00 15.00 ?  488 ALA A C    9  
ATOM   6169  O O    . ALA A 1 17 ? 0.224   -5.589  -9.544  1.00 15.00 ?  488 ALA A O    9  
ATOM   6170  C CB   . ALA A 1 17 ? 2.487   -5.129  -7.266  1.00 15.00 ?  488 ALA A CB   9  
ATOM   6171  H H    . ALA A 1 17 ? 0.195   -3.919  -7.125  1.00 15.00 ?  488 ALA A H    9  
ATOM   6172  H HA   . ALA A 1 17 ? 2.596   -3.595  -8.740  1.00 15.00 ?  488 ALA A HA   9  
ATOM   6173  H HB1  . ALA A 1 17 ? 1.763   -5.835  -6.890  1.00 15.00 ?  488 ALA A HB1  9  
ATOM   6174  H HB2  . ALA A 1 17 ? 2.810   -4.480  -6.462  1.00 15.00 ?  488 ALA A HB2  9  
ATOM   6175  H HB3  . ALA A 1 17 ? 3.338   -5.661  -7.660  1.00 15.00 ?  488 ALA A HB3  9  
ATOM   6176  N N    . PRO A 1 18 ? 2.270   -5.464  -10.495 1.00 15.00 ?  489 PRO A N    9  
ATOM   6177  C CA   . PRO A 1 18 ? 1.934   -6.215  -11.725 1.00 15.00 ?  489 PRO A CA   9  
ATOM   6178  C C    . PRO A 1 18 ? 1.347   -7.613  -11.486 1.00 15.00 ?  489 PRO A C    9  
ATOM   6179  O O    . PRO A 1 18 ? 0.988   -8.308  -12.439 1.00 15.00 ?  489 PRO A O    9  
ATOM   6180  C CB   . PRO A 1 18 ? 3.278   -6.337  -12.455 1.00 15.00 ?  489 PRO A CB   9  
ATOM   6181  C CG   . PRO A 1 18 ? 4.312   -6.052  -11.424 1.00 15.00 ?  489 PRO A CG   9  
ATOM   6182  C CD   . PRO A 1 18 ? 3.687   -5.072  -10.480 1.00 15.00 ?  489 PRO A CD   9  
ATOM   6183  H HA   . PRO A 1 18 ? 1.252   -5.653  -12.343 1.00 15.00 ?  489 PRO A HA   9  
ATOM   6184  H HB2  . PRO A 1 18 ? 3.383   -7.336  -12.853 1.00 15.00 ?  489 PRO A HB2  9  
ATOM   6185  H HB3  . PRO A 1 18 ? 3.321   -5.620  -13.261 1.00 15.00 ?  489 PRO A HB3  9  
ATOM   6186  H HG2  . PRO A 1 18 ? 4.571   -6.962  -10.902 1.00 15.00 ?  489 PRO A HG2  9  
ATOM   6187  H HG3  . PRO A 1 18 ? 5.187   -5.622  -11.888 1.00 15.00 ?  489 PRO A HG3  9  
ATOM   6188  H HD2  . PRO A 1 18 ? 4.106   -5.175  -9.491  1.00 15.00 ?  489 PRO A HD2  9  
ATOM   6189  H HD3  . PRO A 1 18 ? 3.810   -4.064  -10.845 1.00 15.00 ?  489 PRO A HD3  9  
ATOM   6190  N N    . ASN A 1 19 ? 1.264   -8.034  -10.231 1.00 15.00 ?  490 ASN A N    9  
ATOM   6191  C CA   . ASN A 1 19 ? 0.654   -9.318  -9.901  1.00 15.00 ?  490 ASN A CA   9  
ATOM   6192  C C    . ASN A 1 19 ? -0.814  -9.140  -9.516  1.00 15.00 ?  490 ASN A C    9  
ATOM   6193  O O    . ASN A 1 19 ? -1.498  -10.105 -9.180  1.00 15.00 ?  490 ASN A O    9  
ATOM   6194  C CB   . ASN A 1 19 ? 1.423   -10.046 -8.787  1.00 15.00 ?  490 ASN A CB   9  
ATOM   6195  C CG   . ASN A 1 19 ? 1.782   -9.157  -7.613  1.00 15.00 ?  490 ASN A CG   9  
ATOM   6196  O OD1  . ASN A 1 19 ? 1.123   -8.156  -7.342  1.00 15.00 ?  490 ASN A OD1  9  
ATOM   6197  N ND2  . ASN A 1 19 ? 2.834   -9.525  -6.898  1.00 15.00 ?  490 ASN A ND2  9  
ATOM   6198  H H    . ASN A 1 19 ? 1.608   -7.467  -9.511  1.00 15.00 ?  490 ASN A H    9  
ATOM   6199  H HA   . ASN A 1 19 ? 0.692   -9.925  -10.795 1.00 15.00 ?  490 ASN A HA   9  
ATOM   6200  H HB2  . ASN A 1 19 ? 0.816   -10.857 -8.416  1.00 15.00 ?  490 ASN A HB2  9  
ATOM   6201  H HB3  . ASN A 1 19 ? 2.337   -10.451 -9.198  1.00 15.00 ?  490 ASN A HB3  9  
ATOM   6202  H HD21 . ASN A 1 19 ? 3.315   -10.342 -7.165  1.00 15.00 ?  490 ASN A HD21 9  
ATOM   6203  H HD22 . ASN A 1 19 ? 3.090   -8.975  -6.134  1.00 15.00 ?  490 ASN A HD22 9  
ATOM   6204  N N    . GLY A 1 20 ? -1.291  -7.900  -9.570  1.00 15.00 ?  491 GLY A N    9  
ATOM   6205  C CA   . GLY A 1 20 ? -2.711  -7.643  -9.402  1.00 15.00 ?  491 GLY A CA   9  
ATOM   6206  C C    . GLY A 1 20 ? -3.109  -7.262  -7.990  1.00 15.00 ?  491 GLY A C    9  
ATOM   6207  O O    . GLY A 1 20 ? -4.191  -7.626  -7.528  1.00 15.00 ?  491 GLY A O    9  
ATOM   6208  H H    . GLY A 1 20 ? -0.672  -7.153  -9.731  1.00 15.00 ?  491 GLY A H    9  
ATOM   6209  H HA2  . GLY A 1 20 ? -2.992  -6.840  -10.062 1.00 15.00 ?  491 GLY A HA2  9  
ATOM   6210  H HA3  . GLY A 1 20 ? -3.255  -8.531  -9.687  1.00 15.00 ?  491 GLY A HA3  9  
ATOM   6211  N N    . ARG A 1 21 ? -2.256  -6.518  -7.303  1.00 15.00 ?  492 ARG A N    9  
ATOM   6212  C CA   . ARG A 1 21 ? -2.558  -6.108  -5.935  1.00 15.00 ?  492 ARG A CA   9  
ATOM   6213  C C    . ARG A 1 21 ? -2.227  -4.635  -5.696  1.00 15.00 ?  492 ARG A C    9  
ATOM   6214  O O    . ARG A 1 21 ? -1.093  -4.200  -5.903  1.00 15.00 ?  492 ARG A O    9  
ATOM   6215  C CB   . ARG A 1 21 ? -1.787  -6.966  -4.929  1.00 15.00 ?  492 ARG A CB   9  
ATOM   6216  C CG   . ARG A 1 21 ? -0.280  -6.848  -5.050  1.00 15.00 ?  492 ARG A CG   9  
ATOM   6217  C CD   . ARG A 1 21 ? 0.437   -7.589  -3.939  1.00 15.00 ?  492 ARG A CD   9  
ATOM   6218  N NE   . ARG A 1 21 ? 1.887   -7.487  -4.076  1.00 15.00 ?  492 ARG A NE   9  
ATOM   6219  C CZ   . ARG A 1 21 ? 2.739   -8.442  -3.713  1.00 15.00 ?  492 ARG A CZ   9  
ATOM   6220  N NH1  . ARG A 1 21 ? 2.293   -9.559  -3.158  1.00 15.00 1  492 ARG A NH1  9  
ATOM   6221  N NH2  . ARG A 1 21 ? 4.042   -8.279  -3.908  1.00 15.00 ?  492 ARG A NH2  9  
ATOM   6222  H H    . ARG A 1 21 ? -1.417  -6.237  -7.719  1.00 15.00 ?  492 ARG A H    9  
ATOM   6223  H HA   . ARG A 1 21 ? -3.614  -6.258  -5.774  1.00 15.00 ?  492 ARG A HA   9  
ATOM   6224  H HB2  . ARG A 1 21 ? -2.066  -6.660  -3.931  1.00 15.00 ?  492 ARG A HB2  9  
ATOM   6225  H HB3  . ARG A 1 21 ? -2.062  -8.002  -5.068  1.00 15.00 ?  492 ARG A HB3  9  
ATOM   6226  H HG2  . ARG A 1 21 ? 0.027   -7.260  -5.999  1.00 15.00 ?  492 ARG A HG2  9  
ATOM   6227  H HG3  . ARG A 1 21 ? -0.006  -5.802  -5.007  1.00 15.00 ?  492 ARG A HG3  9  
ATOM   6228  H HD2  . ARG A 1 21 ? 0.141   -7.165  -2.991  1.00 15.00 ?  492 ARG A HD2  9  
ATOM   6229  H HD3  . ARG A 1 21 ? 0.152   -8.631  -3.973  1.00 15.00 ?  492 ARG A HD3  9  
ATOM   6230  H HE   . ARG A 1 21 ? 2.241   -6.662  -4.472  1.00 15.00 ?  492 ARG A HE   9  
ATOM   6231  H HH11 . ARG A 1 21 ? 1.313   -9.694  -3.009  1.00 15.00 ?  492 ARG A HH11 9  
ATOM   6232  H HH12 . ARG A 1 21 ? 2.945   -10.273 -2.869  1.00 15.00 ?  492 ARG A HH12 9  
ATOM   6233  H HH21 . ARG A 1 21 ? 4.394   -7.438  -4.320  1.00 15.00 ?  492 ARG A HH21 9  
ATOM   6234  H HH22 . ARG A 1 21 ? 4.689   -9.017  -3.656  1.00 15.00 ?  492 ARG A HH22 9  
ATOM   6235  N N    . PRO A 1 22 ? -3.216  -3.848  -5.259  1.00 15.00 ?  493 PRO A N    9  
ATOM   6236  C CA   . PRO A 1 22 ? -2.989  -2.508  -4.744  1.00 15.00 ?  493 PRO A CA   9  
ATOM   6237  C C    . PRO A 1 22 ? -2.736  -2.531  -3.243  1.00 15.00 ?  493 PRO A C    9  
ATOM   6238  O O    . PRO A 1 22 ? -3.640  -2.805  -2.451  1.00 15.00 ?  493 PRO A O    9  
ATOM   6239  C CB   . PRO A 1 22 ? -4.299  -1.768  -5.059  1.00 15.00 ?  493 PRO A CB   9  
ATOM   6240  C CG   . PRO A 1 22 ? -5.250  -2.802  -5.589  1.00 15.00 ?  493 PRO A CG   9  
ATOM   6241  C CD   . PRO A 1 22 ? -4.643  -4.149  -5.302  1.00 15.00 ?  493 PRO A CD   9  
ATOM   6242  H HA   . PRO A 1 22 ? -2.167  -2.019  -5.235  1.00 15.00 ?  493 PRO A HA   9  
ATOM   6243  H HB2  . PRO A 1 22 ? -4.679  -1.313  -4.155  1.00 15.00 ?  493 PRO A HB2  9  
ATOM   6244  H HB3  . PRO A 1 22 ? -4.107  -1.001  -5.794  1.00 15.00 ?  493 PRO A HB3  9  
ATOM   6245  H HG2  . PRO A 1 22 ? -6.202  -2.712  -5.089  1.00 15.00 ?  493 PRO A HG2  9  
ATOM   6246  H HG3  . PRO A 1 22 ? -5.376  -2.668  -6.655  1.00 15.00 ?  493 PRO A HG3  9  
ATOM   6247  H HD2  . PRO A 1 22 ? -4.989  -4.526  -4.356  1.00 15.00 ?  493 PRO A HD2  9  
ATOM   6248  H HD3  . PRO A 1 22 ? -4.871  -4.841  -6.098  1.00 15.00 ?  493 PRO A HD3  9  
ATOM   6249  N N    . PHE A 1 23 ? -1.486  -2.297  -2.865  1.00 15.00 ?  494 PHE A N    9  
ATOM   6250  C CA   . PHE A 1 23 ? -1.106  -2.283  -1.464  1.00 15.00 ?  494 PHE A CA   9  
ATOM   6251  C C    . PHE A 1 23 ? -1.249  -0.882  -0.896  1.00 15.00 ?  494 PHE A C    9  
ATOM   6252  O O    . PHE A 1 23 ? -0.898  0.108   -1.547  1.00 15.00 ?  494 PHE A O    9  
ATOM   6253  C CB   . PHE A 1 23 ? 0.321   -2.828  -1.255  1.00 15.00 ?  494 PHE A CB   9  
ATOM   6254  C CG   . PHE A 1 23 ? 1.392   -2.272  -2.169  1.00 15.00 ?  494 PHE A CG   9  
ATOM   6255  C CD1  . PHE A 1 23 ? 1.964   -1.028  -1.937  1.00 15.00 ?  494 PHE A CD1  9  
ATOM   6256  C CD2  . PHE A 1 23 ? 1.853   -3.021  -3.241  1.00 15.00 ?  494 PHE A CD2  9  
ATOM   6257  C CE1  . PHE A 1 23 ? 2.969   -0.539  -2.760  1.00 15.00 ?  494 PHE A CE1  9  
ATOM   6258  C CE2  . PHE A 1 23 ? 2.852   -2.540  -4.066  1.00 15.00 ?  494 PHE A CE2  9  
ATOM   6259  C CZ   . PHE A 1 23 ? 3.411   -1.300  -3.824  1.00 15.00 ?  494 PHE A CZ   9  
ATOM   6260  H H    . PHE A 1 23 ? -0.807  -2.110  -3.549  1.00 15.00 ?  494 PHE A H    9  
ATOM   6261  H HA   . PHE A 1 23 ? -1.800  -2.926  -0.940  1.00 15.00 ?  494 PHE A HA   9  
ATOM   6262  H HB2  . PHE A 1 23 ? 0.624   -2.615  -0.242  1.00 15.00 ?  494 PHE A HB2  9  
ATOM   6263  H HB3  . PHE A 1 23 ? 0.302   -3.901  -1.391  1.00 15.00 ?  494 PHE A HB3  9  
ATOM   6264  H HD1  . PHE A 1 23 ? 1.616   -0.434  -1.105  1.00 15.00 ?  494 PHE A HD1  9  
ATOM   6265  H HD2  . PHE A 1 23 ? 1.418   -3.991  -3.435  1.00 15.00 ?  494 PHE A HD2  9  
ATOM   6266  H HE1  . PHE A 1 23 ? 3.410   0.440   -2.567  1.00 15.00 ?  494 PHE A HE1  9  
ATOM   6267  H HE2  . PHE A 1 23 ? 3.201   -3.139  -4.895  1.00 15.00 ?  494 PHE A HE2  9  
ATOM   6268  H HZ   . PHE A 1 23 ? 4.193   -0.924  -4.468  1.00 15.00 ?  494 PHE A HZ   9  
ATOM   6269  N N    . PHE A 1 24 ? -1.775  -0.802  0.314   1.00 15.00 ?  495 PHE A N    9  
ATOM   6270  C CA   . PHE A 1 24 ? -2.031  0.477   0.942   1.00 15.00 ?  495 PHE A CA   9  
ATOM   6271  C C    . PHE A 1 24 ? -0.851  0.881   1.812   1.00 15.00 ?  495 PHE A C    9  
ATOM   6272  O O    . PHE A 1 24 ? -0.620  0.310   2.876   1.00 15.00 ?  495 PHE A O    9  
ATOM   6273  C CB   . PHE A 1 24 ? -3.309  0.431   1.782   1.00 15.00 ?  495 PHE A CB   9  
ATOM   6274  C CG   . PHE A 1 24 ? -4.509  -0.085  1.042   1.00 15.00 ?  495 PHE A CG   9  
ATOM   6275  C CD1  . PHE A 1 24 ? -5.192  0.730   0.154   1.00 15.00 ?  495 PHE A CD1  9  
ATOM   6276  C CD2  . PHE A 1 24 ? -4.956  -1.381  1.239   1.00 15.00 ?  495 PHE A CD2  9  
ATOM   6277  C CE1  . PHE A 1 24 ? -6.299  0.259   -0.525  1.00 15.00 ?  495 PHE A CE1  9  
ATOM   6278  C CE2  . PHE A 1 24 ? -6.063  -1.857  0.565   1.00 15.00 ?  495 PHE A CE2  9  
ATOM   6279  C CZ   . PHE A 1 24 ? -6.736  -1.035  -0.320  1.00 15.00 ?  495 PHE A CZ   9  
ATOM   6280  H H    . PHE A 1 24 ? -1.987  -1.627  0.800   1.00 15.00 ?  495 PHE A H    9  
ATOM   6281  H HA   . PHE A 1 24 ? -2.153  1.213   0.157   1.00 15.00 ?  495 PHE A HA   9  
ATOM   6282  H HB2  . PHE A 1 24 ? -3.150  -0.204  2.637   1.00 15.00 ?  495 PHE A HB2  9  
ATOM   6283  H HB3  . PHE A 1 24 ? -3.534  1.426   2.119   1.00 15.00 ?  495 PHE A HB3  9  
ATOM   6284  H HD1  . PHE A 1 24 ? -4.851  1.742   -0.005  1.00 15.00 ?  495 PHE A HD1  9  
ATOM   6285  H HD2  . PHE A 1 24 ? -4.431  -2.024  1.931   1.00 15.00 ?  495 PHE A HD2  9  
ATOM   6286  H HE1  . PHE A 1 24 ? -6.825  0.905   -1.214  1.00 15.00 ?  495 PHE A HE1  9  
ATOM   6287  H HE2  . PHE A 1 24 ? -6.401  -2.870  0.730   1.00 15.00 ?  495 PHE A HE2  9  
ATOM   6288  H HZ   . PHE A 1 24 ? -7.601  -1.404  -0.851  1.00 15.00 ?  495 PHE A HZ   9  
ATOM   6289  N N    . ILE A 1 25 ? -0.085  1.840   1.332   1.00 15.00 ?  496 ILE A N    9  
ATOM   6290  C CA   . ILE A 1 25 ? 1.044   2.357   2.071   1.00 15.00 ?  496 ILE A CA   9  
ATOM   6291  C C    . ILE A 1 25 ? 0.594   3.512   2.918   1.00 15.00 ?  496 ILE A C    9  
ATOM   6292  O O    . ILE A 1 25 ? 0.366   4.600   2.398   1.00 15.00 ?  496 ILE A O    9  
ATOM   6293  C CB   . ILE A 1 25 ? 2.180   2.874   1.163   1.00 15.00 ?  496 ILE A CB   9  
ATOM   6294  C CG1  . ILE A 1 25 ? 2.457   1.921   0.003   1.00 15.00 ?  496 ILE A CG1  9  
ATOM   6295  C CG2  . ILE A 1 25 ? 3.438   3.087   1.982   1.00 15.00 ?  496 ILE A CG2  9  
ATOM   6296  C CD1  . ILE A 1 25 ? 1.634   2.229   -1.231  1.00 15.00 ?  496 ILE A CD1  9  
ATOM   6297  H H    . ILE A 1 25 ? -0.301  2.225   0.454   1.00 15.00 ?  496 ILE A H    9  
ATOM   6298  H HA   . ILE A 1 25 ? 1.432   1.584   2.704   1.00 15.00 ?  496 ILE A HA   9  
ATOM   6299  H HB   . ILE A 1 25 ? 1.877   3.832   0.766   1.00 15.00 ?  496 ILE A HB   9  
ATOM   6300  H HG12 . ILE A 1 25 ? 3.500   1.986   -0.269  1.00 15.00 ?  496 ILE A HG12 9  
ATOM   6301  H HG13 . ILE A 1 25 ? 2.230   0.911   0.311   1.00 15.00 ?  496 ILE A HG13 9  
ATOM   6302  H HG21 . ILE A 1 25 ? 4.226   3.458   1.343   1.00 15.00 ?  496 ILE A HG21 9  
ATOM   6303  H HG22 . ILE A 1 25 ? 3.742   2.148   2.421   1.00 15.00 ?  496 ILE A HG22 9  
ATOM   6304  H HG23 . ILE A 1 25 ? 3.241   3.804   2.765   1.00 15.00 ?  496 ILE A HG23 9  
ATOM   6305  H HD11 . ILE A 1 25 ? 1.847   3.232   -1.564  1.00 15.00 ?  496 ILE A HD11 9  
ATOM   6306  H HD12 . ILE A 1 25 ? 0.584   2.142   -0.993  1.00 15.00 ?  496 ILE A HD12 9  
ATOM   6307  H HD13 . ILE A 1 25 ? 1.884   1.528   -2.014  1.00 15.00 ?  496 ILE A HD13 9  
ATOM   6308  N N    . ASP A 1 26 ? 0.455   3.309   4.210   1.00 15.00 ?  497 ASP A N    9  
ATOM   6309  C CA   . ASP A 1 26 ? 0.141   4.435   5.039   1.00 15.00 ?  497 ASP A CA   9  
ATOM   6310  C C    . ASP A 1 26 ? 1.386   5.087   5.521   1.00 15.00 ?  497 ASP A C    9  
ATOM   6311  O O    . ASP A 1 26 ? 2.259   4.509   6.172   1.00 15.00 ?  497 ASP A O    9  
ATOM   6312  C CB   . ASP A 1 26 ? -0.817  4.148   6.166   1.00 15.00 ?  497 ASP A CB   9  
ATOM   6313  C CG   . ASP A 1 26 ? -0.478  4.891   7.440   1.00 15.00 ?  497 ASP A CG   9  
ATOM   6314  O OD1  . ASP A 1 26 ? -0.627  6.126   7.460   1.00 15.00 -1 497 ASP A OD1  9  
ATOM   6315  O OD2  . ASP A 1 26 ? -0.062  4.250   8.420   1.00 15.00 ?  497 ASP A OD2  9  
ATOM   6316  H H    . ASP A 1 26 ? 0.578   2.416   4.598   1.00 15.00 ?  497 ASP A H    9  
ATOM   6317  H HA   . ASP A 1 26 ? -0.342  5.148   4.385   1.00 15.00 ?  497 ASP A HA   9  
ATOM   6318  H HB2  . ASP A 1 26 ? -1.767  4.512   5.837   1.00 15.00 ?  497 ASP A HB2  9  
ATOM   6319  H HB3  . ASP A 1 26 ? -0.863  3.088   6.363   1.00 15.00 ?  497 ASP A HB3  9  
ATOM   6320  N N    . HIS A 1 27 ? 1.422   6.318   5.157   1.00 15.00 ?  498 HIS A N    9  
ATOM   6321  C CA   . HIS A 1 27 ? 2.604   7.139   5.264   1.00 15.00 ?  498 HIS A CA   9  
ATOM   6322  C C    . HIS A 1 27 ? 2.806   7.670   6.674   1.00 15.00 ?  498 HIS A C    9  
ATOM   6323  O O    . HIS A 1 27 ? 3.851   8.242   6.982   1.00 15.00 ?  498 HIS A O    9  
ATOM   6324  C CB   . HIS A 1 27 ? 2.589   8.234   4.199   1.00 15.00 ?  498 HIS A CB   9  
ATOM   6325  C CG   . HIS A 1 27 ? 2.873   7.674   2.831   1.00 15.00 ?  498 HIS A CG   9  
ATOM   6326  N ND1  . HIS A 1 27 ? 4.153   7.420   2.390   1.00 15.00 ?  498 HIS A ND1  9  
ATOM   6327  C CD2  . HIS A 1 27 ? 2.048   7.258   1.832   1.00 15.00 ?  498 HIS A CD2  9  
ATOM   6328  C CE1  . HIS A 1 27 ? 4.108   6.873   1.192   1.00 15.00 ?  498 HIS A CE1  9  
ATOM   6329  N NE2  . HIS A 1 27 ? 2.845   6.766   0.824   1.00 15.00 ?  498 HIS A NE2  9  
ATOM   6330  H H    . HIS A 1 27 ? 0.567   6.706   4.821   1.00 15.00 ?  498 HIS A H    9  
ATOM   6331  H HA   . HIS A 1 27 ? 3.440   6.485   5.052   1.00 15.00 ?  498 HIS A HA   9  
ATOM   6332  H HB2  . HIS A 1 27 ? 1.618   8.707   4.180   1.00 15.00 ?  498 HIS A HB2  9  
ATOM   6333  H HB3  . HIS A 1 27 ? 3.347   8.971   4.427   1.00 15.00 ?  498 HIS A HB3  9  
ATOM   6334  H HD1  . HIS A 1 27 ? 4.985   7.627   2.887   1.00 15.00 ?  498 HIS A HD1  9  
ATOM   6335  H HD2  . HIS A 1 27 ? 0.963   7.279   1.829   1.00 15.00 ?  498 HIS A HD2  9  
ATOM   6336  H HE1  . HIS A 1 27 ? 4.963   6.531   0.623   1.00 15.00 ?  498 HIS A HE1  9  
ATOM   6337  H HE2  . HIS A 1 27 ? 2.549   6.655   -0.104  1.00 15.00 ?  498 HIS A HE2  9  
ATOM   6338  N N    . ASN A 1 28 ? 1.801   7.493   7.528   1.00 15.00 ?  499 ASN A N    9  
ATOM   6339  C CA   . ASN A 1 28 ? 1.929   7.895   8.921   1.00 15.00 ?  499 ASN A CA   9  
ATOM   6340  C C    . ASN A 1 28 ? 2.770   6.872   9.680   1.00 15.00 ?  499 ASN A C    9  
ATOM   6341  O O    . ASN A 1 28 ? 3.714   7.233   10.380  1.00 15.00 ?  499 ASN A O    9  
ATOM   6342  C CB   . ASN A 1 28 ? 0.554   8.035   9.592   1.00 15.00 ?  499 ASN A CB   9  
ATOM   6343  C CG   . ASN A 1 28 ? -0.342  9.059   8.916   1.00 15.00 ?  499 ASN A CG   9  
ATOM   6344  O OD1  . ASN A 1 28 ? -0.294  10.250  9.229   1.00 15.00 ?  499 ASN A OD1  9  
ATOM   6345  N ND2  . ASN A 1 28 ? -1.170  8.603   7.987   1.00 15.00 ?  499 ASN A ND2  9  
ATOM   6346  H H    . ASN A 1 28 ? 0.965   7.072   7.221   1.00 15.00 ?  499 ASN A H    9  
ATOM   6347  H HA   . ASN A 1 28 ? 2.433   8.850   8.945   1.00 15.00 ?  499 ASN A HA   9  
ATOM   6348  H HB2  . ASN A 1 28 ? 0.051   7.080   9.567   1.00 15.00 ?  499 ASN A HB2  9  
ATOM   6349  H HB3  . ASN A 1 28 ? 0.694   8.333   10.622  1.00 15.00 ?  499 ASN A HB3  9  
ATOM   6350  H HD21 . ASN A 1 28 ? -1.152  7.629   7.786   1.00 15.00 ?  499 ASN A HD21 9  
ATOM   6351  H HD22 . ASN A 1 28 ? -1.779  9.233   7.550   1.00 15.00 ?  499 ASN A HD22 9  
ATOM   6352  N N    . THR A 1 29 ? 2.425   5.594   9.538   1.00 15.00 ?  500 THR A N    9  
ATOM   6353  C CA   . THR A 1 29 ? 3.207   4.519   10.140  1.00 15.00 ?  500 THR A CA   9  
ATOM   6354  C C    . THR A 1 29 ? 4.433   4.195   9.294   1.00 15.00 ?  500 THR A C    9  
ATOM   6355  O O    . THR A 1 29 ? 5.293   3.429   9.721   1.00 15.00 ?  500 THR A O    9  
ATOM   6356  C CB   . THR A 1 29 ? 2.377   3.232   10.314  1.00 15.00 ?  500 THR A CB   9  
ATOM   6357  O OG1  . THR A 1 29 ? 1.913   2.771   9.038   1.00 15.00 ?  500 THR A OG1  9  
ATOM   6358  C CG2  . THR A 1 29 ? 1.195   3.471   11.239  1.00 15.00 ?  500 THR A CG2  9  
ATOM   6359  H H    . THR A 1 29 ? 1.616   5.366   9.025   1.00 15.00 ?  500 THR A H    9  
ATOM   6360  H HA   . THR A 1 29 ? 3.532   4.850   11.117  1.00 15.00 ?  500 THR A HA   9  
ATOM   6361  H HB   . THR A 1 29 ? 3.008   2.472   10.753  1.00 15.00 ?  500 THR A HB   9  
ATOM   6362  H HG1  . THR A 1 29 ? 1.091   3.244   8.806   1.00 15.00 ?  500 THR A HG1  9  
ATOM   6363  H HG21 . THR A 1 29 ? 0.622   2.560   11.335  1.00 15.00 ?  500 THR A HG21 9  
ATOM   6364  H HG22 . THR A 1 29 ? 0.567   4.247   10.827  1.00 15.00 ?  500 THR A HG22 9  
ATOM   6365  H HG23 . THR A 1 29 ? 1.553   3.776   12.210  1.00 15.00 ?  500 THR A HG23 9  
ATOM   6366  N N    . LYS A 1 30 ? 4.468   4.769   8.087   1.00 15.00 ?  501 LYS A N    9  
ATOM   6367  C CA   . LYS A 1 30 ? 5.510   4.518   7.078   1.00 15.00 ?  501 LYS A CA   9  
ATOM   6368  C C    . LYS A 1 30 ? 5.551   3.040   6.674   1.00 15.00 ?  501 LYS A C    9  
ATOM   6369  O O    . LYS A 1 30 ? 6.534   2.573   6.103   1.00 15.00 ?  501 LYS A O    9  
ATOM   6370  C CB   . LYS A 1 30 ? 6.909   4.994   7.535   1.00 15.00 ?  501 LYS A CB   9  
ATOM   6371  C CG   . LYS A 1 30 ? 7.692   4.011   8.406   1.00 15.00 ?  501 LYS A CG   9  
ATOM   6372  C CD   . LYS A 1 30 ? 9.186   4.306   8.401   1.00 15.00 ?  501 LYS A CD   9  
ATOM   6373  C CE   . LYS A 1 30 ? 9.888   3.724   7.179   1.00 15.00 ?  501 LYS A CE   9  
ATOM   6374  N NZ   . LYS A 1 30 ? 9.451   4.363   5.912   1.00 15.00 1  501 LYS A NZ   9  
ATOM   6375  H H    . LYS A 1 30 ? 3.746   5.390   7.856   1.00 15.00 ?  501 LYS A H    9  
ATOM   6376  H HA   . LYS A 1 30 ? 5.232   5.086   6.201   1.00 15.00 ?  501 LYS A HA   9  
ATOM   6377  H HB2  . LYS A 1 30 ? 7.502   5.196   6.656   1.00 15.00 ?  501 LYS A HB2  9  
ATOM   6378  H HB3  . LYS A 1 30 ? 6.793   5.912   8.091   1.00 15.00 ?  501 LYS A HB3  9  
ATOM   6379  H HG2  . LYS A 1 30 ? 7.329   4.080   9.420   1.00 15.00 ?  501 LYS A HG2  9  
ATOM   6380  H HG3  . LYS A 1 30 ? 7.532   3.010   8.034   1.00 15.00 ?  501 LYS A HG3  9  
ATOM   6381  H HD2  . LYS A 1 30 ? 9.326   5.373   8.396   1.00 15.00 ?  501 LYS A HD2  9  
ATOM   6382  H HD3  . LYS A 1 30 ? 9.629   3.888   9.292   1.00 15.00 ?  501 LYS A HD3  9  
ATOM   6383  H HE2  . LYS A 1 30 ? 10.953  3.867   7.291   1.00 15.00 ?  501 LYS A HE2  9  
ATOM   6384  H HE3  . LYS A 1 30 ? 9.674   2.665   7.131   1.00 15.00 ?  501 LYS A HE3  9  
ATOM   6385  H HZ1  . LYS A 1 30 ? 10.079  4.075   5.128   1.00 15.00 ?  501 LYS A HZ1  9  
ATOM   6386  H HZ2  . LYS A 1 30 ? 9.486   5.404   6.002   1.00 15.00 ?  501 LYS A HZ2  9  
ATOM   6387  H HZ3  . LYS A 1 30 ? 8.480   4.079   5.686   1.00 15.00 ?  501 LYS A HZ3  9  
ATOM   6388  N N    . THR A 1 31 ? 4.455   2.332   6.908   1.00 15.00 ?  502 THR A N    9  
ATOM   6389  C CA   . THR A 1 31 ? 4.377   0.916   6.577   1.00 15.00 ?  502 THR A CA   9  
ATOM   6390  C C    . THR A 1 31 ? 3.167   0.640   5.695   1.00 15.00 ?  502 THR A C    9  
ATOM   6391  O O    . THR A 1 31 ? 2.160   1.348   5.762   1.00 15.00 ?  502 THR A O    9  
ATOM   6392  C CB   . THR A 1 31 ? 4.313   0.019   7.837   1.00 15.00 ?  502 THR A CB   9  
ATOM   6393  O OG1  . THR A 1 31 ? 3.208   0.396   8.674   1.00 15.00 ?  502 THR A OG1  9  
ATOM   6394  C CG2  . THR A 1 31 ? 5.607   0.098   8.633   1.00 15.00 ?  502 THR A CG2  9  
ATOM   6395  H H    . THR A 1 31 ? 3.670   2.780   7.283   1.00 15.00 ?  502 THR A H    9  
ATOM   6396  H HA   . THR A 1 31 ? 5.271   0.657   6.026   1.00 15.00 ?  502 THR A HA   9  
ATOM   6397  H HB   . THR A 1 31 ? 4.171   -1.005  7.518   1.00 15.00 ?  502 THR A HB   9  
ATOM   6398  H HG1  . THR A 1 31 ? 2.932   1.301   8.466   1.00 15.00 ?  502 THR A HG1  9  
ATOM   6399  H HG21 . THR A 1 31 ? 5.532   -0.531  9.508   1.00 15.00 ?  502 THR A HG21 9  
ATOM   6400  H HG22 . THR A 1 31 ? 5.779   1.120   8.939   1.00 15.00 ?  502 THR A HG22 9  
ATOM   6401  H HG23 . THR A 1 31 ? 6.429   -0.239  8.020   1.00 15.00 ?  502 THR A HG23 9  
ATOM   6402  N N    . THR A 1 32 ? 3.279   -0.369  4.848   1.00 15.00 ?  503 THR A N    9  
ATOM   6403  C CA   . THR A 1 32 ? 2.197   -0.729  3.952   1.00 15.00 ?  503 THR A CA   9  
ATOM   6404  C C    . THR A 1 32 ? 1.455   -1.959  4.470   1.00 15.00 ?  503 THR A C    9  
ATOM   6405  O O    . THR A 1 32 ? 2.066   -2.912  4.962   1.00 15.00 ?  503 THR A O    9  
ATOM   6406  C CB   . THR A 1 32 ? 2.714   -0.970  2.511   1.00 15.00 ?  503 THR A CB   9  
ATOM   6407  O OG1  . THR A 1 32 ? 1.637   -1.355  1.646   1.00 15.00 ?  503 THR A OG1  9  
ATOM   6408  C CG2  . THR A 1 32 ? 3.802   -2.037  2.478   1.00 15.00 ?  503 THR A CG2  9  
ATOM   6409  H H    . THR A 1 32 ? 4.106   -0.892  4.835   1.00 15.00 ?  503 THR A H    9  
ATOM   6410  H HA   . THR A 1 32 ? 1.505   0.099   3.927   1.00 15.00 ?  503 THR A HA   9  
ATOM   6411  H HB   . THR A 1 32 ? 3.137   -0.045  2.147   1.00 15.00 ?  503 THR A HB   9  
ATOM   6412  H HG1  . THR A 1 32 ? 0.852   -0.843  1.861   1.00 15.00 ?  503 THR A HG1  9  
ATOM   6413  H HG21 . THR A 1 32 ? 3.407   -2.967  2.858   1.00 15.00 ?  503 THR A HG21 9  
ATOM   6414  H HG22 . THR A 1 32 ? 4.634   -1.722  3.089   1.00 15.00 ?  503 THR A HG22 9  
ATOM   6415  H HG23 . THR A 1 32 ? 4.136   -2.176  1.460   1.00 15.00 ?  503 THR A HG23 9  
ATOM   6416  N N    . THR A 1 33 ? 0.133   -1.914  4.387   1.00 15.00 ?  504 THR A N    9  
ATOM   6417  C CA   . THR A 1 33 ? -0.693  -3.016  4.831   1.00 15.00 ?  504 THR A CA   9  
ATOM   6418  C C    . THR A 1 33 ? -1.161  -3.856  3.650   1.00 15.00 ?  504 THR A C    9  
ATOM   6419  O O    . THR A 1 33 ? -1.480  -3.336  2.570   1.00 15.00 ?  504 THR A O    9  
ATOM   6420  C CB   . THR A 1 33 ? -1.914  -2.529  5.651   1.00 15.00 ?  504 THR A CB   9  
ATOM   6421  O OG1  . THR A 1 33 ? -2.705  -3.649  6.081   1.00 15.00 ?  504 THR A OG1  9  
ATOM   6422  C CG2  . THR A 1 33 ? -2.783  -1.575  4.842   1.00 15.00 ?  504 THR A CG2  9  
ATOM   6423  H H    . THR A 1 33 ? -0.296  -1.115  4.009   1.00 15.00 ?  504 THR A H    9  
ATOM   6424  H HA   . THR A 1 33 ? -0.088  -3.638  5.474   1.00 15.00 ?  504 THR A HA   9  
ATOM   6425  H HB   . THR A 1 33 ? -1.551  -2.004  6.523   1.00 15.00 ?  504 THR A HB   9  
ATOM   6426  H HG1  . THR A 1 33 ? -3.644  -3.439  5.979   1.00 15.00 ?  504 THR A HG1  9  
ATOM   6427  H HG21 . THR A 1 33 ? -3.619  -1.251  5.446   1.00 15.00 ?  504 THR A HG21 9  
ATOM   6428  H HG22 . THR A 1 33 ? -3.151  -2.082  3.963   1.00 15.00 ?  504 THR A HG22 9  
ATOM   6429  H HG23 . THR A 1 33 ? -2.199  -0.716  4.546   1.00 15.00 ?  504 THR A HG23 9  
ATOM   6430  N N    . TRP A 1 34 ? -1.185  -5.162  3.875   1.00 15.00 ?  505 TRP A N    9  
ATOM   6431  C CA   . TRP A 1 34 ? -1.614  -6.124  2.876   1.00 15.00 ?  505 TRP A CA   9  
ATOM   6432  C C    . TRP A 1 34 ? -3.074  -6.511  3.137   1.00 15.00 ?  505 TRP A C    9  
ATOM   6433  O O    . TRP A 1 34 ? -3.674  -7.299  2.406   1.00 15.00 ?  505 TRP A O    9  
ATOM   6434  C CB   . TRP A 1 34 ? -0.683  -7.347  2.936   1.00 15.00 ?  505 TRP A CB   9  
ATOM   6435  C CG   . TRP A 1 34 ? -0.875  -8.381  1.858   1.00 15.00 ?  505 TRP A CG   9  
ATOM   6436  C CD1  . TRP A 1 34 ? -0.511  -9.693  1.942   1.00 15.00 ?  505 TRP A CD1  9  
ATOM   6437  C CD2  . TRP A 1 34 ? -1.455  -8.213  0.550   1.00 15.00 ?  505 TRP A CD2  9  
ATOM   6438  N NE1  . TRP A 1 34 ? -0.820  -10.348 0.780   1.00 15.00 ?  505 TRP A NE1  9  
ATOM   6439  C CE2  . TRP A 1 34 ? -1.406  -9.468  -0.086  1.00 15.00 ?  505 TRP A CE2  9  
ATOM   6440  C CE3  . TRP A 1 34 ? -2.011  -7.133  -0.146  1.00 15.00 ?  505 TRP A CE3  9  
ATOM   6441  C CZ2  . TRP A 1 34 ? -1.891  -9.672  -1.371  1.00 15.00 ?  505 TRP A CZ2  9  
ATOM   6442  C CZ3  . TRP A 1 34 ? -2.493  -7.340  -1.426  1.00 15.00 ?  505 TRP A CZ3  9  
ATOM   6443  C CH2  . TRP A 1 34 ? -2.430  -8.601  -2.025  1.00 15.00 ?  505 TRP A CH2  9  
ATOM   6444  H H    . TRP A 1 34 ? -0.901  -5.493  4.751   1.00 15.00 ?  505 TRP A H    9  
ATOM   6445  H HA   . TRP A 1 34 ? -1.536  -5.661  1.903   1.00 15.00 ?  505 TRP A HA   9  
ATOM   6446  H HB2  . TRP A 1 34 ? 0.339   -7.007  2.873   1.00 15.00 ?  505 TRP A HB2  9  
ATOM   6447  H HB3  . TRP A 1 34 ? -0.826  -7.838  3.889   1.00 15.00 ?  505 TRP A HB3  9  
ATOM   6448  H HD1  . TRP A 1 34 ? -0.038  -10.136 2.804   1.00 15.00 ?  505 TRP A HD1  9  
ATOM   6449  H HE1  . TRP A 1 34 ? -0.652  -11.297 0.605   1.00 15.00 ?  505 TRP A HE1  9  
ATOM   6450  H HE3  . TRP A 1 34 ? -2.070  -6.154  0.301   1.00 15.00 ?  505 TRP A HE3  9  
ATOM   6451  H HZ2  . TRP A 1 34 ? -1.851  -10.639 -1.849  1.00 15.00 ?  505 TRP A HZ2  9  
ATOM   6452  H HZ3  . TRP A 1 34 ? -2.926  -6.519  -1.981  1.00 15.00 ?  505 TRP A HZ3  9  
ATOM   6453  H HH2  . TRP A 1 34 ? -2.816  -8.718  -3.027  1.00 15.00 ?  505 TRP A HH2  9  
ATOM   6454  N N    . GLU A 1 35 ? -3.647  -5.936  4.184   1.00 15.00 ?  506 GLU A N    9  
ATOM   6455  C CA   . GLU A 1 35 ? -5.038  -6.182  4.512   1.00 15.00 ?  506 GLU A CA   9  
ATOM   6456  C C    . GLU A 1 35 ? -5.839  -4.916  4.412   1.00 15.00 ?  506 GLU A C    9  
ATOM   6457  O O    . GLU A 1 35 ? -5.485  -3.881  4.985   1.00 15.00 ?  506 GLU A O    9  
ATOM   6458  C CB   . GLU A 1 35 ? -5.182  -6.817  5.895   1.00 15.00 ?  506 GLU A CB   9  
ATOM   6459  C CG   . GLU A 1 35 ? -4.560  -8.198  5.996   1.00 15.00 ?  506 GLU A CG   9  
ATOM   6460  C CD   . GLU A 1 35 ? -4.947  -8.916  7.271   1.00 15.00 ?  506 GLU A CD   9  
ATOM   6461  O OE1  . GLU A 1 35 ? -5.988  -9.608  7.271   1.00 15.00 -1 506 GLU A OE1  9  
ATOM   6462  O OE2  . GLU A 1 35 ? -4.220  -8.793  8.278   1.00 15.00 ?  506 GLU A OE2  9  
ATOM   6463  H H    . GLU A 1 35 ? -3.123  -5.324  4.743   1.00 15.00 ?  506 GLU A H    9  
ATOM   6464  H HA   . GLU A 1 35 ? -5.435  -6.853  3.772   1.00 15.00 ?  506 GLU A HA   9  
ATOM   6465  H HB2  . GLU A 1 35 ? -4.707  -6.177  6.623   1.00 15.00 ?  506 GLU A HB2  9  
ATOM   6466  H HB3  . GLU A 1 35 ? -6.231  -6.901  6.134   1.00 15.00 ?  506 GLU A HB3  9  
ATOM   6467  H HG2  . GLU A 1 35 ? -4.890  -8.788  5.155   1.00 15.00 ?  506 GLU A HG2  9  
ATOM   6468  H HG3  . GLU A 1 35 ? -3.485  -8.099  5.967   1.00 15.00 ?  506 GLU A HG3  9  
ATOM   6469  N N    . ASP A 1 36 ? -6.919  -5.035  3.666   1.00 15.00 ?  507 ASP A N    9  
ATOM   6470  C CA   . ASP A 1 36 ? -7.796  -3.928  3.370   1.00 15.00 ?  507 ASP A CA   9  
ATOM   6471  C C    . ASP A 1 36 ? -8.556  -3.477  4.615   1.00 15.00 ?  507 ASP A C    9  
ATOM   6472  O O    . ASP A 1 36 ? -9.371  -4.223  5.163   1.00 15.00 ?  507 ASP A O    9  
ATOM   6473  C CB   . ASP A 1 36 ? -8.753  -4.328  2.235   1.00 15.00 ?  507 ASP A CB   9  
ATOM   6474  C CG   . ASP A 1 36 ? -9.949  -3.407  2.085   1.00 15.00 ?  507 ASP A CG   9  
ATOM   6475  O OD1  . ASP A 1 36 ? -9.756  -2.193  1.897   1.00 15.00 -1 507 ASP A OD1  9  
ATOM   6476  O OD2  . ASP A 1 36 ? -11.095 -3.915  2.146   1.00 15.00 ?  507 ASP A OD2  9  
ATOM   6477  H H    . ASP A 1 36 ? -7.132  -5.914  3.289   1.00 15.00 ?  507 ASP A H    9  
ATOM   6478  H HA   . ASP A 1 36 ? -7.170  -3.128  3.034   1.00 15.00 ?  507 ASP A HA   9  
ATOM   6479  H HB2  . ASP A 1 36 ? -8.210  -4.323  1.303   1.00 15.00 ?  507 ASP A HB2  9  
ATOM   6480  H HB3  . ASP A 1 36 ? -9.117  -5.329  2.422   1.00 15.00 ?  507 ASP A HB3  9  
ATOM   6481  N N    . PRO A 1 37 ? -8.265  -2.257  5.093   1.00 15.00 ?  508 PRO A N    9  
ATOM   6482  C CA   . PRO A 1 37 ? -8.896  -1.712  6.291   1.00 15.00 ?  508 PRO A CA   9  
ATOM   6483  C C    . PRO A 1 37 ? -10.369 -1.381  6.059   1.00 15.00 ?  508 PRO A C    9  
ATOM   6484  O O    . PRO A 1 37 ? -11.246 -2.169  6.419   1.00 15.00 ?  508 PRO A O    9  
ATOM   6485  C CB   . PRO A 1 37 ? -8.073  -0.452  6.598   1.00 15.00 ?  508 PRO A CB   9  
ATOM   6486  C CG   . PRO A 1 37 ? -7.405  -0.076  5.318   1.00 15.00 ?  508 PRO A CG   9  
ATOM   6487  C CD   . PRO A 1 37 ? -7.292  -1.326  4.490   1.00 15.00 ?  508 PRO A CD   9  
ATOM   6488  H HA   . PRO A 1 37 ? -8.817  -2.404  7.118   1.00 15.00 ?  508 PRO A HA   9  
ATOM   6489  H HB2  . PRO A 1 37 ? -8.726  0.335   6.945   1.00 15.00 ?  508 PRO A HB2  9  
ATOM   6490  H HB3  . PRO A 1 37 ? -7.346  -0.678  7.363   1.00 15.00 ?  508 PRO A HB3  9  
ATOM   6491  H HG2  . PRO A 1 37 ? -7.991  0.664   4.796   1.00 15.00 ?  508 PRO A HG2  9  
ATOM   6492  H HG3  . PRO A 1 37 ? -6.420  0.318   5.530   1.00 15.00 ?  508 PRO A HG3  9  
ATOM   6493  H HD2  . PRO A 1 37 ? -7.546  -1.117  3.463   1.00 15.00 ?  508 PRO A HD2  9  
ATOM   6494  H HD3  . PRO A 1 37 ? -6.293  -1.724  4.556   1.00 15.00 ?  508 PRO A HD3  9  
ATOM   6495  N N    . ARG A 1 38 ? -10.621 -0.248  5.406   1.00 15.00 ?  509 ARG A N    9  
ATOM   6496  C CA   . ARG A 1 38 ? -11.975 0.210   5.111   1.00 15.00 ?  509 ARG A CA   9  
ATOM   6497  C C    . ARG A 1 38 ? -11.927 1.599   4.491   1.00 15.00 ?  509 ARG A C    9  
ATOM   6498  O O    . ARG A 1 38 ? -11.914 1.697   3.247   1.00 15.00 ?  509 ARG A O    9  
ATOM   6499  C CB   . ARG A 1 38 ? -12.854 0.236   6.372   1.00 15.00 ?  509 ARG A CB   9  
ATOM   6500  C CG   . ARG A 1 38 ? -14.346 0.408   6.087   1.00 15.00 ?  509 ARG A CG   9  
ATOM   6501  C CD   . ARG A 1 38 ? -14.954 -0.830  5.430   1.00 15.00 ?  509 ARG A CD   9  
ATOM   6502  N NE   . ARG A 1 38 ? -14.392 -1.093  4.106   1.00 15.00 ?  509 ARG A NE   9  
ATOM   6503  C CZ   . ARG A 1 38 ? -13.657 -2.161  3.807   1.00 15.00 ?  509 ARG A CZ   9  
ATOM   6504  N NH1  . ARG A 1 38 ? -13.504 -3.134  4.695   1.00 15.00 1  509 ARG A NH1  9  
ATOM   6505  N NH2  . ARG A 1 38 ? -13.084 -2.251  2.615   1.00 15.00 ?  509 ARG A NH2  9  
ATOM   6506  H H    . ARG A 1 38 ? -9.870  0.287   5.088   1.00 15.00 ?  509 ARG A H    9  
ATOM   6507  H HA   . ARG A 1 38 ? -12.406 -0.474  4.396   1.00 15.00 ?  509 ARG A HA   9  
ATOM   6508  H HB2  . ARG A 1 38 ? -12.716 -0.690  6.910   1.00 15.00 ?  509 ARG A HB2  9  
ATOM   6509  H HB3  . ARG A 1 38 ? -12.534 1.055   7.000   1.00 15.00 ?  509 ARG A HB3  9  
ATOM   6510  H HG2  . ARG A 1 38 ? -14.858 0.594   7.019   1.00 15.00 ?  509 ARG A HG2  9  
ATOM   6511  H HG3  . ARG A 1 38 ? -14.477 1.255   5.430   1.00 15.00 ?  509 ARG A HG3  9  
ATOM   6512  H HD2  . ARG A 1 38 ? -14.769 -1.685  6.063   1.00 15.00 ?  509 ARG A HD2  9  
ATOM   6513  H HD3  . ARG A 1 38 ? -16.020 -0.681  5.333   1.00 15.00 ?  509 ARG A HD3  9  
ATOM   6514  H HE   . ARG A 1 38 ? -14.537 -0.408  3.409   1.00 15.00 ?  509 ARG A HE   9  
ATOM   6515  H HH11 . ARG A 1 38 ? -13.943 -3.069  5.592   1.00 15.00 ?  509 ARG A HH11 9  
ATOM   6516  H HH12 . ARG A 1 38 ? -12.935 -3.938  4.477   1.00 15.00 ?  509 ARG A HH12 9  
ATOM   6517  H HH21 . ARG A 1 38 ? -13.210 -1.521  1.941   1.00 15.00 ?  509 ARG A HH21 9  
ATOM   6518  H HH22 . ARG A 1 38 ? -12.489 -3.039  2.392   1.00 15.00 ?  509 ARG A HH22 9  
ATOM   6519  N N    . ARG B 2 1  ? 0.118   -18.398 -2.258  1.00 15.00 ?  925 ARG B N    9  
ATOM   6520  C CA   . ARG B 2 1  ? 0.077   -17.150 -1.468  1.00 15.00 ?  925 ARG B CA   9  
ATOM   6521  C C    . ARG B 2 1  ? 1.119   -16.178 -2.012  1.00 15.00 ?  925 ARG B C    9  
ATOM   6522  O O    . ARG B 2 1  ? 2.312   -16.480 -2.024  1.00 15.00 ?  925 ARG B O    9  
ATOM   6523  C CB   . ARG B 2 1  ? 0.345   -17.482 0.012   1.00 15.00 ?  925 ARG B CB   9  
ATOM   6524  C CG   . ARG B 2 1  ? 0.115   -16.338 1.001   1.00 15.00 ?  925 ARG B CG   9  
ATOM   6525  C CD   . ARG B 2 1  ? 1.286   -15.363 1.051   1.00 15.00 ?  925 ARG B CD   9  
ATOM   6526  N NE   . ARG B 2 1  ? 2.567   -16.040 1.263   1.00 15.00 ?  925 ARG B NE   9  
ATOM   6527  C CZ   . ARG B 2 1  ? 3.695   -15.413 1.594   1.00 15.00 ?  925 ARG B CZ   9  
ATOM   6528  N NH1  . ARG B 2 1  ? 3.678   -14.120 1.898   1.00 15.00 1  925 ARG B NH1  9  
ATOM   6529  N NH2  . ARG B 2 1  ? 4.832   -16.090 1.664   1.00 15.00 ?  925 ARG B NH2  9  
ATOM   6530  H H1   . ARG B 2 1  ? -0.617  -19.056 -1.934  1.00 15.00 ?  925 ARG B H1   9  
ATOM   6531  H H2   . ARG B 2 1  ? 1.048   -18.856 -2.151  1.00 15.00 ?  925 ARG B H2   9  
ATOM   6532  H H3   . ARG B 2 1  ? -0.036  -18.186 -3.267  1.00 15.00 ?  925 ARG B H3   9  
ATOM   6533  H HA   . ARG B 2 1  ? -0.906  -16.708 -1.567  1.00 15.00 ?  925 ARG B HA   9  
ATOM   6534  H HB2  . ARG B 2 1  ? -0.301  -18.300 0.300   1.00 15.00 ?  925 ARG B HB2  9  
ATOM   6535  H HB3  . ARG B 2 1  ? 1.372   -17.807 0.108   1.00 15.00 ?  925 ARG B HB3  9  
ATOM   6536  H HG2  . ARG B 2 1  ? -0.771  -15.796 0.706   1.00 15.00 ?  925 ARG B HG2  9  
ATOM   6537  H HG3  . ARG B 2 1  ? -0.033  -16.756 1.986   1.00 15.00 ?  925 ARG B HG3  9  
ATOM   6538  H HD2  . ARG B 2 1  ? 1.327   -14.824 0.116   1.00 15.00 ?  925 ARG B HD2  9  
ATOM   6539  H HD3  . ARG B 2 1  ? 1.122   -14.664 1.859   1.00 15.00 ?  925 ARG B HD3  9  
ATOM   6540  H HE   . ARG B 2 1  ? 2.594   -17.017 1.113   1.00 15.00 ?  925 ARG B HE   9  
ATOM   6541  H HH11 . ARG B 2 1  ? 2.818   -13.612 1.888   1.00 15.00 ?  925 ARG B HH11 9  
ATOM   6542  H HH12 . ARG B 2 1  ? 4.539   -13.640 2.131   1.00 15.00 ?  925 ARG B HH12 9  
ATOM   6543  H HH21 . ARG B 2 1  ? 4.841   -17.076 1.473   1.00 15.00 ?  925 ARG B HH21 9  
ATOM   6544  H HH22 . ARG B 2 1  ? 5.689   -15.621 1.896   1.00 15.00 ?  925 ARG B HH22 9  
ATOM   6545  N N    . LEU B 2 2  ? 0.667   -15.018 -2.467  1.00 15.00 ?  926 LEU B N    9  
ATOM   6546  C CA   . LEU B 2 2  ? 1.574   -14.010 -2.997  1.00 15.00 ?  926 LEU B CA   9  
ATOM   6547  C C    . LEU B 2 2  ? 2.243   -13.265 -1.851  1.00 15.00 ?  926 LEU B C    9  
ATOM   6548  O O    . LEU B 2 2  ? 1.573   -12.711 -0.975  1.00 15.00 ?  926 LEU B O    9  
ATOM   6549  C CB   . LEU B 2 2  ? 0.844   -13.037 -3.941  1.00 15.00 ?  926 LEU B CB   9  
ATOM   6550  C CG   . LEU B 2 2  ? -0.234  -12.139 -3.313  1.00 15.00 ?  926 LEU B CG   9  
ATOM   6551  C CD1  . LEU B 2 2  ? -0.620  -11.032 -4.280  1.00 15.00 ?  926 LEU B CD1  9  
ATOM   6552  C CD2  . LEU B 2 2  ? -1.471  -12.941 -2.929  1.00 15.00 ?  926 LEU B CD2  9  
ATOM   6553  H H    . LEU B 2 2  ? -0.297  -14.838 -2.453  1.00 15.00 ?  926 LEU B H    9  
ATOM   6554  H HA   . LEU B 2 2  ? 2.339   -14.529 -3.556  1.00 15.00 ?  926 LEU B HA   9  
ATOM   6555  H HB2  . LEU B 2 2  ? 1.584   -12.394 -4.394  1.00 15.00 ?  926 LEU B HB2  9  
ATOM   6556  H HB3  . LEU B 2 2  ? 0.377   -13.619 -4.722  1.00 15.00 ?  926 LEU B HB3  9  
ATOM   6557  H HG   . LEU B 2 2  ? 0.164   -11.680 -2.418  1.00 15.00 ?  926 LEU B HG   9  
ATOM   6558  H HD11 . LEU B 2 2  ? -1.373  -10.405 -3.826  1.00 15.00 ?  926 LEU B HD11 9  
ATOM   6559  H HD12 . LEU B 2 2  ? -1.013  -11.466 -5.188  1.00 15.00 ?  926 LEU B HD12 9  
ATOM   6560  H HD13 . LEU B 2 2  ? 0.251   -10.437 -4.513  1.00 15.00 ?  926 LEU B HD13 9  
ATOM   6561  H HD21 . LEU B 2 2  ? -1.200  -13.701 -2.211  1.00 15.00 ?  926 LEU B HD21 9  
ATOM   6562  H HD22 . LEU B 2 2  ? -1.885  -13.411 -3.810  1.00 15.00 ?  926 LEU B HD22 9  
ATOM   6563  H HD23 . LEU B 2 2  ? -2.207  -12.281 -2.494  1.00 15.00 ?  926 LEU B HD23 9  
ATOM   6564  N N    . ASP B 2 3  ? 3.566   -13.260 -1.857  1.00 15.00 ?  927 ASP B N    9  
ATOM   6565  C CA   . ASP B 2 3  ? 4.334   -12.729 -0.740  1.00 15.00 ?  927 ASP B CA   9  
ATOM   6566  C C    . ASP B 2 3  ? 4.276   -11.210 -0.709  1.00 15.00 ?  927 ASP B C    9  
ATOM   6567  O O    . ASP B 2 3  ? 4.374   -10.552 -1.744  1.00 15.00 ?  927 ASP B O    9  
ATOM   6568  C CB   . ASP B 2 3  ? 5.787   -13.191 -0.829  1.00 15.00 ?  927 ASP B CB   9  
ATOM   6569  C CG   . ASP B 2 3  ? 6.438   -13.310 0.536   1.00 15.00 ?  927 ASP B CG   9  
ATOM   6570  O OD1  . ASP B 2 3  ? 5.985   -12.631 1.480   1.00 15.00 -1 927 ASP B OD1  9  
ATOM   6571  O OD2  . ASP B 2 3  ? 7.384   -14.108 0.676   1.00 15.00 ?  927 ASP B OD2  9  
ATOM   6572  H H    . ASP B 2 3  ? 4.044   -13.624 -2.636  1.00 15.00 ?  927 ASP B H    9  
ATOM   6573  H HA   . ASP B 2 3  ? 3.902   -13.114 0.171   1.00 15.00 ?  927 ASP B HA   9  
ATOM   6574  H HB2  . ASP B 2 3  ? 5.823   -14.157 -1.311  1.00 15.00 ?  927 ASP B HB2  9  
ATOM   6575  H HB3  . ASP B 2 3  ? 6.350   -12.480 -1.414  1.00 15.00 ?  927 ASP B HB3  9  
ATOM   6576  N N    . LEU B 2 4  ? 4.133   -10.663 0.488   1.00 15.00 ?  928 LEU B N    9  
ATOM   6577  C CA   . LEU B 2 4  ? 4.060   -9.223  0.678   1.00 15.00 ?  928 LEU B CA   9  
ATOM   6578  C C    . LEU B 2 4  ? 5.468   -8.691  0.952   1.00 15.00 ?  928 LEU B C    9  
ATOM   6579  O O    . LEU B 2 4  ? 6.119   -9.097  1.918   1.00 15.00 ?  928 LEU B O    9  
ATOM   6580  C CB   . LEU B 2 4  ? 3.079   -8.912  1.831   1.00 15.00 ?  928 LEU B CB   9  
ATOM   6581  C CG   . LEU B 2 4  ? 2.743   -7.430  2.103   1.00 15.00 ?  928 LEU B CG   9  
ATOM   6582  C CD1  . LEU B 2 4  ? 3.891   -6.707  2.795   1.00 15.00 ?  928 LEU B CD1  9  
ATOM   6583  C CD2  . LEU B 2 4  ? 2.361   -6.721  0.813   1.00 15.00 ?  928 LEU B CD2  9  
ATOM   6584  H H    . LEU B 2 4  ? 4.108   -11.247 1.274   1.00 15.00 ?  928 LEU B H    9  
ATOM   6585  H HA   . LEU B 2 4  ? 3.691   -8.784  -0.236  1.00 15.00 ?  928 LEU B HA   9  
ATOM   6586  H HB2  . LEU B 2 4  ? 2.151   -9.418  1.612   1.00 15.00 ?  928 LEU B HB2  9  
ATOM   6587  H HB3  . LEU B 2 4  ? 3.482   -9.337  2.736   1.00 15.00 ?  928 LEU B HB3  9  
ATOM   6588  H HG   . LEU B 2 4  ? 1.889   -7.387  2.766   1.00 15.00 ?  928 LEU B HG   9  
ATOM   6589  H HD11 . LEU B 2 4  ? 4.122   -7.205  3.726   1.00 15.00 ?  928 LEU B HD11 9  
ATOM   6590  H HD12 . LEU B 2 4  ? 3.605   -5.685  2.995   1.00 15.00 ?  928 LEU B HD12 9  
ATOM   6591  H HD13 . LEU B 2 4  ? 4.763   -6.719  2.156   1.00 15.00 ?  928 LEU B HD13 9  
ATOM   6592  H HD21 . LEU B 2 4  ? 2.144   -5.684  1.022   1.00 15.00 ?  928 LEU B HD21 9  
ATOM   6593  H HD22 . LEU B 2 4  ? 1.487   -7.194  0.390   1.00 15.00 ?  928 LEU B HD22 9  
ATOM   6594  H HD23 . LEU B 2 4  ? 3.179   -6.784  0.113   1.00 15.00 ?  928 LEU B HD23 9  
ATOM   6595  N N    . PRO B 2 5  ? 5.957   -7.783  0.091   1.00 15.00 ?  929 PRO B N    9  
ATOM   6596  C CA   . PRO B 2 5  ? 7.328   -7.274  0.158   1.00 15.00 ?  929 PRO B CA   9  
ATOM   6597  C C    . PRO B 2 5  ? 7.530   -6.263  1.283   1.00 15.00 ?  929 PRO B C    9  
ATOM   6598  O O    . PRO B 2 5  ? 6.699   -5.378  1.487   1.00 15.00 ?  929 PRO B O    9  
ATOM   6599  C CB   . PRO B 2 5  ? 7.535   -6.588  -1.202  1.00 15.00 ?  929 PRO B CB   9  
ATOM   6600  C CG   . PRO B 2 5  ? 6.289   -6.826  -1.995  1.00 15.00 ?  929 PRO B CG   9  
ATOM   6601  C CD   . PRO B 2 5  ? 5.212   -7.169  -1.009  1.00 15.00 ?  929 PRO B CD   9  
ATOM   6602  H HA   . PRO B 2 5  ? 8.042   -8.077  0.268   1.00 15.00 ?  929 PRO B HA   9  
ATOM   6603  H HB2  . PRO B 2 5  ? 7.702   -5.532  -1.047  1.00 15.00 ?  929 PRO B HB2  9  
ATOM   6604  H HB3  . PRO B 2 5  ? 8.397   -7.018  -1.691  1.00 15.00 ?  929 PRO B HB3  9  
ATOM   6605  H HG2  . PRO B 2 5  ? 6.020   -5.928  -2.542  1.00 15.00 ?  929 PRO B HG2  9  
ATOM   6606  H HG3  . PRO B 2 5  ? 6.443   -7.647  -2.679  1.00 15.00 ?  929 PRO B HG3  9  
ATOM   6607  H HD2  . PRO B 2 5  ? 4.704   -6.275  -0.681  1.00 15.00 ?  929 PRO B HD2  9  
ATOM   6608  H HD3  . PRO B 2 5  ? 4.512   -7.870  -1.440  1.00 15.00 ?  929 PRO B HD3  9  
ATOM   6609  N N    . PRO B 2 6  ? 8.648   -6.386  2.019   1.00 15.00 ?  930 PRO B N    9  
ATOM   6610  C CA   . PRO B 2 6  ? 9.042   -5.401  3.032   1.00 15.00 ?  930 PRO B CA   9  
ATOM   6611  C C    . PRO B 2 6  ? 9.140   -4.009  2.418   1.00 15.00 ?  930 PRO B C    9  
ATOM   6612  O O    . PRO B 2 6  ? 9.710   -3.845  1.338   1.00 15.00 ?  930 PRO B O    9  
ATOM   6613  C CB   . PRO B 2 6  ? 10.420  -5.890  3.490   1.00 15.00 ?  930 PRO B CB   9  
ATOM   6614  C CG   . PRO B 2 6  ? 10.435  -7.343  3.167   1.00 15.00 ?  930 PRO B CG   9  
ATOM   6615  C CD   . PRO B 2 6  ? 9.608   -7.499  1.925   1.00 15.00 ?  930 PRO B CD   9  
ATOM   6616  H HA   . PRO B 2 6  ? 8.354   -5.388  3.868   1.00 15.00 ?  930 PRO B HA   9  
ATOM   6617  H HB2  . PRO B 2 6  ? 11.190  -5.358  2.951   1.00 15.00 ?  930 PRO B HB2  9  
ATOM   6618  H HB3  . PRO B 2 6  ? 10.531  -5.720  4.550   1.00 15.00 ?  930 PRO B HB3  9  
ATOM   6619  H HG2  . PRO B 2 6  ? 11.449  -7.669  2.988   1.00 15.00 ?  930 PRO B HG2  9  
ATOM   6620  H HG3  . PRO B 2 6  ? 9.998   -7.904  3.980   1.00 15.00 ?  930 PRO B HG3  9  
ATOM   6621  H HD2  . PRO B 2 6  ? 10.228  -7.403  1.044   1.00 15.00 ?  930 PRO B HD2  9  
ATOM   6622  H HD3  . PRO B 2 6  ? 9.097   -8.449  1.927   1.00 15.00 ?  930 PRO B HD3  9  
ATOM   6623  N N    . TYR B 2 7  ? 8.603   -3.008  3.101   1.00 15.00 ?  931 TYR B N    9  
ATOM   6624  C CA   . TYR B 2 7  ? 8.466   -1.687  2.506   1.00 15.00 ?  931 TYR B CA   9  
ATOM   6625  C C    . TYR B 2 7  ? 9.824   -1.053  2.222   1.00 15.00 ?  931 TYR B C    9  
ATOM   6626  O O    . TYR B 2 7  ? 10.636  -0.831  3.123   1.00 15.00 ?  931 TYR B O    9  
ATOM   6627  C CB   . TYR B 2 7  ? 7.631   -0.784  3.428   1.00 15.00 ?  931 TYR B CB   9  
ATOM   6628  C CG   . TYR B 2 7  ? 7.433   0.638   2.929   1.00 15.00 ?  931 TYR B CG   9  
ATOM   6629  C CD1  . TYR B 2 7  ? 6.744   0.901   1.749   1.00 15.00 ?  931 TYR B CD1  9  
ATOM   6630  C CD2  . TYR B 2 7  ? 7.925   1.723   3.650   1.00 15.00 ?  931 TYR B CD2  9  
ATOM   6631  C CE1  . TYR B 2 7  ? 6.556   2.196   1.304   1.00 15.00 ?  931 TYR B CE1  9  
ATOM   6632  C CE2  . TYR B 2 7  ? 7.736   3.018   3.211   1.00 15.00 ?  931 TYR B CE2  9  
ATOM   6633  C CZ   . TYR B 2 7  ? 7.054   3.251   2.038   1.00 15.00 ?  931 TYR B CZ   9  
ATOM   6634  O OH   . TYR B 2 7  ? 6.867   4.543   1.601   1.00 15.00 ?  931 TYR B OH   9  
ATOM   6635  H H    . TYR B 2 7  ? 8.310   -3.154  4.032   1.00 15.00 ?  931 TYR B H    9  
ATOM   6636  H HA   . TYR B 2 7  ? 7.940   -1.804  1.570   1.00 15.00 ?  931 TYR B HA   9  
ATOM   6637  H HB2  . TYR B 2 7  ? 6.652   -1.222  3.552   1.00 15.00 ?  931 TYR B HB2  9  
ATOM   6638  H HB3  . TYR B 2 7  ? 8.116   -0.730  4.391   1.00 15.00 ?  931 TYR B HB3  9  
ATOM   6639  H HD1  . TYR B 2 7  ? 6.354   0.078   1.173   1.00 15.00 ?  931 TYR B HD1  9  
ATOM   6640  H HD2  . TYR B 2 7  ? 8.463   1.546   4.571   1.00 15.00 ?  931 TYR B HD2  9  
ATOM   6641  H HE1  . TYR B 2 7  ? 6.017   2.379   0.386   1.00 15.00 ?  931 TYR B HE1  9  
ATOM   6642  H HE2  . TYR B 2 7  ? 8.121   3.843   3.790   1.00 15.00 ?  931 TYR B HE2  9  
ATOM   6643  H HH   . TYR B 2 7  ? 7.694   5.029   1.679   1.00 15.00 ?  931 TYR B HH   9  
ATOM   6644  N N    . GLU B 2 8  ? 10.046  -0.778  0.949   1.00 15.00 ?  932 GLU B N    9  
ATOM   6645  C CA   . GLU B 2 8  ? 11.129  0.077   0.497   1.00 15.00 ?  932 GLU B CA   9  
ATOM   6646  C C    . GLU B 2 8  ? 10.480  1.352   0.012   1.00 15.00 ?  932 GLU B C    9  
ATOM   6647  O O    . GLU B 2 8  ? 9.256   1.461   0.049   1.00 15.00 ?  932 GLU B O    9  
ATOM   6648  C CB   . GLU B 2 8  ? 11.915  -0.552  -0.658  1.00 15.00 ?  932 GLU B CB   9  
ATOM   6649  C CG   . GLU B 2 8  ? 12.374  -1.976  -0.421  1.00 15.00 ?  932 GLU B CG   9  
ATOM   6650  C CD   . GLU B 2 8  ? 13.195  -2.504  -1.582  1.00 15.00 ?  932 GLU B CD   9  
ATOM   6651  O OE1  . GLU B 2 8  ? 12.723  -2.422  -2.741  1.00 15.00 ?  932 GLU B OE1  9  
ATOM   6652  O OE2  . GLU B 2 8  ? 14.321  -2.993  -1.347  1.00 15.00 -1 932 GLU B OE2  9  
ATOM   6653  H H    . GLU B 2 8  ? 9.444   -1.158  0.277   1.00 15.00 ?  932 GLU B H    9  
ATOM   6654  H HA   . GLU B 2 8  ? 11.783  0.288   1.331   1.00 15.00 ?  932 GLU B HA   9  
ATOM   6655  H HB2  . GLU B 2 8  ? 11.293  -0.546  -1.540  1.00 15.00 ?  932 GLU B HB2  9  
ATOM   6656  H HB3  . GLU B 2 8  ? 12.789  0.055   -0.848  1.00 15.00 ?  932 GLU B HB3  9  
ATOM   6657  H HG2  . GLU B 2 8  ? 12.976  -2.006  0.474   1.00 15.00 ?  932 GLU B HG2  9  
ATOM   6658  H HG3  . GLU B 2 8  ? 11.506  -2.606  -0.296  1.00 15.00 ?  932 GLU B HG3  9  
ATOM   6659  N N    . THR B 2 9  ? 11.235  2.312   -0.459  1.00 15.00 ?  933 THR B N    9  
ATOM   6660  C CA   . THR B 2 9  ? 10.584  3.445   -1.060  1.00 15.00 ?  933 THR B CA   9  
ATOM   6661  C C    . THR B 2 9  ? 10.385  3.205   -2.546  1.00 15.00 ?  933 THR B C    9  
ATOM   6662  O O    . THR B 2 9  ? 11.330  2.982   -3.304  1.00 15.00 ?  933 THR B O    9  
ATOM   6663  C CB   . THR B 2 9  ? 11.322  4.764   -0.826  1.00 15.00 ?  933 THR B CB   9  
ATOM   6664  O OG1  . THR B 2 9  ? 11.768  4.823   0.534   1.00 15.00 ?  933 THR B OG1  9  
ATOM   6665  C CG2  . THR B 2 9  ? 10.383  5.935   -1.114  1.00 15.00 ?  933 THR B CG2  9  
ATOM   6666  H H    . THR B 2 9  ? 12.222  2.258   -0.419  1.00 15.00 ?  933 THR B H    9  
ATOM   6667  H HA   . THR B 2 9  ? 9.607   3.527   -0.601  1.00 15.00 ?  933 THR B HA   9  
ATOM   6668  H HB   . THR B 2 9  ? 12.171  4.821   -1.490  1.00 15.00 ?  933 THR B HB   9  
ATOM   6669  H HG1  . THR B 2 9  ? 11.511  4.010   0.986   1.00 15.00 ?  933 THR B HG1  9  
ATOM   6670  H HG21 . THR B 2 9  ? 10.890  6.865   -0.905  1.00 15.00 ?  933 THR B HG21 9  
ATOM   6671  H HG22 . THR B 2 9  ? 9.501   5.854   -0.489  1.00 15.00 ?  933 THR B HG22 9  
ATOM   6672  H HG23 . THR B 2 9  ? 10.084  5.911   -2.153  1.00 15.00 ?  933 THR B HG23 9  
ATOM   6673  N N    . PHE B 2 10 ? 9.132   3.220   -2.923  1.00 15.00 ?  934 PHE B N    9  
ATOM   6674  C CA   . PHE B 2 10 ? 8.707   3.094   -4.298  1.00 15.00 ?  934 PHE B CA   9  
ATOM   6675  C C    . PHE B 2 10 ? 8.591   4.501   -4.885  1.00 15.00 ?  934 PHE B C    9  
ATOM   6676  O O    . PHE B 2 10 ? 8.908   5.476   -4.197  1.00 15.00 ?  934 PHE B O    9  
ATOM   6677  C CB   . PHE B 2 10 ? 7.382   2.324   -4.388  1.00 15.00 ?  934 PHE B CB   9  
ATOM   6678  C CG   . PHE B 2 10 ? 6.222   3.120   -3.896  1.00 15.00 ?  934 PHE B CG   9  
ATOM   6679  C CD1  . PHE B 2 10 ? 5.951   3.226   -2.546  1.00 15.00 ?  934 PHE B CD1  9  
ATOM   6680  C CD2  . PHE B 2 10 ? 5.442   3.813   -4.792  1.00 15.00 ?  934 PHE B CD2  9  
ATOM   6681  C CE1  . PHE B 2 10 ? 4.912   4.011   -2.106  1.00 15.00 ?  934 PHE B CE1  9  
ATOM   6682  C CE2  . PHE B 2 10 ? 4.416   4.609   -4.361  1.00 15.00 ?  934 PHE B CE2  9  
ATOM   6683  C CZ   . PHE B 2 10 ? 4.151   4.708   -3.021  1.00 15.00 ?  934 PHE B CZ   9  
ATOM   6684  H H    . PHE B 2 10 ? 8.443   3.329   -2.235  1.00 15.00 ?  934 PHE B H    9  
ATOM   6685  H HA   . PHE B 2 10 ? 9.475   2.552   -4.834  1.00 15.00 ?  934 PHE B HA   9  
ATOM   6686  H HB2  . PHE B 2 10 ? 7.195   2.058   -5.416  1.00 15.00 ?  934 PHE B HB2  9  
ATOM   6687  H HB3  . PHE B 2 10 ? 7.452   1.427   -3.792  1.00 15.00 ?  934 PHE B HB3  9  
ATOM   6688  H HD1  . PHE B 2 10 ? 6.545   2.670   -1.838  1.00 15.00 ?  934 PHE B HD1  9  
ATOM   6689  H HD2  . PHE B 2 10 ? 5.649   3.725   -5.844  1.00 15.00 ?  934 PHE B HD2  9  
ATOM   6690  H HE1  . PHE B 2 10 ? 4.701   4.089   -1.049  1.00 15.00 ?  934 PHE B HE1  9  
ATOM   6691  H HE2  . PHE B 2 10 ? 3.811   5.148   -5.073  1.00 15.00 ?  934 PHE B HE2  9  
ATOM   6692  H HZ   . PHE B 2 10 ? 3.366   5.340   -2.692  1.00 15.00 ?  934 PHE B HZ   9  
ATOM   6693  N N    . GLU B 2 11 ? 8.185   4.602   -6.144  1.00 15.00 ?  935 GLU B N    9  
ATOM   6694  C CA   . GLU B 2 11 ? 8.132   5.877   -6.857  1.00 15.00 ?  935 GLU B CA   9  
ATOM   6695  C C    . GLU B 2 11 ? 7.439   6.965   -6.030  1.00 15.00 ?  935 GLU B C    9  
ATOM   6696  O O    . GLU B 2 11 ? 6.446   6.713   -5.347  1.00 15.00 ?  935 GLU B O    9  
ATOM   6697  C CB   . GLU B 2 11 ? 7.353   5.694   -8.167  1.00 15.00 ?  935 GLU B CB   9  
ATOM   6698  C CG   . GLU B 2 11 ? 5.964   5.081   -7.979  1.00 15.00 ?  935 GLU B CG   9  
ATOM   6699  C CD   . GLU B 2 11 ? 5.955   3.565   -8.129  1.00 15.00 ?  935 GLU B CD   9  
ATOM   6700  O OE1  . GLU B 2 11 ? 6.894   2.897   -7.647  1.00 15.00 -1 935 GLU B OE1  9  
ATOM   6701  O OE2  . GLU B 2 11 ? 5.010   3.033   -8.751  1.00 15.00 ?  935 GLU B OE2  9  
ATOM   6702  H H    . GLU B 2 11 ? 7.881   3.787   -6.614  1.00 15.00 ?  935 GLU B H    9  
ATOM   6703  H HA   . GLU B 2 11 ? 9.140   6.186   -7.084  1.00 15.00 ?  935 GLU B HA   9  
ATOM   6704  H HB2  . GLU B 2 11 ? 7.233   6.660   -8.637  1.00 15.00 ?  935 GLU B HB2  9  
ATOM   6705  H HB3  . GLU B 2 11 ? 7.921   5.054   -8.825  1.00 15.00 ?  935 GLU B HB3  9  
ATOM   6706  H HG2  . GLU B 2 11 ? 5.595   5.335   -6.980  1.00 15.00 ?  935 GLU B HG2  9  
ATOM   6707  H HG3  . GLU B 2 11 ? 5.298   5.503   -8.720  1.00 15.00 ?  935 GLU B HG3  9  
ATOM   6708  N N    . ASP B 2 12 ? 7.986   8.177   -6.119  1.00 15.00 ?  936 ASP B N    9  
ATOM   6709  C CA   . ASP B 2 12 ? 7.505   9.334   -5.360  1.00 15.00 ?  936 ASP B CA   9  
ATOM   6710  C C    . ASP B 2 12 ? 5.993   9.496   -5.469  1.00 15.00 ?  936 ASP B C    9  
ATOM   6711  O O    . ASP B 2 12 ? 5.441   9.586   -6.569  1.00 15.00 ?  936 ASP B O    9  
ATOM   6712  C CB   . ASP B 2 12 ? 8.203   10.604  -5.855  1.00 15.00 ?  936 ASP B CB   9  
ATOM   6713  C CG   . ASP B 2 12 ? 7.629   11.869  -5.250  1.00 15.00 ?  936 ASP B CG   9  
ATOM   6714  O OD1  . ASP B 2 12 ? 7.798   12.082  -4.034  1.00 15.00 -1 936 ASP B OD1  9  
ATOM   6715  O OD2  . ASP B 2 12 ? 7.008   12.659  -5.998  1.00 15.00 ?  936 ASP B OD2  9  
ATOM   6716  H H    . ASP B 2 12 ? 8.752   8.299   -6.723  1.00 15.00 ?  936 ASP B H    9  
ATOM   6717  H HA   . ASP B 2 12 ? 7.761   9.178   -4.322  1.00 15.00 ?  936 ASP B HA   9  
ATOM   6718  H HB2  . ASP B 2 12 ? 9.252   10.552  -5.597  1.00 15.00 ?  936 ASP B HB2  9  
ATOM   6719  H HB3  . ASP B 2 12 ? 8.106   10.663  -6.928  1.00 15.00 ?  936 ASP B HB3  9  
ATOM   6720  N N    . LEU B 2 13 ? 5.340   9.540   -4.316  1.00 15.00 ?  937 LEU B N    9  
ATOM   6721  C CA   . LEU B 2 13 ? 3.892   9.649   -4.244  1.00 15.00 ?  937 LEU B CA   9  
ATOM   6722  C C    . LEU B 2 13 ? 3.436   11.052  -4.646  1.00 15.00 ?  937 LEU B C    9  
ATOM   6723  O O    . LEU B 2 13 ? 3.957   12.057  -4.162  1.00 15.00 ?  937 LEU B O    9  
ATOM   6724  C CB   . LEU B 2 13 ? 3.363   9.227   -2.839  1.00 15.00 ?  937 LEU B CB   9  
ATOM   6725  C CG   . LEU B 2 13 ? 3.704   10.100  -1.600  1.00 15.00 ?  937 LEU B CG   9  
ATOM   6726  C CD1  . LEU B 2 13 ? 5.173   10.490  -1.539  1.00 15.00 ?  937 LEU B CD1  9  
ATOM   6727  C CD2  . LEU B 2 13 ? 2.815   11.333  -1.523  1.00 15.00 ?  937 LEU B CD2  9  
ATOM   6728  H H    . LEU B 2 13 ? 5.852   9.507   -3.483  1.00 15.00 ?  937 LEU B H    9  
ATOM   6729  H HA   . LEU B 2 13 ? 3.494   8.956   -4.974  1.00 15.00 ?  937 LEU B HA   9  
ATOM   6730  H HB2  . LEU B 2 13 ? 2.288   9.165   -2.899  1.00 15.00 ?  937 LEU B HB2  9  
ATOM   6731  H HB3  . LEU B 2 13 ? 3.735   8.232   -2.646  1.00 15.00 ?  937 LEU B HB3  9  
ATOM   6732  H HG   . LEU B 2 13 ? 3.503   9.511   -0.714  1.00 15.00 ?  937 LEU B HG   9  
ATOM   6733  H HD11 . LEU B 2 13 ? 5.352   11.076  -0.651  1.00 15.00 ?  937 LEU B HD11 9  
ATOM   6734  H HD12 . LEU B 2 13 ? 5.427   11.073  -2.412  1.00 15.00 ?  937 LEU B HD12 9  
ATOM   6735  H HD13 . LEU B 2 13 ? 5.782   9.598   -1.511  1.00 15.00 ?  937 LEU B HD13 9  
ATOM   6736  H HD21 . LEU B 2 13 ? 2.934   11.918  -2.423  1.00 15.00 ?  937 LEU B HD21 9  
ATOM   6737  H HD22 . LEU B 2 13 ? 3.097   11.928  -0.666  1.00 15.00 ?  937 LEU B HD22 9  
ATOM   6738  H HD23 . LEU B 2 13 ? 1.783   11.028  -1.426  1.00 15.00 ?  937 LEU B HD23 9  
HETATM 6739  N N    . NH2 B 2 14 ? 2.499   11.115  -5.580  1.00 15.00 ?  938 NH2 B N    9  
HETATM 6740  H HN1  . NH2 B 2 14 ? 2.128   10.274  -5.922  1.00 15.00 ?  938 NH2 B HN1  9  
HETATM 6741  H HN2  . NH2 B 2 14 ? 2.217   11.999  -5.890  1.00 15.00 ?  938 NH2 B HN2  9  
ATOM   6742  N N    . PHE A 1 7  ? -10.574 10.226  -0.765  1.00 15.00 ?  478 PHE A N    10 
ATOM   6743  C CA   . PHE A 1 7  ? -9.929  8.899   -0.876  1.00 15.00 ?  478 PHE A CA   10 
ATOM   6744  C C    . PHE A 1 7  ? -9.505  8.375   0.486   1.00 15.00 ?  478 PHE A C    10 
ATOM   6745  O O    . PHE A 1 7  ? -9.764  8.999   1.517   1.00 15.00 ?  478 PHE A O    10 
ATOM   6746  C CB   . PHE A 1 7  ? -8.710  8.945   -1.816  1.00 15.00 ?  478 PHE A CB   10 
ATOM   6747  C CG   . PHE A 1 7  ? -7.767  10.095  -1.568  1.00 15.00 ?  478 PHE A CG   10 
ATOM   6748  C CD1  . PHE A 1 7  ? -6.714  9.968   -0.678  1.00 15.00 ?  478 PHE A CD1  10 
ATOM   6749  C CD2  . PHE A 1 7  ? -7.932  11.297  -2.235  1.00 15.00 ?  478 PHE A CD2  10 
ATOM   6750  C CE1  . PHE A 1 7  ? -5.844  11.018  -0.454  1.00 15.00 ?  478 PHE A CE1  10 
ATOM   6751  C CE2  . PHE A 1 7  ? -7.066  12.352  -2.016  1.00 15.00 ?  478 PHE A CE2  10 
ATOM   6752  C CZ   . PHE A 1 7  ? -6.021  12.212  -1.124  1.00 15.00 ?  478 PHE A CZ   10 
ATOM   6753  H H    . PHE A 1 7  ? -9.906  10.923  -0.375  1.00 15.00 ?  478 PHE A H    10 
ATOM   6754  H HA   . PHE A 1 7  ? -10.656 8.213   -1.289  1.00 15.00 ?  478 PHE A HA   10 
ATOM   6755  H HB2  . PHE A 1 7  ? -8.145  8.033   -1.694  1.00 15.00 ?  478 PHE A HB2  10 
ATOM   6756  H HB3  . PHE A 1 7  ? -9.052  9.004   -2.836  1.00 15.00 ?  478 PHE A HB3  10 
ATOM   6757  H HD1  . PHE A 1 7  ? -6.575  9.035   -0.152  1.00 15.00 ?  478 PHE A HD1  10 
ATOM   6758  H HD2  . PHE A 1 7  ? -8.748  11.409  -2.934  1.00 15.00 ?  478 PHE A HD2  10 
ATOM   6759  H HE1  . PHE A 1 7  ? -5.029  10.906  0.243   1.00 15.00 ?  478 PHE A HE1  10 
ATOM   6760  H HE2  . PHE A 1 7  ? -7.207  13.285  -2.542  1.00 15.00 ?  478 PHE A HE2  10 
ATOM   6761  H HZ   . PHE A 1 7  ? -5.343  13.035  -0.952  1.00 15.00 ?  478 PHE A HZ   10 
ATOM   6762  N N    . LEU A 1 8  ? -8.877  7.205   0.461   1.00 15.00 ?  479 LEU A N    10 
ATOM   6763  C CA   . LEU A 1 8  ? -8.321  6.570   1.646   1.00 15.00 ?  479 LEU A CA   10 
ATOM   6764  C C    . LEU A 1 8  ? -7.422  7.543   2.418   1.00 15.00 ?  479 LEU A C    10 
ATOM   6765  O O    . LEU A 1 8  ? -6.668  8.303   1.815   1.00 15.00 ?  479 LEU A O    10 
ATOM   6766  C CB   . LEU A 1 8  ? -7.556  5.282   1.245   1.00 15.00 ?  479 LEU A CB   10 
ATOM   6767  C CG   . LEU A 1 8  ? -6.300  5.434   0.353   1.00 15.00 ?  479 LEU A CG   10 
ATOM   6768  C CD1  . LEU A 1 8  ? -5.722  4.066   0.030   1.00 15.00 ?  479 LEU A CD1  10 
ATOM   6769  C CD2  . LEU A 1 8  ? -6.592  6.158   -0.950  1.00 15.00 ?  479 LEU A CD2  10 
ATOM   6770  H H    . LEU A 1 8  ? -8.788  6.743   -0.395  1.00 15.00 ?  479 LEU A H    10 
ATOM   6771  H HA   . LEU A 1 8  ? -9.148  6.295   2.283   1.00 15.00 ?  479 LEU A HA   10 
ATOM   6772  H HB2  . LEU A 1 8  ? -7.253  4.785   2.154   1.00 15.00 ?  479 LEU A HB2  10 
ATOM   6773  H HB3  . LEU A 1 8  ? -8.251  4.637   0.729   1.00 15.00 ?  479 LEU A HB3  10 
ATOM   6774  H HG   . LEU A 1 8  ? -5.549  5.995   0.892   1.00 15.00 ?  479 LEU A HG   10 
ATOM   6775  H HD11 . LEU A 1 8  ? -4.838  4.185   -0.581  1.00 15.00 ?  479 LEU A HD11 10 
ATOM   6776  H HD12 . LEU A 1 8  ? -6.456  3.489   -0.517  1.00 15.00 ?  479 LEU A HD12 10 
ATOM   6777  H HD13 . LEU A 1 8  ? -5.466  3.555   0.943   1.00 15.00 ?  479 LEU A HD13 10 
ATOM   6778  H HD21 . LEU A 1 8  ? -5.682  6.242   -1.525  1.00 15.00 ?  479 LEU A HD21 10 
ATOM   6779  H HD22 . LEU A 1 8  ? -6.975  7.144   -0.735  1.00 15.00 ?  479 LEU A HD22 10 
ATOM   6780  H HD23 . LEU A 1 8  ? -7.325  5.600   -1.514  1.00 15.00 ?  479 LEU A HD23 10 
ATOM   6781  N N    . PRO A 1 9  ? -7.521  7.513   3.766   1.00 15.00 ?  480 PRO A N    10 
ATOM   6782  C CA   . PRO A 1 9  ? -6.826  8.416   4.700   1.00 15.00 ?  480 PRO A CA   10 
ATOM   6783  C C    . PRO A 1 9  ? -5.478  8.958   4.227   1.00 15.00 ?  480 PRO A C    10 
ATOM   6784  O O    . PRO A 1 9  ? -4.661  8.229   3.673   1.00 15.00 ?  480 PRO A O    10 
ATOM   6785  C CB   . PRO A 1 9  ? -6.637  7.485   5.883   1.00 15.00 ?  480 PRO A CB   10 
ATOM   6786  C CG   . PRO A 1 9  ? -7.934  6.773   5.958   1.00 15.00 ?  480 PRO A CG   10 
ATOM   6787  C CD   . PRO A 1 9  ? -8.348  6.550   4.523   1.00 15.00 ?  480 PRO A CD   10 
ATOM   6788  H HA   . PRO A 1 9  ? -7.458  9.239   4.997   1.00 15.00 ?  480 PRO A HA   10 
ATOM   6789  H HB2  . PRO A 1 9  ? -5.832  6.802   5.681   1.00 15.00 ?  480 PRO A HB2  10 
ATOM   6790  H HB3  . PRO A 1 9  ? -6.428  8.046   6.774   1.00 15.00 ?  480 PRO A HB3  10 
ATOM   6791  H HG2  . PRO A 1 9  ? -7.809  5.828   6.468   1.00 15.00 ?  480 PRO A HG2  10 
ATOM   6792  H HG3  . PRO A 1 9  ? -8.662  7.385   6.468   1.00 15.00 ?  480 PRO A HG3  10 
ATOM   6793  H HD2  . PRO A 1 9  ? -8.132  5.537   4.221   1.00 15.00 ?  480 PRO A HD2  10 
ATOM   6794  H HD3  . PRO A 1 9  ? -9.393  6.765   4.400   1.00 15.00 ?  480 PRO A HD3  10 
ATOM   6795  N N    . PRO A 1 10 ? -5.228  10.257  4.482   1.00 15.00 ?  481 PRO A N    10 
ATOM   6796  C CA   . PRO A 1 10 ? -3.976  10.918  4.111   1.00 15.00 ?  481 PRO A CA   10 
ATOM   6797  C C    . PRO A 1 10 ? -2.751  10.124  4.552   1.00 15.00 ?  481 PRO A C    10 
ATOM   6798  O O    . PRO A 1 10 ? -2.554  9.850   5.738   1.00 15.00 ?  481 PRO A O    10 
ATOM   6799  C CB   . PRO A 1 10 ? -4.047  12.257  4.842   1.00 15.00 ?  481 PRO A CB   10 
ATOM   6800  C CG   . PRO A 1 10 ? -5.502  12.525  4.991   1.00 15.00 ?  481 PRO A CG   10 
ATOM   6801  C CD   . PRO A 1 10 ? -6.154  11.180  5.164   1.00 15.00 ?  481 PRO A CD   10 
ATOM   6802  H HA   . PRO A 1 10 ? -3.925  11.089  3.045   1.00 15.00 ?  481 PRO A HA   10 
ATOM   6803  H HB2  . PRO A 1 10 ? -3.558  12.173  5.801   1.00 15.00 ?  481 PRO A HB2  10 
ATOM   6804  H HB3  . PRO A 1 10 ? -3.566  13.021  4.250   1.00 15.00 ?  481 PRO A HB3  10 
ATOM   6805  H HG2  . PRO A 1 10 ? -5.675  13.140  5.862   1.00 15.00 ?  481 PRO A HG2  10 
ATOM   6806  H HG3  . PRO A 1 10 ? -5.879  13.013  4.106   1.00 15.00 ?  481 PRO A HG3  10 
ATOM   6807  H HD2  . PRO A 1 10 ? -6.240  10.933  6.212   1.00 15.00 ?  481 PRO A HD2  10 
ATOM   6808  H HD3  . PRO A 1 10 ? -7.126  11.167  4.693   1.00 15.00 ?  481 PRO A HD3  10 
ATOM   6809  N N    . GLY A 1 11 ? -1.948  9.738   3.581   1.00 15.00 ?  482 GLY A N    10 
ATOM   6810  C CA   . GLY A 1 11 ? -0.795  8.915   3.853   1.00 15.00 ?  482 GLY A CA   10 
ATOM   6811  C C    . GLY A 1 11 ? -0.982  7.519   3.329   1.00 15.00 ?  482 GLY A C    10 
ATOM   6812  O O    . GLY A 1 11 ? -0.018  6.782   3.162   1.00 15.00 ?  482 GLY A O    10 
ATOM   6813  H H    . GLY A 1 11 ? -2.147  10.007  2.660   1.00 15.00 ?  482 GLY A H    10 
ATOM   6814  H HA2  . GLY A 1 11 ? 0.068   9.352   3.383   1.00 15.00 ?  482 GLY A HA2  10 
ATOM   6815  H HA3  . GLY A 1 11 ? -0.627  8.868   4.916   1.00 15.00 ?  482 GLY A HA3  10 
ATOM   6816  N N    . TRP A 1 12 ? -2.223  7.162   3.052   1.00 15.00 ?  483 TRP A N    10 
ATOM   6817  C CA   . TRP A 1 12 ? -2.528  5.864   2.491   1.00 15.00 ?  483 TRP A CA   10 
ATOM   6818  C C    . TRP A 1 12 ? -2.490  5.944   0.976   1.00 15.00 ?  483 TRP A C    10 
ATOM   6819  O O    . TRP A 1 12 ? -3.316  6.605   0.349   1.00 15.00 ?  483 TRP A O    10 
ATOM   6820  C CB   . TRP A 1 12 ? -3.901  5.374   2.958   1.00 15.00 ?  483 TRP A CB   10 
ATOM   6821  C CG   . TRP A 1 12 ? -3.924  4.915   4.382   1.00 15.00 ?  483 TRP A CG   10 
ATOM   6822  C CD1  . TRP A 1 12 ? -3.983  5.692   5.506   1.00 15.00 ?  483 TRP A CD1  10 
ATOM   6823  C CD2  . TRP A 1 12 ? -3.890  3.559   4.832   1.00 15.00 ?  483 TRP A CD2  10 
ATOM   6824  N NE1  . TRP A 1 12 ? -3.990  4.894   6.628   1.00 15.00 ?  483 TRP A NE1  10 
ATOM   6825  C CE2  . TRP A 1 12 ? -3.929  3.579   6.238   1.00 15.00 ?  483 TRP A CE2  10 
ATOM   6826  C CE3  . TRP A 1 12 ? -3.828  2.329   4.177   1.00 15.00 ?  483 TRP A CE3  10 
ATOM   6827  C CZ2  . TRP A 1 12 ? -3.910  2.412   6.998   1.00 15.00 ?  483 TRP A CZ2  10 
ATOM   6828  C CZ3  . TRP A 1 12 ? -3.806  1.173   4.932   1.00 15.00 ?  483 TRP A CZ3  10 
ATOM   6829  C CH2  . TRP A 1 12 ? -3.846  1.221   6.329   1.00 15.00 ?  483 TRP A CH2  10 
ATOM   6830  H H    . TRP A 1 12 ? -2.959  7.792   3.229   1.00 15.00 ?  483 TRP A H    10 
ATOM   6831  H HA   . TRP A 1 12 ? -1.772  5.170   2.824   1.00 15.00 ?  483 TRP A HA   10 
ATOM   6832  H HB2  . TRP A 1 12 ? -4.615  6.179   2.858   1.00 15.00 ?  483 TRP A HB2  10 
ATOM   6833  H HB3  . TRP A 1 12 ? -4.210  4.548   2.336   1.00 15.00 ?  483 TRP A HB3  10 
ATOM   6834  H HD1  . TRP A 1 12 ? -4.024  6.778   5.500   1.00 15.00 ?  483 TRP A HD1  10 
ATOM   6835  H HE1  . TRP A 1 12 ? -4.026  5.213   7.554   1.00 15.00 ?  483 TRP A HE1  10 
ATOM   6836  H HE3  . TRP A 1 12 ? -3.800  2.273   3.099   1.00 15.00 ?  483 TRP A HE3  10 
ATOM   6837  H HZ2  . TRP A 1 12 ? -3.941  2.431   8.077   1.00 15.00 ?  483 TRP A HZ2  10 
ATOM   6838  H HZ3  . TRP A 1 12 ? -3.755  0.213   4.440   1.00 15.00 ?  483 TRP A HZ3  10 
ATOM   6839  H HH2  . TRP A 1 12 ? -3.826  0.294   6.877   1.00 15.00 ?  483 TRP A HH2  10 
ATOM   6840  N N    . GLU A 1 13 ? -1.495  5.301   0.402   1.00 15.00 ?  484 GLU A N    10 
ATOM   6841  C CA   . GLU A 1 13 ? -1.312  5.298   -1.031  1.00 15.00 ?  484 GLU A CA   10 
ATOM   6842  C C    . GLU A 1 13 ? -1.769  3.960   -1.590  1.00 15.00 ?  484 GLU A C    10 
ATOM   6843  O O    . GLU A 1 13 ? -1.568  2.917   -0.971  1.00 15.00 ?  484 GLU A O    10 
ATOM   6844  C CB   . GLU A 1 13 ? 0.160   5.542   -1.362  1.00 15.00 ?  484 GLU A CB   10 
ATOM   6845  C CG   . GLU A 1 13 ? 0.383   6.489   -2.532  1.00 15.00 ?  484 GLU A CG   10 
ATOM   6846  C CD   . GLU A 1 13 ? -0.424  6.126   -3.761  1.00 15.00 ?  484 GLU A CD   10 
ATOM   6847  O OE1  . GLU A 1 13 ? -1.600  6.543   -3.847  1.00 15.00 -1 484 GLU A OE1  10 
ATOM   6848  O OE2  . GLU A 1 13 ? 0.106   5.422   -4.638  1.00 15.00 ?  484 GLU A OE2  10 
ATOM   6849  H H    . GLU A 1 13 ? -0.861  4.802   0.965   1.00 15.00 ?  484 GLU A H    10 
ATOM   6850  H HA   . GLU A 1 13 ? -1.914  6.088   -1.454  1.00 15.00 ?  484 GLU A HA   10 
ATOM   6851  H HB2  . GLU A 1 13 ? 0.644   5.962   -0.492  1.00 15.00 ?  484 GLU A HB2  10 
ATOM   6852  H HB3  . GLU A 1 13 ? 0.621   4.599   -1.596  1.00 15.00 ?  484 GLU A HB3  10 
ATOM   6853  H HG2  . GLU A 1 13 ? 0.109   7.486   -2.227  1.00 15.00 ?  484 GLU A HG2  10 
ATOM   6854  H HG3  . GLU A 1 13 ? 1.432   6.471   -2.792  1.00 15.00 ?  484 GLU A HG3  10 
ATOM   6855  N N    . MET A 1 14 ? -2.346  3.992   -2.769  1.00 15.00 ?  485 MET A N    10 
ATOM   6856  C CA   . MET A 1 14 ? -2.926  2.806   -3.372  1.00 15.00 ?  485 MET A CA   10 
ATOM   6857  C C    . MET A 1 14 ? -2.361  2.611   -4.778  1.00 15.00 ?  485 MET A C    10 
ATOM   6858  O O    . MET A 1 14 ? -2.793  3.269   -5.724  1.00 15.00 ?  485 MET A O    10 
ATOM   6859  C CB   . MET A 1 14 ? -4.450  2.950   -3.426  1.00 15.00 ?  485 MET A CB   10 
ATOM   6860  C CG   . MET A 1 14 ? -5.173  1.696   -3.876  1.00 15.00 ?  485 MET A CG   10 
ATOM   6861  S SD   . MET A 1 14 ? -6.882  2.013   -4.365  1.00 15.00 ?  485 MET A SD   10 
ATOM   6862  C CE   . MET A 1 14 ? -7.575  2.658   -2.842  1.00 15.00 ?  485 MET A CE   10 
ATOM   6863  H H    . MET A 1 14 ? -2.356  4.841   -3.270  1.00 15.00 ?  485 MET A H    10 
ATOM   6864  H HA   . MET A 1 14 ? -2.667  1.951   -2.760  1.00 15.00 ?  485 MET A HA   10 
ATOM   6865  H HB2  . MET A 1 14 ? -4.808  3.211   -2.441  1.00 15.00 ?  485 MET A HB2  10 
ATOM   6866  H HB3  . MET A 1 14 ? -4.700  3.748   -4.110  1.00 15.00 ?  485 MET A HB3  10 
ATOM   6867  H HG2  . MET A 1 14 ? -4.645  1.281   -4.712  1.00 15.00 ?  485 MET A HG2  10 
ATOM   6868  H HG3  . MET A 1 14 ? -5.172  0.985   -3.061  1.00 15.00 ?  485 MET A HG3  10 
ATOM   6869  H HE1  . MET A 1 14 ? -7.479  1.919   -2.061  1.00 15.00 ?  485 MET A HE1  10 
ATOM   6870  H HE2  . MET A 1 14 ? -8.619  2.891   -2.992  1.00 15.00 ?  485 MET A HE2  10 
ATOM   6871  H HE3  . MET A 1 14 ? -7.044  3.555   -2.556  1.00 15.00 ?  485 MET A HE3  10 
ATOM   6872  N N    . ARG A 1 15 ? -1.377  1.731   -4.910  1.00 15.00 ?  486 ARG A N    10 
ATOM   6873  C CA   . ARG A 1 15 ? -0.699  1.533   -6.189  1.00 15.00 ?  486 ARG A CA   10 
ATOM   6874  C C    . ARG A 1 15 ? -0.364  0.056   -6.384  1.00 15.00 ?  486 ARG A C    10 
ATOM   6875  O O    . ARG A 1 15 ? -0.152  -0.678  -5.416  1.00 15.00 ?  486 ARG A O    10 
ATOM   6876  C CB   . ARG A 1 15 ? 0.554   2.421   -6.280  1.00 15.00 ?  486 ARG A CB   10 
ATOM   6877  C CG   . ARG A 1 15 ? 1.789   1.873   -5.583  1.00 15.00 ?  486 ARG A CG   10 
ATOM   6878  C CD   . ARG A 1 15 ? 2.759   1.263   -6.584  1.00 15.00 ?  486 ARG A CD   10 
ATOM   6879  N NE   . ARG A 1 15 ? 3.188   2.239   -7.587  1.00 15.00 ?  486 ARG A NE   10 
ATOM   6880  C CZ   . ARG A 1 15 ? 3.292   1.981   -8.893  1.00 15.00 ?  486 ARG A CZ   10 
ATOM   6881  N NH1  . ARG A 1 15 ? 3.043   0.770   -9.362  1.00 15.00 1  486 ARG A NH1  10 
ATOM   6882  N NH2  . ARG A 1 15 ? 3.652   2.937   -9.731  1.00 15.00 ?  486 ARG A NH2  10 
ATOM   6883  H H    . ARG A 1 15 ? -1.101  1.197   -4.133  1.00 15.00 ?  486 ARG A H    10 
ATOM   6884  H HA   . ARG A 1 15 ? -1.388  1.828   -6.967  1.00 15.00 ?  486 ARG A HA   10 
ATOM   6885  H HB2  . ARG A 1 15 ? 0.798   2.564   -7.322  1.00 15.00 ?  486 ARG A HB2  10 
ATOM   6886  H HB3  . ARG A 1 15 ? 0.322   3.383   -5.844  1.00 15.00 ?  486 ARG A HB3  10 
ATOM   6887  H HG2  . ARG A 1 15 ? 2.283   2.679   -5.060  1.00 15.00 ?  486 ARG A HG2  10 
ATOM   6888  H HG3  . ARG A 1 15 ? 1.485   1.114   -4.876  1.00 15.00 ?  486 ARG A HG3  10 
ATOM   6889  H HD2  . ARG A 1 15 ? 3.627   0.902   -6.051  1.00 15.00 ?  486 ARG A HD2  10 
ATOM   6890  H HD3  . ARG A 1 15 ? 2.273   0.436   -7.081  1.00 15.00 ?  486 ARG A HD3  10 
ATOM   6891  H HE   . ARG A 1 15 ? 3.396   3.146   -7.269  1.00 15.00 ?  486 ARG A HE   10 
ATOM   6892  H HH11 . ARG A 1 15 ? 2.766   0.029   -8.742  1.00 15.00 ?  486 ARG A HH11 10 
ATOM   6893  H HH12 . ARG A 1 15 ? 3.137   0.578   -10.349 1.00 15.00 ?  486 ARG A HH12 10 
ATOM   6894  H HH21 . ARG A 1 15 ? 3.854   3.858   -9.396  1.00 15.00 ?  486 ARG A HH21 10 
ATOM   6895  H HH22 . ARG A 1 15 ? 3.713   2.743   -10.713 1.00 15.00 ?  486 ARG A HH22 10 
ATOM   6896  N N    . ILE A 1 16 ? -0.327  -0.376  -7.636  1.00 15.00 ?  487 ILE A N    10 
ATOM   6897  C CA   . ILE A 1 16 ? -0.229  -1.794  -7.955  1.00 15.00 ?  487 ILE A CA   10 
ATOM   6898  C C    . ILE A 1 16 ? 1.225   -2.247  -8.111  1.00 15.00 ?  487 ILE A C    10 
ATOM   6899  O O    . ILE A 1 16 ? 2.082   -1.485  -8.540  1.00 15.00 ?  487 ILE A O    10 
ATOM   6900  C CB   . ILE A 1 16 ? -1.013  -2.118  -9.252  1.00 15.00 ?  487 ILE A CB   10 
ATOM   6901  C CG1  . ILE A 1 16 ? -2.484  -1.736  -9.100  1.00 15.00 ?  487 ILE A CG1  10 
ATOM   6902  C CG2  . ILE A 1 16 ? -0.899  -3.592  -9.618  1.00 15.00 ?  487 ILE A CG2  10 
ATOM   6903  C CD1  . ILE A 1 16 ? -3.332  -2.143  -10.285 1.00 15.00 ?  487 ILE A CD1  10 
ATOM   6904  H H    . ILE A 1 16 ? -0.331  0.286   -8.375  1.00 15.00 ?  487 ILE A H    10 
ATOM   6905  H HA   . ILE A 1 16 ? -0.680  -2.347  -7.143  1.00 15.00 ?  487 ILE A HA   10 
ATOM   6906  H HB   . ILE A 1 16 ? -0.582  -1.540  -10.056 1.00 15.00 ?  487 ILE A HB   10 
ATOM   6907  H HG12 . ILE A 1 16 ? -2.887  -2.218  -8.221  1.00 15.00 ?  487 ILE A HG12 10 
ATOM   6908  H HG13 . ILE A 1 16 ? -2.561  -0.665  -8.986  1.00 15.00 ?  487 ILE A HG13 10 
ATOM   6909  H HG21 . ILE A 1 16 ? -1.456  -3.782  -10.523 1.00 15.00 ?  487 ILE A HG21 10 
ATOM   6910  H HG22 . ILE A 1 16 ? -1.300  -4.195  -8.816  1.00 15.00 ?  487 ILE A HG22 10 
ATOM   6911  H HG23 . ILE A 1 16 ? 0.140   -3.846  -9.773  1.00 15.00 ?  487 ILE A HG23 10 
ATOM   6912  H HD11 . ILE A 1 16 ? -3.211  -3.205  -10.461 1.00 15.00 ?  487 ILE A HD11 10 
ATOM   6913  H HD12 . ILE A 1 16 ? -3.016  -1.595  -11.159 1.00 15.00 ?  487 ILE A HD12 10 
ATOM   6914  H HD13 . ILE A 1 16 ? -4.370  -1.928  -10.079 1.00 15.00 ?  487 ILE A HD13 10 
ATOM   6915  N N    . ALA A 1 17 ? 1.490   -3.487  -7.729  1.00 15.00 ?  488 ALA A N    10 
ATOM   6916  C CA   . ALA A 1 17 ? 2.765   -4.132  -7.994  1.00 15.00 ?  488 ALA A CA   10 
ATOM   6917  C C    . ALA A 1 17 ? 2.692   -4.843  -9.339  1.00 15.00 ?  488 ALA A C    10 
ATOM   6918  O O    . ALA A 1 17 ? 1.613   -5.281  -9.736  1.00 15.00 ?  488 ALA A O    10 
ATOM   6919  C CB   . ALA A 1 17 ? 3.104   -5.117  -6.879  1.00 15.00 ?  488 ALA A CB   10 
ATOM   6920  H H    . ALA A 1 17 ? 0.800   -3.984  -7.234  1.00 15.00 ?  488 ALA A H    10 
ATOM   6921  H HA   . ALA A 1 17 ? 3.529   -3.376  -8.030  1.00 15.00 ?  488 ALA A HA   10 
ATOM   6922  H HB1  . ALA A 1 17 ? 3.132   -4.596  -5.933  1.00 15.00 ?  488 ALA A HB1  10 
ATOM   6923  H HB2  . ALA A 1 17 ? 4.069   -5.562  -7.071  1.00 15.00 ?  488 ALA A HB2  10 
ATOM   6924  H HB3  . ALA A 1 17 ? 2.352   -5.893  -6.840  1.00 15.00 ?  488 ALA A HB3  10 
ATOM   6925  N N    . PRO A 1 18 ? 3.824   -4.968  -10.061 1.00 15.00 ?  489 PRO A N    10 
ATOM   6926  C CA   . PRO A 1 18 ? 3.855   -5.544  -11.425 1.00 15.00 ?  489 PRO A CA   10 
ATOM   6927  C C    . PRO A 1 18 ? 3.226   -6.940  -11.533 1.00 15.00 ?  489 PRO A C    10 
ATOM   6928  O O    . PRO A 1 18 ? 3.001   -7.445  -12.633 1.00 15.00 ?  489 PRO A O    10 
ATOM   6929  C CB   . PRO A 1 18 ? 5.351   -5.613  -11.745 1.00 15.00 ?  489 PRO A CB   10 
ATOM   6930  C CG   . PRO A 1 18 ? 5.972   -4.566  -10.889 1.00 15.00 ?  489 PRO A CG   10 
ATOM   6931  C CD   . PRO A 1 18 ? 5.168   -4.544  -9.620  1.00 15.00 ?  489 PRO A CD   10 
ATOM   6932  H HA   . PRO A 1 18 ? 3.371   -4.887  -12.133 1.00 15.00 ?  489 PRO A HA   10 
ATOM   6933  H HB2  . PRO A 1 18 ? 5.730   -6.596  -11.506 1.00 15.00 ?  489 PRO A HB2  10 
ATOM   6934  H HB3  . PRO A 1 18 ? 5.506   -5.407  -12.794 1.00 15.00 ?  489 PRO A HB3  10 
ATOM   6935  H HG2  . PRO A 1 18 ? 7.000   -4.826  -10.677 1.00 15.00 ?  489 PRO A HG2  10 
ATOM   6936  H HG3  . PRO A 1 18 ? 5.922   -3.607  -11.382 1.00 15.00 ?  489 PRO A HG3  10 
ATOM   6937  H HD2  . PRO A 1 18 ? 5.577   -5.240  -8.903  1.00 15.00 ?  489 PRO A HD2  10 
ATOM   6938  H HD3  . PRO A 1 18 ? 5.141   -3.547  -9.208  1.00 15.00 ?  489 PRO A HD3  10 
ATOM   6939  N N    . ASN A 1 19 ? 2.959   -7.564  -10.396 1.00 15.00 ?  490 ASN A N    10 
ATOM   6940  C CA   . ASN A 1 19 ? 2.345   -8.886  -10.369 1.00 15.00 ?  490 ASN A CA   10 
ATOM   6941  C C    . ASN A 1 19 ? 0.813   -8.778  -10.367 1.00 15.00 ?  490 ASN A C    10 
ATOM   6942  O O    . ASN A 1 19 ? 0.109   -9.784  -10.405 1.00 15.00 ?  490 ASN A O    10 
ATOM   6943  C CB   . ASN A 1 19 ? 2.846   -9.653  -9.134  1.00 15.00 ?  490 ASN A CB   10 
ATOM   6944  C CG   . ASN A 1 19 ? 2.308   -11.070 -9.029  1.00 15.00 ?  490 ASN A CG   10 
ATOM   6945  O OD1  . ASN A 1 19 ? 1.312   -11.322 -8.352  1.00 15.00 ?  490 ASN A OD1  10 
ATOM   6946  N ND2  . ASN A 1 19 ? 2.960   -12.007 -9.698  1.00 15.00 ?  490 ASN A ND2  10 
ATOM   6947  H H    . ASN A 1 19 ? 3.189   -7.127  -9.551  1.00 15.00 ?  490 ASN A H    10 
ATOM   6948  H HA   . ASN A 1 19 ? 2.654   -9.414  -11.259 1.00 15.00 ?  490 ASN A HA   10 
ATOM   6949  H HB2  . ASN A 1 19 ? 3.924   -9.707  -9.170  1.00 15.00 ?  490 ASN A HB2  10 
ATOM   6950  H HB3  . ASN A 1 19 ? 2.553   -9.113  -8.244  1.00 15.00 ?  490 ASN A HB3  10 
ATOM   6951  H HD21 . ASN A 1 19 ? 3.748   -11.744 -10.222 1.00 15.00 ?  490 ASN A HD21 10 
ATOM   6952  H HD22 . ASN A 1 19 ? 2.626   -12.931 -9.644  1.00 15.00 ?  490 ASN A HD22 10 
ATOM   6953  N N    . GLY A 1 20 ? 0.294   -7.550  -10.350 1.00 15.00 ?  491 GLY A N    10 
ATOM   6954  C CA   . GLY A 1 20 ? -1.141  -7.360  -10.267 1.00 15.00 ?  491 GLY A CA   10 
ATOM   6955  C C    . GLY A 1 20 ? -1.592  -7.260  -8.829  1.00 15.00 ?  491 GLY A C    10 
ATOM   6956  O O    . GLY A 1 20 ? -2.650  -7.766  -8.457  1.00 15.00 ?  491 GLY A O    10 
ATOM   6957  H H    . GLY A 1 20 ? 0.888   -6.767  -10.401 1.00 15.00 ?  491 GLY A H    10 
ATOM   6958  H HA2  . GLY A 1 20 ? -1.407  -6.453  -10.789 1.00 15.00 ?  491 GLY A HA2  10 
ATOM   6959  H HA3  . GLY A 1 20 ? -1.636  -8.197  -10.735 1.00 15.00 ?  491 GLY A HA3  10 
ATOM   6960  N N    . ARG A 1 21 ? -0.762  -6.636  -8.005  1.00 15.00 ?  492 ARG A N    10 
ATOM   6961  C CA   . ARG A 1 21 ? -1.014  -6.562  -6.573  1.00 15.00 ?  492 ARG A CA   10 
ATOM   6962  C C    . ARG A 1 21 ? -1.279  -5.123  -6.145  1.00 15.00 ?  492 ARG A C    10 
ATOM   6963  O O    . ARG A 1 21 ? -0.362  -4.312  -6.125  1.00 15.00 ?  492 ARG A O    10 
ATOM   6964  C CB   . ARG A 1 21 ? 0.200   -7.075  -5.793  1.00 15.00 ?  492 ARG A CB   10 
ATOM   6965  C CG   . ARG A 1 21 ? 0.867   -8.305  -6.384  1.00 15.00 ?  492 ARG A CG   10 
ATOM   6966  C CD   . ARG A 1 21 ? 0.088   -9.586  -6.103  1.00 15.00 ?  492 ARG A CD   10 
ATOM   6967  N NE   . ARG A 1 21 ? -1.193  -9.654  -6.806  1.00 15.00 ?  492 ARG A NE   10 
ATOM   6968  C CZ   . ARG A 1 21 ? -1.868  -10.787 -6.996  1.00 15.00 ?  492 ARG A CZ   10 
ATOM   6969  N NH1  . ARG A 1 21 ? -1.352  -11.939 -6.587  1.00 15.00 1  492 ARG A NH1  10 
ATOM   6970  N NH2  . ARG A 1 21 ? -3.043  -10.770 -7.610  1.00 15.00 ?  492 ARG A NH2  10 
ATOM   6971  H H    . ARG A 1 21 ? 0.033   -6.198  -8.376  1.00 15.00 ?  492 ARG A H    10 
ATOM   6972  H HA   . ARG A 1 21 ? -1.873  -7.170  -6.342  1.00 15.00 ?  492 ARG A HA   10 
ATOM   6973  H HB2  . ARG A 1 21 ? 0.936   -6.288  -5.748  1.00 15.00 ?  492 ARG A HB2  10 
ATOM   6974  H HB3  . ARG A 1 21 ? -0.114  -7.313  -4.787  1.00 15.00 ?  492 ARG A HB3  10 
ATOM   6975  H HG2  . ARG A 1 21 ? 0.954   -8.168  -7.451  1.00 15.00 ?  492 ARG A HG2  10 
ATOM   6976  H HG3  . ARG A 1 21 ? 1.856   -8.398  -5.955  1.00 15.00 ?  492 ARG A HG3  10 
ATOM   6977  H HD2  . ARG A 1 21 ? 0.692   -10.427 -6.408  1.00 15.00 ?  492 ARG A HD2  10 
ATOM   6978  H HD3  . ARG A 1 21 ? -0.095  -9.650  -5.040  1.00 15.00 ?  492 ARG A HD3  10 
ATOM   6979  H HE   . ARG A 1 21 ? -1.575  -8.811  -7.143  1.00 15.00 ?  492 ARG A HE   10 
ATOM   6980  H HH11 . ARG A 1 21 ? -0.455  -11.958 -6.142  1.00 15.00 ?  492 ARG A HH11 10 
ATOM   6981  H HH12 . ARG A 1 21 ? -1.862  -12.800 -6.711  1.00 15.00 ?  492 ARG A HH12 10 
ATOM   6982  H HH21 . ARG A 1 21 ? -3.434  -9.901  -7.935  1.00 15.00 ?  492 ARG A HH21 10 
ATOM   6983  H HH22 . ARG A 1 21 ? -3.552  -11.621 -7.749  1.00 15.00 ?  492 ARG A HH22 10 
ATOM   6984  N N    . PRO A 1 22 ? -2.517  -4.773  -5.801  1.00 15.00 ?  493 PRO A N    10 
ATOM   6985  C CA   . PRO A 1 22 ? -2.831  -3.441  -5.324  1.00 15.00 ?  493 PRO A CA   10 
ATOM   6986  C C    . PRO A 1 22 ? -2.692  -3.343  -3.809  1.00 15.00 ?  493 PRO A C    10 
ATOM   6987  O O    . PRO A 1 22 ? -3.472  -3.937  -3.064  1.00 15.00 ?  493 PRO A O    10 
ATOM   6988  C CB   . PRO A 1 22 ? -4.285  -3.245  -5.762  1.00 15.00 ?  493 PRO A CB   10 
ATOM   6989  C CG   . PRO A 1 22 ? -4.846  -4.622  -5.989  1.00 15.00 ?  493 PRO A CG   10 
ATOM   6990  C CD   . PRO A 1 22 ? -3.713  -5.618  -5.864  1.00 15.00 ?  493 PRO A CD   10 
ATOM   6991  H HA   . PRO A 1 22 ? -2.205  -2.694  -5.791  1.00 15.00 ?  493 PRO A HA   10 
ATOM   6992  H HB2  . PRO A 1 22 ? -4.826  -2.725  -4.986  1.00 15.00 ?  493 PRO A HB2  10 
ATOM   6993  H HB3  . PRO A 1 22 ? -4.307  -2.661  -6.670  1.00 15.00 ?  493 PRO A HB3  10 
ATOM   6994  H HG2  . PRO A 1 22 ? -5.602  -4.832  -5.247  1.00 15.00 ?  493 PRO A HG2  10 
ATOM   6995  H HG3  . PRO A 1 22 ? -5.278  -4.676  -6.978  1.00 15.00 ?  493 PRO A HG3  10 
ATOM   6996  H HD2  . PRO A 1 22 ? -3.821  -6.198  -4.960  1.00 15.00 ?  493 PRO A HD2  10 
ATOM   6997  H HD3  . PRO A 1 22 ? -3.684  -6.264  -6.728  1.00 15.00 ?  493 PRO A HD3  10 
ATOM   6998  N N    . PHE A 1 23 ? -1.669  -2.631  -3.355  1.00 15.00 ?  494 PHE A N    10 
ATOM   6999  C CA   . PHE A 1 23 ? -1.408  -2.524  -1.930  1.00 15.00 ?  494 PHE A CA   10 
ATOM   7000  C C    . PHE A 1 23 ? -1.664  -1.118  -1.414  1.00 15.00 ?  494 PHE A C    10 
ATOM   7001  O O    . PHE A 1 23 ? -1.469  -0.128  -2.125  1.00 15.00 ?  494 PHE A O    10 
ATOM   7002  C CB   . PHE A 1 23 ? 0.023   -2.972  -1.579  1.00 15.00 ?  494 PHE A CB   10 
ATOM   7003  C CG   . PHE A 1 23 ? 1.133   -2.397  -2.430  1.00 15.00 ?  494 PHE A CG   10 
ATOM   7004  C CD1  . PHE A 1 23 ? 1.324   -1.027  -2.546  1.00 15.00 ?  494 PHE A CD1  10 
ATOM   7005  C CD2  . PHE A 1 23 ? 2.010   -3.243  -3.087  1.00 15.00 ?  494 PHE A CD2  10 
ATOM   7006  C CE1  . PHE A 1 23 ? 2.362   -0.516  -3.309  1.00 15.00 ?  494 PHE A CE1  10 
ATOM   7007  C CE2  . PHE A 1 23 ? 3.045   -2.740  -3.851  1.00 15.00 ?  494 PHE A CE2  10 
ATOM   7008  C CZ   . PHE A 1 23 ? 3.220   -1.375  -3.963  1.00 15.00 ?  494 PHE A CZ   10 
ATOM   7009  H H    . PHE A 1 23 ? -1.084  -2.161  -3.990  1.00 15.00 ?  494 PHE A H    10 
ATOM   7010  H HA   . PHE A 1 23 ? -2.099  -3.189  -1.435  1.00 15.00 ?  494 PHE A HA   10 
ATOM   7011  H HB2  . PHE A 1 23 ? 0.228   -2.695  -0.557  1.00 15.00 ?  494 PHE A HB2  10 
ATOM   7012  H HB3  . PHE A 1 23 ? 0.073   -4.049  -1.661  1.00 15.00 ?  494 PHE A HB3  10 
ATOM   7013  H HD1  . PHE A 1 23 ? 0.650   -0.356  -2.037  1.00 15.00 ?  494 PHE A HD1  10 
ATOM   7014  H HD2  . PHE A 1 23 ? 1.879   -4.312  -2.995  1.00 15.00 ?  494 PHE A HD2  10 
ATOM   7015  H HE1  . PHE A 1 23 ? 2.504   0.561   -3.389  1.00 15.00 ?  494 PHE A HE1  10 
ATOM   7016  H HE2  . PHE A 1 23 ? 3.718   -3.413  -4.361  1.00 15.00 ?  494 PHE A HE2  10 
ATOM   7017  H HZ   . PHE A 1 23 ? 4.030   -0.980  -4.560  1.00 15.00 ?  494 PHE A HZ   10 
ATOM   7018  N N    . PHE A 1 24 ? -2.104  -1.047  -0.171  1.00 15.00 ?  495 PHE A N    10 
ATOM   7019  C CA   . PHE A 1 24 ? -2.302  0.217   0.504   1.00 15.00 ?  495 PHE A CA   10 
ATOM   7020  C C    . PHE A 1 24 ? -1.098  0.512   1.389   1.00 15.00 ?  495 PHE A C    10 
ATOM   7021  O O    . PHE A 1 24 ? -0.952  -0.068  2.467   1.00 15.00 ?  495 PHE A O    10 
ATOM   7022  C CB   . PHE A 1 24 ? -3.576  0.185   1.354   1.00 15.00 ?  495 PHE A CB   10 
ATOM   7023  C CG   . PHE A 1 24 ? -4.776  -0.369  0.639   1.00 15.00 ?  495 PHE A CG   10 
ATOM   7024  C CD1  . PHE A 1 24 ? -5.410  0.363   -0.349  1.00 15.00 ?  495 PHE A CD1  10 
ATOM   7025  C CD2  . PHE A 1 24 ? -5.270  -1.626  0.957   1.00 15.00 ?  495 PHE A CD2  10 
ATOM   7026  C CE1  . PHE A 1 24 ? -6.511  -0.144  -1.008  1.00 15.00 ?  495 PHE A CE1  10 
ATOM   7027  C CE2  . PHE A 1 24 ? -6.371  -2.139  0.301   1.00 15.00 ?  495 PHE A CE2  10 
ATOM   7028  C CZ   . PHE A 1 24 ? -6.994  -1.397  -0.683  1.00 15.00 ?  495 PHE A CZ   10 
ATOM   7029  H H    . PHE A 1 24 ? -2.303  -1.877  0.309   1.00 15.00 ?  495 PHE A H    10 
ATOM   7030  H HA   . PHE A 1 24 ? -2.391  0.989   -0.246  1.00 15.00 ?  495 PHE A HA   10 
ATOM   7031  H HB2  . PHE A 1 24 ? -3.402  -0.424  2.227   1.00 15.00 ?  495 PHE A HB2  10 
ATOM   7032  H HB3  . PHE A 1 24 ? -3.813  1.191   1.667   1.00 15.00 ?  495 PHE A HB3  10 
ATOM   7033  H HD1  . PHE A 1 24 ? -5.033  1.343   -0.606  1.00 15.00 ?  495 PHE A HD1  10 
ATOM   7034  H HD2  . PHE A 1 24 ? -4.786  -2.206  1.728   1.00 15.00 ?  495 PHE A HD2  10 
ATOM   7035  H HE1  . PHE A 1 24 ? -6.997  0.438   -1.778  1.00 15.00 ?  495 PHE A HE1  10 
ATOM   7036  H HE2  . PHE A 1 24 ? -6.745  -3.120  0.557   1.00 15.00 ?  495 PHE A HE2  10 
ATOM   7037  H HZ   . PHE A 1 24 ? -7.856  -1.795  -1.197  1.00 15.00 ?  495 PHE A HZ   10 
ATOM   7038  N N    . ILE A 1 25 ? -0.207  1.361   0.908   1.00 15.00 ?  496 ILE A N    10 
ATOM   7039  C CA   . ILE A 1 25 ? 0.960   1.756   1.680   1.00 15.00 ?  496 ILE A CA   10 
ATOM   7040  C C    . ILE A 1 25 ? 0.660   3.009   2.470   1.00 15.00 ?  496 ILE A C    10 
ATOM   7041  O O    . ILE A 1 25 ? 0.529   4.089   1.894   1.00 15.00 ?  496 ILE A O    10 
ATOM   7042  C CB   . ILE A 1 25 ? 2.196   2.039   0.796   1.00 15.00 ?  496 ILE A CB   10 
ATOM   7043  C CG1  . ILE A 1 25 ? 2.642   0.780   0.061   1.00 15.00 ?  496 ILE A CG1  10 
ATOM   7044  C CG2  . ILE A 1 25 ? 3.337   2.591   1.644   1.00 15.00 ?  496 ILE A CG2  10 
ATOM   7045  C CD1  . ILE A 1 25 ? 3.891   0.976   -0.776  1.00 15.00 ?  496 ILE A CD1  10 
ATOM   7046  H H    . ILE A 1 25 ? -0.348  1.749   0.014   1.00 15.00 ?  496 ILE A H    10 
ATOM   7047  H HA   . ILE A 1 25 ? 1.202   0.958   2.365   1.00 15.00 ?  496 ILE A HA   10 
ATOM   7048  H HB   . ILE A 1 25 ? 1.924   2.793   0.071   1.00 15.00 ?  496 ILE A HB   10 
ATOM   7049  H HG12 . ILE A 1 25 ? 2.846   0.003   0.782   1.00 15.00 ?  496 ILE A HG12 10 
ATOM   7050  H HG13 . ILE A 1 25 ? 1.851   0.457   -0.597  1.00 15.00 ?  496 ILE A HG13 10 
ATOM   7051  H HG21 . ILE A 1 25 ? 4.192   2.783   1.014   1.00 15.00 ?  496 ILE A HG21 10 
ATOM   7052  H HG22 . ILE A 1 25 ? 3.603   1.871   2.404   1.00 15.00 ?  496 ILE A HG22 10 
ATOM   7053  H HG23 . ILE A 1 25 ? 3.022   3.511   2.114   1.00 15.00 ?  496 ILE A HG23 10 
ATOM   7054  H HD11 . ILE A 1 25 ? 4.148   0.046   -1.261  1.00 15.00 ?  496 ILE A HD11 10 
ATOM   7055  H HD12 . ILE A 1 25 ? 4.706   1.288   -0.140  1.00 15.00 ?  496 ILE A HD12 10 
ATOM   7056  H HD13 . ILE A 1 25 ? 3.707   1.733   -1.524  1.00 15.00 ?  496 ILE A HD13 10 
ATOM   7057  N N    . ASP A 1 26 ? 0.557   2.888   3.776   1.00 15.00 ?  497 ASP A N    10 
ATOM   7058  C CA   . ASP A 1 26 ? 0.407   4.072   4.583   1.00 15.00 ?  497 ASP A CA   10 
ATOM   7059  C C    . ASP A 1 26 ? 1.774   4.576   4.978   1.00 15.00 ?  497 ASP A C    10 
ATOM   7060  O O    . ASP A 1 26 ? 2.613   3.854   5.523   1.00 15.00 ?  497 ASP A O    10 
ATOM   7061  C CB   . ASP A 1 26 ? -0.503  3.865   5.791   1.00 15.00 ?  497 ASP A CB   10 
ATOM   7062  C CG   . ASP A 1 26 ? 0.211   3.929   7.123   1.00 15.00 ?  497 ASP A CG   10 
ATOM   7063  O OD1  . ASP A 1 26 ? 0.521   5.052   7.581   1.00 15.00 ?  497 ASP A OD1  10 
ATOM   7064  O OD2  . ASP A 1 26 ? 0.451   2.865   7.721   1.00 15.00 -1 497 ASP A OD2  10 
ATOM   7065  H H    . ASP A 1 26 ? 0.605   2.003   4.198   1.00 15.00 ?  497 ASP A H    10 
ATOM   7066  H HA   . ASP A 1 26 ? -0.044  4.823   3.947   1.00 15.00 ?  497 ASP A HA   10 
ATOM   7067  H HB2  . ASP A 1 26 ? -1.243  4.647   5.780   1.00 15.00 ?  497 ASP A HB2  10 
ATOM   7068  H HB3  . ASP A 1 26 ? -0.994  2.906   5.707   1.00 15.00 ?  497 ASP A HB3  10 
ATOM   7069  N N    . HIS A 1 27 ? 1.985   5.821   4.653   1.00 15.00 ?  498 HIS A N    10 
ATOM   7070  C CA   . HIS A 1 27 ? 3.291   6.444   4.753   1.00 15.00 ?  498 HIS A CA   10 
ATOM   7071  C C    . HIS A 1 27 ? 3.613   6.875   6.177   1.00 15.00 ?  498 HIS A C    10 
ATOM   7072  O O    . HIS A 1 27 ? 4.744   7.259   6.464   1.00 15.00 ?  498 HIS A O    10 
ATOM   7073  C CB   . HIS A 1 27 ? 3.403   7.620   3.778   1.00 15.00 ?  498 HIS A CB   10 
ATOM   7074  C CG   . HIS A 1 27 ? 3.455   7.192   2.338   1.00 15.00 ?  498 HIS A CG   10 
ATOM   7075  N ND1  . HIS A 1 27 ? 4.626   7.147   1.607   1.00 15.00 ?  498 HIS A ND1  10 
ATOM   7076  C CD2  . HIS A 1 27 ? 2.474   6.782   1.491   1.00 15.00 ?  498 HIS A CD2  10 
ATOM   7077  C CE1  . HIS A 1 27 ? 4.364   6.731   0.381   1.00 15.00 ?  498 HIS A CE1  10 
ATOM   7078  N NE2  . HIS A 1 27 ? 3.068   6.503   0.282   1.00 15.00 ?  498 HIS A NE2  10 
ATOM   7079  H H    . HIS A 1 27 ? 1.215   6.353   4.347   1.00 15.00 ?  498 HIS A H    10 
ATOM   7080  H HA   . HIS A 1 27 ? 4.018   5.699   4.463   1.00 15.00 ?  498 HIS A HA   10 
ATOM   7081  H HB2  . HIS A 1 27 ? 2.547   8.267   3.901   1.00 15.00 ?  498 HIS A HB2  10 
ATOM   7082  H HB3  . HIS A 1 27 ? 4.304   8.175   3.993   1.00 15.00 ?  498 HIS A HB3  10 
ATOM   7083  H HD1  . HIS A 1 27 ? 5.518   7.388   1.937   1.00 15.00 ?  498 HIS A HD1  10 
ATOM   7084  H HD2  . HIS A 1 27 ? 1.420   6.685   1.724   1.00 15.00 ?  498 HIS A HD2  10 
ATOM   7085  H HE1  . HIS A 1 27 ? 5.090   6.596   -0.408  1.00 15.00 ?  498 HIS A HE1  10 
ATOM   7086  H HE2  . HIS A 1 27 ? 2.589   6.330   -0.557  1.00 15.00 ?  498 HIS A HE2  10 
ATOM   7087  N N    . ASN A 1 28 ? 2.629   6.822   7.068   1.00 15.00 ?  499 ASN A N    10 
ATOM   7088  C CA   . ASN A 1 28 ? 2.847   7.288   8.430   1.00 15.00 ?  499 ASN A CA   10 
ATOM   7089  C C    . ASN A 1 28 ? 3.567   6.224   9.226   1.00 15.00 ?  499 ASN A C    10 
ATOM   7090  O O    . ASN A 1 28 ? 4.571   6.486   9.888   1.00 15.00 ?  499 ASN A O    10 
ATOM   7091  C CB   . ASN A 1 28 ? 1.512   7.570   9.127   1.00 15.00 ?  499 ASN A CB   10 
ATOM   7092  C CG   . ASN A 1 28 ? 0.609   8.499   8.344   1.00 15.00 ?  499 ASN A CG   10 
ATOM   7093  O OD1  . ASN A 1 28 ? 0.693   9.721   8.459   1.00 15.00 ?  499 ASN A OD1  10 
ATOM   7094  N ND2  . ASN A 1 28 ? -0.278  7.918   7.546   1.00 15.00 ?  499 ASN A ND2  10 
ATOM   7095  H H    . ASN A 1 28 ? 1.761   6.431   6.822   1.00 15.00 ?  499 ASN A H    10 
ATOM   7096  H HA   . ASN A 1 28 ? 3.440   8.188   8.401   1.00 15.00 ?  499 ASN A HA   10 
ATOM   7097  H HB2  . ASN A 1 28 ? 0.991   6.633   9.261   1.00 15.00 ?  499 ASN A HB2  10 
ATOM   7098  H HB3  . ASN A 1 28 ? 1.706   8.000   10.098  1.00 15.00 ?  499 ASN A HB3  10 
ATOM   7099  H HD21 . ASN A 1 28 ? -0.295  6.931   7.515   1.00 15.00 ?  499 ASN A HD21 10 
ATOM   7100  H HD22 . ASN A 1 28 ? -0.883  8.490   7.027   1.00 15.00 ?  499 ASN A HD22 10 
ATOM   7101  N N    . THR A 1 29 ? 3.030   5.020   9.169   1.00 15.00 ?  500 THR A N    10 
ATOM   7102  C CA   . THR A 1 29 ? 3.668   3.879   9.779   1.00 15.00 ?  500 THR A CA   10 
ATOM   7103  C C    . THR A 1 29 ? 4.772   3.316   8.888   1.00 15.00 ?  500 THR A C    10 
ATOM   7104  O O    . THR A 1 29 ? 5.688   2.649   9.370   1.00 15.00 ?  500 THR A O    10 
ATOM   7105  C CB   . THR A 1 29 ? 2.636   2.804   10.141  1.00 15.00 ?  500 THR A CB   10 
ATOM   7106  O OG1  . THR A 1 29 ? 1.316   3.355   10.050  1.00 15.00 ?  500 THR A OG1  10 
ATOM   7107  C CG2  . THR A 1 29 ? 2.861   2.339   11.562  1.00 15.00 ?  500 THR A CG2  10 
ATOM   7108  H H    . THR A 1 29 ? 2.165   4.898   8.709   1.00 15.00 ?  500 THR A H    10 
ATOM   7109  H HA   . THR A 1 29 ? 4.121   4.220   10.697  1.00 15.00 ?  500 THR A HA   10 
ATOM   7110  H HB   . THR A 1 29 ? 2.734   1.964   9.469   1.00 15.00 ?  500 THR A HB   10 
ATOM   7111  H HG1  . THR A 1 29 ? 0.960   3.190   9.156   1.00 15.00 ?  500 THR A HG1  10 
ATOM   7112  H HG21 . THR A 1 29 ? 2.751   3.186   12.227  1.00 15.00 ?  500 THR A HG21 10 
ATOM   7113  H HG22 . THR A 1 29 ? 3.857   1.933   11.655  1.00 15.00 ?  500 THR A HG22 10 
ATOM   7114  H HG23 . THR A 1 29 ? 2.134   1.584   11.814  1.00 15.00 ?  500 THR A HG23 10 
ATOM   7115  N N    . LYS A 1 30 ? 4.662   3.601   7.581   1.00 15.00 ?  501 LYS A N    10 
ATOM   7116  C CA   . LYS A 1 30 ? 5.610   3.124   6.563   1.00 15.00 ?  501 LYS A CA   10 
ATOM   7117  C C    . LYS A 1 30 ? 5.413   1.635   6.296   1.00 15.00 ?  501 LYS A C    10 
ATOM   7118  O O    . LYS A 1 30 ? 6.374   0.890   6.113   1.00 15.00 ?  501 LYS A O    10 
ATOM   7119  C CB   . LYS A 1 30 ? 7.064   3.393   6.976   1.00 15.00 ?  501 LYS A CB   10 
ATOM   7120  C CG   . LYS A 1 30 ? 7.375   4.859   7.230   1.00 15.00 ?  501 LYS A CG   10 
ATOM   7121  C CD   . LYS A 1 30 ? 8.840   5.064   7.589   1.00 15.00 ?  501 LYS A CD   10 
ATOM   7122  C CE   . LYS A 1 30 ? 9.247   4.240   8.804   1.00 15.00 ?  501 LYS A CE   10 
ATOM   7123  N NZ   . LYS A 1 30 ? 8.445   4.579   10.011  1.00 15.00 1  501 LYS A NZ   10 
ATOM   7124  H H    . LYS A 1 30 ? 3.900   4.145   7.288   1.00 15.00 ?  501 LYS A H    10 
ATOM   7125  H HA   . LYS A 1 30 ? 5.402   3.664   5.651   1.00 15.00 ?  501 LYS A HA   10 
ATOM   7126  H HB2  . LYS A 1 30 ? 7.275   2.842   7.881   1.00 15.00 ?  501 LYS A HB2  10 
ATOM   7127  H HB3  . LYS A 1 30 ? 7.716   3.041   6.191   1.00 15.00 ?  501 LYS A HB3  10 
ATOM   7128  H HG2  . LYS A 1 30 ? 7.152   5.424   6.339   1.00 15.00 ?  501 LYS A HG2  10 
ATOM   7129  H HG3  . LYS A 1 30 ? 6.761   5.211   8.046   1.00 15.00 ?  501 LYS A HG3  10 
ATOM   7130  H HD2  . LYS A 1 30 ? 9.449   4.768   6.749   1.00 15.00 ?  501 LYS A HD2  10 
ATOM   7131  H HD3  . LYS A 1 30 ? 9.004   6.110   7.803   1.00 15.00 ?  501 LYS A HD3  10 
ATOM   7132  H HE2  . LYS A 1 30 ? 9.107   3.194   8.577   1.00 15.00 ?  501 LYS A HE2  10 
ATOM   7133  H HE3  . LYS A 1 30 ? 10.290  4.425   9.014   1.00 15.00 ?  501 LYS A HE3  10 
ATOM   7134  H HZ1  . LYS A 1 30 ? 8.722   3.964   10.809  1.00 15.00 ?  501 LYS A HZ1  10 
ATOM   7135  H HZ2  . LYS A 1 30 ? 7.434   4.441   9.821   1.00 15.00 ?  501 LYS A HZ2  10 
ATOM   7136  H HZ3  . LYS A 1 30 ? 8.603   5.572   10.287  1.00 15.00 ?  501 LYS A HZ3  10 
ATOM   7137  N N    . THR A 1 31 ? 4.160   1.215   6.224   1.00 15.00 ?  502 THR A N    10 
ATOM   7138  C CA   . THR A 1 31 ? 3.840   -0.191  6.043   1.00 15.00 ?  502 THR A CA   10 
ATOM   7139  C C    . THR A 1 31 ? 2.977   -0.414  4.806   1.00 15.00 ?  502 THR A C    10 
ATOM   7140  O O    . THR A 1 31 ? 2.211   0.460   4.394   1.00 15.00 ?  502 THR A O    10 
ATOM   7141  C CB   . THR A 1 31 ? 3.132   -0.774  7.287   1.00 15.00 ?  502 THR A CB   10 
ATOM   7142  O OG1  . THR A 1 31 ? 2.903   -2.178  7.127   1.00 15.00 ?  502 THR A OG1  10 
ATOM   7143  C CG2  . THR A 1 31 ? 1.812   -0.068  7.555   1.00 15.00 ?  502 THR A CG2  10 
ATOM   7144  H H    . THR A 1 31 ? 3.432   1.870   6.278   1.00 15.00 ?  502 THR A H    10 
ATOM   7145  H HA   . THR A 1 31 ? 4.771   -0.723  5.911   1.00 15.00 ?  502 THR A HA   10 
ATOM   7146  H HB   . THR A 1 31 ? 3.775   -0.629  8.134   1.00 15.00 ?  502 THR A HB   10 
ATOM   7147  H HG1  . THR A 1 31 ? 3.184   -2.637  7.935   1.00 15.00 ?  502 THR A HG1  10 
ATOM   7148  H HG21 . THR A 1 31 ? 1.992   0.983   7.720   1.00 15.00 ?  502 THR A HG21 10 
ATOM   7149  H HG22 . THR A 1 31 ? 1.347   -0.496  8.430   1.00 15.00 ?  502 THR A HG22 10 
ATOM   7150  H HG23 . THR A 1 31 ? 1.158   -0.193  6.704   1.00 15.00 ?  502 THR A HG23 10 
ATOM   7151  N N    . THR A 1 32 ? 3.131   -1.583  4.207   1.00 15.00 ?  503 THR A N    10 
ATOM   7152  C CA   . THR A 1 32 ? 2.354   -1.963  3.038   1.00 15.00 ?  503 THR A CA   10 
ATOM   7153  C C    . THR A 1 32 ? 1.258   -2.939  3.455   1.00 15.00 ?  503 THR A C    10 
ATOM   7154  O O    . THR A 1 32 ? 1.533   -3.974  4.061   1.00 15.00 ?  503 THR A O    10 
ATOM   7155  C CB   . THR A 1 32 ? 3.254   -2.606  1.965   1.00 15.00 ?  503 THR A CB   10 
ATOM   7156  O OG1  . THR A 1 32 ? 4.482   -1.876  1.873   1.00 15.00 ?  503 THR A OG1  10 
ATOM   7157  C CG2  . THR A 1 32 ? 2.572   -2.605  0.612   1.00 15.00 ?  503 THR A CG2  10 
ATOM   7158  H H    . THR A 1 32 ? 3.770   -2.223  4.584   1.00 15.00 ?  503 THR A H    10 
ATOM   7159  H HA   . THR A 1 32 ? 1.901   -1.072  2.627   1.00 15.00 ?  503 THR A HA   10 
ATOM   7160  H HB   . THR A 1 32 ? 3.460   -3.628  2.242   1.00 15.00 ?  503 THR A HB   10 
ATOM   7161  H HG1  . THR A 1 32 ? 4.447   -1.124  2.469   1.00 15.00 ?  503 THR A HG1  10 
ATOM   7162  H HG21 . THR A 1 32 ? 3.219   -3.072  -0.116  1.00 15.00 ?  503 THR A HG21 10 
ATOM   7163  H HG22 . THR A 1 32 ? 2.371   -1.586  0.313   1.00 15.00 ?  503 THR A HG22 10 
ATOM   7164  H HG23 . THR A 1 32 ? 1.644   -3.151  0.675   1.00 15.00 ?  503 THR A HG23 10 
ATOM   7165  N N    . THR A 1 33 ? 0.017   -2.601  3.152   1.00 15.00 ?  504 THR A N    10 
ATOM   7166  C CA   . THR A 1 33 ? -1.114  -3.363  3.651   1.00 15.00 ?  504 THR A CA   10 
ATOM   7167  C C    . THR A 1 33 ? -1.893  -4.030  2.514   1.00 15.00 ?  504 THR A C    10 
ATOM   7168  O O    . THR A 1 33 ? -2.281  -3.370  1.547   1.00 15.00 ?  504 THR A O    10 
ATOM   7169  C CB   . THR A 1 33 ? -2.058  -2.435  4.442   1.00 15.00 ?  504 THR A CB   10 
ATOM   7170  O OG1  . THR A 1 33 ? -1.284  -1.511  5.220   1.00 15.00 ?  504 THR A OG1  10 
ATOM   7171  C CG2  . THR A 1 33 ? -2.964  -3.227  5.371   1.00 15.00 ?  504 THR A CG2  10 
ATOM   7172  H H    . THR A 1 33 ? -0.147  -1.813  2.591   1.00 15.00 ?  504 THR A H    10 
ATOM   7173  H HA   . THR A 1 33 ? -0.742  -4.123  4.321   1.00 15.00 ?  504 THR A HA   10 
ATOM   7174  H HB   . THR A 1 33 ? -2.672  -1.884  3.743   1.00 15.00 ?  504 THR A HB   10 
ATOM   7175  H HG1  . THR A 1 33 ? -1.041  -0.758  4.670   1.00 15.00 ?  504 THR A HG1  10 
ATOM   7176  H HG21 . THR A 1 33 ? -3.603  -3.871  4.787   1.00 15.00 ?  504 THR A HG21 10 
ATOM   7177  H HG22 . THR A 1 33 ? -3.572  -2.542  5.948   1.00 15.00 ?  504 THR A HG22 10 
ATOM   7178  H HG23 . THR A 1 33 ? -2.362  -3.823  6.039   1.00 15.00 ?  504 THR A HG23 10 
ATOM   7179  N N    . TRP A 1 34 ? -2.095  -5.345  2.624   1.00 15.00 ?  505 TRP A N    10 
ATOM   7180  C CA   . TRP A 1 34 ? -2.948  -6.075  1.686   1.00 15.00 ?  505 TRP A CA   10 
ATOM   7181  C C    . TRP A 1 34 ? -4.404  -5.997  2.128   1.00 15.00 ?  505 TRP A C    10 
ATOM   7182  O O    . TRP A 1 34 ? -5.324  -6.175  1.329   1.00 15.00 ?  505 TRP A O    10 
ATOM   7183  C CB   . TRP A 1 34 ? -2.540  -7.551  1.584   1.00 15.00 ?  505 TRP A CB   10 
ATOM   7184  C CG   . TRP A 1 34 ? -1.201  -7.787  0.954   1.00 15.00 ?  505 TRP A CG   10 
ATOM   7185  C CD1  . TRP A 1 34 ? -0.172  -8.520  1.472   1.00 15.00 ?  505 TRP A CD1  10 
ATOM   7186  C CD2  . TRP A 1 34 ? -0.746  -7.295  -0.312  1.00 15.00 ?  505 TRP A CD2  10 
ATOM   7187  N NE1  . TRP A 1 34 ? 0.889   -8.520  0.603   1.00 15.00 ?  505 TRP A NE1  10 
ATOM   7188  C CE2  . TRP A 1 34 ? 0.564   -7.771  -0.495  1.00 15.00 ?  505 TRP A CE2  10 
ATOM   7189  C CE3  . TRP A 1 34 ? -1.321  -6.499  -1.308  1.00 15.00 ?  505 TRP A CE3  10 
ATOM   7190  C CZ2  . TRP A 1 34 ? 1.309   -7.479  -1.633  1.00 15.00 ?  505 TRP A CZ2  10 
ATOM   7191  C CZ3  . TRP A 1 34 ? -0.579  -6.210  -2.436  1.00 15.00 ?  505 TRP A CZ3  10 
ATOM   7192  C CH2  . TRP A 1 34 ? 0.724   -6.698  -2.590  1.00 15.00 ?  505 TRP A CH2  10 
ATOM   7193  H H    . TRP A 1 34 ? -1.655  -5.836  3.347   1.00 15.00 ?  505 TRP A H    10 
ATOM   7194  H HA   . TRP A 1 34 ? -2.851  -5.613  0.715   1.00 15.00 ?  505 TRP A HA   10 
ATOM   7195  H HB2  . TRP A 1 34 ? -2.515  -7.975  2.576   1.00 15.00 ?  505 TRP A HB2  10 
ATOM   7196  H HB3  . TRP A 1 34 ? -3.281  -8.075  0.996   1.00 15.00 ?  505 TRP A HB3  10 
ATOM   7197  H HD1  . TRP A 1 34 ? -0.206  -9.026  2.425   1.00 15.00 ?  505 TRP A HD1  10 
ATOM   7198  H HE1  . TRP A 1 34 ? 1.745   -8.981  0.743   1.00 15.00 ?  505 TRP A HE1  10 
ATOM   7199  H HE3  . TRP A 1 34 ? -2.325  -6.114  -1.207  1.00 15.00 ?  505 TRP A HE3  10 
ATOM   7200  H HZ2  . TRP A 1 34 ? 2.315   -7.848  -1.768  1.00 15.00 ?  505 TRP A HZ2  10 
ATOM   7201  H HZ3  . TRP A 1 34 ? -1.005  -5.595  -3.216  1.00 15.00 ?  505 TRP A HZ3  10 
ATOM   7202  H HH2  . TRP A 1 34 ? 1.267   -6.445  -3.489  1.00 15.00 ?  505 TRP A HH2  10 
ATOM   7203  N N    . GLU A 1 35 ? -4.595  -5.763  3.418   1.00 15.00 ?  506 GLU A N    10 
ATOM   7204  C CA   . GLU A 1 35 ? -5.925  -5.716  4.001   1.00 15.00 ?  506 GLU A CA   10 
ATOM   7205  C C    . GLU A 1 35 ? -6.519  -4.344  3.866   1.00 15.00 ?  506 GLU A C    10 
ATOM   7206  O O    . GLU A 1 35 ? -5.861  -3.332  4.109   1.00 15.00 ?  506 GLU A O    10 
ATOM   7207  C CB   . GLU A 1 35 ? -5.882  -6.132  5.474   1.00 15.00 ?  506 GLU A CB   10 
ATOM   7208  C CG   . GLU A 1 35 ? -5.318  -7.524  5.701   1.00 15.00 ?  506 GLU A CG   10 
ATOM   7209  C CD   . GLU A 1 35 ? -6.112  -8.595  4.983   1.00 15.00 ?  506 GLU A CD   10 
ATOM   7210  O OE1  . GLU A 1 35 ? -7.267  -8.851  5.386   1.00 15.00 -1 506 GLU A OE1  10 
ATOM   7211  O OE2  . GLU A 1 35 ? -5.587  -9.181  4.019   1.00 15.00 ?  506 GLU A OE2  10 
ATOM   7212  H H    . GLU A 1 35 ? -3.819  -5.616  3.991   1.00 15.00 ?  506 GLU A H    10 
ATOM   7213  H HA   . GLU A 1 35 ? -6.558  -6.390  3.457   1.00 15.00 ?  506 GLU A HA   10 
ATOM   7214  H HB2  . GLU A 1 35 ? -5.271  -5.426  6.017   1.00 15.00 ?  506 GLU A HB2  10 
ATOM   7215  H HB3  . GLU A 1 35 ? -6.886  -6.106  5.873   1.00 15.00 ?  506 GLU A HB3  10 
ATOM   7216  H HG2  . GLU A 1 35 ? -4.299  -7.550  5.341   1.00 15.00 ?  506 GLU A HG2  10 
ATOM   7217  H HG3  . GLU A 1 35 ? -5.330  -7.736  6.761   1.00 15.00 ?  506 GLU A HG3  10 
ATOM   7218  N N    . ASP A 1 36 ? -7.780  -4.324  3.488   1.00 15.00 ?  507 ASP A N    10 
ATOM   7219  C CA   . ASP A 1 36 ? -8.465  -3.082  3.278   1.00 15.00 ?  507 ASP A CA   10 
ATOM   7220  C C    . ASP A 1 36 ? -8.794  -2.423  4.614   1.00 15.00 ?  507 ASP A C    10 
ATOM   7221  O O    . ASP A 1 36 ? -9.447  -3.020  5.473   1.00 15.00 ?  507 ASP A O    10 
ATOM   7222  C CB   . ASP A 1 36 ? -9.731  -3.292  2.439   1.00 15.00 ?  507 ASP A CB   10 
ATOM   7223  C CG   . ASP A 1 36 ? -10.693 -4.291  3.056   1.00 15.00 ?  507 ASP A CG   10 
ATOM   7224  O OD1  . ASP A 1 36 ? -10.467 -5.509  2.912   1.00 15.00 -1 507 ASP A OD1  10 
ATOM   7225  O OD2  . ASP A 1 36 ? -11.683 -3.868  3.686   1.00 15.00 ?  507 ASP A OD2  10 
ATOM   7226  H H    . ASP A 1 36 ? -8.259  -5.169  3.350   1.00 15.00 ?  507 ASP A H    10 
ATOM   7227  H HA   . ASP A 1 36 ? -7.784  -2.460  2.735   1.00 15.00 ?  507 ASP A HA   10 
ATOM   7228  H HB2  . ASP A 1 36 ? -10.242 -2.347  2.334   1.00 15.00 ?  507 ASP A HB2  10 
ATOM   7229  H HB3  . ASP A 1 36 ? -9.448  -3.652  1.460   1.00 15.00 ?  507 ASP A HB3  10 
ATOM   7230  N N    . PRO A 1 37 ? -8.319  -1.184  4.819   1.00 15.00 ?  508 PRO A N    10 
ATOM   7231  C CA   . PRO A 1 37 ? -8.529  -0.457  6.073   1.00 15.00 ?  508 PRO A CA   10 
ATOM   7232  C C    . PRO A 1 37 ? -9.953  0.078   6.211   1.00 15.00 ?  508 PRO A C    10 
ATOM   7233  O O    . PRO A 1 37 ? -10.351 0.536   7.281   1.00 15.00 ?  508 PRO A O    10 
ATOM   7234  C CB   . PRO A 1 37 ? -7.530  0.696   5.984   1.00 15.00 ?  508 PRO A CB   10 
ATOM   7235  C CG   . PRO A 1 37 ? -7.363  0.936   4.522   1.00 15.00 ?  508 PRO A CG   10 
ATOM   7236  C CD   . PRO A 1 37 ? -7.516  -0.406  3.855   1.00 15.00 ?  508 PRO A CD   10 
ATOM   7237  H HA   . PRO A 1 37 ? -8.294  -1.072  6.929   1.00 15.00 ?  508 PRO A HA   10 
ATOM   7238  H HB2  . PRO A 1 37 ? -7.931  1.565   6.486   1.00 15.00 ?  508 PRO A HB2  10 
ATOM   7239  H HB3  . PRO A 1 37 ? -6.597  0.405   6.443   1.00 15.00 ?  508 PRO A HB3  10 
ATOM   7240  H HG2  . PRO A 1 37 ? -8.127  1.618   4.174   1.00 15.00 ?  508 PRO A HG2  10 
ATOM   7241  H HG3  . PRO A 1 37 ? -6.382  1.341   4.327   1.00 15.00 ?  508 PRO A HG3  10 
ATOM   7242  H HD2  . PRO A 1 37 ? -8.038  -0.302  2.915   1.00 15.00 ?  508 PRO A HD2  10 
ATOM   7243  H HD3  . PRO A 1 37 ? -6.549  -0.863  3.703   1.00 15.00 ?  508 PRO A HD3  10 
ATOM   7244  N N    . ARG A 1 38 ? -10.690 0.056   5.106   1.00 15.00 ?  509 ARG A N    10 
ATOM   7245  C CA   . ARG A 1 38 ? -12.085 0.481   5.083   1.00 15.00 ?  509 ARG A CA   10 
ATOM   7246  C C    . ARG A 1 38 ? -12.725 0.098   3.754   1.00 15.00 ?  509 ARG A C    10 
ATOM   7247  O O    . ARG A 1 38 ? -12.310 0.640   2.709   1.00 15.00 ?  509 ARG A O    10 
ATOM   7248  C CB   . ARG A 1 38 ? -12.243 1.992   5.341   1.00 15.00 ?  509 ARG A CB   10 
ATOM   7249  C CG   . ARG A 1 38 ? -11.330 2.886   4.513   1.00 15.00 ?  509 ARG A CG   10 
ATOM   7250  C CD   . ARG A 1 38 ? -10.110 3.323   5.309   1.00 15.00 ?  509 ARG A CD   10 
ATOM   7251  N NE   . ARG A 1 38 ? -10.477 4.134   6.471   1.00 15.00 ?  509 ARG A NE   10 
ATOM   7252  C CZ   . ARG A 1 38 ? -9.692  4.336   7.530   1.00 15.00 ?  509 ARG A CZ   10 
ATOM   7253  N NH1  . ARG A 1 38 ? -8.502  3.748   7.606   1.00 15.00 1  509 ARG A NH1  10 
ATOM   7254  N NH2  . ARG A 1 38 ? -10.108 5.120   8.515   1.00 15.00 ?  509 ARG A NH2  10 
ATOM   7255  H H    . ARG A 1 38 ? -10.288 -0.269  4.275   1.00 15.00 ?  509 ARG A H    10 
ATOM   7256  H HA   . ARG A 1 38 ? -12.596 -0.060  5.869   1.00 15.00 ?  509 ARG A HA   10 
ATOM   7257  H HB2  . ARG A 1 38 ? -13.264 2.273   5.128   1.00 15.00 ?  509 ARG A HB2  10 
ATOM   7258  H HB3  . ARG A 1 38 ? -12.044 2.185   6.385   1.00 15.00 ?  509 ARG A HB3  10 
ATOM   7259  H HG2  . ARG A 1 38 ? -11.001 2.342   3.642   1.00 15.00 ?  509 ARG A HG2  10 
ATOM   7260  H HG3  . ARG A 1 38 ? -11.882 3.762   4.208   1.00 15.00 ?  509 ARG A HG3  10 
ATOM   7261  H HD2  . ARG A 1 38 ? -9.580  2.445   5.647   1.00 15.00 ?  509 ARG A HD2  10 
ATOM   7262  H HD3  . ARG A 1 38 ? -9.466  3.905   4.664   1.00 15.00 ?  509 ARG A HD3  10 
ATOM   7263  H HE   . ARG A 1 38 ? -11.363 4.568   6.451   1.00 15.00 ?  509 ARG A HE   10 
ATOM   7264  H HH11 . ARG A 1 38 ? -8.190  3.153   6.870   1.00 15.00 ?  509 ARG A HH11 10 
ATOM   7265  H HH12 . ARG A 1 38 ? -7.910  3.902   8.411   1.00 15.00 ?  509 ARG A HH12 10 
ATOM   7266  H HH21 . ARG A 1 38 ? -11.016 5.557   8.461   1.00 15.00 ?  509 ARG A HH21 10 
ATOM   7267  H HH22 . ARG A 1 38 ? -9.517  5.295   9.314   1.00 15.00 ?  509 ARG A HH22 10 
ATOM   7268  N N    . ARG B 2 1  ? -1.272  -18.147 -0.277  1.00 15.00 ?  925 ARG B N    10 
ATOM   7269  C CA   . ARG B 2 1  ? -0.516  -17.344 0.707   1.00 15.00 ?  925 ARG B CA   10 
ATOM   7270  C C    . ARG B 2 1  ? -0.319  -15.919 0.204   1.00 15.00 ?  925 ARG B C    10 
ATOM   7271  O O    . ARG B 2 1  ? 0.058   -15.705 -0.948  1.00 15.00 ?  925 ARG B O    10 
ATOM   7272  C CB   . ARG B 2 1  ? 0.850   -17.983 0.998   1.00 15.00 ?  925 ARG B CB   10 
ATOM   7273  C CG   . ARG B 2 1  ? 1.761   -18.107 -0.217  1.00 15.00 ?  925 ARG B CG   10 
ATOM   7274  C CD   . ARG B 2 1  ? 3.205   -18.372 0.191   1.00 15.00 ?  925 ARG B CD   10 
ATOM   7275  N NE   . ARG B 2 1  ? 3.749   -17.277 0.999   1.00 15.00 ?  925 ARG B NE   10 
ATOM   7276  C CZ   . ARG B 2 1  ? 5.050   -17.030 1.167   1.00 15.00 ?  925 ARG B CZ   10 
ATOM   7277  N NH1  . ARG B 2 1  ? 5.970   -17.805 0.608   1.00 15.00 1  925 ARG B NH1  10 
ATOM   7278  N NH2  . ARG B 2 1  ? 5.427   -15.997 1.908   1.00 15.00 ?  925 ARG B NH2  10 
ATOM   7279  H H1   . ARG B 2 1  ? -2.236  -17.761 -0.391  1.00 15.00 ?  925 ARG B H1   10 
ATOM   7280  H H2   . ARG B 2 1  ? -1.339  -19.137 0.040   1.00 15.00 ?  925 ARG B H2   10 
ATOM   7281  H H3   . ARG B 2 1  ? -0.796  -18.123 -1.202  1.00 15.00 ?  925 ARG B H3   10 
ATOM   7282  H HA   . ARG B 2 1  ? -1.089  -17.309 1.624   1.00 15.00 ?  925 ARG B HA   10 
ATOM   7283  H HB2  . ARG B 2 1  ? 1.360   -17.386 1.738   1.00 15.00 ?  925 ARG B HB2  10 
ATOM   7284  H HB3  . ARG B 2 1  ? 0.689   -18.972 1.399   1.00 15.00 ?  925 ARG B HB3  10 
ATOM   7285  H HG2  . ARG B 2 1  ? 1.416   -18.926 -0.831  1.00 15.00 ?  925 ARG B HG2  10 
ATOM   7286  H HG3  . ARG B 2 1  ? 1.719   -17.187 -0.782  1.00 15.00 ?  925 ARG B HG3  10 
ATOM   7287  H HD2  . ARG B 2 1  ? 3.242   -19.286 0.765   1.00 15.00 ?  925 ARG B HD2  10 
ATOM   7288  H HD3  . ARG B 2 1  ? 3.804   -18.482 -0.702  1.00 15.00 ?  925 ARG B HD3  10 
ATOM   7289  H HE   . ARG B 2 1  ? 3.101   -16.683 1.445   1.00 15.00 ?  925 ARG B HE   10 
ATOM   7290  H HH11 . ARG B 2 1  ? 5.699   -18.596 0.050   1.00 15.00 ?  925 ARG B HH11 10 
ATOM   7291  H HH12 . ARG B 2 1  ? 6.949   -17.608 0.748   1.00 15.00 ?  925 ARG B HH12 10 
ATOM   7292  H HH21 . ARG B 2 1  ? 4.734   -15.408 2.339   1.00 15.00 ?  925 ARG B HH21 10 
ATOM   7293  H HH22 . ARG B 2 1  ? 6.402   -15.800 2.044   1.00 15.00 ?  925 ARG B HH22 10 
ATOM   7294  N N    . LEU B 2 2  ? -0.562  -14.949 1.070   1.00 15.00 ?  926 LEU B N    10 
ATOM   7295  C CA   . LEU B 2 2  ? -0.306  -13.556 0.733   1.00 15.00 ?  926 LEU B CA   10 
ATOM   7296  C C    . LEU B 2 2  ? 1.037   -13.134 1.311   1.00 15.00 ?  926 LEU B C    10 
ATOM   7297  O O    . LEU B 2 2  ? 1.243   -13.187 2.525   1.00 15.00 ?  926 LEU B O    10 
ATOM   7298  C CB   . LEU B 2 2  ? -1.416  -12.637 1.267   1.00 15.00 ?  926 LEU B CB   10 
ATOM   7299  C CG   . LEU B 2 2  ? -2.781  -12.741 0.566   1.00 15.00 ?  926 LEU B CG   10 
ATOM   7300  C CD1  . LEU B 2 2  ? -2.623  -12.634 -0.945  1.00 15.00 ?  926 LEU B CD1  10 
ATOM   7301  C CD2  . LEU B 2 2  ? -3.500  -14.030 0.943   1.00 15.00 ?  926 LEU B CD2  10 
ATOM   7302  H H    . LEU B 2 2  ? -0.913  -15.173 1.960   1.00 15.00 ?  926 LEU B H    10 
ATOM   7303  H HA   . LEU B 2 2  ? -0.265  -13.476 -0.344  1.00 15.00 ?  926 LEU B HA   10 
ATOM   7304  H HB2  . LEU B 2 2  ? -1.559  -12.861 2.314   1.00 15.00 ?  926 LEU B HB2  10 
ATOM   7305  H HB3  . LEU B 2 2  ? -1.074  -11.616 1.183   1.00 15.00 ?  926 LEU B HB3  10 
ATOM   7306  H HG   . LEU B 2 2  ? -3.398  -11.914 0.887   1.00 15.00 ?  926 LEU B HG   10 
ATOM   7307  H HD11 . LEU B 2 2  ? -2.185  -11.680 -1.196  1.00 15.00 ?  926 LEU B HD11 10 
ATOM   7308  H HD12 . LEU B 2 2  ? -3.591  -12.721 -1.416  1.00 15.00 ?  926 LEU B HD12 10 
ATOM   7309  H HD13 . LEU B 2 2  ? -1.980  -13.428 -1.296  1.00 15.00 ?  926 LEU B HD13 10 
ATOM   7310  H HD21 . LEU B 2 2  ? -2.894  -14.878 0.659   1.00 15.00 ?  926 LEU B HD21 10 
ATOM   7311  H HD22 . LEU B 2 2  ? -4.449  -14.077 0.430   1.00 15.00 ?  926 LEU B HD22 10 
ATOM   7312  H HD23 . LEU B 2 2  ? -3.667  -14.052 2.011   1.00 15.00 ?  926 LEU B HD23 10 
ATOM   7313  N N    . ASP B 2 3  ? 1.950   -12.726 0.447   1.00 15.00 ?  927 ASP B N    10 
ATOM   7314  C CA   . ASP B 2 3  ? 3.282   -12.325 0.883   1.00 15.00 ?  927 ASP B CA   10 
ATOM   7315  C C    . ASP B 2 3  ? 3.441   -10.815 0.784   1.00 15.00 ?  927 ASP B C    10 
ATOM   7316  O O    . ASP B 2 3  ? 3.078   -10.202 -0.221  1.00 15.00 ?  927 ASP B O    10 
ATOM   7317  C CB   . ASP B 2 3  ? 4.369   -13.041 0.064   1.00 15.00 ?  927 ASP B CB   10 
ATOM   7318  C CG   . ASP B 2 3  ? 4.381   -12.654 -1.404  1.00 15.00 ?  927 ASP B CG   10 
ATOM   7319  O OD1  . ASP B 2 3  ? 3.470   -13.086 -2.146  1.00 15.00 ?  927 ASP B OD1  10 
ATOM   7320  O OD2  . ASP B 2 3  ? 5.318   -11.942 -1.829  1.00 15.00 -1 927 ASP B OD2  10 
ATOM   7321  H H    . ASP B 2 3  ? 1.729   -12.691 -0.511  1.00 15.00 ?  927 ASP B H    10 
ATOM   7322  H HA   . ASP B 2 3  ? 3.385   -12.610 1.920   1.00 15.00 ?  927 ASP B HA   10 
ATOM   7323  H HB2  . ASP B 2 3  ? 5.336   -12.802 0.480   1.00 15.00 ?  927 ASP B HB2  10 
ATOM   7324  H HB3  . ASP B 2 3  ? 4.211   -14.108 0.134   1.00 15.00 ?  927 ASP B HB3  10 
ATOM   7325  N N    . LEU B 2 4  ? 3.966   -10.214 1.839   1.00 15.00 ?  928 LEU B N    10 
ATOM   7326  C CA   . LEU B 2 4  ? 4.153   -8.775  1.876   1.00 15.00 ?  928 LEU B CA   10 
ATOM   7327  C C    . LEU B 2 4  ? 5.634   -8.451  1.703   1.00 15.00 ?  928 LEU B C    10 
ATOM   7328  O O    . LEU B 2 4  ? 6.468   -8.875  2.506   1.00 15.00 ?  928 LEU B O    10 
ATOM   7329  C CB   . LEU B 2 4  ? 3.612   -8.226  3.211   1.00 15.00 ?  928 LEU B CB   10 
ATOM   7330  C CG   . LEU B 2 4  ? 3.406   -6.704  3.304   1.00 15.00 ?  928 LEU B CG   10 
ATOM   7331  C CD1  . LEU B 2 4  ? 4.722   -5.970  3.508   1.00 15.00 ?  928 LEU B CD1  10 
ATOM   7332  C CD2  . LEU B 2 4  ? 2.698   -6.182  2.063   1.00 15.00 ?  928 LEU B CD2  10 
ATOM   7333  H H    . LEU B 2 4  ? 4.241   -10.753 2.608   1.00 15.00 ?  928 LEU B H    10 
ATOM   7334  H HA   . LEU B 2 4  ? 3.598   -8.340  1.059   1.00 15.00 ?  928 LEU B HA   10 
ATOM   7335  H HB2  . LEU B 2 4  ? 2.662   -8.701  3.406   1.00 15.00 ?  928 LEU B HB2  10 
ATOM   7336  H HB3  . LEU B 2 4  ? 4.301   -8.517  3.993   1.00 15.00 ?  928 LEU B HB3  10 
ATOM   7337  H HG   . LEU B 2 4  ? 2.777   -6.492  4.155   1.00 15.00 ?  928 LEU B HG   10 
ATOM   7338  H HD11 . LEU B 2 4  ? 5.381   -6.177  2.677   1.00 15.00 ?  928 LEU B HD11 10 
ATOM   7339  H HD12 . LEU B 2 4  ? 5.182   -6.306  4.425   1.00 15.00 ?  928 LEU B HD12 10 
ATOM   7340  H HD13 . LEU B 2 4  ? 4.536   -4.907  3.565   1.00 15.00 ?  928 LEU B HD13 10 
ATOM   7341  H HD21 . LEU B 2 4  ? 3.295   -6.396  1.189   1.00 15.00 ?  928 LEU B HD21 10 
ATOM   7342  H HD22 . LEU B 2 4  ? 2.557   -5.115  2.151   1.00 15.00 ?  928 LEU B HD22 10 
ATOM   7343  H HD23 . LEU B 2 4  ? 1.735   -6.665  1.969   1.00 15.00 ?  928 LEU B HD23 10 
ATOM   7344  N N    . PRO B 2 5  ? 5.981   -7.700  0.649   1.00 15.00 ?  929 PRO B N    10 
ATOM   7345  C CA   . PRO B 2 5  ? 7.359   -7.293  0.387   1.00 15.00 ?  929 PRO B CA   10 
ATOM   7346  C C    . PRO B 2 5  ? 7.791   -6.134  1.281   1.00 15.00 ?  929 PRO B C    10 
ATOM   7347  O O    . PRO B 2 5  ? 7.041   -5.173  1.456   1.00 15.00 ?  929 PRO B O    10 
ATOM   7348  C CB   . PRO B 2 5  ? 7.338   -6.842  -1.085  1.00 15.00 ?  929 PRO B CB   10 
ATOM   7349  C CG   . PRO B 2 5  ? 5.961   -7.136  -1.593  1.00 15.00 ?  929 PRO B CG   10 
ATOM   7350  C CD   . PRO B 2 5  ? 5.071   -7.201  -0.387  1.00 15.00 ?  929 PRO B CD   10 
ATOM   7351  H HA   . PRO B 2 5  ? 8.046   -8.117  0.507   1.00 15.00 ?  929 PRO B HA   10 
ATOM   7352  H HB2  . PRO B 2 5  ? 7.557   -5.786  -1.140  1.00 15.00 ?  929 PRO B HB2  10 
ATOM   7353  H HB3  . PRO B 2 5  ? 8.085   -7.393  -1.639  1.00 15.00 ?  929 PRO B HB3  10 
ATOM   7354  H HG2  . PRO B 2 5  ? 5.637   -6.346  -2.254  1.00 15.00 ?  929 PRO B HG2  10 
ATOM   7355  H HG3  . PRO B 2 5  ? 5.956   -8.084  -2.112  1.00 15.00 ?  929 PRO B HG3  10 
ATOM   7356  H HD2  . PRO B 2 5  ? 4.697   -6.218  -0.136  1.00 15.00 ?  929 PRO B HD2  10 
ATOM   7357  H HD3  . PRO B 2 5  ? 4.255   -7.888  -0.552  1.00 15.00 ?  929 PRO B HD3  10 
ATOM   7358  N N    . PRO B 2 6  ? 9.002   -6.218  1.861   1.00 15.00 ?  930 PRO B N    10 
ATOM   7359  C CA   . PRO B 2 6  ? 9.571   -5.131  2.666   1.00 15.00 ?  930 PRO B CA   10 
ATOM   7360  C C    . PRO B 2 6  ? 9.476   -3.790  1.943   1.00 15.00 ?  930 PRO B C    10 
ATOM   7361  O O    . PRO B 2 6  ? 9.990   -3.637  0.832   1.00 15.00 ?  930 PRO B O    10 
ATOM   7362  C CB   . PRO B 2 6  ? 11.029  -5.550  2.845   1.00 15.00 ?  930 PRO B CB   10 
ATOM   7363  C CG   . PRO B 2 6  ? 11.004  -7.038  2.757   1.00 15.00 ?  930 PRO B CG   10 
ATOM   7364  C CD   . PRO B 2 6  ? 9.909   -7.376  1.780   1.00 15.00 ?  930 PRO B CD   10 
ATOM   7365  H HA   . PRO B 2 6  ? 9.089   -5.056  3.630   1.00 15.00 ?  930 PRO B HA   10 
ATOM   7366  H HB2  . PRO B 2 6  ? 11.633  -5.117  2.060   1.00 15.00 ?  930 PRO B HB2  10 
ATOM   7367  H HB3  . PRO B 2 6  ? 11.388  -5.219  3.809   1.00 15.00 ?  930 PRO B HB3  10 
ATOM   7368  H HG2  . PRO B 2 6  ? 11.955  -7.399  2.394   1.00 15.00 ?  930 PRO B HG2  10 
ATOM   7369  H HG3  . PRO B 2 6  ? 10.785  -7.460  3.726   1.00 15.00 ?  930 PRO B HG3  10 
ATOM   7370  H HD2  . PRO B 2 6  ? 10.313  -7.480  0.783   1.00 15.00 ?  930 PRO B HD2  10 
ATOM   7371  H HD3  . PRO B 2 6  ? 9.404   -8.282  2.079   1.00 15.00 ?  930 PRO B HD3  10 
ATOM   7372  N N    . TYR B 2 7  ? 8.814   -2.833  2.580   1.00 15.00 ?  931 TYR B N    10 
ATOM   7373  C CA   . TYR B 2 7  ? 8.455   -1.580  1.930   1.00 15.00 ?  931 TYR B CA   10 
ATOM   7374  C C    . TYR B 2 7  ? 9.676   -0.768  1.503   1.00 15.00 ?  931 TYR B C    10 
ATOM   7375  O O    . TYR B 2 7  ? 10.516  -0.387  2.322   1.00 15.00 ?  931 TYR B O    10 
ATOM   7376  C CB   . TYR B 2 7  ? 7.571   -0.758  2.882   1.00 15.00 ?  931 TYR B CB   10 
ATOM   7377  C CG   . TYR B 2 7  ? 7.465   0.717   2.541   1.00 15.00 ?  931 TYR B CG   10 
ATOM   7378  C CD1  . TYR B 2 7  ? 6.777   1.151   1.414   1.00 15.00 ?  931 TYR B CD1  10 
ATOM   7379  C CD2  . TYR B 2 7  ? 8.054   1.675   3.358   1.00 15.00 ?  931 TYR B CD2  10 
ATOM   7380  C CE1  . TYR B 2 7  ? 6.683   2.497   1.112   1.00 15.00 ?  931 TYR B CE1  10 
ATOM   7381  C CE2  . TYR B 2 7  ? 7.961   3.021   3.061   1.00 15.00 ?  931 TYR B CE2  10 
ATOM   7382  C CZ   . TYR B 2 7  ? 7.275   3.427   1.938   1.00 15.00 ?  931 TYR B CZ   10 
ATOM   7383  O OH   . TYR B 2 7  ? 7.181   4.767   1.641   1.00 15.00 ?  931 TYR B OH   10 
ATOM   7384  H H    . TYR B 2 7  ? 8.556   -2.975  3.518   1.00 15.00 ?  931 TYR B H    10 
ATOM   7385  H HA   . TYR B 2 7  ? 7.879   -1.821  1.051   1.00 15.00 ?  931 TYR B HA   10 
ATOM   7386  H HB2  . TYR B 2 7  ? 6.572   -1.168  2.871   1.00 15.00 ?  931 TYR B HB2  10 
ATOM   7387  H HB3  . TYR B 2 7  ? 7.969   -0.837  3.881   1.00 15.00 ?  931 TYR B HB3  10 
ATOM   7388  H HD1  . TYR B 2 7  ? 6.312   0.421   0.767   1.00 15.00 ?  931 TYR B HD1  10 
ATOM   7389  H HD2  . TYR B 2 7  ? 8.593   1.355   4.238   1.00 15.00 ?  931 TYR B HD2  10 
ATOM   7390  H HE1  . TYR B 2 7  ? 6.145   2.816   0.233   1.00 15.00 ?  931 TYR B HE1  10 
ATOM   7391  H HE2  . TYR B 2 7  ? 8.424   3.749   3.710   1.00 15.00 ?  931 TYR B HE2  10 
ATOM   7392  H HH   . TYR B 2 7  ? 8.065   5.157   1.660   1.00 15.00 ?  931 TYR B HH   10 
ATOM   7393  N N    . GLU B 2 8  ? 9.765   -0.534  0.201   1.00 15.00 ?  932 GLU B N    10 
ATOM   7394  C CA   . GLU B 2 8  ? 10.649  0.473   -0.362  1.00 15.00 ?  932 GLU B CA   10 
ATOM   7395  C C    . GLU B 2 8  ? 9.776   1.603   -0.882  1.00 15.00 ?  932 GLU B C    10 
ATOM   7396  O O    . GLU B 2 8  ? 8.685   1.343   -1.391  1.00 15.00 ?  932 GLU B O    10 
ATOM   7397  C CB   . GLU B 2 8  ? 11.492  -0.112  -1.500  1.00 15.00 ?  932 GLU B CB   10 
ATOM   7398  C CG   . GLU B 2 8  ? 12.305  -1.334  -1.101  1.00 15.00 ?  932 GLU B CG   10 
ATOM   7399  C CD   . GLU B 2 8  ? 13.313  -1.730  -2.160  1.00 15.00 ?  932 GLU B CD   10 
ATOM   7400  O OE1  . GLU B 2 8  ? 12.901  -2.119  -3.271  1.00 15.00 ?  932 GLU B OE1  10 
ATOM   7401  O OE2  . GLU B 2 8  ? 14.530  -1.654  -1.883  1.00 15.00 -1 932 GLU B OE2  10 
ATOM   7402  H H    . GLU B 2 8  ? 9.207   -1.058  -0.409  1.00 15.00 ?  932 GLU B H    10 
ATOM   7403  H HA   . GLU B 2 8  ? 11.294  0.845   0.421   1.00 15.00 ?  932 GLU B HA   10 
ATOM   7404  H HB2  . GLU B 2 8  ? 10.835  -0.392  -2.309  1.00 15.00 ?  932 GLU B HB2  10 
ATOM   7405  H HB3  . GLU B 2 8  ? 12.175  0.649   -1.851  1.00 15.00 ?  932 GLU B HB3  10 
ATOM   7406  H HG2  . GLU B 2 8  ? 12.834  -1.115  -0.184  1.00 15.00 ?  932 GLU B HG2  10 
ATOM   7407  H HG3  . GLU B 2 8  ? 11.628  -2.160  -0.939  1.00 15.00 ?  932 GLU B HG3  10 
ATOM   7408  N N    . THR B 2 9  ? 10.222  2.842   -0.782  1.00 15.00 ?  933 THR B N    10 
ATOM   7409  C CA   . THR B 2 9  ? 9.385   3.941   -1.226  1.00 15.00 ?  933 THR B CA   10 
ATOM   7410  C C    . THR B 2 9  ? 9.384   4.046   -2.748  1.00 15.00 ?  933 THR B C    10 
ATOM   7411  O O    . THR B 2 9  ? 10.425  4.232   -3.383  1.00 15.00 ?  933 THR B O    10 
ATOM   7412  C CB   . THR B 2 9  ? 9.802   5.294   -0.620  1.00 15.00 ?  933 THR B CB   10 
ATOM   7413  O OG1  . THR B 2 9  ? 10.030  5.153   0.791   1.00 15.00 ?  933 THR B OG1  10 
ATOM   7414  C CG2  . THR B 2 9  ? 8.708   6.334   -0.859  1.00 15.00 ?  933 THR B CG2  10 
ATOM   7415  H H    . THR B 2 9  ? 11.120  3.019   -0.423  1.00 15.00 ?  933 THR B H    10 
ATOM   7416  H HA   . THR B 2 9  ? 8.376   3.729   -0.899  1.00 15.00 ?  933 THR B HA   10 
ATOM   7417  H HB   . THR B 2 9  ? 10.711  5.629   -1.098  1.00 15.00 ?  933 THR B HB   10 
ATOM   7418  H HG1  . THR B 2 9  ? 10.977  5.288   0.973   1.00 15.00 ?  933 THR B HG1  10 
ATOM   7419  H HG21 . THR B 2 9  ? 7.783   5.995   -0.411  1.00 15.00 ?  933 THR B HG21 10 
ATOM   7420  H HG22 . THR B 2 9  ? 8.560   6.466   -1.922  1.00 15.00 ?  933 THR B HG22 10 
ATOM   7421  H HG23 . THR B 2 9  ? 9.000   7.275   -0.417  1.00 15.00 ?  933 THR B HG23 10 
ATOM   7422  N N    . PHE B 2 10 ? 8.203   3.912   -3.313  1.00 15.00 ?  934 PHE B N    10 
ATOM   7423  C CA   . PHE B 2 10 ? 7.984   4.096   -4.737  1.00 15.00 ?  934 PHE B CA   10 
ATOM   7424  C C    . PHE B 2 10 ? 7.764   5.593   -5.011  1.00 15.00 ?  934 PHE B C    10 
ATOM   7425  O O    . PHE B 2 10 ? 7.885   6.402   -4.090  1.00 15.00 ?  934 PHE B O    10 
ATOM   7426  C CB   . PHE B 2 10 ? 6.795   3.243   -5.210  1.00 15.00 ?  934 PHE B CB   10 
ATOM   7427  C CG   . PHE B 2 10 ? 5.477   3.808   -4.801  1.00 15.00 ?  934 PHE B CG   10 
ATOM   7428  C CD1  . PHE B 2 10 ? 4.955   3.581   -3.538  1.00 15.00 ?  934 PHE B CD1  10 
ATOM   7429  C CD2  . PHE B 2 10 ? 4.783   4.613   -5.676  1.00 15.00 ?  934 PHE B CD2  10 
ATOM   7430  C CE1  . PHE B 2 10 ? 3.759   4.152   -3.170  1.00 15.00 ?  934 PHE B CE1  10 
ATOM   7431  C CE2  . PHE B 2 10 ? 3.599   5.194   -5.313  1.00 15.00 ?  934 PHE B CE2  10 
ATOM   7432  C CZ   . PHE B 2 10 ? 3.089   4.966   -4.061  1.00 15.00 ?  934 PHE B CZ   10 
ATOM   7433  H H    . PHE B 2 10 ? 7.439   3.679   -2.748  1.00 15.00 ?  934 PHE B H    10 
ATOM   7434  H HA   . PHE B 2 10 ? 8.879   3.776   -5.253  1.00 15.00 ?  934 PHE B HA   10 
ATOM   7435  H HB2  . PHE B 2 10 ? 6.810   3.177   -6.286  1.00 15.00 ?  934 PHE B HB2  10 
ATOM   7436  H HB3  . PHE B 2 10 ? 6.881   2.250   -4.790  1.00 15.00 ?  934 PHE B HB3  10 
ATOM   7437  H HD1  . PHE B 2 10 ? 5.478   2.936   -2.849  1.00 15.00 ?  934 PHE B HD1  10 
ATOM   7438  H HD2  . PHE B 2 10 ? 5.188   4.782   -6.659  1.00 15.00 ?  934 PHE B HD2  10 
ATOM   7439  H HE1  . PHE B 2 10 ? 3.353   3.976   -2.184  1.00 15.00 ?  934 PHE B HE1  10 
ATOM   7440  H HE2  . PHE B 2 10 ? 3.068   5.824   -6.009  1.00 15.00 ?  934 PHE B HE2  10 
ATOM   7441  H HZ   . PHE B 2 10 ? 2.174   5.429   -3.777  1.00 15.00 ?  934 PHE B HZ   10 
ATOM   7442  N N    . GLU B 2 11 ? 7.526   5.958   -6.276  1.00 15.00 ?  935 GLU B N    10 
ATOM   7443  C CA   . GLU B 2 11 ? 7.334   7.361   -6.691  1.00 15.00 ?  935 GLU B CA   10 
ATOM   7444  C C    . GLU B 2 11 ? 6.331   8.141   -5.833  1.00 15.00 ?  935 GLU B C    10 
ATOM   7445  O O    . GLU B 2 11 ? 5.720   7.625   -4.897  1.00 15.00 ?  935 GLU B O    10 
ATOM   7446  C CB   . GLU B 2 11 ? 6.869   7.429   -8.149  1.00 15.00 ?  935 GLU B CB   10 
ATOM   7447  C CG   . GLU B 2 11 ? 5.592   6.650   -8.436  1.00 15.00 ?  935 GLU B CG   10 
ATOM   7448  C CD   . GLU B 2 11 ? 5.882   5.270   -8.990  1.00 15.00 ?  935 GLU B CD   10 
ATOM   7449  O OE1  . GLU B 2 11 ? 6.468   4.436   -8.272  1.00 15.00 -1 935 GLU B OE1  10 
ATOM   7450  O OE2  . GLU B 2 11 ? 5.547   5.020   -10.168 1.00 15.00 ?  935 GLU B OE2  10 
ATOM   7451  H H    . GLU B 2 11 ? 7.450   5.255   -6.960  1.00 15.00 ?  935 GLU B H    10 
ATOM   7452  H HA   . GLU B 2 11 ? 8.284   7.863   -6.622  1.00 15.00 ?  935 GLU B HA   10 
ATOM   7453  H HB2  . GLU B 2 11 ? 6.697   8.463   -8.410  1.00 15.00 ?  935 GLU B HB2  10 
ATOM   7454  H HB3  . GLU B 2 11 ? 7.653   7.037   -8.781  1.00 15.00 ?  935 GLU B HB3  10 
ATOM   7455  H HG2  . GLU B 2 11 ? 5.018   6.548   -7.514  1.00 15.00 ?  935 GLU B HG2  10 
ATOM   7456  H HG3  . GLU B 2 11 ? 5.011   7.198   -9.162  1.00 15.00 ?  935 GLU B HG3  10 
ATOM   7457  N N    . ASP B 2 12 ? 6.183   9.406   -6.202  1.00 15.00 ?  936 ASP B N    10 
ATOM   7458  C CA   . ASP B 2 12 ? 5.318   10.363  -5.502  1.00 15.00 ?  936 ASP B CA   10 
ATOM   7459  C C    . ASP B 2 12 ? 3.920   9.805   -5.244  1.00 15.00 ?  936 ASP B C    10 
ATOM   7460  O O    . ASP B 2 12 ? 3.365   9.075   -6.065  1.00 15.00 ?  936 ASP B O    10 
ATOM   7461  C CB   . ASP B 2 12 ? 5.195   11.651  -6.318  1.00 15.00 ?  936 ASP B CB   10 
ATOM   7462  C CG   . ASP B 2 12 ? 6.524   12.343  -6.538  1.00 15.00 ?  936 ASP B CG   10 
ATOM   7463  O OD1  . ASP B 2 12 ? 6.931   13.152  -5.677  1.00 15.00 ?  936 ASP B OD1  10 
ATOM   7464  O OD2  . ASP B 2 12 ? 7.166   12.090  -7.577  1.00 15.00 -1 936 ASP B OD2  10 
ATOM   7465  H H    . ASP B 2 12 ? 6.694   9.717   -6.979  1.00 15.00 ?  936 ASP B H    10 
ATOM   7466  H HA   . ASP B 2 12 ? 5.781   10.594  -4.555  1.00 15.00 ?  936 ASP B HA   10 
ATOM   7467  H HB2  . ASP B 2 12 ? 4.771   11.418  -7.284  1.00 15.00 ?  936 ASP B HB2  10 
ATOM   7468  H HB3  . ASP B 2 12 ? 4.536   12.332  -5.798  1.00 15.00 ?  936 ASP B HB3  10 
ATOM   7469  N N    . LEU B 2 13 ? 3.354   10.200  -4.105  1.00 15.00 ?  937 LEU B N    10 
ATOM   7470  C CA   . LEU B 2 13 ? 2.028   9.754   -3.682  1.00 15.00 ?  937 LEU B CA   10 
ATOM   7471  C C    . LEU B 2 13 ? 0.961   10.250  -4.660  1.00 15.00 ?  937 LEU B C    10 
ATOM   7472  O O    . LEU B 2 13 ? 0.557   11.414  -4.624  1.00 15.00 ?  937 LEU B O    10 
ATOM   7473  C CB   . LEU B 2 13 ? 1.752   10.271  -2.256  1.00 15.00 ?  937 LEU B CB   10 
ATOM   7474  C CG   . LEU B 2 13 ? 0.572   9.632   -1.502  1.00 15.00 ?  937 LEU B CG   10 
ATOM   7475  C CD1  . LEU B 2 13 ? 0.693   9.905   -0.011  1.00 15.00 ?  937 LEU B CD1  10 
ATOM   7476  C CD2  . LEU B 2 13 ? -0.766  10.158  -2.011  1.00 15.00 ?  937 LEU B CD2  10 
ATOM   7477  H H    . LEU B 2 13 ? 3.843   10.823  -3.534  1.00 15.00 ?  937 LEU B H    10 
ATOM   7478  H HA   . LEU B 2 13 ? 2.026   8.675   -3.674  1.00 15.00 ?  937 LEU B HA   10 
ATOM   7479  H HB2  . LEU B 2 13 ? 2.644   10.113  -1.668  1.00 15.00 ?  937 LEU B HB2  10 
ATOM   7480  H HB3  . LEU B 2 13 ? 1.574   11.334  -2.316  1.00 15.00 ?  937 LEU B HB3  10 
ATOM   7481  H HG   . LEU B 2 13 ? 0.595   8.562   -1.651  1.00 15.00 ?  937 LEU B HG   10 
ATOM   7482  H HD11 . LEU B 2 13 ? -0.136  9.448   0.508   1.00 15.00 ?  937 LEU B HD11 10 
ATOM   7483  H HD12 . LEU B 2 13 ? 0.685   10.971  0.163   1.00 15.00 ?  937 LEU B HD12 10 
ATOM   7484  H HD13 . LEU B 2 13 ? 1.621   9.488   0.357   1.00 15.00 ?  937 LEU B HD13 10 
ATOM   7485  H HD21 . LEU B 2 13 ? -0.811  11.227  -1.870  1.00 15.00 ?  937 LEU B HD21 10 
ATOM   7486  H HD22 . LEU B 2 13 ? -1.569  9.688   -1.460  1.00 15.00 ?  937 LEU B HD22 10 
ATOM   7487  H HD23 . LEU B 2 13 ? -0.869  9.927   -3.061  1.00 15.00 ?  937 LEU B HD23 10 
HETATM 7488  N N    . NH2 B 2 14 ? 0.514   9.366   -5.539  1.00 15.00 ?  938 NH2 B N    10 
HETATM 7489  H HN1  . NH2 B 2 14 ? 0.882   8.458   -5.509  1.00 15.00 ?  938 NH2 B HN1  10 
HETATM 7490  H HN2  . NH2 B 2 14 ? -0.164  9.656   -6.183  1.00 15.00 ?  938 NH2 B HN2  10 
ATOM   7491  N N    . PHE A 1 7  ? -12.318 7.614   -0.389  1.00 15.00 ?  478 PHE A N    11 
ATOM   7492  C CA   . PHE A 1 7  ? -12.207 6.149   -0.201  1.00 15.00 ?  478 PHE A CA   11 
ATOM   7493  C C    . PHE A 1 7  ? -10.851 5.776   0.382   1.00 15.00 ?  478 PHE A C    11 
ATOM   7494  O O    . PHE A 1 7  ? -10.695 4.720   0.997   1.00 15.00 ?  478 PHE A O    11 
ATOM   7495  C CB   . PHE A 1 7  ? -12.424 5.406   -1.529  1.00 15.00 ?  478 PHE A CB   11 
ATOM   7496  C CG   . PHE A 1 7  ? -11.433 5.754   -2.611  1.00 15.00 ?  478 PHE A CG   11 
ATOM   7497  C CD1  . PHE A 1 7  ? -11.631 6.854   -3.430  1.00 15.00 ?  478 PHE A CD1  11 
ATOM   7498  C CD2  . PHE A 1 7  ? -10.305 4.972   -2.810  1.00 15.00 ?  478 PHE A CD2  11 
ATOM   7499  C CE1  . PHE A 1 7  ? -10.723 7.168   -4.424  1.00 15.00 ?  478 PHE A CE1  11 
ATOM   7500  C CE2  . PHE A 1 7  ? -9.396  5.282   -3.801  1.00 15.00 ?  478 PHE A CE2  11 
ATOM   7501  C CZ   . PHE A 1 7  ? -9.605  6.381   -4.610  1.00 15.00 ?  478 PHE A CZ   11 
ATOM   7502  H H    . PHE A 1 7  ? -11.561 7.961   -1.014  1.00 15.00 ?  478 PHE A H    11 
ATOM   7503  H HA   . PHE A 1 7  ? -12.973 5.844   0.498   1.00 15.00 ?  478 PHE A HA   11 
ATOM   7504  H HB2  . PHE A 1 7  ? -12.352 4.345   -1.351  1.00 15.00 ?  478 PHE A HB2  11 
ATOM   7505  H HB3  . PHE A 1 7  ? -13.409 5.633   -1.901  1.00 15.00 ?  478 PHE A HB3  11 
ATOM   7506  H HD1  . PHE A 1 7  ? -12.506 7.471   -3.287  1.00 15.00 ?  478 PHE A HD1  11 
ATOM   7507  H HD2  . PHE A 1 7  ? -10.141 4.111   -2.178  1.00 15.00 ?  478 PHE A HD2  11 
ATOM   7508  H HE1  . PHE A 1 7  ? -10.888 8.030   -5.054  1.00 15.00 ?  478 PHE A HE1  11 
ATOM   7509  H HE2  . PHE A 1 7  ? -8.522  4.664   -3.945  1.00 15.00 ?  478 PHE A HE2  11 
ATOM   7510  H HZ   . PHE A 1 7  ? -8.894  6.625   -5.385  1.00 15.00 ?  478 PHE A HZ   11 
ATOM   7511  N N    . LEU A 1 8  ? -9.862  6.627   0.156   1.00 15.00 ?  479 LEU A N    11 
ATOM   7512  C CA   . LEU A 1 8  ? -8.514  6.364   0.619   1.00 15.00 ?  479 LEU A CA   11 
ATOM   7513  C C    . LEU A 1 8  ? -8.151  7.341   1.729   1.00 15.00 ?  479 LEU A C    11 
ATOM   7514  O O    . LEU A 1 8  ? -8.078  8.547   1.497   1.00 15.00 ?  479 LEU A O    11 
ATOM   7515  C CB   . LEU A 1 8  ? -7.535  6.492   -0.547  1.00 15.00 ?  479 LEU A CB   11 
ATOM   7516  C CG   . LEU A 1 8  ? -6.288  5.608   -0.472  1.00 15.00 ?  479 LEU A CG   11 
ATOM   7517  C CD1  . LEU A 1 8  ? -6.669  4.136   -0.600  1.00 15.00 ?  479 LEU A CD1  11 
ATOM   7518  C CD2  . LEU A 1 8  ? -5.322  5.997   -1.580  1.00 15.00 ?  479 LEU A CD2  11 
ATOM   7519  H H    . LEU A 1 8  ? -10.042 7.466   -0.325  1.00 15.00 ?  479 LEU A H    11 
ATOM   7520  H HA   . LEU A 1 8  ? -8.480  5.357   1.007   1.00 15.00 ?  479 LEU A HA   11 
ATOM   7521  H HB2  . LEU A 1 8  ? -8.064  6.251   -1.458  1.00 15.00 ?  479 LEU A HB2  11 
ATOM   7522  H HB3  . LEU A 1 8  ? -7.214  7.522   -0.604  1.00 15.00 ?  479 LEU A HB3  11 
ATOM   7523  H HG   . LEU A 1 8  ? -5.794  5.757   0.490   1.00 15.00 ?  479 LEU A HG   11 
ATOM   7524  H HD11 . LEU A 1 8  ? -7.276  3.844   0.243   1.00 15.00 ?  479 LEU A HD11 11 
ATOM   7525  H HD12 . LEU A 1 8  ? -5.772  3.530   -0.632  1.00 15.00 ?  479 LEU A HD12 11 
ATOM   7526  H HD13 . LEU A 1 8  ? -7.230  3.988   -1.515  1.00 15.00 ?  479 LEU A HD13 11 
ATOM   7527  H HD21 . LEU A 1 8  ? -4.443  5.370   -1.528  1.00 15.00 ?  479 LEU A HD21 11 
ATOM   7528  H HD22 . LEU A 1 8  ? -5.035  7.031   -1.460  1.00 15.00 ?  479 LEU A HD22 11 
ATOM   7529  H HD23 . LEU A 1 8  ? -5.801  5.866   -2.538  1.00 15.00 ?  479 LEU A HD23 11 
ATOM   7530  N N    . PRO A 1 9  ? -7.971  6.834   2.954   1.00 15.00 ?  480 PRO A N    11 
ATOM   7531  C CA   . PRO A 1 9  ? -7.577  7.646   4.120   1.00 15.00 ?  480 PRO A CA   11 
ATOM   7532  C C    . PRO A 1 9  ? -6.328  8.504   3.863   1.00 15.00 ?  480 PRO A C    11 
ATOM   7533  O O    . PRO A 1 9  ? -5.513  8.171   3.005   1.00 15.00 ?  480 PRO A O    11 
ATOM   7534  C CB   . PRO A 1 9  ? -7.293  6.573   5.171   1.00 15.00 ?  480 PRO A CB   11 
ATOM   7535  C CG   . PRO A 1 9  ? -8.209  5.468   4.817   1.00 15.00 ?  480 PRO A CG   11 
ATOM   7536  C CD   . PRO A 1 9  ? -8.162  5.416   3.320   1.00 15.00 ?  480 PRO A CD   11 
ATOM   7537  H HA   . PRO A 1 9  ? -8.385  8.277   4.457   1.00 15.00 ?  480 PRO A HA   11 
ATOM   7538  H HB2  . PRO A 1 9  ? -6.271  6.263   5.091   1.00 15.00 ?  480 PRO A HB2  11 
ATOM   7539  H HB3  . PRO A 1 9  ? -7.483  6.956   6.159   1.00 15.00 ?  480 PRO A HB3  11 
ATOM   7540  H HG2  . PRO A 1 9  ? -7.855  4.541   5.241   1.00 15.00 ?  480 PRO A HG2  11 
ATOM   7541  H HG3  . PRO A 1 9  ? -9.210  5.687   5.155   1.00 15.00 ?  480 PRO A HG3  11 
ATOM   7542  H HD2  . PRO A 1 9  ? -7.331  4.813   2.987   1.00 15.00 ?  480 PRO A HD2  11 
ATOM   7543  H HD3  . PRO A 1 9  ? -9.088  5.038   2.927   1.00 15.00 ?  480 PRO A HD3  11 
ATOM   7544  N N    . PRO A 1 10 ? -6.165  9.595   4.653   1.00 15.00 ?  481 PRO A N    11 
ATOM   7545  C CA   . PRO A 1 10 ? -5.126  10.626  4.489   1.00 15.00 ?  481 PRO A CA   11 
ATOM   7546  C C    . PRO A 1 10 ? -3.832  10.162  3.812   1.00 15.00 ?  481 PRO A C    11 
ATOM   7547  O O    . PRO A 1 10 ? -3.662  10.335  2.605   1.00 15.00 ?  481 PRO A O    11 
ATOM   7548  C CB   . PRO A 1 10 ? -4.859  11.027  5.935   1.00 15.00 ?  481 PRO A CB   11 
ATOM   7549  C CG   . PRO A 1 10 ? -6.184  10.902  6.615   1.00 15.00 ?  481 PRO A CG   11 
ATOM   7550  C CD   . PRO A 1 10 ? -7.008  9.915   5.816   1.00 15.00 ?  481 PRO A CD   11 
ATOM   7551  H HA   . PRO A 1 10 ? -5.512  11.480  3.956   1.00 15.00 ?  481 PRO A HA   11 
ATOM   7552  H HB2  . PRO A 1 10 ? -4.128  10.360  6.367   1.00 15.00 ?  481 PRO A HB2  11 
ATOM   7553  H HB3  . PRO A 1 10 ? -4.495  12.043  5.969   1.00 15.00 ?  481 PRO A HB3  11 
ATOM   7554  H HG2  . PRO A 1 10 ? -6.043  10.536  7.621   1.00 15.00 ?  481 PRO A HG2  11 
ATOM   7555  H HG3  . PRO A 1 10 ? -6.674  11.864  6.635   1.00 15.00 ?  481 PRO A HG3  11 
ATOM   7556  H HD2  . PRO A 1 10 ? -7.204  9.029   6.400   1.00 15.00 ?  481 PRO A HD2  11 
ATOM   7557  H HD3  . PRO A 1 10 ? -7.935  10.371  5.502   1.00 15.00 ?  481 PRO A HD3  11 
ATOM   7558  N N    . GLY A 1 11 ? -2.927  9.560   4.580   1.00 15.00 ?  482 GLY A N    11 
ATOM   7559  C CA   . GLY A 1 11 ? -1.655  9.141   4.014   1.00 15.00 ?  482 GLY A CA   11 
ATOM   7560  C C    . GLY A 1 11 ? -1.666  7.708   3.568   1.00 15.00 ?  482 GLY A C    11 
ATOM   7561  O O    . GLY A 1 11 ? -0.618  7.072   3.501   1.00 15.00 ?  482 GLY A O    11 
ATOM   7562  H H    . GLY A 1 11 ? -3.122  9.401   5.523   1.00 15.00 ?  482 GLY A H    11 
ATOM   7563  H HA2  . GLY A 1 11 ? -1.435  9.762   3.164   1.00 15.00 ?  482 GLY A HA2  11 
ATOM   7564  H HA3  . GLY A 1 11 ? -0.870  9.264   4.742   1.00 15.00 ?  482 GLY A HA3  11 
ATOM   7565  N N    . TRP A 1 12 ? -2.841  7.194   3.275   1.00 15.00 ?  483 TRP A N    11 
ATOM   7566  C CA   . TRP A 1 12 ? -2.950  5.864   2.725   1.00 15.00 ?  483 TRP A CA   11 
ATOM   7567  C C    . TRP A 1 12 ? -2.891  5.958   1.230   1.00 15.00 ?  483 TRP A C    11 
ATOM   7568  O O    . TRP A 1 12 ? -3.536  6.810   0.627   1.00 15.00 ?  483 TRP A O    11 
ATOM   7569  C CB   . TRP A 1 12 ? -4.245  5.180   3.144   1.00 15.00 ?  483 TRP A CB   11 
ATOM   7570  C CG   . TRP A 1 12 ? -4.217  4.691   4.548   1.00 15.00 ?  483 TRP A CG   11 
ATOM   7571  C CD1  . TRP A 1 12 ? -4.384  5.441   5.663   1.00 15.00 ?  483 TRP A CD1  11 
ATOM   7572  C CD2  . TRP A 1 12 ? -4.009  3.347   4.983   1.00 15.00 ?  483 TRP A CD2  11 
ATOM   7573  N NE1  . TRP A 1 12 ? -4.302  4.649   6.782   1.00 15.00 ?  483 TRP A NE1  11 
ATOM   7574  C CE2  . TRP A 1 12 ? -4.069  3.354   6.387   1.00 15.00 ?  483 TRP A CE2  11 
ATOM   7575  C CE3  . TRP A 1 12 ? -3.778  2.137   4.321   1.00 15.00 ?  483 TRP A CE3  11 
ATOM   7576  C CZ2  . TRP A 1 12 ? -3.912  2.197   7.142   1.00 15.00 ?  483 TRP A CZ2  11 
ATOM   7577  C CZ3  . TRP A 1 12 ? -3.620  0.988   5.072   1.00 15.00 ?  483 TRP A CZ3  11 
ATOM   7578  C CH2  . TRP A 1 12 ? -3.688  1.024   6.470   1.00 15.00 ?  483 TRP A CH2  11 
ATOM   7579  H H    . TRP A 1 12 ? -3.652  7.732   3.401   1.00 15.00 ?  483 TRP A H    11 
ATOM   7580  H HA   . TRP A 1 12 ? -2.108  5.285   3.077   1.00 15.00 ?  483 TRP A HA   11 
ATOM   7581  H HB2  . TRP A 1 12 ? -5.063  5.879   3.052   1.00 15.00 ?  483 TRP A HB2  11 
ATOM   7582  H HB3  . TRP A 1 12 ? -4.425  4.334   2.497   1.00 15.00 ?  483 TRP A HB3  11 
ATOM   7583  H HD1  . TRP A 1 12 ? -4.565  6.506   5.646   1.00 15.00 ?  483 TRP A HD1  11 
ATOM   7584  H HE1  . TRP A 1 12 ? -4.392  4.957   7.706   1.00 15.00 ?  483 TRP A HE1  11 
ATOM   7585  H HE3  . TRP A 1 12 ? -3.721  2.092   3.245   1.00 15.00 ?  483 TRP A HE3  11 
ATOM   7586  H HZ2  . TRP A 1 12 ? -3.966  2.208   8.219   1.00 15.00 ?  483 TRP A HZ2  11 
ATOM   7587  H HZ3  . TRP A 1 12 ? -3.446  0.043   4.578   1.00 15.00 ?  483 TRP A HZ3  11 
ATOM   7588  H HH2  . TRP A 1 12 ? -3.557  0.102   7.020   1.00 15.00 ?  483 TRP A HH2  11 
ATOM   7589  N N    . GLU A 1 13 ? -2.101  5.102   0.646   1.00 15.00 ?  484 GLU A N    11 
ATOM   7590  C CA   . GLU A 1 13 ? -1.976  5.048   -0.782  1.00 15.00 ?  484 GLU A CA   11 
ATOM   7591  C C    . GLU A 1 13 ? -2.242  3.677   -1.293  1.00 15.00 ?  484 GLU A C    11 
ATOM   7592  O O    . GLU A 1 13 ? -2.015  2.665   -0.638  1.00 15.00 ?  484 GLU A O    11 
ATOM   7593  C CB   . GLU A 1 13 ? -0.636  5.487   -1.279  1.00 15.00 ?  484 GLU A CB   11 
ATOM   7594  C CG   . GLU A 1 13 ? 0.484   4.723   -0.667  1.00 15.00 ?  484 GLU A CG   11 
ATOM   7595  C CD   . GLU A 1 13 ? 1.703   4.717   -1.537  1.00 15.00 ?  484 GLU A CD   11 
ATOM   7596  O OE1  . GLU A 1 13 ? 2.321   5.787   -1.695  1.00 15.00 ?  484 GLU A OE1  11 
ATOM   7597  O OE2  . GLU A 1 13 ? 2.043   3.645   -2.057  1.00 15.00 -1 484 GLU A OE2  11 
ATOM   7598  H H    . GLU A 1 13 ? -1.566  4.490   1.197   1.00 15.00 ?  484 GLU A H    11 
ATOM   7599  H HA   . GLU A 1 13 ? -2.724  5.710   -1.192  1.00 15.00 ?  484 GLU A HA   11 
ATOM   7600  H HB2  . GLU A 1 13 ? -0.591  5.350   -2.336  1.00 15.00 ?  484 GLU A HB2  11 
ATOM   7601  H HB3  . GLU A 1 13 ? -0.522  6.517   -1.068  1.00 15.00 ?  484 GLU A HB3  11 
ATOM   7602  H HG2  . GLU A 1 13 ? 0.719   5.172   0.270   1.00 15.00 ?  484 GLU A HG2  11 
ATOM   7603  H HG3  . GLU A 1 13 ? 0.165   3.702   -0.509  1.00 15.00 ?  484 GLU A HG3  11 
ATOM   7604  N N    . MET A 1 14 ? -2.716  3.694   -2.480  1.00 15.00 ?  485 MET A N    11 
ATOM   7605  C CA   . MET A 1 14 ? -3.169  2.496   -3.159  1.00 15.00 ?  485 MET A CA   11 
ATOM   7606  C C    . MET A 1 14 ? -2.384  2.329   -4.456  1.00 15.00 ?  485 MET A C    11 
ATOM   7607  O O    . MET A 1 14 ? -2.644  3.027   -5.436  1.00 15.00 ?  485 MET A O    11 
ATOM   7608  C CB   . MET A 1 14 ? -4.674  2.592   -3.438  1.00 15.00 ?  485 MET A CB   11 
ATOM   7609  C CG   . MET A 1 14 ? -5.284  1.304   -3.957  1.00 15.00 ?  485 MET A CG   11 
ATOM   7610  S SD   . MET A 1 14 ? -6.939  1.529   -4.642  1.00 15.00 ?  485 MET A SD   11 
ATOM   7611  C CE   . MET A 1 14 ? -7.864  1.992   -3.181  1.00 15.00 ?  485 MET A CE   11 
ATOM   7612  H H    . MET A 1 14 ? -2.679  4.557   -2.949  1.00 15.00 ?  485 MET A H    11 
ATOM   7613  H HA   . MET A 1 14 ? -2.974  1.648   -2.512  1.00 15.00 ?  485 MET A HA   11 
ATOM   7614  H HB2  . MET A 1 14 ? -5.181  2.864   -2.524  1.00 15.00 ?  485 MET A HB2  11 
ATOM   7615  H HB3  . MET A 1 14 ? -4.840  3.367   -4.173  1.00 15.00 ?  485 MET A HB3  11 
ATOM   7616  H HG2  . MET A 1 14 ? -4.647  0.916   -4.721  1.00 15.00 ?  485 MET A HG2  11 
ATOM   7617  H HG3  . MET A 1 14 ? -5.340  0.595   -3.142  1.00 15.00 ?  485 MET A HG3  11 
ATOM   7618  H HE1  . MET A 1 14 ? -7.805  1.198   -2.451  1.00 15.00 ?  485 MET A HE1  11 
ATOM   7619  H HE2  . MET A 1 14 ? -8.898  2.160   -3.447  1.00 15.00 ?  485 MET A HE2  11 
ATOM   7620  H HE3  . MET A 1 14 ? -7.448  2.897   -2.764  1.00 15.00 ?  485 MET A HE3  11 
ATOM   7621  N N    . ARG A 1 15 ? -1.395  1.440   -4.443  1.00 15.00 ?  486 ARG A N    11 
ATOM   7622  C CA   . ARG A 1 15 ? -0.485  1.286   -5.578  1.00 15.00 ?  486 ARG A CA   11 
ATOM   7623  C C    . ARG A 1 15 ? -0.435  -0.155  -6.072  1.00 15.00 ?  486 ARG A C    11 
ATOM   7624  O O    . ARG A 1 15 ? -0.592  -1.098  -5.296  1.00 15.00 ?  486 ARG A O    11 
ATOM   7625  C CB   . ARG A 1 15 ? 0.922   1.759   -5.198  1.00 15.00 ?  486 ARG A CB   11 
ATOM   7626  C CG   . ARG A 1 15 ? 1.006   3.257   -4.965  1.00 15.00 ?  486 ARG A CG   11 
ATOM   7627  C CD   . ARG A 1 15 ? 0.750   4.043   -6.245  1.00 15.00 ?  486 ARG A CD   11 
ATOM   7628  N NE   . ARG A 1 15 ? 1.859   3.934   -7.195  1.00 15.00 ?  486 ARG A NE   11 
ATOM   7629  C CZ   . ARG A 1 15 ? 1.716   3.650   -8.492  1.00 15.00 ?  486 ARG A CZ   11 
ATOM   7630  N NH1  . ARG A 1 15 ? 0.511   3.400   -9.001  1.00 15.00 1  486 ARG A NH1  11 
ATOM   7631  N NH2  . ARG A 1 15 ? 2.781   3.622   -9.283  1.00 15.00 ?  486 ARG A NH2  11 
ATOM   7632  H H    . ARG A 1 15 ? -1.270  0.870   -3.648  1.00 15.00 ?  486 ARG A H    11 
ATOM   7633  H HA   . ARG A 1 15 ? -0.855  1.911   -6.378  1.00 15.00 ?  486 ARG A HA   11 
ATOM   7634  H HB2  . ARG A 1 15 ? 1.227   1.257   -4.292  1.00 15.00 ?  486 ARG A HB2  11 
ATOM   7635  H HB3  . ARG A 1 15 ? 1.606   1.500   -5.994  1.00 15.00 ?  486 ARG A HB3  11 
ATOM   7636  H HG2  . ARG A 1 15 ? 0.267   3.538   -4.230  1.00 15.00 ?  486 ARG A HG2  11 
ATOM   7637  H HG3  . ARG A 1 15 ? 1.992   3.499   -4.597  1.00 15.00 ?  486 ARG A HG3  11 
ATOM   7638  H HD2  . ARG A 1 15 ? -0.147  3.663   -6.710  1.00 15.00 ?  486 ARG A HD2  11 
ATOM   7639  H HD3  . ARG A 1 15 ? 0.609   5.083   -5.991  1.00 15.00 ?  486 ARG A HD3  11 
ATOM   7640  H HE   . ARG A 1 15 ? 2.762   4.102   -6.844  1.00 15.00 ?  486 ARG A HE   11 
ATOM   7641  H HH11 . ARG A 1 15 ? -0.308  3.416   -8.410  1.00 15.00 ?  486 ARG A HH11 11 
ATOM   7642  H HH12 . ARG A 1 15 ? 0.406   3.205   -9.983  1.00 15.00 ?  486 ARG A HH12 11 
ATOM   7643  H HH21 . ARG A 1 15 ? 3.694   3.819   -8.913  1.00 15.00 ?  486 ARG A HH21 11 
ATOM   7644  H HH22 . ARG A 1 15 ? 2.681   3.396   -10.260 1.00 15.00 ?  486 ARG A HH22 11 
ATOM   7645  N N    . ILE A 1 16 ? -0.186  -0.309  -7.366  1.00 15.00 ?  487 ILE A N    11 
ATOM   7646  C CA   . ILE A 1 16 ? -0.168  -1.618  -8.004  1.00 15.00 ?  487 ILE A CA   11 
ATOM   7647  C C    . ILE A 1 16 ? 1.260   -2.140  -8.177  1.00 15.00 ?  487 ILE A C    11 
ATOM   7648  O O    . ILE A 1 16 ? 2.153   -1.409  -8.601  1.00 15.00 ?  487 ILE A O    11 
ATOM   7649  C CB   . ILE A 1 16 ? -0.864  -1.563  -9.388  1.00 15.00 ?  487 ILE A CB   11 
ATOM   7650  C CG1  . ILE A 1 16 ? -2.344  -1.214  -9.229  1.00 15.00 ?  487 ILE A CG1  11 
ATOM   7651  C CG2  . ILE A 1 16 ? -0.712  -2.885  -10.132 1.00 15.00 ?  487 ILE A CG2  11 
ATOM   7652  C CD1  . ILE A 1 16 ? -3.139  -2.277  -8.503  1.00 15.00 ?  487 ILE A CD1  11 
ATOM   7653  H H    . ILE A 1 16 ? 0.002   0.483   -7.910  1.00 15.00 ?  487 ILE A H    11 
ATOM   7654  H HA   . ILE A 1 16 ? -0.718  -2.303  -7.376  1.00 15.00 ?  487 ILE A HA   11 
ATOM   7655  H HB   . ILE A 1 16 ? -0.384  -0.795  -9.975  1.00 15.00 ?  487 ILE A HB   11 
ATOM   7656  H HG12 . ILE A 1 16 ? -2.433  -0.295  -8.670  1.00 15.00 ?  487 ILE A HG12 11 
ATOM   7657  H HG13 . ILE A 1 16 ? -2.785  -1.079  -10.207 1.00 15.00 ?  487 ILE A HG13 11 
ATOM   7658  H HG21 . ILE A 1 16 ? -1.194  -2.814  -11.095 1.00 15.00 ?  487 ILE A HG21 11 
ATOM   7659  H HG22 . ILE A 1 16 ? -1.172  -3.675  -9.556  1.00 15.00 ?  487 ILE A HG22 11 
ATOM   7660  H HG23 . ILE A 1 16 ? 0.337   -3.103  -10.267 1.00 15.00 ?  487 ILE A HG23 11 
ATOM   7661  H HD11 . ILE A 1 16 ? -4.176  -1.979  -8.448  1.00 15.00 ?  487 ILE A HD11 11 
ATOM   7662  H HD12 . ILE A 1 16 ? -2.745  -2.399  -7.504  1.00 15.00 ?  487 ILE A HD12 11 
ATOM   7663  H HD13 . ILE A 1 16 ? -3.060  -3.212  -9.038  1.00 15.00 ?  487 ILE A HD13 11 
ATOM   7664  N N    . ALA A 1 17 ? 1.456   -3.405  -7.836  1.00 15.00 ?  488 ALA A N    11 
ATOM   7665  C CA   . ALA A 1 17 ? 2.707   -4.099  -8.092  1.00 15.00 ?  488 ALA A CA   11 
ATOM   7666  C C    . ALA A 1 17 ? 2.643   -4.757  -9.466  1.00 15.00 ?  488 ALA A C    11 
ATOM   7667  O O    . ALA A 1 17 ? 1.561   -5.138  -9.908  1.00 15.00 ?  488 ALA A O    11 
ATOM   7668  C CB   . ALA A 1 17 ? 2.965   -5.137  -7.005  1.00 15.00 ?  488 ALA A CB   11 
ATOM   7669  H H    . ALA A 1 17 ? 0.733   -3.886  -7.374  1.00 15.00 ?  488 ALA A H    11 
ATOM   7670  H HA   . ALA A 1 17 ? 3.507   -3.382  -8.077  1.00 15.00 ?  488 ALA A HA   11 
ATOM   7671  H HB1  . ALA A 1 17 ? 2.983   -4.652  -6.040  1.00 15.00 ?  488 ALA A HB1  11 
ATOM   7672  H HB2  . ALA A 1 17 ? 3.914   -5.619  -7.183  1.00 15.00 ?  488 ALA A HB2  11 
ATOM   7673  H HB3  . ALA A 1 17 ? 2.177   -5.877  -7.020  1.00 15.00 ?  488 ALA A HB3  11 
ATOM   7674  N N    . PRO A 1 18 ? 3.790   -4.906  -10.158 1.00 15.00 ?  489 PRO A N    11 
ATOM   7675  C CA   . PRO A 1 18 ? 3.841   -5.402  -11.552 1.00 15.00 ?  489 PRO A CA   11 
ATOM   7676  C C    . PRO A 1 18 ? 3.264   -6.809  -11.738 1.00 15.00 ?  489 PRO A C    11 
ATOM   7677  O O    . PRO A 1 18 ? 3.186   -7.312  -12.859 1.00 15.00 ?  489 PRO A O    11 
ATOM   7678  C CB   . PRO A 1 18 ? 5.338   -5.402  -11.882 1.00 15.00 ?  489 PRO A CB   11 
ATOM   7679  C CG   . PRO A 1 18 ? 6.026   -5.388  -10.562 1.00 15.00 ?  489 PRO A CG   11 
ATOM   7680  C CD   . PRO A 1 18 ? 5.137   -4.598  -9.649  1.00 15.00 ?  489 PRO A CD   11 
ATOM   7681  H HA   . PRO A 1 18 ? 3.332   -4.724  -12.220 1.00 15.00 ?  489 PRO A HA   11 
ATOM   7682  H HB2  . PRO A 1 18 ? 5.582   -6.290  -12.445 1.00 15.00 ?  489 PRO A HB2  11 
ATOM   7683  H HB3  . PRO A 1 18 ? 5.580   -4.524  -12.462 1.00 15.00 ?  489 PRO A HB3  11 
ATOM   7684  H HG2  . PRO A 1 18 ? 6.138   -6.398  -10.196 1.00 15.00 ?  489 PRO A HG2  11 
ATOM   7685  H HG3  . PRO A 1 18 ? 6.988   -4.910  -10.654 1.00 15.00 ?  489 PRO A HG3  11 
ATOM   7686  H HD2  . PRO A 1 18 ? 5.252   -4.929  -8.628  1.00 15.00 ?  489 PRO A HD2  11 
ATOM   7687  H HD3  . PRO A 1 18 ? 5.349   -3.542  -9.734  1.00 15.00 ?  489 PRO A HD3  11 
ATOM   7688  N N    . ASN A 1 19 ? 2.872   -7.440  -10.644 1.00 15.00 ?  490 ASN A N    11 
ATOM   7689  C CA   . ASN A 1 19 ? 2.269   -8.766  -10.694 1.00 15.00 ?  490 ASN A CA   11 
ATOM   7690  C C    . ASN A 1 19 ? 0.743   -8.648  -10.603 1.00 15.00 ?  490 ASN A C    11 
ATOM   7691  O O    . ASN A 1 19 ? 0.021   -9.643  -10.599 1.00 15.00 ?  490 ASN A O    11 
ATOM   7692  C CB   . ASN A 1 19 ? 2.834   -9.623  -9.551  1.00 15.00 ?  490 ASN A CB   11 
ATOM   7693  C CG   . ASN A 1 19 ? 2.495   -11.100 -9.669  1.00 15.00 ?  490 ASN A CG   11 
ATOM   7694  O OD1  . ASN A 1 19 ? 1.517   -11.577 -9.093  1.00 15.00 ?  490 ASN A OD1  11 
ATOM   7695  N ND2  . ASN A 1 19 ? 3.313   -11.837 -10.404 1.00 15.00 ?  490 ASN A ND2  11 
ATOM   7696  H H    . ASN A 1 19 ? 2.994   -7.005  -9.777  1.00 15.00 ?  490 ASN A H    11 
ATOM   7697  H HA   . ASN A 1 19 ? 2.530   -9.217  -11.641 1.00 15.00 ?  490 ASN A HA   11 
ATOM   7698  H HB2  . ASN A 1 19 ? 3.908   -9.524  -9.540  1.00 15.00 ?  490 ASN A HB2  11 
ATOM   7699  H HB3  . ASN A 1 19 ? 2.438   -9.257  -8.614  1.00 15.00 ?  490 ASN A HB3  11 
ATOM   7700  H HD21 . ASN A 1 19 ? 4.088   -11.394 -10.828 1.00 15.00 ?  490 ASN A HD21 11 
ATOM   7701  H HD22 . ASN A 1 19 ? 3.115   -12.792 -10.504 1.00 15.00 ?  490 ASN A HD22 11 
ATOM   7702  N N    . GLY A 1 20 ? 0.259   -7.408  -10.549 1.00 15.00 ?  491 GLY A N    11 
ATOM   7703  C CA   . GLY A 1 20 ? -1.168  -7.159  -10.436 1.00 15.00 ?  491 GLY A CA   11 
ATOM   7704  C C    . GLY A 1 20 ? -1.619  -7.142  -8.992  1.00 15.00 ?  491 GLY A C    11 
ATOM   7705  O O    . GLY A 1 20 ? -2.729  -7.563  -8.668  1.00 15.00 ?  491 GLY A O    11 
ATOM   7706  H H    . GLY A 1 20 ? 0.879   -6.646  -10.589 1.00 15.00 ?  491 GLY A H    11 
ATOM   7707  H HA2  . GLY A 1 20 ? -1.396  -6.206  -10.889 1.00 15.00 ?  491 GLY A HA2  11 
ATOM   7708  H HA3  . GLY A 1 20 ? -1.704  -7.936  -10.963 1.00 15.00 ?  491 GLY A HA3  11 
ATOM   7709  N N    . ARG A 1 21 ? -0.749  -6.657  -8.118  1.00 15.00 ?  492 ARG A N    11 
ATOM   7710  C CA   . ARG A 1 21 ? -0.996  -6.711  -6.682  1.00 15.00 ?  492 ARG A CA   11 
ATOM   7711  C C    . ARG A 1 21 ? -1.153  -5.298  -6.118  1.00 15.00 ?  492 ARG A C    11 
ATOM   7712  O O    . ARG A 1 21 ? -0.206  -4.523  -6.146  1.00 15.00 ?  492 ARG A O    11 
ATOM   7713  C CB   . ARG A 1 21 ? 0.176   -7.401  -5.975  1.00 15.00 ?  492 ARG A CB   11 
ATOM   7714  C CG   . ARG A 1 21 ? 0.833   -8.520  -6.772  1.00 15.00 ?  492 ARG A CG   11 
ATOM   7715  C CD   . ARG A 1 21 ? 0.041   -9.827  -6.730  1.00 15.00 ?  492 ARG A CD   11 
ATOM   7716  N NE   . ARG A 1 21 ? -1.311  -9.703  -7.279  1.00 15.00 ?  492 ARG A NE   11 
ATOM   7717  C CZ   . ARG A 1 21 ? -1.938  -10.671 -7.957  1.00 15.00 ?  492 ARG A CZ   11 
ATOM   7718  N NH1  . ARG A 1 21 ? -1.298  -11.787 -8.282  1.00 15.00 1  492 ARG A NH1  11 
ATOM   7719  N NH2  . ARG A 1 21 ? -3.196  -10.498 -8.346  1.00 15.00 ?  492 ARG A NH2  11 
ATOM   7720  H H    . ARG A 1 21 ? 0.073   -6.239  -8.446  1.00 15.00 ?  492 ARG A H    11 
ATOM   7721  H HA   . ARG A 1 21 ? -1.897  -7.274  -6.509  1.00 15.00 ?  492 ARG A HA   11 
ATOM   7722  H HB2  . ARG A 1 21 ? 0.930   -6.659  -5.758  1.00 15.00 ?  492 ARG A HB2  11 
ATOM   7723  H HB3  . ARG A 1 21 ? -0.180  -7.815  -5.044  1.00 15.00 ?  492 ARG A HB3  11 
ATOM   7724  H HG2  . ARG A 1 21 ? 0.928   -8.198  -7.799  1.00 15.00 ?  492 ARG A HG2  11 
ATOM   7725  H HG3  . ARG A 1 21 ? 1.818   -8.697  -6.363  1.00 15.00 ?  492 ARG A HG3  11 
ATOM   7726  H HD2  . ARG A 1 21 ? 0.579   -10.570 -7.300  1.00 15.00 ?  492 ARG A HD2  11 
ATOM   7727  H HD3  . ARG A 1 21 ? -0.029  -10.152 -5.703  1.00 15.00 ?  492 ARG A HD3  11 
ATOM   7728  H HE   . ARG A 1 21 ? -1.788  -8.861  -7.112  1.00 15.00 ?  492 ARG A HE   11 
ATOM   7729  H HH11 . ARG A 1 21 ? -0.339  -11.911 -8.022  1.00 15.00 ?  492 ARG A HH11 11 
ATOM   7730  H HH12 . ARG A 1 21 ? -1.768  -12.511 -8.804  1.00 15.00 ?  492 ARG A HH12 11 
ATOM   7731  H HH21 . ARG A 1 21 ? -3.676  -9.641  -8.141  1.00 15.00 ?  492 ARG A HH21 11 
ATOM   7732  H HH22 . ARG A 1 21 ? -3.678  -11.234 -8.839  1.00 15.00 ?  492 ARG A HH22 11 
ATOM   7733  N N    . PRO A 1 22 ? -2.338  -4.930  -5.615  1.00 15.00 ?  493 PRO A N    11 
ATOM   7734  C CA   . PRO A 1 22 ? -2.561  -3.614  -5.025  1.00 15.00 ?  493 PRO A CA   11 
ATOM   7735  C C    . PRO A 1 22 ? -2.268  -3.586  -3.525  1.00 15.00 ?  493 PRO A C    11 
ATOM   7736  O O    . PRO A 1 22 ? -2.930  -4.274  -2.745  1.00 15.00 ?  493 PRO A O    11 
ATOM   7737  C CB   . PRO A 1 22 ? -4.056  -3.362  -5.273  1.00 15.00 ?  493 PRO A CB   11 
ATOM   7738  C CG   . PRO A 1 22 ? -4.639  -4.667  -5.743  1.00 15.00 ?  493 PRO A CG   11 
ATOM   7739  C CD   . PRO A 1 22 ? -3.569  -5.719  -5.607  1.00 15.00 ?  493 PRO A CD   11 
ATOM   7740  H HA   . PRO A 1 22 ? -1.977  -2.852  -5.518  1.00 15.00 ?  493 PRO A HA   11 
ATOM   7741  H HB2  . PRO A 1 22 ? -4.521  -3.037  -4.353  1.00 15.00 ?  493 PRO A HB2  11 
ATOM   7742  H HB3  . PRO A 1 22 ? -4.167  -2.592  -6.022  1.00 15.00 ?  493 PRO A HB3  11 
ATOM   7743  H HG2  . PRO A 1 22 ? -5.489  -4.924  -5.130  1.00 15.00 ?  493 PRO A HG2  11 
ATOM   7744  H HG3  . PRO A 1 22 ? -4.943  -4.577  -6.778  1.00 15.00 ?  493 PRO A HG3  11 
ATOM   7745  H HD2  . PRO A 1 22 ? -3.681  -6.254  -4.676  1.00 15.00 ?  493 PRO A HD2  11 
ATOM   7746  H HD3  . PRO A 1 22 ? -3.603  -6.398  -6.444  1.00 15.00 ?  493 PRO A HD3  11 
ATOM   7747  N N    . PHE A 1 23 ? -1.267  -2.806  -3.128  1.00 15.00 ?  494 PHE A N    11 
ATOM   7748  C CA   . PHE A 1 23 ? -0.932  -2.664  -1.716  1.00 15.00 ?  494 PHE A CA   11 
ATOM   7749  C C    . PHE A 1 23 ? -1.232  -1.263  -1.216  1.00 15.00 ?  494 PHE A C    11 
ATOM   7750  O O    . PHE A 1 23 ? -1.086  -0.278  -1.946  1.00 15.00 ?  494 PHE A O    11 
ATOM   7751  C CB   . PHE A 1 23 ? 0.534   -3.036  -1.418  1.00 15.00 ?  494 PHE A CB   11 
ATOM   7752  C CG   . PHE A 1 23 ? 1.587   -2.412  -2.303  1.00 15.00 ?  494 PHE A CG   11 
ATOM   7753  C CD1  . PHE A 1 23 ? 1.933   -1.070  -2.190  1.00 15.00 ?  494 PHE A CD1  11 
ATOM   7754  C CD2  . PHE A 1 23 ? 2.267   -3.195  -3.219  1.00 15.00 ?  494 PHE A CD2  11 
ATOM   7755  C CE1  . PHE A 1 23 ? 2.934   -0.528  -2.982  1.00 15.00 ?  494 PHE A CE1  11 
ATOM   7756  C CE2  . PHE A 1 23 ? 3.260   -2.662  -4.013  1.00 15.00 ?  494 PHE A CE2  11 
ATOM   7757  C CZ   . PHE A 1 23 ? 3.597   -1.327  -3.894  1.00 15.00 ?  494 PHE A CZ   11 
ATOM   7758  H H    . PHE A 1 23 ? -0.753  -2.301  -3.797  1.00 15.00 ?  494 PHE A H    11 
ATOM   7759  H HA   . PHE A 1 23 ? -1.569  -3.349  -1.175  1.00 15.00 ?  494 PHE A HA   11 
ATOM   7760  H HB2  . PHE A 1 23 ? 0.760   -2.745  -0.404  1.00 15.00 ?  494 PHE A HB2  11 
ATOM   7761  H HB3  . PHE A 1 23 ? 0.636   -4.110  -1.497  1.00 15.00 ?  494 PHE A HB3  11 
ATOM   7762  H HD1  . PHE A 1 23 ? 1.410   -0.445  -1.479  1.00 15.00 ?  494 PHE A HD1  11 
ATOM   7763  H HD2  . PHE A 1 23 ? 2.007   -4.239  -3.316  1.00 15.00 ?  494 PHE A HD2  11 
ATOM   7764  H HE1  . PHE A 1 23 ? 3.201   0.519   -2.884  1.00 15.00 ?  494 PHE A HE1  11 
ATOM   7765  H HE2  . PHE A 1 23 ? 3.781   -3.292  -4.720  1.00 15.00 ?  494 PHE A HE2  11 
ATOM   7766  H HZ   . PHE A 1 23 ? 4.377   -0.908  -4.512  1.00 15.00 ?  494 PHE A HZ   11 
ATOM   7767  N N    . PHE A 1 24 ? -1.650  -1.189  0.036   1.00 15.00 ?  495 PHE A N    11 
ATOM   7768  C CA   . PHE A 1 24 ? -1.941  0.071   0.682   1.00 15.00 ?  495 PHE A CA   11 
ATOM   7769  C C    . PHE A 1 24 ? -0.781  0.471   1.586   1.00 15.00 ?  495 PHE A C    11 
ATOM   7770  O O    . PHE A 1 24 ? -0.440  -0.247  2.526   1.00 15.00 ?  495 PHE A O    11 
ATOM   7771  C CB   . PHE A 1 24 ? -3.228  -0.041  1.507   1.00 15.00 ?  495 PHE A CB   11 
ATOM   7772  C CG   . PHE A 1 24 ? -4.410  -0.548  0.730   1.00 15.00 ?  495 PHE A CG   11 
ATOM   7773  C CD1  . PHE A 1 24 ? -5.183  0.319   -0.026  1.00 15.00 ?  495 PHE A CD1  11 
ATOM   7774  C CD2  . PHE A 1 24 ? -4.754  -1.890  0.761   1.00 15.00 ?  495 PHE A CD2  11 
ATOM   7775  C CE1  . PHE A 1 24 ? -6.273  -0.142  -0.735  1.00 15.00 ?  495 PHE A CE1  11 
ATOM   7776  C CE2  . PHE A 1 24 ? -5.844  -2.359  0.053   1.00 15.00 ?  495 PHE A CE2  11 
ATOM   7777  C CZ   . PHE A 1 24 ? -6.606  -1.484  -0.697  1.00 15.00 ?  495 PHE A CZ   11 
ATOM   7778  H H    . PHE A 1 24 ? -1.765  -2.018  0.544   1.00 15.00 ?  495 PHE A H    11 
ATOM   7779  H HA   . PHE A 1 24 ? -2.072  0.824   -0.082  1.00 15.00 ?  495 PHE A HA   11 
ATOM   7780  H HB2  . PHE A 1 24 ? -3.059  -0.718  2.330   1.00 15.00 ?  495 PHE A HB2  11 
ATOM   7781  H HB3  . PHE A 1 24 ? -3.480  0.933   1.898   1.00 15.00 ?  495 PHE A HB3  11 
ATOM   7782  H HD1  . PHE A 1 24 ? -4.924  1.368   -0.059  1.00 15.00 ?  495 PHE A HD1  11 
ATOM   7783  H HD2  . PHE A 1 24 ? -4.159  -2.576  1.348   1.00 15.00 ?  495 PHE A HD2  11 
ATOM   7784  H HE1  . PHE A 1 24 ? -6.867  0.546   -1.321  1.00 15.00 ?  495 PHE A HE1  11 
ATOM   7785  H HE2  . PHE A 1 24 ? -6.101  -3.407  0.086   1.00 15.00 ?  495 PHE A HE2  11 
ATOM   7786  H HZ   . PHE A 1 24 ? -7.459  -1.847  -1.250  1.00 15.00 ?  495 PHE A HZ   11 
ATOM   7787  N N    . ILE A 1 25 ? -0.153  1.594   1.276   1.00 15.00 ?  496 ILE A N    11 
ATOM   7788  C CA   . ILE A 1 25 ? 0.908   2.122   2.119   1.00 15.00 ?  496 ILE A CA   11 
ATOM   7789  C C    . ILE A 1 25 ? 0.398   3.319   2.906   1.00 15.00 ?  496 ILE A C    11 
ATOM   7790  O O    . ILE A 1 25 ? 0.009   4.328   2.320   1.00 15.00 ?  496 ILE A O    11 
ATOM   7791  C CB   . ILE A 1 25 ? 2.155   2.570   1.310   1.00 15.00 ?  496 ILE A CB   11 
ATOM   7792  C CG1  . ILE A 1 25 ? 2.651   1.459   0.372   1.00 15.00 ?  496 ILE A CG1  11 
ATOM   7793  C CG2  . ILE A 1 25 ? 3.265   2.999   2.263   1.00 15.00 ?  496 ILE A CG2  11 
ATOM   7794  C CD1  . ILE A 1 25 ? 4.026   1.718   -0.209  1.00 15.00 ?  496 ILE A CD1  11 
ATOM   7795  H H    . ILE A 1 25 ? -0.416  2.084   0.465   1.00 15.00 ?  496 ILE A H    11 
ATOM   7796  H HA   . ILE A 1 25 ? 1.206   1.355   2.811   1.00 15.00 ?  496 ILE A HA   11 
ATOM   7797  H HB   . ILE A 1 25 ? 1.877   3.431   0.717   1.00 15.00 ?  496 ILE A HB   11 
ATOM   7798  H HG12 . ILE A 1 25 ? 2.688   0.527   0.911   1.00 15.00 ?  496 ILE A HG12 11 
ATOM   7799  H HG13 . ILE A 1 25 ? 1.968   1.365   -0.458  1.00 15.00 ?  496 ILE A HG13 11 
ATOM   7800  H HG21 . ILE A 1 25 ? 4.126   3.313   1.693   1.00 15.00 ?  496 ILE A HG21 11 
ATOM   7801  H HG22 . ILE A 1 25 ? 3.536   2.170   2.898   1.00 15.00 ?  496 ILE A HG22 11 
ATOM   7802  H HG23 . ILE A 1 25 ? 2.917   3.821   2.873   1.00 15.00 ?  496 ILE A HG23 11 
ATOM   7803  H HD11 . ILE A 1 25 ? 4.310   0.891   -0.844  1.00 15.00 ?  496 ILE A HD11 11 
ATOM   7804  H HD12 . ILE A 1 25 ? 4.743   1.820   0.593   1.00 15.00 ?  496 ILE A HD12 11 
ATOM   7805  H HD13 . ILE A 1 25 ? 4.006   2.627   -0.790  1.00 15.00 ?  496 ILE A HD13 11 
ATOM   7806  N N    . ASP A 1 26 ? 0.376   3.216   4.225   1.00 15.00 ?  497 ASP A N    11 
ATOM   7807  C CA   . ASP A 1 26 ? 0.093   4.384   5.031   1.00 15.00 ?  497 ASP A CA   11 
ATOM   7808  C C    . ASP A 1 26 ? 1.404   5.067   5.342   1.00 15.00 ?  497 ASP A C    11 
ATOM   7809  O O    . ASP A 1 26 ? 2.327   4.480   5.895   1.00 15.00 ?  497 ASP A O    11 
ATOM   7810  C CB   . ASP A 1 26 ? -0.676  4.071   6.312   1.00 15.00 ?  497 ASP A CB   11 
ATOM   7811  C CG   . ASP A 1 26 ? 0.206   3.637   7.461   1.00 15.00 ?  497 ASP A CG   11 
ATOM   7812  O OD1  . ASP A 1 26 ? 0.552   2.443   7.537   1.00 15.00 ?  497 ASP A OD1  11 
ATOM   7813  O OD2  . ASP A 1 26 ? 0.566   4.503   8.294   1.00 15.00 -1 497 ASP A OD2  11 
ATOM   7814  H H    . ASP A 1 26 ? 0.572   2.353   4.659   1.00 15.00 ?  497 ASP A H    11 
ATOM   7815  H HA   . ASP A 1 26 ? -0.501  5.055   4.424   1.00 15.00 ?  497 ASP A HA   11 
ATOM   7816  H HB2  . ASP A 1 26 ? -1.200  4.965   6.612   1.00 15.00 ?  497 ASP A HB2  11 
ATOM   7817  H HB3  . ASP A 1 26 ? -1.395  3.287   6.112   1.00 15.00 ?  497 ASP A HB3  11 
ATOM   7818  N N    . HIS A 1 27 ? 1.500   6.292   4.915   1.00 15.00 ?  498 HIS A N    11 
ATOM   7819  C CA   . HIS A 1 27 ? 2.751   7.018   4.975   1.00 15.00 ?  498 HIS A CA   11 
ATOM   7820  C C    . HIS A 1 27 ? 3.041   7.596   6.350   1.00 15.00 ?  498 HIS A C    11 
ATOM   7821  O O    . HIS A 1 27 ? 4.147   8.074   6.599   1.00 15.00 ?  498 HIS A O    11 
ATOM   7822  C CB   . HIS A 1 27 ? 2.799   8.077   3.882   1.00 15.00 ?  498 HIS A CB   11 
ATOM   7823  C CG   . HIS A 1 27 ? 3.085   7.463   2.553   1.00 15.00 ?  498 HIS A CG   11 
ATOM   7824  N ND1  . HIS A 1 27 ? 4.369   7.195   2.131   1.00 15.00 ?  498 HIS A ND1  11 
ATOM   7825  C CD2  . HIS A 1 27 ? 2.262   6.979   1.586   1.00 15.00 ?  498 HIS A CD2  11 
ATOM   7826  C CE1  . HIS A 1 27 ? 4.330   6.571   0.975   1.00 15.00 ?  498 HIS A CE1  11 
ATOM   7827  N NE2  . HIS A 1 27 ? 3.070   6.431   0.619   1.00 15.00 ?  498 HIS A NE2  11 
ATOM   7828  H H    . HIS A 1 27 ? 0.696   6.732   4.552   1.00 15.00 ?  498 HIS A H    11 
ATOM   7829  H HA   . HIS A 1 27 ? 3.528   6.297   4.765   1.00 15.00 ?  498 HIS A HA   11 
ATOM   7830  H HB2  . HIS A 1 27 ? 1.848   8.586   3.827   1.00 15.00 ?  498 HIS A HB2  11 
ATOM   7831  H HB3  . HIS A 1 27 ? 3.582   8.787   4.100   1.00 15.00 ?  498 HIS A HB3  11 
ATOM   7832  H HD1  . HIS A 1 27 ? 5.197   7.449   2.610   1.00 15.00 ?  498 HIS A HD1  11 
ATOM   7833  H HD2  . HIS A 1 27 ? 1.168   7.000   1.582   1.00 15.00 ?  498 HIS A HD2  11 
ATOM   7834  H HE1  . HIS A 1 27 ? 5.186   6.187   0.435   1.00 15.00 ?  498 HIS A HE1  11 
ATOM   7835  H HE2  . HIS A 1 27 ? 2.769   6.175   -0.296  1.00 15.00 ?  498 HIS A HE2  11 
ATOM   7836  N N    . ASN A 1 28 ? 2.067   7.559   7.247   1.00 15.00 ?  499 ASN A N    11 
ATOM   7837  C CA   . ASN A 1 28 ? 2.279   8.132   8.567   1.00 15.00 ?  499 ASN A CA   11 
ATOM   7838  C C    . ASN A 1 28 ? 3.066   7.166   9.459   1.00 15.00 ?  499 ASN A C    11 
ATOM   7839  O O    . ASN A 1 28 ? 4.046   7.567   10.085  1.00 15.00 ?  499 ASN A O    11 
ATOM   7840  C CB   . ASN A 1 28 ? 0.952   8.567   9.213   1.00 15.00 ?  499 ASN A CB   11 
ATOM   7841  C CG   . ASN A 1 28 ? -0.018  7.424   9.448   1.00 15.00 ?  499 ASN A CG   11 
ATOM   7842  O OD1  . ASN A 1 28 ? -0.029  6.820   10.521  1.00 15.00 ?  499 ASN A OD1  11 
ATOM   7843  N ND2  . ASN A 1 28 ? -0.863  7.140   8.465   1.00 15.00 ?  499 ASN A ND2  11 
ATOM   7844  H H    . ASN A 1 28 ? 1.215   7.131   7.029   1.00 15.00 ?  499 ASN A H    11 
ATOM   7845  H HA   . ASN A 1 28 ? 2.890   9.014   8.423   1.00 15.00 ?  499 ASN A HA   11 
ATOM   7846  H HB2  . ASN A 1 28 ? 1.163   9.028   10.168  1.00 15.00 ?  499 ASN A HB2  11 
ATOM   7847  H HB3  . ASN A 1 28 ? 0.473   9.291   8.572   1.00 15.00 ?  499 ASN A HB3  11 
ATOM   7848  H HD21 . ASN A 1 28 ? -0.826  7.678   7.649   1.00 15.00 ?  499 ASN A HD21 11 
ATOM   7849  H HD22 . ASN A 1 28 ? -1.477  6.385   8.591   1.00 15.00 ?  499 ASN A HD22 11 
ATOM   7850  N N    . THR A 1 29 ? 2.639   5.906   9.554   1.00 15.00 ?  500 THR A N    11 
ATOM   7851  C CA   . THR A 1 29 ? 3.478   4.874   10.160  1.00 15.00 ?  500 THR A CA   11 
ATOM   7852  C C    . THR A 1 29 ? 4.513   4.366   9.155   1.00 15.00 ?  500 THR A C    11 
ATOM   7853  O O    . THR A 1 29 ? 5.439   3.638   9.512   1.00 15.00 ?  500 THR A O    11 
ATOM   7854  C CB   . THR A 1 29 ? 2.661   3.705   10.748  1.00 15.00 ?  500 THR A CB   11 
ATOM   7855  O OG1  . THR A 1 29 ? 2.064   2.927   9.711   1.00 15.00 ?  500 THR A OG1  11 
ATOM   7856  C CG2  . THR A 1 29 ? 1.577   4.226   11.679  1.00 15.00 ?  500 THR A CG2  11 
ATOM   7857  H H    . THR A 1 29 ? 1.750   5.660   9.200   1.00 15.00 ?  500 THR A H    11 
ATOM   7858  H HA   . THR A 1 29 ? 4.012   5.346   10.977  1.00 15.00 ?  500 THR A HA   11 
ATOM   7859  H HB   . THR A 1 29 ? 3.326   3.074   11.320  1.00 15.00 ?  500 THR A HB   11 
ATOM   7860  H HG1  . THR A 1 29 ? 1.455   3.481   9.188   1.00 15.00 ?  500 THR A HG1  11 
ATOM   7861  H HG21 . THR A 1 29 ? 1.016   3.394   12.081  1.00 15.00 ?  500 THR A HG21 11 
ATOM   7862  H HG22 . THR A 1 29 ? 0.914   4.877   11.130  1.00 15.00 ?  500 THR A HG22 11 
ATOM   7863  H HG23 . THR A 1 29 ? 2.034   4.776   12.489  1.00 15.00 ?  500 THR A HG23 11 
ATOM   7864  N N    . LYS A 1 30 ? 4.293   4.751   7.887   1.00 15.00 ?  501 LYS A N    11 
ATOM   7865  C CA   . LYS A 1 30 ? 5.118   4.374   6.724   1.00 15.00 ?  501 LYS A CA   11 
ATOM   7866  C C    . LYS A 1 30 ? 5.119   2.862   6.485   1.00 15.00 ?  501 LYS A C    11 
ATOM   7867  O O    . LYS A 1 30 ? 6.037   2.317   5.864   1.00 15.00 ?  501 LYS A O    11 
ATOM   7868  C CB   . LYS A 1 30 ? 6.558   4.930   6.807   1.00 15.00 ?  501 LYS A CB   11 
ATOM   7869  C CG   . LYS A 1 30 ? 7.519   4.147   7.687   1.00 15.00 ?  501 LYS A CG   11 
ATOM   7870  C CD   . LYS A 1 30 ? 8.962   4.506   7.379   1.00 15.00 ?  501 LYS A CD   11 
ATOM   7871  C CE   . LYS A 1 30 ? 9.929   3.774   8.293   1.00 15.00 ?  501 LYS A CE   11 
ATOM   7872  N NZ   . LYS A 1 30 ? 9.881   4.295   9.686   1.00 15.00 1  501 LYS A NZ   11 
ATOM   7873  H H    . LYS A 1 30 ? 3.506   5.308   7.720   1.00 15.00 ?  501 LYS A H    11 
ATOM   7874  H HA   . LYS A 1 30 ? 4.642   4.827   5.865   1.00 15.00 ?  501 LYS A HA   11 
ATOM   7875  H HB2  . LYS A 1 30 ? 6.971   4.953   5.810   1.00 15.00 ?  501 LYS A HB2  11 
ATOM   7876  H HB3  . LYS A 1 30 ? 6.510   5.942   7.182   1.00 15.00 ?  501 LYS A HB3  11 
ATOM   7877  H HG2  . LYS A 1 30 ? 7.314   4.375   8.721   1.00 15.00 ?  501 LYS A HG2  11 
ATOM   7878  H HG3  . LYS A 1 30 ? 7.375   3.091   7.512   1.00 15.00 ?  501 LYS A HG3  11 
ATOM   7879  H HD2  . LYS A 1 30 ? 9.178   4.235   6.356   1.00 15.00 ?  501 LYS A HD2  11 
ATOM   7880  H HD3  . LYS A 1 30 ? 9.093   5.570   7.506   1.00 15.00 ?  501 LYS A HD3  11 
ATOM   7881  H HE2  . LYS A 1 30 ? 9.672   2.726   8.299   1.00 15.00 ?  501 LYS A HE2  11 
ATOM   7882  H HE3  . LYS A 1 30 ? 10.932  3.897   7.906   1.00 15.00 ?  501 LYS A HE3  11 
ATOM   7883  H HZ1  . LYS A 1 30 ? 10.556  3.775   10.290  1.00 15.00 ?  501 LYS A HZ1  11 
ATOM   7884  H HZ2  . LYS A 1 30 ? 8.924   4.184   10.084  1.00 15.00 ?  501 LYS A HZ2  11 
ATOM   7885  H HZ3  . LYS A 1 30 ? 10.135  5.307   9.698   1.00 15.00 ?  501 LYS A HZ3  11 
ATOM   7886  N N    . THR A 1 31 ? 4.050   2.195   6.900   1.00 15.00 ?  502 THR A N    11 
ATOM   7887  C CA   . THR A 1 31 ? 3.933   0.758   6.688   1.00 15.00 ?  502 THR A CA   11 
ATOM   7888  C C    . THR A 1 31 ? 2.993   0.457   5.522   1.00 15.00 ?  502 THR A C    11 
ATOM   7889  O O    . THR A 1 31 ? 2.076   1.223   5.235   1.00 15.00 ?  502 THR A O    11 
ATOM   7890  C CB   . THR A 1 31 ? 3.445   0.014   7.954   1.00 15.00 ?  502 THR A CB   11 
ATOM   7891  O OG1  . THR A 1 31 ? 2.116   0.413   8.320   1.00 15.00 ?  502 THR A OG1  11 
ATOM   7892  C CG2  . THR A 1 31 ? 4.386   0.261   9.122   1.00 15.00 ?  502 THR A CG2  11 
ATOM   7893  H H    . THR A 1 31 ? 3.315   2.681   7.332   1.00 15.00 ?  502 THR A H    11 
ATOM   7894  H HA   . THR A 1 31 ? 4.918   0.385   6.439   1.00 15.00 ?  502 THR A HA   11 
ATOM   7895  H HB   . THR A 1 31 ? 3.443   -1.046  7.743   1.00 15.00 ?  502 THR A HB   11 
ATOM   7896  H HG1  . THR A 1 31 ? 1.870   1.235   7.857   1.00 15.00 ?  502 THR A HG1  11 
ATOM   7897  H HG21 . THR A 1 31 ? 4.026   -0.267  9.992   1.00 15.00 ?  502 THR A HG21 11 
ATOM   7898  H HG22 . THR A 1 31 ? 4.427   1.320   9.333   1.00 15.00 ?  502 THR A HG22 11 
ATOM   7899  H HG23 . THR A 1 31 ? 5.375   -0.093  8.870   1.00 15.00 ?  502 THR A HG23 11 
ATOM   7900  N N    . THR A 1 32 ? 3.242   -0.646  4.836   1.00 15.00 ?  503 THR A N    11 
ATOM   7901  C CA   . THR A 1 32 ? 2.383   -1.071  3.745   1.00 15.00 ?  503 THR A CA   11 
ATOM   7902  C C    . THR A 1 32 ? 1.804   -2.452  4.040   1.00 15.00 ?  503 THR A C    11 
ATOM   7903  O O    . THR A 1 32 ? 2.420   -3.251  4.745   1.00 15.00 ?  503 THR A O    11 
ATOM   7904  C CB   . THR A 1 32 ? 3.133   -1.068  2.391   1.00 15.00 ?  503 THR A CB   11 
ATOM   7905  O OG1  . THR A 1 32 ? 2.333   -1.684  1.376   1.00 15.00 ?  503 THR A OG1  11 
ATOM   7906  C CG2  . THR A 1 32 ? 4.478   -1.774  2.481   1.00 15.00 ?  503 THR A CG2  11 
ATOM   7907  H H    . THR A 1 32 ? 4.017   -1.191  5.071   1.00 15.00 ?  503 THR A H    11 
ATOM   7908  H HA   . THR A 1 32 ? 1.567   -0.365  3.679   1.00 15.00 ?  503 THR A HA   11 
ATOM   7909  H HB   . THR A 1 32 ? 3.309   -0.040  2.108   1.00 15.00 ?  503 THR A HB   11 
ATOM   7910  H HG1  . THR A 1 32 ? 1.694   -1.047  1.041   1.00 15.00 ?  503 THR A HG1  11 
ATOM   7911  H HG21 . THR A 1 32 ? 4.325   -2.815  2.715   1.00 15.00 ?  503 THR A HG21 11 
ATOM   7912  H HG22 . THR A 1 32 ? 5.072   -1.314  3.256   1.00 15.00 ?  503 THR A HG22 11 
ATOM   7913  H HG23 . THR A 1 32 ? 4.995   -1.685  1.532   1.00 15.00 ?  503 THR A HG23 11 
ATOM   7914  N N    . THR A 1 33 ? 0.595   -2.700  3.557   1.00 15.00 ?  504 THR A N    11 
ATOM   7915  C CA   . THR A 1 33 ? -0.069  -3.976  3.766   1.00 15.00 ?  504 THR A CA   11 
ATOM   7916  C C    . THR A 1 33 ? -1.010  -4.300  2.606   1.00 15.00 ?  504 THR A C    11 
ATOM   7917  O O    . THR A 1 33 ? -1.532  -3.398  1.948   1.00 15.00 ?  504 THR A O    11 
ATOM   7918  C CB   . THR A 1 33 ? -0.852  -3.987  5.099   1.00 15.00 ?  504 THR A CB   11 
ATOM   7919  O OG1  . THR A 1 33 ? -1.480  -5.261  5.296   1.00 15.00 ?  504 THR A OG1  11 
ATOM   7920  C CG2  . THR A 1 33 ? -1.903  -2.885  5.132   1.00 15.00 ?  504 THR A CG2  11 
ATOM   7921  H H    . THR A 1 33 ? 0.133   -2.002  3.039   1.00 15.00 ?  504 THR A H    11 
ATOM   7922  H HA   . THR A 1 33 ? 0.693   -4.740  3.817   1.00 15.00 ?  504 THR A HA   11 
ATOM   7923  H HB   . THR A 1 33 ? -0.153  -3.817  5.906   1.00 15.00 ?  504 THR A HB   11 
ATOM   7924  H HG1  . THR A 1 33 ? -1.794  -5.327  6.204   1.00 15.00 ?  504 THR A HG1  11 
ATOM   7925  H HG21 . THR A 1 33 ? -2.605  -3.032  4.324   1.00 15.00 ?  504 THR A HG21 11 
ATOM   7926  H HG22 . THR A 1 33 ? -1.421  -1.925  5.020   1.00 15.00 ?  504 THR A HG22 11 
ATOM   7927  H HG23 . THR A 1 33 ? -2.429  -2.916  6.076   1.00 15.00 ?  504 THR A HG23 11 
ATOM   7928  N N    . TRP A 1 34 ? -1.194  -5.590  2.334   1.00 15.00 ?  505 TRP A N    11 
ATOM   7929  C CA   . TRP A 1 34 ? -2.189  -6.023  1.360   1.00 15.00 ?  505 TRP A CA   11 
ATOM   7930  C C    . TRP A 1 34 ? -3.587  -5.901  1.962   1.00 15.00 ?  505 TRP A C    11 
ATOM   7931  O O    . TRP A 1 34 ? -4.591  -5.966  1.253   1.00 15.00 ?  505 TRP A O    11 
ATOM   7932  C CB   . TRP A 1 34 ? -1.963  -7.479  0.929   1.00 15.00 ?  505 TRP A CB   11 
ATOM   7933  C CG   . TRP A 1 34 ? -0.635  -7.750  0.291   1.00 15.00 ?  505 TRP A CG   11 
ATOM   7934  C CD1  . TRP A 1 34 ? 0.329   -8.596  0.749   1.00 15.00 ?  505 TRP A CD1  11 
ATOM   7935  C CD2  . TRP A 1 34 ? -0.126  -7.190  -0.924  1.00 15.00 ?  505 TRP A CD2  11 
ATOM   7936  N NE1  . TRP A 1 34 ? 1.402   -8.596  -0.100  1.00 15.00 ?  505 TRP A NE1  11 
ATOM   7937  C CE2  . TRP A 1 34 ? 1.153   -7.739  -1.130  1.00 15.00 ?  505 TRP A CE2  11 
ATOM   7938  C CE3  . TRP A 1 34 ? -0.621  -6.280  -1.855  1.00 15.00 ?  505 TRP A CE3  11 
ATOM   7939  C CZ2  . TRP A 1 34 ? 1.940   -7.409  -2.225  1.00 15.00 ?  505 TRP A CZ2  11 
ATOM   7940  C CZ3  . TRP A 1 34 ? 0.163   -5.953  -2.942  1.00 15.00 ?  505 TRP A CZ3  11 
ATOM   7941  C CH2  . TRP A 1 34 ? 1.431   -6.516  -3.118  1.00 15.00 ?  505 TRP A CH2  11 
ATOM   7942  H H    . TRP A 1 34 ? -0.656  -6.261  2.802   1.00 15.00 ?  505 TRP A H    11 
ATOM   7943  H HA   . TRP A 1 34 ? -2.118  -5.378  0.497   1.00 15.00 ?  505 TRP A HA   11 
ATOM   7944  H HB2  . TRP A 1 34 ? -2.042  -8.114  1.797   1.00 15.00 ?  505 TRP A HB2  11 
ATOM   7945  H HB3  . TRP A 1 34 ? -2.733  -7.755  0.223   1.00 15.00 ?  505 TRP A HB3  11 
ATOM   7946  H HD1  . TRP A 1 34 ? 0.243   -9.189  1.647   1.00 15.00 ?  505 TRP A HD1  11 
ATOM   7947  H HE1  . TRP A 1 34 ? 2.222   -9.126  0.016   1.00 15.00 ?  505 TRP A HE1  11 
ATOM   7948  H HE3  . TRP A 1 34 ? -1.598  -5.834  -1.737  1.00 15.00 ?  505 TRP A HE3  11 
ATOM   7949  H HZ2  . TRP A 1 34 ? 2.919   -7.837  -2.375  1.00 15.00 ?  505 TRP A HZ2  11 
ATOM   7950  H HZ3  . TRP A 1 34 ? -0.203  -5.247  -3.675  1.00 15.00 ?  505 TRP A HZ3  11 
ATOM   7951  H HH2  . TRP A 1 34 ? 2.008   -6.228  -3.986  1.00 15.00 ?  505 TRP A HH2  11 
ATOM   7952  N N    . GLU A 1 35 ? -3.633  -5.754  3.283   1.00 15.00 ?  506 GLU A N    11 
ATOM   7953  C CA   . GLU A 1 35 ? -4.891  -5.689  4.016   1.00 15.00 ?  506 GLU A CA   11 
ATOM   7954  C C    . GLU A 1 35 ? -5.578  -4.369  3.846   1.00 15.00 ?  506 GLU A C    11 
ATOM   7955  O O    . GLU A 1 35 ? -4.979  -3.299  3.958   1.00 15.00 ?  506 GLU A O    11 
ATOM   7956  C CB   . GLU A 1 35 ? -4.669  -5.968  5.501   1.00 15.00 ?  506 GLU A CB   11 
ATOM   7957  C CG   . GLU A 1 35 ? -4.722  -7.440  5.868   1.00 15.00 ?  506 GLU A CG   11 
ATOM   7958  C CD   . GLU A 1 35 ? -6.091  -8.042  5.631   1.00 15.00 ?  506 GLU A CD   11 
ATOM   7959  O OE1  . GLU A 1 35 ? -7.064  -7.603  6.282   1.00 15.00 -1 506 GLU A OE1  11 
ATOM   7960  O OE2  . GLU A 1 35 ? -6.211  -8.945  4.782   1.00 15.00 ?  506 GLU A OE2  11 
ATOM   7961  H H    . GLU A 1 35 ? -2.790  -5.674  3.782   1.00 15.00 ?  506 GLU A H    11 
ATOM   7962  H HA   . GLU A 1 35 ? -5.550  -6.431  3.612   1.00 15.00 ?  506 GLU A HA   11 
ATOM   7963  H HB2  . GLU A 1 35 ? -3.701  -5.583  5.785   1.00 15.00 ?  506 GLU A HB2  11 
ATOM   7964  H HB3  . GLU A 1 35 ? -5.429  -5.451  6.069   1.00 15.00 ?  506 GLU A HB3  11 
ATOM   7965  H HG2  . GLU A 1 35 ? -4.000  -7.974  5.269   1.00 15.00 ?  506 GLU A HG2  11 
ATOM   7966  H HG3  . GLU A 1 35 ? -4.473  -7.546  6.914   1.00 15.00 ?  506 GLU A HG3  11 
ATOM   7967  N N    . ASP A 1 36 ? -6.864  -4.479  3.600   1.00 15.00 ?  507 ASP A N    11 
ATOM   7968  C CA   . ASP A 1 36 ? -7.706  -3.330  3.438   1.00 15.00 ?  507 ASP A CA   11 
ATOM   7969  C C    . ASP A 1 36 ? -7.869  -2.609  4.777   1.00 15.00 ?  507 ASP A C    11 
ATOM   7970  O O    . ASP A 1 36 ? -8.226  -3.232  5.775   1.00 15.00 ?  507 ASP A O    11 
ATOM   7971  C CB   . ASP A 1 36 ? -9.060  -3.769  2.877   1.00 15.00 ?  507 ASP A CB   11 
ATOM   7972  C CG   . ASP A 1 36 ? -10.110 -2.679  2.927   1.00 15.00 ?  507 ASP A CG   11 
ATOM   7973  O OD1  . ASP A 1 36 ? -10.144 -1.833  2.010   1.00 15.00 ?  507 ASP A OD1  11 
ATOM   7974  O OD2  . ASP A 1 36 ? -10.921 -2.685  3.876   1.00 15.00 -1 507 ASP A OD2  11 
ATOM   7975  H H    . ASP A 1 36 ? -7.259  -5.370  3.524   1.00 15.00 ?  507 ASP A H    11 
ATOM   7976  H HA   . ASP A 1 36 ? -7.214  -2.692  2.739   1.00 15.00 ?  507 ASP A HA   11 
ATOM   7977  H HB2  . ASP A 1 36 ? -8.934  -4.068  1.849   1.00 15.00 ?  507 ASP A HB2  11 
ATOM   7978  H HB3  . ASP A 1 36 ? -9.419  -4.614  3.449   1.00 15.00 ?  507 ASP A HB3  11 
ATOM   7979  N N    . PRO A 1 37 ? -7.601  -1.295  4.826   1.00 15.00 ?  508 PRO A N    11 
ATOM   7980  C CA   . PRO A 1 37 ? -7.670  -0.514  6.072   1.00 15.00 ?  508 PRO A CA   11 
ATOM   7981  C C    . PRO A 1 37 ? -9.094  -0.274  6.579   1.00 15.00 ?  508 PRO A C    11 
ATOM   7982  O O    . PRO A 1 37 ? -9.284  0.452   7.558   1.00 15.00 ?  508 PRO A O    11 
ATOM   7983  C CB   . PRO A 1 37 ? -7.023  0.817   5.692   1.00 15.00 ?  508 PRO A CB   11 
ATOM   7984  C CG   . PRO A 1 37 ? -7.229  0.934   4.223   1.00 15.00 ?  508 PRO A CG   11 
ATOM   7985  C CD   . PRO A 1 37 ? -7.176  -0.468  3.682   1.00 15.00 ?  508 PRO A CD   11 
ATOM   7986  H HA   . PRO A 1 37 ? -7.091  -0.980  6.855   1.00 15.00 ?  508 PRO A HA   11 
ATOM   7987  H HB2  . PRO A 1 37 ? -7.509  1.621   6.224   1.00 15.00 ?  508 PRO A HB2  11 
ATOM   7988  H HB3  . PRO A 1 37 ? -5.973  0.794   5.940   1.00 15.00 ?  508 PRO A HB3  11 
ATOM   7989  H HG2  . PRO A 1 37 ? -8.190  1.379   4.026   1.00 15.00 ?  508 PRO A HG2  11 
ATOM   7990  H HG3  . PRO A 1 37 ? -6.442  1.532   3.789   1.00 15.00 ?  508 PRO A HG3  11 
ATOM   7991  H HD2  . PRO A 1 37 ? -7.855  -0.578  2.852   1.00 15.00 ?  508 PRO A HD2  11 
ATOM   7992  H HD3  . PRO A 1 37 ? -6.169  -0.718  3.380   1.00 15.00 ?  508 PRO A HD3  11 
ATOM   7993  N N    . ARG A 1 38 ? -10.077 -0.888  5.921   1.00 15.00 ?  509 ARG A N    11 
ATOM   7994  C CA   . ARG A 1 38 ? -11.484 -0.744  6.291   1.00 15.00 ?  509 ARG A CA   11 
ATOM   7995  C C    . ARG A 1 38 ? -11.941 0.706   6.163   1.00 15.00 ?  509 ARG A C    11 
ATOM   7996  O O    . ARG A 1 38 ? -12.264 1.130   5.034   1.00 15.00 ?  509 ARG A O    11 
ATOM   7997  C CB   . ARG A 1 38 ? -11.748 -1.257  7.715   1.00 15.00 ?  509 ARG A CB   11 
ATOM   7998  C CG   . ARG A 1 38 ? -11.932 -2.767  7.829   1.00 15.00 ?  509 ARG A CG   11 
ATOM   7999  C CD   . ARG A 1 38 ? -10.652 -3.543  7.549   1.00 15.00 ?  509 ARG A CD   11 
ATOM   8000  N NE   . ARG A 1 38 ? -10.822 -4.974  7.810   1.00 15.00 ?  509 ARG A NE   11 
ATOM   8001  C CZ   . ARG A 1 38 ? -9.956  -5.922  7.439   1.00 15.00 ?  509 ARG A CZ   11 
ATOM   8002  N NH1  . ARG A 1 38 ? -8.842  -5.610  6.790   1.00 15.00 1  509 ARG A NH1  11 
ATOM   8003  N NH2  . ARG A 1 38 ? -10.207 -7.195  7.725   1.00 15.00 ?  509 ARG A NH2  11 
ATOM   8004  H H    . ARG A 1 38 ? -9.850  -1.455  5.151   1.00 15.00 ?  509 ARG A H    11 
ATOM   8005  H HA   . ARG A 1 38 ? -12.059 -1.343  5.599   1.00 15.00 ?  509 ARG A HA   11 
ATOM   8006  H HB2  . ARG A 1 38 ? -10.916 -0.974  8.342   1.00 15.00 ?  509 ARG A HB2  11 
ATOM   8007  H HB3  . ARG A 1 38 ? -12.642 -0.781  8.091   1.00 15.00 ?  509 ARG A HB3  11 
ATOM   8008  H HG2  . ARG A 1 38 ? -12.261 -2.999  8.829   1.00 15.00 ?  509 ARG A HG2  11 
ATOM   8009  H HG3  . ARG A 1 38 ? -12.689 -3.077  7.124   1.00 15.00 ?  509 ARG A HG3  11 
ATOM   8010  H HD2  . ARG A 1 38 ? -10.378 -3.403  6.514   1.00 15.00 ?  509 ARG A HD2  11 
ATOM   8011  H HD3  . ARG A 1 38 ? -9.867  -3.161  8.185   1.00 15.00 ?  509 ARG A HD3  11 
ATOM   8012  H HE   . ARG A 1 38 ? -11.637 -5.245  8.298   1.00 15.00 ?  509 ARG A HE   11 
ATOM   8013  H HH11 . ARG A 1 38 ? -8.639  -4.649  6.564   1.00 15.00 ?  509 ARG A HH11 11 
ATOM   8014  H HH12 . ARG A 1 38 ? -8.186  -6.334  6.529   1.00 15.00 ?  509 ARG A HH12 11 
ATOM   8015  H HH21 . ARG A 1 38 ? -11.047 -7.449  8.227   1.00 15.00 ?  509 ARG A HH21 11 
ATOM   8016  H HH22 . ARG A 1 38 ? -9.572  -7.915  7.428   1.00 15.00 ?  509 ARG A HH22 11 
ATOM   8017  N N    . ARG B 2 1  ? -5.097  -12.740 -0.602  1.00 15.00 ?  925 ARG B N    11 
ATOM   8018  C CA   . ARG B 2 1  ? -3.984  -11.786 -0.811  1.00 15.00 ?  925 ARG B CA   11 
ATOM   8019  C C    . ARG B 2 1  ? -2.665  -12.393 -0.352  1.00 15.00 ?  925 ARG B C    11 
ATOM   8020  O O    . ARG B 2 1  ? -2.597  -13.044 0.688   1.00 15.00 ?  925 ARG B O    11 
ATOM   8021  C CB   . ARG B 2 1  ? -4.261  -10.460 -0.092  1.00 15.00 ?  925 ARG B CB   11 
ATOM   8022  C CG   . ARG B 2 1  ? -4.753  -10.608 1.338   1.00 15.00 ?  925 ARG B CG   11 
ATOM   8023  C CD   . ARG B 2 1  ? -5.188  -9.270  1.914   1.00 15.00 ?  925 ARG B CD   11 
ATOM   8024  N NE   . ARG B 2 1  ? -6.160  -8.594  1.051   1.00 15.00 ?  925 ARG B NE   11 
ATOM   8025  C CZ   . ARG B 2 1  ? -7.354  -8.157  1.455   1.00 15.00 ?  925 ARG B CZ   11 
ATOM   8026  N NH1  . ARG B 2 1  ? -7.726  -8.284  2.722   1.00 15.00 1  925 ARG B NH1  11 
ATOM   8027  N NH2  . ARG B 2 1  ? -8.167  -7.567  0.589   1.00 15.00 ?  925 ARG B NH2  11 
ATOM   8028  H H1   . ARG B 2 1  ? -4.955  -13.586 -1.197  1.00 15.00 ?  925 ARG B H1   11 
ATOM   8029  H H2   . ARG B 2 1  ? -6.004  -12.297 -0.858  1.00 15.00 ?  925 ARG B H2   11 
ATOM   8030  H H3   . ARG B 2 1  ? -5.133  -13.037 0.397   1.00 15.00 ?  925 ARG B H3   11 
ATOM   8031  H HA   . ARG B 2 1  ? -3.912  -11.594 -1.872  1.00 15.00 ?  925 ARG B HA   11 
ATOM   8032  H HB2  . ARG B 2 1  ? -3.350  -9.881  -0.073  1.00 15.00 ?  925 ARG B HB2  11 
ATOM   8033  H HB3  . ARG B 2 1  ? -5.008  -9.915  -0.650  1.00 15.00 ?  925 ARG B HB3  11 
ATOM   8034  H HG2  . ARG B 2 1  ? -5.593  -11.286 1.352   1.00 15.00 ?  925 ARG B HG2  11 
ATOM   8035  H HG3  . ARG B 2 1  ? -3.953  -11.010 1.944   1.00 15.00 ?  925 ARG B HG3  11 
ATOM   8036  H HD2  . ARG B 2 1  ? -5.635  -9.436  2.883   1.00 15.00 ?  925 ARG B HD2  11 
ATOM   8037  H HD3  . ARG B 2 1  ? -4.317  -8.640  2.023   1.00 15.00 ?  925 ARG B HD3  11 
ATOM   8038  H HE   . ARG B 2 1  ? -5.902  -8.454  0.109   1.00 15.00 ?  925 ARG B HE   11 
ATOM   8039  H HH11 . ARG B 2 1  ? -7.103  -8.706  3.399   1.00 15.00 ?  925 ARG B HH11 11 
ATOM   8040  H HH12 . ARG B 2 1  ? -8.637  -7.967  3.016   1.00 15.00 ?  925 ARG B HH12 11 
ATOM   8041  H HH21 . ARG B 2 1  ? -7.884  -7.443  -0.366  1.00 15.00 ?  925 ARG B HH21 11 
ATOM   8042  H HH22 . ARG B 2 1  ? -9.075  -7.251  0.883   1.00 15.00 ?  925 ARG B HH22 11 
ATOM   8043  N N    . LEU B 2 2  ? -1.624  -12.156 -1.142  1.00 15.00 ?  926 LEU B N    11 
ATOM   8044  C CA   . LEU B 2 2  ? -0.302  -12.732 -0.900  1.00 15.00 ?  926 LEU B CA   11 
ATOM   8045  C C    . LEU B 2 2  ? 0.370   -12.165 0.346   1.00 15.00 ?  926 LEU B C    11 
ATOM   8046  O O    . LEU B 2 2  ? -0.204  -11.352 1.067   1.00 15.00 ?  926 LEU B O    11 
ATOM   8047  C CB   . LEU B 2 2  ? 0.608   -12.510 -2.115  1.00 15.00 ?  926 LEU B CB   11 
ATOM   8048  C CG   . LEU B 2 2  ? 0.451   -13.531 -3.242  1.00 15.00 ?  926 LEU B CG   11 
ATOM   8049  C CD1  . LEU B 2 2  ? 0.568   -14.932 -2.678  1.00 15.00 ?  926 LEU B CD1  11 
ATOM   8050  C CD2  . LEU B 2 2  ? -0.871  -13.345 -3.973  1.00 15.00 ?  926 LEU B CD2  11 
ATOM   8051  H H    . LEU B 2 2  ? -1.746  -11.575 -1.919  1.00 15.00 ?  926 LEU B H    11 
ATOM   8052  H HA   . LEU B 2 2  ? -0.432  -13.793 -0.762  1.00 15.00 ?  926 LEU B HA   11 
ATOM   8053  H HB2  . LEU B 2 2  ? 0.402   -11.529 -2.516  1.00 15.00 ?  926 LEU B HB2  11 
ATOM   8054  H HB3  . LEU B 2 2  ? 1.634   -12.535 -1.779  1.00 15.00 ?  926 LEU B HB3  11 
ATOM   8055  H HG   . LEU B 2 2  ? 1.251   -13.392 -3.956  1.00 15.00 ?  926 LEU B HG   11 
ATOM   8056  H HD11 . LEU B 2 2  ? 0.425   -15.655 -3.468  1.00 15.00 ?  926 LEU B HD11 11 
ATOM   8057  H HD12 . LEU B 2 2  ? -0.187  -15.072 -1.917  1.00 15.00 ?  926 LEU B HD12 11 
ATOM   8058  H HD13 . LEU B 2 2  ? 1.546   -15.062 -2.239  1.00 15.00 ?  926 LEU B HD13 11 
ATOM   8059  H HD21 . LEU B 2 2  ? -0.911  -12.353 -4.398  1.00 15.00 ?  926 LEU B HD21 11 
ATOM   8060  H HD22 . LEU B 2 2  ? -1.687  -13.472 -3.277  1.00 15.00 ?  926 LEU B HD22 11 
ATOM   8061  H HD23 . LEU B 2 2  ? -0.952  -14.079 -4.762  1.00 15.00 ?  926 LEU B HD23 11 
ATOM   8062  N N    . ASP B 2 3  ? 1.578   -12.647 0.612   1.00 15.00 ?  927 ASP B N    11 
ATOM   8063  C CA   . ASP B 2 3  ? 2.403   -12.125 1.695   1.00 15.00 ?  927 ASP B CA   11 
ATOM   8064  C C    . ASP B 2 3  ? 3.116   -10.856 1.244   1.00 15.00 ?  927 ASP B C    11 
ATOM   8065  O O    . ASP B 2 3  ? 3.520   -10.734 0.087   1.00 15.00 ?  927 ASP B O    11 
ATOM   8066  C CB   . ASP B 2 3  ? 3.416   -13.179 2.162   1.00 15.00 ?  927 ASP B CB   11 
ATOM   8067  C CG   . ASP B 2 3  ? 4.105   -13.897 1.018   1.00 15.00 ?  927 ASP B CG   11 
ATOM   8068  O OD1  . ASP B 2 3  ? 5.148   -13.410 0.531   1.00 15.00 ?  927 ASP B OD1  11 
ATOM   8069  O OD2  . ASP B 2 3  ? 3.609   -14.966 0.608   1.00 15.00 -1 927 ASP B OD2  11 
ATOM   8070  H H    . ASP B 2 3  ? 1.929   -13.378 0.060   1.00 15.00 ?  927 ASP B H    11 
ATOM   8071  H HA   . ASP B 2 3  ? 1.749   -11.878 2.518   1.00 15.00 ?  927 ASP B HA   11 
ATOM   8072  H HB2  . ASP B 2 3  ? 4.173   -12.697 2.761   1.00 15.00 ?  927 ASP B HB2  11 
ATOM   8073  H HB3  . ASP B 2 3  ? 2.904   -13.914 2.766   1.00 15.00 ?  927 ASP B HB3  11 
ATOM   8074  N N    . LEU B 2 4  ? 3.252   -9.911  2.161   1.00 15.00 ?  928 LEU B N    11 
ATOM   8075  C CA   . LEU B 2 4  ? 3.821   -8.602  1.855   1.00 15.00 ?  928 LEU B CA   11 
ATOM   8076  C C    . LEU B 2 4  ? 5.332   -8.664  1.643   1.00 15.00 ?  928 LEU B C    11 
ATOM   8077  O O    . LEU B 2 4  ? 6.054   -9.263  2.442   1.00 15.00 ?  928 LEU B O    11 
ATOM   8078  C CB   . LEU B 2 4  ? 3.524   -7.634  2.998   1.00 15.00 ?  928 LEU B CB   11 
ATOM   8079  C CG   . LEU B 2 4  ? 4.039   -6.212  2.785   1.00 15.00 ?  928 LEU B CG   11 
ATOM   8080  C CD1  . LEU B 2 4  ? 3.077   -5.414  1.916   1.00 15.00 ?  928 LEU B CD1  11 
ATOM   8081  C CD2  . LEU B 2 4  ? 4.274   -5.528  4.117   1.00 15.00 ?  928 LEU B CD2  11 
ATOM   8082  H H    . LEU B 2 4  ? 2.954   -10.096 3.078   1.00 15.00 ?  928 LEU B H    11 
ATOM   8083  H HA   . LEU B 2 4  ? 3.354   -8.234  0.954   1.00 15.00 ?  928 LEU B HA   11 
ATOM   8084  H HB2  . LEU B 2 4  ? 2.454   -7.591  3.136   1.00 15.00 ?  928 LEU B HB2  11 
ATOM   8085  H HB3  . LEU B 2 4  ? 3.973   -8.024  3.901   1.00 15.00 ?  928 LEU B HB3  11 
ATOM   8086  H HG   . LEU B 2 4  ? 4.986   -6.259  2.266   1.00 15.00 ?  928 LEU B HG   11 
ATOM   8087  H HD11 . LEU B 2 4  ? 3.458   -4.412  1.781   1.00 15.00 ?  928 LEU B HD11 11 
ATOM   8088  H HD12 . LEU B 2 4  ? 2.110   -5.369  2.397   1.00 15.00 ?  928 LEU B HD12 11 
ATOM   8089  H HD13 . LEU B 2 4  ? 2.977   -5.895  0.954   1.00 15.00 ?  928 LEU B HD13 11 
ATOM   8090  H HD21 . LEU B 2 4  ? 3.347   -5.486  4.669   1.00 15.00 ?  928 LEU B HD21 11 
ATOM   8091  H HD22 . LEU B 2 4  ? 4.637   -4.525  3.949   1.00 15.00 ?  928 LEU B HD22 11 
ATOM   8092  H HD23 . LEU B 2 4  ? 5.005   -6.086  4.684   1.00 15.00 ?  928 LEU B HD23 11 
ATOM   8093  N N    . PRO B 2 5  ? 5.832   -8.010  0.582   1.00 15.00 ?  929 PRO B N    11 
ATOM   8094  C CA   . PRO B 2 5  ? 7.261   -7.848  0.357   1.00 15.00 ?  929 PRO B CA   11 
ATOM   8095  C C    . PRO B 2 5  ? 7.809   -6.673  1.168   1.00 15.00 ?  929 PRO B C    11 
ATOM   8096  O O    . PRO B 2 5  ? 7.112   -5.672  1.352   1.00 15.00 ?  929 PRO B O    11 
ATOM   8097  C CB   . PRO B 2 5  ? 7.368   -7.550  -1.150  1.00 15.00 ?  929 PRO B CB   11 
ATOM   8098  C CG   . PRO B 2 5  ? 5.966   -7.446  -1.670  1.00 15.00 ?  929 PRO B CG   11 
ATOM   8099  C CD   . PRO B 2 5  ? 5.053   -7.362  -0.480  1.00 15.00 ?  929 PRO B CD   11 
ATOM   8100  H HA   . PRO B 2 5  ? 7.810   -8.746  0.598   1.00 15.00 ?  929 PRO B HA   11 
ATOM   8101  H HB2  . PRO B 2 5  ? 7.906   -6.625  -1.291  1.00 15.00 ?  929 PRO B HB2  11 
ATOM   8102  H HB3  . PRO B 2 5  ? 7.905   -8.353  -1.633  1.00 15.00 ?  929 PRO B HB3  11 
ATOM   8103  H HG2  . PRO B 2 5  ? 5.866   -6.555  -2.275  1.00 15.00 ?  929 PRO B HG2  11 
ATOM   8104  H HG3  . PRO B 2 5  ? 5.733   -8.322  -2.256  1.00 15.00 ?  929 PRO B HG3  11 
ATOM   8105  H HD2  . PRO B 2 5  ? 4.849   -6.330  -0.233  1.00 15.00 ?  929 PRO B HD2  11 
ATOM   8106  H HD3  . PRO B 2 5  ? 4.134   -7.894  -0.672  1.00 15.00 ?  929 PRO B HD3  11 
ATOM   8107  N N    . PRO B 2 6  ? 9.058   -6.771  1.659   1.00 15.00 ?  930 PRO B N    11 
ATOM   8108  C CA   . PRO B 2 6  ? 9.709   -5.688  2.409   1.00 15.00 ?  930 PRO B CA   11 
ATOM   8109  C C    . PRO B 2 6  ? 9.629   -4.365  1.657   1.00 15.00 ?  930 PRO B C    11 
ATOM   8110  O O    . PRO B 2 6  ? 9.903   -4.314  0.455   1.00 15.00 ?  930 PRO B O    11 
ATOM   8111  C CB   . PRO B 2 6  ? 11.169  -6.148  2.538   1.00 15.00 ?  930 PRO B CB   11 
ATOM   8112  C CG   . PRO B 2 6  ? 11.307  -7.322  1.625   1.00 15.00 ?  930 PRO B CG   11 
ATOM   8113  C CD   . PRO B 2 6  ? 9.940   -7.935  1.520   1.00 15.00 ?  930 PRO B CD   11 
ATOM   8114  H HA   . PRO B 2 6  ? 9.274   -5.570  3.392   1.00 15.00 ?  930 PRO B HA   11 
ATOM   8115  H HB2  . PRO B 2 6  ? 11.826  -5.342  2.243   1.00 15.00 ?  930 PRO B HB2  11 
ATOM   8116  H HB3  . PRO B 2 6  ? 11.370  -6.421  3.562   1.00 15.00 ?  930 PRO B HB3  11 
ATOM   8117  H HG2  . PRO B 2 6  ? 11.645  -6.994  0.652   1.00 15.00 ?  930 PRO B HG2  11 
ATOM   8118  H HG3  . PRO B 2 6  ? 12.003  -8.033  2.044   1.00 15.00 ?  930 PRO B HG3  11 
ATOM   8119  H HD2  . PRO B 2 6  ? 9.808   -8.410  0.559   1.00 15.00 ?  930 PRO B HD2  11 
ATOM   8120  H HD3  . PRO B 2 6  ? 9.778   -8.640  2.320   1.00 15.00 ?  930 PRO B HD3  11 
ATOM   8121  N N    . TYR B 2 7  ? 9.260   -3.300  2.366   1.00 15.00 ?  931 TYR B N    11 
ATOM   8122  C CA   . TYR B 2 7  ? 8.980   -2.027  1.720   1.00 15.00 ?  931 TYR B CA   11 
ATOM   8123  C C    . TYR B 2 7  ? 10.242  -1.464  1.067   1.00 15.00 ?  931 TYR B C    11 
ATOM   8124  O O    . TYR B 2 7  ? 11.242  -1.177  1.729   1.00 15.00 ?  931 TYR B O    11 
ATOM   8125  C CB   . TYR B 2 7  ? 8.410   -1.054  2.775   1.00 15.00 ?  931 TYR B CB   11 
ATOM   8126  C CG   . TYR B 2 7  ? 7.994   0.329   2.281   1.00 15.00 ?  931 TYR B CG   11 
ATOM   8127  C CD1  . TYR B 2 7  ? 7.770   0.601   0.936   1.00 15.00 ?  931 TYR B CD1  11 
ATOM   8128  C CD2  . TYR B 2 7  ? 7.820   1.372   3.189   1.00 15.00 ?  931 TYR B CD2  11 
ATOM   8129  C CE1  . TYR B 2 7  ? 7.391   1.863   0.514   1.00 15.00 ?  931 TYR B CE1  11 
ATOM   8130  C CE2  . TYR B 2 7  ? 7.442   2.631   2.774   1.00 15.00 ?  931 TYR B CE2  11 
ATOM   8131  C CZ   . TYR B 2 7  ? 7.228   2.873   1.437   1.00 15.00 ?  931 TYR B CZ   11 
ATOM   8132  O OH   . TYR B 2 7  ? 6.852   4.133   1.022   1.00 15.00 ?  931 TYR B OH   11 
ATOM   8133  H H    . TYR B 2 7  ? 9.178   -3.372  3.338   1.00 15.00 ?  931 TYR B H    11 
ATOM   8134  H HA   . TYR B 2 7  ? 8.235   -2.196  0.958   1.00 15.00 ?  931 TYR B HA   11 
ATOM   8135  H HB2  . TYR B 2 7  ? 7.537   -1.506  3.219   1.00 15.00 ?  931 TYR B HB2  11 
ATOM   8136  H HB3  . TYR B 2 7  ? 9.154   -0.914  3.546   1.00 15.00 ?  931 TYR B HB3  11 
ATOM   8137  H HD1  . TYR B 2 7  ? 7.895   -0.186  0.212   1.00 15.00 ?  931 TYR B HD1  11 
ATOM   8138  H HD2  . TYR B 2 7  ? 7.986   1.187   4.238   1.00 15.00 ?  931 TYR B HD2  11 
ATOM   8139  H HE1  . TYR B 2 7  ? 7.224   2.054   -0.535  1.00 15.00 ?  931 TYR B HE1  11 
ATOM   8140  H HE2  . TYR B 2 7  ? 7.315   3.421   3.502   1.00 15.00 ?  931 TYR B HE2  11 
ATOM   8141  H HH   . TYR B 2 7  ? 6.202   4.052   0.316   1.00 15.00 ?  931 TYR B HH   11 
ATOM   8142  N N    . GLU B 2 8  ? 10.150  -1.306  -0.241  1.00 15.00 ?  932 GLU B N    11 
ATOM   8143  C CA   . GLU B 2 8  ? 11.143  -0.617  -1.045  1.00 15.00 ?  932 GLU B CA   11 
ATOM   8144  C C    . GLU B 2 8  ? 10.527  0.684   -1.499  1.00 15.00 ?  932 GLU B C    11 
ATOM   8145  O O    . GLU B 2 8  ? 9.333   0.706   -1.805  1.00 15.00 ?  932 GLU B O    11 
ATOM   8146  C CB   . GLU B 2 8  ? 11.508  -1.467  -2.264  1.00 15.00 ?  932 GLU B CB   11 
ATOM   8147  C CG   . GLU B 2 8  ? 12.224  -2.764  -1.928  1.00 15.00 ?  932 GLU B CG   11 
ATOM   8148  C CD   . GLU B 2 8  ? 13.696  -2.560  -1.649  1.00 15.00 ?  932 GLU B CD   11 
ATOM   8149  O OE1  . GLU B 2 8  ? 14.463  -2.368  -2.620  1.00 15.00 ?  932 GLU B OE1  11 
ATOM   8150  O OE2  . GLU B 2 8  ? 14.103  -2.600  -0.470  1.00 15.00 -1 932 GLU B OE2  11 
ATOM   8151  H H    . GLU B 2 8  ? 9.364   -1.673  -0.696  1.00 15.00 ?  932 GLU B H    11 
ATOM   8152  H HA   . GLU B 2 8  ? 12.019  -0.426  -0.443  1.00 15.00 ?  932 GLU B HA   11 
ATOM   8153  H HB2  . GLU B 2 8  ? 10.602  -1.712  -2.799  1.00 15.00 ?  932 GLU B HB2  11 
ATOM   8154  H HB3  . GLU B 2 8  ? 12.149  -0.885  -2.910  1.00 15.00 ?  932 GLU B HB3  11 
ATOM   8155  H HG2  . GLU B 2 8  ? 11.765  -3.198  -1.051  1.00 15.00 ?  932 GLU B HG2  11 
ATOM   8156  H HG3  . GLU B 2 8  ? 12.120  -3.445  -2.760  1.00 15.00 ?  932 GLU B HG3  11 
ATOM   8157  N N    . THR B 2 9  ? 11.282  1.761   -1.576  1.00 15.00 ?  933 THR B N    11 
ATOM   8158  C CA   . THR B 2 9  ? 10.665  2.991   -2.012  1.00 15.00 ?  933 THR B CA   11 
ATOM   8159  C C    . THR B 2 9  ? 10.417  2.954   -3.510  1.00 15.00 ?  933 THR B C    11 
ATOM   8160  O O    . THR B 2 9  ? 11.334  2.801   -4.320  1.00 15.00 ?  933 THR B O    11 
ATOM   8161  C CB   . THR B 2 9  ? 11.476  4.249   -1.664  1.00 15.00 ?  933 THR B CB   11 
ATOM   8162  O OG1  . THR B 2 9  ? 12.058  4.113   -0.359  1.00 15.00 ?  933 THR B OG1  11 
ATOM   8163  C CG2  . THR B 2 9  ? 10.554  5.469   -1.694  1.00 15.00 ?  933 THR B CG2  11 
ATOM   8164  H H    . THR B 2 9  ? 12.242  1.728   -1.356  1.00 15.00 ?  933 THR B H    11 
ATOM   8165  H HA   . THR B 2 9  ? 9.709   3.063   -1.515  1.00 15.00 ?  933 THR B HA   11 
ATOM   8166  H HB   . THR B 2 9  ? 12.256  4.383   -2.397  1.00 15.00 ?  933 THR B HB   11 
ATOM   8167  H HG1  . THR B 2 9  ? 11.447  3.630   0.218   1.00 15.00 ?  933 THR B HG1  11 
ATOM   8168  H HG21 . THR B 2 9  ? 9.756   5.339   -0.973  1.00 15.00 ?  933 THR B HG21 11 
ATOM   8169  H HG22 . THR B 2 9  ? 10.121  5.572   -2.681  1.00 15.00 ?  933 THR B HG22 11 
ATOM   8170  H HG23 . THR B 2 9  ? 11.116  6.357   -1.451  1.00 15.00 ?  933 THR B HG23 11 
ATOM   8171  N N    . PHE B 2 10 ? 9.154   3.073   -3.845  1.00 15.00 ?  934 PHE B N    11 
ATOM   8172  C CA   . PHE B 2 10 ? 8.702   3.233   -5.208  1.00 15.00 ?  934 PHE B CA   11 
ATOM   8173  C C    . PHE B 2 10 ? 8.618   4.743   -5.473  1.00 15.00 ?  934 PHE B C    11 
ATOM   8174  O O    . PHE B 2 10 ? 8.991   5.528   -4.598  1.00 15.00 ?  934 PHE B O    11 
ATOM   8175  C CB   . PHE B 2 10 ? 7.347   2.521   -5.406  1.00 15.00 ?  934 PHE B CB   11 
ATOM   8176  C CG   . PHE B 2 10 ? 6.218   3.262   -4.776  1.00 15.00 ?  934 PHE B CG   11 
ATOM   8177  C CD1  . PHE B 2 10 ? 5.966   3.172   -3.412  1.00 15.00 ?  934 PHE B CD1  11 
ATOM   8178  C CD2  . PHE B 2 10 ? 5.455   4.114   -5.543  1.00 15.00 ?  934 PHE B CD2  11 
ATOM   8179  C CE1  . PHE B 2 10 ? 4.973   3.924   -2.845  1.00 15.00 ?  934 PHE B CE1  11 
ATOM   8180  C CE2  . PHE B 2 10 ? 4.473   4.880   -4.974  1.00 15.00 ?  934 PHE B CE2  11 
ATOM   8181  C CZ   . PHE B 2 10 ? 4.237   4.786   -3.627  1.00 15.00 ?  934 PHE B CZ   11 
ATOM   8182  H H    . PHE B 2 10 ? 8.482   3.056   -3.133  1.00 15.00 ?  934 PHE B H    11 
ATOM   8183  H HA   . PHE B 2 10 ? 9.442   2.797   -5.865  1.00 15.00 ?  934 PHE B HA   11 
ATOM   8184  H HB2  . PHE B 2 10 ? 7.140   2.429   -6.462  1.00 15.00 ?  934 PHE B HB2  11 
ATOM   8185  H HB3  . PHE B 2 10 ? 7.392   1.537   -4.963  1.00 15.00 ?  934 PHE B HB3  11 
ATOM   8186  H HD1  . PHE B 2 10 ? 6.527   2.479   -2.799  1.00 15.00 ?  934 PHE B HD1  11 
ATOM   8187  H HD2  . PHE B 2 10 ? 5.645   4.181   -6.601  1.00 15.00 ?  934 PHE B HD2  11 
ATOM   8188  H HE1  . PHE B 2 10 ? 4.782   3.856   -1.784  1.00 15.00 ?  934 PHE B HE1  11 
ATOM   8189  H HE2  . PHE B 2 10 ? 3.879   5.546   -5.583  1.00 15.00 ?  934 PHE B HE2  11 
ATOM   8190  H HZ   . PHE B 2 10 ? 3.486   5.395   -3.177  1.00 15.00 ?  934 PHE B HZ   11 
ATOM   8191  N N    . GLU B 2 11 ? 8.201   5.149   -6.669  1.00 15.00 ?  935 GLU B N    11 
ATOM   8192  C CA   . GLU B 2 11 ? 8.123   6.575   -7.023  1.00 15.00 ?  935 GLU B CA   11 
ATOM   8193  C C    . GLU B 2 11 ? 7.401   7.382   -5.929  1.00 15.00 ?  935 GLU B C    11 
ATOM   8194  O O    . GLU B 2 11 ? 6.533   6.869   -5.230  1.00 15.00 ?  935 GLU B O    11 
ATOM   8195  C CB   . GLU B 2 11 ? 7.346   6.731   -8.339  1.00 15.00 ?  935 GLU B CB   11 
ATOM   8196  C CG   . GLU B 2 11 ? 5.830   6.743   -8.153  1.00 15.00 ?  935 GLU B CG   11 
ATOM   8197  C CD   . GLU B 2 11 ? 5.065   6.602   -9.449  1.00 15.00 ?  935 GLU B CD   11 
ATOM   8198  O OE1  . GLU B 2 11 ? 4.938   5.464   -9.949  1.00 15.00 -1 935 GLU B OE1  11 
ATOM   8199  O OE2  . GLU B 2 11 ? 4.574   7.626   -9.968  1.00 15.00 ?  935 GLU B OE2  11 
ATOM   8200  H H    . GLU B 2 11 ? 7.946   4.478   -7.341  1.00 15.00 ?  935 GLU B H    11 
ATOM   8201  H HA   . GLU B 2 11 ? 9.123   6.955   -7.148  1.00 15.00 ?  935 GLU B HA   11 
ATOM   8202  H HB2  . GLU B 2 11 ? 7.640   7.658   -8.810  1.00 15.00 ?  935 GLU B HB2  11 
ATOM   8203  H HB3  . GLU B 2 11 ? 7.600   5.909   -8.993  1.00 15.00 ?  935 GLU B HB3  11 
ATOM   8204  H HG2  . GLU B 2 11 ? 5.548   5.937   -7.493  1.00 15.00 ?  935 GLU B HG2  11 
ATOM   8205  H HG3  . GLU B 2 11 ? 5.554   7.684   -7.696  1.00 15.00 ?  935 GLU B HG3  11 
ATOM   8206  N N    . ASP B 2 12 ? 7.762   8.646   -5.786  1.00 15.00 ?  936 ASP B N    11 
ATOM   8207  C CA   . ASP B 2 12 ? 7.133   9.496   -4.781  1.00 15.00 ?  936 ASP B CA   11 
ATOM   8208  C C    . ASP B 2 12 ? 5.655   9.705   -5.108  1.00 15.00 ?  936 ASP B C    11 
ATOM   8209  O O    . ASP B 2 12 ? 5.299   10.119  -6.212  1.00 15.00 ?  936 ASP B O    11 
ATOM   8210  C CB   . ASP B 2 12 ? 7.857   10.844  -4.675  1.00 15.00 ?  936 ASP B CB   11 
ATOM   8211  C CG   . ASP B 2 12 ? 7.870   11.614  -5.979  1.00 15.00 ?  936 ASP B CG   11 
ATOM   8212  O OD1  . ASP B 2 12 ? 8.740   11.333  -6.830  1.00 15.00 -1 936 ASP B OD1  11 
ATOM   8213  O OD2  . ASP B 2 12 ? 7.015   12.508  -6.157  1.00 15.00 ?  936 ASP B OD2  11 
ATOM   8214  H H    . ASP B 2 12 ? 8.453   9.021   -6.373  1.00 15.00 ?  936 ASP B H    11 
ATOM   8215  H HA   . ASP B 2 12 ? 7.206   8.985   -3.831  1.00 15.00 ?  936 ASP B HA   11 
ATOM   8216  H HB2  . ASP B 2 12 ? 7.367   11.451  -3.929  1.00 15.00 ?  936 ASP B HB2  11 
ATOM   8217  H HB3  . ASP B 2 12 ? 8.879   10.669  -4.371  1.00 15.00 ?  936 ASP B HB3  11 
ATOM   8218  N N    . LEU B 2 13 ? 4.800   9.396   -4.142  1.00 15.00 ?  937 LEU B N    11 
ATOM   8219  C CA   . LEU B 2 13 ? 3.359   9.531   -4.314  1.00 15.00 ?  937 LEU B CA   11 
ATOM   8220  C C    . LEU B 2 13 ? 2.954   11.001  -4.222  1.00 15.00 ?  937 LEU B C    11 
ATOM   8221  O O    . LEU B 2 13 ? 2.640   11.636  -5.228  1.00 15.00 ?  937 LEU B O    11 
ATOM   8222  C CB   . LEU B 2 13 ? 2.631   8.682   -3.255  1.00 15.00 ?  937 LEU B CB   11 
ATOM   8223  C CG   . LEU B 2 13 ? 1.135   8.409   -3.500  1.00 15.00 ?  937 LEU B CG   11 
ATOM   8224  C CD1  . LEU B 2 13 ? 0.280   9.614   -3.142  1.00 15.00 ?  937 LEU B CD1  11 
ATOM   8225  C CD2  . LEU B 2 13 ? 0.899   8.000   -4.946  1.00 15.00 ?  937 LEU B CD2  11 
ATOM   8226  H H    . LEU B 2 13 ? 5.146   9.057   -3.294  1.00 15.00 ?  937 LEU B H    11 
ATOM   8227  H HA   . LEU B 2 13 ? 3.105   9.160   -5.296  1.00 15.00 ?  937 LEU B HA   11 
ATOM   8228  H HB2  . LEU B 2 13 ? 3.135   7.730   -3.185  1.00 15.00 ?  937 LEU B HB2  11 
ATOM   8229  H HB3  . LEU B 2 13 ? 2.725   9.185   -2.303  1.00 15.00 ?  937 LEU B HB3  11 
ATOM   8230  H HG   . LEU B 2 13 ? 0.824   7.588   -2.871  1.00 15.00 ?  937 LEU B HG   11 
ATOM   8231  H HD11 . LEU B 2 13 ? 0.421   9.856   -2.098  1.00 15.00 ?  937 LEU B HD11 11 
ATOM   8232  H HD12 . LEU B 2 13 ? -0.759  9.385   -3.322  1.00 15.00 ?  937 LEU B HD12 11 
ATOM   8233  H HD13 . LEU B 2 13 ? 0.573   10.457  -3.750  1.00 15.00 ?  937 LEU B HD13 11 
ATOM   8234  H HD21 . LEU B 2 13 ? 1.455   7.100   -5.161  1.00 15.00 ?  937 LEU B HD21 11 
ATOM   8235  H HD22 . LEU B 2 13 ? 1.229   8.793   -5.602  1.00 15.00 ?  937 LEU B HD22 11 
ATOM   8236  H HD23 . LEU B 2 13 ? -0.153  7.819   -5.101  1.00 15.00 ?  937 LEU B HD23 11 
HETATM 8237  N N    . NH2 B 2 14 ? 2.961   11.538  -3.011  1.00 15.00 ?  938 NH2 B N    11 
HETATM 8238  H HN1  . NH2 B 2 14 ? 3.222   10.972  -2.257  1.00 15.00 ?  938 NH2 B HN1  11 
HETATM 8239  H HN2  . NH2 B 2 14 ? 2.703   12.479  -2.920  1.00 15.00 ?  938 NH2 B HN2  11 
ATOM   8240  N N    . PHE A 1 7  ? -12.322 7.725   -0.420  1.00 15.00 ?  478 PHE A N    12 
ATOM   8241  C CA   . PHE A 1 7  ? -11.098 7.141   -1.012  1.00 15.00 ?  478 PHE A CA   12 
ATOM   8242  C C    . PHE A 1 7  ? -10.139 6.712   0.099   1.00 15.00 ?  478 PHE A C    12 
ATOM   8243  O O    . PHE A 1 7  ? -10.575 6.478   1.225   1.00 15.00 ?  478 PHE A O    12 
ATOM   8244  C CB   . PHE A 1 7  ? -10.442 8.131   -1.999  1.00 15.00 ?  478 PHE A CB   12 
ATOM   8245  C CG   . PHE A 1 7  ? -9.937  9.416   -1.389  1.00 15.00 ?  478 PHE A CG   12 
ATOM   8246  C CD1  . PHE A 1 7  ? -10.818 10.395  -0.959  1.00 15.00 ?  478 PHE A CD1  12 
ATOM   8247  C CD2  . PHE A 1 7  ? -8.577  9.644   -1.259  1.00 15.00 ?  478 PHE A CD2  12 
ATOM   8248  C CE1  . PHE A 1 7  ? -10.352 11.574  -0.410  1.00 15.00 ?  478 PHE A CE1  12 
ATOM   8249  C CE2  . PHE A 1 7  ? -8.105  10.823  -0.712  1.00 15.00 ?  478 PHE A CE2  12 
ATOM   8250  C CZ   . PHE A 1 7  ? -8.993  11.789  -0.287  1.00 15.00 ?  478 PHE A CZ   12 
ATOM   8251  H H    . PHE A 1 7  ? -12.917 8.152   -1.164  1.00 15.00 ?  478 PHE A H    12 
ATOM   8252  H HA   . PHE A 1 7  ? -11.393 6.254   -1.556  1.00 15.00 ?  478 PHE A HA   12 
ATOM   8253  H HB2  . PHE A 1 7  ? -9.608  7.647   -2.480  1.00 15.00 ?  478 PHE A HB2  12 
ATOM   8254  H HB3  . PHE A 1 7  ? -11.171 8.393   -2.754  1.00 15.00 ?  478 PHE A HB3  12 
ATOM   8255  H HD1  . PHE A 1 7  ? -11.882 10.229  -1.051  1.00 15.00 ?  478 PHE A HD1  12 
ATOM   8256  H HD2  . PHE A 1 7  ? -7.880  8.889   -1.592  1.00 15.00 ?  478 PHE A HD2  12 
ATOM   8257  H HE1  . PHE A 1 7  ? -11.049 12.329  -0.078  1.00 15.00 ?  478 PHE A HE1  12 
ATOM   8258  H HE2  . PHE A 1 7  ? -7.041  10.986  -0.616  1.00 15.00 ?  478 PHE A HE2  12 
ATOM   8259  H HZ   . PHE A 1 7  ? -8.627  12.710  0.141   1.00 15.00 ?  478 PHE A HZ   12 
ATOM   8260  N N    . LEU A 1 8  ? -8.855  6.570   -0.211  1.00 15.00 ?  479 LEU A N    12 
ATOM   8261  C CA   . LEU A 1 8  ? -7.885  6.135   0.783   1.00 15.00 ?  479 LEU A CA   12 
ATOM   8262  C C    . LEU A 1 8  ? -7.478  7.294   1.692   1.00 15.00 ?  479 LEU A C    12 
ATOM   8263  O O    . LEU A 1 8  ? -7.293  8.419   1.231   1.00 15.00 ?  479 LEU A O    12 
ATOM   8264  C CB   . LEU A 1 8  ? -6.646  5.546   0.101   1.00 15.00 ?  479 LEU A CB   12 
ATOM   8265  C CG   . LEU A 1 8  ? -6.344  4.088   0.464   1.00 15.00 ?  479 LEU A CG   12 
ATOM   8266  C CD1  . LEU A 1 8  ? -7.366  3.154   -0.167  1.00 15.00 ?  479 LEU A CD1  12 
ATOM   8267  C CD2  . LEU A 1 8  ? -4.950  3.700   0.018   1.00 15.00 ?  479 LEU A CD2  12 
ATOM   8268  H H    . LEU A 1 8  ? -8.552  6.762   -1.120  1.00 15.00 ?  479 LEU A H    12 
ATOM   8269  H HA   . LEU A 1 8  ? -8.352  5.368   1.386   1.00 15.00 ?  479 LEU A HA   12 
ATOM   8270  H HB2  . LEU A 1 8  ? -6.785  5.608   -0.968  1.00 15.00 ?  479 LEU A HB2  12 
ATOM   8271  H HB3  . LEU A 1 8  ? -5.789  6.146   0.373   1.00 15.00 ?  479 LEU A HB3  12 
ATOM   8272  H HG   . LEU A 1 8  ? -6.395  3.975   1.543   1.00 15.00 ?  479 LEU A HG   12 
ATOM   8273  H HD11 . LEU A 1 8  ? -8.362  3.486   0.080   1.00 15.00 ?  479 LEU A HD11 12 
ATOM   8274  H HD12 . LEU A 1 8  ? -7.214  2.152   0.209   1.00 15.00 ?  479 LEU A HD12 12 
ATOM   8275  H HD13 . LEU A 1 8  ? -7.238  3.155   -1.242  1.00 15.00 ?  479 LEU A HD13 12 
ATOM   8276  H HD21 . LEU A 1 8  ? -4.228  4.355   0.482   1.00 15.00 ?  479 LEU A HD21 12 
ATOM   8277  H HD22 . LEU A 1 8  ? -4.879  3.787   -1.056  1.00 15.00 ?  479 LEU A HD22 12 
ATOM   8278  H HD23 . LEU A 1 8  ? -4.751  2.681   0.311   1.00 15.00 ?  479 LEU A HD23 12 
ATOM   8279  N N    . PRO A 1 9  ? -7.377  7.025   3.004   1.00 15.00 ?  480 PRO A N    12 
ATOM   8280  C CA   . PRO A 1 9  ? -6.852  7.979   4.000   1.00 15.00 ?  480 PRO A CA   12 
ATOM   8281  C C    . PRO A 1 9  ? -5.569  8.689   3.541   1.00 15.00 ?  480 PRO A C    12 
ATOM   8282  O O    . PRO A 1 9  ? -4.786  8.132   2.778   1.00 15.00 ?  480 PRO A O    12 
ATOM   8283  C CB   . PRO A 1 9  ? -6.560  7.062   5.180   1.00 15.00 ?  480 PRO A CB   12 
ATOM   8284  C CG   . PRO A 1 9  ? -7.626  6.033   5.106   1.00 15.00 ?  480 PRO A CG   12 
ATOM   8285  C CD   . PRO A 1 9  ? -7.805  5.759   3.638   1.00 15.00 ?  480 PRO A CD   12 
ATOM   8286  H HA   . PRO A 1 9  ? -7.594  8.712   4.283   1.00 15.00 ?  480 PRO A HA   12 
ATOM   8287  H HB2  . PRO A 1 9  ? -5.589  6.626   5.052   1.00 15.00 ?  480 PRO A HB2  12 
ATOM   8288  H HB3  . PRO A 1 9  ? -6.597  7.614   6.104   1.00 15.00 ?  480 PRO A HB3  12 
ATOM   8289  H HG2  . PRO A 1 9  ? -7.314  5.137   5.624   1.00 15.00 ?  480 PRO A HG2  12 
ATOM   8290  H HG3  . PRO A 1 9  ? -8.541  6.417   5.530   1.00 15.00 ?  480 PRO A HG3  12 
ATOM   8291  H HD2  . PRO A 1 9  ? -7.177  4.940   3.327   1.00 15.00 ?  480 PRO A HD2  12 
ATOM   8292  H HD3  . PRO A 1 9  ? -8.841  5.549   3.417   1.00 15.00 ?  480 PRO A HD3  12 
ATOM   8293  N N    . PRO A 1 10 ? -5.322  9.910   4.055   1.00 15.00 ?  481 PRO A N    12 
ATOM   8294  C CA   . PRO A 1 10 ? -4.225  10.789  3.600   1.00 15.00 ?  481 PRO A CA   12 
ATOM   8295  C C    . PRO A 1 10 ? -2.845  10.118  3.513   1.00 15.00 ?  481 PRO A C    12 
ATOM   8296  O O    . PRO A 1 10 ? -2.069  10.422  2.604   1.00 15.00 ?  481 PRO A O    12 
ATOM   8297  C CB   . PRO A 1 10 ? -4.205  11.900  4.649   1.00 15.00 ?  481 PRO A CB   12 
ATOM   8298  C CG   . PRO A 1 10 ? -5.602  11.957  5.158   1.00 15.00 ?  481 PRO A CG   12 
ATOM   8299  C CD   . PRO A 1 10 ? -6.109  10.542  5.132   1.00 15.00 ?  481 PRO A CD   12 
ATOM   8300  H HA   . PRO A 1 10 ? -4.457  11.222  2.640   1.00 15.00 ?  481 PRO A HA   12 
ATOM   8301  H HB2  . PRO A 1 10 ? -3.506  11.646  5.434   1.00 15.00 ?  481 PRO A HB2  12 
ATOM   8302  H HB3  . PRO A 1 10 ? -3.915  12.832  4.188   1.00 15.00 ?  481 PRO A HB3  12 
ATOM   8303  H HG2  . PRO A 1 10 ? -5.608  12.339  6.170   1.00 15.00 ?  481 PRO A HG2  12 
ATOM   8304  H HG3  . PRO A 1 10 ? -6.203  12.583  4.516   1.00 15.00 ?  481 PRO A HG3  12 
ATOM   8305  H HD2  . PRO A 1 10 ? -5.923  10.058  6.080   1.00 15.00 ?  481 PRO A HD2  12 
ATOM   8306  H HD3  . PRO A 1 10 ? -7.162  10.523  4.898   1.00 15.00 ?  481 PRO A HD3  12 
ATOM   8307  N N    . GLY A 1 11 ? -2.521  9.239   4.457   1.00 15.00 ?  482 GLY A N    12 
ATOM   8308  C CA   . GLY A 1 11 ? -1.218  8.590   4.431   1.00 15.00 ?  482 GLY A CA   12 
ATOM   8309  C C    . GLY A 1 11 ? -1.259  7.247   3.756   1.00 15.00 ?  482 GLY A C    12 
ATOM   8310  O O    . GLY A 1 11 ? -0.228  6.607   3.576   1.00 15.00 ?  482 GLY A O    12 
ATOM   8311  H H    . GLY A 1 11 ? -3.167  9.026   5.169   1.00 15.00 ?  482 GLY A H    12 
ATOM   8312  H HA2  . GLY A 1 11 ? -0.526  9.222   3.905   1.00 15.00 ?  482 GLY A HA2  12 
ATOM   8313  H HA3  . GLY A 1 11 ? -0.857  8.455   5.431   1.00 15.00 ?  482 GLY A HA3  12 
ATOM   8314  N N    . TRP A 1 12 ? -2.444  6.816   3.389   1.00 15.00 ?  483 TRP A N    12 
ATOM   8315  C CA   . TRP A 1 12 ? -2.609  5.535   2.740   1.00 15.00 ?  483 TRP A CA   12 
ATOM   8316  C C    . TRP A 1 12 ? -2.611  5.719   1.235   1.00 15.00 ?  483 TRP A C    12 
ATOM   8317  O O    . TRP A 1 12 ? -3.433  6.446   0.682   1.00 15.00 ?  483 TRP A O    12 
ATOM   8318  C CB   . TRP A 1 12 ? -3.889  4.847   3.218   1.00 15.00 ?  483 TRP A CB   12 
ATOM   8319  C CG   . TRP A 1 12 ? -3.788  4.346   4.625   1.00 15.00 ?  483 TRP A CG   12 
ATOM   8320  C CD1  . TRP A 1 12 ? -3.857  5.089   5.767   1.00 15.00 ?  483 TRP A CD1  12 
ATOM   8321  C CD2  . TRP A 1 12 ? -3.584  2.992   5.039   1.00 15.00 ?  483 TRP A CD2  12 
ATOM   8322  N NE1  . TRP A 1 12 ? -3.718  4.282   6.865   1.00 15.00 ?  483 TRP A NE1  12 
ATOM   8323  C CE2  . TRP A 1 12 ? -3.546  2.988   6.445   1.00 15.00 ?  483 TRP A CE2  12 
ATOM   8324  C CE3  . TRP A 1 12 ? -3.429  1.781   4.357   1.00 15.00 ?  483 TRP A CE3  12 
ATOM   8325  C CZ2  . TRP A 1 12 ? -3.361  1.822   7.182   1.00 15.00 ?  483 TRP A CZ2  12 
ATOM   8326  C CZ3  . TRP A 1 12 ? -3.244  0.625   5.089   1.00 15.00 ?  483 TRP A CZ3  12 
ATOM   8327  C CH2  . TRP A 1 12 ? -3.211  0.652   6.489   1.00 15.00 ?  483 TRP A CH2  12 
ATOM   8328  H H    . TRP A 1 12 ? -3.232  7.388   3.528   1.00 15.00 ?  483 TRP A H    12 
ATOM   8329  H HA   . TRP A 1 12 ? -1.761  4.922   3.009   1.00 15.00 ?  483 TRP A HA   12 
ATOM   8330  H HB2  . TRP A 1 12 ? -4.710  5.548   3.170   1.00 15.00 ?  483 TRP A HB2  12 
ATOM   8331  H HB3  . TRP A 1 12 ? -4.100  4.003   2.577   1.00 15.00 ?  483 TRP A HB3  12 
ATOM   8332  H HD1  . TRP A 1 12 ? -4.002  6.156   5.788   1.00 15.00 ?  483 TRP A HD1  12 
ATOM   8333  H HE1  . TRP A 1 12 ? -3.732  4.584   7.799   1.00 15.00 ?  483 TRP A HE1  12 
ATOM   8334  H HE3  . TRP A 1 12 ? -3.453  1.739   3.277   1.00 15.00 ?  483 TRP A HE3  12 
ATOM   8335  H HZ2  . TRP A 1 12 ? -3.335  1.826   8.262   1.00 15.00 ?  483 TRP A HZ2  12 
ATOM   8336  H HZ3  . TRP A 1 12 ? -3.122  -0.319  4.578   1.00 15.00 ?  483 TRP A HZ3  12 
ATOM   8337  H HH2  . TRP A 1 12 ? -3.062  -0.277  7.021   1.00 15.00 ?  483 TRP A HH2  12 
ATOM   8338  N N    . GLU A 1 13 ? -1.670  5.065   0.590   1.00 15.00 ?  484 GLU A N    12 
ATOM   8339  C CA   . GLU A 1 13 ? -1.505  5.169   -0.841  1.00 15.00 ?  484 GLU A CA   12 
ATOM   8340  C C    . GLU A 1 13 ? -1.808  3.821   -1.486  1.00 15.00 ?  484 GLU A C    12 
ATOM   8341  O O    . GLU A 1 13 ? -1.384  2.781   -0.993  1.00 15.00 ?  484 GLU A O    12 
ATOM   8342  C CB   . GLU A 1 13 ? -0.077  5.608   -1.144  1.00 15.00 ?  484 GLU A CB   12 
ATOM   8343  C CG   . GLU A 1 13 ? 0.023   6.794   -2.086  1.00 15.00 ?  484 GLU A CG   12 
ATOM   8344  C CD   . GLU A 1 13 ? -0.538  6.524   -3.468  1.00 15.00 ?  484 GLU A CD   12 
ATOM   8345  O OE1  . GLU A 1 13 ? -1.762  6.312   -3.588  1.00 15.00 ?  484 GLU A OE1  12 
ATOM   8346  O OE2  . GLU A 1 13 ? 0.245   6.543   -4.436  1.00 15.00 -1 484 GLU A OE2  12 
ATOM   8347  H H    . GLU A 1 13 ? -1.062  4.483   1.096   1.00 15.00 ?  484 GLU A H    12 
ATOM   8348  H HA   . GLU A 1 13 ? -2.197  5.909   -1.213  1.00 15.00 ?  484 GLU A HA   12 
ATOM   8349  H HB2  . GLU A 1 13 ? 0.404   5.879   -0.215  1.00 15.00 ?  484 GLU A HB2  12 
ATOM   8350  H HB3  . GLU A 1 13 ? 0.449   4.784   -1.576  1.00 15.00 ?  484 GLU A HB3  12 
ATOM   8351  H HG2  . GLU A 1 13 ? -0.516  7.620   -1.653  1.00 15.00 ?  484 GLU A HG2  12 
ATOM   8352  H HG3  . GLU A 1 13 ? 1.066   7.065   -2.186  1.00 15.00 ?  484 GLU A HG3  12 
ATOM   8353  N N    . MET A 1 14 ? -2.507  3.846   -2.596  1.00 15.00 ?  485 MET A N    12 
ATOM   8354  C CA   . MET A 1 14 ? -3.008  2.622   -3.211  1.00 15.00 ?  485 MET A CA   12 
ATOM   8355  C C    . MET A 1 14 ? -2.388  2.431   -4.590  1.00 15.00 ?  485 MET A C    12 
ATOM   8356  O O    . MET A 1 14 ? -2.770  3.090   -5.559  1.00 15.00 ?  485 MET A O    12 
ATOM   8357  C CB   . MET A 1 14 ? -4.539  2.670   -3.297  1.00 15.00 ?  485 MET A CB   12 
ATOM   8358  C CG   . MET A 1 14 ? -5.174  1.392   -3.818  1.00 15.00 ?  485 MET A CG   12 
ATOM   8359  S SD   . MET A 1 14 ? -6.978  1.425   -3.736  1.00 15.00 ?  485 MET A SD   12 
ATOM   8360  C CE   . MET A 1 14 ? -7.341  2.858   -4.748  1.00 15.00 ?  485 MET A CE   12 
ATOM   8361  H H    . MET A 1 14 ? -2.655  4.714   -3.038  1.00 15.00 ?  485 MET A H    12 
ATOM   8362  H HA   . MET A 1 14 ? -2.717  1.788   -2.579  1.00 15.00 ?  485 MET A HA   12 
ATOM   8363  H HB2  . MET A 1 14 ? -4.934  2.866   -2.312  1.00 15.00 ?  485 MET A HB2  12 
ATOM   8364  H HB3  . MET A 1 14 ? -4.824  3.480   -3.953  1.00 15.00 ?  485 MET A HB3  12 
ATOM   8365  H HG2  . MET A 1 14 ? -4.882  1.258   -4.843  1.00 15.00 ?  485 MET A HG2  12 
ATOM   8366  H HG3  . MET A 1 14 ? -4.816  0.561   -3.229  1.00 15.00 ?  485 MET A HG3  12 
ATOM   8367  H HE1  . MET A 1 14 ? -8.409  3.008   -4.791  1.00 15.00 ?  485 MET A HE1  12 
ATOM   8368  H HE2  . MET A 1 14 ? -6.960  2.699   -5.746  1.00 15.00 ?  485 MET A HE2  12 
ATOM   8369  H HE3  . MET A 1 14 ? -6.871  3.731   -4.317  1.00 15.00 ?  485 MET A HE3  12 
ATOM   8370  N N    . ARG A 1 15 ? -1.411  1.537   -4.662  1.00 15.00 ?  486 ARG A N    12 
ATOM   8371  C CA   . ARG A 1 15 ? -0.596  1.372   -5.862  1.00 15.00 ?  486 ARG A CA   12 
ATOM   8372  C C    . ARG A 1 15 ? -0.321  -0.101  -6.115  1.00 15.00 ?  486 ARG A C    12 
ATOM   8373  O O    . ARG A 1 15 ? -0.259  -0.892  -5.176  1.00 15.00 ?  486 ARG A O    12 
ATOM   8374  C CB   . ARG A 1 15 ? 0.724   2.123   -5.687  1.00 15.00 ?  486 ARG A CB   12 
ATOM   8375  C CG   . ARG A 1 15 ? 0.546   3.623   -5.529  1.00 15.00 ?  486 ARG A CG   12 
ATOM   8376  C CD   . ARG A 1 15 ? 0.220   4.293   -6.851  1.00 15.00 ?  486 ARG A CD   12 
ATOM   8377  N NE   . ARG A 1 15 ? 1.367   4.274   -7.758  1.00 15.00 ?  486 ARG A NE   12 
ATOM   8378  C CZ   . ARG A 1 15 ? 1.304   3.934   -9.040  1.00 15.00 ?  486 ARG A CZ   12 
ATOM   8379  N NH1  . ARG A 1 15 ? 0.143   3.583   -9.582  1.00 15.00 1  486 ARG A NH1  12 
ATOM   8380  N NH2  . ARG A 1 15 ? 2.405   3.948   -9.779  1.00 15.00 ?  486 ARG A NH2  12 
ATOM   8381  H H    . ARG A 1 15 ? -1.234  0.962   -3.885  1.00 15.00 ?  486 ARG A H    12 
ATOM   8382  H HA   . ARG A 1 15 ? -1.135  1.784   -6.701  1.00 15.00 ?  486 ARG A HA   12 
ATOM   8383  H HB2  . ARG A 1 15 ? 1.228   1.746   -4.810  1.00 15.00 ?  486 ARG A HB2  12 
ATOM   8384  H HB3  . ARG A 1 15 ? 1.345   1.946   -6.554  1.00 15.00 ?  486 ARG A HB3  12 
ATOM   8385  H HG2  . ARG A 1 15 ? -0.261  3.807   -4.835  1.00 15.00 ?  486 ARG A HG2  12 
ATOM   8386  H HG3  . ARG A 1 15 ? 1.461   4.044   -5.136  1.00 15.00 ?  486 ARG A HG3  12 
ATOM   8387  H HD2  . ARG A 1 15 ? -0.604  3.770   -7.313  1.00 15.00 ?  486 ARG A HD2  12 
ATOM   8388  H HD3  . ARG A 1 15 ? -0.063  5.318   -6.662  1.00 15.00 ?  486 ARG A HD3  12 
ATOM   8389  H HE   . ARG A 1 15 ? 2.237   4.537   -7.382  1.00 15.00 ?  486 ARG A HE   12 
ATOM   8390  H HH11 . ARG A 1 15 ? -0.688  3.576   -9.026  1.00 15.00 ?  486 ARG A HH11 12 
ATOM   8391  H HH12 . ARG A 1 15 ? 0.091   3.324   -10.556 1.00 15.00 ?  486 ARG A HH12 12 
ATOM   8392  H HH21 . ARG A 1 15 ? 3.292   4.222   -9.368  1.00 15.00 ?  486 ARG A HH21 12 
ATOM   8393  H HH22 . ARG A 1 15 ? 2.373   3.693   -10.750 1.00 15.00 ?  486 ARG A HH22 12 
ATOM   8394  N N    . ILE A 1 16 ? -0.155  -0.479  -7.374  1.00 15.00 ?  487 ILE A N    12 
ATOM   8395  C CA   . ILE A 1 16 ? 0.134   -1.864  -7.695  1.00 15.00 ?  487 ILE A CA   12 
ATOM   8396  C C    . ILE A 1 16 ? 1.632   -2.088  -7.883  1.00 15.00 ?  487 ILE A C    12 
ATOM   8397  O O    . ILE A 1 16 ? 2.373   -1.183  -8.271  1.00 15.00 ?  487 ILE A O    12 
ATOM   8398  C CB   . ILE A 1 16 ? -0.627  -2.393  -8.946  1.00 15.00 ?  487 ILE A CB   12 
ATOM   8399  C CG1  . ILE A 1 16 ? 0.092   -2.039  -10.259 1.00 15.00 ?  487 ILE A CG1  12 
ATOM   8400  C CG2  . ILE A 1 16 ? -2.056  -1.865  -8.961  1.00 15.00 ?  487 ILE A CG2  12 
ATOM   8401  C CD1  . ILE A 1 16 ? -0.178  -0.645  -10.773 1.00 15.00 ?  487 ILE A CD1  12 
ATOM   8402  H H    . ILE A 1 16 ? -0.215  0.182   -8.092  1.00 15.00 ?  487 ILE A H    12 
ATOM   8403  H HA   . ILE A 1 16 ? -0.184  -2.456  -6.847  1.00 15.00 ?  487 ILE A HA   12 
ATOM   8404  H HB   . ILE A 1 16 ? -0.682  -3.470  -8.862  1.00 15.00 ?  487 ILE A HB   12 
ATOM   8405  H HG12 . ILE A 1 16 ? 1.156   -2.130  -10.108 1.00 15.00 ?  487 ILE A HG12 12 
ATOM   8406  H HG13 . ILE A 1 16 ? -0.215  -2.739  -11.022 1.00 15.00 ?  487 ILE A HG13 12 
ATOM   8407  H HG21 . ILE A 1 16 ? -2.583  -2.277  -9.807  1.00 15.00 ?  487 ILE A HG21 12 
ATOM   8408  H HG22 . ILE A 1 16 ? -2.040  -0.787  -9.037  1.00 15.00 ?  487 ILE A HG22 12 
ATOM   8409  H HG23 . ILE A 1 16 ? -2.554  -2.153  -8.051  1.00 15.00 ?  487 ILE A HG23 12 
ATOM   8410  H HD11 . ILE A 1 16 ? -1.235  -0.539  -10.969 1.00 15.00 ?  487 ILE A HD11 12 
ATOM   8411  H HD12 . ILE A 1 16 ? 0.374   -0.491  -11.688 1.00 15.00 ?  487 ILE A HD12 12 
ATOM   8412  H HD13 . ILE A 1 16 ? 0.128   0.080   -10.036 1.00 15.00 ?  487 ILE A HD13 12 
ATOM   8413  N N    . ALA A 1 17 ? 2.057   -3.297  -7.572  1.00 15.00 ?  488 ALA A N    12 
ATOM   8414  C CA   . ALA A 1 17 ? 3.407   -3.751  -7.849  1.00 15.00 ?  488 ALA A CA   12 
ATOM   8415  C C    . ALA A 1 17 ? 3.400   -4.370  -9.237  1.00 15.00 ?  488 ALA A C    12 
ATOM   8416  O O    . ALA A 1 17 ? 2.356   -4.851  -9.654  1.00 15.00 ?  488 ALA A O    12 
ATOM   8417  C CB   . ALA A 1 17 ? 3.861   -4.765  -6.799  1.00 15.00 ?  488 ALA A CB   12 
ATOM   8418  H H    . ALA A 1 17 ? 1.428   -3.916  -7.136  1.00 15.00 ?  488 ALA A H    12 
ATOM   8419  H HA   . ALA A 1 17 ? 4.071   -2.898  -7.831  1.00 15.00 ?  488 ALA A HA   12 
ATOM   8420  H HB1  . ALA A 1 17 ? 3.821   -4.315  -5.820  1.00 15.00 ?  488 ALA A HB1  12 
ATOM   8421  H HB2  . ALA A 1 17 ? 4.872   -5.076  -7.010  1.00 15.00 ?  488 ALA A HB2  12 
ATOM   8422  H HB3  . ALA A 1 17 ? 3.208   -5.627  -6.824  1.00 15.00 ?  488 ALA A HB3  12 
ATOM   8423  N N    . PRO A 1 18 ? 4.532   -4.320  -9.978  1.00 15.00 ?  489 PRO A N    12 
ATOM   8424  C CA   . PRO A 1 18 ? 4.618   -4.695  -11.421 1.00 15.00 ?  489 PRO A CA   12 
ATOM   8425  C C    . PRO A 1 18 ? 3.956   -6.029  -11.833 1.00 15.00 ?  489 PRO A C    12 
ATOM   8426  O O    . PRO A 1 18 ? 3.952   -6.378  -13.013 1.00 15.00 ?  489 PRO A O    12 
ATOM   8427  C CB   . PRO A 1 18 ? 6.124   -4.768  -11.663 1.00 15.00 ?  489 PRO A CB   12 
ATOM   8428  C CG   . PRO A 1 18 ? 6.700   -3.790  -10.703 1.00 15.00 ?  489 PRO A CG   12 
ATOM   8429  C CD   . PRO A 1 18 ? 5.845   -3.875  -9.467  1.00 15.00 ?  489 PRO A CD   12 
ATOM   8430  H HA   . PRO A 1 18 ? 4.210   -3.909  -12.039 1.00 15.00 ?  489 PRO A HA   12 
ATOM   8431  H HB2  . PRO A 1 18 ? 6.474   -5.772  -11.468 1.00 15.00 ?  489 PRO A HB2  12 
ATOM   8432  H HB3  . PRO A 1 18 ? 6.342   -4.495  -12.685 1.00 15.00 ?  489 PRO A HB3  12 
ATOM   8433  H HG2  . PRO A 1 18 ? 7.721   -4.059  -10.472 1.00 15.00 ?  489 PRO A HG2  12 
ATOM   8434  H HG3  . PRO A 1 18 ? 6.658   -2.796  -11.120 1.00 15.00 ?  489 PRO A HG3  12 
ATOM   8435  H HD2  . PRO A 1 18 ? 6.253   -4.598  -8.777  1.00 15.00 ?  489 PRO A HD2  12 
ATOM   8436  H HD3  . PRO A 1 18 ? 5.765   -2.906  -8.997  1.00 15.00 ?  489 PRO A HD3  12 
ATOM   8437  N N    . ASN A 1 19 ? 3.422   -6.778  -10.881 1.00 15.00 ?  490 ASN A N    12 
ATOM   8438  C CA   . ASN A 1 19 ? 2.642   -7.975  -11.192 1.00 15.00 ?  490 ASN A CA   12 
ATOM   8439  C C    . ASN A 1 19 ? 1.177   -7.598  -11.408 1.00 15.00 ?  490 ASN A C    12 
ATOM   8440  O O    . ASN A 1 19 ? 0.346   -8.436  -11.756 1.00 15.00 ?  490 ASN A O    12 
ATOM   8441  C CB   . ASN A 1 19 ? 2.730   -9.001  -10.054 1.00 15.00 ?  490 ASN A CB   12 
ATOM   8442  C CG   . ASN A 1 19 ? 4.135   -9.520  -9.807  1.00 15.00 ?  490 ASN A CG   12 
ATOM   8443  O OD1  . ASN A 1 19 ? 5.124   -8.811  -9.996  1.00 15.00 ?  490 ASN A OD1  12 
ATOM   8444  N ND2  . ASN A 1 19 ? 4.228   -10.768 -9.376  1.00 15.00 ?  490 ASN A ND2  12 
ATOM   8445  H H    . ASN A 1 19 ? 3.545   -6.516  -9.947  1.00 15.00 ?  490 ASN A H    12 
ATOM   8446  H HA   . ASN A 1 19 ? 3.035   -8.409  -12.100 1.00 15.00 ?  490 ASN A HA   12 
ATOM   8447  H HB2  . ASN A 1 19 ? 2.378   -8.542  -9.144  1.00 15.00 ?  490 ASN A HB2  12 
ATOM   8448  H HB3  . ASN A 1 19 ? 2.095   -9.843  -10.293 1.00 15.00 ?  490 ASN A HB3  12 
ATOM   8449  H HD21 . ASN A 1 19 ? 3.400   -11.277 -9.246  1.00 15.00 ?  490 ASN A HD21 12 
ATOM   8450  H HD22 . ASN A 1 19 ? 5.124   -11.137 -9.207  1.00 15.00 ?  490 ASN A HD22 12 
ATOM   8451  N N    . GLY A 1 20 ? 0.876   -6.323  -11.195 1.00 15.00 ?  491 GLY A N    12 
ATOM   8452  C CA   . GLY A 1 20 ? -0.491  -5.842  -11.223 1.00 15.00 ?  491 GLY A CA   12 
ATOM   8453  C C    . GLY A 1 20 ? -1.209  -6.129  -9.918  1.00 15.00 ?  491 GLY A C    12 
ATOM   8454  O O    . GLY A 1 20 ? -2.434  -6.211  -9.873  1.00 15.00 ?  491 GLY A O    12 
ATOM   8455  H H    . GLY A 1 20 ? 1.606   -5.685  -11.021 1.00 15.00 ?  491 GLY A H    12 
ATOM   8456  H HA2  . GLY A 1 20 ? -0.480  -4.773  -11.388 1.00 15.00 ?  491 GLY A HA2  12 
ATOM   8457  H HA3  . GLY A 1 20 ? -1.023  -6.310  -12.030 1.00 15.00 ?  491 GLY A HA3  12 
ATOM   8458  N N    . ARG A 1 21 ? -0.433  -6.287  -8.853  1.00 15.00 ?  492 ARG A N    12 
ATOM   8459  C CA   . ARG A 1 21 ? -0.986  -6.533  -7.525  1.00 15.00 ?  492 ARG A CA   12 
ATOM   8460  C C    . ARG A 1 21 ? -1.090  -5.229  -6.746  1.00 15.00 ?  492 ARG A C    12 
ATOM   8461  O O    . ARG A 1 21 ? -0.084  -4.561  -6.524  1.00 15.00 ?  492 ARG A O    12 
ATOM   8462  C CB   . ARG A 1 21 ? -0.129  -7.541  -6.744  1.00 15.00 ?  492 ARG A CB   12 
ATOM   8463  C CG   . ARG A 1 21 ? 1.374   -7.307  -6.837  1.00 15.00 ?  492 ARG A CG   12 
ATOM   8464  C CD   . ARG A 1 21 ? 2.150   -8.467  -6.227  1.00 15.00 ?  492 ARG A CD   12 
ATOM   8465  N NE   . ARG A 1 21 ? 3.599   -8.247  -6.239  1.00 15.00 ?  492 ARG A NE   12 
ATOM   8466  C CZ   . ARG A 1 21 ? 4.490   -9.125  -5.768  1.00 15.00 ?  492 ARG A CZ   12 
ATOM   8467  N NH1  . ARG A 1 21 ? 4.093   -10.298 -5.297  1.00 15.00 1  492 ARG A NH1  12 
ATOM   8468  N NH2  . ARG A 1 21 ? 5.783   -8.836  -5.791  1.00 15.00 ?  492 ARG A NH2  12 
ATOM   8469  H H    . ARG A 1 21 ? 0.536   -6.217  -8.961  1.00 15.00 ?  492 ARG A H    12 
ATOM   8470  H HA   . ARG A 1 21 ? -1.978  -6.941  -7.654  1.00 15.00 ?  492 ARG A HA   12 
ATOM   8471  H HB2  . ARG A 1 21 ? -0.410  -7.478  -5.707  1.00 15.00 ?  492 ARG A HB2  12 
ATOM   8472  H HB3  . ARG A 1 21 ? -0.336  -8.534  -7.091  1.00 15.00 ?  492 ARG A HB3  12 
ATOM   8473  H HG2  . ARG A 1 21 ? 1.652   -7.207  -7.875  1.00 15.00 ?  492 ARG A HG2  12 
ATOM   8474  H HG3  . ARG A 1 21 ? 1.623   -6.399  -6.305  1.00 15.00 ?  492 ARG A HG3  12 
ATOM   8475  H HD2  . ARG A 1 21 ? 1.828   -8.599  -5.206  1.00 15.00 ?  492 ARG A HD2  12 
ATOM   8476  H HD3  . ARG A 1 21 ? 1.928   -9.363  -6.789  1.00 15.00 ?  492 ARG A HD3  12 
ATOM   8477  H HE   . ARG A 1 21 ? 3.923   -7.398  -6.609  1.00 15.00 ?  492 ARG A HE   12 
ATOM   8478  H HH11 . ARG A 1 21 ? 3.116   -10.544 -5.296  1.00 15.00 ?  492 ARG A HH11 12 
ATOM   8479  H HH12 . ARG A 1 21 ? 4.771   -10.954 -4.935  1.00 15.00 ?  492 ARG A HH12 12 
ATOM   8480  H HH21 . ARG A 1 21 ? 6.103   -7.958  -6.163  1.00 15.00 ?  492 ARG A HH21 12 
ATOM   8481  H HH22 . ARG A 1 21 ? 6.457   -9.499  -5.440  1.00 15.00 ?  492 ARG A HH22 12 
ATOM   8482  N N    . PRO A 1 22 ? -2.297  -4.864  -6.297  1.00 15.00 ?  493 PRO A N    12 
ATOM   8483  C CA   . PRO A 1 22 ? -2.535  -3.594  -5.621  1.00 15.00 ?  493 PRO A CA   12 
ATOM   8484  C C    . PRO A 1 22 ? -2.345  -3.690  -4.110  1.00 15.00 ?  493 PRO A C    12 
ATOM   8485  O O    . PRO A 1 22 ? -2.931  -4.550  -3.452  1.00 15.00 ?  493 PRO A O    12 
ATOM   8486  C CB   . PRO A 1 22 ? -4.001  -3.315  -5.949  1.00 15.00 ?  493 PRO A CB   12 
ATOM   8487  C CG   . PRO A 1 22 ? -4.636  -4.664  -6.097  1.00 15.00 ?  493 PRO A CG   12 
ATOM   8488  C CD   . PRO A 1 22 ? -3.536  -5.649  -6.428  1.00 15.00 ?  493 PRO A CD   12 
ATOM   8489  H HA   . PRO A 1 22 ? -1.915  -2.805  -6.018  1.00 15.00 ?  493 PRO A HA   12 
ATOM   8490  H HB2  . PRO A 1 22 ? -4.450  -2.757  -5.139  1.00 15.00 ?  493 PRO A HB2  12 
ATOM   8491  H HB3  . PRO A 1 22 ? -4.071  -2.747  -6.862  1.00 15.00 ?  493 PRO A HB3  12 
ATOM   8492  H HG2  . PRO A 1 22 ? -5.114  -4.943  -5.170  1.00 15.00 ?  493 PRO A HG2  12 
ATOM   8493  H HG3  . PRO A 1 22 ? -5.364  -4.636  -6.895  1.00 15.00 ?  493 PRO A HG3  12 
ATOM   8494  H HD2  . PRO A 1 22 ? -3.545  -6.470  -5.728  1.00 15.00 ?  493 PRO A HD2  12 
ATOM   8495  H HD3  . PRO A 1 22 ? -3.655  -6.014  -7.439  1.00 15.00 ?  493 PRO A HD3  12 
ATOM   8496  N N    . PHE A 1 23 ? -1.524  -2.807  -3.566  1.00 15.00 ?  494 PHE A N    12 
ATOM   8497  C CA   . PHE A 1 23 ? -1.272  -2.802  -2.139  1.00 15.00 ?  494 PHE A CA   12 
ATOM   8498  C C    . PHE A 1 23 ? -1.478  -1.412  -1.539  1.00 15.00 ?  494 PHE A C    12 
ATOM   8499  O O    . PHE A 1 23 ? -1.301  -0.393  -2.212  1.00 15.00 ?  494 PHE A O    12 
ATOM   8500  C CB   . PHE A 1 23 ? 0.131   -3.355  -1.821  1.00 15.00 ?  494 PHE A CB   12 
ATOM   8501  C CG   . PHE A 1 23 ? 1.307   -2.695  -2.519  1.00 15.00 ?  494 PHE A CG   12 
ATOM   8502  C CD1  . PHE A 1 23 ? 1.397   -1.316  -2.681  1.00 15.00 ?  494 PHE A CD1  12 
ATOM   8503  C CD2  . PHE A 1 23 ? 2.348   -3.480  -2.991  1.00 15.00 ?  494 PHE A CD2  12 
ATOM   8504  C CE1  . PHE A 1 23 ? 2.496   -0.740  -3.303  1.00 15.00 ?  494 PHE A CE1  12 
ATOM   8505  C CE2  . PHE A 1 23 ? 3.445   -2.912  -3.611  1.00 15.00 ?  494 PHE A CE2  12 
ATOM   8506  C CZ   . PHE A 1 23 ? 3.519   -1.543  -3.768  1.00 15.00 ?  494 PHE A CZ   12 
ATOM   8507  H H    . PHE A 1 23 ? -1.080  -2.140  -4.137  1.00 15.00 ?  494 PHE A H    12 
ATOM   8508  H HA   . PHE A 1 23 ? -2.001  -3.462  -1.691  1.00 15.00 ?  494 PHE A HA   12 
ATOM   8509  H HB2  . PHE A 1 23 ? 0.295   -3.279  -0.763  1.00 15.00 ?  494 PHE A HB2  12 
ATOM   8510  H HB3  . PHE A 1 23 ? 0.146   -4.403  -2.090  1.00 15.00 ?  494 PHE A HB3  12 
ATOM   8511  H HD1  . PHE A 1 23 ? 0.597   -0.689  -2.318  1.00 15.00 ?  494 PHE A HD1  12 
ATOM   8512  H HD2  . PHE A 1 23 ? 2.298   -4.553  -2.869  1.00 15.00 ?  494 PHE A HD2  12 
ATOM   8513  H HE1  . PHE A 1 23 ? 2.558   0.342   -3.420  1.00 15.00 ?  494 PHE A HE1  12 
ATOM   8514  H HE2  . PHE A 1 23 ? 4.247   -3.542  -3.969  1.00 15.00 ?  494 PHE A HE2  12 
ATOM   8515  H HZ   . PHE A 1 23 ? 4.375   -1.100  -4.253  1.00 15.00 ?  494 PHE A HZ   12 
ATOM   8516  N N    . PHE A 1 24 ? -1.878  -1.387  -0.278  1.00 15.00 ?  495 PHE A N    12 
ATOM   8517  C CA   . PHE A 1 24 ? -2.090  -0.143  0.441   1.00 15.00 ?  495 PHE A CA   12 
ATOM   8518  C C    . PHE A 1 24 ? -0.871  0.180   1.297   1.00 15.00 ?  495 PHE A C    12 
ATOM   8519  O O    . PHE A 1 24 ? -0.620  -0.468  2.313   1.00 15.00 ?  495 PHE A O    12 
ATOM   8520  C CB   . PHE A 1 24 ? -3.330  -0.239  1.337   1.00 15.00 ?  495 PHE A CB   12 
ATOM   8521  C CG   . PHE A 1 24 ? -4.533  -0.826  0.655   1.00 15.00 ?  495 PHE A CG   12 
ATOM   8522  C CD1  . PHE A 1 24 ? -5.251  -0.093  -0.276  1.00 15.00 ?  495 PHE A CD1  12 
ATOM   8523  C CD2  . PHE A 1 24 ? -4.950  -2.113  0.953   1.00 15.00 ?  495 PHE A CD2  12 
ATOM   8524  C CE1  . PHE A 1 24 ? -6.361  -0.633  -0.896  1.00 15.00 ?  495 PHE A CE1  12 
ATOM   8525  C CE2  . PHE A 1 24 ? -6.059  -2.658  0.335   1.00 15.00 ?  495 PHE A CE2  12 
ATOM   8526  C CZ   . PHE A 1 24 ? -6.766  -1.917  -0.590  1.00 15.00 ?  495 PHE A CZ   12 
ATOM   8527  H H    . PHE A 1 24 ? -2.034  -2.234  0.186   1.00 15.00 ?  495 PHE A H    12 
ATOM   8528  H HA   . PHE A 1 24 ? -2.235  0.645   -0.282  1.00 15.00 ?  495 PHE A HA   12 
ATOM   8529  H HB2  . PHE A 1 24 ? -3.099  -0.859  2.191   1.00 15.00 ?  495 PHE A HB2  12 
ATOM   8530  H HB3  . PHE A 1 24 ? -3.590  0.751   1.679   1.00 15.00 ?  495 PHE A HB3  12 
ATOM   8531  H HD1  . PHE A 1 24 ? -4.936  0.910   -0.516  1.00 15.00 ?  495 PHE A HD1  12 
ATOM   8532  H HD2  . PHE A 1 24 ? -4.397  -2.695  1.677   1.00 15.00 ?  495 PHE A HD2  12 
ATOM   8533  H HE1  . PHE A 1 24 ? -6.912  -0.051  -1.620  1.00 15.00 ?  495 PHE A HE1  12 
ATOM   8534  H HE2  . PHE A 1 24 ? -6.374  -3.661  0.578   1.00 15.00 ?  495 PHE A HE2  12 
ATOM   8535  H HZ   . PHE A 1 24 ? -7.633  -2.341  -1.076  1.00 15.00 ?  495 PHE A HZ   12 
ATOM   8536  N N    . ILE A 1 25 ? -0.097  1.157   0.863   1.00 15.00 ?  496 ILE A N    12 
ATOM   8537  C CA   . ILE A 1 25 ? 1.061   1.604   1.613   1.00 15.00 ?  496 ILE A CA   12 
ATOM   8538  C C    . ILE A 1 25 ? 0.679   2.747   2.522   1.00 15.00 ?  496 ILE A C    12 
ATOM   8539  O O    . ILE A 1 25 ? 0.372   3.839   2.047   1.00 15.00 ?  496 ILE A O    12 
ATOM   8540  C CB   . ILE A 1 25 ? 2.206   2.092   0.698   1.00 15.00 ?  496 ILE A CB   12 
ATOM   8541  C CG1  . ILE A 1 25 ? 2.622   0.994   -0.276  1.00 15.00 ?  496 ILE A CG1  12 
ATOM   8542  C CG2  . ILE A 1 25 ? 3.398   2.542   1.536   1.00 15.00 ?  496 ILE A CG2  12 
ATOM   8543  C CD1  . ILE A 1 25 ? 3.809   1.360   -1.135  1.00 15.00 ?  496 ILE A CD1  12 
ATOM   8544  H H    . ILE A 1 25 ? -0.324  1.606   0.017   1.00 15.00 ?  496 ILE A H    12 
ATOM   8545  H HA   . ILE A 1 25 ? 1.422   0.783   2.210   1.00 15.00 ?  496 ILE A HA   12 
ATOM   8546  H HB   . ILE A 1 25 ? 1.848   2.946   0.137   1.00 15.00 ?  496 ILE A HB   12 
ATOM   8547  H HG12 . ILE A 1 25 ? 2.880   0.107   0.283   1.00 15.00 ?  496 ILE A HG12 12 
ATOM   8548  H HG13 . ILE A 1 25 ? 1.793   0.770   -0.931  1.00 15.00 ?  496 ILE A HG13 12 
ATOM   8549  H HG21 . ILE A 1 25 ? 3.749   1.714   2.134   1.00 15.00 ?  496 ILE A HG21 12 
ATOM   8550  H HG22 . ILE A 1 25 ? 3.099   3.353   2.183   1.00 15.00 ?  496 ILE A HG22 12 
ATOM   8551  H HG23 . ILE A 1 25 ? 4.191   2.874   0.883   1.00 15.00 ?  496 ILE A HG23 12 
ATOM   8552  H HD11 . ILE A 1 25 ? 4.048   0.536   -1.791  1.00 15.00 ?  496 ILE A HD11 12 
ATOM   8553  H HD12 . ILE A 1 25 ? 4.659   1.576   -0.503  1.00 15.00 ?  496 ILE A HD12 12 
ATOM   8554  H HD13 . ILE A 1 25 ? 3.570   2.233   -1.726  1.00 15.00 ?  496 ILE A HD13 12 
ATOM   8555  N N    . ASP A 1 26 ? 0.698   2.522   3.819   1.00 15.00 ?  497 ASP A N    12 
ATOM   8556  C CA   . ASP A 1 26 ? 0.486   3.615   4.732   1.00 15.00 ?  497 ASP A CA   12 
ATOM   8557  C C    . ASP A 1 26 ? 1.817   4.239   5.060   1.00 15.00 ?  497 ASP A C    12 
ATOM   8558  O O    . ASP A 1 26 ? 2.774   3.578   5.464   1.00 15.00 ?  497 ASP A O    12 
ATOM   8559  C CB   . ASP A 1 26 ? -0.241  3.206   6.000   1.00 15.00 ?  497 ASP A CB   12 
ATOM   8560  C CG   . ASP A 1 26 ? 0.666   3.112   7.203   1.00 15.00 ?  497 ASP A CG   12 
ATOM   8561  O OD1  . ASP A 1 26 ? 1.262   2.037   7.423   1.00 15.00 -1 497 ASP A OD1  12 
ATOM   8562  O OD2  . ASP A 1 26 ? 0.793   4.129   7.927   1.00 15.00 ?  497 ASP A OD2  12 
ATOM   8563  H H    . ASP A 1 26 ? 0.872   1.616   4.166   1.00 15.00 ?  497 ASP A H    12 
ATOM   8564  H HA   . ASP A 1 26 ? -0.113  4.353   4.213   1.00 15.00 ?  497 ASP A HA   12 
ATOM   8565  H HB2  . ASP A 1 26 ? -0.986  3.959   6.205   1.00 15.00 ?  497 ASP A HB2  12 
ATOM   8566  H HB3  . ASP A 1 26 ? -0.723  2.252   5.848   1.00 15.00 ?  497 ASP A HB3  12 
ATOM   8567  N N    . HIS A 1 27 ? 1.880   5.504   4.801   1.00 15.00 ?  498 HIS A N    12 
ATOM   8568  C CA   . HIS A 1 27 ? 3.103   6.251   4.959   1.00 15.00 ?  498 HIS A CA   12 
ATOM   8569  C C    . HIS A 1 27 ? 3.353   6.647   6.410   1.00 15.00 ?  498 HIS A C    12 
ATOM   8570  O O    . HIS A 1 27 ? 4.461   7.049   6.763   1.00 15.00 ?  498 HIS A O    12 
ATOM   8571  C CB   . HIS A 1 27 ? 3.096   7.459   4.017   1.00 15.00 ?  498 HIS A CB   12 
ATOM   8572  C CG   . HIS A 1 27 ? 3.126   7.045   2.573   1.00 15.00 ?  498 HIS A CG   12 
ATOM   8573  N ND1  . HIS A 1 27 ? 4.292   6.968   1.843   1.00 15.00 ?  498 HIS A ND1  12 
ATOM   8574  C CD2  . HIS A 1 27 ? 2.137   6.621   1.740   1.00 15.00 ?  498 HIS A CD2  12 
ATOM   8575  C CE1  . HIS A 1 27 ? 4.029   6.509   0.634   1.00 15.00 ?  498 HIS A CE1  12 
ATOM   8576  N NE2  . HIS A 1 27 ? 2.728   6.295   0.542   1.00 15.00 ?  498 HIS A NE2  12 
ATOM   8577  H H    . HIS A 1 27 ? 1.053   5.964   4.519   1.00 15.00 ?  498 HIS A H    12 
ATOM   8578  H HA   . HIS A 1 27 ? 3.907   5.597   4.654   1.00 15.00 ?  498 HIS A HA   12 
ATOM   8579  H HB2  . HIS A 1 27 ? 2.201   8.039   4.184   1.00 15.00 ?  498 HIS A HB2  12 
ATOM   8580  H HB3  . HIS A 1 27 ? 3.965   8.070   4.211   1.00 15.00 ?  498 HIS A HB3  12 
ATOM   8581  H HD1  . HIS A 1 27 ? 5.190   7.246   2.160   1.00 15.00 ?  498 HIS A HD1  12 
ATOM   8582  H HD2  . HIS A 1 27 ? 1.077   6.540   1.980   1.00 15.00 ?  498 HIS A HD2  12 
ATOM   8583  H HE1  . HIS A 1 27 ? 4.761   6.298   -0.134  1.00 15.00 ?  498 HIS A HE1  12 
ATOM   8584  H HE2  . HIS A 1 27 ? 2.247   6.118   -0.295  1.00 15.00 ?  498 HIS A HE2  12 
ATOM   8585  N N    . ASN A 1 28 ? 2.326   6.544   7.254   1.00 15.00 ?  499 ASN A N    12 
ATOM   8586  C CA   . ASN A 1 28 ? 2.424   7.095   8.602   1.00 15.00 ?  499 ASN A CA   12 
ATOM   8587  C C    . ASN A 1 28 ? 3.182   6.172   9.557   1.00 15.00 ?  499 ASN A C    12 
ATOM   8588  O O    . ASN A 1 28 ? 4.107   6.619   10.236  1.00 15.00 ?  499 ASN A O    12 
ATOM   8589  C CB   . ASN A 1 28 ? 1.018   7.362   9.142   1.00 15.00 ?  499 ASN A CB   12 
ATOM   8590  C CG   . ASN A 1 28 ? 0.248   8.350   8.286   1.00 15.00 ?  499 ASN A CG   12 
ATOM   8591  O OD1  . ASN A 1 28 ? 0.795   9.353   7.824   1.00 15.00 ?  499 ASN A OD1  12 
ATOM   8592  N ND2  . ASN A 1 28 ? -1.016  8.051   8.028   1.00 15.00 ?  499 ASN A ND2  12 
ATOM   8593  H H    . ASN A 1 28 ? 1.511   6.071   6.977   1.00 15.00 ?  499 ASN A H    12 
ATOM   8594  H HA   . ASN A 1 28 ? 2.952   8.032   8.536   1.00 15.00 ?  499 ASN A HA   12 
ATOM   8595  H HB2  . ASN A 1 28 ? 0.467   6.433   9.170   1.00 15.00 ?  499 ASN A HB2  12 
ATOM   8596  H HB3  . ASN A 1 28 ? 1.093   7.761   10.142  1.00 15.00 ?  499 ASN A HB3  12 
ATOM   8597  H HD21 . ASN A 1 28 ? -1.380  7.219   8.395   1.00 15.00 ?  499 ASN A HD21 12 
ATOM   8598  H HD22 . ASN A 1 28 ? -1.540  8.671   7.480   1.00 15.00 ?  499 ASN A HD22 12 
ATOM   8599  N N    . THR A 1 29 ? 2.802   4.895   9.631   1.00 15.00 ?  500 THR A N    12 
ATOM   8600  C CA   . THR A 1 29 ? 3.643   3.899   10.291  1.00 15.00 ?  500 THR A CA   12 
ATOM   8601  C C    . THR A 1 29 ? 4.748   3.419   9.352   1.00 15.00 ?  500 THR A C    12 
ATOM   8602  O O    . THR A 1 29 ? 5.769   2.884   9.797   1.00 15.00 ?  500 THR A O    12 
ATOM   8603  C CB   . THR A 1 29 ? 2.849   2.721   10.942  1.00 15.00 ?  500 THR A CB   12 
ATOM   8604  O OG1  . THR A 1 29 ? 3.577   1.486   10.866  1.00 15.00 ?  500 THR A OG1  12 
ATOM   8605  C CG2  . THR A 1 29 ? 1.475   2.541   10.337  1.00 15.00 ?  500 THR A CG2  12 
ATOM   8606  H H    . THR A 1 29 ? 1.948   4.614   9.219   1.00 15.00 ?  500 THR A H    12 
ATOM   8607  H HA   . THR A 1 29 ? 4.135   4.426   11.101  1.00 15.00 ?  500 THR A HA   12 
ATOM   8608  H HB   . THR A 1 29 ? 2.718   2.961   11.987  1.00 15.00 ?  500 THR A HB   12 
ATOM   8609  H HG1  . THR A 1 29 ? 3.450   1.087   9.993   1.00 15.00 ?  500 THR A HG1  12 
ATOM   8610  H HG21 . THR A 1 29 ? 0.973   1.719   10.825  1.00 15.00 ?  500 THR A HG21 12 
ATOM   8611  H HG22 . THR A 1 29 ? 1.572   2.328   9.282   1.00 15.00 ?  500 THR A HG22 12 
ATOM   8612  H HG23 . THR A 1 29 ? 0.902   3.445   10.472  1.00 15.00 ?  500 THR A HG23 12 
ATOM   8613  N N    . LYS A 1 30 ? 4.519   3.624   8.045   1.00 15.00 ?  501 LYS A N    12 
ATOM   8614  C CA   . LYS A 1 30 ? 5.447   3.209   6.987   1.00 15.00 ?  501 LYS A CA   12 
ATOM   8615  C C    . LYS A 1 30 ? 5.354   1.696   6.774   1.00 15.00 ?  501 LYS A C    12 
ATOM   8616  O O    . LYS A 1 30 ? 6.355   0.978   6.780   1.00 15.00 ?  501 LYS A O    12 
ATOM   8617  C CB   . LYS A 1 30 ? 6.889   3.645   7.293   1.00 15.00 ?  501 LYS A CB   12 
ATOM   8618  C CG   . LYS A 1 30 ? 7.836   3.500   6.111   1.00 15.00 ?  501 LYS A CG   12 
ATOM   8619  C CD   . LYS A 1 30 ? 9.254   3.896   6.484   1.00 15.00 ?  501 LYS A CD   12 
ATOM   8620  C CE   . LYS A 1 30 ? 10.207  3.716   5.315   1.00 15.00 ?  501 LYS A CE   12 
ATOM   8621  N NZ   . LYS A 1 30 ? 11.608  4.039   5.690   1.00 15.00 1  501 LYS A NZ   12 
ATOM   8622  H H    . LYS A 1 30 ? 3.680   4.059   7.784   1.00 15.00 ?  501 LYS A H    12 
ATOM   8623  H HA   . LYS A 1 30 ? 5.126   3.694   6.076   1.00 15.00 ?  501 LYS A HA   12 
ATOM   8624  H HB2  . LYS A 1 30 ? 6.882   4.684   7.595   1.00 15.00 ?  501 LYS A HB2  12 
ATOM   8625  H HB3  . LYS A 1 30 ? 7.270   3.047   8.107   1.00 15.00 ?  501 LYS A HB3  12 
ATOM   8626  H HG2  . LYS A 1 30 ? 7.836   2.471   5.785   1.00 15.00 ?  501 LYS A HG2  12 
ATOM   8627  H HG3  . LYS A 1 30 ? 7.493   4.136   5.307   1.00 15.00 ?  501 LYS A HG3  12 
ATOM   8628  H HD2  . LYS A 1 30 ? 9.262   4.934   6.785   1.00 15.00 ?  501 LYS A HD2  12 
ATOM   8629  H HD3  . LYS A 1 30 ? 9.585   3.278   7.306   1.00 15.00 ?  501 LYS A HD3  12 
ATOM   8630  H HE2  . LYS A 1 30 ? 10.160  2.688   4.986   1.00 15.00 ?  501 LYS A HE2  12 
ATOM   8631  H HE3  . LYS A 1 30 ? 9.897   4.367   4.511   1.00 15.00 ?  501 LYS A HE3  12 
ATOM   8632  H HZ1  . LYS A 1 30 ? 11.932  3.405   6.451   1.00 15.00 ?  501 LYS A HZ1  12 
ATOM   8633  H HZ2  . LYS A 1 30 ? 11.673  5.028   6.024   1.00 15.00 ?  501 LYS A HZ2  12 
ATOM   8634  H HZ3  . LYS A 1 30 ? 12.235  3.924   4.864   1.00 15.00 ?  501 LYS A HZ3  12 
ATOM   8635  N N    . THR A 1 31 ? 4.132   1.216   6.611   1.00 15.00 ?  502 THR A N    12 
ATOM   8636  C CA   . THR A 1 31 ? 3.875   -0.206  6.449   1.00 15.00 ?  502 THR A CA   12 
ATOM   8637  C C    . THR A 1 31 ? 2.966   -0.451  5.239   1.00 15.00 ?  502 THR A C    12 
ATOM   8638  O O    . THR A 1 31 ? 2.111   0.371   4.921   1.00 15.00 ?  502 THR A O    12 
ATOM   8639  C CB   . THR A 1 31 ? 3.223   -0.779  7.725   1.00 15.00 ?  502 THR A CB   12 
ATOM   8640  O OG1  . THR A 1 31 ? 3.996   -0.392  8.871   1.00 15.00 ?  502 THR A OG1  12 
ATOM   8641  C CG2  . THR A 1 31 ? 3.129   -2.298  7.669   1.00 15.00 ?  502 THR A CG2  12 
ATOM   8642  H H    . THR A 1 31 ? 3.371   1.845   6.577   1.00 15.00 ?  502 THR A H    12 
ATOM   8643  H HA   . THR A 1 31 ? 4.820   -0.704  6.292   1.00 15.00 ?  502 THR A HA   12 
ATOM   8644  H HB   . THR A 1 31 ? 2.224   -0.372  7.817   1.00 15.00 ?  502 THR A HB   12 
ATOM   8645  H HG1  . THR A 1 31 ? 4.803   0.043   8.575   1.00 15.00 ?  502 THR A HG1  12 
ATOM   8646  H HG21 . THR A 1 31 ? 2.662   -2.663  8.571   1.00 15.00 ?  502 THR A HG21 12 
ATOM   8647  H HG22 . THR A 1 31 ? 4.121   -2.716  7.582   1.00 15.00 ?  502 THR A HG22 12 
ATOM   8648  H HG23 . THR A 1 31 ? 2.539   -2.592  6.813   1.00 15.00 ?  502 THR A HG23 12 
ATOM   8649  N N    . THR A 1 32 ? 3.165   -1.568  4.550   1.00 15.00 ?  503 THR A N    12 
ATOM   8650  C CA   . THR A 1 32 ? 2.365   -1.886  3.378   1.00 15.00 ?  503 THR A CA   12 
ATOM   8651  C C    . THR A 1 32 ? 1.455   -3.082  3.659   1.00 15.00 ?  503 THR A C    12 
ATOM   8652  O O    . THR A 1 32 ? 1.902   -4.102  4.180   1.00 15.00 ?  503 THR A O    12 
ATOM   8653  C CB   . THR A 1 32 ? 3.272   -2.191  2.174   1.00 15.00 ?  503 THR A CB   12 
ATOM   8654  O OG1  . THR A 1 32 ? 4.359   -1.256  2.148   1.00 15.00 ?  503 THR A OG1  12 
ATOM   8655  C CG2  . THR A 1 32 ? 2.496   -2.092  0.873   1.00 15.00 ?  503 THR A CG2  12 
ATOM   8656  H H    . THR A 1 32 ? 3.856   -2.199  4.841   1.00 15.00 ?  503 THR A H    12 
ATOM   8657  H HA   . THR A 1 32 ? 1.757   -1.025  3.140   1.00 15.00 ?  503 THR A HA   12 
ATOM   8658  H HB   . THR A 1 32 ? 3.663   -3.194  2.272   1.00 15.00 ?  503 THR A HB   12 
ATOM   8659  H HG1  . THR A 1 32 ? 4.222   -0.592  2.830   1.00 15.00 ?  503 THR A HG1  12 
ATOM   8660  H HG21 . THR A 1 32 ? 3.155   -2.311  0.044   1.00 15.00 ?  503 THR A HG21 12 
ATOM   8661  H HG22 . THR A 1 32 ? 2.103   -1.092  0.764   1.00 15.00 ?  503 THR A HG22 12 
ATOM   8662  H HG23 . THR A 1 32 ? 1.683   -2.801  0.885   1.00 15.00 ?  503 THR A HG23 12 
ATOM   8663  N N    . THR A 1 33 ? 0.178   -2.948  3.322   1.00 15.00 ?  504 THR A N    12 
ATOM   8664  C CA   . THR A 1 33 ? -0.808  -3.978  3.619   1.00 15.00 ?  504 THR A CA   12 
ATOM   8665  C C    . THR A 1 33 ? -1.560  -4.415  2.359   1.00 15.00 ?  504 THR A C    12 
ATOM   8666  O O    . THR A 1 33 ? -1.720  -3.634  1.421   1.00 15.00 ?  504 THR A O    12 
ATOM   8667  C CB   . THR A 1 33 ? -1.826  -3.474  4.662   1.00 15.00 ?  504 THR A CB   12 
ATOM   8668  O OG1  . THR A 1 33 ? -2.405  -2.242  4.221   1.00 15.00 ?  504 THR A OG1  12 
ATOM   8669  C CG2  . THR A 1 33 ? -1.167  -3.269  6.018   1.00 15.00 ?  504 THR A CG2  12 
ATOM   8670  H H    . THR A 1 33 ? -0.113  -2.130  2.857   1.00 15.00 ?  504 THR A H    12 
ATOM   8671  H HA   . THR A 1 33 ? -0.290  -4.830  4.033   1.00 15.00 ?  504 THR A HA   12 
ATOM   8672  H HB   . THR A 1 33 ? -2.608  -4.214  4.766   1.00 15.00 ?  504 THR A HB   12 
ATOM   8673  H HG1  . THR A 1 33 ? -1.719  -1.571  4.145   1.00 15.00 ?  504 THR A HG1  12 
ATOM   8674  H HG21 . THR A 1 33 ? -0.762  -4.206  6.368   1.00 15.00 ?  504 THR A HG21 12 
ATOM   8675  H HG22 . THR A 1 33 ? -1.902  -2.908  6.722   1.00 15.00 ?  504 THR A HG22 12 
ATOM   8676  H HG23 . THR A 1 33 ? -0.372  -2.544  5.923   1.00 15.00 ?  504 THR A HG23 12 
ATOM   8677  N N    . TRP A 1 34 ? -1.992  -5.674  2.339   1.00 15.00 ?  505 TRP A N    12 
ATOM   8678  C CA   . TRP A 1 34 ? -2.823  -6.183  1.249   1.00 15.00 ?  505 TRP A CA   12 
ATOM   8679  C C    . TRP A 1 34 ? -4.302  -5.988  1.561   1.00 15.00 ?  505 TRP A C    12 
ATOM   8680  O O    . TRP A 1 34 ? -5.128  -5.838  0.663   1.00 15.00 ?  505 TRP A O    12 
ATOM   8681  C CB   . TRP A 1 34 ? -2.597  -7.679  1.027   1.00 15.00 ?  505 TRP A CB   12 
ATOM   8682  C CG   . TRP A 1 34 ? -1.282  -8.062  0.420   1.00 15.00 ?  505 TRP A CG   12 
ATOM   8683  C CD1  . TRP A 1 34 ? -0.252  -8.695  1.045   1.00 15.00 ?  505 TRP A CD1  12 
ATOM   8684  C CD2  . TRP A 1 34 ? -0.876  -7.878  -0.941  1.00 15.00 ?  505 TRP A CD2  12 
ATOM   8685  N NE1  . TRP A 1 34 ? 0.766   -8.934  0.156   1.00 15.00 ?  505 TRP A NE1  12 
ATOM   8686  C CE2  . TRP A 1 34 ? 0.409   -8.436  -1.072  1.00 15.00 ?  505 TRP A CE2  12 
ATOM   8687  C CE3  . TRP A 1 34 ? -1.476  -7.298  -2.061  1.00 15.00 ?  505 TRP A CE3  12 
ATOM   8688  C CZ2  . TRP A 1 34 ? 1.100   -8.436  -2.282  1.00 15.00 ?  505 TRP A CZ2  12 
ATOM   8689  C CZ3  . TRP A 1 34 ? -0.791  -7.297  -3.258  1.00 15.00 ?  505 TRP A CZ3  12 
ATOM   8690  C CH2  . TRP A 1 34 ? 0.485   -7.865  -3.363  1.00 15.00 ?  505 TRP A CH2  12 
ATOM   8691  H H    . TRP A 1 34 ? -1.745  -6.275  3.068   1.00 15.00 ?  505 TRP A H    12 
ATOM   8692  H HA   . TRP A 1 34 ? -2.574  -5.644  0.348   1.00 15.00 ?  505 TRP A HA   12 
ATOM   8693  H HB2  . TRP A 1 34 ? -2.672  -8.181  1.978   1.00 15.00 ?  505 TRP A HB2  12 
ATOM   8694  H HB3  . TRP A 1 34 ? -3.379  -8.050  0.377   1.00 15.00 ?  505 TRP A HB3  12 
ATOM   8695  H HD1  . TRP A 1 34 ? -0.252  -8.973  2.089   1.00 15.00 ?  505 TRP A HD1  12 
ATOM   8696  H HE1  . TRP A 1 34 ? 1.612   -9.385  0.370   1.00 15.00 ?  505 TRP A HE1  12 
ATOM   8697  H HE3  . TRP A 1 34 ? -2.453  -6.846  -1.998  1.00 15.00 ?  505 TRP A HE3  12 
ATOM   8698  H HZ2  . TRP A 1 34 ? 2.085   -8.871  -2.379  1.00 15.00 ?  505 TRP A HZ2  12 
ATOM   8699  H HZ3  . TRP A 1 34 ? -1.243  -6.856  -4.133  1.00 15.00 ?  505 TRP A HZ3  12 
ATOM   8700  H HH2  . TRP A 1 34 ? 0.980   -7.849  -4.329  1.00 15.00 ?  505 TRP A HH2  12 
ATOM   8701  N N    . GLU A 1 35 ? -4.626  -6.037  2.845   1.00 15.00 ?  506 GLU A N    12 
ATOM   8702  C CA   . GLU A 1 35 ? -6.011  -6.060  3.295   1.00 15.00 ?  506 GLU A CA   12 
ATOM   8703  C C    . GLU A 1 35 ? -6.553  -4.681  3.530   1.00 15.00 ?  506 GLU A C    12 
ATOM   8704  O O    . GLU A 1 35 ? -5.894  -3.821  4.109   1.00 15.00 ?  506 GLU A O    12 
ATOM   8705  C CB   . GLU A 1 35 ? -6.142  -6.910  4.561   1.00 15.00 ?  506 GLU A CB   12 
ATOM   8706  C CG   . GLU A 1 35 ? -6.624  -8.331  4.302   1.00 15.00 ?  506 GLU A CG   12 
ATOM   8707  C CD   . GLU A 1 35 ? -5.891  -9.013  3.166   1.00 15.00 ?  506 GLU A CD   12 
ATOM   8708  O OE1  . GLU A 1 35 ? -4.774  -9.524  3.386   1.00 15.00 ?  506 GLU A OE1  12 
ATOM   8709  O OE2  . GLU A 1 35 ? -6.445  -9.059  2.049   1.00 15.00 -1 506 GLU A OE2  12 
ATOM   8710  H H    . GLU A 1 35 ? -3.912  -6.049  3.512   1.00 15.00 ?  506 GLU A H    12 
ATOM   8711  H HA   . GLU A 1 35 ? -6.605  -6.496  2.516   1.00 15.00 ?  506 GLU A HA   12 
ATOM   8712  H HB2  . GLU A 1 35 ? -5.178  -6.964  5.045   1.00 15.00 ?  506 GLU A HB2  12 
ATOM   8713  H HB3  . GLU A 1 35 ? -6.843  -6.431  5.229   1.00 15.00 ?  506 GLU A HB3  12 
ATOM   8714  H HG2  . GLU A 1 35 ? -6.479  -8.913  5.200   1.00 15.00 ?  506 GLU A HG2  12 
ATOM   8715  H HG3  . GLU A 1 35 ? -7.677  -8.300  4.064   1.00 15.00 ?  506 GLU A HG3  12 
ATOM   8716  N N    . ASP A 1 36 ? -7.783  -4.507  3.083   1.00 15.00 ?  507 ASP A N    12 
ATOM   8717  C CA   . ASP A 1 36 ? -8.464  -3.244  3.198   1.00 15.00 ?  507 ASP A CA   12 
ATOM   8718  C C    . ASP A 1 36 ? -8.770  -2.940  4.659   1.00 15.00 ?  507 ASP A C    12 
ATOM   8719  O O    . ASP A 1 36 ? -9.526  -3.669  5.306   1.00 15.00 ?  507 ASP A O    12 
ATOM   8720  C CB   . ASP A 1 36 ? -9.756  -3.253  2.375   1.00 15.00 ?  507 ASP A CB   12 
ATOM   8721  C CG   . ASP A 1 36 ? -10.492 -1.924  2.403   1.00 15.00 ?  507 ASP A CG   12 
ATOM   8722  O OD1  . ASP A 1 36 ? -11.261 -1.677  3.354   1.00 15.00 ?  507 ASP A OD1  12 
ATOM   8723  O OD2  . ASP A 1 36 ? -10.330 -1.132  1.449   1.00 15.00 -1 507 ASP A OD2  12 
ATOM   8724  H H    . ASP A 1 36 ? -8.246  -5.259  2.660   1.00 15.00 ?  507 ASP A H    12 
ATOM   8725  H HA   . ASP A 1 36 ? -7.798  -2.501  2.812   1.00 15.00 ?  507 ASP A HA   12 
ATOM   8726  H HB2  . ASP A 1 36 ? -9.516  -3.486  1.348   1.00 15.00 ?  507 ASP A HB2  12 
ATOM   8727  H HB3  . ASP A 1 36 ? -10.415 -4.015  2.766   1.00 15.00 ?  507 ASP A HB3  12 
ATOM   8728  N N    . PRO A 1 37 ? -8.170  -1.874  5.200   1.00 15.00 ?  508 PRO A N    12 
ATOM   8729  C CA   . PRO A 1 37 ? -8.362  -1.481  6.590   1.00 15.00 ?  508 PRO A CA   12 
ATOM   8730  C C    . PRO A 1 37 ? -9.745  -0.886  6.819   1.00 15.00 ?  508 PRO A C    12 
ATOM   8731  O O    . PRO A 1 37 ? -10.655 -1.582  7.271   1.00 15.00 ?  508 PRO A O    12 
ATOM   8732  C CB   . PRO A 1 37 ? -7.274  -0.422  6.834   1.00 15.00 ?  508 PRO A CB   12 
ATOM   8733  C CG   . PRO A 1 37 ? -6.408  -0.439  5.616   1.00 15.00 ?  508 PRO A CG   12 
ATOM   8734  C CD   . PRO A 1 37 ? -7.257  -0.968  4.501   1.00 15.00 ?  508 PRO A CD   12 
ATOM   8735  H HA   . PRO A 1 37 ? -8.214  -2.316  7.261   1.00 15.00 ?  508 PRO A HA   12 
ATOM   8736  H HB2  . PRO A 1 37 ? -7.738  0.544   6.971   1.00 15.00 ?  508 PRO A HB2  12 
ATOM   8737  H HB3  . PRO A 1 37 ? -6.711  -0.682  7.719   1.00 15.00 ?  508 PRO A HB3  12 
ATOM   8738  H HG2  . PRO A 1 37 ? -6.074  0.561   5.389   1.00 15.00 ?  508 PRO A HG2  12 
ATOM   8739  H HG3  . PRO A 1 37 ? -5.560  -1.089  5.780   1.00 15.00 ?  508 PRO A HG3  12 
ATOM   8740  H HD2  . PRO A 1 37 ? -7.797  -0.165  4.022   1.00 15.00 ?  508 PRO A HD2  12 
ATOM   8741  H HD3  . PRO A 1 37 ? -6.652  -1.503  3.783   1.00 15.00 ?  508 PRO A HD3  12 
ATOM   8742  N N    . ARG A 1 38 ? -9.895  0.386   6.441   1.00 15.00 ?  509 ARG A N    12 
ATOM   8743  C CA   . ARG A 1 38 ? -11.141 1.127   6.630   1.00 15.00 ?  509 ARG A CA   12 
ATOM   8744  C C    . ARG A 1 38 ? -11.578 1.106   8.095   1.00 15.00 ?  509 ARG A C    12 
ATOM   8745  O O    . ARG A 1 38 ? -11.159 2.004   8.851   1.00 15.00 ?  509 ARG A O    12 
ATOM   8746  C CB   . ARG A 1 38 ? -12.237 0.564   5.717   1.00 15.00 ?  509 ARG A CB   12 
ATOM   8747  C CG   . ARG A 1 38 ? -13.601 1.202   5.916   1.00 15.00 ?  509 ARG A CG   12 
ATOM   8748  C CD   . ARG A 1 38 ? -14.620 0.629   4.947   1.00 15.00 ?  509 ARG A CD   12 
ATOM   8749  N NE   . ARG A 1 38 ? -14.577 -0.832  4.916   1.00 15.00 ?  509 ARG A NE   12 
ATOM   8750  C CZ   . ARG A 1 38 ? -15.428 -1.591  4.232   1.00 15.00 ?  509 ARG A CZ   12 
ATOM   8751  N NH1  . ARG A 1 38 ? -16.458 -1.044  3.592   1.00 15.00 1  509 ARG A NH1  12 
ATOM   8752  N NH2  . ARG A 1 38 ? -15.254 -2.906  4.209   1.00 15.00 ?  509 ARG A NH2  12 
ATOM   8753  H H    . ARG A 1 38 ? -9.143  0.834   6.009   1.00 15.00 ?  509 ARG A H    12 
ATOM   8754  H HA   . ARG A 1 38 ? -10.952 2.153   6.348   1.00 15.00 ?  509 ARG A HA   12 
ATOM   8755  H HB2  . ARG A 1 38 ? -11.943 0.716   4.689   1.00 15.00 ?  509 ARG A HB2  12 
ATOM   8756  H HB3  . ARG A 1 38 ? -12.331 -0.497  5.900   1.00 15.00 ?  509 ARG A HB3  12 
ATOM   8757  H HG2  . ARG A 1 38 ? -13.933 1.014   6.926   1.00 15.00 ?  509 ARG A HG2  12 
ATOM   8758  H HG3  . ARG A 1 38 ? -13.520 2.266   5.752   1.00 15.00 ?  509 ARG A HG3  12 
ATOM   8759  H HD2  . ARG A 1 38 ? -15.606 0.944   5.253   1.00 15.00 ?  509 ARG A HD2  12 
ATOM   8760  H HD3  . ARG A 1 38 ? -14.410 1.008   3.958   1.00 15.00 ?  509 ARG A HD3  12 
ATOM   8761  H HE   . ARG A 1 38 ? -13.847 -1.272  5.415   1.00 15.00 ?  509 ARG A HE   12 
ATOM   8762  H HH11 . ARG A 1 38 ? -16.605 -0.047  3.627   1.00 15.00 ?  509 ARG A HH11 12 
ATOM   8763  H HH12 . ARG A 1 38 ? -17.087 -1.618  3.055   1.00 15.00 ?  509 ARG A HH12 12 
ATOM   8764  H HH21 . ARG A 1 38 ? -14.481 -3.320  4.707   1.00 15.00 ?  509 ARG A HH21 12 
ATOM   8765  H HH22 . ARG A 1 38 ? -15.894 -3.496  3.695   1.00 15.00 ?  509 ARG A HH22 12 
ATOM   8766  N N    . ARG B 2 1  ? -4.484  -11.743 1.917   1.00 15.00 ?  925 ARG B N    12 
ATOM   8767  C CA   . ARG B 2 1  ? -3.245  -12.170 1.235   1.00 15.00 ?  925 ARG B CA   12 
ATOM   8768  C C    . ARG B 2 1  ? -2.107  -12.273 2.247   1.00 15.00 ?  925 ARG B C    12 
ATOM   8769  O O    . ARG B 2 1  ? -2.020  -11.469 3.175   1.00 15.00 ?  925 ARG B O    12 
ATOM   8770  C CB   . ARG B 2 1  ? -2.897  -11.168 0.125   1.00 15.00 ?  925 ARG B CB   12 
ATOM   8771  C CG   . ARG B 2 1  ? -2.174  -11.781 -1.067  1.00 15.00 ?  925 ARG B CG   12 
ATOM   8772  C CD   . ARG B 2 1  ? -0.715  -12.080 -0.768  1.00 15.00 ?  925 ARG B CD   12 
ATOM   8773  N NE   . ARG B 2 1  ? -0.095  -12.873 -1.827  1.00 15.00 ?  925 ARG B NE   12 
ATOM   8774  C CZ   . ARG B 2 1  ? 1.211   -13.132 -1.902  1.00 15.00 ?  925 ARG B CZ   12 
ATOM   8775  N NH1  . ARG B 2 1  ? 2.051   -12.617 -1.006  1.00 15.00 1  925 ARG B NH1  12 
ATOM   8776  N NH2  . ARG B 2 1  ? 1.676   -13.906 -2.875  1.00 15.00 ?  925 ARG B NH2  12 
ATOM   8777  H H1   . ARG B 2 1  ? -5.251  -11.629 1.222   1.00 15.00 ?  925 ARG B H1   12 
ATOM   8778  H H2   . ARG B 2 1  ? -4.334  -10.830 2.405   1.00 15.00 ?  925 ARG B H2   12 
ATOM   8779  H H3   . ARG B 2 1  ? -4.771  -12.455 2.621   1.00 15.00 ?  925 ARG B H3   12 
ATOM   8780  H HA   . ARG B 2 1  ? -3.415  -13.144 0.799   1.00 15.00 ?  925 ARG B HA   12 
ATOM   8781  H HB2  . ARG B 2 1  ? -3.812  -10.719 -0.234  1.00 15.00 ?  925 ARG B HB2  12 
ATOM   8782  H HB3  . ARG B 2 1  ? -2.268  -10.396 0.540   1.00 15.00 ?  925 ARG B HB3  12 
ATOM   8783  H HG2  . ARG B 2 1  ? -2.668  -12.701 -1.338  1.00 15.00 ?  925 ARG B HG2  12 
ATOM   8784  H HG3  . ARG B 2 1  ? -2.226  -11.089 -1.895  1.00 15.00 ?  925 ARG B HG3  12 
ATOM   8785  H HD2  . ARG B 2 1  ? -0.183  -11.146 -0.670  1.00 15.00 ?  925 ARG B HD2  12 
ATOM   8786  H HD3  . ARG B 2 1  ? -0.658  -12.628 0.161   1.00 15.00 ?  925 ARG B HD3  12 
ATOM   8787  H HE   . ARG B 2 1  ? -0.692  -13.244 -2.517  1.00 15.00 ?  925 ARG B HE   12 
ATOM   8788  H HH11 . ARG B 2 1  ? 1.708   -12.035 -0.267  1.00 15.00 ?  925 ARG B HH11 12 
ATOM   8789  H HH12 . ARG B 2 1  ? 3.042   -12.797 -1.079  1.00 15.00 ?  925 ARG B HH12 12 
ATOM   8790  H HH21 . ARG B 2 1  ? 1.046   -14.301 -3.560  1.00 15.00 ?  925 ARG B HH21 12 
ATOM   8791  H HH22 . ARG B 2 1  ? 2.661   -14.109 -2.936  1.00 15.00 ?  925 ARG B HH22 12 
ATOM   8792  N N    . LEU B 2 2  ? -1.240  -13.264 2.048   1.00 15.00 ?  926 LEU B N    12 
ATOM   8793  C CA   . LEU B 2 2  ? -0.076  -13.481 2.908   1.00 15.00 ?  926 LEU B CA   12 
ATOM   8794  C C    . LEU B 2 2  ? 0.876   -12.274 2.864   1.00 15.00 ?  926 LEU B C    12 
ATOM   8795  O O    . LEU B 2 2  ? 0.635   -11.316 2.132   1.00 15.00 ?  926 LEU B O    12 
ATOM   8796  C CB   . LEU B 2 2  ? 0.648   -14.761 2.469   1.00 15.00 ?  926 LEU B CB   12 
ATOM   8797  C CG   . LEU B 2 2  ? 1.739   -15.267 3.416   1.00 15.00 ?  926 LEU B CG   12 
ATOM   8798  C CD1  . LEU B 2 2  ? 1.156   -15.582 4.785   1.00 15.00 ?  926 LEU B CD1  12 
ATOM   8799  C CD2  . LEU B 2 2  ? 2.422   -16.490 2.831   1.00 15.00 ?  926 LEU B CD2  12 
ATOM   8800  H H    . LEU B 2 2  ? -1.392  -13.880 1.303   1.00 15.00 ?  926 LEU B H    12 
ATOM   8801  H HA   . LEU B 2 2  ? -0.431  -13.606 3.920   1.00 15.00 ?  926 LEU B HA   12 
ATOM   8802  H HB2  . LEU B 2 2  ? -0.088  -15.543 2.359   1.00 15.00 ?  926 LEU B HB2  12 
ATOM   8803  H HB3  . LEU B 2 2  ? 1.099   -14.580 1.504   1.00 15.00 ?  926 LEU B HB3  12 
ATOM   8804  H HG   . LEU B 2 2  ? 2.483   -14.493 3.540   1.00 15.00 ?  926 LEU B HG   12 
ATOM   8805  H HD11 . LEU B 2 2  ? 0.717   -14.688 5.204   1.00 15.00 ?  926 LEU B HD11 12 
ATOM   8806  H HD12 . LEU B 2 2  ? 1.940   -15.936 5.438   1.00 15.00 ?  926 LEU B HD12 12 
ATOM   8807  H HD13 . LEU B 2 2  ? 0.397   -16.345 4.686   1.00 15.00 ?  926 LEU B HD13 12 
ATOM   8808  H HD21 . LEU B 2 2  ? 2.878   -16.232 1.887   1.00 15.00 ?  926 LEU B HD21 12 
ATOM   8809  H HD22 . LEU B 2 2  ? 1.692   -17.271 2.675   1.00 15.00 ?  926 LEU B HD22 12 
ATOM   8810  H HD23 . LEU B 2 2  ? 3.183   -16.840 3.513   1.00 15.00 ?  926 LEU B HD23 12 
ATOM   8811  N N    . ASP B 2 3  ? 1.970   -12.356 3.623   1.00 15.00 ?  927 ASP B N    12 
ATOM   8812  C CA   . ASP B 2 3  ? 2.887   -11.230 3.833   1.00 15.00 ?  927 ASP B CA   12 
ATOM   8813  C C    . ASP B 2 3  ? 3.296   -10.541 2.532   1.00 15.00 ?  927 ASP B C    12 
ATOM   8814  O O    . ASP B 2 3  ? 3.515   -11.181 1.501   1.00 15.00 ?  927 ASP B O    12 
ATOM   8815  C CB   . ASP B 2 3  ? 4.144   -11.696 4.575   1.00 15.00 ?  927 ASP B CB   12 
ATOM   8816  C CG   . ASP B 2 3  ? 3.861   -12.106 6.005   1.00 15.00 ?  927 ASP B CG   12 
ATOM   8817  O OD1  . ASP B 2 3  ? 3.522   -11.227 6.828   1.00 15.00 ?  927 ASP B OD1  12 
ATOM   8818  O OD2  . ASP B 2 3  ? 3.991   -13.309 6.320   1.00 15.00 -1 927 ASP B OD2  12 
ATOM   8819  H H    . ASP B 2 3  ? 2.169   -13.208 4.065   1.00 15.00 ?  927 ASP B H    12 
ATOM   8820  H HA   . ASP B 2 3  ? 2.376   -10.509 4.452   1.00 15.00 ?  927 ASP B HA   12 
ATOM   8821  H HB2  . ASP B 2 3  ? 4.567   -12.543 4.055   1.00 15.00 ?  927 ASP B HB2  12 
ATOM   8822  H HB3  . ASP B 2 3  ? 4.865   -10.891 4.586   1.00 15.00 ?  927 ASP B HB3  12 
ATOM   8823  N N    . LEU B 2 4  ? 3.415   -9.226  2.621   1.00 15.00 ?  928 LEU B N    12 
ATOM   8824  C CA   . LEU B 2 4  ? 3.742   -8.376  1.486   1.00 15.00 ?  928 LEU B CA   12 
ATOM   8825  C C    . LEU B 2 4  ? 5.257   -8.186  1.406   1.00 15.00 ?  928 LEU B C    12 
ATOM   8826  O O    . LEU B 2 4  ? 5.925   -8.156  2.439   1.00 15.00 ?  928 LEU B O    12 
ATOM   8827  C CB   . LEU B 2 4  ? 3.028   -7.031  1.687   1.00 15.00 ?  928 LEU B CB   12 
ATOM   8828  C CG   . LEU B 2 4  ? 2.847   -6.160  0.442   1.00 15.00 ?  928 LEU B CG   12 
ATOM   8829  C CD1  . LEU B 2 4  ? 1.545   -5.387  0.542   1.00 15.00 ?  928 LEU B CD1  12 
ATOM   8830  C CD2  . LEU B 2 4  ? 4.009   -5.193  0.281   1.00 15.00 ?  928 LEU B CD2  12 
ATOM   8831  H H    . LEU B 2 4  ? 3.292   -8.806  3.495   1.00 15.00 ?  928 LEU B H    12 
ATOM   8832  H HA   . LEU B 2 4  ? 3.383   -8.849  0.584   1.00 15.00 ?  928 LEU B HA   12 
ATOM   8833  H HB2  . LEU B 2 4  ? 2.048   -7.233  2.095   1.00 15.00 ?  928 LEU B HB2  12 
ATOM   8834  H HB3  . LEU B 2 4  ? 3.586   -6.462  2.416   1.00 15.00 ?  928 LEU B HB3  12 
ATOM   8835  H HG   . LEU B 2 4  ? 2.802   -6.790  -0.435  1.00 15.00 ?  928 LEU B HG   12 
ATOM   8836  H HD11 . LEU B 2 4  ? 1.422   -4.775  -0.338  1.00 15.00 ?  928 LEU B HD11 12 
ATOM   8837  H HD12 . LEU B 2 4  ? 1.567   -4.758  1.419   1.00 15.00 ?  928 LEU B HD12 12 
ATOM   8838  H HD13 . LEU B 2 4  ? 0.721   -6.081  0.616   1.00 15.00 ?  928 LEU B HD13 12 
ATOM   8839  H HD21 . LEU B 2 4  ? 3.856   -4.592  -0.603  1.00 15.00 ?  928 LEU B HD21 12 
ATOM   8840  H HD22 . LEU B 2 4  ? 4.930   -5.750  0.182   1.00 15.00 ?  928 LEU B HD22 12 
ATOM   8841  H HD23 . LEU B 2 4  ? 4.069   -4.552  1.147   1.00 15.00 ?  928 LEU B HD23 12 
ATOM   8842  N N    . PRO B 2 5  ? 5.821   -8.051  0.186   1.00 15.00 ?  929 PRO B N    12 
ATOM   8843  C CA   . PRO B 2 5  ? 7.268   -7.844  0.005   1.00 15.00 ?  929 PRO B CA   12 
ATOM   8844  C C    . PRO B 2 5  ? 7.771   -6.610  0.755   1.00 15.00 ?  929 PRO B C    12 
ATOM   8845  O O    . PRO B 2 5  ? 7.026   -5.643  0.935   1.00 15.00 ?  929 PRO B O    12 
ATOM   8846  C CB   . PRO B 2 5  ? 7.419   -7.630  -1.508  1.00 15.00 ?  929 PRO B CB   12 
ATOM   8847  C CG   . PRO B 2 5  ? 6.195   -8.212  -2.122  1.00 15.00 ?  929 PRO B CG   12 
ATOM   8848  C CD   . PRO B 2 5  ? 5.101   -8.064  -1.104  1.00 15.00 ?  929 PRO B CD   12 
ATOM   8849  H HA   . PRO B 2 5  ? 7.836   -8.711  0.310   1.00 15.00 ?  929 PRO B HA   12 
ATOM   8850  H HB2  . PRO B 2 5  ? 7.497   -6.572  -1.714  1.00 15.00 ?  929 PRO B HB2  12 
ATOM   8851  H HB3  . PRO B 2 5  ? 8.310   -8.133  -1.854  1.00 15.00 ?  929 PRO B HB3  12 
ATOM   8852  H HG2  . PRO B 2 5  ? 5.941   -7.665  -3.020  1.00 15.00 ?  929 PRO B HG2  12 
ATOM   8853  H HG3  . PRO B 2 5  ? 6.356   -9.256  -2.349  1.00 15.00 ?  929 PRO B HG3  12 
ATOM   8854  H HD2  . PRO B 2 5  ? 4.574   -7.133  -1.256  1.00 15.00 ?  929 PRO B HD2  12 
ATOM   8855  H HD3  . PRO B 2 5  ? 4.418   -8.894  -1.163  1.00 15.00 ?  929 PRO B HD3  12 
ATOM   8856  N N    . PRO B 2 6  ? 9.040   -6.624  1.204   1.00 15.00 ?  930 PRO B N    12 
ATOM   8857  C CA   . PRO B 2 6  ? 9.662   -5.465  1.860   1.00 15.00 ?  930 PRO B CA   12 
ATOM   8858  C C    . PRO B 2 6  ? 9.450   -4.188  1.053   1.00 15.00 ?  930 PRO B C    12 
ATOM   8859  O O    . PRO B 2 6  ? 9.671   -4.170  -0.159  1.00 15.00 ?  930 PRO B O    12 
ATOM   8860  C CB   . PRO B 2 6  ? 11.142  -5.840  1.903   1.00 15.00 ?  930 PRO B CB   12 
ATOM   8861  C CG   . PRO B 2 6  ? 11.150  -7.330  1.929   1.00 15.00 ?  930 PRO B CG   12 
ATOM   8862  C CD   . PRO B 2 6  ? 9.966   -7.768  1.112   1.00 15.00 ?  930 PRO B CD   12 
ATOM   8863  H HA   . PRO B 2 6  ? 9.287   -5.325  2.865   1.00 15.00 ?  930 PRO B HA   12 
ATOM   8864  H HB2  . PRO B 2 6  ? 11.639  -5.456  1.026   1.00 15.00 ?  930 PRO B HB2  12 
ATOM   8865  H HB3  . PRO B 2 6  ? 11.594  -5.427  2.793   1.00 15.00 ?  930 PRO B HB3  12 
ATOM   8866  H HG2  . PRO B 2 6  ? 12.065  -7.699  1.490   1.00 15.00 ?  930 PRO B HG2  12 
ATOM   8867  H HG3  . PRO B 2 6  ? 11.053  -7.680  2.947   1.00 15.00 ?  930 PRO B HG3  12 
ATOM   8868  H HD2  . PRO B 2 6  ? 10.259  -7.944  0.088   1.00 15.00 ?  930 PRO B HD2  12 
ATOM   8869  H HD3  . PRO B 2 6  ? 9.524   -8.658  1.536   1.00 15.00 ?  930 PRO B HD3  12 
ATOM   8870  N N    . TYR B 2 7  ? 9.017   -3.128  1.728   1.00 15.00 ?  931 TYR B N    12 
ATOM   8871  C CA   . TYR B 2 7  ? 8.616   -1.906  1.044   1.00 15.00 ?  931 TYR B CA   12 
ATOM   8872  C C    . TYR B 2 7  ? 9.803   -1.264  0.325   1.00 15.00 ?  931 TYR B C    12 
ATOM   8873  O O    . TYR B 2 7  ? 10.803  -0.886  0.939   1.00 15.00 ?  931 TYR B O    12 
ATOM   8874  C CB   . TYR B 2 7  ? 7.990   -0.946  2.082   1.00 15.00 ?  931 TYR B CB   12 
ATOM   8875  C CG   . TYR B 2 7  ? 7.634   0.453   1.594   1.00 15.00 ?  931 TYR B CG   12 
ATOM   8876  C CD1  . TYR B 2 7  ? 7.357   0.727   0.259   1.00 15.00 ?  931 TYR B CD1  12 
ATOM   8877  C CD2  . TYR B 2 7  ? 7.566   1.508   2.499   1.00 15.00 ?  931 TYR B CD2  12 
ATOM   8878  C CE1  . TYR B 2 7  ? 7.030   2.005   -0.156  1.00 15.00 ?  931 TYR B CE1  12 
ATOM   8879  C CE2  . TYR B 2 7  ? 7.236   2.784   2.094   1.00 15.00 ?  931 TYR B CE2  12 
ATOM   8880  C CZ   . TYR B 2 7  ? 6.971   3.030   0.765   1.00 15.00 ?  931 TYR B CZ   12 
ATOM   8881  O OH   . TYR B 2 7  ? 6.647   4.304   0.355   1.00 15.00 ?  931 TYR B OH   12 
ATOM   8882  H H    . TYR B 2 7  ? 8.975   -3.167  2.704   1.00 15.00 ?  931 TYR B H    12 
ATOM   8883  H HA   . TYR B 2 7  ? 7.867   -2.167  0.313   1.00 15.00 ?  931 TYR B HA   12 
ATOM   8884  H HB2  . TYR B 2 7  ? 7.082   -1.392  2.452   1.00 15.00 ?  931 TYR B HB2  12 
ATOM   8885  H HB3  . TYR B 2 7  ? 8.680   -0.839  2.907   1.00 15.00 ?  931 TYR B HB3  12 
ATOM   8886  H HD1  . TYR B 2 7  ? 7.402   -0.074  -0.460  1.00 15.00 ?  931 TYR B HD1  12 
ATOM   8887  H HD2  . TYR B 2 7  ? 7.774   1.320   3.539   1.00 15.00 ?  931 TYR B HD2  12 
ATOM   8888  H HE1  . TYR B 2 7  ? 6.819   2.197   -1.198  1.00 15.00 ?  931 TYR B HE1  12 
ATOM   8889  H HE2  . TYR B 2 7  ? 7.184   3.583   2.820   1.00 15.00 ?  931 TYR B HE2  12 
ATOM   8890  H HH   . TYR B 2 7  ? 7.286   4.928   0.718   1.00 15.00 ?  931 TYR B HH   12 
ATOM   8891  N N    . GLU B 2 8  ? 9.662   -1.152  -0.987  1.00 15.00 ?  932 GLU B N    12 
ATOM   8892  C CA   . GLU B 2 8  ? 10.581  -0.400  -1.827  1.00 15.00 ?  932 GLU B CA   12 
ATOM   8893  C C    . GLU B 2 8  ? 9.851   0.846   -2.294  1.00 15.00 ?  932 GLU B C    12 
ATOM   8894  O O    . GLU B 2 8  ? 8.726   0.743   -2.786  1.00 15.00 ?  932 GLU B O    12 
ATOM   8895  C CB   . GLU B 2 8  ? 11.018  -1.237  -3.033  1.00 15.00 ?  932 GLU B CB   12 
ATOM   8896  C CG   . GLU B 2 8  ? 11.610  -2.593  -2.676  1.00 15.00 ?  932 GLU B CG   12 
ATOM   8897  C CD   . GLU B 2 8  ? 12.901  -2.495  -1.888  1.00 15.00 ?  932 GLU B CD   12 
ATOM   8898  O OE1  . GLU B 2 8  ? 13.929  -2.088  -2.470  1.00 15.00 -1 932 GLU B OE1  12 
ATOM   8899  O OE2  . GLU B 2 8  ? 12.902  -2.849  -0.694  1.00 15.00 ?  932 GLU B OE2  12 
ATOM   8900  H H    . GLU B 2 8  ? 8.898   -1.595  -1.414  1.00 15.00 ?  932 GLU B H    12 
ATOM   8901  H HA   . GLU B 2 8  ? 11.442  -0.121  -1.236  1.00 15.00 ?  932 GLU B HA   12 
ATOM   8902  H HB2  . GLU B 2 8  ? 10.158  -1.402  -3.667  1.00 15.00 ?  932 GLU B HB2  12 
ATOM   8903  H HB3  . GLU B 2 8  ? 11.758  -0.681  -3.588  1.00 15.00 ?  932 GLU B HB3  12 
ATOM   8904  H HG2  . GLU B 2 8  ? 10.891  -3.138  -2.084  1.00 15.00 ?  932 GLU B HG2  12 
ATOM   8905  H HG3  . GLU B 2 8  ? 11.805  -3.136  -3.590  1.00 15.00 ?  932 GLU B HG3  12 
ATOM   8906  N N    . THR B 2 9  ? 10.451  2.012   -2.154  1.00 15.00 ?  933 THR B N    12 
ATOM   8907  C CA   . THR B 2 9  ? 9.716   3.230   -2.428  1.00 15.00 ?  933 THR B CA   12 
ATOM   8908  C C    . THR B 2 9  ? 9.526   3.459   -3.923  1.00 15.00 ?  933 THR B C    12 
ATOM   8909  O O    . THR B 2 9  ? 10.481  3.577   -4.690  1.00 15.00 ?  933 THR B O    12 
ATOM   8910  C CB   . THR B 2 9  ? 10.371  4.467   -1.795  1.00 15.00 ?  933 THR B CB   12 
ATOM   8911  O OG1  . THR B 2 9  ? 10.709  4.182   -0.430  1.00 15.00 ?  933 THR B OG1  12 
ATOM   8912  C CG2  . THR B 2 9  ? 9.417   5.658   -1.846  1.00 15.00 ?  933 THR B CG2  12 
ATOM   8913  H H    . THR B 2 9  ? 11.395  2.056   -1.889  1.00 15.00 ?  933 THR B H    12 
ATOM   8914  H HA   . THR B 2 9  ? 8.737   3.115   -1.982  1.00 15.00 ?  933 THR B HA   12 
ATOM   8915  H HB   . THR B 2 9  ? 11.270  4.712   -2.344  1.00 15.00 ?  933 THR B HB   12 
ATOM   8916  H HG1  . THR B 2 9  ? 10.521  3.259   -0.242  1.00 15.00 ?  933 THR B HG1  12 
ATOM   8917  H HG21 . THR B 2 9  ? 9.871   6.507   -1.360  1.00 15.00 ?  933 THR B HG21 12 
ATOM   8918  H HG22 . THR B 2 9  ? 8.493   5.404   -1.344  1.00 15.00 ?  933 THR B HG22 12 
ATOM   8919  H HG23 . THR B 2 9  ? 9.205   5.904   -2.877  1.00 15.00 ?  933 THR B HG23 12 
ATOM   8920  N N    . PHE B 2 10 ? 8.267   3.506   -4.303  1.00 15.00 ?  934 PHE B N    12 
ATOM   8921  C CA   . PHE B 2 10 ? 7.837   3.872   -5.640  1.00 15.00 ?  934 PHE B CA   12 
ATOM   8922  C C    . PHE B 2 10 ? 7.675   5.396   -5.688  1.00 15.00 ?  934 PHE B C    12 
ATOM   8923  O O    . PHE B 2 10 ? 8.011   6.071   -4.712  1.00 15.00 ?  934 PHE B O    12 
ATOM   8924  C CB   . PHE B 2 10 ? 6.532   3.153   -6.006  1.00 15.00 ?  934 PHE B CB   12 
ATOM   8925  C CG   . PHE B 2 10 ? 5.348   3.697   -5.278  1.00 15.00 ?  934 PHE B CG   12 
ATOM   8926  C CD1  . PHE B 2 10 ? 5.067   3.317   -3.978  1.00 15.00 ?  934 PHE B CD1  12 
ATOM   8927  C CD2  . PHE B 2 10 ? 4.543   4.634   -5.889  1.00 15.00 ?  934 PHE B CD2  12 
ATOM   8928  C CE1  . PHE B 2 10 ? 4.004   3.872   -3.306  1.00 15.00 ?  934 PHE B CE1  12 
ATOM   8929  C CE2  . PHE B 2 10 ? 3.475   5.182   -5.226  1.00 15.00 ?  934 PHE B CE2  12 
ATOM   8930  C CZ   . PHE B 2 10 ? 3.211   4.804   -3.932  1.00 15.00 ?  934 PHE B CZ   12 
ATOM   8931  H H    . PHE B 2 10 ? 7.577   3.287   -3.644  1.00 15.00 ?  934 PHE B H    12 
ATOM   8932  H HA   . PHE B 2 10 ? 8.615   3.581   -6.333  1.00 15.00 ?  934 PHE B HA   12 
ATOM   8933  H HB2  . PHE B 2 10 ? 6.353   3.259   -7.065  1.00 15.00 ?  934 PHE B HB2  12 
ATOM   8934  H HB3  . PHE B 2 10 ? 6.624   2.105   -5.760  1.00 15.00 ?  934 PHE B HB3  12 
ATOM   8935  H HD1  . PHE B 2 10 ? 5.685   2.577   -3.491  1.00 15.00 ?  934 PHE B HD1  12 
ATOM   8936  H HD2  . PHE B 2 10 ? 4.752   4.923   -6.905  1.00 15.00 ?  934 PHE B HD2  12 
ATOM   8937  H HE1  . PHE B 2 10 ? 3.788   3.571   -2.290  1.00 15.00 ?  934 PHE B HE1  12 
ATOM   8938  H HE2  . PHE B 2 10 ? 2.851   5.914   -5.715  1.00 15.00 ?  934 PHE B HE2  12 
ATOM   8939  H HZ   . PHE B 2 10 ? 2.390   5.241   -3.411  1.00 15.00 ?  934 PHE B HZ   12 
ATOM   8940  N N    . GLU B 2 11 ? 7.263   5.937   -6.833  1.00 15.00 ?  935 GLU B N    12 
ATOM   8941  C CA   . GLU B 2 11 ? 7.099   7.386   -7.009  1.00 15.00 ?  935 GLU B CA   12 
ATOM   8942  C C    . GLU B 2 11 ? 6.307   8.047   -5.867  1.00 15.00 ?  935 GLU B C    12 
ATOM   8943  O O    . GLU B 2 11 ? 5.691   7.377   -5.037  1.00 15.00 ?  935 GLU B O    12 
ATOM   8944  C CB   . GLU B 2 11 ? 6.376   7.668   -8.328  1.00 15.00 ?  935 GLU B CB   12 
ATOM   8945  C CG   . GLU B 2 11 ? 4.915   7.219   -8.347  1.00 15.00 ?  935 GLU B CG   12 
ATOM   8946  C CD   . GLU B 2 11 ? 4.651   6.141   -9.375  1.00 15.00 ?  935 GLU B CD   12 
ATOM   8947  O OE1  . GLU B 2 11 ? 4.366   6.489   -10.543 1.00 15.00 ?  935 GLU B OE1  12 
ATOM   8948  O OE2  . GLU B 2 11 ? 4.711   4.946   -9.025  1.00 15.00 -1 935 GLU B OE2  12 
ATOM   8949  H H    . GLU B 2 11 ? 7.060   5.343   -7.592  1.00 15.00 ?  935 GLU B H    12 
ATOM   8950  H HA   . GLU B 2 11 ? 8.083   7.827   -7.053  1.00 15.00 ?  935 GLU B HA   12 
ATOM   8951  H HB2  . GLU B 2 11 ? 6.405   8.731   -8.519  1.00 15.00 ?  935 GLU B HB2  12 
ATOM   8952  H HB3  . GLU B 2 11 ? 6.896   7.156   -9.125  1.00 15.00 ?  935 GLU B HB3  12 
ATOM   8953  H HG2  . GLU B 2 11 ? 4.641   6.839   -7.366  1.00 15.00 ?  935 GLU B HG2  12 
ATOM   8954  H HG3  . GLU B 2 11 ? 4.299   8.075   -8.580  1.00 15.00 ?  935 GLU B HG3  12 
ATOM   8955  N N    . ASP B 2 12 ? 6.320   9.378   -5.862  1.00 15.00 ?  936 ASP B N    12 
ATOM   8956  C CA   . ASP B 2 12 ? 5.686   10.175  -4.809  1.00 15.00 ?  936 ASP B CA   12 
ATOM   8957  C C    . ASP B 2 12 ? 4.211   9.822   -4.638  1.00 15.00 ?  936 ASP B C    12 
ATOM   8958  O O    . ASP B 2 12 ? 3.538   9.446   -5.601  1.00 15.00 ?  936 ASP B O    12 
ATOM   8959  C CB   . ASP B 2 12 ? 5.806   11.668  -5.127  1.00 15.00 ?  936 ASP B CB   12 
ATOM   8960  C CG   . ASP B 2 12 ? 7.241   12.134  -5.245  1.00 15.00 ?  936 ASP B CG   12 
ATOM   8961  O OD1  . ASP B 2 12 ? 7.864   12.451  -4.207  1.00 15.00 ?  936 ASP B OD1  12 
ATOM   8962  O OD2  . ASP B 2 12 ? 7.750   12.200  -6.383  1.00 15.00 -1 936 ASP B OD2  12 
ATOM   8963  H H    . ASP B 2 12 ? 6.771   9.844   -6.596  1.00 15.00 ?  936 ASP B H    12 
ATOM   8964  H HA   . ASP B 2 12 ? 6.203   9.973   -3.883  1.00 15.00 ?  936 ASP B HA   12 
ATOM   8965  H HB2  . ASP B 2 12 ? 5.308   11.868  -6.063  1.00 15.00 ?  936 ASP B HB2  12 
ATOM   8966  H HB3  . ASP B 2 12 ? 5.326   12.235  -4.342  1.00 15.00 ?  936 ASP B HB3  12 
ATOM   8967  N N    . LEU B 2 13 ? 3.716   10.016  -3.414  1.00 15.00 ?  937 LEU B N    12 
ATOM   8968  C CA   . LEU B 2 13 ? 2.339   9.689   -3.033  1.00 15.00 ?  937 LEU B CA   12 
ATOM   8969  C C    . LEU B 2 13 ? 1.333   10.252  -4.038  1.00 15.00 ?  937 LEU B C    12 
ATOM   8970  O O    . LEU B 2 13 ? 1.129   11.464  -4.126  1.00 15.00 ?  937 LEU B O    12 
ATOM   8971  C CB   . LEU B 2 13 ? 2.068   10.237  -1.619  1.00 15.00 ?  937 LEU B CB   12 
ATOM   8972  C CG   . LEU B 2 13 ? 0.754   9.807   -0.949  1.00 15.00 ?  937 LEU B CG   12 
ATOM   8973  C CD1  . LEU B 2 13 ? 0.883   9.909   0.561   1.00 15.00 ?  937 LEU B CD1  12 
ATOM   8974  C CD2  . LEU B 2 13 ? -0.413  10.663  -1.419  1.00 15.00 ?  937 LEU B CD2  12 
ATOM   8975  H H    . LEU B 2 13 ? 4.308   10.400  -2.731  1.00 15.00 ?  937 LEU B H    12 
ATOM   8976  H HA   . LEU B 2 13 ? 2.246   8.614   -3.015  1.00 15.00 ?  937 LEU B HA   12 
ATOM   8977  H HB2  . LEU B 2 13 ? 2.881   9.927   -0.980  1.00 15.00 ?  937 LEU B HB2  12 
ATOM   8978  H HB3  . LEU B 2 13 ? 2.076   11.316  -1.673  1.00 15.00 ?  937 LEU B HB3  12 
ATOM   8979  H HG   . LEU B 2 13 ? 0.545   8.779   -1.201  1.00 15.00 ?  937 LEU B HG   12 
ATOM   8980  H HD11 . LEU B 2 13 ? -0.048  9.614   1.023   1.00 15.00 ?  937 LEU B HD11 12 
ATOM   8981  H HD12 . LEU B 2 13 ? 1.114   10.928  0.836   1.00 15.00 ?  937 LEU B HD12 12 
ATOM   8982  H HD13 . LEU B 2 13 ? 1.676   9.257   0.901   1.00 15.00 ?  937 LEU B HD13 12 
ATOM   8983  H HD21 . LEU B 2 13 ? -0.526  10.561  -2.488  1.00 15.00 ?  937 LEU B HD21 12 
ATOM   8984  H HD22 . LEU B 2 13 ? -0.222  11.698  -1.174  1.00 15.00 ?  937 LEU B HD22 12 
ATOM   8985  H HD23 . LEU B 2 13 ? -1.318  10.337  -0.929  1.00 15.00 ?  937 LEU B HD23 12 
HETATM 8986  N N    . NH2 B 2 14 ? 0.714   9.369   -4.808  1.00 15.00 ?  938 NH2 B N    12 
HETATM 8987  H HN1  . NH2 B 2 14 ? 0.926   8.413   -4.683  1.00 15.00 ?  938 NH2 B HN1  12 
HETATM 8988  H HN2  . NH2 B 2 14 ? 0.075   9.697   -5.470  1.00 15.00 ?  938 NH2 B HN2  12 
ATOM   8989  N N    . PHE A 1 7  ? -10.639 10.334  -1.730  1.00 15.00 ?  478 PHE A N    13 
ATOM   8990  C CA   . PHE A 1 7  ? -10.559 8.861   -1.852  1.00 15.00 ?  478 PHE A CA   13 
ATOM   8991  C C    . PHE A 1 7  ? -10.322 8.239   -0.476  1.00 15.00 ?  478 PHE A C    13 
ATOM   8992  O O    . PHE A 1 7  ? -11.227 8.204   0.357   1.00 15.00 ?  478 PHE A O    13 
ATOM   8993  C CB   . PHE A 1 7  ? -9.445  8.461   -2.832  1.00 15.00 ?  478 PHE A CB   13 
ATOM   8994  C CG   . PHE A 1 7  ? -9.697  8.889   -4.251  1.00 15.00 ?  478 PHE A CG   13 
ATOM   8995  C CD1  . PHE A 1 7  ? -10.682 8.278   -5.009  1.00 15.00 ?  478 PHE A CD1  13 
ATOM   8996  C CD2  . PHE A 1 7  ? -8.945  9.900   -4.827  1.00 15.00 ?  478 PHE A CD2  13 
ATOM   8997  C CE1  . PHE A 1 7  ? -10.916 8.668   -6.315  1.00 15.00 ?  478 PHE A CE1  13 
ATOM   8998  C CE2  . PHE A 1 7  ? -9.173  10.296  -6.132  1.00 15.00 ?  478 PHE A CE2  13 
ATOM   8999  C CZ   . PHE A 1 7  ? -10.160 9.680   -6.877  1.00 15.00 ?  478 PHE A CZ   13 
ATOM   9000  H H    . PHE A 1 7  ? -11.415 10.596  -1.094  1.00 15.00 ?  478 PHE A H    13 
ATOM   9001  H HA   . PHE A 1 7  ? -11.508 8.504   -2.230  1.00 15.00 ?  478 PHE A HA   13 
ATOM   9002  H HB2  . PHE A 1 7  ? -8.520  8.920   -2.518  1.00 15.00 ?  478 PHE A HB2  13 
ATOM   9003  H HB3  . PHE A 1 7  ? -9.328  7.386   -2.824  1.00 15.00 ?  478 PHE A HB3  13 
ATOM   9004  H HD1  . PHE A 1 7  ? -11.276 7.488   -4.570  1.00 15.00 ?  478 PHE A HD1  13 
ATOM   9005  H HD2  . PHE A 1 7  ? -8.173  10.383  -4.246  1.00 15.00 ?  478 PHE A HD2  13 
ATOM   9006  H HE1  . PHE A 1 7  ? -11.686 8.183   -6.895  1.00 15.00 ?  478 PHE A HE1  13 
ATOM   9007  H HE2  . PHE A 1 7  ? -8.581  11.087  -6.568  1.00 15.00 ?  478 PHE A HE2  13 
ATOM   9008  H HZ   . PHE A 1 7  ? -10.340 9.988   -7.896  1.00 15.00 ?  478 PHE A HZ   13 
ATOM   9009  N N    . LEU A 1 8  ? -9.100  7.793   -0.222  1.00 15.00 ?  479 LEU A N    13 
ATOM   9010  C CA   . LEU A 1 8  ? -8.741  7.243   1.076   1.00 15.00 ?  479 LEU A CA   13 
ATOM   9011  C C    . LEU A 1 8  ? -7.776  8.203   1.777   1.00 15.00 ?  479 LEU A C    13 
ATOM   9012  O O    . LEU A 1 8  ? -7.205  9.075   1.116   1.00 15.00 ?  479 LEU A O    13 
ATOM   9013  C CB   . LEU A 1 8  ? -8.135  5.831   0.926   1.00 15.00 ?  479 LEU A CB   13 
ATOM   9014  C CG   . LEU A 1 8  ? -6.705  5.731   0.373   1.00 15.00 ?  479 LEU A CG   13 
ATOM   9015  C CD1  . LEU A 1 8  ? -6.216  4.293   0.461   1.00 15.00 ?  479 LEU A CD1  13 
ATOM   9016  C CD2  . LEU A 1 8  ? -6.624  6.206   -1.069  1.00 15.00 ?  479 LEU A CD2  13 
ATOM   9017  H H    . LEU A 1 8  ? -8.416  7.838   -0.918  1.00 15.00 ?  479 LEU A H    13 
ATOM   9018  H HA   . LEU A 1 8  ? -9.646  7.177   1.662   1.00 15.00 ?  479 LEU A HA   13 
ATOM   9019  H HB2  . LEU A 1 8  ? -8.146  5.364   1.899   1.00 15.00 ?  479 LEU A HB2  13 
ATOM   9020  H HB3  . LEU A 1 8  ? -8.782  5.263   0.275   1.00 15.00 ?  479 LEU A HB3  13 
ATOM   9021  H HG   . LEU A 1 8  ? -6.047  6.347   0.969   1.00 15.00 ?  479 LEU A HG   13 
ATOM   9022  H HD11 . LEU A 1 8  ? -6.845  3.661   -0.148  1.00 15.00 ?  479 LEU A HD11 13 
ATOM   9023  H HD12 . LEU A 1 8  ? -6.261  3.961   1.488   1.00 15.00 ?  479 LEU A HD12 13 
ATOM   9024  H HD13 . LEU A 1 8  ? -5.196  4.235   0.107   1.00 15.00 ?  479 LEU A HD13 13 
ATOM   9025  H HD21 . LEU A 1 8  ? -7.290  5.615   -1.678  1.00 15.00 ?  479 LEU A HD21 13 
ATOM   9026  H HD22 . LEU A 1 8  ? -5.611  6.090   -1.426  1.00 15.00 ?  479 LEU A HD22 13 
ATOM   9027  H HD23 . LEU A 1 8  ? -6.910  7.246   -1.123  1.00 15.00 ?  479 LEU A HD23 13 
ATOM   9028  N N    . PRO A 1 9  ? -7.626  8.087   3.117   1.00 15.00 ?  480 PRO A N    13 
ATOM   9029  C CA   . PRO A 1 9  ? -6.739  8.944   3.924   1.00 15.00 ?  480 PRO A CA   13 
ATOM   9030  C C    . PRO A 1 9  ? -5.434  9.318   3.212   1.00 15.00 ?  480 PRO A C    13 
ATOM   9031  O O    . PRO A 1 9  ? -4.801  8.475   2.585   1.00 15.00 ?  480 PRO A O    13 
ATOM   9032  C CB   . PRO A 1 9  ? -6.457  8.058   5.131   1.00 15.00 ?  480 PRO A CB   13 
ATOM   9033  C CG   . PRO A 1 9  ? -7.722  7.298   5.335   1.00 15.00 ?  480 PRO A CG   13 
ATOM   9034  C CD   . PRO A 1 9  ? -8.324  7.098   3.966   1.00 15.00 ?  480 PRO A CD   13 
ATOM   9035  H HA   . PRO A 1 9  ? -7.243  9.843   4.246   1.00 15.00 ?  480 PRO A HA   13 
ATOM   9036  H HB2  . PRO A 1 9  ? -5.627  7.400   4.912   1.00 15.00 ?  480 PRO A HB2  13 
ATOM   9037  H HB3  . PRO A 1 9  ? -6.222  8.670   5.989   1.00 15.00 ?  480 PRO A HB3  13 
ATOM   9038  H HG2  . PRO A 1 9  ? -7.508  6.344   5.791   1.00 15.00 ?  480 PRO A HG2  13 
ATOM   9039  H HG3  . PRO A 1 9  ? -8.394  7.869   5.958   1.00 15.00 ?  480 PRO A HG3  13 
ATOM   9040  H HD2  . PRO A 1 9  ? -8.136  6.094   3.616   1.00 15.00 ?  480 PRO A HD2  13 
ATOM   9041  H HD3  . PRO A 1 9  ? -9.384  7.297   3.992   1.00 15.00 ?  480 PRO A HD3  13 
ATOM   9042  N N    . PRO A 1 10 ? -5.002  10.586  3.341   1.00 15.00 ?  481 PRO A N    13 
ATOM   9043  C CA   . PRO A 1 10 ? -3.849  11.127  2.595   1.00 15.00 ?  481 PRO A CA   13 
ATOM   9044  C C    . PRO A 1 10 ? -2.516  10.448  2.927   1.00 15.00 ?  481 PRO A C    13 
ATOM   9045  O O    . PRO A 1 10 ? -1.505  10.701  2.270   1.00 15.00 ?  481 PRO A O    13 
ATOM   9046  C CB   . PRO A 1 10 ? -3.810  12.603  3.007   1.00 15.00 ?  481 PRO A CB   13 
ATOM   9047  C CG   . PRO A 1 10 ? -4.536  12.654  4.308   1.00 15.00 ?  481 PRO A CG   13 
ATOM   9048  C CD   . PRO A 1 10 ? -5.603  11.601  4.223   1.00 15.00 ?  481 PRO A CD   13 
ATOM   9049  H HA   . PRO A 1 10 ? -4.014  11.062  1.531   1.00 15.00 ?  481 PRO A HA   13 
ATOM   9050  H HB2  . PRO A 1 10 ? -2.785  12.923  3.111   1.00 15.00 ?  481 PRO A HB2  13 
ATOM   9051  H HB3  . PRO A 1 10 ? -4.306  13.202  2.256   1.00 15.00 ?  481 PRO A HB3  13 
ATOM   9052  H HG2  . PRO A 1 10 ? -3.854  12.433  5.116   1.00 15.00 ?  481 PRO A HG2  13 
ATOM   9053  H HG3  . PRO A 1 10 ? -4.979  13.629  4.445   1.00 15.00 ?  481 PRO A HG3  13 
ATOM   9054  H HD2  . PRO A 1 10 ? -5.808  11.190  5.201   1.00 15.00 ?  481 PRO A HD2  13 
ATOM   9055  H HD3  . PRO A 1 10 ? -6.502  12.009  3.785   1.00 15.00 ?  481 PRO A HD3  13 
ATOM   9056  N N    . GLY A 1 11 ? -2.500  9.617   3.959   1.00 15.00 ?  482 GLY A N    13 
ATOM   9057  C CA   . GLY A 1 11 ? -1.305  8.857   4.269   1.00 15.00 ?  482 GLY A CA   13 
ATOM   9058  C C    . GLY A 1 11 ? -1.414  7.430   3.801   1.00 15.00 ?  482 GLY A C    13 
ATOM   9059  O O    . GLY A 1 11 ? -0.432  6.694   3.802   1.00 15.00 ?  482 GLY A O    13 
ATOM   9060  H H    . GLY A 1 11 ? -3.302  9.520   4.513   1.00 15.00 ?  482 GLY A H    13 
ATOM   9061  H HA2  . GLY A 1 11 ? -0.459  9.319   3.788   1.00 15.00 ?  482 GLY A HA2  13 
ATOM   9062  H HA3  . GLY A 1 11 ? -1.138  8.858   5.329   1.00 15.00 ?  482 GLY A HA3  13 
ATOM   9063  N N    . TRP A 1 12 ? -2.616  7.042   3.404   1.00 15.00 ?  483 TRP A N    13 
ATOM   9064  C CA   . TRP A 1 12 ? -2.862  5.708   2.894   1.00 15.00 ?  483 TRP A CA   13 
ATOM   9065  C C    . TRP A 1 12 ? -2.701  5.694   1.389   1.00 15.00 ?  483 TRP A C    13 
ATOM   9066  O O    . TRP A 1 12 ? -3.521  6.243   0.655   1.00 15.00 ?  483 TRP A O    13 
ATOM   9067  C CB   . TRP A 1 12 ? -4.258  5.222   3.282   1.00 15.00 ?  483 TRP A CB   13 
ATOM   9068  C CG   . TRP A 1 12 ? -4.338  4.690   4.676   1.00 15.00 ?  483 TRP A CG   13 
ATOM   9069  C CD1  . TRP A 1 12 ? -4.357  5.412   5.834   1.00 15.00 ?  483 TRP A CD1  13 
ATOM   9070  C CD2  . TRP A 1 12 ? -4.413  3.314   5.054   1.00 15.00 ?  483 TRP A CD2  13 
ATOM   9071  N NE1  . TRP A 1 12 ? -4.435  4.565   6.914   1.00 15.00 ?  483 TRP A NE1  13 
ATOM   9072  C CE2  . TRP A 1 12 ? -4.471  3.270   6.460   1.00 15.00 ?  483 TRP A CE2  13 
ATOM   9073  C CE3  . TRP A 1 12 ? -4.432  2.111   4.338   1.00 15.00 ?  483 TRP A CE3  13 
ATOM   9074  C CZ2  . TRP A 1 12 ? -4.553  2.072   7.162   1.00 15.00 ?  483 TRP A CZ2  13 
ATOM   9075  C CZ3  . TRP A 1 12 ? -4.511  0.924   5.038   1.00 15.00 ?  483 TRP A CZ3  13 
ATOM   9076  C CH2  . TRP A 1 12 ? -4.572  0.911   6.438   1.00 15.00 ?  483 TRP A CH2  13 
ATOM   9077  H H    . TRP A 1 12 ? -3.358  7.685   3.425   1.00 15.00 ?  483 TRP A H    13 
ATOM   9078  H HA   . TRP A 1 12 ? -2.126  5.046   3.327   1.00 15.00 ?  483 TRP A HA   13 
ATOM   9079  H HB2  . TRP A 1 12 ? -4.954  6.043   3.197   1.00 15.00 ?  483 TRP A HB2  13 
ATOM   9080  H HB3  . TRP A 1 12 ? -4.556  4.434   2.606   1.00 15.00 ?  483 TRP A HB3  13 
ATOM   9081  H HD1  . TRP A 1 12 ? -4.314  6.490   5.880   1.00 15.00 ?  483 TRP A HD1  13 
ATOM   9082  H HE1  . TRP A 1 12 ? -4.456  4.844   7.856   1.00 15.00 ?  483 TRP A HE1  13 
ATOM   9083  H HE3  . TRP A 1 12 ? -4.391  2.099   3.254   1.00 15.00 ?  483 TRP A HE3  13 
ATOM   9084  H HZ2  . TRP A 1 12 ? -4.606  2.043   8.239   1.00 15.00 ?  483 TRP A HZ2  13 
ATOM   9085  H HZ3  . TRP A 1 12 ? -4.527  -0.015  4.503   1.00 15.00 ?  483 TRP A HZ3  13 
ATOM   9086  H HH2  . TRP A 1 12 ? -4.631  -0.040  6.942   1.00 15.00 ?  483 TRP A HH2  13 
ATOM   9087  N N    . GLU A 1 13 ? -1.624  5.096   0.940   1.00 15.00 ?  484 GLU A N    13 
ATOM   9088  C CA   . GLU A 1 13 ? -1.335  5.035   -0.470  1.00 15.00 ?  484 GLU A CA   13 
ATOM   9089  C C    . GLU A 1 13 ? -1.678  3.707   -1.054  1.00 15.00 ?  484 GLU A C    13 
ATOM   9090  O O    . GLU A 1 13 ? -1.611  2.664   -0.410  1.00 15.00 ?  484 GLU A O    13 
ATOM   9091  C CB   . GLU A 1 13 ? 0.101   5.344   -0.786  1.00 15.00 ?  484 GLU A CB   13 
ATOM   9092  C CG   . GLU A 1 13 ? 1.097   4.499   -0.035  1.00 15.00 ?  484 GLU A CG   13 
ATOM   9093  C CD   . GLU A 1 13 ? 2.512   4.863   -0.384  1.00 15.00 ?  484 GLU A CD   13 
ATOM   9094  O OE1  . GLU A 1 13 ? 2.697   5.895   -1.053  1.00 15.00 -1 484 GLU A OE1  13 
ATOM   9095  O OE2  . GLU A 1 13 ? 3.445   4.169   0.052   1.00 15.00 ?  484 GLU A OE2  13 
ATOM   9096  H H    . GLU A 1 13 ? -1.000  4.684   1.579   1.00 15.00 ?  484 GLU A H    13 
ATOM   9097  H HA   . GLU A 1 13 ? -1.952  5.779   -0.950  1.00 15.00 ?  484 GLU A HA   13 
ATOM   9098  H HB2  . GLU A 1 13 ? 0.263   5.186   -1.825  1.00 15.00 ?  484 GLU A HB2  13 
ATOM   9099  H HB3  . GLU A 1 13 ? 0.269   6.364   -0.579  1.00 15.00 ?  484 GLU A HB3  13 
ATOM   9100  H HG2  . GLU A 1 13 ? 0.947   4.646   1.021   1.00 15.00 ?  484 GLU A HG2  13 
ATOM   9101  H HG3  . GLU A 1 13 ? 0.934   3.461   -0.283  1.00 15.00 ?  484 GLU A HG3  13 
ATOM   9102  N N    . MET A 1 14 ? -2.008  3.785   -2.298  1.00 15.00 ?  485 MET A N    13 
ATOM   9103  C CA   . MET A 1 14 ? -2.499  2.638   -3.040  1.00 15.00 ?  485 MET A CA   13 
ATOM   9104  C C    . MET A 1 14 ? -1.729  2.495   -4.347  1.00 15.00 ?  485 MET A C    13 
ATOM   9105  O O    . MET A 1 14 ? -1.850  3.328   -5.244  1.00 15.00 ?  485 MET A O    13 
ATOM   9106  C CB   . MET A 1 14 ? -4.006  2.791   -3.297  1.00 15.00 ?  485 MET A CB   13 
ATOM   9107  C CG   . MET A 1 14 ? -4.686  1.548   -3.859  1.00 15.00 ?  485 MET A CG   13 
ATOM   9108  S SD   . MET A 1 14 ? -4.426  1.328   -5.630  1.00 15.00 ?  485 MET A SD   13 
ATOM   9109  C CE   . MET A 1 14 ? -5.132  2.852   -6.259  1.00 15.00 ?  485 MET A CE   13 
ATOM   9110  H H    . MET A 1 14 ? -1.853  4.649   -2.747  1.00 15.00 ?  485 MET A H    13 
ATOM   9111  H HA   . MET A 1 14 ? -2.331  1.755   -2.436  1.00 15.00 ?  485 MET A HA   13 
ATOM   9112  H HB2  . MET A 1 14 ? -4.490  3.045   -2.368  1.00 15.00 ?  485 MET A HB2  13 
ATOM   9113  H HB3  . MET A 1 14 ? -4.154  3.600   -3.998  1.00 15.00 ?  485 MET A HB3  13 
ATOM   9114  H HG2  . MET A 1 14 ? -4.297  0.683   -3.344  1.00 15.00 ?  485 MET A HG2  13 
ATOM   9115  H HG3  . MET A 1 14 ? -5.748  1.623   -3.673  1.00 15.00 ?  485 MET A HG3  13 
ATOM   9116  H HE1  . MET A 1 14 ? -4.598  3.695   -5.841  1.00 15.00 ?  485 MET A HE1  13 
ATOM   9117  H HE2  . MET A 1 14 ? -6.174  2.913   -5.977  1.00 15.00 ?  485 MET A HE2  13 
ATOM   9118  H HE3  . MET A 1 14 ? -5.047  2.871   -7.334  1.00 15.00 ?  485 MET A HE3  13 
ATOM   9119  N N    . ARG A 1 15 ? -0.903  1.460   -4.423  1.00 15.00 ?  486 ARG A N    13 
ATOM   9120  C CA   . ARG A 1 15 ? -0.104  1.190   -5.614  1.00 15.00 ?  486 ARG A CA   13 
ATOM   9121  C C    . ARG A 1 15 ? -0.157  -0.297  -5.936  1.00 15.00 ?  486 ARG A C    13 
ATOM   9122  O O    . ARG A 1 15 ? -0.210  -1.132  -5.031  1.00 15.00 ?  486 ARG A O    13 
ATOM   9123  C CB   . ARG A 1 15 ? 1.348   1.636   -5.407  1.00 15.00 ?  486 ARG A CB   13 
ATOM   9124  C CG   . ARG A 1 15 ? 1.502   3.129   -5.153  1.00 15.00 ?  486 ARG A CG   13 
ATOM   9125  C CD   . ARG A 1 15 ? 1.102   3.962   -6.363  1.00 15.00 ?  486 ARG A CD   13 
ATOM   9126  N NE   . ARG A 1 15 ? 2.056   3.833   -7.467  1.00 15.00 ?  486 ARG A NE   13 
ATOM   9127  C CZ   . ARG A 1 15 ? 1.727   3.920   -8.754  1.00 15.00 ?  486 ARG A CZ   13 
ATOM   9128  N NH1  . ARG A 1 15 ? 0.471   4.155   -9.114  1.00 15.00 1  486 ARG A NH1  13 
ATOM   9129  N NH2  . ARG A 1 15 ? 2.668   3.805   -9.680  1.00 15.00 ?  486 ARG A NH2  13 
ATOM   9130  H H    . ARG A 1 15 ? -0.832  0.850   -3.655  1.00 15.00 ?  486 ARG A H    13 
ATOM   9131  H HA   . ARG A 1 15 ? -0.533  1.742   -6.437  1.00 15.00 ?  486 ARG A HA   13 
ATOM   9132  H HB2  . ARG A 1 15 ? 1.755   1.107   -4.559  1.00 15.00 ?  486 ARG A HB2  13 
ATOM   9133  H HB3  . ARG A 1 15 ? 1.920   1.381   -6.287  1.00 15.00 ?  486 ARG A HB3  13 
ATOM   9134  H HG2  . ARG A 1 15 ? 0.876   3.408   -4.319  1.00 15.00 ?  486 ARG A HG2  13 
ATOM   9135  H HG3  . ARG A 1 15 ? 2.535   3.336   -4.911  1.00 15.00 ?  486 ARG A HG3  13 
ATOM   9136  H HD2  . ARG A 1 15 ? 0.131   3.636   -6.700  1.00 15.00 ?  486 ARG A HD2  13 
ATOM   9137  H HD3  . ARG A 1 15 ? 1.049   4.998   -6.064  1.00 15.00 ?  486 ARG A HD3  13 
ATOM   9138  H HE   . ARG A 1 15 ? 3.004   3.684   -7.232  1.00 15.00 ?  486 ARG A HE   13 
ATOM   9139  H HH11 . ARG A 1 15 ? -0.244  4.276   -8.412  1.00 15.00 ?  486 ARG A HH11 13 
ATOM   9140  H HH12 . ARG A 1 15 ? 0.224   4.216   -10.089 1.00 15.00 ?  486 ARG A HH12 13 
ATOM   9141  H HH21 . ARG A 1 15 ? 3.631   3.659   -9.403  1.00 15.00 ?  486 ARG A HH21 13 
ATOM   9142  H HH22 . ARG A 1 15 ? 2.432   3.859   -10.656 1.00 15.00 ?  486 ARG A HH22 13 
ATOM   9143  N N    . ILE A 1 16 ? -0.123  -0.626  -7.215  1.00 15.00 ?  487 ILE A N    13 
ATOM   9144  C CA   . ILE A 1 16 ? -0.306  -2.002  -7.649  1.00 15.00 ?  487 ILE A CA   13 
ATOM   9145  C C    . ILE A 1 16 ? 1.003   -2.656  -8.089  1.00 15.00 ?  487 ILE A C    13 
ATOM   9146  O O    . ILE A 1 16 ? 1.923   -1.990  -8.565  1.00 15.00 ?  487 ILE A O    13 
ATOM   9147  C CB   . ILE A 1 16 ? -1.328  -2.103  -8.796  1.00 15.00 ?  487 ILE A CB   13 
ATOM   9148  C CG1  . ILE A 1 16 ? -0.912  -1.208  -9.964  1.00 15.00 ?  487 ILE A CG1  13 
ATOM   9149  C CG2  . ILE A 1 16 ? -2.718  -1.733  -8.302  1.00 15.00 ?  487 ILE A CG2  13 
ATOM   9150  C CD1  . ILE A 1 16 ? -1.833  -1.302  -11.157 1.00 15.00 ?  487 ILE A CD1  13 
ATOM   9151  H H    . ILE A 1 16 ? 0.038   0.069   -7.887  1.00 15.00 ?  487 ILE A H    13 
ATOM   9152  H HA   . ILE A 1 16 ? -0.698  -2.557  -6.809  1.00 15.00 ?  487 ILE A HA   13 
ATOM   9153  H HB   . ILE A 1 16 ? -1.354  -3.130  -9.132  1.00 15.00 ?  487 ILE A HB   13 
ATOM   9154  H HG12 . ILE A 1 16 ? -0.903  -0.180  -9.634  1.00 15.00 ?  487 ILE A HG12 13 
ATOM   9155  H HG13 . ILE A 1 16 ? 0.081   -1.487  -10.286 1.00 15.00 ?  487 ILE A HG13 13 
ATOM   9156  H HG21 . ILE A 1 16 ? -3.018  -2.419  -7.523  1.00 15.00 ?  487 ILE A HG21 13 
ATOM   9157  H HG22 . ILE A 1 16 ? -3.419  -1.789  -9.121  1.00 15.00 ?  487 ILE A HG22 13 
ATOM   9158  H HG23 . ILE A 1 16 ? -2.706  -0.726  -7.911  1.00 15.00 ?  487 ILE A HG23 13 
ATOM   9159  H HD11 . ILE A 1 16 ? -2.832  -1.013  -10.864 1.00 15.00 ?  487 ILE A HD11 13 
ATOM   9160  H HD12 . ILE A 1 16 ? -1.846  -2.318  -11.522 1.00 15.00 ?  487 ILE A HD12 13 
ATOM   9161  H HD13 . ILE A 1 16 ? -1.481  -0.645  -11.937 1.00 15.00 ?  487 ILE A HD13 13 
ATOM   9162  N N    . ALA A 1 17 ? 1.065   -3.965  -7.904  1.00 15.00 ?  488 ALA A N    13 
ATOM   9163  C CA   . ALA A 1 17 ? 2.173   -4.773  -8.383  1.00 15.00 ?  488 ALA A CA   13 
ATOM   9164  C C    . ALA A 1 17 ? 1.863   -5.260  -9.797  1.00 15.00 ?  488 ALA A C    13 
ATOM   9165  O O    . ALA A 1 17 ? 0.695   -5.423  -10.142 1.00 15.00 ?  488 ALA A O    13 
ATOM   9166  C CB   . ALA A 1 17 ? 2.417   -5.947  -7.441  1.00 15.00 ?  488 ALA A CB   13 
ATOM   9167  H H    . ALA A 1 17 ? 0.337   -4.405  -7.405  1.00 15.00 ?  488 ALA A H    13 
ATOM   9168  H HA   . ALA A 1 17 ? 3.056   -4.162  -8.403  1.00 15.00 ?  488 ALA A HA   13 
ATOM   9169  H HB1  . ALA A 1 17 ? 2.653   -5.576  -6.453  1.00 15.00 ?  488 ALA A HB1  13 
ATOM   9170  H HB2  . ALA A 1 17 ? 3.244   -6.535  -7.809  1.00 15.00 ?  488 ALA A HB2  13 
ATOM   9171  H HB3  . ALA A 1 17 ? 1.531   -6.562  -7.392  1.00 15.00 ?  488 ALA A HB3  13 
ATOM   9172  N N    . PRO A 1 18 ? 2.897   -5.475  -10.638 1.00 15.00 ?  489 PRO A N    13 
ATOM   9173  C CA   . PRO A 1 18 ? 2.729   -5.812  -12.071 1.00 15.00 ?  489 PRO A CA   13 
ATOM   9174  C C    . PRO A 1 18 ? 1.917   -7.088  -12.338 1.00 15.00 ?  489 PRO A C    13 
ATOM   9175  O O    . PRO A 1 18 ? 1.665   -7.443  -13.492 1.00 15.00 ?  489 PRO A O    13 
ATOM   9176  C CB   . PRO A 1 18 ? 4.165   -5.999  -12.569 1.00 15.00 ?  489 PRO A CB   13 
ATOM   9177  C CG   . PRO A 1 18 ? 5.014   -5.262  -11.591 1.00 15.00 ?  489 PRO A CG   13 
ATOM   9178  C CD   . PRO A 1 18 ? 4.322   -5.394  -10.265 1.00 15.00 ?  489 PRO A CD   13 
ATOM   9179  H HA   . PRO A 1 18 ? 2.275   -4.993  -12.609 1.00 15.00 ?  489 PRO A HA   13 
ATOM   9180  H HB2  . PRO A 1 18 ? 4.405   -7.052  -12.589 1.00 15.00 ?  489 PRO A HB2  13 
ATOM   9181  H HB3  . PRO A 1 18 ? 4.258   -5.586  -13.563 1.00 15.00 ?  489 PRO A HB3  13 
ATOM   9182  H HG2  . PRO A 1 18 ? 5.997   -5.707  -11.547 1.00 15.00 ?  489 PRO A HG2  13 
ATOM   9183  H HG3  . PRO A 1 18 ? 5.083   -4.222  -11.874 1.00 15.00 ?  489 PRO A HG3  13 
ATOM   9184  H HD2  . PRO A 1 18 ? 4.641   -6.294  -9.758  1.00 15.00 ?  489 PRO A HD2  13 
ATOM   9185  H HD3  . PRO A 1 18 ? 4.510   -4.526  -9.650  1.00 15.00 ?  489 PRO A HD3  13 
ATOM   9186  N N    . ASN A 1 19 ? 1.530   -7.787  -11.285 1.00 15.00 ?  490 ASN A N    13 
ATOM   9187  C CA   . ASN A 1 19 ? 0.684   -8.968  -11.418 1.00 15.00 ?  490 ASN A CA   13 
ATOM   9188  C C    . ASN A 1 19 ? -0.741  -8.659  -10.957 1.00 15.00 ?  490 ASN A C    13 
ATOM   9189  O O    . ASN A 1 19 ? -1.585  -9.553  -10.859 1.00 15.00 ?  490 ASN A O    13 
ATOM   9190  C CB   . ASN A 1 19 ? 1.272   -10.159 -10.641 1.00 15.00 ?  490 ASN A CB   13 
ATOM   9191  C CG   . ASN A 1 19 ? 1.530   -9.866  -9.176  1.00 15.00 ?  490 ASN A CG   13 
ATOM   9192  O OD1  . ASN A 1 19 ? 1.805   -8.729  -8.792  1.00 15.00 ?  490 ASN A OD1  13 
ATOM   9193  N ND2  . ASN A 1 19 ? 1.449   -10.892 -8.345  1.00 15.00 ?  490 ASN A ND2  13 
ATOM   9194  H H    . ASN A 1 19 ? 1.821   -7.504  -10.391 1.00 15.00 ?  490 ASN A H    13 
ATOM   9195  H HA   . ASN A 1 19 ? 0.652   -9.223  -12.469 1.00 15.00 ?  490 ASN A HA   13 
ATOM   9196  H HB2  . ASN A 1 19 ? 0.584   -10.987 -10.701 1.00 15.00 ?  490 ASN A HB2  13 
ATOM   9197  H HB3  . ASN A 1 19 ? 2.208   -10.446 -11.099 1.00 15.00 ?  490 ASN A HB3  13 
ATOM   9198  H HD21 . ASN A 1 19 ? 1.222   -11.780 -8.719  1.00 15.00 ?  490 ASN A HD21 13 
ATOM   9199  H HD22 . ASN A 1 19 ? 1.635   -10.734 -7.391  1.00 15.00 ?  490 ASN A HD22 13 
ATOM   9200  N N    . GLY A 1 20 ? -1.006  -7.380  -10.707 1.00 15.00 ?  491 GLY A N    13 
ATOM   9201  C CA   . GLY A 1 20 ? -2.351  -6.939  -10.390 1.00 15.00 ?  491 GLY A CA   13 
ATOM   9202  C C    . GLY A 1 20 ? -2.647  -6.940  -8.905  1.00 15.00 ?  491 GLY A C    13 
ATOM   9203  O O    . GLY A 1 20 ? -3.762  -7.252  -8.493  1.00 15.00 ?  491 GLY A O    13 
ATOM   9204  H H    . GLY A 1 20 ? -0.275  -6.722  -10.744 1.00 15.00 ?  491 GLY A H    13 
ATOM   9205  H HA2  . GLY A 1 20 ? -2.486  -5.938  -10.769 1.00 15.00 ?  491 GLY A HA2  13 
ATOM   9206  H HA3  . GLY A 1 20 ? -3.055  -7.594  -10.883 1.00 15.00 ?  491 GLY A HA3  13 
ATOM   9207  N N    . ARG A 1 21 ? -1.657  -6.598  -8.087  1.00 15.00 ?  492 ARG A N    13 
ATOM   9208  C CA   . ARG A 1 21 ? -1.841  -6.623  -6.640  1.00 15.00 ?  492 ARG A CA   13 
ATOM   9209  C C    . ARG A 1 21 ? -1.752  -5.217  -6.056  1.00 15.00 ?  492 ARG A C    13 
ATOM   9210  O O    . ARG A 1 21 ? -0.696  -4.602  -6.102  1.00 15.00 ?  492 ARG A O    13 
ATOM   9211  C CB   . ARG A 1 21 ? -0.786  -7.503  -5.961  1.00 15.00 ?  492 ARG A CB   13 
ATOM   9212  C CG   . ARG A 1 21 ? -0.516  -8.839  -6.639  1.00 15.00 ?  492 ARG A CG   13 
ATOM   9213  C CD   . ARG A 1 21 ? -1.790  -9.593  -7.011  1.00 15.00 ?  492 ARG A CD   13 
ATOM   9214  N NE   . ARG A 1 21 ? -2.855  -9.441  -6.019  1.00 15.00 ?  492 ARG A NE   13 
ATOM   9215  C CZ   . ARG A 1 21 ? -3.576  -10.452 -5.530  1.00 15.00 ?  492 ARG A CZ   13 
ATOM   9216  N NH1  . ARG A 1 21 ? -3.258  -11.708 -5.820  1.00 15.00 1  492 ARG A NH1  13 
ATOM   9217  N NH2  . ARG A 1 21 ? -4.608  -10.209 -4.733  1.00 15.00 ?  492 ARG A NH2  13 
ATOM   9218  H H    . ARG A 1 21 ? -0.795  -6.313  -8.463  1.00 15.00 ?  492 ARG A H    13 
ATOM   9219  H HA   . ARG A 1 21 ? -2.821  -7.027  -6.435  1.00 15.00 ?  492 ARG A HA   13 
ATOM   9220  H HB2  . ARG A 1 21 ? 0.144   -6.955  -5.931  1.00 15.00 ?  492 ARG A HB2  13 
ATOM   9221  H HB3  . ARG A 1 21 ? -1.101  -7.698  -4.947  1.00 15.00 ?  492 ARG A HB3  13 
ATOM   9222  H HG2  . ARG A 1 21 ? 0.054   -8.651  -7.541  1.00 15.00 ?  492 ARG A HG2  13 
ATOM   9223  H HG3  . ARG A 1 21 ? 0.070   -9.452  -5.969  1.00 15.00 ?  492 ARG A HG3  13 
ATOM   9224  H HD2  . ARG A 1 21 ? -2.147  -9.221  -7.958  1.00 15.00 ?  492 ARG A HD2  13 
ATOM   9225  H HD3  . ARG A 1 21 ? -1.551  -10.643 -7.108  1.00 15.00 ?  492 ARG A HD3  13 
ATOM   9226  H HE   . ARG A 1 21 ? -3.077  -8.524  -5.743  1.00 15.00 ?  492 ARG A HE   13 
ATOM   9227  H HH11 . ARG A 1 21 ? -2.472  -11.913 -6.406  1.00 15.00 ?  492 ARG A HH11 13 
ATOM   9228  H HH12 . ARG A 1 21 ? -3.815  -12.464 -5.451  1.00 15.00 ?  492 ARG A HH12 13 
ATOM   9229  H HH21 . ARG A 1 21 ? -4.857  -9.269  -4.493  1.00 15.00 ?  492 ARG A HH21 13 
ATOM   9230  H HH22 . ARG A 1 21 ? -5.151  -10.973 -4.369  1.00 15.00 ?  492 ARG A HH22 13 
ATOM   9231  N N    . PRO A 1 22 ? -2.846  -4.690  -5.500  1.00 15.00 ?  493 PRO A N    13 
ATOM   9232  C CA   . PRO A 1 22 ? -2.848  -3.373  -4.880  1.00 15.00 ?  493 PRO A CA   13 
ATOM   9233  C C    . PRO A 1 22 ? -2.497  -3.424  -3.393  1.00 15.00 ?  493 PRO A C    13 
ATOM   9234  O O    . PRO A 1 22 ? -3.182  -4.083  -2.609  1.00 15.00 ?  493 PRO A O    13 
ATOM   9235  C CB   . PRO A 1 22 ? -4.291  -2.911  -5.076  1.00 15.00 ?  493 PRO A CB   13 
ATOM   9236  C CG   . PRO A 1 22 ? -5.112  -4.164  -5.149  1.00 15.00 ?  493 PRO A CG   13 
ATOM   9237  C CD   . PRO A 1 22 ? -4.175  -5.314  -5.445  1.00 15.00 ?  493 PRO A CD   13 
ATOM   9238  H HA   . PRO A 1 22 ? -2.177  -2.695  -5.386  1.00 15.00 ?  493 PRO A HA   13 
ATOM   9239  H HB2  . PRO A 1 22 ? -4.588  -2.297  -4.239  1.00 15.00 ?  493 PRO A HB2  13 
ATOM   9240  H HB3  . PRO A 1 22 ? -4.367  -2.340  -5.988  1.00 15.00 ?  493 PRO A HB3  13 
ATOM   9241  H HG2  . PRO A 1 22 ? -5.607  -4.327  -4.204  1.00 15.00 ?  493 PRO A HG2  13 
ATOM   9242  H HG3  . PRO A 1 22 ? -5.843  -4.069  -5.938  1.00 15.00 ?  493 PRO A HG3  13 
ATOM   9243  H HD2  . PRO A 1 22 ? -4.217  -6.047  -4.653  1.00 15.00 ?  493 PRO A HD2  13 
ATOM   9244  H HD3  . PRO A 1 22 ? -4.426  -5.768  -6.392  1.00 15.00 ?  493 PRO A HD3  13 
ATOM   9245  N N    . PHE A 1 23 ? -1.418  -2.752  -3.012  1.00 15.00 ?  494 PHE A N    13 
ATOM   9246  C CA   . PHE A 1 23 ? -1.043  -2.673  -1.608  1.00 15.00 ?  494 PHE A CA   13 
ATOM   9247  C C    . PHE A 1 23 ? -1.283  -1.272  -1.065  1.00 15.00 ?  494 PHE A C    13 
ATOM   9248  O O    . PHE A 1 23 ? -1.073  -0.275  -1.762  1.00 15.00 ?  494 PHE A O    13 
ATOM   9249  C CB   . PHE A 1 23 ? 0.418   -3.108  -1.377  1.00 15.00 ?  494 PHE A CB   13 
ATOM   9250  C CG   . PHE A 1 23 ? 1.463   -2.395  -2.207  1.00 15.00 ?  494 PHE A CG   13 
ATOM   9251  C CD1  . PHE A 1 23 ? 1.831   -1.083  -1.933  1.00 15.00 ?  494 PHE A CD1  13 
ATOM   9252  C CD2  . PHE A 1 23 ? 2.090   -3.055  -3.249  1.00 15.00 ?  494 PHE A CD2  13 
ATOM   9253  C CE1  . PHE A 1 23 ? 2.801   -0.444  -2.690  1.00 15.00 ?  494 PHE A CE1  13 
ATOM   9254  C CE2  . PHE A 1 23 ? 3.059   -2.426  -4.006  1.00 15.00 ?  494 PHE A CE2  13 
ATOM   9255  C CZ   . PHE A 1 23 ? 3.415   -1.120  -3.727  1.00 15.00 ?  494 PHE A CZ   13 
ATOM   9256  H H    . PHE A 1 23 ? -0.869  -2.290  -3.686  1.00 15.00 ?  494 PHE A H    13 
ATOM   9257  H HA   . PHE A 1 23 ? -1.689  -3.354  -1.071  1.00 15.00 ?  494 PHE A HA   13 
ATOM   9258  H HB2  . PHE A 1 23 ? 0.665   -2.943  -0.340  1.00 15.00 ?  494 PHE A HB2  13 
ATOM   9259  H HB3  . PHE A 1 23 ? 0.498   -4.165  -1.588  1.00 15.00 ?  494 PHE A HB3  13 
ATOM   9260  H HD1  . PHE A 1 23 ? 1.356   -0.563  -1.115  1.00 15.00 ?  494 PHE A HD1  13 
ATOM   9261  H HD2  . PHE A 1 23 ? 1.818   -4.075  -3.465  1.00 15.00 ?  494 PHE A HD2  13 
ATOM   9262  H HE1  . PHE A 1 23 ? 3.080   0.582   -2.470  1.00 15.00 ?  494 PHE A HE1  13 
ATOM   9263  H HE2  . PHE A 1 23 ? 3.541   -2.958  -4.812  1.00 15.00 ?  494 PHE A HE2  13 
ATOM   9264  H HZ   . PHE A 1 23 ? 4.170   -0.627  -4.320  1.00 15.00 ?  494 PHE A HZ   13 
ATOM   9265  N N    . PHE A 1 24 ? -1.732  -1.208  0.177   1.00 15.00 ?  495 PHE A N    13 
ATOM   9266  C CA   . PHE A 1 24 ? -1.961  0.060   0.841   1.00 15.00 ?  495 PHE A CA   13 
ATOM   9267  C C    . PHE A 1 24 ? -0.835  0.330   1.829   1.00 15.00 ?  495 PHE A C    13 
ATOM   9268  O O    . PHE A 1 24 ? -0.594  -0.464  2.738   1.00 15.00 ?  495 PHE A O    13 
ATOM   9269  C CB   . PHE A 1 24 ? -3.307  0.062   1.577   1.00 15.00 ?  495 PHE A CB   13 
ATOM   9270  C CG   . PHE A 1 24 ? -4.470  -0.395  0.741   1.00 15.00 ?  495 PHE A CG   13 
ATOM   9271  C CD1  . PHE A 1 24 ? -5.090  0.475   -0.140  1.00 15.00 ?  495 PHE A CD1  13 
ATOM   9272  C CD2  . PHE A 1 24 ? -4.945  -1.693  0.843   1.00 15.00 ?  495 PHE A CD2  13 
ATOM   9273  C CE1  . PHE A 1 24 ? -6.163  0.059   -0.906  1.00 15.00 ?  495 PHE A CE1  13 
ATOM   9274  C CE2  . PHE A 1 24 ? -6.017  -2.116  0.080   1.00 15.00 ?  495 PHE A CE2  13 
ATOM   9275  C CZ   . PHE A 1 24 ? -6.628  -1.238  -0.795  1.00 15.00 ?  495 PHE A CZ   13 
ATOM   9276  H H    . PHE A 1 24 ? -1.908  -2.041  0.664   1.00 15.00 ?  495 PHE A H    13 
ATOM   9277  H HA   . PHE A 1 24 ? -1.965  0.836   0.089   1.00 15.00 ?  495 PHE A HA   13 
ATOM   9278  H HB2  . PHE A 1 24 ? -3.242  -0.587  2.436   1.00 15.00 ?  495 PHE A HB2  13 
ATOM   9279  H HB3  . PHE A 1 24 ? -3.518  1.067   1.912   1.00 15.00 ?  495 PHE A HB3  13 
ATOM   9280  H HD1  . PHE A 1 24 ? -4.728  1.488   -0.227  1.00 15.00 ?  495 PHE A HD1  13 
ATOM   9281  H HD2  . PHE A 1 24 ? -4.468  -2.380  1.527   1.00 15.00 ?  495 PHE A HD2  13 
ATOM   9282  H HE1  . PHE A 1 24 ? -6.638  0.747   -1.588  1.00 15.00 ?  495 PHE A HE1  13 
ATOM   9283  H HE2  . PHE A 1 24 ? -6.379  -3.129  0.169   1.00 15.00 ?  495 PHE A HE2  13 
ATOM   9284  H HZ   . PHE A 1 24 ? -7.467  -1.565  -1.392  1.00 15.00 ?  495 PHE A HZ   13 
ATOM   9285  N N    . ILE A 1 25 ? -0.133  1.434   1.638   1.00 15.00 ?  496 ILE A N    13 
ATOM   9286  C CA   . ILE A 1 25 ? 0.916   1.829   2.563   1.00 15.00 ?  496 ILE A CA   13 
ATOM   9287  C C    . ILE A 1 25 ? 0.486   3.053   3.338   1.00 15.00 ?  496 ILE A C    13 
ATOM   9288  O O    . ILE A 1 25 ? 0.254   4.114   2.765   1.00 15.00 ?  496 ILE A O    13 
ATOM   9289  C CB   . ILE A 1 25 ? 2.259   2.123   1.858   1.00 15.00 ?  496 ILE A CB   13 
ATOM   9290  C CG1  . ILE A 1 25 ? 2.616   1.004   0.871   1.00 15.00 ?  496 ILE A CG1  13 
ATOM   9291  C CG2  . ILE A 1 25 ? 3.364   2.308   2.891   1.00 15.00 ?  496 ILE A CG2  13 
ATOM   9292  C CD1  . ILE A 1 25 ? 4.033   1.066   0.355   1.00 15.00 ?  496 ILE A CD1  13 
ATOM   9293  H H    . ILE A 1 25 ? -0.330  2.001   0.860   1.00 15.00 ?  496 ILE A H    13 
ATOM   9294  H HA   . ILE A 1 25 ? 1.069   1.033   3.258   1.00 15.00 ?  496 ILE A HA   13 
ATOM   9295  H HB   . ILE A 1 25 ? 2.157   3.050   1.316   1.00 15.00 ?  496 ILE A HB   13 
ATOM   9296  H HG12 . ILE A 1 25 ? 2.478   0.047   1.349   1.00 15.00 ?  496 ILE A HG12 13 
ATOM   9297  H HG13 . ILE A 1 25 ? 1.962   1.072   0.013   1.00 15.00 ?  496 ILE A HG13 13 
ATOM   9298  H HG21 . ILE A 1 25 ? 3.478   1.398   3.463   1.00 15.00 ?  496 ILE A HG21 13 
ATOM   9299  H HG22 . ILE A 1 25 ? 3.103   3.119   3.554   1.00 15.00 ?  496 ILE A HG22 13 
ATOM   9300  H HG23 . ILE A 1 25 ? 4.292   2.537   2.388   1.00 15.00 ?  496 ILE A HG23 13 
ATOM   9301  H HD11 . ILE A 1 25 ? 4.192   2.007   -0.150  1.00 15.00 ?  496 ILE A HD11 13 
ATOM   9302  H HD12 . ILE A 1 25 ? 4.199   0.253   -0.337  1.00 15.00 ?  496 ILE A HD12 13 
ATOM   9303  H HD13 . ILE A 1 25 ? 4.723   0.981   1.182   1.00 15.00 ?  496 ILE A HD13 13 
ATOM   9304  N N    . ASP A 1 26 ? 0.358   2.914   4.641   1.00 15.00 ?  497 ASP A N    13 
ATOM   9305  C CA   . ASP A 1 26 ? 0.070   4.063   5.463   1.00 15.00 ?  497 ASP A CA   13 
ATOM   9306  C C    . ASP A 1 26 ? 1.385   4.677   5.888   1.00 15.00 ?  497 ASP A C    13 
ATOM   9307  O O    . ASP A 1 26 ? 2.235   4.033   6.506   1.00 15.00 ?  497 ASP A O    13 
ATOM   9308  C CB   . ASP A 1 26 ? -0.805  3.714   6.668   1.00 15.00 ?  497 ASP A CB   13 
ATOM   9309  C CG   . ASP A 1 26 ? -0.093  2.893   7.719   1.00 15.00 ?  497 ASP A CG   13 
ATOM   9310  O OD1  . ASP A 1 26 ? 0.046   1.669   7.534   1.00 15.00 ?  497 ASP A OD1  13 
ATOM   9311  O OD2  . ASP A 1 26 ? 0.320   3.473   8.744   1.00 15.00 -1 497 ASP A OD2  13 
ATOM   9312  H H    . ASP A 1 26 ? 0.468   2.028   5.055   1.00 15.00 ?  497 ASP A H    13 
ATOM   9313  H HA   . ASP A 1 26 ? -0.454  4.778   4.844   1.00 15.00 ?  497 ASP A HA   13 
ATOM   9314  H HB2  . ASP A 1 26 ? -1.139  4.631   7.127   1.00 15.00 ?  497 ASP A HB2  13 
ATOM   9315  H HB3  . ASP A 1 26 ? -1.664  3.158   6.325   1.00 15.00 ?  497 ASP A HB3  13 
ATOM   9316  N N    . HIS A 1 27 ? 1.559   5.924   5.519   1.00 15.00 ?  498 HIS A N    13 
ATOM   9317  C CA   . HIS A 1 27 ? 2.843   6.584   5.652   1.00 15.00 ?  498 HIS A CA   13 
ATOM   9318  C C    . HIS A 1 27 ? 3.162   6.950   7.092   1.00 15.00 ?  498 HIS A C    13 
ATOM   9319  O O    . HIS A 1 27 ? 4.287   7.353   7.396   1.00 15.00 ?  498 HIS A O    13 
ATOM   9320  C CB   . HIS A 1 27 ? 2.890   7.821   4.763   1.00 15.00 ?  498 HIS A CB   13 
ATOM   9321  C CG   . HIS A 1 27 ? 3.175   7.516   3.323   1.00 15.00 ?  498 HIS A CG   13 
ATOM   9322  N ND1  . HIS A 1 27 ? 4.428   7.683   2.768   1.00 15.00 ?  498 HIS A ND1  13 
ATOM   9323  C CD2  . HIS A 1 27 ? 2.376   7.072   2.311   1.00 15.00 ?  498 HIS A CD2  13 
ATOM   9324  C CE1  . HIS A 1 27 ? 4.386   7.364   1.492   1.00 15.00 ?  498 HIS A CE1  13 
ATOM   9325  N NE2  . HIS A 1 27 ? 3.165   7.005   1.197   1.00 15.00 ?  498 HIS A NE2  13 
ATOM   9326  H H    . HIS A 1 27 ? 0.796   6.416   5.138   1.00 15.00 ?  498 HIS A H    13 
ATOM   9327  H HA   . HIS A 1 27 ? 3.593   5.891   5.307   1.00 15.00 ?  498 HIS A HA   13 
ATOM   9328  H HB2  . HIS A 1 27 ? 1.937   8.328   4.813   1.00 15.00 ?  498 HIS A HB2  13 
ATOM   9329  H HB3  . HIS A 1 27 ? 3.663   8.483   5.122   1.00 15.00 ?  498 HIS A HB3  13 
ATOM   9330  H HD1  . HIS A 1 27 ? 5.236   7.994   3.248   1.00 15.00 ?  498 HIS A HD1  13 
ATOM   9331  H HD2  . HIS A 1 27 ? 1.328   6.755   2.374   1.00 15.00 ?  498 HIS A HD2  13 
ATOM   9332  H HE1  . HIS A 1 27 ? 5.224   7.346   0.807   1.00 15.00 ?  498 HIS A HE1  13 
ATOM   9333  H HE2  . HIS A 1 27 ? 2.886   6.640   0.317   1.00 15.00 ?  498 HIS A HE2  13 
ATOM   9334  N N    . ASN A 1 28 ? 2.189   6.816   7.979   1.00 15.00 ?  499 ASN A N    13 
ATOM   9335  C CA   . ASN A 1 28 ? 2.413   7.142   9.375   1.00 15.00 ?  499 ASN A CA   13 
ATOM   9336  C C    . ASN A 1 28 ? 3.181   6.025   10.084  1.00 15.00 ?  499 ASN A C    13 
ATOM   9337  O O    . ASN A 1 28 ? 4.168   6.299   10.764  1.00 15.00 ?  499 ASN A O    13 
ATOM   9338  C CB   . ASN A 1 28 ? 1.099   7.486   10.097  1.00 15.00 ?  499 ASN A CB   13 
ATOM   9339  C CG   . ASN A 1 28 ? 0.043   6.404   9.995   1.00 15.00 ?  499 ASN A CG   13 
ATOM   9340  O OD1  . ASN A 1 28 ? -0.044  5.526   10.853  1.00 15.00 ?  499 ASN A OD1  13 
ATOM   9341  N ND2  . ASN A 1 28 ? -0.777  6.462   8.951   1.00 15.00 ?  499 ASN A ND2  13 
ATOM   9342  H H    . ASN A 1 28 ? 1.306   6.501   7.688   1.00 15.00 ?  499 ASN A H    13 
ATOM   9343  H HA   . ASN A 1 28 ? 3.040   8.023   9.387   1.00 15.00 ?  499 ASN A HA   13 
ATOM   9344  H HB2  . ASN A 1 28 ? 1.309   7.649   11.143  1.00 15.00 ?  499 ASN A HB2  13 
ATOM   9345  H HB3  . ASN A 1 28 ? 0.697   8.396   9.675   1.00 15.00 ?  499 ASN A HB3  13 
ATOM   9346  H HD21 . ASN A 1 28 ? -0.661  7.199   8.300   1.00 15.00 ?  499 ASN A HD21 13 
ATOM   9347  H HD22 . ASN A 1 28 ? -1.472  5.770   8.871   1.00 15.00 ?  499 ASN A HD22 13 
ATOM   9348  N N    . THR A 1 29 ? 2.741   4.775   9.952   1.00 15.00 ?  500 THR A N    13 
ATOM   9349  C CA   . THR A 1 29 ? 3.537   3.659   10.457  1.00 15.00 ?  500 THR A CA   13 
ATOM   9350  C C    . THR A 1 29 ? 4.650   3.304   9.470   1.00 15.00 ?  500 THR A C    13 
ATOM   9351  O O    . THR A 1 29 ? 5.668   2.722   9.852   1.00 15.00 ?  500 THR A O    13 
ATOM   9352  C CB   . THR A 1 29 ? 2.693   2.400   10.741  1.00 15.00 ?  500 THR A CB   13 
ATOM   9353  O OG1  . THR A 1 29 ? 2.164   1.872   9.522   1.00 15.00 ?  500 THR A OG1  13 
ATOM   9354  C CG2  . THR A 1 29 ? 1.556   2.712   11.703  1.00 15.00 ?  500 THR A CG2  13 
ATOM   9355  H H    . THR A 1 29 ? 1.870   4.600   9.524   1.00 15.00 ?  500 THR A H    13 
ATOM   9356  H HA   . THR A 1 29 ? 3.989   3.977   11.387  1.00 15.00 ?  500 THR A HA   13 
ATOM   9357  H HB   . THR A 1 29 ? 3.330   1.656   11.195  1.00 15.00 ?  500 THR A HB   13 
ATOM   9358  H HG1  . THR A 1 29 ? 1.408   2.418   9.233   1.00 15.00 ?  500 THR A HG1  13 
ATOM   9359  H HG21 . THR A 1 29 ? 0.978   1.816   11.879  1.00 15.00 ?  500 THR A HG21 13 
ATOM   9360  H HG22 . THR A 1 29 ? 0.919   3.473   11.276  1.00 15.00 ?  500 THR A HG22 13 
ATOM   9361  H HG23 . THR A 1 29 ? 1.964   3.067   12.638  1.00 15.00 ?  500 THR A HG23 13 
ATOM   9362  N N    . LYS A 1 30 ? 4.429   3.659   8.198   1.00 15.00 ?  501 LYS A N    13 
ATOM   9363  C CA   . LYS A 1 30 ? 5.338   3.319   7.101   1.00 15.00 ?  501 LYS A CA   13 
ATOM   9364  C C    . LYS A 1 30 ? 5.334   1.803   6.892   1.00 15.00 ?  501 LYS A C    13 
ATOM   9365  O O    . LYS A 1 30 ? 6.377   1.153   6.846   1.00 15.00 ?  501 LYS A O    13 
ATOM   9366  C CB   . LYS A 1 30 ? 6.758   3.869   7.352   1.00 15.00 ?  501 LYS A CB   13 
ATOM   9367  C CG   . LYS A 1 30 ? 7.595   4.021   6.083   1.00 15.00 ?  501 LYS A CG   13 
ATOM   9368  C CD   . LYS A 1 30 ? 8.525   2.837   5.852   1.00 15.00 ?  501 LYS A CD   13 
ATOM   9369  C CE   . LYS A 1 30 ? 9.951   3.143   6.276   1.00 15.00 ?  501 LYS A CE   13 
ATOM   9370  N NZ   . LYS A 1 30 ? 10.619  4.086   5.340   1.00 15.00 1  501 LYS A NZ   13 
ATOM   9371  H H    . LYS A 1 30 ? 3.610   4.157   7.988   1.00 15.00 ?  501 LYS A H    13 
ATOM   9372  H HA   . LYS A 1 30 ? 4.941   3.781   6.205   1.00 15.00 ?  501 LYS A HA   13 
ATOM   9373  H HB2  . LYS A 1 30 ? 6.677   4.839   7.820   1.00 15.00 ?  501 LYS A HB2  13 
ATOM   9374  H HB3  . LYS A 1 30 ? 7.277   3.199   8.023   1.00 15.00 ?  501 LYS A HB3  13 
ATOM   9375  H HG2  . LYS A 1 30 ? 6.930   4.104   5.238   1.00 15.00 ?  501 LYS A HG2  13 
ATOM   9376  H HG3  . LYS A 1 30 ? 8.188   4.922   6.162   1.00 15.00 ?  501 LYS A HG3  13 
ATOM   9377  H HD2  . LYS A 1 30 ? 8.165   1.995   6.421   1.00 15.00 ?  501 LYS A HD2  13 
ATOM   9378  H HD3  . LYS A 1 30 ? 8.518   2.590   4.800   1.00 15.00 ?  501 LYS A HD3  13 
ATOM   9379  H HE2  . LYS A 1 30 ? 9.930   3.584   7.260   1.00 15.00 ?  501 LYS A HE2  13 
ATOM   9380  H HE3  . LYS A 1 30 ? 10.511  2.219   6.306   1.00 15.00 ?  501 LYS A HE3  13 
ATOM   9381  H HZ1  . LYS A 1 30 ? 11.543  4.384   5.724   1.00 15.00 ?  501 LYS A HZ1  13 
ATOM   9382  H HZ2  . LYS A 1 30 ? 10.029  4.929   5.194   1.00 15.00 ?  501 LYS A HZ2  13 
ATOM   9383  H HZ3  . LYS A 1 30 ? 10.775  3.624   4.419   1.00 15.00 ?  501 LYS A HZ3  13 
ATOM   9384  N N    . THR A 1 31 ? 4.139   1.244   6.787   1.00 15.00 ?  502 THR A N    13 
ATOM   9385  C CA   . THR A 1 31 ? 3.983   -0.191  6.617   1.00 15.00 ?  502 THR A CA   13 
ATOM   9386  C C    . THR A 1 31 ? 3.110   -0.499  5.405   1.00 15.00 ?  502 THR A C    13 
ATOM   9387  O O    . THR A 1 31 ? 2.071   0.133   5.198   1.00 15.00 ?  502 THR A O    13 
ATOM   9388  C CB   . THR A 1 31 ? 3.342   -0.831  7.861   1.00 15.00 ?  502 THR A CB   13 
ATOM   9389  O OG1  . THR A 1 31 ? 3.860   -0.223  9.052   1.00 15.00 ?  502 THR A OG1  13 
ATOM   9390  C CG2  . THR A 1 31 ? 3.608   -2.332  7.897   1.00 15.00 ?  502 THR A CG2  13 
ATOM   9391  H H    . THR A 1 31 ? 3.338   1.812   6.805   1.00 15.00 ?  502 THR A H    13 
ATOM   9392  H HA   . THR A 1 31 ? 4.963   -0.626  6.472   1.00 15.00 ?  502 THR A HA   13 
ATOM   9393  H HB   . THR A 1 31 ? 2.277   -0.673  7.816   1.00 15.00 ?  502 THR A HB   13 
ATOM   9394  H HG1  . THR A 1 31 ? 3.444   0.649   9.168   1.00 15.00 ?  502 THR A HG1  13 
ATOM   9395  H HG21 . THR A 1 31 ? 4.673   -2.509  7.916   1.00 15.00 ?  502 THR A HG21 13 
ATOM   9396  H HG22 . THR A 1 31 ? 3.183   -2.793  7.019   1.00 15.00 ?  502 THR A HG22 13 
ATOM   9397  H HG23 . THR A 1 31 ? 3.155   -2.758  8.782   1.00 15.00 ?  502 THR A HG23 13 
ATOM   9398  N N    . THR A 1 32 ? 3.542   -1.460  4.609   1.00 15.00 ?  503 THR A N    13 
ATOM   9399  C CA   . THR A 1 32 ? 2.770   -1.917  3.466   1.00 15.00 ?  503 THR A CA   13 
ATOM   9400  C C    . THR A 1 32 ? 1.859   -3.056  3.901   1.00 15.00 ?  503 THR A C    13 
ATOM   9401  O O    . THR A 1 32 ? 2.276   -3.927  4.662   1.00 15.00 ?  503 THR A O    13 
ATOM   9402  C CB   . THR A 1 32 ? 3.696   -2.418  2.339   1.00 15.00 ?  503 THR A CB   13 
ATOM   9403  O OG1  . THR A 1 32 ? 4.847   -1.569  2.240   1.00 15.00 ?  503 THR A OG1  13 
ATOM   9404  C CG2  . THR A 1 32 ? 2.967   -2.443  1.007   1.00 15.00 ?  503 THR A CG2  13 
ATOM   9405  H H    . THR A 1 32 ? 4.404   -1.878  4.797   1.00 15.00 ?  503 THR A H    13 
ATOM   9406  H HA   . THR A 1 32 ? 2.175   -1.095  3.096   1.00 15.00 ?  503 THR A HA   13 
ATOM   9407  H HB   . THR A 1 32 ? 4.013   -3.420  2.569   1.00 15.00 ?  503 THR A HB   13 
ATOM   9408  H HG1  . THR A 1 32 ? 5.576   -2.065  1.854   1.00 15.00 ?  503 THR A HG1  13 
ATOM   9409  H HG21 . THR A 1 32 ? 2.123   -3.112  1.072   1.00 15.00 ?  503 THR A HG21 13 
ATOM   9410  H HG22 . THR A 1 32 ? 3.639   -2.786  0.235   1.00 15.00 ?  503 THR A HG22 13 
ATOM   9411  H HG23 . THR A 1 32 ? 2.620   -1.449  0.767   1.00 15.00 ?  503 THR A HG23 13 
ATOM   9412  N N    . THR A 1 33 ? 0.618   -3.045  3.450   1.00 15.00 ?  504 THR A N    13 
ATOM   9413  C CA   . THR A 1 33 ? -0.295  -4.122  3.782   1.00 15.00 ?  504 THR A CA   13 
ATOM   9414  C C    . THR A 1 33 ? -1.154  -4.508  2.582   1.00 15.00 ?  504 THR A C    13 
ATOM   9415  O O    . THR A 1 33 ? -1.439  -3.681  1.712   1.00 15.00 ?  504 THR A O    13 
ATOM   9416  C CB   . THR A 1 33 ? -1.203  -3.752  4.977   1.00 15.00 ?  504 THR A CB   13 
ATOM   9417  O OG1  . THR A 1 33 ? -1.975  -4.892  5.377   1.00 15.00 ?  504 THR A OG1  13 
ATOM   9418  C CG2  . THR A 1 33 ? -2.140  -2.600  4.632   1.00 15.00 ?  504 THR A CG2  13 
ATOM   9419  H H    . THR A 1 33 ? 0.304   -2.295  2.897   1.00 15.00 ?  504 THR A H    13 
ATOM   9420  H HA   . THR A 1 33 ? 0.299   -4.977  4.068   1.00 15.00 ?  504 THR A HA   13 
ATOM   9421  H HB   . THR A 1 33 ? -0.574  -3.447  5.803   1.00 15.00 ?  504 THR A HB   13 
ATOM   9422  H HG1  . THR A 1 33 ? -1.806  -5.077  6.313   1.00 15.00 ?  504 THR A HG1  13 
ATOM   9423  H HG21 . THR A 1 33 ? -1.558  -1.728  4.371   1.00 15.00 ?  504 THR A HG21 13 
ATOM   9424  H HG22 . THR A 1 33 ? -2.763  -2.375  5.485   1.00 15.00 ?  504 THR A HG22 13 
ATOM   9425  H HG23 . THR A 1 33 ? -2.762  -2.880  3.796   1.00 15.00 ?  504 THR A HG23 13 
ATOM   9426  N N    . TRP A 1 34 ? -1.535  -5.776  2.537   1.00 15.00 ?  505 TRP A N    13 
ATOM   9427  C CA   . TRP A 1 34 ? -2.440  -6.275  1.513   1.00 15.00 ?  505 TRP A CA   13 
ATOM   9428  C C    . TRP A 1 34 ? -3.863  -6.288  2.045   1.00 15.00 ?  505 TRP A C    13 
ATOM   9429  O O    . TRP A 1 34 ? -4.811  -6.601  1.321   1.00 15.00 ?  505 TRP A O    13 
ATOM   9430  C CB   . TRP A 1 34 ? -2.056  -7.695  1.084   1.00 15.00 ?  505 TRP A CB   13 
ATOM   9431  C CG   . TRP A 1 34 ? -0.713  -7.803  0.434   1.00 15.00 ?  505 TRP A CG   13 
ATOM   9432  C CD1  . TRP A 1 34 ? 0.392   -8.428  0.932   1.00 15.00 ?  505 TRP A CD1  13 
ATOM   9433  C CD2  . TRP A 1 34 ? -0.335  -7.273  -0.840  1.00 15.00 ?  505 TRP A CD2  13 
ATOM   9434  N NE1  . TRP A 1 34 ? 1.430   -8.327  0.039   1.00 15.00 ?  505 TRP A NE1  13 
ATOM   9435  C CE2  . TRP A 1 34 ? 1.010   -7.621  -1.054  1.00 15.00 ?  505 TRP A CE2  13 
ATOM   9436  C CE3  . TRP A 1 34 ? -1.006  -6.542  -1.822  1.00 15.00 ?  505 TRP A CE3  13 
ATOM   9437  C CZ2  . TRP A 1 34 ? 1.699   -7.262  -2.209  1.00 15.00 ?  505 TRP A CZ2  13 
ATOM   9438  C CZ3  . TRP A 1 34 ? -0.322  -6.186  -2.965  1.00 15.00 ?  505 TRP A CZ3  13 
ATOM   9439  C CH2  . TRP A 1 34 ? 1.018   -6.547  -3.151  1.00 15.00 ?  505 TRP A CH2  13 
ATOM   9440  H H    . TRP A 1 34 ? -1.204  -6.395  3.219   1.00 15.00 ?  505 TRP A H    13 
ATOM   9441  H HA   . TRP A 1 34 ? -2.383  -5.614  0.660   1.00 15.00 ?  505 TRP A HA   13 
ATOM   9442  H HB2  . TRP A 1 34 ? -2.054  -8.336  1.952   1.00 15.00 ?  505 TRP A HB2  13 
ATOM   9443  H HB3  . TRP A 1 34 ? -2.794  -8.056  0.383   1.00 15.00 ?  505 TRP A HB3  13 
ATOM   9444  H HD1  . TRP A 1 34 ? 0.428   -8.931  1.887   1.00 15.00 ?  505 TRP A HD1  13 
ATOM   9445  H HE1  . TRP A 1 34 ? 2.332   -8.703  0.164   1.00 15.00 ?  505 TRP A HE1  13 
ATOM   9446  H HE3  . TRP A 1 34 ? -2.040  -6.253  -1.695  1.00 15.00 ?  505 TRP A HE3  13 
ATOM   9447  H HZ2  . TRP A 1 34 ? 2.732   -7.534  -2.367  1.00 15.00 ?  505 TRP A HZ2  13 
ATOM   9448  H HZ3  . TRP A 1 34 ? -0.823  -5.619  -3.735  1.00 15.00 ?  505 TRP A HZ3  13 
ATOM   9449  H HH2  . TRP A 1 34 ? 1.511   -6.247  -4.063  1.00 15.00 ?  505 TRP A HH2  13 
ATOM   9450  N N    . GLU A 1 35 ? -4.008  -5.958  3.322   1.00 15.00 ?  506 GLU A N    13 
ATOM   9451  C CA   . GLU A 1 35 ? -5.299  -6.049  3.979   1.00 15.00 ?  506 GLU A CA   13 
ATOM   9452  C C    . GLU A 1 35 ? -6.145  -4.838  3.694   1.00 15.00 ?  506 GLU A C    13 
ATOM   9453  O O    . GLU A 1 35 ? -5.676  -3.701  3.710   1.00 15.00 ?  506 GLU A O    13 
ATOM   9454  C CB   . GLU A 1 35 ? -5.139  -6.257  5.487   1.00 15.00 ?  506 GLU A CB   13 
ATOM   9455  C CG   . GLU A 1 35 ? -6.454  -6.560  6.194   1.00 15.00 ?  506 GLU A CG   13 
ATOM   9456  C CD   . GLU A 1 35 ? -7.178  -7.751  5.589   1.00 15.00 ?  506 GLU A CD   13 
ATOM   9457  O OE1  . GLU A 1 35 ? -7.780  -7.599  4.503   1.00 15.00 -1 506 GLU A OE1  13 
ATOM   9458  O OE2  . GLU A 1 35 ? -7.143  -8.844  6.185   1.00 15.00 ?  506 GLU A OE2  13 
ATOM   9459  H H    . GLU A 1 35 ? -3.232  -5.632  3.829   1.00 15.00 ?  506 GLU A H    13 
ATOM   9460  H HA   . GLU A 1 35 ? -5.817  -6.891  3.563   1.00 15.00 ?  506 GLU A HA   13 
ATOM   9461  H HB2  . GLU A 1 35 ? -4.463  -7.083  5.656   1.00 15.00 ?  506 GLU A HB2  13 
ATOM   9462  H HB3  . GLU A 1 35 ? -4.719  -5.363  5.921   1.00 15.00 ?  506 GLU A HB3  13 
ATOM   9463  H HG2  . GLU A 1 35 ? -6.250  -6.771  7.233   1.00 15.00 ?  506 GLU A HG2  13 
ATOM   9464  H HG3  . GLU A 1 35 ? -7.096  -5.693  6.123   1.00 15.00 ?  506 GLU A HG3  13 
ATOM   9465  N N    . ASP A 1 36 ? -7.410  -5.116  3.464   1.00 15.00 ?  507 ASP A N    13 
ATOM   9466  C CA   . ASP A 1 36 ? -8.353  -4.113  3.060   1.00 15.00 ?  507 ASP A CA   13 
ATOM   9467  C C    . ASP A 1 36 ? -9.014  -3.480  4.281   1.00 15.00 ?  507 ASP A C    13 
ATOM   9468  O O    . ASP A 1 36 ? -9.791  -4.136  4.976   1.00 15.00 ?  507 ASP A O    13 
ATOM   9469  C CB   . ASP A 1 36 ? -9.405  -4.739  2.140   1.00 15.00 ?  507 ASP A CB   13 
ATOM   9470  C CG   . ASP A 1 36 ? -10.518 -3.787  1.756   1.00 15.00 ?  507 ASP A CG   13 
ATOM   9471  O OD1  . ASP A 1 36 ? -11.487 -3.654  2.532   1.00 15.00 ?  507 ASP A OD1  13 
ATOM   9472  O OD2  . ASP A 1 36 ? -10.449 -3.200  0.656   1.00 15.00 -1 507 ASP A OD2  13 
ATOM   9473  H H    . ASP A 1 36 ? -7.725  -6.040  3.601   1.00 15.00 ?  507 ASP A H    13 
ATOM   9474  H HA   . ASP A 1 36 ? -7.802  -3.371  2.520   1.00 15.00 ?  507 ASP A HA   13 
ATOM   9475  H HB2  . ASP A 1 36 ? -8.924  -5.077  1.235   1.00 15.00 ?  507 ASP A HB2  13 
ATOM   9476  H HB3  . ASP A 1 36 ? -9.845  -5.589  2.642   1.00 15.00 ?  507 ASP A HB3  13 
ATOM   9477  N N    . PRO A 1 37 ? -8.688  -2.216  4.583   1.00 15.00 ?  508 PRO A N    13 
ATOM   9478  C CA   . PRO A 1 37 ? -9.248  -1.517  5.737   1.00 15.00 ?  508 PRO A CA   13 
ATOM   9479  C C    . PRO A 1 37 ? -10.661 -0.989  5.476   1.00 15.00 ?  508 PRO A C    13 
ATOM   9480  O O    . PRO A 1 37 ? -11.606 -1.330  6.193   1.00 15.00 ?  508 PRO A O    13 
ATOM   9481  C CB   . PRO A 1 37 ? -8.260  -0.370  5.962   1.00 15.00 ?  508 PRO A CB   13 
ATOM   9482  C CG   . PRO A 1 37 ? -7.667  -0.091  4.621   1.00 15.00 ?  508 PRO A CG   13 
ATOM   9483  C CD   . PRO A 1 37 ? -7.730  -1.376  3.834   1.00 15.00 ?  508 PRO A CD   13 
ATOM   9484  H HA   . PRO A 1 37 ? -9.264  -2.153  6.610   1.00 15.00 ?  508 PRO A HA   13 
ATOM   9485  H HB2  . PRO A 1 37 ? -8.784  0.492   6.349   1.00 15.00 ?  508 PRO A HB2  13 
ATOM   9486  H HB3  . PRO A 1 37 ? -7.503  -0.680  6.667   1.00 15.00 ?  508 PRO A HB3  13 
ATOM   9487  H HG2  . PRO A 1 37 ? -8.233  0.681   4.123   1.00 15.00 ?  508 PRO A HG2  13 
ATOM   9488  H HG3  . PRO A 1 37 ? -6.640  0.221   4.738   1.00 15.00 ?  508 PRO A HG3  13 
ATOM   9489  H HD2  . PRO A 1 37 ? -8.088  -1.184  2.834   1.00 15.00 ?  508 PRO A HD2  13 
ATOM   9490  H HD3  . PRO A 1 37 ? -6.755  -1.841  3.801   1.00 15.00 ?  508 PRO A HD3  13 
ATOM   9491  N N    . ARG A 1 38 ? -10.803 -0.185  4.430   1.00 15.00 ?  509 ARG A N    13 
ATOM   9492  C CA   . ARG A 1 38 ? -12.073 0.431   4.083   1.00 15.00 ?  509 ARG A CA   13 
ATOM   9493  C C    . ARG A 1 38 ? -12.060 0.830   2.614   1.00 15.00 ?  509 ARG A C    13 
ATOM   9494  O O    . ARG A 1 38 ? -12.717 0.147   1.805   1.00 15.00 ?  509 ARG A O    13 
ATOM   9495  C CB   . ARG A 1 38 ? -12.331 1.660   4.966   1.00 15.00 ?  509 ARG A CB   13 
ATOM   9496  C CG   . ARG A 1 38 ? -13.607 2.418   4.624   1.00 15.00 ?  509 ARG A CG   13 
ATOM   9497  C CD   . ARG A 1 38 ? -14.853 1.568   4.833   1.00 15.00 ?  509 ARG A CD   13 
ATOM   9498  N NE   . ARG A 1 38 ? -16.076 2.332   4.580   1.00 15.00 ?  509 ARG A NE   13 
ATOM   9499  C CZ   . ARG A 1 38 ? -17.285 1.981   5.018   1.00 15.00 ?  509 ARG A CZ   13 
ATOM   9500  N NH1  . ARG A 1 38 ? -17.465 0.833   5.659   1.00 15.00 1  509 ARG A NH1  13 
ATOM   9501  N NH2  . ARG A 1 38 ? -18.319 2.777   4.787   1.00 15.00 ?  509 ARG A NH2  13 
ATOM   9502  H H    . ARG A 1 38 ? -10.026 -0.008  3.861   1.00 15.00 ?  509 ARG A H    13 
ATOM   9503  H HA   . ARG A 1 38 ? -12.854 -0.296  4.245   1.00 15.00 ?  509 ARG A HA   13 
ATOM   9504  H HB2  . ARG A 1 38 ? -12.395 1.341   5.994   1.00 15.00 ?  509 ARG A HB2  13 
ATOM   9505  H HB3  . ARG A 1 38 ? -11.498 2.340   4.863   1.00 15.00 ?  509 ARG A HB3  13 
ATOM   9506  H HG2  . ARG A 1 38 ? -13.673 3.290   5.258   1.00 15.00 ?  509 ARG A HG2  13 
ATOM   9507  H HG3  . ARG A 1 38 ? -13.564 2.727   3.590   1.00 15.00 ?  509 ARG A HG3  13 
ATOM   9508  H HD2  . ARG A 1 38 ? -14.818 0.724   4.158   1.00 15.00 ?  509 ARG A HD2  13 
ATOM   9509  H HD3  . ARG A 1 38 ? -14.866 1.213   5.852   1.00 15.00 ?  509 ARG A HD3  13 
ATOM   9510  H HE   . ARG A 1 38 ? -15.987 3.170   4.067   1.00 15.00 ?  509 ARG A HE   13 
ATOM   9511  H HH11 . ARG A 1 38 ? -16.687 0.213   5.816   1.00 15.00 ?  509 ARG A HH11 13 
ATOM   9512  H HH12 . ARG A 1 38 ? -18.382 0.571   5.989   1.00 15.00 ?  509 ARG A HH12 13 
ATOM   9513  H HH21 . ARG A 1 38 ? -18.190 3.636   4.281   1.00 15.00 ?  509 ARG A HH21 13 
ATOM   9514  H HH22 . ARG A 1 38 ? -19.237 2.532   5.124   1.00 15.00 ?  509 ARG A HH22 13 
ATOM   9515  N N    . ARG B 2 1  ? -1.582  -16.941 1.276   1.00 15.00 ?  925 ARG B N    13 
ATOM   9516  C CA   . ARG B 2 1  ? -1.135  -15.690 1.925   1.00 15.00 ?  925 ARG B CA   13 
ATOM   9517  C C    . ARG B 2 1  ? -0.289  -14.873 0.964   1.00 15.00 ?  925 ARG B C    13 
ATOM   9518  O O    . ARG B 2 1  ? 0.747   -15.333 0.482   1.00 15.00 ?  925 ARG B O    13 
ATOM   9519  C CB   . ARG B 2 1  ? -0.331  -16.020 3.190   1.00 15.00 ?  925 ARG B CB   13 
ATOM   9520  C CG   . ARG B 2 1  ? 0.264   -14.809 3.906   1.00 15.00 ?  925 ARG B CG   13 
ATOM   9521  C CD   . ARG B 2 1  ? -0.805  -13.845 4.399   1.00 15.00 ?  925 ARG B CD   13 
ATOM   9522  N NE   . ARG B 2 1  ? -0.904  -12.654 3.554   1.00 15.00 ?  925 ARG B NE   13 
ATOM   9523  C CZ   . ARG B 2 1  ? -1.943  -11.814 3.563   1.00 15.00 ?  925 ARG B CZ   13 
ATOM   9524  N NH1  . ARG B 2 1  ? -2.976  -12.032 4.365   1.00 15.00 1  925 ARG B NH1  13 
ATOM   9525  N NH2  . ARG B 2 1  ? -1.942  -10.747 2.774   1.00 15.00 ?  925 ARG B NH2  13 
ATOM   9526  H H1   . ARG B 2 1  ? -2.259  -17.438 1.886   1.00 15.00 ?  925 ARG B H1   13 
ATOM   9527  H H2   . ARG B 2 1  ? -0.764  -17.565 1.101   1.00 15.00 ?  925 ARG B H2   13 
ATOM   9528  H H3   . ARG B 2 1  ? -2.040  -16.726 0.363   1.00 15.00 ?  925 ARG B H3   13 
ATOM   9529  H HA   . ARG B 2 1  ? -2.008  -15.116 2.198   1.00 15.00 ?  925 ARG B HA   13 
ATOM   9530  H HB2  . ARG B 2 1  ? -0.979  -16.534 3.884   1.00 15.00 ?  925 ARG B HB2  13 
ATOM   9531  H HB3  . ARG B 2 1  ? 0.480   -16.682 2.919   1.00 15.00 ?  925 ARG B HB3  13 
ATOM   9532  H HG2  . ARG B 2 1  ? 0.837   -15.153 4.754   1.00 15.00 ?  925 ARG B HG2  13 
ATOM   9533  H HG3  . ARG B 2 1  ? 0.916   -14.287 3.220   1.00 15.00 ?  925 ARG B HG3  13 
ATOM   9534  H HD2  . ARG B 2 1  ? -1.757  -14.354 4.402   1.00 15.00 ?  925 ARG B HD2  13 
ATOM   9535  H HD3  . ARG B 2 1  ? -0.558  -13.540 5.406   1.00 15.00 ?  925 ARG B HD3  13 
ATOM   9536  H HE   . ARG B 2 1  ? -0.145  -12.465 2.953   1.00 15.00 ?  925 ARG B HE   13 
ATOM   9537  H HH11 . ARG B 2 1  ? -2.988  -12.837 4.974   1.00 15.00 ?  925 ARG B HH11 13 
ATOM   9538  H HH12 . ARG B 2 1  ? -3.754  -11.395 4.374   1.00 15.00 ?  925 ARG B HH12 13 
ATOM   9539  H HH21 . ARG B 2 1  ? -1.166  -10.565 2.170   1.00 15.00 ?  925 ARG B HH21 13 
ATOM   9540  H HH22 . ARG B 2 1  ? -2.736  -10.117 2.775   1.00 15.00 ?  925 ARG B HH22 13 
ATOM   9541  N N    . LEU B 2 2  ? -0.744  -13.662 0.675   1.00 15.00 ?  926 LEU B N    13 
ATOM   9542  C CA   . LEU B 2 2  ? 0.019   -12.739 -0.154  1.00 15.00 ?  926 LEU B CA   13 
ATOM   9543  C C    . LEU B 2 2  ? 1.250   -12.264 0.603   1.00 15.00 ?  926 LEU B C    13 
ATOM   9544  O O    . LEU B 2 2  ? 1.129   -11.701 1.694   1.00 15.00 ?  926 LEU B O    13 
ATOM   9545  C CB   . LEU B 2 2  ? -0.826  -11.527 -0.565  1.00 15.00 ?  926 LEU B CB   13 
ATOM   9546  C CG   . LEU B 2 2  ? -1.904  -11.783 -1.625  1.00 15.00 ?  926 LEU B CG   13 
ATOM   9547  C CD1  . LEU B 2 2  ? -3.049  -12.614 -1.067  1.00 15.00 ?  926 LEU B CD1  13 
ATOM   9548  C CD2  . LEU B 2 2  ? -2.421  -10.462 -2.166  1.00 15.00 ?  926 LEU B CD2  13 
ATOM   9549  H H    . LEU B 2 2  ? -1.623  -13.385 1.021   1.00 15.00 ?  926 LEU B H    13 
ATOM   9550  H HA   . LEU B 2 2  ? 0.334   -13.270 -1.040  1.00 15.00 ?  926 LEU B HA   13 
ATOM   9551  H HB2  . LEU B 2 2  ? -1.310  -11.141 0.319   1.00 15.00 ?  926 LEU B HB2  13 
ATOM   9552  H HB3  . LEU B 2 2  ? -0.159  -10.769 -0.945  1.00 15.00 ?  926 LEU B HB3  13 
ATOM   9553  H HG   . LEU B 2 2  ? -1.466  -12.330 -2.446  1.00 15.00 ?  926 LEU B HG   13 
ATOM   9554  H HD11 . LEU B 2 2  ? -3.504  -12.091 -0.239  1.00 15.00 ?  926 LEU B HD11 13 
ATOM   9555  H HD12 . LEU B 2 2  ? -2.669  -13.566 -0.727  1.00 15.00 ?  926 LEU B HD12 13 
ATOM   9556  H HD13 . LEU B 2 2  ? -3.786  -12.775 -1.840  1.00 15.00 ?  926 LEU B HD13 13 
ATOM   9557  H HD21 . LEU B 2 2  ? -1.606  -9.909  -2.607  1.00 15.00 ?  926 LEU B HD21 13 
ATOM   9558  H HD22 . LEU B 2 2  ? -2.854  -9.886  -1.361  1.00 15.00 ?  926 LEU B HD22 13 
ATOM   9559  H HD23 . LEU B 2 2  ? -3.174  -10.653 -2.916  1.00 15.00 ?  926 LEU B HD23 13 
ATOM   9560  N N    . ASP B 2 3  ? 2.417   -12.502 0.027   1.00 15.00 ?  927 ASP B N    13 
ATOM   9561  C CA   . ASP B 2 3  ? 3.679   -12.118 0.652   1.00 15.00 ?  927 ASP B CA   13 
ATOM   9562  C C    . ASP B 2 3  ? 3.870   -10.608 0.573   1.00 15.00 ?  927 ASP B C    13 
ATOM   9563  O O    . ASP B 2 3  ? 3.642   -9.999  -0.472  1.00 15.00 ?  927 ASP B O    13 
ATOM   9564  C CB   . ASP B 2 3  ? 4.844   -12.837 -0.032  1.00 15.00 ?  927 ASP B CB   13 
ATOM   9565  C CG   . ASP B 2 3  ? 6.144   -12.698 0.735   1.00 15.00 ?  927 ASP B CG   13 
ATOM   9566  O OD1  . ASP B 2 3  ? 6.109   -12.770 1.983   1.00 15.00 ?  927 ASP B OD1  13 
ATOM   9567  O OD2  . ASP B 2 3  ? 7.207   -12.559 0.093   1.00 15.00 -1 927 ASP B OD2  13 
ATOM   9568  H H    . ASP B 2 3  ? 2.436   -12.944 -0.847  1.00 15.00 ?  927 ASP B H    13 
ATOM   9569  H HA   . ASP B 2 3  ? 3.640   -12.414 1.690   1.00 15.00 ?  927 ASP B HA   13 
ATOM   9570  H HB2  . ASP B 2 3  ? 4.610   -13.887 -0.118  1.00 15.00 ?  927 ASP B HB2  13 
ATOM   9571  H HB3  . ASP B 2 3  ? 4.982   -12.421 -1.019  1.00 15.00 ?  927 ASP B HB3  13 
ATOM   9572  N N    . LEU B 2 4  ? 4.289   -10.010 1.676   1.00 15.00 ?  928 LEU B N    13 
ATOM   9573  C CA   . LEU B 2 4  ? 4.425   -8.563  1.753   1.00 15.00 ?  928 LEU B CA   13 
ATOM   9574  C C    . LEU B 2 4  ? 5.881   -8.168  1.517   1.00 15.00 ?  928 LEU B C    13 
ATOM   9575  O O    . LEU B 2 4  ? 6.770   -8.576  2.267   1.00 15.00 ?  928 LEU B O    13 
ATOM   9576  C CB   . LEU B 2 4  ? 3.931   -8.080  3.130   1.00 15.00 ?  928 LEU B CB   13 
ATOM   9577  C CG   . LEU B 2 4  ? 3.669   -6.572  3.285   1.00 15.00 ?  928 LEU B CG   13 
ATOM   9578  C CD1  . LEU B 2 4  ? 4.966   -5.789  3.408   1.00 15.00 ?  928 LEU B CD1  13 
ATOM   9579  C CD2  . LEU B 2 4  ? 2.841   -6.050  2.121   1.00 15.00 ?  928 LEU B CD2  13 
ATOM   9580  H H    . LEU B 2 4  ? 4.539   -10.553 2.451   1.00 15.00 ?  928 LEU B H    13 
ATOM   9581  H HA   . LEU B 2 4  ? 3.810   -8.125  0.981   1.00 15.00 ?  928 LEU B HA   13 
ATOM   9582  H HB2  . LEU B 2 4  ? 3.010   -8.599  3.354   1.00 15.00 ?  928 LEU B HB2  13 
ATOM   9583  H HB3  . LEU B 2 4  ? 4.666   -8.366  3.867   1.00 15.00 ?  928 LEU B HB3  13 
ATOM   9584  H HG   . LEU B 2 4  ? 3.103   -6.411  4.191   1.00 15.00 ?  928 LEU B HG   13 
ATOM   9585  H HD11 . LEU B 2 4  ? 5.518   -6.140  4.266   1.00 15.00 ?  928 LEU B HD11 13 
ATOM   9586  H HD12 . LEU B 2 4  ? 4.742   -4.738  3.529   1.00 15.00 ?  928 LEU B HD12 13 
ATOM   9587  H HD13 . LEU B 2 4  ? 5.559   -5.932  2.515   1.00 15.00 ?  928 LEU B HD13 13 
ATOM   9588  H HD21 . LEU B 2 4  ? 2.651   -4.996  2.260   1.00 15.00 ?  928 LEU B HD21 13 
ATOM   9589  H HD22 . LEU B 2 4  ? 1.902   -6.583  2.080   1.00 15.00 ?  928 LEU B HD22 13 
ATOM   9590  H HD23 . LEU B 2 4  ? 3.382   -6.200  1.199   1.00 15.00 ?  928 LEU B HD23 13 
ATOM   9591  N N    . PRO B 2 5  ? 6.144   -7.365  0.472   1.00 15.00 ?  929 PRO B N    13 
ATOM   9592  C CA   . PRO B 2 5  ? 7.495   -6.917  0.153   1.00 15.00 ?  929 PRO B CA   13 
ATOM   9593  C C    . PRO B 2 5  ? 7.941   -5.748  1.030   1.00 15.00 ?  929 PRO B C    13 
ATOM   9594  O O    . PRO B 2 5  ? 7.205   -4.771  1.196   1.00 15.00 ?  929 PRO B O    13 
ATOM   9595  C CB   . PRO B 2 5  ? 7.387   -6.486  -1.311  1.00 15.00 ?  929 PRO B CB   13 
ATOM   9596  C CG   . PRO B 2 5  ? 5.962   -6.078  -1.501  1.00 15.00 ?  929 PRO B CG   13 
ATOM   9597  C CD   . PRO B 2 5  ? 5.145   -6.843  -0.488  1.00 15.00 ?  929 PRO B CD   13 
ATOM   9598  H HA   . PRO B 2 5  ? 8.207   -7.722  0.243   1.00 15.00 ?  929 PRO B HA   13 
ATOM   9599  H HB2  . PRO B 2 5  ? 8.059   -5.662  -1.494  1.00 15.00 ?  929 PRO B HB2  13 
ATOM   9600  H HB3  . PRO B 2 5  ? 7.645   -7.316  -1.952  1.00 15.00 ?  929 PRO B HB3  13 
ATOM   9601  H HG2  . PRO B 2 5  ? 5.857   -5.014  -1.339  1.00 15.00 ?  929 PRO B HG2  13 
ATOM   9602  H HG3  . PRO B 2 5  ? 5.645   -6.333  -2.500  1.00 15.00 ?  929 PRO B HG3  13 
ATOM   9603  H HD2  . PRO B 2 5  ? 4.450   -6.181  0.006   1.00 15.00 ?  929 PRO B HD2  13 
ATOM   9604  H HD3  . PRO B 2 5  ? 4.618   -7.650  -0.971  1.00 15.00 ?  929 PRO B HD3  13 
ATOM   9605  N N    . PRO B 2 6  ? 9.151   -5.845  1.615   1.00 15.00 ?  930 PRO B N    13 
ATOM   9606  C CA   . PRO B 2 6  ? 9.747   -4.755  2.396   1.00 15.00 ?  930 PRO B CA   13 
ATOM   9607  C C    . PRO B 2 6  ? 9.698   -3.441  1.628   1.00 15.00 ?  930 PRO B C    13 
ATOM   9608  O O    . PRO B 2 6  ? 10.037  -3.395  0.443   1.00 15.00 ?  930 PRO B O    13 
ATOM   9609  C CB   . PRO B 2 6  ? 11.191  -5.217  2.595   1.00 15.00 ?  930 PRO B CB   13 
ATOM   9610  C CG   . PRO B 2 6  ? 11.118  -6.702  2.546   1.00 15.00 ?  930 PRO B CG   13 
ATOM   9611  C CD   . PRO B 2 6  ? 10.031  -7.027  1.561   1.00 15.00 ?  930 PRO B CD   13 
ATOM   9612  H HA   . PRO B 2 6  ? 9.260   -4.636  3.353   1.00 15.00 ?  930 PRO B HA   13 
ATOM   9613  H HB2  . PRO B 2 6  ? 11.809  -4.824  1.801   1.00 15.00 ?  930 PRO B HB2  13 
ATOM   9614  H HB3  . PRO B 2 6  ? 11.555  -4.871  3.550   1.00 15.00 ?  930 PRO B HB3  13 
ATOM   9615  H HG2  . PRO B 2 6  ? 12.062  -7.107  2.210   1.00 15.00 ?  930 PRO B HG2  13 
ATOM   9616  H HG3  . PRO B 2 6  ? 10.866  -7.089  3.521   1.00 15.00 ?  930 PRO B HG3  13 
ATOM   9617  H HD2  . PRO B 2 6  ? 10.446  -7.153  0.572   1.00 15.00 ?  930 PRO B HD2  13 
ATOM   9618  H HD3  . PRO B 2 6  ? 9.500   -7.918  1.865   1.00 15.00 ?  930 PRO B HD3  13 
ATOM   9619  N N    . TYR B 2 7  ? 9.287   -2.376  2.295   1.00 15.00 ?  931 TYR B N    13 
ATOM   9620  C CA   . TYR B 2 7  ? 8.996   -1.141  1.597   1.00 15.00 ?  931 TYR B CA   13 
ATOM   9621  C C    . TYR B 2 7  ? 10.274  -0.378  1.270   1.00 15.00 ?  931 TYR B C    13 
ATOM   9622  O O    . TYR B 2 7  ? 11.032  0.022   2.155   1.00 15.00 ?  931 TYR B O    13 
ATOM   9623  C CB   . TYR B 2 7  ? 8.064   -0.295  2.478   1.00 15.00 ?  931 TYR B CB   13 
ATOM   9624  C CG   . TYR B 2 7  ? 7.633   1.046   1.907   1.00 15.00 ?  931 TYR B CG   13 
ATOM   9625  C CD1  . TYR B 2 7  ? 7.495   1.255   0.540   1.00 15.00 ?  931 TYR B CD1  13 
ATOM   9626  C CD2  . TYR B 2 7  ? 7.343   2.104   2.758   1.00 15.00 ?  931 TYR B CD2  13 
ATOM   9627  C CE1  . TYR B 2 7  ? 7.083   2.481   0.044   1.00 15.00 ?  931 TYR B CE1  13 
ATOM   9628  C CE2  . TYR B 2 7  ? 6.927   3.326   2.274   1.00 15.00 ?  931 TYR B CE2  13 
ATOM   9629  C CZ   . TYR B 2 7  ? 6.800   3.511   0.917   1.00 15.00 ?  931 TYR B CZ   13 
ATOM   9630  O OH   . TYR B 2 7  ? 6.376   4.728   0.435   1.00 15.00 ?  931 TYR B OH   13 
ATOM   9631  H H    . TYR B 2 7  ? 9.199   -2.416  3.274   1.00 15.00 ?  931 TYR B H    13 
ATOM   9632  H HA   . TYR B 2 7  ? 8.485   -1.386  0.680   1.00 15.00 ?  931 TYR B HA   13 
ATOM   9633  H HB2  . TYR B 2 7  ? 7.166   -0.861  2.671   1.00 15.00 ?  931 TYR B HB2  13 
ATOM   9634  H HB3  . TYR B 2 7  ? 8.560   -0.105  3.419   1.00 15.00 ?  931 TYR B HB3  13 
ATOM   9635  H HD1  . TYR B 2 7  ? 7.718   0.449   -0.142  1.00 15.00 ?  931 TYR B HD1  13 
ATOM   9636  H HD2  . TYR B 2 7  ? 7.442   1.963   3.823   1.00 15.00 ?  931 TYR B HD2  13 
ATOM   9637  H HE1  . TYR B 2 7  ? 6.984   2.625   -1.022  1.00 15.00 ?  931 TYR B HE1  13 
ATOM   9638  H HE2  . TYR B 2 7  ? 6.709   4.130   2.962   1.00 15.00 ?  931 TYR B HE2  13 
ATOM   9639  H HH   . TYR B 2 7  ? 5.523   4.613   -0.018  1.00 15.00 ?  931 TYR B HH   13 
ATOM   9640  N N    . GLU B 2 8  ? 10.487  -0.188  -0.019  1.00 15.00 ?  932 GLU B N    13 
ATOM   9641  C CA   . GLU B 2 8  ? 11.473  0.739   -0.536  1.00 15.00 ?  932 GLU B CA   13 
ATOM   9642  C C    . GLU B 2 8  ? 10.692  1.887   -1.149  1.00 15.00 ?  932 GLU B C    13 
ATOM   9643  O O    . GLU B 2 8  ? 9.786   1.632   -1.944  1.00 15.00 ?  932 GLU B O    13 
ATOM   9644  C CB   . GLU B 2 8  ? 12.351  0.044   -1.587  1.00 15.00 ?  932 GLU B CB   13 
ATOM   9645  C CG   . GLU B 2 8  ? 13.768  0.595   -1.695  1.00 15.00 ?  932 GLU B CG   13 
ATOM   9646  C CD   . GLU B 2 8  ? 13.828  2.024   -2.199  1.00 15.00 ?  932 GLU B CD   13 
ATOM   9647  O OE1  . GLU B 2 8  ? 13.801  2.228   -3.430  1.00 15.00 -1 932 GLU B OE1  13 
ATOM   9648  O OE2  . GLU B 2 8  ? 13.920  2.951   -1.365  1.00 15.00 ?  932 GLU B OE2  13 
ATOM   9649  H H    . GLU B 2 8  ? 9.950   -0.700  -0.659  1.00 15.00 ?  932 GLU B H    13 
ATOM   9650  H HA   . GLU B 2 8  ? 12.079  1.099   0.283   1.00 15.00 ?  932 GLU B HA   13 
ATOM   9651  H HB2  . GLU B 2 8  ? 12.418  -1.006  -1.340  1.00 15.00 ?  932 GLU B HB2  13 
ATOM   9652  H HB3  . GLU B 2 8  ? 11.876  0.143   -2.553  1.00 15.00 ?  932 GLU B HB3  13 
ATOM   9653  H HG2  . GLU B 2 8  ? 14.226  0.561   -0.718  1.00 15.00 ?  932 GLU B HG2  13 
ATOM   9654  H HG3  . GLU B 2 8  ? 14.330  -0.032  -2.373  1.00 15.00 ?  932 GLU B HG3  13 
ATOM   9655  N N    . THR B 2 9  ? 10.998  3.124   -0.788  1.00 15.00 ?  933 THR B N    13 
ATOM   9656  C CA   . THR B 2 9  ? 10.186  4.233   -1.250  1.00 15.00 ?  933 THR B CA   13 
ATOM   9657  C C    . THR B 2 9  ? 10.115  4.264   -2.778  1.00 15.00 ?  933 THR B C    13 
ATOM   9658  O O    . THR B 2 9  ? 11.122  4.385   -3.480  1.00 15.00 ?  933 THR B O    13 
ATOM   9659  C CB   . THR B 2 9  ? 10.684  5.587   -0.718  1.00 15.00 ?  933 THR B CB   13 
ATOM   9660  O OG1  . THR B 2 9  ? 10.912  5.497   0.699   1.00 15.00 ?  933 THR B OG1  13 
ATOM   9661  C CG2  . THR B 2 9  ? 9.652   6.673   -1.003  1.00 15.00 ?  933 THR B CG2  13 
ATOM   9662  H H    . THR B 2 9  ? 11.774  3.293   -0.210  1.00 15.00 ?  933 THR B H    13 
ATOM   9663  H HA   . THR B 2 9  ? 9.185   4.076   -0.870  1.00 15.00 ?  933 THR B HA   13 
ATOM   9664  H HB   . THR B 2 9  ? 11.609  5.842   -1.216  1.00 15.00 ?  933 THR B HB   13 
ATOM   9665  H HG1  . THR B 2 9  ? 11.384  6.289   1.000   1.00 15.00 ?  933 THR B HG1  13 
ATOM   9666  H HG21 . THR B 2 9  ? 9.516   6.770   -2.071  1.00 15.00 ?  933 THR B HG21 13 
ATOM   9667  H HG22 . THR B 2 9  ? 9.993   7.613   -0.596  1.00 15.00 ?  933 THR B HG22 13 
ATOM   9668  H HG23 . THR B 2 9  ? 8.709   6.404   -0.547  1.00 15.00 ?  933 THR B HG23 13 
ATOM   9669  N N    . PHE B 2 10 ? 8.898   4.148   -3.253  1.00 15.00 ?  934 PHE B N    13 
ATOM   9670  C CA   . PHE B 2 10 ? 8.569   4.141   -4.664  1.00 15.00 ?  934 PHE B CA   13 
ATOM   9671  C C    . PHE B 2 10 ? 8.287   5.582   -5.105  1.00 15.00 ?  934 PHE B C    13 
ATOM   9672  O O    . PHE B 2 10 ? 8.464   6.511   -4.315  1.00 15.00 ?  934 PHE B O    13 
ATOM   9673  C CB   . PHE B 2 10 ? 7.377   3.206   -4.936  1.00 15.00 ?  934 PHE B CB   13 
ATOM   9674  C CG   . PHE B 2 10 ? 6.091   3.767   -4.441  1.00 15.00 ?  934 PHE B CG   13 
ATOM   9675  C CD1  . PHE B 2 10 ? 5.376   4.617   -5.248  1.00 15.00 ?  934 PHE B CD1  13 
ATOM   9676  C CD2  . PHE B 2 10 ? 5.630   3.507   -3.166  1.00 15.00 ?  934 PHE B CD2  13 
ATOM   9677  C CE1  . PHE B 2 10 ? 4.225   5.203   -4.814  1.00 15.00 ?  934 PHE B CE1  13 
ATOM   9678  C CE2  . PHE B 2 10 ? 4.485   4.103   -2.720  1.00 15.00 ?  934 PHE B CE2  13 
ATOM   9679  C CZ   . PHE B 2 10 ? 3.784   4.952   -3.549  1.00 15.00 ?  934 PHE B CZ   13 
ATOM   9680  H H    . PHE B 2 10 ? 8.162   4.064   -2.612  1.00 15.00 ?  934 PHE B H    13 
ATOM   9681  H HA   . PHE B 2 10 ? 9.433   3.778   -5.202  1.00 15.00 ?  934 PHE B HA   13 
ATOM   9682  H HB2  . PHE B 2 10 ? 7.285   3.044   -6.000  1.00 15.00 ?  934 PHE B HB2  13 
ATOM   9683  H HB3  . PHE B 2 10 ? 7.545   2.260   -4.442  1.00 15.00 ?  934 PHE B HB3  13 
ATOM   9684  H HD1  . PHE B 2 10 ? 5.730   4.807   -6.247  1.00 15.00 ?  934 PHE B HD1  13 
ATOM   9685  H HD2  . PHE B 2 10 ? 6.172   2.833   -2.517  1.00 15.00 ?  934 PHE B HD2  13 
ATOM   9686  H HE1  . PHE B 2 10 ? 3.672   5.867   -5.461  1.00 15.00 ?  934 PHE B HE1  13 
ATOM   9687  H HE2  . PHE B 2 10 ? 4.124   3.901   -1.722  1.00 15.00 ?  934 PHE B HE2  13 
ATOM   9688  H HZ   . PHE B 2 10 ? 2.902   5.431   -3.198  1.00 15.00 ?  934 PHE B HZ   13 
ATOM   9689  N N    . GLU B 2 11 ? 7.934   5.763   -6.377  1.00 15.00 ?  935 GLU B N    13 
ATOM   9690  C CA   . GLU B 2 11 ? 7.706   7.093   -6.965  1.00 15.00 ?  935 GLU B CA   13 
ATOM   9691  C C    . GLU B 2 11 ? 6.797   7.992   -6.113  1.00 15.00 ?  935 GLU B C    13 
ATOM   9692  O O    . GLU B 2 11 ? 6.115   7.536   -5.200  1.00 15.00 ?  935 GLU B O    13 
ATOM   9693  C CB   . GLU B 2 11 ? 7.034   6.931   -8.333  1.00 15.00 ?  935 GLU B CB   13 
ATOM   9694  C CG   . GLU B 2 11 ? 5.719   6.146   -8.295  1.00 15.00 ?  935 GLU B CG   13 
ATOM   9695  C CD   . GLU B 2 11 ? 5.934   4.645   -8.413  1.00 15.00 ?  935 GLU B CD   13 
ATOM   9696  O OE1  . GLU B 2 11 ? 7.089   4.223   -8.650  1.00 15.00 ?  935 GLU B OE1  13 
ATOM   9697  O OE2  . GLU B 2 11 ? 4.955   3.882   -8.274  1.00 15.00 -1 935 GLU B OE2  13 
ATOM   9698  H H    . GLU B 2 11 ? 7.802   4.974   -6.948  1.00 15.00 ?  935 GLU B H    13 
ATOM   9699  H HA   . GLU B 2 11 ? 8.659   7.575   -7.099  1.00 15.00 ?  935 GLU B HA   13 
ATOM   9700  H HB2  . GLU B 2 11 ? 6.829   7.910   -8.736  1.00 15.00 ?  935 GLU B HB2  13 
ATOM   9701  H HB3  . GLU B 2 11 ? 7.716   6.416   -8.994  1.00 15.00 ?  935 GLU B HB3  13 
ATOM   9702  H HG2  . GLU B 2 11 ? 5.205   6.351   -7.351  1.00 15.00 ?  935 GLU B HG2  13 
ATOM   9703  H HG3  . GLU B 2 11 ? 5.099   6.472   -9.118  1.00 15.00 ?  935 GLU B HG3  13 
ATOM   9704  N N    . ASP B 2 12 ? 6.787   9.279   -6.454  1.00 15.00 ?  936 ASP B N    13 
ATOM   9705  C CA   . ASP B 2 12 ? 6.037   10.291  -5.706  1.00 15.00 ?  936 ASP B CA   13 
ATOM   9706  C C    . ASP B 2 12 ? 4.564   9.917   -5.558  1.00 15.00 ?  936 ASP B C    13 
ATOM   9707  O O    . ASP B 2 12 ? 3.847   9.756   -6.550  1.00 15.00 ?  936 ASP B O    13 
ATOM   9708  C CB   . ASP B 2 12 ? 6.156   11.647  -6.405  1.00 15.00 ?  936 ASP B CB   13 
ATOM   9709  C CG   . ASP B 2 12 ? 5.419   12.755  -5.678  1.00 15.00 ?  936 ASP B CG   13 
ATOM   9710  O OD1  . ASP B 2 12 ? 6.031   13.406  -4.804  1.00 15.00 -1 936 ASP B OD1  13 
ATOM   9711  O OD2  . ASP B 2 12 ? 4.233   12.999  -5.993  1.00 15.00 ?  936 ASP B OD2  13 
ATOM   9712  H H    . ASP B 2 12 ? 7.299   9.561   -7.244  1.00 15.00 ?  936 ASP B H    13 
ATOM   9713  H HA   . ASP B 2 12 ? 6.476   10.367  -4.722  1.00 15.00 ?  936 ASP B HA   13 
ATOM   9714  H HB2  . ASP B 2 12 ? 7.199   11.919  -6.469  1.00 15.00 ?  936 ASP B HB2  13 
ATOM   9715  H HB3  . ASP B 2 12 ? 5.750   11.563  -7.403  1.00 15.00 ?  936 ASP B HB3  13 
ATOM   9716  N N    . LEU B 2 13 ? 4.127   9.783   -4.313  1.00 15.00 ?  937 LEU B N    13 
ATOM   9717  C CA   . LEU B 2 13 ? 2.739   9.460   -4.008  1.00 15.00 ?  937 LEU B CA   13 
ATOM   9718  C C    . LEU B 2 13 ? 1.908   10.734  -3.882  1.00 15.00 ?  937 LEU B C    13 
ATOM   9719  O O    . LEU B 2 13 ? 0.704   10.734  -4.137  1.00 15.00 ?  937 LEU B O    13 
ATOM   9720  C CB   . LEU B 2 13 ? 2.627   8.567   -2.738  1.00 15.00 ?  937 LEU B CB   13 
ATOM   9721  C CG   . LEU B 2 13 ? 3.002   9.168   -1.357  1.00 15.00 ?  937 LEU B CG   13 
ATOM   9722  C CD1  . LEU B 2 13 ? 4.336   9.897   -1.379  1.00 15.00 ?  937 LEU B CD1  13 
ATOM   9723  C CD2  . LEU B 2 13 ? 1.897   10.067  -0.817  1.00 15.00 ?  937 LEU B CD2  13 
ATOM   9724  H H    . LEU B 2 13 ? 4.760   9.899   -3.575  1.00 15.00 ?  937 LEU B H    13 
ATOM   9725  H HA   . LEU B 2 13 ? 2.357   8.899   -4.850  1.00 15.00 ?  937 LEU B HA   13 
ATOM   9726  H HB2  . LEU B 2 13 ? 1.604   8.226   -2.667  1.00 15.00 ?  937 LEU B HB2  13 
ATOM   9727  H HB3  . LEU B 2 13 ? 3.252   7.700   -2.898  1.00 15.00 ?  937 LEU B HB3  13 
ATOM   9728  H HG   . LEU B 2 13 ? 3.108   8.348   -0.661  1.00 15.00 ?  937 LEU B HG   13 
ATOM   9729  H HD11 . LEU B 2 13 ? 5.120   9.203   -1.640  1.00 15.00 ?  937 LEU B HD11 13 
ATOM   9730  H HD12 . LEU B 2 13 ? 4.535   10.315  -0.402  1.00 15.00 ?  937 LEU B HD12 13 
ATOM   9731  H HD13 . LEU B 2 13 ? 4.301   10.691  -2.109  1.00 15.00 ?  937 LEU B HD13 13 
ATOM   9732  H HD21 . LEU B 2 13 ? 2.189   10.455  0.147   1.00 15.00 ?  937 LEU B HD21 13 
ATOM   9733  H HD22 . LEU B 2 13 ? 0.986   9.495   -0.715  1.00 15.00 ?  937 LEU B HD22 13 
ATOM   9734  H HD23 . LEU B 2 13 ? 1.733   10.887  -1.501  1.00 15.00 ?  937 LEU B HD23 13 
HETATM 9735  N N    . NH2 B 2 14 ? 2.554   11.820  -3.477  1.00 15.00 ?  938 NH2 B N    13 
HETATM 9736  H HN1  . NH2 B 2 14 ? 3.513   11.744  -3.292  1.00 15.00 ?  938 NH2 B HN1  13 
HETATM 9737  H HN2  . NH2 B 2 14 ? 2.046   12.652  -3.379  1.00 15.00 ?  938 NH2 B HN2  13 
ATOM   9738  N N    . PHE A 1 7  ? -11.819 7.678   -1.408  1.00 15.00 ?  478 PHE A N    14 
ATOM   9739  C CA   . PHE A 1 7  ? -10.503 7.035   -1.630  1.00 15.00 ?  478 PHE A CA   14 
ATOM   9740  C C    . PHE A 1 7  ? -9.818  6.749   -0.297  1.00 15.00 ?  478 PHE A C    14 
ATOM   9741  O O    . PHE A 1 7  ? -10.423 6.902   0.768   1.00 15.00 ?  478 PHE A O    14 
ATOM   9742  C CB   . PHE A 1 7  ? -9.609  7.918   -2.513  1.00 15.00 ?  478 PHE A CB   14 
ATOM   9743  C CG   . PHE A 1 7  ? -10.081 8.029   -3.936  1.00 15.00 ?  478 PHE A CG   14 
ATOM   9744  C CD1  . PHE A 1 7  ? -9.961  6.954   -4.804  1.00 15.00 ?  478 PHE A CD1  14 
ATOM   9745  C CD2  . PHE A 1 7  ? -10.635 9.207   -4.410  1.00 15.00 ?  478 PHE A CD2  14 
ATOM   9746  C CE1  . PHE A 1 7  ? -10.387 7.050   -6.115  1.00 15.00 ?  478 PHE A CE1  14 
ATOM   9747  C CE2  . PHE A 1 7  ? -11.063 9.309   -5.720  1.00 15.00 ?  478 PHE A CE2  14 
ATOM   9748  C CZ   . PHE A 1 7  ? -10.938 8.230   -6.573  1.00 15.00 ?  478 PHE A CZ   14 
ATOM   9749  H H    . PHE A 1 7  ? -11.698 8.590   -0.918  1.00 15.00 ?  478 PHE A H    14 
ATOM   9750  H HA   . PHE A 1 7  ? -10.674 6.093   -2.135  1.00 15.00 ?  478 PHE A HA   14 
ATOM   9751  H HB2  . PHE A 1 7  ? -9.578  8.911   -2.099  1.00 15.00 ?  478 PHE A HB2  14 
ATOM   9752  H HB3  . PHE A 1 7  ? -8.611  7.513   -2.527  1.00 15.00 ?  478 PHE A HB3  14 
ATOM   9753  H HD1  . PHE A 1 7  ? -9.530  6.029   -4.447  1.00 15.00 ?  478 PHE A HD1  14 
ATOM   9754  H HD2  . PHE A 1 7  ? -10.733 10.051  -3.745  1.00 15.00 ?  478 PHE A HD2  14 
ATOM   9755  H HE1  . PHE A 1 7  ? -10.286 6.207   -6.781  1.00 15.00 ?  478 PHE A HE1  14 
ATOM   9756  H HE2  . PHE A 1 7  ? -11.493 10.233  -6.076  1.00 15.00 ?  478 PHE A HE2  14 
ATOM   9757  H HZ   . PHE A 1 7  ? -11.272 8.309   -7.598  1.00 15.00 ?  478 PHE A HZ   14 
ATOM   9758  N N    . LEU A 1 8  ? -8.579  6.286   -0.363  1.00 15.00 ?  479 LEU A N    14 
ATOM   9759  C CA   . LEU A 1 8  ? -7.783  6.007   0.824   1.00 15.00 ?  479 LEU A CA   14 
ATOM   9760  C C    . LEU A 1 8  ? -7.460  7.289   1.608   1.00 15.00 ?  479 LEU A C    14 
ATOM   9761  O O    . LEU A 1 8  ? -7.341  8.372   1.028   1.00 15.00 ?  479 LEU A O    14 
ATOM   9762  C CB   . LEU A 1 8  ? -6.489  5.305   0.405   1.00 15.00 ?  479 LEU A CB   14 
ATOM   9763  C CG   . LEU A 1 8  ? -6.341  3.852   0.862   1.00 15.00 ?  479 LEU A CG   14 
ATOM   9764  C CD1  . LEU A 1 8  ? -7.458  2.991   0.301   1.00 15.00 ?  479 LEU A CD1  14 
ATOM   9765  C CD2  . LEU A 1 8  ? -4.994  3.295   0.432   1.00 15.00 ?  479 LEU A CD2  14 
ATOM   9766  H H    . LEU A 1 8  ? -8.187  6.101   -1.245  1.00 15.00 ?  479 LEU A H    14 
ATOM   9767  H HA   . LEU A 1 8  ? -8.351  5.345   1.458   1.00 15.00 ?  479 LEU A HA   14 
ATOM   9768  H HB2  . LEU A 1 8  ? -6.431  5.325   -0.674  1.00 15.00 ?  479 LEU A HB2  14 
ATOM   9769  H HB3  . LEU A 1 8  ? -5.656  5.869   0.801   1.00 15.00 ?  479 LEU A HB3  14 
ATOM   9770  H HG   . LEU A 1 8  ? -6.393  3.812   1.942   1.00 15.00 ?  479 LEU A HG   14 
ATOM   9771  H HD11 . LEU A 1 8  ? -8.412  3.392   0.610   1.00 15.00 ?  479 LEU A HD11 14 
ATOM   9772  H HD12 . LEU A 1 8  ? -7.352  1.982   0.671   1.00 15.00 ?  479 LEU A HD12 14 
ATOM   9773  H HD13 . LEU A 1 8  ? -7.398  2.988   -0.778  1.00 15.00 ?  479 LEU A HD13 14 
ATOM   9774  H HD21 . LEU A 1 8  ? -4.964  3.223   -0.646  1.00 15.00 ?  479 LEU A HD21 14 
ATOM   9775  H HD22 . LEU A 1 8  ? -4.852  2.317   0.866   1.00 15.00 ?  479 LEU A HD22 14 
ATOM   9776  H HD23 . LEU A 1 8  ? -4.208  3.954   0.767   1.00 15.00 ?  479 LEU A HD23 14 
ATOM   9777  N N    . PRO A 1 9  ? -7.353  7.165   2.949   1.00 15.00 ?  480 PRO A N    14 
ATOM   9778  C CA   . PRO A 1 9  ? -6.897  8.244   3.857   1.00 15.00 ?  480 PRO A CA   14 
ATOM   9779  C C    . PRO A 1 9  ? -5.662  9.006   3.339   1.00 15.00 ?  480 PRO A C    14 
ATOM   9780  O O    . PRO A 1 9  ? -4.896  8.485   2.539   1.00 15.00 ?  480 PRO A O    14 
ATOM   9781  C CB   . PRO A 1 9  ? -6.543  7.452   5.115   1.00 15.00 ?  480 PRO A CB   14 
ATOM   9782  C CG   . PRO A 1 9  ? -7.541  6.353   5.137   1.00 15.00 ?  480 PRO A CG   14 
ATOM   9783  C CD   . PRO A 1 9  ? -7.709  5.943   3.702   1.00 15.00 ?  480 PRO A CD   14 
ATOM   9784  H HA   . PRO A 1 9  ? -7.690  8.942   4.078   1.00 15.00 ?  480 PRO A HA   14 
ATOM   9785  H HB2  . PRO A 1 9  ? -5.541  7.072   5.024   1.00 15.00 ?  480 PRO A HB2  14 
ATOM   9786  H HB3  . PRO A 1 9  ? -6.620  8.076   5.991   1.00 15.00 ?  480 PRO A HB3  14 
ATOM   9787  H HG2  . PRO A 1 9  ? -7.166  5.527   5.725   1.00 15.00 ?  480 PRO A HG2  14 
ATOM   9788  H HG3  . PRO A 1 9  ? -8.477  6.710   5.538   1.00 15.00 ?  480 PRO A HG3  14 
ATOM   9789  H HD2  . PRO A 1 9  ? -7.036  5.133   3.460   1.00 15.00 ?  480 PRO A HD2  14 
ATOM   9790  H HD3  . PRO A 1 9  ? -8.732  5.657   3.507   1.00 15.00 ?  480 PRO A HD3  14 
ATOM   9791  N N    . PRO A 1 10 ? -5.427  10.229  3.860   1.00 15.00 ?  481 PRO A N    14 
ATOM   9792  C CA   . PRO A 1 10 ? -4.395  11.156  3.344   1.00 15.00 ?  481 PRO A CA   14 
ATOM   9793  C C    . PRO A 1 10 ? -2.961  10.608  3.336   1.00 15.00 ?  481 PRO A C    14 
ATOM   9794  O O    . PRO A 1 10 ? -2.099  11.158  2.654   1.00 15.00 ?  481 PRO A O    14 
ATOM   9795  C CB   . PRO A 1 10 ? -4.485  12.361  4.288   1.00 15.00 ?  481 PRO A CB   14 
ATOM   9796  C CG   . PRO A 1 10 ? -5.196  11.857  5.494   1.00 15.00 ?  481 PRO A CG   14 
ATOM   9797  C CD   . PRO A 1 10 ? -6.153  10.817  4.994   1.00 15.00 ?  481 PRO A CD   14 
ATOM   9798  H HA   . PRO A 1 10 ? -4.641  11.481  2.345   1.00 15.00 ?  481 PRO A HA   14 
ATOM   9799  H HB2  . PRO A 1 10 ? -3.491  12.707  4.530   1.00 15.00 ?  481 PRO A HB2  14 
ATOM   9800  H HB3  . PRO A 1 10 ? -5.040  13.155  3.809   1.00 15.00 ?  481 PRO A HB3  14 
ATOM   9801  H HG2  . PRO A 1 10 ? -4.490  11.415  6.181   1.00 15.00 ?  481 PRO A HG2  14 
ATOM   9802  H HG3  . PRO A 1 10 ? -5.733  12.664  5.971   1.00 15.00 ?  481 PRO A HG3  14 
ATOM   9803  H HD2  . PRO A 1 10 ? -6.346  10.078  5.757   1.00 15.00 ?  481 PRO A HD2  14 
ATOM   9804  H HD3  . PRO A 1 10 ? -7.075  11.276  4.665   1.00 15.00 ?  481 PRO A HD3  14 
ATOM   9805  N N    . GLY A 1 11 ? -2.686  9.574   4.122   1.00 15.00 ?  482 GLY A N    14 
ATOM   9806  C CA   . GLY A 1 11 ? -1.365  8.965   4.084   1.00 15.00 ?  482 GLY A CA   14 
ATOM   9807  C C    . GLY A 1 11 ? -1.440  7.508   3.724   1.00 15.00 ?  482 GLY A C    14 
ATOM   9808  O O    . GLY A 1 11 ? -0.438  6.791   3.769   1.00 15.00 ?  482 GLY A O    14 
ATOM   9809  H H    . GLY A 1 11 ? -3.376  9.221   4.717   1.00 15.00 ?  482 GLY A H    14 
ATOM   9810  H HA2  . GLY A 1 11 ? -0.768  9.475   3.344   1.00 15.00 ?  482 GLY A HA2  14 
ATOM   9811  H HA3  . GLY A 1 11 ? -0.885  9.059   5.040   1.00 15.00 ?  482 GLY A HA3  14 
ATOM   9812  N N    . TRP A 1 12 ? -2.639  7.068   3.393   1.00 15.00 ?  483 TRP A N    14 
ATOM   9813  C CA   . TRP A 1 12 ? -2.846  5.739   2.873   1.00 15.00 ?  483 TRP A CA   14 
ATOM   9814  C C    . TRP A 1 12 ? -2.874  5.832   1.366   1.00 15.00 ?  483 TRP A C    14 
ATOM   9815  O O    . TRP A 1 12 ? -3.783  6.409   0.777   1.00 15.00 ?  483 TRP A O    14 
ATOM   9816  C CB   . TRP A 1 12 ? -4.139  5.124   3.402   1.00 15.00 ?  483 TRP A CB   14 
ATOM   9817  C CG   . TRP A 1 12 ? -4.039  4.632   4.810   1.00 15.00 ?  483 TRP A CG   14 
ATOM   9818  C CD1  . TRP A 1 12 ? -4.039  5.384   5.947   1.00 15.00 ?  483 TRP A CD1  14 
ATOM   9819  C CD2  . TRP A 1 12 ? -3.927  3.269   5.228   1.00 15.00 ?  483 TRP A CD2  14 
ATOM   9820  N NE1  . TRP A 1 12 ? -3.952  4.576   7.048   1.00 15.00 ?  483 TRP A NE1  14 
ATOM   9821  C CE2  . TRP A 1 12 ? -3.876  3.270   6.635   1.00 15.00 ?  483 TRP A CE2  14 
ATOM   9822  C CE3  . TRP A 1 12 ? -3.870  2.045   4.550   1.00 15.00 ?  483 TRP A CE3  14 
ATOM   9823  C CZ2  . TRP A 1 12 ? -3.770  2.096   7.375   1.00 15.00 ?  483 TRP A CZ2  14 
ATOM   9824  C CZ3  . TRP A 1 12 ? -3.763  0.883   5.285   1.00 15.00 ?  483 TRP A CZ3  14 
ATOM   9825  C CH2  . TRP A 1 12 ? -3.717  0.915   6.686   1.00 15.00 ?  483 TRP A CH2  14 
ATOM   9826  H H    . TRP A 1 12 ? -3.407  7.676   3.456   1.00 15.00 ?  483 TRP A H    14 
ATOM   9827  H HA   . TRP A 1 12 ? -2.006  5.128   3.173   1.00 15.00 ?  483 TRP A HA   14 
ATOM   9828  H HB2  . TRP A 1 12 ? -4.923  5.864   3.364   1.00 15.00 ?  483 TRP A HB2  14 
ATOM   9829  H HB3  . TRP A 1 12 ? -4.412  4.287   2.777   1.00 15.00 ?  483 TRP A HB3  14 
ATOM   9830  H HD1  . TRP A 1 12 ? -4.107  6.460   5.963   1.00 15.00 ?  483 TRP A HD1  14 
ATOM   9831  H HE1  . TRP A 1 12 ? -3.943  4.885   7.978   1.00 15.00 ?  483 TRP A HE1  14 
ATOM   9832  H HE3  . TRP A 1 12 ? -3.902  1.998   3.470   1.00 15.00 ?  483 TRP A HE3  14 
ATOM   9833  H HZ2  . TRP A 1 12 ? -3.734  2.103   8.454   1.00 15.00 ?  483 TRP A HZ2  14 
ATOM   9834  H HZ3  . TRP A 1 12 ? -3.721  -0.070  4.778   1.00 15.00 ?  483 TRP A HZ3  14 
ATOM   9835  H HH2  . TRP A 1 12 ? -3.633  -0.020  7.221   1.00 15.00 ?  483 TRP A HH2  14 
ATOM   9836  N N    . GLU A 1 13 ? -1.859  5.294   0.754   1.00 15.00 ?  484 GLU A N    14 
ATOM   9837  C CA   . GLU A 1 13 ? -1.640  5.476   -0.655  1.00 15.00 ?  484 GLU A CA   14 
ATOM   9838  C C    . GLU A 1 13 ? -1.626  4.136   -1.369  1.00 15.00 ?  484 GLU A C    14 
ATOM   9839  O O    . GLU A 1 13 ? -0.838  3.267   -1.050  1.00 15.00 ?  484 GLU A O    14 
ATOM   9840  C CB   . GLU A 1 13 ? -0.343  6.256   -0.832  1.00 15.00 ?  484 GLU A CB   14 
ATOM   9841  C CG   . GLU A 1 13 ? -0.537  7.744   -0.569  1.00 15.00 ?  484 GLU A CG   14 
ATOM   9842  C CD   . GLU A 1 13 ? 0.748   8.506   -0.323  1.00 15.00 ?  484 GLU A CD   14 
ATOM   9843  O OE1  . GLU A 1 13 ? 1.720   8.315   -1.087  1.00 15.00 ?  484 GLU A OE1  14 
ATOM   9844  O OE2  . GLU A 1 13 ? 0.803   9.280   0.656   1.00 15.00 -1 484 GLU A OE2  14 
ATOM   9845  H H    . GLU A 1 13 ? -1.220  4.755   1.271   1.00 15.00 ?  484 GLU A H    14 
ATOM   9846  H HA   . GLU A 1 13 ? -2.458  6.065   -1.042  1.00 15.00 ?  484 GLU A HA   14 
ATOM   9847  H HB2  . GLU A 1 13 ? 0.396   5.875   -0.139  1.00 15.00 ?  484 GLU A HB2  14 
ATOM   9848  H HB3  . GLU A 1 13 ? 0.014   6.128   -1.838  1.00 15.00 ?  484 GLU A HB3  14 
ATOM   9849  H HG2  . GLU A 1 13 ? -1.018  8.168   -1.428  1.00 15.00 ?  484 GLU A HG2  14 
ATOM   9850  H HG3  . GLU A 1 13 ? -1.179  7.860   0.292   1.00 15.00 ?  484 GLU A HG3  14 
ATOM   9851  N N    . MET A 1 14 ? -2.518  3.980   -2.328  1.00 15.00 ?  485 MET A N    14 
ATOM   9852  C CA   . MET A 1 14 ? -2.763  2.684   -2.954  1.00 15.00 ?  485 MET A CA   14 
ATOM   9853  C C    . MET A 1 14 ? -2.095  2.603   -4.324  1.00 15.00 ?  485 MET A C    14 
ATOM   9854  O O    . MET A 1 14 ? -2.286  3.479   -5.167  1.00 15.00 ?  485 MET A O    14 
ATOM   9855  C CB   . MET A 1 14 ? -4.282  2.478   -3.065  1.00 15.00 ?  485 MET A CB   14 
ATOM   9856  C CG   . MET A 1 14 ? -4.713  1.108   -3.568  1.00 15.00 ?  485 MET A CG   14 
ATOM   9857  S SD   . MET A 1 14 ? -4.627  0.948   -5.363  1.00 15.00 ?  485 MET A SD   14 
ATOM   9858  C CE   . MET A 1 14 ? -5.774  2.235   -5.866  1.00 15.00 ?  485 MET A CE   14 
ATOM   9859  H H    . MET A 1 14 ? -3.019  4.763   -2.638  1.00 15.00 ?  485 MET A H    14 
ATOM   9860  H HA   . MET A 1 14 ? -2.350  1.916   -2.313  1.00 15.00 ?  485 MET A HA   14 
ATOM   9861  H HB2  . MET A 1 14 ? -4.719  2.626   -2.089  1.00 15.00 ?  485 MET A HB2  14 
ATOM   9862  H HB3  . MET A 1 14 ? -4.680  3.224   -3.739  1.00 15.00 ?  485 MET A HB3  14 
ATOM   9863  H HG2  . MET A 1 14 ? -4.077  0.362   -3.120  1.00 15.00 ?  485 MET A HG2  14 
ATOM   9864  H HG3  . MET A 1 14 ? -5.733  0.935   -3.255  1.00 15.00 ?  485 MET A HG3  14 
ATOM   9865  H HE1  . MET A 1 14 ? -5.827  2.269   -6.944  1.00 15.00 ?  485 MET A HE1  14 
ATOM   9866  H HE2  . MET A 1 14 ? -5.433  3.189   -5.491  1.00 15.00 ?  485 MET A HE2  14 
ATOM   9867  H HE3  . MET A 1 14 ? -6.754  2.021   -5.462  1.00 15.00 ?  485 MET A HE3  14 
ATOM   9868  N N    . ARG A 1 15 ? -1.307  1.552   -4.542  1.00 15.00 ?  486 ARG A N    14 
ATOM   9869  C CA   . ARG A 1 15 ? -0.643  1.345   -5.826  1.00 15.00 ?  486 ARG A CA   14 
ATOM   9870  C C    . ARG A 1 15 ? -0.538  -0.143  -6.133  1.00 15.00 ?  486 ARG A C    14 
ATOM   9871  O O    . ARG A 1 15 ? -0.444  -0.971  -5.225  1.00 15.00 ?  486 ARG A O    14 
ATOM   9872  C CB   . ARG A 1 15 ? 0.756   1.963   -5.848  1.00 15.00 ?  486 ARG A CB   14 
ATOM   9873  C CG   . ARG A 1 15 ? 1.812   1.097   -5.190  1.00 15.00 ?  486 ARG A CG   14 
ATOM   9874  C CD   . ARG A 1 15 ? 3.210   1.480   -5.637  1.00 15.00 ?  486 ARG A CD   14 
ATOM   9875  N NE   . ARG A 1 15 ? 3.457   1.183   -7.050  1.00 15.00 ?  486 ARG A NE   14 
ATOM   9876  C CZ   . ARG A 1 15 ? 3.453   2.100   -8.021  1.00 15.00 ?  486 ARG A CZ   14 
ATOM   9877  N NH1  . ARG A 1 15 ? 3.104   3.354   -7.759  1.00 15.00 1  486 ARG A NH1  14 
ATOM   9878  N NH2  . ARG A 1 15 ? 3.786   1.758   -9.256  1.00 15.00 ?  486 ARG A NH2  14 
ATOM   9879  H H    . ARG A 1 15 ? -1.175  0.892   -3.825  1.00 15.00 ?  486 ARG A H    14 
ATOM   9880  H HA   . ARG A 1 15 ? -1.247  1.815   -6.589  1.00 15.00 ?  486 ARG A HA   14 
ATOM   9881  H HB2  . ARG A 1 15 ? 1.049   2.132   -6.875  1.00 15.00 ?  486 ARG A HB2  14 
ATOM   9882  H HB3  . ARG A 1 15 ? 0.725   2.910   -5.331  1.00 15.00 ?  486 ARG A HB3  14 
ATOM   9883  H HG2  . ARG A 1 15 ? 1.745   1.215   -4.119  1.00 15.00 ?  486 ARG A HG2  14 
ATOM   9884  H HG3  . ARG A 1 15 ? 1.631   0.065   -5.451  1.00 15.00 ?  486 ARG A HG3  14 
ATOM   9885  H HD2  . ARG A 1 15 ? 3.350   2.537   -5.474  1.00 15.00 ?  486 ARG A HD2  14 
ATOM   9886  H HD3  . ARG A 1 15 ? 3.919   0.930   -5.040  1.00 15.00 ?  486 ARG A HD3  14 
ATOM   9887  H HE   . ARG A 1 15 ? 3.683   0.250   -7.279  1.00 15.00 ?  486 ARG A HE   14 
ATOM   9888  H HH11 . ARG A 1 15 ? 2.846   3.622   -6.832  1.00 15.00 ?  486 ARG A HH11 14 
ATOM   9889  H HH12 . ARG A 1 15 ? 3.087   4.043   -8.501  1.00 15.00 ?  486 ARG A HH12 14 
ATOM   9890  H HH21 . ARG A 1 15 ? 4.034   0.811   -9.469  1.00 15.00 ?  486 ARG A HH21 14 
ATOM   9891  H HH22 . ARG A 1 15 ? 3.811   2.456   -9.985  1.00 15.00 ?  486 ARG A HH22 14 
ATOM   9892  N N    . ILE A 1 16 ? -0.544  -0.474  -7.410  1.00 15.00 ?  487 ILE A N    14 
ATOM   9893  C CA   . ILE A 1 16 ? -0.458  -1.860  -7.829  1.00 15.00 ?  487 ILE A CA   14 
ATOM   9894  C C    . ILE A 1 16 ? 0.882   -2.152  -8.489  1.00 15.00 ?  487 ILE A C    14 
ATOM   9895  O O    . ILE A 1 16 ? 1.414   -1.338  -9.246  1.00 15.00 ?  487 ILE A O    14 
ATOM   9896  C CB   . ILE A 1 16 ? -1.635  -2.246  -8.762  1.00 15.00 ?  487 ILE A CB   14 
ATOM   9897  C CG1  . ILE A 1 16 ? -1.473  -3.673  -9.299  1.00 15.00 ?  487 ILE A CG1  14 
ATOM   9898  C CG2  . ILE A 1 16 ? -1.768  -1.256  -9.907  1.00 15.00 ?  487 ILE A CG2  14 
ATOM   9899  C CD1  . ILE A 1 16 ? -2.631  -4.141  -10.155 1.00 15.00 ?  487 ILE A CD1  14 
ATOM   9900  H H    . ILE A 1 16 ? -0.576  0.231   -8.089  1.00 15.00 ?  487 ILE A H    14 
ATOM   9901  H HA   . ILE A 1 16 ? -0.521  -2.466  -6.945  1.00 15.00 ?  487 ILE A HA   14 
ATOM   9902  H HB   . ILE A 1 16 ? -2.544  -2.196  -8.181  1.00 15.00 ?  487 ILE A HB   14 
ATOM   9903  H HG12 . ILE A 1 16 ? -0.577  -3.724  -9.901  1.00 15.00 ?  487 ILE A HG12 14 
ATOM   9904  H HG13 . ILE A 1 16 ? -1.378  -4.355  -8.466  1.00 15.00 ?  487 ILE A HG13 14 
ATOM   9905  H HG21 . ILE A 1 16 ? -0.860  -1.256  -10.489 1.00 15.00 ?  487 ILE A HG21 14 
ATOM   9906  H HG22 . ILE A 1 16 ? -1.943  -0.269  -9.508  1.00 15.00 ?  487 ILE A HG22 14 
ATOM   9907  H HG23 . ILE A 1 16 ? -2.599  -1.545  -10.532 1.00 15.00 ?  487 ILE A HG23 14 
ATOM   9908  H HD11 . ILE A 1 16 ? -3.542  -4.113  -9.575  1.00 15.00 ?  487 ILE A HD11 14 
ATOM   9909  H HD12 . ILE A 1 16 ? -2.448  -5.151  -10.490 1.00 15.00 ?  487 ILE A HD12 14 
ATOM   9910  H HD13 . ILE A 1 16 ? -2.732  -3.490  -11.010 1.00 15.00 ?  487 ILE A HD13 14 
ATOM   9911  N N    . ALA A 1 17 ? 1.431   -3.314  -8.162  1.00 15.00 ?  488 ALA A N    14 
ATOM   9912  C CA   . ALA A 1 17 ? 2.683   -3.771  -8.734  1.00 15.00 ?  488 ALA A CA   14 
ATOM   9913  C C    . ALA A 1 17 ? 2.401   -4.564  -10.000 1.00 15.00 ?  488 ALA A C    14 
ATOM   9914  O O    . ALA A 1 17 ? 1.345   -5.190  -10.110 1.00 15.00 ?  488 ALA A O    14 
ATOM   9915  C CB   . ALA A 1 17 ? 3.441   -4.639  -7.735  1.00 15.00 ?  488 ALA A CB   14 
ATOM   9916  H H    . ALA A 1 17 ? 0.971   -3.885  -7.507  1.00 15.00 ?  488 ALA A H    14 
ATOM   9917  H HA   . ALA A 1 17 ? 3.286   -2.908  -8.967  1.00 15.00 ?  488 ALA A HA   14 
ATOM   9918  H HB1  . ALA A 1 17 ? 4.194   -5.211  -8.258  1.00 15.00 ?  488 ALA A HB1  14 
ATOM   9919  H HB2  . ALA A 1 17 ? 2.754   -5.312  -7.244  1.00 15.00 ?  488 ALA A HB2  14 
ATOM   9920  H HB3  . ALA A 1 17 ? 3.918   -4.012  -7.001  1.00 15.00 ?  488 ALA A HB3  14 
ATOM   9921  N N    . PRO A 1 18 ? 3.331   -4.549  -10.973 1.00 15.00 ?  489 PRO A N    14 
ATOM   9922  C CA   . PRO A 1 18 ? 3.191   -5.293  -12.242 1.00 15.00 ?  489 PRO A CA   14 
ATOM   9923  C C    . PRO A 1 18 ? 2.976   -6.798  -12.041 1.00 15.00 ?  489 PRO A C    14 
ATOM   9924  O O    . PRO A 1 18 ? 2.735   -7.536  -12.997 1.00 15.00 ?  489 PRO A O    14 
ATOM   9925  C CB   . PRO A 1 18 ? 4.522   -5.035  -12.956 1.00 15.00 ?  489 PRO A CB   14 
ATOM   9926  C CG   . PRO A 1 18 ? 5.030   -3.767  -12.363 1.00 15.00 ?  489 PRO A CG   14 
ATOM   9927  C CD   . PRO A 1 18 ? 4.593   -3.789  -10.927 1.00 15.00 ?  489 PRO A CD   14 
ATOM   9928  H HA   . PRO A 1 18 ? 2.382   -4.896  -12.838 1.00 15.00 ?  489 PRO A HA   14 
ATOM   9929  H HB2  . PRO A 1 18 ? 5.197   -5.857  -12.772 1.00 15.00 ?  489 PRO A HB2  14 
ATOM   9930  H HB3  . PRO A 1 18 ? 4.350   -4.933  -14.018 1.00 15.00 ?  489 PRO A HB3  14 
ATOM   9931  H HG2  . PRO A 1 18 ? 6.107   -3.735  -12.427 1.00 15.00 ?  489 PRO A HG2  14 
ATOM   9932  H HG3  . PRO A 1 18 ? 4.596   -2.920  -12.873 1.00 15.00 ?  489 PRO A HG3  14 
ATOM   9933  H HD2  . PRO A 1 18 ? 5.326   -4.295  -10.317 1.00 15.00 ?  489 PRO A HD2  14 
ATOM   9934  H HD3  . PRO A 1 18 ? 4.426   -2.785  -10.566 1.00 15.00 ?  489 PRO A HD3  14 
ATOM   9935  N N    . ASN A 1 19 ? 3.092   -7.247  -10.798 1.00 15.00 ?  490 ASN A N    14 
ATOM   9936  C CA   . ASN A 1 19 ? 2.800   -8.632  -10.438 1.00 15.00 ?  490 ASN A CA   14 
ATOM   9937  C C    . ASN A 1 19 ? 1.287   -8.863  -10.394 1.00 15.00 ?  490 ASN A C    14 
ATOM   9938  O O    . ASN A 1 19 ? 0.814   -9.999  -10.341 1.00 15.00 ?  490 ASN A O    14 
ATOM   9939  C CB   . ASN A 1 19 ? 3.441   -8.956  -9.080  1.00 15.00 ?  490 ASN A CB   14 
ATOM   9940  C CG   . ASN A 1 19 ? 3.119   -10.351 -8.572  1.00 15.00 ?  490 ASN A CG   14 
ATOM   9941  O OD1  . ASN A 1 19 ? 2.144   -10.552 -7.847  1.00 15.00 ?  490 ASN A OD1  14 
ATOM   9942  N ND2  . ASN A 1 19 ? 3.941   -11.319 -8.941  1.00 15.00 ?  490 ASN A ND2  14 
ATOM   9943  H H    . ASN A 1 19 ? 3.392   -6.629  -10.102 1.00 15.00 ?  490 ASN A H    14 
ATOM   9944  H HA   . ASN A 1 19 ? 3.230   -9.271  -11.195 1.00 15.00 ?  490 ASN A HA   14 
ATOM   9945  H HB2  . ASN A 1 19 ? 4.513   -8.873  -9.172  1.00 15.00 ?  490 ASN A HB2  14 
ATOM   9946  H HB3  . ASN A 1 19 ? 3.095   -8.240  -8.348  1.00 15.00 ?  490 ASN A HB3  14 
ATOM   9947  H HD21 . ASN A 1 19 ? 4.705   -11.089 -9.513  1.00 15.00 ?  490 ASN A HD21 14 
ATOM   9948  H HD22 . ASN A 1 19 ? 3.758   -12.232 -8.619  1.00 15.00 ?  490 ASN A HD22 14 
ATOM   9949  N N    . GLY A 1 20 ? 0.533   -7.770  -10.425 1.00 15.00 ?  491 GLY A N    14 
ATOM   9950  C CA   . GLY A 1 20 ? -0.910  -7.856  -10.349 1.00 15.00 ?  491 GLY A CA   14 
ATOM   9951  C C    . GLY A 1 20 ? -1.402  -7.759  -8.921  1.00 15.00 ?  491 GLY A C    14 
ATOM   9952  O O    . GLY A 1 20 ? -2.368  -8.415  -8.545  1.00 15.00 ?  491 GLY A O    14 
ATOM   9953  H H    . GLY A 1 20 ? 0.966   -6.892  -10.505 1.00 15.00 ?  491 GLY A H    14 
ATOM   9954  H HA2  . GLY A 1 20 ? -1.342  -7.052  -10.928 1.00 15.00 ?  491 GLY A HA2  14 
ATOM   9955  H HA3  . GLY A 1 20 ? -1.228  -8.799  -10.765 1.00 15.00 ?  491 GLY A HA3  14 
ATOM   9956  N N    . ARG A 1 21 ? -0.731  -6.939  -8.121  1.00 15.00 ?  492 ARG A N    14 
ATOM   9957  C CA   . ARG A 1 21 ? -1.061  -6.821  -6.708  1.00 15.00 ?  492 ARG A CA   14 
ATOM   9958  C C    . ARG A 1 21 ? -1.158  -5.359  -6.267  1.00 15.00 ?  492 ARG A C    14 
ATOM   9959  O O    . ARG A 1 21 ? -0.172  -4.624  -6.320  1.00 15.00 ?  492 ARG A O    14 
ATOM   9960  C CB   . ARG A 1 21 ? -0.026  -7.561  -5.851  1.00 15.00 ?  492 ARG A CB   14 
ATOM   9961  C CG   . ARG A 1 21 ? 1.420   -7.175  -6.129  1.00 15.00 ?  492 ARG A CG   14 
ATOM   9962  C CD   . ARG A 1 21 ? 2.379   -8.086  -5.382  1.00 15.00 ?  492 ARG A CD   14 
ATOM   9963  N NE   . ARG A 1 21 ? 3.764   -7.612  -5.428  1.00 15.00 ?  492 ARG A NE   14 
ATOM   9964  C CZ   . ARG A 1 21 ? 4.805   -8.341  -5.018  1.00 15.00 ?  492 ARG A CZ   14 
ATOM   9965  N NH1  . ARG A 1 21 ? 4.616   -9.586  -4.598  1.00 15.00 1  492 ARG A NH1  14 
ATOM   9966  N NH2  . ARG A 1 21 ? 6.028   -7.827  -5.040  1.00 15.00 ?  492 ARG A NH2  14 
ATOM   9967  H H    . ARG A 1 21 ? -0.004  -6.396  -8.493  1.00 15.00 ?  492 ARG A H    14 
ATOM   9968  H HA   . ARG A 1 21 ? -2.021  -7.289  -6.560  1.00 15.00 ?  492 ARG A HA   14 
ATOM   9969  H HB2  . ARG A 1 21 ? -0.234  -7.345  -4.819  1.00 15.00 ?  492 ARG A HB2  14 
ATOM   9970  H HB3  . ARG A 1 21 ? -0.127  -8.619  -6.005  1.00 15.00 ?  492 ARG A HB3  14 
ATOM   9971  H HG2  . ARG A 1 21 ? 1.608   -7.256  -7.189  1.00 15.00 ?  492 ARG A HG2  14 
ATOM   9972  H HG3  . ARG A 1 21 ? 1.581   -6.156  -5.809  1.00 15.00 ?  492 ARG A HG3  14 
ATOM   9973  H HD2  . ARG A 1 21 ? 2.064   -8.146  -4.351  1.00 15.00 ?  492 ARG A HD2  14 
ATOM   9974  H HD3  . ARG A 1 21 ? 2.333   -9.069  -5.826  1.00 15.00 ?  492 ARG A HD3  14 
ATOM   9975  H HE   . ARG A 1 21 ? 3.923   -6.700  -5.758  1.00 15.00 ?  492 ARG A HE   14 
ATOM   9976  H HH11 . ARG A 1 21 ? 3.697   -9.980  -4.589  1.00 15.00 ?  492 ARG A HH11 14 
ATOM   9977  H HH12 . ARG A 1 21 ? 5.396   -10.142 -4.278  1.00 15.00 ?  492 ARG A HH12 14 
ATOM   9978  H HH21 . ARG A 1 21 ? 6.175   -6.885  -5.367  1.00 15.00 ?  492 ARG A HH21 14 
ATOM   9979  H HH22 . ARG A 1 21 ? 6.817   -8.374  -4.723  1.00 15.00 ?  492 ARG A HH22 14 
ATOM   9980  N N    . PRO A 1 22 ? -2.356  -4.915  -5.843  1.00 15.00 ?  493 PRO A N    14 
ATOM   9981  C CA   . PRO A 1 22 ? -2.552  -3.598  -5.249  1.00 15.00 ?  493 PRO A CA   14 
ATOM   9982  C C    . PRO A 1 22 ? -2.365  -3.620  -3.738  1.00 15.00 ?  493 PRO A C    14 
ATOM   9983  O O    . PRO A 1 22 ? -3.114  -4.274  -3.012  1.00 15.00 ?  493 PRO A O    14 
ATOM   9984  C CB   . PRO A 1 22 ? -4.009  -3.252  -5.599  1.00 15.00 ?  493 PRO A CB   14 
ATOM   9985  C CG   . PRO A 1 22 ? -4.607  -4.490  -6.204  1.00 15.00 ?  493 PRO A CG   14 
ATOM   9986  C CD   . PRO A 1 22 ? -3.634  -5.615  -5.977  1.00 15.00 ?  493 PRO A CD   14 
ATOM   9987  H HA   . PRO A 1 22 ? -1.898  -2.865  -5.674  1.00 15.00 ?  493 PRO A HA   14 
ATOM   9988  H HB2  . PRO A 1 22 ? -4.534  -2.967  -4.700  1.00 15.00 ?  493 PRO A HB2  14 
ATOM   9989  H HB3  . PRO A 1 22 ? -4.023  -2.431  -6.299  1.00 15.00 ?  493 PRO A HB3  14 
ATOM   9990  H HG2  . PRO A 1 22 ? -5.548  -4.711  -5.722  1.00 15.00 ?  493 PRO A HG2  14 
ATOM   9991  H HG3  . PRO A 1 22 ? -4.760  -4.338  -7.263  1.00 15.00 ?  493 PRO A HG3  14 
ATOM   9992  H HD2  . PRO A 1 22 ? -3.880  -6.147  -5.076  1.00 15.00 ?  493 PRO A HD2  14 
ATOM   9993  H HD3  . PRO A 1 22 ? -3.628  -6.280  -6.825  1.00 15.00 ?  493 PRO A HD3  14 
ATOM   9994  N N    . PHE A 1 23 ? -1.342  -2.918  -3.276  1.00 15.00 ?  494 PHE A N    14 
ATOM   9995  C CA   . PHE A 1 23 ? -1.025  -2.873  -1.861  1.00 15.00 ?  494 PHE A CA   14 
ATOM   9996  C C    . PHE A 1 23 ? -1.209  -1.460  -1.322  1.00 15.00 ?  494 PHE A C    14 
ATOM   9997  O O    . PHE A 1 23 ? -0.884  -0.478  -1.993  1.00 15.00 ?  494 PHE A O    14 
ATOM   9998  C CB   . PHE A 1 23 ? 0.404   -3.386  -1.595  1.00 15.00 ?  494 PHE A CB   14 
ATOM   9999  C CG   . PHE A 1 23 ? 1.502   -2.729  -2.403  1.00 15.00 ?  494 PHE A CG   14 
ATOM   10000 C CD1  . PHE A 1 23 ? 2.122   -1.572  -1.950  1.00 15.00 ?  494 PHE A CD1  14 
ATOM   10001 C CD2  . PHE A 1 23 ? 1.942   -3.290  -3.593  1.00 15.00 ?  494 PHE A CD2  14 
ATOM   10002 C CE1  . PHE A 1 23 ? 3.150   -0.984  -2.673  1.00 15.00 ?  494 PHE A CE1  14 
ATOM   10003 C CE2  . PHE A 1 23 ? 2.968   -2.711  -4.310  1.00 15.00 ?  494 PHE A CE2  14 
ATOM   10004 C CZ   . PHE A 1 23 ? 3.571   -1.558  -3.853  1.00 15.00 ?  494 PHE A CZ   14 
ATOM   10005 H H    . PHE A 1 23 ? -0.795  -2.397  -3.905  1.00 15.00 ?  494 PHE A H    14 
ATOM   10006 H HA   . PHE A 1 23 ? -1.724  -3.521  -1.354  1.00 15.00 ?  494 PHE A HA   14 
ATOM   10007 H HB2  . PHE A 1 23 ? 0.637   -3.231  -0.553  1.00 15.00 ?  494 PHE A HB2  14 
ATOM   10008 H HB3  . PHE A 1 23 ? 0.433   -4.447  -1.803  1.00 15.00 ?  494 PHE A HB3  14 
ATOM   10009 H HD1  . PHE A 1 23 ? 1.792   -1.123  -1.026  1.00 15.00 ?  494 PHE A HD1  14 
ATOM   10010 H HD2  . PHE A 1 23 ? 1.471   -4.188  -3.967  1.00 15.00 ?  494 PHE A HD2  14 
ATOM   10011 H HE1  . PHE A 1 23 ? 3.623   -0.070  -2.315  1.00 15.00 ?  494 PHE A HE1  14 
ATOM   10012 H HE2  . PHE A 1 23 ? 3.300   -3.161  -5.227  1.00 15.00 ?  494 PHE A HE2  14 
ATOM   10013 H HZ   . PHE A 1 23 ? 4.373   -1.107  -4.417  1.00 15.00 ?  494 PHE A HZ   14 
ATOM   10014 N N    . PHE A 1 24 ? -1.740  -1.367  -0.113  1.00 15.00 ?  495 PHE A N    14 
ATOM   10015 C CA   . PHE A 1 24 ? -1.972  -0.081  0.519   1.00 15.00 ?  495 PHE A CA   14 
ATOM   10016 C C    . PHE A 1 24 ? -0.745  0.328   1.323   1.00 15.00 ?  495 PHE A C    14 
ATOM   10017 O O    . PHE A 1 24 ? -0.316  -0.388  2.228   1.00 15.00 ?  495 PHE A O    14 
ATOM   10018 C CB   . PHE A 1 24 ? -3.201  -0.141  1.430   1.00 15.00 ?  495 PHE A CB   14 
ATOM   10019 C CG   . PHE A 1 24 ? -4.377  -0.851  0.813   1.00 15.00 ?  495 PHE A CG   14 
ATOM   10020 C CD1  . PHE A 1 24 ? -5.161  -0.228  -0.145  1.00 15.00 ?  495 PHE A CD1  14 
ATOM   10021 C CD2  . PHE A 1 24 ? -4.697  -2.143  1.196   1.00 15.00 ?  495 PHE A CD2  14 
ATOM   10022 C CE1  . PHE A 1 24 ? -6.240  -0.882  -0.709  1.00 15.00 ?  495 PHE A CE1  14 
ATOM   10023 C CE2  . PHE A 1 24 ? -5.773  -2.800  0.635   1.00 15.00 ?  495 PHE A CE2  14 
ATOM   10024 C CZ   . PHE A 1 24 ? -6.547  -2.169  -0.318  1.00 15.00 ?  495 PHE A CZ   14 
ATOM   10025 H H    . PHE A 1 24 ? -1.972  -2.187  0.373   1.00 15.00 ?  495 PHE A H    14 
ATOM   10026 H HA   . PHE A 1 24 ? -2.142  0.648   -0.257  1.00 15.00 ?  495 PHE A HA   14 
ATOM   10027 H HB2  . PHE A 1 24 ? -2.943  -0.652  2.345   1.00 15.00 ?  495 PHE A HB2  14 
ATOM   10028 H HB3  . PHE A 1 24 ? -3.511  0.868   1.665   1.00 15.00 ?  495 PHE A HB3  14 
ATOM   10029 H HD1  . PHE A 1 24 ? -4.922  0.777   -0.453  1.00 15.00 ?  495 PHE A HD1  14 
ATOM   10030 H HD2  . PHE A 1 24 ? -4.093  -2.639  1.941   1.00 15.00 ?  495 PHE A HD2  14 
ATOM   10031 H HE1  . PHE A 1 24 ? -6.844  -0.384  -1.455  1.00 15.00 ?  495 PHE A HE1  14 
ATOM   10032 H HE2  . PHE A 1 24 ? -6.011  -3.808  0.944   1.00 15.00 ?  495 PHE A HE2  14 
ATOM   10033 H HZ   . PHE A 1 24 ? -7.390  -2.684  -0.757  1.00 15.00 ?  495 PHE A HZ   14 
ATOM   10034 N N    . ILE A 1 25 ? -0.176  1.465   0.966   1.00 15.00 ?  496 ILE A N    14 
ATOM   10035 C CA   . ILE A 1 25 ? 0.989   1.998   1.648   1.00 15.00 ?  496 ILE A CA   14 
ATOM   10036 C C    . ILE A 1 25 ? 0.578   3.071   2.628   1.00 15.00 ?  496 ILE A C    14 
ATOM   10037 O O    . ILE A 1 25 ? 0.233   4.174   2.216   1.00 15.00 ?  496 ILE A O    14 
ATOM   10038 C CB   . ILE A 1 25 ? 2.004   2.648   0.669   1.00 15.00 ?  496 ILE A CB   14 
ATOM   10039 C CG1  . ILE A 1 25 ? 2.428   1.677   -0.432  1.00 15.00 ?  496 ILE A CG1  14 
ATOM   10040 C CG2  . ILE A 1 25 ? 3.231   3.135   1.429   1.00 15.00 ?  496 ILE A CG2  14 
ATOM   10041 C CD1  . ILE A 1 25 ? 1.544   1.714   -1.660  1.00 15.00 ?  496 ILE A CD1  14 
ATOM   10042 H H    . ILE A 1 25 ? -0.553  1.971   0.211   1.00 15.00 ?  496 ILE A H    14 
ATOM   10043 H HA   . ILE A 1 25 ? 1.480   1.196   2.176   1.00 15.00 ?  496 ILE A HA   14 
ATOM   10044 H HB   . ILE A 1 25 ? 1.525   3.514   0.215   1.00 15.00 ?  496 ILE A HB   14 
ATOM   10045 H HG12 . ILE A 1 25 ? 3.434   1.914   -0.743  1.00 15.00 ?  496 ILE A HG12 14 
ATOM   10046 H HG13 . ILE A 1 25 ? 2.407   0.671   -0.040  1.00 15.00 ?  496 ILE A HG13 14 
ATOM   10047 H HG21 . ILE A 1 25 ? 2.933   3.868   2.164   1.00 15.00 ?  496 ILE A HG21 14 
ATOM   10048 H HG22 . ILE A 1 25 ? 3.927   3.582   0.736   1.00 15.00 ?  496 ILE A HG22 14 
ATOM   10049 H HG23 . ILE A 1 25 ? 3.703   2.299   1.924   1.00 15.00 ?  496 ILE A HG23 14 
ATOM   10050 H HD11 . ILE A 1 25 ? 0.530   1.460   -1.384  1.00 15.00 ?  496 ILE A HD11 14 
ATOM   10051 H HD12 . ILE A 1 25 ? 1.909   1.001   -2.387  1.00 15.00 ?  496 ILE A HD12 14 
ATOM   10052 H HD13 . ILE A 1 25 ? 1.564   2.704   -2.087  1.00 15.00 ?  496 ILE A HD13 14 
ATOM   10053 N N    . ASP A 1 26 ? 0.602   2.785   3.913   1.00 15.00 ?  497 ASP A N    14 
ATOM   10054 C CA   . ASP A 1 26 ? 0.443   3.862   4.861   1.00 15.00 ?  497 ASP A CA   14 
ATOM   10055 C C    . ASP A 1 26 ? 1.816   4.406   5.182   1.00 15.00 ?  497 ASP A C    14 
ATOM   10056 O O    . ASP A 1 26 ? 2.713   3.696   5.654   1.00 15.00 ?  497 ASP A O    14 
ATOM   10057 C CB   . ASP A 1 26 ? -0.329  3.470   6.122   1.00 15.00 ?  497 ASP A CB   14 
ATOM   10058 C CG   . ASP A 1 26 ? 0.498   2.758   7.169   1.00 15.00 ?  497 ASP A CG   14 
ATOM   10059 O OD1  . ASP A 1 26 ? 1.156   3.451   7.979   1.00 15.00 -1 497 ASP A OD1  14 
ATOM   10060 O OD2  . ASP A 1 26 ? 0.470   1.514   7.206   1.00 15.00 ?  497 ASP A OD2  14 
ATOM   10061 H H    . ASP A 1 26 ? 0.746   1.860   4.223   1.00 15.00 ?  497 ASP A H    14 
ATOM   10062 H HA   . ASP A 1 26 ? -0.107  4.645   4.352   1.00 15.00 ?  497 ASP A HA   14 
ATOM   10063 H HB2  . ASP A 1 26 ? -0.720  4.373   6.567   1.00 15.00 ?  497 ASP A HB2  14 
ATOM   10064 H HB3  . ASP A 1 26 ? -1.154  2.828   5.844   1.00 15.00 ?  497 ASP A HB3  14 
ATOM   10065 N N    . HIS A 1 27 ? 1.992   5.661   4.864   1.00 15.00 ?  498 HIS A N    14 
ATOM   10066 C CA   . HIS A 1 27 ? 3.301   6.281   4.922   1.00 15.00 ?  498 HIS A CA   14 
ATOM   10067 C C    . HIS A 1 27 ? 3.668   6.677   6.347   1.00 15.00 ?  498 HIS A C    14 
ATOM   10068 O O    . HIS A 1 27 ? 4.805   7.060   6.612   1.00 15.00 ?  498 HIS A O    14 
ATOM   10069 C CB   . HIS A 1 27 ? 3.376   7.483   3.972   1.00 15.00 ?  498 HIS A CB   14 
ATOM   10070 C CG   . HIS A 1 27 ? 3.371   7.104   2.514   1.00 15.00 ?  498 HIS A CG   14 
ATOM   10071 N ND1  . HIS A 1 27 ? 4.523   6.941   1.769   1.00 15.00 ?  498 HIS A ND1  14 
ATOM   10072 C CD2  . HIS A 1 27 ? 2.347   6.869   1.651   1.00 15.00 ?  498 HIS A CD2  14 
ATOM   10073 C CE1  . HIS A 1 27 ? 4.199   6.627   0.527   1.00 15.00 ?  498 HIS A CE1  14 
ATOM   10074 N NE2  . HIS A 1 27 ? 2.893   6.574   0.428   1.00 15.00 ?  498 HIS A NE2  14 
ATOM   10075 H H    . HIS A 1 27 ? 1.210   6.195   4.595   1.00 15.00 ?  498 HIS A H    14 
ATOM   10076 H HA   . HIS A 1 27 ? 4.015   5.540   4.590   1.00 15.00 ?  498 HIS A HA   14 
ATOM   10077 H HB2  . HIS A 1 27 ? 2.528   8.127   4.150   1.00 15.00 ?  498 HIS A HB2  14 
ATOM   10078 H HB3  . HIS A 1 27 ? 4.285   8.031   4.171   1.00 15.00 ?  498 HIS A HB3  14 
ATOM   10079 H HD1  . HIS A 1 27 ? 5.444   7.047   2.097   1.00 15.00 ?  498 HIS A HD1  14 
ATOM   10080 H HD2  . HIS A 1 27 ? 1.284   6.953   1.859   1.00 15.00 ?  498 HIS A HD2  14 
ATOM   10081 H HE1  . HIS A 1 27 ? 4.887   6.459   -0.285  1.00 15.00 ?  498 HIS A HE1  14 
ATOM   10082 H HE2  . HIS A 1 27 ? 2.413   6.720   -0.424  1.00 15.00 ?  498 HIS A HE2  14 
ATOM   10083 N N    . ASN A 1 28 ? 2.706   6.597   7.262   1.00 15.00 ?  499 ASN A N    14 
ATOM   10084 C CA   . ASN A 1 28 ? 2.950   7.013   8.636   1.00 15.00 ?  499 ASN A CA   14 
ATOM   10085 C C    . ASN A 1 28 ? 3.684   5.943   9.442   1.00 15.00 ?  499 ASN A C    14 
ATOM   10086 O O    . ASN A 1 28 ? 4.678   6.249   10.098  1.00 15.00 ?  499 ASN A O    14 
ATOM   10087 C CB   . ASN A 1 28 ? 1.640   7.422   9.331   1.00 15.00 ?  499 ASN A CB   14 
ATOM   10088 C CG   . ASN A 1 28 ? 0.552   6.367   9.248   1.00 15.00 ?  499 ASN A CG   14 
ATOM   10089 O OD1  . ASN A 1 28 ? 0.419   5.521   10.131  1.00 15.00 ?  499 ASN A OD1  14 
ATOM   10090 N ND2  . ASN A 1 28 ? -0.248  6.424   8.191   1.00 15.00 ?  499 ASN A ND2  14 
ATOM   10091 H H    . ASN A 1 28 ? 1.826   6.246   7.009   1.00 15.00 ?  499 ASN A H    14 
ATOM   10092 H HA   . ASN A 1 28 ? 3.587   7.883   8.589   1.00 15.00 ?  499 ASN A HA   14 
ATOM   10093 H HB2  . ASN A 1 28 ? 1.842   7.612   10.374  1.00 15.00 ?  499 ASN A HB2  14 
ATOM   10094 H HB3  . ASN A 1 28 ? 1.270   8.328   8.874   1.00 15.00 ?  499 ASN A HB3  14 
ATOM   10095 H HD21 . ASN A 1 28 ? -0.095  7.139   7.529   1.00 15.00 ?  499 ASN A HD21 14 
ATOM   10096 H HD22 . ASN A 1 28 ? -0.952  5.751   8.109   1.00 15.00 ?  499 ASN A HD22 14 
ATOM   10097 N N    . THR A 1 29 ? 3.211   4.699   9.423   1.00 15.00 ?  500 THR A N    14 
ATOM   10098 C CA   . THR A 1 29 ? 3.947   3.622   10.079  1.00 15.00 ?  500 THR A CA   14 
ATOM   10099 C C    . THR A 1 29 ? 5.085   3.122   9.194   1.00 15.00 ?  500 THR A C    14 
ATOM   10100 O O    . THR A 1 29 ? 5.984   2.421   9.665   1.00 15.00 ?  500 THR A O    14 
ATOM   10101 C CB   . THR A 1 29 ? 3.051   2.446   10.516  1.00 15.00 ?  500 THR A CB   14 
ATOM   10102 O OG1  . THR A 1 29 ? 2.479   1.794   9.385   1.00 15.00 ?  500 THR A OG1  14 
ATOM   10103 C CG2  . THR A 1 29 ? 1.944   2.926   11.441  1.00 15.00 ?  500 THR A CG2  14 
ATOM   10104 H H    . THR A 1 29 ? 2.361   4.497   8.960   1.00 15.00 ?  500 THR A H    14 
ATOM   10105 H HA   . THR A 1 29 ? 4.389   4.046   10.972  1.00 15.00 ?  500 THR A HA   14 
ATOM   10106 H HB   . THR A 1 29 ? 3.661   1.736   11.056  1.00 15.00 ?  500 THR A HB   14 
ATOM   10107 H HG1  . THR A 1 29 ? 1.997   2.445   8.839   1.00 15.00 ?  500 THR A HG1  14 
ATOM   10108 H HG21 . THR A 1 29 ? 1.333   2.086   11.738  1.00 15.00 ?  500 THR A HG21 14 
ATOM   10109 H HG22 . THR A 1 29 ? 1.332   3.651   10.925  1.00 15.00 ?  500 THR A HG22 14 
ATOM   10110 H HG23 . THR A 1 29 ? 2.379   3.381   12.318  1.00 15.00 ?  500 THR A HG23 14 
ATOM   10111 N N    . LYS A 1 30 ? 5.014   3.471   7.903   1.00 15.00 ?  501 LYS A N    14 
ATOM   10112 C CA   . LYS A 1 30 ? 6.031   3.091   6.922   1.00 15.00 ?  501 LYS A CA   14 
ATOM   10113 C C    . LYS A 1 30 ? 5.944   1.589   6.612   1.00 15.00 ?  501 LYS A C    14 
ATOM   10114 O O    . LYS A 1 30 ? 6.958   0.893   6.518   1.00 15.00 ?  501 LYS A O    14 
ATOM   10115 C CB   . LYS A 1 30 ? 7.435   3.475   7.430   1.00 15.00 ?  501 LYS A CB   14 
ATOM   10116 C CG   . LYS A 1 30 ? 8.544   3.282   6.405   1.00 15.00 ?  501 LYS A CG   14 
ATOM   10117 C CD   . LYS A 1 30 ? 9.923   3.528   6.999   1.00 15.00 ?  501 LYS A CD   14 
ATOM   10118 C CE   . LYS A 1 30 ? 10.348  4.986   6.897   1.00 15.00 ?  501 LYS A CE   14 
ATOM   10119 N NZ   . LYS A 1 30 ? 9.483   5.901   7.691   1.00 15.00 1  501 LYS A NZ   14 
ATOM   10120 H H    . LYS A 1 30 ? 4.243   3.996   7.602   1.00 15.00 ?  501 LYS A H    14 
ATOM   10121 H HA   . LYS A 1 30 ? 5.827   3.640   6.013   1.00 15.00 ?  501 LYS A HA   14 
ATOM   10122 H HB2  . LYS A 1 30 ? 7.424   4.513   7.723   1.00 15.00 ?  501 LYS A HB2  14 
ATOM   10123 H HB3  . LYS A 1 30 ? 7.666   2.870   8.296   1.00 15.00 ?  501 LYS A HB3  14 
ATOM   10124 H HG2  . LYS A 1 30 ? 8.502   2.270   6.032   1.00 15.00 ?  501 LYS A HG2  14 
ATOM   10125 H HG3  . LYS A 1 30 ? 8.386   3.973   5.589   1.00 15.00 ?  501 LYS A HG3  14 
ATOM   10126 H HD2  . LYS A 1 30 ? 9.908   3.245   8.041   1.00 15.00 ?  501 LYS A HD2  14 
ATOM   10127 H HD3  . LYS A 1 30 ? 10.642  2.916   6.473   1.00 15.00 ?  501 LYS A HD3  14 
ATOM   10128 H HE2  . LYS A 1 30 ? 11.363  5.075   7.252   1.00 15.00 ?  501 LYS A HE2  14 
ATOM   10129 H HE3  . LYS A 1 30 ? 10.307  5.282   5.858   1.00 15.00 ?  501 LYS A HE3  14 
ATOM   10130 H HZ1  . LYS A 1 30 ? 9.890   6.860   7.696   1.00 15.00 ?  501 LYS A HZ1  14 
ATOM   10131 H HZ2  . LYS A 1 30 ? 9.404   5.564   8.676   1.00 15.00 ?  501 LYS A HZ2  14 
ATOM   10132 H HZ3  . LYS A 1 30 ? 8.529   5.947   7.271   1.00 15.00 ?  501 LYS A HZ3  14 
ATOM   10133 N N    . THR A 1 31 ? 4.729   1.090   6.418   1.00 15.00 ?  502 THR A N    14 
ATOM   10134 C CA   . THR A 1 31 ? 4.551   -0.320  6.105   1.00 15.00 ?  502 THR A CA   14 
ATOM   10135 C C    . THR A 1 31 ? 3.489   -0.535  5.034   1.00 15.00 ?  502 THR A C    14 
ATOM   10136 O O    . THR A 1 31 ? 2.558   0.257   4.871   1.00 15.00 ?  502 THR A O    14 
ATOM   10137 C CB   . THR A 1 31 ? 4.205   -1.172  7.348   1.00 15.00 ?  502 THR A CB   14 
ATOM   10138 O OG1  . THR A 1 31 ? 4.261   -2.569  7.023   1.00 15.00 ?  502 THR A OG1  14 
ATOM   10139 C CG2  . THR A 1 31 ? 2.822   -0.842  7.888   1.00 15.00 ?  502 THR A CG2  14 
ATOM   10140 H H    . THR A 1 31 ? 3.942   1.678   6.479   1.00 15.00 ?  502 THR A H    14 
ATOM   10141 H HA   . THR A 1 31 ? 5.492   -0.680  5.716   1.00 15.00 ?  502 THR A HA   14 
ATOM   10142 H HB   . THR A 1 31 ? 4.933   -0.966  8.111   1.00 15.00 ?  502 THR A HB   14 
ATOM   10143 H HG1  . THR A 1 31 ? 3.454   -2.823  6.558   1.00 15.00 ?  502 THR A HG1  14 
ATOM   10144 H HG21 . THR A 1 31 ? 2.785   0.199   8.174   1.00 15.00 ?  502 THR A HG21 14 
ATOM   10145 H HG22 . THR A 1 31 ? 2.616   -1.460  8.749   1.00 15.00 ?  502 THR A HG22 14 
ATOM   10146 H HG23 . THR A 1 31 ? 2.082   -1.032  7.124   1.00 15.00 ?  502 THR A HG23 14 
ATOM   10147 N N    . THR A 1 32 ? 3.681   -1.599  4.284   1.00 15.00 ?  503 THR A N    14 
ATOM   10148 C CA   . THR A 1 32 ? 2.729   -2.030  3.278   1.00 15.00 ?  503 THR A CA   14 
ATOM   10149 C C    . THR A 1 32 ? 1.719   -3.001  3.889   1.00 15.00 ?  503 THR A C    14 
ATOM   10150 O O    . THR A 1 32 ? 2.033   -3.701  4.853   1.00 15.00 ?  503 THR A O    14 
ATOM   10151 C CB   . THR A 1 32 ? 3.466   -2.702  2.106   1.00 15.00 ?  503 THR A CB   14 
ATOM   10152 O OG1  . THR A 1 32 ? 4.604   -3.429  2.600   1.00 15.00 ?  503 THR A OG1  14 
ATOM   10153 C CG2  . THR A 1 32 ? 3.920   -1.671  1.091   1.00 15.00 ?  503 THR A CG2  14 
ATOM   10154 H H    . THR A 1 32 ? 4.494   -2.128  4.420   1.00 15.00 ?  503 THR A H    14 
ATOM   10155 H HA   . THR A 1 32 ? 2.209   -1.158  2.907   1.00 15.00 ?  503 THR A HA   14 
ATOM   10156 H HB   . THR A 1 32 ? 2.788   -3.391  1.622   1.00 15.00 ?  503 THR A HB   14 
ATOM   10157 H HG1  . THR A 1 32 ? 5.004   -3.936  1.882   1.00 15.00 ?  503 THR A HG1  14 
ATOM   10158 H HG21 . THR A 1 32 ? 3.056   -1.184  0.661   1.00 15.00 ?  503 THR A HG21 14 
ATOM   10159 H HG22 . THR A 1 32 ? 4.486   -2.158  0.311   1.00 15.00 ?  503 THR A HG22 14 
ATOM   10160 H HG23 . THR A 1 32 ? 4.538   -0.938  1.582   1.00 15.00 ?  503 THR A HG23 14 
ATOM   10161 N N    . THR A 1 33 ? 0.502   -3.021  3.364   1.00 15.00 ?  504 THR A N    14 
ATOM   10162 C CA   . THR A 1 33 ? -0.506  -3.953  3.846   1.00 15.00 ?  504 THR A CA   14 
ATOM   10163 C C    . THR A 1 33 ? -1.454  -4.363  2.721   1.00 15.00 ?  504 THR A C    14 
ATOM   10164 O O    . THR A 1 33 ? -1.680  -3.606  1.773   1.00 15.00 ?  504 THR A O    14 
ATOM   10165 C CB   . THR A 1 33 ? -1.313  -3.365  5.030   1.00 15.00 ?  504 THR A CB   14 
ATOM   10166 O OG1  . THR A 1 33 ? -2.204  -4.357  5.568   1.00 15.00 ?  504 THR A OG1  14 
ATOM   10167 C CG2  . THR A 1 33 ? -2.111  -2.142  4.599   1.00 15.00 ?  504 THR A CG2  14 
ATOM   10168 H H    . THR A 1 33 ? 0.270   -2.388  2.648   1.00 15.00 ?  504 THR A H    14 
ATOM   10169 H HA   . THR A 1 33 ? 0.008   -4.836  4.198   1.00 15.00 ?  504 THR A HA   14 
ATOM   10170 H HB   . THR A 1 33 ? -0.617  -3.066  5.802   1.00 15.00 ?  504 THR A HB   14 
ATOM   10171 H HG1  . THR A 1 33 ? -1.906  -4.606  6.453   1.00 15.00 ?  504 THR A HG1  14 
ATOM   10172 H HG21 . THR A 1 33 ? -2.802  -2.419  3.816   1.00 15.00 ?  504 THR A HG21 14 
ATOM   10173 H HG22 . THR A 1 33 ? -1.436  -1.385  4.229   1.00 15.00 ?  504 THR A HG22 14 
ATOM   10174 H HG23 . THR A 1 33 ? -2.660  -1.753  5.444   1.00 15.00 ?  504 THR A HG23 14 
ATOM   10175 N N    . TRP A 1 34 ? -1.978  -5.577  2.820   1.00 15.00 ?  505 TRP A N    14 
ATOM   10176 C CA   . TRP A 1 34 ? -2.936  -6.085  1.846   1.00 15.00 ?  505 TRP A CA   14 
ATOM   10177 C C    . TRP A 1 34 ? -4.358  -5.865  2.339   1.00 15.00 ?  505 TRP A C    14 
ATOM   10178 O O    . TRP A 1 34 ? -5.324  -6.161  1.635   1.00 15.00 ?  505 TRP A O    14 
ATOM   10179 C CB   . TRP A 1 34 ? -2.737  -7.585  1.611   1.00 15.00 ?  505 TRP A CB   14 
ATOM   10180 C CG   . TRP A 1 34 ? -1.394  -7.960  1.070   1.00 15.00 ?  505 TRP A CG   14 
ATOM   10181 C CD1  . TRP A 1 34 ? -0.411  -8.642  1.725   1.00 15.00 ?  505 TRP A CD1  14 
ATOM   10182 C CD2  . TRP A 1 34 ? -0.891  -7.686  -0.240  1.00 15.00 ?  505 TRP A CD2  14 
ATOM   10183 N NE1  . TRP A 1 34 ? 0.670   -8.818  0.898   1.00 15.00 ?  505 TRP A NE1  14 
ATOM   10184 C CE2  . TRP A 1 34 ? 0.403   -8.233  -0.311  1.00 15.00 ?  505 TRP A CE2  14 
ATOM   10185 C CE3  . TRP A 1 34 ? -1.408  -7.030  -1.358  1.00 15.00 ?  505 TRP A CE3  14 
ATOM   10186 C CZ2  . TRP A 1 34 ? 1.184   -8.146  -1.457  1.00 15.00 ?  505 TRP A CZ2  14 
ATOM   10187 C CZ3  . TRP A 1 34 ? -0.633  -6.945  -2.495  1.00 15.00 ?  505 TRP A CZ3  14 
ATOM   10188 C CH2  . TRP A 1 34 ? 0.653   -7.499  -2.538  1.00 15.00 ?  505 TRP A CH2  14 
ATOM   10189 H H    . TRP A 1 34 ? -1.720  -6.147  3.573   1.00 15.00 ?  505 TRP A H    14 
ATOM   10190 H HA   . TRP A 1 34 ? -2.793  -5.555  0.916   1.00 15.00 ?  505 TRP A HA   14 
ATOM   10191 H HB2  . TRP A 1 34 ? -2.870  -8.106  2.547   1.00 15.00 ?  505 TRP A HB2  14 
ATOM   10192 H HB3  . TRP A 1 34 ? -3.485  -7.930  0.910   1.00 15.00 ?  505 TRP A HB3  14 
ATOM   10193 H HD1  . TRP A 1 34 ? -0.488  -8.993  2.743   1.00 15.00 ?  505 TRP A HD1  14 
ATOM   10194 H HE1  . TRP A 1 34 ? 1.500   -9.284  1.134   1.00 15.00 ?  505 TRP A HE1  14 
ATOM   10195 H HE3  . TRP A 1 34 ? -2.397  -6.598  -1.345  1.00 15.00 ?  505 TRP A HE3  14 
ATOM   10196 H HZ2  . TRP A 1 34 ? 2.177   -8.568  -1.508  1.00 15.00 ?  505 TRP A HZ2  14 
ATOM   10197 H HZ3  . TRP A 1 34 ? -1.017  -6.442  -3.371  1.00 15.00 ?  505 TRP A HZ3  14 
ATOM   10198 H HH2  . TRP A 1 34 ? 1.224   -7.413  -3.454  1.00 15.00 ?  505 TRP A HH2  14 
ATOM   10199 N N    . GLU A 1 35 ? -4.487  -5.362  3.556   1.00 15.00 ?  506 GLU A N    14 
ATOM   10200 C CA   . GLU A 1 35 ? -5.784  -5.314  4.210   1.00 15.00 ?  506 GLU A CA   14 
ATOM   10201 C C    . GLU A 1 35 ? -6.476  -3.996  4.009   1.00 15.00 ?  506 GLU A C    14 
ATOM   10202 O O    . GLU A 1 35 ? -5.879  -2.926  4.130   1.00 15.00 ?  506 GLU A O    14 
ATOM   10203 C CB   . GLU A 1 35 ? -5.644  -5.617  5.699   1.00 15.00 ?  506 GLU A CB   14 
ATOM   10204 C CG   . GLU A 1 35 ? -6.946  -6.067  6.338   1.00 15.00 ?  506 GLU A CG   14 
ATOM   10205 C CD   . GLU A 1 35 ? -7.423  -7.394  5.784   1.00 15.00 ?  506 GLU A CD   14 
ATOM   10206 O OE1  . GLU A 1 35 ? -7.957  -7.422  4.656   1.00 15.00 ?  506 GLU A OE1  14 
ATOM   10207 O OE2  . GLU A 1 35 ? -7.260  -8.420  6.474   1.00 15.00 -1 506 GLU A OE2  14 
ATOM   10208 H H    . GLU A 1 35 ? -3.697  -5.008  4.021   1.00 15.00 ?  506 GLU A H    14 
ATOM   10209 H HA   . GLU A 1 35 ? -6.408  -6.058  3.758   1.00 15.00 ?  506 GLU A HA   14 
ATOM   10210 H HB2  . GLU A 1 35 ? -4.911  -6.399  5.832   1.00 15.00 ?  506 GLU A HB2  14 
ATOM   10211 H HB3  . GLU A 1 35 ? -5.307  -4.727  6.209   1.00 15.00 ?  506 GLU A HB3  14 
ATOM   10212 H HG2  . GLU A 1 35 ? -6.795  -6.171  7.403   1.00 15.00 ?  506 GLU A HG2  14 
ATOM   10213 H HG3  . GLU A 1 35 ? -7.703  -5.321  6.151   1.00 15.00 ?  506 GLU A HG3  14 
ATOM   10214 N N    . ASP A 1 36 ? -7.763  -4.102  3.735   1.00 15.00 ?  507 ASP A N    14 
ATOM   10215 C CA   . ASP A 1 36 ? -8.579  -2.949  3.466   1.00 15.00 ?  507 ASP A CA   14 
ATOM   10216 C C    . ASP A 1 36 ? -8.983  -2.272  4.779   1.00 15.00 ?  507 ASP A C    14 
ATOM   10217 O O    . ASP A 1 36 ? -9.725  -2.846  5.579   1.00 15.00 ?  507 ASP A O    14 
ATOM   10218 C CB   . ASP A 1 36 ? -9.811  -3.357  2.653   1.00 15.00 ?  507 ASP A CB   14 
ATOM   10219 C CG   . ASP A 1 36 ? -10.753 -2.205  2.379   1.00 15.00 ?  507 ASP A CG   14 
ATOM   10220 O OD1  . ASP A 1 36 ? -10.407 -1.330  1.563   1.00 15.00 ?  507 ASP A OD1  14 
ATOM   10221 O OD2  . ASP A 1 36 ? -11.862 -2.195  2.955   1.00 15.00 -1 507 ASP A OD2  14 
ATOM   10222 H H    . ASP A 1 36 ? -8.177  -4.992  3.725   1.00 15.00 ?  507 ASP A H    14 
ATOM   10223 H HA   . ASP A 1 36 ? -7.974  -2.281  2.887   1.00 15.00 ?  507 ASP A HA   14 
ATOM   10224 H HB2  . ASP A 1 36 ? -9.488  -3.762  1.705   1.00 15.00 ?  507 ASP A HB2  14 
ATOM   10225 H HB3  . ASP A 1 36 ? -10.353 -4.119  3.196   1.00 15.00 ?  507 ASP A HB3  14 
ATOM   10226 N N    . PRO A 1 37 ? -8.470  -1.055  5.035   1.00 15.00 ?  508 PRO A N    14 
ATOM   10227 C CA   . PRO A 1 37 ? -8.632  -0.381  6.325   1.00 15.00 ?  508 PRO A CA   14 
ATOM   10228 C C    . PRO A 1 37 ? -9.923  0.429   6.471   1.00 15.00 ?  508 PRO A C    14 
ATOM   10229 O O    . PRO A 1 37 ? -10.325 0.760   7.586   1.00 15.00 ?  508 PRO A O    14 
ATOM   10230 C CB   . PRO A 1 37 ? -7.427  0.551   6.350   1.00 15.00 ?  508 PRO A CB   14 
ATOM   10231 C CG   . PRO A 1 37 ? -7.248  0.947   4.924   1.00 15.00 ?  508 PRO A CG   14 
ATOM   10232 C CD   . PRO A 1 37 ? -7.656  -0.250  4.099   1.00 15.00 ?  508 PRO A CD   14 
ATOM   10233 H HA   . PRO A 1 37 ? -8.557  -1.078  7.145   1.00 15.00 ?  508 PRO A HA   14 
ATOM   10234 H HB2  . PRO A 1 37 ? -7.635  1.404   6.980   1.00 15.00 ?  508 PRO A HB2  14 
ATOM   10235 H HB3  . PRO A 1 37 ? -6.563  0.019   6.723   1.00 15.00 ?  508 PRO A HB3  14 
ATOM   10236 H HG2  . PRO A 1 37 ? -7.883  1.790   4.696   1.00 15.00 ?  508 PRO A HG2  14 
ATOM   10237 H HG3  . PRO A 1 37 ? -6.213  1.195   4.737   1.00 15.00 ?  508 PRO A HG3  14 
ATOM   10238 H HD2  . PRO A 1 37 ? -8.239  0.060   3.248   1.00 15.00 ?  508 PRO A HD2  14 
ATOM   10239 H HD3  . PRO A 1 37 ? -6.784  -0.801  3.779   1.00 15.00 ?  508 PRO A HD3  14 
ATOM   10240 N N    . ARG A 1 38 ? -10.570 0.760   5.366   1.00 15.00 ?  509 ARG A N    14 
ATOM   10241 C CA   . ARG A 1 38 ? -11.742 1.623   5.423   1.00 15.00 ?  509 ARG A CA   14 
ATOM   10242 C C    . ARG A 1 38 ? -12.869 1.072   4.564   1.00 15.00 ?  509 ARG A C    14 
ATOM   10243 O O    . ARG A 1 38 ? -13.752 0.389   5.124   1.00 15.00 ?  509 ARG A O    14 
ATOM   10244 C CB   . ARG A 1 38 ? -11.380 3.053   4.999   1.00 15.00 ?  509 ARG A CB   14 
ATOM   10245 C CG   . ARG A 1 38 ? -12.564 4.013   4.966   1.00 15.00 ?  509 ARG A CG   14 
ATOM   10246 C CD   . ARG A 1 38 ? -13.335 4.019   6.281   1.00 15.00 ?  509 ARG A CD   14 
ATOM   10247 N NE   . ARG A 1 38 ? -12.541 4.522   7.403   1.00 15.00 ?  509 ARG A NE   14 
ATOM   10248 C CZ   . ARG A 1 38 ? -12.810 4.247   8.680   1.00 15.00 ?  509 ARG A CZ   14 
ATOM   10249 N NH1  . ARG A 1 38 ? -13.795 3.414   8.991   1.00 15.00 1  509 ARG A NH1  14 
ATOM   10250 N NH2  . ARG A 1 38 ? -12.077 4.784   9.642   1.00 15.00 ?  509 ARG A NH2  14 
ATOM   10251 H H    . ARG A 1 38 ? -10.269 0.410   4.501   1.00 15.00 ?  509 ARG A H    14 
ATOM   10252 H HA   . ARG A 1 38 ? -12.078 1.643   6.449   1.00 15.00 ?  509 ARG A HA   14 
ATOM   10253 H HB2  . ARG A 1 38 ? -10.650 3.445   5.692   1.00 15.00 ?  509 ARG A HB2  14 
ATOM   10254 H HB3  . ARG A 1 38 ? -10.945 3.022   4.011   1.00 15.00 ?  509 ARG A HB3  14 
ATOM   10255 H HG2  . ARG A 1 38 ? -12.201 5.011   4.773   1.00 15.00 ?  509 ARG A HG2  14 
ATOM   10256 H HG3  . ARG A 1 38 ? -13.232 3.713   4.170   1.00 15.00 ?  509 ARG A HG3  14 
ATOM   10257 H HD2  . ARG A 1 38 ? -14.208 4.645   6.166   1.00 15.00 ?  509 ARG A HD2  14 
ATOM   10258 H HD3  . ARG A 1 38 ? -13.648 3.008   6.499   1.00 15.00 ?  509 ARG A HD3  14 
ATOM   10259 H HE   . ARG A 1 38 ? -11.779 5.113   7.193   1.00 15.00 ?  509 ARG A HE   14 
ATOM   10260 H HH11 . ARG A 1 38 ? -14.340 2.982   8.265   1.00 15.00 ?  509 ARG A HH11 14 
ATOM   10261 H HH12 . ARG A 1 38 ? -14.001 3.206   9.954   1.00 15.00 ?  509 ARG A HH12 14 
ATOM   10262 H HH21 . ARG A 1 38 ? -11.317 5.401   9.412   1.00 15.00 ?  509 ARG A HH21 14 
ATOM   10263 H HH22 . ARG A 1 38 ? -12.272 4.570   10.604  1.00 15.00 ?  509 ARG A HH22 14 
ATOM   10264 N N    . ARG B 2 1  ? -3.619  -14.117 2.508   1.00 15.00 ?  925 ARG B N    14 
ATOM   10265 C CA   . ARG B 2 1  ? -2.737  -13.012 2.061   1.00 15.00 ?  925 ARG B CA   14 
ATOM   10266 C C    . ARG B 2 1  ? -1.393  -13.571 1.615   1.00 15.00 ?  925 ARG B C    14 
ATOM   10267 O O    . ARG B 2 1  ? -0.738  -14.294 2.364   1.00 15.00 ?  925 ARG B O    14 
ATOM   10268 C CB   . ARG B 2 1  ? -2.519  -11.988 3.192   1.00 15.00 ?  925 ARG B CB   14 
ATOM   10269 C CG   . ARG B 2 1  ? -3.710  -11.075 3.481   1.00 15.00 ?  925 ARG B CG   14 
ATOM   10270 C CD   . ARG B 2 1  ? -4.842  -11.806 4.187   1.00 15.00 ?  925 ARG B CD   14 
ATOM   10271 N NE   . ARG B 2 1  ? -5.976  -10.926 4.473   1.00 15.00 ?  925 ARG B NE   14 
ATOM   10272 C CZ   . ARG B 2 1  ? -7.242  -11.340 4.561   1.00 15.00 ?  925 ARG B CZ   14 
ATOM   10273 N NH1  . ARG B 2 1  ? -7.546  -12.618 4.361   1.00 15.00 1  925 ARG B NH1  14 
ATOM   10274 N NH2  . ARG B 2 1  ? -8.204  -10.473 4.852   1.00 15.00 ?  925 ARG B NH2  14 
ATOM   10275 H H1   . ARG B 2 1  ? -3.667  -14.858 1.777   1.00 15.00 ?  925 ARG B H1   14 
ATOM   10276 H H2   . ARG B 2 1  ? -4.584  -13.763 2.678   1.00 15.00 ?  925 ARG B H2   14 
ATOM   10277 H H3   . ARG B 2 1  ? -3.253  -14.541 3.389   1.00 15.00 ?  925 ARG B H3   14 
ATOM   10278 H HA   . ARG B 2 1  ? -3.206  -12.520 1.221   1.00 15.00 ?  925 ARG B HA   14 
ATOM   10279 H HB2  . ARG B 2 1  ? -2.286  -12.525 4.099   1.00 15.00 ?  925 ARG B HB2  14 
ATOM   10280 H HB3  . ARG B 2 1  ? -1.675  -11.365 2.933   1.00 15.00 ?  925 ARG B HB3  14 
ATOM   10281 H HG2  . ARG B 2 1  ? -3.380  -10.263 4.111   1.00 15.00 ?  925 ARG B HG2  14 
ATOM   10282 H HG3  . ARG B 2 1  ? -4.080  -10.678 2.546   1.00 15.00 ?  925 ARG B HG3  14 
ATOM   10283 H HD2  . ARG B 2 1  ? -5.179  -12.615 3.557   1.00 15.00 ?  925 ARG B HD2  14 
ATOM   10284 H HD3  . ARG B 2 1  ? -4.468  -12.208 5.117   1.00 15.00 ?  925 ARG B HD3  14 
ATOM   10285 H HE   . ARG B 2 1  ? -5.781  -9.971  4.617   1.00 15.00 ?  925 ARG B HE   14 
ATOM   10286 H HH11 . ARG B 2 1  ? -6.823  -13.285 4.145   1.00 15.00 ?  925 ARG B HH11 14 
ATOM   10287 H HH12 . ARG B 2 1  ? -8.505  -12.927 4.428   1.00 15.00 ?  925 ARG B HH12 14 
ATOM   10288 H HH21 . ARG B 2 1  ? -7.980  -9.501  5.012   1.00 15.00 ?  925 ARG B HH21 14 
ATOM   10289 H HH22 . ARG B 2 1  ? -9.155  -10.778 4.914   1.00 15.00 ?  925 ARG B HH22 14 
ATOM   10290 N N    . LEU B 2 2  ? -0.982  -13.234 0.395   1.00 15.00 ?  926 LEU B N    14 
ATOM   10291 C CA   . LEU B 2 2  ? 0.281   -13.720 -0.147  1.00 15.00 ?  926 LEU B CA   14 
ATOM   10292 C C    . LEU B 2 2  ? 1.455   -12.918 0.414   1.00 15.00 ?  926 LEU B C    14 
ATOM   10293 O O    . LEU B 2 2  ? 1.258   -11.972 1.180   1.00 15.00 ?  926 LEU B O    14 
ATOM   10294 C CB   . LEU B 2 2  ? 0.255   -13.685 -1.686  1.00 15.00 ?  926 LEU B CB   14 
ATOM   10295 C CG   . LEU B 2 2  ? -0.117  -12.341 -2.329  1.00 15.00 ?  926 LEU B CG   14 
ATOM   10296 C CD1  . LEU B 2 2  ? 1.093   -11.426 -2.428  1.00 15.00 ?  926 LEU B CD1  14 
ATOM   10297 C CD2  . LEU B 2 2  ? -0.724  -12.563 -3.705  1.00 15.00 ?  926 LEU B CD2  14 
ATOM   10298 H H    . LEU B 2 2  ? -1.535  -12.637 -0.148  1.00 15.00 ?  926 LEU B H    14 
ATOM   10299 H HA   . LEU B 2 2  ? 0.391   -14.747 0.173   1.00 15.00 ?  926 LEU B HA   14 
ATOM   10300 H HB2  . LEU B 2 2  ? 1.235   -13.965 -2.043  1.00 15.00 ?  926 LEU B HB2  14 
ATOM   10301 H HB3  . LEU B 2 2  ? -0.453  -14.426 -2.025  1.00 15.00 ?  926 LEU B HB3  14 
ATOM   10302 H HG   . LEU B 2 2  ? -0.857  -11.849 -1.714  1.00 15.00 ?  926 LEU B HG   14 
ATOM   10303 H HD11 . LEU B 2 2  ? 1.855   -11.900 -3.029  1.00 15.00 ?  926 LEU B HD11 14 
ATOM   10304 H HD12 . LEU B 2 2  ? 1.482   -11.236 -1.438  1.00 15.00 ?  926 LEU B HD12 14 
ATOM   10305 H HD13 . LEU B 2 2  ? 0.802   -10.492 -2.886  1.00 15.00 ?  926 LEU B HD13 14 
ATOM   10306 H HD21 . LEU B 2 2  ? -0.007  -13.065 -4.338  1.00 15.00 ?  926 LEU B HD21 14 
ATOM   10307 H HD22 . LEU B 2 2  ? -0.985  -11.610 -4.142  1.00 15.00 ?  926 LEU B HD22 14 
ATOM   10308 H HD23 . LEU B 2 2  ? -1.611  -13.171 -3.613  1.00 15.00 ?  926 LEU B HD23 14 
ATOM   10309 N N    . ASP B 2 3  ? 2.667   -13.308 0.031   1.00 15.00 ?  927 ASP B N    14 
ATOM   10310 C CA   . ASP B 2 3  ? 3.885   -12.685 0.544   1.00 15.00 ?  927 ASP B CA   14 
ATOM   10311 C C    . ASP B 2 3  ? 3.943   -11.193 0.241   1.00 15.00 ?  927 ASP B C    14 
ATOM   10312 O O    . ASP B 2 3  ? 3.931   -10.772 -0.917  1.00 15.00 ?  927 ASP B O    14 
ATOM   10313 C CB   . ASP B 2 3  ? 5.124   -13.376 -0.026  1.00 15.00 ?  927 ASP B CB   14 
ATOM   10314 C CG   . ASP B 2 3  ? 5.642   -14.473 0.877   1.00 15.00 ?  927 ASP B CG   14 
ATOM   10315 O OD1  . ASP B 2 3  ? 4.984   -15.528 0.980   1.00 15.00 ?  927 ASP B OD1  14 
ATOM   10316 O OD2  . ASP B 2 3  ? 6.712   -14.281 1.492   1.00 15.00 -1 927 ASP B OD2  14 
ATOM   10317 H H    . ASP B 2 3  ? 2.745   -14.041 -0.613  1.00 15.00 ?  927 ASP B H    14 
ATOM   10318 H HA   . ASP B 2 3  ? 3.886   -12.813 1.616   1.00 15.00 ?  927 ASP B HA   14 
ATOM   10319 H HB2  . ASP B 2 3  ? 4.877   -13.809 -0.983  1.00 15.00 ?  927 ASP B HB2  14 
ATOM   10320 H HB3  . ASP B 2 3  ? 5.907   -12.643 -0.159  1.00 15.00 ?  927 ASP B HB3  14 
ATOM   10321 N N    . LEU B 2 4  ? 4.019   -10.408 1.305   1.00 15.00 ?  928 LEU B N    14 
ATOM   10322 C CA   . LEU B 2 4  ? 4.108   -8.960  1.213   1.00 15.00 ?  928 LEU B CA   14 
ATOM   10323 C C    . LEU B 2 4  ? 5.552   -8.532  0.992   1.00 15.00 ?  928 LEU B C    14 
ATOM   10324 O O    . LEU B 2 4  ? 6.436   -8.918  1.760   1.00 15.00 ?  928 LEU B O    14 
ATOM   10325 C CB   . LEU B 2 4  ? 3.585   -8.339  2.513   1.00 15.00 ?  928 LEU B CB   14 
ATOM   10326 C CG   . LEU B 2 4  ? 3.688   -6.818  2.610   1.00 15.00 ?  928 LEU B CG   14 
ATOM   10327 C CD1  . LEU B 2 4  ? 2.708   -6.150  1.661   1.00 15.00 ?  928 LEU B CD1  14 
ATOM   10328 C CD2  . LEU B 2 4  ? 3.445   -6.365  4.038   1.00 15.00 ?  928 LEU B CD2  14 
ATOM   10329 H H    . LEU B 2 4  ? 4.026   -10.822 2.192   1.00 15.00 ?  928 LEU B H    14 
ATOM   10330 H HA   . LEU B 2 4  ? 3.501   -8.627  0.385   1.00 15.00 ?  928 LEU B HA   14 
ATOM   10331 H HB2  . LEU B 2 4  ? 2.547   -8.613  2.624   1.00 15.00 ?  928 LEU B HB2  14 
ATOM   10332 H HB3  . LEU B 2 4  ? 4.139   -8.766  3.334   1.00 15.00 ?  928 LEU B HB3  14 
ATOM   10333 H HG   . LEU B 2 4  ? 4.685   -6.514  2.328   1.00 15.00 ?  928 LEU B HG   14 
ATOM   10334 H HD11 . LEU B 2 4  ? 1.701   -6.452  1.911   1.00 15.00 ?  928 LEU B HD11 14 
ATOM   10335 H HD12 . LEU B 2 4  ? 2.930   -6.448  0.647   1.00 15.00 ?  928 LEU B HD12 14 
ATOM   10336 H HD13 . LEU B 2 4  ? 2.794   -5.078  1.749   1.00 15.00 ?  928 LEU B HD13 14 
ATOM   10337 H HD21 . LEU B 2 4  ? 3.518   -5.289  4.091   1.00 15.00 ?  928 LEU B HD21 14 
ATOM   10338 H HD22 . LEU B 2 4  ? 4.186   -6.809  4.687   1.00 15.00 ?  928 LEU B HD22 14 
ATOM   10339 H HD23 . LEU B 2 4  ? 2.461   -6.676  4.352   1.00 15.00 ?  928 LEU B HD23 14 
ATOM   10340 N N    . PRO B 2 5  ? 5.820   -7.734  -0.052  1.00 15.00 ?  929 PRO B N    14 
ATOM   10341 C CA   . PRO B 2 5  ? 7.155   -7.194  -0.282  1.00 15.00 ?  929 PRO B CA   14 
ATOM   10342 C C    . PRO B 2 5  ? 7.532   -6.170  0.786   1.00 15.00 ?  929 PRO B C    14 
ATOM   10343 O O    . PRO B 2 5  ? 6.743   -5.270  1.099   1.00 15.00 ?  929 PRO B O    14 
ATOM   10344 C CB   . PRO B 2 5  ? 7.045   -6.523  -1.656  1.00 15.00 ?  929 PRO B CB   14 
ATOM   10345 C CG   . PRO B 2 5  ? 5.596   -6.219  -1.825  1.00 15.00 ?  929 PRO B CG   14 
ATOM   10346 C CD   . PRO B 2 5  ? 4.855   -7.297  -1.086  1.00 15.00 ?  929 PRO B CD   14 
ATOM   10347 H HA   . PRO B 2 5  ? 7.900   -7.975  -0.313  1.00 15.00 ?  929 PRO B HA   14 
ATOM   10348 H HB2  . PRO B 2 5  ? 7.641   -5.622  -1.667  1.00 15.00 ?  929 PRO B HB2  14 
ATOM   10349 H HB3  . PRO B 2 5  ? 7.397   -7.203  -2.418  1.00 15.00 ?  929 PRO B HB3  14 
ATOM   10350 H HG2  . PRO B 2 5  ? 5.369   -5.249  -1.406  1.00 15.00 ?  929 PRO B HG2  14 
ATOM   10351 H HG3  . PRO B 2 5  ? 5.339   -6.241  -2.874  1.00 15.00 ?  929 PRO B HG3  14 
ATOM   10352 H HD2  . PRO B 2 5  ? 3.960   -6.893  -0.635  1.00 15.00 ?  929 PRO B HD2  14 
ATOM   10353 H HD3  . PRO B 2 5  ? 4.610   -8.107  -1.756  1.00 15.00 ?  929 PRO B HD3  14 
ATOM   10354 N N    . PRO B 2 6  ? 8.736   -6.304  1.373   1.00 15.00 ?  930 PRO B N    14 
ATOM   10355 C CA   . PRO B 2 6  ? 9.264   -5.330  2.332   1.00 15.00 ?  930 PRO B CA   14 
ATOM   10356 C C    . PRO B 2 6  ? 9.193   -3.925  1.751   1.00 15.00 ?  930 PRO B C    14 
ATOM   10357 O O    . PRO B 2 6  ? 9.542   -3.719  0.585   1.00 15.00 ?  930 PRO B O    14 
ATOM   10358 C CB   . PRO B 2 6  ? 10.725  -5.764  2.538   1.00 15.00 ?  930 PRO B CB   14 
ATOM   10359 C CG   . PRO B 2 6  ? 10.999  -6.783  1.480   1.00 15.00 ?  930 PRO B CG   14 
ATOM   10360 C CD   . PRO B 2 6  ? 9.676   -7.406  1.144   1.00 15.00 ?  930 PRO B CD   14 
ATOM   10361 H HA   . PRO B 2 6  ? 8.730   -5.363  3.271   1.00 15.00 ?  930 PRO B HA   14 
ATOM   10362 H HB2  . PRO B 2 6  ? 11.371  -4.906  2.432   1.00 15.00 ?  930 PRO B HB2  14 
ATOM   10363 H HB3  . PRO B 2 6  ? 10.838  -6.183  3.526   1.00 15.00 ?  930 PRO B HB3  14 
ATOM   10364 H HG2  . PRO B 2 6  ? 11.417  -6.303  0.608   1.00 15.00 ?  930 PRO B HG2  14 
ATOM   10365 H HG3  . PRO B 2 6  ? 11.679  -7.531  1.859   1.00 15.00 ?  930 PRO B HG3  14 
ATOM   10366 H HD2  . PRO B 2 6  ? 9.657   -7.724  0.112   1.00 15.00 ?  930 PRO B HD2  14 
ATOM   10367 H HD3  . PRO B 2 6  ? 9.468   -8.236  1.803   1.00 15.00 ?  930 PRO B HD3  14 
ATOM   10368 N N    . TYR B 2 7  ? 8.736   -2.966  2.554   1.00 15.00 ?  931 TYR B N    14 
ATOM   10369 C CA   . TYR B 2 7  ? 8.450   -1.638  2.034   1.00 15.00 ?  931 TYR B CA   14 
ATOM   10370 C C    . TYR B 2 7  ? 9.684   -0.999  1.415   1.00 15.00 ?  931 TYR B C    14 
ATOM   10371 O O    . TYR B 2 7  ? 10.700  -0.783  2.078   1.00 15.00 ?  931 TYR B O    14 
ATOM   10372 C CB   . TYR B 2 7  ? 7.897   -0.740  3.150   1.00 15.00 ?  931 TYR B CB   14 
ATOM   10373 C CG   . TYR B 2 7  ? 7.773   0.728   2.770   1.00 15.00 ?  931 TYR B CG   14 
ATOM   10374 C CD1  . TYR B 2 7  ? 6.752   1.180   1.938   1.00 15.00 ?  931 TYR B CD1  14 
ATOM   10375 C CD2  . TYR B 2 7  ? 8.679   1.665   3.254   1.00 15.00 ?  931 TYR B CD2  14 
ATOM   10376 C CE1  . TYR B 2 7  ? 6.643   2.515   1.602   1.00 15.00 ?  931 TYR B CE1  14 
ATOM   10377 C CE2  . TYR B 2 7  ? 8.574   3.002   2.920   1.00 15.00 ?  931 TYR B CE2  14 
ATOM   10378 C CZ   . TYR B 2 7  ? 7.555   3.420   2.095   1.00 15.00 ?  931 TYR B CZ   14 
ATOM   10379 O OH   . TYR B 2 7  ? 7.447   4.750   1.763   1.00 15.00 ?  931 TYR B OH   14 
ATOM   10380 H H    . TYR B 2 7  ? 8.596   -3.155  3.504   1.00 15.00 ?  931 TYR B H    14 
ATOM   10381 H HA   . TYR B 2 7  ? 7.695   -1.741  1.269   1.00 15.00 ?  931 TYR B HA   14 
ATOM   10382 H HB2  . TYR B 2 7  ? 6.916   -1.091  3.429   1.00 15.00 ?  931 TYR B HB2  14 
ATOM   10383 H HB3  . TYR B 2 7  ? 8.552   -0.805  4.007   1.00 15.00 ?  931 TYR B HB3  14 
ATOM   10384 H HD1  . TYR B 2 7  ? 6.038   0.475   1.548   1.00 15.00 ?  931 TYR B HD1  14 
ATOM   10385 H HD2  . TYR B 2 7  ? 9.479   1.336   3.900   1.00 15.00 ?  931 TYR B HD2  14 
ATOM   10386 H HE1  . TYR B 2 7  ? 5.844   2.844   0.956   1.00 15.00 ?  931 TYR B HE1  14 
ATOM   10387 H HE2  . TYR B 2 7  ? 9.289   3.712   3.306   1.00 15.00 ?  931 TYR B HE2  14 
ATOM   10388 H HH   . TYR B 2 7  ? 8.322   5.098   1.551   1.00 15.00 ?  931 TYR B HH   14 
ATOM   10389 N N    . GLU B 2 8  ? 9.558   -0.710  0.135   1.00 15.00 ?  932 GLU B N    14 
ATOM   10390 C CA   . GLU B 2 8  ? 10.488  0.130   -0.589  1.00 15.00 ?  932 GLU B CA   14 
ATOM   10391 C C    . GLU B 2 8  ? 9.771   1.430   -0.892  1.00 15.00 ?  932 GLU B C    14 
ATOM   10392 O O    . GLU B 2 8  ? 8.557   1.414   -1.107  1.00 15.00 ?  932 GLU B O    14 
ATOM   10393 C CB   . GLU B 2 8  ? 10.919  -0.562  -1.889  1.00 15.00 ?  932 GLU B CB   14 
ATOM   10394 C CG   . GLU B 2 8  ? 9.758   -0.914  -2.811  1.00 15.00 ?  932 GLU B CG   14 
ATOM   10395 C CD   . GLU B 2 8  ? 10.207  -1.508  -4.129  1.00 15.00 ?  932 GLU B CD   14 
ATOM   10396 O OE1  . GLU B 2 8  ? 10.595  -0.734  -5.032  1.00 15.00 ?  932 GLU B OE1  14 
ATOM   10397 O OE2  . GLU B 2 8  ? 10.167  -2.747  -4.274  1.00 15.00 -1 932 GLU B OE2  14 
ATOM   10398 H H    . GLU B 2 8  ? 8.795   -1.081  -0.352  1.00 15.00 ?  932 GLU B H    14 
ATOM   10399 H HA   . GLU B 2 8  ? 11.349  0.320   0.035   1.00 15.00 ?  932 GLU B HA   14 
ATOM   10400 H HB2  . GLU B 2 8  ? 11.590  0.093   -2.426  1.00 15.00 ?  932 GLU B HB2  14 
ATOM   10401 H HB3  . GLU B 2 8  ? 11.443  -1.474  -1.642  1.00 15.00 ?  932 GLU B HB3  14 
ATOM   10402 H HG2  . GLU B 2 8  ? 9.124   -1.630  -2.311  1.00 15.00 ?  932 GLU B HG2  14 
ATOM   10403 H HG3  . GLU B 2 8  ? 9.192   -0.014  -3.013  1.00 15.00 ?  932 GLU B HG3  14 
ATOM   10404 N N    . THR B 2 9  ? 10.459  2.554   -0.927  1.00 15.00 ?  933 THR B N    14 
ATOM   10405 C CA   . THR B 2 9  ? 9.751   3.763   -1.275  1.00 15.00 ?  933 THR B CA   14 
ATOM   10406 C C    . THR B 2 9  ? 9.758   3.976   -2.777  1.00 15.00 ?  933 THR B C    14 
ATOM   10407 O O    . THR B 2 9  ? 10.801  4.088   -3.420  1.00 15.00 ?  933 THR B O    14 
ATOM   10408 C CB   . THR B 2 9  ? 10.259  5.026   -0.565  1.00 15.00 ?  933 THR B CB   14 
ATOM   10409 O OG1  . THR B 2 9  ? 10.367  4.788   0.847   1.00 15.00 ?  933 THR B OG1  14 
ATOM   10410 C CG2  . THR B 2 9  ? 9.282   6.175   -0.815  1.00 15.00 ?  933 THR B CG2  14 
ATOM   10411 H H    . THR B 2 9  ? 11.425  2.564   -0.750  1.00 15.00 ?  933 THR B H    14 
ATOM   10412 H HA   . THR B 2 9  ? 8.723   3.614   -0.973  1.00 15.00 ?  933 THR B HA   14 
ATOM   10413 H HB   . THR B 2 9  ? 11.227  5.294   -0.963  1.00 15.00 ?  933 THR B HB   14 
ATOM   10414 H HG1  . THR B 2 9  ? 10.911  4.001   1.000   1.00 15.00 ?  933 THR B HG1  14 
ATOM   10415 H HG21 . THR B 2 9  ? 9.306   6.445   -1.862  1.00 15.00 ?  933 THR B HG21 14 
ATOM   10416 H HG22 . THR B 2 9  ? 9.557   7.027   -0.215  1.00 15.00 ?  933 THR B HG22 14 
ATOM   10417 H HG23 . THR B 2 9  ? 8.275   5.856   -0.558  1.00 15.00 ?  933 THR B HG23 14 
ATOM   10418 N N    . PHE B 2 10 ? 8.558   4.009   -3.295  1.00 15.00 ?  934 PHE B N    14 
ATOM   10419 C CA   . PHE B 2 10 ? 8.266   4.269   -4.686  1.00 15.00 ?  934 PHE B CA   14 
ATOM   10420 C C    . PHE B 2 10 ? 7.801   5.726   -4.786  1.00 15.00 ?  934 PHE B C    14 
ATOM   10421 O O    . PHE B 2 10 ? 7.828   6.436   -3.778  1.00 15.00 ?  934 PHE B O    14 
ATOM   10422 C CB   . PHE B 2 10 ? 7.189   3.296   -5.175  1.00 15.00 ?  934 PHE B CB   14 
ATOM   10423 C CG   . PHE B 2 10 ? 5.864   3.612   -4.581  1.00 15.00 ?  934 PHE B CG   14 
ATOM   10424 C CD1  . PHE B 2 10 ? 5.563   3.265   -3.274  1.00 15.00 ?  934 PHE B CD1  14 
ATOM   10425 C CD2  . PHE B 2 10 ? 4.948   4.330   -5.311  1.00 15.00 ?  934 PHE B CD2  14 
ATOM   10426 C CE1  . PHE B 2 10 ? 4.363   3.631   -2.720  1.00 15.00 ?  934 PHE B CE1  14 
ATOM   10427 C CE2  . PHE B 2 10 ? 3.758   4.710   -4.757  1.00 15.00 ?  934 PHE B CE2  14 
ATOM   10428 C CZ   . PHE B 2 10 ? 3.467   4.363   -3.465  1.00 15.00 ?  934 PHE B CZ   14 
ATOM   10429 H H    . PHE B 2 10 ? 7.801   3.851   -2.696  1.00 15.00 ?  934 PHE B H    14 
ATOM   10430 H HA   . PHE B 2 10 ? 9.172   4.137   -5.259  1.00 15.00 ?  934 PHE B HA   14 
ATOM   10431 H HB2  . PHE B 2 10 ? 7.106   3.360   -6.250  1.00 15.00 ?  934 PHE B HB2  14 
ATOM   10432 H HB3  . PHE B 2 10 ? 7.457   2.290   -4.892  1.00 15.00 ?  934 PHE B HB3  14 
ATOM   10433 H HD1  . PHE B 2 10 ? 6.265   2.679   -2.699  1.00 15.00 ?  934 PHE B HD1  14 
ATOM   10434 H HD2  . PHE B 2 10 ? 5.179   4.593   -6.329  1.00 15.00 ?  934 PHE B HD2  14 
ATOM   10435 H HE1  . PHE B 2 10 ? 4.131   3.359   -1.701  1.00 15.00 ?  934 PHE B HE1  14 
ATOM   10436 H HE2  . PHE B 2 10 ? 3.046   5.276   -5.340  1.00 15.00 ?  934 PHE B HE2  14 
ATOM   10437 H HZ   . PHE B 2 10 ? 2.552   4.674   -3.036  1.00 15.00 ?  934 PHE B HZ   14 
ATOM   10438 N N    . GLU B 2 11 ? 7.451   6.188   -5.979  1.00 15.00 ?  935 GLU B N    14 
ATOM   10439 C CA   . GLU B 2 11 ? 7.051   7.586   -6.190  1.00 15.00 ?  935 GLU B CA   14 
ATOM   10440 C C    . GLU B 2 11 ? 6.019   8.060   -5.162  1.00 15.00 ?  935 GLU B C    14 
ATOM   10441 O O    . GLU B 2 11 ? 5.091   7.338   -4.809  1.00 15.00 ?  935 GLU B O    14 
ATOM   10442 C CB   . GLU B 2 11 ? 6.437   7.743   -7.580  1.00 15.00 ?  935 GLU B CB   14 
ATOM   10443 C CG   . GLU B 2 11 ? 5.277   6.785   -7.856  1.00 15.00 ?  935 GLU B CG   14 
ATOM   10444 C CD   . GLU B 2 11 ? 5.714   5.571   -8.649  1.00 15.00 ?  935 GLU B CD   14 
ATOM   10445 O OE1  . GLU B 2 11 ? 6.446   4.720   -8.104  1.00 15.00 ?  935 GLU B OE1  14 
ATOM   10446 O OE2  . GLU B 2 11 ? 5.329   5.468   -9.832  1.00 15.00 -1 935 GLU B OE2  14 
ATOM   10447 H H    . GLU B 2 11 ? 7.437   5.568   -6.746  1.00 15.00 ?  935 GLU B H    14 
ATOM   10448 H HA   . GLU B 2 11 ? 7.933   8.205   -6.122  1.00 15.00 ?  935 GLU B HA   14 
ATOM   10449 H HB2  . GLU B 2 11 ? 6.072   8.754   -7.684  1.00 15.00 ?  935 GLU B HB2  14 
ATOM   10450 H HB3  . GLU B 2 11 ? 7.202   7.568   -8.321  1.00 15.00 ?  935 GLU B HB3  14 
ATOM   10451 H HG2  . GLU B 2 11 ? 4.847   6.448   -6.906  1.00 15.00 ?  935 GLU B HG2  14 
ATOM   10452 H HG3  . GLU B 2 11 ? 4.522   7.312   -8.421  1.00 15.00 ?  935 GLU B HG3  14 
ATOM   10453 N N    . ASP B 2 12 ? 6.180   9.295   -4.703  1.00 15.00 ?  936 ASP B N    14 
ATOM   10454 C CA   . ASP B 2 12 ? 5.263   9.880   -3.730  1.00 15.00 ?  936 ASP B CA   14 
ATOM   10455 C C    . ASP B 2 12 ? 3.914   10.173  -4.382  1.00 15.00 ?  936 ASP B C    14 
ATOM   10456 O O    . ASP B 2 12 ? 3.850   10.731  -5.482  1.00 15.00 ?  936 ASP B O    14 
ATOM   10457 C CB   . ASP B 2 12 ? 5.860   11.161  -3.131  1.00 15.00 ?  936 ASP B CB   14 
ATOM   10458 C CG   . ASP B 2 12 ? 6.084   12.259  -4.157  1.00 15.00 ?  936 ASP B CG   14 
ATOM   10459 O OD1  . ASP B 2 12 ? 7.031   12.143  -4.966  1.00 15.00 ?  936 ASP B OD1  14 
ATOM   10460 O OD2  . ASP B 2 12 ? 5.326   13.256  -4.148  1.00 15.00 -1 936 ASP B OD2  14 
ATOM   10461 H H    . ASP B 2 12 ? 6.926   9.836   -5.036  1.00 15.00 ?  936 ASP B H    14 
ATOM   10462 H HA   . ASP B 2 12 ? 5.116   9.158   -2.940  1.00 15.00 ?  936 ASP B HA   14 
ATOM   10463 H HB2  . ASP B 2 12 ? 5.190   11.540  -2.374  1.00 15.00 ?  936 ASP B HB2  14 
ATOM   10464 H HB3  . ASP B 2 12 ? 6.811   10.925  -2.674  1.00 15.00 ?  936 ASP B HB3  14 
ATOM   10465 N N    . LEU B 2 13 ? 2.834   9.801   -3.701  1.00 15.00 ?  937 LEU B N    14 
ATOM   10466 C CA   . LEU B 2 13 ? 1.494   9.963   -4.254  1.00 15.00 ?  937 LEU B CA   14 
ATOM   10467 C C    . LEU B 2 13 ? 0.960   11.371  -3.999  1.00 15.00 ?  937 LEU B C    14 
ATOM   10468 O O    . LEU B 2 13 ? 0.035   11.569  -3.210  1.00 15.00 ?  937 LEU B O    14 
ATOM   10469 C CB   . LEU B 2 13 ? 0.534   8.930   -3.653  1.00 15.00 ?  937 LEU B CB   14 
ATOM   10470 C CG   . LEU B 2 13 ? 0.843   7.454   -3.927  1.00 15.00 ?  937 LEU B CG   14 
ATOM   10471 C CD1  . LEU B 2 13 ? -0.448  6.672   -4.114  1.00 15.00 ?  937 LEU B CD1  14 
ATOM   10472 C CD2  . LEU B 2 13 ? 1.734   7.286   -5.149  1.00 15.00 ?  937 LEU B CD2  14 
ATOM   10473 H H    . LEU B 2 13 ? 2.937   9.409   -2.804  1.00 15.00 ?  937 LEU B H    14 
ATOM   10474 H HA   . LEU B 2 13 ? 1.556   9.802   -5.320  1.00 15.00 ?  937 LEU B HA   14 
ATOM   10475 H HB2  . LEU B 2 13 ? 0.552   9.061   -2.576  1.00 15.00 ?  937 LEU B HB2  14 
ATOM   10476 H HB3  . LEU B 2 13 ? -0.463  9.141   -4.010  1.00 15.00 ?  937 LEU B HB3  14 
ATOM   10477 H HG   . LEU B 2 13 ? 1.361   7.041   -3.054  1.00 15.00 ?  937 LEU B HG   14 
ATOM   10478 H HD11 . LEU B 2 13 ? -1.051  6.755   -3.221  1.00 15.00 ?  937 LEU B HD11 14 
ATOM   10479 H HD12 . LEU B 2 13 ? -0.217  5.634   -4.298  1.00 15.00 ?  937 LEU B HD12 14 
ATOM   10480 H HD13 . LEU B 2 13 ? -0.995  7.076   -4.953  1.00 15.00 ?  937 LEU B HD13 14 
ATOM   10481 H HD21 . LEU B 2 13 ? 2.667   7.807   -4.989  1.00 15.00 ?  937 LEU B HD21 14 
ATOM   10482 H HD22 . LEU B 2 13 ? 1.237   7.695   -6.016  1.00 15.00 ?  937 LEU B HD22 14 
ATOM   10483 H HD23 . LEU B 2 13 ? 1.932   6.235   -5.309  1.00 15.00 ?  937 LEU B HD23 14 
HETATM 10484 N N    . NH2 B 2 14 ? 1.531   12.345  -4.688  1.00 15.00 ?  938 NH2 B N    14 
HETATM 10485 H HN1  . NH2 B 2 14 ? 2.262   12.113  -5.297  1.00 15.00 ?  938 NH2 B HN1  14 
HETATM 10486 H HN2  . NH2 B 2 14 ? 1.200   13.259  -4.559  1.00 15.00 ?  938 NH2 B HN2  14 
ATOM   10487 N N    . PHE A 1 7  ? -8.811  10.043  -2.112  1.00 15.00 ?  478 PHE A N    15 
ATOM   10488 C CA   . PHE A 1 7  ? -9.840  8.979   -2.058  1.00 15.00 ?  478 PHE A CA   15 
ATOM   10489 C C    . PHE A 1 7  ? -9.510  7.976   -0.959  1.00 15.00 ?  478 PHE A C    15 
ATOM   10490 O O    . PHE A 1 7  ? -10.380 7.249   -0.481  1.00 15.00 ?  478 PHE A O    15 
ATOM   10491 C CB   . PHE A 1 7  ? -9.945  8.259   -3.406  1.00 15.00 ?  478 PHE A CB   15 
ATOM   10492 C CG   . PHE A 1 7  ? -10.213 9.181   -4.565  1.00 15.00 ?  478 PHE A CG   15 
ATOM   10493 C CD1  . PHE A 1 7  ? -11.456 9.771   -4.726  1.00 15.00 ?  478 PHE A CD1  15 
ATOM   10494 C CD2  . PHE A 1 7  ? -9.218  9.458   -5.490  1.00 15.00 ?  478 PHE A CD2  15 
ATOM   10495 C CE1  . PHE A 1 7  ? -11.701 10.622  -5.789  1.00 15.00 ?  478 PHE A CE1  15 
ATOM   10496 C CE2  . PHE A 1 7  ? -9.458  10.307  -6.553  1.00 15.00 ?  478 PHE A CE2  15 
ATOM   10497 C CZ   . PHE A 1 7  ? -10.702 10.890  -6.702  1.00 15.00 ?  478 PHE A CZ   15 
ATOM   10498 H H    . PHE A 1 7  ? -7.879  9.636   -2.332  1.00 15.00 ?  478 PHE A H    15 
ATOM   10499 H HA   . PHE A 1 7  ? -10.790 9.442   -1.830  1.00 15.00 ?  478 PHE A HA   15 
ATOM   10500 H HB2  . PHE A 1 7  ? -9.017  7.741   -3.601  1.00 15.00 ?  478 PHE A HB2  15 
ATOM   10501 H HB3  . PHE A 1 7  ? -10.749 7.539   -3.360  1.00 15.00 ?  478 PHE A HB3  15 
ATOM   10502 H HD1  . PHE A 1 7  ? -12.238 9.563   -4.012  1.00 15.00 ?  478 PHE A HD1  15 
ATOM   10503 H HD2  . PHE A 1 7  ? -8.246  9.003   -5.374  1.00 15.00 ?  478 PHE A HD2  15 
ATOM   10504 H HE1  . PHE A 1 7  ? -12.674 11.078  -5.905  1.00 15.00 ?  478 PHE A HE1  15 
ATOM   10505 H HE2  . PHE A 1 7  ? -8.674  10.515  -7.267  1.00 15.00 ?  478 PHE A HE2  15 
ATOM   10506 H HZ   . PHE A 1 7  ? -10.893 11.554  -7.532  1.00 15.00 ?  478 PHE A HZ   15 
ATOM   10507 N N    . LEU A 1 8  ? -8.235  7.914   -0.601  1.00 15.00 ?  479 LEU A N    15 
ATOM   10508 C CA   . LEU A 1 8  ? -7.776  7.096   0.508   1.00 15.00 ?  479 LEU A CA   15 
ATOM   10509 C C    . LEU A 1 8  ? -7.327  8.037   1.628   1.00 15.00 ?  479 LEU A C    15 
ATOM   10510 O O    . LEU A 1 8  ? -6.961  9.178   1.338   1.00 15.00 ?  479 LEU A O    15 
ATOM   10511 C CB   . LEU A 1 8  ? -6.617  6.202   0.039   1.00 15.00 ?  479 LEU A CB   15 
ATOM   10512 C CG   . LEU A 1 8  ? -6.641  4.754   0.546   1.00 15.00 ?  479 LEU A CG   15 
ATOM   10513 C CD1  . LEU A 1 8  ? -7.791  3.985   -0.083  1.00 15.00 ?  479 LEU A CD1  15 
ATOM   10514 C CD2  . LEU A 1 8  ? -5.331  4.052   0.240   1.00 15.00 ?  479 LEU A CD2  15 
ATOM   10515 H H    . LEU A 1 8  ? -7.572  8.439   -1.099  1.00 15.00 ?  479 LEU A H    15 
ATOM   10516 H HA   . LEU A 1 8  ? -8.599  6.487   0.853   1.00 15.00 ?  479 LEU A HA   15 
ATOM   10517 H HB2  . LEU A 1 8  ? -6.628  6.181   -1.042  1.00 15.00 ?  479 LEU A HB2  15 
ATOM   10518 H HB3  . LEU A 1 8  ? -5.692  6.657   0.360   1.00 15.00 ?  479 LEU A HB3  15 
ATOM   10519 H HG   . LEU A 1 8  ? -6.779  4.757   1.618   1.00 15.00 ?  479 LEU A HG   15 
ATOM   10520 H HD11 . LEU A 1 8  ? -8.712  4.526   0.068   1.00 15.00 ?  479 LEU A HD11 15 
ATOM   10521 H HD12 . LEU A 1 8  ? -7.864  3.009   0.378   1.00 15.00 ?  479 LEU A HD12 15 
ATOM   10522 H HD13 . LEU A 1 8  ? -7.607  3.870   -1.144  1.00 15.00 ?  479 LEU A HD13 15 
ATOM   10523 H HD21 . LEU A 1 8  ? -5.351  3.056   0.654   1.00 15.00 ?  479 LEU A HD21 15 
ATOM   10524 H HD22 . LEU A 1 8  ? -4.514  4.609   0.676   1.00 15.00 ?  479 LEU A HD22 15 
ATOM   10525 H HD23 . LEU A 1 8  ? -5.196  3.994   -0.831  1.00 15.00 ?  479 LEU A HD23 15 
ATOM   10526 N N    . PRO A 1 9  ? -7.368  7.593   2.903   1.00 15.00 ?  480 PRO A N    15 
ATOM   10527 C CA   . PRO A 1 9  ? -6.949  8.408   4.064   1.00 15.00 ?  480 PRO A CA   15 
ATOM   10528 C C    . PRO A 1 9  ? -5.642  9.193   3.833   1.00 15.00 ?  480 PRO A C    15 
ATOM   10529 O O    . PRO A 1 9  ? -4.809  8.797   3.023   1.00 15.00 ?  480 PRO A O    15 
ATOM   10530 C CB   . PRO A 1 9  ? -6.762  7.351   5.150   1.00 15.00 ?  480 PRO A CB   15 
ATOM   10531 C CG   . PRO A 1 9  ? -7.771  6.308   4.825   1.00 15.00 ?  480 PRO A CG   15 
ATOM   10532 C CD   . PRO A 1 9  ? -7.843  6.259   3.323   1.00 15.00 ?  480 PRO A CD   15 
ATOM   10533 H HA   . PRO A 1 9  ? -7.726  9.095   4.361   1.00 15.00 ?  480 PRO A HA   15 
ATOM   10534 H HB2  . PRO A 1 9  ? -5.758  6.960   5.105   1.00 15.00 ?  480 PRO A HB2  15 
ATOM   10535 H HB3  . PRO A 1 9  ? -6.945  7.790   6.120   1.00 15.00 ?  480 PRO A HB3  15 
ATOM   10536 H HG2  . PRO A 1 9  ? -7.450  5.354   5.216   1.00 15.00 ?  480 PRO A HG2  15 
ATOM   10537 H HG3  . PRO A 1 9  ? -8.732  6.581   5.238   1.00 15.00 ?  480 PRO A HG3  15 
ATOM   10538 H HD2  . PRO A 1 9  ? -7.195  5.483   2.943   1.00 15.00 ?  480 PRO A HD2  15 
ATOM   10539 H HD3  . PRO A 1 9  ? -8.860  6.091   3.001   1.00 15.00 ?  480 PRO A HD3  15 
ATOM   10540 N N    . PRO A 1 10 ? -5.429  10.279  4.610   1.00 15.00 ?  481 PRO A N    15 
ATOM   10541 C CA   . PRO A 1 10 ? -4.365  11.282  4.366   1.00 15.00 ?  481 PRO A CA   15 
ATOM   10542 C C    . PRO A 1 10 ? -2.934  10.727  4.308   1.00 15.00 ?  481 PRO A C    15 
ATOM   10543 O O    . PRO A 1 10 ? -2.009  11.435  3.903   1.00 15.00 ?  481 PRO A O    15 
ATOM   10544 C CB   . PRO A 1 10 ? -4.502  12.250  5.548   1.00 15.00 ?  481 PRO A CB   15 
ATOM   10545 C CG   . PRO A 1 10 ? -5.279  11.503  6.575   1.00 15.00 ?  481 PRO A CG   15 
ATOM   10546 C CD   . PRO A 1 10 ? -6.214  10.618  5.809   1.00 15.00 ?  481 PRO A CD   15 
ATOM   10547 H HA   . PRO A 1 10 ? -4.558  11.823  3.451   1.00 15.00 ?  481 PRO A HA   15 
ATOM   10548 H HB2  . PRO A 1 10 ? -3.521  12.517  5.912   1.00 15.00 ?  481 PRO A HB2  15 
ATOM   10549 H HB3  . PRO A 1 10 ? -5.025  13.139  5.229   1.00 15.00 ?  481 PRO A HB3  15 
ATOM   10550 H HG2  . PRO A 1 10 ? -4.612  10.909  7.181   1.00 15.00 ?  481 PRO A HG2  15 
ATOM   10551 H HG3  . PRO A 1 10 ? -5.836  12.193  7.190   1.00 15.00 ?  481 PRO A HG3  15 
ATOM   10552 H HD2  . PRO A 1 10 ? -6.451  9.733   6.382   1.00 15.00 ?  481 PRO A HD2  15 
ATOM   10553 H HD3  . PRO A 1 10 ? -7.113  11.154  5.544   1.00 15.00 ?  481 PRO A HD3  15 
ATOM   10554 N N    . GLY A 1 11 ? -2.740  9.495   4.752   1.00 15.00 ?  482 GLY A N    15 
ATOM   10555 C CA   . GLY A 1 11 ? -1.439  8.864   4.615   1.00 15.00 ?  482 GLY A CA   15 
ATOM   10556 C C    . GLY A 1 11 ? -1.553  7.469   4.071   1.00 15.00 ?  482 GLY A C    15 
ATOM   10557 O O    . GLY A 1 11 ? -0.586  6.716   4.066   1.00 15.00 ?  482 GLY A O    15 
ATOM   10558 H H    . GLY A 1 11 ? -3.480  9.010   5.167   1.00 15.00 ?  482 GLY A H    15 
ATOM   10559 H HA2  . GLY A 1 11 ? -0.837  9.450   3.938   1.00 15.00 ?  482 GLY A HA2  15 
ATOM   10560 H HA3  . GLY A 1 11 ? -0.947  8.823   5.570   1.00 15.00 ?  482 GLY A HA3  15 
ATOM   10561 N N    . TRP A 1 12 ? -2.742  7.118   3.629   1.00 15.00 ?  483 TRP A N    15 
ATOM   10562 C CA   . TRP A 1 12 ? -2.961  5.845   2.990   1.00 15.00 ?  483 TRP A CA   15 
ATOM   10563 C C    . TRP A 1 12 ? -2.949  6.048   1.493   1.00 15.00 ?  483 TRP A C    15 
ATOM   10564 O O    . TRP A 1 12 ? -3.766  6.782   0.943   1.00 15.00 ?  483 TRP A O    15 
ATOM   10565 C CB   . TRP A 1 12 ? -4.276  5.215   3.439   1.00 15.00 ?  483 TRP A CB   15 
ATOM   10566 C CG   . TRP A 1 12 ? -4.214  4.604   4.803   1.00 15.00 ?  483 TRP A CG   15 
ATOM   10567 C CD1  . TRP A 1 12 ? -4.265  5.260   5.996   1.00 15.00 ?  483 TRP A CD1  15 
ATOM   10568 C CD2  . TRP A 1 12 ? -4.099  3.210   5.114   1.00 15.00 ?  483 TRP A CD2  15 
ATOM   10569 N NE1  . TRP A 1 12 ? -4.189  4.364   7.032   1.00 15.00 ?  483 TRP A NE1  15 
ATOM   10570 C CE2  . TRP A 1 12 ? -4.086  3.099   6.517   1.00 15.00 ?  483 TRP A CE2  15 
ATOM   10571 C CE3  . TRP A 1 12 ? -4.005  2.042   4.348   1.00 15.00 ?  483 TRP A CE3  15 
ATOM   10572 C CZ2  . TRP A 1 12 ? -3.989  1.872   7.166   1.00 15.00 ?  483 TRP A CZ2  15 
ATOM   10573 C CZ3  . TRP A 1 12 ? -3.909  0.825   4.995   1.00 15.00 ?  483 TRP A CZ3  15 
ATOM   10574 C CH2  . TRP A 1 12 ? -3.902  0.748   6.391   1.00 15.00 ?  483 TRP A CH2  15 
ATOM   10575 H H    . TRP A 1 12 ? -3.486  7.756   3.691   1.00 15.00 ?  483 TRP A H    15 
ATOM   10576 H HA   . TRP A 1 12 ? -2.143  5.194   3.259   1.00 15.00 ?  483 TRP A HA   15 
ATOM   10577 H HB2  . TRP A 1 12 ? -5.045  5.973   3.448   1.00 15.00 ?  483 TRP A HB2  15 
ATOM   10578 H HB3  . TRP A 1 12 ? -4.552  4.440   2.741   1.00 15.00 ?  483 TRP A HB3  15 
ATOM   10579 H HD1  . TRP A 1 12 ? -4.353  6.331   6.096   1.00 15.00 ?  483 TRP A HD1  15 
ATOM   10580 H HE1  . TRP A 1 12 ? -4.206  4.594   7.990   1.00 15.00 ?  483 TRP A HE1  15 
ATOM   10581 H HE3  . TRP A 1 12 ? -4.005  2.076   3.268   1.00 15.00 ?  483 TRP A HE3  15 
ATOM   10582 H HZ2  . TRP A 1 12 ? -3.986  1.795   8.240   1.00 15.00 ?  483 TRP A HZ2  15 
ATOM   10583 H HZ3  . TRP A 1 12 ? -3.841  -0.085  4.418   1.00 15.00 ?  483 TRP A HZ3  15 
ATOM   10584 H HH2  . TRP A 1 12 ? -3.827  -0.225  6.855   1.00 15.00 ?  483 TRP A HH2  15 
ATOM   10585 N N    . GLU A 1 13 ? -2.007  5.412   0.850   1.00 15.00 ?  484 GLU A N    15 
ATOM   10586 C CA   . GLU A 1 13 ? -1.783  5.603   -0.560  1.00 15.00 ?  484 GLU A CA   15 
ATOM   10587 C C    . GLU A 1 13 ? -1.617  4.262   -1.246  1.00 15.00 ?  484 GLU A C    15 
ATOM   10588 O O    . GLU A 1 13 ? -0.716  3.505   -0.931  1.00 15.00 ?  484 GLU A O    15 
ATOM   10589 C CB   . GLU A 1 13 ? -0.565  6.498   -0.733  1.00 15.00 ?  484 GLU A CB   15 
ATOM   10590 C CG   . GLU A 1 13 ? -0.901  7.954   -0.478  1.00 15.00 ?  484 GLU A CG   15 
ATOM   10591 C CD   . GLU A 1 13 ? 0.208   8.747   0.176   1.00 15.00 ?  484 GLU A CD   15 
ATOM   10592 O OE1  . GLU A 1 13 ? 1.289   8.890   -0.423  1.00 15.00 ?  484 GLU A OE1  15 
ATOM   10593 O OE2  . GLU A 1 13 ? -0.001  9.233   1.306   1.00 15.00 -1 484 GLU A OE2  15 
ATOM   10594 H H    . GLU A 1 13 ? -1.427  4.791   1.343   1.00 15.00 ?  484 GLU A H    15 
ATOM   10595 H HA   . GLU A 1 13 ? -2.649  6.101   -0.971  1.00 15.00 ?  484 GLU A HA   15 
ATOM   10596 H HB2  . GLU A 1 13 ? 0.203   6.193   -0.035  1.00 15.00 ?  484 GLU A HB2  15 
ATOM   10597 H HB3  . GLU A 1 13 ? -0.196  6.398   -1.732  1.00 15.00 ?  484 GLU A HB3  15 
ATOM   10598 H HG2  . GLU A 1 13 ? -1.141  8.417   -1.417  1.00 15.00 ?  484 GLU A HG2  15 
ATOM   10599 H HG3  . GLU A 1 13 ? -1.765  7.981   0.164   1.00 15.00 ?  484 GLU A HG3  15 
ATOM   10600 N N    . MET A 1 14 ? -2.496  3.979   -2.182  1.00 15.00 ?  485 MET A N    15 
ATOM   10601 C CA   . MET A 1 14 ? -2.604  2.639   -2.752  1.00 15.00 ?  485 MET A CA   15 
ATOM   10602 C C    . MET A 1 14 ? -2.018  2.579   -4.159  1.00 15.00 ?  485 MET A C    15 
ATOM   10603 O O    . MET A 1 14 ? -2.311  3.422   -5.005  1.00 15.00 ?  485 MET A O    15 
ATOM   10604 C CB   . MET A 1 14 ? -4.071  2.170   -2.744  1.00 15.00 ?  485 MET A CB   15 
ATOM   10605 C CG   . MET A 1 14 ? -5.033  2.976   -3.615  1.00 15.00 ?  485 MET A CG   15 
ATOM   10606 S SD   . MET A 1 14 ? -5.120  4.731   -3.190  1.00 15.00 ?  485 MET A SD   15 
ATOM   10607 C CE   . MET A 1 14 ? -6.316  5.314   -4.392  1.00 15.00 ?  485 MET A CE   15 
ATOM   10608 H H    . MET A 1 14 ? -3.073  4.695   -2.518  1.00 15.00 ?  485 MET A H    15 
ATOM   10609 H HA   . MET A 1 14 ? -2.031  1.974   -2.120  1.00 15.00 ?  485 MET A HA   15 
ATOM   10610 H HB2  . MET A 1 14 ? -4.101  1.146   -3.086  1.00 15.00 ?  485 MET A HB2  15 
ATOM   10611 H HB3  . MET A 1 14 ? -4.435  2.201   -1.727  1.00 15.00 ?  485 MET A HB3  15 
ATOM   10612 H HG2  . MET A 1 14 ? -4.721  2.889   -4.637  1.00 15.00 ?  485 MET A HG2  15 
ATOM   10613 H HG3  . MET A 1 14 ? -6.021  2.552   -3.514  1.00 15.00 ?  485 MET A HG3  15 
ATOM   10614 H HE1  . MET A 1 14 ? -7.251  4.790   -4.253  1.00 15.00 ?  485 MET A HE1  15 
ATOM   10615 H HE2  . MET A 1 14 ? -5.944  5.129   -5.389  1.00 15.00 ?  485 MET A HE2  15 
ATOM   10616 H HE3  . MET A 1 14 ? -6.474  6.374   -4.259  1.00 15.00 ?  485 MET A HE3  15 
ATOM   10617 N N    . ARG A 1 15 ? -1.191  1.568   -4.399  1.00 15.00 ?  486 ARG A N    15 
ATOM   10618 C CA   . ARG A 1 15 ? -0.516  1.412   -5.680  1.00 15.00 ?  486 ARG A CA   15 
ATOM   10619 C C    . ARG A 1 15 ? -0.269  -0.070  -5.963  1.00 15.00 ?  486 ARG A C    15 
ATOM   10620 O O    . ARG A 1 15 ? -0.093  -0.866  -5.038  1.00 15.00 ?  486 ARG A O    15 
ATOM   10621 C CB   . ARG A 1 15 ? 0.792   2.215   -5.694  1.00 15.00 ?  486 ARG A CB   15 
ATOM   10622 C CG   . ARG A 1 15 ? 1.950   1.565   -4.958  1.00 15.00 ?  486 ARG A CG   15 
ATOM   10623 C CD   . ARG A 1 15 ? 2.832   0.781   -5.913  1.00 15.00 ?  486 ARG A CD   15 
ATOM   10624 N NE   . ARG A 1 15 ? 3.172   1.574   -7.088  1.00 15.00 ?  486 ARG A NE   15 
ATOM   10625 C CZ   . ARG A 1 15 ? 3.834   1.103   -8.138  1.00 15.00 ?  486 ARG A CZ   15 
ATOM   10626 N NH1  . ARG A 1 15 ? 4.352   -0.115  -8.119  1.00 15.00 1  486 ARG A NH1  15 
ATOM   10627 N NH2  . ARG A 1 15 ? 4.013   1.869   -9.196  1.00 15.00 ?  486 ARG A NH2  15 
ATOM   10628 H H    . ARG A 1 15 ? -1.037  0.898   -3.693  1.00 15.00 ?  486 ARG A H    15 
ATOM   10629 H HA   . ARG A 1 15 ? -1.173  1.803   -6.444  1.00 15.00 ?  486 ARG A HA   15 
ATOM   10630 H HB2  . ARG A 1 15 ? 1.093   2.364   -6.719  1.00 15.00 ?  486 ARG A HB2  15 
ATOM   10631 H HB3  . ARG A 1 15 ? 0.610   3.179   -5.243  1.00 15.00 ?  486 ARG A HB3  15 
ATOM   10632 H HG2  . ARG A 1 15 ? 2.542   2.335   -4.485  1.00 15.00 ?  486 ARG A HG2  15 
ATOM   10633 H HG3  . ARG A 1 15 ? 1.558   0.895   -4.209  1.00 15.00 ?  486 ARG A HG3  15 
ATOM   10634 H HD2  . ARG A 1 15 ? 3.740   0.502   -5.399  1.00 15.00 ?  486 ARG A HD2  15 
ATOM   10635 H HD3  . ARG A 1 15 ? 2.306   -0.106  -6.227  1.00 15.00 ?  486 ARG A HD3  15 
ATOM   10636 H HE   . ARG A 1 15 ? 2.860   2.506   -7.105  1.00 15.00 ?  486 ARG A HE   15 
ATOM   10637 H HH11 . ARG A 1 15 ? 4.251   -0.695  -7.313  1.00 15.00 ?  486 ARG A HH11 15 
ATOM   10638 H HH12 . ARG A 1 15 ? 4.849   -0.461  -8.926  1.00 15.00 ?  486 ARG A HH12 15 
ATOM   10639 H HH21 . ARG A 1 15 ? 3.661   2.814   -9.215  1.00 15.00 ?  486 ARG A HH21 15 
ATOM   10640 H HH22 . ARG A 1 15 ? 4.501   1.518   -9.986  1.00 15.00 ?  486 ARG A HH22 15 
ATOM   10641 N N    . ILE A 1 16 ? -0.244  -0.437  -7.237  1.00 15.00 ?  487 ILE A N    15 
ATOM   10642 C CA   . ILE A 1 16 ? -0.204  -1.844  -7.613  1.00 15.00 ?  487 ILE A CA   15 
ATOM   10643 C C    . ILE A 1 16 ? 1.184   -2.272  -8.079  1.00 15.00 ?  487 ILE A C    15 
ATOM   10644 O O    . ILE A 1 16 ? 1.943   -1.477  -8.624  1.00 15.00 ?  487 ILE A O    15 
ATOM   10645 C CB   . ILE A 1 16 ? -1.223  -2.171  -8.729  1.00 15.00 ?  487 ILE A CB   15 
ATOM   10646 C CG1  . ILE A 1 16 ? -0.925  -1.357  -9.994  1.00 15.00 ?  487 ILE A CG1  15 
ATOM   10647 C CG2  . ILE A 1 16 ? -2.643  -1.913  -8.246  1.00 15.00 ?  487 ILE A CG2  15 
ATOM   10648 C CD1  . ILE A 1 16 ? -1.799  -1.724  -11.176 1.00 15.00 ?  487 ILE A CD1  15 
ATOM   10649 H H    . ILE A 1 16 ? -0.209  0.249   -7.940  1.00 15.00 ?  487 ILE A H    15 
ATOM   10650 H HA   . ILE A 1 16 ? -0.468  -2.422  -6.740  1.00 15.00 ?  487 ILE A HA   15 
ATOM   10651 H HB   . ILE A 1 16 ? -1.137  -3.221  -8.959  1.00 15.00 ?  487 ILE A HB   15 
ATOM   10652 H HG12 . ILE A 1 16 ? -1.081  -0.309  -9.782  1.00 15.00 ?  487 ILE A HG12 15 
ATOM   10653 H HG13 . ILE A 1 16 ? 0.105   -1.511  -10.279 1.00 15.00 ?  487 ILE A HG13 15 
ATOM   10654 H HG21 . ILE A 1 16 ? -2.748  -0.875  -7.964  1.00 15.00 ?  487 ILE A HG21 15 
ATOM   10655 H HG22 . ILE A 1 16 ? -2.852  -2.540  -7.395  1.00 15.00 ?  487 ILE A HG22 15 
ATOM   10656 H HG23 . ILE A 1 16 ? -3.339  -2.140  -9.040  1.00 15.00 ?  487 ILE A HG23 15 
ATOM   10657 H HD11 . ILE A 1 16 ? -1.541  -1.101  -12.020 1.00 15.00 ?  487 ILE A HD11 15 
ATOM   10658 H HD12 . ILE A 1 16 ? -2.836  -1.573  -10.918 1.00 15.00 ?  487 ILE A HD12 15 
ATOM   10659 H HD13 . ILE A 1 16 ? -1.638  -2.760  -11.429 1.00 15.00 ?  487 ILE A HD13 15 
ATOM   10660 N N    . ALA A 1 17 ? 1.497   -3.538  -7.852  1.00 15.00 ?  488 ALA A N    15 
ATOM   10661 C CA   . ALA A 1 17 ? 2.725   -4.140  -8.345  1.00 15.00 ?  488 ALA A CA   15 
ATOM   10662 C C    . ALA A 1 17 ? 2.476   -4.721  -9.726  1.00 15.00 ?  488 ALA A C    15 
ATOM   10663 O O    . ALA A 1 17 ? 1.353   -5.127  -10.019 1.00 15.00 ?  488 ALA A O    15 
ATOM   10664 C CB   . ALA A 1 17 ? 3.206   -5.223  -7.387  1.00 15.00 ?  488 ALA A CB   15 
ATOM   10665 H H    . ALA A 1 17 ? 0.880   -4.088  -7.320  1.00 15.00 ?  488 ALA A H    15 
ATOM   10666 H HA   . ALA A 1 17 ? 3.482   -3.377  -8.407  1.00 15.00 ?  488 ALA A HA   15 
ATOM   10667 H HB1  . ALA A 1 17 ? 2.457   -5.998  -7.315  1.00 15.00 ?  488 ALA A HB1  15 
ATOM   10668 H HB2  . ALA A 1 17 ? 3.372   -4.796  -6.410  1.00 15.00 ?  488 ALA A HB2  15 
ATOM   10669 H HB3  . ALA A 1 17 ? 4.128   -5.648  -7.755  1.00 15.00 ?  488 ALA A HB3  15 
ATOM   10670 N N    . PRO A 1 18 ? 3.505   -4.761  -10.591 1.00 15.00 ?  489 PRO A N    15 
ATOM   10671 C CA   . PRO A 1 18 ? 3.365   -5.215  -11.987 1.00 15.00 ?  489 PRO A CA   15 
ATOM   10672 C C    . PRO A 1 18 ? 2.794   -6.628  -12.112 1.00 15.00 ?  489 PRO A C    15 
ATOM   10673 O O    . PRO A 1 18 ? 2.323   -7.024  -13.176 1.00 15.00 ?  489 PRO A O    15 
ATOM   10674 C CB   . PRO A 1 18 ? 4.795   -5.165  -12.533 1.00 15.00 ?  489 PRO A CB   15 
ATOM   10675 C CG   . PRO A 1 18 ? 5.506   -4.196  -11.651 1.00 15.00 ?  489 PRO A CG   15 
ATOM   10676 C CD   . PRO A 1 18 ? 4.890   -4.349  -10.290 1.00 15.00 ?  489 PRO A CD   15 
ATOM   10677 H HA   . PRO A 1 18 ? 2.744   -4.535  -12.555 1.00 15.00 ?  489 PRO A HA   15 
ATOM   10678 H HB2  . PRO A 1 18 ? 5.238   -6.149  -12.479 1.00 15.00 ?  489 PRO A HB2  15 
ATOM   10679 H HB3  . PRO A 1 18 ? 4.779   -4.826  -13.558 1.00 15.00 ?  489 PRO A HB3  15 
ATOM   10680 H HG2  . PRO A 1 18 ? 6.559   -4.435  -11.618 1.00 15.00 ?  489 PRO A HG2  15 
ATOM   10681 H HG3  . PRO A 1 18 ? 5.359   -3.191  -12.017 1.00 15.00 ?  489 PRO A HG3  15 
ATOM   10682 H HD2  . PRO A 1 18 ? 5.405   -5.111  -9.726  1.00 15.00 ?  489 PRO A HD2  15 
ATOM   10683 H HD3  . PRO A 1 18 ? 4.907   -3.408  -9.761  1.00 15.00 ?  489 PRO A HD3  15 
ATOM   10684 N N    . ASN A 1 19 ? 2.847   -7.387  -11.028 1.00 15.00 ?  490 ASN A N    15 
ATOM   10685 C CA   . ASN A 1 19 ? 2.302   -8.740  -11.016 1.00 15.00 ?  490 ASN A CA   15 
ATOM   10686 C C    . ASN A 1 19 ? 0.802   -8.704  -10.707 1.00 15.00 ?  490 ASN A C    15 
ATOM   10687 O O    . ASN A 1 19 ? 0.149   -9.740  -10.589 1.00 15.00 ?  490 ASN A O    15 
ATOM   10688 C CB   . ASN A 1 19 ? 3.043   -9.586  -9.975  1.00 15.00 ?  490 ASN A CB   15 
ATOM   10689 C CG   . ASN A 1 19 ? 2.699   -11.065 -10.037 1.00 15.00 ?  490 ASN A CG   15 
ATOM   10690 O OD1  . ASN A 1 19 ? 2.671   -11.742 -9.010  1.00 15.00 ?  490 ASN A OD1  15 
ATOM   10691 N ND2  . ASN A 1 19 ? 2.456   -11.582 -11.234 1.00 15.00 ?  490 ASN A ND2  15 
ATOM   10692 H H    . ASN A 1 19 ? 3.272   -7.032  -10.219 1.00 15.00 ?  490 ASN A H    15 
ATOM   10693 H HA   . ASN A 1 19 ? 2.451   -9.168  -11.995 1.00 15.00 ?  490 ASN A HA   15 
ATOM   10694 H HB2  . ASN A 1 19 ? 4.107   -9.481  -10.132 1.00 15.00 ?  490 ASN A HB2  15 
ATOM   10695 H HB3  . ASN A 1 19 ? 2.797   -9.221  -8.989  1.00 15.00 ?  490 ASN A HB3  15 
ATOM   10696 H HD21 . ASN A 1 19 ? 2.510   -10.992 -12.021 1.00 15.00 ?  490 ASN A HD21 15 
ATOM   10697 H HD22 . ASN A 1 19 ? 2.234   -12.535 -11.290 1.00 15.00 ?  490 ASN A HD22 15 
ATOM   10698 N N    . GLY A 1 20 ? 0.257   -7.499  -10.589 1.00 15.00 ?  491 GLY A N    15 
ATOM   10699 C CA   . GLY A 1 20 ? -1.151  -7.347  -10.280 1.00 15.00 ?  491 GLY A CA   15 
ATOM   10700 C C    . GLY A 1 20 ? -1.407  -7.411  -8.790  1.00 15.00 ?  491 GLY A C    15 
ATOM   10701 O O    . GLY A 1 20 ? -2.408  -7.969  -8.340  1.00 15.00 ?  491 GLY A O    15 
ATOM   10702 H H    . GLY A 1 20 ? 0.817   -6.702  -10.720 1.00 15.00 ?  491 GLY A H    15 
ATOM   10703 H HA2  . GLY A 1 20 ? -1.491  -6.393  -10.656 1.00 15.00 ?  491 GLY A HA2  15 
ATOM   10704 H HA3  . GLY A 1 20 ? -1.706  -8.135  -10.766 1.00 15.00 ?  491 GLY A HA3  15 
ATOM   10705 N N    . ARG A 1 21 ? -0.480  -6.863  -8.015  1.00 15.00 ?  492 ARG A N    15 
ATOM   10706 C CA   . ARG A 1 21 ? -0.567  -6.922  -6.560  1.00 15.00 ?  492 ARG A CA   15 
ATOM   10707 C C    . ARG A 1 21 ? -0.873  -5.539  -5.993  1.00 15.00 ?  492 ARG A C    15 
ATOM   10708 O O    . ARG A 1 21 ? -0.019  -4.661  -6.013  1.00 15.00 ?  492 ARG A O    15 
ATOM   10709 C CB   . ARG A 1 21 ? 0.751   -7.429  -5.965  1.00 15.00 ?  492 ARG A CB   15 
ATOM   10710 C CG   . ARG A 1 21 ? 1.378   -8.602  -6.713  1.00 15.00 ?  492 ARG A CG   15 
ATOM   10711 C CD   . ARG A 1 21 ? 0.649   -9.923  -6.471  1.00 15.00 ?  492 ARG A CD   15 
ATOM   10712 N NE   . ARG A 1 21 ? -0.692  -9.967  -7.060  1.00 15.00 ?  492 ARG A NE   15 
ATOM   10713 C CZ   . ARG A 1 21 ? -1.423  -11.080 -7.166  1.00 15.00 ?  492 ARG A CZ   15 
ATOM   10714 N NH1  . ARG A 1 21 ? -0.942  -12.240 -6.728  1.00 15.00 1  492 ARG A NH1  15 
ATOM   10715 N NH2  . ARG A 1 21 ? -2.635  -11.033 -7.705  1.00 15.00 ?  492 ARG A NH2  15 
ATOM   10716 H H    . ARG A 1 21 ? 0.275   -6.398  -8.433  1.00 15.00 ?  492 ARG A H    15 
ATOM   10717 H HA   . ARG A 1 21 ? -1.366  -7.599  -6.294  1.00 15.00 ?  492 ARG A HA   15 
ATOM   10718 H HB2  . ARG A 1 21 ? 1.463   -6.617  -5.962  1.00 15.00 ?  492 ARG A HB2  15 
ATOM   10719 H HB3  . ARG A 1 21 ? 0.574   -7.737  -4.944  1.00 15.00 ?  492 ARG A HB3  15 
ATOM   10720 H HG2  . ARG A 1 21 ? 1.363   -8.380  -7.772  1.00 15.00 ?  492 ARG A HG2  15 
ATOM   10721 H HG3  . ARG A 1 21 ? 2.403   -8.707  -6.389  1.00 15.00 ?  492 ARG A HG3  15 
ATOM   10722 H HD2  . ARG A 1 21 ? 1.235   -10.722 -6.898  1.00 15.00 ?  492 ARG A HD2  15 
ATOM   10723 H HD3  . ARG A 1 21 ? 0.563   -10.078 -5.406  1.00 15.00 ?  492 ARG A HD3  15 
ATOM   10724 H HE   . ARG A 1 21 ? -1.068  -9.122  -7.396  1.00 15.00 ?  492 ARG A HE   15 
ATOM   10725 H HH11 . ARG A 1 21 ? -0.027  -12.287 -6.318  1.00 15.00 ?  492 ARG A HH11 15 
ATOM   10726 H HH12 . ARG A 1 21 ? -1.491  -13.083 -6.813  1.00 15.00 ?  492 ARG A HH12 15 
ATOM   10727 H HH21 . ARG A 1 21 ? -3.010  -10.160 -8.042  1.00 15.00 ?  492 ARG A HH21 15 
ATOM   10728 H HH22 . ARG A 1 21 ? -3.190  -11.872 -7.779  1.00 15.00 ?  492 ARG A HH22 15 
ATOM   10729 N N    . PRO A 1 22 ? -2.099  -5.311  -5.512  1.00 15.00 ?  493 PRO A N    15 
ATOM   10730 C CA   . PRO A 1 22 ? -2.488  -4.037  -4.934  1.00 15.00 ?  493 PRO A CA   15 
ATOM   10731 C C    . PRO A 1 22 ? -2.229  -3.970  -3.432  1.00 15.00 ?  493 PRO A C    15 
ATOM   10732 O O    . PRO A 1 22 ? -2.847  -4.696  -2.653  1.00 15.00 ?  493 PRO A O    15 
ATOM   10733 C CB   . PRO A 1 22 ? -3.990  -3.964  -5.222  1.00 15.00 ?  493 PRO A CB   15 
ATOM   10734 C CG   . PRO A 1 22 ? -4.434  -5.368  -5.530  1.00 15.00 ?  493 PRO A CG   15 
ATOM   10735 C CD   . PRO A 1 22 ? -3.214  -6.259  -5.509  1.00 15.00 ?  493 PRO A CD   15 
ATOM   10736 H HA   . PRO A 1 22 ? -1.988  -3.214  -5.422  1.00 15.00 ?  493 PRO A HA   15 
ATOM   10737 H HB2  . PRO A 1 22 ? -4.500  -3.576  -4.353  1.00 15.00 ?  493 PRO A HB2  15 
ATOM   10738 H HB3  . PRO A 1 22 ? -4.165  -3.308  -6.059  1.00 15.00 ?  493 PRO A HB3  15 
ATOM   10739 H HG2  . PRO A 1 22 ? -5.139  -5.696  -4.784  1.00 15.00 ?  493 PRO A HG2  15 
ATOM   10740 H HG3  . PRO A 1 22 ? -4.894  -5.393  -6.508  1.00 15.00 ?  493 PRO A HG3  15 
ATOM   10741 H HD2  . PRO A 1 22 ? -3.202  -6.862  -4.615  1.00 15.00 ?  493 PRO A HD2  15 
ATOM   10742 H HD3  . PRO A 1 22 ? -3.189  -6.884  -6.390  1.00 15.00 ?  493 PRO A HD3  15 
ATOM   10743 N N    . PHE A 1 23 ? -1.303  -3.110  -3.032  1.00 15.00 ?  494 PHE A N    15 
ATOM   10744 C CA   . PHE A 1 23 ? -0.980  -2.947  -1.623  1.00 15.00 ?  494 PHE A CA   15 
ATOM   10745 C C    . PHE A 1 23 ? -1.187  -1.502  -1.185  1.00 15.00 ?  494 PHE A C    15 
ATOM   10746 O O    . PHE A 1 23 ? -0.934  -0.564  -1.947  1.00 15.00 ?  494 PHE A O    15 
ATOM   10747 C CB   . PHE A 1 23 ? 0.456   -3.411  -1.327  1.00 15.00 ?  494 PHE A CB   15 
ATOM   10748 C CG   . PHE A 1 23 ? 1.530   -2.778  -2.181  1.00 15.00 ?  494 PHE A CG   15 
ATOM   10749 C CD1  . PHE A 1 23 ? 2.022   -1.513  -1.894  1.00 15.00 ?  494 PHE A CD1  15 
ATOM   10750 C CD2  . PHE A 1 23 ? 2.062   -3.466  -3.261  1.00 15.00 ?  494 PHE A CD2  15 
ATOM   10751 C CE1  . PHE A 1 23 ? 3.022   -0.947  -2.670  1.00 15.00 ?  494 PHE A CE1  15 
ATOM   10752 C CE2  . PHE A 1 23 ? 3.057   -2.903  -4.039  1.00 15.00 ?  494 PHE A CE2  15 
ATOM   10753 C CZ   . PHE A 1 23 ? 3.537   -1.645  -3.742  1.00 15.00 ?  494 PHE A CZ   15 
ATOM   10754 H H    . PHE A 1 23 ? -0.829  -2.566  -3.699  1.00 15.00 ?  494 PHE A H    15 
ATOM   10755 H HA   . PHE A 1 23 ? -1.664  -3.567  -1.064  1.00 15.00 ?  494 PHE A HA   15 
ATOM   10756 H HB2  . PHE A 1 23 ? 0.686   -3.193  -0.298  1.00 15.00 ?  494 PHE A HB2  15 
ATOM   10757 H HB3  . PHE A 1 23 ? 0.510   -4.480  -1.475  1.00 15.00 ?  494 PHE A HB3  15 
ATOM   10758 H HD1  . PHE A 1 23 ? 1.617   -0.964  -1.056  1.00 15.00 ?  494 PHE A HD1  15 
ATOM   10759 H HD2  . PHE A 1 23 ? 1.689   -4.452  -3.495  1.00 15.00 ?  494 PHE A HD2  15 
ATOM   10760 H HE1  . PHE A 1 23 ? 3.394   0.048   -2.439  1.00 15.00 ?  494 PHE A HE1  15 
ATOM   10761 H HE2  . PHE A 1 23 ? 3.462   -3.449  -4.875  1.00 15.00 ?  494 PHE A HE2  15 
ATOM   10762 H HZ   . PHE A 1 23 ? 4.315   -1.205  -4.348  1.00 15.00 ?  494 PHE A HZ   15 
ATOM   10763 N N    . PHE A 1 24 ? -1.654  -1.330  0.044   1.00 15.00 ?  495 PHE A N    15 
ATOM   10764 C CA   . PHE A 1 24 ? -1.883  -0.004  0.593   1.00 15.00 ?  495 PHE A CA   15 
ATOM   10765 C C    . PHE A 1 24 ? -0.676  0.456   1.394   1.00 15.00 ?  495 PHE A C    15 
ATOM   10766 O O    . PHE A 1 24 ? -0.259  -0.201  2.352   1.00 15.00 ?  495 PHE A O    15 
ATOM   10767 C CB   . PHE A 1 24 ? -3.138  0.012   1.472   1.00 15.00 ?  495 PHE A CB   15 
ATOM   10768 C CG   . PHE A 1 24 ? -4.370  -0.470  0.760   1.00 15.00 ?  495 PHE A CG   15 
ATOM   10769 C CD1  . PHE A 1 24 ? -4.989  0.329   -0.182  1.00 15.00 ?  495 PHE A CD1  15 
ATOM   10770 C CD2  . PHE A 1 24 ? -4.898  -1.723  1.026   1.00 15.00 ?  495 PHE A CD2  15 
ATOM   10771 C CE1  . PHE A 1 24 ? -6.116  -0.107  -0.849  1.00 15.00 ?  495 PHE A CE1  15 
ATOM   10772 C CE2  . PHE A 1 24 ? -6.026  -2.167  0.362   1.00 15.00 ?  495 PHE A CE2  15 
ATOM   10773 C CZ   . PHE A 1 24 ? -6.635  -1.358  -0.578  1.00 15.00 ?  495 PHE A CZ   15 
ATOM   10774 H H    . PHE A 1 24 ? -1.846  -2.119  0.597   1.00 15.00 ?  495 PHE A H    15 
ATOM   10775 H HA   . PHE A 1 24 ? -2.026  0.674   -0.237  1.00 15.00 ?  495 PHE A HA   15 
ATOM   10776 H HB2  . PHE A 1 24 ? -2.978  -0.620  2.331   1.00 15.00 ?  495 PHE A HB2  15 
ATOM   10777 H HB3  . PHE A 1 24 ? -3.320  1.024   1.804   1.00 15.00 ?  495 PHE A HB3  15 
ATOM   10778 H HD1  . PHE A 1 24 ? -4.584  1.307   -0.394  1.00 15.00 ?  495 PHE A HD1  15 
ATOM   10779 H HD2  . PHE A 1 24 ? -4.421  -2.356  1.760   1.00 15.00 ?  495 PHE A HD2  15 
ATOM   10780 H HE1  . PHE A 1 24 ? -6.587  0.530   -1.585  1.00 15.00 ?  495 PHE A HE1  15 
ATOM   10781 H HE2  . PHE A 1 24 ? -6.429  -3.146  0.575   1.00 15.00 ?  495 PHE A HE2  15 
ATOM   10782 H HZ   . PHE A 1 24 ? -7.516  -1.701  -1.099  1.00 15.00 ?  495 PHE A HZ   15 
ATOM   10783 N N    . ILE A 1 25 ? -0.108  1.572   0.979   1.00 15.00 ?  496 ILE A N    15 
ATOM   10784 C CA   . ILE A 1 25 ? 1.007   2.176   1.678   1.00 15.00 ?  496 ILE A CA   15 
ATOM   10785 C C    . ILE A 1 25 ? 0.501   3.148   2.717   1.00 15.00 ?  496 ILE A C    15 
ATOM   10786 O O    . ILE A 1 25 ? 0.009   4.219   2.369   1.00 15.00 ?  496 ILE A O    15 
ATOM   10787 C CB   . ILE A 1 25 ? 1.949   2.976   0.736   1.00 15.00 ?  496 ILE A CB   15 
ATOM   10788 C CG1  . ILE A 1 25 ? 2.543   2.103   -0.376  1.00 15.00 ?  496 ILE A CG1  15 
ATOM   10789 C CG2  . ILE A 1 25 ? 3.075   3.604   1.544   1.00 15.00 ?  496 ILE A CG2  15 
ATOM   10790 C CD1  . ILE A 1 25 ? 1.596   1.816   -1.516  1.00 15.00 ?  496 ILE A CD1  15 
ATOM   10791 H H    . ILE A 1 25 ? -0.456  2.013   0.172   1.00 15.00 ?  496 ILE A H    15 
ATOM   10792 H HA   . ILE A 1 25 ? 1.575   1.401   2.159   1.00 15.00 ?  496 ILE A HA   15 
ATOM   10793 H HB   . ILE A 1 25 ? 1.368   3.783   0.288   1.00 15.00 ?  496 ILE A HB   15 
ATOM   10794 H HG12 . ILE A 1 25 ? 3.405   2.604   -0.788  1.00 15.00 ?  496 ILE A HG12 15 
ATOM   10795 H HG13 . ILE A 1 25 ? 2.853   1.160   0.044   1.00 15.00 ?  496 ILE A HG13 15 
ATOM   10796 H HG21 . ILE A 1 25 ? 3.712   4.176   0.887   1.00 15.00 ?  496 ILE A HG21 15 
ATOM   10797 H HG22 . ILE A 1 25 ? 3.656   2.828   2.021   1.00 15.00 ?  496 ILE A HG22 15 
ATOM   10798 H HG23 . ILE A 1 25 ? 2.657   4.256   2.298   1.00 15.00 ?  496 ILE A HG23 15 
ATOM   10799 H HD11 . ILE A 1 25 ? 1.292   2.745   -1.974  1.00 15.00 ?  496 ILE A HD11 15 
ATOM   10800 H HD12 . ILE A 1 25 ? 0.725   1.301   -1.139  1.00 15.00 ?  496 ILE A HD12 15 
ATOM   10801 H HD13 . ILE A 1 25 ? 2.090   1.197   -2.251  1.00 15.00 ?  496 ILE A HD13 15 
ATOM   10802 N N    . ASP A 1 26 ? 0.602   2.804   3.985   1.00 15.00 ?  497 ASP A N    15 
ATOM   10803 C CA   . ASP A 1 26 ? 0.352   3.800   4.993   1.00 15.00 ?  497 ASP A CA   15 
ATOM   10804 C C    . ASP A 1 26 ? 1.653   4.480   5.335   1.00 15.00 ?  497 ASP A C    15 
ATOM   10805 O O    . ASP A 1 26 ? 2.655   3.858   5.692   1.00 15.00 ?  497 ASP A O    15 
ATOM   10806 C CB   . ASP A 1 26 ? -0.326  3.264   6.241   1.00 15.00 ?  497 ASP A CB   15 
ATOM   10807 C CG   . ASP A 1 26 ? 0.599   3.176   7.428   1.00 15.00 ?  497 ASP A CG   15 
ATOM   10808 O OD1  . ASP A 1 26 ? 1.311   2.166   7.562   1.00 15.00 ?  497 ASP A OD1  15 
ATOM   10809 O OD2  . ASP A 1 26 ? 0.626   4.133   8.231   1.00 15.00 -1 497 ASP A OD2  15 
ATOM   10810 H H    . ASP A 1 26 ? 0.852   1.887   4.237   1.00 15.00 ?  497 ASP A H    15 
ATOM   10811 H HA   . ASP A 1 26 ? -0.297  4.539   4.543   1.00 15.00 ?  497 ASP A HA   15 
ATOM   10812 H HB2  . ASP A 1 26 ? -1.119  3.949   6.493   1.00 15.00 ?  497 ASP A HB2  15 
ATOM   10813 H HB3  . ASP A 1 26 ? -0.738  2.284   6.042   1.00 15.00 ?  497 ASP A HB3  15 
ATOM   10814 N N    . HIS A 1 27 ? 1.640   5.760   5.146   1.00 15.00 ?  498 HIS A N    15 
ATOM   10815 C CA   . HIS A 1 27 ? 2.837   6.552   5.279   1.00 15.00 ?  498 HIS A CA   15 
ATOM   10816 C C    . HIS A 1 27 ? 3.178   6.893   6.726   1.00 15.00 ?  498 HIS A C    15 
ATOM   10817 O O    . HIS A 1 27 ? 4.327   7.215   7.027   1.00 15.00 ?  498 HIS A O    15 
ATOM   10818 C CB   . HIS A 1 27 ? 2.763   7.793   4.392   1.00 15.00 ?  498 HIS A CB   15 
ATOM   10819 C CG   . HIS A 1 27 ? 2.973   7.461   2.940   1.00 15.00 ?  498 HIS A CG   15 
ATOM   10820 N ND1  . HIS A 1 27 ? 4.225   7.367   2.369   1.00 15.00 ?  498 HIS A ND1  15 
ATOM   10821 C CD2  . HIS A 1 27 ? 2.094   7.153   1.952   1.00 15.00 ?  498 HIS A CD2  15 
ATOM   10822 C CE1  . HIS A 1 27 ? 4.107   7.011   1.106   1.00 15.00 ?  498 HIS A CE1  15 
ATOM   10823 N NE2  . HIS A 1 27 ? 2.824   6.879   0.821   1.00 15.00 ?  498 HIS A NE2  15 
ATOM   10824 H H    . HIS A 1 27 ? 0.778   6.191   4.931   1.00 15.00 ?  498 HIS A H    15 
ATOM   10825 H HA   . HIS A 1 27 ? 3.643   5.938   4.904   1.00 15.00 ?  498 HIS A HA   15 
ATOM   10826 H HB2  . HIS A 1 27 ? 1.790   8.252   4.498   1.00 15.00 ?  498 HIS A HB2  15 
ATOM   10827 H HB3  . HIS A 1 27 ? 3.527   8.495   4.690   1.00 15.00 ?  498 HIS A HB3  15 
ATOM   10828 H HD1  . HIS A 1 27 ? 5.079   7.566   2.817   1.00 15.00 ?  498 HIS A HD1  15 
ATOM   10829 H HD2  . HIS A 1 27 ? 1.006   7.144   2.023   1.00 15.00 ?  498 HIS A HD2  15 
ATOM   10830 H HE1  . HIS A 1 27 ? 4.927   6.816   0.428   1.00 15.00 ?  498 HIS A HE1  15 
ATOM   10831 H HE2  . HIS A 1 27 ? 2.460   6.950   -0.090  1.00 15.00 ?  498 HIS A HE2  15 
ATOM   10832 N N    . ASN A 1 28 ? 2.196   6.848   7.629   1.00 15.00 ?  499 ASN A N    15 
ATOM   10833 C CA   . ASN A 1 28 ? 2.468   7.270   8.999   1.00 15.00 ?  499 ASN A CA   15 
ATOM   10834 C C    . ASN A 1 28 ? 3.161   6.178   9.820   1.00 15.00 ?  499 ASN A C    15 
ATOM   10835 O O    . ASN A 1 28 ? 4.183   6.450   10.455  1.00 15.00 ?  499 ASN A O    15 
ATOM   10836 C CB   . ASN A 1 28 ? 1.193   7.762   9.708   1.00 15.00 ?  499 ASN A CB   15 
ATOM   10837 C CG   . ASN A 1 28 ? 0.081   6.727   9.781   1.00 15.00 ?  499 ASN A CG   15 
ATOM   10838 O OD1  . ASN A 1 28 ? 0.026   5.922   10.710  1.00 15.00 ?  499 ASN A OD1  15 
ATOM   10839 N ND2  . ASN A 1 28 ? -0.845  6.774   8.831   1.00 15.00 ?  499 ASN A ND2  15 
ATOM   10840 H H    . ASN A 1 28 ? 1.311   6.511   7.380   1.00 15.00 ?  499 ASN A H    15 
ATOM   10841 H HA   . ASN A 1 28 ? 3.152   8.105   8.932   1.00 15.00 ?  499 ASN A HA   15 
ATOM   10842 H HB2  . ASN A 1 28 ? 1.444   8.051   10.716  1.00 15.00 ?  499 ASN A HB2  15 
ATOM   10843 H HB3  . ASN A 1 28 ? 0.817   8.624   9.182   1.00 15.00 ?  499 ASN A HB3  15 
ATOM   10844 H HD21 . ASN A 1 28 ? -0.772  7.470   8.146   1.00 15.00 ?  499 ASN A HD21 15 
ATOM   10845 H HD22 . ASN A 1 28 ? -1.561  6.101   8.849   1.00 15.00 ?  499 ASN A HD22 15 
ATOM   10846 N N    . THR A 1 29 ? 2.629   4.956   9.830   1.00 15.00 ?  500 THR A N    15 
ATOM   10847 C CA   . THR A 1 29 ? 3.339   3.848   10.457  1.00 15.00 ?  500 THR A CA   15 
ATOM   10848 C C    . THR A 1 29 ? 4.408   3.271   9.530   1.00 15.00 ?  500 THR A C    15 
ATOM   10849 O O    . THR A 1 29 ? 5.299   2.544   9.974   1.00 15.00 ?  500 THR A O    15 
ATOM   10850 C CB   . THR A 1 29 ? 2.409   2.752   11.038  1.00 15.00 ?  500 THR A CB   15 
ATOM   10851 O OG1  . THR A 1 29 ? 1.430   2.303   10.098  1.00 15.00 ?  500 THR A OG1  15 
ATOM   10852 C CG2  . THR A 1 29 ? 1.699   3.280   12.273  1.00 15.00 ?  500 THR A CG2  15 
ATOM   10853 H H    . THR A 1 29 ? 1.749   4.796   9.406   1.00 15.00 ?  500 THR A H    15 
ATOM   10854 H HA   . THR A 1 29 ? 3.868   4.282   11.297  1.00 15.00 ?  500 THR A HA   15 
ATOM   10855 H HB   . THR A 1 29 ? 3.018   1.913   11.336  1.00 15.00 ?  500 THR A HB   15 
ATOM   10856 H HG1  . THR A 1 29 ? 1.669   2.590   9.199   1.00 15.00 ?  500 THR A HG1  15 
ATOM   10857 H HG21 . THR A 1 29 ? 2.427   3.499   13.041  1.00 15.00 ?  500 THR A HG21 15 
ATOM   10858 H HG22 . THR A 1 29 ? 1.005   2.537   12.632  1.00 15.00 ?  500 THR A HG22 15 
ATOM   10859 H HG23 . THR A 1 29 ? 1.162   4.185   12.019  1.00 15.00 ?  500 THR A HG23 15 
ATOM   10860 N N    . LYS A 1 30 ? 4.291   3.594   8.236   1.00 15.00 ?  501 LYS A N    15 
ATOM   10861 C CA   . LYS A 1 30 ? 5.303   3.249   7.236   1.00 15.00 ?  501 LYS A CA   15 
ATOM   10862 C C    . LYS A 1 30 ? 5.326   1.739   6.976   1.00 15.00 ?  501 LYS A C    15 
ATOM   10863 O O    . LYS A 1 30 ? 6.381   1.099   6.980   1.00 15.00 ?  501 LYS A O    15 
ATOM   10864 C CB   . LYS A 1 30 ? 6.678   3.766   7.685   1.00 15.00 ?  501 LYS A CB   15 
ATOM   10865 C CG   . LYS A 1 30 ? 7.747   3.760   6.603   1.00 15.00 ?  501 LYS A CG   15 
ATOM   10866 C CD   . LYS A 1 30 ? 9.023   4.403   7.113   1.00 15.00 ?  501 LYS A CD   15 
ATOM   10867 C CE   . LYS A 1 30 ? 10.112  4.433   6.053   1.00 15.00 ?  501 LYS A CE   15 
ATOM   10868 N NZ   . LYS A 1 30 ? 10.510  3.070   5.618   1.00 15.00 1  501 LYS A NZ   15 
ATOM   10869 H H    . LYS A 1 30 ? 3.486   4.069   7.942   1.00 15.00 ?  501 LYS A H    15 
ATOM   10870 H HA   . LYS A 1 30 ? 5.031   3.746   6.315   1.00 15.00 ?  501 LYS A HA   15 
ATOM   10871 H HB2  . LYS A 1 30 ? 6.563   4.779   8.034   1.00 15.00 ?  501 LYS A HB2  15 
ATOM   10872 H HB3  . LYS A 1 30 ? 7.024   3.153   8.504   1.00 15.00 ?  501 LYS A HB3  15 
ATOM   10873 H HG2  . LYS A 1 30 ? 7.955   2.739   6.319   1.00 15.00 ?  501 LYS A HG2  15 
ATOM   10874 H HG3  . LYS A 1 30 ? 7.389   4.313   5.747   1.00 15.00 ?  501 LYS A HG3  15 
ATOM   10875 H HD2  . LYS A 1 30 ? 8.806   5.416   7.420   1.00 15.00 ?  501 LYS A HD2  15 
ATOM   10876 H HD3  . LYS A 1 30 ? 9.379   3.838   7.963   1.00 15.00 ?  501 LYS A HD3  15 
ATOM   10877 H HE2  . LYS A 1 30 ? 9.746   4.980   5.197   1.00 15.00 ?  501 LYS A HE2  15 
ATOM   10878 H HE3  . LYS A 1 30 ? 10.976  4.938   6.459   1.00 15.00 ?  501 LYS A HE3  15 
ATOM   10879 H HZ1  . LYS A 1 30 ? 9.742   2.629   5.081   1.00 15.00 ?  501 LYS A HZ1  15 
ATOM   10880 H HZ2  . LYS A 1 30 ? 10.725  2.476   6.449   1.00 15.00 ?  501 LYS A HZ2  15 
ATOM   10881 H HZ3  . LYS A 1 30 ? 11.359  3.126   5.012   1.00 15.00 ?  501 LYS A HZ3  15 
ATOM   10882 N N    . THR A 1 31 ? 4.152   1.178   6.728   1.00 15.00 ?  502 THR A N    15 
ATOM   10883 C CA   . THR A 1 31 ? 4.027   -0.240  6.440   1.00 15.00 ?  502 THR A CA   15 
ATOM   10884 C C    . THR A 1 31 ? 2.933   -0.486  5.404   1.00 15.00 ?  502 THR A C    15 
ATOM   10885 O O    . THR A 1 31 ? 1.975   0.280   5.290   1.00 15.00 ?  502 THR A O    15 
ATOM   10886 C CB   . THR A 1 31 ? 3.750   -1.075  7.716   1.00 15.00 ?  502 THR A CB   15 
ATOM   10887 O OG1  . THR A 1 31 ? 3.667   -2.470  7.391   1.00 15.00 ?  502 THR A OG1  15 
ATOM   10888 C CG2  . THR A 1 31 ? 2.468   -0.639  8.408   1.00 15.00 ?  502 THR A CG2  15 
ATOM   10889 H H    . THR A 1 31 ? 3.342   1.739   6.722   1.00 15.00 ?  502 THR A H    15 
ATOM   10890 H HA   . THR A 1 31 ? 4.968   -0.572  6.021   1.00 15.00 ?  502 THR A HA   15 
ATOM   10891 H HB   . THR A 1 31 ? 4.574   -0.930  8.396   1.00 15.00 ?  502 THR A HB   15 
ATOM   10892 H HG1  . THR A 1 31 ? 2.956   -2.607  6.753   1.00 15.00 ?  502 THR A HG1  15 
ATOM   10893 H HG21 . THR A 1 31 ? 1.632   -0.777  7.738   1.00 15.00 ?  502 THR A HG21 15 
ATOM   10894 H HG22 . THR A 1 31 ? 2.543   0.403   8.679   1.00 15.00 ?  502 THR A HG22 15 
ATOM   10895 H HG23 . THR A 1 31 ? 2.319   -1.233  9.297   1.00 15.00 ?  502 THR A HG23 15 
ATOM   10896 N N    . THR A 1 32 ? 3.106   -1.537  4.625   1.00 15.00 ?  503 THR A N    15 
ATOM   10897 C CA   . THR A 1 32 ? 2.158   -1.884  3.584   1.00 15.00 ?  503 THR A CA   15 
ATOM   10898 C C    . THR A 1 32 ? 1.191   -2.968  4.049   1.00 15.00 ?  503 THR A C    15 
ATOM   10899 O O    . THR A 1 32 ? 1.586   -3.913  4.738   1.00 15.00 ?  503 THR A O    15 
ATOM   10900 C CB   . THR A 1 32 ? 2.903   -2.352  2.325   1.00 15.00 ?  503 THR A CB   15 
ATOM   10901 O OG1  . THR A 1 32 ? 4.056   -3.118  2.702   1.00 15.00 ?  503 THR A OG1  15 
ATOM   10902 C CG2  . THR A 1 32 ? 3.331   -1.165  1.480   1.00 15.00 ?  503 THR A CG2  15 
ATOM   10903 H H    . THR A 1 32 ? 3.898   -2.102  4.752   1.00 15.00 ?  503 THR A H    15 
ATOM   10904 H HA   . THR A 1 32 ? 1.597   -0.996  3.335   1.00 15.00 ?  503 THR A HA   15 
ATOM   10905 H HB   . THR A 1 32 ? 2.241   -2.974  1.742   1.00 15.00 ?  503 THR A HB   15 
ATOM   10906 H HG1  . THR A 1 32 ? 4.496   -3.450  1.914   1.00 15.00 ?  503 THR A HG1  15 
ATOM   10907 H HG21 . THR A 1 32 ? 2.456   -0.607  1.183   1.00 15.00 ?  503 THR A HG21 15 
ATOM   10908 H HG22 . THR A 1 32 ? 3.849   -1.518  0.602   1.00 15.00 ?  503 THR A HG22 15 
ATOM   10909 H HG23 . THR A 1 32 ? 3.987   -0.529  2.057   1.00 15.00 ?  503 THR A HG23 15 
ATOM   10910 N N    . THR A 1 33 ? -0.078  -2.816  3.694   1.00 15.00 ?  504 THR A N    15 
ATOM   10911 C CA   . THR A 1 33 ? -1.091  -3.796  4.053   1.00 15.00 ?  504 THR A CA   15 
ATOM   10912 C C    . THR A 1 33 ? -1.785  -4.343  2.808   1.00 15.00 ?  504 THR A C    15 
ATOM   10913 O O    . THR A 1 33 ? -2.066  -3.598  1.866   1.00 15.00 ?  504 THR A O    15 
ATOM   10914 C CB   . THR A 1 33 ? -2.155  -3.190  4.998   1.00 15.00 ?  504 THR A CB   15 
ATOM   10915 O OG1  . THR A 1 33 ? -2.806  -2.081  4.364   1.00 15.00 ?  504 THR A OG1  15 
ATOM   10916 C CG2  . THR A 1 33 ? -1.528  -2.730  6.307   1.00 15.00 ?  504 THR A CG2  15 
ATOM   10917 H H    . THR A 1 33 ? -0.345  -2.016  3.188   1.00 15.00 ?  504 THR A H    15 
ATOM   10918 H HA   . THR A 1 33 ? -0.602  -4.609  4.569   1.00 15.00 ?  504 THR A HA   15 
ATOM   10919 H HB   . THR A 1 33 ? -2.893  -3.948  5.218   1.00 15.00 ?  504 THR A HB   15 
ATOM   10920 H HG1  . THR A 1 33 ? -3.728  -2.306  4.190   1.00 15.00 ?  504 THR A HG1  15 
ATOM   10921 H HG21 . THR A 1 33 ? -2.298  -2.336  6.953   1.00 15.00 ?  504 THR A HG21 15 
ATOM   10922 H HG22 . THR A 1 33 ? -0.799  -1.958  6.105   1.00 15.00 ?  504 THR A HG22 15 
ATOM   10923 H HG23 . THR A 1 33 ? -1.044  -3.567  6.790   1.00 15.00 ?  504 THR A HG23 15 
ATOM   10924 N N    . TRP A 1 34 ? -2.033  -5.648  2.792   1.00 15.00 ?  505 TRP A N    15 
ATOM   10925 C CA   . TRP A 1 34 ? -2.839  -6.251  1.735   1.00 15.00 ?  505 TRP A CA   15 
ATOM   10926 C C    . TRP A 1 34 ? -4.323  -6.093  2.048   1.00 15.00 ?  505 TRP A C    15 
ATOM   10927 O O    . TRP A 1 34 ? -5.181  -6.281  1.184   1.00 15.00 ?  505 TRP A O    15 
ATOM   10928 C CB   . TRP A 1 34 ? -2.517  -7.739  1.572   1.00 15.00 ?  505 TRP A CB   15 
ATOM   10929 C CG   . TRP A 1 34 ? -1.140  -8.021  1.060   1.00 15.00 ?  505 TRP A CG   15 
ATOM   10930 C CD1  . TRP A 1 34 ? -0.126  -8.638  1.732   1.00 15.00 ?  505 TRP A CD1  15 
ATOM   10931 C CD2  . TRP A 1 34 ? -0.627  -7.700  -0.238  1.00 15.00 ?  505 TRP A CD2  15 
ATOM   10932 N NE1  . TRP A 1 34 ? 0.983   -8.732  0.927   1.00 15.00 ?  505 TRP A NE1  15 
ATOM   10933 C CE2  . TRP A 1 34 ? 0.702   -8.157  -0.284  1.00 15.00 ?  505 TRP A CE2  15 
ATOM   10934 C CE3  . TRP A 1 34 ? -1.163  -7.073  -1.365  1.00 15.00 ?  505 TRP A CE3  15 
ATOM   10935 C CZ2  . TRP A 1 34 ? 1.501   -8.005  -1.415  1.00 15.00 ?  505 TRP A CZ2  15 
ATOM   10936 C CZ3  . TRP A 1 34 ? -0.368  -6.923  -2.484  1.00 15.00 ?  505 TRP A CZ3  15 
ATOM   10937 C CH2  . TRP A 1 34 ? 0.951   -7.387  -2.501  1.00 15.00 ?  505 TRP A CH2  15 
ATOM   10938 H H    . TRP A 1 34 ? -1.648  -6.221  3.489   1.00 15.00 ?  505 TRP A H    15 
ATOM   10939 H HA   . TRP A 1 34 ? -2.618  -5.736  0.811   1.00 15.00 ?  505 TRP A HA   15 
ATOM   10940 H HB2  . TRP A 1 34 ? -2.614  -8.223  2.532   1.00 15.00 ?  505 TRP A HB2  15 
ATOM   10941 H HB3  . TRP A 1 34 ? -3.227  -8.178  0.884   1.00 15.00 ?  505 TRP A HB3  15 
ATOM   10942 H HD1  . TRP A 1 34 ? -0.201  -9.006  2.746   1.00 15.00 ?  505 TRP A HD1  15 
ATOM   10943 H HE1  . TRP A 1 34 ? 1.839   -9.140  1.181   1.00 15.00 ?  505 TRP A HE1  15 
ATOM   10944 H HE3  . TRP A 1 34 ? -2.179  -6.706  -1.370  1.00 15.00 ?  505 TRP A HE3  15 
ATOM   10945 H HZ2  . TRP A 1 34 ? 2.522   -8.355  -1.446  1.00 15.00 ?  505 TRP A HZ2  15 
ATOM   10946 H HZ3  . TRP A 1 34 ? -0.766  -6.439  -3.364  1.00 15.00 ?  505 TRP A HZ3  15 
ATOM   10947 H HH2  . TRP A 1 34 ? 1.536   -7.246  -3.398  1.00 15.00 ?  505 TRP A HH2  15 
ATOM   10948 N N    . GLU A 1 35 ? -4.614  -5.762  3.296   1.00 15.00 ?  506 GLU A N    15 
ATOM   10949 C CA   . GLU A 1 35 ? -5.984  -5.644  3.762   1.00 15.00 ?  506 GLU A CA   15 
ATOM   10950 C C    . GLU A 1 35 ? -6.482  -4.231  3.677   1.00 15.00 ?  506 GLU A C    15 
ATOM   10951 O O    . GLU A 1 35 ? -5.780  -3.276  4.021   1.00 15.00 ?  506 GLU A O    15 
ATOM   10952 C CB   . GLU A 1 35 ? -6.105  -6.166  5.192   1.00 15.00 ?  506 GLU A CB   15 
ATOM   10953 C CG   . GLU A 1 35 ? -6.098  -7.682  5.284   1.00 15.00 ?  506 GLU A CG   15 
ATOM   10954 C CD   . GLU A 1 35 ? -7.361  -8.295  4.717   1.00 15.00 ?  506 GLU A CD   15 
ATOM   10955 O OE1  . GLU A 1 35 ? -7.426  -8.513  3.489   1.00 15.00 -1 506 GLU A OE1  15 
ATOM   10956 O OE2  . GLU A 1 35 ? -8.300  -8.553  5.499   1.00 15.00 ?  506 GLU A OE2  15 
ATOM   10957 H H    . GLU A 1 35 ? -3.885  -5.587  3.922   1.00 15.00 ?  506 GLU A H    15 
ATOM   10958 H HA   . GLU A 1 35 ? -6.607  -6.232  3.116   1.00 15.00 ?  506 GLU A HA   15 
ATOM   10959 H HB2  . GLU A 1 35 ? -5.280  -5.785  5.773   1.00 15.00 ?  506 GLU A HB2  15 
ATOM   10960 H HB3  . GLU A 1 35 ? -7.031  -5.806  5.617   1.00 15.00 ?  506 GLU A HB3  15 
ATOM   10961 H HG2  . GLU A 1 35 ? -5.252  -8.060  4.732   1.00 15.00 ?  506 GLU A HG2  15 
ATOM   10962 H HG3  . GLU A 1 35 ? -6.010  -7.968  6.321   1.00 15.00 ?  506 GLU A HG3  15 
ATOM   10963 N N    . ASP A 1 36 ? -7.716  -4.127  3.221   1.00 15.00 ?  507 ASP A N    15 
ATOM   10964 C CA   . ASP A 1 36 ? -8.354  -2.852  3.047   1.00 15.00 ?  507 ASP A CA   15 
ATOM   10965 C C    . ASP A 1 36 ? -8.714  -2.271  4.414   1.00 15.00 ?  507 ASP A C    15 
ATOM   10966 O O    . ASP A 1 36 ? -9.361  -2.940  5.222   1.00 15.00 ?  507 ASP A O    15 
ATOM   10967 C CB   . ASP A 1 36 ? -9.598  -3.012  2.169   1.00 15.00 ?  507 ASP A CB   15 
ATOM   10968 C CG   . ASP A 1 36 ? -10.273 -1.694  1.846   1.00 15.00 ?  507 ASP A CG   15 
ATOM   10969 O OD1  . ASP A 1 36 ? -11.052 -1.205  2.688   1.00 15.00 -1 507 ASP A OD1  15 
ATOM   10970 O OD2  . ASP A 1 36 ? -10.044 -1.161  0.739   1.00 15.00 ?  507 ASP A OD2  15 
ATOM   10971 H H    . ASP A 1 36 ? -8.214  -4.942  3.000   1.00 15.00 ?  507 ASP A H    15 
ATOM   10972 H HA   . ASP A 1 36 ? -7.643  -2.221  2.558   1.00 15.00 ?  507 ASP A HA   15 
ATOM   10973 H HB2  . ASP A 1 36 ? -9.312  -3.480  1.241   1.00 15.00 ?  507 ASP A HB2  15 
ATOM   10974 H HB3  . ASP A 1 36 ? -10.311 -3.643  2.680   1.00 15.00 ?  507 ASP A HB3  15 
ATOM   10975 N N    . PRO A 1 37 ? -8.312  -1.018  4.689   1.00 15.00 ?  508 PRO A N    15 
ATOM   10976 C CA   . PRO A 1 37 ? -8.425  -0.423  6.029   1.00 15.00 ?  508 PRO A CA   15 
ATOM   10977 C C    . PRO A 1 37 ? -9.859  -0.089  6.460   1.00 15.00 ?  508 PRO A C    15 
ATOM   10978 O O    . PRO A 1 37 ? -10.073 0.412   7.565   1.00 15.00 ?  508 PRO A O    15 
ATOM   10979 C CB   . PRO A 1 37 ? -7.588  0.853   5.920   1.00 15.00 ?  508 PRO A CB   15 
ATOM   10980 C CG   . PRO A 1 37 ? -7.633  1.217   4.476   1.00 15.00 ?  508 PRO A CG   15 
ATOM   10981 C CD   . PRO A 1 37 ? -7.710  -0.082  3.718   1.00 15.00 ?  508 PRO A CD   15 
ATOM   10982 H HA   . PRO A 1 37 ? -7.984  -1.067  6.775   1.00 15.00 ?  508 PRO A HA   15 
ATOM   10983 H HB2  . PRO A 1 37 ? -8.022  1.625   6.537   1.00 15.00 ?  508 PRO A HB2  15 
ATOM   10984 H HB3  . PRO A 1 37 ? -6.578  0.653   6.245   1.00 15.00 ?  508 PRO A HB3  15 
ATOM   10985 H HG2  . PRO A 1 37 ? -8.505  1.819   4.280   1.00 15.00 ?  508 PRO A HG2  15 
ATOM   10986 H HG3  . PRO A 1 37 ? -6.735  1.752   4.207   1.00 15.00 ?  508 PRO A HG3  15 
ATOM   10987 H HD2  . PRO A 1 37 ? -8.341  0.026   2.849   1.00 15.00 ?  508 PRO A HD2  15 
ATOM   10988 H HD3  . PRO A 1 37 ? -6.723  -0.410  3.430   1.00 15.00 ?  508 PRO A HD3  15 
ATOM   10989 N N    . ARG A 1 38 ? -10.840 -0.353  5.610   1.00 15.00 ?  509 ARG A N    15 
ATOM   10990 C CA   . ARG A 1 38 ? -12.226 -0.122  5.990   1.00 15.00 ?  509 ARG A CA   15 
ATOM   10991 C C    . ARG A 1 38 ? -13.027 -1.417  5.880   1.00 15.00 ?  509 ARG A C    15 
ATOM   10992 O O    . ARG A 1 38 ? -13.763 -1.592  4.884   1.00 15.00 ?  509 ARG A O    15 
ATOM   10993 C CB   . ARG A 1 38 ? -12.855 0.975   5.124   1.00 15.00 ?  509 ARG A CB   15 
ATOM   10994 C CG   . ARG A 1 38 ? -14.247 1.387   5.585   1.00 15.00 ?  509 ARG A CG   15 
ATOM   10995 C CD   . ARG A 1 38 ? -14.205 2.119   6.918   1.00 15.00 ?  509 ARG A CD   15 
ATOM   10996 N NE   . ARG A 1 38 ? -13.793 3.516   6.767   1.00 15.00 ?  509 ARG A NE   15 
ATOM   10997 C CZ   . ARG A 1 38 ? -12.969 4.153   7.597   1.00 15.00 ?  509 ARG A CZ   15 
ATOM   10998 N NH1  . ARG A 1 38 ? -12.399 3.510   8.610   1.00 15.00 1  509 ARG A NH1  15 
ATOM   10999 N NH2  . ARG A 1 38 ? -12.700 5.438   7.398   1.00 15.00 ?  509 ARG A NH2  15 
ATOM   11000 H H    . ARG A 1 38 ? -10.634 -0.711  4.718   1.00 15.00 ?  509 ARG A H    15 
ATOM   11001 H HA   . ARG A 1 38 ? -12.231 0.199   7.021   1.00 15.00 ?  509 ARG A HA   15 
ATOM   11002 H HB2  . ARG A 1 38 ? -12.218 1.847   5.148   1.00 15.00 ?  509 ARG A HB2  15 
ATOM   11003 H HB3  . ARG A 1 38 ? -12.927 0.619   4.108   1.00 15.00 ?  509 ARG A HB3  15 
ATOM   11004 H HG2  . ARG A 1 38 ? -14.682 2.040   4.844   1.00 15.00 ?  509 ARG A HG2  15 
ATOM   11005 H HG3  . ARG A 1 38 ? -14.858 0.502   5.690   1.00 15.00 ?  509 ARG A HG3  15 
ATOM   11006 H HD2  . ARG A 1 38 ? -15.189 2.089   7.360   1.00 15.00 ?  509 ARG A HD2  15 
ATOM   11007 H HD3  . ARG A 1 38 ? -13.504 1.617   7.567   1.00 15.00 ?  509 ARG A HD3  15 
ATOM   11008 H HE   . ARG A 1 38 ? -14.175 4.014   6.009   1.00 15.00 ?  509 ARG A HE   15 
ATOM   11009 H HH11 . ARG A 1 38 ? -12.584 2.526   8.761   1.00 15.00 ?  509 ARG A HH11 15 
ATOM   11010 H HH12 . ARG A 1 38 ? -11.783 4.000   9.235   1.00 15.00 ?  509 ARG A HH12 15 
ATOM   11011 H HH21 . ARG A 1 38 ? -13.120 5.928   6.620   1.00 15.00 ?  509 ARG A HH21 15 
ATOM   11012 H HH22 . ARG A 1 38 ? -12.090 5.929   8.026   1.00 15.00 ?  509 ARG A HH22 15 
ATOM   11013 N N    . ARG B 2 1  ? -1.195  -17.697 0.327   1.00 15.00 ?  925 ARG B N    15 
ATOM   11014 C CA   . ARG B 2 1  ? -1.115  -16.618 1.332   1.00 15.00 ?  925 ARG B CA   15 
ATOM   11015 C C    . ARG B 2 1  ? -0.381  -15.416 0.748   1.00 15.00 ?  925 ARG B C    15 
ATOM   11016 O O    . ARG B 2 1  ? 0.686   -15.559 0.148   1.00 15.00 ?  925 ARG B O    15 
ATOM   11017 C CB   . ARG B 2 1  ? -0.395  -17.118 2.588   1.00 15.00 ?  925 ARG B CB   15 
ATOM   11018 C CG   . ARG B 2 1  ? -0.535  -16.182 3.776   1.00 15.00 ?  925 ARG B CG   15 
ATOM   11019 C CD   . ARG B 2 1  ? 0.109   -16.755 5.023   1.00 15.00 ?  925 ARG B CD   15 
ATOM   11020 N NE   . ARG B 2 1  ? -0.236  -15.981 6.214   1.00 15.00 ?  925 ARG B NE   15 
ATOM   11021 C CZ   . ARG B 2 1  ? 0.374   -16.110 7.393   1.00 15.00 ?  925 ARG B CZ   15 
ATOM   11022 N NH1  . ARG B 2 1  ? 1.401   -16.937 7.527   1.00 15.00 1  925 ARG B NH1  15 
ATOM   11023 N NH2  . ARG B 2 1  ? -0.032  -15.393 8.435   1.00 15.00 ?  925 ARG B NH2  15 
ATOM   11024 H H1   . ARG B 2 1  ? -1.731  -18.508 0.707   1.00 15.00 ?  925 ARG B H1   15 
ATOM   11025 H H2   . ARG B 2 1  ? -0.237  -18.020 0.072   1.00 15.00 ?  925 ARG B H2   15 
ATOM   11026 H H3   . ARG B 2 1  ? -1.674  -17.350 -0.531  1.00 15.00 ?  925 ARG B H3   15 
ATOM   11027 H HA   . ARG B 2 1  ? -2.121  -16.320 1.593   1.00 15.00 ?  925 ARG B HA   15 
ATOM   11028 H HB2  . ARG B 2 1  ? -0.801  -18.079 2.864   1.00 15.00 ?  925 ARG B HB2  15 
ATOM   11029 H HB3  . ARG B 2 1  ? 0.656   -17.231 2.369   1.00 15.00 ?  925 ARG B HB3  15 
ATOM   11030 H HG2  . ARG B 2 1  ? -0.059  -15.244 3.537   1.00 15.00 ?  925 ARG B HG2  15 
ATOM   11031 H HG3  . ARG B 2 1  ? -1.585  -16.016 3.968   1.00 15.00 ?  925 ARG B HG3  15 
ATOM   11032 H HD2  . ARG B 2 1  ? -0.230  -17.773 5.153   1.00 15.00 ?  925 ARG B HD2  15 
ATOM   11033 H HD3  . ARG B 2 1  ? 1.181   -16.747 4.896   1.00 15.00 ?  925 ARG B HD3  15 
ATOM   11034 H HE   . ARG B 2 1  ? -0.983  -15.337 6.131   1.00 15.00 ?  925 ARG B HE   15 
ATOM   11035 H HH11 . ARG B 2 1  ? 1.729   -17.472 6.740   1.00 15.00 ?  925 ARG B HH11 15 
ATOM   11036 H HH12 . ARG B 2 1  ? 1.863   -17.030 8.420   1.00 15.00 ?  925 ARG B HH12 15 
ATOM   11037 H HH21 . ARG B 2 1  ? -0.800  -14.752 8.342   1.00 15.00 ?  925 ARG B HH21 15 
ATOM   11038 H HH22 . ARG B 2 1  ? 0.422   -15.491 9.328   1.00 15.00 ?  925 ARG B HH22 15 
ATOM   11039 N N    . LEU B 2 2  ? -0.952  -14.235 0.942   1.00 15.00 ?  926 LEU B N    15 
ATOM   11040 C CA   . LEU B 2 2  ? -0.380  -13.002 0.414   1.00 15.00 ?  926 LEU B CA   15 
ATOM   11041 C C    . LEU B 2 2  ? 0.980   -12.720 1.041   1.00 15.00 ?  926 LEU B C    15 
ATOM   11042 O O    . LEU B 2 2  ? 1.099   -12.587 2.261   1.00 15.00 ?  926 LEU B O    15 
ATOM   11043 C CB   . LEU B 2 2  ? -1.323  -11.816 0.662   1.00 15.00 ?  926 LEU B CB   15 
ATOM   11044 C CG   . LEU B 2 2  ? -2.488  -11.663 -0.323  1.00 15.00 ?  926 LEU B CG   15 
ATOM   11045 C CD1  . LEU B 2 2  ? -1.969  -11.542 -1.746  1.00 15.00 ?  926 LEU B CD1  15 
ATOM   11046 C CD2  . LEU B 2 2  ? -3.467  -12.823 -0.206  1.00 15.00 ?  926 LEU B CD2  15 
ATOM   11047 H H    . LEU B 2 2  ? -1.781  -14.187 1.475   1.00 15.00 ?  926 LEU B H    15 
ATOM   11048 H HA   . LEU B 2 2  ? -0.250  -13.127 -0.650  1.00 15.00 ?  926 LEU B HA   15 
ATOM   11049 H HB2  . LEU B 2 2  ? -1.737  -11.918 1.654   1.00 15.00 ?  926 LEU B HB2  15 
ATOM   11050 H HB3  . LEU B 2 2  ? -0.735  -10.909 0.631   1.00 15.00 ?  926 LEU B HB3  15 
ATOM   11051 H HG   . LEU B 2 2  ? -3.023  -10.753 -0.092  1.00 15.00 ?  926 LEU B HG   15 
ATOM   11052 H HD11 . LEU B 2 2  ? -1.333  -10.673 -1.824  1.00 15.00 ?  926 LEU B HD11 15 
ATOM   11053 H HD12 . LEU B 2 2  ? -2.801  -11.442 -2.427  1.00 15.00 ?  926 LEU B HD12 15 
ATOM   11054 H HD13 . LEU B 2 2  ? -1.402  -12.426 -1.998  1.00 15.00 ?  926 LEU B HD13 15 
ATOM   11055 H HD21 . LEU B 2 2  ? -3.865  -12.856 0.798   1.00 15.00 ?  926 LEU B HD21 15 
ATOM   11056 H HD22 . LEU B 2 2  ? -2.956  -13.748 -0.424  1.00 15.00 ?  926 LEU B HD22 15 
ATOM   11057 H HD23 . LEU B 2 2  ? -4.274  -12.683 -0.909  1.00 15.00 ?  926 LEU B HD23 15 
ATOM   11058 N N    . ASP B 2 3  ? 1.997   -12.627 0.198   1.00 15.00 ?  927 ASP B N    15 
ATOM   11059 C CA   . ASP B 2 3  ? 3.355   -12.381 0.657   1.00 15.00 ?  927 ASP B CA   15 
ATOM   11060 C C    . ASP B 2 3  ? 3.647   -10.888 0.590   1.00 15.00 ?  927 ASP B C    15 
ATOM   11061 O O    . ASP B 2 3  ? 3.512   -10.274 -0.469  1.00 15.00 ?  927 ASP B O    15 
ATOM   11062 C CB   . ASP B 2 3  ? 4.354   -13.159 -0.206  1.00 15.00 ?  927 ASP B CB   15 
ATOM   11063 C CG   . ASP B 2 3  ? 5.562   -13.625 0.580   1.00 15.00 ?  927 ASP B CG   15 
ATOM   11064 O OD1  . ASP B 2 3  ? 5.506   -14.735 1.152   1.00 15.00 -1 927 ASP B OD1  15 
ATOM   11065 O OD2  . ASP B 2 3  ? 6.578   -12.900 0.626   1.00 15.00 ?  927 ASP B OD2  15 
ATOM   11066 H H    . ASP B 2 3  ? 1.829   -12.719 -0.764  1.00 15.00 ?  927 ASP B H    15 
ATOM   11067 H HA   . ASP B 2 3  ? 3.432   -12.712 1.683   1.00 15.00 ?  927 ASP B HA   15 
ATOM   11068 H HB2  . ASP B 2 3  ? 3.863   -14.026 -0.622  1.00 15.00 ?  927 ASP B HB2  15 
ATOM   11069 H HB3  . ASP B 2 3  ? 4.695   -12.523 -1.010  1.00 15.00 ?  927 ASP B HB3  15 
ATOM   11070 N N    . LEU B 2 4  ? 4.032   -10.309 1.715   1.00 15.00 ?  928 LEU B N    15 
ATOM   11071 C CA   . LEU B 2 4  ? 4.216   -8.866  1.811   1.00 15.00 ?  928 LEU B CA   15 
ATOM   11072 C C    . LEU B 2 4  ? 5.658   -8.496  1.459   1.00 15.00 ?  928 LEU B C    15 
ATOM   11073 O O    . LEU B 2 4  ? 6.598   -8.955  2.112   1.00 15.00 ?  928 LEU B O    15 
ATOM   11074 C CB   . LEU B 2 4  ? 3.850   -8.411  3.239   1.00 15.00 ?  928 LEU B CB   15 
ATOM   11075 C CG   . LEU B 2 4  ? 3.598   -6.908  3.458   1.00 15.00 ?  928 LEU B CG   15 
ATOM   11076 C CD1  . LEU B 2 4  ? 4.894   -6.122  3.500   1.00 15.00 ?  928 LEU B CD1  15 
ATOM   11077 C CD2  . LEU B 2 4  ? 2.674   -6.349  2.385   1.00 15.00 ?  928 LEU B CD2  15 
ATOM   11078 H H    . LEU B 2 4  ? 4.222   -10.868 2.500   1.00 15.00 ?  928 LEU B H    15 
ATOM   11079 H HA   . LEU B 2 4  ? 3.548   -8.397  1.103   1.00 15.00 ?  928 LEU B HA   15 
ATOM   11080 H HB2  . LEU B 2 4  ? 2.959   -8.939  3.538   1.00 15.00 ?  928 LEU B HB2  15 
ATOM   11081 H HB3  . LEU B 2 4  ? 4.652   -8.709  3.896   1.00 15.00 ?  928 LEU B HB3  15 
ATOM   11082 H HG   . LEU B 2 4  ? 3.109   -6.776  4.411   1.00 15.00 ?  928 LEU B HG   15 
ATOM   11083 H HD11 . LEU B 2 4  ? 5.421   -6.242  2.565   1.00 15.00 ?  928 LEU B HD11 15 
ATOM   11084 H HD12 . LEU B 2 4  ? 5.508   -6.485  4.309   1.00 15.00 ?  928 LEU B HD12 15 
ATOM   11085 H HD13 . LEU B 2 4  ? 4.671   -5.077  3.657   1.00 15.00 ?  928 LEU B HD13 15 
ATOM   11086 H HD21 . LEU B 2 4  ? 2.495   -5.301  2.575   1.00 15.00 ?  928 LEU B HD21 15 
ATOM   11087 H HD22 . LEU B 2 4  ? 1.736   -6.884  2.408   1.00 15.00 ?  928 LEU B HD22 15 
ATOM   11088 H HD23 . LEU B 2 4  ? 3.133   -6.467  1.416   1.00 15.00 ?  928 LEU B HD23 15 
ATOM   11089 N N    . PRO B 2 5  ? 5.852   -7.674  0.414   1.00 15.00 ?  929 PRO B N    15 
ATOM   11090 C CA   . PRO B 2 5  ? 7.181   -7.219  0.000   1.00 15.00 ?  929 PRO B CA   15 
ATOM   11091 C C    . PRO B 2 5  ? 7.709   -6.082  0.877   1.00 15.00 ?  929 PRO B C    15 
ATOM   11092 O O    . PRO B 2 5  ? 6.968   -5.153  1.210   1.00 15.00 ?  929 PRO B O    15 
ATOM   11093 C CB   . PRO B 2 5  ? 6.939   -6.721  -1.426  1.00 15.00 ?  929 PRO B CB   15 
ATOM   11094 C CG   . PRO B 2 5  ? 5.532   -6.235  -1.417  1.00 15.00 ?  929 PRO B CG   15 
ATOM   11095 C CD   . PRO B 2 5  ? 4.789   -7.133  -0.462  1.00 15.00 ?  929 PRO B CD   15 
ATOM   11096 H HA   . PRO B 2 5  ? 7.894   -8.030  -0.012  1.00 15.00 ?  929 PRO B HA   15 
ATOM   11097 H HB2  . PRO B 2 5  ? 7.634   -5.925  -1.655  1.00 15.00 ?  929 PRO B HB2  15 
ATOM   11098 H HB3  . PRO B 2 5  ? 7.072   -7.535  -2.122  1.00 15.00 ?  929 PRO B HB3  15 
ATOM   11099 H HG2  . PRO B 2 5  ? 5.499   -5.212  -1.072  1.00 15.00 ?  929 PRO B HG2  15 
ATOM   11100 H HG3  . PRO B 2 5  ? 5.110   -6.312  -2.408  1.00 15.00 ?  929 PRO B HG3  15 
ATOM   11101 H HD2  . PRO B 2 5  ? 4.071   -6.564  0.111   1.00 15.00 ?  929 PRO B HD2  15 
ATOM   11102 H HD3  . PRO B 2 5  ? 4.295   -7.927  -1.004  1.00 15.00 ?  929 PRO B HD3  15 
ATOM   11103 N N    . PRO B 2 6  ? 8.996   -6.144  1.260   1.00 15.00 ?  930 PRO B N    15 
ATOM   11104 C CA   . PRO B 2 6  ? 9.642   -5.075  2.028   1.00 15.00 ?  930 PRO B CA   15 
ATOM   11105 C C    . PRO B 2 6  ? 9.515   -3.735  1.315   1.00 15.00 ?  930 PRO B C    15 
ATOM   11106 O O    . PRO B 2 6  ? 9.919   -3.601  0.159   1.00 15.00 ?  930 PRO B O    15 
ATOM   11107 C CB   . PRO B 2 6  ? 11.105  -5.517  2.105   1.00 15.00 ?  930 PRO B CB   15 
ATOM   11108 C CG   . PRO B 2 6  ? 11.064  -6.993  1.915   1.00 15.00 ?  930 PRO B CG   15 
ATOM   11109 C CD   . PRO B 2 6  ? 9.922   -7.254  0.976   1.00 15.00 ?  930 PRO B CD   15 
ATOM   11110 H HA   . PRO B 2 6  ? 9.229   -4.996  3.023   1.00 15.00 ?  930 PRO B HA   15 
ATOM   11111 H HB2  . PRO B 2 6  ? 11.673  -5.032  1.324   1.00 15.00 ?  930 PRO B HB2  15 
ATOM   11112 H HB3  . PRO B 2 6  ? 11.512  -5.255  3.070   1.00 15.00 ?  930 PRO B HB3  15 
ATOM   11113 H HG2  . PRO B 2 6  ? 11.992  -7.334  1.482   1.00 15.00 ?  930 PRO B HG2  15 
ATOM   11114 H HG3  . PRO B 2 6  ? 10.887  -7.481  2.862   1.00 15.00 ?  930 PRO B HG3  15 
ATOM   11115 H HD2  . PRO B 2 6  ? 10.261  -7.222  -0.050  1.00 15.00 ?  930 PRO B HD2  15 
ATOM   11116 H HD3  . PRO B 2 6  ? 9.461   -8.206  1.194   1.00 15.00 ?  930 PRO B HD3  15 
ATOM   11117 N N    . TYR B 2 7  ? 8.944   -2.755  2.001   1.00 15.00 ?  931 TYR B N    15 
ATOM   11118 C CA   . TYR B 2 7  ? 8.581   -1.497  1.363   1.00 15.00 ?  931 TYR B CA   15 
ATOM   11119 C C    . TYR B 2 7  ? 9.814   -0.646  1.056   1.00 15.00 ?  931 TYR B C    15 
ATOM   11120 O O    . TYR B 2 7  ? 10.572  -0.258  1.949   1.00 15.00 ?  931 TYR B O    15 
ATOM   11121 C CB   . TYR B 2 7  ? 7.605   -0.760  2.303   1.00 15.00 ?  931 TYR B CB   15 
ATOM   11122 C CG   . TYR B 2 7  ? 7.274   0.679   1.948   1.00 15.00 ?  931 TYR B CG   15 
ATOM   11123 C CD1  . TYR B 2 7  ? 6.699   1.017   0.728   1.00 15.00 ?  931 TYR B CD1  15 
ATOM   11124 C CD2  . TYR B 2 7  ? 7.515   1.701   2.862   1.00 15.00 ?  931 TYR B CD2  15 
ATOM   11125 C CE1  . TYR B 2 7  ? 6.384   2.332   0.429   1.00 15.00 ?  931 TYR B CE1  15 
ATOM   11126 C CE2  . TYR B 2 7  ? 7.201   3.012   2.569   1.00 15.00 ?  931 TYR B CE2  15 
ATOM   11127 C CZ   . TYR B 2 7  ? 6.638   3.323   1.354   1.00 15.00 ?  931 TYR B CZ   15 
ATOM   11128 O OH   . TYR B 2 7  ? 6.335   4.633   1.060   1.00 15.00 ?  931 TYR B OH   15 
ATOM   11129 H H    . TYR B 2 7  ? 8.763   -2.878  2.953   1.00 15.00 ?  931 TYR B H    15 
ATOM   11130 H HA   . TYR B 2 7  ? 8.072   -1.725  0.440   1.00 15.00 ?  931 TYR B HA   15 
ATOM   11131 H HB2  . TYR B 2 7  ? 6.674   -1.302  2.321   1.00 15.00 ?  931 TYR B HB2  15 
ATOM   11132 H HB3  . TYR B 2 7  ? 8.024   -0.761  3.299   1.00 15.00 ?  931 TYR B HB3  15 
ATOM   11133 H HD1  . TYR B 2 7  ? 6.502   0.242   0.008   1.00 15.00 ?  931 TYR B HD1  15 
ATOM   11134 H HD2  . TYR B 2 7  ? 7.958   1.458   3.815   1.00 15.00 ?  931 TYR B HD2  15 
ATOM   11135 H HE1  . TYR B 2 7  ? 5.934   2.575   -0.523  1.00 15.00 ?  931 TYR B HE1  15 
ATOM   11136 H HE2  . TYR B 2 7  ? 7.395   3.788   3.296   1.00 15.00 ?  931 TYR B HE2  15 
ATOM   11137 H HH   . TYR B 2 7  ? 7.129   5.175   1.160   1.00 15.00 ?  931 TYR B HH   15 
ATOM   11138 N N    . GLU B 2 8  ? 10.003  -0.375  -0.229  1.00 15.00 ?  932 GLU B N    15 
ATOM   11139 C CA   . GLU B 2 8  ? 10.926  0.644   -0.695  1.00 15.00 ?  932 GLU B CA   15 
ATOM   11140 C C    . GLU B 2 8  ? 10.112  1.796   -1.254  1.00 15.00 ?  932 GLU B C    15 
ATOM   11141 O O    . GLU B 2 8  ? 8.886   1.738   -1.233  1.00 15.00 ?  932 GLU B O    15 
ATOM   11142 C CB   . GLU B 2 8  ? 11.920  0.090   -1.732  1.00 15.00 ?  932 GLU B CB   15 
ATOM   11143 C CG   . GLU B 2 8  ? 11.511  -1.231  -2.369  1.00 15.00 ?  932 GLU B CG   15 
ATOM   11144 C CD   . GLU B 2 8  ? 10.338  -1.100  -3.314  1.00 15.00 ?  932 GLU B CD   15 
ATOM   11145 O OE1  . GLU B 2 8  ? 10.563  -0.771  -4.493  1.00 15.00 ?  932 GLU B OE1  15 
ATOM   11146 O OE2  . GLU B 2 8  ? 9.196   -1.345  -2.878  1.00 15.00 -1 932 GLU B OE2  15 
ATOM   11147 H H    . GLU B 2 8  ? 9.485   -0.878  -0.899  1.00 15.00 ?  932 GLU B H    15 
ATOM   11148 H HA   . GLU B 2 8  ? 11.476  0.999   0.165   1.00 15.00 ?  932 GLU B HA   15 
ATOM   11149 H HB2  . GLU B 2 8  ? 12.035  0.817   -2.521  1.00 15.00 ?  932 GLU B HB2  15 
ATOM   11150 H HB3  . GLU B 2 8  ? 12.877  -0.052  -1.250  1.00 15.00 ?  932 GLU B HB3  15 
ATOM   11151 H HG2  . GLU B 2 8  ? 12.354  -1.624  -2.919  1.00 15.00 ?  932 GLU B HG2  15 
ATOM   11152 H HG3  . GLU B 2 8  ? 11.244  -1.924  -1.585  1.00 15.00 ?  932 GLU B HG3  15 
ATOM   11153 N N    . THR B 2 9  ? 10.743  2.846   -1.743  1.00 15.00 ?  933 THR B N    15 
ATOM   11154 C CA   . THR B 2 9  ? 9.956   3.932   -2.279  1.00 15.00 ?  933 THR B CA   15 
ATOM   11155 C C    . THR B 2 9  ? 9.778   3.806   -3.788  1.00 15.00 ?  933 THR B C    15 
ATOM   11156 O O    . THR B 2 9  ? 10.737  3.767   -4.562  1.00 15.00 ?  933 THR B O    15 
ATOM   11157 C CB   . THR B 2 9  ? 10.519  5.321   -1.925  1.00 15.00 ?  933 THR B CB   15 
ATOM   11158 O OG1  . THR B 2 9  ? 10.736  5.417   -0.506  1.00 15.00 ?  933 THR B OG1  15 
ATOM   11159 C CG2  . THR B 2 9  ? 9.541   6.407   -2.357  1.00 15.00 ?  933 THR B CG2  15 
ATOM   11160 H H    . THR B 2 9  ? 11.722  2.880   -1.764  1.00 15.00 ?  933 THR B H    15 
ATOM   11161 H HA   . THR B 2 9  ? 8.975   3.857   -1.829  1.00 15.00 ?  933 THR B HA   15 
ATOM   11162 H HB   . THR B 2 9  ? 11.455  5.466   -2.444  1.00 15.00 ?  933 THR B HB   15 
ATOM   11163 H HG1  . THR B 2 9  ? 11.270  4.668   -0.206  1.00 15.00 ?  933 THR B HG1  15 
ATOM   11164 H HG21 . THR B 2 9  ? 9.454   6.404   -3.433  1.00 15.00 ?  933 THR B HG21 15 
ATOM   11165 H HG22 . THR B 2 9  ? 9.896   7.371   -2.026  1.00 15.00 ?  933 THR B HG22 15 
ATOM   11166 H HG23 . THR B 2 9  ? 8.567   6.211   -1.922  1.00 15.00 ?  933 THR B HG23 15 
ATOM   11167 N N    . PHE B 2 10 ? 8.521   3.707   -4.155  1.00 15.00 ?  934 PHE B N    15 
ATOM   11168 C CA   . PHE B 2 10 ? 8.046   3.787   -5.522  1.00 15.00 ?  934 PHE B CA   15 
ATOM   11169 C C    . PHE B 2 10 ? 7.677   5.246   -5.785  1.00 15.00 ?  934 PHE B C    15 
ATOM   11170 O O    . PHE B 2 10 ? 7.876   6.081   -4.906  1.00 15.00 ?  934 PHE B O    15 
ATOM   11171 C CB