data_2MX4
# 
_entry.id   2MX4 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_code 
_database_2.database_id 
RCSB104153   RCSB  
2MX4         PDB   
19905        BMRB  
D_1000104153 WWPDB 
# 
loop_
_pdbx_database_related.content_type 
_pdbx_database_related.db_id 
_pdbx_database_related.db_name 
_pdbx_database_related.details 
unspecified 19905 BMRB 'chemical shifts of full length phosphorylated 4E-BP2'     
unspecified 19114 BMRB 'chemical shifts of full length non-phosphorylated 4E-BP2' 
# 
_pdbx_database_status.deposit_site                    BMRB 
_pdbx_database_status.entry_id                        2MX4 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2014-12-10 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  REL 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Bah, A.'        1 
'Forman-Kay, J.' 2 
'Vernon, R.'     3 
'Siddiqui, Z.'   4 
'Krzeminski, M.' 5 
'Muhandiram, R.' 6 
'Zhao, C.'       7 
'Sonenberg, N.'  8 
'Kay, L.'        9 
# 
_citation.id                        primary 
_citation.title                     'Folding of an intrinsically disordered protein by phosphorylation as a regulatory switch.' 
_citation.journal_abbrev            Nature 
_citation.journal_volume            519 
_citation.page_first                106 
_citation.page_last                 109 
_citation.year                      2015 
_citation.journal_id_ASTM           NATUAS 
_citation.country                   UK 
_citation.journal_id_ISSN           0028-0836 
_citation.journal_id_CSD            0006 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   25533957 
_citation.pdbx_database_id_DOI      10.1038/nature13999 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Bah, A.'          1 
primary 'Vernon, R.M.'     2 
primary 'Siddiqui, Z.'     3 
primary 'Krzeminski, M.'   4 
primary 'Muhandiram, R.'   5 
primary 'Zhao, C.'         6 
primary 'Sonenberg, N.'    7 
primary 'Kay, L.E.'        8 
primary 'Forman-Kay, J.D.' 9 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'Eukaryotic translation initiation factor 4E-binding protein 2' 
_entity.formula_weight             5090.515 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'residues 18-62' 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        '4E-BP2, eIF4E-binding protein 2' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   yes 
_entity_poly.pdbx_seq_one_letter_code       'PTRTVAISDAAQLPHDYCT(TPO)PGGTLFST(TPO)PGGTRIIYDRKFLLDR' 
_entity_poly.pdbx_seq_one_letter_code_can   PTRTVAISDAAQLPHDYCTTPGGTLFSTTPGGTRIIYDRKFLLDR 
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  PRO n 
1 2  THR n 
1 3  ARG n 
1 4  THR n 
1 5  VAL n 
1 6  ALA n 
1 7  ILE n 
1 8  SER n 
1 9  ASP n 
1 10 ALA n 
1 11 ALA n 
1 12 GLN n 
1 13 LEU n 
1 14 PRO n 
1 15 HIS n 
1 16 ASP n 
1 17 TYR n 
1 18 CYS n 
1 19 THR n 
1 20 TPO n 
1 21 PRO n 
1 22 GLY n 
1 23 GLY n 
1 24 THR n 
1 25 LEU n 
1 26 PHE n 
1 27 SER n 
1 28 THR n 
1 29 TPO n 
1 30 PRO n 
1 31 GLY n 
1 32 GLY n 
1 33 THR n 
1 34 ARG n 
1 35 ILE n 
1 36 ILE n 
1 37 TYR n 
1 38 ASP n 
1 39 ARG n 
1 40 LYS n 
1 41 PHE n 
1 42 LEU n 
1 43 LEU n 
1 44 ASP n 
1 45 ARG n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 EIF4EBP2 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               'pET SUMO' 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    4EBP2_HUMAN 
_struct_ref.pdbx_db_accession          Q13542 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   PTRTVAISDAAQLPHDYCTTPGGTLFSTTPGGTRIIYDRKFLLDR 
_struct_ref.pdbx_align_begin           18 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2MX4 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 45 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q13542 
_struct_ref_seq.db_align_beg                  18 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  62 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       18 
_struct_ref_seq.pdbx_auth_seq_align_end       62 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE          ?                  'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE         ?                  'C6 H15 N4 O2 1' 175.209 
ASP 'L-peptide linking' y 'ASPARTIC ACID'  ?                  'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE         ?                  'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE        ?                  'C5 H10 N2 O3'   146.144 
GLY 'peptide linking'   y GLYCINE          ?                  'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE        ?                  'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE       ?                  'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE          ?                  'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE           ?                  'C6 H15 N2 O2 1' 147.195 
PHE 'L-peptide linking' y PHENYLALANINE    ?                  'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE          ?                  'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE           ?                  'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE        ?                  'C4 H9 N O3'     119.119 
TPO 'L-peptide linking' n PHOSPHOTHREONINE PHOSPHONOTHREONINE 'C4 H10 N O6 P'  199.099 
TYR 'L-peptide linking' y TYROSINE         ?                  'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE           ?                  'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.type 
1 1 1 '2D 1H-15N HSQC'  
1 2 1 '3D HNCO'         
1 3 1 '3D H(CCO)NH'     
1 4 1 '3D 1H-15N NOESY' 
1 5 1 '3D CBCA(CO)NH'   
1 6 1 '3D 1H-13C NOESY' 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      0.150 
_pdbx_nmr_exptl_sample_conditions.pH                  6.0 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature         20 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_sample_details.contents         
;1 mM [U-99% 13C; U-99% 15N] Phosphorylated 4E-BP2, 2 mM DTT, 100 mM sodium chloride, 30 mM sodium phosphate, 1 mM EDTA, 1 mM Benzamidine, 90% H2O/10% D2O
;
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.solvent_system   '90% H2O/10% D2O' 
# 
loop_
_pdbx_nmr_spectrometer.field_strength 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.type 
500 Varian INOVA 1 'Varian INOVA' 
600 Varian INOVA 2 'Varian INOVA' 
800 Varian INOVA 3 'Varian INOVA' 
500 Varian INOVA 4 'Varian INOVA' 
# 
_pdbx_nmr_refine.entry_id           2MX4 
_pdbx_nmr_refine.method             'simulated annealing' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy' 
_pdbx_nmr_ensemble.conformers_calculated_total_number            20359 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.entry_id                                      2MX4 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.entry_id             2MX4 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.authors 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.ordinal 
'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing                  NMRPipe    ? 1  
'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 'chemical shift assignment' NMRPipe    ? 2  
'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 'structure solution'        NMRPipe    ? 3  
Goddard                                             processing                  NMRPipe    ? 4  
Goddard                                             'chemical shift assignment' NMRPipe    ? 5  
Goddard                                             'structure solution'        NMRPipe    ? 6  
'Shen, Vernon, Baker and Bax'                       processing                  NMRPipe    ? 7  
'Shen, Vernon, Baker and Bax'                       'chemical shift assignment' NMRPipe    ? 8  
'Shen, Vernon, Baker and Bax'                       'structure solution'        NMRPipe    ? 9  
'Lange and Baker'                                   refinement                  CS-ROSETTA ? 10 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.entry_id                   2MX4 
_exptl.method                     'SOLUTION NMR' 
_exptl.method_details             ? 
# 
_struct.entry_id                  2MX4 
_struct.title                     'NMR structure of Phosphorylated 4E-BP2' 
_struct.pdbx_descriptor           'Eukaryotic translation initiation factor 4E-binding protein 2' 
_struct.pdbx_model_details        'lowest energy, model1' 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2MX4 
_struct_keywords.pdbx_keywords   'Translation,protein Binding' 
_struct_keywords.text            'phosphorylation, intrinsic disorder, Translation, protein Binding' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1 covale ? ? A THR 19 C ? ? ? 1_555 A TPO 20 N ? ? A THR 36 A TPO 37 1_555 ? ? ? ? ? ? ? 1.329 ? 
covale2 covale ? ? A TPO 20 C ? ? ? 1_555 A PRO 21 N ? ? A TPO 37 A PRO 38 1_555 ? ? ? ? ? ? ? 1.329 ? 
covale3 covale ? ? A THR 28 C ? ? ? 1_555 A TPO 29 N ? ? A THR 45 A TPO 46 1_555 ? ? ? ? ? ? ? 1.329 ? 
covale4 covale ? ? A TPO 29 C ? ? ? 1_555 A PRO 30 N ? ? A TPO 46 A PRO 47 1_555 ? ? ? ? ? ? ? 1.329 ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 HIS 15 A . ? HIS 32 A ASP 16 A ? ASP 33 A 6  6.79  
2 HIS 15 A . ? HIS 32 A ASP 16 A ? ASP 33 A 8  2.95  
3 HIS 15 A . ? HIS 32 A ASP 16 A ? ASP 33 A 9  4.85  
4 HIS 15 A . ? HIS 32 A ASP 16 A ? ASP 33 A 10 4.65  
5 HIS 15 A . ? HIS 32 A ASP 16 A ? ASP 33 A 14 -0.55 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   4 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 THR A 2  ? ILE A 7  ? THR A 19 ILE A 24 
A 2 ARG A 34 ? ARG A 39 ? ARG A 51 ARG A 56 
A 3 LEU A 25 ? THR A 28 ? LEU A 42 THR A 45 
A 4 CYS A 18 ? THR A 19 ? CYS A 35 THR A 36 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ILE A 7  ? N ILE A 24 O ASP A 38 ? O ASP A 55 
A 2 3 O ILE A 35 ? O ILE A 52 N SER A 27 ? N SER A 44 
A 3 4 O PHE A 26 ? O PHE A 43 N CYS A 18 ? N CYS A 35 
# 
_atom_sites.entry_id                    2MX4 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N    . PRO A 1 1  ? 0.592  -0.732 -0.717  1.00 0.00 ? 18 PRO A N    1  
ATOM   2     C CA   . PRO A 1 1  ? 1.885  -0.592 -0.059  1.00 0.00 ? 18 PRO A CA   1  
ATOM   3     C C    . PRO A 1 1  ? 2.362  0.854  -0.085  1.00 0.00 ? 18 PRO A C    1  
ATOM   4     O O    . PRO A 1 1  ? 1.950  1.639  -0.940  1.00 0.00 ? 18 PRO A O    1  
ATOM   5     C CB   . PRO A 1 1  ? 2.811  -1.519 -0.853  1.00 0.00 ? 18 PRO A CB   1  
ATOM   6     C CG   . PRO A 1 1  ? 2.241  -1.522 -2.230  1.00 0.00 ? 18 PRO A CG   1  
ATOM   7     C CD   . PRO A 1 1  ? 0.751  -1.431 -2.046  1.00 0.00 ? 18 PRO A CD   1  
ATOM   8     H H2   . PRO A 1 1  ? 0.497  -1.331 -1.512  1.00 0.00 ? 18 PRO A H2   1  
ATOM   9     H H3   . PRO A 1 1  ? -0.194 -1.080 -0.205  1.00 0.00 ? 18 PRO A H3   1  
ATOM   10    H HA   . PRO A 1 1  ? 1.853  -0.860 1.007   1.00 0.00 ? 18 PRO A HA   1  
ATOM   11    H HB2  . PRO A 1 1  ? 3.848  -1.150 -0.852  1.00 0.00 ? 18 PRO A HB2  1  
ATOM   12    H HB3  . PRO A 1 1  ? 2.829  -2.533 -0.427  1.00 0.00 ? 18 PRO A HB3  1  
ATOM   13    H HG2  . PRO A 1 1  ? 2.620  -0.673 -2.819  1.00 0.00 ? 18 PRO A HG2  1  
ATOM   14    H HG3  . PRO A 1 1  ? 2.518  -2.438 -2.773  1.00 0.00 ? 18 PRO A HG3  1  
ATOM   15    H HD2  . PRO A 1 1  ? 0.266  -0.857 -2.849  1.00 0.00 ? 18 PRO A HD2  1  
ATOM   16    H HD3  . PRO A 1 1  ? 0.273  -2.422 -2.027  1.00 0.00 ? 18 PRO A HD3  1  
ATOM   17    N N    . THR A 1 2  ? 3.234  1.202  0.856   1.00 0.00 ? 19 THR A N    1  
ATOM   18    C CA   . THR A 1 2  ? 3.762  2.558  0.948   1.00 0.00 ? 19 THR A CA   1  
ATOM   19    C C    . THR A 1 2  ? 5.252  2.592  0.634   1.00 0.00 ? 19 THR A C    1  
ATOM   20    O O    . THR A 1 2  ? 6.030  1.814  1.188   1.00 0.00 ? 19 THR A O    1  
ATOM   21    C CB   . THR A 1 2  ? 3.528  3.161  2.345   1.00 0.00 ? 19 THR A CB   1  
ATOM   22    O OG1  . THR A 1 2  ? 2.121  3.213  2.618   1.00 0.00 ? 19 THR A OG1  1  
ATOM   23    C CG2  . THR A 1 2  ? 4.107  4.566  2.424   1.00 0.00 ? 19 THR A CG2  1  
ATOM   24    H H    . THR A 1 2  ? 3.538  0.509  1.525   1.00 0.00 ? 19 THR A H    1  
ATOM   25    H HA   . THR A 1 2  ? 3.276  3.194  0.207   1.00 0.00 ? 19 THR A HA   1  
ATOM   26    H HB   . THR A 1 2  ? 4.010  2.528  3.090   1.00 0.00 ? 19 THR A HB   1  
ATOM   27    H HG1  . THR A 1 2  ? 1.978  3.588  3.490   1.00 0.00 ? 19 THR A HG1  1  
ATOM   28    H HG21 . THR A 1 2  ? 3.625  5.199  1.680   1.00 0.00 ? 19 THR A HG21 1  
ATOM   29    H HG22 . THR A 1 2  ? 3.932  4.975  3.418   1.00 0.00 ? 19 THR A HG22 1  
ATOM   30    H HG23 . THR A 1 2  ? 5.179  4.528  2.228   1.00 0.00 ? 19 THR A HG23 1  
ATOM   31    N N    . ARG A 1 3  ? 5.644  3.496  -0.256  1.00 0.00 ? 20 ARG A N    1  
ATOM   32    C CA   . ARG A 1 3  ? 7.042  3.634  -0.643  1.00 0.00 ? 20 ARG A CA   1  
ATOM   33    C C    . ARG A 1 3  ? 7.554  5.042  -0.369  1.00 0.00 ? 20 ARG A C    1  
ATOM   34    O O    . ARG A 1 3  ? 6.926  6.027  -0.758  1.00 0.00 ? 20 ARG A O    1  
ATOM   35    C CB   . ARG A 1 3  ? 7.281  3.227  -2.090  1.00 0.00 ? 20 ARG A CB   1  
ATOM   36    C CG   . ARG A 1 3  ? 8.713  3.393  -2.574  1.00 0.00 ? 20 ARG A CG   1  
ATOM   37    C CD   . ARG A 1 3  ? 8.939  2.961  -3.976  1.00 0.00 ? 20 ARG A CD   1  
ATOM   38    N NE   . ARG A 1 3  ? 10.298 3.154  -4.455  1.00 0.00 ? 20 ARG A NE   1  
ATOM   39    C CZ   . ARG A 1 3  ? 10.745 2.770  -5.666  1.00 0.00 ? 20 ARG A CZ   1  
ATOM   40    N NH1  . ARG A 1 3  ? 9.958  2.137  -6.509  1.00 0.00 ? 20 ARG A NH1  1  
ATOM   41    N NH2  . ARG A 1 3  ? 12.005 3.024  -5.977  1.00 0.00 ? 20 ARG A NH2  1  
ATOM   42    H H    . ARG A 1 3  ? 4.955  4.103  -0.676  1.00 0.00 ? 20 ARG A H    1  
ATOM   43    H HA   . ARG A 1 3  ? 7.659  2.959  -0.048  1.00 0.00 ? 20 ARG A HA   1  
ATOM   44    H HB2  . ARG A 1 3  ? 6.991  2.181  -2.178  1.00 0.00 ? 20 ARG A HB2  1  
ATOM   45    H HB3  . ARG A 1 3  ? 6.621  3.839  -2.705  1.00 0.00 ? 20 ARG A HB3  1  
ATOM   46    H HG2  . ARG A 1 3  ? 8.984  4.446  -2.500  1.00 0.00 ? 20 ARG A HG2  1  
ATOM   47    H HG3  . ARG A 1 3  ? 9.366  2.804  -1.930  1.00 0.00 ? 20 ARG A HG3  1  
ATOM   48    H HD2  . ARG A 1 3  ? 8.713  1.898  -4.059  1.00 0.00 ? 20 ARG A HD2  1  
ATOM   49    H HD3  . ARG A 1 3  ? 8.277  3.525  -4.633  1.00 0.00 ? 20 ARG A HD3  1  
ATOM   50    H HE   . ARG A 1 3  ? 11.089 3.583  -3.993  1.00 0.00 ? 20 ARG A HE   1  
ATOM   51    H HH11 . ARG A 1 3  ? 9.003  1.936  -6.249  1.00 0.00 ? 20 ARG A HH11 1  
ATOM   52    H HH12 . ARG A 1 3  ? 10.313 1.858  -7.412  1.00 0.00 ? 20 ARG A HH12 1  
ATOM   53    H HH21 . ARG A 1 3  ? 12.601 3.495  -5.310  1.00 0.00 ? 20 ARG A HH21 1  
ATOM   54    H HH22 . ARG A 1 3  ? 12.365 2.746  -6.877  1.00 0.00 ? 20 ARG A HH22 1  
ATOM   55    N N    . THR A 1 4  ? 8.697  5.131  0.302   1.00 0.00 ? 21 THR A N    1  
ATOM   56    C CA   . THR A 1 4  ? 9.298  6.420  0.626   1.00 0.00 ? 21 THR A CA   1  
ATOM   57    C C    . THR A 1 4  ? 10.409 6.770  -0.356  1.00 0.00 ? 21 THR A C    1  
ATOM   58    O O    . THR A 1 4  ? 11.394 6.042  -0.480  1.00 0.00 ? 21 THR A O    1  
ATOM   59    C CB   . THR A 1 4  ? 9.867  6.436  2.057   1.00 0.00 ? 21 THR A CB   1  
ATOM   60    O OG1  . THR A 1 4  ? 8.811  6.196  2.996   1.00 0.00 ? 21 THR A OG1  1  
ATOM   61    C CG2  . THR A 1 4  ? 10.513 7.779  2.358   1.00 0.00 ? 21 THR A CG2  1  
ATOM   62    H H    . THR A 1 4  ? 9.161  4.284  0.597   1.00 0.00 ? 21 THR A H    1  
ATOM   63    H HA   . THR A 1 4  ? 8.550  7.208  0.539   1.00 0.00 ? 21 THR A HA   1  
ATOM   64    H HB   . THR A 1 4  ? 10.612 5.646  2.150   1.00 0.00 ? 21 THR A HB   1  
ATOM   65    H HG1  . THR A 1 4  ? 9.168  6.206  3.887   1.00 0.00 ? 21 THR A HG1  1  
ATOM   66    H HG21 . THR A 1 4  ? 9.769  8.570  2.266   1.00 0.00 ? 21 THR A HG21 1  
ATOM   67    H HG22 . THR A 1 4  ? 10.910 7.771  3.373   1.00 0.00 ? 21 THR A HG22 1  
ATOM   68    H HG23 . THR A 1 4  ? 11.324 7.959  1.652   1.00 0.00 ? 21 THR A HG23 1  
ATOM   69    N N    . VAL A 1 5  ? 10.244 7.891  -1.052  1.00 0.00 ? 22 VAL A N    1  
ATOM   70    C CA   . VAL A 1 5  ? 11.247 8.355  -2.004  1.00 0.00 ? 22 VAL A CA   1  
ATOM   71    C C    . VAL A 1 5  ? 11.648 9.796  -1.721  1.00 0.00 ? 22 VAL A C    1  
ATOM   72    O O    . VAL A 1 5  ? 10.795 10.670 -1.568  1.00 0.00 ? 22 VAL A O    1  
ATOM   73    C CB   . VAL A 1 5  ? 10.741 8.247  -3.455  1.00 0.00 ? 22 VAL A CB   1  
ATOM   74    C CG1  . VAL A 1 5  ? 11.773 8.810  -4.422  1.00 0.00 ? 22 VAL A CG1  1  
ATOM   75    C CG2  . VAL A 1 5  ? 10.420 6.802  -3.802  1.00 0.00 ? 22 VAL A CG2  1  
ATOM   76    H H    . VAL A 1 5  ? 9.404  8.434  -0.918  1.00 0.00 ? 22 VAL A H    1  
ATOM   77    H HA   . VAL A 1 5  ? 12.172 7.784  -1.916  1.00 0.00 ? 22 VAL A HA   1  
ATOM   78    H HB   . VAL A 1 5  ? 9.812  8.810  -3.549  1.00 0.00 ? 22 VAL A HB   1  
ATOM   79    H HG11 . VAL A 1 5  ? 11.399 8.726  -5.443  1.00 0.00 ? 22 VAL A HG11 1  
ATOM   80    H HG12 . VAL A 1 5  ? 11.957 9.858  -4.187  1.00 0.00 ? 22 VAL A HG12 1  
ATOM   81    H HG13 . VAL A 1 5  ? 12.702 8.247  -4.329  1.00 0.00 ? 22 VAL A HG13 1  
ATOM   82    H HG21 . VAL A 1 5  ? 9.647  6.429  -3.130  1.00 0.00 ? 22 VAL A HG21 1  
ATOM   83    H HG22 . VAL A 1 5  ? 10.063 6.744  -4.830  1.00 0.00 ? 22 VAL A HG22 1  
ATOM   84    H HG23 . VAL A 1 5  ? 11.319 6.195  -3.695  1.00 0.00 ? 22 VAL A HG23 1  
ATOM   85    N N    . ALA A 1 6  ? 12.953 10.040 -1.654  1.00 0.00 ? 23 ALA A N    1  
ATOM   86    C CA   . ALA A 1 6  ? 13.471 11.386 -1.443  1.00 0.00 ? 23 ALA A CA   1  
ATOM   87    C C    . ALA A 1 6  ? 13.737 12.089 -2.768  1.00 0.00 ? 23 ALA A C    1  
ATOM   88    O O    . ALA A 1 6  ? 14.162 11.462 -3.739  1.00 0.00 ? 23 ALA A O    1  
ATOM   89    C CB   . ALA A 1 6  ? 14.737 11.340 -0.601  1.00 0.00 ? 23 ALA A CB   1  
ATOM   90    H H    . ALA A 1 6  ? 13.602 9.273  -1.752  1.00 0.00 ? 23 ALA A H    1  
ATOM   91    H HA   . ALA A 1 6  ? 12.720 11.971 -0.911  1.00 0.00 ? 23 ALA A HA   1  
ATOM   92    H HB1  . ALA A 1 6  ? 15.493 10.746 -1.112  1.00 0.00 ? 23 ALA A HB1  1  
ATOM   93    H HB2  . ALA A 1 6  ? 15.112 12.353 -0.452  1.00 0.00 ? 23 ALA A HB2  1  
ATOM   94    H HB3  . ALA A 1 6  ? 14.515 10.891 0.368   1.00 0.00 ? 23 ALA A HB3  1  
ATOM   95    N N    . ILE A 1 7  ? 13.484 13.393 -2.803  1.00 0.00 ? 24 ILE A N    1  
ATOM   96    C CA   . ILE A 1 7  ? 13.758 14.195 -3.988  1.00 0.00 ? 24 ILE A CA   1  
ATOM   97    C C    . ILE A 1 7  ? 14.763 15.299 -3.685  1.00 0.00 ? 24 ILE A C    1  
ATOM   98    O O    . ILE A 1 7  ? 14.473 16.225 -2.929  1.00 0.00 ? 24 ILE A O    1  
ATOM   99    C CB   . ILE A 1 7  ? 12.473 14.825 -4.554  1.00 0.00 ? 24 ILE A CB   1  
ATOM   100   C CG1  . ILE A 1 7  ? 11.472 13.735 -4.947  1.00 0.00 ? 24 ILE A CG1  1  
ATOM   101   C CG2  . ILE A 1 7  ? 12.795 15.712 -5.747  1.00 0.00 ? 24 ILE A CG2  1  
ATOM   102   C CD1  . ILE A 1 7  ? 10.108 14.265 -5.325  1.00 0.00 ? 24 ILE A CD1  1  
ATOM   103   H H    . ILE A 1 7  ? 13.091 13.839 -1.986  1.00 0.00 ? 24 ILE A H    1  
ATOM   104   H HA   . ILE A 1 7  ? 14.236 13.591 -4.759  1.00 0.00 ? 24 ILE A HA   1  
ATOM   105   H HB   . ILE A 1 7  ? 11.997 15.421 -3.776  1.00 0.00 ? 24 ILE A HB   1  
ATOM   106   H HG12 . ILE A 1 7  ? 11.898 13.192 -5.790  1.00 0.00 ? 24 ILE A HG12 1  
ATOM   107   H HG13 . ILE A 1 7  ? 11.376 13.062 -4.095  1.00 0.00 ? 24 ILE A HG13 1  
ATOM   108   H HG21 . ILE A 1 7  ? 11.875 16.148 -6.135  1.00 0.00 ? 24 ILE A HG21 1  
ATOM   109   H HG22 . ILE A 1 7  ? 13.472 16.507 -5.438  1.00 0.00 ? 24 ILE A HG22 1  
ATOM   110   H HG23 . ILE A 1 7  ? 13.270 15.115 -6.526  1.00 0.00 ? 24 ILE A HG23 1  
ATOM   111   H HD11 . ILE A 1 7  ? 10.202 14.938 -6.177  1.00 0.00 ? 24 ILE A HD11 1  
ATOM   112   H HD12 . ILE A 1 7  ? 9.454  13.435 -5.591  1.00 0.00 ? 24 ILE A HD12 1  
ATOM   113   H HD13 . ILE A 1 7  ? 9.681  14.807 -4.480  1.00 0.00 ? 24 ILE A HD13 1  
ATOM   114   N N    . SER A 1 8  ? 15.946 15.195 -4.281  1.00 0.00 ? 25 SER A N    1  
ATOM   115   C CA   . SER A 1 8  ? 17.030 16.130 -4.001  1.00 0.00 ? 25 SER A CA   1  
ATOM   116   C C    . SER A 1 8  ? 17.410 16.921 -5.246  1.00 0.00 ? 25 SER A C    1  
ATOM   117   O O    . SER A 1 8  ? 18.365 17.697 -5.233  1.00 0.00 ? 25 SER A O    1  
ATOM   118   C CB   . SER A 1 8  ? 18.235 15.385 -3.461  1.00 0.00 ? 25 SER A CB   1  
ATOM   119   O OG   . SER A 1 8  ? 18.694 14.408 -4.354  1.00 0.00 ? 25 SER A OG   1  
ATOM   120   H H    . SER A 1 8  ? 16.100 14.449 -4.944  1.00 0.00 ? 25 SER A H    1  
ATOM   121   H HA   . SER A 1 8  ? 16.811 16.812 -3.180  1.00 0.00 ? 25 SER A HA   1  
ATOM   122   H HB2  . SER A 1 8  ? 19.035 16.102 -3.279  1.00 0.00 ? 25 SER A HB2  1  
ATOM   123   H HB3  . SER A 1 8  ? 17.958 14.907 -2.523  1.00 0.00 ? 25 SER A HB3  1  
ATOM   124   H HG   . SER A 1 8  ? 17.944 13.938 -4.725  1.00 0.00 ? 25 SER A HG   1  
ATOM   125   N N    . ASP A 1 9  ? 16.655 16.721 -6.321  1.00 0.00 ? 26 ASP A N    1  
ATOM   126   C CA   . ASP A 1 9  ? 16.902 17.427 -7.573  1.00 0.00 ? 26 ASP A CA   1  
ATOM   127   C C    . ASP A 1 9  ? 15.651 17.465 -8.440  1.00 0.00 ? 26 ASP A C    1  
ATOM   128   O O    . ASP A 1 9  ? 14.755 16.633 -8.292  1.00 0.00 ? 26 ASP A O    1  
ATOM   129   C CB   . ASP A 1 9  ? 18.053 16.773 -8.340  1.00 0.00 ? 26 ASP A CB   1  
ATOM   130   C CG   . ASP A 1 9  ? 18.730 17.683 -9.357  1.00 0.00 ? 26 ASP A CG   1  
ATOM   131   O OD1  . ASP A 1 9  ? 18.345 18.826 -9.451  1.00 0.00 ? 26 ASP A OD1  1  
ATOM   132   O OD2  . ASP A 1 9  ? 19.722 17.283 -9.916  1.00 0.00 ? 26 ASP A OD2  1  
ATOM   133   H H    . ASP A 1 9  ? 15.892 16.062 -6.270  1.00 0.00 ? 26 ASP A H    1  
ATOM   134   H HA   . ASP A 1 9  ? 17.167 18.465 -7.365  1.00 0.00 ? 26 ASP A HA   1  
ATOM   135   H HB2  . ASP A 1 9  ? 18.809 16.328 -7.694  1.00 0.00 ? 26 ASP A HB2  1  
ATOM   136   H HB3  . ASP A 1 9  ? 17.511 15.985 -8.863  1.00 0.00 ? 26 ASP A HB3  1  
ATOM   137   N N    . ALA A 1 10 ? 15.593 18.436 -9.345  1.00 0.00 ? 27 ALA A N    1  
ATOM   138   C CA   . ALA A 1 10 ? 14.478 18.549 -10.279 1.00 0.00 ? 27 ALA A CA   1  
ATOM   139   C C    . ALA A 1 10 ? 14.449 17.372 -11.245 1.00 0.00 ? 27 ALA A C    1  
ATOM   140   O O    . ALA A 1 10 ? 13.398 17.024 -11.783 1.00 0.00 ? 27 ALA A O    1  
ATOM   141   C CB   . ALA A 1 10 ? 14.556 19.863 -11.041 1.00 0.00 ? 27 ALA A CB   1  
ATOM   142   H H    . ALA A 1 10 ? 16.341 19.114 -9.387  1.00 0.00 ? 27 ALA A H    1  
ATOM   143   H HA   . ALA A 1 10 ? 13.546 18.529 -9.714  1.00 0.00 ? 27 ALA A HA   1  
ATOM   144   H HB1  . ALA A 1 10 ? 15.490 19.906 -11.598 1.00 0.00 ? 27 ALA A HB1  1  
ATOM   145   H HB2  . ALA A 1 10 ? 13.717 19.931 -11.733 1.00 0.00 ? 27 ALA A HB2  1  
ATOM   146   H HB3  . ALA A 1 10 ? 14.514 20.695 -10.337 1.00 0.00 ? 27 ALA A HB3  1  
ATOM   147   N N    . ALA A 1 11 ? 15.609 16.762 -11.462 1.00 0.00 ? 28 ALA A N    1  
ATOM   148   C CA   . ALA A 1 11 ? 15.695 15.532 -12.240 1.00 0.00 ? 28 ALA A CA   1  
ATOM   149   C C    . ALA A 1 11 ? 14.970 14.388 -11.543 1.00 0.00 ? 28 ALA A C    1  
ATOM   150   O O    . ALA A 1 11 ? 14.439 13.488 -12.193 1.00 0.00 ? 28 ALA A O    1  
ATOM   151   C CB   . ALA A 1 11 ? 17.149 15.165 -12.494 1.00 0.00 ? 28 ALA A CB   1  
ATOM   152   H H    . ALA A 1 11 ? 16.454 17.161 -11.078 1.00 0.00 ? 28 ALA A H    1  
ATOM   153   H HA   . ALA A 1 11 ? 15.204 15.691 -13.199 1.00 0.00 ? 28 ALA A HA   1  
ATOM   154   H HB1  . ALA A 1 11 ? 17.659 15.019 -11.543 1.00 0.00 ? 28 ALA A HB1  1  
ATOM   155   H HB2  . ALA A 1 11 ? 17.196 14.245 -13.076 1.00 0.00 ? 28 ALA A HB2  1  
ATOM   156   H HB3  . ALA A 1 11 ? 17.637 15.969 -13.047 1.00 0.00 ? 28 ALA A HB3  1  
ATOM   157   N N    . GLN A 1 12 ? 14.951 14.428 -10.215 1.00 0.00 ? 29 GLN A N    1  
ATOM   158   C CA   . GLN A 1 12 ? 14.298 13.390 -9.426  1.00 0.00 ? 29 GLN A CA   1  
ATOM   159   C C    . GLN A 1 12 ? 12.836 13.732 -9.168  1.00 0.00 ? 29 GLN A C    1  
ATOM   160   O O    . GLN A 1 12 ? 12.023 12.851 -8.886  1.00 0.00 ? 29 GLN A O    1  
ATOM   161   C CB   . GLN A 1 12 ? 15.025 13.192 -8.093  1.00 0.00 ? 29 GLN A CB   1  
ATOM   162   C CG   . GLN A 1 12 ? 16.478 12.769 -8.234  1.00 0.00 ? 29 GLN A CG   1  
ATOM   163   C CD   . GLN A 1 12 ? 17.181 12.662 -6.894  1.00 0.00 ? 29 GLN A CD   1  
ATOM   164   O OE1  . GLN A 1 12 ? 16.575 12.873 -5.839  1.00 0.00 ? 29 GLN A OE1  1  
ATOM   165   N NE2  . GLN A 1 12 ? 18.469 12.339 -6.928  1.00 0.00 ? 29 GLN A NE2  1  
ATOM   166   H H    . GLN A 1 12 ? 15.400 15.198 -9.739  1.00 0.00 ? 29 GLN A H    1  
ATOM   167   H HA   . GLN A 1 12 ? 14.304 12.452 -9.980  1.00 0.00 ? 29 GLN A HA   1  
ATOM   168   H HB2  . GLN A 1 12 ? 14.967 14.141 -7.559  1.00 0.00 ? 29 GLN A HB2  1  
ATOM   169   H HB3  . GLN A 1 12 ? 14.471 12.432 -7.542  1.00 0.00 ? 29 GLN A HB3  1  
ATOM   170   H HG2  . GLN A 1 12 ? 16.788 11.920 -8.842  1.00 0.00 ? 29 GLN A HG2  1  
ATOM   171   H HG3  . GLN A 1 12 ? 16.791 13.694 -8.716  1.00 0.00 ? 29 GLN A HG3  1  
ATOM   172   H HE21 . GLN A 1 12 ? 18.922 12.178 -7.804  1.00 0.00 ? 29 GLN A HE21 1  
ATOM   173   H HE22 . GLN A 1 12 ? 18.986 12.254 -6.074  1.00 0.00 ? 29 GLN A HE22 1  
ATOM   174   N N    . LEU A 1 13 ? 12.508 15.015 -9.267  1.00 0.00 ? 30 LEU A N    1  
ATOM   175   C CA   . LEU A 1 13 ? 11.121 15.459 -9.187  1.00 0.00 ? 30 LEU A CA   1  
ATOM   176   C C    . LEU A 1 13 ? 10.289 14.873 -10.321 1.00 0.00 ? 30 LEU A C    1  
ATOM   177   O O    . LEU A 1 13 ? 10.569 15.110 -11.496 1.00 0.00 ? 30 LEU A O    1  
ATOM   178   C CB   . LEU A 1 13 ? 11.053 16.992 -9.213  1.00 0.00 ? 30 LEU A CB   1  
ATOM   179   C CG   . LEU A 1 13 ? 9.667  17.588 -8.934  1.00 0.00 ? 30 LEU A CG   1  
ATOM   180   C CD1  . LEU A 1 13 ? 9.274  17.339 -7.484  1.00 0.00 ? 30 LEU A CD1  1  
ATOM   181   C CD2  . LEU A 1 13 ? 9.684  19.078 -9.239  1.00 0.00 ? 30 LEU A CD2  1  
ATOM   182   H H    . LEU A 1 13 ? 13.237 15.701 -9.400  1.00 0.00 ? 30 LEU A H    1  
ATOM   183   H HA   . LEU A 1 13 ? 10.675 15.101 -8.260  1.00 0.00 ? 30 LEU A HA   1  
ATOM   184   H HB2  . LEU A 1 13 ? 11.728 17.212 -8.387  1.00 0.00 ? 30 LEU A HB2  1  
ATOM   185   H HB3  . LEU A 1 13 ? 11.463 17.398 -10.136 1.00 0.00 ? 30 LEU A HB3  1  
ATOM   186   H HG   . LEU A 1 13 ? 8.966  17.114 -9.621  1.00 0.00 ? 30 LEU A HG   1  
ATOM   187   H HD11 . LEU A 1 13 ? 8.289  17.766 -7.295  1.00 0.00 ? 30 LEU A HD11 1  
ATOM   188   H HD12 . LEU A 1 13 ? 9.246  16.266 -7.293  1.00 0.00 ? 30 LEU A HD12 1  
ATOM   189   H HD13 . LEU A 1 13 ? 10.004 17.807 -6.824  1.00 0.00 ? 30 LEU A HD13 1  
ATOM   190   H HD21 . LEU A 1 13 ? 9.940  19.232 -10.287 1.00 0.00 ? 30 LEU A HD21 1  
ATOM   191   H HD22 . LEU A 1 13 ? 8.699  19.501 -9.042  1.00 0.00 ? 30 LEU A HD22 1  
ATOM   192   H HD23 . LEU A 1 13 ? 10.424 19.572 -8.609  1.00 0.00 ? 30 LEU A HD23 1  
ATOM   193   N N    . PRO A 1 14 ? 9.265  14.108 -9.961  1.00 0.00 ? 31 PRO A N    1  
ATOM   194   C CA   . PRO A 1 14 ? 8.355  13.533 -10.946 1.00 0.00 ? 31 PRO A CA   1  
ATOM   195   C C    . PRO A 1 14 ? 7.673  14.620 -11.767 1.00 0.00 ? 31 PRO A C    1  
ATOM   196   O O    . PRO A 1 14 ? 7.738  15.802 -11.426 1.00 0.00 ? 31 PRO A O    1  
ATOM   197   C CB   . PRO A 1 14 ? 7.354  12.731 -10.108 1.00 0.00 ? 31 PRO A CB   1  
ATOM   198   C CG   . PRO A 1 14 ? 8.063  12.483 -8.820  1.00 0.00 ? 31 PRO A CG   1  
ATOM   199   C CD   . PRO A 1 14 ? 8.910  13.706 -8.589  1.00 0.00 ? 31 PRO A CD   1  
ATOM   200   H HA   . PRO A 1 14 ? 8.871  12.902 -11.684 1.00 0.00 ? 31 PRO A HA   1  
ATOM   201   H HB2  . PRO A 1 14 ? 6.422  13.292 -9.948  1.00 0.00 ? 31 PRO A HB2  1  
ATOM   202   H HB3  . PRO A 1 14 ? 7.082  11.786 -10.600 1.00 0.00 ? 31 PRO A HB3  1  
ATOM   203   H HG2  . PRO A 1 14 ? 7.350  12.335 -7.996  1.00 0.00 ? 31 PRO A HG2  1  
ATOM   204   H HG3  . PRO A 1 14 ? 8.684  11.577 -8.876  1.00 0.00 ? 31 PRO A HG3  1  
ATOM   205   H HD2  . PRO A 1 14 ? 8.359  14.501 -8.065  1.00 0.00 ? 31 PRO A HD2  1  
ATOM   206   H HD3  . PRO A 1 14 ? 9.804  13.486 -7.987  1.00 0.00 ? 31 PRO A HD3  1  
ATOM   207   N N    . HIS A 1 15 ? 7.021  14.214 -12.851 1.00 0.00 ? 32 HIS A N    1  
ATOM   208   C CA   . HIS A 1 15 ? 6.300  15.150 -13.705 1.00 0.00 ? 32 HIS A CA   1  
ATOM   209   C C    . HIS A 1 15 ? 4.793  14.954 -13.587 1.00 0.00 ? 32 HIS A C    1  
ATOM   210   O O    . HIS A 1 15 ? 4.014  15.653 -14.234 1.00 0.00 ? 32 HIS A O    1  
ATOM   211   C CB   . HIS A 1 15 ? 6.735  14.994 -15.166 1.00 0.00 ? 32 HIS A CB   1  
ATOM   212   C CG   . HIS A 1 15 ? 8.127  15.473 -15.433 1.00 0.00 ? 32 HIS A CG   1  
ATOM   213   N ND1  . HIS A 1 15 ? 8.736  15.339 -16.664 1.00 0.00 ? 32 HIS A ND1  1  
ATOM   214   C CD2  . HIS A 1 15 ? 9.028  16.086 -14.631 1.00 0.00 ? 32 HIS A CD2  1  
ATOM   215   C CE1  . HIS A 1 15 ? 9.954  15.849 -16.606 1.00 0.00 ? 32 HIS A CE1  1  
ATOM   216   N NE2  . HIS A 1 15 ? 10.155 16.308 -15.383 1.00 0.00 ? 32 HIS A NE2  1  
ATOM   217   H H    . HIS A 1 15 ? 7.025  13.233 -13.089 1.00 0.00 ? 32 HIS A H    1  
ATOM   218   H HA   . HIS A 1 15 ? 6.506  16.170 -13.386 1.00 0.00 ? 32 HIS A HA   1  
ATOM   219   H HB2  . HIS A 1 15 ? 6.705  13.943 -15.457 1.00 0.00 ? 32 HIS A HB2  1  
ATOM   220   H HB3  . HIS A 1 15 ? 6.076  15.569 -15.817 1.00 0.00 ? 32 HIS A HB3  1  
ATOM   221   H HD1  . HIS A 1 15 ? 8.311  14.993 -17.500 1.00 0.00 ? 32 HIS A HD1  1  
ATOM   222   H HD2  . HIS A 1 15 ? 9.000  16.395 -13.586 1.00 0.00 ? 32 HIS A HD2  1  
ATOM   223   H HE1  . HIS A 1 15 ? 10.602 15.841 -17.482 1.00 0.00 ? 32 HIS A HE1  1  
ATOM   224   N N    . ASP A 1 16 ? 4.389  14.000 -12.755 1.00 0.00 ? 33 ASP A N    1  
ATOM   225   C CA   . ASP A 1 16 ? 2.979  13.664 -12.602 1.00 0.00 ? 33 ASP A CA   1  
ATOM   226   C C    . ASP A 1 16 ? 2.597  13.545 -11.132 1.00 0.00 ? 33 ASP A C    1  
ATOM   227   O O    . ASP A 1 16 ? 1.533  13.024 -10.797 1.00 0.00 ? 33 ASP A O    1  
ATOM   228   C CB   . ASP A 1 16 ? 2.655  12.360 -13.336 1.00 0.00 ? 33 ASP A CB   1  
ATOM   229   C CG   . ASP A 1 16 ? 3.383  11.136 -12.795 1.00 0.00 ? 33 ASP A CG   1  
ATOM   230   O OD1  . ASP A 1 16 ? 4.106  11.274 -11.837 1.00 0.00 ? 33 ASP A OD1  1  
ATOM   231   O OD2  . ASP A 1 16 ? 3.092  10.052 -13.242 1.00 0.00 ? 33 ASP A OD2  1  
ATOM   232   H H    . ASP A 1 16 ? 5.077  13.494 -12.216 1.00 0.00 ? 33 ASP A H    1  
ATOM   233   H HA   . ASP A 1 16 ? 2.362  14.460 -13.020 1.00 0.00 ? 33 ASP A HA   1  
ATOM   234   H HB2  . ASP A 1 16 ? 1.587  12.149 -13.396 1.00 0.00 ? 33 ASP A HB2  1  
ATOM   235   H HB3  . ASP A 1 16 ? 3.036  12.600 -14.329 1.00 0.00 ? 33 ASP A HB3  1  
ATOM   236   N N    . TYR A 1 17 ? 3.472  14.031 -10.258 1.00 0.00 ? 34 TYR A N    1  
ATOM   237   C CA   . TYR A 1 17 ? 3.227  13.982 -8.822  1.00 0.00 ? 34 TYR A CA   1  
ATOM   238   C C    . TYR A 1 17 ? 2.080  14.903 -8.426  1.00 0.00 ? 34 TYR A C    1  
ATOM   239   O O    . TYR A 1 17 ? 1.727  15.822 -9.164  1.00 0.00 ? 34 TYR A O    1  
ATOM   240   C CB   . TYR A 1 17 ? 4.493  14.361 -8.050  1.00 0.00 ? 34 TYR A CB   1  
ATOM   241   C CG   . TYR A 1 17 ? 4.845  15.830 -8.132  1.00 0.00 ? 34 TYR A CG   1  
ATOM   242   C CD1  . TYR A 1 17 ? 4.209  16.761 -7.325  1.00 0.00 ? 34 TYR A CD1  1  
ATOM   243   C CD2  . TYR A 1 17 ? 5.814  16.281 -9.017  1.00 0.00 ? 34 TYR A CD2  1  
ATOM   244   C CE1  . TYR A 1 17 ? 4.525  18.105 -7.396  1.00 0.00 ? 34 TYR A CE1  1  
ATOM   245   C CE2  . TYR A 1 17 ? 6.139  17.621 -9.097  1.00 0.00 ? 34 TYR A CE2  1  
ATOM   246   C CZ   . TYR A 1 17 ? 5.493  18.530 -8.285  1.00 0.00 ? 34 TYR A CZ   1  
ATOM   247   O OH   . TYR A 1 17 ? 5.814  19.866 -8.359  1.00 0.00 ? 34 TYR A OH   1  
ATOM   248   H H    . TYR A 1 17 ? 4.328  14.445 -10.597 1.00 0.00 ? 34 TYR A H    1  
ATOM   249   H HA   . TYR A 1 17 ? 2.932  12.974 -8.531  1.00 0.00 ? 34 TYR A HA   1  
ATOM   250   H HB2  . TYR A 1 17 ? 4.331  14.084 -7.007  1.00 0.00 ? 34 TYR A HB2  1  
ATOM   251   H HB3  . TYR A 1 17 ? 5.310  13.769 -8.460  1.00 0.00 ? 34 TYR A HB3  1  
ATOM   252   H HD1  . TYR A 1 17 ? 3.446  16.418 -6.626  1.00 0.00 ? 34 TYR A HD1  1  
ATOM   253   H HD2  . TYR A 1 17 ? 6.320  15.557 -9.655  1.00 0.00 ? 34 TYR A HD2  1  
ATOM   254   H HE1  . TYR A 1 17 ? 4.017  18.826 -6.756  1.00 0.00 ? 34 TYR A HE1  1  
ATOM   255   H HE2  . TYR A 1 17 ? 6.903  17.956 -9.799  1.00 0.00 ? 34 TYR A HE2  1  
ATOM   256   H HH   . TYR A 1 17 ? 5.305  20.409 -7.752  1.00 0.00 ? 34 TYR A HH   1  
ATOM   257   N N    . CYS A 1 18 ? 1.499  14.649 -7.258  1.00 0.00 ? 35 CYS A N    1  
ATOM   258   C CA   . CYS A 1 18 ? 0.535  15.567 -6.666  1.00 0.00 ? 35 CYS A CA   1  
ATOM   259   C C    . CYS A 1 18 ? 0.999  16.043 -5.295  1.00 0.00 ? 35 CYS A C    1  
ATOM   260   O O    . CYS A 1 18 ? 1.885  15.445 -4.687  1.00 0.00 ? 35 CYS A O    1  
ATOM   261   C CB   . CYS A 1 18 ? -0.721 14.705 -6.540  1.00 0.00 ? 35 CYS A CB   1  
ATOM   262   S SG   . CYS A 1 18 ? -1.344 14.056 -8.109  1.00 0.00 ? 35 CYS A SG   1  
ATOM   263   H H    . CYS A 1 18 ? 1.733  13.796 -6.769  1.00 0.00 ? 35 CYS A H    1  
ATOM   264   H HA   . CYS A 1 18 ? 0.307  16.424 -7.300  1.00 0.00 ? 35 CYS A HA   1  
ATOM   265   H HB2  . CYS A 1 18 ? -0.520 13.836 -5.912  1.00 0.00 ? 35 CYS A HB2  1  
ATOM   266   H HB3  . CYS A 1 18 ? -1.535 15.286 -6.108  1.00 0.00 ? 35 CYS A HB3  1  
ATOM   267   H HG   . CYS A 1 18 ? -2.378 13.403 -7.588  1.00 0.00 ? 35 CYS A HG   1  
ATOM   268   N N    . THR A 1 19 ? 0.393  17.124 -4.814  1.00 0.00 ? 36 THR A N    1  
ATOM   269   C CA   . THR A 1 19 ? 0.786  17.720 -3.542  1.00 0.00 ? 36 THR A CA   1  
ATOM   270   C C    . THR A 1 19 ? -0.433 18.067 -2.698  1.00 0.00 ? 36 THR A C    1  
ATOM   271   O O    . THR A 1 19 ? -1.401 18.644 -3.194  1.00 0.00 ? 36 THR A O    1  
ATOM   272   C CB   . THR A 1 19 ? 1.633  18.988 -3.750  1.00 0.00 ? 36 THR A CB   1  
ATOM   273   O OG1  . THR A 1 19 ? 2.792  18.670 -4.531  1.00 0.00 ? 36 THR A OG1  1  
ATOM   274   C CG2  . THR A 1 19 ? 2.069  19.564 -2.411  1.00 0.00 ? 36 THR A CG2  1  
ATOM   275   H H    . THR A 1 19 ? -0.358 17.544 -5.343  1.00 0.00 ? 36 THR A H    1  
ATOM   276   H HA   . THR A 1 19 ? 1.367  17.003 -2.963  1.00 0.00 ? 36 THR A HA   1  
ATOM   277   H HB   . THR A 1 19 ? 1.036  19.728 -4.285  1.00 0.00 ? 36 THR A HB   1  
ATOM   278   H HG1  . THR A 1 19 ? 3.317  19.464 -4.659  1.00 0.00 ? 36 THR A HG1  1  
ATOM   279   H HG21 . THR A 1 19 ? 2.666  18.825 -1.876  1.00 0.00 ? 36 THR A HG21 1  
ATOM   280   H HG22 . THR A 1 19 ? 2.666  20.460 -2.579  1.00 0.00 ? 36 THR A HG22 1  
ATOM   281   H HG23 . THR A 1 19 ? 1.189  19.817 -1.820  1.00 0.00 ? 36 THR A HG23 1  
HETATM 282   N N    . TPO A 1 20 ? -0.381 17.712 -1.418  1.00 0.00 ? 37 TPO A N    1  
HETATM 283   C CA   . TPO A 1 20 ? -1.467 18.015 -0.494  1.00 0.00 ? 37 TPO A CA   1  
HETATM 284   C CB   . TPO A 1 20 ? -1.524 17.001 0.663   1.00 0.00 ? 37 TPO A CB   1  
HETATM 285   C CG2  . TPO A 1 20 ? -1.498 15.578 0.127   1.00 0.00 ? 37 TPO A CG2  1  
HETATM 286   O OG1  . TPO A 1 20 ? -0.402 17.201 1.533   1.00 0.00 ? 37 TPO A OG1  1  
HETATM 287   P P    . TPO A 1 20 ? -0.450 16.693 3.063   1.00 0.00 ? 37 TPO A P    1  
HETATM 288   O O1P  . TPO A 1 20 ? 0.909  17.063 3.714   1.00 0.00 ? 37 TPO A O1P  1  
HETATM 289   O O2P  . TPO A 1 20 ? -0.668 15.157 3.033   1.00 0.00 ? 37 TPO A O2P  1  
HETATM 290   O O3P  . TPO A 1 20 ? -1.631 17.422 3.755   1.00 0.00 ? 37 TPO A O3P  1  
HETATM 291   C C    . TPO A 1 20 ? -1.325 19.419 0.081   1.00 0.00 ? 37 TPO A C    1  
HETATM 292   O O    . TPO A 1 20 ? -0.260 20.031 -0.005  1.00 0.00 ? 37 TPO A O    1  
HETATM 293   H H    . TPO A 1 20 ? 0.433  17.220 -1.077  1.00 0.00 ? 37 TPO A H    1  
HETATM 294   H HA   . TPO A 1 20 ? -2.419 17.994 -1.024  1.00 0.00 ? 37 TPO A HA   1  
HETATM 295   H HB   . TPO A 1 20 ? -2.442 17.160 1.228   1.00 0.00 ? 37 TPO A HB   1  
HETATM 296   H HG21 . TPO A 1 20 ? -1.539 14.876 0.960   1.00 0.00 ? 37 TPO A HG21 1  
HETATM 297   H HG22 . TPO A 1 20 ? -2.356 15.420 -0.525  1.00 0.00 ? 37 TPO A HG22 1  
HETATM 298   H HG23 . TPO A 1 20 ? -0.579 15.420 -0.436  1.00 0.00 ? 37 TPO A HG23 1  
ATOM   299   N N    . PRO A 1 21 ? -2.405 19.925 0.668   1.00 0.00 ? 38 PRO A N    1  
ATOM   300   C CA   . PRO A 1 21 ? -2.415 21.271 1.226   1.00 0.00 ? 38 PRO A CA   1  
ATOM   301   C C    . PRO A 1 21 ? -1.284 21.459 2.231   1.00 0.00 ? 38 PRO A C    1  
ATOM   302   O O    . PRO A 1 21 ? -0.760 22.561 2.391   1.00 0.00 ? 38 PRO A O    1  
ATOM   303   C CB   . PRO A 1 21 ? -3.794 21.396 1.880   1.00 0.00 ? 38 PRO A CB   1  
ATOM   304   C CG   . PRO A 1 21 ? -4.659 20.463 1.103   1.00 0.00 ? 38 PRO A CG   1  
ATOM   305   C CD   . PRO A 1 21 ? -3.772 19.297 0.752   1.00 0.00 ? 38 PRO A CD   1  
ATOM   306   H HA   . PRO A 1 21 ? -2.249 22.048 0.466   1.00 0.00 ? 38 PRO A HA   1  
ATOM   307   H HB2  . PRO A 1 21 ? -3.762 21.119 2.943   1.00 0.00 ? 38 PRO A HB2  1  
ATOM   308   H HB3  . PRO A 1 21 ? -4.173 22.427 1.827   1.00 0.00 ? 38 PRO A HB3  1  
ATOM   309   H HG2  . PRO A 1 21 ? -5.525 20.136 1.697   1.00 0.00 ? 38 PRO A HG2  1  
ATOM   310   H HG3  . PRO A 1 21 ? -5.054 20.946 0.198   1.00 0.00 ? 38 PRO A HG3  1  
ATOM   311   H HD2  . PRO A 1 21 ? -3.802 18.507 1.517   1.00 0.00 ? 38 PRO A HD2  1  
ATOM   312   H HD3  . PRO A 1 21 ? -4.058 18.830 -0.202  1.00 0.00 ? 38 PRO A HD3  1  
ATOM   313   N N    . GLY A 1 22 ? -0.915 20.376 2.906   1.00 0.00 ? 39 GLY A N    1  
ATOM   314   C CA   . GLY A 1 22 ? 0.155  20.419 3.896   1.00 0.00 ? 39 GLY A CA   1  
ATOM   315   C C    . GLY A 1 22 ? 1.508  20.656 3.237   1.00 0.00 ? 39 GLY A C    1  
ATOM   316   O O    . GLY A 1 22 ? 2.427  21.188 3.859   1.00 0.00 ? 39 GLY A O    1  
ATOM   317   H H    . GLY A 1 22 ? -1.385 19.500 2.728   1.00 0.00 ? 39 GLY A H    1  
ATOM   318   H HA2  . GLY A 1 22 ? -0.043 21.228 4.600   1.00 0.00 ? 39 GLY A HA2  1  
ATOM   319   H HA3  . GLY A 1 22 ? 0.182  19.471 4.432   1.00 0.00 ? 39 GLY A HA3  1  
ATOM   320   N N    . GLY A 1 23 ? 1.623  20.258 1.975   1.00 0.00 ? 40 GLY A N    1  
ATOM   321   C CA   . GLY A 1 23 ? 2.835  20.500 1.203   1.00 0.00 ? 40 GLY A CA   1  
ATOM   322   C C    . GLY A 1 23 ? 3.669  19.231 1.073   1.00 0.00 ? 40 GLY A C    1  
ATOM   323   O O    . GLY A 1 23 ? 4.895  19.289 0.987   1.00 0.00 ? 40 GLY A O    1  
ATOM   324   H H    . GLY A 1 23 ? 0.850  19.775 1.538   1.00 0.00 ? 40 GLY A H    1  
ATOM   325   H HA2  . GLY A 1 23 ? 2.560  20.847 0.207   1.00 0.00 ? 40 GLY A HA2  1  
ATOM   326   H HA3  . GLY A 1 23 ? 3.429  21.266 1.701   1.00 0.00 ? 40 GLY A HA3  1  
ATOM   327   N N    . THR A 1 24 ? 2.995  18.087 1.061   1.00 0.00 ? 41 THR A N    1  
ATOM   328   C CA   . THR A 1 24 ? 3.667  16.804 0.887   1.00 0.00 ? 41 THR A CA   1  
ATOM   329   C C    . THR A 1 24 ? 3.375  16.211 -0.485  1.00 0.00 ? 41 THR A C    1  
ATOM   330   O O    . THR A 1 24 ? 2.221  16.131 -0.904  1.00 0.00 ? 41 THR A O    1  
ATOM   331   C CB   . THR A 1 24 ? 3.248  15.794 1.972   1.00 0.00 ? 41 THR A CB   1  
ATOM   332   O OG1  . THR A 1 24 ? 3.602  16.303 3.264   1.00 0.00 ? 41 THR A OG1  1  
ATOM   333   C CG2  . THR A 1 24 ? 3.938  14.457 1.751   1.00 0.00 ? 41 THR A CG2  1  
ATOM   334   H H    . THR A 1 24 ? 1.992  18.105 1.176   1.00 0.00 ? 41 THR A H    1  
ATOM   335   H HA   . THR A 1 24 ? 4.747  16.944 0.940   1.00 0.00 ? 41 THR A HA   1  
ATOM   336   H HB   . THR A 1 24 ? 2.167  15.656 1.929   1.00 0.00 ? 41 THR A HB   1  
ATOM   337   H HG1  . THR A 1 24 ? 2.828  16.691 3.678   1.00 0.00 ? 41 THR A HG1  1  
ATOM   338   H HG21 . THR A 1 24 ? 5.017  14.593 1.794   1.00 0.00 ? 41 THR A HG21 1  
ATOM   339   H HG22 . THR A 1 24 ? 3.629  13.756 2.527   1.00 0.00 ? 41 THR A HG22 1  
ATOM   340   H HG23 . THR A 1 24 ? 3.660  14.062 0.773   1.00 0.00 ? 41 THR A HG23 1  
ATOM   341   N N    . LEU A 1 25 ? 4.428  15.794 -1.180  1.00 0.00 ? 42 LEU A N    1  
ATOM   342   C CA   . LEU A 1 25 ? 4.288  15.229 -2.517  1.00 0.00 ? 42 LEU A CA   1  
ATOM   343   C C    . LEU A 1 25 ? 3.955  13.744 -2.453  1.00 0.00 ? 42 LEU A C    1  
ATOM   344   O O    . LEU A 1 25 ? 4.423  13.029 -1.568  1.00 0.00 ? 42 LEU A O    1  
ATOM   345   C CB   . LEU A 1 25 ? 5.573  15.453 -3.324  1.00 0.00 ? 42 LEU A CB   1  
ATOM   346   C CG   . LEU A 1 25 ? 5.678  16.818 -4.019  1.00 0.00 ? 42 LEU A CG   1  
ATOM   347   C CD1  . LEU A 1 25 ? 5.841  17.920 -2.982  1.00 0.00 ? 42 LEU A CD1  1  
ATOM   348   C CD2  . LEU A 1 25 ? 6.852  16.807 -4.986  1.00 0.00 ? 42 LEU A CD2  1  
ATOM   349   H H    . LEU A 1 25 ? 5.349  15.872 -0.772  1.00 0.00 ? 42 LEU A H    1  
ATOM   350   H HA   . LEU A 1 25 ? 3.459  15.711 -3.032  1.00 0.00 ? 42 LEU A HA   1  
ATOM   351   H HB2  . LEU A 1 25 ? 6.302  15.388 -2.518  1.00 0.00 ? 42 LEU A HB2  1  
ATOM   352   H HB3  . LEU A 1 25 ? 5.747  14.649 -4.037  1.00 0.00 ? 42 LEU A HB3  1  
ATOM   353   H HG   . LEU A 1 25 ? 4.766  16.954 -4.602  1.00 0.00 ? 42 LEU A HG   1  
ATOM   354   H HD11 . LEU A 1 25 ? 5.914  18.885 -3.485  1.00 0.00 ? 42 LEU A HD11 1  
ATOM   355   H HD12 . LEU A 1 25 ? 4.979  17.924 -2.315  1.00 0.00 ? 42 LEU A HD12 1  
ATOM   356   H HD13 . LEU A 1 25 ? 6.747  17.743 -2.403  1.00 0.00 ? 42 LEU A HD13 1  
ATOM   357   H HD21 . LEU A 1 25 ? 6.700  16.030 -5.735  1.00 0.00 ? 42 LEU A HD21 1  
ATOM   358   H HD22 . LEU A 1 25 ? 6.925  17.777 -5.480  1.00 0.00 ? 42 LEU A HD22 1  
ATOM   359   H HD23 . LEU A 1 25 ? 7.773  16.608 -4.438  1.00 0.00 ? 42 LEU A HD23 1  
ATOM   360   N N    . PHE A 1 26 ? 3.142  13.284 -3.399  1.00 0.00 ? 43 PHE A N    1  
ATOM   361   C CA   . PHE A 1 26 ? 2.782  11.874 -3.481  1.00 0.00 ? 43 PHE A CA   1  
ATOM   362   C C    . PHE A 1 26 ? 2.388  11.488 -4.901  1.00 0.00 ? 43 PHE A C    1  
ATOM   363   O O    . PHE A 1 26 ? 1.958  12.331 -5.687  1.00 0.00 ? 43 PHE A O    1  
ATOM   364   C CB   . PHE A 1 26 ? 1.639  11.558 -2.514  1.00 0.00 ? 43 PHE A CB   1  
ATOM   365   C CG   . PHE A 1 26 ? 0.333  12.198 -2.889  1.00 0.00 ? 43 PHE A CG   1  
ATOM   366   C CD1  . PHE A 1 26 ? 0.066  13.515 -2.548  1.00 0.00 ? 43 PHE A CD1  1  
ATOM   367   C CD2  . PHE A 1 26 ? -0.632 11.483 -3.584  1.00 0.00 ? 43 PHE A CD2  1  
ATOM   368   C CE1  . PHE A 1 26 ? -1.136 14.104 -2.891  1.00 0.00 ? 43 PHE A CE1  1  
ATOM   369   C CE2  . PHE A 1 26 ? -1.834 12.070 -3.929  1.00 0.00 ? 43 PHE A CE2  1  
ATOM   370   C CZ   . PHE A 1 26 ? -2.086 13.381 -3.583  1.00 0.00 ? 43 PHE A CZ   1  
ATOM   371   H H    . PHE A 1 26 ? 2.764  13.929 -4.079  1.00 0.00 ? 43 PHE A H    1  
ATOM   372   H HA   . PHE A 1 26 ? 3.642  11.256 -3.218  1.00 0.00 ? 43 PHE A HA   1  
ATOM   373   H HB2  . PHE A 1 26 ? 1.462  10.484 -2.481  1.00 0.00 ? 43 PHE A HB2  1  
ATOM   374   H HB3  . PHE A 1 26 ? 1.885  11.915 -1.514  1.00 0.00 ? 43 PHE A HB3  1  
ATOM   375   H HD1  . PHE A 1 26 ? 0.817  14.087 -2.003  1.00 0.00 ? 43 PHE A HD1  1  
ATOM   376   H HD2  . PHE A 1 26 ? -0.433 10.445 -3.856  1.00 0.00 ? 43 PHE A HD2  1  
ATOM   377   H HE1  . PHE A 1 26 ? -1.333 15.141 -2.618  1.00 0.00 ? 43 PHE A HE1  1  
ATOM   378   H HE2  . PHE A 1 26 ? -2.583 11.497 -4.475  1.00 0.00 ? 43 PHE A HE2  1  
ATOM   379   H HZ   . PHE A 1 26 ? -3.033 13.845 -3.855  1.00 0.00 ? 43 PHE A HZ   1  
ATOM   380   N N    . SER A 1 27 ? 2.537  10.208 -5.223  1.00 0.00 ? 44 SER A N    1  
ATOM   381   C CA   . SER A 1 27 ? 2.060  9.677  -6.495  1.00 0.00 ? 44 SER A CA   1  
ATOM   382   C C    . SER A 1 27 ? 1.776  8.183  -6.396  1.00 0.00 ? 44 SER A C    1  
ATOM   383   O O    . SER A 1 27 ? 2.519  7.441  -5.754  1.00 0.00 ? 44 SER A O    1  
ATOM   384   C CB   . SER A 1 27 ? 3.074  9.949  -7.588  1.00 0.00 ? 44 SER A CB   1  
ATOM   385   O OG   . SER A 1 27 ? 2.631  9.504  -8.841  1.00 0.00 ? 44 SER A OG   1  
ATOM   386   H H    . SER A 1 27 ? 2.994  9.586  -4.570  1.00 0.00 ? 44 SER A H    1  
ATOM   387   H HA   . SER A 1 27 ? 1.182  10.197 -6.878  1.00 0.00 ? 44 SER A HA   1  
ATOM   388   H HB2  . SER A 1 27 ? 3.253  11.024 -7.637  1.00 0.00 ? 44 SER A HB2  1  
ATOM   389   H HB3  . SER A 1 27 ? 4.004  9.439  -7.338  1.00 0.00 ? 44 SER A HB3  1  
ATOM   390   H HG   . SER A 1 27 ? 3.121  9.955  -9.532  1.00 0.00 ? 44 SER A HG   1  
ATOM   391   N N    . THR A 1 28 ? 0.695  7.749  -7.035  1.00 0.00 ? 45 THR A N    1  
ATOM   392   C CA   . THR A 1 28 ? 0.310  6.343  -7.021  1.00 0.00 ? 45 THR A CA   1  
ATOM   393   C C    . THR A 1 28 ? 0.395  5.735  -8.414  1.00 0.00 ? 45 THR A C    1  
ATOM   394   O O    . THR A 1 28 ? -0.146 6.281  -9.375  1.00 0.00 ? 45 THR A O    1  
ATOM   395   C CB   . THR A 1 28 ? -1.118 6.153  -6.475  1.00 0.00 ? 45 THR A CB   1  
ATOM   396   O OG1  . THR A 1 28 ? -1.196 6.675  -5.142  1.00 0.00 ? 45 THR A OG1  1  
ATOM   397   C CG2  . THR A 1 28 ? -1.491 4.678  -6.461  1.00 0.00 ? 45 THR A CG2  1  
ATOM   398   H H    . THR A 1 28 ? 0.125  8.410  -7.544  1.00 0.00 ? 45 THR A H    1  
ATOM   399   H HA   . THR A 1 28 ? 1.001  5.778  -6.395  1.00 0.00 ? 45 THR A HA   1  
ATOM   400   H HB   . THR A 1 28 ? -1.815 6.697  -7.111  1.00 0.00 ? 45 THR A HB   1  
ATOM   401   H HG1  . THR A 1 28 ? -0.986 7.613  -5.154  1.00 0.00 ? 45 THR A HG1  1  
ATOM   402   H HG21 . THR A 1 28 ? -0.796 4.134  -5.824  1.00 0.00 ? 45 THR A HG21 1  
ATOM   403   H HG22 . THR A 1 28 ? -2.503 4.565  -6.073  1.00 0.00 ? 45 THR A HG22 1  
ATOM   404   H HG23 . THR A 1 28 ? -1.443 4.281  -7.475  1.00 0.00 ? 45 THR A HG23 1  
HETATM 405   N N    . TPO A 1 29 ? 1.079  4.600  -8.519  1.00 0.00 ? 46 TPO A N    1  
HETATM 406   C CA   . TPO A 1 29 ? 1.292  3.949  -9.806  1.00 0.00 ? 46 TPO A CA   1  
HETATM 407   C CB   . TPO A 1 29 ? 2.661  3.247  -9.864  1.00 0.00 ? 46 TPO A CB   1  
HETATM 408   C CG2  . TPO A 1 29 ? 3.761  4.183  -9.390  1.00 0.00 ? 46 TPO A CG2  1  
HETATM 409   O OG1  . TPO A 1 29 ? 2.639  2.081  -9.031  1.00 0.00 ? 46 TPO A OG1  1  
HETATM 410   P P    . TPO A 1 29 ? 3.656  0.858  -9.303  1.00 0.00 ? 46 TPO A P    1  
HETATM 411   O O1P  . TPO A 1 29 ? 3.368  -0.227 -8.233  1.00 0.00 ? 46 TPO A O1P  1  
HETATM 412   O O2P  . TPO A 1 29 ? 5.095  1.420  -9.174  1.00 0.00 ? 46 TPO A O2P  1  
HETATM 413   O O3P  . TPO A 1 29 ? 3.374  0.335  -10.735 1.00 0.00 ? 46 TPO A O3P  1  
HETATM 414   C C    . TPO A 1 29 ? 0.197  2.929  -10.095 1.00 0.00 ? 46 TPO A C    1  
HETATM 415   O O    . TPO A 1 29 ? -0.546 2.530  -9.198  1.00 0.00 ? 46 TPO A O    1  
HETATM 416   H H    . TPO A 1 29 ? 1.460  4.177  -7.684  1.00 0.00 ? 46 TPO A H    1  
HETATM 417   H HA   . TPO A 1 29 ? 1.243  4.688  -10.605 1.00 0.00 ? 46 TPO A HA   1  
HETATM 418   H HB   . TPO A 1 29 ? 2.860  2.944  -10.892 1.00 0.00 ? 46 TPO A HB   1  
HETATM 419   H HG21 . TPO A 1 29 ? 4.721  3.670  -9.439  1.00 0.00 ? 46 TPO A HG21 1  
HETATM 420   H HG22 . TPO A 1 29 ? 3.787  5.066  -10.029 1.00 0.00 ? 46 TPO A HG22 1  
HETATM 421   H HG23 . TPO A 1 29 ? 3.563  4.486  -8.362  1.00 0.00 ? 46 TPO A HG23 1  
ATOM   422   N N    . PRO A 1 30 ? 0.102  2.512  -11.353 1.00 0.00 ? 47 PRO A N    1  
ATOM   423   C CA   . PRO A 1 30 ? -0.957 1.608  -11.782 1.00 0.00 ? 47 PRO A CA   1  
ATOM   424   C C    . PRO A 1 30 ? -0.945 0.319  -10.969 1.00 0.00 ? 47 PRO A C    1  
ATOM   425   O O    . PRO A 1 30 ? -1.983 -0.317 -10.780 1.00 0.00 ? 47 PRO A O    1  
ATOM   426   C CB   . PRO A 1 30 ? -0.658 1.357  -13.264 1.00 0.00 ? 47 PRO A CB   1  
ATOM   427   C CG   . PRO A 1 30 ? 0.067  2.581  -13.708 1.00 0.00 ? 47 PRO A CG   1  
ATOM   428   C CD   . PRO A 1 30 ? 0.905  2.998  -12.530 1.00 0.00 ? 47 PRO A CD   1  
ATOM   429   H HA   . PRO A 1 30 ? -1.963 2.028  -11.632 1.00 0.00 ? 47 PRO A HA   1  
ATOM   430   H HB2  . PRO A 1 30 ? -0.043 0.456  -13.404 1.00 0.00 ? 47 PRO A HB2  1  
ATOM   431   H HB3  . PRO A 1 30 ? -1.583 1.210  -13.842 1.00 0.00 ? 47 PRO A HB3  1  
ATOM   432   H HG2  . PRO A 1 30 ? 0.695  2.374  -14.588 1.00 0.00 ? 47 PRO A HG2  1  
ATOM   433   H HG3  . PRO A 1 30 ? -0.636 3.377  -13.995 1.00 0.00 ? 47 PRO A HG3  1  
ATOM   434   H HD2  . PRO A 1 30 ? 1.904  2.538  -12.546 1.00 0.00 ? 47 PRO A HD2  1  
ATOM   435   H HD3  . PRO A 1 30 ? 1.054  4.088  -12.490 1.00 0.00 ? 47 PRO A HD3  1  
ATOM   436   N N    . GLY A 1 31 ? 0.234  -0.061 -10.491 1.00 0.00 ? 48 GLY A N    1  
ATOM   437   C CA   . GLY A 1 31 ? 0.386  -1.282 -9.707  1.00 0.00 ? 48 GLY A CA   1  
ATOM   438   C C    . GLY A 1 31 ? -0.368 -1.185 -8.387  1.00 0.00 ? 48 GLY A C    1  
ATOM   439   O O    . GLY A 1 31 ? -0.751 -2.200 -7.804  1.00 0.00 ? 48 GLY A O    1  
ATOM   440   H H    . GLY A 1 31 ? 1.047  0.510  -10.675 1.00 0.00 ? 48 GLY A H    1  
ATOM   441   H HA2  . GLY A 1 31 ? -0.006 -2.123 -10.279 1.00 0.00 ? 48 GLY A HA2  1  
ATOM   442   H HA3  . GLY A 1 31 ? 1.443  -1.443 -9.501  1.00 0.00 ? 48 GLY A HA3  1  
ATOM   443   N N    . GLY A 1 32 ? -0.579 0.041  -7.919  1.00 0.00 ? 49 GLY A N    1  
ATOM   444   C CA   . GLY A 1 32 ? -1.340 0.275  -6.698  1.00 0.00 ? 49 GLY A CA   1  
ATOM   445   C C    . GLY A 1 32 ? -0.444 0.801  -5.583  1.00 0.00 ? 49 GLY A C    1  
ATOM   446   O O    . GLY A 1 32 ? -0.927 1.204  -4.525  1.00 0.00 ? 49 GLY A O    1  
ATOM   447   H H    . GLY A 1 32 ? -0.202 0.831  -8.423  1.00 0.00 ? 49 GLY A H    1  
ATOM   448   H HA2  . GLY A 1 32 ? -2.122 1.006  -6.900  1.00 0.00 ? 49 GLY A HA2  1  
ATOM   449   H HA3  . GLY A 1 32 ? -1.794 -0.662 -6.376  1.00 0.00 ? 49 GLY A HA3  1  
ATOM   450   N N    . THR A 1 33 ? 0.861  0.797  -5.829  1.00 0.00 ? 50 THR A N    1  
ATOM   451   C CA   . THR A 1 33 ? 1.826  1.280  -4.849  1.00 0.00 ? 50 THR A CA   1  
ATOM   452   C C    . THR A 1 33 ? 1.701  2.785  -4.647  1.00 0.00 ? 50 THR A C    1  
ATOM   453   O O    . THR A 1 33 ? 1.680  3.550  -5.610  1.00 0.00 ? 50 THR A O    1  
ATOM   454   C CB   . THR A 1 33 ? 3.272  0.949  -5.267  1.00 0.00 ? 50 THR A CB   1  
ATOM   455   O OG1  . THR A 1 33 ? 3.418  -0.471 -5.402  1.00 0.00 ? 50 THR A OG1  1  
ATOM   456   C CG2  . THR A 1 33 ? 4.258  1.459  -4.228  1.00 0.00 ? 50 THR A CG2  1  
ATOM   457   H H    . THR A 1 33 ? 1.194  0.450  -6.717  1.00 0.00 ? 50 THR A H    1  
ATOM   458   H HA   . THR A 1 33 ? 1.629  0.821  -3.880  1.00 0.00 ? 50 THR A HA   1  
ATOM   459   H HB   . THR A 1 33 ? 3.479  1.420  -6.227  1.00 0.00 ? 50 THR A HB   1  
ATOM   460   H HG1  . THR A 1 33 ? 3.435  -0.703 -6.334  1.00 0.00 ? 50 THR A HG1  1  
ATOM   461   H HG21 . THR A 1 33 ? 4.051  0.988  -3.268  1.00 0.00 ? 50 THR A HG21 1  
ATOM   462   H HG22 . THR A 1 33 ? 5.273  1.216  -4.542  1.00 0.00 ? 50 THR A HG22 1  
ATOM   463   H HG23 . THR A 1 33 ? 4.156  2.540  -4.131  1.00 0.00 ? 50 THR A HG23 1  
ATOM   464   N N    . ARG A 1 34 ? 1.615  3.202  -3.388  1.00 0.00 ? 51 ARG A N    1  
ATOM   465   C CA   . ARG A 1 34 ? 1.521  4.618  -3.056  1.00 0.00 ? 51 ARG A CA   1  
ATOM   466   C C    . ARG A 1 34 ? 2.872  5.174  -2.623  1.00 0.00 ? 51 ARG A C    1  
ATOM   467   O O    . ARG A 1 34 ? 3.399  4.804  -1.574  1.00 0.00 ? 51 ARG A O    1  
ATOM   468   C CB   . ARG A 1 34 ? 0.446  4.894  -2.015  1.00 0.00 ? 51 ARG A CB   1  
ATOM   469   C CG   . ARG A 1 34 ? -0.966 4.527  -2.442  1.00 0.00 ? 51 ARG A CG   1  
ATOM   470   C CD   . ARG A 1 34 ? -1.989 4.690  -1.377  1.00 0.00 ? 51 ARG A CD   1  
ATOM   471   N NE   . ARG A 1 34 ? -3.332 4.292  -1.766  1.00 0.00 ? 51 ARG A NE   1  
ATOM   472   C CZ   . ARG A 1 34 ? -4.419 4.390  -0.976  1.00 0.00 ? 51 ARG A CZ   1  
ATOM   473   N NH1  . ARG A 1 34 ? -4.322 4.836  0.257   1.00 0.00 ? 51 ARG A NH1  1  
ATOM   474   N NH2  . ARG A 1 34 ? -5.584 4.003  -1.465  1.00 0.00 ? 51 ARG A NH2  1  
ATOM   475   H H    . ARG A 1 34 ? 1.617  2.521  -2.642  1.00 0.00 ? 51 ARG A H    1  
ATOM   476   H HA   . ARG A 1 34 ? 1.220  5.185  -3.937  1.00 0.00 ? 51 ARG A HA   1  
ATOM   477   H HB2  . ARG A 1 34 ? 0.712  4.324  -1.125  1.00 0.00 ? 51 ARG A HB2  1  
ATOM   478   H HB3  . ARG A 1 34 ? 0.487  5.959  -1.789  1.00 0.00 ? 51 ARG A HB3  1  
ATOM   479   H HG2  . ARG A 1 34 ? -1.252 5.164  -3.280  1.00 0.00 ? 51 ARG A HG2  1  
ATOM   480   H HG3  . ARG A 1 34 ? -0.973 3.484  -2.759  1.00 0.00 ? 51 ARG A HG3  1  
ATOM   481   H HD2  . ARG A 1 34 ? -1.706 4.082  -0.519  1.00 0.00 ? 51 ARG A HD2  1  
ATOM   482   H HD3  . ARG A 1 34 ? -2.031 5.738  -1.083  1.00 0.00 ? 51 ARG A HD3  1  
ATOM   483   H HE   . ARG A 1 34 ? -3.661 3.899  -2.638  1.00 0.00 ? 51 ARG A HE   1  
ATOM   484   H HH11 . ARG A 1 34 ? -3.420 5.111  0.622   1.00 0.00 ? 51 ARG A HH11 1  
ATOM   485   H HH12 . ARG A 1 34 ? -5.148 4.902  0.834   1.00 0.00 ? 51 ARG A HH12 1  
ATOM   486   H HH21 . ARG A 1 34 ? -5.639 3.646  -2.409  1.00 0.00 ? 51 ARG A HH21 1  
ATOM   487   H HH22 . ARG A 1 34 ? -6.414 4.066  -0.894  1.00 0.00 ? 51 ARG A HH22 1  
ATOM   488   N N    . ILE A 1 35 ? 3.427  6.065  -3.437  1.00 0.00 ? 52 ILE A N    1  
ATOM   489   C CA   . ILE A 1 35 ? 4.751  6.620  -3.176  1.00 0.00 ? 52 ILE A CA   1  
ATOM   490   C C    . ILE A 1 35 ? 4.655  7.993  -2.525  1.00 0.00 ? 52 ILE A C    1  
ATOM   491   O O    . ILE A 1 35 ? 4.101  8.928  -3.104  1.00 0.00 ? 52 ILE A O    1  
ATOM   492   C CB   . ILE A 1 35 ? 5.580  6.732  -4.469  1.00 0.00 ? 52 ILE A CB   1  
ATOM   493   C CG1  . ILE A 1 35 ? 5.737  5.357  -5.124  1.00 0.00 ? 52 ILE A CG1  1  
ATOM   494   C CG2  . ILE A 1 35 ? 6.942  7.343  -4.175  1.00 0.00 ? 52 ILE A CG2  1  
ATOM   495   C CD1  . ILE A 1 35 ? 6.339  5.406  -6.510  1.00 0.00 ? 52 ILE A CD1  1  
ATOM   496   H H    . ILE A 1 35 ? 2.921  6.366  -4.257  1.00 0.00 ? 52 ILE A H    1  
ATOM   497   H HA   . ILE A 1 35 ? 5.288  6.008  -2.453  1.00 0.00 ? 52 ILE A HA   1  
ATOM   498   H HB   . ILE A 1 35 ? 5.046  7.360  -5.180  1.00 0.00 ? 52 ILE A HB   1  
ATOM   499   H HG12 . ILE A 1 35 ? 6.372  4.758  -4.473  1.00 0.00 ? 52 ILE A HG12 1  
ATOM   500   H HG13 . ILE A 1 35 ? 4.744  4.908  -5.175  1.00 0.00 ? 52 ILE A HG13 1  
ATOM   501   H HG21 . ILE A 1 35 ? 7.515  7.415  -5.099  1.00 0.00 ? 52 ILE A HG21 1  
ATOM   502   H HG22 . ILE A 1 35 ? 6.810  8.339  -3.752  1.00 0.00 ? 52 ILE A HG22 1  
ATOM   503   H HG23 . ILE A 1 35 ? 7.477  6.714  -3.464  1.00 0.00 ? 52 ILE A HG23 1  
ATOM   504   H HD11 . ILE A 1 35 ? 7.331  5.854  -6.460  1.00 0.00 ? 52 ILE A HD11 1  
ATOM   505   H HD12 . ILE A 1 35 ? 6.418  4.395  -6.909  1.00 0.00 ? 52 ILE A HD12 1  
ATOM   506   H HD13 . ILE A 1 35 ? 5.703  6.005  -7.163  1.00 0.00 ? 52 ILE A HD13 1  
ATOM   507   N N    . ILE A 1 36 ? 5.194  8.108  -1.316  1.00 0.00 ? 53 ILE A N    1  
ATOM   508   C CA   . ILE A 1 36 ? 5.264  9.391  -0.627  1.00 0.00 ? 53 ILE A CA   1  
ATOM   509   C C    . ILE A 1 36 ? 6.640  10.026 -0.785  1.00 0.00 ? 53 ILE A C    1  
ATOM   510   O O    . ILE A 1 36 ? 7.660  9.401  -0.496  1.00 0.00 ? 53 ILE A O    1  
ATOM   511   C CB   . ILE A 1 36 ? 4.944  9.246  0.871   1.00 0.00 ? 53 ILE A CB   1  
ATOM   512   C CG1  . ILE A 1 36 ? 3.526  8.702  1.064   1.00 0.00 ? 53 ILE A CG1  1  
ATOM   513   C CG2  . ILE A 1 36 ? 5.107  10.581 1.582   1.00 0.00 ? 53 ILE A CG2  1  
ATOM   514   C CD1  . ILE A 1 36 ? 3.208  8.317  2.491   1.00 0.00 ? 53 ILE A CD1  1  
ATOM   515   H H    . ILE A 1 36 ? 5.566  7.285  -0.863  1.00 0.00 ? 53 ILE A H    1  
ATOM   516   H HA   . ILE A 1 36 ? 4.576  10.107 -1.077  1.00 0.00 ? 53 ILE A HA   1  
ATOM   517   H HB   . ILE A 1 36 ? 5.622  8.515  1.311   1.00 0.00 ? 53 ILE A HB   1  
ATOM   518   H HG12 . ILE A 1 36 ? 2.834  9.476  0.734   1.00 0.00 ? 53 ILE A HG12 1  
ATOM   519   H HG13 . ILE A 1 36 ? 3.423  7.828  0.421   1.00 0.00 ? 53 ILE A HG13 1  
ATOM   520   H HG21 . ILE A 1 36 ? 4.876  10.460 2.640   1.00 0.00 ? 53 ILE A HG21 1  
ATOM   521   H HG22 . ILE A 1 36 ? 6.133  10.929 1.472   1.00 0.00 ? 53 ILE A HG22 1  
ATOM   522   H HG23 . ILE A 1 36 ? 4.427  11.313 1.143   1.00 0.00 ? 53 ILE A HG23 1  
ATOM   523   H HD11 . ILE A 1 36 ? 3.308  9.190  3.136   1.00 0.00 ? 53 ILE A HD11 1  
ATOM   524   H HD12 . ILE A 1 36 ? 2.186  7.941  2.548   1.00 0.00 ? 53 ILE A HD12 1  
ATOM   525   H HD13 . ILE A 1 36 ? 3.899  7.541  2.822   1.00 0.00 ? 53 ILE A HD13 1  
ATOM   526   N N    . TYR A 1 37 ? 6.661  11.274 -1.242  1.00 0.00 ? 54 TYR A N    1  
ATOM   527   C CA   . TYR A 1 37 ? 7.908  11.935 -1.605  1.00 0.00 ? 54 TYR A CA   1  
ATOM   528   C C    . TYR A 1 37 ? 8.344  12.920 -0.528  1.00 0.00 ? 54 TYR A C    1  
ATOM   529   O O    . TYR A 1 37 ? 7.527  13.665 0.012   1.00 0.00 ? 54 TYR A O    1  
ATOM   530   C CB   . TYR A 1 37 ? 7.762  12.656 -2.947  1.00 0.00 ? 54 TYR A CB   1  
ATOM   531   C CG   . TYR A 1 37 ? 7.554  11.726 -4.123  1.00 0.00 ? 54 TYR A CG   1  
ATOM   532   C CD1  . TYR A 1 37 ? 8.623  11.057 -4.698  1.00 0.00 ? 54 TYR A CD1  1  
ATOM   533   C CD2  . TYR A 1 37 ? 6.289  11.523 -4.655  1.00 0.00 ? 54 TYR A CD2  1  
ATOM   534   C CE1  . TYR A 1 37 ? 8.441  10.207 -5.771  1.00 0.00 ? 54 TYR A CE1  1  
ATOM   535   C CE2  . TYR A 1 37 ? 6.094  10.675 -5.728  1.00 0.00 ? 54 TYR A CE2  1  
ATOM   536   C CZ   . TYR A 1 37 ? 7.173  10.019 -6.284  1.00 0.00 ? 54 TYR A CZ   1  
ATOM   537   O OH   . TYR A 1 37 ? 6.985  9.174  -7.354  1.00 0.00 ? 54 TYR A OH   1  
ATOM   538   H H    . TYR A 1 37 ? 5.791  11.777 -1.341  1.00 0.00 ? 54 TYR A H    1  
ATOM   539   H HA   . TYR A 1 37 ? 8.707  11.197 -1.693  1.00 0.00 ? 54 TYR A HA   1  
ATOM   540   H HB2  . TYR A 1 37 ? 6.906  13.329 -2.860  1.00 0.00 ? 54 TYR A HB2  1  
ATOM   541   H HB3  . TYR A 1 37 ? 8.669  13.238 -3.101  1.00 0.00 ? 54 TYR A HB3  1  
ATOM   542   H HD1  . TYR A 1 37 ? 9.622  11.210 -4.288  1.00 0.00 ? 54 TYR A HD1  1  
ATOM   543   H HD2  . TYR A 1 37 ? 5.441  12.044 -4.211  1.00 0.00 ? 54 TYR A HD2  1  
ATOM   544   H HE1  . TYR A 1 37 ? 9.294  9.689  -6.209  1.00 0.00 ? 54 TYR A HE1  1  
ATOM   545   H HE2  . TYR A 1 37 ? 5.095  10.524 -6.136  1.00 0.00 ? 54 TYR A HE2  1  
ATOM   546   H HH   . TYR A 1 37 ? 7.801  8.772  -7.663  1.00 0.00 ? 54 TYR A HH   1  
ATOM   547   N N    . ASP A 1 38 ? 9.636  12.919 -0.219  1.00 0.00 ? 55 ASP A N    1  
ATOM   548   C CA   . ASP A 1 38 ? 10.227 13.964 0.607   1.00 0.00 ? 55 ASP A CA   1  
ATOM   549   C C    . ASP A 1 38 ? 11.030 14.946 -0.236  1.00 0.00 ? 55 ASP A C    1  
ATOM   550   O O    . ASP A 1 38 ? 12.175 14.675 -0.600  1.00 0.00 ? 55 ASP A O    1  
ATOM   551   C CB   . ASP A 1 38 ? 11.118 13.350 1.691   1.00 0.00 ? 55 ASP A CB   1  
ATOM   552   C CG   . ASP A 1 38 ? 11.748 14.365 2.636   1.00 0.00 ? 55 ASP A CG   1  
ATOM   553   O OD1  . ASP A 1 38 ? 11.585 15.540 2.410   1.00 0.00 ? 55 ASP A OD1  1  
ATOM   554   O OD2  . ASP A 1 38 ? 12.251 13.962 3.658   1.00 0.00 ? 55 ASP A OD2  1  
ATOM   555   H H    . ASP A 1 38 ? 10.224 12.175 -0.567  1.00 0.00 ? 55 ASP A H    1  
ATOM   556   H HA   . ASP A 1 38 ? 9.440  14.543 1.091   1.00 0.00 ? 55 ASP A HA   1  
ATOM   557   H HB2  . ASP A 1 38 ? 10.622 12.573 2.273   1.00 0.00 ? 55 ASP A HB2  1  
ATOM   558   H HB3  . ASP A 1 38 ? 11.894 12.902 1.070   1.00 0.00 ? 55 ASP A HB3  1  
ATOM   559   N N    . ARG A 1 39 ? 10.425 16.087 -0.543  1.00 0.00 ? 56 ARG A N    1  
ATOM   560   C CA   . ARG A 1 39 ? 11.018 17.046 -1.468  1.00 0.00 ? 56 ARG A CA   1  
ATOM   561   C C    . ARG A 1 39 ? 12.084 17.889 -0.778  1.00 0.00 ? 56 ARG A C    1  
ATOM   562   O O    . ARG A 1 39 ? 11.789 18.950 -0.228  1.00 0.00 ? 56 ARG A O    1  
ATOM   563   C CB   . ARG A 1 39 ? 9.970  17.917 -2.143  1.00 0.00 ? 56 ARG A CB   1  
ATOM   564   C CG   . ARG A 1 39 ? 10.509 18.851 -3.215  1.00 0.00 ? 56 ARG A CG   1  
ATOM   565   C CD   . ARG A 1 39 ? 9.461  19.569 -3.985  1.00 0.00 ? 56 ARG A CD   1  
ATOM   566   N NE   . ARG A 1 39 ? 9.971  20.432 -5.037  1.00 0.00 ? 56 ARG A NE   1  
ATOM   567   C CZ   . ARG A 1 39 ? 9.207  21.046 -5.962  1.00 0.00 ? 56 ARG A CZ   1  
ATOM   568   N NH1  . ARG A 1 39 ? 7.905  20.864 -5.994  1.00 0.00 ? 56 ARG A NH1  1  
ATOM   569   N NH2  . ARG A 1 39 ? 9.804  21.817 -6.854  1.00 0.00 ? 56 ARG A NH2  1  
ATOM   570   H H    . ARG A 1 39 ? 9.529  16.298 -0.124  1.00 0.00 ? 56 ARG A H    1  
ATOM   571   H HA   . ARG A 1 39 ? 11.519 16.514 -2.278  1.00 0.00 ? 56 ARG A HA   1  
ATOM   572   H HB2  . ARG A 1 39 ? 9.236  17.245 -2.588  1.00 0.00 ? 56 ARG A HB2  1  
ATOM   573   H HB3  . ARG A 1 39 ? 9.494  18.506 -1.359  1.00 0.00 ? 56 ARG A HB3  1  
ATOM   574   H HG2  . ARG A 1 39 ? 11.144 19.598 -2.737  1.00 0.00 ? 56 ARG A HG2  1  
ATOM   575   H HG3  . ARG A 1 39 ? 11.102 18.266 -3.918  1.00 0.00 ? 56 ARG A HG3  1  
ATOM   576   H HD2  . ARG A 1 39 ? 8.804  18.837 -4.454  1.00 0.00 ? 56 ARG A HD2  1  
ATOM   577   H HD3  . ARG A 1 39 ? 8.883  20.191 -3.302  1.00 0.00 ? 56 ARG A HD3  1  
ATOM   578   H HE   . ARG A 1 39 ? 10.924 20.705 -5.242  1.00 0.00 ? 56 ARG A HE   1  
ATOM   579   H HH11 . ARG A 1 39 ? 7.466  20.257 -5.315  1.00 0.00 ? 56 ARG A HH11 1  
ATOM   580   H HH12 . ARG A 1 39 ? 7.351  21.333 -6.695  1.00 0.00 ? 56 ARG A HH12 1  
ATOM   581   H HH21 . ARG A 1 39 ? 10.809 21.932 -6.826  1.00 0.00 ? 56 ARG A HH21 1  
ATOM   582   H HH22 . ARG A 1 39 ? 9.256  22.287 -7.558  1.00 0.00 ? 56 ARG A HH22 1  
ATOM   583   N N    . LYS A 1 40 ? 13.323 17.411 -0.812  1.00 0.00 ? 57 LYS A N    1  
ATOM   584   C CA   . LYS A 1 40 ? 14.441 18.140 -0.226  1.00 0.00 ? 57 LYS A CA   1  
ATOM   585   C C    . LYS A 1 40 ? 14.986 19.184 -1.192  1.00 0.00 ? 57 LYS A C    1  
ATOM   586   O O    . LYS A 1 40 ? 15.634 20.146 -0.781  1.00 0.00 ? 57 LYS A O    1  
ATOM   587   C CB   . LYS A 1 40 ? 15.554 17.174 0.185   1.00 0.00 ? 57 LYS A CB   1  
ATOM   588   C CG   . LYS A 1 40 ? 15.154 16.176 1.263   1.00 0.00 ? 57 LYS A CG   1  
ATOM   589   C CD   . LYS A 1 40 ? 16.298 15.229 1.594   1.00 0.00 ? 57 LYS A CD   1  
ATOM   590   C CE   . LYS A 1 40 ? 15.900 14.232 2.672   1.00 0.00 ? 57 LYS A CE   1  
ATOM   591   N NZ   . LYS A 1 40 ? 17.021 13.323 3.032   1.00 0.00 ? 57 LYS A NZ   1  
ATOM   592   H H    . LYS A 1 40 ? 13.494 16.520 -1.256  1.00 0.00 ? 57 LYS A H    1  
ATOM   593   H HA   . LYS A 1 40 ? 14.106 18.681 0.660   1.00 0.00 ? 57 LYS A HA   1  
ATOM   594   H HB2  . LYS A 1 40 ? 15.857 16.635 -0.714  1.00 0.00 ? 57 LYS A HB2  1  
ATOM   595   H HB3  . LYS A 1 40 ? 16.387 17.778 0.542   1.00 0.00 ? 57 LYS A HB3  1  
ATOM   596   H HG2  . LYS A 1 40 ? 14.868 16.729 2.158   1.00 0.00 ? 57 LYS A HG2  1  
ATOM   597   H HG3  . LYS A 1 40 ? 14.299 15.601 0.904   1.00 0.00 ? 57 LYS A HG3  1  
ATOM   598   H HD2  . LYS A 1 40 ? 16.577 14.692 0.686   1.00 0.00 ? 57 LYS A HD2  1  
ATOM   599   H HD3  . LYS A 1 40 ? 17.147 15.819 1.941   1.00 0.00 ? 57 LYS A HD3  1  
ATOM   600   H HE2  . LYS A 1 40 ? 15.586 14.790 3.553   1.00 0.00 ? 57 LYS A HE2  1  
ATOM   601   H HE3  . LYS A 1 40 ? 15.061 13.643 2.298   1.00 0.00 ? 57 LYS A HE3  1  
ATOM   602   H HZ1  . LYS A 1 40 ? 17.798 13.869 3.379   1.00 0.00 ? 57 LYS A HZ1  1  
ATOM   603   H HZ2  . LYS A 1 40 ? 16.716 12.680 3.748   1.00 0.00 ? 57 LYS A HZ2  1  
ATOM   604   H HZ3  . LYS A 1 40 ? 17.312 12.806 2.215   1.00 0.00 ? 57 LYS A HZ3  1  
ATOM   605   N N    . PHE A 1 41 ? 14.718 18.989 -2.479  1.00 0.00 ? 58 PHE A N    1  
ATOM   606   C CA   . PHE A 1 41 ? 15.113 19.953 -3.499  1.00 0.00 ? 58 PHE A CA   1  
ATOM   607   C C    . PHE A 1 41 ? 14.594 21.346 -3.172  1.00 0.00 ? 58 PHE A C    1  
ATOM   608   O O    . PHE A 1 41 ? 15.362 22.304 -3.099  1.00 0.00 ? 58 PHE A O    1  
ATOM   609   C CB   . PHE A 1 41 ? 14.611 19.512 -4.875  1.00 0.00 ? 58 PHE A CB   1  
ATOM   610   C CG   . PHE A 1 41 ? 14.871 20.513 -5.965  1.00 0.00 ? 58 PHE A CG   1  
ATOM   611   C CD1  . PHE A 1 41 ? 16.158 20.728 -6.434  1.00 0.00 ? 58 PHE A CD1  1  
ATOM   612   C CD2  . PHE A 1 41 ? 13.831 21.240 -6.522  1.00 0.00 ? 58 PHE A CD2  1  
ATOM   613   C CE1  . PHE A 1 41 ? 16.399 21.649 -7.436  1.00 0.00 ? 58 PHE A CE1  1  
ATOM   614   C CE2  . PHE A 1 41 ? 14.068 22.160 -7.525  1.00 0.00 ? 58 PHE A CE2  1  
ATOM   615   C CZ   . PHE A 1 41 ? 15.354 22.364 -7.982  1.00 0.00 ? 58 PHE A CZ   1  
ATOM   616   H H    . PHE A 1 41 ? 14.227 18.151 -2.758  1.00 0.00 ? 58 PHE A H    1  
ATOM   617   H HA   . PHE A 1 41 ? 16.202 20.027 -3.534  1.00 0.00 ? 58 PHE A HA   1  
ATOM   618   H HB2  . PHE A 1 41 ? 15.101 18.588 -5.177  1.00 0.00 ? 58 PHE A HB2  1  
ATOM   619   H HB3  . PHE A 1 41 ? 13.532 19.357 -4.846  1.00 0.00 ? 58 PHE A HB3  1  
ATOM   620   H HD1  . PHE A 1 41 ? 16.984 20.161 -6.003  1.00 0.00 ? 58 PHE A HD1  1  
ATOM   621   H HD2  . PHE A 1 41 ? 12.814 21.078 -6.161  1.00 0.00 ? 58 PHE A HD2  1  
ATOM   622   H HE1  . PHE A 1 41 ? 17.415 21.809 -7.796  1.00 0.00 ? 58 PHE A HE1  1  
ATOM   623   H HE2  . PHE A 1 41 ? 13.242 22.724 -7.955  1.00 0.00 ? 58 PHE A HE2  1  
ATOM   624   H HZ   . PHE A 1 41 ? 15.544 23.090 -8.772  1.00 0.00 ? 58 PHE A HZ   1  
ATOM   625   N N    . LEU A 1 42 ? 13.284 21.453 -2.976  1.00 0.00 ? 59 LEU A N    1  
ATOM   626   C CA   . LEU A 1 42 ? 12.667 22.714 -2.584  1.00 0.00 ? 59 LEU A CA   1  
ATOM   627   C C    . LEU A 1 42 ? 12.733 22.915 -1.076  1.00 0.00 ? 59 LEU A C    1  
ATOM   628   O O    . LEU A 1 42 ? 12.219 22.100 -0.309  1.00 0.00 ? 59 LEU A O    1  
ATOM   629   C CB   . LEU A 1 42 ? 11.213 22.765 -3.067  1.00 0.00 ? 59 LEU A CB   1  
ATOM   630   C CG   . LEU A 1 42 ? 10.438 24.031 -2.674  1.00 0.00 ? 59 LEU A CG   1  
ATOM   631   C CD1  . LEU A 1 42 ? 11.065 25.252 -3.332  1.00 0.00 ? 59 LEU A CD1  1  
ATOM   632   C CD2  . LEU A 1 42 ? 8.981  23.883 -3.085  1.00 0.00 ? 59 LEU A CD2  1  
ATOM   633   H H    . LEU A 1 42 ? 12.700 20.637 -3.100  1.00 0.00 ? 59 LEU A H    1  
ATOM   634   H HA   . LEU A 1 42 ? 13.217 23.543 -3.031  1.00 0.00 ? 59 LEU A HA   1  
ATOM   635   H HB2  . LEU A 1 42 ? 11.382 22.752 -4.142  1.00 0.00 ? 59 LEU A HB2  1  
ATOM   636   H HB3  . LEU A 1 42 ? 10.659 21.874 -2.775  1.00 0.00 ? 59 LEU A HB3  1  
ATOM   637   H HG   . LEU A 1 42 ? 10.472 24.106 -1.586  1.00 0.00 ? 59 LEU A HG   1  
ATOM   638   H HD11 . LEU A 1 42 ? 10.508 26.145 -3.046  1.00 0.00 ? 59 LEU A HD11 1  
ATOM   639   H HD12 . LEU A 1 42 ? 12.100 25.351 -3.005  1.00 0.00 ? 59 LEU A HD12 1  
ATOM   640   H HD13 . LEU A 1 42 ? 11.035 25.137 -4.415  1.00 0.00 ? 59 LEU A HD13 1  
ATOM   641   H HD21 . LEU A 1 42 ? 8.546  23.021 -2.581  1.00 0.00 ? 59 LEU A HD21 1  
ATOM   642   H HD22 . LEU A 1 42 ? 8.432  24.783 -2.804  1.00 0.00 ? 59 LEU A HD22 1  
ATOM   643   H HD23 . LEU A 1 42 ? 8.920  23.742 -4.164  1.00 0.00 ? 59 LEU A HD23 1  
ATOM   644   N N    . LEU A 1 43 ? 13.368 24.004 -0.656  1.00 0.00 ? 60 LEU A N    1  
ATOM   645   C CA   . LEU A 1 43 ? 13.463 24.336 0.760   1.00 0.00 ? 60 LEU A CA   1  
ATOM   646   C C    . LEU A 1 43 ? 12.249 25.132 1.222   1.00 0.00 ? 60 LEU A C    1  
ATOM   647   O O    . LEU A 1 43 ? 11.731 24.912 2.317   1.00 0.00 ? 60 LEU A O    1  
ATOM   648   C CB   . LEU A 1 43 ? 14.752 25.122 1.035   1.00 0.00 ? 60 LEU A CB   1  
ATOM   649   C CG   . LEU A 1 43 ? 16.053 24.366 0.740   1.00 0.00 ? 60 LEU A CG   1  
ATOM   650   C CD1  . LEU A 1 43 ? 17.250 25.283 0.952   1.00 0.00 ? 60 LEU A CD1  1  
ATOM   651   C CD2  . LEU A 1 43 ? 16.145 23.142 1.640   1.00 0.00 ? 60 LEU A CD2  1  
ATOM   652   H H    . LEU A 1 43 ? 13.795 24.617 -1.335  1.00 0.00 ? 60 LEU A H    1  
ATOM   653   H HA   . LEU A 1 43 ? 13.475 23.421 1.351   1.00 0.00 ? 60 LEU A HA   1  
ATOM   654   H HB2  . LEU A 1 43 ? 14.620 25.933 0.319   1.00 0.00 ? 60 LEU A HB2  1  
ATOM   655   H HB3  . LEU A 1 43 ? 14.769 25.529 2.045   1.00 0.00 ? 60 LEU A HB3  1  
ATOM   656   H HG   . LEU A 1 43 ? 15.999 24.017 -0.292  1.00 0.00 ? 60 LEU A HG   1  
ATOM   657   H HD11 . LEU A 1 43 ? 18.170 24.737 0.740   1.00 0.00 ? 60 LEU A HD11 1  
ATOM   658   H HD12 . LEU A 1 43 ? 17.175 26.139 0.282   1.00 0.00 ? 60 LEU A HD12 1  
ATOM   659   H HD13 . LEU A 1 43 ? 17.263 25.629 1.985   1.00 0.00 ? 60 LEU A HD13 1  
ATOM   660   H HD21 . LEU A 1 43 ? 15.294 22.486 1.451   1.00 0.00 ? 60 LEU A HD21 1  
ATOM   661   H HD22 . LEU A 1 43 ? 17.070 22.605 1.429   1.00 0.00 ? 60 LEU A HD22 1  
ATOM   662   H HD23 . LEU A 1 43 ? 16.137 23.456 2.684   1.00 0.00 ? 60 LEU A HD23 1  
ATOM   663   N N    . ASP A 1 44 ? 11.799 26.057 0.381   1.00 0.00 ? 61 ASP A N    1  
ATOM   664   C CA   . ASP A 1 44 ? 10.624 26.864 0.687   1.00 0.00 ? 61 ASP A CA   1  
ATOM   665   C C    . ASP A 1 44 ? 9.342  26.143 0.288   1.00 0.00 ? 61 ASP A C    1  
ATOM   666   O O    . ASP A 1 44 ? 8.671  26.533 -0.667  1.00 0.00 ? 61 ASP A O    1  
ATOM   667   C CB   . ASP A 1 44 ? 10.705 28.220 -0.019  1.00 0.00 ? 61 ASP A CB   1  
ATOM   668   C CG   . ASP A 1 44 ? 9.625  29.209 0.394   1.00 0.00 ? 61 ASP A CG   1  
ATOM   669   O OD1  . ASP A 1 44 ? 8.892  28.913 1.309   1.00 0.00 ? 61 ASP A OD1  1  
ATOM   670   O OD2  . ASP A 1 44 ? 9.638  30.312 -0.098  1.00 0.00 ? 61 ASP A OD2  1  
ATOM   671   H H    . ASP A 1 44 ? 12.284 26.205 -0.492  1.00 0.00 ? 61 ASP A H    1  
ATOM   672   H HA   . ASP A 1 44 ? 10.562 27.034 1.762   1.00 0.00 ? 61 ASP A HA   1  
ATOM   673   H HB2  . ASP A 1 44 ? 11.683 28.694 0.064   1.00 0.00 ? 61 ASP A HB2  1  
ATOM   674   H HB3  . ASP A 1 44 ? 10.538 27.909 -1.051  1.00 0.00 ? 61 ASP A HB3  1  
ATOM   675   N N    . ARG A 1 45 ? 9.007  25.091 1.026   1.00 0.00 ? 62 ARG A N    1  
ATOM   676   C CA   . ARG A 1 45 ? 7.792  24.328 0.766   1.00 0.00 ? 62 ARG A CA   1  
ATOM   677   C C    . ARG A 1 45 ? 6.585  24.970 1.437   1.00 0.00 ? 62 ARG A C    1  
ATOM   678   O O    . ARG A 1 45 ? 6.044  25.912 0.927   1.00 0.00 ? 62 ARG A O    1  
ATOM   679   C CB   . ARG A 1 45 ? 7.936  22.866 1.162   1.00 0.00 ? 62 ARG A CB   1  
ATOM   680   C CG   . ARG A 1 45 ? 8.929  22.072 0.327   1.00 0.00 ? 62 ARG A CG   1  
ATOM   681   C CD   . ARG A 1 45 ? 9.127  20.671 0.778   1.00 0.00 ? 62 ARG A CD   1  
ATOM   682   N NE   . ARG A 1 45 ? 9.891  20.536 2.007   1.00 0.00 ? 62 ARG A NE   1  
ATOM   683   C CZ   . ARG A 1 45 ? 10.090 19.375 2.661   1.00 0.00 ? 62 ARG A CZ   1  
ATOM   684   N NH1  . ARG A 1 45 ? 9.555  18.254 2.230   1.00 0.00 ? 62 ARG A NH1  1  
ATOM   685   N NH2  . ARG A 1 45 ? 10.820 19.395 3.763   1.00 0.00 ? 62 ARG A NH2  1  
ATOM   686   O OXT  . ARG A 1 45 ? 6.174  24.535 2.478   1.00 0.00 ? 62 ARG A OXT  1  
ATOM   687   H H    . ARG A 1 45 ? 9.610  24.810 1.787   1.00 0.00 ? 62 ARG A H    1  
ATOM   688   H HA   . ARG A 1 45 ? 7.584  24.318 -0.303  1.00 0.00 ? 62 ARG A HA   1  
ATOM   689   H HB2  . ARG A 1 45 ? 8.248  22.848 2.205   1.00 0.00 ? 62 ARG A HB2  1  
ATOM   690   H HB3  . ARG A 1 45 ? 6.949  22.412 1.071   1.00 0.00 ? 62 ARG A HB3  1  
ATOM   691   H HG2  . ARG A 1 45 ? 8.573  22.046 -0.703  1.00 0.00 ? 62 ARG A HG2  1  
ATOM   692   H HG3  . ARG A 1 45 ? 9.895  22.577 0.365   1.00 0.00 ? 62 ARG A HG3  1  
ATOM   693   H HD2  . ARG A 1 45 ? 8.153  20.213 0.948   1.00 0.00 ? 62 ARG A HD2  1  
ATOM   694   H HD3  . ARG A 1 45 ? 9.656  20.120 0.002   1.00 0.00 ? 62 ARG A HD3  1  
ATOM   695   H HE   . ARG A 1 45 ? 10.372 21.242 2.548   1.00 0.00 ? 62 ARG A HE   1  
ATOM   696   H HH11 . ARG A 1 45 ? 8.985  18.258 1.396   1.00 0.00 ? 62 ARG A HH11 1  
ATOM   697   H HH12 . ARG A 1 45 ? 9.716  17.394 2.734   1.00 0.00 ? 62 ARG A HH12 1  
ATOM   698   H HH21 . ARG A 1 45 ? 11.209 20.268 4.091   1.00 0.00 ? 62 ARG A HH21 1  
ATOM   699   H HH22 . ARG A 1 45 ? 10.984 18.539 4.271   1.00 0.00 ? 62 ARG A HH22 1  
ATOM   700   N N    . PRO A 1 1  ? 0.290  -0.469 -0.357  1.00 0.00 ? 18 PRO A N    2  
ATOM   701   C CA   . PRO A 1 1  ? 1.699  -0.336 -0.006  1.00 0.00 ? 18 PRO A CA   2  
ATOM   702   C C    . PRO A 1 1  ? 2.181  1.096  -0.195  1.00 0.00 ? 18 PRO A C    2  
ATOM   703   O O    . PRO A 1 1  ? 1.682  1.821  -1.056  1.00 0.00 ? 18 PRO A O    2  
ATOM   704   C CB   . PRO A 1 1  ? 2.413  -1.314 -0.945  1.00 0.00 ? 18 PRO A CB   2  
ATOM   705   C CG   . PRO A 1 1  ? 1.541  -1.372 -2.152  1.00 0.00 ? 18 PRO A CG   2  
ATOM   706   C CD   . PRO A 1 1  ? 0.133  -1.244 -1.634  1.00 0.00 ? 18 PRO A CD   2  
ATOM   707   H H2   . PRO A 1 1  ? 0.014  -1.094 -1.087  1.00 0.00 ? 18 PRO A H2   2  
ATOM   708   H H3   . PRO A 1 1  ? -0.369 -0.778 0.329   1.00 0.00 ? 18 PRO A H3   2  
ATOM   709   H HA   . PRO A 1 1  ? 1.898  -0.564 1.052   1.00 0.00 ? 18 PRO A HA   2  
ATOM   710   H HB2  . PRO A 1 1  ? 3.424  -0.962 -1.200  1.00 0.00 ? 18 PRO A HB2  2  
ATOM   711   H HB3  . PRO A 1 1  ? 2.523  -2.306 -0.485  1.00 0.00 ? 18 PRO A HB3  2  
ATOM   712   H HG2  . PRO A 1 1  ? 1.779  -0.559 -2.854  1.00 0.00 ? 18 PRO A HG2  2  
ATOM   713   H HG3  . PRO A 1 1  ? 1.678  -2.318 -2.696  1.00 0.00 ? 18 PRO A HG3  2  
ATOM   714   H HD2  . PRO A 1 1  ? -0.522 -0.709 -2.338  1.00 0.00 ? 18 PRO A HD2  2  
ATOM   715   H HD3  . PRO A 1 1  ? -0.331 -2.224 -1.446  1.00 0.00 ? 18 PRO A HD3  2  
ATOM   716   N N    . THR A 1 2  ? 3.155  1.500  0.614   1.00 0.00 ? 19 THR A N    2  
ATOM   717   C CA   . THR A 1 2  ? 3.684  2.857  0.559   1.00 0.00 ? 19 THR A CA   2  
ATOM   718   C C    . THR A 1 2  ? 5.202  2.852  0.435   1.00 0.00 ? 19 THR A C    2  
ATOM   719   O O    . THR A 1 2  ? 5.895  2.177  1.198   1.00 0.00 ? 19 THR A O    2  
ATOM   720   C CB   . THR A 1 2  ? 3.285  3.671  1.804   1.00 0.00 ? 19 THR A CB   2  
ATOM   721   O OG1  . THR A 1 2  ? 1.855  3.730  1.900   1.00 0.00 ? 19 THR A OG1  2  
ATOM   722   C CG2  . THR A 1 2  ? 3.842  5.084  1.720   1.00 0.00 ? 19 THR A CG2  2  
ATOM   723   H H    . THR A 1 2  ? 3.538  0.849  1.285   1.00 0.00 ? 19 THR A H    2  
ATOM   724   H HA   . THR A 1 2  ? 3.304  3.366  -0.327  1.00 0.00 ? 19 THR A HA   2  
ATOM   725   H HB   . THR A 1 2  ? 3.679  3.178  2.692   1.00 0.00 ? 19 THR A HB   2  
ATOM   726   H HG1  . THR A 1 2  ? 1.608  4.236  2.678   1.00 0.00 ? 19 THR A HG1  2  
ATOM   727   H HG21 . THR A 1 2  ? 3.447  5.577  0.833   1.00 0.00 ? 19 THR A HG21 2  
ATOM   728   H HG22 . THR A 1 2  ? 3.549  5.643  2.608   1.00 0.00 ? 19 THR A HG22 2  
ATOM   729   H HG23 . THR A 1 2  ? 4.929  5.041  1.657   1.00 0.00 ? 19 THR A HG23 2  
ATOM   730   N N    . ARG A 1 3  ? 5.714  3.607  -0.530  1.00 0.00 ? 20 ARG A N    2  
ATOM   731   C CA   . ARG A 1 3  ? 7.155  3.732  -0.722  1.00 0.00 ? 20 ARG A CA   2  
ATOM   732   C C    . ARG A 1 3  ? 7.636  5.136  -0.378  1.00 0.00 ? 20 ARG A C    2  
ATOM   733   O O    . ARG A 1 3  ? 7.077  6.127  -0.847  1.00 0.00 ? 20 ARG A O    2  
ATOM   734   C CB   . ARG A 1 3  ? 7.584  3.324  -2.124  1.00 0.00 ? 20 ARG A CB   2  
ATOM   735   C CG   . ARG A 1 3  ? 9.074  3.454  -2.400  1.00 0.00 ? 20 ARG A CG   2  
ATOM   736   C CD   . ARG A 1 3  ? 9.487  3.015  -3.757  1.00 0.00 ? 20 ARG A CD   2  
ATOM   737   N NE   . ARG A 1 3  ? 10.910 3.140  -4.025  1.00 0.00 ? 20 ARG A NE   2  
ATOM   738   C CZ   . ARG A 1 3  ? 11.496 2.845  -5.201  1.00 0.00 ? 20 ARG A CZ   2  
ATOM   739   N NH1  . ARG A 1 3  ? 10.795 2.373  -6.207  1.00 0.00 ? 20 ARG A NH1  2  
ATOM   740   N NH2  . ARG A 1 3  ? 12.802 3.020  -5.309  1.00 0.00 ? 20 ARG A NH2  2  
ATOM   741   H H    . ARG A 1 3  ? 5.090  4.107  -1.148  1.00 0.00 ? 20 ARG A H    2  
ATOM   742   H HA   . ARG A 1 3  ? 7.678  3.052  -0.051  1.00 0.00 ? 20 ARG A HA   2  
ATOM   743   H HB2  . ARG A 1 3  ? 7.282  2.287  -2.260  1.00 0.00 ? 20 ARG A HB2  2  
ATOM   744   H HB3  . ARG A 1 3  ? 7.035  3.958  -2.822  1.00 0.00 ? 20 ARG A HB3  2  
ATOM   745   H HG2  . ARG A 1 3  ? 9.359  4.500  -2.284  1.00 0.00 ? 20 ARG A HG2  2  
ATOM   746   H HG3  . ARG A 1 3  ? 9.615  2.848  -1.671  1.00 0.00 ? 20 ARG A HG3  2  
ATOM   747   H HD2  . ARG A 1 3  ? 9.222  1.966  -3.885  1.00 0.00 ? 20 ARG A HD2  2  
ATOM   748   H HD3  . ARG A 1 3  ? 8.961  3.615  -4.499  1.00 0.00 ? 20 ARG A HD3  2  
ATOM   749   H HE   . ARG A 1 3  ? 11.656 3.450  -3.415  1.00 0.00 ? 20 ARG A HE   2  
ATOM   750   H HH11 . ARG A 1 3  ? 9.801  2.227  -6.103  1.00 0.00 ? 20 ARG A HH11 2  
ATOM   751   H HH12 . ARG A 1 3  ? 11.254 2.158  -7.081  1.00 0.00 ? 20 ARG A HH12 2  
ATOM   752   H HH21 . ARG A 1 3  ? 13.329 3.368  -4.520  1.00 0.00 ? 20 ARG A HH21 2  
ATOM   753   H HH22 . ARG A 1 3  ? 13.266 2.807  -6.180  1.00 0.00 ? 20 ARG A HH22 2  
ATOM   754   N N    . THR A 1 4  ? 8.677  5.214  0.444   1.00 0.00 ? 21 THR A N    2  
ATOM   755   C CA   . THR A 1 4  ? 9.268  6.495  0.813   1.00 0.00 ? 21 THR A CA   2  
ATOM   756   C C    . THR A 1 4  ? 10.435 6.847  -0.101  1.00 0.00 ? 21 THR A C    2  
ATOM   757   O O    . THR A 1 4  ? 11.422 6.116  -0.173  1.00 0.00 ? 21 THR A O    2  
ATOM   758   C CB   . THR A 1 4  ? 9.756  6.491  2.274   1.00 0.00 ? 21 THR A CB   2  
ATOM   759   O OG1  . THR A 1 4  ? 8.648  6.248  3.150   1.00 0.00 ? 21 THR A OG1  2  
ATOM   760   C CG2  . THR A 1 4  ? 10.393 7.827  2.626   1.00 0.00 ? 21 THR A CG2  2  
ATOM   761   H H    . THR A 1 4  ? 9.070  4.364  0.822   1.00 0.00 ? 21 THR A H    2  
ATOM   762   H HA   . THR A 1 4  ? 8.531  7.289  0.693   1.00 0.00 ? 21 THR A HA   2  
ATOM   763   H HB   . THR A 1 4  ? 10.490 5.695  2.400   1.00 0.00 ? 21 THR A HB   2  
ATOM   764   H HG1  . THR A 1 4  ? 8.956  6.246  4.060   1.00 0.00 ? 21 THR A HG1  2  
ATOM   765   H HG21 . THR A 1 4  ? 9.660  8.623  2.500   1.00 0.00 ? 21 THR A HG21 2  
ATOM   766   H HG22 . THR A 1 4  ? 10.732 7.805  3.661   1.00 0.00 ? 21 THR A HG22 2  
ATOM   767   H HG23 . THR A 1 4  ? 11.243 8.009  1.968   1.00 0.00 ? 21 THR A HG23 2  
ATOM   768   N N    . VAL A 1 5  ? 10.314 7.971  -0.799  1.00 0.00 ? 22 VAL A N    2  
ATOM   769   C CA   . VAL A 1 5  ? 11.355 8.420  -1.715  1.00 0.00 ? 22 VAL A CA   2  
ATOM   770   C C    . VAL A 1 5  ? 11.847 9.815  -1.351  1.00 0.00 ? 22 VAL A C    2  
ATOM   771   O O    . VAL A 1 5  ? 11.059 10.755 -1.249  1.00 0.00 ? 22 VAL A O    2  
ATOM   772   C CB   . VAL A 1 5  ? 10.859 8.426  -3.174  1.00 0.00 ? 22 VAL A CB   2  
ATOM   773   C CG1  . VAL A 1 5  ? 11.941 8.959  -4.102  1.00 0.00 ? 22 VAL A CG1  2  
ATOM   774   C CG2  . VAL A 1 5  ? 10.436 7.029  -3.598  1.00 0.00 ? 22 VAL A CG2  2  
ATOM   775   H H    . VAL A 1 5  ? 9.479  8.530  -0.690  1.00 0.00 ? 22 VAL A H    2  
ATOM   776   H HA   . VAL A 1 5  ? 12.239 7.785  -1.651  1.00 0.00 ? 22 VAL A HA   2  
ATOM   777   H HB   . VAL A 1 5  ? 9.975  9.060  -3.245  1.00 0.00 ? 22 VAL A HB   2  
ATOM   778   H HG11 . VAL A 1 5  ? 11.573 8.957  -5.128  1.00 0.00 ? 22 VAL A HG11 2  
ATOM   779   H HG12 . VAL A 1 5  ? 12.199 9.977  -3.812  1.00 0.00 ? 22 VAL A HG12 2  
ATOM   780   H HG13 . VAL A 1 5  ? 12.824 8.325  -4.032  1.00 0.00 ? 22 VAL A HG13 2  
ATOM   781   H HG21 . VAL A 1 5  ? 9.630  6.679  -2.952  1.00 0.00 ? 22 VAL A HG21 2  
ATOM   782   H HG22 . VAL A 1 5  ? 10.088 7.051  -4.631  1.00 0.00 ? 22 VAL A HG22 2  
ATOM   783   H HG23 . VAL A 1 5  ? 11.286 6.351  -3.516  1.00 0.00 ? 22 VAL A HG23 2  
ATOM   784   N N    . ALA A 1 6  ? 13.155 9.943  -1.154  1.00 0.00 ? 23 ALA A N    2  
ATOM   785   C CA   . ALA A 1 6  ? 13.765 11.237 -0.873  1.00 0.00 ? 23 ALA A CA   2  
ATOM   786   C C    . ALA A 1 6  ? 14.016 12.017 -2.158  1.00 0.00 ? 23 ALA A C    2  
ATOM   787   O O    . ALA A 1 6  ? 14.404 11.445 -3.177  1.00 0.00 ? 23 ALA A O    2  
ATOM   788   C CB   . ALA A 1 6  ? 15.060 11.055 -0.097  1.00 0.00 ? 23 ALA A CB   2  
ATOM   789   H H    . ALA A 1 6  ? 13.742 9.122  -1.201  1.00 0.00 ? 23 ALA A H    2  
ATOM   790   H HA   . ALA A 1 6  ? 13.075 11.824 -0.267  1.00 0.00 ? 23 ALA A HA   2  
ATOM   791   H HB1  . ALA A 1 6  ? 15.755 10.456 -0.684  1.00 0.00 ? 23 ALA A HB1  2  
ATOM   792   H HB2  . ALA A 1 6  ? 15.502 12.031 0.104   1.00 0.00 ? 23 ALA A HB2  2  
ATOM   793   H HB3  . ALA A 1 6  ? 14.852 10.550 0.846   1.00 0.00 ? 23 ALA A HB3  2  
ATOM   794   N N    . ILE A 1 7  ? 13.795 13.326 -2.103  1.00 0.00 ? 24 ILE A N    2  
ATOM   795   C CA   . ILE A 1 7  ? 13.940 14.177 -3.276  1.00 0.00 ? 24 ILE A CA   2  
ATOM   796   C C    . ILE A 1 7  ? 14.925 15.310 -3.017  1.00 0.00 ? 24 ILE A C    2  
ATOM   797   O O    . ILE A 1 7  ? 14.794 16.048 -2.040  1.00 0.00 ? 24 ILE A O    2  
ATOM   798   C CB   . ILE A 1 7  ? 12.590 14.775 -3.712  1.00 0.00 ? 24 ILE A CB   2  
ATOM   799   C CG1  . ILE A 1 7  ? 11.611 13.661 -4.090  1.00 0.00 ? 24 ILE A CG1  2  
ATOM   800   C CG2  . ILE A 1 7  ? 12.784 15.736 -4.875  1.00 0.00 ? 24 ILE A CG2  2  
ATOM   801   C CD1  . ILE A 1 7  ? 12.026 12.872 -5.311  1.00 0.00 ? 24 ILE A CD1  2  
ATOM   802   H H    . ILE A 1 7  ? 13.518 13.741 -1.224  1.00 0.00 ? 24 ILE A H    2  
ATOM   803   H HA   . ILE A 1 7  ? 14.374 13.619 -4.105  1.00 0.00 ? 24 ILE A HA   2  
ATOM   804   H HB   . ILE A 1 7  ? 12.149 15.307 -2.870  1.00 0.00 ? 24 ILE A HB   2  
ATOM   805   H HG12 . ILE A 1 7  ? 11.534 12.992 -3.234  1.00 0.00 ? 24 ILE A HG12 2  
ATOM   806   H HG13 . ILE A 1 7  ? 10.643 14.129 -4.273  1.00 0.00 ? 24 ILE A HG13 2  
ATOM   807   H HG21 . ILE A 1 7  ? 11.819 16.148 -5.171  1.00 0.00 ? 24 ILE A HG21 2  
ATOM   808   H HG22 . ILE A 1 7  ? 13.447 16.545 -4.573  1.00 0.00 ? 24 ILE A HG22 2  
ATOM   809   H HG23 . ILE A 1 7  ? 13.223 15.203 -5.718  1.00 0.00 ? 24 ILE A HG23 2  
ATOM   810   H HD11 . ILE A 1 7  ? 12.992 12.402 -5.130  1.00 0.00 ? 24 ILE A HD11 2  
ATOM   811   H HD12 . ILE A 1 7  ? 11.283 12.100 -5.516  1.00 0.00 ? 24 ILE A HD12 2  
ATOM   812   H HD13 . ILE A 1 7  ? 12.102 13.539 -6.170  1.00 0.00 ? 24 ILE A HD13 2  
ATOM   813   N N    . SER A 1 8  ? 15.912 15.442 -3.897  1.00 0.00 ? 25 SER A N    2  
ATOM   814   C CA   . SER A 1 8  ? 16.942 16.464 -3.746  1.00 0.00 ? 25 SER A CA   2  
ATOM   815   C C    . SER A 1 8  ? 16.702 17.632 -4.693  1.00 0.00 ? 25 SER A C    2  
ATOM   816   O O    . SER A 1 8  ? 17.244 18.720 -4.502  1.00 0.00 ? 25 SER A O    2  
ATOM   817   C CB   . SER A 1 8  ? 18.313 15.862 -3.985  1.00 0.00 ? 25 SER A CB   2  
ATOM   818   O OG   . SER A 1 8  ? 18.454 15.376 -5.291  1.00 0.00 ? 25 SER A OG   2  
ATOM   819   H H    . SER A 1 8  ? 15.951 14.819 -4.690  1.00 0.00 ? 25 SER A H    2  
ATOM   820   H HA   . SER A 1 8  ? 17.041 16.830 -2.723  1.00 0.00 ? 25 SER A HA   2  
ATOM   821   H HB2  . SER A 1 8  ? 19.065 16.631 -3.810  1.00 0.00 ? 25 SER A HB2  2  
ATOM   822   H HB3  . SER A 1 8  ? 18.462 15.043 -3.284  1.00 0.00 ? 25 SER A HB3  2  
ATOM   823   H HG   . SER A 1 8  ? 19.333 15.005 -5.401  1.00 0.00 ? 25 SER A HG   2  
ATOM   824   N N    . ASP A 1 9  ? 15.886 17.400 -5.715  1.00 0.00 ? 26 ASP A N    2  
ATOM   825   C CA   . ASP A 1 9  ? 15.607 18.420 -6.720  1.00 0.00 ? 26 ASP A CA   2  
ATOM   826   C C    . ASP A 1 9  ? 14.320 18.111 -7.475  1.00 0.00 ? 26 ASP A C    2  
ATOM   827   O O    . ASP A 1 9  ? 13.847 16.974 -7.476  1.00 0.00 ? 26 ASP A O    2  
ATOM   828   C CB   . ASP A 1 9  ? 16.776 18.540 -7.701  1.00 0.00 ? 26 ASP A CB   2  
ATOM   829   C CG   . ASP A 1 9  ? 16.849 19.875 -8.430  1.00 0.00 ? 26 ASP A CG   2  
ATOM   830   O OD1  . ASP A 1 9  ? 16.017 20.714 -8.179  1.00 0.00 ? 26 ASP A OD1  2  
ATOM   831   O OD2  . ASP A 1 9  ? 17.821 20.103 -9.111  1.00 0.00 ? 26 ASP A OD2  2  
ATOM   832   H H    . ASP A 1 9  ? 15.447 16.494 -5.799  1.00 0.00 ? 26 ASP A H    2  
ATOM   833   H HA   . ASP A 1 9  ? 15.459 19.384 -6.235  1.00 0.00 ? 26 ASP A HA   2  
ATOM   834   H HB2  . ASP A 1 9  ? 17.744 18.317 -7.252  1.00 0.00 ? 26 ASP A HB2  2  
ATOM   835   H HB3  . ASP A 1 9  ? 16.513 17.753 -8.409  1.00 0.00 ? 26 ASP A HB3  2  
ATOM   836   N N    . ALA A 1 10 ? 13.758 19.130 -8.116  1.00 0.00 ? 27 ALA A N    2  
ATOM   837   C CA   . ALA A 1 10 ? 12.519 18.972 -8.868  1.00 0.00 ? 27 ALA A CA   2  
ATOM   838   C C    . ALA A 1 10 ? 12.713 18.042 -10.059 1.00 0.00 ? 27 ALA A C    2  
ATOM   839   O O    . ALA A 1 10 ? 11.753 17.468 -10.574 1.00 0.00 ? 27 ALA A O    2  
ATOM   840   C CB   . ALA A 1 10 ? 12.002 20.327 -9.329  1.00 0.00 ? 27 ALA A CB   2  
ATOM   841   H H    . ALA A 1 10 ? 14.200 20.038 -8.080  1.00 0.00 ? 27 ALA A H    2  
ATOM   842   H HA   . ALA A 1 10 ? 11.771 18.518 -8.220  1.00 0.00 ? 27 ALA A HA   2  
ATOM   843   H HB1  . ALA A 1 10 ? 12.747 20.802 -9.967  1.00 0.00 ? 27 ALA A HB1  2  
ATOM   844   H HB2  . ALA A 1 10 ? 11.077 20.192 -9.889  1.00 0.00 ? 27 ALA A HB2  2  
ATOM   845   H HB3  . ALA A 1 10 ? 11.811 20.958 -8.461  1.00 0.00 ? 27 ALA A HB3  2  
ATOM   846   N N    . ALA A 1 11 ? 13.960 17.896 -10.492 1.00 0.00 ? 28 ALA A N    2  
ATOM   847   C CA   . ALA A 1 11 ? 14.294 16.968 -11.566 1.00 0.00 ? 28 ALA A CA   2  
ATOM   848   C C    . ALA A 1 11 ? 13.935 15.536 -11.188 1.00 0.00 ? 28 ALA A C    2  
ATOM   849   O O    . ALA A 1 11 ? 13.703 14.695 -12.056 1.00 0.00 ? 28 ALA A O    2  
ATOM   850   C CB   . ALA A 1 11 ? 15.772 17.071 -11.916 1.00 0.00 ? 28 ALA A CB   2  
ATOM   851   H H    . ALA A 1 11 ? 14.696 18.443 -10.068 1.00 0.00 ? 28 ALA A H    2  
ATOM   852   H HA   . ALA A 1 11 ? 13.710 17.228 -12.449 1.00 0.00 ? 28 ALA A HA   2  
ATOM   853   H HB1  . ALA A 1 11 ? 16.371 16.830 -11.039 1.00 0.00 ? 28 ALA A HB1  2  
ATOM   854   H HB2  . ALA A 1 11 ? 16.005 16.372 -12.718 1.00 0.00 ? 28 ALA A HB2  2  
ATOM   855   H HB3  . ALA A 1 11 ? 15.999 18.086 -12.242 1.00 0.00 ? 28 ALA A HB3  2  
ATOM   856   N N    . GLN A 1 12 ? 13.891 15.266 -9.888  1.00 0.00 ? 29 GLN A N    2  
ATOM   857   C CA   . GLN A 1 12 ? 13.638 13.919 -9.394  1.00 0.00 ? 29 GLN A CA   2  
ATOM   858   C C    . GLN A 1 12 ? 12.151 13.683 -9.168  1.00 0.00 ? 29 GLN A C    2  
ATOM   859   O O    . GLN A 1 12 ? 11.731 12.574 -8.839  1.00 0.00 ? 29 GLN A O    2  
ATOM   860   C CB   . GLN A 1 12 ? 14.404 13.674 -8.091  1.00 0.00 ? 29 GLN A CB   2  
ATOM   861   C CG   . GLN A 1 12 ? 15.908 13.851 -8.209  1.00 0.00 ? 29 GLN A CG   2  
ATOM   862   C CD   . GLN A 1 12 ? 16.526 12.898 -9.215  1.00 0.00 ? 29 GLN A CD   2  
ATOM   863   O OE1  . GLN A 1 12 ? 16.247 11.696 -9.204  1.00 0.00 ? 29 GLN A OE1  2  
ATOM   864   N NE2  . GLN A 1 12 ? 17.372 13.430 -10.090 1.00 0.00 ? 29 GLN A NE2  2  
ATOM   865   H H    . GLN A 1 12 ? 14.035 16.015 -9.225  1.00 0.00 ? 29 GLN A H    2  
ATOM   866   H HA   . GLN A 1 12 ? 13.958 13.190 -10.140 1.00 0.00 ? 29 GLN A HA   2  
ATOM   867   H HB2  . GLN A 1 12 ? 14.006 14.374 -7.355  1.00 0.00 ? 29 GLN A HB2  2  
ATOM   868   H HB3  . GLN A 1 12 ? 14.177 12.654 -7.779  1.00 0.00 ? 29 GLN A HB3  2  
ATOM   869   H HG2  . GLN A 1 12 ? 16.379 14.825 -8.338  1.00 0.00 ? 29 GLN A HG2  2  
ATOM   870   H HG3  . GLN A 1 12 ? 16.119 13.478 -7.206  1.00 0.00 ? 29 GLN A HG3  2  
ATOM   871   H HE21 . GLN A 1 12 ? 17.571 14.409 -10.062 1.00 0.00 ? 29 GLN A HE21 2  
ATOM   872   H HE22 . GLN A 1 12 ? 17.812 12.850 -10.777 1.00 0.00 ? 29 GLN A HE22 2  
ATOM   873   N N    . LEU A 1 13 ? 11.358 14.734 -9.346  1.00 0.00 ? 30 LEU A N    2  
ATOM   874   C CA   . LEU A 1 13 ? 9.916  14.649 -9.141  1.00 0.00 ? 30 LEU A CA   2  
ATOM   875   C C    . LEU A 1 13 ? 9.206  14.181 -10.404 1.00 0.00 ? 30 LEU A C    2  
ATOM   876   O O    . LEU A 1 13 ? 9.665  14.438 -11.517 1.00 0.00 ? 30 LEU A O    2  
ATOM   877   C CB   . LEU A 1 13 ? 9.364  16.008 -8.690  1.00 0.00 ? 30 LEU A CB   2  
ATOM   878   C CG   . LEU A 1 13 ? 9.815  16.467 -7.298  1.00 0.00 ? 30 LEU A CG   2  
ATOM   879   C CD1  . LEU A 1 13 ? 9.312  17.878 -7.025  1.00 0.00 ? 30 LEU A CD1  2  
ATOM   880   C CD2  . LEU A 1 13 ? 9.295  15.495 -6.249  1.00 0.00 ? 30 LEU A CD2  2  
ATOM   881   H H    . LEU A 1 13 ? 11.763 15.614 -9.631  1.00 0.00 ? 30 LEU A H    2  
ATOM   882   H HA   . LEU A 1 13 ? 9.701  13.908 -8.372  1.00 0.00 ? 30 LEU A HA   2  
ATOM   883   H HB2  . LEU A 1 13 ? 9.810  16.642 -9.455  1.00 0.00 ? 30 LEU A HB2  2  
ATOM   884   H HB3  . LEU A 1 13 ? 8.279  16.049 -8.772  1.00 0.00 ? 30 LEU A HB3  2  
ATOM   885   H HG   . LEU A 1 13 ? 10.905 16.424 -7.280  1.00 0.00 ? 30 LEU A HG   2  
ATOM   886   H HD11 . LEU A 1 13 ? 9.637  18.194 -6.034  1.00 0.00 ? 30 LEU A HD11 2  
ATOM   887   H HD12 . LEU A 1 13 ? 9.715  18.559 -7.774  1.00 0.00 ? 30 LEU A HD12 2  
ATOM   888   H HD13 . LEU A 1 13 ? 8.223  17.890 -7.071  1.00 0.00 ? 30 LEU A HD13 2  
ATOM   889   H HD21 . LEU A 1 13 ? 9.689  14.499 -6.448  1.00 0.00 ? 30 LEU A HD21 2  
ATOM   890   H HD22 . LEU A 1 13 ? 9.617  15.823 -5.260  1.00 0.00 ? 30 LEU A HD22 2  
ATOM   891   H HD23 . LEU A 1 13 ? 8.206  15.468 -6.286  1.00 0.00 ? 30 LEU A HD23 2  
ATOM   892   N N    . PRO A 1 14 ? 8.084  13.492 -10.226 1.00 0.00 ? 31 PRO A N    2  
ATOM   893   C CA   . PRO A 1 14 ? 7.253  13.077 -11.349 1.00 0.00 ? 31 PRO A CA   2  
ATOM   894   C C    . PRO A 1 14 ? 6.702  14.282 -12.102 1.00 0.00 ? 31 PRO A C    2  
ATOM   895   O O    . PRO A 1 14 ? 6.955  15.427 -11.729 1.00 0.00 ? 31 PRO A O    2  
ATOM   896   C CB   . PRO A 1 14 ? 6.142  12.242 -10.706 1.00 0.00 ? 31 PRO A CB   2  
ATOM   897   C CG   . PRO A 1 14 ? 6.677  11.887 -9.361  1.00 0.00 ? 31 PRO A CG   2  
ATOM   898   C CD   . PRO A 1 14 ? 7.519  13.063 -8.942  1.00 0.00 ? 31 PRO A CD   2  
ATOM   899   H HA   . PRO A 1 14 ? 7.812  12.503 -12.103 1.00 0.00 ? 31 PRO A HA   2  
ATOM   900   H HB2  . PRO A 1 14 ? 5.205  12.813 -10.623 1.00 0.00 ? 31 PRO A HB2  2  
ATOM   901   H HB3  . PRO A 1 14 ? 5.919  11.342 -11.296 1.00 0.00 ? 31 PRO A HB3  2  
ATOM   902   H HG2  . PRO A 1 14 ? 5.863  11.709 -8.642  1.00 0.00 ? 31 PRO A HG2  2  
ATOM   903   H HG3  . PRO A 1 14 ? 7.276  10.966 -9.402  1.00 0.00 ? 31 PRO A HG3  2  
ATOM   904   H HD2  . PRO A 1 14 ? 6.921  13.856 -8.471  1.00 0.00 ? 31 PRO A HD2  2  
ATOM   905   H HD3  . PRO A 1 14 ? 8.301  12.779 -8.222  1.00 0.00 ? 31 PRO A HD3  2  
ATOM   906   N N    . HIS A 1 15 ? 5.949  14.016 -13.164 1.00 0.00 ? 32 HIS A N    2  
ATOM   907   C CA   . HIS A 1 15 ? 5.292  15.074 -13.922 1.00 0.00 ? 32 HIS A CA   2  
ATOM   908   C C    . HIS A 1 15 ? 3.791  15.088 -13.662 1.00 0.00 ? 32 HIS A C    2  
ATOM   909   O O    . HIS A 1 15 ? 3.063  15.910 -14.216 1.00 0.00 ? 32 HIS A O    2  
ATOM   910   C CB   . HIS A 1 15 ? 5.562  14.913 -15.421 1.00 0.00 ? 32 HIS A CB   2  
ATOM   911   C CG   . HIS A 1 15 ? 6.980  15.192 -15.811 1.00 0.00 ? 32 HIS A CG   2  
ATOM   912   N ND1  . HIS A 1 15 ? 7.435  15.060 -17.106 1.00 0.00 ? 32 HIS A ND1  2  
ATOM   913   C CD2  . HIS A 1 15 ? 8.043  15.595 -15.077 1.00 0.00 ? 32 HIS A CD2  2  
ATOM   914   C CE1  . HIS A 1 15 ? 8.719  15.371 -17.151 1.00 0.00 ? 32 HIS A CE1  2  
ATOM   915   N NE2  . HIS A 1 15 ? 9.112  15.699 -15.933 1.00 0.00 ? 32 HIS A NE2  2  
ATOM   916   H H    . HIS A 1 15 ? 5.828  13.056 -13.454 1.00 0.00 ? 32 HIS A H    2  
ATOM   917   H HA   . HIS A 1 15 ? 5.671  16.044 -13.601 1.00 0.00 ? 32 HIS A HA   2  
ATOM   918   H HB2  . HIS A 1 15 ? 5.348  13.890 -15.734 1.00 0.00 ? 32 HIS A HB2  2  
ATOM   919   H HB3  . HIS A 1 15 ? 4.940  15.603 -15.991 1.00 0.00 ? 32 HIS A HB3  2  
ATOM   920   H HD2  . HIS A 1 15 ? 8.169  15.825 -14.019 1.00 0.00 ? 32 HIS A HD2  2  
ATOM   921   H HE1  . HIS A 1 15 ? 9.268  15.330 -18.092 1.00 0.00 ? 32 HIS A HE1  2  
ATOM   922   H HE2  . HIS A 1 15 ? 10.043 15.981 -15.666 1.00 0.00 ? 32 HIS A HE2  2  
ATOM   923   N N    . ASP A 1 16 ? 3.335  14.171 -12.815 1.00 0.00 ? 33 ASP A N    2  
ATOM   924   C CA   . ASP A 1 16 ? 1.912  14.034 -12.530 1.00 0.00 ? 33 ASP A CA   2  
ATOM   925   C C    . ASP A 1 16 ? 1.667  13.799 -11.044 1.00 0.00 ? 33 ASP A C    2  
ATOM   926   O O    . ASP A 1 16 ? 0.612  13.303 -10.649 1.00 0.00 ? 33 ASP A O    2  
ATOM   927   C CB   . ASP A 1 16 ? 1.308  12.890 -13.349 1.00 0.00 ? 33 ASP A CB   2  
ATOM   928   C CG   . ASP A 1 16 ? 1.892  11.518 -13.037 1.00 0.00 ? 33 ASP A CG   2  
ATOM   929   O OD1  . ASP A 1 16 ? 2.751  11.438 -12.193 1.00 0.00 ? 33 ASP A OD1  2  
ATOM   930   O OD2  . ASP A 1 16 ? 1.368  10.548 -13.530 1.00 0.00 ? 33 ASP A OD2  2  
ATOM   931   H H    . ASP A 1 16 ? 3.989  13.555 -12.356 1.00 0.00 ? 33 ASP A H    2  
ATOM   932   H HA   . ASP A 1 16 ? 1.392  14.958 -12.786 1.00 0.00 ? 33 ASP A HA   2  
ATOM   933   H HB2  . ASP A 1 16 ? 0.220  12.843 -13.294 1.00 0.00 ? 33 ASP A HB2  2  
ATOM   934   H HB3  . ASP A 1 16 ? 1.610  13.194 -14.352 1.00 0.00 ? 33 ASP A HB3  2  
ATOM   935   N N    . TYR A 1 17 ? 2.649  14.157 -10.225 1.00 0.00 ? 34 TYR A N    2  
ATOM   936   C CA   . TYR A 1 17 ? 2.524  14.030 -8.777  1.00 0.00 ? 34 TYR A CA   2  
ATOM   937   C C    . TYR A 1 17 ? 1.505  15.017 -8.223  1.00 0.00 ? 34 TYR A C    2  
ATOM   938   O O    . TYR A 1 17 ? 1.140  15.986 -8.888  1.00 0.00 ? 34 TYR A O    2  
ATOM   939   C CB   . TYR A 1 17 ? 3.881  14.241 -8.102  1.00 0.00 ? 34 TYR A CB   2  
ATOM   940   C CG   . TYR A 1 17 ? 4.379  15.668 -8.163  1.00 0.00 ? 34 TYR A CG   2  
ATOM   941   C CD1  . TYR A 1 17 ? 3.903  16.628 -7.281  1.00 0.00 ? 34 TYR A CD1  2  
ATOM   942   C CD2  . TYR A 1 17 ? 5.327  16.051 -9.100  1.00 0.00 ? 34 TYR A CD2  2  
ATOM   943   C CE1  . TYR A 1 17 ? 4.354  17.933 -7.333  1.00 0.00 ? 34 TYR A CE1  2  
ATOM   944   C CE2  . TYR A 1 17 ? 5.786  17.353 -9.161  1.00 0.00 ? 34 TYR A CE2  2  
ATOM   945   C CZ   . TYR A 1 17 ? 5.298  18.291 -8.275  1.00 0.00 ? 34 TYR A CZ   2  
ATOM   946   O OH   . TYR A 1 17 ? 5.752  19.588 -8.330  1.00 0.00 ? 34 TYR A OH   2  
ATOM   947   H H    . TYR A 1 17 ? 3.504  14.528 -10.614 1.00 0.00 ? 34 TYR A H    2  
ATOM   948   H HA   . TYR A 1 17 ? 2.162  13.033 -8.523  1.00 0.00 ? 34 TYR A HA   2  
ATOM   949   H HB2  . TYR A 1 17 ? 3.774  13.939 -7.060  1.00 0.00 ? 34 TYR A HB2  2  
ATOM   950   H HB3  . TYR A 1 17 ? 4.595  13.586 -8.600  1.00 0.00 ? 34 TYR A HB3  2  
ATOM   951   H HD1  . TYR A 1 17 ? 3.158  16.338 -6.541  1.00 0.00 ? 34 TYR A HD1  2  
ATOM   952   H HD2  . TYR A 1 17 ? 5.709  15.305 -9.798  1.00 0.00 ? 34 TYR A HD2  2  
ATOM   953   H HE1  . TYR A 1 17 ? 3.971  18.676 -6.635  1.00 0.00 ? 34 TYR A HE1  2  
ATOM   954   H HE2  . TYR A 1 17 ? 6.531  17.633 -9.906  1.00 0.00 ? 34 TYR A HE2  2  
ATOM   955   H HH   . TYR A 1 17 ? 6.406  19.728 -9.020  1.00 0.00 ? 34 TYR A HH   2  
ATOM   956   N N    . CYS A 1 18 ? 1.048  14.764 -7.001  1.00 0.00 ? 35 CYS A N    2  
ATOM   957   C CA   . CYS A 1 18 ? 0.132  15.673 -6.322  1.00 0.00 ? 35 CYS A CA   2  
ATOM   958   C C    . CYS A 1 18 ? 0.702  16.131 -4.985  1.00 0.00 ? 35 CYS A C    2  
ATOM   959   O O    . CYS A 1 18 ? 1.670  15.560 -4.484  1.00 0.00 ? 35 CYS A O    2  
ATOM   960   C CB   . CYS A 1 18 ? -1.108 14.806 -6.110  1.00 0.00 ? 35 CYS A CB   2  
ATOM   961   S SG   . CYS A 1 18 ? -1.872 14.205 -7.636  1.00 0.00 ? 35 CYS A SG   2  
ATOM   962   H H    . CYS A 1 18 ? 1.342  13.920 -6.531  1.00 0.00 ? 35 CYS A H    2  
ATOM   963   H HA   . CYS A 1 18 ? -0.145 16.538 -6.924  1.00 0.00 ? 35 CYS A HA   2  
ATOM   964   H HB2  . CYS A 1 18 ? -0.855 13.919 -5.529  1.00 0.00 ? 35 CYS A HB2  2  
ATOM   965   H HB3  . CYS A 1 18 ? -1.880 15.373 -5.590  1.00 0.00 ? 35 CYS A HB3  2  
ATOM   966   H HG   . CYS A 1 18 ? -2.857 13.535 -7.044  1.00 0.00 ? 35 CYS A HG   2  
ATOM   967   N N    . THR A 1 19 ? 0.094  17.165 -4.413  1.00 0.00 ? 36 THR A N    2  
ATOM   968   C CA   . THR A 1 19 ? 0.552  17.713 -3.141  1.00 0.00 ? 36 THR A CA   2  
ATOM   969   C C    . THR A 1 19 ? -0.619 17.977 -2.203  1.00 0.00 ? 36 THR A C    2  
ATOM   970   O O    . THR A 1 19 ? -1.643 18.525 -2.611  1.00 0.00 ? 36 THR A O    2  
ATOM   971   C CB   . THR A 1 19 ? 1.340  19.021 -3.340  1.00 0.00 ? 36 THR A CB   2  
ATOM   972   O OG1  . THR A 1 19 ? 2.454  18.782 -4.211  1.00 0.00 ? 36 THR A OG1  2  
ATOM   973   C CG2  . THR A 1 19 ? 1.847  19.547 -2.007  1.00 0.00 ? 36 THR A CG2  2  
ATOM   974   H H    . THR A 1 19 ? -0.704 17.581 -4.870  1.00 0.00 ? 36 THR A H    2  
ATOM   975   H HA   . THR A 1 19 ? 1.194  16.991 -2.638  1.00 0.00 ? 36 THR A HA   2  
ATOM   976   H HB   . THR A 1 19 ? 0.685  19.763 -3.798  1.00 0.00 ? 36 THR A HB   2  
ATOM   977   H HG1  . THR A 1 19 ? 2.943  19.600 -4.334  1.00 0.00 ? 36 THR A HG1  2  
ATOM   978   H HG21 . THR A 1 19 ? 2.501  18.806 -1.549  1.00 0.00 ? 36 THR A HG21 2  
ATOM   979   H HG22 . THR A 1 19 ? 2.401  20.471 -2.167  1.00 0.00 ? 36 THR A HG22 2  
ATOM   980   H HG23 . THR A 1 19 ? 1.001  19.740 -1.347  1.00 0.00 ? 36 THR A HG23 2  
HETATM 981   N N    . TPO A 1 20 ? -0.462 17.582 -0.944  1.00 0.00 ? 37 TPO A N    2  
HETATM 982   C CA   . TPO A 1 20 ? -1.504 17.776 0.056   1.00 0.00 ? 37 TPO A CA   2  
HETATM 983   C CB   . TPO A 1 20 ? -1.418 16.722 1.175   1.00 0.00 ? 37 TPO A CB   2  
HETATM 984   C CG2  . TPO A 1 20 ? -1.309 15.325 0.585   1.00 0.00 ? 37 TPO A CG2  2  
HETATM 985   O OG1  . TPO A 1 20 ? -0.269 16.983 1.993   1.00 0.00 ? 37 TPO A OG1  2  
HETATM 986   P P    . TPO A 1 20 ? -0.210 16.458 3.517   1.00 0.00 ? 37 TPO A P    2  
HETATM 987   O O1P  . TPO A 1 20 ? 1.154  16.905 4.106   1.00 0.00 ? 37 TPO A O1P  2  
HETATM 988   O O2P  . TPO A 1 20 ? -0.334 14.913 3.476   1.00 0.00 ? 37 TPO A O2P  2  
HETATM 989   O O3P  . TPO A 1 20 ? -1.398 17.106 4.273   1.00 0.00 ? 37 TPO A O3P  2  
HETATM 990   C C    . TPO A 1 20 ? -1.424 19.166 0.674   1.00 0.00 ? 37 TPO A C    2  
HETATM 991   O O    . TPO A 1 20 ? -0.410 19.853 0.550   1.00 0.00 ? 37 TPO A O    2  
HETATM 992   H H    . TPO A 1 20 ? 0.404  17.136 -0.672  1.00 0.00 ? 37 TPO A H    2  
HETATM 993   H HA   . TPO A 1 20 ? -2.485 17.705 -0.415  1.00 0.00 ? 37 TPO A HA   2  
HETATM 994   H HB   . TPO A 1 20 ? -2.314 16.786 1.793   1.00 0.00 ? 37 TPO A HB   2  
HETATM 995   H HG21 . TPO A 1 20 ? -1.248 14.594 1.391   1.00 0.00 ? 37 TPO A HG21 2  
HETATM 996   H HG22 . TPO A 1 20 ? -2.186 15.119 -0.028  1.00 0.00 ? 37 TPO A HG22 2  
HETATM 997   H HG23 . TPO A 1 20 ? -0.412 15.260 -0.031  1.00 0.00 ? 37 TPO A HG23 2  
ATOM   998   N N    . PRO A 1 21 ? -2.498 19.575 1.340   1.00 0.00 ? 38 PRO A N    2  
ATOM   999   C CA   . PRO A 1 21 ? -2.572 20.906 1.931   1.00 0.00 ? 38 PRO A CA   2  
ATOM   1000  C C    . PRO A 1 21 ? -1.397 21.160 2.866   1.00 0.00 ? 38 PRO A C    2  
ATOM   1001  O O    . PRO A 1 21 ? -0.938 22.292 3.009   1.00 0.00 ? 38 PRO A O    2  
ATOM   1002  C CB   . PRO A 1 21 ? -3.912 20.912 2.674   1.00 0.00 ? 38 PRO A CB   2  
ATOM   1003  C CG   . PRO A 1 21 ? -4.756 19.938 1.925   1.00 0.00 ? 38 PRO A CG   2  
ATOM   1004  C CD   . PRO A 1 21 ? -3.815 18.850 1.482   1.00 0.00 ? 38 PRO A CD   2  
ATOM   1005  H HA   . PRO A 1 21 ? -2.516 21.709 1.181   1.00 0.00 ? 38 PRO A HA   2  
ATOM   1006  H HB2  . PRO A 1 21 ? -3.792 20.608 3.725   1.00 0.00 ? 38 PRO A HB2  2  
ATOM   1007  H HB3  . PRO A 1 21 ? -4.367 21.913 2.678   1.00 0.00 ? 38 PRO A HB3  2  
ATOM   1008  H HG2  . PRO A 1 21 ? -5.557 19.532 2.562   1.00 0.00 ? 38 PRO A HG2  2  
ATOM   1009  H HG3  . PRO A 1 21 ? -5.243 20.416 1.062   1.00 0.00 ? 38 PRO A HG3  2  
ATOM   1010  H HD2  . PRO A 1 21 ? -3.741 18.038 2.220   1.00 0.00 ? 38 PRO A HD2  2  
ATOM   1011  H HD3  . PRO A 1 21 ? -4.123 18.393 0.531   1.00 0.00 ? 38 PRO A HD3  2  
ATOM   1012  N N    . GLY A 1 22 ? -0.914 20.098 3.503   1.00 0.00 ? 39 GLY A N    2  
ATOM   1013  C CA   . GLY A 1 22 ? 0.225  20.199 4.407   1.00 0.00 ? 39 GLY A CA   2  
ATOM   1014  C C    . GLY A 1 22 ? 1.493  20.580 3.654   1.00 0.00 ? 39 GLY A C    2  
ATOM   1015  O O    . GLY A 1 22 ? 2.374  21.244 4.200   1.00 0.00 ? 39 GLY A O    2  
ATOM   1016  H H    . GLY A 1 22 ? -1.348 19.197 3.357   1.00 0.00 ? 39 GLY A H    2  
ATOM   1017  H HA2  . GLY A 1 22 ? 0.016  20.959 5.159   1.00 0.00 ? 39 GLY A HA2  2  
ATOM   1018  H HA3  . GLY A 1 22 ? 0.378  19.237 4.896   1.00 0.00 ? 39 GLY A HA3  2  
ATOM   1019  N N    . GLY A 1 23 ? 1.579  20.158 2.397   1.00 0.00 ? 40 GLY A N    2  
ATOM   1020  C CA   . GLY A 1 23 ? 2.702  20.521 1.542   1.00 0.00 ? 40 GLY A CA   2  
ATOM   1021  C C    . GLY A 1 23 ? 3.585  19.315 1.249   1.00 0.00 ? 40 GLY A C    2  
ATOM   1022  O O    . GLY A 1 23 ? 4.743  19.460 0.859   1.00 0.00 ? 40 GLY A O    2  
ATOM   1023  H H    . GLY A 1 23 ? 0.847  19.569 2.025   1.00 0.00 ? 40 GLY A H    2  
ATOM   1024  H HA2  . GLY A 1 23 ? 2.320  20.918 0.602   1.00 0.00 ? 40 GLY A HA2  2  
ATOM   1025  H HA3  . GLY A 1 23 ? 3.298  21.284 2.041   1.00 0.00 ? 40 GLY A HA3  2  
ATOM   1026  N N    . THR A 1 24 ? 3.030  18.121 1.439   1.00 0.00 ? 41 THR A N    2  
ATOM   1027  C CA   . THR A 1 24 ? 3.756  16.887 1.167   1.00 0.00 ? 41 THR A CA   2  
ATOM   1028  C C    . THR A 1 24 ? 3.424  16.348 -0.218  1.00 0.00 ? 41 THR A C    2  
ATOM   1029  O O    . THR A 1 24 ? 2.255  16.216 -0.580  1.00 0.00 ? 41 THR A O    2  
ATOM   1030  C CB   . THR A 1 24 ? 3.444  15.804 2.216   1.00 0.00 ? 41 THR A CB   2  
ATOM   1031  O OG1  . THR A 1 24 ? 3.851  16.260 3.513   1.00 0.00 ? 41 THR A OG1  2  
ATOM   1032  C CG2  . THR A 1 24 ? 4.176  14.512 1.884   1.00 0.00 ? 41 THR A CG2  2  
ATOM   1033  H H    . THR A 1 24 ? 2.081  18.069 1.781   1.00 0.00 ? 41 THR A H    2  
ATOM   1034  H HA   . THR A 1 24 ? 4.829  17.081 1.173   1.00 0.00 ? 41 THR A HA   2  
ATOM   1035  H HB   . THR A 1 24 ? 2.370  15.620 2.227   1.00 0.00 ? 41 THR A HB   2  
ATOM   1036  H HG1  . THR A 1 24 ? 3.088  16.603 3.985   1.00 0.00 ? 41 THR A HG1  2  
ATOM   1037  H HG21 . THR A 1 24 ? 5.248  14.696 1.875   1.00 0.00 ? 41 THR A HG21 2  
ATOM   1038  H HG22 . THR A 1 24 ? 3.942  13.760 2.637   1.00 0.00 ? 41 THR A HG22 2  
ATOM   1039  H HG23 . THR A 1 24 ? 3.858  14.157 0.904   1.00 0.00 ? 41 THR A HG23 2  
ATOM   1040  N N    . LEU A 1 25 ? 4.460  16.036 -0.990  1.00 0.00 ? 42 LEU A N    2  
ATOM   1041  C CA   . LEU A 1 25 ? 4.281  15.513 -2.339  1.00 0.00 ? 42 LEU A CA   2  
ATOM   1042  C C    . LEU A 1 25 ? 4.073  14.004 -2.323  1.00 0.00 ? 42 LEU A C    2  
ATOM   1043  O O    . LEU A 1 25 ? 4.651  13.298 -1.497  1.00 0.00 ? 42 LEU A O    2  
ATOM   1044  C CB   . LEU A 1 25 ? 5.487  15.877 -3.214  1.00 0.00 ? 42 LEU A CB   2  
ATOM   1045  C CG   . LEU A 1 25 ? 5.425  17.262 -3.870  1.00 0.00 ? 42 LEU A CG   2  
ATOM   1046  C CD1  . LEU A 1 25 ? 5.447  18.347 -2.802  1.00 0.00 ? 42 LEU A CD1  2  
ATOM   1047  C CD2  . LEU A 1 25 ? 6.594  17.424 -4.829  1.00 0.00 ? 42 LEU A CD2  2  
ATOM   1048  H H    . LEU A 1 25 ? 5.396  16.165 -0.633  1.00 0.00 ? 42 LEU A H    2  
ATOM   1049  H HA   . LEU A 1 25 ? 3.383  15.944 -2.781  1.00 0.00 ? 42 LEU A HA   2  
ATOM   1050  H HB2  . LEU A 1 25 ? 6.268  15.858 -2.455  1.00 0.00 ? 42 LEU A HB2  2  
ATOM   1051  H HB3  . LEU A 1 25 ? 5.690  15.110 -3.961  1.00 0.00 ? 42 LEU A HB3  2  
ATOM   1052  H HG   . LEU A 1 25 ? 4.506  17.302 -4.456  1.00 0.00 ? 42 LEU A HG   2  
ATOM   1053  H HD11 . LEU A 1 25 ? 5.403  19.327 -3.277  1.00 0.00 ? 42 LEU A HD11 2  
ATOM   1054  H HD12 . LEU A 1 25 ? 4.589  18.225 -2.141  1.00 0.00 ? 42 LEU A HD12 2  
ATOM   1055  H HD13 . LEU A 1 25 ? 6.367  18.268 -2.223  1.00 0.00 ? 42 LEU A HD13 2  
ATOM   1056  H HD21 . LEU A 1 25 ? 6.543  16.655 -5.599  1.00 0.00 ? 42 LEU A HD21 2  
ATOM   1057  H HD22 . LEU A 1 25 ? 6.548  18.409 -5.295  1.00 0.00 ? 42 LEU A HD22 2  
ATOM   1058  H HD23 . LEU A 1 25 ? 7.532  17.325 -4.280  1.00 0.00 ? 42 LEU A HD23 2  
ATOM   1059  N N    . PHE A 1 26 ? 3.246  13.516 -3.239  1.00 0.00 ? 43 PHE A N    2  
ATOM   1060  C CA   . PHE A 1 26 ? 3.003  12.083 -3.368  1.00 0.00 ? 43 PHE A CA   2  
ATOM   1061  C C    . PHE A 1 26 ? 2.579  11.721 -4.785  1.00 0.00 ? 43 PHE A C    2  
ATOM   1062  O O    . PHE A 1 26 ? 2.198  12.589 -5.570  1.00 0.00 ? 43 PHE A O    2  
ATOM   1063  C CB   . PHE A 1 26 ? 1.938  11.631 -2.368  1.00 0.00 ? 43 PHE A CB   2  
ATOM   1064  C CG   . PHE A 1 26 ? 0.570  12.187 -2.646  1.00 0.00 ? 43 PHE A CG   2  
ATOM   1065  C CD1  . PHE A 1 26 ? 0.231  13.470 -2.246  1.00 0.00 ? 43 PHE A CD1  2  
ATOM   1066  C CD2  . PHE A 1 26 ? -0.381 11.427 -3.311  1.00 0.00 ? 43 PHE A CD2  2  
ATOM   1067  C CE1  . PHE A 1 26 ? -1.026 13.982 -2.499  1.00 0.00 ? 43 PHE A CE1  2  
ATOM   1068  C CE2  . PHE A 1 26 ? -1.640 11.937 -3.568  1.00 0.00 ? 43 PHE A CE2  2  
ATOM   1069  C CZ   . PHE A 1 26 ? -1.963 13.214 -3.163  1.00 0.00 ? 43 PHE A CZ   2  
ATOM   1070  H H    . PHE A 1 26 ? 2.772  14.153 -3.864  1.00 0.00 ? 43 PHE A H    2  
ATOM   1071  H HA   . PHE A 1 26 ? 3.924  11.533 -3.169  1.00 0.00 ? 43 PHE A HA   2  
ATOM   1072  H HB2  . PHE A 1 26 ? 1.843  10.546 -2.386  1.00 0.00 ? 43 PHE A HB2  2  
ATOM   1073  H HB3  . PHE A 1 26 ? 2.205  11.954 -1.363  1.00 0.00 ? 43 PHE A HB3  2  
ATOM   1074  H HD1  . PHE A 1 26 ? 0.972  14.077 -1.722  1.00 0.00 ? 43 PHE A HD1  2  
ATOM   1075  H HD2  . PHE A 1 26 ? -0.126 10.416 -3.632  1.00 0.00 ? 43 PHE A HD2  2  
ATOM   1076  H HE1  . PHE A 1 26 ? -1.280 14.992 -2.179  1.00 0.00 ? 43 PHE A HE1  2  
ATOM   1077  H HE2  . PHE A 1 26 ? -2.377 11.329 -4.092  1.00 0.00 ? 43 PHE A HE2  2  
ATOM   1078  H HZ   . PHE A 1 26 ? -2.953 13.618 -3.366  1.00 0.00 ? 43 PHE A HZ   2  
ATOM   1079  N N    . SER A 1 27 ? 2.647  10.433 -5.106  1.00 0.00 ? 44 SER A N    2  
ATOM   1080  C CA   . SER A 1 27 ? 2.136  9.933  -6.376  1.00 0.00 ? 44 SER A CA   2  
ATOM   1081  C C    . SER A 1 27 ? 1.655  8.494  -6.248  1.00 0.00 ? 44 SER A C    2  
ATOM   1082  O O    . SER A 1 27 ? 1.838  7.859  -5.210  1.00 0.00 ? 44 SER A O    2  
ATOM   1083  C CB   . SER A 1 27 ? 3.204  10.039 -7.448  1.00 0.00 ? 44 SER A CB   2  
ATOM   1084  O OG   . SER A 1 27 ? 4.249  9.128  -7.241  1.00 0.00 ? 44 SER A OG   2  
ATOM   1085  H H    . SER A 1 27 ? 3.064  9.785  -4.454  1.00 0.00 ? 44 SER A H    2  
ATOM   1086  H HA   . SER A 1 27 ? 1.344  10.553 -6.799  1.00 0.00 ? 44 SER A HA   2  
ATOM   1087  H HB2  . SER A 1 27 ? 2.747  9.839  -8.417  1.00 0.00 ? 44 SER A HB2  2  
ATOM   1088  H HB3  . SER A 1 27 ? 3.608  11.050 -7.439  1.00 0.00 ? 44 SER A HB3  2  
ATOM   1089  H HG   . SER A 1 27 ? 3.893  8.238  -7.196  1.00 0.00 ? 44 SER A HG   2  
ATOM   1090  N N    . THR A 1 28 ? 1.038  7.985  -7.309  1.00 0.00 ? 45 THR A N    2  
ATOM   1091  C CA   . THR A 1 28 ? 0.582  6.600  -7.339  1.00 0.00 ? 45 THR A CA   2  
ATOM   1092  C C    . THR A 1 28 ? 0.822  5.970  -8.705  1.00 0.00 ? 45 THR A C    2  
ATOM   1093  O O    . THR A 1 28 ? 0.460  6.540  -9.734  1.00 0.00 ? 45 THR A O    2  
ATOM   1094  C CB   . THR A 1 28 ? -0.913 6.489  -6.990  1.00 0.00 ? 45 THR A CB   2  
ATOM   1095  O OG1  . THR A 1 28 ? -1.151 7.070  -5.702  1.00 0.00 ? 45 THR A OG1  2  
ATOM   1096  C CG2  . THR A 1 28 ? -1.350 5.033  -6.973  1.00 0.00 ? 45 THR A CG2  2  
ATOM   1097  H H    . THR A 1 28 ? 0.880  8.571  -8.116  1.00 0.00 ? 45 THR A H    2  
ATOM   1098  H HA   . THR A 1 28 ? 1.153  6.008  -6.622  1.00 0.00 ? 45 THR A HA   2  
ATOM   1099  H HB   . THR A 1 28 ? -1.493 7.033  -7.737  1.00 0.00 ? 45 THR A HB   2  
ATOM   1100  H HG1  . THR A 1 28 ? -0.421 6.856  -5.114  1.00 0.00 ? 45 THR A HG1  2  
ATOM   1101  H HG21 . THR A 1 28 ? -0.773 4.489  -6.226  1.00 0.00 ? 45 THR A HG21 2  
ATOM   1102  H HG22 . THR A 1 28 ? -2.411 4.975  -6.724  1.00 0.00 ? 45 THR A HG22 2  
ATOM   1103  H HG23 . THR A 1 28 ? -1.182 4.591  -7.954  1.00 0.00 ? 45 THR A HG23 2  
HETATM 1104  N N    . TPO A 1 29 ? 1.435  4.791  -8.708  1.00 0.00 ? 46 TPO A N    2  
HETATM 1105  C CA   . TPO A 1 29 ? 1.762  4.101  -9.950  1.00 0.00 ? 46 TPO A CA   2  
HETATM 1106  C CB   . TPO A 1 29 ? 3.049  3.265  -9.811  1.00 0.00 ? 46 TPO A CB   2  
HETATM 1107  C CG2  . TPO A 1 29 ? 4.156  4.093  -9.175  1.00 0.00 ? 46 TPO A CG2  2  
HETATM 1108  O OG1  . TPO A 1 29 ? 2.788  2.115  -8.996  1.00 0.00 ? 46 TPO A OG1  2  
HETATM 1109  P P    . TPO A 1 29 ? 3.687  0.784  -9.145  1.00 0.00 ? 46 TPO A P    2  
HETATM 1110  O O1P  . TPO A 1 29 ? 3.144  -0.255 -8.129  1.00 0.00 ? 46 TPO A O1P  2  
HETATM 1111  O O2P  . TPO A 1 29 ? 5.152  1.179  -8.829  1.00 0.00 ? 46 TPO A O2P  2  
HETATM 1112  O O3P  . TPO A 1 29 ? 3.533  0.287  -10.607 1.00 0.00 ? 46 TPO A O3P  2  
HETATM 1113  C C    . TPO A 1 29 ? 0.624  3.191  -10.391 1.00 0.00 ? 46 TPO A C    2  
HETATM 1114  O O    . TPO A 1 29 ? -0.276 2.883  -9.608  1.00 0.00 ? 46 TPO A O    2  
HETATM 1115  H H    . TPO A 1 29 ? 1.682  4.362  -7.828  1.00 0.00 ? 46 TPO A H    2  
HETATM 1116  H HA   . TPO A 1 29 ? 1.903  4.828  -10.750 1.00 0.00 ? 46 TPO A HA   2  
HETATM 1117  H HB   . TPO A 1 29 ? 3.365  2.934  -10.800 1.00 0.00 ? 46 TPO A HB   2  
HETATM 1118  H HG21 . TPO A 1 29 ? 5.056  3.485  -9.085  1.00 0.00 ? 46 TPO A HG21 2  
HETATM 1119  H HG22 . TPO A 1 29 ? 4.364  4.962  -9.799  1.00 0.00 ? 46 TPO A HG22 2  
HETATM 1120  H HG23 . TPO A 1 29 ? 3.840  4.423  -8.186  1.00 0.00 ? 46 TPO A HG23 2  
ATOM   1121  N N    . PRO A 1 30 ? 0.667  2.764  -11.648 1.00 0.00 ? 47 PRO A N    2  
ATOM   1122  C CA   . PRO A 1 30 ? -0.406 1.962  -12.223 1.00 0.00 ? 47 PRO A CA   2  
ATOM   1123  C C    . PRO A 1 30 ? -0.651 0.701  -11.405 1.00 0.00 ? 47 PRO A C    2  
ATOM   1124  O O    . PRO A 1 30 ? -1.771 0.195  -11.344 1.00 0.00 ? 47 PRO A O    2  
ATOM   1125  C CB   . PRO A 1 30 ? 0.080  1.645  -13.640 1.00 0.00 ? 47 PRO A CB   2  
ATOM   1126  C CG   . PRO A 1 30 ? 0.980  2.781  -13.987 1.00 0.00 ? 47 PRO A CG   2  
ATOM   1127  C CD   . PRO A 1 30 ? 1.675  3.146  -12.703 1.00 0.00 ? 47 PRO A CD   2  
ATOM   1128  H HA   . PRO A 1 30 ? -1.373 2.487  -12.230 1.00 0.00 ? 47 PRO A HA   2  
ATOM   1129  H HB2  . PRO A 1 30 ? 0.618  0.686  -13.676 1.00 0.00 ? 47 PRO A HB2  2  
ATOM   1130  H HB3  . PRO A 1 30 ? -0.759 1.571  -14.348 1.00 0.00 ? 47 PRO A HB3  2  
ATOM   1131  H HG2  . PRO A 1 30 ? 1.705  2.492  -14.761 1.00 0.00 ? 47 PRO A HG2  2  
ATOM   1132  H HG3  . PRO A 1 30 ? 0.409  3.634  -14.384 1.00 0.00 ? 47 PRO A HG3  2  
ATOM   1133  H HD2  . PRO A 1 30 ? 2.618  2.595  -12.569 1.00 0.00 ? 47 PRO A HD2  2  
ATOM   1134  H HD3  . PRO A 1 30 ? 1.920  4.218  -12.652 1.00 0.00 ? 47 PRO A HD3  2  
ATOM   1135  N N    . GLY A 1 31 ? 0.405  0.196  -10.776 1.00 0.00 ? 48 GLY A N    2  
ATOM   1136  C CA   . GLY A 1 31 ? 0.310  -1.014 -9.969  1.00 0.00 ? 48 GLY A CA   2  
ATOM   1137  C C    . GLY A 1 31 ? -0.574 -0.795 -8.749  1.00 0.00 ? 48 GLY A C    2  
ATOM   1138  O O    . GLY A 1 31 ? -1.155 -1.739 -8.213  1.00 0.00 ? 48 GLY A O    2  
ATOM   1139  H H    . GLY A 1 31 ? 1.297  0.663  -10.859 1.00 0.00 ? 48 GLY A H    2  
ATOM   1140  H HA2  . GLY A 1 31 ? -0.113 -1.815 -10.575 1.00 0.00 ? 48 GLY A HA2  2  
ATOM   1141  H HA3  . GLY A 1 31 ? 1.308  -1.301 -9.637  1.00 0.00 ? 48 GLY A HA3  2  
ATOM   1142  N N    . GLY A 1 32 ? -0.674 0.456  -8.313  1.00 0.00 ? 49 GLY A N    2  
ATOM   1143  C CA   . GLY A 1 32 ? -1.528 0.809  -7.186  1.00 0.00 ? 49 GLY A CA   2  
ATOM   1144  C C    . GLY A 1 32 ? -0.702 1.258  -5.988  1.00 0.00 ? 49 GLY A C    2  
ATOM   1145  O O    . GLY A 1 32 ? -1.235 1.806  -5.023  1.00 0.00 ? 49 GLY A O    2  
ATOM   1146  H H    . GLY A 1 32 ? -0.145 1.182  -8.776  1.00 0.00 ? 49 GLY A H    2  
ATOM   1147  H HA2  . GLY A 1 32 ? -2.192 1.622  -7.483  1.00 0.00 ? 49 GLY A HA2  2  
ATOM   1148  H HA3  . GLY A 1 32 ? -2.122 -0.059 -6.903  1.00 0.00 ? 49 GLY A HA3  2  
ATOM   1149  N N    . THR A 1 33 ? 0.604  1.022  -6.055  1.00 0.00 ? 50 THR A N    2  
ATOM   1150  C CA   . THR A 1 33 ? 1.508  1.404  -4.976  1.00 0.00 ? 50 THR A CA   2  
ATOM   1151  C C    . THR A 1 33 ? 1.585  2.918  -4.833  1.00 0.00 ? 50 THR A C    2  
ATOM   1152  O O    . THR A 1 33 ? 1.724  3.639  -5.821  1.00 0.00 ? 50 THR A O    2  
ATOM   1153  C CB   . THR A 1 33 ? 2.926  0.848  -5.205  1.00 0.00 ? 50 THR A CB   2  
ATOM   1154  O OG1  . THR A 1 33 ? 2.871  -0.581 -5.305  1.00 0.00 ? 50 THR A OG1  2  
ATOM   1155  C CG2  . THR A 1 33 ? 3.843  1.236  -4.054  1.00 0.00 ? 50 THR A CG2  2  
ATOM   1156  H H    . THR A 1 33 ? 0.980  0.565  -6.873  1.00 0.00 ? 50 THR A H    2  
ATOM   1157  H HA   . THR A 1 33 ? 1.132  1.022  -4.027  1.00 0.00 ? 50 THR A HA   2  
ATOM   1158  H HB   . THR A 1 33 ? 3.321  1.254  -6.135  1.00 0.00 ? 50 THR A HB   2  
ATOM   1159  H HG1  . THR A 1 33 ? 2.902  -0.837 -6.230  1.00 0.00 ? 50 THR A HG1  2  
ATOM   1160  H HG21 . THR A 1 33 ? 3.449  0.829  -3.123  1.00 0.00 ? 50 THR A HG21 2  
ATOM   1161  H HG22 . THR A 1 33 ? 4.840  0.835  -4.233  1.00 0.00 ? 50 THR A HG22 2  
ATOM   1162  H HG23 . THR A 1 33 ? 3.895  2.322  -3.982  1.00 0.00 ? 50 THR A HG23 2  
ATOM   1163  N N    . ARG A 1 34 ? 1.494  3.395  -3.596  1.00 0.00 ? 51 ARG A N    2  
ATOM   1164  C CA   . ARG A 1 34 ? 1.596  4.823  -3.317  1.00 0.00 ? 51 ARG A CA   2  
ATOM   1165  C C    . ARG A 1 34 ? 3.027  5.216  -2.974  1.00 0.00 ? 51 ARG A C    2  
ATOM   1166  O O    . ARG A 1 34 ? 3.759  4.449  -2.349  1.00 0.00 ? 51 ARG A O    2  
ATOM   1167  C CB   . ARG A 1 34 ? 0.623  5.266  -2.234  1.00 0.00 ? 51 ARG A CB   2  
ATOM   1168  C CG   . ARG A 1 34 ? -0.847 5.132  -2.602  1.00 0.00 ? 51 ARG A CG   2  
ATOM   1169  C CD   . ARG A 1 34 ? -1.785 5.624  -1.561  1.00 0.00 ? 51 ARG A CD   2  
ATOM   1170  N NE   . ARG A 1 34 ? -3.187 5.359  -1.839  1.00 0.00 ? 51 ARG A NE   2  
ATOM   1171  C CZ   . ARG A 1 34 ? -4.207 5.690  -1.022  1.00 0.00 ? 51 ARG A CZ   2  
ATOM   1172  N NH1  . ARG A 1 34 ? -3.984 6.264  0.139   1.00 0.00 ? 51 ARG A NH1  2  
ATOM   1173  N NH2  . ARG A 1 34 ? -5.437 5.399  -1.408  1.00 0.00 ? 51 ARG A NH2  2  
ATOM   1174  H H    . ARG A 1 34 ? 1.350  2.754  -2.830  1.00 0.00 ? 51 ARG A H    2  
ATOM   1175  H HA   . ARG A 1 34 ? 1.321  5.394  -4.204  1.00 0.00 ? 51 ARG A HA   2  
ATOM   1176  H HB2  . ARG A 1 34 ? 0.830  4.661  -1.353  1.00 0.00 ? 51 ARG A HB2  2  
ATOM   1177  H HB3  . ARG A 1 34 ? 0.843  6.312  -2.017  1.00 0.00 ? 51 ARG A HB3  2  
ATOM   1178  H HG2  . ARG A 1 34 ? -1.030 5.700  -3.514  1.00 0.00 ? 51 ARG A HG2  2  
ATOM   1179  H HG3  . ARG A 1 34 ? -1.065 4.078  -2.779  1.00 0.00 ? 51 ARG A HG3  2  
ATOM   1180  H HD2  . ARG A 1 34 ? -1.545 5.146  -0.612  1.00 0.00 ? 51 ARG A HD2  2  
ATOM   1181  H HD3  . ARG A 1 34 ? -1.671 6.703  -1.463  1.00 0.00 ? 51 ARG A HD3  2  
ATOM   1182  H HE   . ARG A 1 34 ? -3.612 4.909  -2.640  1.00 0.00 ? 51 ARG A HE   2  
ATOM   1183  H HH11 . ARG A 1 34 ? -3.036 6.464  0.428   1.00 0.00 ? 51 ARG A HH11 2  
ATOM   1184  H HH12 . ARG A 1 34 ? -4.761 6.504  0.737   1.00 0.00 ? 51 ARG A HH12 2  
ATOM   1185  H HH21 . ARG A 1 34 ? -5.589 4.941  -2.297  1.00 0.00 ? 51 ARG A HH21 2  
ATOM   1186  H HH22 . ARG A 1 34 ? -6.217 5.636  -0.815  1.00 0.00 ? 51 ARG A HH22 2  
ATOM   1187  N N    . ILE A 1 35 ? 3.420  6.416  -3.388  1.00 0.00 ? 52 ILE A N    2  
ATOM   1188  C CA   . ILE A 1 35 ? 4.761  6.919  -3.113  1.00 0.00 ? 52 ILE A CA   2  
ATOM   1189  C C    . ILE A 1 35 ? 4.708  8.269  -2.406  1.00 0.00 ? 52 ILE A C    2  
ATOM   1190  O O    . ILE A 1 35 ? 4.088  9.213  -2.896  1.00 0.00 ? 52 ILE A O    2  
ATOM   1191  C CB   . ILE A 1 35 ? 5.588  7.059  -4.404  1.00 0.00 ? 52 ILE A CB   2  
ATOM   1192  C CG1  . ILE A 1 35 ? 5.723  5.702  -5.101  1.00 0.00 ? 52 ILE A CG1  2  
ATOM   1193  C CG2  . ILE A 1 35 ? 6.959  7.642  -4.097  1.00 0.00 ? 52 ILE A CG2  2  
ATOM   1194  C CD1  . ILE A 1 35 ? 6.368  5.778  -6.465  1.00 0.00 ? 52 ILE A CD1  2  
ATOM   1195  H H    . ILE A 1 35 ? 2.774  6.994  -3.907  1.00 0.00 ? 52 ILE A H    2  
ATOM   1196  H HA   . ILE A 1 35 ? 5.282  6.264  -2.418  1.00 0.00 ? 52 ILE A HA   2  
ATOM   1197  H HB   . ILE A 1 35 ? 5.060  7.715  -5.095  1.00 0.00 ? 52 ILE A HB   2  
ATOM   1198  H HG12 . ILE A 1 35 ? 6.320  5.061  -4.451  1.00 0.00 ? 52 ILE A HG12 2  
ATOM   1199  H HG13 . ILE A 1 35 ? 4.720  5.286  -5.196  1.00 0.00 ? 52 ILE A HG13 2  
ATOM   1200  H HG21 . ILE A 1 35 ? 7.530  7.732  -5.020  1.00 0.00 ? 52 ILE A HG21 2  
ATOM   1201  H HG22 . ILE A 1 35 ? 6.843  8.626  -3.645  1.00 0.00 ? 52 ILE A HG22 2  
ATOM   1202  H HG23 . ILE A 1 35 ? 7.488  6.985  -3.406  1.00 0.00 ? 52 ILE A HG23 2  
ATOM   1203  H HD11 . ILE A 1 35 ? 7.372  6.191  -6.371  1.00 0.00 ? 52 ILE A HD11 2  
ATOM   1204  H HD12 . ILE A 1 35 ? 6.429  4.777  -6.896  1.00 0.00 ? 52 ILE A HD12 2  
ATOM   1205  H HD13 . ILE A 1 35 ? 5.772  6.416  -7.116  1.00 0.00 ? 52 ILE A HD13 2  
ATOM   1206  N N    . ILE A 1 36 ? 5.362  8.352  -1.253  1.00 0.00 ? 53 ILE A N    2  
ATOM   1207  C CA   . ILE A 1 36 ? 5.452  9.606  -0.514  1.00 0.00 ? 53 ILE A CA   2  
ATOM   1208  C C    . ILE A 1 36 ? 6.830  10.237 -0.665  1.00 0.00 ? 53 ILE A C    2  
ATOM   1209  O O    . ILE A 1 36 ? 7.848  9.605  -0.382  1.00 0.00 ? 53 ILE A O    2  
ATOM   1210  C CB   . ILE A 1 36 ? 5.154  9.400  0.983   1.00 0.00 ? 53 ILE A CB   2  
ATOM   1211  C CG1  . ILE A 1 36 ? 3.782  8.746  1.169   1.00 0.00 ? 53 ILE A CG1  2  
ATOM   1212  C CG2  . ILE A 1 36 ? 5.218  10.727 1.724   1.00 0.00 ? 53 ILE A CG2  2  
ATOM   1213  C CD1  . ILE A 1 36 ? 2.638  9.552  0.598   1.00 0.00 ? 53 ILE A CD1  2  
ATOM   1214  H H    . ILE A 1 36 ? 5.809  7.527  -0.880  1.00 0.00 ? 53 ILE A H    2  
ATOM   1215  H HA   . ILE A 1 36 ? 4.763  10.343 -0.923  1.00 0.00 ? 53 ILE A HA   2  
ATOM   1216  H HB   . ILE A 1 36 ? 5.888  8.714  1.401   1.00 0.00 ? 53 ILE A HB   2  
ATOM   1217  H HG12 . ILE A 1 36 ? 3.819  7.772  0.681   1.00 0.00 ? 53 ILE A HG12 2  
ATOM   1218  H HG13 . ILE A 1 36 ? 3.631  8.609  2.240   1.00 0.00 ? 53 ILE A HG13 2  
ATOM   1219  H HG21 . ILE A 1 36 ? 5.004  10.564 2.781   1.00 0.00 ? 53 ILE A HG21 2  
ATOM   1220  H HG22 . ILE A 1 36 ? 6.215  11.155 1.618   1.00 0.00 ? 53 ILE A HG22 2  
ATOM   1221  H HG23 . ILE A 1 36 ? 4.482  11.414 1.308   1.00 0.00 ? 53 ILE A HG23 2  
ATOM   1222  H HD11 . ILE A 1 36 ? 2.786  9.689  -0.472  1.00 0.00 ? 53 ILE A HD11 2  
ATOM   1223  H HD12 . ILE A 1 36 ? 1.699  9.024  0.769   1.00 0.00 ? 53 ILE A HD12 2  
ATOM   1224  H HD13 . ILE A 1 36 ? 2.600  10.527 1.087   1.00 0.00 ? 53 ILE A HD13 2  
ATOM   1225  N N    . TYR A 1 37 ? 6.856  11.488 -1.113  1.00 0.00 ? 54 TYR A N    2  
ATOM   1226  C CA   . TYR A 1 37 ? 8.107  12.153 -1.458  1.00 0.00 ? 54 TYR A CA   2  
ATOM   1227  C C    . TYR A 1 37 ? 8.557  13.092 -0.348  1.00 0.00 ? 54 TYR A C    2  
ATOM   1228  O O    . TYR A 1 37 ? 7.830  14.009 0.035   1.00 0.00 ? 54 TYR A O    2  
ATOM   1229  C CB   . TYR A 1 37 ? 7.958  12.924 -2.772  1.00 0.00 ? 54 TYR A CB   2  
ATOM   1230  C CG   . TYR A 1 37 ? 7.725  12.043 -3.978  1.00 0.00 ? 54 TYR A CG   2  
ATOM   1231  C CD1  . TYR A 1 37 ? 8.770  11.335 -4.554  1.00 0.00 ? 54 TYR A CD1  2  
ATOM   1232  C CD2  . TYR A 1 37 ? 6.462  11.921 -4.538  1.00 0.00 ? 54 TYR A CD2  2  
ATOM   1233  C CE1  . TYR A 1 37 ? 8.563  10.528 -5.656  1.00 0.00 ? 54 TYR A CE1  2  
ATOM   1234  C CE2  . TYR A 1 37 ? 6.244  11.117 -5.641  1.00 0.00 ? 54 TYR A CE2  2  
ATOM   1235  C CZ   . TYR A 1 37 ? 7.299  10.421 -6.196  1.00 0.00 ? 54 TYR A CZ   2  
ATOM   1236  O OH   . TYR A 1 37 ? 7.087  9.620  -7.295  1.00 0.00 ? 54 TYR A OH   2  
ATOM   1237  H H    . TYR A 1 37 ? 5.987  11.991 -1.215  1.00 0.00 ? 54 TYR A H    2  
ATOM   1238  H HA   . TYR A 1 37 ? 8.898  11.411 -1.578  1.00 0.00 ? 54 TYR A HA   2  
ATOM   1239  H HB2  . TYR A 1 37 ? 7.115  13.606 -2.651  1.00 0.00 ? 54 TYR A HB2  2  
ATOM   1240  H HB3  . TYR A 1 37 ? 8.873  13.499 -2.912  1.00 0.00 ? 54 TYR A HB3  2  
ATOM   1241  H HD1  . TYR A 1 37 ? 9.767  11.424 -4.122  1.00 0.00 ? 54 TYR A HD1  2  
ATOM   1242  H HD2  . TYR A 1 37 ? 5.634  12.472 -4.093  1.00 0.00 ? 54 TYR A HD2  2  
ATOM   1243  H HE1  . TYR A 1 37 ? 9.398  9.980  -6.094  1.00 0.00 ? 54 TYR A HE1  2  
ATOM   1244  H HE2  . TYR A 1 37 ? 5.246  11.030 -6.070  1.00 0.00 ? 54 TYR A HE2  2  
ATOM   1245  H HH   . TYR A 1 37 ? 6.164  9.389  -7.419  1.00 0.00 ? 54 TYR A HH   2  
ATOM   1246  N N    . ASP A 1 38 ? 9.760  12.860 0.166   1.00 0.00 ? 55 ASP A N    2  
ATOM   1247  C CA   . ASP A 1 38 ? 10.358 13.753 1.151   1.00 0.00 ? 55 ASP A CA   2  
ATOM   1248  C C    . ASP A 1 38 ? 11.373 14.686 0.503   1.00 0.00 ? 55 ASP A C    2  
ATOM   1249  O O    . ASP A 1 38 ? 12.523 14.309 0.277   1.00 0.00 ? 55 ASP A O    2  
ATOM   1250  C CB   . ASP A 1 38 ? 11.023 12.951 2.271   1.00 0.00 ? 55 ASP A CB   2  
ATOM   1251  C CG   . ASP A 1 38 ? 11.644 13.800 3.372   1.00 0.00 ? 55 ASP A CG   2  
ATOM   1252  O OD1  . ASP A 1 38 ? 11.663 14.999 3.230   1.00 0.00 ? 55 ASP A OD1  2  
ATOM   1253  O OD2  . ASP A 1 38 ? 11.950 13.261 4.409   1.00 0.00 ? 55 ASP A OD2  2  
ATOM   1254  H H    . ASP A 1 38 ? 10.273 12.044 -0.133  1.00 0.00 ? 55 ASP A H    2  
ATOM   1255  H HA   . ASP A 1 38 ? 9.589  14.389 1.588   1.00 0.00 ? 55 ASP A HA   2  
ATOM   1256  H HB2  . ASP A 1 38 ? 10.368 12.201 2.717   1.00 0.00 ? 55 ASP A HB2  2  
ATOM   1257  H HB3  . ASP A 1 38 ? 11.814 12.453 1.707   1.00 0.00 ? 55 ASP A HB3  2  
ATOM   1258  N N    . ARG A 1 39 ? 10.942 15.907 0.206   1.00 0.00 ? 56 ARG A N    2  
ATOM   1259  C CA   . ARG A 1 39 ? 11.774 16.858 -0.522  1.00 0.00 ? 56 ARG A CA   2  
ATOM   1260  C C    . ARG A 1 39 ? 12.667 17.649 0.425   1.00 0.00 ? 56 ARG A C    2  
ATOM   1261  O O    . ARG A 1 39 ? 12.237 18.054 1.505   1.00 0.00 ? 56 ARG A O    2  
ATOM   1262  C CB   . ARG A 1 39 ? 10.950 17.780 -1.410  1.00 0.00 ? 56 ARG A CB   2  
ATOM   1263  C CG   . ARG A 1 39 ? 11.747 18.534 -2.462  1.00 0.00 ? 56 ARG A CG   2  
ATOM   1264  C CD   . ARG A 1 39 ? 10.927 19.403 -3.345  1.00 0.00 ? 56 ARG A CD   2  
ATOM   1265  N NE   . ARG A 1 39 ? 10.436 20.615 -2.709  1.00 0.00 ? 56 ARG A NE   2  
ATOM   1266  C CZ   . ARG A 1 39 ? 9.553  21.468 -3.265  1.00 0.00 ? 56 ARG A CZ   2  
ATOM   1267  N NH1  . ARG A 1 39 ? 9.092  21.267 -4.480  1.00 0.00 ? 56 ARG A NH1  2  
ATOM   1268  N NH2  . ARG A 1 39 ? 9.181  22.526 -2.566  1.00 0.00 ? 56 ARG A NH2  2  
ATOM   1269  H H    . ARG A 1 39 ? 10.014 16.185 0.492   1.00 0.00 ? 56 ARG A H    2  
ATOM   1270  H HA   . ARG A 1 39 ? 12.439 16.322 -1.201  1.00 0.00 ? 56 ARG A HA   2  
ATOM   1271  H HB2  . ARG A 1 39 ? 10.201 17.162 -1.901  1.00 0.00 ? 56 ARG A HB2  2  
ATOM   1272  H HB3  . ARG A 1 39 ? 10.457 18.496 -0.753  1.00 0.00 ? 56 ARG A HB3  2  
ATOM   1273  H HG2  . ARG A 1 39 ? 12.480 19.164 -1.959  1.00 0.00 ? 56 ARG A HG2  2  
ATOM   1274  H HG3  . ARG A 1 39 ? 12.264 17.808 -3.092  1.00 0.00 ? 56 ARG A HG3  2  
ATOM   1275  H HD2  . ARG A 1 39 ? 11.528 19.706 -4.202  1.00 0.00 ? 56 ARG A HD2  2  
ATOM   1276  H HD3  . ARG A 1 39 ? 10.060 18.841 -3.689  1.00 0.00 ? 56 ARG A HD3  2  
ATOM   1277  H HE   . ARG A 1 39 ? 10.656 21.001 -1.800  1.00 0.00 ? 56 ARG A HE   2  
ATOM   1278  H HH11 . ARG A 1 39 ? 9.400  20.463 -5.008  1.00 0.00 ? 56 ARG A HH11 2  
ATOM   1279  H HH12 . ARG A 1 39 ? 8.431  21.918 -4.879  1.00 0.00 ? 56 ARG A HH12 2  
ATOM   1280  H HH21 . ARG A 1 39 ? 9.560  22.674 -1.641  1.00 0.00 ? 56 ARG A HH21 2  
ATOM   1281  H HH22 . ARG A 1 39 ? 8.522  23.181 -2.959  1.00 0.00 ? 56 ARG A HH22 2  
ATOM   1282  N N    . LYS A 1 40 ? 13.912 17.864 0.015   1.00 0.00 ? 57 LYS A N    2  
ATOM   1283  C CA   . LYS A 1 40 ? 14.837 18.694 0.778   1.00 0.00 ? 57 LYS A CA   2  
ATOM   1284  C C    . LYS A 1 40 ? 14.199 20.025 1.156   1.00 0.00 ? 57 LYS A C    2  
ATOM   1285  O O    . LYS A 1 40 ? 14.388 20.521 2.267   1.00 0.00 ? 57 LYS A O    2  
ATOM   1286  C CB   . LYS A 1 40 ? 16.122 18.933 -0.016  1.00 0.00 ? 57 LYS A CB   2  
ATOM   1287  C CG   . LYS A 1 40 ? 17.150 19.800 0.698   1.00 0.00 ? 57 LYS A CG   2  
ATOM   1288  C CD   . LYS A 1 40 ? 18.423 19.938 -0.122  1.00 0.00 ? 57 LYS A CD   2  
ATOM   1289  C CE   . LYS A 1 40 ? 19.439 20.832 0.575   1.00 0.00 ? 57 LYS A CE   2  
ATOM   1290  N NZ   . LYS A 1 40 ? 20.698 20.957 -0.207  1.00 0.00 ? 57 LYS A NZ   2  
ATOM   1291  H H    . LYS A 1 40 ? 14.226 17.443 -0.847  1.00 0.00 ? 57 LYS A H    2  
ATOM   1292  H HA   . LYS A 1 40 ? 15.094 18.196 1.714   1.00 0.00 ? 57 LYS A HA   2  
ATOM   1293  H HB2  . LYS A 1 40 ? 16.555 17.954 -0.223  1.00 0.00 ? 57 LYS A HB2  2  
ATOM   1294  H HB3  . LYS A 1 40 ? 15.835 19.408 -0.953  1.00 0.00 ? 57 LYS A HB3  2  
ATOM   1295  H HG2  . LYS A 1 40 ? 16.715 20.788 0.863   1.00 0.00 ? 57 LYS A HG2  2  
ATOM   1296  H HG3  . LYS A 1 40 ? 17.384 19.342 1.659   1.00 0.00 ? 57 LYS A HG3  2  
ATOM   1297  H HD2  . LYS A 1 40 ? 18.852 18.945 -0.267  1.00 0.00 ? 57 LYS A HD2  2  
ATOM   1298  H HD3  . LYS A 1 40 ? 18.168 20.367 -1.091  1.00 0.00 ? 57 LYS A HD3  2  
ATOM   1299  H HE2  . LYS A 1 40 ? 18.994 21.817 0.706   1.00 0.00 ? 57 LYS A HE2  2  
ATOM   1300  H HE3  . LYS A 1 40 ? 19.660 20.401 1.552   1.00 0.00 ? 57 LYS A HE3  2  
ATOM   1301  H HZ1  . LYS A 1 40 ? 20.495 21.358 -1.112  1.00 0.00 ? 57 LYS A HZ1  2  
ATOM   1302  H HZ2  . LYS A 1 40 ? 21.344 21.557 0.289   1.00 0.00 ? 57 LYS A HZ2  2  
ATOM   1303  H HZ3  . LYS A 1 40 ? 21.113 20.044 -0.328  1.00 0.00 ? 57 LYS A HZ3  2  
ATOM   1304  N N    . PHE A 1 41 ? 13.445 20.599 0.225   1.00 0.00 ? 58 PHE A N    2  
ATOM   1305  C CA   . PHE A 1 41 ? 12.758 21.862 0.469   1.00 0.00 ? 58 PHE A CA   2  
ATOM   1306  C C    . PHE A 1 41 ? 11.248 21.666 0.517   1.00 0.00 ? 58 PHE A C    2  
ATOM   1307  O O    . PHE A 1 41 ? 10.487 22.505 0.034   1.00 0.00 ? 58 PHE A O    2  
ATOM   1308  C CB   . PHE A 1 41 ? 13.121 22.885 -0.610  1.00 0.00 ? 58 PHE A CB   2  
ATOM   1309  C CG   . PHE A 1 41 ? 14.589 23.192 -0.683  1.00 0.00 ? 58 PHE A CG   2  
ATOM   1310  C CD1  . PHE A 1 41 ? 15.201 23.961 0.295   1.00 0.00 ? 58 PHE A CD1  2  
ATOM   1311  C CD2  . PHE A 1 41 ? 15.362 22.712 -1.730  1.00 0.00 ? 58 PHE A CD2  2  
ATOM   1312  C CE1  . PHE A 1 41 ? 16.552 24.246 0.230   1.00 0.00 ? 58 PHE A CE1  2  
ATOM   1313  C CE2  . PHE A 1 41 ? 16.713 22.994 -1.798  1.00 0.00 ? 58 PHE A CE2  2  
ATOM   1314  C CZ   . PHE A 1 41 ? 17.309 23.761 -0.818  1.00 0.00 ? 58 PHE A CZ   2  
ATOM   1315  H H    . PHE A 1 41 ? 13.345 20.149 -0.673  1.00 0.00 ? 58 PHE A H    2  
ATOM   1316  H HA   . PHE A 1 41 ? 13.050 22.261 1.441   1.00 0.00 ? 58 PHE A HA   2  
ATOM   1317  H HB2  . PHE A 1 41 ? 12.832 22.513 -1.592  1.00 0.00 ? 58 PHE A HB2  2  
ATOM   1318  H HB3  . PHE A 1 41 ? 12.614 23.829 -0.416  1.00 0.00 ? 58 PHE A HB3  2  
ATOM   1319  H HD1  . PHE A 1 41 ? 14.604 24.343 1.124   1.00 0.00 ? 58 PHE A HD1  2  
ATOM   1320  H HD2  . PHE A 1 41 ? 14.892 22.106 -2.505  1.00 0.00 ? 58 PHE A HD2  2  
ATOM   1321  H HE1  . PHE A 1 41 ? 17.021 24.852 1.004   1.00 0.00 ? 58 PHE A HE1  2  
ATOM   1322  H HE2  . PHE A 1 41 ? 17.309 22.610 -2.625  1.00 0.00 ? 58 PHE A HE2  2  
ATOM   1323  H HZ   . PHE A 1 41 ? 18.373 23.983 -0.870  1.00 0.00 ? 58 PHE A HZ   2  
ATOM   1324  N N    . LEU A 1 42 ? 10.818 20.554 1.104   1.00 0.00 ? 59 LEU A N    2  
ATOM   1325  C CA   . LEU A 1 42 ? 9.401  20.221 1.172   1.00 0.00 ? 59 LEU A CA   2  
ATOM   1326  C C    . LEU A 1 42 ? 8.617  21.297 1.912   1.00 0.00 ? 59 LEU A C    2  
ATOM   1327  O O    . LEU A 1 42 ? 9.056  21.798 2.947   1.00 0.00 ? 59 LEU A O    2  
ATOM   1328  C CB   . LEU A 1 42 ? 9.208  18.859 1.850   1.00 0.00 ? 59 LEU A CB   2  
ATOM   1329  C CG   . LEU A 1 42 ? 7.807  18.250 1.706   1.00 0.00 ? 59 LEU A CG   2  
ATOM   1330  C CD1  . LEU A 1 42 ? 7.542  17.887 0.252   1.00 0.00 ? 59 LEU A CD1  2  
ATOM   1331  C CD2  . LEU A 1 42 ? 7.691  17.024 2.599   1.00 0.00 ? 59 LEU A CD2  2  
ATOM   1332  H H    . LEU A 1 42 ? 11.493 19.923 1.514   1.00 0.00 ? 59 LEU A H    2  
ATOM   1333  H HA   . LEU A 1 42 ? 8.989  20.176 0.164   1.00 0.00 ? 59 LEU A HA   2  
ATOM   1334  H HB2  . LEU A 1 42 ? 9.929  18.274 1.280   1.00 0.00 ? 59 LEU A HB2  2  
ATOM   1335  H HB3  . LEU A 1 42 ? 9.507  18.883 2.897   1.00 0.00 ? 59 LEU A HB3  2  
ATOM   1336  H HG   . LEU A 1 42 ? 7.094  18.993 2.065   1.00 0.00 ? 59 LEU A HG   2  
ATOM   1337  H HD11 . LEU A 1 42 ? 6.545  17.456 0.160   1.00 0.00 ? 59 LEU A HD11 2  
ATOM   1338  H HD12 . LEU A 1 42 ? 7.608  18.783 -0.365  1.00 0.00 ? 59 LEU A HD12 2  
ATOM   1339  H HD13 . LEU A 1 42 ? 8.283  17.161 -0.082  1.00 0.00 ? 59 LEU A HD13 2  
ATOM   1340  H HD21 . LEU A 1 42 ? 7.856  17.313 3.638   1.00 0.00 ? 59 LEU A HD21 2  
ATOM   1341  H HD22 . LEU A 1 42 ? 6.694  16.594 2.497   1.00 0.00 ? 59 LEU A HD22 2  
ATOM   1342  H HD23 . LEU A 1 42 ? 8.438  16.287 2.304   1.00 0.00 ? 59 LEU A HD23 2  
ATOM   1343  N N    . LEU A 1 43 ? 7.454  21.650 1.373   1.00 0.00 ? 60 LEU A N    2  
ATOM   1344  C CA   . LEU A 1 43 ? 6.620  22.688 1.966   1.00 0.00 ? 60 LEU A CA   2  
ATOM   1345  C C    . LEU A 1 43 ? 6.164  22.296 3.367   1.00 0.00 ? 60 LEU A C    2  
ATOM   1346  O O    . LEU A 1 43 ? 6.038  23.144 4.249   1.00 0.00 ? 60 LEU A O    2  
ATOM   1347  C CB   . LEU A 1 43 ? 5.407  22.969 1.070   1.00 0.00 ? 60 LEU A CB   2  
ATOM   1348  C CG   . LEU A 1 43 ? 5.729  23.631 -0.275  1.00 0.00 ? 60 LEU A CG   2  
ATOM   1349  C CD1  . LEU A 1 43 ? 4.478  23.689 -1.141  1.00 0.00 ? 60 LEU A CD1  2  
ATOM   1350  C CD2  . LEU A 1 43 ? 6.284  25.027 -0.036  1.00 0.00 ? 60 LEU A CD2  2  
ATOM   1351  H H    . LEU A 1 43 ? 7.140  21.187 0.533   1.00 0.00 ? 60 LEU A H    2  
ATOM   1352  H HA   . LEU A 1 43 ? 7.198  23.604 2.075   1.00 0.00 ? 60 LEU A HA   2  
ATOM   1353  H HB2  . LEU A 1 43 ? 5.064  21.948 0.912   1.00 0.00 ? 60 LEU A HB2  2  
ATOM   1354  H HB3  . LEU A 1 43 ? 4.638  23.534 1.597   1.00 0.00 ? 60 LEU A HB3  2  
ATOM   1355  H HG   . LEU A 1 43 ? 6.512  23.038 -0.748  1.00 0.00 ? 60 LEU A HG   2  
ATOM   1356  H HD11 . LEU A 1 43 ? 4.717  24.161 -2.095  1.00 0.00 ? 60 LEU A HD11 2  
ATOM   1357  H HD12 . LEU A 1 43 ? 4.112  22.678 -1.319  1.00 0.00 ? 60 LEU A HD12 2  
ATOM   1358  H HD13 . LEU A 1 43 ? 3.710  24.270 -0.632  1.00 0.00 ? 60 LEU A HD13 2  
ATOM   1359  H HD21 . LEU A 1 43 ? 7.194  24.960 0.562   1.00 0.00 ? 60 LEU A HD21 2  
ATOM   1360  H HD22 . LEU A 1 43 ? 6.513  25.496 -0.993  1.00 0.00 ? 60 LEU A HD22 2  
ATOM   1361  H HD23 . LEU A 1 43 ? 5.545  25.627 0.496   1.00 0.00 ? 60 LEU A HD23 2  
ATOM   1362  N N    . ASP A 1 44 ? 5.919  21.004 3.563   1.00 0.00 ? 61 ASP A N    2  
ATOM   1363  C CA   . ASP A 1 44 ? 5.547  20.487 4.875   1.00 0.00 ? 61 ASP A CA   2  
ATOM   1364  C C    . ASP A 1 44 ? 6.761  20.379 5.789   1.00 0.00 ? 61 ASP A C    2  
ATOM   1365  O O    . ASP A 1 44 ? 7.298  19.291 5.997   1.00 0.00 ? 61 ASP A O    2  
ATOM   1366  C CB   . ASP A 1 44 ? 4.867  19.122 4.739   1.00 0.00 ? 61 ASP A CB   2  
ATOM   1367  C CG   . ASP A 1 44 ? 4.293  18.574 6.039   1.00 0.00 ? 61 ASP A CG   2  
ATOM   1368  O OD1  . ASP A 1 44 ? 4.332  19.272 7.024   1.00 0.00 ? 61 ASP A OD1  2  
ATOM   1369  O OD2  . ASP A 1 44 ? 3.681  17.533 6.002   1.00 0.00 ? 61 ASP A OD2  2  
ATOM   1370  H H    . ASP A 1 44 ? 5.992  20.365 2.785   1.00 0.00 ? 61 ASP A H    2  
ATOM   1371  H HA   . ASP A 1 44 ? 4.853  21.174 5.360   1.00 0.00 ? 61 ASP A HA   2  
ATOM   1372  H HB2  . ASP A 1 44 ? 4.102  19.093 3.963   1.00 0.00 ? 61 ASP A HB2  2  
ATOM   1373  H HB3  . ASP A 1 44 ? 5.719  18.513 4.434   1.00 0.00 ? 61 ASP A HB3  2  
ATOM   1374  N N    . ARG A 1 45 ? 7.187  21.513 6.334   1.00 0.00 ? 62 ARG A N    2  
ATOM   1375  C CA   . ARG A 1 45 ? 8.334  21.546 7.234   1.00 0.00 ? 62 ARG A CA   2  
ATOM   1376  C C    . ARG A 1 45 ? 7.942  21.111 8.640   1.00 0.00 ? 62 ARG A C    2  
ATOM   1377  O O    . ARG A 1 45 ? 7.835  19.945 8.899   1.00 0.00 ? 62 ARG A O    2  
ATOM   1378  C CB   . ARG A 1 45 ? 9.019  22.906 7.241   1.00 0.00 ? 62 ARG A CB   2  
ATOM   1379  C CG   . ARG A 1 45 ? 9.669  23.301 5.926   1.00 0.00 ? 62 ARG A CG   2  
ATOM   1380  C CD   . ARG A 1 45 ? 10.258 24.665 5.920   1.00 0.00 ? 62 ARG A CD   2  
ATOM   1381  N NE   . ARG A 1 45 ? 9.282  25.742 5.970   1.00 0.00 ? 62 ARG A NE   2  
ATOM   1382  C CZ   . ARG A 1 45 ? 9.582  27.034 6.204   1.00 0.00 ? 62 ARG A CZ   2  
ATOM   1383  N NH1  . ARG A 1 45 ? 10.818 27.410 6.447   1.00 0.00 ? 62 ARG A NH1  2  
ATOM   1384  N NH2  . ARG A 1 45 ? 8.595  27.913 6.207   1.00 0.00 ? 62 ARG A NH2  2  
ATOM   1385  O OXT  . ARG A 1 45 ? 7.742  21.935 9.489   1.00 0.00 ? 62 ARG A OXT  2  
ATOM   1386  H H    . ARG A 1 45 ? 6.705  22.374 6.118   1.00 0.00 ? 62 ARG A H    2  
ATOM   1387  H HA   . ARG A 1 45 ? 9.093  20.843 6.891   1.00 0.00 ? 62 ARG A HA   2  
ATOM   1388  H HB2  . ARG A 1 45 ? 8.260  23.642 7.503   1.00 0.00 ? 62 ARG A HB2  2  
ATOM   1389  H HB3  . ARG A 1 45 ? 9.778  22.874 8.023   1.00 0.00 ? 62 ARG A HB3  2  
ATOM   1390  H HG2  . ARG A 1 45 ? 10.467 22.590 5.706   1.00 0.00 ? 62 ARG A HG2  2  
ATOM   1391  H HG3  . ARG A 1 45 ? 8.915  23.255 5.139   1.00 0.00 ? 62 ARG A HG3  2  
ATOM   1392  H HD2  . ARG A 1 45 ? 10.908 24.773 6.786   1.00 0.00 ? 62 ARG A HD2  2  
ATOM   1393  H HD3  . ARG A 1 45 ? 10.841 24.794 5.009   1.00 0.00 ? 62 ARG A HD3  2  
ATOM   1394  H HE   . ARG A 1 45 ? 8.279  25.709 5.846   1.00 0.00 ? 62 ARG A HE   2  
ATOM   1395  H HH11 . ARG A 1 45 ? 11.558 26.724 6.459   1.00 0.00 ? 62 ARG A HH11 2  
ATOM   1396  H HH12 . ARG A 1 45 ? 11.021 28.384 6.620   1.00 0.00 ? 62 ARG A HH12 2  
ATOM   1397  H HH21 . ARG A 1 45 ? 7.647  27.604 6.036   1.00 0.00 ? 62 ARG A HH21 2  
ATOM   1398  H HH22 . ARG A 1 45 ? 8.790  28.887 6.381   1.00 0.00 ? 62 ARG A HH22 2  
ATOM   1399  N N    . PRO A 1 1  ? 0.218  -0.299 -0.558  1.00 0.00 ? 18 PRO A N    3  
ATOM   1400  C CA   . PRO A 1 1  ? 1.674  -0.249 -0.508  1.00 0.00 ? 18 PRO A CA   3  
ATOM   1401  C C    . PRO A 1 1  ? 2.172  1.183  -0.359  1.00 0.00 ? 18 PRO A C    3  
ATOM   1402  O O    . PRO A 1 1  ? 1.761  2.074  -1.103  1.00 0.00 ? 18 PRO A O    3  
ATOM   1403  C CB   . PRO A 1 1  ? 2.116  -0.878 -1.833  1.00 0.00 ? 18 PRO A CB   3  
ATOM   1404  C CG   . PRO A 1 1  ? 0.918  -1.626 -2.307  1.00 0.00 ? 18 PRO A CG   3  
ATOM   1405  C CD   . PRO A 1 1  ? -0.265 -0.826 -1.832  1.00 0.00 ? 18 PRO A CD   3  
ATOM   1406  H H2   . PRO A 1 1  ? -0.242 -0.677 -1.362  1.00 0.00 ? 18 PRO A H2   3  
ATOM   1407  H H3   . PRO A 1 1  ? -0.288 -0.816 0.131   1.00 0.00 ? 18 PRO A H3   3  
ATOM   1408  H HA   . PRO A 1 1  ? 2.089  -0.784 0.358   1.00 0.00 ? 18 PRO A HA   3  
ATOM   1409  H HB2  . PRO A 1 1  ? 2.421  -0.111 -2.561  1.00 0.00 ? 18 PRO A HB2  3  
ATOM   1410  H HB3  . PRO A 1 1  ? 2.976  -1.550 -1.694  1.00 0.00 ? 18 PRO A HB3  3  
ATOM   1411  H HG2  . PRO A 1 1  ? 0.916  -1.721 -3.403  1.00 0.00 ? 18 PRO A HG2  3  
ATOM   1412  H HG3  . PRO A 1 1  ? 0.897  -2.646 -1.896  1.00 0.00 ? 18 PRO A HG3  3  
ATOM   1413  H HD2  . PRO A 1 1  ? -0.532 -0.021 -2.533  1.00 0.00 ? 18 PRO A HD2  3  
ATOM   1414  H HD3  . PRO A 1 1  ? -1.164 -1.449 -1.703  1.00 0.00 ? 18 PRO A HD3  3  
ATOM   1415  N N    . THR A 1 2  ? 3.059  1.399  0.606   1.00 0.00 ? 19 THR A N    3  
ATOM   1416  C CA   . THR A 1 2  ? 3.627  2.720  0.844   1.00 0.00 ? 19 THR A CA   3  
ATOM   1417  C C    . THR A 1 2  ? 5.125  2.733  0.566   1.00 0.00 ? 19 THR A C    3  
ATOM   1418  O O    . THR A 1 2  ? 5.877  1.935  1.124   1.00 0.00 ? 19 THR A O    3  
ATOM   1419  C CB   . THR A 1 2  ? 3.380  3.190  2.290   1.00 0.00 ? 19 THR A CB   3  
ATOM   1420  O OG1  . THR A 1 2  ? 1.969  3.259  2.537   1.00 0.00 ? 19 THR A OG1  3  
ATOM   1421  C CG2  . THR A 1 2  ? 3.999  4.561  2.518   1.00 0.00 ? 19 THR A CG2  3  
ATOM   1422  H H    . THR A 1 2  ? 3.347  0.627  1.191   1.00 0.00 ? 19 THR A H    3  
ATOM   1423  H HA   . THR A 1 2  ? 3.180  3.442  0.161   1.00 0.00 ? 19 THR A HA   3  
ATOM   1424  H HB   . THR A 1 2  ? 3.826  2.472  2.977   1.00 0.00 ? 19 THR A HB   3  
ATOM   1425  H HG1  . THR A 1 2  ? 1.818  3.551  3.440   1.00 0.00 ? 19 THR A HG1  3  
ATOM   1426  H HG21 . THR A 1 2  ? 3.552  5.280  1.832   1.00 0.00 ? 19 THR A HG21 3  
ATOM   1427  H HG22 . THR A 1 2  ? 3.814  4.875  3.545   1.00 0.00 ? 19 THR A HG22 3  
ATOM   1428  H HG23 . THR A 1 2  ? 5.073  4.509  2.341   1.00 0.00 ? 19 THR A HG23 3  
ATOM   1429  N N    . ARG A 1 3  ? 5.552  3.646  -0.301  1.00 0.00 ? 20 ARG A N    3  
ATOM   1430  C CA   . ARG A 1 3  ? 6.962  3.770  -0.648  1.00 0.00 ? 20 ARG A CA   3  
ATOM   1431  C C    . ARG A 1 3  ? 7.489  5.163  -0.323  1.00 0.00 ? 20 ARG A C    3  
ATOM   1432  O O    . ARG A 1 3  ? 6.908  6.168  -0.733  1.00 0.00 ? 20 ARG A O    3  
ATOM   1433  C CB   . ARG A 1 3  ? 7.230  3.398  -2.099  1.00 0.00 ? 20 ARG A CB   3  
ATOM   1434  C CG   . ARG A 1 3  ? 8.677  3.554  -2.543  1.00 0.00 ? 20 ARG A CG   3  
ATOM   1435  C CD   . ARG A 1 3  ? 8.931  3.156  -3.951  1.00 0.00 ? 20 ARG A CD   3  
ATOM   1436  N NE   . ARG A 1 3  ? 10.306 3.339  -4.390  1.00 0.00 ? 20 ARG A NE   3  
ATOM   1437  C CZ   . ARG A 1 3  ? 10.778 2.977  -5.599  1.00 0.00 ? 20 ARG A CZ   3  
ATOM   1438  N NH1  . ARG A 1 3  ? 10.003 2.379  -6.476  1.00 0.00 ? 20 ARG A NH1  3  
ATOM   1439  N NH2  . ARG A 1 3  ? 12.049 3.216  -5.870  1.00 0.00 ? 20 ARG A NH2  3  
ATOM   1440  H H    . ARG A 1 3  ? 4.883  4.270  -0.729  1.00 0.00 ? 20 ARG A H    3  
ATOM   1441  H HA   . ARG A 1 3  ? 7.552  3.069  -0.057  1.00 0.00 ? 20 ARG A HA   3  
ATOM   1442  H HB2  . ARG A 1 3  ? 6.927  2.360  -2.223  1.00 0.00 ? 20 ARG A HB2  3  
ATOM   1443  H HB3  . ARG A 1 3  ? 6.597  4.038  -2.713  1.00 0.00 ? 20 ARG A HB3  3  
ATOM   1444  H HG2  . ARG A 1 3  ? 8.963  4.600  -2.432  1.00 0.00 ? 20 ARG A HG2  3  
ATOM   1445  H HG3  . ARG A 1 3  ? 9.305  2.937  -1.899  1.00 0.00 ? 20 ARG A HG3  3  
ATOM   1446  H HD2  . ARG A 1 3  ? 8.689  2.101  -4.070  1.00 0.00 ? 20 ARG A HD2  3  
ATOM   1447  H HD3  . ARG A 1 3  ? 8.297  3.752  -4.607  1.00 0.00 ? 20 ARG A HD3  3  
ATOM   1448  H HE   . ARG A 1 3  ? 11.091 3.742  -3.897  1.00 0.00 ? 20 ARG A HE   3  
ATOM   1449  H HH11 . ARG A 1 3  ? 9.038  2.187  -6.247  1.00 0.00 ? 20 ARG A HH11 3  
ATOM   1450  H HH12 . ARG A 1 3  ? 10.376 2.116  -7.377  1.00 0.00 ? 20 ARG A HH12 3  
ATOM   1451  H HH21 . ARG A 1 3  ? 12.635 3.660  -5.176  1.00 0.00 ? 20 ARG A HH21 3  
ATOM   1452  H HH22 . ARG A 1 3  ? 12.429 2.954  -6.768  1.00 0.00 ? 20 ARG A HH22 3  
ATOM   1453  N N    . THR A 1 4  ? 8.592  5.214  0.415   1.00 0.00 ? 21 THR A N    3  
ATOM   1454  C CA   . THR A 1 4  ? 9.209  6.483  0.783   1.00 0.00 ? 21 THR A CA   3  
ATOM   1455  C C    . THR A 1 4  ? 10.376 6.816  -0.137  1.00 0.00 ? 21 THR A C    3  
ATOM   1456  O O    . THR A 1 4  ? 11.338 6.055  -0.237  1.00 0.00 ? 21 THR A O    3  
ATOM   1457  C CB   . THR A 1 4  ? 9.707  6.468  2.240   1.00 0.00 ? 21 THR A CB   3  
ATOM   1458  O OG1  . THR A 1 4  ? 8.601  6.244  3.124   1.00 0.00 ? 21 THR A OG1  3  
ATOM   1459  C CG2  . THR A 1 4  ? 10.372 7.791  2.591   1.00 0.00 ? 21 THR A CG2  3  
ATOM   1460  H H    . THR A 1 4  ? 9.015  4.352  0.730   1.00 0.00 ? 21 THR A H    3  
ATOM   1461  H HA   . THR A 1 4  ? 8.487  7.291  0.670   1.00 0.00 ? 21 THR A HA   3  
ATOM   1462  H HB   . THR A 1 4  ? 10.426 5.657  2.361   1.00 0.00 ? 21 THR A HB   3  
ATOM   1463  H HG1  . THR A 1 4  ? 8.913  6.235  4.032   1.00 0.00 ? 21 THR A HG1  3  
ATOM   1464  H HG21 . THR A 1 4  ? 9.653  8.600  2.471   1.00 0.00 ? 21 THR A HG21 3  
ATOM   1465  H HG22 . THR A 1 4  ? 10.718 7.760  3.624   1.00 0.00 ? 21 THR A HG22 3  
ATOM   1466  H HG23 . THR A 1 4  ? 11.221 7.957  1.928   1.00 0.00 ? 21 THR A HG23 3  
ATOM   1467  N N    . VAL A 1 5  ? 10.285 7.958  -0.811  1.00 0.00 ? 22 VAL A N    3  
ATOM   1468  C CA   . VAL A 1 5  ? 11.342 8.404  -1.711  1.00 0.00 ? 22 VAL A CA   3  
ATOM   1469  C C    . VAL A 1 5  ? 11.824 9.801  -1.344  1.00 0.00 ? 22 VAL A C    3  
ATOM   1470  O O    . VAL A 1 5  ? 11.033 10.740 -1.262  1.00 0.00 ? 22 VAL A O    3  
ATOM   1471  C CB   . VAL A 1 5  ? 10.873 8.401  -3.178  1.00 0.00 ? 22 VAL A CB   3  
ATOM   1472  C CG1  . VAL A 1 5  ? 11.966 8.944  -4.087  1.00 0.00 ? 22 VAL A CG1  3  
ATOM   1473  C CG2  . VAL A 1 5  ? 10.472 6.999  -3.607  1.00 0.00 ? 22 VAL A CG2  3  
ATOM   1474  H H    . VAL A 1 5  ? 9.462  8.532  -0.696  1.00 0.00 ? 22 VAL A H    3  
ATOM   1475  H HA   . VAL A 1 5  ? 12.227 7.771  -1.627  1.00 0.00 ? 22 VAL A HA   3  
ATOM   1476  H HB   . VAL A 1 5  ? 9.985  9.026  -3.266  1.00 0.00 ? 22 VAL A HB   3  
ATOM   1477  H HG11 . VAL A 1 5  ? 11.619 8.935  -5.120  1.00 0.00 ? 22 VAL A HG11 3  
ATOM   1478  H HG12 . VAL A 1 5  ? 12.210 9.965  -3.795  1.00 0.00 ? 22 VAL A HG12 3  
ATOM   1479  H HG13 . VAL A 1 5  ? 12.856 8.319  -3.999  1.00 0.00 ? 22 VAL A HG13 3  
ATOM   1480  H HG21 . VAL A 1 5  ? 9.659  6.643  -2.976  1.00 0.00 ? 22 VAL A HG21 3  
ATOM   1481  H HG22 . VAL A 1 5  ? 10.144 7.016  -4.646  1.00 0.00 ? 22 VAL A HG22 3  
ATOM   1482  H HG23 . VAL A 1 5  ? 11.328 6.330  -3.508  1.00 0.00 ? 22 VAL A HG23 3  
ATOM   1483  N N    . ALA A 1 6  ? 13.129 9.932  -1.124  1.00 0.00 ? 23 ALA A N    3  
ATOM   1484  C CA   . ALA A 1 6  ? 13.732 11.230 -0.847  1.00 0.00 ? 23 ALA A CA   3  
ATOM   1485  C C    . ALA A 1 6  ? 14.021 11.990 -2.135  1.00 0.00 ? 23 ALA A C    3  
ATOM   1486  O O    . ALA A 1 6  ? 14.429 11.401 -3.136  1.00 0.00 ? 23 ALA A O    3  
ATOM   1487  C CB   . ALA A 1 6  ? 15.005 11.060 -0.031  1.00 0.00 ? 23 ALA A CB   3  
ATOM   1488  H H    . ALA A 1 6  ? 13.716 9.112  -1.150  1.00 0.00 ? 23 ALA A H    3  
ATOM   1489  H HA   . ALA A 1 6  ? 13.026 11.827 -0.269  1.00 0.00 ? 23 ALA A HA   3  
ATOM   1490  H HB1  . ALA A 1 6  ? 15.715 10.452 -0.589  1.00 0.00 ? 23 ALA A HB1  3  
ATOM   1491  H HB2  . ALA A 1 6  ? 15.442 12.038 0.168   1.00 0.00 ? 23 ALA A HB2  3  
ATOM   1492  H HB3  . ALA A 1 6  ? 14.769 10.569 0.914   1.00 0.00 ? 23 ALA A HB3  3  
ATOM   1493  N N    . ILE A 1 7  ? 13.808 13.302 -2.103  1.00 0.00 ? 24 ILE A N    3  
ATOM   1494  C CA   . ILE A 1 7  ? 13.979 14.134 -3.287  1.00 0.00 ? 24 ILE A CA   3  
ATOM   1495  C C    . ILE A 1 7  ? 14.959 15.271 -3.026  1.00 0.00 ? 24 ILE A C    3  
ATOM   1496  O O    . ILE A 1 7  ? 14.807 16.024 -2.064  1.00 0.00 ? 24 ILE A O    3  
ATOM   1497  C CB   . ILE A 1 7  ? 12.639 14.724 -3.761  1.00 0.00 ? 24 ILE A CB   3  
ATOM   1498  C CG1  . ILE A 1 7  ? 11.665 13.604 -4.135  1.00 0.00 ? 24 ILE A CG1  3  
ATOM   1499  C CG2  . ILE A 1 7  ? 12.856 15.661 -4.940  1.00 0.00 ? 24 ILE A CG2  3  
ATOM   1500  C CD1  . ILE A 1 7  ? 12.098 12.794 -5.336  1.00 0.00 ? 24 ILE A CD1  3  
ATOM   1501  H H    . ILE A 1 7  ? 13.521 13.733 -1.236  1.00 0.00 ? 24 ILE A H    3  
ATOM   1502  H HA   . ILE A 1 7  ? 14.430 13.563 -4.097  1.00 0.00 ? 24 ILE A HA   3  
ATOM   1503  H HB   . ILE A 1 7  ? 12.182 15.275 -2.939  1.00 0.00 ? 24 ILE A HB   3  
ATOM   1504  H HG12 . ILE A 1 7  ? 11.574 12.950 -3.269  1.00 0.00 ? 24 ILE A HG12 3  
ATOM   1505  H HG13 . ILE A 1 7  ? 10.700 14.068 -4.340  1.00 0.00 ? 24 ILE A HG13 3  
ATOM   1506  H HG21 . ILE A 1 7  ? 11.899 16.068 -5.263  1.00 0.00 ? 24 ILE A HG21 3  
ATOM   1507  H HG22 . ILE A 1 7  ? 13.514 16.475 -4.641  1.00 0.00 ? 24 ILE A HG22 3  
ATOM   1508  H HG23 . ILE A 1 7  ? 13.311 15.109 -5.763  1.00 0.00 ? 24 ILE A HG23 3  
ATOM   1509  H HD11 . ILE A 1 7  ? 13.061 12.328 -5.132  1.00 0.00 ? 24 ILE A HD11 3  
ATOM   1510  H HD12 . ILE A 1 7  ? 11.358 12.019 -5.540  1.00 0.00 ? 24 ILE A HD12 3  
ATOM   1511  H HD13 . ILE A 1 7  ? 12.188 13.447 -6.204  1.00 0.00 ? 24 ILE A HD13 3  
ATOM   1512  N N    . SER A 1 8  ? 15.964 15.388 -3.886  1.00 0.00 ? 25 SER A N    3  
ATOM   1513  C CA   . SER A 1 8  ? 16.992 16.411 -3.728  1.00 0.00 ? 25 SER A CA   3  
ATOM   1514  C C    . SER A 1 8  ? 16.781 17.559 -4.706  1.00 0.00 ? 25 SER A C    3  
ATOM   1515  O O    . SER A 1 8  ? 17.343 18.641 -4.538  1.00 0.00 ? 25 SER A O    3  
ATOM   1516  C CB   . SER A 1 8  ? 18.368 15.801 -3.917  1.00 0.00 ? 25 SER A CB   3  
ATOM   1517  O OG   . SER A 1 8  ? 18.558 15.328 -5.223  1.00 0.00 ? 25 SER A OG   3  
ATOM   1518  H H    . SER A 1 8  ? 16.018 14.754 -4.670  1.00 0.00 ? 25 SER A H    3  
ATOM   1519  H HA   . SER A 1 8  ? 17.065 16.798 -2.711  1.00 0.00 ? 25 SER A HA   3  
ATOM   1520  H HB2  . SER A 1 8  ? 19.118 16.562 -3.703  1.00 0.00 ? 25 SER A HB2  3  
ATOM   1521  H HB3  . SER A 1 8  ? 18.482 14.974 -3.219  1.00 0.00 ? 25 SER A HB3  3  
ATOM   1522  H HG   . SER A 1 8  ? 18.475 16.056 -5.843  1.00 0.00 ? 25 SER A HG   3  
ATOM   1523  N N    . ASP A 1 9  ? 15.968 17.318 -5.728  1.00 0.00 ? 26 ASP A N    3  
ATOM   1524  C CA   . ASP A 1 9  ? 15.705 18.322 -6.752  1.00 0.00 ? 26 ASP A CA   3  
ATOM   1525  C C    . ASP A 1 9  ? 14.411 18.022 -7.499  1.00 0.00 ? 26 ASP A C    3  
ATOM   1526  O O    . ASP A 1 9  ? 13.926 16.890 -7.489  1.00 0.00 ? 26 ASP A O    3  
ATOM   1527  C CB   . ASP A 1 9  ? 16.873 18.403 -7.737  1.00 0.00 ? 26 ASP A CB   3  
ATOM   1528  C CG   . ASP A 1 9  ? 16.969 19.722 -8.492  1.00 0.00 ? 26 ASP A CG   3  
ATOM   1529  O OD1  . ASP A 1 9  ? 16.156 20.583 -8.250  1.00 0.00 ? 26 ASP A OD1  3  
ATOM   1530  O OD2  . ASP A 1 9  ? 17.939 19.917 -9.184  1.00 0.00 ? 26 ASP A OD2  3  
ATOM   1531  H H    . ASP A 1 9  ? 15.519 16.415 -5.797  1.00 0.00 ? 26 ASP A H    3  
ATOM   1532  H HA   . ASP A 1 9  ? 15.573 19.299 -6.286  1.00 0.00 ? 26 ASP A HA   3  
ATOM   1533  H HB2  . ASP A 1 9  ? 17.838 18.173 -7.285  1.00 0.00 ? 26 ASP A HB2  3  
ATOM   1534  H HB3  . ASP A 1 9  ? 16.596 17.608 -8.429  1.00 0.00 ? 26 ASP A HB3  3  
ATOM   1535  N N    . ALA A 1 10 ? 13.857 19.041 -8.146  1.00 0.00 ? 27 ALA A N    3  
ATOM   1536  C CA   . ALA A 1 10 ? 12.606 18.893 -8.880  1.00 0.00 ? 27 ALA A CA   3  
ATOM   1537  C C    . ALA A 1 10 ? 12.776 17.969 -10.078 1.00 0.00 ? 27 ALA A C    3  
ATOM   1538  O O    . ALA A 1 10 ? 11.803 17.409 -10.585 1.00 0.00 ? 27 ALA A O    3  
ATOM   1539  C CB   . ALA A 1 10 ? 12.088 20.254 -9.324  1.00 0.00 ? 27 ALA A CB   3  
ATOM   1540  H H    . ALA A 1 10 ? 14.314 19.941 -8.129  1.00 0.00 ? 27 ALA A H    3  
ATOM   1541  H HA   . ALA A 1 10 ? 11.866 18.438 -8.221  1.00 0.00 ? 27 ALA A HA   3  
ATOM   1542  H HB1  . ALA A 1 10 ? 12.824 20.729 -9.971  1.00 0.00 ? 27 ALA A HB1  3  
ATOM   1543  H HB2  . ALA A 1 10 ? 11.154 20.126 -9.870  1.00 0.00 ? 27 ALA A HB2  3  
ATOM   1544  H HB3  . ALA A 1 10 ? 11.914 20.881 -8.450  1.00 0.00 ? 27 ALA A HB3  3  
ATOM   1545  N N    . ALA A 1 11 ? 14.016 17.814 -10.528 1.00 0.00 ? 28 ALA A N    3  
ATOM   1546  C CA   . ALA A 1 11 ? 14.328 16.890 -11.612 1.00 0.00 ? 28 ALA A CA   3  
ATOM   1547  C C    . ALA A 1 11 ? 13.949 15.461 -11.245 1.00 0.00 ? 28 ALA A C    3  
ATOM   1548  O O    . ALA A 1 11 ? 13.699 14.631 -12.118 1.00 0.00 ? 28 ALA A O    3  
ATOM   1549  C CB   . ALA A 1 11 ? 15.803 16.974 -11.972 1.00 0.00 ? 28 ALA A CB   3  
ATOM   1550  H H    . ALA A 1 11 ? 14.762 18.349 -10.108 1.00 0.00 ? 28 ALA A H    3  
ATOM   1551  H HA   . ALA A 1 11 ? 13.740 17.167 -12.487 1.00 0.00 ? 28 ALA A HA   3  
ATOM   1552  H HB1  . ALA A 1 11 ? 16.405 16.715 -11.102 1.00 0.00 ? 28 ALA A HB1  3  
ATOM   1553  H HB2  . ALA A 1 11 ? 16.020 16.278 -12.783 1.00 0.00 ? 28 ALA A HB2  3  
ATOM   1554  H HB3  . ALA A 1 11 ? 16.044 17.988 -12.291 1.00 0.00 ? 28 ALA A HB3  3  
ATOM   1555  N N    . GLN A 1 12 ? 13.908 15.180 -9.946  1.00 0.00 ? 29 GLN A N    3  
ATOM   1556  C CA   . GLN A 1 12 ? 13.639 13.831 -9.462  1.00 0.00 ? 29 GLN A CA   3  
ATOM   1557  C C    . GLN A 1 12 ? 12.150 13.622 -9.213  1.00 0.00 ? 29 GLN A C    3  
ATOM   1558  O O    . GLN A 1 12 ? 11.715 12.518 -8.887  1.00 0.00 ? 29 GLN A O    3  
ATOM   1559  C CB   . GLN A 1 12 ? 14.422 13.558 -8.175  1.00 0.00 ? 29 GLN A CB   3  
ATOM   1560  C CG   . GLN A 1 12 ? 15.931 13.607 -8.342  1.00 0.00 ? 29 GLN A CG   3  
ATOM   1561  C CD   . GLN A 1 12 ? 16.665 13.433 -7.027  1.00 0.00 ? 29 GLN A CD   3  
ATOM   1562  O OE1  . GLN A 1 12 ? 16.048 13.342 -5.963  1.00 0.00 ? 29 GLN A OE1  3  
ATOM   1563  N NE2  . GLN A 1 12 ? 17.991 13.388 -7.092  1.00 0.00 ? 29 GLN A NE2  3  
ATOM   1564  H H    . GLN A 1 12 ? 14.067 15.921 -9.278  1.00 0.00 ? 29 GLN A H    3  
ATOM   1565  H HA   . GLN A 1 12 ? 13.931 13.106 -10.221 1.00 0.00 ? 29 GLN A HA   3  
ATOM   1566  H HB2  . GLN A 1 12 ? 14.107 14.308 -7.450  1.00 0.00 ? 29 GLN A HB2  3  
ATOM   1567  H HB3  . GLN A 1 12 ? 14.122 12.569 -7.829  1.00 0.00 ? 29 GLN A HB3  3  
ATOM   1568  H HG2  . GLN A 1 12 ? 16.460 13.029 -9.100  1.00 0.00 ? 29 GLN A HG2  3  
ATOM   1569  H HG3  . GLN A 1 12 ? 15.954 14.664 -8.613  1.00 0.00 ? 29 GLN A HG3  3  
ATOM   1570  H HE21 . GLN A 1 12 ? 18.453 13.467 -7.976  1.00 0.00 ? 29 GLN A HE21 3  
ATOM   1571  H HE22 . GLN A 1 12 ? 18.530 13.274 -6.255  1.00 0.00 ? 29 GLN A HE22 3  
ATOM   1572  N N    . LEU A 1 13 ? 11.374 14.689 -9.367  1.00 0.00 ? 30 LEU A N    3  
ATOM   1573  C CA   . LEU A 1 13 ? 9.932  14.623 -9.162  1.00 0.00 ? 30 LEU A CA   3  
ATOM   1574  C C    . LEU A 1 13 ? 9.216  14.165 -10.426 1.00 0.00 ? 30 LEU A C    3  
ATOM   1575  O O    . LEU A 1 13 ? 9.679  14.416 -11.538 1.00 0.00 ? 30 LEU A O    3  
ATOM   1576  C CB   . LEU A 1 13 ? 9.398  15.989 -8.712  1.00 0.00 ? 30 LEU A CB   3  
ATOM   1577  C CG   . LEU A 1 13 ? 9.863  16.446 -7.323  1.00 0.00 ? 30 LEU A CG   3  
ATOM   1578  C CD1  . LEU A 1 13 ? 9.378  17.863 -7.050  1.00 0.00 ? 30 LEU A CD1  3  
ATOM   1579  C CD2  . LEU A 1 13 ? 9.340  15.484 -6.267  1.00 0.00 ? 30 LEU A CD2  3  
ATOM   1580  H H    . LEU A 1 13 ? 11.794 15.569 -9.633  1.00 0.00 ? 30 LEU A H    3  
ATOM   1581  H HA   . LEU A 1 13 ? 9.706  13.885 -8.394  1.00 0.00 ? 30 LEU A HA   3  
ATOM   1582  H HB2  . LEU A 1 13 ? 9.845  16.616 -9.481  1.00 0.00 ? 30 LEU A HB2  3  
ATOM   1583  H HB3  . LEU A 1 13 ? 8.312  16.041 -8.785  1.00 0.00 ? 30 LEU A HB3  3  
ATOM   1584  H HG   . LEU A 1 13 ? 10.953 16.392 -7.313  1.00 0.00 ? 30 LEU A HG   3  
ATOM   1585  H HD11 . LEU A 1 13 ? 9.714  18.179 -6.063  1.00 0.00 ? 30 LEU A HD11 3  
ATOM   1586  H HD12 . LEU A 1 13 ? 9.783  18.538 -7.804  1.00 0.00 ? 30 LEU A HD12 3  
ATOM   1587  H HD13 . LEU A 1 13 ? 8.289  17.888 -7.088  1.00 0.00 ? 30 LEU A HD13 3  
ATOM   1588  H HD21 . LEU A 1 13 ? 9.723  14.483 -6.467  1.00 0.00 ? 30 LEU A HD21 3  
ATOM   1589  H HD22 . LEU A 1 13 ? 9.673  15.810 -5.282  1.00 0.00 ? 30 LEU A HD22 3  
ATOM   1590  H HD23 . LEU A 1 13 ? 8.250  15.468 -6.297  1.00 0.00 ? 30 LEU A HD23 3  
ATOM   1591  N N    . PRO A 1 14 ? 8.085  13.490 -10.248 1.00 0.00 ? 31 PRO A N    3  
ATOM   1592  C CA   . PRO A 1 14 ? 7.254  13.079 -11.372 1.00 0.00 ? 31 PRO A CA   3  
ATOM   1593  C C    . PRO A 1 14 ? 6.722  14.285 -12.136 1.00 0.00 ? 31 PRO A C    3  
ATOM   1594  O O    . PRO A 1 14 ? 6.987  15.430 -11.768 1.00 0.00 ? 31 PRO A O    3  
ATOM   1595  C CB   . PRO A 1 14 ? 6.129  12.263 -10.727 1.00 0.00 ? 31 PRO A CB   3  
ATOM   1596  C CG   . PRO A 1 14 ? 6.656  11.904 -9.379  1.00 0.00 ? 31 PRO A CG   3  
ATOM   1597  C CD   . PRO A 1 14 ? 7.514  13.069 -8.963  1.00 0.00 ? 31 PRO A CD   3  
ATOM   1598  H HA   . PRO A 1 14 ? 7.809  12.492 -12.119 1.00 0.00 ? 31 PRO A HA   3  
ATOM   1599  H HB2  . PRO A 1 14 ? 5.201  12.848 -10.648 1.00 0.00 ? 31 PRO A HB2  3  
ATOM   1600  H HB3  . PRO A 1 14 ? 5.895  11.363 -11.315 1.00 0.00 ? 31 PRO A HB3  3  
ATOM   1601  H HG2  . PRO A 1 14 ? 5.838  11.740 -8.663  1.00 0.00 ? 31 PRO A HG2  3  
ATOM   1602  H HG3  . PRO A 1 14 ? 7.243  10.975 -9.417  1.00 0.00 ? 31 PRO A HG3  3  
ATOM   1603  H HD2  . PRO A 1 14 ? 6.927  13.871 -8.493  1.00 0.00 ? 31 PRO A HD2  3  
ATOM   1604  H HD3  . PRO A 1 14 ? 8.292  12.777 -8.243  1.00 0.00 ? 31 PRO A HD3  3  
ATOM   1605  N N    . HIS A 1 15 ? 5.972  14.020 -13.200 1.00 0.00 ? 32 HIS A N    3  
ATOM   1606  C CA   . HIS A 1 15 ? 5.327  15.081 -13.965 1.00 0.00 ? 32 HIS A CA   3  
ATOM   1607  C C    . HIS A 1 15 ? 3.825  15.108 -13.713 1.00 0.00 ? 32 HIS A C    3  
ATOM   1608  O O    . HIS A 1 15 ? 3.104  15.925 -14.286 1.00 0.00 ? 32 HIS A O    3  
ATOM   1609  C CB   . HIS A 1 15 ? 5.605  14.913 -15.462 1.00 0.00 ? 32 HIS A CB   3  
ATOM   1610  C CG   . HIS A 1 15 ? 7.029  15.171 -15.843 1.00 0.00 ? 32 HIS A CG   3  
ATOM   1611  N ND1  . HIS A 1 15 ? 7.500  14.996 -17.127 1.00 0.00 ? 32 HIS A ND1  3  
ATOM   1612  C CD2  . HIS A 1 15 ? 8.087  15.591 -15.109 1.00 0.00 ? 32 HIS A CD2  3  
ATOM   1613  C CE1  . HIS A 1 15 ? 8.786  15.296 -17.166 1.00 0.00 ? 32 HIS A CE1  3  
ATOM   1614  N NE2  . HIS A 1 15 ? 9.166  15.660 -15.955 1.00 0.00 ? 32 HIS A NE2  3  
ATOM   1615  H H    . HIS A 1 15 ? 5.844  13.061 -13.486 1.00 0.00 ? 32 HIS A H    3  
ATOM   1616  H HA   . HIS A 1 15 ? 5.712  16.049 -13.644 1.00 0.00 ? 32 HIS A HA   3  
ATOM   1617  H HB2  . HIS A 1 15 ? 5.378  13.893 -15.775 1.00 0.00 ? 32 HIS A HB2  3  
ATOM   1618  H HB3  . HIS A 1 15 ? 4.996  15.612 -16.037 1.00 0.00 ? 32 HIS A HB3  3  
ATOM   1619  H HD2  . HIS A 1 15 ? 8.201  15.854 -14.057 1.00 0.00 ? 32 HIS A HD2  3  
ATOM   1620  H HE1  . HIS A 1 15 ? 9.345  15.222 -18.099 1.00 0.00 ? 32 HIS A HE1  3  
ATOM   1621  H HE2  . HIS A 1 15 ? 10.097 15.946 -15.686 1.00 0.00 ? 32 HIS A HE2  3  
ATOM   1622  N N    . ASP A 1 16 ? 3.359  14.208 -12.853 1.00 0.00 ? 33 ASP A N    3  
ATOM   1623  C CA   . ASP A 1 16 ? 1.934  14.087 -12.570 1.00 0.00 ? 33 ASP A CA   3  
ATOM   1624  C C    . ASP A 1 16 ? 1.685  13.859 -11.085 1.00 0.00 ? 33 ASP A C    3  
ATOM   1625  O O    . ASP A 1 16 ? 0.624  13.374 -10.690 1.00 0.00 ? 33 ASP A O    3  
ATOM   1626  C CB   . ASP A 1 16 ? 1.320  12.947 -13.387 1.00 0.00 ? 33 ASP A CB   3  
ATOM   1627  C CG   . ASP A 1 16 ? 1.888  11.570 -13.072 1.00 0.00 ? 33 ASP A CG   3  
ATOM   1628  O OD1  . ASP A 1 16 ? 2.741  11.482 -12.220 1.00 0.00 ? 33 ASP A OD1  3  
ATOM   1629  O OD2  . ASP A 1 16 ? 1.361  10.604 -13.568 1.00 0.00 ? 33 ASP A OD2  3  
ATOM   1630  H H    . ASP A 1 16 ? 4.008  13.594 -12.383 1.00 0.00 ? 33 ASP A H    3  
ATOM   1631  H HA   . ASP A 1 16 ? 1.425  15.015 -12.831 1.00 0.00 ? 33 ASP A HA   3  
ATOM   1632  H HB2  . ASP A 1 16 ? 0.232  12.911 -13.333 1.00 0.00 ? 33 ASP A HB2  3  
ATOM   1633  H HB3  . ASP A 1 16 ? 1.625  13.245 -14.391 1.00 0.00 ? 33 ASP A HB3  3  
ATOM   1634  N N    . TYR A 1 17 ? 2.670  14.210 -10.264 1.00 0.00 ? 34 TYR A N    3  
ATOM   1635  C CA   . TYR A 1 17 ? 2.541  14.088 -8.817  1.00 0.00 ? 34 TYR A CA   3  
ATOM   1636  C C    . TYR A 1 17 ? 1.528  15.083 -8.268  1.00 0.00 ? 34 TYR A C    3  
ATOM   1637  O O    . TYR A 1 17 ? 1.149  16.038 -8.947  1.00 0.00 ? 34 TYR A O    3  
ATOM   1638  C CB   . TYR A 1 17 ? 3.898  14.293 -8.140  1.00 0.00 ? 34 TYR A CB   3  
ATOM   1639  C CG   . TYR A 1 17 ? 4.406  15.716 -8.205  1.00 0.00 ? 34 TYR A CG   3  
ATOM   1640  C CD1  . TYR A 1 17 ? 3.938  16.681 -7.326  1.00 0.00 ? 34 TYR A CD1  3  
ATOM   1641  C CD2  . TYR A 1 17 ? 5.355  16.090 -9.145  1.00 0.00 ? 34 TYR A CD2  3  
ATOM   1642  C CE1  . TYR A 1 17 ? 4.399  17.983 -7.381  1.00 0.00 ? 34 TYR A CE1  3  
ATOM   1643  C CE2  . TYR A 1 17 ? 5.824  17.387 -9.208  1.00 0.00 ? 34 TYR A CE2  3  
ATOM   1644  C CZ   . TYR A 1 17 ? 5.343  18.331 -8.325  1.00 0.00 ? 34 TYR A CZ   3  
ATOM   1645  O OH   . TYR A 1 17 ? 5.808  19.625 -8.383  1.00 0.00 ? 34 TYR A OH   3  
ATOM   1646  H H    . TYR A 1 17 ? 3.529  14.572 -10.653 1.00 0.00 ? 34 TYR A H    3  
ATOM   1647  H HA   . TYR A 1 17 ? 2.171  13.094 -8.561  1.00 0.00 ? 34 TYR A HA   3  
ATOM   1648  H HB2  . TYR A 1 17 ? 3.786  13.994 -7.097  1.00 0.00 ? 34 TYR A HB2  3  
ATOM   1649  H HB3  . TYR A 1 17 ? 4.607  13.630 -8.634  1.00 0.00 ? 34 TYR A HB3  3  
ATOM   1650  H HD1  . TYR A 1 17 ? 3.193  16.398 -6.582  1.00 0.00 ? 34 TYR A HD1  3  
ATOM   1651  H HD2  . TYR A 1 17 ? 5.731  15.340 -9.840  1.00 0.00 ? 34 TYR A HD2  3  
ATOM   1652  H HE1  . TYR A 1 17 ? 4.022  18.731 -6.684  1.00 0.00 ? 34 TYR A HE1  3  
ATOM   1653  H HE2  . TYR A 1 17 ? 6.570  17.662 -9.956  1.00 0.00 ? 34 TYR A HE2  3  
ATOM   1654  H HH   . TYR A 1 17 ? 6.461  19.759 -9.075  1.00 0.00 ? 34 TYR A HH   3  
ATOM   1655  N N    . CYS A 1 18 ? 1.090  14.856 -7.034  1.00 0.00 ? 35 CYS A N    3  
ATOM   1656  C CA   . CYS A 1 18 ? 0.182  15.776 -6.360  1.00 0.00 ? 35 CYS A CA   3  
ATOM   1657  C C    . CYS A 1 18 ? 0.735  16.203 -5.007  1.00 0.00 ? 35 CYS A C    3  
ATOM   1658  O O    . CYS A 1 18 ? 1.705  15.629 -4.511  1.00 0.00 ? 35 CYS A O    3  
ATOM   1659  C CB   . CYS A 1 18 ? -1.082 14.935 -6.184  1.00 0.00 ? 35 CYS A CB   3  
ATOM   1660  S SG   . CYS A 1 18 ? -1.835 14.379 -7.732  1.00 0.00 ? 35 CYS A SG   3  
ATOM   1661  H H    . CYS A 1 18 ? 1.395  14.023 -6.550  1.00 0.00 ? 35 CYS A H    3  
ATOM   1662  H HA   . CYS A 1 18 ? -0.064 16.655 -6.956  1.00 0.00 ? 35 CYS A HA   3  
ATOM   1663  H HB2  . CYS A 1 18 ? -0.858 14.031 -5.615  1.00 0.00 ? 35 CYS A HB2  3  
ATOM   1664  H HB3  . CYS A 1 18 ? -1.849 15.510 -5.666  1.00 0.00 ? 35 CYS A HB3  3  
ATOM   1665  H HG   . CYS A 1 18 ? -2.843 13.721 -7.168  1.00 0.00 ? 35 CYS A HG   3  
ATOM   1666  N N    . THR A 1 19 ? 0.112  17.216 -4.412  1.00 0.00 ? 36 THR A N    3  
ATOM   1667  C CA   . THR A 1 19 ? 0.552  17.733 -3.121  1.00 0.00 ? 36 THR A CA   3  
ATOM   1668  C C    . THR A 1 19 ? -0.631 17.959 -2.188  1.00 0.00 ? 36 THR A C    3  
ATOM   1669  O O    . THR A 1 19 ? -1.663 18.491 -2.595  1.00 0.00 ? 36 THR A O    3  
ATOM   1670  C CB   . THR A 1 19 ? 1.329  19.053 -3.276  1.00 0.00 ? 36 THR A CB   3  
ATOM   1671  O OG1  . THR A 1 19 ? 2.452  18.850 -4.143  1.00 0.00 ? 36 THR A OG1  3  
ATOM   1672  C CG2  . THR A 1 19 ? 1.821  19.545 -1.924  1.00 0.00 ? 36 THR A CG2  3  
ATOM   1673  H H    . THR A 1 19 ? -0.684 17.638 -4.866  1.00 0.00 ? 36 THR A H    3  
ATOM   1674  H HA   . THR A 1 19 ? 1.197  17.004 -2.632  1.00 0.00 ? 36 THR A HA   3  
ATOM   1675  H HB   . THR A 1 19 ? 0.672  19.802 -3.717  1.00 0.00 ? 36 THR A HB   3  
ATOM   1676  H HG1  . THR A 1 19 ? 2.936  19.674 -4.239  1.00 0.00 ? 36 THR A HG1  3  
ATOM   1677  H HG21 . THR A 1 19 ? 2.479  18.797 -1.483  1.00 0.00 ? 36 THR A HG21 3  
ATOM   1678  H HG22 . THR A 1 19 ? 2.367  20.478 -2.054  1.00 0.00 ? 36 THR A HG22 3  
ATOM   1679  H HG23 . THR A 1 19 ? 0.968  19.710 -1.266  1.00 0.00 ? 36 THR A HG23 3  
HETATM 1680  N N    . TPO A 1 20 ? -0.474 17.552 -0.934  1.00 0.00 ? 37 TPO A N    3  
HETATM 1681  C CA   . TPO A 1 20 ? -1.531 17.700 0.059   1.00 0.00 ? 37 TPO A CA   3  
HETATM 1682  C CB   . TPO A 1 20 ? -1.426 16.632 1.163   1.00 0.00 ? 37 TPO A CB   3  
HETATM 1683  C CG2  . TPO A 1 20 ? -1.284 15.246 0.553   1.00 0.00 ? 37 TPO A CG2  3  
HETATM 1684  O OG1  . TPO A 1 20 ? -0.285 16.906 1.987   1.00 0.00 ? 37 TPO A OG1  3  
HETATM 1685  P P    . TPO A 1 20 ? -0.212 16.343 3.498   1.00 0.00 ? 37 TPO A P    3  
HETATM 1686  O O1P  . TPO A 1 20 ? 1.138  16.815 4.099   1.00 0.00 ? 37 TPO A O1P  3  
HETATM 1687  O O2P  . TPO A 1 20 ? -0.290 14.796 3.418   1.00 0.00 ? 37 TPO A O2P  3  
HETATM 1688  O O3P  . TPO A 1 20 ? -1.419 16.937 4.270   1.00 0.00 ? 37 TPO A O3P  3  
HETATM 1689  C C    . TPO A 1 20 ? -1.496 19.083 0.698   1.00 0.00 ? 37 TPO A C    3  
HETATM 1690  O O    . TPO A 1 20 ? -0.496 19.794 0.606   1.00 0.00 ? 37 TPO A O    3  
HETATM 1691  H H    . TPO A 1 20 ? 0.401  17.127 -0.660  1.00 0.00 ? 37 TPO A H    3  
HETATM 1692  H HA   . TPO A 1 20 ? -2.506 17.609 -0.423  1.00 0.00 ? 37 TPO A HA   3  
HETATM 1693  H HB   . TPO A 1 20 ? -2.324 16.668 1.779   1.00 0.00 ? 37 TPO A HB   3  
HETATM 1694  H HG21 . TPO A 1 20 ? -1.211 14.505 1.348   1.00 0.00 ? 37 TPO A HG21 3  
HETATM 1695  H HG22 . TPO A 1 20 ? -2.156 15.031 -0.066  1.00 0.00 ? 37 TPO A HG22 3  
HETATM 1696  H HG23 . TPO A 1 20 ? -0.386 15.210 -0.061  1.00 0.00 ? 37 TPO A HG23 3  
ATOM   1697  N N    . PRO A 1 21 ? -2.594 19.456 1.347   1.00 0.00 ? 38 PRO A N    3  
ATOM   1698  C CA   . PRO A 1 21 ? -2.708 20.773 1.965   1.00 0.00 ? 38 PRO A CA   3  
ATOM   1699  C C    . PRO A 1 21 ? -1.565 21.024 2.938   1.00 0.00 ? 38 PRO A C    3  
ATOM   1700  O O    . PRO A 1 21 ? -1.129 22.161 3.119   1.00 0.00 ? 38 PRO A O    3  
ATOM   1701  C CB   . PRO A 1 21 ? -4.069 20.740 2.668   1.00 0.00 ? 38 PRO A CB   3  
ATOM   1702  C CG   . PRO A 1 21 ? -4.870 19.760 1.881   1.00 0.00 ? 38 PRO A CG   3  
ATOM   1703  C CD   . PRO A 1 21 ? -3.893 18.700 1.449   1.00 0.00 ? 38 PRO A CD   3  
ATOM   1704  H HA   . PRO A 1 21 ? -2.644 21.592 1.233   1.00 0.00 ? 38 PRO A HA   3  
ATOM   1705  H HB2  . PRO A 1 21 ? -3.972 20.424 3.717   1.00 0.00 ? 38 PRO A HB2  3  
ATOM   1706  H HB3  . PRO A 1 21 ? -4.544 21.732 2.672   1.00 0.00 ? 38 PRO A HB3  3  
ATOM   1707  H HG2  . PRO A 1 21 ? -5.679 19.328 2.489   1.00 0.00 ? 38 PRO A HG2  3  
ATOM   1708  H HG3  . PRO A 1 21 ? -5.342 20.241 1.011   1.00 0.00 ? 38 PRO A HG3  3  
ATOM   1709  H HD2  . PRO A 1 21 ? -3.819 17.880 2.178   1.00 0.00 ? 38 PRO A HD2  3  
ATOM   1710  H HD3  . PRO A 1 21 ? -4.169 18.248 0.485   1.00 0.00 ? 38 PRO A HD3  3  
ATOM   1711  N N    . GLY A 1 22 ? -1.081 19.958 3.565   1.00 0.00 ? 39 GLY A N    3  
ATOM   1712  C CA   . GLY A 1 22 ? 0.007  20.062 4.530   1.00 0.00 ? 39 GLY A CA   3  
ATOM   1713  C C    . GLY A 1 22 ? 1.315  20.436 3.844   1.00 0.00 ? 39 GLY A C    3  
ATOM   1714  O O    . GLY A 1 22 ? 2.207  21.017 4.462   1.00 0.00 ? 39 GLY A O    3  
ATOM   1715  H H    . GLY A 1 22 ? -1.479 19.049 3.369   1.00 0.00 ? 39 GLY A H    3  
ATOM   1716  H HA2  . GLY A 1 22 ? -0.240 20.827 5.264   1.00 0.00 ? 39 GLY A HA2  3  
ATOM   1717  H HA3  . GLY A 1 22 ? 0.132  19.104 5.032   1.00 0.00 ? 39 GLY A HA3  3  
ATOM   1718  N N    . GLY A 1 23 ? 1.423  20.100 2.563   1.00 0.00 ? 40 GLY A N    3  
ATOM   1719  C CA   . GLY A 1 23 ? 2.594  20.461 1.772   1.00 0.00 ? 40 GLY A CA   3  
ATOM   1720  C C    . GLY A 1 23 ? 3.531  19.273 1.601   1.00 0.00 ? 40 GLY A C    3  
ATOM   1721  O O    . GLY A 1 23 ? 4.752  19.422 1.637   1.00 0.00 ? 40 GLY A O    3  
ATOM   1722  H H    . GLY A 1 23 ? 0.676  19.581 2.125   1.00 0.00 ? 40 GLY A H    3  
ATOM   1723  H HA2  . GLY A 1 23 ? 2.268  20.802 0.789   1.00 0.00 ? 40 GLY A HA2  3  
ATOM   1724  H HA3  . GLY A 1 23 ? 3.129  21.266 2.276   1.00 0.00 ? 40 GLY A HA3  3  
ATOM   1725  N N    . THR A 1 24 ? 2.952  18.091 1.413   1.00 0.00 ? 41 THR A N    3  
ATOM   1726  C CA   . THR A 1 24 ? 3.732  16.891 1.136   1.00 0.00 ? 41 THR A CA   3  
ATOM   1727  C C    . THR A 1 24 ? 3.419  16.339 -0.249  1.00 0.00 ? 41 THR A C    3  
ATOM   1728  O O    . THR A 1 24 ? 2.254  16.161 -0.608  1.00 0.00 ? 41 THR A O    3  
ATOM   1729  C CB   . THR A 1 24 ? 3.474  15.794 2.185   1.00 0.00 ? 41 THR A CB   3  
ATOM   1730  O OG1  . THR A 1 24 ? 3.844  16.275 3.484   1.00 0.00 ? 41 THR A OG1  3  
ATOM   1731  C CG2  . THR A 1 24 ? 4.282  14.546 1.862   1.00 0.00 ? 41 THR A CG2  3  
ATOM   1732  H H    . THR A 1 24 ? 1.945  18.023 1.465   1.00 0.00 ? 41 THR A H    3  
ATOM   1733  H HA   . THR A 1 24 ? 4.794  17.134 1.138   1.00 0.00 ? 41 THR A HA   3  
ATOM   1734  H HB   . THR A 1 24 ? 2.413  15.548 2.187   1.00 0.00 ? 41 THR A HB   3  
ATOM   1735  H HG1  . THR A 1 24 ? 3.057  16.559 3.955   1.00 0.00 ? 41 THR A HG1  3  
ATOM   1736  H HG21 . THR A 1 24 ? 5.344  14.792 1.861   1.00 0.00 ? 41 THR A HG21 3  
ATOM   1737  H HG22 . THR A 1 24 ? 4.087  13.783 2.614   1.00 0.00 ? 41 THR A HG22 3  
ATOM   1738  H HG23 . THR A 1 24 ? 3.995  14.172 0.880   1.00 0.00 ? 41 THR A HG23 3  
ATOM   1739  N N    . LEU A 1 25 ? 4.464  16.069 -1.024  1.00 0.00 ? 42 LEU A N    3  
ATOM   1740  C CA   . LEU A 1 25 ? 4.301  15.554 -2.377  1.00 0.00 ? 42 LEU A CA   3  
ATOM   1741  C C    . LEU A 1 25 ? 4.091  14.045 -2.371  1.00 0.00 ? 42 LEU A C    3  
ATOM   1742  O O    . LEU A 1 25 ? 4.656  13.334 -1.539  1.00 0.00 ? 42 LEU A O    3  
ATOM   1743  C CB   . LEU A 1 25 ? 5.519  15.919 -3.235  1.00 0.00 ? 42 LEU A CB   3  
ATOM   1744  C CG   . LEU A 1 25 ? 5.448  17.289 -3.921  1.00 0.00 ? 42 LEU A CG   3  
ATOM   1745  C CD1  . LEU A 1 25 ? 5.445  18.397 -2.876  1.00 0.00 ? 42 LEU A CD1  3  
ATOM   1746  C CD2  . LEU A 1 25 ? 6.628  17.445 -4.868  1.00 0.00 ? 42 LEU A CD2  3  
ATOM   1747  H H    . LEU A 1 25 ? 5.395  16.227 -0.666  1.00 0.00 ? 42 LEU A H    3  
ATOM   1748  H HA   . LEU A 1 25 ? 3.410  15.987 -2.829  1.00 0.00 ? 42 LEU A HA   3  
ATOM   1749  H HB2  . LEU A 1 25 ? 6.284  15.929 -2.459  1.00 0.00 ? 42 LEU A HB2  3  
ATOM   1750  H HB3  . LEU A 1 25 ? 5.750  15.141 -3.961  1.00 0.00 ? 42 LEU A HB3  3  
ATOM   1751  H HG   . LEU A 1 25 ? 4.536  17.305 -4.518  1.00 0.00 ? 42 LEU A HG   3  
ATOM   1752  H HD11 . LEU A 1 25 ? 5.393  19.366 -3.372  1.00 0.00 ? 42 LEU A HD11 3  
ATOM   1753  H HD12 . LEU A 1 25 ? 4.580  18.279 -2.223  1.00 0.00 ? 42 LEU A HD12 3  
ATOM   1754  H HD13 . LEU A 1 25 ? 6.358  18.341 -2.284  1.00 0.00 ? 42 LEU A HD13 3  
ATOM   1755  H HD21 . LEU A 1 25 ? 6.595  16.660 -5.624  1.00 0.00 ? 42 LEU A HD21 3  
ATOM   1756  H HD22 . LEU A 1 25 ? 6.575  18.419 -5.357  1.00 0.00 ? 42 LEU A HD22 3  
ATOM   1757  H HD23 . LEU A 1 25 ? 7.559  17.369 -4.308  1.00 0.00 ? 42 LEU A HD23 3  
ATOM   1758  N N    . PHE A 1 26 ? 3.275  13.561 -3.301  1.00 0.00 ? 43 PHE A N    3  
ATOM   1759  C CA   . PHE A 1 26 ? 3.037  12.130 -3.443  1.00 0.00 ? 43 PHE A CA   3  
ATOM   1760  C C    . PHE A 1 26 ? 2.621  11.779 -4.866  1.00 0.00 ? 43 PHE A C    3  
ATOM   1761  O O    . PHE A 1 26 ? 2.238  12.653 -5.644  1.00 0.00 ? 43 PHE A O    3  
ATOM   1762  C CB   . PHE A 1 26 ? 1.968  11.665 -2.452  1.00 0.00 ? 43 PHE A CB   3  
ATOM   1763  C CG   . PHE A 1 26 ? 0.600  12.217 -2.734  1.00 0.00 ? 43 PHE A CG   3  
ATOM   1764  C CD1  . PHE A 1 26 ? 0.250  13.492 -2.314  1.00 0.00 ? 43 PHE A CD1  3  
ATOM   1765  C CD2  . PHE A 1 26 ? -0.340 11.464 -3.421  1.00 0.00 ? 43 PHE A CD2  3  
ATOM   1766  C CE1  . PHE A 1 26 ? -1.008 14.001 -2.571  1.00 0.00 ? 43 PHE A CE1  3  
ATOM   1767  C CE2  . PHE A 1 26 ? -1.599 11.970 -3.680  1.00 0.00 ? 43 PHE A CE2  3  
ATOM   1768  C CZ   . PHE A 1 26 ? -1.933 13.239 -3.256  1.00 0.00 ? 43 PHE A CZ   3  
ATOM   1769  H H    . PHE A 1 26 ? 2.808  14.203 -3.927  1.00 0.00 ? 43 PHE A H    3  
ATOM   1770  H HA   . PHE A 1 26 ? 3.959  11.580 -3.245  1.00 0.00 ? 43 PHE A HA   3  
ATOM   1771  H HB2  . PHE A 1 26 ? 1.878  10.580 -2.479  1.00 0.00 ? 43 PHE A HB2  3  
ATOM   1772  H HB3  . PHE A 1 26 ? 2.230  11.982 -1.444  1.00 0.00 ? 43 PHE A HB3  3  
ATOM   1773  H HD1  . PHE A 1 26 ? 0.982  14.094 -1.773  1.00 0.00 ? 43 PHE A HD1  3  
ATOM   1774  H HD2  . PHE A 1 26 ? -0.076 10.460 -3.755  1.00 0.00 ? 43 PHE A HD2  3  
ATOM   1775  H HE1  . PHE A 1 26 ? -1.270 15.004 -2.234  1.00 0.00 ? 43 PHE A HE1  3  
ATOM   1776  H HE2  . PHE A 1 26 ? -2.329 11.368 -4.220  1.00 0.00 ? 43 PHE A HE2  3  
ATOM   1777  H HZ   . PHE A 1 26 ? -2.925 13.640 -3.460  1.00 0.00 ? 43 PHE A HZ   3  
ATOM   1778  N N    . SER A 1 27 ? 2.700  10.496 -5.200  1.00 0.00 ? 44 SER A N    3  
ATOM   1779  C CA   . SER A 1 27 ? 2.171  10.000 -6.466  1.00 0.00 ? 44 SER A CA   3  
ATOM   1780  C C    . SER A 1 27 ? 1.705  8.556  -6.340  1.00 0.00 ? 44 SER A C    3  
ATOM   1781  O O    . SER A 1 27 ? 1.965  7.894  -5.335  1.00 0.00 ? 44 SER A O    3  
ATOM   1782  C CB   . SER A 1 27 ? 3.220  10.124 -7.554  1.00 0.00 ? 44 SER A CB   3  
ATOM   1783  O OG   . SER A 1 27 ? 4.275  9.219  -7.373  1.00 0.00 ? 44 SER A OG   3  
ATOM   1784  H H    . SER A 1 27 ? 3.135  9.847  -4.562  1.00 0.00 ? 44 SER A H    3  
ATOM   1785  H HA   . SER A 1 27 ? 1.367  10.616 -6.870  1.00 0.00 ? 44 SER A HA   3  
ATOM   1786  H HB2  . SER A 1 27 ? 2.747  9.930  -8.516  1.00 0.00 ? 44 SER A HB2  3  
ATOM   1787  H HB3  . SER A 1 27 ? 3.617  11.138 -7.542  1.00 0.00 ? 44 SER A HB3  3  
ATOM   1788  H HG   . SER A 1 27 ? 3.930  8.324  -7.367  1.00 0.00 ? 44 SER A HG   3  
ATOM   1789  N N    . THR A 1 28 ? 1.013  8.071  -7.365  1.00 0.00 ? 45 THR A N    3  
ATOM   1790  C CA   . THR A 1 28 ? 0.537  6.693  -7.386  1.00 0.00 ? 45 THR A CA   3  
ATOM   1791  C C    . THR A 1 28 ? 0.743  6.059  -8.755  1.00 0.00 ? 45 THR A C    3  
ATOM   1792  O O    . THR A 1 28 ? 0.386  6.641  -9.780  1.00 0.00 ? 45 THR A O    3  
ATOM   1793  C CB   . THR A 1 28 ? -0.953 6.605  -7.010  1.00 0.00 ? 45 THR A CB   3  
ATOM   1794  O OG1  . THR A 1 28 ? -1.158 7.187  -5.716  1.00 0.00 ? 45 THR A OG1  3  
ATOM   1795  C CG2  . THR A 1 28 ? -1.413 5.155  -6.988  1.00 0.00 ? 45 THR A CG2  3  
ATOM   1796  H H    . THR A 1 28 ? 0.812  8.673  -8.152  1.00 0.00 ? 45 THR A H    3  
ATOM   1797  H HA   . THR A 1 28 ? 1.111  6.094  -6.680  1.00 0.00 ? 45 THR A HA   3  
ATOM   1798  H HB   . THR A 1 28 ? -1.538 7.159  -7.744  1.00 0.00 ? 45 THR A HB   3  
ATOM   1799  H HG1  . THR A 1 28 ? -1.144 8.145  -5.791  1.00 0.00 ? 45 THR A HG1  3  
ATOM   1800  H HG21 . THR A 1 28 ? -0.831 4.600  -6.253  1.00 0.00 ? 45 THR A HG21 3  
ATOM   1801  H HG22 . THR A 1 28 ? -2.469 5.113  -6.720  1.00 0.00 ? 45 THR A HG22 3  
ATOM   1802  H HG23 . THR A 1 28 ? -1.270 4.713  -7.973  1.00 0.00 ? 45 THR A HG23 3  
HETATM 1803  N N    . TPO A 1 29 ? 1.320  4.862  -8.767  1.00 0.00 ? 46 TPO A N    3  
HETATM 1804  C CA   . TPO A 1 29 ? 1.602  4.159  -10.014 1.00 0.00 ? 46 TPO A CA   3  
HETATM 1805  C CB   . TPO A 1 29 ? 2.951  3.420  -9.954  1.00 0.00 ? 46 TPO A CB   3  
HETATM 1806  C CG2  . TPO A 1 29 ? 4.040  4.341  -9.423  1.00 0.00 ? 46 TPO A CG2  3  
HETATM 1807  O OG1  . TPO A 1 29 ? 2.836  2.278  -9.097  1.00 0.00 ? 46 TPO A OG1  3  
HETATM 1808  P P    . TPO A 1 29 ? 3.832  1.020  -9.268  1.00 0.00 ? 46 TPO A P    3  
HETATM 1809  O O1P  . TPO A 1 29 ? 3.438  -0.029 -8.196  1.00 0.00 ? 46 TPO A O1P  3  
HETATM 1810  O O2P  . TPO A 1 29 ? 5.275  1.543  -9.053  1.00 0.00 ? 46 TPO A O2P  3  
HETATM 1811  O O3P  . TPO A 1 29 ? 3.633  0.468  -10.705 1.00 0.00 ? 46 TPO A O3P  3  
HETATM 1812  C C    . TPO A 1 29 ? 0.501  3.159  -10.341 1.00 0.00 ? 46 TPO A C    3  
HETATM 1813  O O    . TPO A 1 29 ? -0.313 2.813  -9.484  1.00 0.00 ? 46 TPO A O    3  
HETATM 1814  H H    . TPO A 1 29 ? 1.572  4.429  -7.891  1.00 0.00 ? 46 TPO A H    3  
HETATM 1815  H HA   . TPO A 1 29 ? 1.628  4.870  -10.840 1.00 0.00 ? 46 TPO A HA   3  
HETATM 1816  H HB   . TPO A 1 29 ? 3.217  3.087  -10.957 1.00 0.00 ? 46 TPO A HB   3  
HETATM 1817  H HG21 . TPO A 1 29 ? 4.986  3.801  -9.389  1.00 0.00 ? 46 TPO A HG21 3  
HETATM 1818  H HG22 . TPO A 1 29 ? 4.137  5.205  -10.079 1.00 0.00 ? 46 TPO A HG22 3  
HETATM 1819  H HG23 . TPO A 1 29 ? 3.776  4.675  -8.421  1.00 0.00 ? 46 TPO A HG23 3  
ATOM   1820  N N    . PRO A 1 30 ? 0.480  2.697  -11.586 1.00 0.00 ? 47 PRO A N    3  
ATOM   1821  C CA   . PRO A 1 30 ? -0.576 1.807  -12.056 1.00 0.00 ? 47 PRO A CA   3  
ATOM   1822  C C    . PRO A 1 30 ? -0.665 0.555  -11.195 1.00 0.00 ? 47 PRO A C    3  
ATOM   1823  O O    . PRO A 1 30 ? -1.736 -0.036 -11.050 1.00 0.00 ? 47 PRO A O    3  
ATOM   1824  C CB   . PRO A 1 30 ? -0.180 1.487  -13.501 1.00 0.00 ? 47 PRO A CB   3  
ATOM   1825  C CG   . PRO A 1 30 ? 0.610  2.671  -13.942 1.00 0.00 ? 47 PRO A CG   3  
ATOM   1826  C CD   . PRO A 1 30 ? 1.375  3.115  -12.723 1.00 0.00 ? 47 PRO A CD   3  
ATOM   1827  H HA   . PRO A 1 30 ? -1.575 2.265  -11.997 1.00 0.00 ? 47 PRO A HA   3  
ATOM   1828  H HB2  . PRO A 1 30 ? 0.417  0.565  -13.559 1.00 0.00 ? 47 PRO A HB2  3  
ATOM   1829  H HB3  . PRO A 1 30 ? -1.064 1.339  -14.139 1.00 0.00 ? 47 PRO A HB3  3  
ATOM   1830  H HG2  . PRO A 1 30 ? 1.293  2.411  -14.764 1.00 0.00 ? 47 PRO A HG2  3  
ATOM   1831  H HG3  . PRO A 1 30 ? -0.046 3.473  -14.311 1.00 0.00 ? 47 PRO A HG3  3  
ATOM   1832  H HD2  . PRO A 1 30 ? 2.360  2.631  -12.651 1.00 0.00 ? 47 PRO A HD2  3  
ATOM   1833  H HD3  . PRO A 1 30 ? 1.550  4.201  -12.715 1.00 0.00 ? 47 PRO A HD3  3  
ATOM   1834  N N    . GLY A 1 31 ? 0.465  0.153  -10.623 1.00 0.00 ? 48 GLY A N    3  
ATOM   1835  C CA   . GLY A 1 31 ? 0.519  -1.038 -9.785  1.00 0.00 ? 48 GLY A CA   3  
ATOM   1836  C C    . GLY A 1 31 ? -0.316 -0.862 -8.523  1.00 0.00 ? 48 GLY A C    3  
ATOM   1837  O O    . GLY A 1 31 ? -0.783 -1.837 -7.935  1.00 0.00 ? 48 GLY A O    3  
ATOM   1838  H H    . GLY A 1 31 ? 1.309  0.688  -10.774 1.00 0.00 ? 48 GLY A H    3  
ATOM   1839  H HA2  . GLY A 1 31 ? 0.135  -1.888 -10.349 1.00 0.00 ? 48 GLY A HA2  3  
ATOM   1840  H HA3  . GLY A 1 31 ? 1.554  -1.229 -9.503  1.00 0.00 ? 48 GLY A HA3  3  
ATOM   1841  N N    . GLY A 1 32 ? -0.500 0.387  -8.111  1.00 0.00 ? 49 GLY A N    3  
ATOM   1842  C CA   . GLY A 1 32 ? -1.323 0.698  -6.949  1.00 0.00 ? 49 GLY A CA   3  
ATOM   1843  C C    . GLY A 1 32 ? -0.475 1.216  -5.795  1.00 0.00 ? 49 GLY A C    3  
ATOM   1844  O O    . GLY A 1 32 ? -1.002 1.656  -4.773  1.00 0.00 ? 49 GLY A O    3  
ATOM   1845  H H    . GLY A 1 32 ? -0.058 1.143  -8.617  1.00 0.00 ? 49 GLY A H    3  
ATOM   1846  H HA2  . GLY A 1 32 ? -2.054 1.460  -7.223  1.00 0.00 ? 49 GLY A HA2  3  
ATOM   1847  H HA3  . GLY A 1 32 ? -1.843 -0.204 -6.630  1.00 0.00 ? 49 GLY A HA3  3  
ATOM   1848  N N    . THR A 1 33 ? 0.842  1.162  -5.965  1.00 0.00 ? 50 THR A N    3  
ATOM   1849  C CA   . THR A 1 33 ? 1.767  1.632  -4.940  1.00 0.00 ? 50 THR A CA   3  
ATOM   1850  C C    . THR A 1 33 ? 1.683  3.143  -4.773  1.00 0.00 ? 50 THR A C    3  
ATOM   1851  O O    . THR A 1 33 ? 1.718  3.889  -5.751  1.00 0.00 ? 50 THR A O    3  
ATOM   1852  C CB   . THR A 1 33 ? 3.219  1.242  -5.268  1.00 0.00 ? 50 THR A CB   3  
ATOM   1853  O OG1  . THR A 1 33 ? 3.326  -0.185 -5.359  1.00 0.00 ? 50 THR A OG1  3  
ATOM   1854  C CG2  . THR A 1 33 ? 4.165  1.750  -4.190  1.00 0.00 ? 50 THR A CG2  3  
ATOM   1855  H H    . THR A 1 33 ? 1.212  0.787  -6.827  1.00 0.00 ? 50 THR A H    3  
ATOM   1856  H HA   . THR A 1 33 ? 1.498  1.200  -3.976  1.00 0.00 ? 50 THR A HA   3  
ATOM   1857  H HB   . THR A 1 33 ? 3.496  1.680  -6.228  1.00 0.00 ? 50 THR A HB   3  
ATOM   1858  H HG1  . THR A 1 33 ? 3.372  -0.443 -6.282  1.00 0.00 ? 50 THR A HG1  3  
ATOM   1859  H HG21 . THR A 1 33 ? 3.891  1.312  -3.231  1.00 0.00 ? 50 THR A HG21 3  
ATOM   1860  H HG22 . THR A 1 33 ? 5.187  1.465  -4.440  1.00 0.00 ? 50 THR A HG22 3  
ATOM   1861  H HG23 . THR A 1 33 ? 4.095  2.836  -4.127  1.00 0.00 ? 50 THR A HG23 3  
ATOM   1862  N N    . ARG A 1 34 ? 1.570  3.590  -3.526  1.00 0.00 ? 51 ARG A N    3  
ATOM   1863  C CA   . ARG A 1 34 ? 1.542  5.016  -3.223  1.00 0.00 ? 51 ARG A CA   3  
ATOM   1864  C C    . ARG A 1 34 ? 2.903  5.504  -2.743  1.00 0.00 ? 51 ARG A C    3  
ATOM   1865  O O    . ARG A 1 34 ? 3.412  5.048  -1.718  1.00 0.00 ? 51 ARG A O    3  
ATOM   1866  C CB   . ARG A 1 34 ? 0.443  5.371  -2.233  1.00 0.00 ? 51 ARG A CB   3  
ATOM   1867  C CG   . ARG A 1 34 ? -0.972 5.118  -2.730  1.00 0.00 ? 51 ARG A CG   3  
ATOM   1868  C CD   . ARG A 1 34 ? -2.026 5.314  -1.703  1.00 0.00 ? 51 ARG A CD   3  
ATOM   1869  N NE   . ARG A 1 34 ? -3.375 5.024  -2.161  1.00 0.00 ? 51 ARG A NE   3  
ATOM   1870  C CZ   . ARG A 1 34 ? -4.485 5.166  -1.411  1.00 0.00 ? 51 ARG A CZ   3  
ATOM   1871  N NH1  . ARG A 1 34 ? -4.411 5.556  -0.157  1.00 0.00 ? 51 ARG A NH1  3  
ATOM   1872  N NH2  . ARG A 1 34 ? -5.652 4.878  -1.960  1.00 0.00 ? 51 ARG A NH2  3  
ATOM   1873  H H    . ARG A 1 34 ? 1.502  2.925  -2.769  1.00 0.00 ? 51 ARG A H    3  
ATOM   1874  H HA   . ARG A 1 34 ? 1.311  5.581  -4.126  1.00 0.00 ? 51 ARG A HA   3  
ATOM   1875  H HB2  . ARG A 1 34 ? 0.619  4.779  -1.335  1.00 0.00 ? 51 ARG A HB2  3  
ATOM   1876  H HB3  . ARG A 1 34 ? 0.556  6.429  -1.998  1.00 0.00 ? 51 ARG A HB3  3  
ATOM   1877  H HG2  . ARG A 1 34 ? -1.177 5.799  -3.556  1.00 0.00 ? 51 ARG A HG2  3  
ATOM   1878  H HG3  . ARG A 1 34 ? -1.035 4.088  -3.084  1.00 0.00 ? 51 ARG A HG3  3  
ATOM   1879  H HD2  . ARG A 1 34 ? -1.822 4.660  -0.855  1.00 0.00 ? 51 ARG A HD2  3  
ATOM   1880  H HD3  . ARG A 1 34 ? -2.010 6.352  -1.372  1.00 0.00 ? 51 ARG A HD3  3  
ATOM   1881  H HE   . ARG A 1 34 ? -3.692 4.688  -3.060  1.00 0.00 ? 51 ARG A HE   3  
ATOM   1882  H HH11 . ARG A 1 34 ? -3.510 5.755  0.254   1.00 0.00 ? 51 ARG A HH11 3  
ATOM   1883  H HH12 . ARG A 1 34 ? -5.254 5.657  0.388   1.00 0.00 ? 51 ARG A HH12 3  
ATOM   1884  H HH21 . ARG A 1 34 ? -5.690 4.562  -2.920  1.00 0.00 ? 51 ARG A HH21 3  
ATOM   1885  H HH22 . ARG A 1 34 ? -6.499 4.976  -1.421  1.00 0.00 ? 51 ARG A HH22 3  
ATOM   1886  N N    . ILE A 1 35 ? 3.489  6.434  -3.489  1.00 0.00 ? 52 ILE A N    3  
ATOM   1887  C CA   . ILE A 1 35 ? 4.821  6.938  -3.178  1.00 0.00 ? 52 ILE A CA   3  
ATOM   1888  C C    . ILE A 1 35 ? 4.750  8.299  -2.495  1.00 0.00 ? 52 ILE A C    3  
ATOM   1889  O O    . ILE A 1 35 ? 4.189  9.248  -3.042  1.00 0.00 ? 52 ILE A O    3  
ATOM   1890  C CB   . ILE A 1 35 ? 5.692  7.054  -4.442  1.00 0.00 ? 52 ILE A CB   3  
ATOM   1891  C CG1  . ILE A 1 35 ? 5.847  5.685  -5.109  1.00 0.00 ? 52 ILE A CG1  3  
ATOM   1892  C CG2  . ILE A 1 35 ? 7.052  7.641  -4.099  1.00 0.00 ? 52 ILE A CG2  3  
ATOM   1893  C CD1  . ILE A 1 35 ? 6.491  5.742  -6.477  1.00 0.00 ? 52 ILE A CD1  3  
ATOM   1894  H H    . ILE A 1 35 ? 3.000  6.801  -4.293  1.00 0.00 ? 52 ILE A H    3  
ATOM   1895  H HA   . ILE A 1 35 ? 5.318  6.292  -2.454  1.00 0.00 ? 52 ILE A HA   3  
ATOM   1896  H HB   . ILE A 1 35 ? 5.189  7.698  -5.162  1.00 0.00 ? 52 ILE A HB   3  
ATOM   1897  H HG12 . ILE A 1 35 ? 6.454  5.068  -4.448  1.00 0.00 ? 52 ILE A HG12 3  
ATOM   1898  H HG13 . ILE A 1 35 ? 4.851  5.251  -5.196  1.00 0.00 ? 52 ILE A HG13 3  
ATOM   1899  H HG21 . ILE A 1 35 ? 7.655  7.715  -5.005  1.00 0.00 ? 52 ILE A HG21 3  
ATOM   1900  H HG22 . ILE A 1 35 ? 6.923  8.632  -3.668  1.00 0.00 ? 52 ILE A HG22 3  
ATOM   1901  H HG23 . ILE A 1 35 ? 7.557  6.995  -3.380  1.00 0.00 ? 52 ILE A HG23 3  
ATOM   1902  H HD11 . ILE A 1 35 ? 7.488  6.173  -6.392  1.00 0.00 ? 52 ILE A HD11 3  
ATOM   1903  H HD12 . ILE A 1 35 ? 6.568  4.734  -6.886  1.00 0.00 ? 52 ILE A HD12 3  
ATOM   1904  H HD13 . ILE A 1 35 ? 5.884  6.357  -7.141  1.00 0.00 ? 52 ILE A HD13 3  
ATOM   1905  N N    . ILE A 1 36 ? 5.321  8.387  -1.300  1.00 0.00 ? 53 ILE A N    3  
ATOM   1906  C CA   . ILE A 1 36 ? 5.403  9.652  -0.580  1.00 0.00 ? 53 ILE A CA   3  
ATOM   1907  C C    . ILE A 1 36 ? 6.790  10.270 -0.709  1.00 0.00 ? 53 ILE A C    3  
ATOM   1908  O O    . ILE A 1 36 ? 7.795  9.634  -0.392  1.00 0.00 ? 53 ILE A O    3  
ATOM   1909  C CB   . ILE A 1 36 ? 5.066  9.476  0.912   1.00 0.00 ? 53 ILE A CB   3  
ATOM   1910  C CG1  . ILE A 1 36 ? 3.642  8.942  1.078   1.00 0.00 ? 53 ILE A CG1  3  
ATOM   1911  C CG2  . ILE A 1 36 ? 5.234  10.793 1.653   1.00 0.00 ? 53 ILE A CG2  3  
ATOM   1912  C CD1  . ILE A 1 36 ? 3.309  8.519  2.491   1.00 0.00 ? 53 ILE A CD1  3  
ATOM   1913  H H    . ILE A 1 36 ? 5.709  7.554  -0.878  1.00 0.00 ? 53 ILE A H    3  
ATOM   1914  H HA   . ILE A 1 36 ? 4.730  10.387 -1.019  1.00 0.00 ? 53 ILE A HA   3  
ATOM   1915  H HB   . ILE A 1 36 ? 5.733  8.729  1.342   1.00 0.00 ? 53 ILE A HB   3  
ATOM   1916  H HG12 . ILE A 1 36 ? 2.960  9.733  0.767   1.00 0.00 ? 53 ILE A HG12 3  
ATOM   1917  H HG13 . ILE A 1 36 ? 3.536  8.088  0.409   1.00 0.00 ? 53 ILE A HG13 3  
ATOM   1918  H HG21 . ILE A 1 36 ? 4.992  10.651 2.706   1.00 0.00 ? 53 ILE A HG21 3  
ATOM   1919  H HG22 . ILE A 1 36 ? 6.265  11.134 1.561   1.00 0.00 ? 53 ILE A HG22 3  
ATOM   1920  H HG23 . ILE A 1 36 ? 4.567  11.541 1.225   1.00 0.00 ? 53 ILE A HG23 3  
ATOM   1921  H HD11 . ILE A 1 36 ? 3.413  9.371  3.161   1.00 0.00 ? 53 ILE A HD11 3  
ATOM   1922  H HD12 . ILE A 1 36 ? 2.283  8.152  2.529   1.00 0.00 ? 53 ILE A HD12 3  
ATOM   1923  H HD13 . ILE A 1 36 ? 3.989  7.726  2.804   1.00 0.00 ? 53 ILE A HD13 3  
ATOM   1924  N N    . TYR A 1 37 ? 6.835  11.513 -1.177  1.00 0.00 ? 54 TYR A N    3  
ATOM   1925  C CA   . TYR A 1 37 ? 8.100  12.160 -1.507  1.00 0.00 ? 54 TYR A CA   3  
ATOM   1926  C C    . TYR A 1 37 ? 8.542  13.103 -0.395  1.00 0.00 ? 54 TYR A C    3  
ATOM   1927  O O    . TYR A 1 37 ? 7.807  14.012 -0.010  1.00 0.00 ? 54 TYR A O    3  
ATOM   1928  C CB   . TYR A 1 37 ? 7.980  12.925 -2.827  1.00 0.00 ? 54 TYR A CB   3  
ATOM   1929  C CG   . TYR A 1 37 ? 7.752  12.037 -4.030  1.00 0.00 ? 54 TYR A CG   3  
ATOM   1930  C CD1  . TYR A 1 37 ? 8.797  11.320 -4.594  1.00 0.00 ? 54 TYR A CD1  3  
ATOM   1931  C CD2  . TYR A 1 37 ? 6.493  11.920 -4.601  1.00 0.00 ? 54 TYR A CD2  3  
ATOM   1932  C CE1  . TYR A 1 37 ? 8.594  10.508 -5.693  1.00 0.00 ? 54 TYR A CE1  3  
ATOM   1933  C CE2  . TYR A 1 37 ? 6.278  11.111 -5.700  1.00 0.00 ? 54 TYR A CE2  3  
ATOM   1934  C CZ   . TYR A 1 37 ? 7.333  10.405 -6.243  1.00 0.00 ? 54 TYR A CZ   3  
ATOM   1935  O OH   . TYR A 1 37 ? 7.126  9.599  -7.339  1.00 0.00 ? 54 TYR A OH   3  
ATOM   1936  H H    . TYR A 1 37 ? 5.973  12.022 -1.306  1.00 0.00 ? 54 TYR A H    3  
ATOM   1937  H HA   . TYR A 1 37 ? 8.884  11.410 -1.609  1.00 0.00 ? 54 TYR A HA   3  
ATOM   1938  H HB2  . TYR A 1 37 ? 7.146  13.620 -2.724  1.00 0.00 ? 54 TYR A HB2  3  
ATOM   1939  H HB3  . TYR A 1 37 ? 8.906  13.485 -2.960  1.00 0.00 ? 54 TYR A HB3  3  
ATOM   1940  H HD1  . TYR A 1 37 ? 9.791  11.404 -4.154  1.00 0.00 ? 54 TYR A HD1  3  
ATOM   1941  H HD2  . TYR A 1 37 ? 5.665  12.480 -4.167  1.00 0.00 ? 54 TYR A HD2  3  
ATOM   1942  H HE1  . TYR A 1 37 ? 9.429  9.951  -6.121  1.00 0.00 ? 54 TYR A HE1  3  
ATOM   1943  H HE2  . TYR A 1 37 ? 5.284  11.029 -6.138  1.00 0.00 ? 54 TYR A HE2  3  
ATOM   1944  H HH   . TYR A 1 37 ? 6.197  9.433  -7.512  1.00 0.00 ? 54 TYR A HH   3  
ATOM   1945  N N    . ASP A 1 38 ? 9.748  12.882 0.116   1.00 0.00 ? 55 ASP A N    3  
ATOM   1946  C CA   . ASP A 1 38 ? 10.341 13.783 1.098   1.00 0.00 ? 55 ASP A CA   3  
ATOM   1947  C C    . ASP A 1 38 ? 11.373 14.699 0.454   1.00 0.00 ? 55 ASP A C    3  
ATOM   1948  O O    . ASP A 1 38 ? 12.529 14.315 0.271   1.00 0.00 ? 55 ASP A O    3  
ATOM   1949  C CB   . ASP A 1 38 ? 10.983 12.986 2.238   1.00 0.00 ? 55 ASP A CB   3  
ATOM   1950  C CG   . ASP A 1 38 ? 11.590 13.843 3.339   1.00 0.00 ? 55 ASP A CG   3  
ATOM   1951  O OD1  . ASP A 1 38 ? 11.617 15.042 3.187   1.00 0.00 ? 55 ASP A OD1  3  
ATOM   1952  O OD2  . ASP A 1 38 ? 11.876 13.314 4.387   1.00 0.00 ? 55 ASP A OD2  3  
ATOM   1953  H H    . ASP A 1 38 ? 10.267 12.069 -0.182  1.00 0.00 ? 55 ASP A H    3  
ATOM   1954  H HA   . ASP A 1 38 ? 9.570  14.430 1.518   1.00 0.00 ? 55 ASP A HA   3  
ATOM   1955  H HB2  . ASP A 1 38 ? 10.317 12.245 2.679   1.00 0.00 ? 55 ASP A HB2  3  
ATOM   1956  H HB3  . ASP A 1 38 ? 11.779 12.479 1.692   1.00 0.00 ? 55 ASP A HB3  3  
ATOM   1957  N N    . ARG A 1 39 ? 10.949 15.909 0.111   1.00 0.00 ? 56 ARG A N    3  
ATOM   1958  C CA   . ARG A 1 39 ? 11.809 16.850 -0.599  1.00 0.00 ? 56 ARG A CA   3  
ATOM   1959  C C    . ARG A 1 39 ? 12.697 17.622 0.369   1.00 0.00 ? 56 ARG A C    3  
ATOM   1960  O O    . ARG A 1 39 ? 12.260 18.009 1.454   1.00 0.00 ? 56 ARG A O    3  
ATOM   1961  C CB   . ARG A 1 39 ? 11.016 17.788 -1.495  1.00 0.00 ? 56 ARG A CB   3  
ATOM   1962  C CG   . ARG A 1 39 ? 11.839 18.511 -2.551  1.00 0.00 ? 56 ARG A CG   3  
ATOM   1963  C CD   . ARG A 1 39 ? 11.050 19.407 -3.435  1.00 0.00 ? 56 ARG A CD   3  
ATOM   1964  N NE   . ARG A 1 39 ? 10.617 20.645 -2.807  1.00 0.00 ? 56 ARG A NE   3  
ATOM   1965  C CZ   . ARG A 1 39 ? 9.842  21.574 -3.400  1.00 0.00 ? 56 ARG A CZ   3  
ATOM   1966  N NH1  . ARG A 1 39 ? 9.445  21.429 -4.645  1.00 0.00 ? 56 ARG A NH1  3  
ATOM   1967  N NH2  . ARG A 1 39 ? 9.513  22.648 -2.705  1.00 0.00 ? 56 ARG A NH2  3  
ATOM   1968  H H    . ARG A 1 39 ? 10.007 16.187 0.346   1.00 0.00 ? 56 ARG A H    3  
ATOM   1969  H HA   . ARG A 1 39 ? 12.477 16.307 -1.267  1.00 0.00 ? 56 ARG A HA   3  
ATOM   1970  H HB2  . ARG A 1 39 ? 10.250 17.190 -1.985  1.00 0.00 ? 56 ARG A HB2  3  
ATOM   1971  H HB3  . ARG A 1 39 ? 10.542 18.525 -0.846  1.00 0.00 ? 56 ARG A HB3  3  
ATOM   1972  H HG2  . ARG A 1 39 ? 12.595 19.115 -2.049  1.00 0.00 ? 56 ARG A HG2  3  
ATOM   1973  H HG3  . ARG A 1 39 ? 12.328 17.765 -3.179  1.00 0.00 ? 56 ARG A HG3  3  
ATOM   1974  H HD2  . ARG A 1 39 ? 11.656 19.674 -4.300  1.00 0.00 ? 56 ARG A HD2  3  
ATOM   1975  H HD3  . ARG A 1 39 ? 10.156 18.880 -3.767  1.00 0.00 ? 56 ARG A HD3  3  
ATOM   1976  H HE   . ARG A 1 39 ? 10.810 20.998 -1.879  1.00 0.00 ? 56 ARG A HE   3  
ATOM   1977  H HH11 . ARG A 1 39 ? 9.720  20.611 -5.168  1.00 0.00 ? 56 ARG A HH11 3  
ATOM   1978  H HH12 . ARG A 1 39 ? 8.864  22.137 -5.071  1.00 0.00 ? 56 ARG A HH12 3  
ATOM   1979  H HH21 . ARG A 1 39 ? 9.842  22.752 -1.755  1.00 0.00 ? 56 ARG A HH21 3  
ATOM   1980  H HH22 . ARG A 1 39 ? 8.934  23.359 -3.125  1.00 0.00 ? 56 ARG A HH22 3  
ATOM   1981  N N    . LYS A 1 40 ? 13.945 17.842 -0.028  1.00 0.00 ? 57 LYS A N    3  
ATOM   1982  C CA   . LYS A 1 40 ? 14.862 18.669 0.748   1.00 0.00 ? 57 LYS A CA   3  
ATOM   1983  C C    . LYS A 1 40 ? 14.223 20.002 1.117   1.00 0.00 ? 57 LYS A C    3  
ATOM   1984  O O    . LYS A 1 40 ? 14.397 20.497 2.230   1.00 0.00 ? 57 LYS A O    3  
ATOM   1985  C CB   . LYS A 1 40 ? 16.158 18.905 -0.029  1.00 0.00 ? 57 LYS A CB   3  
ATOM   1986  C CG   . LYS A 1 40 ? 17.175 19.779 0.695   1.00 0.00 ? 57 LYS A CG   3  
ATOM   1987  C CD   . LYS A 1 40 ? 18.459 19.916 -0.110  1.00 0.00 ? 57 LYS A CD   3  
ATOM   1988  C CE   . LYS A 1 40 ? 19.459 20.823 0.591   1.00 0.00 ? 57 LYS A CE   3  
ATOM   1989  N NZ   . LYS A 1 40 ? 20.729 20.948 -0.173  1.00 0.00 ? 57 LYS A NZ   3  
ATOM   1990  H H    . LYS A 1 40 ? 14.267 17.427 -0.891  1.00 0.00 ? 57 LYS A H    3  
ATOM   1991  H HA   . LYS A 1 40 ? 15.104 18.170 1.687   1.00 0.00 ? 57 LYS A HA   3  
ATOM   1992  H HB2  . LYS A 1 40 ? 16.596 17.926 -0.225  1.00 0.00 ? 57 LYS A HB2  3  
ATOM   1993  H HB3  . LYS A 1 40 ? 15.885 19.375 -0.974  1.00 0.00 ? 57 LYS A HB3  3  
ATOM   1994  H HG2  . LYS A 1 40 ? 16.735 20.765 0.849   1.00 0.00 ? 57 LYS A HG2  3  
ATOM   1995  H HG3  . LYS A 1 40 ? 17.396 19.326 1.659   1.00 0.00 ? 57 LYS A HG3  3  
ATOM   1996  H HD2  . LYS A 1 40 ? 18.895 18.924 -0.239  1.00 0.00 ? 57 LYS A HD2  3  
ATOM   1997  H HD3  . LYS A 1 40 ? 18.214 20.334 -1.087  1.00 0.00 ? 57 LYS A HD3  3  
ATOM   1998  H HE2  . LYS A 1 40 ? 19.006 21.807 0.705   1.00 0.00 ? 57 LYS A HE2  3  
ATOM   1999  H HE3  . LYS A 1 40 ? 19.667 20.405 1.576   1.00 0.00 ? 57 LYS A HE3  3  
ATOM   2000  H HZ1  . LYS A 1 40 ? 20.536 21.337 -1.084  1.00 0.00 ? 57 LYS A HZ1  3  
ATOM   2001  H HZ2  . LYS A 1 40 ? 21.363 21.556 0.325   1.00 0.00 ? 57 LYS A HZ2  3  
ATOM   2002  H HZ3  . LYS A 1 40 ? 21.150 20.036 -0.278  1.00 0.00 ? 57 LYS A HZ3  3  
ATOM   2003  N N    . PHE A 1 41 ? 13.482 20.578 0.177   1.00 0.00 ? 58 PHE A N    3  
ATOM   2004  C CA   . PHE A 1 41 ? 12.805 21.848 0.406   1.00 0.00 ? 58 PHE A CA   3  
ATOM   2005  C C    . PHE A 1 41 ? 11.295 21.662 0.482   1.00 0.00 ? 58 PHE A C    3  
ATOM   2006  O O    . PHE A 1 41 ? 10.531 22.508 0.016   1.00 0.00 ? 58 PHE A O    3  
ATOM   2007  C CB   . PHE A 1 41 ? 13.157 22.848 -0.696  1.00 0.00 ? 58 PHE A CB   3  
ATOM   2008  C CG   . PHE A 1 41 ? 14.627 23.138 -0.804  1.00 0.00 ? 58 PHE A CG   3  
ATOM   2009  C CD1  . PHE A 1 41 ? 15.266 23.924 0.142   1.00 0.00 ? 58 PHE A CD1  3  
ATOM   2010  C CD2  . PHE A 1 41 ? 15.375 22.625 -1.853  1.00 0.00 ? 58 PHE A CD2  3  
ATOM   2011  C CE1  . PHE A 1 41 ? 16.617 24.193 0.044   1.00 0.00 ? 58 PHE A CE1  3  
ATOM   2012  C CE2  . PHE A 1 41 ? 16.727 22.890 -1.954  1.00 0.00 ? 58 PHE A CE2  3  
ATOM   2013  C CZ   . PHE A 1 41 ? 17.349 23.674 -1.006  1.00 0.00 ? 58 PHE A CZ   3  
ATOM   2014  H H    . PHE A 1 41 ? 13.386 20.124 -0.720  1.00 0.00 ? 58 PHE A H    3  
ATOM   2015  H HA   . PHE A 1 41 ? 13.114 22.265 1.366   1.00 0.00 ? 58 PHE A HA   3  
ATOM   2016  H HB2  . PHE A 1 41 ? 12.843 22.464 -1.665  1.00 0.00 ? 58 PHE A HB2  3  
ATOM   2017  H HB3  . PHE A 1 41 ? 12.665 23.802 -0.508  1.00 0.00 ? 58 PHE A HB3  3  
ATOM   2018  H HD1  . PHE A 1 41 ? 14.688 24.333 0.972   1.00 0.00 ? 58 PHE A HD1  3  
ATOM   2019  H HD2  . PHE A 1 41 ? 14.883 22.006 -2.605  1.00 0.00 ? 58 PHE A HD2  3  
ATOM   2020  H HE1  . PHE A 1 41 ? 17.107 24.813 0.795   1.00 0.00 ? 58 PHE A HE1  3  
ATOM   2021  H HE2  . PHE A 1 41 ? 17.302 22.481 -2.784  1.00 0.00 ? 58 PHE A HE2  3  
ATOM   2022  H HZ   . PHE A 1 41 ? 18.415 23.884 -1.084  1.00 0.00 ? 58 PHE A HZ   3  
ATOM   2023  N N    . LEU A 1 42 ? 10.870 20.551 1.073   1.00 0.00 ? 59 LEU A N    3  
ATOM   2024  C CA   . LEU A 1 42 ? 9.451  20.232 1.175   1.00 0.00 ? 59 LEU A CA   3  
ATOM   2025  C C    . LEU A 1 42 ? 8.713  21.267 2.015   1.00 0.00 ? 59 LEU A C    3  
ATOM   2026  O O    . LEU A 1 42 ? 9.204  21.698 3.058   1.00 0.00 ? 59 LEU A O    3  
ATOM   2027  C CB   . LEU A 1 42 ? 9.264  18.831 1.770   1.00 0.00 ? 59 LEU A CB   3  
ATOM   2028  C CG   . LEU A 1 42 ? 7.843  18.261 1.666   1.00 0.00 ? 59 LEU A CG   3  
ATOM   2029  C CD1  . LEU A 1 42 ? 7.491  18.003 0.207   1.00 0.00 ? 59 LEU A CD1  3  
ATOM   2030  C CD2  . LEU A 1 42 ? 7.748  16.979 2.479   1.00 0.00 ? 59 LEU A CD2  3  
ATOM   2031  H H    . LEU A 1 42 ? 11.547 19.909 1.461   1.00 0.00 ? 59 LEU A H    3  
ATOM   2032  H HA   . LEU A 1 42 ? 8.999  20.258 0.185   1.00 0.00 ? 59 LEU A HA   3  
ATOM   2033  H HB2  . LEU A 1 42 ? 9.939  18.272 1.125   1.00 0.00 ? 59 LEU A HB2  3  
ATOM   2034  H HB3  . LEU A 1 42 ? 9.620  18.778 2.800   1.00 0.00 ? 59 LEU A HB3  3  
ATOM   2035  H HG   . LEU A 1 42 ? 7.168  18.990 2.114   1.00 0.00 ? 59 LEU A HG   3  
ATOM   2036  H HD11 . LEU A 1 42 ? 6.481  17.599 0.143   1.00 0.00 ? 59 LEU A HD11 3  
ATOM   2037  H HD12 . LEU A 1 42 ? 7.543  18.938 -0.350  1.00 0.00 ? 59 LEU A HD12 3  
ATOM   2038  H HD13 . LEU A 1 42 ? 8.196  17.288 -0.216  1.00 0.00 ? 59 LEU A HD13 3  
ATOM   2039  H HD21 . LEU A 1 42 ? 7.977  17.191 3.523   1.00 0.00 ? 59 LEU A HD21 3  
ATOM   2040  H HD22 . LEU A 1 42 ? 6.738  16.575 2.403   1.00 0.00 ? 59 LEU A HD22 3  
ATOM   2041  H HD23 . LEU A 1 42 ? 8.461  16.249 2.093   1.00 0.00 ? 59 LEU A HD23 3  
ATOM   2042  N N    . LEU A 1 43 ? 7.532  21.663 1.552   1.00 0.00 ? 60 LEU A N    3  
ATOM   2043  C CA   . LEU A 1 43 ? 6.716  22.636 2.269   1.00 0.00 ? 60 LEU A CA   3  
ATOM   2044  C C    . LEU A 1 43 ? 6.404  22.159 3.681   1.00 0.00 ? 60 LEU A C    3  
ATOM   2045  O O    . LEU A 1 43 ? 6.505  22.923 4.641   1.00 0.00 ? 60 LEU A O    3  
ATOM   2046  C CB   . LEU A 1 43 ? 5.418  22.908 1.499   1.00 0.00 ? 60 LEU A CB   3  
ATOM   2047  C CG   . LEU A 1 43 ? 5.588  23.677 0.182   1.00 0.00 ? 60 LEU A CG   3  
ATOM   2048  C CD1  . LEU A 1 43 ? 4.268  23.711 -0.576  1.00 0.00 ? 60 LEU A CD1  3  
ATOM   2049  C CD2  . LEU A 1 43 ? 6.078  25.087 0.477   1.00 0.00 ? 60 LEU A CD2  3  
ATOM   2050  H H    . LEU A 1 43 ? 7.190  21.281 0.682   1.00 0.00 ? 60 LEU A H    3  
ATOM   2051  H HA   . LEU A 1 43 ? 7.267  23.570 2.373   1.00 0.00 ? 60 LEU A HA   3  
ATOM   2052  H HB2  . LEU A 1 43 ? 5.113  21.882 1.296   1.00 0.00 ? 60 LEU A HB2  3  
ATOM   2053  H HB3  . LEU A 1 43 ? 4.669  23.391 2.127   1.00 0.00 ? 60 LEU A HB3  3  
ATOM   2054  H HG   . LEU A 1 43 ? 6.362  23.168 -0.392  1.00 0.00 ? 60 LEU A HG   3  
ATOM   2055  H HD11 . LEU A 1 43 ? 4.399  24.259 -1.510  1.00 0.00 ? 60 LEU A HD11 3  
ATOM   2056  H HD12 . LEU A 1 43 ? 3.948  22.694 -0.797  1.00 0.00 ? 60 LEU A HD12 3  
ATOM   2057  H HD13 . LEU A 1 43 ? 3.513  24.207 0.031   1.00 0.00 ? 60 LEU A HD13 3  
ATOM   2058  H HD21 . LEU A 1 43 ? 7.036  25.039 0.995   1.00 0.00 ? 60 LEU A HD21 3  
ATOM   2059  H HD22 . LEU A 1 43 ? 6.200  25.632 -0.459  1.00 0.00 ? 60 LEU A HD22 3  
ATOM   2060  H HD23 . LEU A 1 43 ? 5.351  25.602 1.106   1.00 0.00 ? 60 LEU A HD23 3  
ATOM   2061  N N    . ASP A 1 44 ? 6.025  20.891 3.803   1.00 0.00 ? 61 ASP A N    3  
ATOM   2062  C CA   . ASP A 1 44 ? 5.807  20.279 5.107   1.00 0.00 ? 61 ASP A CA   3  
ATOM   2063  C C    . ASP A 1 44 ? 7.128  19.966 5.798   1.00 0.00 ? 61 ASP A C    3  
ATOM   2064  O O    . ASP A 1 44 ? 7.621  18.839 5.736   1.00 0.00 ? 61 ASP A O    3  
ATOM   2065  C CB   . ASP A 1 44 ? 4.972  19.002 4.968   1.00 0.00 ? 61 ASP A CB   3  
ATOM   2066  C CG   . ASP A 1 44 ? 4.577  18.362 6.292   1.00 0.00 ? 61 ASP A CG   3  
ATOM   2067  O OD1  . ASP A 1 44 ? 4.917  18.903 7.316   1.00 0.00 ? 61 ASP A OD1  3  
ATOM   2068  O OD2  . ASP A 1 44 ? 3.808  17.430 6.271   1.00 0.00 ? 61 ASP A OD2  3  
ATOM   2069  H H    . ASP A 1 44 ? 5.884  20.338 2.970   1.00 0.00 ? 61 ASP A H    3  
ATOM   2070  H HA   . ASP A 1 44 ? 5.274  20.973 5.757   1.00 0.00 ? 61 ASP A HA   3  
ATOM   2071  H HB2  . ASP A 1 44 ? 4.085  19.130 4.347   1.00 0.00 ? 61 ASP A HB2  3  
ATOM   2072  H HB3  . ASP A 1 44 ? 5.688  18.361 4.454   1.00 0.00 ? 61 ASP A HB3  3  
ATOM   2073  N N    . ARG A 1 45 ? 7.699  20.970 6.455   1.00 0.00 ? 62 ARG A N    3  
ATOM   2074  C CA   . ARG A 1 45 ? 8.958  20.801 7.170   1.00 0.00 ? 62 ARG A CA   3  
ATOM   2075  C C    . ARG A 1 45 ? 8.737  20.142 8.525   1.00 0.00 ? 62 ARG A C    3  
ATOM   2076  O O    . ARG A 1 45 ? 8.593  18.952 8.597   1.00 0.00 ? 62 ARG A O    3  
ATOM   2077  C CB   . ARG A 1 45 ? 9.722  22.110 7.306   1.00 0.00 ? 62 ARG A CB   3  
ATOM   2078  C CG   . ARG A 1 45 ? 10.209 22.705 5.994   1.00 0.00 ? 62 ARG A CG   3  
ATOM   2079  C CD   . ARG A 1 45 ? 10.880 24.023 6.131   1.00 0.00 ? 62 ARG A CD   3  
ATOM   2080  N NE   . ARG A 1 45 ? 9.994  25.114 6.504   1.00 0.00 ? 62 ARG A NE   3  
ATOM   2081  C CZ   . ARG A 1 45 ? 10.407 26.331 6.905   1.00 0.00 ? 62 ARG A CZ   3  
ATOM   2082  N NH1  . ARG A 1 45 ? 11.688 26.608 7.023   1.00 0.00 ? 62 ARG A NH1  3  
ATOM   2083  N NH2  . ARG A 1 45 ? 9.490  27.237 7.201   1.00 0.00 ? 62 ARG A NH2  3  
ATOM   2084  O OXT  . ARG A 1 45 ? 8.708  20.811 9.520   1.00 0.00 ? 62 ARG A OXT  3  
ATOM   2085  H H    . ARG A 1 45 ? 7.248  21.874 6.458   1.00 0.00 ? 62 ARG A H    3  
ATOM   2086  H HA   . ARG A 1 45 ? 9.616  20.139 6.606   1.00 0.00 ? 62 ARG A HA   3  
ATOM   2087  H HB2  . ARG A 1 45 ? 9.055  22.818 7.795   1.00 0.00 ? 62 ARG A HB2  3  
ATOM   2088  H HB3  . ARG A 1 45 ? 10.578 21.912 7.949   1.00 0.00 ? 62 ARG A HB3  3  
ATOM   2089  H HG2  . ARG A 1 45 ? 10.919 22.012 5.541   1.00 0.00 ? 62 ARG A HG2  3  
ATOM   2090  H HG3  . ARG A 1 45 ? 9.352  22.830 5.331   1.00 0.00 ? 62 ARG A HG3  3  
ATOM   2091  H HD2  . ARG A 1 45 ? 11.649 23.950 6.900   1.00 0.00 ? 62 ARG A HD2  3  
ATOM   2092  H HD3  . ARG A 1 45 ? 11.341 24.286 5.180   1.00 0.00 ? 62 ARG A HD3  3  
ATOM   2093  H HE   . ARG A 1 45 ? 8.983  25.145 6.525   1.00 0.00 ? 62 ARG A HE   3  
ATOM   2094  H HH11 . ARG A 1 45 ? 12.376 25.900 6.811   1.00 0.00 ? 62 ARG A HH11 3  
ATOM   2095  H HH12 . ARG A 1 45 ? 11.976 27.527 7.326   1.00 0.00 ? 62 ARG A HH12 3  
ATOM   2096  H HH21 . ARG A 1 45 ? 8.510  27.001 7.121   1.00 0.00 ? 62 ARG A HH21 3  
ATOM   2097  H HH22 . ARG A 1 45 ? 9.772  28.157 7.505   1.00 0.00 ? 62 ARG A HH22 3  
ATOM   2098  N N    . PRO A 1 1  ? 0.187  -0.772 -0.808  1.00 0.00 ? 18 PRO A N    4  
ATOM   2099  C CA   . PRO A 1 1  ? 1.495  -0.648 -0.177  1.00 0.00 ? 18 PRO A CA   4  
ATOM   2100  C C    . PRO A 1 1  ? 1.972  0.799  -0.180  1.00 0.00 ? 18 PRO A C    4  
ATOM   2101  O O    . PRO A 1 1  ? 1.571  1.593  -1.031  1.00 0.00 ? 18 PRO A O    4  
ATOM   2102  C CB   . PRO A 1 1  ? 2.402  -1.555 -1.015  1.00 0.00 ? 18 PRO A CB   4  
ATOM   2103  C CG   . PRO A 1 1  ? 1.796  -1.530 -2.377  1.00 0.00 ? 18 PRO A CG   4  
ATOM   2104  C CD   . PRO A 1 1  ? 0.311  -1.446 -2.151  1.00 0.00 ? 18 PRO A CD   4  
ATOM   2105  H H2   . PRO A 1 1  ? 0.073  -1.352 -1.615  1.00 0.00 ? 18 PRO A H2   4  
ATOM   2106  H H3   . PRO A 1 1  ? -0.587 -1.132 -0.286  1.00 0.00 ? 18 PRO A H3   4  
ATOM   2107  H HA   . PRO A 1 1  ? 1.487  -0.942 0.883   1.00 0.00 ? 18 PRO A HA   4  
ATOM   2108  H HB2  . PRO A 1 1  ? 3.438  -1.184 -1.033  1.00 0.00 ? 18 PRO A HB2  4  
ATOM   2109  H HB3  . PRO A 1 1  ? 2.433  -2.577 -0.611  1.00 0.00 ? 18 PRO A HB3  4  
ATOM   2110  H HG2  . PRO A 1 1  ? 2.158  -0.669 -2.957  1.00 0.00 ? 18 PRO A HG2  4  
ATOM   2111  H HG3  . PRO A 1 1  ? 2.060  -2.434 -2.945  1.00 0.00 ? 18 PRO A HG3  4  
ATOM   2112  H HD2  . PRO A 1 1  ? -0.197 -0.859 -2.930  1.00 0.00 ? 18 PRO A HD2  4  
ATOM   2113  H HD3  . PRO A 1 1  ? -0.165 -2.438 -2.137  1.00 0.00 ? 18 PRO A HD3  4  
ATOM   2114  N N    . THR A 1 2  ? 2.830  1.135  0.777   1.00 0.00 ? 19 THR A N    4  
ATOM   2115  C CA   . THR A 1 2  ? 3.353  2.492  0.896   1.00 0.00 ? 19 THR A CA   4  
ATOM   2116  C C    . THR A 1 2  ? 4.873  2.506  0.792   1.00 0.00 ? 19 THR A C    4  
ATOM   2117  O O    . THR A 1 2  ? 5.553  1.670  1.386   1.00 0.00 ? 19 THR A O    4  
ATOM   2118  C CB   . THR A 1 2  ? 2.933  3.145  2.226   1.00 0.00 ? 19 THR A CB   4  
ATOM   2119  O OG1  . THR A 1 2  ? 1.502  3.188  2.308   1.00 0.00 ? 19 THR A OG1  4  
ATOM   2120  C CG2  . THR A 1 2  ? 3.485  4.559  2.323   1.00 0.00 ? 19 THR A CG2  4  
ATOM   2121  H H    . THR A 1 2  ? 3.127  0.434  1.441   1.00 0.00 ? 19 THR A H    4  
ATOM   2122  H HA   . THR A 1 2  ? 2.981  3.103  0.073   1.00 0.00 ? 19 THR A HA   4  
ATOM   2123  H HB   . THR A 1 2  ? 3.318  2.548  3.051   1.00 0.00 ? 19 THR A HB   4  
ATOM   2124  H HG1  . THR A 1 2  ? 1.242  3.595  3.139   1.00 0.00 ? 19 THR A HG1  4  
ATOM   2125  H HG21 . THR A 1 2  ? 3.100  5.157  1.498   1.00 0.00 ? 19 THR A HG21 4  
ATOM   2126  H HG22 . THR A 1 2  ? 3.178  5.004  3.268   1.00 0.00 ? 19 THR A HG22 4  
ATOM   2127  H HG23 . THR A 1 2  ? 4.574  4.528  2.271   1.00 0.00 ? 19 THR A HG23 4  
ATOM   2128  N N    . ARG A 1 3  ? 5.399  3.462  0.034   1.00 0.00 ? 20 ARG A N    4  
ATOM   2129  C CA   . ARG A 1 3  ? 6.840  3.592  -0.145  1.00 0.00 ? 20 ARG A CA   4  
ATOM   2130  C C    . ARG A 1 3  ? 7.303  5.019  0.117   1.00 0.00 ? 20 ARG A C    4  
ATOM   2131  O O    . ARG A 1 3  ? 6.507  5.957  0.070   1.00 0.00 ? 20 ARG A O    4  
ATOM   2132  C CB   . ARG A 1 3  ? 7.295  3.100  -1.511  1.00 0.00 ? 20 ARG A CB   4  
ATOM   2133  C CG   . ARG A 1 3  ? 7.002  1.635  -1.794  1.00 0.00 ? 20 ARG A CG   4  
ATOM   2134  C CD   . ARG A 1 3  ? 7.809  0.682  -0.991  1.00 0.00 ? 20 ARG A CD   4  
ATOM   2135  N NE   . ARG A 1 3  ? 7.567  -0.719 -1.295  1.00 0.00 ? 20 ARG A NE   4  
ATOM   2136  C CZ   . ARG A 1 3  ? 6.637  -1.484 -0.689  1.00 0.00 ? 20 ARG A CZ   4  
ATOM   2137  N NH1  . ARG A 1 3  ? 5.887  -1.000 0.277   1.00 0.00 ? 20 ARG A NH1  4  
ATOM   2138  N NH2  . ARG A 1 3  ? 6.515  -2.741 -1.076  1.00 0.00 ? 20 ARG A NH2  4  
ATOM   2139  H H    . ARG A 1 3  ? 4.785  4.117  -0.429  1.00 0.00 ? 20 ARG A H    4  
ATOM   2140  H HA   . ARG A 1 3  ? 7.360  2.960  0.576   1.00 0.00 ? 20 ARG A HA   4  
ATOM   2141  H HB2  . ARG A 1 3  ? 6.793  3.718  -2.255  1.00 0.00 ? 20 ARG A HB2  4  
ATOM   2142  H HB3  . ARG A 1 3  ? 8.371  3.267  -1.567  1.00 0.00 ? 20 ARG A HB3  4  
ATOM   2143  H HG2  . ARG A 1 3  ? 5.949  1.445  -1.583  1.00 0.00 ? 20 ARG A HG2  4  
ATOM   2144  H HG3  . ARG A 1 3  ? 7.200  1.440  -2.848  1.00 0.00 ? 20 ARG A HG3  4  
ATOM   2145  H HD2  . ARG A 1 3  ? 8.866  0.876  -1.170  1.00 0.00 ? 20 ARG A HD2  4  
ATOM   2146  H HD3  . ARG A 1 3  ? 7.586  0.831  0.065   1.00 0.00 ? 20 ARG A HD3  4  
ATOM   2147  H HE   . ARG A 1 3  ? 8.022  -1.321 -1.968  1.00 0.00 ? 20 ARG A HE   4  
ATOM   2148  H HH11 . ARG A 1 3  ? 6.005  -0.042 0.574   1.00 0.00 ? 20 ARG A HH11 4  
ATOM   2149  H HH12 . ARG A 1 3  ? 5.196  -1.590 0.719   1.00 0.00 ? 20 ARG A HH12 4  
ATOM   2150  H HH21 . ARG A 1 3  ? 7.111  -3.102 -1.808  1.00 0.00 ? 20 ARG A HH21 4  
ATOM   2151  H HH22 . ARG A 1 3  ? 5.827  -3.336 -0.637  1.00 0.00 ? 20 ARG A HH22 4  
ATOM   2152  N N    . THR A 1 4  ? 8.593  5.177  0.390   1.00 0.00 ? 21 THR A N    4  
ATOM   2153  C CA   . THR A 1 4  ? 9.165  6.491  0.657   1.00 0.00 ? 21 THR A CA   4  
ATOM   2154  C C    . THR A 1 4  ? 10.354 6.770  -0.252  1.00 0.00 ? 21 THR A C    4  
ATOM   2155  O O    . THR A 1 4  ? 11.309 5.994  -0.297  1.00 0.00 ? 21 THR A O    4  
ATOM   2156  C CB   . THR A 1 4  ? 9.610  6.627  2.125   1.00 0.00 ? 21 THR A CB   4  
ATOM   2157  O OG1  . THR A 1 4  ? 8.485  6.423  2.989   1.00 0.00 ? 21 THR A OG1  4  
ATOM   2158  C CG2  . THR A 1 4  ? 10.197 8.006  2.379   1.00 0.00 ? 21 THR A CG2  4  
ATOM   2159  H H    . THR A 1 4  ? 9.194  4.366  0.414   1.00 0.00 ? 21 THR A H    4  
ATOM   2160  H HA   . THR A 1 4  ? 8.426  7.265  0.443   1.00 0.00 ? 21 THR A HA   4  
ATOM   2161  H HB   . THR A 1 4  ? 10.362 5.868  2.338   1.00 0.00 ? 21 THR A HB   4  
ATOM   2162  H HG1  . THR A 1 4  ? 8.765  6.507  3.904   1.00 0.00 ? 21 THR A HG1  4  
ATOM   2163  H HG21 . THR A 1 4  ? 9.445  8.766  2.168   1.00 0.00 ? 21 THR A HG21 4  
ATOM   2164  H HG22 . THR A 1 4  ? 10.506 8.082  3.422   1.00 0.00 ? 21 THR A HG22 4  
ATOM   2165  H HG23 . THR A 1 4  ? 11.060 8.159  1.731   1.00 0.00 ? 21 THR A HG23 4  
ATOM   2166  N N    . VAL A 1 5  ? 10.292 7.883  -0.976  1.00 0.00 ? 22 VAL A N    4  
ATOM   2167  C CA   . VAL A 1 5  ? 11.371 8.274  -1.875  1.00 0.00 ? 22 VAL A CA   4  
ATOM   2168  C C    . VAL A 1 5  ? 11.814 9.708  -1.612  1.00 0.00 ? 22 VAL A C    4  
ATOM   2169  O O    . VAL A 1 5  ? 10.988 10.616 -1.519  1.00 0.00 ? 22 VAL A O    4  
ATOM   2170  C CB   . VAL A 1 5  ? 10.955 8.137  -3.351  1.00 0.00 ? 22 VAL A CB   4  
ATOM   2171  C CG1  . VAL A 1 5  ? 12.063 8.638  -4.266  1.00 0.00 ? 22 VAL A CG1  4  
ATOM   2172  C CG2  . VAL A 1 5  ? 10.610 6.691  -3.676  1.00 0.00 ? 22 VAL A CG2  4  
ATOM   2173  H H    . VAL A 1 5  ? 9.476  8.473  -0.902  1.00 0.00 ? 22 VAL A H    4  
ATOM   2174  H HA   . VAL A 1 5  ? 12.264 7.671  -1.708  1.00 0.00 ? 22 VAL A HA   4  
ATOM   2175  H HB   . VAL A 1 5  ? 10.051 8.723  -3.521  1.00 0.00 ? 22 VAL A HB   4  
ATOM   2176  H HG11 . VAL A 1 5  ? 11.752 8.534  -5.306  1.00 0.00 ? 22 VAL A HG11 4  
ATOM   2177  H HG12 . VAL A 1 5  ? 12.266 9.687  -4.051  1.00 0.00 ? 22 VAL A HG12 4  
ATOM   2178  H HG13 . VAL A 1 5  ? 12.966 8.051  -4.098  1.00 0.00 ? 22 VAL A HG13 4  
ATOM   2179  H HG21 . VAL A 1 5  ? 9.785  6.363  -3.044  1.00 0.00 ? 22 VAL A HG21 4  
ATOM   2180  H HG22 . VAL A 1 5  ? 10.318 6.613  -4.723  1.00 0.00 ? 22 VAL A HG22 4  
ATOM   2181  H HG23 . VAL A 1 5  ? 11.481 6.061  -3.494  1.00 0.00 ? 22 VAL A HG23 4  
ATOM   2182  N N    . ALA A 1 6  ? 13.123 9.905  -1.495  1.00 0.00 ? 23 ALA A N    4  
ATOM   2183  C CA   . ALA A 1 6  ? 13.681 11.234 -1.272  1.00 0.00 ? 23 ALA A CA   4  
ATOM   2184  C C    . ALA A 1 6  ? 13.944 11.949 -2.590  1.00 0.00 ? 23 ALA A C    4  
ATOM   2185  O O    . ALA A 1 6  ? 14.268 11.318 -3.596  1.00 0.00 ? 23 ALA A O    4  
ATOM   2186  C CB   . ALA A 1 6  ? 14.958 11.140 -0.449  1.00 0.00 ? 23 ALA A CB   4  
ATOM   2187  H H    . ALA A 1 6  ? 13.748 9.114  -1.562  1.00 0.00 ? 23 ALA A H    4  
ATOM   2188  H HA   . ALA A 1 6  ? 12.953 11.829 -0.719  1.00 0.00 ? 23 ALA A HA   4  
ATOM   2189  H HB1  . ALA A 1 6  ? 15.689 10.535 -0.982  1.00 0.00 ? 23 ALA A HB1  4  
ATOM   2190  H HB2  . ALA A 1 6  ? 15.360 12.141 -0.292  1.00 0.00 ? 23 ALA A HB2  4  
ATOM   2191  H HB3  . ALA A 1 6  ? 14.738 10.682 0.514   1.00 0.00 ? 23 ALA A HB3  4  
ATOM   2192  N N    . ILE A 1 7  ? 13.805 13.270 -2.579  1.00 0.00 ? 24 ILE A N    4  
ATOM   2193  C CA   . ILE A 1 7  ? 14.081 14.080 -3.759  1.00 0.00 ? 24 ILE A CA   4  
ATOM   2194  C C    . ILE A 1 7  ? 15.127 15.146 -3.463  1.00 0.00 ? 24 ILE A C    4  
ATOM   2195  O O    . ILE A 1 7  ? 14.803 16.227 -2.970  1.00 0.00 ? 24 ILE A O    4  
ATOM   2196  C CB   . ILE A 1 7  ? 12.805 14.758 -4.290  1.00 0.00 ? 24 ILE A CB   4  
ATOM   2197  C CG1  . ILE A 1 7  ? 11.742 13.708 -4.624  1.00 0.00 ? 24 ILE A CG1  4  
ATOM   2198  C CG2  . ILE A 1 7  ? 13.123 15.606 -5.513  1.00 0.00 ? 24 ILE A CG2  4  
ATOM   2199  C CD1  . ILE A 1 7  ? 10.408 14.296 -5.025  1.00 0.00 ? 24 ILE A CD1  4  
ATOM   2200  H H    . ILE A 1 7  ? 13.500 13.725 -1.730  1.00 0.00 ? 24 ILE A H    4  
ATOM   2201  H HA   . ILE A 1 7  ? 14.523 13.471 -4.547  1.00 0.00 ? 24 ILE A HA   4  
ATOM   2202  H HB   . ILE A 1 7  ? 12.387 15.390 -3.508  1.00 0.00 ? 24 ILE A HB   4  
ATOM   2203  H HG12 . ILE A 1 7  ? 12.132 13.101 -5.441  1.00 0.00 ? 24 ILE A HG12 4  
ATOM   2204  H HG13 . ILE A 1 7  ? 11.613 13.085 -3.738  1.00 0.00 ? 24 ILE A HG13 4  
ATOM   2205  H HG21 . ILE A 1 7  ? 12.210 16.077 -5.876  1.00 0.00 ? 24 ILE A HG21 4  
ATOM   2206  H HG22 . ILE A 1 7  ? 13.846 16.375 -5.244  1.00 0.00 ? 24 ILE A HG22 4  
ATOM   2207  H HG23 . ILE A 1 7  ? 13.541 14.973 -6.296  1.00 0.00 ? 24 ILE A HG23 4  
ATOM   2208  H HD11 . ILE A 1 7  ? 10.535 14.918 -5.910  1.00 0.00 ? 24 ILE A HD11 4  
ATOM   2209  H HD12 . ILE A 1 7  ? 9.707  13.491 -5.246  1.00 0.00 ? 24 ILE A HD12 4  
ATOM   2210  H HD13 . ILE A 1 7  ? 10.017 14.903 -4.208  1.00 0.00 ? 24 ILE A HD13 4  
ATOM   2211  N N    . SER A 1 8  ? 16.383 14.838 -3.767  1.00 0.00 ? 25 SER A N    4  
ATOM   2212  C CA   . SER A 1 8  ? 17.491 15.728 -3.444  1.00 0.00 ? 25 SER A CA   4  
ATOM   2213  C C    . SER A 1 8  ? 17.693 16.775 -4.531  1.00 0.00 ? 25 SER A C    4  
ATOM   2214  O O    . SER A 1 8  ? 18.387 17.771 -4.327  1.00 0.00 ? 25 SER A O    4  
ATOM   2215  C CB   . SER A 1 8  ? 18.762 14.927 -3.239  1.00 0.00 ? 25 SER A CB   4  
ATOM   2216  O OG   . SER A 1 8  ? 19.214 14.342 -4.429  1.00 0.00 ? 25 SER A OG   4  
ATOM   2217  H H    . SER A 1 8  ? 16.575 13.963 -4.235  1.00 0.00 ? 25 SER A H    4  
ATOM   2218  H HA   . SER A 1 8  ? 17.385 16.216 -2.474  1.00 0.00 ? 25 SER A HA   4  
ATOM   2219  H HB2  . SER A 1 8  ? 19.535 15.593 -2.855  1.00 0.00 ? 25 SER A HB2  4  
ATOM   2220  H HB3  . SER A 1 8  ? 18.566 14.142 -2.510  1.00 0.00 ? 25 SER A HB3  4  
ATOM   2221  H HG   . SER A 1 8  ? 19.488 15.031 -5.039  1.00 0.00 ? 25 SER A HG   4  
ATOM   2222  N N    . ASP A 1 9  ? 17.083 16.543 -5.689  1.00 0.00 ? 26 ASP A N    4  
ATOM   2223  C CA   . ASP A 1 9  ? 17.240 17.437 -6.830  1.00 0.00 ? 26 ASP A CA   4  
ATOM   2224  C C    . ASP A 1 9  ? 16.053 17.332 -7.779  1.00 0.00 ? 26 ASP A C    4  
ATOM   2225  O O    . ASP A 1 9  ? 15.271 16.384 -7.706  1.00 0.00 ? 26 ASP A O    4  
ATOM   2226  C CB   . ASP A 1 9  ? 18.539 17.128 -7.579  1.00 0.00 ? 26 ASP A CB   4  
ATOM   2227  C CG   . ASP A 1 9  ? 19.082 18.290 -8.401  1.00 0.00 ? 26 ASP A CG   4  
ATOM   2228  O OD1  . ASP A 1 9  ? 18.482 19.338 -8.380  1.00 0.00 ? 26 ASP A OD1  4  
ATOM   2229  O OD2  . ASP A 1 9  ? 20.168 18.170 -8.916  1.00 0.00 ? 26 ASP A OD2  4  
ATOM   2230  H H    . ASP A 1 9  ? 16.497 15.726 -5.781  1.00 0.00 ? 26 ASP A H    4  
ATOM   2231  H HA   . ASP A 1 9  ? 17.273 18.471 -6.487  1.00 0.00 ? 26 ASP A HA   4  
ATOM   2232  H HB2  . ASP A 1 9  ? 19.329 16.740 -6.935  1.00 0.00 ? 26 ASP A HB2  4  
ATOM   2233  H HB3  . ASP A 1 9  ? 18.193 16.341 -8.247  1.00 0.00 ? 26 ASP A HB3  4  
ATOM   2234  N N    . ALA A 1 10 ? 15.924 18.311 -8.668  1.00 0.00 ? 27 ALA A N    4  
ATOM   2235  C CA   . ALA A 1 10 ? 14.839 18.325 -9.641  1.00 0.00 ? 27 ALA A CA   4  
ATOM   2236  C C    . ALA A 1 10 ? 14.934 17.134 -10.588 1.00 0.00 ? 27 ALA A C    4  
ATOM   2237  O O    . ALA A 1 10 ? 13.931 16.696 -11.152 1.00 0.00 ? 27 ALA A O    4  
ATOM   2238  C CB   . ALA A 1 10 ? 14.845 19.629 -10.423 1.00 0.00 ? 27 ALA A CB   4  
ATOM   2239  H H    . ALA A 1 10 ? 16.596 19.066 -8.669  1.00 0.00 ? 27 ALA A H    4  
ATOM   2240  H HA   . ALA A 1 10 ? 13.891 18.242 -9.110  1.00 0.00 ? 27 ALA A HA   4  
ATOM   2241  H HB1  . ALA A 1 10 ? 15.793 19.734 -10.949 1.00 0.00 ? 27 ALA A HB1  4  
ATOM   2242  H HB2  . ALA A 1 10 ? 14.029 19.624 -11.146 1.00 0.00 ? 27 ALA A HB2  4  
ATOM   2243  H HB3  . ALA A 1 10 ? 14.715 20.466 -9.737  1.00 0.00 ? 27 ALA A HB3  4  
ATOM   2244  N N    . ALA A 1 11 ? 16.145 16.615 -10.758 1.00 0.00 ? 28 ALA A N    4  
ATOM   2245  C CA   . ALA A 1 11 ? 16.356 15.400 -11.537 1.00 0.00 ? 28 ALA A CA   4  
ATOM   2246  C C    . ALA A 1 11 ? 15.575 14.230 -10.952 1.00 0.00 ? 28 ALA A C    4  
ATOM   2247  O O    . ALA A 1 11 ? 15.180 13.314 -11.673 1.00 0.00 ? 28 ALA A O    4  
ATOM   2248  C CB   . ALA A 1 11 ? 17.839 15.069 -11.610 1.00 0.00 ? 28 ALA A CB   4  
ATOM   2249  H H    . ALA A 1 11 ? 16.941 17.074 -10.337 1.00 0.00 ? 28 ALA A H    4  
ATOM   2250  H HA   . ALA A 1 11 ? 15.985 15.565 -12.548 1.00 0.00 ? 28 ALA A HA   4  
ATOM   2251  H HB1  . ALA A 1 11 ? 18.228 14.916 -10.605 1.00 0.00 ? 28 ALA A HB1  4  
ATOM   2252  H HB2  . ALA A 1 11 ? 17.978 14.159 -12.196 1.00 0.00 ? 28 ALA A HB2  4  
ATOM   2253  H HB3  . ALA A 1 11 ? 18.373 15.891 -12.086 1.00 0.00 ? 28 ALA A HB3  4  
ATOM   2254  N N    . GLN A 1 12 ? 15.357 14.266 -9.642  1.00 0.00 ? 29 GLN A N    4  
ATOM   2255  C CA   . GLN A 1 12 ? 14.653 13.191 -8.954  1.00 0.00 ? 29 GLN A CA   4  
ATOM   2256  C C    . GLN A 1 12 ? 13.173 13.516 -8.792  1.00 0.00 ? 29 GLN A C    4  
ATOM   2257  O O    . GLN A 1 12 ? 12.399 12.699 -8.295  1.00 0.00 ? 29 GLN A O    4  
ATOM   2258  C CB   . GLN A 1 12 ? 15.278 12.935 -7.580  1.00 0.00 ? 29 GLN A CB   4  
ATOM   2259  C CG   . GLN A 1 12 ? 16.737 12.516 -7.628  1.00 0.00 ? 29 GLN A CG   4  
ATOM   2260  C CD   . GLN A 1 12 ? 17.347 12.382 -6.246  1.00 0.00 ? 29 GLN A CD   4  
ATOM   2261  O OE1  . GLN A 1 12 ? 16.636 12.355 -5.238  1.00 0.00 ? 29 GLN A OE1  4  
ATOM   2262  N NE2  . GLN A 1 12 ? 18.671 12.303 -6.190  1.00 0.00 ? 29 GLN A NE2  4  
ATOM   2263  H H    . GLN A 1 12 ? 15.686 15.059 -9.110  1.00 0.00 ? 29 GLN A H    4  
ATOM   2264  H HA   . GLN A 1 12 ? 14.707 12.279 -9.548  1.00 0.00 ? 29 GLN A HA   4  
ATOM   2265  H HB2  . GLN A 1 12 ? 15.177 13.859 -7.011  1.00 0.00 ? 29 GLN A HB2  4  
ATOM   2266  H HB3  . GLN A 1 12 ? 14.686 12.153 -7.106  1.00 0.00 ? 29 GLN A HB3  4  
ATOM   2267  H HG2  . GLN A 1 12 ? 17.091 11.682 -8.233  1.00 0.00 ? 29 GLN A HG2  4  
ATOM   2268  H HG3  . GLN A 1 12 ? 17.081 13.453 -8.068  1.00 0.00 ? 29 GLN A HG3  4  
ATOM   2269  H HE21 . GLN A 1 12 ? 19.211 12.331 -7.032  1.00 0.00 ? 29 GLN A HE21 4  
ATOM   2270  H HE22 . GLN A 1 12 ? 19.132 12.213 -5.305  1.00 0.00 ? 29 GLN A HE22 4  
ATOM   2271  N N    . LEU A 1 13 ? 12.787 14.715 -9.215  1.00 0.00 ? 30 LEU A N    4  
ATOM   2272  C CA   . LEU A 1 13 ? 11.395 15.143 -9.136  1.00 0.00 ? 30 LEU A CA   4  
ATOM   2273  C C    . LEU A 1 13 ? 10.542 14.443 -10.186 1.00 0.00 ? 30 LEU A C    4  
ATOM   2274  O O    . LEU A 1 13 ? 10.833 14.508 -11.380 1.00 0.00 ? 30 LEU A O    4  
ATOM   2275  C CB   . LEU A 1 13 ? 11.299 16.666 -9.300  1.00 0.00 ? 30 LEU A CB   4  
ATOM   2276  C CG   . LEU A 1 13 ? 9.920  17.268 -9.004  1.00 0.00 ? 30 LEU A CG   4  
ATOM   2277  C CD1  . LEU A 1 13 ? 9.609  17.157 -7.517  1.00 0.00 ? 30 LEU A CD1  4  
ATOM   2278  C CD2  . LEU A 1 13 ? 9.893  18.721 -9.452  1.00 0.00 ? 30 LEU A CD2  4  
ATOM   2279  H H    . LEU A 1 13 ? 13.474 15.345 -9.602  1.00 0.00 ? 30 LEU A H    4  
ATOM   2280  H HA   . LEU A 1 13 ? 10.982 14.865 -8.168  1.00 0.00 ? 30 LEU A HA   4  
ATOM   2281  H HB2  . LEU A 1 13 ? 12.012 16.970 -8.535  1.00 0.00 ? 30 LEU A HB2  4  
ATOM   2282  H HB3  . LEU A 1 13 ? 11.654 16.990 -10.277 1.00 0.00 ? 30 LEU A HB3  4  
ATOM   2283  H HG   . LEU A 1 13 ? 9.192  16.720 -9.602  1.00 0.00 ? 30 LEU A HG   4  
ATOM   2284  H HD11 . LEU A 1 13 ? 8.628  17.587 -7.316  1.00 0.00 ? 30 LEU A HD11 4  
ATOM   2285  H HD12 . LEU A 1 13 ? 9.611  16.107 -7.223  1.00 0.00 ? 30 LEU A HD12 4  
ATOM   2286  H HD13 . LEU A 1 13 ? 10.364 17.695 -6.946  1.00 0.00 ? 30 LEU A HD13 4  
ATOM   2287  H HD21 . LEU A 1 13 ? 10.089 18.776 -10.523 1.00 0.00 ? 30 LEU A HD21 4  
ATOM   2288  H HD22 . LEU A 1 13 ? 8.911  19.149 -9.242  1.00 0.00 ? 30 LEU A HD22 4  
ATOM   2289  H HD23 . LEU A 1 13 ? 10.656 19.284 -8.915  1.00 0.00 ? 30 LEU A HD23 4  
ATOM   2290  N N    . PRO A 1 14 ? 9.488  13.773 -9.734  1.00 0.00 ? 31 PRO A N    4  
ATOM   2291  C CA   . PRO A 1 14 ? 8.556  13.108 -10.638 1.00 0.00 ? 31 PRO A CA   4  
ATOM   2292  C C    . PRO A 1 14 ? 7.890  14.108 -11.574 1.00 0.00 ? 31 PRO A C    4  
ATOM   2293  O O    . PRO A 1 14 ? 8.112  15.315 -11.469 1.00 0.00 ? 31 PRO A O    4  
ATOM   2294  C CB   . PRO A 1 14 ? 7.547  12.432 -9.705  1.00 0.00 ? 31 PRO A CB   4  
ATOM   2295  C CG   . PRO A 1 14 ? 8.255  12.341 -8.396  1.00 0.00 ? 31 PRO A CG   4  
ATOM   2296  C CD   . PRO A 1 14 ? 9.121  13.570 -8.324  1.00 0.00 ? 31 PRO A CD   4  
ATOM   2297  H HA   . PRO A 1 14 ? 9.052  12.384 -11.302 1.00 0.00 ? 31 PRO A HA   4  
ATOM   2298  H HB2  . PRO A 1 14 ? 6.622  13.020 -9.618  1.00 0.00 ? 31 PRO A HB2  4  
ATOM   2299  H HB3  . PRO A 1 14 ? 7.263  11.436 -10.073 1.00 0.00 ? 31 PRO A HB3  4  
ATOM   2300  H HG2  . PRO A 1 14 ? 7.541  12.311 -7.559  1.00 0.00 ? 31 PRO A HG2  4  
ATOM   2301  H HG3  . PRO A 1 14 ? 8.861  11.426 -8.334  1.00 0.00 ? 31 PRO A HG3  4  
ATOM   2302  H HD2  . PRO A 1 14 ? 8.580  14.437 -7.916  1.00 0.00 ? 31 PRO A HD2  4  
ATOM   2303  H HD3  . PRO A 1 14 ? 10.008 13.418 -7.691  1.00 0.00 ? 31 PRO A HD3  4  
ATOM   2304  N N    . HIS A 1 15 ? 7.073  13.599 -12.490 1.00 0.00 ? 32 HIS A N    4  
ATOM   2305  C CA   . HIS A 1 15 ? 6.386  14.445 -13.458 1.00 0.00 ? 32 HIS A CA   4  
ATOM   2306  C C    . HIS A 1 15 ? 4.875  14.265 -13.373 1.00 0.00 ? 32 HIS A C    4  
ATOM   2307  O O    . HIS A 1 15 ? 4.121  14.916 -14.097 1.00 0.00 ? 32 HIS A O    4  
ATOM   2308  C CB   . HIS A 1 15 ? 6.870  14.145 -14.880 1.00 0.00 ? 32 HIS A CB   4  
ATOM   2309  C CG   . HIS A 1 15 ? 8.341  14.346 -15.069 1.00 0.00 ? 32 HIS A CG   4  
ATOM   2310  N ND1  . HIS A 1 15 ? 8.917  15.596 -15.146 1.00 0.00 ? 32 HIS A ND1  4  
ATOM   2311  C CD2  . HIS A 1 15 ? 9.354  13.456 -15.198 1.00 0.00 ? 32 HIS A CD2  4  
ATOM   2312  C CE1  . HIS A 1 15 ? 10.222 15.467 -15.314 1.00 0.00 ? 32 HIS A CE1  4  
ATOM   2313  N NE2  . HIS A 1 15 ? 10.512 14.179 -15.348 1.00 0.00 ? 32 HIS A NE2  4  
ATOM   2314  H H    . HIS A 1 15 ? 6.925  12.600 -12.516 1.00 0.00 ? 32 HIS A H    4  
ATOM   2315  H HA   . HIS A 1 15 ? 6.585  15.494 -13.235 1.00 0.00 ? 32 HIS A HA   4  
ATOM   2316  H HB2  . HIS A 1 15 ? 6.662  13.106 -15.136 1.00 0.00 ? 32 HIS A HB2  4  
ATOM   2317  H HB3  . HIS A 1 15 ? 6.371  14.801 -15.593 1.00 0.00 ? 32 HIS A HB3  4  
ATOM   2318  H HD1  . HIS A 1 15 ? 8.451  16.472 -15.014 1.00 0.00 ? 32 HIS A HD1  4  
ATOM   2319  H HD2  . HIS A 1 15 ? 9.386  12.366 -15.200 1.00 0.00 ? 32 HIS A HD2  4  
ATOM   2320  H HE1  . HIS A 1 15 ? 10.861 16.346 -15.397 1.00 0.00 ? 32 HIS A HE1  4  
ATOM   2321  N N    . ASP A 1 16 ? 4.440  13.376 -12.486 1.00 0.00 ? 33 ASP A N    4  
ATOM   2322  C CA   . ASP A 1 16 ? 3.018  13.113 -12.301 1.00 0.00 ? 33 ASP A CA   4  
ATOM   2323  C C    . ASP A 1 16 ? 2.631  13.186 -10.830 1.00 0.00 ? 33 ASP A C    4  
ATOM   2324  O O    . ASP A 1 16 ? 1.549  12.747 -10.439 1.00 0.00 ? 33 ASP A O    4  
ATOM   2325  C CB   . ASP A 1 16 ? 2.647  11.742 -12.875 1.00 0.00 ? 33 ASP A CB   4  
ATOM   2326  C CG   . ASP A 1 16 ? 3.301  10.566 -12.164 1.00 0.00 ? 33 ASP A CG   4  
ATOM   2327  O OD1  . ASP A 1 16 ? 3.988  10.788 -11.196 1.00 0.00 ? 33 ASP A OD1  4  
ATOM   2328  O OD2  . ASP A 1 16 ? 2.983  9.448  -12.494 1.00 0.00 ? 33 ASP A OD2  4  
ATOM   2329  H H    . ASP A 1 16 ? 5.111  12.871 -11.926 1.00 0.00 ? 33 ASP A H    4  
ATOM   2330  H HA   . ASP A 1 16 ? 2.431  13.875 -12.814 1.00 0.00 ? 33 ASP A HA   4  
ATOM   2331  H HB2  . ASP A 1 16 ? 1.571  11.576 -12.940 1.00 0.00 ? 33 ASP A HB2  4  
ATOM   2332  H HB3  . ASP A 1 16 ? 3.063  11.837 -13.878 1.00 0.00 ? 33 ASP A HB3  4  
ATOM   2333  N N    . TYR A 1 17 ? 3.522  13.743 -10.016 1.00 0.00 ? 34 TYR A N    4  
ATOM   2334  C CA   . TYR A 1 17 ? 3.299  13.827 -8.578  1.00 0.00 ? 34 TYR A CA   4  
ATOM   2335  C C    . TYR A 1 17 ? 2.214  14.845 -8.248  1.00 0.00 ? 34 TYR A C    4  
ATOM   2336  O O    . TYR A 1 17 ? 1.892  15.709 -9.061  1.00 0.00 ? 34 TYR A O    4  
ATOM   2337  C CB   . TYR A 1 17 ? 4.597  14.191 -7.855  1.00 0.00 ? 34 TYR A CB   4  
ATOM   2338  C CG   . TYR A 1 17 ? 5.040  15.620 -8.073  1.00 0.00 ? 34 TYR A CG   4  
ATOM   2339  C CD1  . TYR A 1 17 ? 4.485  16.659 -7.340  1.00 0.00 ? 34 TYR A CD1  4  
ATOM   2340  C CD2  . TYR A 1 17 ? 6.015  15.927 -9.011  1.00 0.00 ? 34 TYR A CD2  4  
ATOM   2341  C CE1  . TYR A 1 17 ? 4.885  17.967 -7.536  1.00 0.00 ? 34 TYR A CE1  4  
ATOM   2342  C CE2  . TYR A 1 17 ? 6.425  17.231 -9.215  1.00 0.00 ? 34 TYR A CE2  4  
ATOM   2343  C CZ   . TYR A 1 17 ? 5.858  18.249 -8.475  1.00 0.00 ? 34 TYR A CZ   4  
ATOM   2344  O OH   . TYR A 1 17 ? 6.262  19.549 -8.674  1.00 0.00 ? 34 TYR A OH   4  
ATOM   2345  H H    . TYR A 1 17 ? 4.375  14.120 -10.405 1.00 0.00 ? 34 TYR A H    4  
ATOM   2346  H HA   . TYR A 1 17 ? 2.948  12.866 -8.201  1.00 0.00 ? 34 TYR A HA   4  
ATOM   2347  H HB2  . TYR A 1 17 ? 4.434  14.020 -6.790  1.00 0.00 ? 34 TYR A HB2  4  
ATOM   2348  H HB3  . TYR A 1 17 ? 5.369  13.512 -8.218  1.00 0.00 ? 34 TYR A HB3  4  
ATOM   2349  H HD1  . TYR A 1 17 ? 3.718  16.429 -6.601  1.00 0.00 ? 34 TYR A HD1  4  
ATOM   2350  H HD2  . TYR A 1 17 ? 6.459  15.119 -9.592  1.00 0.00 ? 34 TYR A HD2  4  
ATOM   2351  H HE1  . TYR A 1 17 ? 4.440  18.772 -6.953  1.00 0.00 ? 34 TYR A HE1  4  
ATOM   2352  H HE2  . TYR A 1 17 ? 7.191  17.452 -9.958  1.00 0.00 ? 34 TYR A HE2  4  
ATOM   2353  H HH   . TYR A 1 17 ? 5.804  20.175 -8.108  1.00 0.00 ? 34 TYR A HH   4  
ATOM   2354  N N    . CYS A 1 18 ? 1.654  14.735 -7.047  1.00 0.00 ? 35 CYS A N    4  
ATOM   2355  C CA   . CYS A 1 18 ? 0.729  15.742 -6.539  1.00 0.00 ? 35 CYS A CA   4  
ATOM   2356  C C    . CYS A 1 18 ? 1.125  16.198 -5.140  1.00 0.00 ? 35 CYS A C    4  
ATOM   2357  O O    . CYS A 1 18 ? 1.829  15.489 -4.422  1.00 0.00 ? 35 CYS A O    4  
ATOM   2358  C CB   . CYS A 1 18 ? -0.602 14.990 -6.504  1.00 0.00 ? 35 CYS A CB   4  
ATOM   2359  S SG   . CYS A 1 18 ? -1.214 14.474 -8.125  1.00 0.00 ? 35 CYS A SG   4  
ATOM   2360  H H    . CYS A 1 18 ? 1.875  13.936 -6.471  1.00 0.00 ? 35 CYS A H    4  
ATOM   2361  H HA   . CYS A 1 18 ? 0.624  16.606 -7.196  1.00 0.00 ? 35 CYS A HA   4  
ATOM   2362  H HB2  . CYS A 1 18 ? -0.504 14.078 -5.914  1.00 0.00 ? 35 CYS A HB2  4  
ATOM   2363  H HB3  . CYS A 1 18 ? -1.379 15.620 -6.074  1.00 0.00 ? 35 CYS A HB3  4  
ATOM   2364  H HG   . CYS A 1 18 ? -2.322 13.892 -7.677  1.00 0.00 ? 35 CYS A HG   4  
ATOM   2365  N N    . THR A 1 19 ? 0.669  17.387 -4.761  1.00 0.00 ? 36 THR A N    4  
ATOM   2366  C CA   . THR A 1 19 ? 1.025  17.967 -3.471  1.00 0.00 ? 36 THR A CA   4  
ATOM   2367  C C    . THR A 1 19 ? -0.215 18.250 -2.633  1.00 0.00 ? 36 THR A C    4  
ATOM   2368  O O    . THR A 1 19 ? -1.181 18.842 -3.116  1.00 0.00 ? 36 THR A O    4  
ATOM   2369  C CB   . THR A 1 19 ? 1.825  19.271 -3.640  1.00 0.00 ? 36 THR A CB   4  
ATOM   2370  O OG1  . THR A 1 19 ? 3.015  19.010 -4.396  1.00 0.00 ? 36 THR A OG1  4  
ATOM   2371  C CG2  . THR A 1 19 ? 2.206  19.843 -2.283  1.00 0.00 ? 36 THR A CG2  4  
ATOM   2372  H H    . THR A 1 19 ? 0.059  17.901 -5.380  1.00 0.00 ? 36 THR A H    4  
ATOM   2373  H HA   . THR A 1 19 ? 1.627  17.259 -2.901  1.00 0.00 ? 36 THR A HA   4  
ATOM   2374  H HB   . THR A 1 19 ? 1.214  19.995 -4.180  1.00 0.00 ? 36 THR A HB   4  
ATOM   2375  H HG1  . THR A 1 19 ? 3.513  19.825 -4.500  1.00 0.00 ? 36 THR A HG1  4  
ATOM   2376  H HG21 . THR A 1 19 ? 2.818  19.121 -1.743  1.00 0.00 ? 36 THR A HG21 4  
ATOM   2377  H HG22 . THR A 1 19 ? 2.771  20.765 -2.423  1.00 0.00 ? 36 THR A HG22 4  
ATOM   2378  H HG23 . THR A 1 19 ? 1.303  20.054 -1.711  1.00 0.00 ? 36 THR A HG23 4  
HETATM 2379  N N    . TPO A 1 20 ? -0.184 17.823 -1.375  1.00 0.00 ? 37 TPO A N    4  
HETATM 2380  C CA   . TPO A 1 20 ? -1.304 18.032 -0.466  1.00 0.00 ? 37 TPO A CA   4  
HETATM 2381  C CB   . TPO A 1 20 ? -1.344 16.961 0.639   1.00 0.00 ? 37 TPO A CB   4  
HETATM 2382  C CG2  . TPO A 1 20 ? -1.254 15.568 0.035   1.00 0.00 ? 37 TPO A CG2  4  
HETATM 2383  O OG1  . TPO A 1 20 ? -0.246 17.159 1.539   1.00 0.00 ? 37 TPO A OG1  4  
HETATM 2384  P P    . TPO A 1 20 ? -0.303 16.576 3.043   1.00 0.00 ? 37 TPO A P    4  
HETATM 2385  O O1P  . TPO A 1 20 ? 1.028  16.962 3.738   1.00 0.00 ? 37 TPO A O1P  4  
HETATM 2386  O O2P  . TPO A 1 20 ? -0.463 15.037 2.933   1.00 0.00 ? 37 TPO A O2P  4  
HETATM 2387  O O3P  . TPO A 1 20 ? -1.524 17.228 3.743   1.00 0.00 ? 37 TPO A O3P  4  
HETATM 2388  C C    . TPO A 1 20 ? -1.239 19.410 0.179   1.00 0.00 ? 37 TPO A C    4  
HETATM 2389  O O    . TPO A 1 20 ? -0.200 20.069 0.157   1.00 0.00 ? 37 TPO A O    4  
HETATM 2390  H H    . TPO A 1 20 ? 0.638  17.341 -1.040  1.00 0.00 ? 37 TPO A H    4  
HETATM 2391  H HA   . TPO A 1 20 ? -2.242 17.996 -1.022  1.00 0.00 ? 37 TPO A HA   4  
HETATM 2392  H HB   . TPO A 1 20 ? -2.278 17.057 1.191   1.00 0.00 ? 37 TPO A HB   4  
HETATM 2393  H HG21 . TPO A 1 20 ? -1.284 14.824 0.830   1.00 0.00 ? 37 TPO A HG21 4  
HETATM 2394  H HG22 . TPO A 1 20 ? -2.094 15.410 -0.642  1.00 0.00 ? 37 TPO A HG22 4  
HETATM 2395  H HG23 . TPO A 1 20 ? -0.320 15.471 -0.518  1.00 0.00 ? 37 TPO A HG23 4  
ATOM   2396  N N    . PRO A 1 21 ? -2.357 19.843 0.754   1.00 0.00 ? 38 PRO A N    4  
ATOM   2397  C CA   . PRO A 1 21 ? -2.441 21.159 1.374   1.00 0.00 ? 38 PRO A CA   4  
ATOM   2398  C C    . PRO A 1 21 ? -1.352 21.343 2.424   1.00 0.00 ? 38 PRO A C    4  
ATOM   2399  O O    . PRO A 1 21 ? -0.874 22.455 2.648   1.00 0.00 ? 38 PRO A O    4  
ATOM   2400  C CB   . PRO A 1 21 ? -3.845 21.196 1.987   1.00 0.00 ? 38 PRO A CB   4  
ATOM   2401  C CG   . PRO A 1 21 ? -4.644 20.265 1.141   1.00 0.00 ? 38 PRO A CG   4  
ATOM   2402  C CD   . PRO A 1 21 ? -3.697 19.156 0.764   1.00 0.00 ? 38 PRO A CD   4  
ATOM   2403  H HA   . PRO A 1 21 ? -2.285 21.978 0.656   1.00 0.00 ? 38 PRO A HA   4  
ATOM   2404  H HB2  . PRO A 1 21 ? -3.834 20.870 3.038   1.00 0.00 ? 38 PRO A HB2  4  
ATOM   2405  H HB3  . PRO A 1 21 ? -4.266 22.212 1.968   1.00 0.00 ? 38 PRO A HB3  4  
ATOM   2406  H HG2  . PRO A 1 21 ? -5.512 19.874 1.691   1.00 0.00 ? 38 PRO A HG2  4  
ATOM   2407  H HG3  . PRO A 1 21 ? -5.032 20.774 0.247   1.00 0.00 ? 38 PRO A HG3  4  
ATOM   2408  H HD2  . PRO A 1 21 ? -3.716 18.330 1.489   1.00 0.00 ? 38 PRO A HD2  4  
ATOM   2409  H HD3  . PRO A 1 21 ? -3.933 18.725 -0.220  1.00 0.00 ? 38 PRO A HD3  4  
ATOM   2410  N N    . GLY A 1 22 ? -0.963 20.246 3.064   1.00 0.00 ? 39 GLY A N    4  
ATOM   2411  C CA   . GLY A 1 22 ? 0.092  20.279 4.070   1.00 0.00 ? 39 GLY A CA   4  
ATOM   2412  C C    . GLY A 1 22 ? 1.444  20.588 3.439   1.00 0.00 ? 39 GLY A C    4  
ATOM   2413  O O    . GLY A 1 22 ? 2.316  21.181 4.075   1.00 0.00 ? 39 GLY A O    4  
ATOM   2414  H H    . GLY A 1 22 ? -1.411 19.367 2.849   1.00 0.00 ? 39 GLY A H    4  
ATOM   2415  H HA2  . GLY A 1 22 ? -0.141 21.050 4.806   1.00 0.00 ? 39 GLY A HA2  4  
ATOM   2416  H HA3  . GLY A 1 22 ? 0.144  19.311 4.564   1.00 0.00 ? 39 GLY A HA3  4  
ATOM   2417  N N    . GLY A 1 23 ? 1.613  20.182 2.185   1.00 0.00 ? 40 GLY A N    4  
ATOM   2418  C CA   . GLY A 1 23 ? 2.829  20.482 1.439   1.00 0.00 ? 40 GLY A CA   4  
ATOM   2419  C C    . GLY A 1 23 ? 3.711  19.247 1.304   1.00 0.00 ? 40 GLY A C    4  
ATOM   2420  O O    . GLY A 1 23 ? 4.936  19.337 1.372   1.00 0.00 ? 40 GLY A O    4  
ATOM   2421  H H    . GLY A 1 23 ? 0.879  19.653 1.737   1.00 0.00 ? 40 GLY A H    4  
ATOM   2422  H HA2  . GLY A 1 23 ? 2.559  20.837 0.445   1.00 0.00 ? 40 GLY A HA2  4  
ATOM   2423  H HA3  . GLY A 1 23 ? 3.385  21.260 1.963   1.00 0.00 ? 40 GLY A HA3  4  
ATOM   2424  N N    . THR A 1 24 ? 3.079  18.094 1.113   1.00 0.00 ? 41 THR A N    4  
ATOM   2425  C CA   . THR A 1 24 ? 3.807  16.846 0.914   1.00 0.00 ? 41 THR A CA   4  
ATOM   2426  C C    . THR A 1 24 ? 3.535  16.265 -0.468  1.00 0.00 ? 41 THR A C    4  
ATOM   2427  O O    . THR A 1 24 ? 2.388  16.198 -0.909  1.00 0.00 ? 41 THR A O    4  
ATOM   2428  C CB   . THR A 1 24 ? 3.436  15.800 1.981   1.00 0.00 ? 41 THR A CB   4  
ATOM   2429  O OG1  . THR A 1 24 ? 3.753  16.309 3.284   1.00 0.00 ? 41 THR A OG1  4  
ATOM   2430  C CG2  . THR A 1 24 ? 4.201  14.506 1.748   1.00 0.00 ? 41 THR A CG2  4  
ATOM   2431  H H    . THR A 1 24 ? 2.069  18.082 1.105   1.00 0.00 ? 41 THR A H    4  
ATOM   2432  H HA   . THR A 1 24 ? 4.879  17.032 0.965   1.00 0.00 ? 41 THR A HA   4  
ATOM   2433  H HB   . THR A 1 24 ? 2.366  15.603 1.929   1.00 0.00 ? 41 THR A HB   4  
ATOM   2434  H HG1  . THR A 1 24 ? 2.945  16.588 3.723   1.00 0.00 ? 41 THR A HG1  4  
ATOM   2435  H HG21 . THR A 1 24 ? 5.270  14.701 1.802   1.00 0.00 ? 41 THR A HG21 4  
ATOM   2436  H HG22 . THR A 1 24 ? 3.926  13.779 2.512   1.00 0.00 ? 41 THR A HG22 4  
ATOM   2437  H HG23 . THR A 1 24 ? 3.953  14.110 0.763   1.00 0.00 ? 41 THR A HG23 4  
ATOM   2438  N N    . LEU A 1 25 ? 4.598  15.844 -1.146  1.00 0.00 ? 42 LEU A N    4  
ATOM   2439  C CA   . LEU A 1 25 ? 4.476  15.264 -2.478  1.00 0.00 ? 42 LEU A CA   4  
ATOM   2440  C C    . LEU A 1 25 ? 4.137  13.781 -2.404  1.00 0.00 ? 42 LEU A C    4  
ATOM   2441  O O    . LEU A 1 25 ? 4.620  13.067 -1.524  1.00 0.00 ? 42 LEU A O    4  
ATOM   2442  C CB   . LEU A 1 25 ? 5.773  15.477 -3.269  1.00 0.00 ? 42 LEU A CB   4  
ATOM   2443  C CG   . LEU A 1 25 ? 5.846  16.788 -4.062  1.00 0.00 ? 42 LEU A CG   4  
ATOM   2444  C CD1  . LEU A 1 25 ? 5.889  17.973 -3.107  1.00 0.00 ? 42 LEU A CD1  4  
ATOM   2445  C CD2  . LEU A 1 25 ? 7.075  16.772 -4.958  1.00 0.00 ? 42 LEU A CD2  4  
ATOM   2446  H H    . LEU A 1 25 ? 5.513  15.929 -0.728  1.00 0.00 ? 42 LEU A H    4  
ATOM   2447  H HA   . LEU A 1 25 ? 3.654  15.742 -3.011  1.00 0.00 ? 42 LEU A HA   4  
ATOM   2448  H HB2  . LEU A 1 25 ? 6.482  15.499 -2.444  1.00 0.00 ? 42 LEU A HB2  4  
ATOM   2449  H HB3  . LEU A 1 25 ? 5.994  14.628 -3.916  1.00 0.00 ? 42 LEU A HB3  4  
ATOM   2450  H HG   . LEU A 1 25 ? 4.966  16.828 -4.704  1.00 0.00 ? 42 LEU A HG   4  
ATOM   2451  H HD11 . LEU A 1 25 ? 5.941  18.899 -3.679  1.00 0.00 ? 42 LEU A HD11 4  
ATOM   2452  H HD12 . LEU A 1 25 ? 4.989  17.977 -2.491  1.00 0.00 ? 42 LEU A HD12 4  
ATOM   2453  H HD13 . LEU A 1 25 ? 6.767  17.893 -2.467  1.00 0.00 ? 42 LEU A HD13 4  
ATOM   2454  H HD21 . LEU A 1 25 ? 7.010  15.934 -5.651  1.00 0.00 ? 42 LEU A HD21 4  
ATOM   2455  H HD22 . LEU A 1 25 ? 7.126  17.705 -5.521  1.00 0.00 ? 42 LEU A HD22 4  
ATOM   2456  H HD23 . LEU A 1 25 ? 7.971  16.668 -4.346  1.00 0.00 ? 42 LEU A HD23 4  
ATOM   2457  N N    . PHE A 1 26 ? 3.305  13.322 -3.332  1.00 0.00 ? 43 PHE A N    4  
ATOM   2458  C CA   . PHE A 1 26 ? 2.977  11.905 -3.434  1.00 0.00 ? 43 PHE A CA   4  
ATOM   2459  C C    . PHE A 1 26 ? 2.617  11.524 -4.864  1.00 0.00 ? 43 PHE A C    4  
ATOM   2460  O O    . PHE A 1 26 ? 2.184  12.366 -5.650  1.00 0.00 ? 43 PHE A O    4  
ATOM   2461  C CB   . PHE A 1 26 ? 1.825  11.554 -2.490  1.00 0.00 ? 43 PHE A CB   4  
ATOM   2462  C CG   . PHE A 1 26 ? 0.504  12.139 -2.903  1.00 0.00 ? 43 PHE A CG   4  
ATOM   2463  C CD1  . PHE A 1 26 ? 0.171  13.444 -2.569  1.00 0.00 ? 43 PHE A CD1  4  
ATOM   2464  C CD2  . PHE A 1 26 ? -0.409 11.387 -3.628  1.00 0.00 ? 43 PHE A CD2  4  
ATOM   2465  C CE1  . PHE A 1 26 ? -1.043 13.984 -2.946  1.00 0.00 ? 43 PHE A CE1  4  
ATOM   2466  C CE2  . PHE A 1 26 ? -1.624 11.925 -4.007  1.00 0.00 ? 43 PHE A CE2  4  
ATOM   2467  C CZ   . PHE A 1 26 ? -1.941 13.222 -3.666  1.00 0.00 ? 43 PHE A CZ   4  
ATOM   2468  H H    . PHE A 1 26 ? 2.888  13.971 -3.984  1.00 0.00 ? 43 PHE A H    4  
ATOM   2469  H HA   . PHE A 1 26 ? 3.845  11.304 -3.161  1.00 0.00 ? 43 PHE A HA   4  
ATOM   2470  H HB2  . PHE A 1 26 ? 1.687  10.474 -2.450  1.00 0.00 ? 43 PHE A HB2  4  
ATOM   2471  H HB3  . PHE A 1 26 ? 2.032  11.930 -1.490  1.00 0.00 ? 43 PHE A HB3  4  
ATOM   2472  H HD1  . PHE A 1 26 ? 0.881  14.045 -1.999  1.00 0.00 ? 43 PHE A HD1  4  
ATOM   2473  H HD2  . PHE A 1 26 ? -0.159 10.361 -3.896  1.00 0.00 ? 43 PHE A HD2  4  
ATOM   2474  H HE1  . PHE A 1 26 ? -1.292 15.009 -2.675  1.00 0.00 ? 43 PHE A HE1  4  
ATOM   2475  H HE2  . PHE A 1 26 ? -2.332 11.323 -4.577  1.00 0.00 ? 43 PHE A HE2  4  
ATOM   2476  H HZ   . PHE A 1 26 ? -2.898 13.648 -3.966  1.00 0.00 ? 43 PHE A HZ   4  
ATOM   2477  N N    . SER A 1 27 ? 2.798  10.250 -5.195  1.00 0.00 ? 44 SER A N    4  
ATOM   2478  C CA   . SER A 1 27 ? 2.352  9.721  -6.479  1.00 0.00 ? 44 SER A CA   4  
ATOM   2479  C C    . SER A 1 27 ? 1.992  8.246  -6.371  1.00 0.00 ? 44 SER A C    4  
ATOM   2480  O O    . SER A 1 27 ? 2.673  7.478  -5.693  1.00 0.00 ? 44 SER A O    4  
ATOM   2481  C CB   . SER A 1 27 ? 3.426  9.927  -7.529  1.00 0.00 ? 44 SER A CB   4  
ATOM   2482  O OG   . SER A 1 27 ? 3.012  9.497  -8.797  1.00 0.00 ? 44 SER A OG   4  
ATOM   2483  H H    . SER A 1 27 ? 3.256  9.633  -4.541  1.00 0.00 ? 44 SER A H    4  
ATOM   2484  H HA   . SER A 1 27 ? 1.518  10.277 -6.910  1.00 0.00 ? 44 SER A HA   4  
ATOM   2485  H HB2  . SER A 1 27 ? 3.668  10.989 -7.577  1.00 0.00 ? 44 SER A HB2  4  
ATOM   2486  H HB3  . SER A 1 27 ? 4.314  9.367  -7.237  1.00 0.00 ? 44 SER A HB3  4  
ATOM   2487  H HG   . SER A 1 27 ? 3.433  10.036 -9.471  1.00 0.00 ? 44 SER A HG   4  
ATOM   2488  N N    . THR A 1 28 ? 0.915  7.855  -7.045  1.00 0.00 ? 45 THR A N    4  
ATOM   2489  C CA   . THR A 1 28 ? 0.469  6.466  -7.038  1.00 0.00 ? 45 THR A CA   4  
ATOM   2490  C C    . THR A 1 28 ? 0.585  5.843  -8.423  1.00 0.00 ? 45 THR A C    4  
ATOM   2491  O O    . THR A 1 28 ? 0.063  6.379  -9.400  1.00 0.00 ? 45 THR A O    4  
ATOM   2492  C CB   . THR A 1 28 ? -0.986 6.342  -6.551  1.00 0.00 ? 45 THR A CB   4  
ATOM   2493  O OG1  . THR A 1 28 ? -1.096 6.878  -5.226  1.00 0.00 ? 45 THR A OG1  4  
ATOM   2494  C CG2  . THR A 1 28 ? -1.424 4.886  -6.543  1.00 0.00 ? 45 THR A CG2  4  
ATOM   2495  H H    . THR A 1 28 ? 0.392  8.536  -7.576  1.00 0.00 ? 45 THR A H    4  
ATOM   2496  H HA   . THR A 1 28 ? 1.109  5.877  -6.380  1.00 0.00 ? 45 THR A HA   4  
ATOM   2497  H HB   . THR A 1 28 ? -1.633 6.911  -7.218  1.00 0.00 ? 45 THR A HB   4  
ATOM   2498  H HG1  . THR A 1 28 ? -0.841 7.804  -5.233  1.00 0.00 ? 45 THR A HG1  4  
ATOM   2499  H HG21 . THR A 1 28 ? -0.778 4.316  -5.875  1.00 0.00 ? 45 THR A HG21 4  
ATOM   2500  H HG22 . THR A 1 28 ? -2.455 4.818  -6.196  1.00 0.00 ? 45 THR A HG22 4  
ATOM   2501  H HG23 . THR A 1 28 ? -1.352 4.479  -7.551  1.00 0.00 ? 45 THR A HG23 4  
HETATM 2502  N N    . TPO A 1 29 ? 1.273  4.709  -8.500  1.00 0.00 ? 46 TPO A N    4  
HETATM 2503  C CA   . TPO A 1 29 ? 1.527  4.053  -9.778  1.00 0.00 ? 46 TPO A CA   4  
HETATM 2504  C CB   . TPO A 1 29 ? 2.867  3.295  -9.767  1.00 0.00 ? 46 TPO A CB   4  
HETATM 2505  C CG2  . TPO A 1 29 ? 3.979  4.183  -9.230  1.00 0.00 ? 46 TPO A CG2  4  
HETATM 2506  O OG1  . TPO A 1 29 ? 2.753  2.128  -8.942  1.00 0.00 ? 46 TPO A OG1  4  
HETATM 2507  P P    . TPO A 1 29 ? 3.732  0.865  -9.168  1.00 0.00 ? 46 TPO A P    4  
HETATM 2508  O O1P  . TPO A 1 29 ? 3.342  -0.212 -8.121  1.00 0.00 ? 46 TPO A O1P  4  
HETATM 2509  O O2P  . TPO A 1 29 ? 5.184  1.365  -8.959  1.00 0.00 ? 46 TPO A O2P  4  
HETATM 2510  O O3P  . TPO A 1 29 ? 3.505  0.360  -10.616 1.00 0.00 ? 46 TPO A O3P  4  
HETATM 2511  C C    . TPO A 1 29 ? 0.409  3.081  -10.130 1.00 0.00 ? 46 TPO A C    4  
HETATM 2512  O O    . TPO A 1 29 ? -0.398 2.712  -9.275  1.00 0.00 ? 46 TPO A O    4  
HETATM 2513  H H    . TPO A 1 29 ? 1.629  4.291  -7.653  1.00 0.00 ? 46 TPO A H    4  
HETATM 2514  H HA   . TPO A 1 29 ? 1.553  4.795  -10.575 1.00 0.00 ? 46 TPO A HA   4  
HETATM 2515  H HB   . TPO A 1 29 ? 3.109  2.988  -10.784 1.00 0.00 ? 46 TPO A HB   4  
HETATM 2516  H HG21 . TPO A 1 29 ? 4.918  3.631  -9.230  1.00 0.00 ? 46 TPO A HG21 4  
HETATM 2517  H HG22 . TPO A 1 29 ? 4.076  5.066  -9.861  1.00 0.00 ? 46 TPO A HG22 4  
HETATM 2518  H HG23 . TPO A 1 29 ? 3.738  4.490  -8.212  1.00 0.00 ? 46 TPO A HG23 4  
ATOM   2519  N N    . PRO A 1 30 ? 0.365  2.669  -11.392 1.00 0.00 ? 47 PRO A N    4  
ATOM   2520  C CA   . PRO A 1 30 ? -0.707 1.809  -11.881 1.00 0.00 ? 47 PRO A CA   4  
ATOM   2521  C C    . PRO A 1 30 ? -0.793 0.522  -11.070 1.00 0.00 ? 47 PRO A C    4  
ATOM   2522  O O    . PRO A 1 30 ? -1.865 -0.068 -10.936 1.00 0.00 ? 47 PRO A O    4  
ATOM   2523  C CB   . PRO A 1 30 ? -0.338 1.546  -13.344 1.00 0.00 ? 47 PRO A CB   4  
ATOM   2524  C CG   . PRO A 1 30 ? 0.460  2.739  -13.746 1.00 0.00 ? 47 PRO A CG   4  
ATOM   2525  C CD   . PRO A 1 30 ? 1.249  3.123  -12.523 1.00 0.00 ? 47 PRO A CD   4  
ATOM   2526  H HA   . PRO A 1 30 ? -1.700 2.271  -11.785 1.00 0.00 ? 47 PRO A HA   4  
ATOM   2527  H HB2  . PRO A 1 30 ? 0.248  0.620  -13.451 1.00 0.00 ? 47 PRO A HB2  4  
ATOM   2528  H HB3  . PRO A 1 30 ? -1.233 1.435  -13.972 1.00 0.00 ? 47 PRO A HB3  4  
ATOM   2529  H HG2  . PRO A 1 30 ? 1.126  2.506  -14.590 1.00 0.00 ? 47 PRO A HG2  4  
ATOM   2530  H HG3  . PRO A 1 30 ? -0.194 3.563  -14.070 1.00 0.00 ? 47 PRO A HG3  4  
ATOM   2531  H HD2  . PRO A 1 30 ? 2.228  2.624  -12.487 1.00 0.00 ? 47 PRO A HD2  4  
ATOM   2532  H HD3  . PRO A 1 30 ? 1.438  4.206  -12.473 1.00 0.00 ? 47 PRO A HD3  4  
ATOM   2533  N N    . GLY A 1 31 ? 0.342  0.091  -10.530 1.00 0.00 ? 48 GLY A N    4  
ATOM   2534  C CA   . GLY A 1 31 ? 0.399  -1.131 -9.738  1.00 0.00 ? 48 GLY A CA   4  
ATOM   2535  C C    . GLY A 1 31 ? -0.418 -0.996 -8.459  1.00 0.00 ? 48 GLY A C    4  
ATOM   2536  O O    . GLY A 1 31 ? -0.890 -1.989 -7.905  1.00 0.00 ? 48 GLY A O    4  
ATOM   2537  H H    . GLY A 1 31 ? 1.188  0.624  -10.673 1.00 0.00 ? 48 GLY A H    4  
ATOM   2538  H HA2  . GLY A 1 31 ? 0.001  -1.957 -10.328 1.00 0.00 ? 48 GLY A HA2  4  
ATOM   2539  H HA3  . GLY A 1 31 ? 1.435  -1.339 -9.478  1.00 0.00 ? 48 GLY A HA3  4  
ATOM   2540  N N    . GLY A 1 32 ? -0.580 0.238  -7.994  1.00 0.00 ? 49 GLY A N    4  
ATOM   2541  C CA   . GLY A 1 32 ? -1.393 0.511  -6.816  1.00 0.00 ? 49 GLY A CA   4  
ATOM   2542  C C    . GLY A 1 32 ? -0.528 0.921  -5.632  1.00 0.00 ? 49 GLY A C    4  
ATOM   2543  O O    . GLY A 1 32 ? -1.023 1.091  -4.518  1.00 0.00 ? 49 GLY A O    4  
ATOM   2544  H H    . GLY A 1 32 ? -0.129 1.006  -8.470  1.00 0.00 ? 49 GLY A H    4  
ATOM   2545  H HA2  . GLY A 1 32 ? -2.090 1.319  -7.043  1.00 0.00 ? 49 GLY A HA2  4  
ATOM   2546  H HA3  . GLY A 1 32 ? -1.954 -0.385 -6.553  1.00 0.00 ? 49 GLY A HA3  4  
ATOM   2547  N N    . THR A 1 33 ? 0.768  1.080  -5.880  1.00 0.00 ? 50 THR A N    4  
ATOM   2548  C CA   . THR A 1 33 ? 1.706  1.473  -4.835  1.00 0.00 ? 50 THR A CA   4  
ATOM   2549  C C    . THR A 1 33 ? 1.681  2.979  -4.611  1.00 0.00 ? 50 THR A C    4  
ATOM   2550  O O    . THR A 1 33 ? 1.777  3.759  -5.560  1.00 0.00 ? 50 THR A O    4  
ATOM   2551  C CB   . THR A 1 33 ? 3.144  1.038  -5.174  1.00 0.00 ? 50 THR A CB   4  
ATOM   2552  O OG1  . THR A 1 33 ? 3.197  -0.389 -5.302  1.00 0.00 ? 50 THR A OG1  4  
ATOM   2553  C CG2  . THR A 1 33 ? 4.105  1.481  -4.081  1.00 0.00 ? 50 THR A CG2  4  
ATOM   2554  H H    . THR A 1 33 ? 1.112  0.922  -6.816  1.00 0.00 ? 50 THR A H    4  
ATOM   2555  H HA   . THR A 1 33 ? 1.416  1.016  -3.888  1.00 0.00 ? 50 THR A HA   4  
ATOM   2556  H HB   . THR A 1 33 ? 3.438  1.491  -6.121  1.00 0.00 ? 50 THR A HB   4  
ATOM   2557  H HG1  . THR A 1 33 ? 3.274  -0.622 -6.230  1.00 0.00 ? 50 THR A HG1  4  
ATOM   2558  H HG21 . THR A 1 33 ? 3.813  1.028  -3.135  1.00 0.00 ? 50 THR A HG21 4  
ATOM   2559  H HG22 . THR A 1 33 ? 5.117  1.165  -4.338  1.00 0.00 ? 50 THR A HG22 4  
ATOM   2560  H HG23 . THR A 1 33 ? 4.076  2.567  -3.988  1.00 0.00 ? 50 THR A HG23 4  
ATOM   2561  N N    . ARG A 1 34 ? 1.551  3.384  -3.353  1.00 0.00 ? 51 ARG A N    4  
ATOM   2562  C CA   . ARG A 1 34 ? 1.515  4.798  -3.002  1.00 0.00 ? 51 ARG A CA   4  
ATOM   2563  C C    . ARG A 1 34 ? 2.875  5.281  -2.515  1.00 0.00 ? 51 ARG A C    4  
ATOM   2564  O O    . ARG A 1 34 ? 3.343  4.877  -1.450  1.00 0.00 ? 51 ARG A O    4  
ATOM   2565  C CB   . ARG A 1 34 ? 0.419  5.112  -1.994  1.00 0.00 ? 51 ARG A CB   4  
ATOM   2566  C CG   . ARG A 1 34 ? -0.993 4.812  -2.471  1.00 0.00 ? 51 ARG A CG   4  
ATOM   2567  C CD   . ARG A 1 34 ? -2.044 5.020  -1.441  1.00 0.00 ? 51 ARG A CD   4  
ATOM   2568  N NE   . ARG A 1 34 ? -3.391 4.697  -1.882  1.00 0.00 ? 51 ARG A NE   4  
ATOM   2569  C CZ   . ARG A 1 34 ? -4.497 4.836  -1.125  1.00 0.00 ? 51 ARG A CZ   4  
ATOM   2570  N NH1  . ARG A 1 34 ? -4.420 5.254  0.119   1.00 0.00 ? 51 ARG A NH1  4  
ATOM   2571  N NH2  . ARG A 1 34 ? -5.663 4.518  -1.659  1.00 0.00 ? 51 ARG A NH2  4  
ATOM   2572  H H    . ARG A 1 34 ? 1.475  2.693  -2.619  1.00 0.00 ? 51 ARG A H    4  
ATOM   2573  H HA   . ARG A 1 34 ? 1.273  5.392  -3.885  1.00 0.00 ? 51 ARG A HA   4  
ATOM   2574  H HB2  . ARG A 1 34 ? 0.630  4.524  -1.102  1.00 0.00 ? 51 ARG A HB2  4  
ATOM   2575  H HB3  . ARG A 1 34 ? 0.499  6.174  -1.757  1.00 0.00 ? 51 ARG A HB3  4  
ATOM   2576  H HG2  . ARG A 1 34 ? -1.219 5.463  -3.316  1.00 0.00 ? 51 ARG A HG2  4  
ATOM   2577  H HG3  . ARG A 1 34 ? -1.037 3.772  -2.791  1.00 0.00 ? 51 ARG A HG3  4  
ATOM   2578  H HD2  . ARG A 1 34 ? -1.823 4.390  -0.579  1.00 0.00 ? 51 ARG A HD2  4  
ATOM   2579  H HD3  . ARG A 1 34 ? -2.041 6.065  -1.138  1.00 0.00 ? 51 ARG A HD3  4  
ATOM   2580  H HE   . ARG A 1 34 ? -3.710 4.337  -2.771  1.00 0.00 ? 51 ARG A HE   4  
ATOM   2581  H HH11 . ARG A 1 34 ? -3.518 5.477  0.519   1.00 0.00 ? 51 ARG A HH11 4  
ATOM   2582  H HH12 . ARG A 1 34 ? -5.260 5.352  0.670   1.00 0.00 ? 51 ARG A HH12 4  
ATOM   2583  H HH21 . ARG A 1 34 ? -5.704 4.180  -2.611  1.00 0.00 ? 51 ARG A HH21 4  
ATOM   2584  H HH22 . ARG A 1 34 ? -6.508 4.612  -1.115  1.00 0.00 ? 51 ARG A HH22 4  
ATOM   2585  N N    . ILE A 1 35 ? 3.507  6.146  -3.300  1.00 0.00 ? 52 ILE A N    4  
ATOM   2586  C CA   . ILE A 1 35 ? 4.839  6.642  -2.979  1.00 0.00 ? 52 ILE A CA   4  
ATOM   2587  C C    . ILE A 1 35 ? 4.776  8.044  -2.386  1.00 0.00 ? 52 ILE A C    4  
ATOM   2588  O O    . ILE A 1 35 ? 4.328  8.985  -3.041  1.00 0.00 ? 52 ILE A O    4  
ATOM   2589  C CB   . ILE A 1 35 ? 5.751  6.661  -4.219  1.00 0.00 ? 52 ILE A CB   4  
ATOM   2590  C CG1  . ILE A 1 35 ? 5.892  5.250  -4.798  1.00 0.00 ? 52 ILE A CG1  4  
ATOM   2591  C CG2  . ILE A 1 35 ? 7.116  7.234  -3.868  1.00 0.00 ? 52 ILE A CG2  4  
ATOM   2592  C CD1  . ILE A 1 35 ? 6.578  5.209  -6.144  1.00 0.00 ? 52 ILE A CD1  4  
ATOM   2593  H H    . ILE A 1 35 ? 3.052  6.468  -4.143  1.00 0.00 ? 52 ILE A H    4  
ATOM   2594  H HA   . ILE A 1 35 ? 5.298  6.034  -2.200  1.00 0.00 ? 52 ILE A HA   4  
ATOM   2595  H HB   . ILE A 1 35 ? 5.287  7.272  -4.992  1.00 0.00 ? 52 ILE A HB   4  
ATOM   2596  H HG12 . ILE A 1 35 ? 6.464  4.661  -4.080  1.00 0.00 ? 52 ILE A HG12 4  
ATOM   2597  H HG13 . ILE A 1 35 ? 4.888  4.835  -4.889  1.00 0.00 ? 52 ILE A HG13 4  
ATOM   2598  H HG21 . ILE A 1 35 ? 7.747  7.239  -4.755  1.00 0.00 ? 52 ILE A HG21 4  
ATOM   2599  H HG22 . ILE A 1 35 ? 6.998  8.254  -3.502  1.00 0.00 ? 52 ILE A HG22 4  
ATOM   2600  H HG23 . ILE A 1 35 ? 7.580  6.622  -3.095  1.00 0.00 ? 52 ILE A HG23 4  
ATOM   2601  H HD11 . ILE A 1 35 ? 7.582  5.621  -6.055  1.00 0.00 ? 52 ILE A HD11 4  
ATOM   2602  H HD12 . ILE A 1 35 ? 6.641  4.176  -6.489  1.00 0.00 ? 52 ILE A HD12 4  
ATOM   2603  H HD13 . ILE A 1 35 ? 6.007  5.797  -6.863  1.00 0.00 ? 52 ILE A HD13 4  
ATOM   2604  N N    . ILE A 1 36 ? 5.226  8.177  -1.143  1.00 0.00 ? 53 ILE A N    4  
ATOM   2605  C CA   . ILE A 1 36 ? 5.347  9.483  -0.508  1.00 0.00 ? 53 ILE A CA   4  
ATOM   2606  C C    . ILE A 1 36 ? 6.757  10.043 -0.661  1.00 0.00 ? 53 ILE A C    4  
ATOM   2607  O O    . ILE A 1 36 ? 7.741  9.347  -0.413  1.00 0.00 ? 53 ILE A O    4  
ATOM   2608  C CB   . ILE A 1 36 ? 4.991  9.419  0.989   1.00 0.00 ? 53 ILE A CB   4  
ATOM   2609  C CG1  . ILE A 1 36 ? 3.541  8.963  1.173   1.00 0.00 ? 53 ILE A CG1  4  
ATOM   2610  C CG2  . ILE A 1 36 ? 5.214  10.772 1.648   1.00 0.00 ? 53 ILE A CG2  4  
ATOM   2611  C CD1  . ILE A 1 36 ? 3.183  8.631  2.603   1.00 0.00 ? 53 ILE A CD1  4  
ATOM   2612  H H    . ILE A 1 36 ? 5.493  7.351  -0.626  1.00 0.00 ? 53 ILE A H    4  
ATOM   2613  H HA   . ILE A 1 36 ? 4.706  10.212 -1.002  1.00 0.00 ? 53 ILE A HA   4  
ATOM   2614  H HB   . ILE A 1 36 ? 5.619  8.671  1.471   1.00 0.00 ? 53 ILE A HB   4  
ATOM   2615  H HG12 . ILE A 1 36 ? 2.900  9.768  0.814   1.00 0.00 ? 53 ILE A HG12 4  
ATOM   2616  H HG13 . ILE A 1 36 ? 3.397  8.081  0.548   1.00 0.00 ? 53 ILE A HG13 4  
ATOM   2617  H HG21 . ILE A 1 36 ? 4.958  10.708 2.705   1.00 0.00 ? 53 ILE A HG21 4  
ATOM   2618  H HG22 . ILE A 1 36 ? 6.261  11.056 1.546   1.00 0.00 ? 53 ILE A HG22 4  
ATOM   2619  H HG23 . ILE A 1 36 ? 4.586  11.520 1.167   1.00 0.00 ? 53 ILE A HG23 4  
ATOM   2620  H HD11 . ILE A 1 36 ? 3.324  9.511  3.229   1.00 0.00 ? 53 ILE A HD11 4  
ATOM   2621  H HD12 . ILE A 1 36 ? 2.140  8.316  2.654   1.00 0.00 ? 53 ILE A HD12 4  
ATOM   2622  H HD13 . ILE A 1 36 ? 3.822  7.824  2.962   1.00 0.00 ? 53 ILE A HD13 4  
ATOM   2623  N N    . TYR A 1 37 ? 6.846  11.303 -1.070  1.00 0.00 ? 54 TYR A N    4  
ATOM   2624  C CA   . TYR A 1 37 ? 8.124  11.900 -1.442  1.00 0.00 ? 54 TYR A CA   4  
ATOM   2625  C C    . TYR A 1 37 ? 8.601  12.884 -0.383  1.00 0.00 ? 54 TYR A C    4  
ATOM   2626  O O    . TYR A 1 37 ? 7.834  13.723 0.090   1.00 0.00 ? 54 TYR A O    4  
ATOM   2627  C CB   . TYR A 1 37 ? 8.013  12.600 -2.799  1.00 0.00 ? 54 TYR A CB   4  
ATOM   2628  C CG   . TYR A 1 37 ? 7.785  11.658 -3.960  1.00 0.00 ? 54 TYR A CG   4  
ATOM   2629  C CD1  . TYR A 1 37 ? 8.844  10.973 -4.538  1.00 0.00 ? 54 TYR A CD1  4  
ATOM   2630  C CD2  . TYR A 1 37 ? 6.514  11.456 -4.474  1.00 0.00 ? 54 TYR A CD2  4  
ATOM   2631  C CE1  . TYR A 1 37 ? 8.643  10.111 -5.598  1.00 0.00 ? 54 TYR A CE1  4  
ATOM   2632  C CE2  . TYR A 1 37 ? 6.300  10.595 -5.534  1.00 0.00 ? 54 TYR A CE2  4  
ATOM   2633  C CZ   . TYR A 1 37 ? 7.368  9.925  -6.094  1.00 0.00 ? 54 TYR A CZ   4  
ATOM   2634  O OH   . TYR A 1 37 ? 7.162  9.068  -7.150  1.00 0.00 ? 54 TYR A OH   4  
ATOM   2635  H H    . TYR A 1 37 ? 6.007  11.863 -1.126  1.00 0.00 ? 54 TYR A H    4  
ATOM   2636  H HA   . TYR A 1 37 ? 8.887  11.124 -1.513  1.00 0.00 ? 54 TYR A HA   4  
ATOM   2637  H HB2  . TYR A 1 37 ? 7.181  13.302 -2.732  1.00 0.00 ? 54 TYR A HB2  4  
ATOM   2638  H HB3  . TYR A 1 37 ? 8.941  13.150 -2.953  1.00 0.00 ? 54 TYR A HB3  4  
ATOM   2639  H HD1  . TYR A 1 37 ? 9.848  11.125 -4.141  1.00 0.00 ? 54 TYR A HD1  4  
ATOM   2640  H HD2  . TYR A 1 37 ? 5.674  11.989 -4.027  1.00 0.00 ? 54 TYR A HD2  4  
ATOM   2641  H HE1  . TYR A 1 37 ? 9.487  9.582  -6.038  1.00 0.00 ? 54 TYR A HE1  4  
ATOM   2642  H HE2  . TYR A 1 37 ? 5.295  10.446 -5.928  1.00 0.00 ? 54 TYR A HE2  4  
ATOM   2643  H HH   . TYR A 1 37 ? 7.972  8.655  -7.462  1.00 0.00 ? 54 TYR A HH   4  
ATOM   2644  N N    . ASP A 1 38 ? 9.873  12.776 -0.014  1.00 0.00 ? 55 ASP A N    4  
ATOM   2645  C CA   . ASP A 1 38 ? 10.495 13.745 0.883   1.00 0.00 ? 55 ASP A CA   4  
ATOM   2646  C C    . ASP A 1 38 ? 11.461 14.650 0.131   1.00 0.00 ? 55 ASP A C    4  
ATOM   2647  O O    . ASP A 1 38 ? 12.600 14.270 -0.140  1.00 0.00 ? 55 ASP A O    4  
ATOM   2648  C CB   . ASP A 1 38 ? 11.224 13.028 2.023   1.00 0.00 ? 55 ASP A CB   4  
ATOM   2649  C CG   . ASP A 1 38 ? 11.872 13.961 3.037   1.00 0.00 ? 55 ASP A CG   4  
ATOM   2650  O OD1  . ASP A 1 38 ? 11.849 15.149 2.823   1.00 0.00 ? 55 ASP A OD1  4  
ATOM   2651  O OD2  . ASP A 1 38 ? 12.244 13.494 4.088   1.00 0.00 ? 55 ASP A OD2  4  
ATOM   2652  H H    . ASP A 1 38 ? 10.423 12.005 -0.362  1.00 0.00 ? 55 ASP A H    4  
ATOM   2653  H HA   . ASP A 1 38 ? 9.731  14.393 1.312   1.00 0.00 ? 55 ASP A HA   4  
ATOM   2654  H HB2  . ASP A 1 38 ? 10.605 12.298 2.544   1.00 0.00 ? 55 ASP A HB2  4  
ATOM   2655  H HB3  . ASP A 1 38 ? 12.000 12.511 1.458   1.00 0.00 ? 55 ASP A HB3  4  
ATOM   2656  N N    . ARG A 1 39 ? 10.999 15.850 -0.206  1.00 0.00 ? 56 ARG A N    4  
ATOM   2657  C CA   . ARG A 1 39 ? 11.780 16.768 -1.026  1.00 0.00 ? 56 ARG A CA   4  
ATOM   2658  C C    . ARG A 1 39 ? 12.761 17.568 -0.178  1.00 0.00 ? 56 ARG A C    4  
ATOM   2659  O O    . ARG A 1 39 ? 12.443 17.971 0.941   1.00 0.00 ? 56 ARG A O    4  
ATOM   2660  C CB   . ARG A 1 39 ? 10.897 17.682 -1.864  1.00 0.00 ? 56 ARG A CB   4  
ATOM   2661  C CG   . ARG A 1 39 ? 11.606 18.379 -3.014  1.00 0.00 ? 56 ARG A CG   4  
ATOM   2662  C CD   . ARG A 1 39 ? 10.729 19.250 -3.836  1.00 0.00 ? 56 ARG A CD   4  
ATOM   2663  N NE   . ARG A 1 39 ? 10.338 20.493 -3.189  1.00 0.00 ? 56 ARG A NE   4  
ATOM   2664  C CZ   . ARG A 1 39 ? 9.468  21.383 -3.704  1.00 0.00 ? 56 ARG A CZ   4  
ATOM   2665  N NH1  . ARG A 1 39 ? 8.924  21.192 -4.886  1.00 0.00 ? 56 ARG A NH1  4  
ATOM   2666  N NH2  . ARG A 1 39 ? 9.192  22.467 -2.999  1.00 0.00 ? 56 ARG A NH2  4  
ATOM   2667  H H    . ARG A 1 39 ? 10.084 16.132 0.116   1.00 0.00 ? 56 ARG A H    4  
ATOM   2668  H HA   . ARG A 1 39 ? 12.377 16.206 -1.744  1.00 0.00 ? 56 ARG A HA   4  
ATOM   2669  H HB2  . ARG A 1 39 ? 10.089 17.067 -2.259  1.00 0.00 ? 56 ARG A HB2  4  
ATOM   2670  H HB3  . ARG A 1 39 ? 10.485 18.432 -1.189  1.00 0.00 ? 56 ARG A HB3  4  
ATOM   2671  H HG2  . ARG A 1 39 ? 12.405 18.996 -2.605  1.00 0.00 ? 56 ARG A HG2  4  
ATOM   2672  H HG3  . ARG A 1 39 ? 12.033 17.618 -3.669  1.00 0.00 ? 56 ARG A HG3  4  
ATOM   2673  H HD2  . ARG A 1 39 ? 11.252 19.512 -4.755  1.00 0.00 ? 56 ARG A HD2  4  
ATOM   2674  H HD3  . ARG A 1 39 ? 9.816  18.707 -4.078  1.00 0.00 ? 56 ARG A HD3  4  
ATOM   2675  H HE   . ARG A 1 39 ? 10.631 20.878 -2.301  1.00 0.00 ? 56 ARG A HE   4  
ATOM   2676  H HH11 . ARG A 1 39 ? 9.160  20.368 -5.420  1.00 0.00 ? 56 ARG A HH11 4  
ATOM   2677  H HH12 . ARG A 1 39 ? 8.274  21.872 -5.255  1.00 0.00 ? 56 ARG A HH12 4  
ATOM   2678  H HH21 . ARG A 1 39 ? 9.631  22.605 -2.100  1.00 0.00 ? 56 ARG A HH21 4  
ATOM   2679  H HH22 . ARG A 1 39 ? 8.543  23.149 -3.363  1.00 0.00 ? 56 ARG A HH22 4  
ATOM   2680  N N    . LYS A 1 40 ? 13.954 17.794 -0.716  1.00 0.00 ? 57 LYS A N    4  
ATOM   2681  C CA   . LYS A 1 40 ? 14.946 18.636 -0.057  1.00 0.00 ? 57 LYS A CA   4  
ATOM   2682  C C    . LYS A 1 40 ? 14.342 19.969 0.365   1.00 0.00 ? 57 LYS A C    4  
ATOM   2683  O O    . LYS A 1 40 ? 14.634 20.478 1.447   1.00 0.00 ? 57 LYS A O    4  
ATOM   2684  C CB   . LYS A 1 40 ? 16.146 18.868 -0.976  1.00 0.00 ? 57 LYS A CB   4  
ATOM   2685  C CG   . LYS A 1 40 ? 17.235 19.748 -0.377  1.00 0.00 ? 57 LYS A CG   4  
ATOM   2686  C CD   . LYS A 1 40 ? 18.420 19.883 -1.322  1.00 0.00 ? 57 LYS A CD   4  
ATOM   2687  C CE   . LYS A 1 40 ? 19.493 20.790 -0.739  1.00 0.00 ? 57 LYS A CE   4  
ATOM   2688  N NZ   . LYS A 1 40 ? 20.665 20.920 -1.647  1.00 0.00 ? 57 LYS A NZ   4  
ATOM   2689  H H    . LYS A 1 40 ? 14.180 17.371 -1.605  1.00 0.00 ? 57 LYS A H    4  
ATOM   2690  H HA   . LYS A 1 40 ? 15.295 18.149 0.854   1.00 0.00 ? 57 LYS A HA   4  
ATOM   2691  H HB2  . LYS A 1 40 ? 16.561 17.889 -1.214  1.00 0.00 ? 57 LYS A HB2  4  
ATOM   2692  H HB3  . LYS A 1 40 ? 15.766 19.332 -1.887  1.00 0.00 ? 57 LYS A HB3  4  
ATOM   2693  H HG2  . LYS A 1 40 ? 16.813 20.735 -0.179  1.00 0.00 ? 57 LYS A HG2  4  
ATOM   2694  H HG3  . LYS A 1 40 ? 17.565 19.301 0.560   1.00 0.00 ? 57 LYS A HG3  4  
ATOM   2695  H HD2  . LYS A 1 40 ? 18.838 18.891 -1.498  1.00 0.00 ? 57 LYS A HD2  4  
ATOM   2696  H HD3  . LYS A 1 40 ? 18.067 20.299 -2.265  1.00 0.00 ? 57 LYS A HD3  4  
ATOM   2697  H HE2  . LYS A 1 40 ? 19.055 21.772 -0.568  1.00 0.00 ? 57 LYS A HE2  4  
ATOM   2698  H HE3  . LYS A 1 40 ? 19.818 20.368 0.212   1.00 0.00 ? 57 LYS A HE3  4  
ATOM   2699  H HZ1  . LYS A 1 40 ? 20.366 21.312 -2.528  1.00 0.00 ? 57 LYS A HZ1  4  
ATOM   2700  H HZ2  . LYS A 1 40 ? 21.352 21.528 -1.224  1.00 0.00 ? 57 LYS A HZ2  4  
ATOM   2701  H HZ3  . LYS A 1 40 ? 21.073 20.009 -1.805  1.00 0.00 ? 57 LYS A HZ3  4  
ATOM   2702  N N    . PHE A 1 41 ? 13.500 20.530 -0.495  1.00 0.00 ? 58 PHE A N    4  
ATOM   2703  C CA   . PHE A 1 41 ? 12.831 21.792 -0.201  1.00 0.00 ? 58 PHE A CA   4  
ATOM   2704  C C    . PHE A 1 41 ? 11.334 21.590 -0.006  1.00 0.00 ? 58 PHE A C    4  
ATOM   2705  O O    . PHE A 1 41 ? 10.526 22.421 -0.423  1.00 0.00 ? 58 PHE A O    4  
ATOM   2706  C CB   . PHE A 1 41 ? 13.085 22.804 -1.319  1.00 0.00 ? 58 PHE A CB   4  
ATOM   2707  C CG   . PHE A 1 41 ? 14.538 23.120 -1.533  1.00 0.00 ? 58 PHE A CG   4  
ATOM   2708  C CD1  . PHE A 1 41 ? 15.235 23.901 -0.625  1.00 0.00 ? 58 PHE A CD1  4  
ATOM   2709  C CD2  . PHE A 1 41 ? 15.211 22.634 -2.644  1.00 0.00 ? 58 PHE A CD2  4  
ATOM   2710  C CE1  . PHE A 1 41 ? 16.571 24.192 -0.820  1.00 0.00 ? 58 PHE A CE1  4  
ATOM   2711  C CE2  . PHE A 1 41 ? 16.548 22.923 -2.843  1.00 0.00 ? 58 PHE A CE2  4  
ATOM   2712  C CZ   . PHE A 1 41 ? 17.228 23.702 -1.931  1.00 0.00 ? 58 PHE A CZ   4  
ATOM   2713  H H    . PHE A 1 41 ? 13.317 20.071 -1.376  1.00 0.00 ? 58 PHE A H    4  
ATOM   2714  H HA   . PHE A 1 41 ? 13.213 22.203 0.735   1.00 0.00 ? 58 PHE A HA   4  
ATOM   2715  H HB2  . PHE A 1 41 ? 12.706 22.422 -2.266  1.00 0.00 ? 58 PHE A HB2  4  
ATOM   2716  H HB3  . PHE A 1 41 ? 12.592 23.748 -1.087  1.00 0.00 ? 58 PHE A HB3  4  
ATOM   2717  H HD1  . PHE A 1 41 ? 14.716 24.287 0.253   1.00 0.00 ? 58 PHE A HD1  4  
ATOM   2718  H HD2  . PHE A 1 41 ? 14.673 22.018 -3.366  1.00 0.00 ? 58 PHE A HD2  4  
ATOM   2719  H HE1  . PHE A 1 41 ? 17.107 24.808 -0.099  1.00 0.00 ? 58 PHE A HE1  4  
ATOM   2720  H HE2  . PHE A 1 41 ? 17.064 22.534 -3.720  1.00 0.00 ? 58 PHE A HE2  4  
ATOM   2721  H HZ   . PHE A 1 41 ? 18.281 23.929 -2.087  1.00 0.00 ? 58 PHE A HZ   4  
ATOM   2722  N N    . LEU A 1 42 ? 10.969 20.482 0.630   1.00 0.00 ? 59 LEU A N    4  
ATOM   2723  C CA   . LEU A 1 42 ? 9.566  20.143 0.835   1.00 0.00 ? 59 LEU A CA   4  
ATOM   2724  C C    . LEU A 1 42 ? 8.858  21.205 1.666   1.00 0.00 ? 59 LEU A C    4  
ATOM   2725  O O    . LEU A 1 42 ? 9.383  21.664 2.681   1.00 0.00 ? 59 LEU A O    4  
ATOM   2726  C CB   . LEU A 1 42 ? 9.445  18.770 1.508   1.00 0.00 ? 59 LEU A CB   4  
ATOM   2727  C CG   . LEU A 1 42 ? 8.034  18.168 1.515   1.00 0.00 ? 59 LEU A CG   4  
ATOM   2728  C CD1  . LEU A 1 42 ? 7.600  17.841 0.093   1.00 0.00 ? 59 LEU A CD1  4  
ATOM   2729  C CD2  . LEU A 1 42 ? 8.018  16.919 2.384   1.00 0.00 ? 59 LEU A CD2  4  
ATOM   2730  H H    . LEU A 1 42 ? 11.682 19.859 0.980   1.00 0.00 ? 59 LEU A H    4  
ATOM   2731  H HA   . LEU A 1 42 ? 9.054  20.111 -0.126  1.00 0.00 ? 59 LEU A HA   4  
ATOM   2732  H HB2  . LEU A 1 42 ? 10.095 18.194 0.852   1.00 0.00 ? 59 LEU A HB2  4  
ATOM   2733  H HB3  . LEU A 1 42 ? 9.860  18.777 2.516   1.00 0.00 ? 59 LEU A HB3  4  
ATOM   2734  H HG   . LEU A 1 42 ? 7.371  18.902 1.973   1.00 0.00 ? 59 LEU A HG   4  
ATOM   2735  H HD11 . LEU A 1 42 ? 6.596  17.414 0.108   1.00 0.00 ? 59 LEU A HD11 4  
ATOM   2736  H HD12 . LEU A 1 42 ? 7.596  18.753 -0.506  1.00 0.00 ? 59 LEU A HD12 4  
ATOM   2737  H HD13 . LEU A 1 42 ? 8.293  17.123 -0.343  1.00 0.00 ? 59 LEU A HD13 4  
ATOM   2738  H HD21 . LEU A 1 42 ? 8.305  17.181 3.403   1.00 0.00 ? 59 LEU A HD21 4  
ATOM   2739  H HD22 . LEU A 1 42 ? 7.015  16.493 2.389   1.00 0.00 ? 59 LEU A HD22 4  
ATOM   2740  H HD23 . LEU A 1 42 ? 8.722  16.189 1.985   1.00 0.00 ? 59 LEU A HD23 4  
ATOM   2741  N N    . LEU A 1 43 ? 7.664  21.592 1.231   1.00 0.00 ? 60 LEU A N    4  
ATOM   2742  C CA   . LEU A 1 43 ? 6.876  22.592 1.942   1.00 0.00 ? 60 LEU A CA   4  
ATOM   2743  C C    . LEU A 1 43 ? 6.568  22.140 3.364   1.00 0.00 ? 60 LEU A C    4  
ATOM   2744  O O    . LEU A 1 43 ? 6.672  22.921 4.310   1.00 0.00 ? 60 LEU A O    4  
ATOM   2745  C CB   . LEU A 1 43 ? 5.576  22.882 1.181   1.00 0.00 ? 60 LEU A CB   4  
ATOM   2746  C CG   . LEU A 1 43 ? 5.751  23.624 -0.150  1.00 0.00 ? 60 LEU A CG   4  
ATOM   2747  C CD1  . LEU A 1 43 ? 4.425  23.677 -0.896  1.00 0.00 ? 60 LEU A CD1  4  
ATOM   2748  C CD2  . LEU A 1 43 ? 6.277  25.027 0.115   1.00 0.00 ? 60 LEU A CD2  4  
ATOM   2749  H H    . LEU A 1 43 ? 7.293  21.185 0.384   1.00 0.00 ? 60 LEU A H    4  
ATOM   2750  H HA   . LEU A 1 43 ? 7.448  23.515 2.029   1.00 0.00 ? 60 LEU A HA   4  
ATOM   2751  H HB2  . LEU A 1 43 ? 5.246  21.860 0.999   1.00 0.00 ? 60 LEU A HB2  4  
ATOM   2752  H HB3  . LEU A 1 43 ? 4.846  23.392 1.808   1.00 0.00 ? 60 LEU A HB3  4  
ATOM   2753  H HG   . LEU A 1 43 ? 6.507  23.088 -0.724  1.00 0.00 ? 60 LEU A HG   4  
ATOM   2754  H HD11 . LEU A 1 43 ? 4.558  24.206 -1.840  1.00 0.00 ? 60 LEU A HD11 4  
ATOM   2755  H HD12 . LEU A 1 43 ? 4.079  22.662 -1.096  1.00 0.00 ? 60 LEU A HD12 4  
ATOM   2756  H HD13 . LEU A 1 43 ? 3.686  24.200 -0.289  1.00 0.00 ? 60 LEU A HD13 4  
ATOM   2757  H HD21 . LEU A 1 43 ? 7.238  24.965 0.624   1.00 0.00 ? 60 LEU A HD21 4  
ATOM   2758  H HD22 . LEU A 1 43 ? 6.401  25.553 -0.832  1.00 0.00 ? 60 LEU A HD22 4  
ATOM   2759  H HD23 . LEU A 1 43 ? 5.569  25.568 0.742   1.00 0.00 ? 60 LEU A HD23 4  
ATOM   2760  N N    . ASP A 1 44 ? 6.189  20.874 3.509   1.00 0.00 ? 61 ASP A N    4  
ATOM   2761  C CA   . ASP A 1 44 ? 5.961  20.288 4.824   1.00 0.00 ? 61 ASP A CA   4  
ATOM   2762  C C    . ASP A 1 44 ? 7.274  19.874 5.476   1.00 0.00 ? 61 ASP A C    4  
ATOM   2763  O O    . ASP A 1 44 ? 7.689  18.720 5.379   1.00 0.00 ? 61 ASP A O    4  
ATOM   2764  C CB   . ASP A 1 44 ? 5.023  19.083 4.719   1.00 0.00 ? 61 ASP A CB   4  
ATOM   2765  C CG   . ASP A 1 44 ? 4.625  18.478 6.058   1.00 0.00 ? 61 ASP A CG   4  
ATOM   2766  O OD1  . ASP A 1 44 ? 5.078  18.966 7.067   1.00 0.00 ? 61 ASP A OD1  4  
ATOM   2767  O OD2  . ASP A 1 44 ? 3.754  17.642 6.074   1.00 0.00 ? 61 ASP A OD2  4  
ATOM   2768  H H    . ASP A 1 44 ? 6.054  20.304 2.685   1.00 0.00 ? 61 ASP A H    4  
ATOM   2769  H HA   . ASP A 1 44 ? 5.506  21.028 5.484   1.00 0.00 ? 61 ASP A HA   4  
ATOM   2770  H HB2  . ASP A 1 44 ? 4.127  19.280 4.129   1.00 0.00 ? 61 ASP A HB2  4  
ATOM   2771  H HB3  . ASP A 1 44 ? 5.666  18.386 4.182   1.00 0.00 ? 61 ASP A HB3  4  
ATOM   2772  N N    . ARG A 1 45 ? 7.923  20.823 6.142   1.00 0.00 ? 62 ARG A N    4  
ATOM   2773  C CA   . ARG A 1 45 ? 9.188  20.557 6.816   1.00 0.00 ? 62 ARG A CA   4  
ATOM   2774  C C    . ARG A 1 45 ? 8.963  19.860 8.152   1.00 0.00 ? 62 ARG A C    4  
ATOM   2775  O O    . ARG A 1 45 ? 8.754  18.678 8.184   1.00 0.00 ? 62 ARG A O    4  
ATOM   2776  C CB   . ARG A 1 45 ? 10.027 21.816 6.980   1.00 0.00 ? 62 ARG A CB   4  
ATOM   2777  C CG   . ARG A 1 45 ? 10.518 22.430 5.680   1.00 0.00 ? 62 ARG A CG   4  
ATOM   2778  C CD   . ARG A 1 45 ? 11.273 23.699 5.848   1.00 0.00 ? 62 ARG A CD   4  
ATOM   2779  N NE   . ARG A 1 45 ? 10.467 24.826 6.285   1.00 0.00 ? 62 ARG A NE   4  
ATOM   2780  C CZ   . ARG A 1 45 ? 10.965 26.004 6.712   1.00 0.00 ? 62 ARG A CZ   4  
ATOM   2781  N NH1  . ARG A 1 45 ? 12.263 26.199 6.796   1.00 0.00 ? 62 ARG A NH1  4  
ATOM   2782  N NH2  . ARG A 1 45 ? 10.115 26.950 7.067   1.00 0.00 ? 62 ARG A NH2  4  
ATOM   2783  O OXT  . ARG A 1 45 ? 8.996  20.491 9.172   1.00 0.00 ? 62 ARG A OXT  4  
ATOM   2784  H H    . ARG A 1 45 ? 7.531  21.753 6.180   1.00 0.00 ? 62 ARG A H    4  
ATOM   2785  H HA   . ARG A 1 45 ? 9.794  19.883 6.212   1.00 0.00 ? 62 ARG A HA   4  
ATOM   2786  H HB2  . ARG A 1 45 ? 9.413  22.542 7.512   1.00 0.00 ? 62 ARG A HB2  4  
ATOM   2787  H HB3  . ARG A 1 45 ? 10.886 21.548 7.596   1.00 0.00 ? 62 ARG A HB3  4  
ATOM   2788  H HG2  . ARG A 1 45 ? 11.173 21.714 5.182   1.00 0.00 ? 62 ARG A HG2  4  
ATOM   2789  H HG3  . ARG A 1 45 ? 9.654  22.635 5.046   1.00 0.00 ? 62 ARG A HG3  4  
ATOM   2790  H HD2  . ARG A 1 45 ? 12.055 23.548 6.592   1.00 0.00 ? 62 ARG A HD2  4  
ATOM   2791  H HD3  . ARG A 1 45 ? 11.726 23.970 4.895   1.00 0.00 ? 62 ARG A HD3  4  
ATOM   2792  H HE   . ARG A 1 45 ? 9.461  24.916 6.341   1.00 0.00 ? 62 ARG A HE   4  
ATOM   2793  H HH11 . ARG A 1 45 ? 12.900 25.459 6.538   1.00 0.00 ? 62 ARG A HH11 4  
ATOM   2794  H HH12 . ARG A 1 45 ? 12.616 27.089 7.118   1.00 0.00 ? 62 ARG A HH12 4  
ATOM   2795  H HH21 . ARG A 1 45 ? 9.120  26.777 7.013   1.00 0.00 ? 62 ARG A HH21 4  
ATOM   2796  H HH22 . ARG A 1 45 ? 10.461 27.841 7.390   1.00 0.00 ? 62 ARG A HH22 4  
ATOM   2797  N N    . PRO A 1 1  ? 0.441  -0.943 -0.745  1.00 0.00 ? 18 PRO A N    5  
ATOM   2798  C CA   . PRO A 1 1  ? 1.766  -0.766 -0.164  1.00 0.00 ? 18 PRO A CA   5  
ATOM   2799  C C    . PRO A 1 1  ? 2.186  0.699  -0.185  1.00 0.00 ? 18 PRO A C    5  
ATOM   2800  O O    . PRO A 1 1  ? 1.737  1.471  -1.033  1.00 0.00 ? 18 PRO A O    5  
ATOM   2801  C CB   . PRO A 1 1  ? 2.676  -1.639 -1.033  1.00 0.00 ? 18 PRO A CB   5  
ATOM   2802  C CG   . PRO A 1 1  ? 2.018  -1.643 -2.371  1.00 0.00 ? 18 PRO A CG   5  
ATOM   2803  C CD   . PRO A 1 1  ? 0.539  -1.619 -2.088  1.00 0.00 ? 18 PRO A CD   5  
ATOM   2804  H H2   . PRO A 1 1  ? 0.321  -1.528 -1.547  1.00 0.00 ? 18 PRO A H2   5  
ATOM   2805  H H3   . PRO A 1 1  ? -0.298 -1.331 -0.195  1.00 0.00 ? 18 PRO A H3   5  
ATOM   2806  H HA   . PRO A 1 1  ? 1.809  -1.057 0.896   1.00 0.00 ? 18 PRO A HA   5  
ATOM   2807  H HB2  . PRO A 1 1  ? 3.695  -1.226 -1.092  1.00 0.00 ? 18 PRO A HB2  5  
ATOM   2808  H HB3  . PRO A 1 1  ? 2.765  -2.658 -0.629  1.00 0.00 ? 18 PRO A HB3  5  
ATOM   2809  H HG2  . PRO A 1 1  ? 2.322  -0.771 -2.967  1.00 0.00 ? 18 PRO A HG2  5  
ATOM   2810  H HG3  . PRO A 1 1  ? 2.296  -2.538 -2.947  1.00 0.00 ? 18 PRO A HG3  5  
ATOM   2811  H HD2  . PRO A 1 1  ? -0.020 -1.056 -2.850  1.00 0.00 ? 18 PRO A HD2  5  
ATOM   2812  H HD3  . PRO A 1 1  ? 0.106  -2.629 -2.053  1.00 0.00 ? 18 PRO A HD3  5  
ATOM   2813  N N    . THR A 1 2  ? 3.047  1.076  0.753   1.00 0.00 ? 19 THR A N    5  
ATOM   2814  C CA   . THR A 1 2  ? 3.519  2.452  0.852   1.00 0.00 ? 19 THR A CA   5  
ATOM   2815  C C    . THR A 1 2  ? 5.035  2.525  0.723   1.00 0.00 ? 19 THR A C    5  
ATOM   2816  O O    . THR A 1 2  ? 5.758  1.720  1.311   1.00 0.00 ? 19 THR A O    5  
ATOM   2817  C CB   . THR A 1 2  ? 3.096  3.100  2.184   1.00 0.00 ? 19 THR A CB   5  
ATOM   2818  O OG1  . THR A 1 2  ? 1.667  3.088  2.291   1.00 0.00 ? 19 THR A OG1  5  
ATOM   2819  C CG2  . THR A 1 2  ? 3.595  4.535  2.261   1.00 0.00 ? 19 THR A CG2  5  
ATOM   2820  H H    . THR A 1 2  ? 3.386  0.391  1.415   1.00 0.00 ? 19 THR A H    5  
ATOM   2821  H HA   . THR A 1 2  ? 3.111  3.042  0.031   1.00 0.00 ? 19 THR A HA   5  
ATOM   2822  H HB   . THR A 1 2  ? 3.518  2.524  3.008   1.00 0.00 ? 19 THR A HB   5  
ATOM   2823  H HG1  . THR A 1 2  ? 1.406  3.491  3.123   1.00 0.00 ? 19 THR A HG1  5  
ATOM   2824  H HG21 . THR A 1 2  ? 3.173  5.110  1.439   1.00 0.00 ? 19 THR A HG21 5  
ATOM   2825  H HG22 . THR A 1 2  ? 3.287  4.976  3.209   1.00 0.00 ? 19 THR A HG22 5  
ATOM   2826  H HG23 . THR A 1 2  ? 4.683  4.545  2.191   1.00 0.00 ? 19 THR A HG23 5  
ATOM   2827  N N    . ARG A 1 3  ? 5.511  3.495  -0.050  1.00 0.00 ? 20 ARG A N    5  
ATOM   2828  C CA   . ARG A 1 3  ? 6.943  3.677  -0.257  1.00 0.00 ? 20 ARG A CA   5  
ATOM   2829  C C    . ARG A 1 3  ? 7.355  5.124  -0.018  1.00 0.00 ? 20 ARG A C    5  
ATOM   2830  O O    . ARG A 1 3  ? 6.523  6.030  -0.056  1.00 0.00 ? 20 ARG A O    5  
ATOM   2831  C CB   . ARG A 1 3  ? 7.391  3.189  -1.628  1.00 0.00 ? 20 ARG A CB   5  
ATOM   2832  C CG   . ARG A 1 3  ? 7.145  1.712  -1.893  1.00 0.00 ? 20 ARG A CG   5  
ATOM   2833  C CD   . ARG A 1 3  ? 8.000  0.797  -1.094  1.00 0.00 ? 20 ARG A CD   5  
ATOM   2834  N NE   . ARG A 1 3  ? 7.804  -0.615 -1.382  1.00 0.00 ? 20 ARG A NE   5  
ATOM   2835  C CZ   . ARG A 1 3  ? 6.912  -1.407 -0.756  1.00 0.00 ? 20 ARG A CZ   5  
ATOM   2836  N NH1  . ARG A 1 3  ? 6.160  -0.943 0.218   1.00 0.00 ? 20 ARG A NH1  5  
ATOM   2837  N NH2  . ARG A 1 3  ? 6.829  -2.672 -1.129  1.00 0.00 ? 20 ARG A NH2  5  
ATOM   2838  H H    . ARG A 1 3  ? 4.865  4.123  -0.506  1.00 0.00 ? 20 ARG A H    5  
ATOM   2839  H HA   . ARG A 1 3  ? 7.499  3.073  0.460   1.00 0.00 ? 20 ARG A HA   5  
ATOM   2840  H HB2  . ARG A 1 3  ? 6.855  3.782  -2.367  1.00 0.00 ? 20 ARG A HB2  5  
ATOM   2841  H HB3  . ARG A 1 3  ? 8.460  3.394  -1.703  1.00 0.00 ? 20 ARG A HB3  5  
ATOM   2842  H HG2  . ARG A 1 3  ? 6.105  1.487  -1.661  1.00 0.00 ? 20 ARG A HG2  5  
ATOM   2843  H HG3  . ARG A 1 3  ? 7.334  1.514  -2.948  1.00 0.00 ? 20 ARG A HG3  5  
ATOM   2844  H HD2  . ARG A 1 3  ? 9.047  1.027  -1.292  1.00 0.00 ? 20 ARG A HD2  5  
ATOM   2845  H HD3  . ARG A 1 3  ? 7.788  0.946  -0.036  1.00 0.00 ? 20 ARG A HD3  5  
ATOM   2846  H HE   . ARG A 1 3  ? 8.270  -1.206 -2.057  1.00 0.00 ? 20 ARG A HE   5  
ATOM   2847  H HH11 . ARG A 1 3  ? 6.248  0.022  0.504   1.00 0.00 ? 20 ARG A HH11 5  
ATOM   2848  H HH12 . ARG A 1 3  ? 5.498  -1.553 0.676   1.00 0.00 ? 20 ARG A HH12 5  
ATOM   2849  H HH21 . ARG A 1 3  ? 7.427  -3.018 -1.868  1.00 0.00 ? 20 ARG A HH21 5  
ATOM   2850  H HH22 . ARG A 1 3  ? 6.170  -3.287 -0.676  1.00 0.00 ? 20 ARG A HH22 5  
ATOM   2851  N N    . THR A 1 4  ? 8.644  5.334  0.227   1.00 0.00 ? 21 THR A N    5  
ATOM   2852  C CA   . THR A 1 4  ? 9.170  6.672  0.468   1.00 0.00 ? 21 THR A CA   5  
ATOM   2853  C C    . THR A 1 4  ? 10.334 6.982  -0.465  1.00 0.00 ? 21 THR A C    5  
ATOM   2854  O O    . THR A 1 4  ? 11.316 6.240  -0.517  1.00 0.00 ? 21 THR A O    5  
ATOM   2855  C CB   . THR A 1 4  ? 9.634  6.845  1.926   1.00 0.00 ? 21 THR A CB   5  
ATOM   2856  O OG1  . THR A 1 4  ? 8.532  6.611  2.812   1.00 0.00 ? 21 THR A OG1  5  
ATOM   2857  C CG2  . THR A 1 4  ? 10.173 8.248  2.151   1.00 0.00 ? 21 THR A CG2  5  
ATOM   2858  H H    . THR A 1 4  ? 9.276  4.546  0.249   1.00 0.00 ? 21 THR A H    5  
ATOM   2859  H HA   . THR A 1 4  ? 8.400  7.414  0.256   1.00 0.00 ? 21 THR A HA   5  
ATOM   2860  H HB   . THR A 1 4  ? 10.418 6.118  2.136   1.00 0.00 ? 21 THR A HB   5  
ATOM   2861  H HG1  . THR A 1 4  ? 8.824  6.719  3.719   1.00 0.00 ? 21 THR A HG1  5  
ATOM   2862  H HG21 . THR A 1 4  ? 9.389  8.976  1.942   1.00 0.00 ? 21 THR A HG21 5  
ATOM   2863  H HG22 . THR A 1 4  ? 10.497 8.351  3.187   1.00 0.00 ? 21 THR A HG22 5  
ATOM   2864  H HG23 . THR A 1 4  ? 11.019 8.425  1.487   1.00 0.00 ? 21 THR A HG23 5  
ATOM   2865  N N    . VAL A 1 5  ? 10.219 8.081  -1.202  1.00 0.00 ? 22 VAL A N    5  
ATOM   2866  C CA   . VAL A 1 5  ? 11.264 8.494  -2.131  1.00 0.00 ? 22 VAL A CA   5  
ATOM   2867  C C    . VAL A 1 5  ? 11.645 9.954  -1.920  1.00 0.00 ? 22 VAL A C    5  
ATOM   2868  O O    . VAL A 1 5  ? 10.779 10.824 -1.827  1.00 0.00 ? 22 VAL A O    5  
ATOM   2869  C CB   . VAL A 1 5  ? 10.830 8.293  -3.596  1.00 0.00 ? 22 VAL A CB   5  
ATOM   2870  C CG1  . VAL A 1 5  ? 11.904 8.805  -4.544  1.00 0.00 ? 22 VAL A CG1  5  
ATOM   2871  C CG2  . VAL A 1 5  ? 10.534 6.827  -3.867  1.00 0.00 ? 22 VAL A CG2  5  
ATOM   2872  H H    . VAL A 1 5  ? 9.387  8.646  -1.116  1.00 0.00 ? 22 VAL A H    5  
ATOM   2873  H HA   . VAL A 1 5  ? 12.187 7.937  -1.963  1.00 0.00 ? 22 VAL A HA   5  
ATOM   2874  H HB   . VAL A 1 5  ? 9.903  8.842  -3.768  1.00 0.00 ? 22 VAL A HB   5  
ATOM   2875  H HG11 . VAL A 1 5  ? 11.581 8.655  -5.574  1.00 0.00 ? 22 VAL A HG11 5  
ATOM   2876  H HG12 . VAL A 1 5  ? 12.072 9.866  -4.367  1.00 0.00 ? 22 VAL A HG12 5  
ATOM   2877  H HG13 . VAL A 1 5  ? 12.830 8.256  -4.374  1.00 0.00 ? 22 VAL A HG13 5  
ATOM   2878  H HG21 . VAL A 1 5  ? 9.731  6.489  -3.212  1.00 0.00 ? 22 VAL A HG21 5  
ATOM   2879  H HG22 . VAL A 1 5  ? 10.228 6.704  -4.906  1.00 0.00 ? 22 VAL A HG22 5  
ATOM   2880  H HG23 . VAL A 1 5  ? 11.430 6.235  -3.681  1.00 0.00 ? 22 VAL A HG23 5  
ATOM   2881  N N    . ALA A 1 6  ? 12.945 10.215 -1.844  1.00 0.00 ? 23 ALA A N    5  
ATOM   2882  C CA   . ALA A 1 6  ? 13.445 11.577 -1.697  1.00 0.00 ? 23 ALA A CA   5  
ATOM   2883  C C    . ALA A 1 6  ? 13.683 12.226 -3.055  1.00 0.00 ? 23 ALA A C    5  
ATOM   2884  O O    . ALA A 1 6  ? 14.082 11.560 -4.010  1.00 0.00 ? 23 ALA A O    5  
ATOM   2885  C CB   . ALA A 1 6  ? 14.723 11.586 -0.871  1.00 0.00 ? 23 ALA A CB   5  
ATOM   2886  H H    . ALA A 1 6  ? 13.605 9.451  -1.889  1.00 0.00 ? 23 ALA A H    5  
ATOM   2887  H HA   . ALA A 1 6  ? 12.692 12.172 -1.180  1.00 0.00 ? 23 ALA A HA   5  
ATOM   2888  H HB1  . ALA A 1 6  ? 15.482 10.983 -1.368  1.00 0.00 ? 23 ALA A HB1  5  
ATOM   2889  H HB2  . ALA A 1 6  ? 15.084 12.610 -0.772  1.00 0.00 ? 23 ALA A HB2  5  
ATOM   2890  H HB3  . ALA A 1 6  ? 14.521 11.176 0.117   1.00 0.00 ? 23 ALA A HB3  5  
ATOM   2891  N N    . ILE A 1 7  ? 13.432 13.528 -3.134  1.00 0.00 ? 24 ILE A N    5  
ATOM   2892  C CA   . ILE A 1 7  ? 13.657 14.279 -4.364  1.00 0.00 ? 24 ILE A CA   5  
ATOM   2893  C C    . ILE A 1 7  ? 14.703 15.368 -4.162  1.00 0.00 ? 24 ILE A C    5  
ATOM   2894  O O    . ILE A 1 7  ? 14.447 16.372 -3.500  1.00 0.00 ? 24 ILE A O    5  
ATOM   2895  C CB   . ILE A 1 7  ? 12.356 14.919 -4.882  1.00 0.00 ? 24 ILE A CB   5  
ATOM   2896  C CG1  . ILE A 1 7  ? 11.307 13.841 -5.166  1.00 0.00 ? 24 ILE A CG1  5  
ATOM   2897  C CG2  . ILE A 1 7  ? 12.630 15.742 -6.131  1.00 0.00 ? 24 ILE A CG2  5  
ATOM   2898  C CD1  . ILE A 1 7  ? 9.935  14.392 -5.479  1.00 0.00 ? 24 ILE A CD1  5  
ATOM   2899  H H    . ILE A 1 7  ? 13.077 14.011 -2.322  1.00 0.00 ? 24 ILE A H    5  
ATOM   2900  H HA   . ILE A 1 7  ? 14.076 13.634 -5.136  1.00 0.00 ? 24 ILE A HA   5  
ATOM   2901  H HB   . ILE A 1 7  ? 11.944 15.562 -4.106  1.00 0.00 ? 24 ILE A HB   5  
ATOM   2902  H HG12 . ILE A 1 7  ? 11.665 13.256 -6.013  1.00 0.00 ? 24 ILE A HG12 5  
ATOM   2903  H HG13 . ILE A 1 7  ? 11.251 13.204 -4.284  1.00 0.00 ? 24 ILE A HG13 5  
ATOM   2904  H HG21 . ILE A 1 7  ? 11.700 16.187 -6.484  1.00 0.00 ? 24 ILE A HG21 5  
ATOM   2905  H HG22 . ILE A 1 7  ? 13.344 16.531 -5.897  1.00 0.00 ? 24 ILE A HG22 5  
ATOM   2906  H HG23 . ILE A 1 7  ? 13.043 15.100 -6.909  1.00 0.00 ? 24 ILE A HG23 5  
ATOM   2907  H HD11 . ILE A 1 7  ? 9.989  15.028 -6.361  1.00 0.00 ? 24 ILE A HD11 5  
ATOM   2908  H HD12 . ILE A 1 7  ? 9.246  13.569 -5.668  1.00 0.00 ? 24 ILE A HD12 5  
ATOM   2909  H HD13 . ILE A 1 7  ? 9.575  14.978 -4.631  1.00 0.00 ? 24 ILE A HD13 5  
ATOM   2910  N N    . SER A 1 8  ? 15.884 15.161 -4.736  1.00 0.00 ? 25 SER A N    5  
ATOM   2911  C CA   . SER A 1 8  ? 16.996 16.086 -4.555  1.00 0.00 ? 25 SER A CA   5  
ATOM   2912  C C    . SER A 1 8  ? 17.245 16.903 -5.816  1.00 0.00 ? 25 SER A C    5  
ATOM   2913  O O    . SER A 1 8  ? 18.085 17.803 -5.829  1.00 0.00 ? 25 SER A O    5  
ATOM   2914  C CB   . SER A 1 8  ? 18.248 15.327 -4.162  1.00 0.00 ? 25 SER A CB   5  
ATOM   2915  O OG   . SER A 1 8  ? 18.693 14.479 -5.185  1.00 0.00 ? 25 SER A OG   5  
ATOM   2916  H H    . SER A 1 8  ? 16.014 14.342 -5.313  1.00 0.00 ? 25 SER A H    5  
ATOM   2917  H HA   . SER A 1 8  ? 16.870 16.753 -3.700  1.00 0.00 ? 25 SER A HA   5  
ATOM   2918  H HB2  . SER A 1 8  ? 19.033 16.045 -3.930  1.00 0.00 ? 25 SER A HB2  5  
ATOM   2919  H HB3  . SER A 1 8  ? 18.031 14.730 -3.277  1.00 0.00 ? 25 SER A HB3  5  
ATOM   2920  H HG   . SER A 1 8  ? 18.938 15.005 -5.950  1.00 0.00 ? 25 SER A HG   5  
ATOM   2921  N N    . ASP A 1 9  ? 16.511 16.583 -6.876  1.00 0.00 ? 26 ASP A N    5  
ATOM   2922  C CA   . ASP A 1 9  ? 16.679 17.259 -8.157  1.00 0.00 ? 26 ASP A CA   5  
ATOM   2923  C C    . ASP A 1 9  ? 15.432 17.122 -9.021  1.00 0.00 ? 26 ASP A C    5  
ATOM   2924  O O    . ASP A 1 9  ? 14.587 16.262 -8.775  1.00 0.00 ? 26 ASP A O    5  
ATOM   2925  C CB   . ASP A 1 9  ? 17.897 16.703 -8.900  1.00 0.00 ? 26 ASP A CB   5  
ATOM   2926  C CG   . ASP A 1 9  ? 18.485 17.649 -9.938  1.00 0.00 ? 26 ASP A CG   5  
ATOM   2927  O OD1  . ASP A 1 9  ? 17.979 18.737 -10.077 1.00 0.00 ? 26 ASP A OD1  5  
ATOM   2928  O OD2  . ASP A 1 9  ? 19.526 17.342 -10.470 1.00 0.00 ? 26 ASP A OD2  5  
ATOM   2929  H H    . ASP A 1 9  ? 15.817 15.854 -6.793  1.00 0.00 ? 26 ASP A H    5  
ATOM   2930  H HA   . ASP A 1 9  ? 16.828 18.327 -7.994  1.00 0.00 ? 26 ASP A HA   5  
ATOM   2931  H HB2  . ASP A 1 9  ? 18.688 16.354 -8.238  1.00 0.00 ? 26 ASP A HB2  5  
ATOM   2932  H HB3  . ASP A 1 9  ? 17.441 15.851 -9.404  1.00 0.00 ? 26 ASP A HB3  5  
ATOM   2933  N N    . ALA A 1 10 ? 15.323 17.976 -10.034 1.00 0.00 ? 27 ALA A N    5  
ATOM   2934  C CA   . ALA A 1 10 ? 14.197 17.926 -10.959 1.00 0.00 ? 27 ALA A CA   5  
ATOM   2935  C C    . ALA A 1 10 ? 14.191 16.624 -11.750 1.00 0.00 ? 27 ALA A C    5  
ATOM   2936  O O    . ALA A 1 10 ? 13.149 16.186 -12.235 1.00 0.00 ? 27 ALA A O    5  
ATOM   2937  C CB   . ALA A 1 10 ? 14.233 19.121 -11.900 1.00 0.00 ? 27 ALA A CB   5  
ATOM   2938  H H    . ALA A 1 10 ? 16.038 18.677 -10.165 1.00 0.00 ? 27 ALA A H    5  
ATOM   2939  H HA   . ALA A 1 10 ? 13.271 17.962 -10.386 1.00 0.00 ? 27 ALA A HA   5  
ATOM   2940  H HB1  . ALA A 1 10 ? 15.160 19.109 -12.470 1.00 0.00 ? 27 ALA A HB1  5  
ATOM   2941  H HB2  . ALA A 1 10 ? 13.386 19.070 -12.584 1.00 0.00 ? 27 ALA A HB2  5  
ATOM   2942  H HB3  . ALA A 1 10 ? 14.175 20.043 -11.321 1.00 0.00 ? 27 ALA A HB3  5  
ATOM   2943  N N    . ALA A 1 11 ? 15.363 16.010 -11.877 1.00 0.00 ? 28 ALA A N    5  
ATOM   2944  C CA   . ALA A 1 11 ? 15.474 14.694 -12.494 1.00 0.00 ? 28 ALA A CA   5  
ATOM   2945  C C    . ALA A 1 11 ? 14.699 13.647 -11.702 1.00 0.00 ? 28 ALA A C    5  
ATOM   2946  O O    . ALA A 1 11 ? 14.184 12.683 -12.268 1.00 0.00 ? 28 ALA A O    5  
ATOM   2947  C CB   . ALA A 1 11 ? 16.936 14.290 -12.621 1.00 0.00 ? 28 ALA A CB   5  
ATOM   2948  H H    . ALA A 1 11 ? 16.198 16.467 -11.538 1.00 0.00 ? 28 ALA A H    5  
ATOM   2949  H HA   . ALA A 1 11 ? 15.037 14.736 -13.491 1.00 0.00 ? 28 ALA A HA   5  
ATOM   2950  H HB1  . ALA A 1 11 ? 17.392 14.257 -11.633 1.00 0.00 ? 28 ALA A HB1  5  
ATOM   2951  H HB2  . ALA A 1 11 ? 17.001 13.305 -13.083 1.00 0.00 ? 28 ALA A HB2  5  
ATOM   2952  H HB3  . ALA A 1 11 ? 17.462 15.016 -13.241 1.00 0.00 ? 28 ALA A HB3  5  
ATOM   2953  N N    . GLN A 1 12 ? 14.620 13.844 -10.390 1.00 0.00 ? 29 GLN A N    5  
ATOM   2954  C CA   . GLN A 1 12 ? 13.915 12.913 -9.518  1.00 0.00 ? 29 GLN A CA   5  
ATOM   2955  C C    . GLN A 1 12 ? 12.469 13.344 -9.305  1.00 0.00 ? 29 GLN A C    5  
ATOM   2956  O O    . GLN A 1 12 ? 11.610 12.525 -8.980  1.00 0.00 ? 29 GLN A O    5  
ATOM   2957  C CB   . GLN A 1 12 ? 14.625 12.804 -8.166  1.00 0.00 ? 29 GLN A CB   5  
ATOM   2958  C CG   . GLN A 1 12 ? 16.066 12.328 -8.256  1.00 0.00 ? 29 GLN A CG   5  
ATOM   2959  C CD   . GLN A 1 12 ? 16.754 12.310 -6.904  1.00 0.00 ? 29 GLN A CD   5  
ATOM   2960  O OE1  . GLN A 1 12 ? 16.123 12.528 -5.867  1.00 0.00 ? 29 GLN A OE1  5  
ATOM   2961  N NE2  . GLN A 1 12 ? 18.057 12.051 -6.909  1.00 0.00 ? 29 GLN A NE2  5  
ATOM   2962  H H    . GLN A 1 12 ? 15.059 14.660 -9.988  1.00 0.00 ? 29 GLN A H    5  
ATOM   2963  H HA   . GLN A 1 12 ? 13.880 11.929 -9.986  1.00 0.00 ? 29 GLN A HA   5  
ATOM   2964  H HB2  . GLN A 1 12 ? 14.591 13.794 -7.711  1.00 0.00 ? 29 GLN A HB2  5  
ATOM   2965  H HB3  . GLN A 1 12 ? 14.045 12.107 -7.561  1.00 0.00 ? 29 GLN A HB3  5  
ATOM   2966  H HG2  . GLN A 1 12 ? 16.356 11.426 -8.792  1.00 0.00 ? 29 GLN A HG2  5  
ATOM   2967  H HG3  . GLN A 1 12 ? 16.411 13.204 -8.807  1.00 0.00 ? 29 GLN A HG3  5  
ATOM   2968  H HE21 . GLN A 1 12 ? 18.531 11.881 -7.773  1.00 0.00 ? 29 GLN A HE21 5  
ATOM   2969  H HE22 . GLN A 1 12 ? 18.565 12.026 -6.047  1.00 0.00 ? 29 GLN A HE22 5  
ATOM   2970  N N    . LEU A 1 13 ? 12.208 14.633 -9.492  1.00 0.00 ? 30 LEU A N    5  
ATOM   2971  C CA   . LEU A 1 13 ? 10.846 15.152 -9.451  1.00 0.00 ? 30 LEU A CA   5  
ATOM   2972  C C    . LEU A 1 13 ? 9.978  14.507 -10.524 1.00 0.00 ? 30 LEU A C    5  
ATOM   2973  O O    . LEU A 1 13 ? 10.257 14.626 -11.717 1.00 0.00 ? 30 LEU A O    5  
ATOM   2974  C CB   . LEU A 1 13 ? 10.855 16.677 -9.617  1.00 0.00 ? 30 LEU A CB   5  
ATOM   2975  C CG   . LEU A 1 13 ? 9.507  17.368 -9.375  1.00 0.00 ? 30 LEU A CG   5  
ATOM   2976  C CD1  . LEU A 1 13 ? 9.139  17.291 -7.899  1.00 0.00 ? 30 LEU A CD1  5  
ATOM   2977  C CD2  . LEU A 1 13 ? 9.587  18.814 -9.837  1.00 0.00 ? 30 LEU A CD2  5  
ATOM   2978  H H    . LEU A 1 13 ? 12.972 15.269 -9.667  1.00 0.00 ? 30 LEU A H    5  
ATOM   2979  H HA   . LEU A 1 13 ? 10.390 14.903 -8.493  1.00 0.00 ? 30 LEU A HA   5  
ATOM   2980  H HB2  . LEU A 1 13 ? 11.555 16.936 -8.824  1.00 0.00 ? 30 LEU A HB2  5  
ATOM   2981  H HB3  . LEU A 1 13 ? 11.269 16.975 -10.579 1.00 0.00 ? 30 LEU A HB3  5  
ATOM   2982  H HG   . LEU A 1 13 ? 8.768  16.860 -9.995  1.00 0.00 ? 30 LEU A HG   5  
ATOM   2983  H HD11 . LEU A 1 13 ? 8.180  17.785 -7.738  1.00 0.00 ? 30 LEU A HD11 5  
ATOM   2984  H HD12 . LEU A 1 13 ? 9.064  16.247 -7.596  1.00 0.00 ? 30 LEU A HD12 5  
ATOM   2985  H HD13 . LEU A 1 13 ? 9.906  17.789 -7.307  1.00 0.00 ? 30 LEU A HD13 5  
ATOM   2986  H HD21 . LEU A 1 13 ? 9.823  18.845 -10.900 1.00 0.00 ? 30 LEU A HD21 5  
ATOM   2987  H HD22 . LEU A 1 13 ? 8.627  19.304 -9.665  1.00 0.00 ? 30 LEU A HD22 5  
ATOM   2988  H HD23 . LEU A 1 13 ? 10.365 19.333 -9.277  1.00 0.00 ? 30 LEU A HD23 5  
ATOM   2989  N N    . PRO A 1 14 ? 8.923  13.824 -10.092 1.00 0.00 ? 31 PRO A N    5  
ATOM   2990  C CA   . PRO A 1 14 ? 7.983  13.202 -11.017 1.00 0.00 ? 31 PRO A CA   5  
ATOM   2991  C C    . PRO A 1 14 ? 7.319  14.241 -11.911 1.00 0.00 ? 31 PRO A C    5  
ATOM   2992  O O    . PRO A 1 14 ? 7.408  15.442 -11.654 1.00 0.00 ? 31 PRO A O    5  
ATOM   2993  C CB   . PRO A 1 14 ? 6.973  12.497 -10.105 1.00 0.00 ? 31 PRO A CB   5  
ATOM   2994  C CG   . PRO A 1 14 ? 7.688  12.343 -8.807  1.00 0.00 ? 31 PRO A CG   5  
ATOM   2995  C CD   . PRO A 1 14 ? 8.566  13.562 -8.688  1.00 0.00 ? 31 PRO A CD   5  
ATOM   2996  H HA   . PRO A 1 14 ? 8.470  12.500 -11.710 1.00 0.00 ? 31 PRO A HA   5  
ATOM   2997  H HB2  . PRO A 1 14 ? 6.055  13.090 -9.987  1.00 0.00 ? 31 PRO A HB2  5  
ATOM   2998  H HB3  . PRO A 1 14 ? 6.676  11.519 -10.514 1.00 0.00 ? 31 PRO A HB3  5  
ATOM   2999  H HG2  . PRO A 1 14 ? 6.980  12.284 -7.968  1.00 0.00 ? 31 PRO A HG2  5  
ATOM   3000  H HG3  . PRO A 1 14 ? 8.287  11.421 -8.789  1.00 0.00 ? 31 PRO A HG3  5  
ATOM   3001  H HD2  . PRO A 1 14 ? 8.036  14.414 -8.237  1.00 0.00 ? 31 PRO A HD2  5  
ATOM   3002  H HD3  . PRO A 1 14 ? 9.457  13.374 -8.071  1.00 0.00 ? 31 PRO A HD3  5  
ATOM   3003  N N    . HIS A 1 15 ? 6.655  13.773 -12.962 1.00 0.00 ? 32 HIS A N    5  
ATOM   3004  C CA   . HIS A 1 15 ? 5.959  14.661 -13.886 1.00 0.00 ? 32 HIS A CA   5  
ATOM   3005  C C    . HIS A 1 15 ? 4.448  14.543 -13.728 1.00 0.00 ? 32 HIS A C    5  
ATOM   3006  O O    . HIS A 1 15 ? 3.688  15.202 -14.439 1.00 0.00 ? 32 HIS A O    5  
ATOM   3007  C CB   . HIS A 1 15 ? 6.359  14.358 -15.332 1.00 0.00 ? 32 HIS A CB   5  
ATOM   3008  C CG   . HIS A 1 15 ? 7.769  14.745 -15.659 1.00 0.00 ? 32 HIS A CG   5  
ATOM   3009  N ND1  . HIS A 1 15 ? 8.348  14.480 -16.882 1.00 0.00 ? 32 HIS A ND1  5  
ATOM   3010  C CD2  . HIS A 1 15 ? 8.714  15.375 -14.923 1.00 0.00 ? 32 HIS A CD2  5  
ATOM   3011  C CE1  . HIS A 1 15 ? 9.591  14.931 -16.885 1.00 0.00 ? 32 HIS A CE1  5  
ATOM   3012  N NE2  . HIS A 1 15 ? 9.836  15.478 -15.708 1.00 0.00 ? 32 HIS A NE2  5  
ATOM   3013  H H    . HIS A 1 15 ? 6.632  12.777 -13.125 1.00 0.00 ? 32 HIS A H    5  
ATOM   3014  H HA   . HIS A 1 15 ? 6.213  15.696 -13.661 1.00 0.00 ? 32 HIS A HA   5  
ATOM   3015  H HB2  . HIS A 1 15 ? 6.276  13.290 -15.531 1.00 0.00 ? 32 HIS A HB2  5  
ATOM   3016  H HB3  . HIS A 1 15 ? 5.718  14.906 -16.022 1.00 0.00 ? 32 HIS A HB3  5  
ATOM   3017  H HD2  . HIS A 1 15 ? 8.720  15.771 -13.907 1.00 0.00 ? 32 HIS A HD2  5  
ATOM   3018  H HE1  . HIS A 1 15 ? 10.220 14.819 -17.767 1.00 0.00 ? 32 HIS A HE1  5  
ATOM   3019  H HE2  . HIS A 1 15 ? 10.706 15.905 -15.423 1.00 0.00 ? 32 HIS A HE2  5  
ATOM   3020  N N    . ASP A 1 16 ? 4.018  13.701 -12.795 1.00 0.00 ? 33 ASP A N    5  
ATOM   3021  C CA   . ASP A 1 16 ? 2.598  13.450 -12.584 1.00 0.00 ? 33 ASP A CA   5  
ATOM   3022  C C    . ASP A 1 16 ? 2.271  13.350 -11.099 1.00 0.00 ? 33 ASP A C    5  
ATOM   3023  O O    . ASP A 1 16 ? 1.261  12.762 -10.714 1.00 0.00 ? 33 ASP A O    5  
ATOM   3024  C CB   . ASP A 1 16 ? 2.166  12.171 -13.304 1.00 0.00 ? 33 ASP A CB   5  
ATOM   3025  C CG   . ASP A 1 16 ? 2.844  10.905 -12.800 1.00 0.00 ? 33 ASP A CG   5  
ATOM   3026  O OD1  . ASP A 1 16 ? 3.617  10.996 -11.874 1.00 0.00 ? 33 ASP A OD1  5  
ATOM   3027  O OD2  . ASP A 1 16 ? 2.471  9.842  -13.234 1.00 0.00 ? 33 ASP A OD2  5  
ATOM   3028  H H    . ASP A 1 16 ? 4.694  13.221 -12.217 1.00 0.00 ? 33 ASP A H    5  
ATOM   3029  H HA   . ASP A 1 16 ? 2.014  14.284 -12.974 1.00 0.00 ? 33 ASP A HA   5  
ATOM   3030  H HB2  . ASP A 1 16 ? 1.085  12.023 -13.316 1.00 0.00 ? 33 ASP A HB2  5  
ATOM   3031  H HB3  . ASP A 1 16 ? 2.515  12.393 -14.313 1.00 0.00 ? 33 ASP A HB3  5  
ATOM   3032  N N    . TYR A 1 17 ? 3.132  13.929 -10.269 1.00 0.00 ? 34 TYR A N    5  
ATOM   3033  C CA   . TYR A 1 17 ? 2.934  13.910 -8.824  1.00 0.00 ? 34 TYR A CA   5  
ATOM   3034  C C    . TYR A 1 17 ? 1.813  14.853 -8.409  1.00 0.00 ? 34 TYR A C    5  
ATOM   3035  O O    . TYR A 1 17 ? 1.449  15.765 -9.152  1.00 0.00 ? 34 TYR A O    5  
ATOM   3036  C CB   . TYR A 1 17 ? 4.231  14.285 -8.102  1.00 0.00 ? 34 TYR A CB   5  
ATOM   3037  C CG   . TYR A 1 17 ? 4.616  15.739 -8.250  1.00 0.00 ? 34 TYR A CG   5  
ATOM   3038  C CD1  . TYR A 1 17 ? 4.022  16.718 -7.466  1.00 0.00 ? 34 TYR A CD1  5  
ATOM   3039  C CD2  . TYR A 1 17 ? 5.575  16.130 -9.173  1.00 0.00 ? 34 TYR A CD2  5  
ATOM   3040  C CE1  . TYR A 1 17 ? 4.371  18.048 -7.599  1.00 0.00 ? 34 TYR A CE1  5  
ATOM   3041  C CE2  . TYR A 1 17 ? 5.932  17.456 -9.313  1.00 0.00 ? 34 TYR A CE2  5  
ATOM   3042  C CZ   . TYR A 1 17 ? 5.327  18.414 -8.523  1.00 0.00 ? 34 TYR A CZ   5  
ATOM   3043  O OH   . TYR A 1 17 ? 5.680  19.737 -8.658  1.00 0.00 ? 34 TYR A OH   5  
ATOM   3044  H H    . TYR A 1 17 ? 3.944  14.395 -10.648 1.00 0.00 ? 34 TYR A H    5  
ATOM   3045  H HA   . TYR A 1 17 ? 2.634  12.912 -8.506  1.00 0.00 ? 34 TYR A HA   5  
ATOM   3046  H HB2  . TYR A 1 17 ? 4.090  14.052 -7.045  1.00 0.00 ? 34 TYR A HB2  5  
ATOM   3047  H HB3  . TYR A 1 17 ? 5.021  13.656 -8.511  1.00 0.00 ? 34 TYR A HB3  5  
ATOM   3048  H HD1  . TYR A 1 17 ? 3.267  16.422 -6.738  1.00 0.00 ? 34 TYR A HD1  5  
ATOM   3049  H HD2  . TYR A 1 17 ? 6.049  15.369 -9.793  1.00 0.00 ? 34 TYR A HD2  5  
ATOM   3050  H HE1  . TYR A 1 17 ? 3.895  18.806 -6.976  1.00 0.00 ? 34 TYR A HE1  5  
ATOM   3051  H HE2  . TYR A 1 17 ? 6.688  17.743 -10.045 1.00 0.00 ? 34 TYR A HE2  5  
ATOM   3052  H HH   . TYR A 1 17 ? 5.199  20.316 -8.062  1.00 0.00 ? 34 TYR A HH   5  
ATOM   3053  N N    . CYS A 1 18 ? 1.268  14.629 -7.219  1.00 0.00 ? 35 CYS A N    5  
ATOM   3054  C CA   . CYS A 1 18 ? 0.347  15.578 -6.606  1.00 0.00 ? 35 CYS A CA   5  
ATOM   3055  C C    . CYS A 1 18 ? 0.876  16.073 -5.267  1.00 0.00 ? 35 CYS A C    5  
ATOM   3056  O O    . CYS A 1 18 ? 1.789  15.481 -4.691  1.00 0.00 ? 35 CYS A O    5  
ATOM   3057  C CB   . CYS A 1 18 ? -0.918 14.742 -6.409  1.00 0.00 ? 35 CYS A CB   5  
ATOM   3058  S SG   . CYS A 1 18 ? -1.622 14.077 -7.938  1.00 0.00 ? 35 CYS A SG   5  
ATOM   3059  H H    . CYS A 1 18 ? 1.499  13.778 -6.724  1.00 0.00 ? 35 CYS A H    5  
ATOM   3060  H HA   . CYS A 1 18 ? 0.109  16.426 -7.248  1.00 0.00 ? 35 CYS A HA   5  
ATOM   3061  H HB2  . CYS A 1 18 ? -0.707 13.882 -5.775  1.00 0.00 ? 35 CYS A HB2  5  
ATOM   3062  H HB3  . CYS A 1 18 ? -1.702 15.347 -5.955  1.00 0.00 ? 35 CYS A HB3  5  
ATOM   3063  H HG   . CYS A 1 18 ? -2.643 13.453 -7.360  1.00 0.00 ? 35 CYS A HG   5  
ATOM   3064  N N    . THR A 1 19 ? 0.297  17.163 -4.774  1.00 0.00 ? 36 THR A N    5  
ATOM   3065  C CA   . THR A 1 19 ? 0.750  17.776 -3.530  1.00 0.00 ? 36 THR A CA   5  
ATOM   3066  C C    . THR A 1 19 ? -0.427 18.141 -2.635  1.00 0.00 ? 36 THR A C    5  
ATOM   3067  O O    . THR A 1 19 ? -1.416 18.711 -3.096  1.00 0.00 ? 36 THR A O    5  
ATOM   3068  C CB   . THR A 1 19 ? 1.591  19.038 -3.796  1.00 0.00 ? 36 THR A CB   5  
ATOM   3069  O OG1  . THR A 1 19 ? 2.711  18.704 -4.626  1.00 0.00 ? 36 THR A OG1  5  
ATOM   3070  C CG2  . THR A 1 19 ? 2.093  19.629 -2.487  1.00 0.00 ? 36 THR A CG2  5  
ATOM   3071  H H    . THR A 1 19 ? -0.476 17.578 -5.273  1.00 0.00 ? 36 THR A H    5  
ATOM   3072  H HA   . THR A 1 19 ? 1.355  17.064 -2.968  1.00 0.00 ? 36 THR A HA   5  
ATOM   3073  H HB   . THR A 1 19 ? 0.974  19.772 -4.312  1.00 0.00 ? 36 THR A HB   5  
ATOM   3074  H HG1  . THR A 1 19 ? 3.233  19.493 -4.790  1.00 0.00 ? 36 THR A HG1  5  
ATOM   3075  H HG21 . THR A 1 19 ? 2.711  18.895 -1.971  1.00 0.00 ? 36 THR A HG21 5  
ATOM   3076  H HG22 . THR A 1 19 ? 2.684  20.520 -2.696  1.00 0.00 ? 36 THR A HG22 5  
ATOM   3077  H HG23 . THR A 1 19 ? 1.243  19.895 -1.859  1.00 0.00 ? 36 THR A HG23 5  
HETATM 3078  N N    . TPO A 1 20 ? -0.315 17.809 -1.353  1.00 0.00 ? 37 TPO A N    5  
HETATM 3079  C CA   . TPO A 1 20 ? -1.358 18.126 -0.385  1.00 0.00 ? 37 TPO A CA   5  
HETATM 3080  C CB   . TPO A 1 20 ? -1.359 17.132 0.791   1.00 0.00 ? 37 TPO A CB   5  
HETATM 3081  C CG2  . TPO A 1 20 ? -1.361 15.700 0.279   1.00 0.00 ? 37 TPO A CG2  5  
HETATM 3082  O OG1  . TPO A 1 20 ? -0.196 17.346 1.601   1.00 0.00 ? 37 TPO A OG1  5  
HETATM 3083  P P    . TPO A 1 20 ? -0.170 16.870 3.141   1.00 0.00 ? 37 TPO A P    5  
HETATM 3084  O O1P  . TPO A 1 20 ? 1.219  17.247 3.718   1.00 0.00 ? 37 TPO A O1P  5  
HETATM 3085  O O2P  . TPO A 1 20 ? -0.394 15.335 3.153   1.00 0.00 ? 37 TPO A O2P  5  
HETATM 3086  O O3P  . TPO A 1 20 ? -1.314 17.617 3.874   1.00 0.00 ? 37 TPO A O3P  5  
HETATM 3087  C C    . TPO A 1 20 ? -1.194 19.540 0.157   1.00 0.00 ? 37 TPO A C    5  
HETATM 3088  O O    . TPO A 1 20 ? -0.133 20.149 0.018   1.00 0.00 ? 37 TPO A O    5  
HETATM 3089  H H    . TPO A 1 20 ? 0.515  17.324 -1.042  1.00 0.00 ? 37 TPO A H    5  
HETATM 3090  H HA   . TPO A 1 20 ? -2.334 18.093 -0.871  1.00 0.00 ? 37 TPO A HA   5  
HETATM 3091  H HB   . TPO A 1 20 ? -2.248 17.302 1.397   1.00 0.00 ? 37 TPO A HB   5  
HETATM 3092  H HG21 . TPO A 1 20 ? -1.362 15.013 1.125   1.00 0.00 ? 37 TPO A HG21 5  
HETATM 3093  H HG22 . TPO A 1 20 ? -2.251 15.532 -0.328  1.00 0.00 ? 37 TPO A HG22 5  
HETATM 3094  H HG23 . TPO A 1 20 ? -0.471 15.530 -0.326  1.00 0.00 ? 37 TPO A HG23 5  
ATOM   3095  N N    . PRO A 1 21 ? -2.250 20.057 0.776   1.00 0.00 ? 38 PRO A N    5  
ATOM   3096  C CA   . PRO A 1 21 ? -2.237 21.415 1.308   1.00 0.00 ? 38 PRO A CA   5  
ATOM   3097  C C    . PRO A 1 21 ? -1.070 21.622 2.263   1.00 0.00 ? 38 PRO A C    5  
ATOM   3098  O O    . PRO A 1 21 ? -0.539 22.726 2.382   1.00 0.00 ? 38 PRO A O    5  
ATOM   3099  C CB   . PRO A 1 21 ? -3.590 21.553 2.014   1.00 0.00 ? 38 PRO A CB   5  
ATOM   3100  C CG   . PRO A 1 21 ? -4.485 20.604 1.290   1.00 0.00 ? 38 PRO A CG   5  
ATOM   3101  C CD   . PRO A 1 21 ? -3.613 19.432 0.926   1.00 0.00 ? 38 PRO A CD   5  
ATOM   3102  H HA   . PRO A 1 21 ? -2.103 22.176 0.526   1.00 0.00 ? 38 PRO A HA   5  
ATOM   3103  H HB2  . PRO A 1 21 ? -3.516 21.297 3.080   1.00 0.00 ? 38 PRO A HB2  5  
ATOM   3104  H HB3  . PRO A 1 21 ? -3.972 22.583 1.955   1.00 0.00 ? 38 PRO A HB3  5  
ATOM   3105  H HG2  . PRO A 1 21 ? -5.326 20.289 1.925   1.00 0.00 ? 38 PRO A HG2  5  
ATOM   3106  H HG3  . PRO A 1 21 ? -4.916 21.070 0.392   1.00 0.00 ? 38 PRO A HG3  5  
ATOM   3107  H HD2  . PRO A 1 21 ? -3.610 18.657 1.707   1.00 0.00 ? 38 PRO A HD2  5  
ATOM   3108  H HD3  . PRO A 1 21 ? -3.935 18.947 -0.006  1.00 0.00 ? 38 PRO A HD3  5  
ATOM   3109  N N    . GLY A 1 22 ? -0.672 20.552 2.943   1.00 0.00 ? 39 GLY A N    5  
ATOM   3110  C CA   . GLY A 1 22 ? 0.442  20.612 3.884   1.00 0.00 ? 39 GLY A CA   5  
ATOM   3111  C C    . GLY A 1 22 ? 1.762  20.845 3.161   1.00 0.00 ? 39 GLY A C    5  
ATOM   3112  O O    . GLY A 1 22 ? 2.693  21.424 3.720   1.00 0.00 ? 39 GLY A O    5  
ATOM   3113  H H    . GLY A 1 22 ? -1.153 19.675 2.806   1.00 0.00 ? 39 GLY A H    5  
ATOM   3114  H HA2  . GLY A 1 22 ? 0.271  21.429 4.585   1.00 0.00 ? 39 GLY A HA2  5  
ATOM   3115  H HA3  . GLY A 1 22 ? 0.497  19.672 4.431   1.00 0.00 ? 39 GLY A HA3  5  
ATOM   3116  N N    . GLY A 1 23 ? 1.836  20.391 1.914   1.00 0.00 ? 40 GLY A N    5  
ATOM   3117  C CA   . GLY A 1 23 ? 3.012  20.623 1.083   1.00 0.00 ? 40 GLY A CA   5  
ATOM   3118  C C    . GLY A 1 23 ? 3.840  19.353 0.934   1.00 0.00 ? 40 GLY A C    5  
ATOM   3119  O O    . GLY A 1 23 ? 5.062  19.410 0.804   1.00 0.00 ? 40 GLY A O    5  
ATOM   3120  H H    . GLY A 1 23 ? 1.058  19.871 1.533   1.00 0.00 ? 40 GLY A H    5  
ATOM   3121  H HA2  . GLY A 1 23 ? 2.689  20.955 0.096   1.00 0.00 ? 40 GLY A HA2  5  
ATOM   3122  H HA3  . GLY A 1 23 ? 3.626  21.396 1.544   1.00 0.00 ? 40 GLY A HA3  5  
ATOM   3123  N N    . THR A 1 24 ? 3.166  18.208 0.954   1.00 0.00 ? 41 THR A N    5  
ATOM   3124  C CA   . THR A 1 24 ? 3.833  16.924 0.771   1.00 0.00 ? 41 THR A CA   5  
ATOM   3125  C C    . THR A 1 24 ? 3.472  16.302 -0.572  1.00 0.00 ? 41 THR A C    5  
ATOM   3126  O O    . THR A 1 24 ? 2.296  16.215 -0.931  1.00 0.00 ? 41 THR A O    5  
ATOM   3127  C CB   . THR A 1 24 ? 3.474  15.936 1.896   1.00 0.00 ? 41 THR A CB   5  
ATOM   3128  O OG1  . THR A 1 24 ? 3.886  16.475 3.159   1.00 0.00 ? 41 THR A OG1  5  
ATOM   3129  C CG2  . THR A 1 24 ? 4.163  14.599 1.671   1.00 0.00 ? 41 THR A CG2  5  
ATOM   3130  H H    . THR A 1 24 ? 2.167  18.227 1.099   1.00 0.00 ? 41 THR A H    5  
ATOM   3131  H HA   . THR A 1 24 ? 4.914  17.068 0.763   1.00 0.00 ? 41 THR A HA   5  
ATOM   3132  H HB   . THR A 1 24 ? 2.394  15.789 1.908   1.00 0.00 ? 41 THR A HB   5  
ATOM   3133  H HG1  . THR A 1 24 ? 3.166  16.983 3.539   1.00 0.00 ? 41 THR A HG1  5  
ATOM   3134  H HG21 . THR A 1 24 ? 5.242  14.744 1.658   1.00 0.00 ? 41 THR A HG21 5  
ATOM   3135  H HG22 . THR A 1 24 ? 3.897  13.914 2.476   1.00 0.00 ? 41 THR A HG22 5  
ATOM   3136  H HG23 . THR A 1 24 ? 3.842  14.181 0.716   1.00 0.00 ? 41 THR A HG23 5  
ATOM   3137  N N    . LEU A 1 25 ? 4.487  15.870 -1.311  1.00 0.00 ? 42 LEU A N    5  
ATOM   3138  C CA   . LEU A 1 25 ? 4.280  15.276 -2.626  1.00 0.00 ? 42 LEU A CA   5  
ATOM   3139  C C    . LEU A 1 25 ? 3.931  13.798 -2.514  1.00 0.00 ? 42 LEU A C    5  
ATOM   3140  O O    . LEU A 1 25 ? 4.414  13.102 -1.622  1.00 0.00 ? 42 LEU A O    5  
ATOM   3141  C CB   . LEU A 1 25 ? 5.529  15.467 -3.496  1.00 0.00 ? 42 LEU A CB   5  
ATOM   3142  C CG   . LEU A 1 25 ? 5.615  16.810 -4.231  1.00 0.00 ? 42 LEU A CG   5  
ATOM   3143  C CD1  . LEU A 1 25 ? 5.808  17.941 -3.229  1.00 0.00 ? 42 LEU A CD1  5  
ATOM   3144  C CD2  . LEU A 1 25 ? 6.764  16.772 -5.228  1.00 0.00 ? 42 LEU A CD2  5  
ATOM   3145  H H    . LEU A 1 25 ? 5.428  15.956 -0.953  1.00 0.00 ? 42 LEU A H    5  
ATOM   3146  H HA   . LEU A 1 25 ? 3.433  15.758 -3.115  1.00 0.00 ? 42 LEU A HA   5  
ATOM   3147  H HB2  . LEU A 1 25 ? 6.294  15.413 -2.722  1.00 0.00 ? 42 LEU A HB2  5  
ATOM   3148  H HB3  . LEU A 1 25 ? 5.663  14.641 -4.196  1.00 0.00 ? 42 LEU A HB3  5  
ATOM   3149  H HG   . LEU A 1 25 ? 4.689  16.932 -4.793  1.00 0.00 ? 42 LEU A HG   5  
ATOM   3150  H HD11 . LEU A 1 25 ? 5.868  18.892 -3.759  1.00 0.00 ? 42 LEU A HD11 5  
ATOM   3151  H HD12 . LEU A 1 25 ? 4.963  17.964 -2.539  1.00 0.00 ? 42 LEU A HD12 5  
ATOM   3152  H HD13 . LEU A 1 25 ? 6.729  17.779 -2.670  1.00 0.00 ? 42 LEU A HD13 5  
ATOM   3153  H HD21 . LEU A 1 25 ? 6.592  15.975 -5.950  1.00 0.00 ? 42 LEU A HD21 5  
ATOM   3154  H HD22 . LEU A 1 25 ? 6.824  17.729 -5.749  1.00 0.00 ? 42 LEU A HD22 5  
ATOM   3155  H HD23 . LEU A 1 25 ? 7.700  16.587 -4.699  1.00 0.00 ? 42 LEU A HD23 5  
ATOM   3156  N N    . PHE A 1 26 ? 3.090  13.323 -3.426  1.00 0.00 ? 43 PHE A N    5  
ATOM   3157  C CA   . PHE A 1 26 ? 2.737  11.910 -3.480  1.00 0.00 ? 43 PHE A CA   5  
ATOM   3158  C C    . PHE A 1 26 ? 2.287  11.507 -4.879  1.00 0.00 ? 43 PHE A C    5  
ATOM   3159  O O    . PHE A 1 26 ? 1.794  12.335 -5.646  1.00 0.00 ? 43 PHE A O    5  
ATOM   3160  C CB   . PHE A 1 26 ? 1.637  11.595 -2.463  1.00 0.00 ? 43 PHE A CB   5  
ATOM   3161  C CG   . PHE A 1 26 ? 0.315  12.232 -2.785  1.00 0.00 ? 43 PHE A CG   5  
ATOM   3162  C CD1  . PHE A 1 26 ? 0.059  13.548 -2.432  1.00 0.00 ? 43 PHE A CD1  5  
ATOM   3163  C CD2  . PHE A 1 26 ? -0.675 11.515 -3.440  1.00 0.00 ? 43 PHE A CD2  5  
ATOM   3164  C CE1  . PHE A 1 26 ? -1.157 14.135 -2.725  1.00 0.00 ? 43 PHE A CE1  5  
ATOM   3165  C CE2  . PHE A 1 26 ? -1.892 12.101 -3.735  1.00 0.00 ? 43 PHE A CE2  5  
ATOM   3166  C CZ   . PHE A 1 26 ? -2.133 13.410 -3.378  1.00 0.00 ? 43 PHE A CZ   5  
ATOM   3167  H H    . PHE A 1 26 ? 2.685  13.958 -4.100  1.00 0.00 ? 43 PHE A H    5  
ATOM   3168  H HA   . PHE A 1 26 ? 3.610  11.300 -3.248  1.00 0.00 ? 43 PHE A HA   5  
ATOM   3169  H HB2  . PHE A 1 26 ? 1.463  10.521 -2.420  1.00 0.00 ? 43 PHE A HB2  5  
ATOM   3170  H HB3  . PHE A 1 26 ? 1.926  11.955 -1.477  1.00 0.00 ? 43 PHE A HB3  5  
ATOM   3171  H HD1  . PHE A 1 26 ? 0.830  14.121 -1.916  1.00 0.00 ? 43 PHE A HD1  5  
ATOM   3172  H HD2  . PHE A 1 26 ? -0.485 10.480 -3.723  1.00 0.00 ? 43 PHE A HD2  5  
ATOM   3173  H HE1  . PHE A 1 26 ? -1.346 15.170 -2.441  1.00 0.00 ? 43 PHE A HE1  5  
ATOM   3174  H HE2  . PHE A 1 26 ? -2.662 11.526 -4.251  1.00 0.00 ? 43 PHE A HE2  5  
ATOM   3175  H HZ   . PHE A 1 26 ? -3.091 13.872 -3.611  1.00 0.00 ? 43 PHE A HZ   5  
ATOM   3176  N N    . SER A 1 27 ? 2.461  10.231 -5.206  1.00 0.00 ? 44 SER A N    5  
ATOM   3177  C CA   . SER A 1 27 ? 1.952  9.685  -6.459  1.00 0.00 ? 44 SER A CA   5  
ATOM   3178  C C    . SER A 1 27 ? 1.727  8.183  -6.354  1.00 0.00 ? 44 SER A C    5  
ATOM   3179  O O    . SER A 1 27 ? 2.470  7.480  -5.670  1.00 0.00 ? 44 SER A O    5  
ATOM   3180  C CB   . SER A 1 27 ? 2.911  9.997  -7.592  1.00 0.00 ? 44 SER A CB   5  
ATOM   3181  O OG   . SER A 1 27 ? 2.417  9.570  -8.832  1.00 0.00 ? 44 SER A OG   5  
ATOM   3182  H H    . SER A 1 27 ? 2.959  9.624  -4.572  1.00 0.00 ? 44 SER A H    5  
ATOM   3183  H HA   . SER A 1 27 ? 1.041  10.174 -6.806  1.00 0.00 ? 44 SER A HA   5  
ATOM   3184  H HB2  . SER A 1 27 ? 3.070  11.074 -7.626  1.00 0.00 ? 44 SER A HB2  5  
ATOM   3185  H HB3  . SER A 1 27 ? 3.858  9.497  -7.396  1.00 0.00 ? 44 SER A HB3  5  
ATOM   3186  H HG   . SER A 1 27 ? 2.866  10.045 -9.535  1.00 0.00 ? 44 SER A HG   5  
ATOM   3187  N N    . THR A 1 28 ? 0.695  7.695  -7.035  1.00 0.00 ? 45 THR A N    5  
ATOM   3188  C CA   . THR A 1 28 ? 0.373  6.274  -7.026  1.00 0.00 ? 45 THR A CA   5  
ATOM   3189  C C    . THR A 1 28 ? 0.542  5.661  -8.410  1.00 0.00 ? 45 THR A C    5  
ATOM   3190  O O    . THR A 1 28 ? 0.002  6.167  -9.393  1.00 0.00 ? 45 THR A O    5  
ATOM   3191  C CB   . THR A 1 28 ? -1.066 6.023  -6.538  1.00 0.00 ? 45 THR A CB   5  
ATOM   3192  O OG1  . THR A 1 28 ? -1.222 6.550  -5.214  1.00 0.00 ? 45 THR A OG1  5  
ATOM   3193  C CG2  . THR A 1 28 ? -1.372 4.533  -6.525  1.00 0.00 ? 45 THR A CG2  5  
ATOM   3194  H H    . THR A 1 28 ? 0.119  8.326  -7.574  1.00 0.00 ? 45 THR A H    5  
ATOM   3195  H HA   . THR A 1 28 ? 1.062  5.744  -6.368  1.00 0.00 ? 45 THR A HA   5  
ATOM   3196  H HB   . THR A 1 28 ? -1.761 6.531  -7.205  1.00 0.00 ? 45 THR A HB   5  
ATOM   3197  H HG1  . THR A 1 28 ? -1.033 7.491  -5.220  1.00 0.00 ? 45 THR A HG1  5  
ATOM   3198  H HG21 . THR A 1 28 ? -0.679 4.025  -5.856  1.00 0.00 ? 45 THR A HG21 5  
ATOM   3199  H HG22 . THR A 1 28 ? -2.394 4.376  -6.177  1.00 0.00 ? 45 THR A HG22 5  
ATOM   3200  H HG23 . THR A 1 28 ? -1.265 4.132  -7.532  1.00 0.00 ? 45 THR A HG23 5  
HETATM 3201  N N    . TPO A 1 29 ? 1.295  4.569  -8.480  1.00 0.00 ? 46 TPO A N    5  
HETATM 3202  C CA   . TPO A 1 29 ? 1.604  3.931  -9.755  1.00 0.00 ? 46 TPO A CA   5  
HETATM 3203  C CB   . TPO A 1 29 ? 2.974  3.228  -9.719  1.00 0.00 ? 46 TPO A CB   5  
HETATM 3204  C CG2  . TPO A 1 29 ? 4.033  4.157  -9.144  1.00 0.00 ? 46 TPO A CG2  5  
HETATM 3205  O OG1  . TPO A 1 29 ? 2.888  2.049  -8.909  1.00 0.00 ? 46 TPO A OG1  5  
HETATM 3206  P P    . TPO A 1 29 ? 3.908  0.821  -9.138  1.00 0.00 ? 46 TPO A P    5  
HETATM 3207  O O1P  . TPO A 1 29 ? 3.542  -0.280 -8.108  1.00 0.00 ? 46 TPO A O1P  5  
HETATM 3208  O O2P  . TPO A 1 29 ? 5.342  1.365  -8.906  1.00 0.00 ? 46 TPO A O2P  5  
HETATM 3209  O O3P  . TPO A 1 29 ? 3.715  0.326  -10.595 1.00 0.00 ? 46 TPO A O3P  5  
HETATM 3210  C C    . TPO A 1 29 ? 0.535  2.917  -10.137 1.00 0.00 ? 46 TPO A C    5  
HETATM 3211  O O    . TPO A 1 29 ? -0.273 2.507  -9.302  1.00 0.00 ? 46 TPO A O    5  
HETATM 3212  H H    . TPO A 1 29 ? 1.663  4.169  -7.629  1.00 0.00 ? 46 TPO A H    5  
HETATM 3213  H HA   . TPO A 1 29 ? 1.616  4.679  -10.548 1.00 0.00 ? 46 TPO A HA   5  
HETATM 3214  H HB   . TPO A 1 29 ? 3.253  2.943  -10.733 1.00 0.00 ? 46 TPO A HB   5  
HETATM 3215  H HG21 . TPO A 1 29 ? 4.995  3.642  -9.127  1.00 0.00 ? 46 TPO A HG21 5  
HETATM 3216  H HG22 . TPO A 1 29 ? 4.110  5.049  -9.765  1.00 0.00 ? 46 TPO A HG22 5  
HETATM 3217  H HG23 . TPO A 1 29 ? 3.756  4.441  -8.130  1.00 0.00 ? 46 TPO A HG23 5  
ATOM   3218  N N    . PRO A 1 30 ? 0.533  2.513  -11.403 1.00 0.00 ? 47 PRO A N    5  
ATOM   3219  C CA   . PRO A 1 30 ? -0.493 1.617  -11.921 1.00 0.00 ? 47 PRO A CA   5  
ATOM   3220  C C    . PRO A 1 30 ? -0.549 0.323  -11.120 1.00 0.00 ? 47 PRO A C    5  
ATOM   3221  O O    . PRO A 1 30 ? -1.603 -0.303 -11.006 1.00 0.00 ? 47 PRO A O    5  
ATOM   3222  C CB   . PRO A 1 30 ? -0.081 1.377  -13.377 1.00 0.00 ? 47 PRO A CB   5  
ATOM   3223  C CG   . PRO A 1 30 ? 0.676  2.604  -13.756 1.00 0.00 ? 47 PRO A CG   5  
ATOM   3224  C CD   . PRO A 1 30 ? 1.422  3.012  -12.514 1.00 0.00 ? 47 PRO A CD   5  
ATOM   3225  H HA   . PRO A 1 30 ? -1.505 2.041  -11.847 1.00 0.00 ? 47 PRO A HA   5  
ATOM   3226  H HB2  . PRO A 1 30 ? 0.545  0.477  -13.475 1.00 0.00 ? 47 PRO A HB2  5  
ATOM   3227  H HB3  . PRO A 1 30 ? -0.957 1.233  -14.026 1.00 0.00 ? 47 PRO A HB3  5  
ATOM   3228  H HG2  . PRO A 1 30 ? 1.370  2.403  -14.585 1.00 0.00 ? 47 PRO A HG2  5  
ATOM   3229  H HG3  . PRO A 1 30 ? -0.002 3.402  -14.090 1.00 0.00 ? 47 PRO A HG3  5  
ATOM   3230  H HD2  . PRO A 1 30 ? 2.420  2.555  -12.458 1.00 0.00 ? 47 PRO A HD2  5  
ATOM   3231  H HD3  . PRO A 1 30 ? 1.564  4.101  -12.453 1.00 0.00 ? 47 PRO A HD3  5  
ATOM   3232  N N    . GLY A 1 31 ? 0.592  -0.074 -10.566 1.00 0.00 ? 48 GLY A N    5  
ATOM   3233  C CA   . GLY A 1 31 ? 0.677  -1.300 -9.782  1.00 0.00 ? 48 GLY A CA   5  
ATOM   3234  C C    . GLY A 1 31 ? -0.161 -1.203 -8.514  1.00 0.00 ? 48 GLY A C    5  
ATOM   3235  O O    . GLY A 1 31 ? -0.611 -2.215 -7.976  1.00 0.00 ? 48 GLY A O    5  
ATOM   3236  H H    . GLY A 1 31 ? 1.421  0.487  -10.692 1.00 0.00 ? 48 GLY A H    5  
ATOM   3237  H HA2  . GLY A 1 31 ? 0.315  -2.134 -10.385 1.00 0.00 ? 48 GLY A HA2  5  
ATOM   3238  H HA3  . GLY A 1 31 ? 1.717  -1.477 -9.508  1.00 0.00 ? 48 GLY A HA3  5  
ATOM   3239  N N    . GLY A 1 32 ? -0.370 0.022  -8.042  1.00 0.00 ? 49 GLY A N    5  
ATOM   3240  C CA   . GLY A 1 32 ? -1.205 0.258  -6.870  1.00 0.00 ? 49 GLY A CA   5  
ATOM   3241  C C    . GLY A 1 32 ? -0.365 0.676  -5.671  1.00 0.00 ? 49 GLY A C    5  
ATOM   3242  O O    . GLY A 1 32 ? -0.867 0.770  -4.551  1.00 0.00 ? 49 GLY A O    5  
ATOM   3243  H H    . GLY A 1 32 ? 0.061  0.808  -8.506  1.00 0.00 ? 49 GLY A H    5  
ATOM   3244  H HA2  . GLY A 1 32 ? -1.921 1.050  -7.097  1.00 0.00 ? 49 GLY A HA2  5  
ATOM   3245  H HA3  . GLY A 1 32 ? -1.744 -0.656 -6.625  1.00 0.00 ? 49 GLY A HA3  5  
ATOM   3246  N N    . THR A 1 33 ? 0.917  0.928  -5.911  1.00 0.00 ? 50 THR A N    5  
ATOM   3247  C CA   . THR A 1 33 ? 1.828  1.345  -4.852  1.00 0.00 ? 50 THR A CA   5  
ATOM   3248  C C    . THR A 1 33 ? 1.757  2.849  -4.623  1.00 0.00 ? 50 THR A C    5  
ATOM   3249  O O    . THR A 1 33 ? 1.846  3.635  -5.567  1.00 0.00 ? 50 THR A O    5  
ATOM   3250  C CB   . THR A 1 33 ? 3.284  0.952  -5.172  1.00 0.00 ? 50 THR A CB   5  
ATOM   3251  O OG1  . THR A 1 33 ? 3.380  -0.473 -5.297  1.00 0.00 ? 50 THR A OG1  5  
ATOM   3252  C CG2  . THR A 1 33 ? 4.217  1.424  -4.068  1.00 0.00 ? 50 THR A CG2  5  
ATOM   3253  H H    . THR A 1 33 ? 1.269  0.829  -6.853  1.00 0.00 ? 50 THR A H    5  
ATOM   3254  H HA   . THR A 1 33 ? 1.539  0.876  -3.912  1.00 0.00 ? 50 THR A HA   5  
ATOM   3255  H HB   . THR A 1 33 ? 3.575  1.412  -6.116  1.00 0.00 ? 50 THR A HB   5  
ATOM   3256  H HG1  . THR A 1 33 ? 3.453  -0.707 -6.226  1.00 0.00 ? 50 THR A HG1  5  
ATOM   3257  H HG21 . THR A 1 33 ? 3.927  0.964  -3.125  1.00 0.00 ? 50 THR A HG21 5  
ATOM   3258  H HG22 . THR A 1 33 ? 5.240  1.138  -4.311  1.00 0.00 ? 50 THR A HG22 5  
ATOM   3259  H HG23 . THR A 1 33 ? 4.154  2.508  -3.977  1.00 0.00 ? 50 THR A HG23 5  
ATOM   3260  N N    . ARG A 1 34 ? 1.597  3.244  -3.365  1.00 0.00 ? 51 ARG A N    5  
ATOM   3261  C CA   . ARG A 1 34 ? 1.508  4.656  -3.011  1.00 0.00 ? 51 ARG A CA   5  
ATOM   3262  C C    . ARG A 1 34 ? 2.856  5.195  -2.552  1.00 0.00 ? 51 ARG A C    5  
ATOM   3263  O O    . ARG A 1 34 ? 3.365  4.807  -1.500  1.00 0.00 ? 51 ARG A O    5  
ATOM   3264  C CB   . ARG A 1 34 ? 0.422  4.920  -1.979  1.00 0.00 ? 51 ARG A CB   5  
ATOM   3265  C CG   . ARG A 1 34 ? -0.986 4.564  -2.427  1.00 0.00 ? 51 ARG A CG   5  
ATOM   3266  C CD   . ARG A 1 34 ? -2.023 4.730  -1.377  1.00 0.00 ? 51 ARG A CD   5  
ATOM   3267  N NE   . ARG A 1 34 ? -3.368 4.363  -1.794  1.00 0.00 ? 51 ARG A NE   5  
ATOM   3268  C CZ   . ARG A 1 34 ? -4.460 4.444  -1.011  1.00 0.00 ? 51 ARG A CZ   5  
ATOM   3269  N NH1  . ARG A 1 34 ? -4.370 4.839  0.240   1.00 0.00 ? 51 ARG A NH1  5  
ATOM   3270  N NH2  . ARG A 1 34 ? -5.625 4.091  -1.525  1.00 0.00 ? 51 ARG A NH2  5  
ATOM   3271  H H    . ARG A 1 34 ? 1.536  2.549  -2.635  1.00 0.00 ? 51 ARG A H    5  
ATOM   3272  H HA   . ARG A 1 34 ? 1.223  5.238  -3.888  1.00 0.00 ? 51 ARG A HA   5  
ATOM   3273  H HB2  . ARG A 1 34 ? 0.676  4.340  -1.094  1.00 0.00 ? 51 ARG A HB2  5  
ATOM   3274  H HB3  . ARG A 1 34 ? 0.463  5.983  -1.740  1.00 0.00 ? 51 ARG A HB3  5  
ATOM   3275  H HG2  . ARG A 1 34 ? -1.256 5.203  -3.269  1.00 0.00 ? 51 ARG A HG2  5  
ATOM   3276  H HG3  . ARG A 1 34 ? -0.995 3.521  -2.746  1.00 0.00 ? 51 ARG A HG3  5  
ATOM   3277  H HD2  . ARG A 1 34 ? -1.766 4.105  -0.523  1.00 0.00 ? 51 ARG A HD2  5  
ATOM   3278  H HD3  . ARG A 1 34 ? -2.051 5.774  -1.068  1.00 0.00 ? 51 ARG A HD3  5  
ATOM   3279  H HE   . ARG A 1 34 ? -3.692 4.009  -2.685  1.00 0.00 ? 51 ARG A HE   5  
ATOM   3280  H HH11 . ARG A 1 34 ? -3.469 5.089  0.624   1.00 0.00 ? 51 ARG A HH11 5  
ATOM   3281  H HH12 . ARG A 1 34 ? -5.201 4.893  0.810   1.00 0.00 ? 51 ARG A HH12 5  
ATOM   3282  H HH21 . ARG A 1 34 ? -5.675 3.772  -2.483  1.00 0.00 ? 51 ARG A HH21 5  
ATOM   3283  H HH22 . ARG A 1 34 ? -6.460 4.141  -0.960  1.00 0.00 ? 51 ARG A HH22 5  
ATOM   3284  N N    . ILE A 1 35 ? 3.431  6.091  -3.346  1.00 0.00 ? 52 ILE A N    5  
ATOM   3285  C CA   . ILE A 1 35 ? 4.755  6.633  -3.060  1.00 0.00 ? 52 ILE A CA   5  
ATOM   3286  C C    . ILE A 1 35 ? 4.661  8.036  -2.476  1.00 0.00 ? 52 ILE A C    5  
ATOM   3287  O O    . ILE A 1 35 ? 4.167  8.957  -3.126  1.00 0.00 ? 52 ILE A O    5  
ATOM   3288  C CB   . ILE A 1 35 ? 5.635  6.670  -4.322  1.00 0.00 ? 52 ILE A CB   5  
ATOM   3289  C CG1  . ILE A 1 35 ? 5.802  5.261  -4.898  1.00 0.00 ? 52 ILE A CG1  5  
ATOM   3290  C CG2  . ILE A 1 35 ? 6.992  7.283  -4.007  1.00 0.00 ? 52 ILE A CG2  5  
ATOM   3291  C CD1  . ILE A 1 35 ? 6.466  5.231  -6.256  1.00 0.00 ? 52 ILE A CD1  5  
ATOM   3292  H H    . ILE A 1 35 ? 2.939  6.406  -4.170  1.00 0.00 ? 52 ILE A H    5  
ATOM   3293  H HA   . ILE A 1 35 ? 5.251  6.045  -2.289  1.00 0.00 ? 52 ILE A HA   5  
ATOM   3294  H HB   . ILE A 1 35 ? 5.136  7.264  -5.086  1.00 0.00 ? 52 ILE A HB   5  
ATOM   3295  H HG12 . ILE A 1 35 ? 6.400  4.689  -4.189  1.00 0.00 ? 52 ILE A HG12 5  
ATOM   3296  H HG13 . ILE A 1 35 ? 4.808  4.821  -4.971  1.00 0.00 ? 52 ILE A HG13 5  
ATOM   3297  H HG21 . ILE A 1 35 ? 7.602  7.300  -4.910  1.00 0.00 ? 52 ILE A HG21 5  
ATOM   3298  H HG22 . ILE A 1 35 ? 6.854  8.300  -3.642  1.00 0.00 ? 52 ILE A HG22 5  
ATOM   3299  H HG23 . ILE A 1 35 ? 7.492  6.688  -3.243  1.00 0.00 ? 52 ILE A HG23 5  
ATOM   3300  H HD11 . ILE A 1 35 ? 7.461  5.669  -6.185  1.00 0.00 ? 52 ILE A HD11 5  
ATOM   3301  H HD12 . ILE A 1 35 ? 6.549  4.200  -6.600  1.00 0.00 ? 52 ILE A HD12 5  
ATOM   3302  H HD13 . ILE A 1 35 ? 5.868  5.802  -6.967  1.00 0.00 ? 52 ILE A HD13 5  
ATOM   3303  N N    . ILE A 1 36 ? 5.139  8.193  -1.246  1.00 0.00 ? 53 ILE A N    5  
ATOM   3304  C CA   . ILE A 1 36 ? 5.239  9.508  -0.626  1.00 0.00 ? 53 ILE A CA   5  
ATOM   3305  C C    . ILE A 1 36 ? 6.618  10.118 -0.847  1.00 0.00 ? 53 ILE A C    5  
ATOM   3306  O O    . ILE A 1 36 ? 7.639  9.473  -0.607  1.00 0.00 ? 53 ILE A O    5  
ATOM   3307  C CB   . ILE A 1 36 ? 4.955  9.443  0.887   1.00 0.00 ? 53 ILE A CB   5  
ATOM   3308  C CG1  . ILE A 1 36 ? 3.534  8.933  1.141   1.00 0.00 ? 53 ILE A CG1  5  
ATOM   3309  C CG2  . ILE A 1 36 ? 5.157  10.809 1.525   1.00 0.00 ? 53 ILE A CG2  5  
ATOM   3310  C CD1  . ILE A 1 36 ? 3.253  8.606  2.590   1.00 0.00 ? 53 ILE A CD1  5  
ATOM   3311  H H    . ILE A 1 36 ? 5.439  7.380  -0.727  1.00 0.00 ? 53 ILE A H    5  
ATOM   3312  H HA   . ILE A 1 36 ? 4.549  10.209 -1.094  1.00 0.00 ? 53 ILE A HA   5  
ATOM   3313  H HB   . ILE A 1 36 ? 5.633  8.724  1.345   1.00 0.00 ? 53 ILE A HB   5  
ATOM   3314  H HG12 . ILE A 1 36 ? 2.847  9.708  0.803   1.00 0.00 ? 53 ILE A HG12 5  
ATOM   3315  H HG13 . ILE A 1 36 ? 3.398  8.039  0.533   1.00 0.00 ? 53 ILE A HG13 5  
ATOM   3316  H HG21 . ILE A 1 36 ? 4.951  10.745 2.594   1.00 0.00 ? 53 ILE A HG21 5  
ATOM   3317  H HG22 . ILE A 1 36 ? 6.185  11.133 1.373   1.00 0.00 ? 53 ILE A HG22 5  
ATOM   3318  H HG23 . ILE A 1 36 ? 4.477  11.529 1.068   1.00 0.00 ? 53 ILE A HG23 5  
ATOM   3319  H HD11 . ILE A 1 36 ? 3.388  9.499  3.199   1.00 0.00 ? 53 ILE A HD11 5  
ATOM   3320  H HD12 . ILE A 1 36 ? 2.227  8.251  2.691   1.00 0.00 ? 53 ILE A HD12 5  
ATOM   3321  H HD13 . ILE A 1 36 ? 3.940  7.830  2.928   1.00 0.00 ? 53 ILE A HD13 5  
ATOM   3322  N N    . TYR A 1 37 ? 6.641  11.364 -1.308  1.00 0.00 ? 54 TYR A N    5  
ATOM   3323  C CA   . TYR A 1 37 ? 7.882  12.001 -1.732  1.00 0.00 ? 54 TYR A CA   5  
ATOM   3324  C C    . TYR A 1 37 ? 8.346  13.034 -0.714  1.00 0.00 ? 54 TYR A C    5  
ATOM   3325  O O    . TYR A 1 37 ? 7.558  13.852 -0.241  1.00 0.00 ? 54 TYR A O    5  
ATOM   3326  C CB   . TYR A 1 37 ? 7.705  12.658 -3.103  1.00 0.00 ? 54 TYR A CB   5  
ATOM   3327  C CG   . TYR A 1 37 ? 7.491  11.672 -4.232  1.00 0.00 ? 54 TYR A CG   5  
ATOM   3328  C CD1  . TYR A 1 37 ? 8.567  11.040 -4.836  1.00 0.00 ? 54 TYR A CD1  5  
ATOM   3329  C CD2  . TYR A 1 37 ? 6.215  11.381 -4.691  1.00 0.00 ? 54 TYR A CD2  5  
ATOM   3330  C CE1  . TYR A 1 37 ? 8.378  10.140 -5.867  1.00 0.00 ? 54 TYR A CE1  5  
ATOM   3331  C CE2  . TYR A 1 37 ? 6.014  10.481 -5.720  1.00 0.00 ? 54 TYR A CE2  5  
ATOM   3332  C CZ   . TYR A 1 37 ? 7.100  9.863  -6.306  1.00 0.00 ? 54 TYR A CZ   5  
ATOM   3333  O OH   . TYR A 1 37 ? 6.906  8.968  -7.334  1.00 0.00 ? 54 TYR A OH   5  
ATOM   3334  H H    . TYR A 1 37 ? 5.777  11.883 -1.366  1.00 0.00 ? 54 TYR A H    5  
ATOM   3335  H HA   . TYR A 1 37 ? 8.675  11.256 -1.803  1.00 0.00 ? 54 TYR A HA   5  
ATOM   3336  H HB2  . TYR A 1 37 ? 6.843  13.323 -3.034  1.00 0.00 ? 54 TYR A HB2  5  
ATOM   3337  H HB3  . TYR A 1 37 ? 8.603  13.244 -3.298  1.00 0.00 ? 54 TYR A HB3  5  
ATOM   3338  H HD1  . TYR A 1 37 ? 9.574  11.262 -4.484  1.00 0.00 ? 54 TYR A HD1  5  
ATOM   3339  H HD2  . TYR A 1 37 ? 5.363  11.873 -4.223  1.00 0.00 ? 54 TYR A HD2  5  
ATOM   3340  H HE1  . TYR A 1 37 ? 9.237  9.651  -6.328  1.00 0.00 ? 54 TYR A HE1  5  
ATOM   3341  H HE2  . TYR A 1 37 ? 5.006  10.262 -6.070  1.00 0.00 ? 54 TYR A HE2  5  
ATOM   3342  H HH   . TYR A 1 37 ? 7.726  8.597  -7.667  1.00 0.00 ? 54 TYR A HH   5  
ATOM   3343  N N    . ASP A 1 38 ? 9.631  12.992 -0.380  1.00 0.00 ? 55 ASP A N    5  
ATOM   3344  C CA   . ASP A 1 38 ? 10.250 14.042 0.420   1.00 0.00 ? 55 ASP A CA   5  
ATOM   3345  C C    . ASP A 1 38 ? 11.032 15.013 -0.454  1.00 0.00 ? 55 ASP A C    5  
ATOM   3346  O O    . ASP A 1 38 ? 12.176 14.747 -0.826  1.00 0.00 ? 55 ASP A O    5  
ATOM   3347  C CB   . ASP A 1 38 ? 11.168 13.435 1.484   1.00 0.00 ? 55 ASP A CB   5  
ATOM   3348  C CG   . ASP A 1 38 ? 11.828 14.455 2.402   1.00 0.00 ? 55 ASP A CG   5  
ATOM   3349  O OD1  . ASP A 1 38 ? 11.674 15.629 2.162   1.00 0.00 ? 55 ASP A OD1  5  
ATOM   3350  O OD2  . ASP A 1 38 ? 12.345 14.061 3.420   1.00 0.00 ? 55 ASP A OD2  5  
ATOM   3351  H H    . ASP A 1 38 ? 10.195 12.213 -0.690  1.00 0.00 ? 55 ASP A H    5  
ATOM   3352  H HA   . ASP A 1 38 ? 9.478  14.628 0.920   1.00 0.00 ? 55 ASP A HA   5  
ATOM   3353  H HB2  . ASP A 1 38 ? 10.686 12.664 2.086   1.00 0.00 ? 55 ASP A HB2  5  
ATOM   3354  H HB3  . ASP A 1 38 ? 11.925 12.979 0.845   1.00 0.00 ? 55 ASP A HB3  5  
ATOM   3355  N N    . ARG A 1 39 ? 10.411 16.142 -0.779  1.00 0.00 ? 56 ARG A N    5  
ATOM   3356  C CA   . ARG A 1 39 ? 10.973 17.074 -1.749  1.00 0.00 ? 56 ARG A CA   5  
ATOM   3357  C C    . ARG A 1 39 ? 11.981 18.010 -1.093  1.00 0.00 ? 56 ARG A C    5  
ATOM   3358  O O    . ARG A 1 39 ? 11.609 18.896 -0.323  1.00 0.00 ? 56 ARG A O    5  
ATOM   3359  C CB   . ARG A 1 39 ? 9.895  17.849 -2.492  1.00 0.00 ? 56 ARG A CB   5  
ATOM   3360  C CG   . ARG A 1 39 ? 10.414 18.824 -3.538  1.00 0.00 ? 56 ARG A CG   5  
ATOM   3361  C CD   . ARG A 1 39 ? 9.351  19.577 -4.252  1.00 0.00 ? 56 ARG A CD   5  
ATOM   3362  N NE   . ARG A 1 39 ? 8.491  20.370 -3.389  1.00 0.00 ? 56 ARG A NE   5  
ATOM   3363  C CZ   . ARG A 1 39 ? 8.820  21.572 -2.877  1.00 0.00 ? 56 ARG A CZ   5  
ATOM   3364  N NH1  . ARG A 1 39 ? 9.999  22.105 -3.103  1.00 0.00 ? 56 ARG A NH1  5  
ATOM   3365  N NH2  . ARG A 1 39 ? 7.932  22.191 -2.117  1.00 0.00 ? 56 ARG A NH2  5  
ATOM   3366  H H    . ARG A 1 39 ? 9.526  16.358 -0.344  1.00 0.00 ? 56 ARG A H    5  
ATOM   3367  H HA   . ARG A 1 39 ? 11.516 16.524 -2.518  1.00 0.00 ? 56 ARG A HA   5  
ATOM   3368  H HB2  . ARG A 1 39 ? 9.251  17.114 -2.974  1.00 0.00 ? 56 ARG A HB2  5  
ATOM   3369  H HB3  . ARG A 1 39 ? 9.324  18.397 -1.743  1.00 0.00 ? 56 ARG A HB3  5  
ATOM   3370  H HG2  . ARG A 1 39 ? 11.065 19.546 -3.045  1.00 0.00 ? 56 ARG A HG2  5  
ATOM   3371  H HG3  . ARG A 1 39 ? 10.986 18.264 -4.278  1.00 0.00 ? 56 ARG A HG3  5  
ATOM   3372  H HD2  . ARG A 1 39 ? 9.818  20.258 -4.963  1.00 0.00 ? 56 ARG A HD2  5  
ATOM   3373  H HD3  . ARG A 1 39 ? 8.717  18.872 -4.789  1.00 0.00 ? 56 ARG A HD3  5  
ATOM   3374  H HE   . ARG A 1 39 ? 7.559  20.171 -3.049  1.00 0.00 ? 56 ARG A HE   5  
ATOM   3375  H HH11 . ARG A 1 39 ? 10.673 21.611 -3.671  1.00 0.00 ? 56 ARG A HH11 5  
ATOM   3376  H HH12 . ARG A 1 39 ? 10.227 23.006 -2.709  1.00 0.00 ? 56 ARG A HH12 5  
ATOM   3377  H HH21 . ARG A 1 39 ? 7.037  21.758 -1.937  1.00 0.00 ? 56 ARG A HH21 5  
ATOM   3378  H HH22 . ARG A 1 39 ? 8.153  23.091 -1.719  1.00 0.00 ? 56 ARG A HH22 5  
ATOM   3379  N N    . LYS A 1 40 ? 13.257 17.809 -1.402  1.00 0.00 ? 57 LYS A N    5  
ATOM   3380  C CA   . LYS A 1 40 ? 14.299 18.747 -1.005  1.00 0.00 ? 57 LYS A CA   5  
ATOM   3381  C C    . LYS A 1 40 ? 14.571 19.767 -2.102  1.00 0.00 ? 57 LYS A C    5  
ATOM   3382  O O    . LYS A 1 40 ? 14.877 20.926 -1.824  1.00 0.00 ? 57 LYS A O    5  
ATOM   3383  C CB   . LYS A 1 40 ? 15.586 18.000 -0.651  1.00 0.00 ? 57 LYS A CB   5  
ATOM   3384  C CG   . LYS A 1 40 ? 15.467 17.079 0.557   1.00 0.00 ? 57 LYS A CG   5  
ATOM   3385  C CD   . LYS A 1 40 ? 16.792 16.398 0.866   1.00 0.00 ? 57 LYS A CD   5  
ATOM   3386  C CE   . LYS A 1 40 ? 16.664 15.446 2.047   1.00 0.00 ? 57 LYS A CE   5  
ATOM   3387  N NZ   . LYS A 1 40 ? 17.930 14.709 2.306   1.00 0.00 ? 57 LYS A NZ   5  
ATOM   3388  H H    . LYS A 1 40 ? 13.511 16.984 -1.927  1.00 0.00 ? 57 LYS A H    5  
ATOM   3389  H HA   . LYS A 1 40 ? 13.973 19.310 -0.130  1.00 0.00 ? 57 LYS A HA   5  
ATOM   3390  H HB2  . LYS A 1 40 ? 15.866 17.414 -1.527  1.00 0.00 ? 57 LYS A HB2  5  
ATOM   3391  H HB3  . LYS A 1 40 ? 16.351 18.752 -0.458  1.00 0.00 ? 57 LYS A HB3  5  
ATOM   3392  H HG2  . LYS A 1 40 ? 15.154 17.674 1.416   1.00 0.00 ? 57 LYS A HG2  5  
ATOM   3393  H HG3  . LYS A 1 40 ? 14.711 16.324 0.344   1.00 0.00 ? 57 LYS A HG3  5  
ATOM   3394  H HD2  . LYS A 1 40 ? 17.111 15.842 -0.016  1.00 0.00 ? 57 LYS A HD2  5  
ATOM   3395  H HD3  . LYS A 1 40 ? 17.532 17.165 1.097   1.00 0.00 ? 57 LYS A HD3  5  
ATOM   3396  H HE2  . LYS A 1 40 ? 16.397 16.029 2.928   1.00 0.00 ? 57 LYS A HE2  5  
ATOM   3397  H HE3  . LYS A 1 40 ? 15.869 14.735 1.827   1.00 0.00 ? 57 LYS A HE3  5  
ATOM   3398  H HZ1  . LYS A 1 40 ? 18.668 15.368 2.511   1.00 0.00 ? 57 LYS A HZ1  5  
ATOM   3399  H HZ2  . LYS A 1 40 ? 17.803 14.089 3.095   1.00 0.00 ? 57 LYS A HZ2  5  
ATOM   3400  H HZ3  . LYS A 1 40 ? 18.179 14.167 1.489   1.00 0.00 ? 57 LYS A HZ3  5  
ATOM   3401  N N    . PHE A 1 41 ? 14.457 19.329 -3.351  1.00 0.00 ? 58 PHE A N    5  
ATOM   3402  C CA   . PHE A 1 41 ? 14.580 20.227 -4.493  1.00 0.00 ? 58 PHE A CA   5  
ATOM   3403  C C    . PHE A 1 41 ? 13.539 21.337 -4.435  1.00 0.00 ? 58 PHE A C    5  
ATOM   3404  O O    . PHE A 1 41 ? 12.336 21.074 -4.416  1.00 0.00 ? 58 PHE A O    5  
ATOM   3405  C CB   . PHE A 1 41 ? 14.445 19.449 -5.803  1.00 0.00 ? 58 PHE A CB   5  
ATOM   3406  C CG   . PHE A 1 41 ? 14.565 20.304 -7.032  1.00 0.00 ? 58 PHE A CG   5  
ATOM   3407  C CD1  . PHE A 1 41 ? 15.792 20.825 -7.414  1.00 0.00 ? 58 PHE A CD1  5  
ATOM   3408  C CD2  . PHE A 1 41 ? 13.452 20.592 -7.806  1.00 0.00 ? 58 PHE A CD2  5  
ATOM   3409  C CE1  . PHE A 1 41 ? 15.903 21.614 -8.546  1.00 0.00 ? 58 PHE A CE1  5  
ATOM   3410  C CE2  . PHE A 1 41 ? 13.559 21.377 -8.937  1.00 0.00 ? 58 PHE A CE2  5  
ATOM   3411  C CZ   . PHE A 1 41 ? 14.787 21.889 -9.306  1.00 0.00 ? 58 PHE A CZ   5  
ATOM   3412  H H    . PHE A 1 41 ? 14.281 18.347 -3.514  1.00 0.00 ? 58 PHE A H    5  
ATOM   3413  H HA   . PHE A 1 41 ? 15.555 20.716 -4.476  1.00 0.00 ? 58 PHE A HA   5  
ATOM   3414  H HB2  . PHE A 1 41 ? 15.227 18.694 -5.873  1.00 0.00 ? 58 PHE A HB2  5  
ATOM   3415  H HB3  . PHE A 1 41 ? 13.470 18.967 -5.853  1.00 0.00 ? 58 PHE A HB3  5  
ATOM   3416  H HD1  . PHE A 1 41 ? 16.675 20.606 -6.814  1.00 0.00 ? 58 PHE A HD1  5  
ATOM   3417  H HD2  . PHE A 1 41 ? 12.481 20.187 -7.514  1.00 0.00 ? 58 PHE A HD2  5  
ATOM   3418  H HE1  . PHE A 1 41 ? 16.873 22.017 -8.834  1.00 0.00 ? 58 PHE A HE1  5  
ATOM   3419  H HE2  . PHE A 1 41 ? 12.676 21.594 -9.537  1.00 0.00 ? 58 PHE A HE2  5  
ATOM   3420  H HZ   . PHE A 1 41 ? 14.873 22.510 -10.196 1.00 0.00 ? 58 PHE A HZ   5  
ATOM   3421  N N    . LEU A 1 42 ? 14.007 22.580 -4.405  1.00 0.00 ? 59 LEU A N    5  
ATOM   3422  C CA   . LEU A 1 42 ? 13.117 23.733 -4.346  1.00 0.00 ? 59 LEU A CA   5  
ATOM   3423  C C    . LEU A 1 42 ? 12.509 24.031 -5.711  1.00 0.00 ? 59 LEU A C    5  
ATOM   3424  O O    . LEU A 1 42 ? 13.172 23.897 -6.739  1.00 0.00 ? 59 LEU A O    5  
ATOM   3425  C CB   . LEU A 1 42 ? 13.873 24.960 -3.819  1.00 0.00 ? 59 LEU A CB   5  
ATOM   3426  C CG   . LEU A 1 42 ? 14.418 24.828 -2.392  1.00 0.00 ? 59 LEU A CG   5  
ATOM   3427  C CD1  . LEU A 1 42 ? 15.210 26.074 -2.017  1.00 0.00 ? 59 LEU A CD1  5  
ATOM   3428  C CD2  . LEU A 1 42 ? 13.263 24.613 -1.425  1.00 0.00 ? 59 LEU A CD2  5  
ATOM   3429  H H    . LEU A 1 42 ? 15.006 22.730 -4.425  1.00 0.00 ? 59 LEU A H    5  
ATOM   3430  H HA   . LEU A 1 42 ? 12.284 23.518 -3.677  1.00 0.00 ? 59 LEU A HA   5  
ATOM   3431  H HB2  . LEU A 1 42 ? 14.696 24.981 -4.532  1.00 0.00 ? 59 LEU A HB2  5  
ATOM   3432  H HB3  . LEU A 1 42 ? 13.283 25.871 -3.919  1.00 0.00 ? 59 LEU A HB3  5  
ATOM   3433  H HG   . LEU A 1 42 ? 15.045 23.937 -2.366  1.00 0.00 ? 59 LEU A HG   5  
ATOM   3434  H HD11 . LEU A 1 42 ? 15.592 25.970 -1.002  1.00 0.00 ? 59 LEU A HD11 5  
ATOM   3435  H HD12 . LEU A 1 42 ? 16.044 26.196 -2.708  1.00 0.00 ? 59 LEU A HD12 5  
ATOM   3436  H HD13 . LEU A 1 42 ? 14.561 26.947 -2.073  1.00 0.00 ? 59 LEU A HD13 5  
ATOM   3437  H HD21 . LEU A 1 42 ? 12.727 23.702 -1.693  1.00 0.00 ? 59 LEU A HD21 5  
ATOM   3438  H HD22 . LEU A 1 42 ? 13.652 24.518 -0.410  1.00 0.00 ? 59 LEU A HD22 5  
ATOM   3439  H HD23 . LEU A 1 42 ? 12.582 25.462 -1.475  1.00 0.00 ? 59 LEU A HD23 5  
ATOM   3440  N N    . LEU A 1 43 ? 11.244 24.436 -5.713  1.00 0.00 ? 60 LEU A N    5  
ATOM   3441  C CA   . LEU A 1 43 ? 10.534 24.725 -6.954  1.00 0.00 ? 60 LEU A CA   5  
ATOM   3442  C C    . LEU A 1 43 ? 10.387 26.227 -7.165  1.00 0.00 ? 60 LEU A C    5  
ATOM   3443  O O    . LEU A 1 43 ? 10.400 27.003 -6.209  1.00 0.00 ? 60 LEU A O    5  
ATOM   3444  C CB   . LEU A 1 43 ? 9.158  24.049 -6.948  1.00 0.00 ? 60 LEU A CB   5  
ATOM   3445  C CG   . LEU A 1 43 ? 9.177  22.530 -6.734  1.00 0.00 ? 60 LEU A CG   5  
ATOM   3446  C CD1  . LEU A 1 43 ? 7.755  21.989 -6.701  1.00 0.00 ? 60 LEU A CD1  5  
ATOM   3447  C CD2  . LEU A 1 43 ? 9.981  21.870 -7.846  1.00 0.00 ? 60 LEU A CD2  5  
ATOM   3448  H H    . LEU A 1 43 ? 10.760 24.545 -4.834  1.00 0.00 ? 60 LEU A H    5  
ATOM   3449  H HA   . LEU A 1 43 ? 11.109 24.350 -7.799  1.00 0.00 ? 60 LEU A HA   5  
ATOM   3450  H HB2  . LEU A 1 43 ? 8.721  24.543 -6.082  1.00 0.00 ? 60 LEU A HB2  5  
ATOM   3451  H HB3  . LEU A 1 43 ? 8.581  24.300 -7.839  1.00 0.00 ? 60 LEU A HB3  5  
ATOM   3452  H HG   . LEU A 1 43 ? 9.695  22.343 -5.793  1.00 0.00 ? 60 LEU A HG   5  
ATOM   3453  H HD11 . LEU A 1 43 ? 7.779  20.910 -6.549  1.00 0.00 ? 60 LEU A HD11 5  
ATOM   3454  H HD12 . LEU A 1 43 ? 7.206  22.458 -5.885  1.00 0.00 ? 60 LEU A HD12 5  
ATOM   3455  H HD13 . LEU A 1 43 ? 7.260  22.211 -7.646  1.00 0.00 ? 60 LEU A HD13 5  
ATOM   3456  H HD21 . LEU A 1 43 ? 11.001 22.251 -7.833  1.00 0.00 ? 60 LEU A HD21 5  
ATOM   3457  H HD22 . LEU A 1 43 ? 9.994  20.791 -7.692  1.00 0.00 ? 60 LEU A HD22 5  
ATOM   3458  H HD23 . LEU A 1 43 ? 9.522  22.094 -8.808  1.00 0.00 ? 60 LEU A HD23 5  
ATOM   3459  N N    . ASP A 1 44 ? 10.246 26.631 -8.423  1.00 0.00 ? 61 ASP A N    5  
ATOM   3460  C CA   . ASP A 1 44 ? 10.081 28.040 -8.761  1.00 0.00 ? 61 ASP A CA   5  
ATOM   3461  C C    . ASP A 1 44 ? 8.732  28.565 -8.290  1.00 0.00 ? 61 ASP A C    5  
ATOM   3462  O O    . ASP A 1 44 ? 7.734  27.845 -8.307  1.00 0.00 ? 61 ASP A O    5  
ATOM   3463  C CB   . ASP A 1 44 ? 10.229 28.250 -10.271 1.00 0.00 ? 61 ASP A CB   5  
ATOM   3464  C CG   . ASP A 1 44 ? 11.657 28.126 -10.786 1.00 0.00 ? 61 ASP A CG   5  
ATOM   3465  O OD1  . ASP A 1 44 ? 12.556 28.075 -9.981  1.00 0.00 ? 61 ASP A OD1  5  
ATOM   3466  O OD2  . ASP A 1 44 ? 11.826 27.927 -11.965 1.00 0.00 ? 61 ASP A OD2  5  
ATOM   3467  H H    . ASP A 1 44 ? 10.252 25.944 -9.164  1.00 0.00 ? 61 ASP A H    5  
ATOM   3468  H HA   . ASP A 1 44 ? 10.840 28.633 -8.252  1.00 0.00 ? 61 ASP A HA   5  
ATOM   3469  H HB2  . ASP A 1 44 ? 9.573  27.613 -10.864 1.00 0.00 ? 61 ASP A HB2  5  
ATOM   3470  H HB3  . ASP A 1 44 ? 9.902  29.287 -10.352 1.00 0.00 ? 61 ASP A HB3  5  
ATOM   3471  N N    . ARG A 1 45 ? 8.708  29.826 -7.870  1.00 0.00 ? 62 ARG A N    5  
ATOM   3472  C CA   . ARG A 1 45 ? 7.480  30.451 -7.393  1.00 0.00 ? 62 ARG A CA   5  
ATOM   3473  C C    . ARG A 1 45 ? 6.500  30.683 -8.536  1.00 0.00 ? 62 ARG A C    5  
ATOM   3474  O O    . ARG A 1 45 ? 5.824  29.777 -8.940  1.00 0.00 ? 62 ARG A O    5  
ATOM   3475  C CB   . ARG A 1 45 ? 7.751  31.735 -6.623  1.00 0.00 ? 62 ARG A CB   5  
ATOM   3476  C CG   . ARG A 1 45 ? 6.521  32.383 -6.007  1.00 0.00 ? 62 ARG A CG   5  
ATOM   3477  C CD   . ARG A 1 45 ? 6.805  33.608 -5.217  1.00 0.00 ? 62 ARG A CD   5  
ATOM   3478  N NE   . ARG A 1 45 ? 5.635  34.214 -4.602  1.00 0.00 ? 62 ARG A NE   5  
ATOM   3479  C CZ   . ARG A 1 45 ? 5.660  35.322 -3.836  1.00 0.00 ? 62 ARG A CZ   5  
ATOM   3480  N NH1  . ARG A 1 45 ? 6.793  35.927 -3.557  1.00 0.00 ? 62 ARG A NH1  5  
ATOM   3481  N NH2  . ARG A 1 45 ? 4.516  35.772 -3.352  1.00 0.00 ? 62 ARG A NH2  5  
ATOM   3482  O OXT  . ARG A 1 45 ? 6.404  31.771 -9.032  1.00 0.00 ? 62 ARG A OXT  5  
ATOM   3483  H H    . ARG A 1 45 ? 9.562  30.365 -7.880  1.00 0.00 ? 62 ARG A H    5  
ATOM   3484  H HA   . ARG A 1 45 ? 6.979  29.790 -6.684  1.00 0.00 ? 62 ARG A HA   5  
ATOM   3485  H HB2  . ARG A 1 45 ? 8.460  31.489 -5.834  1.00 0.00 ? 62 ARG A HB2  5  
ATOM   3486  H HB3  . ARG A 1 45 ? 8.212  32.433 -7.321  1.00 0.00 ? 62 ARG A HB3  5  
ATOM   3487  H HG2  . ARG A 1 45 ? 5.832  32.653 -6.809  1.00 0.00 ? 62 ARG A HG2  5  
ATOM   3488  H HG3  . ARG A 1 45 ? 6.042  31.660 -5.346  1.00 0.00 ? 62 ARG A HG3  5  
ATOM   3489  H HD2  . ARG A 1 45 ? 7.502  33.360 -4.417  1.00 0.00 ? 62 ARG A HD2  5  
ATOM   3490  H HD3  . ARG A 1 45 ? 7.254  34.355 -5.871  1.00 0.00 ? 62 ARG A HD3  5  
ATOM   3491  H HE   . ARG A 1 45 ? 4.666  33.928 -4.640  1.00 0.00 ? 62 ARG A HE   5  
ATOM   3492  H HH11 . ARG A 1 45 ? 7.662  35.559 -3.921  1.00 0.00 ? 62 ARG A HH11 5  
ATOM   3493  H HH12 . ARG A 1 45 ? 6.792  36.756 -2.981  1.00 0.00 ? 62 ARG A HH12 5  
ATOM   3494  H HH21 . ARG A 1 45 ? 3.655  35.285 -3.561  1.00 0.00 ? 62 ARG A HH21 5  
ATOM   3495  H HH22 . ARG A 1 45 ? 4.506  36.600 -2.775  1.00 0.00 ? 62 ARG A HH22 5  
ATOM   3496  N N    . PRO A 1 1  ? 0.590  -1.536 -0.734  1.00 0.00 ? 18 PRO A N    6  
ATOM   3497  C CA   . PRO A 1 1  ? 2.012  -1.289 -0.525  1.00 0.00 ? 18 PRO A CA   6  
ATOM   3498  C C    . PRO A 1 1  ? 2.335  0.195  -0.636  1.00 0.00 ? 18 PRO A C    6  
ATOM   3499  O O    . PRO A 1 1  ? 1.731  0.914  -1.433  1.00 0.00 ? 18 PRO A O    6  
ATOM   3500  C CB   . PRO A 1 1  ? 2.700  -2.113 -1.618  1.00 0.00 ? 18 PRO A CB   6  
ATOM   3501  C CG   . PRO A 1 1  ? 1.708  -2.158 -2.730  1.00 0.00 ? 18 PRO A CG   6  
ATOM   3502  C CD   . PRO A 1 1  ? 0.360  -2.210 -2.060  1.00 0.00 ? 18 PRO A CD   6  
ATOM   3503  H H2   . PRO A 1 1  ? 0.291  -2.127 -1.483  1.00 0.00 ? 18 PRO A H2   6  
ATOM   3504  H H3   . PRO A 1 1  ? 0.046  -1.963 -0.013  1.00 0.00 ? 18 PRO A H3   6  
ATOM   3505  H HA   . PRO A 1 1  ? 2.351  -1.578 0.481   1.00 0.00 ? 18 PRO A HA   6  
ATOM   3506  H HB2  . PRO A 1 1  ? 3.642  -1.645 -1.942  1.00 0.00 ? 18 PRO A HB2  6  
ATOM   3507  H HB3  . PRO A 1 1  ? 2.948  -3.124 -1.265  1.00 0.00 ? 18 PRO A HB3  6  
ATOM   3508  H HG2  . PRO A 1 1  ? 1.794  -1.271 -3.376  1.00 0.00 ? 18 PRO A HG2  6  
ATOM   3509  H HG3  . PRO A 1 1  ? 1.867  -3.039 -3.369  1.00 0.00 ? 18 PRO A HG3  6  
ATOM   3510  H HD2  . PRO A 1 1  ? -0.411 -1.680 -2.637  1.00 0.00 ? 18 PRO A HD2  6  
ATOM   3511  H HD3  . PRO A 1 1  ? 0.005  -3.241 -1.920  1.00 0.00 ? 18 PRO A HD3  6  
ATOM   3512  N N    . THR A 1 2  ? 3.291  0.649  0.167   1.00 0.00 ? 19 THR A N    6  
ATOM   3513  C CA   . THR A 1 2  ? 3.716  2.044  0.141   1.00 0.00 ? 19 THR A CA   6  
ATOM   3514  C C    . THR A 1 2  ? 5.232  2.157  0.042   1.00 0.00 ? 19 THR A C    6  
ATOM   3515  O O    . THR A 1 2  ? 5.958  1.232  0.406   1.00 0.00 ? 19 THR A O    6  
ATOM   3516  C CB   . THR A 1 2  ? 3.235  2.804  1.390   1.00 0.00 ? 19 THR A CB   6  
ATOM   3517  O OG1  . THR A 1 2  ? 3.823  2.224  2.562   1.00 0.00 ? 19 THR A OG1  6  
ATOM   3518  C CG2  . THR A 1 2  ? 1.720  2.741  1.504   1.00 0.00 ? 19 THR A CG2  6  
ATOM   3519  H H    . THR A 1 2  ? 3.735  0.011  0.812   1.00 0.00 ? 19 THR A H    6  
ATOM   3520  H HA   . THR A 1 2  ? 3.312  2.536  -0.744  1.00 0.00 ? 19 THR A HA   6  
ATOM   3521  H HB   . THR A 1 2  ? 3.550  3.845  1.315   1.00 0.00 ? 19 THR A HB   6  
ATOM   3522  H HG1  . THR A 1 2  ? 3.522  2.700  3.340   1.00 0.00 ? 19 THR A HG1  6  
ATOM   3523  H HG21 . THR A 1 2  ? 1.405  1.700  1.581   1.00 0.00 ? 19 THR A HG21 6  
ATOM   3524  H HG22 . THR A 1 2  ? 1.399  3.283  2.392   1.00 0.00 ? 19 THR A HG22 6  
ATOM   3525  H HG23 . THR A 1 2  ? 1.269  3.192  0.620   1.00 0.00 ? 19 THR A HG23 6  
ATOM   3526  N N    . ARG A 1 3  ? 5.703  3.296  -0.453  1.00 0.00 ? 20 ARG A N    6  
ATOM   3527  C CA   . ARG A 1 3  ? 7.135  3.538  -0.585  1.00 0.00 ? 20 ARG A CA   6  
ATOM   3528  C C    . ARG A 1 3  ? 7.502  4.940  -0.114  1.00 0.00 ? 20 ARG A C    6  
ATOM   3529  O O    . ARG A 1 3  ? 6.656  5.833  -0.073  1.00 0.00 ? 20 ARG A O    6  
ATOM   3530  C CB   . ARG A 1 3  ? 7.634  3.278  -1.998  1.00 0.00 ? 20 ARG A CB   6  
ATOM   3531  C CG   . ARG A 1 3  ? 7.485  1.841  -2.474  1.00 0.00 ? 20 ARG A CG   6  
ATOM   3532  C CD   . ARG A 1 3  ? 8.389  0.877  -1.798  1.00 0.00 ? 20 ARG A CD   6  
ATOM   3533  N NE   . ARG A 1 3  ? 8.345  -0.473 -2.340  1.00 0.00 ? 20 ARG A NE   6  
ATOM   3534  C CZ   . ARG A 1 3  ? 7.475  -1.424 -1.952  1.00 0.00 ? 20 ARG A CZ   6  
ATOM   3535  N NH1  . ARG A 1 3  ? 6.602  -1.196 -0.996  1.00 0.00 ? 20 ARG A NH1  6  
ATOM   3536  N NH2  . ARG A 1 3  ? 7.537  -2.606 -2.541  1.00 0.00 ? 20 ARG A NH2  6  
ATOM   3537  H H    . ARG A 1 3  ? 5.055  4.012  -0.745  1.00 0.00 ? 20 ARG A H    6  
ATOM   3538  H HA   . ARG A 1 3  ? 7.688  2.844  0.050   1.00 0.00 ? 20 ARG A HA   6  
ATOM   3539  H HB2  . ARG A 1 3  ? 7.072  3.935  -2.660  1.00 0.00 ? 20 ARG A HB2  6  
ATOM   3540  H HB3  . ARG A 1 3  ? 8.688  3.556  -2.020  1.00 0.00 ? 20 ARG A HB3  6  
ATOM   3541  H HG2  . ARG A 1 3  ? 6.458  1.521  -2.296  1.00 0.00 ? 20 ARG A HG2  6  
ATOM   3542  H HG3  . ARG A 1 3  ? 7.697  1.808  -3.544  1.00 0.00 ? 20 ARG A HG3  6  
ATOM   3543  H HD2  . ARG A 1 3  ? 9.416  1.229  -1.887  1.00 0.00 ? 20 ARG A HD2  6  
ATOM   3544  H HD3  . ARG A 1 3  ? 8.117  0.815  -0.745  1.00 0.00 ? 20 ARG A HD3  6  
ATOM   3545  H HE   . ARG A 1 3  ? 8.920  -0.900 -3.053  1.00 0.00 ? 20 ARG A HE   6  
ATOM   3546  H HH11 . ARG A 1 3  ? 6.578  -0.293 -0.543  1.00 0.00 ? 20 ARG A HH11 6  
ATOM   3547  H HH12 . ARG A 1 3  ? 5.958  -1.922 -0.719  1.00 0.00 ? 20 ARG A HH12 6  
ATOM   3548  H HH21 . ARG A 1 3  ? 8.226  -2.771 -3.263  1.00 0.00 ? 20 ARG A HH21 6  
ATOM   3549  H HH22 . ARG A 1 3  ? 6.897  -3.337 -2.270  1.00 0.00 ? 20 ARG A HH22 6  
ATOM   3550  N N    . THR A 1 4  ? 8.769  5.127  0.243   1.00 0.00 ? 21 THR A N    6  
ATOM   3551  C CA   . THR A 1 4  ? 9.257  6.428  0.683   1.00 0.00 ? 21 THR A CA   6  
ATOM   3552  C C    . THR A 1 4  ? 10.450 6.879  -0.149  1.00 0.00 ? 21 THR A C    6  
ATOM   3553  O O    . THR A 1 4  ? 11.488 6.219  -0.174  1.00 0.00 ? 21 THR A O    6  
ATOM   3554  C CB   . THR A 1 4  ? 9.660  6.407  2.170   1.00 0.00 ? 21 THR A CB   6  
ATOM   3555  O OG1  . THR A 1 4  ? 8.529  6.041  2.969   1.00 0.00 ? 21 THR A OG1  6  
ATOM   3556  C CG2  . THR A 1 4  ? 10.162 7.774  2.605   1.00 0.00 ? 21 THR A CG2  6  
ATOM   3557  H H    . THR A 1 4  ? 9.409  4.347  0.207   1.00 0.00 ? 21 THR A H    6  
ATOM   3558  H HA   . THR A 1 4  ? 8.480  7.180  0.543   1.00 0.00 ? 21 THR A HA   6  
ATOM   3559  H HB   . THR A 1 4  ? 10.450 5.669  2.312   1.00 0.00 ? 21 THR A HB   6  
ATOM   3560  H HG1  . THR A 1 4  ? 8.783  6.027  3.895   1.00 0.00 ? 21 THR A HG1  6  
ATOM   3561  H HG21 . THR A 1 4  ? 9.375  8.513  2.464   1.00 0.00 ? 21 THR A HG21 6  
ATOM   3562  H HG22 . THR A 1 4  ? 10.443 7.740  3.658   1.00 0.00 ? 21 THR A HG22 6  
ATOM   3563  H HG23 . THR A 1 4  ? 11.030 8.051  2.007   1.00 0.00 ? 21 THR A HG23 6  
ATOM   3564  N N    . VAL A 1 5  ? 10.295 8.010  -0.831  1.00 0.00 ? 22 VAL A N    6  
ATOM   3565  C CA   . VAL A 1 5  ? 11.363 8.558  -1.659  1.00 0.00 ? 22 VAL A CA   6  
ATOM   3566  C C    . VAL A 1 5  ? 11.630 10.018 -1.318  1.00 0.00 ? 22 VAL A C    6  
ATOM   3567  O O    . VAL A 1 5  ? 10.700 10.808 -1.158  1.00 0.00 ? 22 VAL A O    6  
ATOM   3568  C CB   . VAL A 1 5  ? 11.032 8.443  -3.159  1.00 0.00 ? 22 VAL A CB   6  
ATOM   3569  C CG1  . VAL A 1 5  ? 12.136 9.069  -3.997  1.00 0.00 ? 22 VAL A CG1  6  
ATOM   3570  C CG2  . VAL A 1 5  ? 10.827 6.988  -3.550  1.00 0.00 ? 22 VAL A CG2  6  
ATOM   3571  H H    . VAL A 1 5  ? 9.415  8.501  -0.775  1.00 0.00 ? 22 VAL A H    6  
ATOM   3572  H HA   . VAL A 1 5  ? 12.309 8.049  -1.473  1.00 0.00 ? 22 VAL A HA   6  
ATOM   3573  H HB   . VAL A 1 5  ? 10.091 8.959  -3.354  1.00 0.00 ? 22 VAL A HB   6  
ATOM   3574  H HG11 . VAL A 1 5  ? 11.885 8.980  -5.055  1.00 0.00 ? 22 VAL A HG11 6  
ATOM   3575  H HG12 . VAL A 1 5  ? 12.238 10.123 -3.737  1.00 0.00 ? 22 VAL A HG12 6  
ATOM   3576  H HG13 . VAL A 1 5  ? 13.076 8.554  -3.804  1.00 0.00 ? 22 VAL A HG13 6  
ATOM   3577  H HG21 . VAL A 1 5  ? 10.003 6.568  -2.972  1.00 0.00 ? 22 VAL A HG21 6  
ATOM   3578  H HG22 . VAL A 1 5  ? 10.593 6.926  -4.612  1.00 0.00 ? 22 VAL A HG22 6  
ATOM   3579  H HG23 . VAL A 1 5  ? 11.739 6.425  -3.345  1.00 0.00 ? 22 VAL A HG23 6  
ATOM   3580  N N    . ALA A 1 6  ? 12.906 10.370 -1.206  1.00 0.00 ? 23 ALA A N    6  
ATOM   3581  C CA   . ALA A 1 6  ? 13.300 11.750 -0.948  1.00 0.00 ? 23 ALA A CA   6  
ATOM   3582  C C    . ALA A 1 6  ? 13.444 12.534 -2.246  1.00 0.00 ? 23 ALA A C    6  
ATOM   3583  O O    . ALA A 1 6  ? 14.142 12.106 -3.166  1.00 0.00 ? 23 ALA A O    6  
ATOM   3584  C CB   . ALA A 1 6  ? 14.598 11.790 -0.154  1.00 0.00 ? 23 ALA A CB   6  
ATOM   3585  H H    . ALA A 1 6  ? 13.622 9.664  -1.302  1.00 0.00 ? 23 ALA A H    6  
ATOM   3586  H HA   . ALA A 1 6  ? 12.519 12.233 -0.362  1.00 0.00 ? 23 ALA A HA   6  
ATOM   3587  H HB1  . ALA A 1 6  ? 15.386 11.298 -0.719  1.00 0.00 ? 23 ALA A HB1  6  
ATOM   3588  H HB2  . ALA A 1 6  ? 14.877 12.827 0.031   1.00 0.00 ? 23 ALA A HB2  6  
ATOM   3589  H HB3  . ALA A 1 6  ? 14.458 11.279 0.799   1.00 0.00 ? 23 ALA A HB3  6  
ATOM   3590  N N    . ILE A 1 7  ? 12.782 13.684 -2.313  1.00 0.00 ? 24 ILE A N    6  
ATOM   3591  C CA   . ILE A 1 7  ? 12.801 14.508 -3.516  1.00 0.00 ? 24 ILE A CA   6  
ATOM   3592  C C    . ILE A 1 7  ? 13.263 15.926 -3.203  1.00 0.00 ? 24 ILE A C    6  
ATOM   3593  O O    . ILE A 1 7  ? 12.812 16.537 -2.234  1.00 0.00 ? 24 ILE A O    6  
ATOM   3594  C CB   . ILE A 1 7  ? 11.414 14.566 -4.183  1.00 0.00 ? 24 ILE A CB   6  
ATOM   3595  C CG1  . ILE A 1 7  ? 10.955 13.161 -4.581  1.00 0.00 ? 24 ILE A CG1  6  
ATOM   3596  C CG2  . ILE A 1 7  ? 11.446 15.483 -5.397  1.00 0.00 ? 24 ILE A CG2  6  
ATOM   3597  C CD1  . ILE A 1 7  ? 11.816 12.515 -5.643  1.00 0.00 ? 24 ILE A CD1  6  
ATOM   3598  H H    . ILE A 1 7  ? 12.252 13.994 -1.512  1.00 0.00 ? 24 ILE A H    6  
ATOM   3599  H HA   . ILE A 1 7  ? 13.531 14.131 -4.229  1.00 0.00 ? 24 ILE A HA   6  
ATOM   3600  H HB   . ILE A 1 7  ? 10.688 14.941 -3.463  1.00 0.00 ? 24 ILE A HB   6  
ATOM   3601  H HG12 . ILE A 1 7  ? 10.967 12.548 -3.681  1.00 0.00 ? 24 ILE A HG12 6  
ATOM   3602  H HG13 . ILE A 1 7  ? 9.932  13.246 -4.947  1.00 0.00 ? 24 ILE A HG13 6  
ATOM   3603  H HG21 . ILE A 1 7  ? 10.459 15.511 -5.857  1.00 0.00 ? 24 ILE A HG21 6  
ATOM   3604  H HG22 . ILE A 1 7  ? 11.730 16.487 -5.086  1.00 0.00 ? 24 ILE A HG22 6  
ATOM   3605  H HG23 . ILE A 1 7  ? 12.172 15.107 -6.118  1.00 0.00 ? 24 ILE A HG23 6  
ATOM   3606  H HD11 . ILE A 1 7  ? 12.839 12.428 -5.279  1.00 0.00 ? 24 ILE A HD11 6  
ATOM   3607  H HD12 . ILE A 1 7  ? 11.428 11.522 -5.872  1.00 0.00 ? 24 ILE A HD12 6  
ATOM   3608  H HD13 . ILE A 1 7  ? 11.803 13.126 -6.545  1.00 0.00 ? 24 ILE A HD13 6  
ATOM   3609  N N    . SER A 1 8  ? 14.164 16.445 -4.031  1.00 0.00 ? 25 SER A N    6  
ATOM   3610  C CA   . SER A 1 8  ? 14.784 17.740 -3.775  1.00 0.00 ? 25 SER A CA   6  
ATOM   3611  C C    . SER A 1 8  ? 13.836 18.881 -4.118  1.00 0.00 ? 25 SER A C    6  
ATOM   3612  O O    . SER A 1 8  ? 13.867 19.938 -3.487  1.00 0.00 ? 25 SER A O    6  
ATOM   3613  C CB   . SER A 1 8  ? 16.072 17.867 -4.563  1.00 0.00 ? 25 SER A CB   6  
ATOM   3614  O OG   . SER A 1 8  ? 15.845 17.879 -5.946  1.00 0.00 ? 25 SER A OG   6  
ATOM   3615  H H    . SER A 1 8  ? 14.427 15.929 -4.858  1.00 0.00 ? 25 SER A H    6  
ATOM   3616  H HA   . SER A 1 8  ? 15.144 17.852 -2.751  1.00 0.00 ? 25 SER A HA   6  
ATOM   3617  H HB2  . SER A 1 8  ? 16.565 18.796 -4.277  1.00 0.00 ? 25 SER A HB2  6  
ATOM   3618  H HB3  . SER A 1 8  ? 16.717 17.024 -4.317  1.00 0.00 ? 25 SER A HB3  6  
ATOM   3619  H HG   . SER A 1 8  ? 16.680 17.984 -6.406  1.00 0.00 ? 25 SER A HG   6  
ATOM   3620  N N    . ASP A 1 9  ? 12.993 18.662 -5.122  1.00 0.00 ? 26 ASP A N    6  
ATOM   3621  C CA   . ASP A 1 9  ? 11.998 19.651 -5.517  1.00 0.00 ? 26 ASP A CA   6  
ATOM   3622  C C    . ASP A 1 9  ? 10.937 19.036 -6.421  1.00 0.00 ? 26 ASP A C    6  
ATOM   3623  O O    . ASP A 1 9  ? 11.183 18.032 -7.088  1.00 0.00 ? 26 ASP A O    6  
ATOM   3624  C CB   . ASP A 1 9  ? 12.667 20.835 -6.222  1.00 0.00 ? 26 ASP A CB   6  
ATOM   3625  C CG   . ASP A 1 9  ? 11.834 22.110 -6.238  1.00 0.00 ? 26 ASP A CG   6  
ATOM   3626  O OD1  . ASP A 1 9  ? 10.738 22.086 -5.731  1.00 0.00 ? 26 ASP A OD1  6  
ATOM   3627  O OD2  . ASP A 1 9  ? 12.358 23.132 -6.612  1.00 0.00 ? 26 ASP A OD2  6  
ATOM   3628  H H    . ASP A 1 9  ? 13.045 17.788 -5.625  1.00 0.00 ? 26 ASP A H    6  
ATOM   3629  H HA   . ASP A 1 9  ? 11.476 20.022 -4.635  1.00 0.00 ? 26 ASP A HA   6  
ATOM   3630  H HB2  . ASP A 1 9  ? 13.665 21.057 -5.844  1.00 0.00 ? 26 ASP A HB2  6  
ATOM   3631  H HB3  . ASP A 1 9  ? 12.741 20.437 -7.235  1.00 0.00 ? 26 ASP A HB3  6  
ATOM   3632  N N    . ALA A 1 10 ? 9.756  19.643 -6.437  1.00 0.00 ? 27 ALA A N    6  
ATOM   3633  C CA   . ALA A 1 10 ? 8.660  19.167 -7.273  1.00 0.00 ? 27 ALA A CA   6  
ATOM   3634  C C    . ALA A 1 10 ? 8.999  19.301 -8.752  1.00 0.00 ? 27 ALA A C    6  
ATOM   3635  O O    . ALA A 1 10 ? 8.469  18.570 -9.589  1.00 0.00 ? 27 ALA A O    6  
ATOM   3636  C CB   . ALA A 1 10 ? 7.380  19.922 -6.949  1.00 0.00 ? 27 ALA A CB   6  
ATOM   3637  H H    . ALA A 1 10 ? 9.613  20.457 -5.855  1.00 0.00 ? 27 ALA A H    6  
ATOM   3638  H HA   . ALA A 1 10 ? 8.502  18.108 -7.071  1.00 0.00 ? 27 ALA A HA   6  
ATOM   3639  H HB1  . ALA A 1 10 ? 7.528  20.984 -7.132  1.00 0.00 ? 27 ALA A HB1  6  
ATOM   3640  H HB2  . ALA A 1 10 ? 6.572  19.553 -7.582  1.00 0.00 ? 27 ALA A HB2  6  
ATOM   3641  H HB3  . ALA A 1 10 ? 7.120  19.765 -5.902  1.00 0.00 ? 27 ALA A HB3  6  
ATOM   3642  N N    . ALA A 1 11 ? 9.885  20.239 -9.069  1.00 0.00 ? 28 ALA A N    6  
ATOM   3643  C CA   . ALA A 1 11 ? 10.349 20.423 -10.439 1.00 0.00 ? 28 ALA A CA   6  
ATOM   3644  C C    . ALA A 1 11 ? 11.131 19.210 -10.925 1.00 0.00 ? 28 ALA A C    6  
ATOM   3645  O O    . ALA A 1 11 ? 11.205 18.949 -12.126 1.00 0.00 ? 28 ALA A O    6  
ATOM   3646  C CB   . ALA A 1 11 ? 11.197 21.683 -10.546 1.00 0.00 ? 28 ALA A CB   6  
ATOM   3647  H H    . ALA A 1 11 ? 10.248 20.838 -8.342  1.00 0.00 ? 28 ALA A H    6  
ATOM   3648  H HA   . ALA A 1 11 ? 9.481  20.533 -11.090 1.00 0.00 ? 28 ALA A HA   6  
ATOM   3649  H HB1  . ALA A 1 11 ? 12.061 21.595 -9.889  1.00 0.00 ? 28 ALA A HB1  6  
ATOM   3650  H HB2  . ALA A 1 11 ? 11.534 21.807 -11.576 1.00 0.00 ? 28 ALA A HB2  6  
ATOM   3651  H HB3  . ALA A 1 11 ? 10.603 22.548 -10.253 1.00 0.00 ? 28 ALA A HB3  6  
ATOM   3652  N N    . GLN A 1 12 ? 11.711 18.472 -9.986  1.00 0.00 ? 29 GLN A N    6  
ATOM   3653  C CA   . GLN A 1 12 ? 12.589 17.356 -10.322 1.00 0.00 ? 29 GLN A CA   6  
ATOM   3654  C C    . GLN A 1 12 ? 11.791 16.080 -10.555 1.00 0.00 ? 29 GLN A C    6  
ATOM   3655  O O    . GLN A 1 12 ? 12.140 15.265 -11.409 1.00 0.00 ? 29 GLN A O    6  
ATOM   3656  C CB   . GLN A 1 12 ? 13.615 17.128 -9.210  1.00 0.00 ? 29 GLN A CB   6  
ATOM   3657  C CG   . GLN A 1 12 ? 14.535 18.312 -8.960  1.00 0.00 ? 29 GLN A CG   6  
ATOM   3658  C CD   . GLN A 1 12 ? 15.294 18.729 -10.205 1.00 0.00 ? 29 GLN A CD   6  
ATOM   3659  O OE1  . GLN A 1 12 ? 15.890 17.896 -10.894 1.00 0.00 ? 29 GLN A OE1  6  
ATOM   3660  N NE2  . GLN A 1 12 ? 15.279 20.023 -10.501 1.00 0.00 ? 29 GLN A NE2  6  
ATOM   3661  H H    . GLN A 1 12 ? 11.542 18.689 -9.015  1.00 0.00 ? 29 GLN A H    6  
ATOM   3662  H HA   . GLN A 1 12 ? 13.111 17.570 -11.255 1.00 0.00 ? 29 GLN A HA   6  
ATOM   3663  H HB2  . GLN A 1 12 ? 13.054 16.900 -8.304  1.00 0.00 ? 29 GLN A HB2  6  
ATOM   3664  H HB3  . GLN A 1 12 ? 14.205 16.259 -9.499  1.00 0.00 ? 29 GLN A HB3  6  
ATOM   3665  H HG2  . GLN A 1 12 ? 14.207 19.217 -8.450  1.00 0.00 ? 29 GLN A HG2  6  
ATOM   3666  H HG3  . GLN A 1 12 ? 15.215 17.758 -8.312  1.00 0.00 ? 29 GLN A HG3  6  
ATOM   3667  H HE21 . GLN A 1 12 ? 14.784 20.665 -9.914  1.00 0.00 ? 29 GLN A HE21 6  
ATOM   3668  H HE22 . GLN A 1 12 ? 15.762 20.358 -11.311 1.00 0.00 ? 29 GLN A HE22 6  
ATOM   3669  N N    . LEU A 1 13 ? 10.718 15.910 -9.789  1.00 0.00 ? 30 LEU A N    6  
ATOM   3670  C CA   . LEU A 1 13 ? 9.886  14.718 -9.890  1.00 0.00 ? 30 LEU A CA   6  
ATOM   3671  C C    . LEU A 1 13 ? 9.016  14.757 -11.141 1.00 0.00 ? 30 LEU A C    6  
ATOM   3672  O O    . LEU A 1 13 ? 8.191  15.655 -11.307 1.00 0.00 ? 30 LEU A O    6  
ATOM   3673  C CB   . LEU A 1 13 ? 9.012  14.574 -8.637  1.00 0.00 ? 30 LEU A CB   6  
ATOM   3674  C CG   . LEU A 1 13 ? 8.169  13.294 -8.573  1.00 0.00 ? 30 LEU A CG   6  
ATOM   3675  C CD1  . LEU A 1 13 ? 9.074  12.079 -8.418  1.00 0.00 ? 30 LEU A CD1  6  
ATOM   3676  C CD2  . LEU A 1 13 ? 7.189  13.388 -7.414  1.00 0.00 ? 30 LEU A CD2  6  
ATOM   3677  H H    . LEU A 1 13 ? 10.473 16.626 -9.120  1.00 0.00 ? 30 LEU A H    6  
ATOM   3678  H HA   . LEU A 1 13 ? 10.519 13.837 -9.983  1.00 0.00 ? 30 LEU A HA   6  
ATOM   3679  H HB2  . LEU A 1 13 ? 9.794  14.545 -7.880  1.00 0.00 ? 30 LEU A HB2  6  
ATOM   3680  H HB3  . LEU A 1 13 ? 8.385  15.451 -8.480  1.00 0.00 ? 30 LEU A HB3  6  
ATOM   3681  H HG   . LEU A 1 13 ? 7.590  13.241 -9.496  1.00 0.00 ? 30 LEU A HG   6  
ATOM   3682  H HD11 . LEU A 1 13 ? 8.466  11.175 -8.373  1.00 0.00 ? 30 LEU A HD11 6  
ATOM   3683  H HD12 . LEU A 1 13 ? 9.751  12.019 -9.270  1.00 0.00 ? 30 LEU A HD12 6  
ATOM   3684  H HD13 . LEU A 1 13 ? 9.653  12.173 -7.499  1.00 0.00 ? 30 LEU A HD13 6  
ATOM   3685  H HD21 . LEU A 1 13 ? 6.533  14.246 -7.560  1.00 0.00 ? 30 LEU A HD21 6  
ATOM   3686  H HD22 . LEU A 1 13 ? 6.589  12.478 -7.370  1.00 0.00 ? 30 LEU A HD22 6  
ATOM   3687  H HD23 . LEU A 1 13 ? 7.738  13.507 -6.480  1.00 0.00 ? 30 LEU A HD23 6  
ATOM   3688  N N    . PRO A 1 14 ? 9.207  13.778 -12.018 1.00 0.00 ? 31 PRO A N    6  
ATOM   3689  C CA   . PRO A 1 14 ? 8.405  13.670 -13.232 1.00 0.00 ? 31 PRO A CA   6  
ATOM   3690  C C    . PRO A 1 14 ? 6.932  13.462 -12.902 1.00 0.00 ? 31 PRO A C    6  
ATOM   3691  O O    . PRO A 1 14 ? 6.592  12.823 -11.908 1.00 0.00 ? 31 PRO A O    6  
ATOM   3692  C CB   . PRO A 1 14 ? 9.005  12.470 -13.971 1.00 0.00 ? 31 PRO A CB   6  
ATOM   3693  C CG   . PRO A 1 14 ? 10.372 12.324 -13.394 1.00 0.00 ? 31 PRO A CG   6  
ATOM   3694  C CD   . PRO A 1 14 ? 10.239 12.717 -11.948 1.00 0.00 ? 31 PRO A CD   6  
ATOM   3695  H HA   . PRO A 1 14 ? 8.433  14.584 -13.843 1.00 0.00 ? 31 PRO A HA   6  
ATOM   3696  H HB2  . PRO A 1 14 ? 8.407  11.560 -13.814 1.00 0.00 ? 31 PRO A HB2  6  
ATOM   3697  H HB3  . PRO A 1 14 ? 9.046  12.645 -15.056 1.00 0.00 ? 31 PRO A HB3  6  
ATOM   3698  H HG2  . PRO A 1 14 ? 10.737 11.290 -13.492 1.00 0.00 ? 31 PRO A HG2  6  
ATOM   3699  H HG3  . PRO A 1 14 ? 11.094 12.970 -13.916 1.00 0.00 ? 31 PRO A HG3  6  
ATOM   3700  H HD2  . PRO A 1 14 ? 9.920  11.877 -11.315 1.00 0.00 ? 31 PRO A HD2  6  
ATOM   3701  H HD3  . PRO A 1 14 ? 11.185 13.092 -11.530 1.00 0.00 ? 31 PRO A HD3  6  
ATOM   3702  N N    . HIS A 1 15 ? 6.061  14.007 -13.745 1.00 0.00 ? 32 HIS A N    6  
ATOM   3703  C CA   . HIS A 1 15 ? 4.637  13.697 -13.681 1.00 0.00 ? 32 HIS A CA   6  
ATOM   3704  C C    . HIS A 1 15 ? 4.375  12.241 -14.048 1.00 0.00 ? 32 HIS A C    6  
ATOM   3705  O O    . HIS A 1 15 ? 5.145  11.629 -14.789 1.00 0.00 ? 32 HIS A O    6  
ATOM   3706  C CB   . HIS A 1 15 ? 3.840  14.622 -14.607 1.00 0.00 ? 32 HIS A CB   6  
ATOM   3707  C CG   . HIS A 1 15 ? 3.622  15.992 -14.044 1.00 0.00 ? 32 HIS A CG   6  
ATOM   3708  N ND1  . HIS A 1 15 ? 2.798  16.230 -12.964 1.00 0.00 ? 32 HIS A ND1  6  
ATOM   3709  C CD2  . HIS A 1 15 ? 4.118  17.197 -14.412 1.00 0.00 ? 32 HIS A CD2  6  
ATOM   3710  C CE1  . HIS A 1 15 ? 2.798  17.523 -12.691 1.00 0.00 ? 32 HIS A CE1  6  
ATOM   3711  N NE2  . HIS A 1 15 ? 3.590  18.131 -13.554 1.00 0.00 ? 32 HIS A NE2  6  
ATOM   3712  H H    . HIS A 1 15 ? 6.393  14.653 -14.446 1.00 0.00 ? 32 HIS A H    6  
ATOM   3713  H HA   . HIS A 1 15 ? 4.278  13.829 -12.662 1.00 0.00 ? 32 HIS A HA   6  
ATOM   3714  H HB2  . HIS A 1 15 ? 4.368  14.754 -15.552 1.00 0.00 ? 32 HIS A HB2  6  
ATOM   3715  H HB3  . HIS A 1 15 ? 2.853  14.202 -14.798 1.00 0.00 ? 32 HIS A HB3  6  
ATOM   3716  H HD1  . HIS A 1 15 ? 2.336  15.537 -12.409 1.00 0.00 ? 32 HIS A HD1  6  
ATOM   3717  H HD2  . HIS A 1 15 ? 4.800  17.507 -15.204 1.00 0.00 ? 32 HIS A HD2  6  
ATOM   3718  H HE1  . HIS A 1 15 ? 2.205  17.916 -11.864 1.00 0.00 ? 32 HIS A HE1  6  
ATOM   3719  N N    . ASP A 1 16 ? 3.284  11.693 -13.526 1.00 0.00 ? 33 ASP A N    6  
ATOM   3720  C CA   . ASP A 1 16 ? 2.315  12.481 -12.773 1.00 0.00 ? 33 ASP A CA   6  
ATOM   3721  C C    . ASP A 1 16 ? 2.588  12.406 -11.276 1.00 0.00 ? 33 ASP A C    6  
ATOM   3722  O O    . ASP A 1 16 ? 3.096  11.401 -10.778 1.00 0.00 ? 33 ASP A O    6  
ATOM   3723  C CB   . ASP A 1 16 ? 0.890  12.008 -13.072 1.00 0.00 ? 33 ASP A CB   6  
ATOM   3724  C CG   . ASP A 1 16 ? 0.455  12.200 -14.518 1.00 0.00 ? 33 ASP A CG   6  
ATOM   3725  O OD1  . ASP A 1 16 ? 0.628  13.280 -15.033 1.00 0.00 ? 33 ASP A OD1  6  
ATOM   3726  O OD2  . ASP A 1 16 ? 0.099  11.230 -15.143 1.00 0.00 ? 33 ASP A OD2  6  
ATOM   3727  H H    . ASP A 1 16 ? 3.121  10.705 -13.654 1.00 0.00 ? 33 ASP A H    6  
ATOM   3728  H HA   . ASP A 1 16 ? 2.399  13.532 -13.051 1.00 0.00 ? 33 ASP A HA   6  
ATOM   3729  H HB2  . ASP A 1 16 ? 0.702  10.978 -12.770 1.00 0.00 ? 33 ASP A HB2  6  
ATOM   3730  H HB3  . ASP A 1 16 ? 0.325  12.685 -12.430 1.00 0.00 ? 33 ASP A HB3  6  
ATOM   3731  N N    . TYR A 1 17 ? 2.248  13.474 -10.563 1.00 0.00 ? 34 TYR A N    6  
ATOM   3732  C CA   . TYR A 1 17 ? 2.340  13.485 -9.109  1.00 0.00 ? 34 TYR A CA   6  
ATOM   3733  C C    . TYR A 1 17 ? 1.410  14.530 -8.506  1.00 0.00 ? 34 TYR A C    6  
ATOM   3734  O O    . TYR A 1 17 ? 0.889  15.392 -9.212  1.00 0.00 ? 34 TYR A O    6  
ATOM   3735  C CB   . TYR A 1 17 ? 3.780  13.747 -8.664  1.00 0.00 ? 34 TYR A CB   6  
ATOM   3736  C CG   . TYR A 1 17 ? 4.292  15.124 -9.024  1.00 0.00 ? 34 TYR A CG   6  
ATOM   3737  C CD1  . TYR A 1 17 ? 4.080  16.205 -8.180  1.00 0.00 ? 34 TYR A CD1  6  
ATOM   3738  C CD2  . TYR A 1 17 ? 4.988  15.338 -10.204 1.00 0.00 ? 34 TYR A CD2  6  
ATOM   3739  C CE1  . TYR A 1 17 ? 4.546  17.465 -8.503  1.00 0.00 ? 34 TYR A CE1  6  
ATOM   3740  C CE2  . TYR A 1 17 ? 5.458  16.594 -10.537 1.00 0.00 ? 34 TYR A CE2  6  
ATOM   3741  C CZ   . TYR A 1 17 ? 5.235  17.655 -9.684  1.00 0.00 ? 34 TYR A CZ   6  
ATOM   3742  O OH   . TYR A 1 17 ? 5.702  18.908 -10.011 1.00 0.00 ? 34 TYR A OH   6  
ATOM   3743  H H    . TYR A 1 17 ? 1.918  14.300 -11.041 1.00 0.00 ? 34 TYR A H    6  
ATOM   3744  H HA   . TYR A 1 17 ? 2.023  12.521 -8.710  1.00 0.00 ? 34 TYR A HA   6  
ATOM   3745  H HB2  . TYR A 1 17 ? 3.814  13.617 -7.581  1.00 0.00 ? 34 TYR A HB2  6  
ATOM   3746  H HB3  . TYR A 1 17 ? 4.406  12.991 -9.139  1.00 0.00 ? 34 TYR A HB3  6  
ATOM   3747  H HD1  . TYR A 1 17 ? 3.536  16.047 -7.250  1.00 0.00 ? 34 TYR A HD1  6  
ATOM   3748  H HD2  . TYR A 1 17 ? 5.160  14.496 -10.873 1.00 0.00 ? 34 TYR A HD2  6  
ATOM   3749  H HE1  . TYR A 1 17 ? 4.372  18.305 -7.831  1.00 0.00 ? 34 TYR A HE1  6  
ATOM   3750  H HE2  . TYR A 1 17 ? 6.001  16.743 -11.471 1.00 0.00 ? 34 TYR A HE2  6  
ATOM   3751  H HH   . TYR A 1 17 ? 6.660  18.968 -9.992  1.00 0.00 ? 34 TYR A HH   6  
ATOM   3752  N N    . CYS A 1 18 ? 1.205  14.447 -7.195  1.00 0.00 ? 35 CYS A N    6  
ATOM   3753  C CA   . CYS A 1 18 ? 0.392  15.427 -6.484  1.00 0.00 ? 35 CYS A CA   6  
ATOM   3754  C C    . CYS A 1 18 ? 1.164  16.048 -5.327  1.00 0.00 ? 35 CYS A C    6  
ATOM   3755  O O    . CYS A 1 18 ? 2.097  15.445 -4.796  1.00 0.00 ? 35 CYS A O    6  
ATOM   3756  C CB   . CYS A 1 18 ? -0.772 14.584 -5.963  1.00 0.00 ? 35 CYS A CB   6  
ATOM   3757  S SG   . CYS A 1 18 ? -1.778 13.814 -7.255  1.00 0.00 ? 35 CYS A SG   6  
ATOM   3758  H H    . CYS A 1 18 ? 1.623  13.687 -6.679  1.00 0.00 ? 35 CYS A H    6  
ATOM   3759  H HA   . CYS A 1 18 ? -0.006 16.210 -7.128  1.00 0.00 ? 35 CYS A HA   6  
ATOM   3760  H HB2  . CYS A 1 18 ? -0.400 13.767 -5.343  1.00 0.00 ? 35 CYS A HB2  6  
ATOM   3761  H HB3  . CYS A 1 18 ? -1.453 15.203 -5.378  1.00 0.00 ? 35 CYS A HB3  6  
ATOM   3762  H HG   . CYS A 1 18 ? -2.626 13.211 -6.428  1.00 0.00 ? 35 CYS A HG   6  
ATOM   3763  N N    . THR A 1 19 ? 0.772  17.257 -4.942  1.00 0.00 ? 36 THR A N    6  
ATOM   3764  C CA   . THR A 1 19 ? 1.459  17.983 -3.880  1.00 0.00 ? 36 THR A CA   6  
ATOM   3765  C C    . THR A 1 19 ? 0.468  18.542 -2.865  1.00 0.00 ? 36 THR A C    6  
ATOM   3766  O O    . THR A 1 19 ? -0.599 19.033 -3.231  1.00 0.00 ? 36 THR A O    6  
ATOM   3767  C CB   . THR A 1 19 ? 2.307  19.138 -4.443  1.00 0.00 ? 36 THR A CB   6  
ATOM   3768  O OG1  . THR A 1 19 ? 3.241  18.626 -5.401  1.00 0.00 ? 36 THR A OG1  6  
ATOM   3769  C CG2  . THR A 1 19 ? 3.066  19.838 -3.325  1.00 0.00 ? 36 THR A CG2  6  
ATOM   3770  H H    . THR A 1 19 ? -0.023 17.684 -5.395  1.00 0.00 ? 36 THR A H    6  
ATOM   3771  H HA   . THR A 1 19 ? 2.112  17.305 -3.331  1.00 0.00 ? 36 THR A HA   6  
ATOM   3772  H HB   . THR A 1 19 ? 1.649  19.853 -4.937  1.00 0.00 ? 36 THR A HB   6  
ATOM   3773  H HG1  . THR A 1 19 ? 3.769  19.347 -5.752  1.00 0.00 ? 36 THR A HG1  6  
ATOM   3774  H HG21 . THR A 1 19 ? 3.724  19.123 -2.833  1.00 0.00 ? 36 THR A HG21 6  
ATOM   3775  H HG22 . THR A 1 19 ? 3.659  20.651 -3.743  1.00 0.00 ? 36 THR A HG22 6  
ATOM   3776  H HG23 . THR A 1 19 ? 2.357  20.238 -2.601  1.00 0.00 ? 36 THR A HG23 6  
HETATM 3777  N N    . TPO A 1 20 ? 0.830  18.464 -1.589  1.00 0.00 ? 37 TPO A N    6  
HETATM 3778  C CA   . TPO A 1 20 ? -0.008 18.998 -0.522  1.00 0.00 ? 37 TPO A CA   6  
HETATM 3779  C CB   . TPO A 1 20 ? -0.029 18.063 0.702   1.00 0.00 ? 37 TPO A CB   6  
HETATM 3780  C CG2  . TPO A 1 20 ? -0.242 16.621 0.268   1.00 0.00 ? 37 TPO A CG2  6  
HETATM 3781  O OG1  . TPO A 1 20 ? 1.216  18.167 1.406   1.00 0.00 ? 37 TPO A OG1  6  
HETATM 3782  P P    . TPO A 1 20 ? 1.295  17.836 2.983   1.00 0.00 ? 37 TPO A P    6  
HETATM 3783  O O1P  . TPO A 1 20 ? 2.767  18.045 3.424   1.00 0.00 ? 37 TPO A O1P  6  
HETATM 3784  O O2P  . TPO A 1 20 ? 0.848  16.362 3.168   1.00 0.00 ? 37 TPO A O2P  6  
HETATM 3785  O O3P  . TPO A 1 20 ? 0.338  18.817 3.709   1.00 0.00 ? 37 TPO A O3P  6  
HETATM 3786  C C    . TPO A 1 20 ? 0.469  20.378 -0.086  1.00 0.00 ? 37 TPO A C    6  
HETATM 3787  O O    . TPO A 1 20 ? 1.597  20.776 -0.377  1.00 0.00 ? 37 TPO A O    6  
HETATM 3788  H H    . TPO A 1 20 ? 1.708  18.024 -1.352  1.00 0.00 ? 37 TPO A H    6  
HETATM 3789  H HA   . TPO A 1 20 ? -1.029 19.125 -0.882  1.00 0.00 ? 37 TPO A HA   6  
HETATM 3790  H HB   . TPO A 1 20 ? -0.838 18.366 1.365   1.00 0.00 ? 37 TPO A HB   6  
HETATM 3791  H HG21 . TPO A 1 20 ? -0.254 15.976 1.146   1.00 0.00 ? 37 TPO A HG21 6  
HETATM 3792  H HG22 . TPO A 1 20 ? -1.193 16.537 -0.259  1.00 0.00 ? 37 TPO A HG22 6  
HETATM 3793  H HG23 . TPO A 1 20 ? 0.568  16.318 -0.395  1.00 0.00 ? 37 TPO A HG23 6  
ATOM   3794  N N    . PRO A 1 21 ? -0.397 21.103 0.614   1.00 0.00 ? 38 PRO A N    6  
ATOM   3795  C CA   . PRO A 1 21 ? -0.103 22.476 1.009   1.00 0.00 ? 38 PRO A CA   6  
ATOM   3796  C C    . PRO A 1 21 ? 1.201  22.555 1.793   1.00 0.00 ? 38 PRO A C    6  
ATOM   3797  O O    . PRO A 1 21 ? 1.919  23.552 1.721   1.00 0.00 ? 38 PRO A O    6  
ATOM   3798  C CB   . PRO A 1 21 ? -1.312 22.888 1.855   1.00 0.00 ? 38 PRO A CB   6  
ATOM   3799  C CG   . PRO A 1 21 ? -2.435 22.066 1.325   1.00 0.00 ? 38 PRO A CG   6  
ATOM   3800  C CD   . PRO A 1 21 ? -1.821 20.741 0.956   1.00 0.00 ? 38 PRO A CD   6  
ATOM   3801  H HA   . PRO A 1 21 ? 0.042  23.145 0.148   1.00 0.00 ? 38 PRO A HA   6  
ATOM   3802  H HB2  . PRO A 1 21 ? -1.142 22.689 2.924   1.00 0.00 ? 38 PRO A HB2  6  
ATOM   3803  H HB3  . PRO A 1 21 ? -1.524 23.963 1.758   1.00 0.00 ? 38 PRO A HB3  6  
ATOM   3804  H HG2  . PRO A 1 21 ? -3.227 21.939 2.078   1.00 0.00 ? 38 PRO A HG2  6  
ATOM   3805  H HG3  . PRO A 1 21 ? -2.899 22.543 0.449   1.00 0.00 ? 38 PRO A HG3  6  
ATOM   3806  H HD2  . PRO A 1 21 ? -1.855 20.021 1.787   1.00 0.00 ? 38 PRO A HD2  6  
ATOM   3807  H HD3  . PRO A 1 21 ? -2.329 20.270 0.103   1.00 0.00 ? 38 PRO A HD3  6  
ATOM   3808  N N    . GLY A 1 22 ? 1.501  21.500 2.541   1.00 0.00 ? 39 GLY A N    6  
ATOM   3809  C CA   . GLY A 1 22 ? 2.713  21.453 3.350   1.00 0.00 ? 39 GLY A CA   6  
ATOM   3810  C C    . GLY A 1 22 ? 3.959  21.449 2.475   1.00 0.00 ? 39 GLY A C    6  
ATOM   3811  O O    . GLY A 1 22 ? 5.017  21.930 2.883   1.00 0.00 ? 39 GLY A O    6  
ATOM   3812  H H    . GLY A 1 22 ? 0.873  20.708 2.550   1.00 0.00 ? 39 GLY A H    6  
ATOM   3813  H HA2  . GLY A 1 22 ? 2.739  22.326 4.003   1.00 0.00 ? 39 GLY A HA2  6  
ATOM   3814  H HA3  . GLY A 1 22 ? 2.702  20.548 3.957   1.00 0.00 ? 39 GLY A HA3  6  
ATOM   3815  N N    . GLY A 1 23 ? 3.828  20.903 1.271   1.00 0.00 ? 40 GLY A N    6  
ATOM   3816  C CA   . GLY A 1 23 ? 4.935  20.868 0.321   1.00 0.00 ? 40 GLY A CA   6  
ATOM   3817  C C    . GLY A 1 23 ? 5.417  19.441 0.093   1.00 0.00 ? 40 GLY A C    6  
ATOM   3818  O O    . GLY A 1 23 ? 6.391  19.213 -0.626  1.00 0.00 ? 40 GLY A O    6  
ATOM   3819  H H    . GLY A 1 23 ? 2.940  20.504 1.005   1.00 0.00 ? 40 GLY A H    6  
ATOM   3820  H HA2  . GLY A 1 23 ? 4.604  21.287 -0.628  1.00 0.00 ? 40 GLY A HA2  6  
ATOM   3821  H HA3  . GLY A 1 23 ? 5.759  21.463 0.713   1.00 0.00 ? 40 GLY A HA3  6  
ATOM   3822  N N    . THR A 1 24 ? 4.732  18.484 0.708   1.00 0.00 ? 41 THR A N    6  
ATOM   3823  C CA   . THR A 1 24 ? 5.065  17.075 0.540   1.00 0.00 ? 41 THR A CA   6  
ATOM   3824  C C    . THR A 1 24 ? 4.339  16.476 -0.659  1.00 0.00 ? 41 THR A C    6  
ATOM   3825  O O    . THR A 1 24 ? 3.161  16.752 -0.885  1.00 0.00 ? 41 THR A O    6  
ATOM   3826  C CB   . THR A 1 24 ? 4.716  16.257 1.798   1.00 0.00 ? 41 THR A CB   6  
ATOM   3827  O OG1  . THR A 1 24 ? 5.396  16.808 2.933   1.00 0.00 ? 41 THR A OG1  6  
ATOM   3828  C CG2  . THR A 1 24 ? 5.128  14.804 1.622   1.00 0.00 ? 41 THR A CG2  6  
ATOM   3829  H H    . THR A 1 24 ? 3.962  18.739 1.308   1.00 0.00 ? 41 THR A H    6  
ATOM   3830  H HA   . THR A 1 24 ? 6.131  16.968 0.339   1.00 0.00 ? 41 THR A HA   6  
ATOM   3831  H HB   . THR A 1 24 ? 3.641  16.311 1.969   1.00 0.00 ? 41 THR A HB   6  
ATOM   3832  H HG1  . THR A 1 24 ? 4.791  17.365 3.429   1.00 0.00 ? 41 THR A HG1  6  
ATOM   3833  H HG21 . THR A 1 24 ? 6.202  14.750 1.452   1.00 0.00 ? 41 THR A HG21 6  
ATOM   3834  H HG22 . THR A 1 24 ? 4.874  14.242 2.520   1.00 0.00 ? 41 THR A HG22 6  
ATOM   3835  H HG23 . THR A 1 24 ? 4.604  14.379 0.766   1.00 0.00 ? 41 THR A HG23 6  
ATOM   3836  N N    . LEU A 1 25 ? 5.050  15.656 -1.425  1.00 0.00 ? 42 LEU A N    6  
ATOM   3837  C CA   . LEU A 1 25 ? 4.515  15.113 -2.668  1.00 0.00 ? 42 LEU A CA   6  
ATOM   3838  C C    . LEU A 1 25 ? 4.084  13.662 -2.496  1.00 0.00 ? 42 LEU A C    6  
ATOM   3839  O O    . LEU A 1 25 ? 4.490  12.992 -1.548  1.00 0.00 ? 42 LEU A O    6  
ATOM   3840  C CB   . LEU A 1 25 ? 5.557  15.231 -3.789  1.00 0.00 ? 42 LEU A CB   6  
ATOM   3841  C CG   . LEU A 1 25 ? 5.593  16.586 -4.507  1.00 0.00 ? 42 LEU A CG   6  
ATOM   3842  C CD1  . LEU A 1 25 ? 6.112  17.664 -3.564  1.00 0.00 ? 42 LEU A CD1  6  
ATOM   3843  C CD2  . LEU A 1 25 ? 6.471  16.483 -5.744  1.00 0.00 ? 42 LEU A CD2  6  
ATOM   3844  H H    . LEU A 1 25 ? 5.985  15.401 -1.138  1.00 0.00 ? 42 LEU A H    6  
ATOM   3845  H HA   . LEU A 1 25 ? 3.624  15.670 -2.955  1.00 0.00 ? 42 LEU A HA   6  
ATOM   3846  H HB2  . LEU A 1 25 ? 6.464  15.095 -3.202  1.00 0.00 ? 42 LEU A HB2  6  
ATOM   3847  H HB3  . LEU A 1 25 ? 5.467  14.420 -4.511  1.00 0.00 ? 42 LEU A HB3  6  
ATOM   3848  H HG   . LEU A 1 25 ? 4.577  16.805 -4.836  1.00 0.00 ? 42 LEU A HG   6  
ATOM   3849  H HD11 . LEU A 1 25 ? 6.134  18.622 -4.082  1.00 0.00 ? 42 LEU A HD11 6  
ATOM   3850  H HD12 . LEU A 1 25 ? 5.456  17.736 -2.697  1.00 0.00 ? 42 LEU A HD12 6  
ATOM   3851  H HD13 . LEU A 1 25 ? 7.119  17.406 -3.237  1.00 0.00 ? 42 LEU A HD13 6  
ATOM   3852  H HD21 . LEU A 1 25 ? 6.066  15.727 -6.417  1.00 0.00 ? 42 LEU A HD21 6  
ATOM   3853  H HD22 . LEU A 1 25 ? 6.496  17.447 -6.254  1.00 0.00 ? 42 LEU A HD22 6  
ATOM   3854  H HD23 . LEU A 1 25 ? 7.483  16.202 -5.450  1.00 0.00 ? 42 LEU A HD23 6  
ATOM   3855  N N    . PHE A 1 26 ? 3.257  13.183 -3.420  1.00 0.00 ? 43 PHE A N    6  
ATOM   3856  C CA   . PHE A 1 26 ? 2.890  11.772 -3.461  1.00 0.00 ? 43 PHE A CA   6  
ATOM   3857  C C    . PHE A 1 26 ? 2.354  11.384 -4.832  1.00 0.00 ? 43 PHE A C    6  
ATOM   3858  O O    . PHE A 1 26 ? 1.806  12.216 -5.554  1.00 0.00 ? 43 PHE A O    6  
ATOM   3859  C CB   . PHE A 1 26 ? 1.854  11.459 -2.380  1.00 0.00 ? 43 PHE A CB   6  
ATOM   3860  C CG   . PHE A 1 26 ? 0.544  12.170 -2.572  1.00 0.00 ? 43 PHE A CG   6  
ATOM   3861  C CD1  . PHE A 1 26 ? 0.372  13.471 -2.123  1.00 0.00 ? 43 PHE A CD1  6  
ATOM   3862  C CD2  . PHE A 1 26 ? -0.518 11.539 -3.203  1.00 0.00 ? 43 PHE A CD2  6  
ATOM   3863  C CE1  . PHE A 1 26 ? -0.831 14.126 -2.297  1.00 0.00 ? 43 PHE A CE1  6  
ATOM   3864  C CE2  . PHE A 1 26 ? -1.723 12.193 -3.380  1.00 0.00 ? 43 PHE A CE2  6  
ATOM   3865  C CZ   . PHE A 1 26 ? -1.879 13.485 -2.927  1.00 0.00 ? 43 PHE A CZ   6  
ATOM   3866  H H    . PHE A 1 26 ? 2.874  13.812 -4.110  1.00 0.00 ? 43 PHE A H    6  
ATOM   3867  H HA   . PHE A 1 26 ? 3.773  11.156 -3.287  1.00 0.00 ? 43 PHE A HA   6  
ATOM   3868  H HB2  . PHE A 1 26 ? 1.631  10.392 -2.373  1.00 0.00 ? 43 PHE A HB2  6  
ATOM   3869  H HB3  . PHE A 1 26 ? 2.230  11.757 -1.403  1.00 0.00 ? 43 PHE A HB3  6  
ATOM   3870  H HD1  . PHE A 1 26 ? 1.202  13.976 -1.626  1.00 0.00 ? 43 PHE A HD1  6  
ATOM   3871  H HD2  . PHE A 1 26 ? -0.394 10.517 -3.560  1.00 0.00 ? 43 PHE A HD2  6  
ATOM   3872  H HE1  . PHE A 1 26 ? -0.953 15.147 -1.939  1.00 0.00 ? 43 PHE A HE1  6  
ATOM   3873  H HE2  . PHE A 1 26 ? -2.549 11.686 -3.877  1.00 0.00 ? 43 PHE A HE2  6  
ATOM   3874  H HZ   . PHE A 1 26 ? -2.828 14.002 -3.067  1.00 0.00 ? 43 PHE A HZ   6  
ATOM   3875  N N    . SER A 1 27 ? 2.513  10.113 -5.185  1.00 0.00 ? 44 SER A N    6  
ATOM   3876  C CA   . SER A 1 27 ? 1.934  9.580  -6.413  1.00 0.00 ? 44 SER A CA   6  
ATOM   3877  C C    . SER A 1 27 ? 1.740  8.072  -6.322  1.00 0.00 ? 44 SER A C    6  
ATOM   3878  O O    . SER A 1 27 ? 2.529  7.373  -5.687  1.00 0.00 ? 44 SER A O    6  
ATOM   3879  C CB   . SER A 1 27 ? 2.813  9.929  -7.598  1.00 0.00 ? 44 SER A CB   6  
ATOM   3880  O OG   . SER A 1 27 ? 2.249  9.515  -8.812  1.00 0.00 ? 44 SER A OG   6  
ATOM   3881  H H    . SER A 1 27 ? 3.050  9.499  -4.588  1.00 0.00 ? 44 SER A H    6  
ATOM   3882  H HA   . SER A 1 27 ? 0.995  10.059 -6.692  1.00 0.00 ? 44 SER A HA   6  
ATOM   3883  H HB2  . SER A 1 27 ? 2.953  11.009 -7.623  1.00 0.00 ? 44 SER A HB2  6  
ATOM   3884  H HB3  . SER A 1 27 ? 3.779  9.441  -7.473  1.00 0.00 ? 44 SER A HB3  6  
ATOM   3885  H HG   . SER A 1 27 ? 2.478  10.142 -9.502  1.00 0.00 ? 44 SER A HG   6  
ATOM   3886  N N    . THR A 1 28 ? 0.684  7.577  -6.959  1.00 0.00 ? 45 THR A N    6  
ATOM   3887  C CA   . THR A 1 28 ? 0.380  6.151  -6.945  1.00 0.00 ? 45 THR A CA   6  
ATOM   3888  C C    . THR A 1 28 ? 0.499  5.549  -8.339  1.00 0.00 ? 45 THR A C    6  
ATOM   3889  O O    . THR A 1 28 ? -0.111 6.036  -9.290  1.00 0.00 ? 45 THR A O    6  
ATOM   3890  C CB   . THR A 1 28 ? -1.035 5.882  -6.399  1.00 0.00 ? 45 THR A CB   6  
ATOM   3891  O OG1  . THR A 1 28 ? -1.142 6.399  -5.066  1.00 0.00 ? 45 THR A OG1  6  
ATOM   3892  C CG2  . THR A 1 28 ? -1.325 4.389  -6.384  1.00 0.00 ? 45 THR A CG2  6  
ATOM   3893  H H    . THR A 1 28 ? 0.077  8.205  -7.468  1.00 0.00 ? 45 THR A H    6  
ATOM   3894  H HA   . THR A 1 28 ? 1.101  5.626  -6.318  1.00 0.00 ? 45 THR A HA   6  
ATOM   3895  H HB   . THR A 1 28 ? -1.762 6.386  -7.034  1.00 0.00 ? 45 THR A HB   6  
ATOM   3896  H HG1  . THR A 1 28 ? -0.985 7.346  -5.078  1.00 0.00 ? 45 THR A HG1  6  
ATOM   3897  H HG21 . THR A 1 28 ? -0.599 3.884  -5.748  1.00 0.00 ? 45 THR A HG21 6  
ATOM   3898  H HG22 . THR A 1 28 ? -2.329 4.218  -5.996  1.00 0.00 ? 45 THR A HG22 6  
ATOM   3899  H HG23 . THR A 1 28 ? -1.255 3.995  -7.397  1.00 0.00 ? 45 THR A HG23 6  
HETATM 3900  N N    . TPO A 1 29 ? 1.287  4.485  -8.452  1.00 0.00 ? 46 TPO A N    6  
HETATM 3901  C CA   . TPO A 1 29 ? 1.556  3.866  -9.744  1.00 0.00 ? 46 TPO A CA   6  
HETATM 3902  C CB   . TPO A 1 29 ? 2.921  3.151  -9.754  1.00 0.00 ? 46 TPO A CB   6  
HETATM 3903  C CG2  . TPO A 1 29 ? 4.009  4.072  -9.226  1.00 0.00 ? 46 TPO A CG2  6  
HETATM 3904  O OG1  . TPO A 1 29 ? 2.854  1.976  -8.936  1.00 0.00 ? 46 TPO A OG1  6  
HETATM 3905  P P    . TPO A 1 29 ? 3.886  0.757  -9.166  1.00 0.00 ? 46 TPO A P    6  
HETATM 3906  O O1P  . TPO A 1 29 ? 3.541  -0.340 -8.125  1.00 0.00 ? 46 TPO A O1P  6  
HETATM 3907  O O2P  . TPO A 1 29 ? 5.316  1.318  -8.951  1.00 0.00 ? 46 TPO A O2P  6  
HETATM 3908  O O3P  . TPO A 1 29 ? 3.684  0.249  -10.618 1.00 0.00 ? 46 TPO A O3P  6  
HETATM 3909  C C    . TPO A 1 29 ? 0.469  2.866  -10.113 1.00 0.00 ? 46 TPO A C    6  
HETATM 3910  O O    . TPO A 1 29 ? -0.312 2.441  -9.261  1.00 0.00 ? 46 TPO A O    6  
HETATM 3911  H H    . TPO A 1 29 ? 1.711  4.096  -7.622  1.00 0.00 ? 46 TPO A H    6  
HETATM 3912  H HA   . TPO A 1 29 ? 1.555  4.626  -10.525 1.00 0.00 ? 46 TPO A HA   6  
HETATM 3913  H HB   . TPO A 1 29 ? 3.160  2.858  -10.776 1.00 0.00 ? 46 TPO A HB   6  
HETATM 3914  H HG21 . TPO A 1 29 ? 4.966  3.550  -9.241  1.00 0.00 ? 46 TPO A HG21 6  
HETATM 3915  H HG22 . TPO A 1 29 ? 4.070  4.961  -9.852  1.00 0.00 ? 46 TPO A HG22 6  
HETATM 3916  H HG23 . TPO A 1 29 ? 3.772  4.364  -8.204  1.00 0.00 ? 46 TPO A HG23 6  
ATOM   3917  N N    . PRO A 1 30 ? 0.422  2.493  -11.387 1.00 0.00 ? 47 PRO A N    6  
ATOM   3918  C CA   . PRO A 1 30 ? -0.617 1.601  -11.887 1.00 0.00 ? 47 PRO A CA   6  
ATOM   3919  C C    . PRO A 1 30 ? -0.634 0.287  -11.116 1.00 0.00 ? 47 PRO A C    6  
ATOM   3920  O O    . PRO A 1 30 ? -1.675 -0.356 -10.988 1.00 0.00 ? 47 PRO A O    6  
ATOM   3921  C CB   . PRO A 1 30 ? -0.260 1.399  -13.364 1.00 0.00 ? 47 PRO A CB   6  
ATOM   3922  C CG   . PRO A 1 30 ? 0.483  2.636  -13.738 1.00 0.00 ? 47 PRO A CG   6  
ATOM   3923  C CD   . PRO A 1 30 ? 1.273  3.014  -12.513 1.00 0.00 ? 47 PRO A CD   6  
ATOM   3924  H HA   . PRO A 1 30 ? -1.629 2.014  -11.763 1.00 0.00 ? 47 PRO A HA   6  
ATOM   3925  H HB2  . PRO A 1 30 ? 0.362  0.502  -13.509 1.00 0.00 ? 47 PRO A HB2  6  
ATOM   3926  H HB3  . PRO A 1 30 ? -1.160 1.272  -13.983 1.00 0.00 ? 47 PRO A HB3  6  
ATOM   3927  H HG2  . PRO A 1 30 ? 1.146  2.458  -14.596 1.00 0.00 ? 47 PRO A HG2  6  
ATOM   3928  H HG3  . PRO A 1 30 ? -0.208 3.443  -14.027 1.00 0.00 ? 47 PRO A HG3  6  
ATOM   3929  H HD2  . PRO A 1 30 ? 2.271  2.552  -12.503 1.00 0.00 ? 47 PRO A HD2  6  
ATOM   3930  H HD3  . PRO A 1 30 ? 1.421  4.100  -12.433 1.00 0.00 ? 47 PRO A HD3  6  
ATOM   3931  N N    . GLY A 1 31 ? 0.528  -0.107 -10.605 1.00 0.00 ? 48 GLY A N    6  
ATOM   3932  C CA   . GLY A 1 31 ? 0.651  -1.348 -9.849  1.00 0.00 ? 48 GLY A CA   6  
ATOM   3933  C C    . GLY A 1 31 ? -0.156 -1.288 -8.558  1.00 0.00 ? 48 GLY A C    6  
ATOM   3934  O O    . GLY A 1 31 ? -0.584 -2.316 -8.035  1.00 0.00 ? 48 GLY A O    6  
ATOM   3935  H H    . GLY A 1 31 ? 1.347  0.467  -10.745 1.00 0.00 ? 48 GLY A H    6  
ATOM   3936  H HA2  . GLY A 1 31 ? 0.285  -2.175 -10.458 1.00 0.00 ? 48 GLY A HA2  6  
ATOM   3937  H HA3  . GLY A 1 31 ? 1.700  -1.514 -9.605  1.00 0.00 ? 48 GLY A HA3  6  
ATOM   3938  N N    . GLY A 1 32 ? -0.361 -0.078 -8.050  1.00 0.00 ? 49 GLY A N    6  
ATOM   3939  C CA   . GLY A 1 32 ? -1.175 0.125  -6.858  1.00 0.00 ? 49 GLY A CA   6  
ATOM   3940  C C    . GLY A 1 32 ? -0.314 0.514  -5.663  1.00 0.00 ? 49 GLY A C    6  
ATOM   3941  O O    . GLY A 1 32 ? -0.792 0.559  -4.529  1.00 0.00 ? 49 GLY A O    6  
ATOM   3942  H H    . GLY A 1 32 ? 0.057  0.723  -8.502  1.00 0.00 ? 49 GLY A H    6  
ATOM   3943  H HA2  . GLY A 1 32 ? -1.897 0.919  -7.049  1.00 0.00 ? 49 GLY A HA2  6  
ATOM   3944  H HA3  . GLY A 1 32 ? -1.705 -0.799 -6.627  1.00 0.00 ? 49 GLY A HA3  6  
ATOM   3945  N N    . THR A 1 33 ? 0.958  0.793  -5.924  1.00 0.00 ? 50 THR A N    6  
ATOM   3946  C CA   . THR A 1 33 ? 1.885  1.196  -4.872  1.00 0.00 ? 50 THR A CA   6  
ATOM   3947  C C    . THR A 1 33 ? 1.838  2.701  -4.646  1.00 0.00 ? 50 THR A C    6  
ATOM   3948  O O    . THR A 1 33 ? 2.024  3.486  -5.576  1.00 0.00 ? 50 THR A O    6  
ATOM   3949  C CB   . THR A 1 33 ? 3.331  0.783  -5.204  1.00 0.00 ? 50 THR A CB   6  
ATOM   3950  O OG1  . THR A 1 33 ? 3.401  -0.642 -5.349  1.00 0.00 ? 50 THR A OG1  6  
ATOM   3951  C CG2  . THR A 1 33 ? 4.278  1.224  -4.099  1.00 0.00 ? 50 THR A CG2  6  
ATOM   3952  H H    . THR A 1 33 ? 1.293  0.724  -6.874  1.00 0.00 ? 50 THR A H    6  
ATOM   3953  H HA   . THR A 1 33 ? 1.597  0.733  -3.928  1.00 0.00 ? 50 THR A HA   6  
ATOM   3954  H HB   . THR A 1 33 ? 3.627  1.249  -6.143  1.00 0.00 ? 50 THR A HB   6  
ATOM   3955  H HG1  . THR A 1 33 ? 2.836  -0.917 -6.074  1.00 0.00 ? 50 THR A HG1  6  
ATOM   3956  H HG21 . THR A 1 33 ? 3.984  0.757  -3.159  1.00 0.00 ? 50 THR A HG21 6  
ATOM   3957  H HG22 . THR A 1 33 ? 5.295  0.922  -4.350  1.00 0.00 ? 50 THR A HG22 6  
ATOM   3958  H HG23 . THR A 1 33 ? 4.235  2.308  -3.994  1.00 0.00 ? 50 THR A HG23 6  
ATOM   3959  N N    . ARG A 1 34 ? 1.590  3.100  -3.403  1.00 0.00 ? 51 ARG A N    6  
ATOM   3960  C CA   . ARG A 1 34 ? 1.536  4.514  -3.047  1.00 0.00 ? 51 ARG A CA   6  
ATOM   3961  C C    . ARG A 1 34 ? 2.906  5.028  -2.622  1.00 0.00 ? 51 ARG A C    6  
ATOM   3962  O O    . ARG A 1 34 ? 3.412  4.667  -1.560  1.00 0.00 ? 51 ARG A O    6  
ATOM   3963  C CB   . ARG A 1 34 ? 0.481  4.799  -1.988  1.00 0.00 ? 51 ARG A CB   6  
ATOM   3964  C CG   . ARG A 1 34 ? -0.919 4.320  -2.335  1.00 0.00 ? 51 ARG A CG   6  
ATOM   3965  C CD   . ARG A 1 34 ? -1.930 4.564  -1.275  1.00 0.00 ? 51 ARG A CD   6  
ATOM   3966  N NE   . ARG A 1 34 ? -1.794 3.712  -0.104  1.00 0.00 ? 51 ARG A NE   6  
ATOM   3967  C CZ   . ARG A 1 34 ? -2.473 3.880  1.047   1.00 0.00 ? 51 ARG A CZ   6  
ATOM   3968  N NH1  . ARG A 1 34 ? -3.308 4.884  1.202   1.00 0.00 ? 51 ARG A NH1  6  
ATOM   3969  N NH2  . ARG A 1 34 ? -2.261 3.020  2.028   1.00 0.00 ? 51 ARG A NH2  6  
ATOM   3970  H H    . ARG A 1 34 ? 1.434  2.407  -2.685  1.00 0.00 ? 51 ARG A H    6  
ATOM   3971  H HA   . ARG A 1 34 ? 1.239  5.102  -3.916  1.00 0.00 ? 51 ARG A HA   6  
ATOM   3972  H HB2  . ARG A 1 34 ? 0.811  4.313  -1.071  1.00 0.00 ? 51 ARG A HB2  6  
ATOM   3973  H HB3  . ARG A 1 34 ? 0.464  5.879  -1.841  1.00 0.00 ? 51 ARG A HB3  6  
ATOM   3974  H HG2  . ARG A 1 34 ? -1.249 4.835  -3.238  1.00 0.00 ? 51 ARG A HG2  6  
ATOM   3975  H HG3  . ARG A 1 34 ? -0.881 3.246  -2.523  1.00 0.00 ? 51 ARG A HG3  6  
ATOM   3976  H HD2  . ARG A 1 34 ? -1.848 5.597  -0.938  1.00 0.00 ? 51 ARG A HD2  6  
ATOM   3977  H HD3  . ARG A 1 34 ? -2.924 4.395  -1.688  1.00 0.00 ? 51 ARG A HD3  6  
ATOM   3978  H HE   . ARG A 1 34 ? -1.206 2.902  0.038   1.00 0.00 ? 51 ARG A HE   6  
ATOM   3979  H HH11 . ARG A 1 34 ? -3.445 5.543  0.449   1.00 0.00 ? 51 ARG A HH11 6  
ATOM   3980  H HH12 . ARG A 1 34 ? -3.807 4.992  2.072   1.00 0.00 ? 51 ARG A HH12 6  
ATOM   3981  H HH21 . ARG A 1 34 ? -1.603 2.263  1.898   1.00 0.00 ? 51 ARG A HH21 6  
ATOM   3982  H HH22 . ARG A 1 34 ? -2.756 3.122  2.901   1.00 0.00 ? 51 ARG A HH22 6  
ATOM   3983  N N    . ILE A 1 35 ? 3.501  5.871  -3.458  1.00 0.00 ? 52 ILE A N    6  
ATOM   3984  C CA   . ILE A 1 35 ? 4.839  6.388  -3.200  1.00 0.00 ? 52 ILE A CA   6  
ATOM   3985  C C    . ILE A 1 35 ? 4.783  7.792  -2.612  1.00 0.00 ? 52 ILE A C    6  
ATOM   3986  O O    . ILE A 1 35 ? 4.340  8.734  -3.271  1.00 0.00 ? 52 ILE A O    6  
ATOM   3987  C CB   . ILE A 1 35 ? 5.692  6.412  -4.482  1.00 0.00 ? 52 ILE A CB   6  
ATOM   3988  C CG1  . ILE A 1 35 ? 5.762  5.015  -5.104  1.00 0.00 ? 52 ILE A CG1  6  
ATOM   3989  C CG2  . ILE A 1 35 ? 7.089  6.935  -4.182  1.00 0.00 ? 52 ILE A CG2  6  
ATOM   3990  C CD1  . ILE A 1 35 ? 6.390  4.988  -6.478  1.00 0.00 ? 52 ILE A CD1  6  
ATOM   3991  H H    . ILE A 1 35 ? 3.013  6.162  -4.294  1.00 0.00 ? 52 ILE A H    6  
ATOM   3992  H HA   . ILE A 1 35 ? 5.342  5.790  -2.441  1.00 0.00 ? 52 ILE A HA   6  
ATOM   3993  H HB   . ILE A 1 35 ? 5.213  7.059  -5.216  1.00 0.00 ? 52 ILE A HB   6  
ATOM   3994  H HG12 . ILE A 1 35 ? 6.342  4.387  -4.427  1.00 0.00 ? 52 ILE A HG12 6  
ATOM   3995  H HG13 . ILE A 1 35 ? 4.741  4.636  -5.163  1.00 0.00 ? 52 ILE A HG13 6  
ATOM   3996  H HG21 . ILE A 1 35 ? 7.679  6.944  -5.098  1.00 0.00 ? 52 ILE A HG21 6  
ATOM   3997  H HG22 . ILE A 1 35 ? 7.021  7.946  -3.784  1.00 0.00 ? 52 ILE A HG22 6  
ATOM   3998  H HG23 . ILE A 1 35 ? 7.569  6.288  -3.448  1.00 0.00 ? 52 ILE A HG23 6  
ATOM   3999  H HD11 . ILE A 1 35 ? 7.410  5.365  -6.420  1.00 0.00 ? 52 ILE A HD11 6  
ATOM   4000  H HD12 . ILE A 1 35 ? 6.403  3.964  -6.853  1.00 0.00 ? 52 ILE A HD12 6  
ATOM   4001  H HD13 . ILE A 1 35 ? 5.809  5.615  -7.157  1.00 0.00 ? 52 ILE A HD13 6  
ATOM   4002  N N    . ILE A 1 36 ? 5.235  7.927  -1.370  1.00 0.00 ? 53 ILE A N    6  
ATOM   4003  C CA   . ILE A 1 36 ? 5.268  9.222  -0.702  1.00 0.00 ? 53 ILE A CA   6  
ATOM   4004  C C    . ILE A 1 36 ? 6.614  9.908  -0.896  1.00 0.00 ? 53 ILE A C    6  
ATOM   4005  O O    . ILE A 1 36 ? 7.663  9.323  -0.629  1.00 0.00 ? 53 ILE A O    6  
ATOM   4006  C CB   . ILE A 1 36 ? 4.982  9.089  0.804   1.00 0.00 ? 53 ILE A CB   6  
ATOM   4007  C CG1  . ILE A 1 36 ? 3.640  8.387  1.033   1.00 0.00 ? 53 ILE A CG1  6  
ATOM   4008  C CG2  . ILE A 1 36 ? 4.990  10.456 1.471   1.00 0.00 ? 53 ILE A CG2  6  
ATOM   4009  C CD1  . ILE A 1 36 ? 2.463  9.099  0.408   1.00 0.00 ? 53 ILE A CD1  6  
ATOM   4010  H H    . ILE A 1 36 ? 5.564  7.110  -0.875  1.00 0.00 ? 53 ILE A H    6  
ATOM   4011  H HA   . ILE A 1 36 ? 4.543  9.903  -1.150  1.00 0.00 ? 53 ILE A HA   6  
ATOM   4012  H HB   . ILE A 1 36 ? 5.747  8.458  1.257   1.00 0.00 ? 53 ILE A HB   6  
ATOM   4013  H HG12 . ILE A 1 36 ? 3.724  7.384  0.613   1.00 0.00 ? 53 ILE A HG12 6  
ATOM   4014  H HG13 . ILE A 1 36 ? 3.491  8.317  2.111   1.00 0.00 ? 53 ILE A HG13 6  
ATOM   4015  H HG21 . ILE A 1 36 ? 4.785  10.343 2.535   1.00 0.00 ? 53 ILE A HG21 6  
ATOM   4016  H HG22 . ILE A 1 36 ? 5.966  10.920 1.336   1.00 0.00 ? 53 ILE A HG22 6  
ATOM   4017  H HG23 . ILE A 1 36 ? 4.224  11.086 1.019   1.00 0.00 ? 53 ILE A HG23 6  
ATOM   4018  H HD11 . ILE A 1 36 ? 2.609  9.170  -0.670  1.00 0.00 ? 53 ILE A HD11 6  
ATOM   4019  H HD12 . ILE A 1 36 ? 1.549  8.543  0.613   1.00 0.00 ? 53 ILE A HD12 6  
ATOM   4020  H HD13 . ILE A 1 36 ? 2.378  10.102 0.829   1.00 0.00 ? 53 ILE A HD13 6  
ATOM   4021  N N    . TYR A 1 37 ? 6.577  11.152 -1.361  1.00 0.00 ? 54 TYR A N    6  
ATOM   4022  C CA   . TYR A 1 37 ? 7.792  11.867 -1.735  1.00 0.00 ? 54 TYR A CA   6  
ATOM   4023  C C    . TYR A 1 37 ? 8.124  12.956 -0.722  1.00 0.00 ? 54 TYR A C    6  
ATOM   4024  O O    . TYR A 1 37 ? 7.485  14.007 -0.696  1.00 0.00 ? 54 TYR A O    6  
ATOM   4025  C CB   . TYR A 1 37 ? 7.647  12.475 -3.131  1.00 0.00 ? 54 TYR A CB   6  
ATOM   4026  C CG   . TYR A 1 37 ? 7.478  11.451 -4.231  1.00 0.00 ? 54 TYR A CG   6  
ATOM   4027  C CD1  . TYR A 1 37 ? 8.566  10.736 -4.709  1.00 0.00 ? 54 TYR A CD1  6  
ATOM   4028  C CD2  . TYR A 1 37 ? 6.232  11.202 -4.790  1.00 0.00 ? 54 TYR A CD2  6  
ATOM   4029  C CE1  . TYR A 1 37 ? 8.419  9.800  -5.715  1.00 0.00 ? 54 TYR A CE1  6  
ATOM   4030  C CE2  . TYR A 1 37 ? 6.073  10.268 -5.794  1.00 0.00 ? 54 TYR A CE2  6  
ATOM   4031  C CZ   . TYR A 1 37 ? 7.169  9.568  -6.254  1.00 0.00 ? 54 TYR A CZ   6  
ATOM   4032  O OH   . TYR A 1 37 ? 7.017  8.637  -7.256  1.00 0.00 ? 54 TYR A OH   6  
ATOM   4033  H H    . TYR A 1 37 ? 5.685  11.616 -1.457  1.00 0.00 ? 54 TYR A H    6  
ATOM   4034  H HA   . TYR A 1 37 ? 8.638  11.179 -1.740  1.00 0.00 ? 54 TYR A HA   6  
ATOM   4035  H HB2  . TYR A 1 37 ? 6.775  13.130 -3.109  1.00 0.00 ? 54 TYR A HB2  6  
ATOM   4036  H HB3  . TYR A 1 37 ? 8.542  13.067 -3.320  1.00 0.00 ? 54 TYR A HB3  6  
ATOM   4037  H HD1  . TYR A 1 37 ? 9.549  10.923 -4.279  1.00 0.00 ? 54 TYR A HD1  6  
ATOM   4038  H HD2  . TYR A 1 37 ? 5.370  11.760 -4.421  1.00 0.00 ? 54 TYR A HD2  6  
ATOM   4039  H HE1  . TYR A 1 37 ? 9.286  9.247  -6.077  1.00 0.00 ? 54 TYR A HE1  6  
ATOM   4040  H HE2  . TYR A 1 37 ? 5.088  10.084 -6.223  1.00 0.00 ? 54 TYR A HE2  6  
ATOM   4041  H HH   . TYR A 1 37 ? 7.842  8.211  -7.500  1.00 0.00 ? 54 TYR A HH   6  
ATOM   4042  N N    . ASP A 1 38 ? 9.127  12.698 0.109   1.00 0.00 ? 55 ASP A N    6  
ATOM   4043  C CA   . ASP A 1 38 ? 9.491  13.617 1.181   1.00 0.00 ? 55 ASP A CA   6  
ATOM   4044  C C    . ASP A 1 38 ? 10.388 14.735 0.667   1.00 0.00 ? 55 ASP A C    6  
ATOM   4045  O O    . ASP A 1 38 ? 11.518 14.492 0.242   1.00 0.00 ? 55 ASP A O    6  
ATOM   4046  C CB   . ASP A 1 38 ? 10.186 12.866 2.319   1.00 0.00 ? 55 ASP A CB   6  
ATOM   4047  C CG   . ASP A 1 38 ? 10.536 13.732 3.522   1.00 0.00 ? 55 ASP A CG   6  
ATOM   4048  O OD1  . ASP A 1 38 ? 10.324 14.919 3.457   1.00 0.00 ? 55 ASP A OD1  6  
ATOM   4049  O OD2  . ASP A 1 38 ? 10.864 13.184 4.547   1.00 0.00 ? 55 ASP A OD2  6  
ATOM   4050  H H    . ASP A 1 38 ? 9.652  11.842 -0.004  1.00 0.00 ? 55 ASP A H    6  
ATOM   4051  H HA   . ASP A 1 38 ? 8.594  14.095 1.576   1.00 0.00 ? 55 ASP A HA   6  
ATOM   4052  H HB2  . ASP A 1 38 ? 9.641  11.983 2.654   1.00 0.00 ? 55 ASP A HB2  6  
ATOM   4053  H HB3  . ASP A 1 38 ? 11.102 12.559 1.814   1.00 0.00 ? 55 ASP A HB3  6  
ATOM   4054  N N    . ARG A 1 39 ? 9.879  15.961 0.708   1.00 0.00 ? 56 ARG A N    6  
ATOM   4055  C CA   . ARG A 1 39 ? 10.655 17.128 0.305   1.00 0.00 ? 56 ARG A CA   6  
ATOM   4056  C C    . ARG A 1 39 ? 11.904 17.281 1.165   1.00 0.00 ? 56 ARG A C    6  
ATOM   4057  O O    . ARG A 1 39 ? 11.815 17.432 2.383   1.00 0.00 ? 56 ARG A O    6  
ATOM   4058  C CB   . ARG A 1 39 ? 9.821  18.400 0.301   1.00 0.00 ? 56 ARG A CB   6  
ATOM   4059  C CG   . ARG A 1 39 ? 10.547 19.640 -0.198  1.00 0.00 ? 56 ARG A CG   6  
ATOM   4060  C CD   . ARG A 1 39 ? 9.702  20.859 -0.265  1.00 0.00 ? 56 ARG A CD   6  
ATOM   4061  N NE   . ARG A 1 39 ? 8.634  20.798 -1.251  1.00 0.00 ? 56 ARG A NE   6  
ATOM   4062  C CZ   . ARG A 1 39 ? 8.780  21.097 -2.556  1.00 0.00 ? 56 ARG A CZ   6  
ATOM   4063  N NH1  . ARG A 1 39 ? 9.934  21.513 -3.030  1.00 0.00 ? 56 ARG A NH1  6  
ATOM   4064  N NH2  . ARG A 1 39 ? 7.726  20.984 -3.345  1.00 0.00 ? 56 ARG A NH2  6  
ATOM   4065  H H    . ARG A 1 39 ? 8.929  16.089 1.026   1.00 0.00 ? 56 ARG A H    6  
ATOM   4066  H HA   . ARG A 1 39 ? 10.999 17.004 -0.723  1.00 0.00 ? 56 ARG A HA   6  
ATOM   4067  H HB2  . ARG A 1 39 ? 8.956  18.211 -0.332  1.00 0.00 ? 56 ARG A HB2  6  
ATOM   4068  H HB3  . ARG A 1 39 ? 9.491  18.566 1.327   1.00 0.00 ? 56 ARG A HB3  6  
ATOM   4069  H HG2  . ARG A 1 39 ? 11.381 19.847 0.472   1.00 0.00 ? 56 ARG A HG2  6  
ATOM   4070  H HG3  . ARG A 1 39 ? 10.928 19.437 -1.199  1.00 0.00 ? 56 ARG A HG3  6  
ATOM   4071  H HD2  . ARG A 1 39 ? 9.239  21.023 0.708   1.00 0.00 ? 56 ARG A HD2  6  
ATOM   4072  H HD3  . ARG A 1 39 ? 10.331 21.712 -0.516  1.00 0.00 ? 56 ARG A HD3  6  
ATOM   4073  H HE   . ARG A 1 39 ? 7.664  20.538 -1.135  1.00 0.00 ? 56 ARG A HE   6  
ATOM   4074  H HH11 . ARG A 1 39 ? 10.726 21.611 -2.411  1.00 0.00 ? 56 ARG A HH11 6  
ATOM   4075  H HH12 . ARG A 1 39 ? 10.023 21.732 -4.012  1.00 0.00 ? 56 ARG A HH12 6  
ATOM   4076  H HH21 . ARG A 1 39 ? 6.842  20.680 -2.961  1.00 0.00 ? 56 ARG A HH21 6  
ATOM   4077  H HH22 . ARG A 1 39 ? 7.807  21.203 -4.326  1.00 0.00 ? 56 ARG A HH22 6  
ATOM   4078  N N    . LYS A 1 40 ? 13.067 17.244 0.523   1.00 0.00 ? 57 LYS A N    6  
ATOM   4079  C CA   . LYS A 1 40 ? 14.337 17.329 1.233   1.00 0.00 ? 57 LYS A CA   6  
ATOM   4080  C C    . LYS A 1 40 ? 14.472 18.660 1.962   1.00 0.00 ? 57 LYS A C    6  
ATOM   4081  O O    . LYS A 1 40 ? 15.127 18.746 3.001   1.00 0.00 ? 57 LYS A O    6  
ATOM   4082  C CB   . LYS A 1 40 ? 15.505 17.140 0.265   1.00 0.00 ? 57 LYS A CB   6  
ATOM   4083  C CG   . LYS A 1 40 ? 15.655 15.722 -0.273  1.00 0.00 ? 57 LYS A CG   6  
ATOM   4084  C CD   . LYS A 1 40 ? 16.841 15.610 -1.217  1.00 0.00 ? 57 LYS A CD   6  
ATOM   4085  C CE   . LYS A 1 40 ? 16.989 14.195 -1.756  1.00 0.00 ? 57 LYS A CE   6  
ATOM   4086  N NZ   . LYS A 1 40 ? 18.174 14.059 -2.646  1.00 0.00 ? 57 LYS A NZ   6  
ATOM   4087  H H    . LYS A 1 40 ? 13.071 17.152 -0.483  1.00 0.00 ? 57 LYS A H    6  
ATOM   4088  H HA   . LYS A 1 40 ? 14.387 16.551 1.995   1.00 0.00 ? 57 LYS A HA   6  
ATOM   4089  H HB2  . LYS A 1 40 ? 15.347 17.828 -0.567  1.00 0.00 ? 57 LYS A HB2  6  
ATOM   4090  H HB3  . LYS A 1 40 ? 16.414 17.421 0.799   1.00 0.00 ? 57 LYS A HB3  6  
ATOM   4091  H HG2  . LYS A 1 40 ? 15.794 15.046 0.572   1.00 0.00 ? 57 LYS A HG2  6  
ATOM   4092  H HG3  . LYS A 1 40 ? 14.741 15.455 -0.803  1.00 0.00 ? 57 LYS A HG3  6  
ATOM   4093  H HD2  . LYS A 1 40 ? 16.691 16.302 -2.047  1.00 0.00 ? 57 LYS A HD2  6  
ATOM   4094  H HD3  . LYS A 1 40 ? 17.745 15.886 -0.674  1.00 0.00 ? 57 LYS A HD3  6  
ATOM   4095  H HE2  . LYS A 1 40 ? 17.090 13.515 -0.910  1.00 0.00 ? 57 LYS A HE2  6  
ATOM   4096  H HE3  . LYS A 1 40 ? 16.086 13.946 -2.314  1.00 0.00 ? 57 LYS A HE3  6  
ATOM   4097  H HZ1  . LYS A 1 40 ? 19.011 14.288 -2.129  1.00 0.00 ? 57 LYS A HZ1  6  
ATOM   4098  H HZ2  . LYS A 1 40 ? 18.236 13.107 -2.982  1.00 0.00 ? 57 LYS A HZ2  6  
ATOM   4099  H HZ3  . LYS A 1 40 ? 18.079 14.688 -3.431  1.00 0.00 ? 57 LYS A HZ3  6  
ATOM   4100  N N    . PHE A 1 41 ? 13.848 19.696 1.412   1.00 0.00 ? 58 PHE A N    6  
ATOM   4101  C CA   . PHE A 1 41 ? 13.911 21.029 2.000   1.00 0.00 ? 58 PHE A CA   6  
ATOM   4102  C C    . PHE A 1 41 ? 12.567 21.435 2.592   1.00 0.00 ? 58 PHE A C    6  
ATOM   4103  O O    . PHE A 1 41 ? 12.221 22.616 2.617   1.00 0.00 ? 58 PHE A O    6  
ATOM   4104  C CB   . PHE A 1 41 ? 14.356 22.053 0.955   1.00 0.00 ? 58 PHE A CB   6  
ATOM   4105  C CG   . PHE A 1 41 ? 15.692 21.748 0.338   1.00 0.00 ? 58 PHE A CG   6  
ATOM   4106  C CD1  . PHE A 1 41 ? 16.868 22.080 0.995   1.00 0.00 ? 58 PHE A CD1  6  
ATOM   4107  C CD2  . PHE A 1 41 ? 15.776 21.127 -0.899  1.00 0.00 ? 58 PHE A CD2  6  
ATOM   4108  C CE1  . PHE A 1 41 ? 18.097 21.801 0.429   1.00 0.00 ? 58 PHE A CE1  6  
ATOM   4109  C CE2  . PHE A 1 41 ? 17.004 20.846 -1.467  1.00 0.00 ? 58 PHE A CE2  6  
ATOM   4110  C CZ   . PHE A 1 41 ? 18.165 21.183 -0.803  1.00 0.00 ? 58 PHE A CZ   6  
ATOM   4111  H H    . PHE A 1 41 ? 13.315 19.556 0.565   1.00 0.00 ? 58 PHE A H    6  
ATOM   4112  H HA   . PHE A 1 41 ? 14.627 21.036 2.822   1.00 0.00 ? 58 PHE A HA   6  
ATOM   4113  H HB2  . PHE A 1 41 ? 13.638 22.093 0.137   1.00 0.00 ? 58 PHE A HB2  6  
ATOM   4114  H HB3  . PHE A 1 41 ? 14.442 23.039 1.410   1.00 0.00 ? 58 PHE A HB3  6  
ATOM   4115  H HD1  . PHE A 1 41 ? 16.814 22.567 1.969   1.00 0.00 ? 58 PHE A HD1  6  
ATOM   4116  H HD2  . PHE A 1 41 ? 14.858 20.862 -1.425  1.00 0.00 ? 58 PHE A HD2  6  
ATOM   4117  H HE1  . PHE A 1 41 ? 19.013 22.067 0.955   1.00 0.00 ? 58 PHE A HE1  6  
ATOM   4118  H HE2  . PHE A 1 41 ? 17.055 20.358 -2.440  1.00 0.00 ? 58 PHE A HE2  6  
ATOM   4119  H HZ   . PHE A 1 41 ? 19.133 20.960 -1.249  1.00 0.00 ? 58 PHE A HZ   6  
ATOM   4120  N N    . LEU A 1 42 ? 11.813 20.449 3.065   1.00 0.00 ? 59 LEU A N    6  
ATOM   4121  C CA   . LEU A 1 42 ? 10.498 20.700 3.642   1.00 0.00 ? 59 LEU A CA   6  
ATOM   4122  C C    . LEU A 1 42 ? 10.577 21.717 4.773   1.00 0.00 ? 59 LEU A C    6  
ATOM   4123  O O    . LEU A 1 42 ? 11.282 21.510 5.760   1.00 0.00 ? 59 LEU A O    6  
ATOM   4124  C CB   . LEU A 1 42 ? 9.880  19.389 4.146   1.00 0.00 ? 59 LEU A CB   6  
ATOM   4125  C CG   . LEU A 1 42 ? 8.438  19.499 4.653   1.00 0.00 ? 59 LEU A CG   6  
ATOM   4126  C CD1  . LEU A 1 42 ? 7.515  19.919 3.516   1.00 0.00 ? 59 LEU A CD1  6  
ATOM   4127  C CD2  . LEU A 1 42 ? 8.000  18.165 5.238   1.00 0.00 ? 59 LEU A CD2  6  
ATOM   4128  H H    . LEU A 1 42 ? 12.160 19.502 3.026   1.00 0.00 ? 59 LEU A H    6  
ATOM   4129  H HA   . LEU A 1 42 ? 9.844  21.130 2.884   1.00 0.00 ? 59 LEU A HA   6  
ATOM   4130  H HB2  . LEU A 1 42 ? 9.910  18.813 3.223   1.00 0.00 ? 59 LEU A HB2  6  
ATOM   4131  H HB3  . LEU A 1 42 ? 10.512 18.908 4.893   1.00 0.00 ? 59 LEU A HB3  6  
ATOM   4132  H HG   . LEU A 1 42 ? 8.432  20.234 5.459   1.00 0.00 ? 59 LEU A HG   6  
ATOM   4133  H HD11 . LEU A 1 42 ? 6.492  19.995 3.886   1.00 0.00 ? 59 LEU A HD11 6  
ATOM   4134  H HD12 . LEU A 1 42 ? 7.833  20.886 3.129   1.00 0.00 ? 59 LEU A HD12 6  
ATOM   4135  H HD13 . LEU A 1 42 ? 7.558  19.176 2.721   1.00 0.00 ? 59 LEU A HD13 6  
ATOM   4136  H HD21 . LEU A 1 42 ? 8.656  17.897 6.067   1.00 0.00 ? 59 LEU A HD21 6  
ATOM   4137  H HD22 . LEU A 1 42 ? 6.974  18.244 5.599   1.00 0.00 ? 59 LEU A HD22 6  
ATOM   4138  H HD23 . LEU A 1 42 ? 8.056  17.394 4.469   1.00 0.00 ? 59 LEU A HD23 6  
ATOM   4139  N N    . LEU A 1 43 ? 9.849  22.819 4.623   1.00 0.00 ? 60 LEU A N    6  
ATOM   4140  C CA   . LEU A 1 43 ? 9.787  23.843 5.659   1.00 0.00 ? 60 LEU A CA   6  
ATOM   4141  C C    . LEU A 1 43 ? 8.645  23.576 6.630   1.00 0.00 ? 60 LEU A C    6  
ATOM   4142  O O    . LEU A 1 43 ? 8.804  23.714 7.844   1.00 0.00 ? 60 LEU A O    6  
ATOM   4143  C CB   . LEU A 1 43 ? 9.633  25.231 5.023   1.00 0.00 ? 60 LEU A CB   6  
ATOM   4144  C CG   . LEU A 1 43 ? 10.790 25.664 4.114   1.00 0.00 ? 60 LEU A CG   6  
ATOM   4145  C CD1  . LEU A 1 43 ? 10.467 27.000 3.458   1.00 0.00 ? 60 LEU A CD1  6  
ATOM   4146  C CD2  . LEU A 1 43 ? 12.070 25.760 4.931   1.00 0.00 ? 60 LEU A CD2  6  
ATOM   4147  H H    . LEU A 1 43 ? 9.324  22.949 3.770   1.00 0.00 ? 60 LEU A H    6  
ATOM   4148  H HA   . LEU A 1 43 ? 10.704 23.823 6.246   1.00 0.00 ? 60 LEU A HA   6  
ATOM   4149  H HB2  . LEU A 1 43 ? 8.737  25.055 4.430   1.00 0.00 ? 60 LEU A HB2  6  
ATOM   4150  H HB3  . LEU A 1 43 ? 9.428  25.997 5.771   1.00 0.00 ? 60 LEU A HB3  6  
ATOM   4151  H HG   . LEU A 1 43 ? 10.928 24.881 3.369   1.00 0.00 ? 60 LEU A HG   6  
ATOM   4152  H HD11 . LEU A 1 43 ? 11.293 27.300 2.815   1.00 0.00 ? 60 LEU A HD11 6  
ATOM   4153  H HD12 . LEU A 1 43 ? 9.560  26.902 2.861   1.00 0.00 ? 60 LEU A HD12 6  
ATOM   4154  H HD13 . LEU A 1 43 ? 10.314 27.756 4.229   1.00 0.00 ? 60 LEU A HD13 6  
ATOM   4155  H HD21 . LEU A 1 43 ? 12.297 24.788 5.367   1.00 0.00 ? 60 LEU A HD21 6  
ATOM   4156  H HD22 . LEU A 1 43 ? 12.892 26.068 4.284   1.00 0.00 ? 60 LEU A HD22 6  
ATOM   4157  H HD23 . LEU A 1 43 ? 11.940 26.495 5.727   1.00 0.00 ? 60 LEU A HD23 6  
ATOM   4158  N N    . ASP A 1 44 ? 7.494  23.191 6.092   1.00 0.00 ? 61 ASP A N    6  
ATOM   4159  C CA   . ASP A 1 44 ? 6.343  22.837 6.913   1.00 0.00 ? 61 ASP A CA   6  
ATOM   4160  C C    . ASP A 1 44 ? 6.408  21.380 7.354   1.00 0.00 ? 61 ASP A C    6  
ATOM   4161  O O    . ASP A 1 44 ? 5.672  20.534 6.847   1.00 0.00 ? 61 ASP A O    6  
ATOM   4162  C CB   . ASP A 1 44 ? 5.040  23.098 6.155   1.00 0.00 ? 61 ASP A CB   6  
ATOM   4163  C CG   . ASP A 1 44 ? 3.780  22.948 6.997   1.00 0.00 ? 61 ASP A CG   6  
ATOM   4164  O OD1  . ASP A 1 44 ? 3.902  22.746 8.182   1.00 0.00 ? 61 ASP A OD1  6  
ATOM   4165  O OD2  . ASP A 1 44 ? 2.714  23.190 6.483   1.00 0.00 ? 61 ASP A OD2  6  
ATOM   4166  H H    . ASP A 1 44 ? 7.412  23.144 5.086   1.00 0.00 ? 61 ASP A H    6  
ATOM   4167  H HA   . ASP A 1 44 ? 6.341  23.436 7.824   1.00 0.00 ? 61 ASP A HA   6  
ATOM   4168  H HB2  . ASP A 1 44 ? 5.021  24.060 5.642   1.00 0.00 ? 61 ASP A HB2  6  
ATOM   4169  H HB3  . ASP A 1 44 ? 5.082  22.294 5.419   1.00 0.00 ? 61 ASP A HB3  6  
ATOM   4170  N N    . ARG A 1 45 ? 7.295  21.093 8.301   1.00 0.00 ? 62 ARG A N    6  
ATOM   4171  C CA   . ARG A 1 45 ? 7.474  19.733 8.796   1.00 0.00 ? 62 ARG A CA   6  
ATOM   4172  C C    . ARG A 1 45 ? 6.397  19.371 9.811   1.00 0.00 ? 62 ARG A C    6  
ATOM   4173  O O    . ARG A 1 45 ? 5.307  19.039 9.436   1.00 0.00 ? 62 ARG A O    6  
ATOM   4174  C CB   . ARG A 1 45 ? 8.869  19.506 9.360   1.00 0.00 ? 62 ARG A CB   6  
ATOM   4175  C CG   . ARG A 1 45 ? 9.993  19.599 8.339   1.00 0.00 ? 62 ARG A CG   6  
ATOM   4176  C CD   . ARG A 1 45 ? 11.356 19.470 8.917   1.00 0.00 ? 62 ARG A CD   6  
ATOM   4177  N NE   . ARG A 1 45 ? 11.768 20.593 9.745   1.00 0.00 ? 62 ARG A NE   6  
ATOM   4178  C CZ   . ARG A 1 45 ? 12.848 20.593 10.551  1.00 0.00 ? 62 ARG A CZ   6  
ATOM   4179  N NH1  . ARG A 1 45 ? 13.603 19.523 10.670  1.00 0.00 ? 62 ARG A NH1  6  
ATOM   4180  N NH2  . ARG A 1 45 ? 13.114 21.690 11.237  1.00 0.00 ? 62 ARG A NH2  6  
ATOM   4181  O OXT  . ARG A 1 45 ? 6.640  19.417 10.986  1.00 0.00 ? 62 ARG A OXT  6  
ATOM   4182  H H    . ARG A 1 45 ? 7.859  21.836 8.688   1.00 0.00 ? 62 ARG A H    6  
ATOM   4183  H HA   . ARG A 1 45 ? 7.376  19.024 7.973   1.00 0.00 ? 62 ARG A HA   6  
ATOM   4184  H HB2  . ARG A 1 45 ? 9.025  20.255 10.135  1.00 0.00 ? 62 ARG A HB2  6  
ATOM   4185  H HB3  . ARG A 1 45 ? 8.873  18.513 9.808   1.00 0.00 ? 62 ARG A HB3  6  
ATOM   4186  H HG2  . ARG A 1 45 ? 9.863  18.804 7.606   1.00 0.00 ? 62 ARG A HG2  6  
ATOM   4187  H HG3  . ARG A 1 45 ? 9.929  20.568 7.841   1.00 0.00 ? 62 ARG A HG3  6  
ATOM   4188  H HD2  . ARG A 1 45 ? 11.394 18.576 9.538   1.00 0.00 ? 62 ARG A HD2  6  
ATOM   4189  H HD3  . ARG A 1 45 ? 12.077 19.380 8.105   1.00 0.00 ? 62 ARG A HD3  6  
ATOM   4190  H HE   . ARG A 1 45 ? 11.346 21.505 9.851   1.00 0.00 ? 62 ARG A HE   6  
ATOM   4191  H HH11 . ARG A 1 45 ? 13.376 18.686 10.153  1.00 0.00 ? 62 ARG A HH11 6  
ATOM   4192  H HH12 . ARG A 1 45 ? 14.408 19.544 11.281  1.00 0.00 ? 62 ARG A HH12 6  
ATOM   4193  H HH21 . ARG A 1 45 ? 12.512 22.497 11.147  1.00 0.00 ? 62 ARG A HH21 6  
ATOM   4194  H HH22 . ARG A 1 45 ? 13.916 21.717 11.849  1.00 0.00 ? 62 ARG A HH22 6  
ATOM   4195  N N    . PRO A 1 1  ? 0.804  -0.541 0.386   1.00 0.00 ? 18 PRO A N    7  
ATOM   4196  C CA   . PRO A 1 1  ? 2.104  -0.394 -0.258  1.00 0.00 ? 18 PRO A CA   7  
ATOM   4197  C C    . PRO A 1 1  ? 2.575  1.054  -0.224  1.00 0.00 ? 18 PRO A C    7  
ATOM   4198  O O    . PRO A 1 1  ? 2.049  1.905  -0.941  1.00 0.00 ? 18 PRO A O    7  
ATOM   4199  C CB   . PRO A 1 1  ? 1.872  -0.892 -1.688  1.00 0.00 ? 18 PRO A CB   7  
ATOM   4200  C CG   . PRO A 1 1  ? 0.425  -0.636 -1.939  1.00 0.00 ? 18 PRO A CG   7  
ATOM   4201  C CD   . PRO A 1 1  ? -0.253 -0.846 -0.612  1.00 0.00 ? 18 PRO A CD   7  
ATOM   4202  H H2   . PRO A 1 1  ? 0.025  -0.890 -0.135  1.00 0.00 ? 18 PRO A H2   7  
ATOM   4203  H H3   . PRO A 1 1  ? 0.705  -1.142 1.179   1.00 0.00 ? 18 PRO A H3   7  
ATOM   4204  H HA   . PRO A 1 1  ? 2.898  -0.962 0.249   1.00 0.00 ? 18 PRO A HA   7  
ATOM   4205  H HB2  . PRO A 1 1  ? 2.503  -0.351 -2.410  1.00 0.00 ? 18 PRO A HB2  7  
ATOM   4206  H HB3  . PRO A 1 1  ? 2.112  -1.960 -1.787  1.00 0.00 ? 18 PRO A HB3  7  
ATOM   4207  H HG2  . PRO A 1 1  ? 0.260  0.386  -2.311  1.00 0.00 ? 18 PRO A HG2  7  
ATOM   4208  H HG3  . PRO A 1 1  ? 0.027  -1.324 -2.701  1.00 0.00 ? 18 PRO A HG3  7  
ATOM   4209  H HD2  . PRO A 1 1  ? -1.115 -0.176 -0.475  1.00 0.00 ? 18 PRO A HD2  7  
ATOM   4210  H HD3  . PRO A 1 1  ? -0.625 -1.875 -0.492  1.00 0.00 ? 18 PRO A HD3  7  
ATOM   4211  N N    . THR A 1 2  ? 3.570  1.328  0.613   1.00 0.00 ? 19 THR A N    7  
ATOM   4212  C CA   . THR A 1 2  ? 4.114  2.675  0.742   1.00 0.00 ? 19 THR A CA   7  
ATOM   4213  C C    . THR A 1 2  ? 5.581  2.717  0.330   1.00 0.00 ? 19 THR A C    7  
ATOM   4214  O O    . THR A 1 2  ? 6.387  1.907  0.788   1.00 0.00 ? 19 THR A O    7  
ATOM   4215  C CB   . THR A 1 2  ? 3.980  3.204  2.181   1.00 0.00 ? 19 THR A CB   7  
ATOM   4216  O OG1  . THR A 1 2  ? 2.596  3.244  2.550   1.00 0.00 ? 19 THR A OG1  7  
ATOM   4217  C CG2  . THR A 1 2  ? 4.570  4.602  2.292   1.00 0.00 ? 19 THR A CG2  7  
ATOM   4218  H H    . THR A 1 2  ? 3.958  0.585  1.176   1.00 0.00 ? 19 THR A H    7  
ATOM   4219  H HA   . THR A 1 2  ? 3.587  3.352  0.069   1.00 0.00 ? 19 THR A HA   7  
ATOM   4220  H HB   . THR A 1 2  ? 4.509  2.533  2.856   1.00 0.00 ? 19 THR A HB   7  
ATOM   4221  H HG1  . THR A 1 2  ? 2.515  3.574  3.449   1.00 0.00 ? 19 THR A HG1  7  
ATOM   4222  H HG21 . THR A 1 2  ? 4.042  5.274  1.617   1.00 0.00 ? 19 THR A HG21 7  
ATOM   4223  H HG22 . THR A 1 2  ? 4.467  4.959  3.316   1.00 0.00 ? 19 THR A HG22 7  
ATOM   4224  H HG23 . THR A 1 2  ? 5.627  4.573  2.022   1.00 0.00 ? 19 THR A HG23 7  
ATOM   4225  N N    . ARG A 1 3  ? 5.920  3.665  -0.537  1.00 0.00 ? 20 ARG A N    7  
ATOM   4226  C CA   . ARG A 1 3  ? 7.292  3.820  -1.005  1.00 0.00 ? 20 ARG A CA   7  
ATOM   4227  C C    . ARG A 1 3  ? 7.820  5.218  -0.710  1.00 0.00 ? 20 ARG A C    7  
ATOM   4228  O O    . ARG A 1 3  ? 7.169  6.216  -1.022  1.00 0.00 ? 20 ARG A O    7  
ATOM   4229  C CB   . ARG A 1 3  ? 7.441  3.467  -2.477  1.00 0.00 ? 20 ARG A CB   7  
ATOM   4230  C CG   . ARG A 1 3  ? 8.839  3.655  -3.042  1.00 0.00 ? 20 ARG A CG   7  
ATOM   4231  C CD   . ARG A 1 3  ? 8.980  3.269  -4.469  1.00 0.00 ? 20 ARG A CD   7  
ATOM   4232  N NE   . ARG A 1 3  ? 10.307 3.484  -5.024  1.00 0.00 ? 20 ARG A NE   7  
ATOM   4233  C CZ   . ARG A 1 3  ? 10.677 3.146  -6.274  1.00 0.00 ? 20 ARG A CZ   7  
ATOM   4234  N NH1  . ARG A 1 3  ? 9.840  2.545  -7.090  1.00 0.00 ? 20 ARG A NH1  7  
ATOM   4235  N NH2  . ARG A 1 3  ? 11.915 3.413  -6.653  1.00 0.00 ? 20 ARG A NH2  7  
ATOM   4236  H H    . ARG A 1 3  ? 5.209  4.295  -0.880  1.00 0.00 ? 20 ARG A H    7  
ATOM   4237  H HA   . ARG A 1 3  ? 7.944  3.124  -0.473  1.00 0.00 ? 20 ARG A HA   7  
ATOM   4238  H HB2  . ARG A 1 3  ? 7.146  2.424  -2.585  1.00 0.00 ? 20 ARG A HB2  7  
ATOM   4239  H HB3  . ARG A 1 3  ? 6.744  4.100  -3.027  1.00 0.00 ? 20 ARG A HB3  7  
ATOM   4240  H HG2  . ARG A 1 3  ? 9.112  4.706  -2.950  1.00 0.00 ? 20 ARG A HG2  7  
ATOM   4241  H HG3  . ARG A 1 3  ? 9.533  3.047  -2.460  1.00 0.00 ? 20 ARG A HG3  7  
ATOM   4242  H HD2  . ARG A 1 3  ? 8.751  2.210  -4.574  1.00 0.00 ? 20 ARG A HD2  7  
ATOM   4243  H HD3  . ARG A 1 3  ? 8.279  3.854  -5.065  1.00 0.00 ? 20 ARG A HD3  7  
ATOM   4244  H HE   . ARG A 1 3  ? 11.125 3.896  -4.596  1.00 0.00 ? 20 ARG A HE   7  
ATOM   4245  H HH11 . ARG A 1 3  ? 8.903  2.331  -6.780  1.00 0.00 ? 20 ARG A HH11 7  
ATOM   4246  H HH12 . ARG A 1 3  ? 10.138 2.299  -8.023  1.00 0.00 ? 20 ARG A HH12 7  
ATOM   4247  H HH21 . ARG A 1 3  ? 12.552 3.859  -6.007  1.00 0.00 ? 20 ARG A HH21 7  
ATOM   4248  H HH22 . ARG A 1 3  ? 12.220 3.170  -7.583  1.00 0.00 ? 20 ARG A HH22 7  
ATOM   4249  N N    . THR A 1 4  ? 9.002  5.285  -0.109  1.00 0.00 ? 21 THR A N    7  
ATOM   4250  C CA   . THR A 1 4  ? 9.618  6.562  0.232   1.00 0.00 ? 21 THR A CA   7  
ATOM   4251  C C    . THR A 1 4  ? 10.671 6.956  -0.797  1.00 0.00 ? 21 THR A C    7  
ATOM   4252  O O    . THR A 1 4  ? 11.649 6.238  -1.006  1.00 0.00 ? 21 THR A O    7  
ATOM   4253  C CB   . THR A 1 4  ? 10.268 6.522  1.627   1.00 0.00 ? 21 THR A CB   7  
ATOM   4254  O OG1  . THR A 1 4  ? 9.268  6.241  2.615   1.00 0.00 ? 21 THR A OG1  7  
ATOM   4255  C CG2  . THR A 1 4  ? 10.929 7.855  1.945   1.00 0.00 ? 21 THR A CG2  7  
ATOM   4256  H H    . THR A 1 4  ? 9.487  4.429  0.120   1.00 0.00 ? 21 THR A H    7  
ATOM   4257  H HA   . THR A 1 4  ? 8.865  7.350  0.220   1.00 0.00 ? 21 THR A HA   7  
ATOM   4258  H HB   . THR A 1 4  ? 11.019 5.733  1.646   1.00 0.00 ? 21 THR A HB   7  
ATOM   4259  H HG1  . THR A 1 4  ? 9.677  6.217  3.484   1.00 0.00 ? 21 THR A HG1  7  
ATOM   4260  H HG21 . THR A 1 4  ? 10.179 8.645  1.927   1.00 0.00 ? 21 THR A HG21 7  
ATOM   4261  H HG22 . THR A 1 4  ? 11.383 7.808  2.935   1.00 0.00 ? 21 THR A HG22 7  
ATOM   4262  H HG23 . THR A 1 4  ? 11.698 8.067  1.202   1.00 0.00 ? 21 THR A HG23 7  
ATOM   4263  N N    . VAL A 1 5  ? 10.465 8.103  -1.437  1.00 0.00 ? 22 VAL A N    7  
ATOM   4264  C CA   . VAL A 1 5  ? 11.415 8.613  -2.419  1.00 0.00 ? 22 VAL A CA   7  
ATOM   4265  C C    . VAL A 1 5  ? 11.833 10.040 -2.091  1.00 0.00 ? 22 VAL A C    7  
ATOM   4266  O O    . VAL A 1 5  ? 10.991 10.901 -1.837  1.00 0.00 ? 22 VAL A O    7  
ATOM   4267  C CB   . VAL A 1 5  ? 10.829 8.575  -3.843  1.00 0.00 ? 22 VAL A CB   7  
ATOM   4268  C CG1  . VAL A 1 5  ? 11.809 9.180  -4.838  1.00 0.00 ? 22 VAL A CG1  7  
ATOM   4269  C CG2  . VAL A 1 5  ? 10.482 7.149  -4.239  1.00 0.00 ? 22 VAL A CG2  7  
ATOM   4270  H H    . VAL A 1 5  ? 9.630  8.634  -1.238  1.00 0.00 ? 22 VAL A H    7  
ATOM   4271  H HA   . VAL A 1 5  ? 12.342 8.040  -2.409  1.00 0.00 ? 22 VAL A HA   7  
ATOM   4272  H HB   . VAL A 1 5  ? 9.899  9.143  -3.859  1.00 0.00 ? 22 VAL A HB   7  
ATOM   4273  H HG11 . VAL A 1 5  ? 11.379 9.145  -5.839  1.00 0.00 ? 22 VAL A HG11 7  
ATOM   4274  H HG12 . VAL A 1 5  ? 12.010 10.215 -4.566  1.00 0.00 ? 22 VAL A HG12 7  
ATOM   4275  H HG13 . VAL A 1 5  ? 12.739 8.612  -4.823  1.00 0.00 ? 22 VAL A HG13 7  
ATOM   4276  H HG21 . VAL A 1 5  ? 9.747  6.745  -3.543  1.00 0.00 ? 22 VAL A HG21 7  
ATOM   4277  H HG22 . VAL A 1 5  ? 10.070 7.139  -5.247  1.00 0.00 ? 22 VAL A HG22 7  
ATOM   4278  H HG23 . VAL A 1 5  ? 11.384 6.535  -4.210  1.00 0.00 ? 22 VAL A HG23 7  
ATOM   4279  N N    . ALA A 1 6  ? 13.139 10.285 -2.096  1.00 0.00 ? 23 ALA A N    7  
ATOM   4280  C CA   . ALA A 1 6  ? 13.672 11.612 -1.811  1.00 0.00 ? 23 ALA A CA   7  
ATOM   4281  C C    . ALA A 1 6  ? 13.855 12.418 -3.091  1.00 0.00 ? 23 ALA A C    7  
ATOM   4282  O O    . ALA A 1 6  ? 14.154 11.864 -4.148  1.00 0.00 ? 23 ALA A O    7  
ATOM   4283  C CB   . ALA A 1 6  ? 14.988 11.503 -1.055  1.00 0.00 ? 23 ALA A CB   7  
ATOM   4284  H H    . ALA A 1 6  ? 13.779 9.532  -2.305  1.00 0.00 ? 23 ALA A H    7  
ATOM   4285  H HA   . ALA A 1 6  ? 12.956 12.149 -1.188  1.00 0.00 ? 23 ALA A HA   7  
ATOM   4286  H HB1  . ALA A 1 6  ? 15.709 10.955 -1.659  1.00 0.00 ? 23 ALA A HB1  7  
ATOM   4287  H HB2  . ALA A 1 6  ? 15.372 12.502 -0.850  1.00 0.00 ? 23 ALA A HB2  7  
ATOM   4288  H HB3  . ALA A 1 6  ? 14.825 10.976 -0.115  1.00 0.00 ? 23 ALA A HB3  7  
ATOM   4289  N N    . ILE A 1 7  ? 13.674 13.731 -2.987  1.00 0.00 ? 24 ILE A N    7  
ATOM   4290  C CA   . ILE A 1 7  ? 13.879 14.624 -4.121  1.00 0.00 ? 24 ILE A CA   7  
ATOM   4291  C C    . ILE A 1 7  ? 14.882 15.720 -3.784  1.00 0.00 ? 24 ILE A C    7  
ATOM   4292  O O    . ILE A 1 7  ? 14.522 16.753 -3.218  1.00 0.00 ? 24 ILE A O    7  
ATOM   4293  C CB   . ILE A 1 7  ? 12.559 15.271 -4.577  1.00 0.00 ? 24 ILE A CB   7  
ATOM   4294  C CG1  . ILE A 1 7  ? 11.544 14.194 -4.968  1.00 0.00 ? 24 ILE A CG1  7  
ATOM   4295  C CG2  . ILE A 1 7  ? 12.806 16.222 -5.738  1.00 0.00 ? 24 ILE A CG2  7  
ATOM   4296  C CD1  . ILE A 1 7  ? 10.190 14.744 -5.356  1.00 0.00 ? 24 ILE A CD1  7  
ATOM   4297  H H    . ILE A 1 7  ? 13.387 14.120 -2.100  1.00 0.00 ? 24 ILE A H    7  
ATOM   4298  H HA   . ILE A 1 7  ? 14.327 14.087 -4.956  1.00 0.00 ? 24 ILE A HA   7  
ATOM   4299  H HB   . ILE A 1 7  ? 12.126 15.822 -3.742  1.00 0.00 ? 24 ILE A HB   7  
ATOM   4300  H HG12 . ILE A 1 7  ? 11.965 13.640 -5.806  1.00 0.00 ? 24 ILE A HG12 7  
ATOM   4301  H HG13 . ILE A 1 7  ? 11.432 13.528 -4.111  1.00 0.00 ? 24 ILE A HG13 7  
ATOM   4302  H HG21 . ILE A 1 7  ? 11.862 16.671 -6.049  1.00 0.00 ? 24 ILE A HG21 7  
ATOM   4303  H HG22 . ILE A 1 7  ? 13.494 17.006 -5.426  1.00 0.00 ? 24 ILE A HG22 7  
ATOM   4304  H HG23 . ILE A 1 7  ? 13.237 15.671 -6.574  1.00 0.00 ? 24 ILE A HG23 7  
ATOM   4305  H HD11 . ILE A 1 7  ? 10.298 15.409 -6.213  1.00 0.00 ? 24 ILE A HD11 7  
ATOM   4306  H HD12 . ILE A 1 7  ? 9.525  13.922 -5.620  1.00 0.00 ? 24 ILE A HD12 7  
ATOM   4307  H HD13 . ILE A 1 7  ? 9.767  15.297 -4.518  1.00 0.00 ? 24 ILE A HD13 7  
ATOM   4308  N N    . SER A 1 8  ? 16.143 15.490 -4.135  1.00 0.00 ? 25 SER A N    7  
ATOM   4309  C CA   . SER A 1 8  ? 17.209 16.435 -3.825  1.00 0.00 ? 25 SER A CA   7  
ATOM   4310  C C    . SER A 1 8  ? 17.299 17.530 -4.880  1.00 0.00 ? 25 SER A C    7  
ATOM   4311  O O    . SER A 1 8  ? 17.873 18.592 -4.640  1.00 0.00 ? 25 SER A O    7  
ATOM   4312  C CB   . SER A 1 8  ? 18.534 15.707 -3.705  1.00 0.00 ? 25 SER A CB   7  
ATOM   4313  O OG   . SER A 1 8  ? 18.954 15.174 -4.932  1.00 0.00 ? 25 SER A OG   7  
ATOM   4314  H H    . SER A 1 8  ? 16.368 14.638 -4.629  1.00 0.00 ? 25 SER A H    7  
ATOM   4315  H HA   . SER A 1 8  ? 17.117 16.882 -2.834  1.00 0.00 ? 25 SER A HA   7  
ATOM   4316  H HB2  . SER A 1 8  ? 19.286 16.409 -3.348  1.00 0.00 ? 25 SER A HB2  7  
ATOM   4317  H HB3  . SER A 1 8  ? 18.423 14.897 -2.986  1.00 0.00 ? 25 SER A HB3  7  
ATOM   4318  H HG   . SER A 1 8  ? 19.793 14.723 -4.812  1.00 0.00 ? 25 SER A HG   7  
ATOM   4319  N N    . ASP A 1 9  ? 16.728 17.265 -6.051  1.00 0.00 ? 26 ASP A N    7  
ATOM   4320  C CA   . ASP A 1 9  ? 16.777 18.211 -7.159  1.00 0.00 ? 26 ASP A CA   7  
ATOM   4321  C C    . ASP A 1 9  ? 15.610 18.000 -8.115  1.00 0.00 ? 26 ASP A C    7  
ATOM   4322  O O    . ASP A 1 9  ? 14.867 17.025 -7.999  1.00 0.00 ? 26 ASP A O    7  
ATOM   4323  C CB   . ASP A 1 9  ? 18.103 18.086 -7.913  1.00 0.00 ? 26 ASP A CB   7  
ATOM   4324  C CG   . ASP A 1 9  ? 18.525 19.346 -8.658  1.00 0.00 ? 26 ASP A CG   7  
ATOM   4325  O OD1  . ASP A 1 9  ? 17.806 20.316 -8.599  1.00 0.00 ? 26 ASP A OD1  7  
ATOM   4326  O OD2  . ASP A 1 9  ? 19.628 19.381 -9.146  1.00 0.00 ? 26 ASP A OD2  7  
ATOM   4327  H H    . ASP A 1 9  ? 16.248 16.384 -6.176  1.00 0.00 ? 26 ASP A H    7  
ATOM   4328  H HA   . ASP A 1 9  ? 16.687 19.229 -6.779  1.00 0.00 ? 26 ASP A HA   7  
ATOM   4329  H HB2  . ASP A 1 9  ? 18.928 17.741 -7.288  1.00 0.00 ? 26 ASP A HB2  7  
ATOM   4330  H HB3  . ASP A 1 9  ? 17.841 17.309 -8.632  1.00 0.00 ? 26 ASP A HB3  7  
ATOM   4331  N N    . ALA A 1 10 ? 15.452 18.920 -9.061  1.00 0.00 ? 27 ALA A N    7  
ATOM   4332  C CA   . ALA A 1 10 ? 14.409 18.809 -10.073 1.00 0.00 ? 27 ALA A CA   7  
ATOM   4333  C C    . ALA A 1 10 ? 14.597 17.560 -10.923 1.00 0.00 ? 27 ALA A C    7  
ATOM   4334  O O    . ALA A 1 10 ? 13.642 17.039 -11.499 1.00 0.00 ? 27 ALA A O    7  
ATOM   4335  C CB   . ALA A 1 10 ? 14.385 20.053 -10.948 1.00 0.00 ? 27 ALA A CB   7  
ATOM   4336  H H    . ALA A 1 10 ? 16.073 19.717 -9.079  1.00 0.00 ? 27 ALA A H    7  
ATOM   4337  H HA   . ALA A 1 10 ? 13.445 18.717 -9.571  1.00 0.00 ? 27 ALA A HA   7  
ATOM   4338  H HB1  . ALA A 1 10 ? 15.347 20.167 -11.444 1.00 0.00 ? 27 ALA A HB1  7  
ATOM   4339  H HB2  . ALA A 1 10 ? 13.600 19.953 -11.697 1.00 0.00 ? 27 ALA A HB2  7  
ATOM   4340  H HB3  . ALA A 1 10 ? 14.188 20.930 -10.331 1.00 0.00 ? 27 ALA A HB3  7  
ATOM   4341  N N    . ALA A 1 11 ? 15.836 17.084 -11.000 1.00 0.00 ? 28 ALA A N    7  
ATOM   4342  C CA   . ALA A 1 11 ? 16.135 15.836 -11.691 1.00 0.00 ? 28 ALA A CA   7  
ATOM   4343  C C    . ALA A 1 11 ? 15.387 14.666 -11.064 1.00 0.00 ? 28 ALA A C    7  
ATOM   4344  O O    . ALA A 1 11 ? 15.091 13.675 -11.732 1.00 0.00 ? 28 ALA A O    7  
ATOM   4345  C CB   . ALA A 1 11 ? 17.634 15.573 -11.687 1.00 0.00 ? 28 ALA A CB   7  
ATOM   4346  H H    . ALA A 1 11 ? 16.588 17.600 -10.568 1.00 0.00 ? 28 ALA A H    7  
ATOM   4347  H HA   . ALA A 1 11 ? 15.799 15.918 -12.725 1.00 0.00 ? 28 ALA A HA   7  
ATOM   4348  H HB1  . ALA A 1 11 ? 17.987 15.503 -10.659 1.00 0.00 ? 28 ALA A HB1  7  
ATOM   4349  H HB2  . ALA A 1 11 ? 17.840 14.637 -12.206 1.00 0.00 ? 28 ALA A HB2  7  
ATOM   4350  H HB3  . ALA A 1 11 ? 18.148 16.391 -12.193 1.00 0.00 ? 28 ALA A HB3  7  
ATOM   4351  N N    . GLN A 1 12 ? 15.083 14.787 -9.776  1.00 0.00 ? 29 GLN A N    7  
ATOM   4352  C CA   . GLN A 1 12 ? 14.399 13.725 -9.047  1.00 0.00 ? 29 GLN A CA   7  
ATOM   4353  C C    . GLN A 1 12 ? 12.911 14.021 -8.911  1.00 0.00 ? 29 GLN A C    7  
ATOM   4354  O O    . GLN A 1 12 ? 12.181 13.289 -8.242  1.00 0.00 ? 29 GLN A O    7  
ATOM   4355  C CB   . GLN A 1 12 ? 15.018 13.542 -7.659  1.00 0.00 ? 29 GLN A CB   7  
ATOM   4356  C CG   . GLN A 1 12 ? 16.512 13.265 -7.675  1.00 0.00 ? 29 GLN A CG   7  
ATOM   4357  C CD   . GLN A 1 12 ? 16.856 11.984 -8.411  1.00 0.00 ? 29 GLN A CD   7  
ATOM   4358  O OE1  . GLN A 1 12 ? 16.244 10.938 -8.182  1.00 0.00 ? 29 GLN A OE1  7  
ATOM   4359  N NE2  . GLN A 1 12 ? 17.841 12.059 -9.298  1.00 0.00 ? 29 GLN A NE2  7  
ATOM   4360  H H    . GLN A 1 12 ? 15.333 15.636 -9.289  1.00 0.00 ? 29 GLN A H    7  
ATOM   4361  H HA   . GLN A 1 12 ? 14.479 12.791 -9.602  1.00 0.00 ? 29 GLN A HA   7  
ATOM   4362  H HB2  . GLN A 1 12 ? 14.818 14.457 -7.101  1.00 0.00 ? 29 GLN A HB2  7  
ATOM   4363  H HB3  . GLN A 1 12 ? 14.495 12.710 -7.188  1.00 0.00 ? 29 GLN A HB3  7  
ATOM   4364  H HG2  . GLN A 1 12 ? 17.248 14.020 -7.953  1.00 0.00 ? 29 GLN A HG2  7  
ATOM   4365  H HG3  . GLN A 1 12 ? 16.576 13.077 -6.603  1.00 0.00 ? 29 GLN A HG3  7  
ATOM   4366  H HE21 . GLN A 1 12 ? 18.312 12.927 -9.451  1.00 0.00 ? 29 GLN A HE21 7  
ATOM   4367  H HE22 . GLN A 1 12 ? 18.113 11.246 -9.813  1.00 0.00 ? 29 GLN A HE22 7  
ATOM   4368  N N    . LEU A 1 13 ? 12.466 15.098 -9.549  1.00 0.00 ? 30 LEU A N    7  
ATOM   4369  C CA   . LEU A 1 13 ? 11.069 15.509 -9.480  1.00 0.00 ? 30 LEU A CA   7  
ATOM   4370  C C    . LEU A 1 13 ? 10.279 14.978 -10.669 1.00 0.00 ? 30 LEU A C    7  
ATOM   4371  O O    . LEU A 1 13 ? 10.547 15.340 -11.815 1.00 0.00 ? 30 LEU A O    7  
ATOM   4372  C CB   . LEU A 1 13 ? 10.968 17.037 -9.411  1.00 0.00 ? 30 LEU A CB   7  
ATOM   4373  C CG   . LEU A 1 13 ? 9.547  17.591 -9.242  1.00 0.00 ? 30 LEU A CG   7  
ATOM   4374  C CD1  . LEU A 1 13 ? 9.014  17.245 -7.858  1.00 0.00 ? 30 LEU A CD1  7  
ATOM   4375  C CD2  . LEU A 1 13 ? 9.559  19.097 -9.455  1.00 0.00 ? 30 LEU A CD2  7  
ATOM   4376  H H    . LEU A 1 13 ? 13.113 15.648 -10.097 1.00 0.00 ? 30 LEU A H    7  
ATOM   4377  H HA   . LEU A 1 13 ? 10.608 15.084 -8.589  1.00 0.00 ? 30 LEU A HA   7  
ATOM   4378  H HB2  . LEU A 1 13 ? 11.547 17.212 -8.506  1.00 0.00 ? 30 LEU A HB2  7  
ATOM   4379  H HB3  . LEU A 1 13 ? 11.463 17.513 -10.257 1.00 0.00 ? 30 LEU A HB3  7  
ATOM   4380  H HG   . LEU A 1 13 ? 8.932  17.148 -10.026 1.00 0.00 ? 30 LEU A HG   7  
ATOM   4381  H HD11 . LEU A 1 13 ? 8.004  17.642 -7.748  1.00 0.00 ? 30 LEU A HD11 7  
ATOM   4382  H HD12 . LEU A 1 13 ? 8.991  16.162 -7.737  1.00 0.00 ? 30 LEU A HD12 7  
ATOM   4383  H HD13 . LEU A 1 13 ? 9.660  17.684 -7.100  1.00 0.00 ? 30 LEU A HD13 7  
ATOM   4384  H HD21 . LEU A 1 13 ? 9.917  19.319 -10.460 1.00 0.00 ? 30 LEU A HD21 7  
ATOM   4385  H HD22 . LEU A 1 13 ? 8.548  19.489 -9.336  1.00 0.00 ? 30 LEU A HD22 7  
ATOM   4386  H HD23 . LEU A 1 13 ? 10.218 19.563 -8.724  1.00 0.00 ? 30 LEU A HD23 7  
ATOM   4387  N N    . PRO A 1 14 ? 9.305  14.118 -10.391 1.00 0.00 ? 31 PRO A N    7  
ATOM   4388  C CA   . PRO A 1 14 ? 8.440  13.577 -11.432 1.00 0.00 ? 31 PRO A CA   7  
ATOM   4389  C C    . PRO A 1 14 ? 7.498  14.644 -11.975 1.00 0.00 ? 31 PRO A C    7  
ATOM   4390  O O    . PRO A 1 14 ? 7.557  15.804 -11.567 1.00 0.00 ? 31 PRO A O    7  
ATOM   4391  C CB   . PRO A 1 14 ? 7.684  12.440 -10.737 1.00 0.00 ? 31 PRO A CB   7  
ATOM   4392  C CG   . PRO A 1 14 ? 7.637  12.847 -9.303  1.00 0.00 ? 31 PRO A CG   7  
ATOM   4393  C CD   . PRO A 1 14 ? 8.944  13.547 -9.045  1.00 0.00 ? 31 PRO A CD   7  
ATOM   4394  H HA   . PRO A 1 14 ? 9.000  13.221 -12.309 1.00 0.00 ? 31 PRO A HA   7  
ATOM   4395  H HB2  . PRO A 1 14 ? 6.672  12.318 -11.150 1.00 0.00 ? 31 PRO A HB2  7  
ATOM   4396  H HB3  . PRO A 1 14 ? 8.201  11.477 -10.861 1.00 0.00 ? 31 PRO A HB3  7  
ATOM   4397  H HG2  . PRO A 1 14 ? 6.786  13.515 -9.107  1.00 0.00 ? 31 PRO A HG2  7  
ATOM   4398  H HG3  . PRO A 1 14 ? 7.519  11.974 -8.646  1.00 0.00 ? 31 PRO A HG3  7  
ATOM   4399  H HD2  . PRO A 1 14 ? 8.848  14.342 -8.290  1.00 0.00 ? 31 PRO A HD2  7  
ATOM   4400  H HD3  . PRO A 1 14 ? 9.723  12.857 -8.686  1.00 0.00 ? 31 PRO A HD3  7  
ATOM   4401  N N    . HIS A 1 15 ? 6.630  14.245 -12.899 1.00 0.00 ? 32 HIS A N    7  
ATOM   4402  C CA   . HIS A 1 15 ? 5.641  15.155 -13.463 1.00 0.00 ? 32 HIS A CA   7  
ATOM   4403  C C    . HIS A 1 15 ? 4.228  14.617 -13.278 1.00 0.00 ? 32 HIS A C    7  
ATOM   4404  O O    . HIS A 1 15 ? 3.250  15.288 -13.608 1.00 0.00 ? 32 HIS A O    7  
ATOM   4405  C CB   . HIS A 1 15 ? 5.917  15.398 -14.952 1.00 0.00 ? 32 HIS A CB   7  
ATOM   4406  C CG   . HIS A 1 15 ? 7.258  16.004 -15.223 1.00 0.00 ? 32 HIS A CG   7  
ATOM   4407  N ND1  . HIS A 1 15 ? 7.594  17.280 -14.819 1.00 0.00 ? 32 HIS A ND1  7  
ATOM   4408  C CD2  . HIS A 1 15 ? 8.347  15.512 -15.859 1.00 0.00 ? 32 HIS A CD2  7  
ATOM   4409  C CE1  . HIS A 1 15 ? 8.833  17.545 -15.194 1.00 0.00 ? 32 HIS A CE1  7  
ATOM   4410  N NE2  . HIS A 1 15 ? 9.311  16.490 -15.828 1.00 0.00 ? 32 HIS A NE2  7  
ATOM   4411  H H    . HIS A 1 15 ? 6.656  13.287 -13.217 1.00 0.00 ? 32 HIS A H    7  
ATOM   4412  H HA   . HIS A 1 15 ? 5.680  16.110 -12.941 1.00 0.00 ? 32 HIS A HA   7  
ATOM   4413  H HB2  . HIS A 1 15 ? 5.885  14.455 -15.499 1.00 0.00 ? 32 HIS A HB2  7  
ATOM   4414  H HB3  . HIS A 1 15 ? 5.175  16.082 -15.364 1.00 0.00 ? 32 HIS A HB3  7  
ATOM   4415  H HD1  . HIS A 1 15 ? 7.033  17.889 -14.257 1.00 0.00 ? 32 HIS A HD1  7  
ATOM   4416  H HD2  . HIS A 1 15 ? 8.553  14.557 -16.344 1.00 0.00 ? 32 HIS A HD2  7  
ATOM   4417  H HE1  . HIS A 1 15 ? 9.287  18.508 -14.967 1.00 0.00 ? 32 HIS A HE1  7  
ATOM   4418  N N    . ASP A 1 16 ? 4.127  13.405 -12.745 1.00 0.00 ? 33 ASP A N    7  
ATOM   4419  C CA   . ASP A 1 16 ? 2.832  12.780 -12.499 1.00 0.00 ? 33 ASP A CA   7  
ATOM   4420  C C    . ASP A 1 16 ? 2.525  12.720 -11.009 1.00 0.00 ? 33 ASP A C    7  
ATOM   4421  O O    . ASP A 1 16 ? 1.952  11.745 -10.523 1.00 0.00 ? 33 ASP A O    7  
ATOM   4422  C CB   . ASP A 1 16 ? 2.791  11.374 -13.103 1.00 0.00 ? 33 ASP A CB   7  
ATOM   4423  C CG   . ASP A 1 16 ? 3.834  10.418 -12.541 1.00 0.00 ? 33 ASP A CG   7  
ATOM   4424  O OD1  . ASP A 1 16 ? 4.677  10.859 -11.798 1.00 0.00 ? 33 ASP A OD1  7  
ATOM   4425  O OD2  . ASP A 1 16 ? 3.688  9.234  -12.732 1.00 0.00 ? 33 ASP A OD2  7  
ATOM   4426  H H    . ASP A 1 16 ? 4.970  12.901 -12.507 1.00 0.00 ? 33 ASP A H    7  
ATOM   4427  H HA   . ASP A 1 16 ? 2.042  13.378 -12.955 1.00 0.00 ? 33 ASP A HA   7  
ATOM   4428  H HB2  . ASP A 1 16 ? 1.807  10.909 -13.052 1.00 0.00 ? 33 ASP A HB2  7  
ATOM   4429  H HB3  . ASP A 1 16 ? 3.031  11.605 -14.142 1.00 0.00 ? 33 ASP A HB3  7  
ATOM   4430  N N    . TYR A 1 17 ? 2.911  13.766 -10.287 1.00 0.00 ? 34 TYR A N    7  
ATOM   4431  C CA   . TYR A 1 17 ? 2.731  13.807 -8.840  1.00 0.00 ? 34 TYR A CA   7  
ATOM   4432  C C    . TYR A 1 17 ? 1.664  14.821 -8.446  1.00 0.00 ? 34 TYR A C    7  
ATOM   4433  O O    . TYR A 1 17 ? 1.305  15.695 -9.234  1.00 0.00 ? 34 TYR A O    7  
ATOM   4434  C CB   . TYR A 1 17 ? 4.054  14.140 -8.146  1.00 0.00 ? 34 TYR A CB   7  
ATOM   4435  C CG   . TYR A 1 17 ? 4.489  15.579 -8.316  1.00 0.00 ? 34 TYR A CG   7  
ATOM   4436  C CD1  . TYR A 1 17 ? 4.032  16.568 -7.457  1.00 0.00 ? 34 TYR A CD1  7  
ATOM   4437  C CD2  . TYR A 1 17 ? 5.360  15.943 -9.332  1.00 0.00 ? 34 TYR A CD2  7  
ATOM   4438  C CE1  . TYR A 1 17 ? 4.426  17.884 -7.608  1.00 0.00 ? 34 TYR A CE1  7  
ATOM   4439  C CE2  . TYR A 1 17 ? 5.761  17.255 -9.492  1.00 0.00 ? 34 TYR A CE2  7  
ATOM   4440  C CZ   . TYR A 1 17 ? 5.292  18.224 -8.628  1.00 0.00 ? 34 TYR A CZ   7  
ATOM   4441  O OH   . TYR A 1 17 ? 5.690  19.531 -8.781  1.00 0.00 ? 34 TYR A OH   7  
ATOM   4442  H H    . TYR A 1 17 ? 3.339  14.553 -10.752 1.00 0.00 ? 34 TYR A H    7  
ATOM   4443  H HA   . TYR A 1 17 ? 2.385  12.837 -8.483  1.00 0.00 ? 34 TYR A HA   7  
ATOM   4444  H HB2  . TYR A 1 17 ? 3.925  13.922 -7.085  1.00 0.00 ? 34 TYR A HB2  7  
ATOM   4445  H HB3  . TYR A 1 17 ? 4.812  13.479 -8.564  1.00 0.00 ? 34 TYR A HB3  7  
ATOM   4446  H HD1  . TYR A 1 17 ? 3.348  16.292 -6.655  1.00 0.00 ? 34 TYR A HD1  7  
ATOM   4447  H HD2  . TYR A 1 17 ? 5.725  15.174 -10.013 1.00 0.00 ? 34 TYR A HD2  7  
ATOM   4448  H HE1  . TYR A 1 17 ? 4.058  18.650 -6.927  1.00 0.00 ? 34 TYR A HE1  7  
ATOM   4449  H HE2  . TYR A 1 17 ? 6.444  17.522 -10.299 1.00 0.00 ? 34 TYR A HE2  7  
ATOM   4450  H HH   . TYR A 1 17 ? 6.292  19.656 -9.519  1.00 0.00 ? 34 TYR A HH   7  
ATOM   4451  N N    . CYS A 1 18 ? 1.161  14.697 -7.223  1.00 0.00 ? 35 CYS A N    7  
ATOM   4452  C CA   . CYS A 1 18 ? 0.284  15.710 -6.649  1.00 0.00 ? 35 CYS A CA   7  
ATOM   4453  C C    . CYS A 1 18 ? 0.784  16.163 -5.283  1.00 0.00 ? 35 CYS A C    7  
ATOM   4454  O O    . CYS A 1 18 ? 1.694  15.561 -4.713  1.00 0.00 ? 35 CYS A O    7  
ATOM   4455  C CB   . CYS A 1 18 ? -1.046 14.969 -6.518  1.00 0.00 ? 35 CYS A CB   7  
ATOM   4456  S SG   . CYS A 1 18 ? -1.751 14.410 -8.087  1.00 0.00 ? 35 CYS A SG   7  
ATOM   4457  H H    . CYS A 1 18 ? 1.393  13.881 -6.676  1.00 0.00 ? 35 CYS A H    7  
ATOM   4458  H HA   . CYS A 1 18 ? 0.139  16.576 -7.297  1.00 0.00 ? 35 CYS A HA   7  
ATOM   4459  H HB2  . CYS A 1 18 ? -0.921 14.076 -5.906  1.00 0.00 ? 35 CYS A HB2  7  
ATOM   4460  H HB3  . CYS A 1 18 ? -1.796 15.619 -6.064  1.00 0.00 ? 35 CYS A HB3  7  
ATOM   4461  H HG   . CYS A 1 18 ? -2.835 13.850 -7.559  1.00 0.00 ? 35 CYS A HG   7  
ATOM   4462  N N    . THR A 1 19 ? 0.184  17.228 -4.762  1.00 0.00 ? 36 THR A N    7  
ATOM   4463  C CA   . THR A 1 19 ? 0.599  17.791 -3.483  1.00 0.00 ? 36 THR A CA   7  
ATOM   4464  C C    . THR A 1 19 ? -0.601 18.065 -2.585  1.00 0.00 ? 36 THR A C    7  
ATOM   4465  O O    . THR A 1 19 ? -1.604 18.623 -3.029  1.00 0.00 ? 36 THR A O    7  
ATOM   4466  C CB   . THR A 1 19 ? 1.393  19.097 -3.672  1.00 0.00 ? 36 THR A CB   7  
ATOM   4467  O OG1  . THR A 1 19 ? 2.533  18.850 -4.506  1.00 0.00 ? 36 THR A OG1  7  
ATOM   4468  C CG2  . THR A 1 19 ? 1.860  19.638 -2.329  1.00 0.00 ? 36 THR A CG2  7  
ATOM   4469  H H    . THR A 1 19 ? -0.580 17.657 -5.264  1.00 0.00 ? 36 THR A H    7  
ATOM   4470  H HA   . THR A 1 19 ? 1.226  17.076 -2.950  1.00 0.00 ? 36 THR A HA   7  
ATOM   4471  H HB   . THR A 1 19 ? 0.753  19.834 -4.156  1.00 0.00 ? 36 THR A HB   7  
ATOM   4472  H HG1  . THR A 1 19 ? 3.026  19.665 -4.623  1.00 0.00 ? 36 THR A HG1  7  
ATOM   4473  H HG21 . THR A 1 19 ? 2.500  18.901 -1.844  1.00 0.00 ? 36 THR A HG21 7  
ATOM   4474  H HG22 . THR A 1 19 ? 2.419  20.559 -2.484  1.00 0.00 ? 36 THR A HG22 7  
ATOM   4475  H HG23 . THR A 1 19 ? 0.994  19.837 -1.697  1.00 0.00 ? 36 THR A HG23 7  
HETATM 4476  N N    . TPO A 1 20 ? -0.491 17.667 -1.323  1.00 0.00 ? 37 TPO A N    7  
HETATM 4477  C CA   . TPO A 1 20 ? -1.567 17.874 -0.359  1.00 0.00 ? 37 TPO A CA   7  
HETATM 4478  C CB   . TPO A 1 20 ? -1.533 16.817 0.760   1.00 0.00 ? 37 TPO A CB   7  
HETATM 4479  C CG2  . TPO A 1 20 ? -1.437 15.418 0.171   1.00 0.00 ? 37 TPO A CG2  7  
HETATM 4480  O OG1  . TPO A 1 20 ? -0.402 17.052 1.609   1.00 0.00 ? 37 TPO A OG1  7  
HETATM 4481  P P    . TPO A 1 20 ? -0.388 16.508 3.127   1.00 0.00 ? 37 TPO A P    7  
HETATM 4482  O O1P  . TPO A 1 20 ? 0.965  16.929 3.756   1.00 0.00 ? 37 TPO A O1P  7  
HETATM 4483  O O2P  . TPO A 1 20 ? -0.531 14.964 3.065   1.00 0.00 ? 37 TPO A O2P  7  
HETATM 4484  O O3P  . TPO A 1 20 ? -1.587 17.162 3.862   1.00 0.00 ? 37 TPO A O3P  7  
HETATM 4485  C C    . TPO A 1 20 ? -1.488 19.261 0.265   1.00 0.00 ? 37 TPO A C    7  
HETATM 4486  O O    . TPO A 1 20 ? -0.464 19.937 0.173   1.00 0.00 ? 37 TPO A O    7  
HETATM 4487  H H    . TPO A 1 20 ? 0.357  17.211 -1.022  1.00 0.00 ? 37 TPO A H    7  
HETATM 4488  H HA   . TPO A 1 20 ? -2.531 17.817 -0.864  1.00 0.00 ? 37 TPO A HA   7  
HETATM 4489  H HB   . TPO A 1 20 ? -2.443 16.898 1.353   1.00 0.00 ? 37 TPO A HB   7  
HETATM 4490  H HG21 . TPO A 1 20 ? -1.414 14.686 0.977   1.00 0.00 ? 37 TPO A HG21 7  
HETATM 4491  H HG22 . TPO A 1 20 ? -2.301 15.232 -0.466  1.00 0.00 ? 37 TPO A HG22 7  
HETATM 4492  H HG23 . TPO A 1 20 ? -0.526 15.336 -0.421  1.00 0.00 ? 37 TPO A HG23 7  
ATOM   4493  N N    . PRO A 1 21 ? -2.578 19.682 0.898   1.00 0.00 ? 38 PRO A N    7  
ATOM   4494  C CA   . PRO A 1 21 ? -2.652 21.010 1.496   1.00 0.00 ? 38 PRO A CA   7  
ATOM   4495  C C    . PRO A 1 21 ? -1.504 21.240 2.471   1.00 0.00 ? 38 PRO A C    7  
ATOM   4496  O O    . PRO A 1 21 ? -1.036 22.365 2.638   1.00 0.00 ? 38 PRO A O    7  
ATOM   4497  C CB   . PRO A 1 21 ? -4.015 21.029 2.195   1.00 0.00 ? 38 PRO A CB   7  
ATOM   4498  C CG   . PRO A 1 21 ? -4.847 20.070 1.415   1.00 0.00 ? 38 PRO A CG   7  
ATOM   4499  C CD   . PRO A 1 21 ? -3.906 18.973 0.998   1.00 0.00 ? 38 PRO A CD   7  
ATOM   4500  H HA   . PRO A 1 21 ? -2.560 21.817 0.754   1.00 0.00 ? 38 PRO A HA   7  
ATOM   4501  H HB2  . PRO A 1 21 ? -3.933 20.720 3.248   1.00 0.00 ? 38 PRO A HB2  7  
ATOM   4502  H HB3  . PRO A 1 21 ? -4.457 22.037 2.189   1.00 0.00 ? 38 PRO A HB3  7  
ATOM   4503  H HG2  . PRO A 1 21 ? -5.673 19.673 2.023   1.00 0.00 ? 38 PRO A HG2  7  
ATOM   4504  H HG3  . PRO A 1 21 ? -5.300 20.557 0.539   1.00 0.00 ? 38 PRO A HG3  7  
ATOM   4505  H HD2  . PRO A 1 21 ? -3.865 18.157 1.734   1.00 0.00 ? 38 PRO A HD2  7  
ATOM   4506  H HD3  . PRO A 1 21 ? -4.191 18.522 0.036   1.00 0.00 ? 38 PRO A HD3  7  
ATOM   4507  N N    . GLY A 1 22 ? -1.055 20.166 3.112   1.00 0.00 ? 39 GLY A N    7  
ATOM   4508  C CA   . GLY A 1 22 ? 0.067  20.240 4.040   1.00 0.00 ? 39 GLY A CA   7  
ATOM   4509  C C    . GLY A 1 22 ? 1.356  20.607 3.316   1.00 0.00 ? 39 GLY A C    7  
ATOM   4510  O O    . GLY A 1 22 ? 2.229  21.268 3.879   1.00 0.00 ? 39 GLY A O    7  
ATOM   4511  H H    . GLY A 1 22 ? -1.503 19.275 2.953   1.00 0.00 ? 39 GLY A H    7  
ATOM   4512  H HA2  . GLY A 1 22 ? -0.144 20.999 4.794   1.00 0.00 ? 39 GLY A HA2  7  
ATOM   4513  H HA3  . GLY A 1 22 ? 0.194  19.273 4.524   1.00 0.00 ? 39 GLY A HA3  7  
ATOM   4514  N N    . GLY A 1 23 ? 1.471  20.175 2.065   1.00 0.00 ? 40 GLY A N    7  
ATOM   4515  C CA   . GLY A 1 23 ? 2.613  20.530 1.232   1.00 0.00 ? 40 GLY A CA   7  
ATOM   4516  C C    . GLY A 1 23 ? 3.496  19.319 0.963   1.00 0.00 ? 40 GLY A C    7  
ATOM   4517  O O    . GLY A 1 23 ? 4.672  19.458 0.626   1.00 0.00 ? 40 GLY A O    7  
ATOM   4518  H H    . GLY A 1 23 ? 0.746  19.585 1.681   1.00 0.00 ? 40 GLY A H    7  
ATOM   4519  H HA2  . GLY A 1 23 ? 2.252  20.925 0.282   1.00 0.00 ? 40 GLY A HA2  7  
ATOM   4520  H HA3  . GLY A 1 23 ? 3.201  21.293 1.741   1.00 0.00 ? 40 GLY A HA3  7  
ATOM   4521  N N    . THR A 1 24 ? 2.923  18.129 1.114   1.00 0.00 ? 41 THR A N    7  
ATOM   4522  C CA   . THR A 1 24 ? 3.653  16.891 0.872   1.00 0.00 ? 41 THR A CA   7  
ATOM   4523  C C    . THR A 1 24 ? 3.368  16.346 -0.521  1.00 0.00 ? 41 THR A C    7  
ATOM   4524  O O    . THR A 1 24 ? 2.211  16.227 -0.927  1.00 0.00 ? 41 THR A O    7  
ATOM   4525  C CB   . THR A 1 24 ? 3.300  15.815 1.915   1.00 0.00 ? 41 THR A CB   7  
ATOM   4526  O OG1  . THR A 1 24 ? 3.665  16.275 3.223   1.00 0.00 ? 41 THR A OG1  7  
ATOM   4527  C CG2  . THR A 1 24 ? 4.038  14.519 1.615   1.00 0.00 ? 41 THR A CG2  7  
ATOM   4528  H H    . THR A 1 24 ? 1.956  18.082 1.403   1.00 0.00 ? 41 THR A H    7  
ATOM   4529  H HA   . THR A 1 24 ? 4.726  17.081 0.914   1.00 0.00 ? 41 THR A HA   7  
ATOM   4530  H HB   . THR A 1 24 ? 2.226  15.635 1.889   1.00 0.00 ? 41 THR A HB   7  
ATOM   4531  H HG1  . THR A 1 24 ? 2.906  16.694 3.637   1.00 0.00 ? 41 THR A HG1  7  
ATOM   4532  H HG21 . THR A 1 24 ? 5.112  14.698 1.641   1.00 0.00 ? 41 THR A HG21 7  
ATOM   4533  H HG22 . THR A 1 24 ? 3.775  13.770 2.363   1.00 0.00 ? 41 THR A HG22 7  
ATOM   4534  H HG23 . THR A 1 24 ? 3.755  14.160 0.625   1.00 0.00 ? 41 THR A HG23 7  
ATOM   4535  N N    . LEU A 1 25 ? 4.427  16.016 -1.251  1.00 0.00 ? 42 LEU A N    7  
ATOM   4536  C CA   . LEU A 1 25 ? 4.292  15.455 -2.590  1.00 0.00 ? 42 LEU A CA   7  
ATOM   4537  C C    . LEU A 1 25 ? 4.034  13.955 -2.536  1.00 0.00 ? 42 LEU A C    7  
ATOM   4538  O O    . LEU A 1 25 ? 4.580  13.252 -1.685  1.00 0.00 ? 42 LEU A O    7  
ATOM   4539  C CB   . LEU A 1 25 ? 5.548  15.750 -3.418  1.00 0.00 ? 42 LEU A CB   7  
ATOM   4540  C CG   . LEU A 1 25 ? 5.536  17.090 -4.166  1.00 0.00 ? 42 LEU A CG   7  
ATOM   4541  C CD1  . LEU A 1 25 ? 5.579  18.243 -3.173  1.00 0.00 ? 42 LEU A CD1  7  
ATOM   4542  C CD2  . LEU A 1 25 ? 6.722  17.152 -5.118  1.00 0.00 ? 42 LEU A CD2  7  
ATOM   4543  H H    . LEU A 1 25 ? 5.352  16.157 -0.869  1.00 0.00 ? 42 LEU A H    7  
ATOM   4544  H HA   . LEU A 1 25 ? 3.429  15.898 -3.086  1.00 0.00 ? 42 LEU A HA   7  
ATOM   4545  H HB2  . LEU A 1 25 ? 6.286  15.776 -2.618  1.00 0.00 ? 42 LEU A HB2  7  
ATOM   4546  H HB3  . LEU A 1 25 ? 5.782  14.935 -4.103  1.00 0.00 ? 42 LEU A HB3  7  
ATOM   4547  H HG   . LEU A 1 25 ? 4.626  17.117 -4.767  1.00 0.00 ? 42 LEU A HG   7  
ATOM   4548  H HD11 . LEU A 1 25 ? 5.569  19.190 -3.714  1.00 0.00 ? 42 LEU A HD11 7  
ATOM   4549  H HD12 . LEU A 1 25 ? 4.709  18.192 -2.518  1.00 0.00 ? 42 LEU A HD12 7  
ATOM   4550  H HD13 . LEU A 1 25 ? 6.488  18.175 -2.577  1.00 0.00 ? 42 LEU A HD13 7  
ATOM   4551  H HD21 . LEU A 1 25 ? 6.657  16.336 -5.836  1.00 0.00 ? 42 LEU A HD21 7  
ATOM   4552  H HD22 . LEU A 1 25 ? 6.712  18.104 -5.649  1.00 0.00 ? 42 LEU A HD22 7  
ATOM   4553  H HD23 . LEU A 1 25 ? 7.649  17.063 -4.549  1.00 0.00 ? 42 LEU A HD23 7  
ATOM   4554  N N    . PHE A 1 26 ? 3.200  13.469 -3.448  1.00 0.00 ? 43 PHE A N    7  
ATOM   4555  C CA   . PHE A 1 26 ? 2.919  12.041 -3.547  1.00 0.00 ? 43 PHE A CA   7  
ATOM   4556  C C    . PHE A 1 26 ? 2.536  11.653 -4.969  1.00 0.00 ? 43 PHE A C    7  
ATOM   4557  O O    . PHE A 1 26 ? 2.138  12.500 -5.769  1.00 0.00 ? 43 PHE A O    7  
ATOM   4558  C CB   . PHE A 1 26 ? 1.804  11.647 -2.576  1.00 0.00 ? 43 PHE A CB   7  
ATOM   4559  C CG   . PHE A 1 26 ? 0.462  12.222 -2.929  1.00 0.00 ? 43 PHE A CG   7  
ATOM   4560  C CD1  . PHE A 1 26 ? 0.130  13.519 -2.570  1.00 0.00 ? 43 PHE A CD1  7  
ATOM   4561  C CD2  . PHE A 1 26 ? -0.472 11.466 -3.623  1.00 0.00 ? 43 PHE A CD2  7  
ATOM   4562  C CE1  . PHE A 1 26 ? -1.106 14.048 -2.893  1.00 0.00 ? 43 PHE A CE1  7  
ATOM   4563  C CE2  . PHE A 1 26 ? -1.707 11.993 -3.948  1.00 0.00 ? 43 PHE A CE2  7  
ATOM   4564  C CZ   . PHE A 1 26 ? -2.024 13.284 -3.583  1.00 0.00 ? 43 PHE A CZ   7  
ATOM   4565  H H    . PHE A 1 26 ? 2.748  14.105 -4.089  1.00 0.00 ? 43 PHE A H    7  
ATOM   4566  H HA   . PHE A 1 26 ? 3.814  11.470 -3.300  1.00 0.00 ? 43 PHE A HA   7  
ATOM   4567  H HB2  . PHE A 1 26 ? 1.686  10.565 -2.560  1.00 0.00 ? 43 PHE A HB2  7  
ATOM   4568  H HB3  . PHE A 1 26 ? 2.039  12.001 -1.573  1.00 0.00 ? 43 PHE A HB3  7  
ATOM   4569  H HD1  . PHE A 1 26 ? 0.855  14.123 -2.024  1.00 0.00 ? 43 PHE A HD1  7  
ATOM   4570  H HD2  . PHE A 1 26 ? -0.221 10.444 -3.910  1.00 0.00 ? 43 PHE A HD2  7  
ATOM   4571  H HE1  . PHE A 1 26 ? -1.354 15.069 -2.604  1.00 0.00 ? 43 PHE A HE1  7  
ATOM   4572  H HE2  . PHE A 1 26 ? -2.430 11.387 -4.493  1.00 0.00 ? 43 PHE A HE2  7  
ATOM   4573  H HZ   . PHE A 1 26 ? -2.996 13.701 -3.841  1.00 0.00 ? 43 PHE A HZ   7  
ATOM   4574  N N    . SER A 1 27 ? 2.658  10.366 -5.279  1.00 0.00 ? 44 SER A N    7  
ATOM   4575  C CA   . SER A 1 27 ? 2.181  9.835  -6.549  1.00 0.00 ? 44 SER A CA   7  
ATOM   4576  C C    . SER A 1 27 ? 1.812  8.363  -6.428  1.00 0.00 ? 44 SER A C    7  
ATOM   4577  O O    . SER A 1 27 ? 2.564  7.569  -5.863  1.00 0.00 ? 44 SER A O    7  
ATOM   4578  C CB   . SER A 1 27 ? 3.232  10.030 -7.625  1.00 0.00 ? 44 SER A CB   7  
ATOM   4579  O OG   . SER A 1 27 ? 2.800  9.568  -8.875  1.00 0.00 ? 44 SER A OG   7  
ATOM   4580  H H    . SER A 1 27 ? 3.093  9.740  -4.616  1.00 0.00 ? 44 SER A H    7  
ATOM   4581  H HA   . SER A 1 27 ? 1.342  10.395 -6.965  1.00 0.00 ? 44 SER A HA   7  
ATOM   4582  H HB2  . SER A 1 27 ? 3.462  11.092 -7.699  1.00 0.00 ? 44 SER A HB2  7  
ATOM   4583  H HB3  . SER A 1 27 ? 4.131  9.484  -7.337  1.00 0.00 ? 44 SER A HB3  7  
ATOM   4584  H HG   . SER A 1 27 ? 2.488  10.310 -9.399  1.00 0.00 ? 44 SER A HG   7  
ATOM   4585  N N    . THR A 1 28 ? 0.650  8.002  -6.962  1.00 0.00 ? 45 THR A N    7  
ATOM   4586  C CA   . THR A 1 28 ? 0.180  6.624  -6.915  1.00 0.00 ? 45 THR A CA   7  
ATOM   4587  C C    . THR A 1 28 ? 0.156  6.002  -8.307  1.00 0.00 ? 45 THR A C    7  
ATOM   4588  O O    . THR A 1 28 ? -0.451 6.546  -9.229  1.00 0.00 ? 45 THR A O    7  
ATOM   4589  C CB   . THR A 1 28 ? -1.227 6.527  -6.298  1.00 0.00 ? 45 THR A CB   7  
ATOM   4590  O OG1  . THR A 1 28 ? -1.205 7.055  -4.966  1.00 0.00 ? 45 THR A OG1  7  
ATOM   4591  C CG2  . THR A 1 28 ? -1.694 5.080  -6.257  1.00 0.00 ? 45 THR A CG2  7  
ATOM   4592  H H    . THR A 1 28 ? 0.077  8.703  -7.412  1.00 0.00 ? 45 THR A H    7  
ATOM   4593  H HA   . THR A 1 28 ? 0.865  6.020  -6.320  1.00 0.00 ? 45 THR A HA   7  
ATOM   4594  H HB   . THR A 1 28 ? -1.921 7.114  -6.900  1.00 0.00 ? 45 THR A HB   7  
ATOM   4595  H HG1  . THR A 1 28 ? -0.931 7.976  -4.991  1.00 0.00 ? 45 THR A HG1  7  
ATOM   4596  H HG21 . THR A 1 28 ? -1.002 4.493  -5.654  1.00 0.00 ? 45 THR A HG21 7  
ATOM   4597  H HG22 . THR A 1 28 ? -2.690 5.031  -5.817  1.00 0.00 ? 45 THR A HG22 7  
ATOM   4598  H HG23 . THR A 1 28 ? -1.723 4.679  -7.270  1.00 0.00 ? 45 THR A HG23 7  
HETATM 4599  N N    . TPO A 1 29 ? 0.820  4.861  -8.451  1.00 0.00 ? 46 TPO A N    7  
HETATM 4600  C CA   . TPO A 1 29 ? 0.934  4.199  -9.744  1.00 0.00 ? 46 TPO A CA   7  
HETATM 4601  C CB   . TPO A 1 29 ? 2.279  3.462  -9.886  1.00 0.00 ? 46 TPO A CB   7  
HETATM 4602  C CG2  . TPO A 1 29 ? 3.431  4.377  -9.503  1.00 0.00 ? 46 TPO A CG2  7  
HETATM 4603  O OG1  . TPO A 1 29 ? 2.287  2.308  -9.035  1.00 0.00 ? 46 TPO A OG1  7  
HETATM 4604  P P    . TPO A 1 29 ? 3.264  1.064  -9.348  1.00 0.00 ? 46 TPO A P    7  
HETATM 4605  O O1P  . TPO A 1 29 ? 3.022  0.000  -8.246  1.00 0.00 ? 46 TPO A O1P  7  
HETATM 4606  O O2P  . TPO A 1 29 ? 4.718  1.601  -9.313  1.00 0.00 ? 46 TPO A O2P  7  
HETATM 4607  O O3P  . TPO A 1 29 ? 2.888  0.526  -10.753 1.00 0.00 ? 46 TPO A O3P  7  
HETATM 4608  C C    . TPO A 1 29 ? -0.201 3.206  -9.957  1.00 0.00 ? 46 TPO A C    7  
HETATM 4609  O O    . TPO A 1 29 ? -0.897 2.832  -9.013  1.00 0.00 ? 46 TPO A O    7  
HETATM 4610  H H    . TPO A 1 29 ? 1.258  4.441  -7.643  1.00 0.00 ? 46 TPO A H    7  
HETATM 4611  H HA   . TPO A 1 29 ? 0.855  4.935  -10.544 1.00 0.00 ? 46 TPO A HA   7  
HETATM 4612  H HB   . TPO A 1 29 ? 2.400  3.140  -10.920 1.00 0.00 ? 46 TPO A HB   7  
HETATM 4613  H HG21 . TPO A 1 29 ? 4.373  3.839  -9.609  1.00 0.00 ? 46 TPO A HG21 7  
HETATM 4614  H HG22 . TPO A 1 29 ? 3.435  5.249  -10.156 1.00 0.00 ? 46 TPO A HG22 7  
HETATM 4615  H HG23 . TPO A 1 29 ? 3.312  4.699  -8.469  1.00 0.00 ? 46 TPO A HG23 7  
ATOM   4616  N N    . PRO A 1 30 ? -0.387 2.785  -11.204 1.00 0.00 ? 47 PRO A N    7  
ATOM   4617  C CA   . PRO A 1 30 ? -1.489 1.899  -11.557 1.00 0.00 ? 47 PRO A CA   7  
ATOM   4618  C C    . PRO A 1 30 ? -1.450 0.616  -10.736 1.00 0.00 ? 47 PRO A C    7  
ATOM   4619  O O    . PRO A 1 30 ? -2.486 0.005  -10.474 1.00 0.00 ? 47 PRO A O    7  
ATOM   4620  C CB   . PRO A 1 30 ? -1.289 1.632  -13.053 1.00 0.00 ? 47 PRO A CB   7  
ATOM   4621  C CG   . PRO A 1 30 ? -0.569 2.837  -13.553 1.00 0.00 ? 47 PRO A CG   7  
ATOM   4622  C CD   . PRO A 1 30 ? 0.352  3.244  -12.433 1.00 0.00 ? 47 PRO A CD   7  
ATOM   4623  H HA   . PRO A 1 30 ? -2.474 2.341  -11.348 1.00 0.00 ? 47 PRO A HA   7  
ATOM   4624  H HB2  . PRO A 1 30 ? -0.702 0.717  -13.224 1.00 0.00 ? 47 PRO A HB2  7  
ATOM   4625  H HB3  . PRO A 1 30 ? -2.251 1.499  -13.571 1.00 0.00 ? 47 PRO A HB3  7  
ATOM   4626  H HG2  . PRO A 1 30 ? -0.002 2.610  -14.468 1.00 0.00 ? 47 PRO A HG2  7  
ATOM   4627  H HG3  . PRO A 1 30 ? -1.272 3.645  -13.802 1.00 0.00 ? 47 PRO A HG3  7  
ATOM   4628  H HD2  . PRO A 1 30 ? 1.338  2.763  -12.509 1.00 0.00 ? 47 PRO A HD2  7  
ATOM   4629  H HD3  . PRO A 1 30 ? 0.526  4.331  -12.412 1.00 0.00 ? 47 PRO A HD3  7  
ATOM   4630  N N    . GLY A 1 31 ? -0.251 0.215  -10.331 1.00 0.00 ? 48 GLY A N    7  
ATOM   4631  C CA   . GLY A 1 31 ? -0.074 -0.999 -9.543  1.00 0.00 ? 48 GLY A CA   7  
ATOM   4632  C C    . GLY A 1 31 ? -0.737 -0.870 -8.177  1.00 0.00 ? 48 GLY A C    7  
ATOM   4633  O O    . GLY A 1 31 ? -1.109 -1.869 -7.560  1.00 0.00 ? 48 GLY A O    7  
ATOM   4634  H H    . GLY A 1 31 ? 0.561  0.765  -10.576 1.00 0.00 ? 48 GLY A H    7  
ATOM   4635  H HA2  . GLY A 1 31 ? -0.522 -1.838 -10.076 1.00 0.00 ? 48 GLY A HA2  7  
ATOM   4636  H HA3  . GLY A 1 31 ? 0.990  -1.183 -9.405  1.00 0.00 ? 48 GLY A HA3  7  
ATOM   4637  N N    . GLY A 1 32 ? -0.882 0.365  -7.710  1.00 0.00 ? 49 GLY A N    7  
ATOM   4638  C CA   . GLY A 1 32 ? -1.557 0.632  -6.445  1.00 0.00 ? 49 GLY A CA   7  
ATOM   4639  C C    . GLY A 1 32 ? -0.585 1.166  -5.402  1.00 0.00 ? 49 GLY A C    7  
ATOM   4640  O O    . GLY A 1 32 ? -0.995 1.653  -4.349  1.00 0.00 ? 49 GLY A O    7  
ATOM   4641  H H    . GLY A 1 32 ? -0.514 1.140  -8.244  1.00 0.00 ? 49 GLY A H    7  
ATOM   4642  H HA2  . GLY A 1 32 ? -2.343 1.370  -6.610  1.00 0.00 ? 49 GLY A HA2  7  
ATOM   4643  H HA3  . GLY A 1 32 ? -2.001 -0.293 -6.076  1.00 0.00 ? 49 GLY A HA3  7  
ATOM   4644  N N    . THR A 1 33 ? 0.706  1.072  -5.702  1.00 0.00 ? 50 THR A N    7  
ATOM   4645  C CA   . THR A 1 33 ? 1.741  1.538  -4.786  1.00 0.00 ? 50 THR A CA   7  
ATOM   4646  C C    . THR A 1 33 ? 1.669  3.048  -4.597  1.00 0.00 ? 50 THR A C    7  
ATOM   4647  O O    . THR A 1 33 ? 1.615  3.803  -5.568  1.00 0.00 ? 50 THR A O    7  
ATOM   4648  C CB   . THR A 1 33 ? 3.149  1.159  -5.285  1.00 0.00 ? 50 THR A CB   7  
ATOM   4649  O OG1  . THR A 1 33 ? 3.241  -0.264 -5.426  1.00 0.00 ? 50 THR A OG1  7  
ATOM   4650  C CG2  . THR A 1 33 ? 4.208  1.638  -4.304  1.00 0.00 ? 50 THR A CG2  7  
ATOM   4651  H H    . THR A 1 33 ? 0.978  0.668  -6.587  1.00 0.00 ? 50 THR A H    7  
ATOM   4652  H HA   . THR A 1 33 ? 1.589  1.096  -3.801  1.00 0.00 ? 50 THR A HA   7  
ATOM   4653  H HB   . THR A 1 33 ? 3.317  1.623  -6.256  1.00 0.00 ? 50 THR A HB   7  
ATOM   4654  H HG1  . THR A 1 33 ? 3.105  -0.503 -6.346  1.00 0.00 ? 50 THR A HG1  7  
ATOM   4655  H HG21 . THR A 1 33 ? 4.040  1.173  -3.333  1.00 0.00 ? 50 THR A HG21 7  
ATOM   4656  H HG22 . THR A 1 33 ? 5.194  1.362  -4.673  1.00 0.00 ? 50 THR A HG22 7  
ATOM   4657  H HG23 . THR A 1 33 ? 4.147  2.722  -4.203  1.00 0.00 ? 50 THR A HG23 7  
ATOM   4658  N N    . ARG A 1 34 ? 1.671  3.482  -3.341  1.00 0.00 ? 51 ARG A N    7  
ATOM   4659  C CA   . ARG A 1 34 ? 1.631  4.905  -3.023  1.00 0.00 ? 51 ARG A CA   7  
ATOM   4660  C C    . ARG A 1 34 ? 3.019  5.430  -2.678  1.00 0.00 ? 51 ARG A C    7  
ATOM   4661  O O    . ARG A 1 34 ? 3.604  5.048  -1.666  1.00 0.00 ? 51 ARG A O    7  
ATOM   4662  C CB   . ARG A 1 34 ? 0.627  5.219  -1.923  1.00 0.00 ? 51 ARG A CB   7  
ATOM   4663  C CG   . ARG A 1 34 ? -0.816 4.888  -2.262  1.00 0.00 ? 51 ARG A CG   7  
ATOM   4664  C CD   . ARG A 1 34 ? -1.769 5.082  -1.138  1.00 0.00 ? 51 ARG A CD   7  
ATOM   4665  N NE   . ARG A 1 34 ? -3.143 4.717  -1.443  1.00 0.00 ? 51 ARG A NE   7  
ATOM   4666  C CZ   . ARG A 1 34 ? -4.177 4.847  -0.589  1.00 0.00 ? 51 ARG A CZ   7  
ATOM   4667  N NH1  . ARG A 1 34 ? -3.994 5.297  0.633   1.00 0.00 ? 51 ARG A NH1  7  
ATOM   4668  N NH2  . ARG A 1 34 ? -5.379 4.487  -1.005  1.00 0.00 ? 51 ARG A NH2  7  
ATOM   4669  H H    . ARG A 1 34 ? 1.699  2.810  -2.588  1.00 0.00 ? 51 ARG A H    7  
ATOM   4670  H HA   . ARG A 1 34 ? 1.293  5.468  -3.892  1.00 0.00 ? 51 ARG A HA   7  
ATOM   4671  H HB2  . ARG A 1 34 ? 0.930  4.650  -1.044  1.00 0.00 ? 51 ARG A HB2  7  
ATOM   4672  H HB3  . ARG A 1 34 ? 0.711  6.284  -1.712  1.00 0.00 ? 51 ARG A HB3  7  
ATOM   4673  H HG2  . ARG A 1 34 ? -1.135 5.528  -3.085  1.00 0.00 ? 51 ARG A HG2  7  
ATOM   4674  H HG3  . ARG A 1 34 ? -0.870 3.843  -2.571  1.00 0.00 ? 51 ARG A HG3  7  
ATOM   4675  H HD2  . ARG A 1 34 ? -1.449 4.474  -0.294  1.00 0.00 ? 51 ARG A HD2  7  
ATOM   4676  H HD3  . ARG A 1 34 ? -1.767 6.133  -0.850  1.00 0.00 ? 51 ARG A HD3  7  
ATOM   4677  H HE   . ARG A 1 34 ? -3.534 4.327  -2.291  1.00 0.00 ? 51 ARG A HE   7  
ATOM   4678  H HH11 . ARG A 1 34 ? -3.066 5.550  0.941   1.00 0.00 ? 51 ARG A HH11 7  
ATOM   4679  H HH12 . ARG A 1 34 ? -4.781 5.386  1.258   1.00 0.00 ? 51 ARG A HH12 7  
ATOM   4680  H HH21 . ARG A 1 34 ? -5.499 4.126  -1.941  1.00 0.00 ? 51 ARG A HH21 7  
ATOM   4681  H HH22 . ARG A 1 34 ? -6.171 4.573  -0.385  1.00 0.00 ? 51 ARG A HH22 7  
ATOM   4682  N N    . ILE A 1 35 ? 3.541  6.310  -3.528  1.00 0.00 ? 52 ILE A N    7  
ATOM   4683  C CA   . ILE A 1 35 ? 4.869  6.875  -3.324  1.00 0.00 ? 52 ILE A CA   7  
ATOM   4684  C C    . ILE A 1 35 ? 4.791  8.227  -2.626  1.00 0.00 ? 52 ILE A C    7  
ATOM   4685  O O    . ILE A 1 35 ? 4.187  9.167  -3.140  1.00 0.00 ? 52 ILE A O    7  
ATOM   4686  C CB   . ILE A 1 35 ? 5.623  7.039  -4.657  1.00 0.00 ? 52 ILE A CB   7  
ATOM   4687  C CG1  . ILE A 1 35 ? 5.765  5.686  -5.359  1.00 0.00 ? 52 ILE A CG1  7  
ATOM   4688  C CG2  . ILE A 1 35 ? 6.988  7.665  -4.422  1.00 0.00 ? 52 ILE A CG2  7  
ATOM   4689  C CD1  . ILE A 1 35 ? 6.282  5.785  -6.776  1.00 0.00 ? 52 ILE A CD1  7  
ATOM   4690  H H    . ILE A 1 35 ? 3.003  6.593  -4.334  1.00 0.00 ? 52 ILE A H    7  
ATOM   4691  H HA   . ILE A 1 35 ? 5.454  6.249  -2.651  1.00 0.00 ? 52 ILE A HA   7  
ATOM   4692  H HB   . ILE A 1 35 ? 5.039  7.676  -5.320  1.00 0.00 ? 52 ILE A HB   7  
ATOM   4693  H HG12 . ILE A 1 35 ? 6.449  5.082  -4.765  1.00 0.00 ? 52 ILE A HG12 7  
ATOM   4694  H HG13 . ILE A 1 35 ? 4.780  5.218  -5.365  1.00 0.00 ? 52 ILE A HG13 7  
ATOM   4695  H HG21 . ILE A 1 35 ? 7.508  7.774  -5.373  1.00 0.00 ? 52 ILE A HG21 7  
ATOM   4696  H HG22 . ILE A 1 35 ? 6.864  8.646  -3.964  1.00 0.00 ? 52 ILE A HG22 7  
ATOM   4697  H HG23 . ILE A 1 35 ? 7.574  7.027  -3.760  1.00 0.00 ? 52 ILE A HG23 7  
ATOM   4698  H HD11 . ILE A 1 35 ? 7.266  6.250  -6.774  1.00 0.00 ? 52 ILE A HD11 7  
ATOM   4699  H HD12 . ILE A 1 35 ? 6.355  4.787  -7.208  1.00 0.00 ? 52 ILE A HD12 7  
ATOM   4700  H HD13 . ILE A 1 35 ? 5.597  6.388  -7.373  1.00 0.00 ? 52 ILE A HD13 7  
ATOM   4701  N N    . ILE A 1 36 ? 5.408  8.316  -1.453  1.00 0.00 ? 53 ILE A N    7  
ATOM   4702  C CA   . ILE A 1 36 ? 5.496  9.578  -0.728  1.00 0.00 ? 53 ILE A CA   7  
ATOM   4703  C C    . ILE A 1 36 ? 6.861  10.228 -0.917  1.00 0.00 ? 53 ILE A C    7  
ATOM   4704  O O    . ILE A 1 36 ? 7.894  9.604  -0.677  1.00 0.00 ? 53 ILE A O    7  
ATOM   4705  C CB   . ILE A 1 36 ? 5.233  9.386  0.777   1.00 0.00 ? 53 ILE A CB   7  
ATOM   4706  C CG1  . ILE A 1 36 ? 3.828  8.822  1.006   1.00 0.00 ? 53 ILE A CG1  7  
ATOM   4707  C CG2  . ILE A 1 36 ? 5.410  10.702 1.520   1.00 0.00 ? 53 ILE A CG2  7  
ATOM   4708  C CD1  . ILE A 1 36 ? 3.571  8.385  2.429   1.00 0.00 ? 53 ILE A CD1  7  
ATOM   4709  H H    . ILE A 1 36 ? 5.824  7.489  -1.051  1.00 0.00 ? 53 ILE A H    7  
ATOM   4710  H HA   . ILE A 1 36 ? 4.788  10.302 -1.130  1.00 0.00 ? 53 ILE A HA   7  
ATOM   4711  H HB   . ILE A 1 36 ? 5.935  8.650  1.169   1.00 0.00 ? 53 ILE A HB   7  
ATOM   4712  H HG12 . ILE A 1 36 ? 3.118  9.601  0.731   1.00 0.00 ? 53 ILE A HG12 7  
ATOM   4713  H HG13 . ILE A 1 36 ? 3.709  7.970  0.337   1.00 0.00 ? 53 ILE A HG13 7  
ATOM   4714  H HG21 . ILE A 1 36 ? 5.220  10.548 2.582   1.00 0.00 ? 53 ILE A HG21 7  
ATOM   4715  H HG22 . ILE A 1 36 ? 6.428  11.063 1.382   1.00 0.00 ? 53 ILE A HG22 7  
ATOM   4716  H HG23 . ILE A 1 36 ? 4.708  11.438 1.129   1.00 0.00 ? 53 ILE A HG23 7  
ATOM   4717  H HD11 . ILE A 1 36 ? 3.689  9.236  3.100   1.00 0.00 ? 53 ILE A HD11 7  
ATOM   4718  H HD12 . ILE A 1 36 ? 2.556  7.997  2.515   1.00 0.00 ? 53 ILE A HD12 7  
ATOM   4719  H HD13 . ILE A 1 36 ? 4.281  7.604  2.706   1.00 0.00 ? 53 ILE A HD13 7  
ATOM   4720  N N    . TYR A 1 37 ? 6.858  11.485 -1.349  1.00 0.00 ? 54 TYR A N    7  
ATOM   4721  C CA   . TYR A 1 37 ? 8.087  12.163 -1.741  1.00 0.00 ? 54 TYR A CA   7  
ATOM   4722  C C    . TYR A 1 37 ? 8.574  13.100 -0.642  1.00 0.00 ? 54 TYR A C    7  
ATOM   4723  O O    . TYR A 1 37 ? 7.812  13.924 -0.135  1.00 0.00 ? 54 TYR A O    7  
ATOM   4724  C CB   . TYR A 1 37 ? 7.878  12.942 -3.041  1.00 0.00 ? 54 TYR A CB   7  
ATOM   4725  C CG   . TYR A 1 37 ? 7.654  12.064 -4.252  1.00 0.00 ? 54 TYR A CG   7  
ATOM   4726  C CD1  . TYR A 1 37 ? 8.720  11.459 -4.900  1.00 0.00 ? 54 TYR A CD1  7  
ATOM   4727  C CD2  . TYR A 1 37 ? 6.375  11.844 -4.746  1.00 0.00 ? 54 TYR A CD2  7  
ATOM   4728  C CE1  . TYR A 1 37 ? 8.521  10.656 -6.006  1.00 0.00 ? 54 TYR A CE1  7  
ATOM   4729  C CE2  . TYR A 1 37 ? 6.164  11.043 -5.851  1.00 0.00 ? 54 TYR A CE2  7  
ATOM   4730  C CZ   . TYR A 1 37 ? 7.241  10.450 -6.479  1.00 0.00 ? 54 TYR A CZ   7  
ATOM   4731  O OH   . TYR A 1 37 ? 7.037  9.653  -7.581  1.00 0.00 ? 54 TYR A OH   7  
ATOM   4732  H H    . TYR A 1 37 ? 5.981  11.982 -1.408  1.00 0.00 ? 54 TYR A H    7  
ATOM   4733  H HA   . TYR A 1 37 ? 8.880  11.430 -1.897  1.00 0.00 ? 54 TYR A HA   7  
ATOM   4734  H HB2  . TYR A 1 37 ? 7.012  13.588 -2.894  1.00 0.00 ? 54 TYR A HB2  7  
ATOM   4735  H HB3  . TYR A 1 37 ? 8.767  13.554 -3.196  1.00 0.00 ? 54 TYR A HB3  7  
ATOM   4736  H HD1  . TYR A 1 37 ? 9.728  11.625 -4.521  1.00 0.00 ? 54 TYR A HD1  7  
ATOM   4737  H HD2  . TYR A 1 37 ? 5.529  12.315 -4.244  1.00 0.00 ? 54 TYR A HD2  7  
ATOM   4738  H HE1  . TYR A 1 37 ? 9.373  10.189 -6.501  1.00 0.00 ? 54 TYR A HE1  7  
ATOM   4739  H HE2  . TYR A 1 37 ? 5.155  10.879 -6.227  1.00 0.00 ? 54 TYR A HE2  7  
ATOM   4740  H HH   . TYR A 1 37 ? 7.852  9.293  -7.940  1.00 0.00 ? 54 TYR A HH   7  
ATOM   4741  N N    . ASP A 1 38 ? 9.844  12.969 -0.279  1.00 0.00 ? 55 ASP A N    7  
ATOM   4742  C CA   . ASP A 1 38 ? 10.479 13.908 0.638   1.00 0.00 ? 55 ASP A CA   7  
ATOM   4743  C C    . ASP A 1 38 ? 11.375 14.887 -0.110  1.00 0.00 ? 55 ASP A C    7  
ATOM   4744  O O    . ASP A 1 38 ? 12.507 14.561 -0.468  1.00 0.00 ? 55 ASP A O    7  
ATOM   4745  C CB   . ASP A 1 38 ? 11.291 13.159 1.697   1.00 0.00 ? 55 ASP A CB   7  
ATOM   4746  C CG   . ASP A 1 38 ? 11.965 14.057 2.725   1.00 0.00 ? 55 ASP A CG   7  
ATOM   4747  O OD1  . ASP A 1 38 ? 11.901 15.254 2.573   1.00 0.00 ? 55 ASP A OD1  7  
ATOM   4748  O OD2  . ASP A 1 38 ? 12.400 13.551 3.733   1.00 0.00 ? 55 ASP A OD2  7  
ATOM   4749  H H    . ASP A 1 38 ? 10.385 12.200 -0.647  1.00 0.00 ? 55 ASP A H    7  
ATOM   4750  H HA   . ASP A 1 38 ? 9.719  14.506 1.141   1.00 0.00 ? 55 ASP A HA   7  
ATOM   4751  H HB2  . ASP A 1 38 ? 10.722 12.382 2.210   1.00 0.00 ? 55 ASP A HB2  7  
ATOM   4752  H HB3  . ASP A 1 38 ? 12.050 12.697 1.066   1.00 0.00 ? 55 ASP A HB3  7  
ATOM   4753  N N    . ARG A 1 39 ? 10.862 16.091 -0.344  1.00 0.00 ? 56 ARG A N    7  
ATOM   4754  C CA   . ARG A 1 39 ? 11.564 17.079 -1.155  1.00 0.00 ? 56 ARG A CA   7  
ATOM   4755  C C    . ARG A 1 39 ? 12.529 17.899 -0.308  1.00 0.00 ? 56 ARG A C    7  
ATOM   4756  O O    . ARG A 1 39 ? 12.214 18.278 0.820   1.00 0.00 ? 56 ARG A O    7  
ATOM   4757  C CB   . ARG A 1 39 ? 10.606 17.971 -1.930  1.00 0.00 ? 56 ARG A CB   7  
ATOM   4758  C CG   . ARG A 1 39 ? 11.244 18.762 -3.061  1.00 0.00 ? 56 ARG A CG   7  
ATOM   4759  C CD   . ARG A 1 39 ? 10.295 19.614 -3.822  1.00 0.00 ? 56 ARG A CD   7  
ATOM   4760  N NE   . ARG A 1 39 ? 9.844  20.800 -3.111  1.00 0.00 ? 56 ARG A NE   7  
ATOM   4761  C CZ   . ARG A 1 39 ? 8.858  21.616 -3.532  1.00 0.00 ? 56 ARG A CZ   7  
ATOM   4762  N NH1  . ARG A 1 39 ? 8.243  21.402 -4.673  1.00 0.00 ? 56 ARG A NH1  7  
ATOM   4763  N NH2  . ARG A 1 39 ? 8.542  22.653 -2.776  1.00 0.00 ? 56 ARG A NH2  7  
ATOM   4764  H H    . ARG A 1 39 ? 9.962  16.327 0.049   1.00 0.00 ? 56 ARG A H    7  
ATOM   4765  H HA   . ARG A 1 39 ? 12.166 16.574 -1.911  1.00 0.00 ? 56 ARG A HA   7  
ATOM   4766  H HB2  . ARG A 1 39 ? 9.829  17.326 -2.337  1.00 0.00 ? 56 ARG A HB2  7  
ATOM   4767  H HB3  . ARG A 1 39 ? 10.166 18.663 -1.212  1.00 0.00 ? 56 ARG A HB3  7  
ATOM   4768  H HG2  . ARG A 1 39 ? 12.013 19.410 -2.641  1.00 0.00 ? 56 ARG A HG2  7  
ATOM   4769  H HG3  . ARG A 1 39 ? 11.701 18.061 -3.759  1.00 0.00 ? 56 ARG A HG3  7  
ATOM   4770  H HD2  . ARG A 1 39 ? 10.777 19.947 -4.741  1.00 0.00 ? 56 ARG A HD2  7  
ATOM   4771  H HD3  . ARG A 1 39 ? 9.411  19.026 -4.069  1.00 0.00 ? 56 ARG A HD3  7  
ATOM   4772  H HE   . ARG A 1 39 ? 10.171 21.190 -2.237  1.00 0.00 ? 56 ARG A HE   7  
ATOM   4773  H HH11 . ARG A 1 39 ? 8.508  20.615 -5.248  1.00 0.00 ? 56 ARG A HH11 7  
ATOM   4774  H HH12 . ARG A 1 39 ? 7.506  22.026 -4.971  1.00 0.00 ? 56 ARG A HH12 7  
ATOM   4775  H HH21 . ARG A 1 39 ? 9.038  22.813 -1.910  1.00 0.00 ? 56 ARG A HH21 7  
ATOM   4776  H HH22 . ARG A 1 39 ? 7.808  23.281 -3.068  1.00 0.00 ? 56 ARG A HH22 7  
ATOM   4777  N N    . LYS A 1 40 ? 13.707 18.171 -0.859  1.00 0.00 ? 57 LYS A N    7  
ATOM   4778  C CA   . LYS A 1 40 ? 14.691 19.012 -0.189  1.00 0.00 ? 57 LYS A CA   7  
ATOM   4779  C C    . LYS A 1 40 ? 14.065 20.315 0.291   1.00 0.00 ? 57 LYS A C    7  
ATOM   4780  O O    . LYS A 1 40 ? 14.365 20.793 1.386   1.00 0.00 ? 57 LYS A O    7  
ATOM   4781  C CB   . LYS A 1 40 ? 15.868 19.307 -1.121  1.00 0.00 ? 57 LYS A CB   7  
ATOM   4782  C CG   . LYS A 1 40 ? 16.950 20.187 -0.509  1.00 0.00 ? 57 LYS A CG   7  
ATOM   4783  C CD   . LYS A 1 40 ? 18.115 20.379 -1.468  1.00 0.00 ? 57 LYS A CD   7  
ATOM   4784  C CE   . LYS A 1 40 ? 19.185 21.278 -0.867  1.00 0.00 ? 57 LYS A CE   7  
ATOM   4785  N NZ   . LYS A 1 40 ? 20.337 21.466 -1.790  1.00 0.00 ? 57 LYS A NZ   7  
ATOM   4786  H H    . LYS A 1 40 ? 13.927 17.784 -1.767  1.00 0.00 ? 57 LYS A H    7  
ATOM   4787  H HA   . LYS A 1 40 ? 15.069 18.504 0.699   1.00 0.00 ? 57 LYS A HA   7  
ATOM   4788  H HB2  . LYS A 1 40 ? 16.299 18.346 -1.404  1.00 0.00 ? 57 LYS A HB2  7  
ATOM   4789  H HB3  . LYS A 1 40 ? 15.461 19.796 -2.006  1.00 0.00 ? 57 LYS A HB3  7  
ATOM   4790  H HG2  . LYS A 1 40 ? 16.512 21.157 -0.269  1.00 0.00 ? 57 LYS A HG2  7  
ATOM   4791  H HG3  . LYS A 1 40 ? 17.305 19.714 0.406   1.00 0.00 ? 57 LYS A HG3  7  
ATOM   4792  H HD2  . LYS A 1 40 ? 18.546 19.401 -1.692  1.00 0.00 ? 57 LYS A HD2  7  
ATOM   4793  H HD3  . LYS A 1 40 ? 17.739 20.828 -2.386  1.00 0.00 ? 57 LYS A HD3  7  
ATOM   4794  H HE2  . LYS A 1 40 ? 18.735 22.245 -0.646  1.00 0.00 ? 57 LYS A HE2  7  
ATOM   4795  H HE3  . LYS A 1 40 ? 19.534 20.822 0.060   1.00 0.00 ? 57 LYS A HE3  7  
ATOM   4796  H HZ1  . LYS A 1 40 ? 20.015 21.890 -2.647  1.00 0.00 ? 57 LYS A HZ1  7  
ATOM   4797  H HZ2  . LYS A 1 40 ? 21.023 22.067 -1.354  1.00 0.00 ? 57 LYS A HZ2  7  
ATOM   4798  H HZ3  . LYS A 1 40 ? 20.756 20.569 -1.993  1.00 0.00 ? 57 LYS A HZ3  7  
ATOM   4799  N N    . PHE A 1 41 ? 13.193 20.887 -0.534  1.00 0.00 ? 58 PHE A N    7  
ATOM   4800  C CA   . PHE A 1 41 ? 12.498 22.118 -0.179  1.00 0.00 ? 58 PHE A CA   7  
ATOM   4801  C C    . PHE A 1 41 ? 11.006 21.875 0.001   1.00 0.00 ? 58 PHE A C    7  
ATOM   4802  O O    . PHE A 1 41 ? 10.180 22.699 -0.392  1.00 0.00 ? 58 PHE A O    7  
ATOM   4803  C CB   . PHE A 1 41 ? 12.731 23.189 -1.247  1.00 0.00 ? 58 PHE A CB   7  
ATOM   4804  C CG   . PHE A 1 41 ? 14.176 23.551 -1.437  1.00 0.00 ? 58 PHE A CG   7  
ATOM   4805  C CD1  . PHE A 1 41 ? 14.848 24.305 -0.487  1.00 0.00 ? 58 PHE A CD1  7  
ATOM   4806  C CD2  . PHE A 1 41 ? 14.867 23.139 -2.567  1.00 0.00 ? 58 PHE A CD2  7  
ATOM   4807  C CE1  . PHE A 1 41 ? 16.177 24.641 -0.660  1.00 0.00 ? 58 PHE A CE1  7  
ATOM   4808  C CE2  . PHE A 1 41 ? 16.197 23.472 -2.742  1.00 0.00 ? 58 PHE A CE2  7  
ATOM   4809  C CZ   . PHE A 1 41 ? 16.852 24.223 -1.789  1.00 0.00 ? 58 PHE A CZ   7  
ATOM   4810  H H    . PHE A 1 41 ? 13.009 20.457 -1.428  1.00 0.00 ? 58 PHE A H    7  
ATOM   4811  H HA   . PHE A 1 41 ? 12.870 22.492 0.776   1.00 0.00 ? 58 PHE A HA   7  
ATOM   4812  H HB2  . PHE A 1 41 ? 12.368 22.842 -2.214  1.00 0.00 ? 58 PHE A HB2  7  
ATOM   4813  H HB3  . PHE A 1 41 ? 12.212 24.107 -0.975  1.00 0.00 ? 58 PHE A HB3  7  
ATOM   4814  H HD1  . PHE A 1 41 ? 14.314 24.635 0.406   1.00 0.00 ? 58 PHE A HD1  7  
ATOM   4815  H HD2  . PHE A 1 41 ? 14.350 22.546 -3.320  1.00 0.00 ? 58 PHE A HD2  7  
ATOM   4816  H HE1  . PHE A 1 41 ? 16.693 25.234 0.095   1.00 0.00 ? 58 PHE A HE1  7  
ATOM   4817  H HE2  . PHE A 1 41 ? 16.728 23.141 -3.634  1.00 0.00 ? 58 PHE A HE2  7  
ATOM   4818  H HZ   . PHE A 1 41 ? 17.900 24.485 -1.926  1.00 0.00 ? 58 PHE A HZ   7  
ATOM   4819  N N    . LEU A 1 42 ? 10.665 20.738 0.600   1.00 0.00 ? 59 LEU A N    7  
ATOM   4820  C CA   . LEU A 1 42 ? 9.270  20.351 0.771   1.00 0.00 ? 59 LEU A CA   7  
ATOM   4821  C C    . LEU A 1 42 ? 8.494  21.412 1.542   1.00 0.00 ? 59 LEU A C    7  
ATOM   4822  O O    . LEU A 1 42 ? 8.972  21.934 2.549   1.00 0.00 ? 59 LEU A O    7  
ATOM   4823  C CB   . LEU A 1 42 ? 9.180  18.997 1.487   1.00 0.00 ? 59 LEU A CB   7  
ATOM   4824  C CG   . LEU A 1 42 ? 7.799  18.331 1.451   1.00 0.00 ? 59 LEU A CG   7  
ATOM   4825  C CD1  . LEU A 1 42 ? 7.445  17.937 0.024   1.00 0.00 ? 59 LEU A CD1  7  
ATOM   4826  C CD2  . LEU A 1 42 ? 7.798  17.112 2.363   1.00 0.00 ? 59 LEU A CD2  7  
ATOM   4827  H H    . LEU A 1 42 ? 11.391 20.128 0.945   1.00 0.00 ? 59 LEU A H    7  
ATOM   4828  H HA   . LEU A 1 42 ? 8.792  20.267 -0.204  1.00 0.00 ? 59 LEU A HA   7  
ATOM   4829  H HB2  . LEU A 1 42 ? 9.884  18.430 0.882   1.00 0.00 ? 59 LEU A HB2  7  
ATOM   4830  H HB3  . LEU A 1 42 ? 9.547  19.057 2.511   1.00 0.00 ? 59 LEU A HB3  7  
ATOM   4831  H HG   . LEU A 1 42 ? 7.082  19.048 1.853   1.00 0.00 ? 59 LEU A HG   7  
ATOM   4832  H HD11 . LEU A 1 42 ? 6.463  17.465 0.009   1.00 0.00 ? 59 LEU A HD11 7  
ATOM   4833  H HD12 . LEU A 1 42 ? 7.429  18.827 -0.606  1.00 0.00 ? 59 LEU A HD12 7  
ATOM   4834  H HD13 . LEU A 1 42 ? 8.190  17.238 -0.354  1.00 0.00 ? 59 LEU A HD13 7  
ATOM   4835  H HD21 . LEU A 1 42 ? 8.025  17.421 3.383   1.00 0.00 ? 59 LEU A HD21 7  
ATOM   4836  H HD22 . LEU A 1 42 ? 6.816  16.640 2.337   1.00 0.00 ? 59 LEU A HD22 7  
ATOM   4837  H HD23 . LEU A 1 42 ? 8.552  16.403 2.022   1.00 0.00 ? 59 LEU A HD23 7  
ATOM   4838  N N    . LEU A 1 43 ? 7.295  21.725 1.065   1.00 0.00 ? 60 LEU A N    7  
ATOM   4839  C CA   . LEU A 1 43 ? 6.459  22.738 1.696   1.00 0.00 ? 60 LEU A CA   7  
ATOM   4840  C C    . LEU A 1 43 ? 6.035  22.309 3.095   1.00 0.00 ? 60 LEU A C    7  
ATOM   4841  O O    . LEU A 1 43 ? 5.904  23.137 3.996   1.00 0.00 ? 60 LEU A O    7  
ATOM   4842  C CB   . LEU A 1 43 ? 5.227  23.025 0.829   1.00 0.00 ? 60 LEU A CB   7  
ATOM   4843  C CG   . LEU A 1 43 ? 5.517  23.721 -0.508  1.00 0.00 ? 60 LEU A CG   7  
ATOM   4844  C CD1  . LEU A 1 43 ? 4.247  23.793 -1.345  1.00 0.00 ? 60 LEU A CD1  7  
ATOM   4845  C CD2  . LEU A 1 43 ? 6.072  25.113 -0.247  1.00 0.00 ? 60 LEU A CD2  7  
ATOM   4846  H H    . LEU A 1 43 ? 6.953  21.248 0.242   1.00 0.00 ? 60 LEU A H    7  
ATOM   4847  H HA   . LEU A 1 43 ? 7.030  23.659 1.816   1.00 0.00 ? 60 LEU A HA   7  
ATOM   4848  H HB2  . LEU A 1 43 ? 4.891  22.004 0.654   1.00 0.00 ? 60 LEU A HB2  7  
ATOM   4849  H HB3  . LEU A 1 43 ? 4.462  23.569 1.383   1.00 0.00 ? 60 LEU A HB3  7  
ATOM   4850  H HG   . LEU A 1 43 ? 6.292  23.142 -1.011  1.00 0.00 ? 60 LEU A HG   7  
ATOM   4851  H HD11 . LEU A 1 43 ? 4.463  24.287 -2.292  1.00 0.00 ? 60 LEU A HD11 7  
ATOM   4852  H HD12 . LEU A 1 43 ? 3.882  22.785 -1.538  1.00 0.00 ? 60 LEU A HD12 7  
ATOM   4853  H HD13 . LEU A 1 43 ? 3.488  24.358 -0.806  1.00 0.00 ? 60 LEU A HD13 7  
ATOM   4854  H HD21 . LEU A 1 43 ? 6.994  25.037 0.329   1.00 0.00 ? 60 LEU A HD21 7  
ATOM   4855  H HD22 . LEU A 1 43 ? 6.277  25.606 -1.198  1.00 0.00 ? 60 LEU A HD22 7  
ATOM   4856  H HD23 . LEU A 1 43 ? 5.341  25.697 0.313   1.00 0.00 ? 60 LEU A HD23 7  
ATOM   4857  N N    . ASP A 1 44 ? 5.819  21.010 3.269   1.00 0.00 ? 61 ASP A N    7  
ATOM   4858  C CA   . ASP A 1 44 ? 5.469  20.459 4.573   1.00 0.00 ? 61 ASP A CA   7  
ATOM   4859  C C    . ASP A 1 44 ? 6.706  20.261 5.439   1.00 0.00 ? 61 ASP A C    7  
ATOM   4860  O O    . ASP A 1 44 ? 7.439  19.286 5.276   1.00 0.00 ? 61 ASP A O    7  
ATOM   4861  C CB   . ASP A 1 44 ? 4.721  19.133 4.413   1.00 0.00 ? 61 ASP A CB   7  
ATOM   4862  C CG   . ASP A 1 44 ? 4.253  18.513 5.723   1.00 0.00 ? 61 ASP A CG   7  
ATOM   4863  O OD1  . ASP A 1 44 ? 4.621  19.013 6.759   1.00 0.00 ? 61 ASP A OD1  7  
ATOM   4864  O OD2  . ASP A 1 44 ? 3.411  17.648 5.678   1.00 0.00 ? 61 ASP A OD2  7  
ATOM   4865  H H    . ASP A 1 44 ? 5.901  20.387 2.478   1.00 0.00 ? 61 ASP A H    7  
ATOM   4866  H HA   . ASP A 1 44 ? 4.826  21.159 5.108   1.00 0.00 ? 61 ASP A HA   7  
ATOM   4867  H HB2  . ASP A 1 44 ? 3.883  19.189 3.717   1.00 0.00 ? 61 ASP A HB2  7  
ATOM   4868  H HB3  . ASP A 1 44 ? 5.512  18.519 3.982   1.00 0.00 ? 61 ASP A HB3  7  
ATOM   4869  N N    . ARG A 1 45 ? 6.934  21.192 6.359   1.00 0.00 ? 62 ARG A N    7  
ATOM   4870  C CA   . ARG A 1 45 ? 8.119  21.155 7.209   1.00 0.00 ? 62 ARG A CA   7  
ATOM   4871  C C    . ARG A 1 45 ? 7.739  21.001 8.676   1.00 0.00 ? 62 ARG A C    7  
ATOM   4872  O O    . ARG A 1 45 ? 7.453  19.920 9.112   1.00 0.00 ? 62 ARG A O    7  
ATOM   4873  C CB   . ARG A 1 45 ? 9.019  22.361 6.990   1.00 0.00 ? 62 ARG A CB   7  
ATOM   4874  C CG   . ARG A 1 45 ? 9.597  22.483 5.590   1.00 0.00 ? 62 ARG A CG   7  
ATOM   4875  C CD   . ARG A 1 45 ? 10.444 23.684 5.379   1.00 0.00 ? 62 ARG A CD   7  
ATOM   4876  N NE   . ARG A 1 45 ? 10.979 23.815 4.033   1.00 0.00 ? 62 ARG A NE   7  
ATOM   4877  C CZ   . ARG A 1 45 ? 11.757 24.833 3.615   1.00 0.00 ? 62 ARG A CZ   7  
ATOM   4878  N NH1  . ARG A 1 45 ? 12.062 25.827 4.419   1.00 0.00 ? 62 ARG A NH1  7  
ATOM   4879  N NH2  . ARG A 1 45 ? 12.186 24.819 2.365   1.00 0.00 ? 62 ARG A NH2  7  
ATOM   4880  O OXT  . ARG A 1 45 ? 7.726  21.960 9.396   1.00 0.00 ? 62 ARG A OXT  7  
ATOM   4881  H H    . ARG A 1 45 ? 6.269  21.944 6.473   1.00 0.00 ? 62 ARG A H    7  
ATOM   4882  H HA   . ARG A 1 45 ? 8.728  20.288 6.954   1.00 0.00 ? 62 ARG A HA   7  
ATOM   4883  H HB2  . ARG A 1 45 ? 8.425  23.246 7.212   1.00 0.00 ? 62 ARG A HB2  7  
ATOM   4884  H HB3  . ARG A 1 45 ? 9.835  22.283 7.709   1.00 0.00 ? 62 ARG A HB3  7  
ATOM   4885  H HG2  . ARG A 1 45 ? 10.208 21.602 5.388   1.00 0.00 ? 62 ARG A HG2  7  
ATOM   4886  H HG3  . ARG A 1 45 ? 8.772  22.523 4.878   1.00 0.00 ? 62 ARG A HG3  7  
ATOM   4887  H HD2  . ARG A 1 45 ? 9.851  24.575 5.583   1.00 0.00 ? 62 ARG A HD2  7  
ATOM   4888  H HD3  . ARG A 1 45 ? 11.290 23.646 6.064   1.00 0.00 ? 62 ARG A HD3  7  
ATOM   4889  H HE   . ARG A 1 45 ? 10.867 23.207 3.232   1.00 0.00 ? 62 ARG A HE   7  
ATOM   4890  H HH11 . ARG A 1 45 ? 11.712 25.832 5.366   1.00 0.00 ? 62 ARG A HH11 7  
ATOM   4891  H HH12 . ARG A 1 45 ? 12.646 26.580 4.086   1.00 0.00 ? 62 ARG A HH12 7  
ATOM   4892  H HH21 . ARG A 1 45 ? 11.927 24.055 1.754   1.00 0.00 ? 62 ARG A HH21 7  
ATOM   4893  H HH22 . ARG A 1 45 ? 12.770 25.568 2.026   1.00 0.00 ? 62 ARG A HH22 7  
ATOM   4894  N N    . PRO A 1 1  ? 0.082  -1.147 -0.989  1.00 0.00 ? 18 PRO A N    8  
ATOM   4895  C CA   . PRO A 1 1  ? 1.524  -0.949 -0.893  1.00 0.00 ? 18 PRO A CA   8  
ATOM   4896  C C    . PRO A 1 1  ? 1.865  0.519  -0.673  1.00 0.00 ? 18 PRO A C    8  
ATOM   4897  O O    . PRO A 1 1  ? 1.383  1.393  -1.394  1.00 0.00 ? 18 PRO A O    8  
ATOM   4898  C CB   . PRO A 1 1  ? 2.062  -1.474 -2.227  1.00 0.00 ? 18 PRO A CB   8  
ATOM   4899  C CG   . PRO A 1 1  ? 0.965  -2.328 -2.762  1.00 0.00 ? 18 PRO A CG   8  
ATOM   4900  C CD   . PRO A 1 1  ? -0.311 -1.680 -2.292  1.00 0.00 ? 18 PRO A CD   8  
ATOM   4901  H H2   . PRO A 1 1  ? -0.315 -1.537 -1.819  1.00 0.00 ? 18 PRO A H2   8  
ATOM   4902  H H3   . PRO A 1 1  ? -0.386 -1.742 -0.335  1.00 0.00 ? 18 PRO A H3   8  
ATOM   4903  H HA   . PRO A 1 1  ? 1.969  -1.475 -0.036  1.00 0.00 ? 18 PRO A HA   8  
ATOM   4904  H HB2  . PRO A 1 1  ? 2.299  -0.651 -2.918  1.00 0.00 ? 18 PRO A HB2  8  
ATOM   4905  H HB3  . PRO A 1 1  ? 2.987  -2.054 -2.089  1.00 0.00 ? 18 PRO A HB3  8  
ATOM   4906  H HG2  . PRO A 1 1  ? 0.999  -2.380 -3.861  1.00 0.00 ? 18 PRO A HG2  8  
ATOM   4907  H HG3  . PRO A 1 1  ? 1.045  -3.359 -2.388  1.00 0.00 ? 18 PRO A HG3  8  
ATOM   4908  H HD2  . PRO A 1 1  ? -0.648 -0.884 -2.972  1.00 0.00 ? 18 PRO A HD2  8  
ATOM   4909  H HD3  . PRO A 1 1  ? -1.137 -2.401 -2.206  1.00 0.00 ? 18 PRO A HD3  8  
ATOM   4910  N N    . THR A 1 2  ? 2.700  0.784  0.326   1.00 0.00 ? 19 THR A N    8  
ATOM   4911  C CA   . THR A 1 2  ? 3.123  2.145  0.631   1.00 0.00 ? 19 THR A CA   8  
ATOM   4912  C C    . THR A 1 2  ? 4.642  2.257  0.662   1.00 0.00 ? 19 THR A C    8  
ATOM   4913  O O    . THR A 1 2  ? 5.320  1.443  1.289   1.00 0.00 ? 19 THR A O    8  
ATOM   4914  C CB   . THR A 1 2  ? 2.556  2.625  1.979   1.00 0.00 ? 19 THR A CB   8  
ATOM   4915  O OG1  . THR A 1 2  ? 1.123  2.576  1.942   1.00 0.00 ? 19 THR A OG1  8  
ATOM   4916  C CG2  . THR A 1 2  ? 3.003  4.049  2.269   1.00 0.00 ? 19 THR A CG2  8  
ATOM   4917  H H    . THR A 1 2  ? 3.050  0.022  0.889   1.00 0.00 ? 19 THR A H    8  
ATOM   4918  H HA   . THR A 1 2  ? 2.781  2.822  -0.153  1.00 0.00 ? 19 THR A HA   8  
ATOM   4919  H HB   . THR A 1 2  ? 2.913  1.965  2.768   1.00 0.00 ? 19 THR A HB   8  
ATOM   4920  H HG1  . THR A 1 2  ? 0.772  2.874  2.785   1.00 0.00 ? 19 THR A HG1  8  
ATOM   4921  H HG21 . THR A 1 2  ? 2.645  4.710  1.480   1.00 0.00 ? 19 THR A HG21 8  
ATOM   4922  H HG22 . THR A 1 2  ? 2.593  4.371  3.226   1.00 0.00 ? 19 THR A HG22 8  
ATOM   4923  H HG23 . THR A 1 2  ? 4.092  4.088  2.309   1.00 0.00 ? 19 THR A HG23 8  
ATOM   4924  N N    . ARG A 1 3  ? 5.170  3.268  -0.019  1.00 0.00 ? 20 ARG A N    8  
ATOM   4925  C CA   . ARG A 1 3  ? 6.611  3.483  -0.077  1.00 0.00 ? 20 ARG A CA   8  
ATOM   4926  C C    . ARG A 1 3  ? 6.962  4.938  0.209   1.00 0.00 ? 20 ARG A C    8  
ATOM   4927  O O    . ARG A 1 3  ? 6.122  5.827  0.075   1.00 0.00 ? 20 ARG A O    8  
ATOM   4928  C CB   . ARG A 1 3  ? 7.210  3.014  -1.395  1.00 0.00 ? 20 ARG A CB   8  
ATOM   4929  C CG   . ARG A 1 3  ? 7.040  1.531  -1.683  1.00 0.00 ? 20 ARG A CG   8  
ATOM   4930  C CD   . ARG A 1 3  ? 7.838  0.641  -0.801  1.00 0.00 ? 20 ARG A CD   8  
ATOM   4931  N NE   . ARG A 1 3  ? 7.740  -0.773 -1.125  1.00 0.00 ? 20 ARG A NE   8  
ATOM   4932  C CZ   . ARG A 1 3  ? 6.798  -1.605 -0.640  1.00 0.00 ? 20 ARG A CZ   8  
ATOM   4933  N NH1  . ARG A 1 3  ? 5.896  -1.180 0.217   1.00 0.00 ? 20 ARG A NH1  8  
ATOM   4934  N NH2  . ARG A 1 3  ? 6.818  -2.867 -1.031  1.00 0.00 ? 20 ARG A NH2  8  
ATOM   4935  H H    . ARG A 1 3  ? 4.558  3.904  -0.510  1.00 0.00 ? 20 ARG A H    8  
ATOM   4936  H HA   . ARG A 1 3  ? 7.104  2.887  0.693   1.00 0.00 ? 20 ARG A HA   8  
ATOM   4937  H HB2  . ARG A 1 3  ? 6.730  3.590  -2.184  1.00 0.00 ? 20 ARG A HB2  8  
ATOM   4938  H HB3  . ARG A 1 3  ? 8.273  3.254  -1.363  1.00 0.00 ? 20 ARG A HB3  8  
ATOM   4939  H HG2  . ARG A 1 3  ? 5.989  1.271  -1.558  1.00 0.00 ? 20 ARG A HG2  8  
ATOM   4940  H HG3  . ARG A 1 3  ? 7.341  1.342  -2.713  1.00 0.00 ? 20 ARG A HG3  8  
ATOM   4941  H HD2  . ARG A 1 3  ? 8.889  0.920  -0.875  1.00 0.00 ? 20 ARG A HD2  8  
ATOM   4942  H HD3  . ARG A 1 3  ? 7.501  0.765  0.227   1.00 0.00 ? 20 ARG A HD3  8  
ATOM   4943  H HE   . ARG A 1 3  ? 8.322  -1.338 -1.728  1.00 0.00 ? 20 ARG A HE   8  
ATOM   4944  H HH11 . ARG A 1 3  ? 5.903  -0.217 0.520   1.00 0.00 ? 20 ARG A HH11 8  
ATOM   4945  H HH12 . ARG A 1 3  ? 5.197  -1.819 0.569   1.00 0.00 ? 20 ARG A HH12 8  
ATOM   4946  H HH21 . ARG A 1 3  ? 7.530  -3.182 -1.676  1.00 0.00 ? 20 ARG A HH21 8  
ATOM   4947  H HH22 . ARG A 1 3  ? 6.124  -3.512 -0.682  1.00 0.00 ? 20 ARG A HH22 8  
ATOM   4948  N N    . THR A 1 4  ? 8.210  5.172  0.604   1.00 0.00 ? 21 THR A N    8  
ATOM   4949  C CA   . THR A 1 4  ? 8.677  6.521  0.900   1.00 0.00 ? 21 THR A CA   8  
ATOM   4950  C C    . THR A 1 4  ? 9.955  6.842  0.135   1.00 0.00 ? 21 THR A C    8  
ATOM   4951  O O    . THR A 1 4  ? 10.948 6.120  0.236   1.00 0.00 ? 21 THR A O    8  
ATOM   4952  C CB   . THR A 1 4  ? 8.932  6.714  2.406   1.00 0.00 ? 21 THR A CB   8  
ATOM   4953  O OG1  . THR A 1 4  ? 7.722  6.464  3.134   1.00 0.00 ? 21 THR A OG1  8  
ATOM   4954  C CG2  . THR A 1 4  ? 9.407  8.131  2.691   1.00 0.00 ? 21 THR A CG2  8  
ATOM   4955  H H    . THR A 1 4  ? 8.849  4.398  0.702   1.00 0.00 ? 21 THR A H    8  
ATOM   4956  H HA   . THR A 1 4  ? 7.933  7.249  0.577   1.00 0.00 ? 21 THR A HA   8  
ATOM   4957  H HB   . THR A 1 4  ? 9.693  6.005  2.731   1.00 0.00 ? 21 THR A HB   8  
ATOM   4958  H HG1  . THR A 1 4  ? 7.884  6.584  4.073   1.00 0.00 ? 21 THR A HG1  8  
ATOM   4959  H HG21 . THR A 1 4  ? 8.646  8.840  2.368   1.00 0.00 ? 21 THR A HG21 8  
ATOM   4960  H HG22 . THR A 1 4  ? 9.582  8.247  3.760   1.00 0.00 ? 21 THR A HG22 8  
ATOM   4961  H HG23 . THR A 1 4  ? 10.334 8.319  2.149   1.00 0.00 ? 21 THR A HG23 8  
ATOM   4962  N N    . VAL A 1 5  ? 9.925  7.928  -0.631  1.00 0.00 ? 22 VAL A N    8  
ATOM   4963  C CA   . VAL A 1 5  ? 11.094 8.371  -1.379  1.00 0.00 ? 22 VAL A CA   8  
ATOM   4964  C C    . VAL A 1 5  ? 11.444 9.816  -1.048  1.00 0.00 ? 22 VAL A C    8  
ATOM   4965  O O    . VAL A 1 5  ? 10.568 10.680 -0.994  1.00 0.00 ? 22 VAL A O    8  
ATOM   4966  C CB   . VAL A 1 5  ? 10.877 8.239  -2.898  1.00 0.00 ? 22 VAL A CB   8  
ATOM   4967  C CG1  . VAL A 1 5  ? 12.075 8.794  -3.656  1.00 0.00 ? 22 VAL A CG1  8  
ATOM   4968  C CG2  . VAL A 1 5  ? 10.634 6.787  -3.277  1.00 0.00 ? 22 VAL A CG2  8  
ATOM   4969  H H    . VAL A 1 5  ? 9.068  8.459  -0.696  1.00 0.00 ? 22 VAL A H    8  
ATOM   4970  H HA   . VAL A 1 5  ? 11.981 7.799  -1.102  1.00 0.00 ? 22 VAL A HA   8  
ATOM   4971  H HB   . VAL A 1 5  ? 9.982  8.795  -3.177  1.00 0.00 ? 22 VAL A HB   8  
ATOM   4972  H HG11 . VAL A 1 5  ? 11.904 8.693  -4.729  1.00 0.00 ? 22 VAL A HG11 8  
ATOM   4973  H HG12 . VAL A 1 5  ? 12.207 9.846  -3.408  1.00 0.00 ? 22 VAL A HG12 8  
ATOM   4974  H HG13 . VAL A 1 5  ? 12.970 8.238  -3.379  1.00 0.00 ? 22 VAL A HG13 8  
ATOM   4975  H HG21 . VAL A 1 5  ? 9.747  6.420  -2.760  1.00 0.00 ? 22 VAL A HG21 8  
ATOM   4976  H HG22 . VAL A 1 5  ? 10.482 6.713  -4.354  1.00 0.00 ? 22 VAL A HG22 8  
ATOM   4977  H HG23 . VAL A 1 5  ? 11.497 6.186  -2.990  1.00 0.00 ? 22 VAL A HG23 8  
ATOM   4978  N N    . ALA A 1 6  ? 12.728 10.074 -0.828  1.00 0.00 ? 23 ALA A N    8  
ATOM   4979  C CA   . ALA A 1 6  ? 13.207 11.428 -0.576  1.00 0.00 ? 23 ALA A CA   8  
ATOM   4980  C C    . ALA A 1 6  ? 13.625 12.114 -1.870  1.00 0.00 ? 23 ALA A C    8  
ATOM   4981  O O    . ALA A 1 6  ? 14.278 11.510 -2.721  1.00 0.00 ? 23 ALA A O    8  
ATOM   4982  C CB   . ALA A 1 6  ? 14.361 11.407 0.415   1.00 0.00 ? 23 ALA A CB   8  
ATOM   4983  H H    . ALA A 1 6  ? 13.391 9.311  -0.835  1.00 0.00 ? 23 ALA A H    8  
ATOM   4984  H HA   . ALA A 1 6  ? 12.391 12.012 -0.147  1.00 0.00 ? 23 ALA A HA   8  
ATOM   4985  H HB1  . ALA A 1 6  ? 15.179 10.813 0.008   1.00 0.00 ? 23 ALA A HB1  8  
ATOM   4986  H HB2  . ALA A 1 6  ? 14.706 12.425 0.592   1.00 0.00 ? 23 ALA A HB2  8  
ATOM   4987  H HB3  . ALA A 1 6  ? 14.027 10.969 1.355   1.00 0.00 ? 23 ALA A HB3  8  
ATOM   4988  N N    . ILE A 1 7  ? 13.246 13.380 -2.012  1.00 0.00 ? 24 ILE A N    8  
ATOM   4989  C CA   . ILE A 1 7  ? 13.566 14.144 -3.211  1.00 0.00 ? 24 ILE A CA   8  
ATOM   4990  C C    . ILE A 1 7  ? 14.182 15.492 -2.856  1.00 0.00 ? 24 ILE A C    8  
ATOM   4991  O O    . ILE A 1 7  ? 14.122 15.930 -1.707  1.00 0.00 ? 24 ILE A O    8  
ATOM   4992  C CB   . ILE A 1 7  ? 12.319 14.374 -4.084  1.00 0.00 ? 24 ILE A CB   8  
ATOM   4993  C CG1  . ILE A 1 7  ? 11.271 15.182 -3.315  1.00 0.00 ? 24 ILE A CG1  8  
ATOM   4994  C CG2  . ILE A 1 7  ? 11.740 13.046 -4.544  1.00 0.00 ? 24 ILE A CG2  8  
ATOM   4995  C CD1  . ILE A 1 7  ? 10.091 15.612 -4.158  1.00 0.00 ? 24 ILE A CD1  8  
ATOM   4996  H H    . ILE A 1 7  ? 12.724 13.822 -1.270  1.00 0.00 ? 24 ILE A H    8  
ATOM   4997  H HA   . ILE A 1 7  ? 14.331 13.637 -3.797  1.00 0.00 ? 24 ILE A HA   8  
ATOM   4998  H HB   . ILE A 1 7  ? 12.599 14.969 -4.953  1.00 0.00 ? 24 ILE A HB   8  
ATOM   4999  H HG12 . ILE A 1 7  ? 10.921 14.559 -2.492  1.00 0.00 ? 24 ILE A HG12 8  
ATOM   5000  H HG13 . ILE A 1 7  ? 11.771 16.065 -2.915  1.00 0.00 ? 24 ILE A HG13 8  
ATOM   5001  H HG21 . ILE A 1 7  ? 10.859 13.226 -5.160  1.00 0.00 ? 24 ILE A HG21 8  
ATOM   5002  H HG22 . ILE A 1 7  ? 12.486 12.507 -5.127  1.00 0.00 ? 24 ILE A HG22 8  
ATOM   5003  H HG23 . ILE A 1 7  ? 11.459 12.450 -3.675  1.00 0.00 ? 24 ILE A HG23 8  
ATOM   5004  H HD11 . ILE A 1 7  ? 9.590  14.732 -4.559  1.00 0.00 ? 24 ILE A HD11 8  
ATOM   5005  H HD12 . ILE A 1 7  ? 9.391  16.179 -3.545  1.00 0.00 ? 24 ILE A HD12 8  
ATOM   5006  H HD13 . ILE A 1 7  ? 10.440 16.236 -4.982  1.00 0.00 ? 24 ILE A HD13 8  
ATOM   5007  N N    . SER A 1 8  ? 14.774 16.147 -3.849  1.00 0.00 ? 25 SER A N    8  
ATOM   5008  C CA   . SER A 1 8  ? 15.408 17.443 -3.643  1.00 0.00 ? 25 SER A CA   8  
ATOM   5009  C C    . SER A 1 8  ? 14.605 18.560 -4.296  1.00 0.00 ? 25 SER A C    8  
ATOM   5010  O O    . SER A 1 8  ? 14.543 19.676 -3.782  1.00 0.00 ? 25 SER A O    8  
ATOM   5011  C CB   . SER A 1 8  ? 16.825 17.424 -4.184  1.00 0.00 ? 25 SER A CB   8  
ATOM   5012  O OG   . SER A 1 8  ? 16.859 17.141 -5.556  1.00 0.00 ? 25 SER A OG   8  
ATOM   5013  H H    . SER A 1 8  ? 14.785 15.735 -4.772  1.00 0.00 ? 25 SER A H    8  
ATOM   5014  H HA   . SER A 1 8  ? 15.581 17.677 -2.592  1.00 0.00 ? 25 SER A HA   8  
ATOM   5015  H HB2  . SER A 1 8  ? 17.276 18.400 -4.013  1.00 0.00 ? 25 SER A HB2  8  
ATOM   5016  H HB3  . SER A 1 8  ? 17.392 16.663 -3.650  1.00 0.00 ? 25 SER A HB3  8  
ATOM   5017  H HG   . SER A 1 8  ? 17.769 17.154 -5.863  1.00 0.00 ? 25 SER A HG   8  
ATOM   5018  N N    . ASP A 1 9  ? 13.990 18.252 -5.434  1.00 0.00 ? 26 ASP A N    8  
ATOM   5019  C CA   . ASP A 1 9  ? 13.257 19.250 -6.202  1.00 0.00 ? 26 ASP A CA   8  
ATOM   5020  C C    . ASP A 1 9  ? 11.959 18.676 -6.755  1.00 0.00 ? 26 ASP A C    8  
ATOM   5021  O O    . ASP A 1 9  ? 11.974 17.819 -7.639  1.00 0.00 ? 26 ASP A O    8  
ATOM   5022  C CB   . ASP A 1 9  ? 14.121 19.789 -7.345  1.00 0.00 ? 26 ASP A CB   8  
ATOM   5023  C CG   . ASP A 1 9  ? 13.491 20.936 -8.124  1.00 0.00 ? 26 ASP A CG   8  
ATOM   5024  O OD1  . ASP A 1 9  ? 12.371 21.283 -7.832  1.00 0.00 ? 26 ASP A OD1  8  
ATOM   5025  O OD2  . ASP A 1 9  ? 14.185 21.556 -8.893  1.00 0.00 ? 26 ASP A OD2  8  
ATOM   5026  H H    . ASP A 1 9  ? 14.032 17.302 -5.773  1.00 0.00 ? 26 ASP A H    8  
ATOM   5027  H HA   . ASP A 1 9  ? 12.977 20.082 -5.556  1.00 0.00 ? 26 ASP A HA   8  
ATOM   5028  H HB2  . ASP A 1 9  ? 15.127 20.073 -7.032  1.00 0.00 ? 26 ASP A HB2  8  
ATOM   5029  H HB3  . ASP A 1 9  ? 14.173 18.904 -7.980  1.00 0.00 ? 26 ASP A HB3  8  
ATOM   5030  N N    . ALA A 1 10 ? 10.835 19.151 -6.229  1.00 0.00 ? 27 ALA A N    8  
ATOM   5031  C CA   . ALA A 1 10 ? 9.525  18.697 -6.679  1.00 0.00 ? 27 ALA A CA   8  
ATOM   5032  C C    . ALA A 1 10 ? 9.347  18.924 -8.175  1.00 0.00 ? 27 ALA A C    8  
ATOM   5033  O O    . ALA A 1 10 ? 8.693  18.136 -8.858  1.00 0.00 ? 27 ALA A O    8  
ATOM   5034  C CB   . ALA A 1 10 ? 8.423  19.399 -5.898  1.00 0.00 ? 27 ALA A CB   8  
ATOM   5035  H H    . ALA A 1 10 ? 10.890 19.847 -5.499  1.00 0.00 ? 27 ALA A H    8  
ATOM   5036  H HA   . ALA A 1 10 ? 9.448  17.624 -6.502  1.00 0.00 ? 27 ALA A HA   8  
ATOM   5037  H HB1  . ALA A 1 10 ? 8.497  20.474 -6.053  1.00 0.00 ? 27 ALA A HB1  8  
ATOM   5038  H HB2  . ALA A 1 10 ? 7.453  19.047 -6.246  1.00 0.00 ? 27 ALA A HB2  8  
ATOM   5039  H HB3  . ALA A 1 10 ? 8.531  19.176 -4.837  1.00 0.00 ? 27 ALA A HB3  8  
ATOM   5040  N N    . ALA A 1 11 ? 9.934  20.004 -8.678  1.00 0.00 ? 28 ALA A N    8  
ATOM   5041  C CA   . ALA A 1 11 ? 9.778  20.378 -10.078 1.00 0.00 ? 28 ALA A CA   8  
ATOM   5042  C C    . ALA A 1 11 ? 10.395 19.333 -10.999 1.00 0.00 ? 28 ALA A C    8  
ATOM   5043  O O    . ALA A 1 11 ? 10.010 19.212 -12.162 1.00 0.00 ? 28 ALA A O    8  
ATOM   5044  C CB   . ALA A 1 11 ? 10.397 21.745 -10.334 1.00 0.00 ? 28 ALA A CB   8  
ATOM   5045  H H    . ALA A 1 11 ? 10.502 20.582 -8.075  1.00 0.00 ? 28 ALA A H    8  
ATOM   5046  H HA   . ALA A 1 11 ? 8.714  20.428 -10.311 1.00 0.00 ? 28 ALA A HA   8  
ATOM   5047  H HB1  . ALA A 1 11 ? 11.458 21.715 -10.091 1.00 0.00 ? 28 ALA A HB1  8  
ATOM   5048  H HB2  . ALA A 1 11 ? 10.272 22.009 -11.385 1.00 0.00 ? 28 ALA A HB2  8  
ATOM   5049  H HB3  . ALA A 1 11 ? 9.901  22.490 -9.711  1.00 0.00 ? 28 ALA A HB3  8  
ATOM   5050  N N    . GLN A 1 12 ? 11.353 18.578 -10.472 1.00 0.00 ? 29 GLN A N    8  
ATOM   5051  C CA   . GLN A 1 12 ? 12.078 17.594 -11.267 1.00 0.00 ? 29 GLN A CA   8  
ATOM   5052  C C    . GLN A 1 12 ? 11.440 16.216 -11.151 1.00 0.00 ? 29 GLN A C    8  
ATOM   5053  O O    . GLN A 1 12 ? 11.856 15.270 -11.822 1.00 0.00 ? 29 GLN A O    8  
ATOM   5054  C CB   . GLN A 1 12 ? 13.543 17.523 -10.827 1.00 0.00 ? 29 GLN A CB   8  
ATOM   5055  C CG   . GLN A 1 12 ? 14.332 18.797 -11.084 1.00 0.00 ? 29 GLN A CG   8  
ATOM   5056  C CD   . GLN A 1 12 ? 15.768 18.694 -10.607 1.00 0.00 ? 29 GLN A CD   8  
ATOM   5057  O OE1  . GLN A 1 12 ? 16.236 17.616 -10.232 1.00 0.00 ? 29 GLN A OE1  8  
ATOM   5058  N NE2  . GLN A 1 12 ? 16.474 19.819 -10.614 1.00 0.00 ? 29 GLN A NE2  8  
ATOM   5059  H H    . GLN A 1 12 ? 11.587 18.691 -9.495  1.00 0.00 ? 29 GLN A H    8  
ATOM   5060  H HA   . GLN A 1 12 ? 12.032 17.870 -12.321 1.00 0.00 ? 29 GLN A HA   8  
ATOM   5061  H HB2  . GLN A 1 12 ? 13.542 17.299 -9.761  1.00 0.00 ? 29 GLN A HB2  8  
ATOM   5062  H HB3  . GLN A 1 12 ? 13.996 16.695 -11.372 1.00 0.00 ? 29 GLN A HB3  8  
ATOM   5063  H HG2  . GLN A 1 12 ? 14.335 19.305 -12.049 1.00 0.00 ? 29 GLN A HG2  8  
ATOM   5064  H HG3  . GLN A 1 12 ? 13.771 19.393 -10.364 1.00 0.00 ? 29 GLN A HG3  8  
ATOM   5065  H HE21 . GLN A 1 12 ? 16.054 20.672 -10.924 1.00 0.00 ? 29 GLN A HE21 8  
ATOM   5066  H HE22 . GLN A 1 12 ? 17.428 19.813 -10.309 1.00 0.00 ? 29 GLN A HE22 8  
ATOM   5067  N N    . LEU A 1 13 ? 10.429 16.107 -10.296 1.00 0.00 ? 30 LEU A N    8  
ATOM   5068  C CA   . LEU A 1 13 ? 9.718  14.849 -10.107 1.00 0.00 ? 30 LEU A CA   8  
ATOM   5069  C C    . LEU A 1 13 ? 8.821  14.539 -11.298 1.00 0.00 ? 30 LEU A C    8  
ATOM   5070  O O    . LEU A 1 13 ? 7.984  15.354 -11.687 1.00 0.00 ? 30 LEU A O    8  
ATOM   5071  C CB   . LEU A 1 13 ? 8.892  14.897 -8.815  1.00 0.00 ? 30 LEU A CB   8  
ATOM   5072  C CG   . LEU A 1 13 ? 8.323  13.548 -8.354  1.00 0.00 ? 30 LEU A CG   8  
ATOM   5073  C CD1  . LEU A 1 13 ? 9.454  12.624 -7.923  1.00 0.00 ? 30 LEU A CD1  8  
ATOM   5074  C CD2  . LEU A 1 13 ? 7.345  13.773 -7.211  1.00 0.00 ? 30 LEU A CD2  8  
ATOM   5075  H H    . LEU A 1 13 ? 10.146 16.917 -9.764  1.00 0.00 ? 30 LEU A H    8  
ATOM   5076  H HA   . LEU A 1 13 ? 10.434 14.031 -10.039 1.00 0.00 ? 30 LEU A HA   8  
ATOM   5077  H HB2  . LEU A 1 13 ? 9.663  15.233 -8.124  1.00 0.00 ? 30 LEU A HB2  8  
ATOM   5078  H HB3  . LEU A 1 13 ? 8.101  15.645 -8.868  1.00 0.00 ? 30 LEU A HB3  8  
ATOM   5079  H HG   . LEU A 1 13 ? 7.766  13.128 -9.192  1.00 0.00 ? 30 LEU A HG   8  
ATOM   5080  H HD11 . LEU A 1 13 ? 9.041  11.669 -7.597  1.00 0.00 ? 30 LEU A HD11 8  
ATOM   5081  H HD12 . LEU A 1 13 ? 10.129 12.459 -8.763  1.00 0.00 ? 30 LEU A HD12 8  
ATOM   5082  H HD13 . LEU A 1 13 ? 10.003 13.081 -7.100  1.00 0.00 ? 30 LEU A HD13 8  
ATOM   5083  H HD21 . LEU A 1 13 ? 6.530  14.413 -7.549  1.00 0.00 ? 30 LEU A HD21 8  
ATOM   5084  H HD22 . LEU A 1 13 ? 6.940  12.814 -6.885  1.00 0.00 ? 30 LEU A HD22 8  
ATOM   5085  H HD23 . LEU A 1 13 ? 7.861  14.252 -6.378  1.00 0.00 ? 30 LEU A HD23 8  
ATOM   5086  N N    . PRO A 1 14 ? 8.999  13.355 -11.874 1.00 0.00 ? 31 PRO A N    8  
ATOM   5087  C CA   . PRO A 1 14 ? 8.231  12.949 -13.045 1.00 0.00 ? 31 PRO A CA   8  
ATOM   5088  C C    . PRO A 1 14 ? 6.733  13.048 -12.784 1.00 0.00 ? 31 PRO A C    8  
ATOM   5089  O O    . PRO A 1 14 ? 6.252  12.657 -11.720 1.00 0.00 ? 31 PRO A O    8  
ATOM   5090  C CB   . PRO A 1 14 ? 8.677  11.507 -13.305 1.00 0.00 ? 31 PRO A CB   8  
ATOM   5091  C CG   . PRO A 1 14 ? 10.057 11.439 -12.747 1.00 0.00 ? 31 PRO A CG   8  
ATOM   5092  C CD   . PRO A 1 14 ? 10.039 12.324 -11.529 1.00 0.00 ? 31 PRO A CD   8  
ATOM   5093  H HA   . PRO A 1 14 ? 8.410  13.597 -13.916 1.00 0.00 ? 31 PRO A HA   8  
ATOM   5094  H HB2  . PRO A 1 14 ? 8.012  10.785 -12.810 1.00 0.00 ? 31 PRO A HB2  8  
ATOM   5095  H HB3  . PRO A 1 14 ? 8.669  11.269 -14.379 1.00 0.00 ? 31 PRO A HB3  8  
ATOM   5096  H HG2  . PRO A 1 14 ? 10.330 10.407 -12.483 1.00 0.00 ? 31 PRO A HG2  8  
ATOM   5097  H HG3  . PRO A 1 14 ? 10.800 11.790 -13.480 1.00 0.00 ? 31 PRO A HG3  8  
ATOM   5098  H HD2  . PRO A 1 14 ? 9.764  11.772 -10.618 1.00 0.00 ? 31 PRO A HD2  8  
ATOM   5099  H HD3  . PRO A 1 14 ? 11.018 12.789 -11.338 1.00 0.00 ? 31 PRO A HD3  8  
ATOM   5100  N N    . HIS A 1 15 ? 6.001  13.573 -13.760 1.00 0.00 ? 32 HIS A N    8  
ATOM   5101  C CA   . HIS A 1 15 ? 4.544  13.565 -13.714 1.00 0.00 ? 32 HIS A CA   8  
ATOM   5102  C C    . HIS A 1 15 ? 3.987  12.210 -14.133 1.00 0.00 ? 32 HIS A C    8  
ATOM   5103  O O    . HIS A 1 15 ? 4.635  11.460 -14.863 1.00 0.00 ? 32 HIS A O    8  
ATOM   5104  C CB   . HIS A 1 15 ? 3.967  14.666 -14.609 1.00 0.00 ? 32 HIS A CB   8  
ATOM   5105  C CG   . HIS A 1 15 ? 4.012  16.029 -13.991 1.00 0.00 ? 32 HIS A CG   8  
ATOM   5106  N ND1  . HIS A 1 15 ? 3.140  16.424 -12.997 1.00 0.00 ? 32 HIS A ND1  8  
ATOM   5107  C CD2  . HIS A 1 15 ? 4.823  17.087 -14.224 1.00 0.00 ? 32 HIS A CD2  8  
ATOM   5108  C CE1  . HIS A 1 15 ? 3.415  17.668 -12.646 1.00 0.00 ? 32 HIS A CE1  8  
ATOM   5109  N NE2  . HIS A 1 15 ? 4.430  18.094 -13.376 1.00 0.00 ? 32 HIS A NE2  8  
ATOM   5110  H H    . HIS A 1 15 ? 6.465  13.989 -14.555 1.00 0.00 ? 32 HIS A H    8  
ATOM   5111  H HA   . HIS A 1 15 ? 4.209  13.734 -12.691 1.00 0.00 ? 32 HIS A HA   8  
ATOM   5112  H HB2  . HIS A 1 15 ? 4.531  14.728 -15.541 1.00 0.00 ? 32 HIS A HB2  8  
ATOM   5113  H HB3  . HIS A 1 15 ? 2.921  14.459 -14.832 1.00 0.00 ? 32 HIS A HB3  8  
ATOM   5114  H HD1  . HIS A 1 15 ? 2.461  15.848 -12.543 1.00 0.00 ? 32 HIS A HD1  8  
ATOM   5115  H HD2  . HIS A 1 15 ? 5.653  17.247 -14.912 1.00 0.00 ? 32 HIS A HD2  8  
ATOM   5116  H HE1  . HIS A 1 15 ? 2.835  18.167 -11.870 1.00 0.00 ? 32 HIS A HE1  8  
ATOM   5117  N N    . ASP A 1 16 ? 2.782  11.901 -13.666 1.00 0.00 ? 33 ASP A N    8  
ATOM   5118  C CA   . ASP A 1 16 ? 2.012  12.836 -12.854 1.00 0.00 ? 33 ASP A CA   8  
ATOM   5119  C C    . ASP A 1 16 ? 2.275  12.624 -11.369 1.00 0.00 ? 33 ASP A C    8  
ATOM   5120  O O    . ASP A 1 16 ? 2.599  11.517 -10.938 1.00 0.00 ? 33 ASP A O    8  
ATOM   5121  C CB   . ASP A 1 16 ? 0.516  12.695 -13.148 1.00 0.00 ? 33 ASP A CB   8  
ATOM   5122  C CG   . ASP A 1 16 ? 0.119  13.050 -14.575 1.00 0.00 ? 33 ASP A CG   8  
ATOM   5123  O OD1  . ASP A 1 16 ? 0.517  14.092 -15.040 1.00 0.00 ? 33 ASP A OD1  8  
ATOM   5124  O OD2  . ASP A 1 16 ? -0.443 12.213 -15.239 1.00 0.00 ? 33 ASP A OD2  8  
ATOM   5125  H H    . ASP A 1 16 ? 2.390  10.995 -13.878 1.00 0.00 ? 33 ASP A H    8  
ATOM   5126  H HA   . ASP A 1 16 ? 2.316  13.858 -13.080 1.00 0.00 ? 33 ASP A HA   8  
ATOM   5127  H HB2  . ASP A 1 16 ? 0.114  11.715 -12.894 1.00 0.00 ? 33 ASP A HB2  8  
ATOM   5128  H HB3  . ASP A 1 16 ? 0.115  13.443 -12.463 1.00 0.00 ? 33 ASP A HB3  8  
ATOM   5129  N N    . TYR A 1 17 ? 2.135  13.692 -10.590 1.00 0.00 ? 34 TYR A N    8  
ATOM   5130  C CA   . TYR A 1 17 ? 2.209  13.595 -9.138  1.00 0.00 ? 34 TYR A CA   8  
ATOM   5131  C C    . TYR A 1 17 ? 1.345  14.656 -8.470  1.00 0.00 ? 34 TYR A C    8  
ATOM   5132  O O    . TYR A 1 17 ? 0.918  15.617 -9.111  1.00 0.00 ? 34 TYR A O    8  
ATOM   5133  C CB   . TYR A 1 17 ? 3.659  13.726 -8.666  1.00 0.00 ? 34 TYR A CB   8  
ATOM   5134  C CG   . TYR A 1 17 ? 4.250  15.102 -8.876  1.00 0.00 ? 34 TYR A CG   8  
ATOM   5135  C CD1  . TYR A 1 17 ? 4.053  16.112 -7.945  1.00 0.00 ? 34 TYR A CD1  8  
ATOM   5136  C CD2  . TYR A 1 17 ? 5.005  15.387 -10.003 1.00 0.00 ? 34 TYR A CD2  8  
ATOM   5137  C CE1  . TYR A 1 17 ? 4.591  17.370 -8.131  1.00 0.00 ? 34 TYR A CE1  8  
ATOM   5138  C CE2  . TYR A 1 17 ? 5.548  16.641 -10.201 1.00 0.00 ? 34 TYR A CE2  8  
ATOM   5139  C CZ   . TYR A 1 17 ? 5.338  17.632 -9.262  1.00 0.00 ? 34 TYR A CZ   8  
ATOM   5140  O OH   . TYR A 1 17 ? 5.878  18.883 -9.452  1.00 0.00 ? 34 TYR A OH   8  
ATOM   5141  H H    . TYR A 1 17 ? 1.973  14.593 -11.016 1.00 0.00 ? 34 TYR A H    8  
ATOM   5142  H HA   . TYR A 1 17 ? 1.823  12.629 -8.811  1.00 0.00 ? 34 TYR A HA   8  
ATOM   5143  H HB2  . TYR A 1 17 ? 3.675  13.480 -7.602  1.00 0.00 ? 34 TYR A HB2  8  
ATOM   5144  H HB3  . TYR A 1 17 ? 4.244  12.991 -9.217  1.00 0.00 ? 34 TYR A HB3  8  
ATOM   5145  H HD1  . TYR A 1 17 ? 3.462  15.898 -7.054  1.00 0.00 ? 34 TYR A HD1  8  
ATOM   5146  H HD2  . TYR A 1 17 ? 5.167  14.601 -10.741 1.00 0.00 ? 34 TYR A HD2  8  
ATOM   5147  H HE1  . TYR A 1 17 ? 4.427  18.154 -7.392  1.00 0.00 ? 34 TYR A HE1  8  
ATOM   5148  H HE2  . TYR A 1 17 ? 6.137  16.847 -11.094 1.00 0.00 ? 34 TYR A HE2  8  
ATOM   5149  H HH   . TYR A 1 17 ? 6.367  18.959 -10.275 1.00 0.00 ? 34 TYR A HH   8  
ATOM   5150  N N    . CYS A 1 18 ? 1.090  14.479 -7.179  1.00 0.00 ? 35 CYS A N    8  
ATOM   5151  C CA   . CYS A 1 18 ? 0.299  15.436 -6.415  1.00 0.00 ? 35 CYS A CA   8  
ATOM   5152  C C    . CYS A 1 18 ? 1.043  15.893 -5.166  1.00 0.00 ? 35 CYS A C    8  
ATOM   5153  O O    . CYS A 1 18 ? 2.070  15.321 -4.799  1.00 0.00 ? 35 CYS A O    8  
ATOM   5154  C CB   . CYS A 1 18 ? -0.940 14.625 -6.035  1.00 0.00 ? 35 CYS A CB   8  
ATOM   5155  S SG   . CYS A 1 18 ? -1.896 14.014 -7.445  1.00 0.00 ? 35 CYS A SG   8  
ATOM   5156  H H    . CYS A 1 18 ? 1.452  13.658 -6.714  1.00 0.00 ? 35 CYS A H    8  
ATOM   5157  H HA   . CYS A 1 18 ? -0.015 16.302 -6.998  1.00 0.00 ? 35 CYS A HA   8  
ATOM   5158  H HB2  . CYS A 1 18 ? -0.654 13.744 -5.460  1.00 0.00 ? 35 CYS A HB2  8  
ATOM   5159  H HB3  . CYS A 1 18 ? -1.625 15.235 -5.449  1.00 0.00 ? 35 CYS A HB3  8  
ATOM   5160  H HG   . CYS A 1 18 ? -2.829 13.400 -6.724  1.00 0.00 ? 35 CYS A HG   8  
ATOM   5161  N N    . THR A 1 19 ? 0.519  16.927 -4.517  1.00 0.00 ? 36 THR A N    8  
ATOM   5162  C CA   . THR A 1 19 ? 1.133  17.463 -3.308  1.00 0.00 ? 36 THR A CA   8  
ATOM   5163  C C    . THR A 1 19 ? 0.086  18.067 -2.381  1.00 0.00 ? 36 THR A C    8  
ATOM   5164  O O    . THR A 1 19 ? -0.981 18.490 -2.825  1.00 0.00 ? 36 THR A O    8  
ATOM   5165  C CB   . THR A 1 19 ? 2.191  18.533 -3.636  1.00 0.00 ? 36 THR A CB   8  
ATOM   5166  O OG1  . THR A 1 19 ? 2.865  18.927 -2.435  1.00 0.00 ? 36 THR A OG1  8  
ATOM   5167  C CG2  . THR A 1 19 ? 1.538  19.751 -4.271  1.00 0.00 ? 36 THR A CG2  8  
ATOM   5168  H H    . THR A 1 19 ? -0.325 17.353 -4.870  1.00 0.00 ? 36 THR A H    8  
ATOM   5169  H HA   . THR A 1 19 ? 1.612  16.658 -2.749  1.00 0.00 ? 36 THR A HA   8  
ATOM   5170  H HB   . THR A 1 19 ? 2.919  18.109 -4.328  1.00 0.00 ? 36 THR A HB   8  
ATOM   5171  H HG1  . THR A 1 19 ? 3.524  19.594 -2.642  1.00 0.00 ? 36 THR A HG1  8  
ATOM   5172  H HG21 . THR A 1 19 ? 0.811  20.175 -3.580  1.00 0.00 ? 36 THR A HG21 8  
ATOM   5173  H HG22 . THR A 1 19 ? 2.302  20.495 -4.496  1.00 0.00 ? 36 THR A HG22 8  
ATOM   5174  H HG23 . THR A 1 19 ? 1.035  19.456 -5.192  1.00 0.00 ? 36 THR A HG23 8  
HETATM 5175  N N    . TPO A 1 20 ? 0.398  18.105 -1.089  1.00 0.00 ? 37 TPO A N    8  
HETATM 5176  C CA   . TPO A 1 20 ? -0.479 18.731 -0.107  1.00 0.00 ? 37 TPO A CA   8  
HETATM 5177  C CB   . TPO A 1 20 ? -0.621 17.865 1.157   1.00 0.00 ? 37 TPO A CB   8  
HETATM 5178  C CG2  . TPO A 1 20 ? -0.961 16.429 0.785   1.00 0.00 ? 37 TPO A CG2  8  
HETATM 5179  O OG1  . TPO A 1 20 ? 0.608  17.884 1.895   1.00 0.00 ? 37 TPO A OG1  8  
HETATM 5180  P P    . TPO A 1 20 ? 0.632  17.497 3.460   1.00 0.00 ? 37 TPO A P    8  
HETATM 5181  O O1P  . TPO A 1 20 ? 2.100  17.621 3.943   1.00 0.00 ? 37 TPO A O1P  8  
HETATM 5182  O O2P  . TPO A 1 20 ? 0.112  16.041 3.583   1.00 0.00 ? 37 TPO A O2P  8  
HETATM 5183  O O3P  . TPO A 1 20 ? -0.298 18.497 4.196   1.00 0.00 ? 37 TPO A O3P  8  
HETATM 5184  C C    . TPO A 1 20 ? 0.034  20.109 0.290   1.00 0.00 ? 37 TPO A C    8  
HETATM 5185  O O    . TPO A 1 20 ? 1.196  20.441 0.056   1.00 0.00 ? 37 TPO A O    8  
HETATM 5186  H H    . TPO A 1 20 ? 1.266  17.689 -0.780  1.00 0.00 ? 37 TPO A H    8  
HETATM 5187  H HA   . TPO A 1 20 ? -1.468 18.884 -0.540  1.00 0.00 ? 37 TPO A HA   8  
HETATM 5188  H HB   . TPO A 1 20 ? -1.416 18.275 1.781   1.00 0.00 ? 37 TPO A HB   8  
HETATM 5189  H HG21 . TPO A 1 20 ? -1.058 15.832 1.691   1.00 0.00 ? 37 TPO A HG21 8  
HETATM 5190  H HG22 . TPO A 1 20 ? -1.901 16.410 0.234   1.00 0.00 ? 37 TPO A HG22 8  
HETATM 5191  H HG23 . TPO A 1 20 ? -0.167 16.018 0.162   1.00 0.00 ? 37 TPO A HG23 8  
ATOM   5192  N N    . PRO A 1 21 ? -0.840 20.910 0.890   1.00 0.00 ? 38 PRO A N    8  
ATOM   5193  C CA   . PRO A 1 21 ? -0.494 22.275 1.270   1.00 0.00 ? 38 PRO A CA   8  
ATOM   5194  C C    . PRO A 1 21 ? 0.729  22.301 2.176   1.00 0.00 ? 38 PRO A C    8  
ATOM   5195  O O    . PRO A 1 21 ? 1.482  23.275 2.191   1.00 0.00 ? 38 PRO A O    8  
ATOM   5196  C CB   . PRO A 1 21 ? -1.749 22.796 1.978   1.00 0.00 ? 38 PRO A CB   8  
ATOM   5197  C CG   . PRO A 1 21 ? -2.865 22.003 1.387   1.00 0.00 ? 38 PRO A CG   8  
ATOM   5198  C CD   . PRO A 1 21 ? -2.295 20.631 1.145   1.00 0.00 ? 38 PRO A CD   8  
ATOM   5199  H HA   . PRO A 1 21 ? -0.221 22.900 0.406   1.00 0.00 ? 38 PRO A HA   8  
ATOM   5200  H HB2  . PRO A 1 21 ? -1.687 22.649 3.066   1.00 0.00 ? 38 PRO A HB2  8  
ATOM   5201  H HB3  . PRO A 1 21 ? -1.891 23.873 1.805   1.00 0.00 ? 38 PRO A HB3  8  
ATOM   5202  H HG2  . PRO A 1 21 ? -3.725 21.959 2.071   1.00 0.00 ? 38 PRO A HG2  8  
ATOM   5203  H HG3  . PRO A 1 21 ? -3.221 22.454 0.449   1.00 0.00 ? 38 PRO A HG3  8  
ATOM   5204  H HD2  . PRO A 1 21 ? -2.425 19.967 2.013   1.00 0.00 ? 38 PRO A HD2  8  
ATOM   5205  H HD3  . PRO A 1 21 ? -2.764 20.131 0.285   1.00 0.00 ? 38 PRO A HD3  8  
ATOM   5206  N N    . GLY A 1 22 ? 0.922  21.227 2.933   1.00 0.00 ? 39 GLY A N    8  
ATOM   5207  C CA   . GLY A 1 22 ? 2.041  21.134 3.863   1.00 0.00 ? 39 GLY A CA   8  
ATOM   5208  C C    . GLY A 1 22 ? 3.372  21.126 3.123   1.00 0.00 ? 39 GLY A C    8  
ATOM   5209  O O    . GLY A 1 22 ? 4.385  21.593 3.642   1.00 0.00 ? 39 GLY A O    8  
ATOM   5210  H H    . GLY A 1 22 ? 0.276  20.453 2.863   1.00 0.00 ? 39 GLY A H    8  
ATOM   5211  H HA2  . GLY A 1 22 ? 2.016  21.989 4.538   1.00 0.00 ? 39 GLY A HA2  8  
ATOM   5212  H HA3  . GLY A 1 22 ? 1.950  20.214 4.440   1.00 0.00 ? 39 GLY A HA3  8  
ATOM   5213  N N    . GLY A 1 23 ? 3.363  20.590 1.906   1.00 0.00 ? 40 GLY A N    8  
ATOM   5214  C CA   . GLY A 1 23 ? 4.559  20.565 1.072   1.00 0.00 ? 40 GLY A CA   8  
ATOM   5215  C C    . GLY A 1 23 ? 5.072  19.143 0.887   1.00 0.00 ? 40 GLY A C    8  
ATOM   5216  O O    . GLY A 1 23 ? 6.201  18.932 0.445   1.00 0.00 ? 40 GLY A O    8  
ATOM   5217  H H    . GLY A 1 23 ? 2.507  20.191 1.551   1.00 0.00 ? 40 GLY A H    8  
ATOM   5218  H HA2  . GLY A 1 23 ? 4.321  20.986 0.095   1.00 0.00 ? 40 GLY A HA2  8  
ATOM   5219  H HA3  . GLY A 1 23 ? 5.337  21.164 1.545   1.00 0.00 ? 40 GLY A HA3  8  
ATOM   5220  N N    . THR A 1 24 ? 4.234  18.169 1.227   1.00 0.00 ? 41 THR A N    8  
ATOM   5221  C CA   . THR A 1 24 ? 4.570  16.764 1.025   1.00 0.00 ? 41 THR A CA   8  
ATOM   5222  C C    . THR A 1 24 ? 3.933  16.223 -0.248  1.00 0.00 ? 41 THR A C    8  
ATOM   5223  O O    . THR A 1 24 ? 2.740  16.407 -0.483  1.00 0.00 ? 41 THR A O    8  
ATOM   5224  C CB   . THR A 1 24 ? 4.122  15.900 2.219   1.00 0.00 ? 41 THR A CB   8  
ATOM   5225  O OG1  . THR A 1 24 ? 4.778  16.349 3.412   1.00 0.00 ? 41 THR A OG1  8  
ATOM   5226  C CG2  . THR A 1 24 ? 4.466  14.438 1.976   1.00 0.00 ? 41 THR A CG2  8  
ATOM   5227  H H    . THR A 1 24 ? 3.342  18.407 1.636   1.00 0.00 ? 41 THR A H    8  
ATOM   5228  H HA   . THR A 1 24 ? 5.648  16.657 0.902   1.00 0.00 ? 41 THR A HA   8  
ATOM   5229  H HB   . THR A 1 24 ? 3.045  16.002 2.346   1.00 0.00 ? 41 THR A HB   8  
ATOM   5230  H HG1  . THR A 1 24 ? 4.337  17.136 3.741   1.00 0.00 ? 41 THR A HG1  8  
ATOM   5231  H HG21 . THR A 1 24 ? 5.543  14.334 1.850   1.00 0.00 ? 41 THR A HG21 8  
ATOM   5232  H HG22 . THR A 1 24 ? 4.142  13.842 2.829   1.00 0.00 ? 41 THR A HG22 8  
ATOM   5233  H HG23 . THR A 1 24 ? 3.959  14.090 1.076   1.00 0.00 ? 41 THR A HG23 8  
ATOM   5234  N N    . LEU A 1 25 ? 4.738  15.554 -1.066  1.00 0.00 ? 42 LEU A N    8  
ATOM   5235  C CA   . LEU A 1 25 ? 4.277  15.061 -2.359  1.00 0.00 ? 42 LEU A CA   8  
ATOM   5236  C C    . LEU A 1 25 ? 3.853  13.601 -2.272  1.00 0.00 ? 42 LEU A C    8  
ATOM   5237  O O    . LEU A 1 25 ? 4.167  12.909 -1.305  1.00 0.00 ? 42 LEU A O    8  
ATOM   5238  C CB   . LEU A 1 25 ? 5.377  15.235 -3.415  1.00 0.00 ? 42 LEU A CB   8  
ATOM   5239  C CG   . LEU A 1 25 ? 5.394  16.595 -4.123  1.00 0.00 ? 42 LEU A CG   8  
ATOM   5240  C CD1  . LEU A 1 25 ? 5.850  17.681 -3.158  1.00 0.00 ? 42 LEU A CD1  8  
ATOM   5241  C CD2  . LEU A 1 25 ? 6.313  16.528 -5.333  1.00 0.00 ? 42 LEU A CD2  8  
ATOM   5242  H H    . LEU A 1 25 ? 5.694  15.383 -0.787  1.00 0.00 ? 42 LEU A H    8  
ATOM   5243  H HA   . LEU A 1 25 ? 3.397  15.622 -2.671  1.00 0.00 ? 42 LEU A HA   8  
ATOM   5244  H HB2  . LEU A 1 25 ? 6.253  15.136 -2.776  1.00 0.00 ? 42 LEU A HB2  8  
ATOM   5245  H HB3  . LEU A 1 25 ? 5.367  14.425 -4.145  1.00 0.00 ? 42 LEU A HB3  8  
ATOM   5246  H HG   . LEU A 1 25 ? 4.382  16.785 -4.483  1.00 0.00 ? 42 LEU A HG   8  
ATOM   5247  H HD11 . LEU A 1 25 ? 5.859  18.643 -3.670  1.00 0.00 ? 42 LEU A HD11 8  
ATOM   5248  H HD12 . LEU A 1 25 ? 5.166  17.727 -2.312  1.00 0.00 ? 42 LEU A HD12 8  
ATOM   5249  H HD13 . LEU A 1 25 ? 6.854  17.451 -2.801  1.00 0.00 ? 42 LEU A HD13 8  
ATOM   5250  H HD21 . LEU A 1 25 ? 5.952  15.766 -6.024  1.00 0.00 ? 42 LEU A HD21 8  
ATOM   5251  H HD22 . LEU A 1 25 ? 6.323  17.496 -5.836  1.00 0.00 ? 42 LEU A HD22 8  
ATOM   5252  H HD23 . LEU A 1 25 ? 7.323  16.275 -5.010  1.00 0.00 ? 42 LEU A HD23 8  
ATOM   5253  N N    . PHE A 1 26 ? 3.134  13.138 -3.290  1.00 0.00 ? 43 PHE A N    8  
ATOM   5254  C CA   . PHE A 1 26 ? 2.757  11.733 -3.386  1.00 0.00 ? 43 PHE A CA   8  
ATOM   5255  C C    . PHE A 1 26 ? 2.265  11.388 -4.785  1.00 0.00 ? 43 PHE A C    8  
ATOM   5256  O O    . PHE A 1 26 ? 1.706  12.234 -5.483  1.00 0.00 ? 43 PHE A O    8  
ATOM   5257  C CB   . PHE A 1 26 ? 1.681  11.397 -2.351  1.00 0.00 ? 43 PHE A CB   8  
ATOM   5258  C CG   . PHE A 1 26 ? 0.409  12.179 -2.524  1.00 0.00 ? 43 PHE A CG   8  
ATOM   5259  C CD1  . PHE A 1 26 ? 0.279  13.449 -1.983  1.00 0.00 ? 43 PHE A CD1  8  
ATOM   5260  C CD2  . PHE A 1 26 ? -0.659 11.645 -3.229  1.00 0.00 ? 43 PHE A CD2  8  
ATOM   5261  C CE1  . PHE A 1 26 ? -0.889 14.168 -2.140  1.00 0.00 ? 43 PHE A CE1  8  
ATOM   5262  C CE2  . PHE A 1 26 ? -1.829 12.363 -3.389  1.00 0.00 ? 43 PHE A CE2  8  
ATOM   5263  C CZ   . PHE A 1 26 ? -1.944 13.625 -2.844  1.00 0.00 ? 43 PHE A CZ   8  
ATOM   5264  H H    . PHE A 1 26 ? 2.842  13.776 -4.016  1.00 0.00 ? 43 PHE A H    8  
ATOM   5265  H HA   . PHE A 1 26 ? 3.628  11.103 -3.199  1.00 0.00 ? 43 PHE A HA   8  
ATOM   5266  H HB2  . PHE A 1 26 ? 1.411  10.344 -2.419  1.00 0.00 ? 43 PHE A HB2  8  
ATOM   5267  H HB3  . PHE A 1 26 ? 2.045  11.614 -1.348  1.00 0.00 ? 43 PHE A HB3  8  
ATOM   5268  H HD1  . PHE A 1 26 ? 1.114  13.879 -1.427  1.00 0.00 ? 43 PHE A HD1  8  
ATOM   5269  H HD2  . PHE A 1 26 ? -0.568 10.647 -3.659  1.00 0.00 ? 43 PHE A HD2  8  
ATOM   5270  H HE1  . PHE A 1 26 ? -0.978 15.165 -1.709  1.00 0.00 ? 43 PHE A HE1  8  
ATOM   5271  H HE2  . PHE A 1 26 ? -2.661 11.932 -3.945  1.00 0.00 ? 43 PHE A HE2  8  
ATOM   5272  H HZ   . PHE A 1 26 ? -2.865 14.191 -2.970  1.00 0.00 ? 43 PHE A HZ   8  
ATOM   5273  N N    . SER A 1 27 ? 2.475  10.140 -5.190  1.00 0.00 ? 44 SER A N    8  
ATOM   5274  C CA   . SER A 1 27 ? 1.942  9.644  -6.452  1.00 0.00 ? 44 SER A CA   8  
ATOM   5275  C C    . SER A 1 27 ? 1.785  8.129  -6.427  1.00 0.00 ? 44 SER A C    8  
ATOM   5276  O O    . SER A 1 27 ? 2.558  7.426  -5.778  1.00 0.00 ? 44 SER A O    8  
ATOM   5277  C CB   . SER A 1 27 ? 2.841  10.063 -7.600  1.00 0.00 ? 44 SER A CB   8  
ATOM   5278  O OG   . SER A 1 27 ? 2.362  9.609  -8.837  1.00 0.00 ? 44 SER A OG   8  
ATOM   5279  H H    . SER A 1 27 ? 3.019  9.519  -4.607  1.00 0.00 ? 44 SER A H    8  
ATOM   5280  H HA   . SER A 1 27 ? 0.998  10.111 -6.737  1.00 0.00 ? 44 SER A HA   8  
ATOM   5281  H HB2  . SER A 1 27 ? 2.898  11.151 -7.618  1.00 0.00 ? 44 SER A HB2  8  
ATOM   5282  H HB3  . SER A 1 27 ? 3.835  9.651  -7.432  1.00 0.00 ? 44 SER A HB3  8  
ATOM   5283  H HG   . SER A 1 27 ? 2.394  10.328 -9.473  1.00 0.00 ? 44 SER A HG   8  
ATOM   5284  N N    . THR A 1 28 ? 0.777  7.633  -7.138  1.00 0.00 ? 45 THR A N    8  
ATOM   5285  C CA   . THR A 1 28 ? 0.514  6.199  -7.193  1.00 0.00 ? 45 THR A CA   8  
ATOM   5286  C C    . THR A 1 28 ? 0.819  5.637  -8.576  1.00 0.00 ? 45 THR A C    8  
ATOM   5287  O O    . THR A 1 28 ? 0.318  6.134  -9.584  1.00 0.00 ? 45 THR A O    8  
ATOM   5288  C CB   . THR A 1 28 ? -0.949 5.880  -6.833  1.00 0.00 ? 45 THR A CB   8  
ATOM   5289  O OG1  . THR A 1 28 ? -1.233 6.360  -5.513  1.00 0.00 ? 45 THR A OG1  8  
ATOM   5290  C CG2  . THR A 1 28 ? -1.197 4.380  -6.887  1.00 0.00 ? 45 THR A CG2  8  
ATOM   5291  H H    . THR A 1 28 ? 0.180  8.263  -7.652  1.00 0.00 ? 45 THR A H    8  
ATOM   5292  H HA   . THR A 1 28 ? 1.168  5.676  -6.496  1.00 0.00 ? 45 THR A HA   8  
ATOM   5293  H HB   . THR A 1 28 ? -1.607 6.382  -7.542  1.00 0.00 ? 45 THR A HB   8  
ATOM   5294  H HG1  . THR A 1 28 ? -1.100 7.311  -5.482  1.00 0.00 ? 45 THR A HG1  8  
ATOM   5295  H HG21 . THR A 1 28 ? -0.540 3.878  -6.177  1.00 0.00 ? 45 THR A HG21 8  
ATOM   5296  H HG22 . THR A 1 28 ? -2.234 4.174  -6.629  1.00 0.00 ? 45 THR A HG22 8  
ATOM   5297  H HG23 . THR A 1 28 ? -0.992 4.015  -7.893  1.00 0.00 ? 45 THR A HG23 8  
HETATM 5298  N N    . TPO A 1 29 ? 1.646  4.597  -8.616  1.00 0.00 ? 46 TPO A N    8  
HETATM 5299  C CA   . TPO A 1 29 ? 2.078  4.009  -9.879  1.00 0.00 ? 46 TPO A CA   8  
HETATM 5300  C CB   . TPO A 1 29 ? 3.453  3.331  -9.746  1.00 0.00 ? 46 TPO A CB   8  
HETATM 5301  C CG2  . TPO A 1 29 ? 4.447  4.267  -9.075  1.00 0.00 ? 46 TPO A CG2  8  
HETATM 5302  O OG1  . TPO A 1 29 ? 3.326  2.136  -8.964  1.00 0.00 ? 46 TPO A OG1  8  
HETATM 5303  P P    . TPO A 1 29 ? 4.388  0.933  -9.127  1.00 0.00 ? 46 TPO A P    8  
HETATM 5304  O O1P  . TPO A 1 29 ? 3.963  -0.192 -8.148  1.00 0.00 ? 46 TPO A O1P  8  
HETATM 5305  O O2P  . TPO A 1 29 ? 5.786  1.500  -8.771  1.00 0.00 ? 46 TPO A O2P  8  
HETATM 5306  O O3P  . TPO A 1 29 ? 4.324  0.458  -10.603 1.00 0.00 ? 46 TPO A O3P  8  
HETATM 5307  C C    . TPO A 1 29 ? 1.066  2.989  -10.386 1.00 0.00 ? 46 TPO A C    8  
HETATM 5308  O O    . TPO A 1 29 ? 0.196  2.539  -9.641  1.00 0.00 ? 46 TPO A O    8  
HETATM 5309  H H    . TPO A 1 29 ? 1.983  4.203  -7.750  1.00 0.00 ? 46 TPO A H    8  
HETATM 5310  H HA   . TPO A 1 29 ? 2.143  4.785  -10.643 1.00 0.00 ? 46 TPO A HA   8  
HETATM 5311  H HB   . TPO A 1 29 ? 3.816  3.068  -10.739 1.00 0.00 ? 46 TPO A HB   8  
HETATM 5312  H HG21 . TPO A 1 29 ? 5.413  3.771  -8.990  1.00 0.00 ? 46 TPO A HG21 8  
HETATM 5313  H HG22 . TPO A 1 29 ? 4.555  5.173  -9.673  1.00 0.00 ? 46 TPO A HG22 8  
HETATM 5314  H HG23 . TPO A 1 29 ? 4.085  4.530  -8.081  1.00 0.00 ? 46 TPO A HG23 8  
ATOM   5315  N N    . PRO A 1 30 ? 1.186  2.627  -11.658 1.00 0.00 ? 47 PRO A N    8  
ATOM   5316  C CA   . PRO A 1 30 ? 0.235  1.722  -12.291 1.00 0.00 ? 47 PRO A CA   8  
ATOM   5317  C C    . PRO A 1 30 ? 0.135  0.407  -11.527 1.00 0.00 ? 47 PRO A C    8  
ATOM   5318  O O    . PRO A 1 30 ? -0.913 -0.240 -11.520 1.00 0.00 ? 47 PRO A O    8  
ATOM   5319  C CB   . PRO A 1 30 ? 0.788  1.526  -13.706 1.00 0.00 ? 47 PRO A CB   8  
ATOM   5320  C CG   . PRO A 1 30 ? 1.544  2.779  -13.986 1.00 0.00 ? 47 PRO A CG   8  
ATOM   5321  C CD   . PRO A 1 30 ? 2.161  3.175  -12.671 1.00 0.00 ? 47 PRO A CD   8  
ATOM   5322  H HA   . PRO A 1 30 ? -0.790 2.121  -12.302 1.00 0.00 ? 47 PRO A HA   8  
ATOM   5323  H HB2  . PRO A 1 30 ? 1.442  0.644  -13.765 1.00 0.00 ? 47 PRO A HB2  8  
ATOM   5324  H HB3  . PRO A 1 30 ? -0.021 1.377  -14.438 1.00 0.00 ? 47 PRO A HB3  8  
ATOM   5325  H HG2  . PRO A 1 30 ? 2.316  2.615  -14.752 1.00 0.00 ? 47 PRO A HG2  8  
ATOM   5326  H HG3  . PRO A 1 30 ? 0.878  3.569  -14.364 1.00 0.00 ? 47 PRO A HG3  8  
ATOM   5327  H HD2  . PRO A 1 30 ? 3.162  2.741  -12.534 1.00 0.00 ? 47 PRO A HD2  8  
ATOM   5328  H HD3  . PRO A 1 30 ? 2.267  4.266  -12.573 1.00 0.00 ? 47 PRO A HD3  8  
ATOM   5329  N N    . GLY A 1 31 ? 1.230  0.017  -10.886 1.00 0.00 ? 48 GLY A N    8  
ATOM   5330  C CA   . GLY A 1 31 ? 1.269  -1.223 -10.119 1.00 0.00 ? 48 GLY A CA   8  
ATOM   5331  C C    . GLY A 1 31 ? 0.324  -1.161 -8.925  1.00 0.00 ? 48 GLY A C    8  
ATOM   5332  O O    . GLY A 1 31 ? -0.162 -2.189 -8.453  1.00 0.00 ? 48 GLY A O    8  
ATOM   5333  H H    . GLY A 1 31 ? 2.059  0.593  -10.930 1.00 0.00 ? 48 GLY A H    8  
ATOM   5334  H HA2  . GLY A 1 31 ? 0.973  -2.051 -10.764 1.00 0.00 ? 48 GLY A HA2  8  
ATOM   5335  H HA3  . GLY A 1 31 ? 2.284  -1.389 -9.759  1.00 0.00 ? 48 GLY A HA3  8  
ATOM   5336  N N    . GLY A 1 32 ? 0.067  0.050  -8.442  1.00 0.00 ? 49 GLY A N    8  
ATOM   5337  C CA   . GLY A 1 32 ? -0.870 0.254  -7.344  1.00 0.00 ? 49 GLY A CA   8  
ATOM   5338  C C    . GLY A 1 32 ? -0.143 0.655  -6.067  1.00 0.00 ? 49 GLY A C    8  
ATOM   5339  O O    . GLY A 1 32 ? -0.738 0.698  -4.990  1.00 0.00 ? 49 GLY A O    8  
ATOM   5340  H H    . GLY A 1 32 ? 0.533  0.849  -8.846  1.00 0.00 ? 49 GLY A H    8  
ATOM   5341  H HA2  . GLY A 1 32 ? -1.572 1.041  -7.617  1.00 0.00 ? 49 GLY A HA2  8  
ATOM   5342  H HA3  . GLY A 1 32 ? -1.416 -0.672 -7.165  1.00 0.00 ? 49 GLY A HA3  8  
ATOM   5343  N N    . THR A 1 33 ? 1.146  0.950  -6.194  1.00 0.00 ? 50 THR A N    8  
ATOM   5344  C CA   . THR A 1 33 ? 1.957  1.350  -5.050  1.00 0.00 ? 50 THR A CA   8  
ATOM   5345  C C    . THR A 1 33 ? 1.878  2.853  -4.817  1.00 0.00 ? 50 THR A C    8  
ATOM   5346  O O    . THR A 1 33 ? 2.146  3.645  -5.719  1.00 0.00 ? 50 THR A O    8  
ATOM   5347  C CB   . THR A 1 33 ? 3.431  0.946  -5.234  1.00 0.00 ? 50 THR A CB   8  
ATOM   5348  O OG1  . THR A 1 33 ? 3.527  -0.479 -5.360  1.00 0.00 ? 50 THR A OG1  8  
ATOM   5349  C CG2  . THR A 1 33 ? 4.261  1.404  -4.044  1.00 0.00 ? 50 THR A CG2  8  
ATOM   5350  H H    . THR A 1 33 ? 1.576  0.897  -7.106  1.00 0.00 ? 50 THR A H    8  
ATOM   5351  H HA   . THR A 1 33 ? 1.576  0.877  -4.144  1.00 0.00 ? 50 THR A HA   8  
ATOM   5352  H HB   . THR A 1 33 ? 3.815  1.409  -6.142  1.00 0.00 ? 50 THR A HB   8  
ATOM   5353  H HG1  . THR A 1 33 ? 3.687  -0.708 -6.279  1.00 0.00 ? 50 THR A HG1  8  
ATOM   5354  H HG21 . THR A 1 33 ? 3.879  0.940  -3.136  1.00 0.00 ? 50 THR A HG21 8  
ATOM   5355  H HG22 . THR A 1 33 ? 5.301  1.109  -4.193  1.00 0.00 ? 50 THR A HG22 8  
ATOM   5356  H HG23 . THR A 1 33 ? 4.200  2.487  -3.952  1.00 0.00 ? 50 THR A HG23 8  
ATOM   5357  N N    . ARG A 1 34 ? 1.506  3.239  -3.600  1.00 0.00 ? 51 ARG A N    8  
ATOM   5358  C CA   . ARG A 1 34 ? 1.433  4.649  -3.234  1.00 0.00 ? 51 ARG A CA   8  
ATOM   5359  C C    . ARG A 1 34 ? 2.759  5.141  -2.669  1.00 0.00 ? 51 ARG A C    8  
ATOM   5360  O O    . ARG A 1 34 ? 3.157  4.756  -1.570  1.00 0.00 ? 51 ARG A O    8  
ATOM   5361  C CB   . ARG A 1 34 ? 0.281  4.933  -2.281  1.00 0.00 ? 51 ARG A CB   8  
ATOM   5362  C CG   . ARG A 1 34 ? -1.072 4.412  -2.739  1.00 0.00 ? 51 ARG A CG   8  
ATOM   5363  C CD   . ARG A 1 34 ? -2.202 4.777  -1.848  1.00 0.00 ? 51 ARG A CD   8  
ATOM   5364  N NE   . ARG A 1 34 ? -2.227 4.062  -0.581  1.00 0.00 ? 51 ARG A NE   8  
ATOM   5365  C CZ   . ARG A 1 34 ? -3.058 4.344  0.441   1.00 0.00 ? 51 ARG A CZ   8  
ATOM   5366  N NH1  . ARG A 1 34 ? -3.906 5.346  0.367   1.00 0.00 ? 51 ARG A NH1  8  
ATOM   5367  N NH2  . ARG A 1 34 ? -2.981 3.601  1.531   1.00 0.00 ? 51 ARG A NH2  8  
ATOM   5368  H H    . ARG A 1 34 ? 1.270  2.538  -2.912  1.00 0.00 ? 51 ARG A H    8  
ATOM   5369  H HA   . ARG A 1 34 ? 1.230  5.250  -4.120  1.00 0.00 ? 51 ARG A HA   8  
ATOM   5370  H HB2  . ARG A 1 34 ? 0.537  4.477  -1.326  1.00 0.00 ? 51 ARG A HB2  8  
ATOM   5371  H HB3  . ARG A 1 34 ? 0.227  6.016  -2.163  1.00 0.00 ? 51 ARG A HB3  8  
ATOM   5372  H HG2  . ARG A 1 34 ? -1.282 4.817  -3.730  1.00 0.00 ? 51 ARG A HG2  8  
ATOM   5373  H HG3  . ARG A 1 34 ? -1.024 3.325  -2.793  1.00 0.00 ? 51 ARG A HG3  8  
ATOM   5374  H HD2  . ARG A 1 34 ? -2.145 5.841  -1.620  1.00 0.00 ? 51 ARG A HD2  8  
ATOM   5375  H HD3  . ARG A 1 34 ? -3.141 4.567  -2.360  1.00 0.00 ? 51 ARG A HD3  8  
ATOM   5376  H HE   . ARG A 1 34 ? -1.662 3.282  -0.271  1.00 0.00 ? 51 ARG A HE   8  
ATOM   5377  H HH11 . ARG A 1 34 ? -3.941 5.915  -0.466  1.00 0.00 ? 51 ARG A HH11 8  
ATOM   5378  H HH12 . ARG A 1 34 ? -4.521 5.540  1.144   1.00 0.00 ? 51 ARG A HH12 8  
ATOM   5379  H HH21 . ARG A 1 34 ? -2.310 2.846  1.578   1.00 0.00 ? 51 ARG A HH21 8  
ATOM   5380  H HH22 . ARG A 1 34 ? -3.591 3.791  2.312   1.00 0.00 ? 51 ARG A HH22 8  
ATOM   5381  N N    . ILE A 1 35 ? 3.438  5.995  -3.427  1.00 0.00 ? 52 ILE A N    8  
ATOM   5382  C CA   . ILE A 1 35 ? 4.745  6.504  -3.027  1.00 0.00 ? 52 ILE A CA   8  
ATOM   5383  C C    . ILE A 1 35 ? 4.643  7.927  -2.496  1.00 0.00 ? 52 ILE A C    8  
ATOM   5384  O O    . ILE A 1 35 ? 4.215  8.836  -3.208  1.00 0.00 ? 52 ILE A O    8  
ATOM   5385  C CB   . ILE A 1 35 ? 5.746  6.471  -4.196  1.00 0.00 ? 52 ILE A CB   8  
ATOM   5386  C CG1  . ILE A 1 35 ? 5.908  5.041  -4.720  1.00 0.00 ? 52 ILE A CG1  8  
ATOM   5387  C CG2  . ILE A 1 35 ? 7.089  7.038  -3.763  1.00 0.00 ? 52 ILE A CG2  8  
ATOM   5388  C CD1  . ILE A 1 35 ? 6.701  4.949  -6.004  1.00 0.00 ? 52 ILE A CD1  8  
ATOM   5389  H H    . ILE A 1 35 ? 3.039  6.301  -4.303  1.00 0.00 ? 52 ILE A H    8  
ATOM   5390  H HA   . ILE A 1 35 ? 5.142  5.925  -2.193  1.00 0.00 ? 52 ILE A HA   8  
ATOM   5391  H HB   . ILE A 1 35 ? 5.349  7.064  -5.019  1.00 0.00 ? 52 ILE A HB   8  
ATOM   5392  H HG12 . ILE A 1 35 ? 6.408  4.466  -3.942  1.00 0.00 ? 52 ILE A HG12 8  
ATOM   5393  H HG13 . ILE A 1 35 ? 4.908  4.641  -4.882  1.00 0.00 ? 52 ILE A HG13 8  
ATOM   5394  H HG21 . ILE A 1 35 ? 7.785  7.008  -4.600  1.00 0.00 ? 52 ILE A HG21 8  
ATOM   5395  H HG22 . ILE A 1 35 ? 6.960  8.070  -3.436  1.00 0.00 ? 52 ILE A HG22 8  
ATOM   5396  H HG23 . ILE A 1 35 ? 7.486  6.444  -2.939  1.00 0.00 ? 52 ILE A HG23 8  
ATOM   5397  H HD11 . ILE A 1 35 ? 7.702  5.349  -5.844  1.00 0.00 ? 52 ILE A HD11 8  
ATOM   5398  H HD12 . ILE A 1 35 ? 6.774  3.905  -6.314  1.00 0.00 ? 52 ILE A HD12 8  
ATOM   5399  H HD13 . ILE A 1 35 ? 6.201  5.524  -6.784  1.00 0.00 ? 52 ILE A HD13 8  
ATOM   5400  N N    . ILE A 1 36 ? 5.040  8.116  -1.242  1.00 0.00 ? 53 ILE A N    8  
ATOM   5401  C CA   . ILE A 1 36 ? 5.083  9.445  -0.644  1.00 0.00 ? 53 ILE A CA   8  
ATOM   5402  C C    . ILE A 1 36 ? 6.456  10.082 -0.815  1.00 0.00 ? 53 ILE A C    8  
ATOM   5403  O O    . ILE A 1 36 ? 7.477  9.476  -0.491  1.00 0.00 ? 53 ILE A O    8  
ATOM   5404  C CB   . ILE A 1 36 ? 4.730  9.401  0.855   1.00 0.00 ? 53 ILE A CB   8  
ATOM   5405  C CG1  . ILE A 1 36 ? 3.309  8.871  1.053   1.00 0.00 ? 53 ILE A CG1  8  
ATOM   5406  C CG2  . ILE A 1 36 ? 4.878  10.782 1.476   1.00 0.00 ? 53 ILE A CG2  8  
ATOM   5407  C CD1  . ILE A 1 36 ? 2.967  8.563  2.493   1.00 0.00 ? 53 ILE A CD1  8  
ATOM   5408  H H    . ILE A 1 36 ? 5.319  7.319  -0.689  1.00 0.00 ? 53 ILE A H    8  
ATOM   5409  H HA   . ILE A 1 36 ? 4.400  10.120 -1.158  1.00 0.00 ? 53 ILE A HA   8  
ATOM   5410  H HB   . ILE A 1 36 ? 5.399  8.703  1.357   1.00 0.00 ? 53 ILE A HB   8  
ATOM   5411  H HG12 . ILE A 1 36 ? 2.624  9.627  0.670   1.00 0.00 ? 53 ILE A HG12 8  
ATOM   5412  H HG13 . ILE A 1 36 ? 3.215  7.963  0.456   1.00 0.00 ? 53 ILE A HG13 8  
ATOM   5413  H HG21 . ILE A 1 36 ? 4.625  10.733 2.535   1.00 0.00 ? 53 ILE A HG21 8  
ATOM   5414  H HG22 . ILE A 1 36 ? 5.907  11.123 1.364   1.00 0.00 ? 53 ILE A HG22 8  
ATOM   5415  H HG23 . ILE A 1 36 ? 4.209  11.481 0.974   1.00 0.00 ? 53 ILE A HG23 8  
ATOM   5416  H HD11 . ILE A 1 36 ? 3.058  9.469  3.091   1.00 0.00 ? 53 ILE A HD11 8  
ATOM   5417  H HD12 . ILE A 1 36 ? 1.944  8.192  2.554   1.00 0.00 ? 53 ILE A HD12 8  
ATOM   5418  H HD13 . ILE A 1 36 ? 3.651  7.805  2.876   1.00 0.00 ? 53 ILE A HD13 8  
ATOM   5419  N N    . TYR A 1 37 ? 6.474  11.308 -1.325  1.00 0.00 ? 54 TYR A N    8  
ATOM   5420  C CA   . TYR A 1 37 ? 7.722  11.971 -1.682  1.00 0.00 ? 54 TYR A CA   8  
ATOM   5421  C C    . TYR A 1 37 ? 8.051  13.092 -0.705  1.00 0.00 ? 54 TYR A C    8  
ATOM   5422  O O    . TYR A 1 37 ? 7.351  14.105 -0.649  1.00 0.00 ? 54 TYR A O    8  
ATOM   5423  C CB   . TYR A 1 37 ? 7.646  12.524 -3.108  1.00 0.00 ? 54 TYR A CB   8  
ATOM   5424  C CG   . TYR A 1 37 ? 7.505  11.458 -4.171  1.00 0.00 ? 54 TYR A CG   8  
ATOM   5425  C CD1  . TYR A 1 37 ? 8.619  10.799 -4.670  1.00 0.00 ? 54 TYR A CD1  8  
ATOM   5426  C CD2  . TYR A 1 37 ? 6.259  11.114 -4.675  1.00 0.00 ? 54 TYR A CD2  8  
ATOM   5427  C CE1  . TYR A 1 37 ? 8.496  9.825  -5.642  1.00 0.00 ? 54 TYR A CE1  8  
ATOM   5428  C CE2  . TYR A 1 37 ? 6.124  10.141 -5.647  1.00 0.00 ? 54 TYR A CE2  8  
ATOM   5429  C CZ   . TYR A 1 37 ? 7.247  9.499  -6.128  1.00 0.00 ? 54 TYR A CZ   8  
ATOM   5430  O OH   . TYR A 1 37 ? 7.119  8.529  -7.096  1.00 0.00 ? 54 TYR A OH   8  
ATOM   5431  H H    . TYR A 1 37 ? 5.600  11.794 -1.469  1.00 0.00 ? 54 TYR A H    8  
ATOM   5432  H HA   . TYR A 1 37 ? 8.547  11.261 -1.628  1.00 0.00 ? 54 TYR A HA   8  
ATOM   5433  H HB2  . TYR A 1 37 ? 6.787  13.195 -3.149  1.00 0.00 ? 54 TYR A HB2  8  
ATOM   5434  H HB3  . TYR A 1 37 ? 8.559  13.092 -3.282  1.00 0.00 ? 54 TYR A HB3  8  
ATOM   5435  H HD1  . TYR A 1 37 ? 9.603  11.061 -4.282  1.00 0.00 ? 54 TYR A HD1  8  
ATOM   5436  H HD2  . TYR A 1 37 ? 5.377  11.626 -4.290  1.00 0.00 ? 54 TYR A HD2  8  
ATOM   5437  H HE1  . TYR A 1 37 ? 9.384  9.318  -6.020  1.00 0.00 ? 54 TYR A HE1  8  
ATOM   5438  H HE2  . TYR A 1 37 ? 5.139  9.881  -6.033  1.00 0.00 ? 54 TYR A HE2  8  
ATOM   5439  H HH   . TYR A 1 37 ? 7.960  8.148  -7.360  1.00 0.00 ? 54 TYR A HH   8  
ATOM   5440  N N    . ASP A 1 38 ? 9.118  12.907 0.064   1.00 0.00 ? 55 ASP A N    8  
ATOM   5441  C CA   . ASP A 1 38 ? 9.532  13.895 1.053   1.00 0.00 ? 55 ASP A CA   8  
ATOM   5442  C C    . ASP A 1 38 ? 10.654 14.774 0.516   1.00 0.00 ? 55 ASP A C    8  
ATOM   5443  O O    . ASP A 1 38 ? 11.783 14.316 0.336   1.00 0.00 ? 55 ASP A O    8  
ATOM   5444  C CB   . ASP A 1 38 ? 9.976  13.207 2.347   1.00 0.00 ? 55 ASP A CB   8  
ATOM   5445  C CG   . ASP A 1 38 ? 10.406 14.163 3.451   1.00 0.00 ? 55 ASP A CG   8  
ATOM   5446  O OD1  . ASP A 1 38 ? 10.416 15.347 3.215   1.00 0.00 ? 55 ASP A OD1  8  
ATOM   5447  O OD2  . ASP A 1 38 ? 10.569 13.719 4.563   1.00 0.00 ? 55 ASP A OD2  8  
ATOM   5448  H H    . ASP A 1 38 ? 9.657  12.058 -0.038  1.00 0.00 ? 55 ASP A H    8  
ATOM   5449  H HA   . ASP A 1 38 ? 8.698  14.561 1.281   1.00 0.00 ? 55 ASP A HA   8  
ATOM   5450  H HB2  . ASP A 1 38 ? 9.240  12.505 2.740   1.00 0.00 ? 55 ASP A HB2  8  
ATOM   5451  H HB3  . ASP A 1 38 ? 10.845 12.658 1.982   1.00 0.00 ? 55 ASP A HB3  8  
ATOM   5452  N N    . ARG A 1 39 ? 10.338 16.039 0.262   1.00 0.00 ? 56 ARG A N    8  
ATOM   5453  C CA   . ARG A 1 39 ? 11.318 16.985 -0.257  1.00 0.00 ? 56 ARG A CA   8  
ATOM   5454  C C    . ARG A 1 39 ? 12.181 17.554 0.861   1.00 0.00 ? 56 ARG A C    8  
ATOM   5455  O O    . ARG A 1 39 ? 11.681 18.225 1.764   1.00 0.00 ? 56 ARG A O    8  
ATOM   5456  C CB   . ARG A 1 39 ? 10.671 18.090 -1.079  1.00 0.00 ? 56 ARG A CB   8  
ATOM   5457  C CG   . ARG A 1 39 ? 11.647 19.023 -1.779  1.00 0.00 ? 56 ARG A CG   8  
ATOM   5458  C CD   . ARG A 1 39 ? 11.006 20.033 -2.657  1.00 0.00 ? 56 ARG A CD   8  
ATOM   5459  N NE   . ARG A 1 39 ? 11.939 20.865 -3.401  1.00 0.00 ? 56 ARG A NE   8  
ATOM   5460  C CZ   . ARG A 1 39 ? 11.611 22.014 -4.022  1.00 0.00 ? 56 ARG A CZ   8  
ATOM   5461  N NH1  . ARG A 1 39 ? 10.373 22.454 -4.025  1.00 0.00 ? 56 ARG A NH1  8  
ATOM   5462  N NH2  . ARG A 1 39 ? 12.567 22.678 -4.651  1.00 0.00 ? 56 ARG A NH2  8  
ATOM   5463  H H    . ARG A 1 39 ? 9.393  16.354 0.433   1.00 0.00 ? 56 ARG A H    8  
ATOM   5464  H HA   . ARG A 1 39 ? 11.996 16.475 -0.943  1.00 0.00 ? 56 ARG A HA   8  
ATOM   5465  H HB2  . ARG A 1 39 ? 10.040 17.606 -1.823  1.00 0.00 ? 56 ARG A HB2  8  
ATOM   5466  H HB3  . ARG A 1 39 ? 10.049 18.669 -0.397  1.00 0.00 ? 56 ARG A HB3  8  
ATOM   5467  H HG2  . ARG A 1 39 ? 12.224 19.554 -1.021  1.00 0.00 ? 56 ARG A HG2  8  
ATOM   5468  H HG3  . ARG A 1 39 ? 12.320 18.423 -2.392  1.00 0.00 ? 56 ARG A HG3  8  
ATOM   5469  H HD2  . ARG A 1 39 ? 10.374 19.522 -3.383  1.00 0.00 ? 56 ARG A HD2  8  
ATOM   5470  H HD3  . ARG A 1 39 ? 10.393 20.696 -2.046  1.00 0.00 ? 56 ARG A HD3  8  
ATOM   5471  H HE   . ARG A 1 39 ? 12.928 20.733 -3.568  1.00 0.00 ? 56 ARG A HE   8  
ATOM   5472  H HH11 . ARG A 1 39 ? 9.651  21.926 -3.556  1.00 0.00 ? 56 ARG A HH11 8  
ATOM   5473  H HH12 . ARG A 1 39 ? 10.147 23.318 -4.497  1.00 0.00 ? 56 ARG A HH12 8  
ATOM   5474  H HH21 . ARG A 1 39 ? 13.511 22.317 -4.654  1.00 0.00 ? 56 ARG A HH21 8  
ATOM   5475  H HH22 . ARG A 1 39 ? 12.349 23.541 -5.125  1.00 0.00 ? 56 ARG A HH22 8  
ATOM   5476  N N    . LYS A 1 40 ? 13.480 17.282 0.796   1.00 0.00 ? 57 LYS A N    8  
ATOM   5477  C CA   . LYS A 1 40 ? 14.408 17.716 1.834   1.00 0.00 ? 57 LYS A CA   8  
ATOM   5478  C C    . LYS A 1 40 ? 14.551 19.233 1.844   1.00 0.00 ? 57 LYS A C    8  
ATOM   5479  O O    . LYS A 1 40 ? 14.784 19.838 2.891   1.00 0.00 ? 57 LYS A O    8  
ATOM   5480  C CB   . LYS A 1 40 ? 15.775 17.059 1.641   1.00 0.00 ? 57 LYS A CB   8  
ATOM   5481  C CG   . LYS A 1 40 ? 15.805 15.569 1.945   1.00 0.00 ? 57 LYS A CG   8  
ATOM   5482  C CD   . LYS A 1 40 ? 17.202 14.994 1.761   1.00 0.00 ? 57 LYS A CD   8  
ATOM   5483  C CE   . LYS A 1 40 ? 17.245 13.516 2.118   1.00 0.00 ? 57 LYS A CE   8  
ATOM   5484  N NZ   . LYS A 1 40 ? 18.609 12.943 1.954   1.00 0.00 ? 57 LYS A NZ   8  
ATOM   5485  H H    . LYS A 1 40 ? 13.835 16.760 0.007   1.00 0.00 ? 57 LYS A H    8  
ATOM   5486  H HA   . LYS A 1 40 ? 14.022 17.435 2.815   1.00 0.00 ? 57 LYS A HA   8  
ATOM   5487  H HB2  . LYS A 1 40 ? 16.064 17.224 0.602   1.00 0.00 ? 57 LYS A HB2  8  
ATOM   5488  H HB3  . LYS A 1 40 ? 16.475 17.577 2.297   1.00 0.00 ? 57 LYS A HB3  8  
ATOM   5489  H HG2  . LYS A 1 40 ? 15.483 15.419 2.976   1.00 0.00 ? 57 LYS A HG2  8  
ATOM   5490  H HG3  . LYS A 1 40 ? 15.113 15.063 1.272   1.00 0.00 ? 57 LYS A HG3  8  
ATOM   5491  H HD2  . LYS A 1 40 ? 17.497 15.125 0.719   1.00 0.00 ? 57 LYS A HD2  8  
ATOM   5492  H HD3  . LYS A 1 40 ? 17.890 15.542 2.404   1.00 0.00 ? 57 LYS A HD3  8  
ATOM   5493  H HE2  . LYS A 1 40 ? 16.927 13.404 3.154   1.00 0.00 ? 57 LYS A HE2  8  
ATOM   5494  H HE3  . LYS A 1 40 ? 16.549 12.986 1.467   1.00 0.00 ? 57 LYS A HE3  8  
ATOM   5495  H HZ1  . LYS A 1 40 ? 19.254 13.432 2.558   1.00 0.00 ? 57 LYS A HZ1  8  
ATOM   5496  H HZ2  . LYS A 1 40 ? 18.594 11.963 2.200   1.00 0.00 ? 57 LYS A HZ2  8  
ATOM   5497  H HZ3  . LYS A 1 40 ? 18.905 13.044 0.993   1.00 0.00 ? 57 LYS A HZ3  8  
ATOM   5498  N N    . PHE A 1 41 ? 14.411 19.843 0.672   1.00 0.00 ? 58 PHE A N    8  
ATOM   5499  C CA   . PHE A 1 41 ? 14.483 21.294 0.549   1.00 0.00 ? 58 PHE A CA   8  
ATOM   5500  C C    . PHE A 1 41 ? 13.476 21.974 1.469   1.00 0.00 ? 58 PHE A C    8  
ATOM   5501  O O    . PHE A 1 41 ? 13.802 22.942 2.156   1.00 0.00 ? 58 PHE A O    8  
ATOM   5502  C CB   . PHE A 1 41 ? 14.245 21.721 -0.900  1.00 0.00 ? 58 PHE A CB   8  
ATOM   5503  C CG   . PHE A 1 41 ? 14.195 23.211 -1.093  1.00 0.00 ? 58 PHE A CG   8  
ATOM   5504  C CD1  . PHE A 1 41 ? 15.365 23.950 -1.188  1.00 0.00 ? 58 PHE A CD1  8  
ATOM   5505  C CD2  . PHE A 1 41 ? 12.981 23.874 -1.177  1.00 0.00 ? 58 PHE A CD2  8  
ATOM   5506  C CE1  . PHE A 1 41 ? 15.320 25.320 -1.366  1.00 0.00 ? 58 PHE A CE1  8  
ATOM   5507  C CE2  . PHE A 1 41 ? 12.934 25.243 -1.355  1.00 0.00 ? 58 PHE A CE2  8  
ATOM   5508  C CZ   . PHE A 1 41 ? 14.106 25.967 -1.450  1.00 0.00 ? 58 PHE A CZ   8  
ATOM   5509  H H    . PHE A 1 41 ? 14.251 19.287 -0.156  1.00 0.00 ? 58 PHE A H    8  
ATOM   5510  H HA   . PHE A 1 41 ? 15.470 21.644 0.858   1.00 0.00 ? 58 PHE A HA   8  
ATOM   5511  H HB2  . PHE A 1 41 ? 15.047 21.351 -1.536  1.00 0.00 ? 58 PHE A HB2  8  
ATOM   5512  H HB3  . PHE A 1 41 ? 13.291 21.330 -1.253  1.00 0.00 ? 58 PHE A HB3  8  
ATOM   5513  H HD1  . PHE A 1 41 ? 16.326 23.439 -1.124  1.00 0.00 ? 58 PHE A HD1  8  
ATOM   5514  H HD2  . PHE A 1 41 ? 12.055 23.302 -1.103  1.00 0.00 ? 58 PHE A HD2  8  
ATOM   5515  H HE1  . PHE A 1 41 ? 16.247 25.890 -1.440  1.00 0.00 ? 58 PHE A HE1  8  
ATOM   5516  H HE2  . PHE A 1 41 ? 11.973 25.752 -1.422  1.00 0.00 ? 58 PHE A HE2  8  
ATOM   5517  H HZ   . PHE A 1 41 ? 14.070 27.046 -1.588  1.00 0.00 ? 58 PHE A HZ   8  
ATOM   5518  N N    . LEU A 1 42 ? 12.250 21.462 1.476   1.00 0.00 ? 59 LEU A N    8  
ATOM   5519  C CA   . LEU A 1 42 ? 11.180 22.049 2.276   1.00 0.00 ? 59 LEU A CA   8  
ATOM   5520  C C    . LEU A 1 42 ? 11.322 21.676 3.746   1.00 0.00 ? 59 LEU A C    8  
ATOM   5521  O O    . LEU A 1 42 ? 11.932 20.661 4.082   1.00 0.00 ? 59 LEU A O    8  
ATOM   5522  C CB   . LEU A 1 42 ? 9.814  21.601 1.741   1.00 0.00 ? 59 LEU A CB   8  
ATOM   5523  C CG   . LEU A 1 42 ? 9.492  22.053 0.311   1.00 0.00 ? 59 LEU A CG   8  
ATOM   5524  C CD1  . LEU A 1 42 ? 8.179  21.434 -0.149  1.00 0.00 ? 59 LEU A CD1  8  
ATOM   5525  C CD2  . LEU A 1 42 ? 9.420  23.571 0.260   1.00 0.00 ? 59 LEU A CD2  8  
ATOM   5526  H H    . LEU A 1 42 ? 12.054 20.646 0.914   1.00 0.00 ? 59 LEU A H    8  
ATOM   5527  H HA   . LEU A 1 42 ? 11.241 23.136 2.225   1.00 0.00 ? 59 LEU A HA   8  
ATOM   5528  H HB2  . LEU A 1 42 ? 9.958  20.522 1.770   1.00 0.00 ? 59 LEU A HB2  8  
ATOM   5529  H HB3  . LEU A 1 42 ? 9.006  21.878 2.418   1.00 0.00 ? 59 LEU A HB3  8  
ATOM   5530  H HG   . LEU A 1 42 ? 10.322 21.737 -0.323  1.00 0.00 ? 59 LEU A HG   8  
ATOM   5531  H HD11 . LEU A 1 42 ? 7.958  21.759 -1.166  1.00 0.00 ? 59 LEU A HD11 8  
ATOM   5532  H HD12 . LEU A 1 42 ? 8.261  20.347 -0.127  1.00 0.00 ? 59 LEU A HD12 8  
ATOM   5533  H HD13 . LEU A 1 42 ? 7.375  21.751 0.515   1.00 0.00 ? 59 LEU A HD13 8  
ATOM   5534  H HD21 . LEU A 1 42 ? 10.378 23.992 0.566   1.00 0.00 ? 59 LEU A HD21 8  
ATOM   5535  H HD22 . LEU A 1 42 ? 9.192  23.891 -0.756  1.00 0.00 ? 59 LEU A HD22 8  
ATOM   5536  H HD23 . LEU A 1 42 ? 8.638  23.921 0.935   1.00 0.00 ? 59 LEU A HD23 8  
ATOM   5537  N N    . LEU A 1 43 ? 10.757 22.503 4.618   1.00 0.00 ? 60 LEU A N    8  
ATOM   5538  C CA   . LEU A 1 43 ? 10.862 22.288 6.056   1.00 0.00 ? 60 LEU A CA   8  
ATOM   5539  C C    . LEU A 1 43 ? 9.981  21.129 6.506   1.00 0.00 ? 60 LEU A C    8  
ATOM   5540  O O    . LEU A 1 43 ? 10.162 20.586 7.595   1.00 0.00 ? 60 LEU A O    8  
ATOM   5541  C CB   . LEU A 1 43 ? 10.485 23.569 6.812   1.00 0.00 ? 60 LEU A CB   8  
ATOM   5542  C CG   . LEU A 1 43 ? 11.429 24.758 6.594   1.00 0.00 ? 60 LEU A CG   8  
ATOM   5543  C CD1  . LEU A 1 43 ? 10.892 25.989 7.310   1.00 0.00 ? 60 LEU A CD1  8  
ATOM   5544  C CD2  . LEU A 1 43 ? 12.820 24.403 7.099   1.00 0.00 ? 60 LEU A CD2  8  
ATOM   5545  H H    . LEU A 1 43 ? 10.241 23.301 4.276   1.00 0.00 ? 60 LEU A H    8  
ATOM   5546  H HA   . LEU A 1 43 ? 11.885 22.016 6.311   1.00 0.00 ? 60 LEU A HA   8  
ATOM   5547  H HB2  . LEU A 1 43 ? 9.519  23.769 6.351   1.00 0.00 ? 60 LEU A HB2  8  
ATOM   5548  H HB3  . LEU A 1 43 ? 10.347 23.383 7.877   1.00 0.00 ? 60 LEU A HB3  8  
ATOM   5549  H HG   . LEU A 1 43 ? 11.498 24.924 5.519   1.00 0.00 ? 60 LEU A HG   8  
ATOM   5550  H HD11 . LEU A 1 43 ? 11.570 26.828 7.149   1.00 0.00 ? 60 LEU A HD11 8  
ATOM   5551  H HD12 . LEU A 1 43 ? 9.907  26.239 6.917   1.00 0.00 ? 60 LEU A HD12 8  
ATOM   5552  H HD13 . LEU A 1 43 ? 10.817 25.785 8.378   1.00 0.00 ? 60 LEU A HD13 8  
ATOM   5553  H HD21 . LEU A 1 43 ? 13.195 23.537 6.553   1.00 0.00 ? 60 LEU A HD21 8  
ATOM   5554  H HD22 . LEU A 1 43 ? 13.490 25.248 6.943   1.00 0.00 ? 60 LEU A HD22 8  
ATOM   5555  H HD23 . LEU A 1 43 ? 12.772 24.168 8.163   1.00 0.00 ? 60 LEU A HD23 8  
ATOM   5556  N N    . ASP A 1 44 ? 9.028  20.755 5.660   1.00 0.00 ? 61 ASP A N    8  
ATOM   5557  C CA   . ASP A 1 44 ? 8.132  19.643 5.959   1.00 0.00 ? 61 ASP A CA   8  
ATOM   5558  C C    . ASP A 1 44 ? 8.823  18.304 5.739   1.00 0.00 ? 61 ASP A C    8  
ATOM   5559  O O    . ASP A 1 44 ? 8.563  17.614 4.752   1.00 0.00 ? 61 ASP A O    8  
ATOM   5560  C CB   . ASP A 1 44 ? 6.867  19.729 5.101   1.00 0.00 ? 61 ASP A CB   8  
ATOM   5561  C CG   . ASP A 1 44 ? 5.794  18.710 5.459   1.00 0.00 ? 61 ASP A CG   8  
ATOM   5562  O OD1  . ASP A 1 44 ? 5.948  18.038 6.452   1.00 0.00 ? 61 ASP A OD1  8  
ATOM   5563  O OD2  . ASP A 1 44 ? 4.762  18.719 4.832   1.00 0.00 ? 61 ASP A OD2  8  
ATOM   5564  H H    . ASP A 1 44 ? 8.922  21.251 4.787   1.00 0.00 ? 61 ASP A H    8  
ATOM   5565  H HA   . ASP A 1 44 ? 7.843  19.675 7.009   1.00 0.00 ? 61 ASP A HA   8  
ATOM   5566  H HB2  . ASP A 1 44 ? 6.426  20.726 5.075   1.00 0.00 ? 61 ASP A HB2  8  
ATOM   5567  H HB3  . ASP A 1 44 ? 7.283  19.489 4.122   1.00 0.00 ? 61 ASP A HB3  8  
ATOM   5568  N N    . ARG A 1 45 ? 9.704  17.940 6.665   1.00 0.00 ? 62 ARG A N    8  
ATOM   5569  C CA   . ARG A 1 45 ? 10.394 16.657 6.604   1.00 0.00 ? 62 ARG A CA   8  
ATOM   5570  C C    . ARG A 1 45 ? 9.683  15.608 7.448   1.00 0.00 ? 62 ARG A C    8  
ATOM   5571  O O    . ARG A 1 45 ? 8.711  15.050 7.020   1.00 0.00 ? 62 ARG A O    8  
ATOM   5572  C CB   . ARG A 1 45 ? 11.862 16.776 6.983   1.00 0.00 ? 62 ARG A CB   8  
ATOM   5573  C CG   . ARG A 1 45 ? 12.704 17.611 6.030   1.00 0.00 ? 62 ARG A CG   8  
ATOM   5574  C CD   . ARG A 1 45 ? 14.119 17.776 6.448   1.00 0.00 ? 62 ARG A CD   8  
ATOM   5575  N NE   . ARG A 1 45 ? 14.939 18.531 5.514   1.00 0.00 ? 62 ARG A NE   8  
ATOM   5576  C CZ   . ARG A 1 45 ? 16.247 18.804 5.691   1.00 0.00 ? 62 ARG A CZ   8  
ATOM   5577  N NH1  . ARG A 1 45 ? 16.878 18.420 6.778   1.00 0.00 ? 62 ARG A NH1  8  
ATOM   5578  N NH2  . ARG A 1 45 ? 16.874 19.490 4.750   1.00 0.00 ? 62 ARG A NH2  8  
ATOM   5579  O OXT  . ARG A 1 45 ? 10.095 15.340 8.544   1.00 0.00 ? 62 ARG A OXT  8  
ATOM   5580  H H    . ARG A 1 45 ? 9.901  18.568 7.431   1.00 0.00 ? 62 ARG A H    8  
ATOM   5581  H HA   . ARG A 1 45 ? 10.390 16.284 5.579   1.00 0.00 ? 62 ARG A HA   8  
ATOM   5582  H HB2  . ARG A 1 45 ? 11.900 17.220 7.977   1.00 0.00 ? 62 ARG A HB2  8  
ATOM   5583  H HB3  . ARG A 1 45 ? 12.264 15.764 7.022   1.00 0.00 ? 62 ARG A HB3  8  
ATOM   5584  H HG2  . ARG A 1 45 ? 12.696 17.133 5.051   1.00 0.00 ? 62 ARG A HG2  8  
ATOM   5585  H HG3  . ARG A 1 45 ? 12.257 18.603 5.954   1.00 0.00 ? 62 ARG A HG3  8  
ATOM   5586  H HD2  . ARG A 1 45 ? 14.149 18.299 7.403   1.00 0.00 ? 62 ARG A HD2  8  
ATOM   5587  H HD3  . ARG A 1 45 ? 14.573 16.791 6.558   1.00 0.00 ? 62 ARG A HD3  8  
ATOM   5588  H HE   . ARG A 1 45 ? 14.687 18.952 4.629   1.00 0.00 ? 62 ARG A HE   8  
ATOM   5589  H HH11 . ARG A 1 45 ? 16.379 17.912 7.496   1.00 0.00 ? 62 ARG A HH11 8  
ATOM   5590  H HH12 . ARG A 1 45 ? 17.857 18.635 6.892   1.00 0.00 ? 62 ARG A HH12 8  
ATOM   5591  H HH21 . ARG A 1 45 ? 16.370 19.791 3.928   1.00 0.00 ? 62 ARG A HH21 8  
ATOM   5592  H HH22 . ARG A 1 45 ? 17.853 19.708 4.858   1.00 0.00 ? 62 ARG A HH22 8  
ATOM   5593  N N    . PRO A 1 1  ? 0.234  -0.637 0.388   1.00 0.00 ? 18 PRO A N    9  
ATOM   5594  C CA   . PRO A 1 1  ? 1.578  -0.522 -0.166  1.00 0.00 ? 18 PRO A CA   9  
ATOM   5595  C C    . PRO A 1 1  ? 2.076  0.917  -0.108  1.00 0.00 ? 18 PRO A C    9  
ATOM   5596  O O    . PRO A 1 1  ? 1.603  1.777  -0.851  1.00 0.00 ? 18 PRO A O    9  
ATOM   5597  C CB   . PRO A 1 1  ? 1.434  -1.025 -1.605  1.00 0.00 ? 18 PRO A CB   9  
ATOM   5598  C CG   . PRO A 1 1  ? 0.013  -0.742 -1.957  1.00 0.00 ? 18 PRO A CG   9  
ATOM   5599  C CD   . PRO A 1 1  ? -0.759 -0.929 -0.679  1.00 0.00 ? 18 PRO A CD   9  
ATOM   5600  H H2   . PRO A 1 1  ? -0.515 -0.974 -0.182  1.00 0.00 ? 18 PRO A H2   9  
ATOM   5601  H H3   . PRO A 1 1  ? 0.067  -1.229 1.176   1.00 0.00 ? 18 PRO A H3   9  
ATOM   5602  H HA   . PRO A 1 1  ? 2.323  -1.102 0.399   1.00 0.00 ? 18 PRO A HA   9  
ATOM   5603  H HB2  . PRO A 1 1  ? 2.124  -0.504 -2.285  1.00 0.00 ? 18 PRO A HB2  9  
ATOM   5604  H HB3  . PRO A 1 1  ? 1.656  -2.100 -1.681  1.00 0.00 ? 18 PRO A HB3  9  
ATOM   5605  H HG2  . PRO A 1 1  ? -0.104 0.280  -2.345  1.00 0.00 ? 18 PRO A HG2  9  
ATOM   5606  H HG3  . PRO A 1 1  ? -0.346 -1.427 -2.740  1.00 0.00 ? 18 PRO A HG3  9  
ATOM   5607  H HD2  . PRO A 1 1  ? -1.615 -0.241 -0.606  1.00 0.00 ? 18 PRO A HD2  9  
ATOM   5608  H HD3  . PRO A 1 1  ? -1.158 -1.948 -0.578  1.00 0.00 ? 18 PRO A HD3  9  
ATOM   5609  N N    . THR A 1 2  ? 3.032  1.172  0.778   1.00 0.00 ? 19 THR A N    9  
ATOM   5610  C CA   . THR A 1 2  ? 3.591  2.509  0.939   1.00 0.00 ? 19 THR A CA   9  
ATOM   5611  C C    . THR A 1 2  ? 5.086  2.520  0.647   1.00 0.00 ? 19 THR A C    9  
ATOM   5612  O O    . THR A 1 2  ? 5.830  1.667  1.131   1.00 0.00 ? 19 THR A O    9  
ATOM   5613  C CB   . THR A 1 2  ? 3.352  3.053  2.359   1.00 0.00 ? 19 THR A CB   9  
ATOM   5614  O OG1  . THR A 1 2  ? 1.944  3.112  2.621   1.00 0.00 ? 19 THR A OG1  9  
ATOM   5615  C CG2  . THR A 1 2  ? 3.948  4.445  2.505   1.00 0.00 ? 19 THR A CG2  9  
ATOM   5616  H H    . THR A 1 2  ? 3.382  0.419  1.354   1.00 0.00 ? 19 THR A H    9  
ATOM   5617  H HA   . THR A 1 2  ? 3.132  3.189  0.222   1.00 0.00 ? 19 THR A HA   9  
ATOM   5618  H HB   . THR A 1 2  ? 3.819  2.381  3.079   1.00 0.00 ? 19 THR A HB   9  
ATOM   5619  H HG1  . THR A 1 2  ? 1.797  3.451  3.507   1.00 0.00 ? 19 THR A HG1  9  
ATOM   5620  H HG21 . THR A 1 2  ? 3.481  5.117  1.785   1.00 0.00 ? 19 THR A HG21 9  
ATOM   5621  H HG22 . THR A 1 2  ? 3.770  4.813  3.515   1.00 0.00 ? 19 THR A HG22 9  
ATOM   5622  H HG23 . THR A 1 2  ? 5.022  4.402  2.317   1.00 0.00 ? 19 THR A HG23 9  
ATOM   5623  N N    . ARG A 1 3  ? 5.521  3.492  -0.148  1.00 0.00 ? 20 ARG A N    9  
ATOM   5624  C CA   . ARG A 1 3  ? 6.929  3.618  -0.504  1.00 0.00 ? 20 ARG A CA   9  
ATOM   5625  C C    . ARG A 1 3  ? 7.463  5.002  -0.159  1.00 0.00 ? 20 ARG A C    9  
ATOM   5626  O O    . ARG A 1 3  ? 6.768  6.005  -0.322  1.00 0.00 ? 20 ARG A O    9  
ATOM   5627  C CB   . ARG A 1 3  ? 7.186  3.271  -1.963  1.00 0.00 ? 20 ARG A CB   9  
ATOM   5628  C CG   . ARG A 1 3  ? 8.627  3.435  -2.417  1.00 0.00 ? 20 ARG A CG   9  
ATOM   5629  C CD   . ARG A 1 3  ? 8.886  2.986  -3.809  1.00 0.00 ? 20 ARG A CD   9  
ATOM   5630  N NE   . ARG A 1 3  ? 10.260 3.163  -4.253  1.00 0.00 ? 20 ARG A NE   9  
ATOM   5631  C CZ   . ARG A 1 3  ? 10.735 2.764  -5.448  1.00 0.00 ? 20 ARG A CZ   9  
ATOM   5632  N NH1  . ARG A 1 3  ? 9.965  2.131  -6.306  1.00 0.00 ? 20 ARG A NH1  9  
ATOM   5633  N NH2  . ARG A 1 3  ? 12.004 3.003  -5.727  1.00 0.00 ? 20 ARG A NH2  9  
ATOM   5634  H H    . ARG A 1 3  ? 4.859  4.161  -0.515  1.00 0.00 ? 20 ARG A H    9  
ATOM   5635  H HA   . ARG A 1 3  ? 7.520  2.904  0.070   1.00 0.00 ? 20 ARG A HA   9  
ATOM   5636  H HB2  . ARG A 1 3  ? 6.881  2.234  -2.102  1.00 0.00 ? 20 ARG A HB2  9  
ATOM   5637  H HB3  . ARG A 1 3  ? 6.546  3.921  -2.562  1.00 0.00 ? 20 ARG A HB3  9  
ATOM   5638  H HG2  . ARG A 1 3  ? 8.895  4.490  -2.349  1.00 0.00 ? 20 ARG A HG2  9  
ATOM   5639  H HG3  . ARG A 1 3  ? 9.267  2.855  -1.751  1.00 0.00 ? 20 ARG A HG3  9  
ATOM   5640  H HD2  . ARG A 1 3  ? 8.653  1.924  -3.887  1.00 0.00 ? 20 ARG A HD2  9  
ATOM   5641  H HD3  . ARG A 1 3  ? 8.248  3.549  -4.487  1.00 0.00 ? 20 ARG A HD3  9  
ATOM   5642  H HE   . ARG A 1 3  ? 11.043 3.589  -3.774  1.00 0.00 ? 20 ARG A HE   9  
ATOM   5643  H HH11 . ARG A 1 3  ? 9.002  1.940  -6.071  1.00 0.00 ? 20 ARG A HH11 9  
ATOM   5644  H HH12 . ARG A 1 3  ? 10.340 1.840  -7.197  1.00 0.00 ? 20 ARG A HH12 9  
ATOM   5645  H HH21 . ARG A 1 3  ? 12.587 3.475  -5.050  1.00 0.00 ? 20 ARG A HH21 9  
ATOM   5646  H HH22 . ARG A 1 3  ? 12.385 2.713  -6.616  1.00 0.00 ? 20 ARG A HH22 9  
ATOM   5647  N N    . THR A 1 4  ? 8.701  5.050  0.321   1.00 0.00 ? 21 THR A N    9  
ATOM   5648  C CA   . THR A 1 4  ? 9.335  6.313  0.681   1.00 0.00 ? 21 THR A CA   9  
ATOM   5649  C C    . THR A 1 4  ? 10.479 6.646  -0.267  1.00 0.00 ? 21 THR A C    9  
ATOM   5650  O O    . THR A 1 4  ? 11.449 5.897  -0.372  1.00 0.00 ? 21 THR A O    9  
ATOM   5651  C CB   . THR A 1 4  ? 9.871  6.284  2.125   1.00 0.00 ? 21 THR A CB   9  
ATOM   5652  O OG1  . THR A 1 4  ? 8.787  6.057  3.035   1.00 0.00 ? 21 THR A OG1  9  
ATOM   5653  C CG2  . THR A 1 4  ? 10.550 7.600  2.469   1.00 0.00 ? 21 THR A CG2  9  
ATOM   5654  H H    . THR A 1 4  ? 9.218  4.190  0.437   1.00 0.00 ? 21 THR A H    9  
ATOM   5655  H HA   . THR A 1 4  ? 8.614  7.126  0.593   1.00 0.00 ? 21 THR A HA   9  
ATOM   5656  H HB   . THR A 1 4  ? 10.589 5.469  2.220   1.00 0.00 ? 21 THR A HB   9  
ATOM   5657  H HG1  . THR A 1 4  ? 9.123  6.040  3.934   1.00 0.00 ? 21 THR A HG1  9  
ATOM   5658  H HG21 . THR A 1 4  ? 9.832  8.414  2.375   1.00 0.00 ? 21 THR A HG21 9  
ATOM   5659  H HG22 . THR A 1 4  ? 10.922 7.560  3.492   1.00 0.00 ? 21 THR A HG22 9  
ATOM   5660  H HG23 . THR A 1 4  ? 11.382 7.769  1.785   1.00 0.00 ? 21 THR A HG23 9  
ATOM   5661  N N    . VAL A 1 5  ? 10.359 7.776  -0.956  1.00 0.00 ? 22 VAL A N    9  
ATOM   5662  C CA   . VAL A 1 5  ? 11.410 8.243  -1.852  1.00 0.00 ? 22 VAL A CA   9  
ATOM   5663  C C    . VAL A 1 5  ? 11.819 9.672  -1.524  1.00 0.00 ? 22 VAL A C    9  
ATOM   5664  O O    . VAL A 1 5  ? 10.970 10.538 -1.309  1.00 0.00 ? 22 VAL A O    9  
ATOM   5665  C CB   . VAL A 1 5  ? 10.970 8.170  -3.326  1.00 0.00 ? 22 VAL A CB   9  
ATOM   5666  C CG1  . VAL A 1 5  ? 12.052 8.734  -4.234  1.00 0.00 ? 22 VAL A CG1  9  
ATOM   5667  C CG2  . VAL A 1 5  ? 10.644 6.736  -3.716  1.00 0.00 ? 22 VAL A CG2  9  
ATOM   5668  H H    . VAL A 1 5  ? 9.517  8.326  -0.856  1.00 0.00 ? 22 VAL A H    9  
ATOM   5669  H HA   . VAL A 1 5  ? 12.322 7.656  -1.732  1.00 0.00 ? 22 VAL A HA   9  
ATOM   5670  H HB   . VAL A 1 5  ? 10.054 8.748  -3.451  1.00 0.00 ? 22 VAL A HB   9  
ATOM   5671  H HG11 . VAL A 1 5  ? 11.724 8.676  -5.272  1.00 0.00 ? 22 VAL A HG11 9  
ATOM   5672  H HG12 . VAL A 1 5  ? 12.241 9.776  -3.972  1.00 0.00 ? 22 VAL A HG12 9  
ATOM   5673  H HG13 . VAL A 1 5  ? 12.968 8.157  -4.111  1.00 0.00 ? 22 VAL A HG13 9  
ATOM   5674  H HG21 . VAL A 1 5  ? 9.836  6.363  -3.086  1.00 0.00 ? 22 VAL A HG21 9  
ATOM   5675  H HG22 . VAL A 1 5  ? 10.334 6.704  -4.760  1.00 0.00 ? 22 VAL A HG22 9  
ATOM   5676  H HG23 . VAL A 1 5  ? 11.528 6.114  -3.579  1.00 0.00 ? 22 VAL A HG23 9  
ATOM   5677  N N    . ALA A 1 6  ? 13.126 9.915  -1.487  1.00 0.00 ? 23 ALA A N    9  
ATOM   5678  C CA   . ALA A 1 6  ? 13.648 11.254 -1.248  1.00 0.00 ? 23 ALA A CA   9  
ATOM   5679  C C    . ALA A 1 6  ? 13.924 11.980 -2.559  1.00 0.00 ? 23 ALA A C    9  
ATOM   5680  O O    . ALA A 1 6  ? 14.498 11.411 -3.486  1.00 0.00 ? 23 ALA A O    9  
ATOM   5681  C CB   . ALA A 1 6  ? 14.912 11.187 -0.401  1.00 0.00 ? 23 ALA A CB   9  
ATOM   5682  H H    . ALA A 1 6  ? 13.771 9.152  -1.628  1.00 0.00 ? 23 ALA A H    9  
ATOM   5683  H HA   . ALA A 1 6  ? 12.898 11.832 -0.708  1.00 0.00 ? 23 ALA A HA   9  
ATOM   5684  H HB1  . ALA A 1 6  ? 15.667 10.599 -0.921  1.00 0.00 ? 23 ALA A HB1  9  
ATOM   5685  H HB2  . ALA A 1 6  ? 15.290 12.195 -0.232  1.00 0.00 ? 23 ALA A HB2  9  
ATOM   5686  H HB3  . ALA A 1 6  ? 14.682 10.720 0.557   1.00 0.00 ? 23 ALA A HB3  9  
ATOM   5687  N N    . ILE A 1 7  ? 13.510 13.241 -2.629  1.00 0.00 ? 24 ILE A N    9  
ATOM   5688  C CA   . ILE A 1 7  ? 13.727 14.053 -3.821  1.00 0.00 ? 24 ILE A CA   9  
ATOM   5689  C C    . ILE A 1 7  ? 14.343 15.400 -3.465  1.00 0.00 ? 24 ILE A C    9  
ATOM   5690  O O    . ILE A 1 7  ? 14.275 15.840 -2.317  1.00 0.00 ? 24 ILE A O    9  
ATOM   5691  C CB   . ILE A 1 7  ? 12.415 14.287 -4.592  1.00 0.00 ? 24 ILE A CB   9  
ATOM   5692  C CG1  . ILE A 1 7  ? 11.406 15.035 -3.715  1.00 0.00 ? 24 ILE A CG1  9  
ATOM   5693  C CG2  . ILE A 1 7  ? 11.833 12.964 -5.065  1.00 0.00 ? 24 ILE A CG2  9  
ATOM   5694  C CD1  . ILE A 1 7  ? 10.173 15.494 -4.459  1.00 0.00 ? 24 ILE A CD1  9  
ATOM   5695  H H    . ILE A 1 7  ? 13.032 13.647 -1.837  1.00 0.00 ? 24 ILE A H    9  
ATOM   5696  H HA   . ILE A 1 7  ? 14.455 13.582 -4.479  1.00 0.00 ? 24 ILE A HA   9  
ATOM   5697  H HB   . ILE A 1 7  ? 12.616 14.924 -5.452  1.00 0.00 ? 24 ILE A HB   9  
ATOM   5698  H HG12 . ILE A 1 7  ? 11.116 14.364 -2.908  1.00 0.00 ? 24 ILE A HG12 9  
ATOM   5699  H HG13 . ILE A 1 7  ? 11.921 15.902 -3.298  1.00 0.00 ? 24 ILE A HG13 9  
ATOM   5700  H HG21 . ILE A 1 7  ? 10.905 13.148 -5.608  1.00 0.00 ? 24 ILE A HG21 9  
ATOM   5701  H HG22 . ILE A 1 7  ? 12.546 12.468 -5.723  1.00 0.00 ? 24 ILE A HG22 9  
ATOM   5702  H HG23 . ILE A 1 7  ? 11.629 12.327 -4.205  1.00 0.00 ? 24 ILE A HG23 9  
ATOM   5703  H HD11 . ILE A 1 7  ? 9.657  14.630 -4.876  1.00 0.00 ? 24 ILE A HD11 9  
ATOM   5704  H HD12 . ILE A 1 7  ? 9.506  16.017 -3.772  1.00 0.00 ? 24 ILE A HD12 9  
ATOM   5705  H HD13 . ILE A 1 7  ? 10.463 16.168 -5.266  1.00 0.00 ? 24 ILE A HD13 9  
ATOM   5706  N N    . SER A 1 8  ? 14.943 16.051 -4.455  1.00 0.00 ? 25 SER A N    9  
ATOM   5707  C CA   . SER A 1 8  ? 15.566 17.353 -4.250  1.00 0.00 ? 25 SER A CA   9  
ATOM   5708  C C    . SER A 1 8  ? 14.537 18.473 -4.320  1.00 0.00 ? 25 SER A C    9  
ATOM   5709  O O    . SER A 1 8  ? 14.590 19.427 -3.543  1.00 0.00 ? 25 SER A O    9  
ATOM   5710  C CB   . SER A 1 8  ? 16.660 17.576 -5.276  1.00 0.00 ? 25 SER A CB   9  
ATOM   5711  O OG   . SER A 1 8  ? 17.696 16.640 -5.153  1.00 0.00 ? 25 SER A OG   9  
ATOM   5712  H H    . SER A 1 8  ? 14.968 15.632 -5.374  1.00 0.00 ? 25 SER A H    9  
ATOM   5713  H HA   . SER A 1 8  ? 16.128 17.422 -3.317  1.00 0.00 ? 25 SER A HA   9  
ATOM   5714  H HB2  . SER A 1 8  ? 16.225 17.493 -6.272  1.00 0.00 ? 25 SER A HB2  9  
ATOM   5715  H HB3  . SER A 1 8  ? 17.068 18.576 -5.140  1.00 0.00 ? 25 SER A HB3  9  
ATOM   5716  H HG   . SER A 1 8  ? 18.366 16.815 -5.819  1.00 0.00 ? 25 SER A HG   9  
ATOM   5717  N N    . ASP A 1 9  ? 13.600 18.353 -5.254  1.00 0.00 ? 26 ASP A N    9  
ATOM   5718  C CA   . ASP A 1 9  ? 12.557 19.356 -5.427  1.00 0.00 ? 26 ASP A CA   9  
ATOM   5719  C C    . ASP A 1 9  ? 11.408 18.815 -6.270  1.00 0.00 ? 26 ASP A C    9  
ATOM   5720  O O    . ASP A 1 9  ? 11.559 17.818 -6.977  1.00 0.00 ? 26 ASP A O    9  
ATOM   5721  C CB   . ASP A 1 9  ? 13.130 20.621 -6.069  1.00 0.00 ? 26 ASP A CB   9  
ATOM   5722  C CG   . ASP A 1 9  ? 12.312 21.880 -5.817  1.00 0.00 ? 26 ASP A CG   9  
ATOM   5723  O OD1  . ASP A 1 9  ? 11.301 21.786 -5.162  1.00 0.00 ? 26 ASP A OD1  9  
ATOM   5724  O OD2  . ASP A 1 9  ? 12.780 22.945 -6.145  1.00 0.00 ? 26 ASP A OD2  9  
ATOM   5725  H H    . ASP A 1 9  ? 13.612 17.544 -5.861  1.00 0.00 ? 26 ASP A H    9  
ATOM   5726  H HA   . ASP A 1 9  ? 12.133 19.617 -4.458  1.00 0.00 ? 26 ASP A HA   9  
ATOM   5727  H HB2  . ASP A 1 9  ? 14.172 20.807 -5.807  1.00 0.00 ? 26 ASP A HB2  9  
ATOM   5728  H HB3  . ASP A 1 9  ? 13.063 20.349 -7.123  1.00 0.00 ? 26 ASP A HB3  9  
ATOM   5729  N N    . ALA A 1 10 ? 10.260 19.480 -6.192  1.00 0.00 ? 27 ALA A N    9  
ATOM   5730  C CA   . ALA A 1 10 ? 9.112  19.123 -7.016  1.00 0.00 ? 27 ALA A CA   9  
ATOM   5731  C C    . ALA A 1 10 ? 9.418  19.305 -8.496  1.00 0.00 ? 27 ALA A C    9  
ATOM   5732  O O    . ALA A 1 10 ? 8.901  18.574 -9.341  1.00 0.00 ? 27 ALA A O    9  
ATOM   5733  C CB   . ALA A 1 10 ? 7.897  19.949 -6.617  1.00 0.00 ? 27 ALA A CB   9  
ATOM   5734  H H    . ALA A 1 10 ? 10.181 20.250 -5.544  1.00 0.00 ? 27 ALA A H    9  
ATOM   5735  H HA   . ALA A 1 10 ? 8.882  18.069 -6.858  1.00 0.00 ? 27 ALA A HA   9  
ATOM   5736  H HB1  . ALA A 1 10 ? 8.116  21.007 -6.754  1.00 0.00 ? 27 ALA A HB1  9  
ATOM   5737  H HB2  . ALA A 1 10 ? 7.048  19.672 -7.241  1.00 0.00 ? 27 ALA A HB2  9  
ATOM   5738  H HB3  . ALA A 1 10 ? 7.655  19.760 -5.571  1.00 0.00 ? 27 ALA A HB3  9  
ATOM   5739  N N    . ALA A 1 11 ? 10.262 20.284 -8.805  1.00 0.00 ? 28 ALA A N    9  
ATOM   5740  C CA   . ALA A 1 11 ? 10.739 20.483 -10.168 1.00 0.00 ? 28 ALA A CA   9  
ATOM   5741  C C    . ALA A 1 11 ? 11.582 19.304 -10.635 1.00 0.00 ? 28 ALA A C    9  
ATOM   5742  O O    . ALA A 1 11 ? 11.697 19.047 -11.834 1.00 0.00 ? 28 ALA A O    9  
ATOM   5743  C CB   . ALA A 1 11 ? 11.532 21.778 -10.268 1.00 0.00 ? 28 ALA A CB   9  
ATOM   5744  H H    . ALA A 1 11 ? 10.582 20.906 -8.076  1.00 0.00 ? 28 ALA A H    9  
ATOM   5745  H HA   . ALA A 1 11 ? 9.877  20.551 -10.833 1.00 0.00 ? 28 ALA A HA   9  
ATOM   5746  H HB1  . ALA A 1 11 ? 12.389 21.732 -9.597  1.00 0.00 ? 28 ALA A HB1  9  
ATOM   5747  H HB2  . ALA A 1 11 ? 11.881 21.911 -11.292 1.00 0.00 ? 28 ALA A HB2  9  
ATOM   5748  H HB3  . ALA A 1 11 ? 10.895 22.618 -9.989  1.00 0.00 ? 28 ALA A HB3  9  
ATOM   5749  N N    . GLN A 1 12 ? 12.168 18.588 -9.682  1.00 0.00 ? 29 GLN A N    9  
ATOM   5750  C CA   . GLN A 1 12 ? 13.011 17.440 -9.994  1.00 0.00 ? 29 GLN A CA   9  
ATOM   5751  C C    . GLN A 1 12 ? 12.219 16.140 -9.918  1.00 0.00 ? 29 GLN A C    9  
ATOM   5752  O O    . GLN A 1 12 ? 12.781 15.052 -10.049 1.00 0.00 ? 29 GLN A O    9  
ATOM   5753  C CB   . GLN A 1 12 ? 14.205 17.374 -9.038  1.00 0.00 ? 29 GLN A CB   9  
ATOM   5754  C CG   . GLN A 1 12 ? 15.059 18.631 -9.021  1.00 0.00 ? 29 GLN A CG   9  
ATOM   5755  C CD   . GLN A 1 12 ? 15.659 18.940 -10.379 1.00 0.00 ? 29 GLN A CD   9  
ATOM   5756  O OE1  . GLN A 1 12 ? 16.223 18.062 -11.039 1.00 0.00 ? 29 GLN A OE1  9  
ATOM   5757  N NE2  . GLN A 1 12 ? 15.545 20.193 -10.804 1.00 0.00 ? 29 GLN A NE2  9  
ATOM   5758  H H    . GLN A 1 12 ? 12.028 18.847 -8.715  1.00 0.00 ? 29 GLN A H    9  
ATOM   5759  H HA   . GLN A 1 12 ? 13.375 17.522 -11.018 1.00 0.00 ? 29 GLN A HA   9  
ATOM   5760  H HB2  . GLN A 1 12 ? 13.801 17.189 -8.042  1.00 0.00 ? 29 GLN A HB2  9  
ATOM   5761  H HB3  . GLN A 1 12 ? 14.810 16.522 -9.348  1.00 0.00 ? 29 GLN A HB3  9  
ATOM   5762  H HG2  . GLN A 1 12 ? 14.719 19.569 -8.584  1.00 0.00 ? 29 GLN A HG2  9  
ATOM   5763  H HG3  . GLN A 1 12 ? 15.836 18.198 -8.391  1.00 0.00 ? 29 GLN A HG3  9  
ATOM   5764  H HE21 . GLN A 1 12 ? 15.082 20.874 -10.236 1.00 0.00 ? 29 GLN A HE21 9  
ATOM   5765  H HE22 . GLN A 1 12 ? 15.923 20.457 -11.693 1.00 0.00 ? 29 GLN A HE22 9  
ATOM   5766  N N    . LEU A 1 13 ? 10.913 16.260 -9.708  1.00 0.00 ? 30 LEU A N    9  
ATOM   5767  C CA   . LEU A 1 13 ? 10.039 15.096 -9.638  1.00 0.00 ? 30 LEU A CA   9  
ATOM   5768  C C    . LEU A 1 13 ? 9.195  14.963 -10.899 1.00 0.00 ? 30 LEU A C    9  
ATOM   5769  O O    . LEU A 1 13 ? 8.308  15.779 -11.152 1.00 0.00 ? 30 LEU A O    9  
ATOM   5770  C CB   . LEU A 1 13 ? 9.137  15.184 -8.400  1.00 0.00 ? 30 LEU A CB   9  
ATOM   5771  C CG   . LEU A 1 13 ? 8.140  14.029 -8.234  1.00 0.00 ? 30 LEU A CG   9  
ATOM   5772  C CD1  . LEU A 1 13 ? 8.888  12.711 -8.090  1.00 0.00 ? 30 LEU A CD1  9  
ATOM   5773  C CD2  . LEU A 1 13 ? 7.262  14.286 -7.019  1.00 0.00 ? 30 LEU A CD2  9  
ATOM   5774  H H    . LEU A 1 13 ? 10.516 17.182 -9.593  1.00 0.00 ? 30 LEU A H    9  
ATOM   5775  H HA   . LEU A 1 13 ? 10.640 14.190 -9.572  1.00 0.00 ? 30 LEU A HA   9  
ATOM   5776  H HB2  . LEU A 1 13 ? 9.898  15.134 -7.623  1.00 0.00 ? 30 LEU A HB2  9  
ATOM   5777  H HB3  . LEU A 1 13 ? 8.621  16.143 -8.343  1.00 0.00 ? 30 LEU A HB3  9  
ATOM   5778  H HG   . LEU A 1 13 ? 7.499  14.026 -9.116  1.00 0.00 ? 30 LEU A HG   9  
ATOM   5779  H HD11 . LEU A 1 13 ? 8.173  11.896 -7.973  1.00 0.00 ? 30 LEU A HD11 9  
ATOM   5780  H HD12 . LEU A 1 13 ? 9.493  12.536 -8.980  1.00 0.00 ? 30 LEU A HD12 9  
ATOM   5781  H HD13 . LEU A 1 13 ? 9.535  12.754 -7.214  1.00 0.00 ? 30 LEU A HD13 9  
ATOM   5782  H HD21 . LEU A 1 13 ? 6.715  15.219 -7.156  1.00 0.00 ? 30 LEU A HD21 9  
ATOM   5783  H HD22 . LEU A 1 13 ? 6.553  13.465 -6.903  1.00 0.00 ? 30 LEU A HD22 9  
ATOM   5784  H HD23 . LEU A 1 13 ? 7.884  14.358 -6.127  1.00 0.00 ? 30 LEU A HD23 9  
ATOM   5785  N N    . PRO A 1 14 ? 9.476  13.932 -11.688 1.00 0.00 ? 31 PRO A N    9  
ATOM   5786  C CA   . PRO A 1 14 ? 8.780  13.721 -12.951 1.00 0.00 ? 31 PRO A CA   9  
ATOM   5787  C C    . PRO A 1 14 ? 7.281  13.552 -12.733 1.00 0.00 ? 31 PRO A C    9  
ATOM   5788  O O    . PRO A 1 14 ? 6.850  12.953 -11.749 1.00 0.00 ? 31 PRO A O    9  
ATOM   5789  C CB   . PRO A 1 14 ? 9.424  12.456 -13.527 1.00 0.00 ? 31 PRO A CB   9  
ATOM   5790  C CG   . PRO A 1 14 ? 10.773 12.406 -12.896 1.00 0.00 ? 31 PRO A CG   9  
ATOM   5791  C CD   . PRO A 1 14 ? 10.582 12.947 -11.503 1.00 0.00 ? 31 PRO A CD   9  
ATOM   5792  H HA   . PRO A 1 14 ? 8.873  14.577 -13.635 1.00 0.00 ? 31 PRO A HA   9  
ATOM   5793  H HB2  . PRO A 1 14 ? 8.837  11.558 -13.284 1.00 0.00 ? 31 PRO A HB2  9  
ATOM   5794  H HB3  . PRO A 1 14 ? 9.499  12.505 -14.623 1.00 0.00 ? 31 PRO A HB3  9  
ATOM   5795  H HG2  . PRO A 1 14 ? 11.163 11.377 -12.870 1.00 0.00 ? 31 PRO A HG2  9  
ATOM   5796  H HG3  . PRO A 1 14 ? 11.499 13.011 -13.459 1.00 0.00 ? 31 PRO A HG3  9  
ATOM   5797  H HD2  . PRO A 1 14 ? 10.307 12.160 -10.786 1.00 0.00 ? 31 PRO A HD2  9  
ATOM   5798  H HD3  . PRO A 1 14 ? 11.493 13.429 -11.116 1.00 0.00 ? 31 PRO A HD3  9  
ATOM   5799  N N    . HIS A 1 15 ? 6.491  14.086 -13.659 1.00 0.00 ? 32 HIS A N    9  
ATOM   5800  C CA   . HIS A 1 15 ? 5.060  13.808 -13.697 1.00 0.00 ? 32 HIS A CA   9  
ATOM   5801  C C    . HIS A 1 15 ? 4.791  12.364 -14.104 1.00 0.00 ? 32 HIS A C    9  
ATOM   5802  O O    . HIS A 1 15 ? 5.600  11.740 -14.789 1.00 0.00 ? 32 HIS A O    9  
ATOM   5803  C CB   . HIS A 1 15 ? 4.348  14.764 -14.659 1.00 0.00 ? 32 HIS A CB   9  
ATOM   5804  C CG   . HIS A 1 15 ? 4.133  16.134 -14.095 1.00 0.00 ? 32 HIS A CG   9  
ATOM   5805  N ND1  . HIS A 1 15 ? 3.233  16.390 -13.082 1.00 0.00 ? 32 HIS A ND1  9  
ATOM   5806  C CD2  . HIS A 1 15 ? 4.700  17.324 -14.404 1.00 0.00 ? 32 HIS A CD2  9  
ATOM   5807  C CE1  . HIS A 1 15 ? 3.257  17.678 -12.791 1.00 0.00 ? 32 HIS A CE1  9  
ATOM   5808  N NE2  . HIS A 1 15 ? 4.138  18.266 -13.578 1.00 0.00 ? 32 HIS A NE2  9  
ATOM   5809  H H    . HIS A 1 15 ? 6.892  14.699 -14.353 1.00 0.00 ? 32 HIS A H    9  
ATOM   5810  H HA   . HIS A 1 15 ? 4.636  13.933 -12.701 1.00 0.00 ? 32 HIS A HA   9  
ATOM   5811  H HB2  . HIS A 1 15 ? 4.936  14.889 -15.569 1.00 0.00 ? 32 HIS A HB2  9  
ATOM   5812  H HB3  . HIS A 1 15 ? 3.364  14.374 -14.915 1.00 0.00 ? 32 HIS A HB3  9  
ATOM   5813  H HD1  . HIS A 1 15 ? 2.702  15.708 -12.578 1.00 0.00 ? 32 HIS A HD1  9  
ATOM   5814  H HD2  . HIS A 1 15 ? 5.457  17.618 -15.133 1.00 0.00 ? 32 HIS A HD2  9  
ATOM   5815  H HE1  . HIS A 1 15 ? 2.614  18.083 -12.010 1.00 0.00 ? 32 HIS A HE1  9  
ATOM   5816  N N    . ASP A 1 16 ? 3.647  11.839 -13.676 1.00 0.00 ? 33 ASP A N    9  
ATOM   5817  C CA   . ASP A 1 16 ? 2.661  12.633 -12.954 1.00 0.00 ? 33 ASP A CA   9  
ATOM   5818  C C    . ASP A 1 16 ? 2.870  12.533 -11.448 1.00 0.00 ? 33 ASP A C    9  
ATOM   5819  O O    . ASP A 1 16 ? 3.258  11.484 -10.934 1.00 0.00 ? 33 ASP A O    9  
ATOM   5820  C CB   . ASP A 1 16 ? 1.243  12.189 -13.319 1.00 0.00 ? 33 ASP A CB   9  
ATOM   5821  C CG   . ASP A 1 16 ? 0.866  12.422 -14.777 1.00 0.00 ? 33 ASP A CG   9  
ATOM   5822  O OD1  . ASP A 1 16 ? 1.073  13.512 -15.256 1.00 0.00 ? 33 ASP A OD1  9  
ATOM   5823  O OD2  . ASP A 1 16 ? 0.525  11.472 -15.439 1.00 0.00 ? 33 ASP A OD2  9  
ATOM   5824  H H    . ASP A 1 16 ? 3.456  10.863 -13.858 1.00 0.00 ? 33 ASP A H    9  
ATOM   5825  H HA   . ASP A 1 16 ? 2.774  13.686 -13.213 1.00 0.00 ? 33 ASP A HA   9  
ATOM   5826  H HB2  . ASP A 1 16 ? 1.028  11.155 -13.050 1.00 0.00 ? 33 ASP A HB2  9  
ATOM   5827  H HB3  . ASP A 1 16 ? 0.662  12.859 -12.684 1.00 0.00 ? 33 ASP A HB3  9  
ATOM   5828  N N    . TYR A 1 17 ? 2.607  13.629 -10.746 1.00 0.00 ? 34 TYR A N    9  
ATOM   5829  C CA   . TYR A 1 17 ? 2.630  13.629 -9.288  1.00 0.00 ? 34 TYR A CA   9  
ATOM   5830  C C    . TYR A 1 17 ? 1.672  14.670 -8.722  1.00 0.00 ? 34 TYR A C    9  
ATOM   5831  O O    . TYR A 1 17 ? 1.209  15.557 -9.439  1.00 0.00 ? 34 TYR A O    9  
ATOM   5832  C CB   . TYR A 1 17 ? 4.048  13.887 -8.774  1.00 0.00 ? 34 TYR A CB   9  
ATOM   5833  C CG   . TYR A 1 17 ? 4.547  15.292 -9.029  1.00 0.00 ? 34 TYR A CG   9  
ATOM   5834  C CD1  . TYR A 1 17 ? 4.321  16.306 -8.110  1.00 0.00 ? 34 TYR A CD1  9  
ATOM   5835  C CD2  . TYR A 1 17 ? 5.243  15.600 -10.189 1.00 0.00 ? 34 TYR A CD2  9  
ATOM   5836  C CE1  . TYR A 1 17 ? 4.773  17.592 -8.338  1.00 0.00 ? 34 TYR A CE1  9  
ATOM   5837  C CE2  . TYR A 1 17 ? 5.701  16.881 -10.427 1.00 0.00 ? 34 TYR A CE2  9  
ATOM   5838  C CZ   . TYR A 1 17 ? 5.464  17.875 -9.499  1.00 0.00 ? 34 TYR A CZ   9  
ATOM   5839  O OH   . TYR A 1 17 ? 5.919  19.152 -9.732  1.00 0.00 ? 34 TYR A OH   9  
ATOM   5840  H H    . TYR A 1 17 ? 2.388  14.486 -11.234 1.00 0.00 ? 34 TYR A H    9  
ATOM   5841  H HA   . TYR A 1 17 ? 2.295  12.662 -8.912  1.00 0.00 ? 34 TYR A HA   9  
ATOM   5842  H HB2  . TYR A 1 17 ? 4.043  13.693 -7.701  1.00 0.00 ? 34 TYR A HB2  9  
ATOM   5843  H HB3  . TYR A 1 17 ? 4.705  13.173 -9.269  1.00 0.00 ? 34 TYR A HB3  9  
ATOM   5844  H HD1  . TYR A 1 17 ? 3.775  16.076 -7.195  1.00 0.00 ? 34 TYR A HD1  9  
ATOM   5845  H HD2  . TYR A 1 17 ? 5.427  14.810 -10.917 1.00 0.00 ? 34 TYR A HD2  9  
ATOM   5846  H HE1  . TYR A 1 17 ? 4.589  18.379 -7.608  1.00 0.00 ? 34 TYR A HE1  9  
ATOM   5847  H HE2  . TYR A 1 17 ? 6.246  17.103 -11.346 1.00 0.00 ? 34 TYR A HE2  9  
ATOM   5848  H HH   . TYR A 1 17 ? 6.386  19.239 -10.567 1.00 0.00 ? 34 TYR A HH   9  
ATOM   5849  N N    . CYS A 1 18 ? 1.378  14.556 -7.431  1.00 0.00 ? 35 CYS A N    9  
ATOM   5850  C CA   . CYS A 1 18 ? 0.493  15.501 -6.761  1.00 0.00 ? 35 CYS A CA   9  
ATOM   5851  C C    . CYS A 1 18 ? 1.122  16.028 -5.477  1.00 0.00 ? 35 CYS A C    9  
ATOM   5852  O O    . CYS A 1 18 ? 2.160  15.538 -5.036  1.00 0.00 ? 35 CYS A O    9  
ATOM   5853  C CB   . CYS A 1 18 ? -0.736 14.648 -6.448  1.00 0.00 ? 35 CYS A CB   9  
ATOM   5854  S SG   . CYS A 1 18 ? -1.538 13.927 -7.899  1.00 0.00 ? 35 CYS A SG   9  
ATOM   5855  H H    . CYS A 1 18 ? 1.778  13.795 -6.900  1.00 0.00 ? 35 CYS A H    9  
ATOM   5856  H HA   . CYS A 1 18 ? 0.188  16.334 -7.394  1.00 0.00 ? 35 CYS A HA   9  
ATOM   5857  H HB2  . CYS A 1 18 ? -0.461 13.810 -5.807  1.00 0.00 ? 35 CYS A HB2  9  
ATOM   5858  H HB3  . CYS A 1 18 ? -1.496 15.251 -5.951  1.00 0.00 ? 35 CYS A HB3  9  
ATOM   5859  H HG   . CYS A 1 18 ? -2.502 13.302 -7.230  1.00 0.00 ? 35 CYS A HG   9  
ATOM   5860  N N    . THR A 1 19 ? 0.485  17.031 -4.881  1.00 0.00 ? 36 THR A N    9  
ATOM   5861  C CA   . THR A 1 19 ? 1.021  17.678 -3.689  1.00 0.00 ? 36 THR A CA   9  
ATOM   5862  C C    . THR A 1 19 ? -0.077 17.949 -2.669  1.00 0.00 ? 36 THR A C    9  
ATOM   5863  O O    . THR A 1 19 ? -1.236 18.158 -3.030  1.00 0.00 ? 36 THR A O    9  
ATOM   5864  C CB   . THR A 1 19 ? 1.725  19.003 -4.035  1.00 0.00 ? 36 THR A CB   9  
ATOM   5865  O OG1  . THR A 1 19 ? 2.382  19.516 -2.869  1.00 0.00 ? 36 THR A OG1  9  
ATOM   5866  C CG2  . THR A 1 19 ? 0.717  20.028 -4.536  1.00 0.00 ? 36 THR A CG2  9  
ATOM   5867  H H    . THR A 1 19 ? -0.393 17.352 -5.263  1.00 0.00 ? 36 THR A H    9  
ATOM   5868  H HA   . THR A 1 19 ? 1.738  17.018 -3.202  1.00 0.00 ? 36 THR A HA   9  
ATOM   5869  H HB   . THR A 1 19 ? 2.469  18.818 -4.808  1.00 0.00 ? 36 THR A HB   9  
ATOM   5870  H HG1  . THR A 1 19 ? 3.026  18.876 -2.558  1.00 0.00 ? 36 THR A HG1  9  
ATOM   5871  H HG21 . THR A 1 19 ? -0.027 20.214 -3.763  1.00 0.00 ? 36 THR A HG21 9  
ATOM   5872  H HG22 . THR A 1 19 ? 1.233  20.957 -4.775  1.00 0.00 ? 36 THR A HG22 9  
ATOM   5873  H HG23 . THR A 1 19 ? 0.225  19.644 -5.429  1.00 0.00 ? 36 THR A HG23 9  
HETATM 5874  N N    . TPO A 1 20 ? 0.294  17.944 -1.394  1.00 0.00 ? 37 TPO A N    9  
HETATM 5875  C CA   . TPO A 1 20 ? -0.624 18.330 -0.327  1.00 0.00 ? 37 TPO A CA   9  
HETATM 5876  C CB   . TPO A 1 20 ? -0.505 17.391 0.888   1.00 0.00 ? 37 TPO A CB   9  
HETATM 5877  C CG2  . TPO A 1 20 ? -0.518 15.937 0.441   1.00 0.00 ? 37 TPO A CG2  9  
HETATM 5878  O OG1  . TPO A 1 20 ? 0.717  17.661 1.587   1.00 0.00 ? 37 TPO A OG1  9  
HETATM 5879  P P    . TPO A 1 20 ? 0.886  17.240 3.134   1.00 0.00 ? 37 TPO A P    9  
HETATM 5880  O O1P  . TPO A 1 20 ? 2.309  17.672 3.576   1.00 0.00 ? 37 TPO A O1P  9  
HETATM 5881  O O2P  . TPO A 1 20 ? 0.707  15.701 3.216   1.00 0.00 ? 37 TPO A O2P  9  
HETATM 5882  O O3P  . TPO A 1 20 ? -0.212 17.985 3.938   1.00 0.00 ? 37 TPO A O3P  9  
HETATM 5883  C C    . TPO A 1 20 ? -0.370 19.763 0.125   1.00 0.00 ? 37 TPO A C    9  
HETATM 5884  O O    . TPO A 1 20 ? 0.665  20.349 -0.189  1.00 0.00 ? 37 TPO A O    9  
HETATM 5885  H H    . TPO A 1 20 ? 1.235  17.666 -1.156  1.00 0.00 ? 37 TPO A H    9  
HETATM 5886  H HA   . TPO A 1 20 ? -1.650 18.298 -0.694  1.00 0.00 ? 37 TPO A HA   9  
HETATM 5887  H HB   . TPO A 1 20 ? -1.345 17.572 1.559   1.00 0.00 ? 37 TPO A HB   9  
HETATM 5888  H HG21 . TPO A 1 20 ? -0.434 15.288 1.313   1.00 0.00 ? 37 TPO A HG21 9  
HETATM 5889  H HG22 . TPO A 1 20 ? -1.452 15.726 -0.081  1.00 0.00 ? 37 TPO A HG22 9  
HETATM 5890  H HG23 . TPO A 1 20 ? 0.322  15.755 -0.229  1.00 0.00 ? 37 TPO A HG23 9  
ATOM   5891  N N    . PRO A 1 21 ? -1.323 20.321 0.864   1.00 0.00 ? 38 PRO A N    9  
ATOM   5892  C CA   . PRO A 1 21 ? -1.229 21.704 1.316   1.00 0.00 ? 38 PRO A CA   9  
ATOM   5893  C C    . PRO A 1 21 ? 0.068  21.948 2.076   1.00 0.00 ? 38 PRO A C    9  
ATOM   5894  O O    . PRO A 1 21 ? 0.619  23.048 2.045   1.00 0.00 ? 38 PRO A O    9  
ATOM   5895  C CB   . PRO A 1 21 ? -2.463 21.890 2.206   1.00 0.00 ? 38 PRO A CB   9  
ATOM   5896  C CG   . PRO A 1 21 ? -3.461 20.924 1.665   1.00 0.00 ? 38 PRO A CG   9  
ATOM   5897  C CD   . PRO A 1 21 ? -2.661 19.724 1.233   1.00 0.00 ? 38 PRO A CD   9  
ATOM   5898  H HA   . PRO A 1 21 ? -1.211 22.424 0.484   1.00 0.00 ? 38 PRO A HA   9  
ATOM   5899  H HB2  . PRO A 1 21 ? -2.235 21.680 3.261   1.00 0.00 ? 38 PRO A HB2  9  
ATOM   5900  H HB3  . PRO A 1 21 ? -2.841 22.922 2.158   1.00 0.00 ? 38 PRO A HB3  9  
ATOM   5901  H HG2  . PRO A 1 21 ? -4.204 20.651 2.429   1.00 0.00 ? 38 PRO A HG2  9  
ATOM   5902  H HG3  . PRO A 1 21 ? -4.014 21.356 0.817   1.00 0.00 ? 38 PRO A HG3  9  
ATOM   5903  H HD2  . PRO A 1 21 ? -2.556 18.983 2.039   1.00 0.00 ? 38 PRO A HD2  9  
ATOM   5904  H HD3  . PRO A 1 21 ? -3.117 19.205 0.378   1.00 0.00 ? 38 PRO A HD3  9  
ATOM   5905  N N    . GLY A 1 22 ? 0.551  20.916 2.759   1.00 0.00 ? 39 GLY A N    9  
ATOM   5906  C CA   . GLY A 1 22 ? 1.800  21.007 3.504   1.00 0.00 ? 39 GLY A CA   9  
ATOM   5907  C C    . GLY A 1 22 ? 2.990  21.162 2.567   1.00 0.00 ? 39 GLY A C    9  
ATOM   5908  O O    . GLY A 1 22 ? 4.013  21.739 2.937   1.00 0.00 ? 39 GLY A O    9  
ATOM   5909  H H    . GLY A 1 22 ? 0.039  20.045 2.763   1.00 0.00 ? 39 GLY A H    9  
ATOM   5910  H HA2  . GLY A 1 22 ? 1.756  21.871 4.169   1.00 0.00 ? 39 GLY A HA2  9  
ATOM   5911  H HA3  . GLY A 1 22 ? 1.930  20.102 4.096   1.00 0.00 ? 39 GLY A HA3  9  
ATOM   5912  N N    . GLY A 1 23 ? 2.852  20.644 1.352   1.00 0.00 ? 40 GLY A N    9  
ATOM   5913  C CA   . GLY A 1 23 ? 3.877  20.804 0.328   1.00 0.00 ? 40 GLY A CA   9  
ATOM   5914  C C    . GLY A 1 23 ? 4.504  19.465 -0.038  1.00 0.00 ? 40 GLY A C    9  
ATOM   5915  O O    . GLY A 1 23 ? 5.265  19.368 -1.002  1.00 0.00 ? 40 GLY A O    9  
ATOM   5916  H H    . GLY A 1 23 ? 2.013  20.126 1.131   1.00 0.00 ? 40 GLY A H    9  
ATOM   5917  H HA2  . GLY A 1 23 ? 3.426  21.241 -0.563  1.00 0.00 ? 40 GLY A HA2  9  
ATOM   5918  H HA3  . GLY A 1 23 ? 4.654  21.469 0.704   1.00 0.00 ? 40 GLY A HA3  9  
ATOM   5919  N N    . THR A 1 24 ? 4.180  18.435 0.736   1.00 0.00 ? 41 THR A N    9  
ATOM   5920  C CA   . THR A 1 24 ? 4.728  17.104 0.507   1.00 0.00 ? 41 THR A CA   9  
ATOM   5921  C C    . THR A 1 24 ? 4.208  16.510 -0.796  1.00 0.00 ? 41 THR A C    9  
ATOM   5922  O O    . THR A 1 24 ? 3.015  16.584 -1.090  1.00 0.00 ? 41 THR A O    9  
ATOM   5923  C CB   . THR A 1 24 ? 4.390  16.147 1.665   1.00 0.00 ? 41 THR A CB   9  
ATOM   5924  O OG1  . THR A 1 24 ? 4.892  16.685 2.895   1.00 0.00 ? 41 THR A OG1  9  
ATOM   5925  C CG2  . THR A 1 24 ? 5.009  14.778 1.425   1.00 0.00 ? 41 THR A CG2  9  
ATOM   5926  H H    . THR A 1 24 ? 3.539  18.578 1.502   1.00 0.00 ? 41 THR A H    9  
ATOM   5927  H HA   . THR A 1 24 ? 5.812  17.162 0.407   1.00 0.00 ? 41 THR A HA   9  
ATOM   5928  H HB   . THR A 1 24 ? 3.308  16.046 1.738   1.00 0.00 ? 41 THR A HB   9  
ATOM   5929  H HG1  . THR A 1 24 ? 4.184  17.140 3.357   1.00 0.00 ? 41 THR A HG1  9  
ATOM   5930  H HG21 . THR A 1 24 ? 6.092  14.878 1.353   1.00 0.00 ? 41 THR A HG21 9  
ATOM   5931  H HG22 . THR A 1 24 ? 4.760  14.116 2.253   1.00 0.00 ? 41 THR A HG22 9  
ATOM   5932  H HG23 . THR A 1 24 ? 4.621  14.361 0.496   1.00 0.00 ? 41 THR A HG23 9  
ATOM   5933  N N    . LEU A 1 25 ? 5.109  15.922 -1.575  1.00 0.00 ? 42 LEU A N    9  
ATOM   5934  C CA   . LEU A 1 25 ? 4.746  15.332 -2.858  1.00 0.00 ? 42 LEU A CA   9  
ATOM   5935  C C    . LEU A 1 25 ? 4.362  13.867 -2.702  1.00 0.00 ? 42 LEU A C    9  
ATOM   5936  O O    . LEU A 1 25 ? 4.837  13.184 -1.794  1.00 0.00 ? 42 LEU A O    9  
ATOM   5937  C CB   . LEU A 1 25 ? 5.904  15.477 -3.854  1.00 0.00 ? 42 LEU A CB   9  
ATOM   5938  C CG   . LEU A 1 25 ? 6.121  16.894 -4.400  1.00 0.00 ? 42 LEU A CG   9  
ATOM   5939  C CD1  . LEU A 1 25 ? 4.780  17.558 -4.678  1.00 0.00 ? 42 LEU A CD1  9  
ATOM   5940  C CD2  . LEU A 1 25 ? 6.928  17.708 -3.398  1.00 0.00 ? 42 LEU A CD2  9  
ATOM   5941  H H    . LEU A 1 25 ? 6.072  15.882 -1.269  1.00 0.00 ? 42 LEU A H    9  
ATOM   5942  H HA   . LEU A 1 25 ? 3.870  15.841 -3.258  1.00 0.00 ? 42 LEU A HA   9  
ATOM   5943  H HB2  . LEU A 1 25 ? 6.732  15.195 -3.206  1.00 0.00 ? 42 LEU A HB2  9  
ATOM   5944  H HB3  . LEU A 1 25 ? 5.824  14.762 -4.672  1.00 0.00 ? 42 LEU A HB3  9  
ATOM   5945  H HG   . LEU A 1 25 ? 6.715  16.803 -5.310  1.00 0.00 ? 42 LEU A HG   9  
ATOM   5946  H HD11 . LEU A 1 25 ? 4.945  18.563 -5.067  1.00 0.00 ? 42 LEU A HD11 9  
ATOM   5947  H HD12 . LEU A 1 25 ? 4.230  16.973 -5.415  1.00 0.00 ? 42 LEU A HD12 9  
ATOM   5948  H HD13 . LEU A 1 25 ? 4.204  17.615 -3.756  1.00 0.00 ? 42 LEU A HD13 9  
ATOM   5949  H HD21 . LEU A 1 25 ? 7.894  17.229 -3.235  1.00 0.00 ? 42 LEU A HD21 9  
ATOM   5950  H HD22 . LEU A 1 25 ? 7.082  18.714 -3.788  1.00 0.00 ? 42 LEU A HD22 9  
ATOM   5951  H HD23 . LEU A 1 25 ? 6.386  17.762 -2.453  1.00 0.00 ? 42 LEU A HD23 9  
ATOM   5952  N N    . PHE A 1 26 ? 3.499  13.388 -3.592  1.00 0.00 ? 43 PHE A N    9  
ATOM   5953  C CA   . PHE A 1 26 ? 3.130  11.978 -3.620  1.00 0.00 ? 43 PHE A CA   9  
ATOM   5954  C C    . PHE A 1 26 ? 2.608  11.573 -4.992  1.00 0.00 ? 43 PHE A C    9  
ATOM   5955  O O    . PHE A 1 26 ? 2.110  12.406 -5.749  1.00 0.00 ? 43 PHE A O    9  
ATOM   5956  C CB   . PHE A 1 26 ? 2.079  11.679 -2.549  1.00 0.00 ? 43 PHE A CB   9  
ATOM   5957  C CG   . PHE A 1 26 ? 0.757  12.351 -2.791  1.00 0.00 ? 43 PHE A CG   9  
ATOM   5958  C CD1  . PHE A 1 26 ? 0.542  13.659 -2.383  1.00 0.00 ? 43 PHE A CD1  9  
ATOM   5959  C CD2  . PHE A 1 26 ? -0.273 11.677 -3.430  1.00 0.00 ? 43 PHE A CD2  9  
ATOM   5960  C CE1  . PHE A 1 26 ? -0.673 14.277 -2.604  1.00 0.00 ? 43 PHE A CE1  9  
ATOM   5961  C CE2  . PHE A 1 26 ? -1.489 12.294 -3.654  1.00 0.00 ? 43 PHE A CE2  9  
ATOM   5962  C CZ   . PHE A 1 26 ? -1.690 13.594 -3.241  1.00 0.00 ? 43 PHE A CZ   9  
ATOM   5963  H H    . PHE A 1 26 ? 3.088  14.018 -4.266  1.00 0.00 ? 43 PHE A H    9  
ATOM   5964  H HA   . PHE A 1 26 ? 4.009  11.362 -3.427  1.00 0.00 ? 43 PHE A HA   9  
ATOM   5965  H HB2  . PHE A 1 26 ? 1.882  10.610 -2.505  1.00 0.00 ? 43 PHE A HB2  9  
ATOM   5966  H HB3  . PHE A 1 26 ? 2.429  12.023 -1.576  1.00 0.00 ? 43 PHE A HB3  9  
ATOM   5967  H HD1  . PHE A 1 26 ? 1.345  14.199 -1.881  1.00 0.00 ? 43 PHE A HD1  9  
ATOM   5968  H HD2  . PHE A 1 26 ? -0.114 10.648 -3.755  1.00 0.00 ? 43 PHE A HD2  9  
ATOM   5969  H HE1  . PHE A 1 26 ? -0.830 15.305 -2.279  1.00 0.00 ? 43 PHE A HE1  9  
ATOM   5970  H HE2  . PHE A 1 26 ? -2.290 11.752 -4.157  1.00 0.00 ? 43 PHE A HE2  9  
ATOM   5971  H HZ   . PHE A 1 26 ? -2.647 14.081 -3.419  1.00 0.00 ? 43 PHE A HZ   9  
ATOM   5972  N N    . SER A 1 27 ? 2.725  10.288 -5.308  1.00 0.00 ? 44 SER A N    9  
ATOM   5973  C CA   . SER A 1 27 ? 2.186  9.752  -6.553  1.00 0.00 ? 44 SER A CA   9  
ATOM   5974  C C    . SER A 1 27 ? 1.888  8.264  -6.428  1.00 0.00 ? 44 SER A C    9  
ATOM   5975  O O    . SER A 1 27 ? 2.605  7.533  -5.743  1.00 0.00 ? 44 SER A O    9  
ATOM   5976  C CB   . SER A 1 27 ? 3.153  10.005 -7.692  1.00 0.00 ? 44 SER A CB   9  
ATOM   5977  O OG   . SER A 1 27 ? 2.647  9.559  -8.920  1.00 0.00 ? 44 SER A OG   9  
ATOM   5978  H H    . SER A 1 27 ? 3.201  9.666  -4.670  1.00 0.00 ? 44 SER A H    9  
ATOM   5979  H HA   . SER A 1 27 ? 1.297  10.280 -6.902  1.00 0.00 ? 44 SER A HA   9  
ATOM   5980  H HB2  . SER A 1 27 ? 3.345  11.075 -7.755  1.00 0.00 ? 44 SER A HB2  9  
ATOM   5981  H HB3  . SER A 1 27 ? 4.085  9.481  -7.482  1.00 0.00 ? 44 SER A HB3  9  
ATOM   5982  H HG   . SER A 1 27 ? 2.763  10.245 -9.582  1.00 0.00 ? 44 SER A HG   9  
ATOM   5983  N N    . THR A 1 28 ? 0.828  7.818  -7.095  1.00 0.00 ? 45 THR A N    9  
ATOM   5984  C CA   . THR A 1 28 ? 0.423  6.419  -7.044  1.00 0.00 ? 45 THR A CA   9  
ATOM   5985  C C    . THR A 1 28 ? 0.552  5.758  -8.409  1.00 0.00 ? 45 THR A C    9  
ATOM   5986  O O    . THR A 1 28 ? 0.057  6.275  -9.410  1.00 0.00 ? 45 THR A O    9  
ATOM   5987  C CB   . THR A 1 28 ? -1.028 6.269  -6.548  1.00 0.00 ? 45 THR A CB   9  
ATOM   5988  O OG1  . THR A 1 28 ? -1.150 6.844  -5.240  1.00 0.00 ? 45 THR A OG1  9  
ATOM   5989  C CG2  . THR A 1 28 ? -1.424 4.802  -6.492  1.00 0.00 ? 45 THR A CG2  9  
ATOM   5990  H H    . THR A 1 28 ? 0.290  8.467  -7.652  1.00 0.00 ? 45 THR A H    9  
ATOM   5991  H HA   . THR A 1 28 ? 1.081  5.869  -6.370  1.00 0.00 ? 45 THR A HA   9  
ATOM   5992  H HB   . THR A 1 28 ? -1.692 6.799  -7.231  1.00 0.00 ? 45 THR A HB   9  
ATOM   5993  H HG1  . THR A 1 28 ? -0.920 7.775  -5.277  1.00 0.00 ? 45 THR A HG1  9  
ATOM   5994  H HG21 . THR A 1 28 ? -0.760 4.273  -5.809  1.00 0.00 ? 45 THR A HG21 9  
ATOM   5995  H HG22 . THR A 1 28 ? -2.451 4.716  -6.140  1.00 0.00 ? 45 THR A HG22 9  
ATOM   5996  H HG23 . THR A 1 28 ? -1.342 4.366  -7.488  1.00 0.00 ? 45 THR A HG23 9  
HETATM 5997  N N    . TPO A 1 29 ? 1.222  4.610  -8.444  1.00 0.00 ? 46 TPO A N    9  
HETATM 5998  C CA   . TPO A 1 29 ? 1.472  3.907  -9.697  1.00 0.00 ? 46 TPO A CA   9  
HETATM 5999  C CB   . TPO A 1 29 ? 2.802  3.133  -9.655  1.00 0.00 ? 46 TPO A CB   9  
HETATM 6000  C CG2  . TPO A 1 29 ? 3.925  4.030  -9.155  1.00 0.00 ? 46 TPO A CG2  9  
HETATM 6001  O OG1  . TPO A 1 29 ? 2.674  2.003  -8.782  1.00 0.00 ? 46 TPO A OG1  9  
HETATM 6002  P P    . TPO A 1 29 ? 3.629  0.716  -8.961  1.00 0.00 ? 46 TPO A P    9  
HETATM 6003  O O1P  . TPO A 1 29 ? 3.230  -0.309 -7.868  1.00 0.00 ? 46 TPO A O1P  9  
HETATM 6004  O O2P  . TPO A 1 29 ? 5.093  1.199  -8.783  1.00 0.00 ? 46 TPO A O2P  9  
HETATM 6005  O O3P  . TPO A 1 29 ? 3.384  0.155  -10.387 1.00 0.00 ? 46 TPO A O3P  9  
HETATM 6006  C C    . TPO A 1 29 ? 0.342  2.937  -10.017 1.00 0.00 ? 46 TPO A C    9  
HETATM 6007  O O    . TPO A 1 29 ? -0.472 2.609  -9.154  1.00 0.00 ? 46 TPO A O    9  
HETATM 6008  H H    . TPO A 1 29 ? 1.567  4.216  -7.581  1.00 0.00 ? 46 TPO A H    9  
HETATM 6009  H HA   . TPO A 1 29 ? 1.508  4.620  -10.520 1.00 0.00 ? 46 TPO A HA   9  
HETATM 6010  H HB   . TPO A 1 29 ? 3.039  2.781  -10.658 1.00 0.00 ? 46 TPO A HB   9  
HETATM 6011  H HG21 . TPO A 1 29 ? 4.857  3.465  -9.133  1.00 0.00 ? 46 TPO A HG21 9  
HETATM 6012  H HG22 . TPO A 1 29 ? 4.032  4.884  -9.824  1.00 0.00 ? 46 TPO A HG22 9  
HETATM 6013  H HG23 . TPO A 1 29 ? 3.690  4.381  -8.152  1.00 0.00 ? 46 TPO A HG23 9  
ATOM   6014  N N    . PRO A 1 30 ? 0.298  2.479  -11.264 1.00 0.00 ? 47 PRO A N    9  
ATOM   6015  C CA   . PRO A 1 30 ? -0.779 1.611  -11.724 1.00 0.00 ? 47 PRO A CA   9  
ATOM   6016  C C    . PRO A 1 30 ? -0.885 0.360  -10.862 1.00 0.00 ? 47 PRO A C    9  
ATOM   6017  O O    . PRO A 1 30 ? -1.966 -0.206 -10.700 1.00 0.00 ? 47 PRO A O    9  
ATOM   6018  C CB   . PRO A 1 30 ? -0.403 1.282  -13.172 1.00 0.00 ? 47 PRO A CB   9  
ATOM   6019  C CG   . PRO A 1 30 ? 0.406  2.452  -13.620 1.00 0.00 ? 47 PRO A CG   9  
ATOM   6020  C CD   . PRO A 1 30 ? 1.191  2.880  -12.410 1.00 0.00 ? 47 PRO A CD   9  
ATOM   6021  H HA   . PRO A 1 30 ? -1.769 2.086  -11.654 1.00 0.00 ? 47 PRO A HA   9  
ATOM   6022  H HB2  . PRO A 1 30 ? 0.176  0.349  -13.237 1.00 0.00 ? 47 PRO A HB2  9  
ATOM   6023  H HB3  . PRO A 1 30 ? -1.297 1.152  -13.801 1.00 0.00 ? 47 PRO A HB3  9  
ATOM   6024  H HG2  . PRO A 1 30 ? 1.075  2.178  -14.449 1.00 0.00 ? 47 PRO A HG2  9  
ATOM   6025  H HG3  . PRO A 1 30 ? -0.238 3.267  -13.981 1.00 0.00 ? 47 PRO A HG3  9  
ATOM   6026  H HD2  . PRO A 1 30 ? 2.167  2.376  -12.347 1.00 0.00 ? 47 PRO A HD2  9  
ATOM   6027  H HD3  . PRO A 1 30 ? 1.389  3.962  -12.402 1.00 0.00 ? 47 PRO A HD3  9  
ATOM   6028  N N    . GLY A 1 31 ? 0.246  -0.069 -10.308 1.00 0.00 ? 48 GLY A N    9  
ATOM   6029  C CA   . GLY A 1 31 ? 0.282  -1.256 -9.463  1.00 0.00 ? 48 GLY A CA   9  
ATOM   6030  C C    . GLY A 1 31 ? -0.523 -1.050 -8.187  1.00 0.00 ? 48 GLY A C    9  
ATOM   6031  O O    . GLY A 1 31 ? -1.007 -2.009 -7.585  1.00 0.00 ? 48 GLY A O    9  
ATOM   6032  H H    . GLY A 1 31 ? 1.100  0.442  -10.477 1.00 0.00 ? 48 GLY A H    9  
ATOM   6033  H HA2  . GLY A 1 31 ? -0.134 -2.099 -10.015 1.00 0.00 ? 48 GLY A HA2  9  
ATOM   6034  H HA3  . GLY A 1 31 ? 1.317  -1.473 -9.199  1.00 0.00 ? 48 GLY A HA3  9  
ATOM   6035  N N    . GLY A 1 32 ? -0.665 0.206  -7.780  1.00 0.00 ? 49 GLY A N    9  
ATOM   6036  C CA   . GLY A 1 32 ? -1.466 0.546  -6.610  1.00 0.00 ? 49 GLY A CA   9  
ATOM   6037  C C    . GLY A 1 32 ? -0.594 1.072  -5.478  1.00 0.00 ? 49 GLY A C    9  
ATOM   6038  O O    . GLY A 1 32 ? -1.098 1.575  -4.474  1.00 0.00 ? 49 GLY A O    9  
ATOM   6039  H H    . GLY A 1 32 ? -0.205 0.945  -8.293  1.00 0.00 ? 49 GLY A H    9  
ATOM   6040  H HA2  . GLY A 1 32 ? -2.191 1.314  -6.886  1.00 0.00 ? 49 GLY A HA2  9  
ATOM   6041  H HA3  . GLY A 1 32 ? -1.993 -0.343 -6.269  1.00 0.00 ? 49 GLY A HA3  9  
ATOM   6042  N N    . THR A 1 33 ? 0.719  0.952  -5.644  1.00 0.00 ? 50 THR A N    9  
ATOM   6043  C CA   . THR A 1 33 ? 1.665  1.410  -4.634  1.00 0.00 ? 50 THR A CA   9  
ATOM   6044  C C    . THR A 1 33 ? 1.635  2.928  -4.499  1.00 0.00 ? 50 THR A C    9  
ATOM   6045  O O    . THR A 1 33 ? 1.711  3.651  -5.493  1.00 0.00 ? 50 THR A O    9  
ATOM   6046  C CB   . THR A 1 33 ? 3.101  0.962  -4.961  1.00 0.00 ? 50 THR A CB   9  
ATOM   6047  O OG1  . THR A 1 33 ? 3.152  -0.468 -5.040  1.00 0.00 ? 50 THR A OG1  9  
ATOM   6048  C CG2  . THR A 1 33 ? 4.067  1.442  -3.887  1.00 0.00 ? 50 THR A CG2  9  
ATOM   6049  H H    . THR A 1 33 ? 1.071  0.534  -6.494  1.00 0.00 ? 50 THR A H    9  
ATOM   6050  H HA   . THR A 1 33 ? 1.387  1.009  -3.660  1.00 0.00 ? 50 THR A HA   9  
ATOM   6051  H HB   . THR A 1 33 ? 3.393  1.382  -5.923  1.00 0.00 ? 50 THR A HB   9  
ATOM   6052  H HG1  . THR A 1 33 ? 3.051  -0.741 -5.955  1.00 0.00 ? 50 THR A HG1  9  
ATOM   6053  H HG21 . THR A 1 33 ? 3.776  1.023  -2.925  1.00 0.00 ? 50 THR A HG21 9  
ATOM   6054  H HG22 . THR A 1 33 ? 5.076  1.116  -4.136  1.00 0.00 ? 50 THR A HG22 9  
ATOM   6055  H HG23 . THR A 1 33 ? 4.038  2.530  -3.833  1.00 0.00 ? 50 THR A HG23 9  
ATOM   6056  N N    . ARG A 1 34 ? 1.525  3.405  -3.265  1.00 0.00 ? 51 ARG A N    9  
ATOM   6057  C CA   . ARG A 1 34 ? 1.520  4.837  -2.994  1.00 0.00 ? 51 ARG A CA   9  
ATOM   6058  C C    . ARG A 1 34 ? 2.903  5.325  -2.583  1.00 0.00 ? 51 ARG A C    9  
ATOM   6059  O O    . ARG A 1 34 ? 3.408  4.964  -1.520  1.00 0.00 ? 51 ARG A O    9  
ATOM   6060  C CB   . ARG A 1 34 ? 0.465  5.224  -1.968  1.00 0.00 ? 51 ARG A CB   9  
ATOM   6061  C CG   . ARG A 1 34 ? -0.968 4.928  -2.381  1.00 0.00 ? 51 ARG A CG   9  
ATOM   6062  C CD   . ARG A 1 34 ? -1.979 5.208  -1.329  1.00 0.00 ? 51 ARG A CD   9  
ATOM   6063  N NE   . ARG A 1 34 ? -3.347 4.897  -1.710  1.00 0.00 ? 51 ARG A NE   9  
ATOM   6064  C CZ   . ARG A 1 34 ? -4.422 5.083  -0.921  1.00 0.00 ? 51 ARG A CZ   9  
ATOM   6065  N NH1  . ARG A 1 34 ? -4.292 5.541  0.305   1.00 0.00 ? 51 ARG A NH1  9  
ATOM   6066  N NH2  . ARG A 1 34 ? -5.612 4.768  -1.402  1.00 0.00 ? 51 ARG A NH2  9  
ATOM   6067  H H    . ARG A 1 34 ? 1.442  2.759  -2.493  1.00 0.00 ? 51 ARG A H    9  
ATOM   6068  H HA   . ARG A 1 34 ? 1.255  5.383  -3.900  1.00 0.00 ? 51 ARG A HA   9  
ATOM   6069  H HB2  . ARG A 1 34 ? 0.695  4.680  -1.054  1.00 0.00 ? 51 ARG A HB2  9  
ATOM   6070  H HB3  . ARG A 1 34 ? 0.572  6.295  -1.790  1.00 0.00 ? 51 ARG A HB3  9  
ATOM   6071  H HG2  . ARG A 1 34 ? -1.211 5.538  -3.252  1.00 0.00 ? 51 ARG A HG2  9  
ATOM   6072  H HG3  . ARG A 1 34 ? -1.041 3.873  -2.645  1.00 0.00 ? 51 ARG A HG3  9  
ATOM   6073  H HD2  . ARG A 1 34 ? -1.743 4.616  -0.446  1.00 0.00 ? 51 ARG A HD2  9  
ATOM   6074  H HD3  . ARG A 1 34 ? -1.943 6.267  -1.077  1.00 0.00 ? 51 ARG A HD3  9  
ATOM   6075  H HE   . ARG A 1 34 ? -3.704 4.513  -2.576  1.00 0.00 ? 51 ARG A HE   9  
ATOM   6076  H HH11 . ARG A 1 34 ? -3.374 5.759  0.664   1.00 0.00 ? 51 ARG A HH11 9  
ATOM   6077  H HH12 . ARG A 1 34 ? -5.110 5.673  0.881   1.00 0.00 ? 51 ARG A HH12 9  
ATOM   6078  H HH21 . ARG A 1 34 ? -5.694 4.400  -2.339  1.00 0.00 ? 51 ARG A HH21 9  
ATOM   6079  H HH22 . ARG A 1 34 ? -6.435 4.896  -0.830  1.00 0.00 ? 51 ARG A HH22 9  
ATOM   6080  N N    . ILE A 1 35 ? 3.512  6.147  -3.431  1.00 0.00 ? 52 ILE A N    9  
ATOM   6081  C CA   . ILE A 1 35 ? 4.865  6.633  -3.190  1.00 0.00 ? 52 ILE A CA   9  
ATOM   6082  C C    . ILE A 1 35 ? 4.850  8.040  -2.607  1.00 0.00 ? 52 ILE A C    9  
ATOM   6083  O O    . ILE A 1 35 ? 4.395  8.985  -3.253  1.00 0.00 ? 52 ILE A O    9  
ATOM   6084  C CB   . ILE A 1 35 ? 5.705  6.631  -4.480  1.00 0.00 ? 52 ILE A CB   9  
ATOM   6085  C CG1  . ILE A 1 35 ? 5.760  5.223  -5.078  1.00 0.00 ? 52 ILE A CG1  9  
ATOM   6086  C CG2  . ILE A 1 35 ? 7.106  7.151  -4.204  1.00 0.00 ? 52 ILE A CG2  9  
ATOM   6087  C CD1  . ILE A 1 35 ? 6.377  5.169  -6.458  1.00 0.00 ? 52 ILE A CD1  9  
ATOM   6088  H H    . ILE A 1 35 ? 3.024  6.444  -4.264  1.00 0.00 ? 52 ILE A H    9  
ATOM   6089  H HA   . ILE A 1 35 ? 5.361  6.026  -2.433  1.00 0.00 ? 52 ILE A HA   9  
ATOM   6090  H HB   . ILE A 1 35 ? 5.220  7.267  -5.221  1.00 0.00 ? 52 ILE A HB   9  
ATOM   6091  H HG12 . ILE A 1 35 ? 6.342  4.604  -4.396  1.00 0.00 ? 52 ILE A HG12 9  
ATOM   6092  H HG13 . ILE A 1 35 ? 4.737  4.848  -5.123  1.00 0.00 ? 52 ILE A HG13 9  
ATOM   6093  H HG21 . ILE A 1 35 ? 7.686  7.142  -5.126  1.00 0.00 ? 52 ILE A HG21 9  
ATOM   6094  H HG22 . ILE A 1 35 ? 7.047  8.169  -3.822  1.00 0.00 ? 52 ILE A HG22 9  
ATOM   6095  H HG23 . ILE A 1 35 ? 7.592  6.514  -3.464  1.00 0.00 ? 52 ILE A HG23 9  
ATOM   6096  H HD11 . ILE A 1 35 ? 7.400  5.541  -6.415  1.00 0.00 ? 52 ILE A HD11 9  
ATOM   6097  H HD12 . ILE A 1 35 ? 6.381  4.139  -6.816  1.00 0.00 ? 52 ILE A HD12 9  
ATOM   6098  H HD13 . ILE A 1 35 ? 5.794  5.787  -7.142  1.00 0.00 ? 52 ILE A HD13 9  
ATOM   6099  N N    . ILE A 1 36 ? 5.349  8.174  -1.383  1.00 0.00 ? 53 ILE A N    9  
ATOM   6100  C CA   . ILE A 1 36 ? 5.466  9.477  -0.742  1.00 0.00 ? 53 ILE A CA   9  
ATOM   6101  C C    . ILE A 1 36 ? 6.858  10.064 -0.939  1.00 0.00 ? 53 ILE A C    9  
ATOM   6102  O O    . ILE A 1 36 ? 7.863  9.406  -0.674  1.00 0.00 ? 53 ILE A O    9  
ATOM   6103  C CB   . ILE A 1 36 ? 5.163  9.395  0.766   1.00 0.00 ? 53 ILE A CB   9  
ATOM   6104  C CG1  . ILE A 1 36 ? 3.734  8.899  0.997   1.00 0.00 ? 53 ILE A CG1  9  
ATOM   6105  C CG2  . ILE A 1 36 ? 5.373  10.750 1.426   1.00 0.00 ? 53 ILE A CG2  9  
ATOM   6106  C CD1  . ILE A 1 36 ? 3.431  8.554  2.437   1.00 0.00 ? 53 ILE A CD1  9  
ATOM   6107  H H    . ILE A 1 36 ? 5.654  7.350  -0.883  1.00 0.00 ? 53 ILE A H    9  
ATOM   6108  H HA   . ILE A 1 36 ? 4.794  10.197 -1.207  1.00 0.00 ? 53 ILE A HA   9  
ATOM   6109  H HB   . ILE A 1 36 ? 5.827  8.662  1.222   1.00 0.00 ? 53 ILE A HB   9  
ATOM   6110  H HG12 . ILE A 1 36 ? 3.058  9.687  0.663   1.00 0.00 ? 53 ILE A HG12 9  
ATOM   6111  H HG13 . ILE A 1 36 ? 3.593  8.015  0.374   1.00 0.00 ? 53 ILE A HG13 9  
ATOM   6112  H HG21 . ILE A 1 36 ? 5.154  10.674 2.490   1.00 0.00 ? 53 ILE A HG21 9  
ATOM   6113  H HG22 . ILE A 1 36 ? 6.407  11.064 1.290   1.00 0.00 ? 53 ILE A HG22 9  
ATOM   6114  H HG23 . ILE A 1 36 ? 4.708  11.484 0.970   1.00 0.00 ? 53 ILE A HG23 9  
ATOM   6115  H HD11 . ILE A 1 36 ? 3.570  9.436  3.060   1.00 0.00 ? 53 ILE A HD11 9  
ATOM   6116  H HD12 . ILE A 1 36 ? 2.400  8.210  2.522   1.00 0.00 ? 53 ILE A HD12 9  
ATOM   6117  H HD13 . ILE A 1 36 ? 4.105  7.764  2.772   1.00 0.00 ? 53 ILE A HD13 9  
ATOM   6118  N N    . TYR A 1 37 ? 6.908  11.308 -1.405  1.00 0.00 ? 54 TYR A N    9  
ATOM   6119  C CA   . TYR A 1 37 ? 8.170  11.931 -1.788  1.00 0.00 ? 54 TYR A CA   9  
ATOM   6120  C C    . TYR A 1 37 ? 8.606  12.970 -0.763  1.00 0.00 ? 54 TYR A C    9  
ATOM   6121  O O    . TYR A 1 37 ? 7.967  14.011 -0.610  1.00 0.00 ? 54 TYR A O    9  
ATOM   6122  C CB   . TYR A 1 37 ? 8.050  12.576 -3.171  1.00 0.00 ? 54 TYR A CB   9  
ATOM   6123  C CG   . TYR A 1 37 ? 7.819  11.587 -4.291  1.00 0.00 ? 54 TYR A CG   9  
ATOM   6124  C CD1  . TYR A 1 37 ? 8.871  10.853 -4.819  1.00 0.00 ? 54 TYR A CD1  9  
ATOM   6125  C CD2  . TYR A 1 37 ? 6.552  11.391 -4.820  1.00 0.00 ? 54 TYR A CD2  9  
ATOM   6126  C CE1  . TYR A 1 37 ? 8.667  9.948  -5.843  1.00 0.00 ? 54 TYR A CE1  9  
ATOM   6127  C CE2  . TYR A 1 37 ? 6.335  10.489 -5.843  1.00 0.00 ? 54 TYR A CE2  9  
ATOM   6128  C CZ   . TYR A 1 37 ? 7.397  9.769  -6.352  1.00 0.00 ? 54 TYR A CZ   9  
ATOM   6129  O OH   . TYR A 1 37 ? 7.189  8.869  -7.373  1.00 0.00 ? 54 TYR A OH   9  
ATOM   6130  H H    . TYR A 1 37 ? 6.052  11.835 -1.495  1.00 0.00 ? 54 TYR A H    9  
ATOM   6131  H HA   . TYR A 1 37 ? 8.960  11.179 -1.823  1.00 0.00 ? 54 TYR A HA   9  
ATOM   6132  H HB2  . TYR A 1 37 ? 7.215  13.278 -3.127  1.00 0.00 ? 54 TYR A HB2  9  
ATOM   6133  H HB3  . TYR A 1 37 ? 8.975  13.123 -3.353  1.00 0.00 ? 54 TYR A HB3  9  
ATOM   6134  H HD1  . TYR A 1 37 ? 9.872  10.999 -4.412  1.00 0.00 ? 54 TYR A HD1  9  
ATOM   6135  H HD2  . TYR A 1 37 ? 5.718  11.964 -4.412  1.00 0.00 ? 54 TYR A HD2  9  
ATOM   6136  H HE1  . TYR A 1 37 ? 9.506  9.380  -6.243  1.00 0.00 ? 54 TYR A HE1  9  
ATOM   6137  H HE2  . TYR A 1 37 ? 5.334  10.346 -6.248  1.00 0.00 ? 54 TYR A HE2  9  
ATOM   6138  H HH   . TYR A 1 37 ? 7.992  8.425  -7.651  1.00 0.00 ? 54 TYR A HH   9  
ATOM   6139  N N    . ASP A 1 38 ? 9.696  12.681 -0.062  1.00 0.00 ? 55 ASP A N    9  
ATOM   6140  C CA   . ASP A 1 38 ? 10.243 13.606 0.924   1.00 0.00 ? 55 ASP A CA   9  
ATOM   6141  C C    . ASP A 1 38 ? 11.142 14.646 0.265   1.00 0.00 ? 55 ASP A C    9  
ATOM   6142  O O    . ASP A 1 38 ? 12.225 14.324 -0.221  1.00 0.00 ? 55 ASP A O    9  
ATOM   6143  C CB   . ASP A 1 38 ? 11.020 12.847 2.001   1.00 0.00 ? 55 ASP A CB   9  
ATOM   6144  C CG   . ASP A 1 38 ? 11.581 13.726 3.110   1.00 0.00 ? 55 ASP A CG   9  
ATOM   6145  O OD1  . ASP A 1 38 ? 11.470 14.925 3.004   1.00 0.00 ? 55 ASP A OD1  9  
ATOM   6146  O OD2  . ASP A 1 38 ? 11.973 13.194 4.122   1.00 0.00 ? 55 ASP A OD2  9  
ATOM   6147  H H    . ASP A 1 38 ? 10.160 11.796 -0.216  1.00 0.00 ? 55 ASP A H    9  
ATOM   6148  H HA   . ASP A 1 38 ? 9.431  14.157 1.402   1.00 0.00 ? 55 ASP A HA   9  
ATOM   6149  H HB2  . ASP A 1 38 ? 10.458 12.022 2.441   1.00 0.00 ? 55 ASP A HB2  9  
ATOM   6150  H HB3  . ASP A 1 38 ? 11.840 12.450 1.402   1.00 0.00 ? 55 ASP A HB3  9  
ATOM   6151  N N    . ARG A 1 39 ? 10.684 15.893 0.252   1.00 0.00 ? 56 ARG A N    9  
ATOM   6152  C CA   . ARG A 1 39 ? 11.405 16.966 -0.422  1.00 0.00 ? 56 ARG A CA   9  
ATOM   6153  C C    . ARG A 1 39 ? 12.554 17.482 0.435   1.00 0.00 ? 56 ARG A C    9  
ATOM   6154  O O    . ARG A 1 39 ? 12.368 17.806 1.609   1.00 0.00 ? 56 ARG A O    9  
ATOM   6155  C CB   . ARG A 1 39 ? 10.481 18.095 -0.853  1.00 0.00 ? 56 ARG A CB   9  
ATOM   6156  C CG   . ARG A 1 39 ? 10.981 18.916 -2.032  1.00 0.00 ? 56 ARG A CG   9  
ATOM   6157  C CD   . ARG A 1 39 ? 10.042 19.974 -2.484  1.00 0.00 ? 56 ARG A CD   9  
ATOM   6158  N NE   . ARG A 1 39 ? 9.983  21.139 -1.615  1.00 0.00 ? 56 ARG A NE   9  
ATOM   6159  C CZ   . ARG A 1 39 ? 9.136  22.175 -1.780  1.00 0.00 ? 56 ARG A CZ   9  
ATOM   6160  N NH1  . ARG A 1 39 ? 8.304  22.213 -2.796  1.00 0.00 ? 56 ARG A NH1  9  
ATOM   6161  N NH2  . ARG A 1 39 ? 9.182  23.163 -0.905  1.00 0.00 ? 56 ARG A NH2  9  
ATOM   6162  H H    . ARG A 1 39 ? 9.815  16.103 0.721   1.00 0.00 ? 56 ARG A H    9  
ATOM   6163  H HA   . ARG A 1 39 ? 11.850 16.589 -1.344  1.00 0.00 ? 56 ARG A HA   9  
ATOM   6164  H HB2  . ARG A 1 39 ? 9.525  17.644 -1.109  1.00 0.00 ? 56 ARG A HB2  9  
ATOM   6165  H HB3  . ARG A 1 39 ? 10.355 18.749 0.010   1.00 0.00 ? 56 ARG A HB3  9  
ATOM   6166  H HG2  . ARG A 1 39 ? 11.917 19.397 -1.748  1.00 0.00 ? 56 ARG A HG2  9  
ATOM   6167  H HG3  . ARG A 1 39 ? 11.159 18.243 -2.871  1.00 0.00 ? 56 ARG A HG3  9  
ATOM   6168  H HD2  . ARG A 1 39 ? 10.345 20.318 -3.472  1.00 0.00 ? 56 ARG A HD2  9  
ATOM   6169  H HD3  . ARG A 1 39 ? 9.037  19.555 -2.537  1.00 0.00 ? 56 ARG A HD3  9  
ATOM   6170  H HE   . ARG A 1 39 ? 10.530 21.359 -0.794  1.00 0.00 ? 56 ARG A HE   9  
ATOM   6171  H HH11 . ARG A 1 39 ? 8.294  21.458 -3.467  1.00 0.00 ? 56 ARG A HH11 9  
ATOM   6172  H HH12 . ARG A 1 39 ? 7.677  22.998 -2.902  1.00 0.00 ? 56 ARG A HH12 9  
ATOM   6173  H HH21 . ARG A 1 39 ? 9.841  23.126 -0.138  1.00 0.00 ? 56 ARG A HH21 9  
ATOM   6174  H HH22 . ARG A 1 39 ? 8.560  23.951 -1.005  1.00 0.00 ? 56 ARG A HH22 9  
ATOM   6175  N N    . LYS A 1 40 ? 13.741 17.554 -0.157  1.00 0.00 ? 57 LYS A N    9  
ATOM   6176  C CA   . LYS A 1 40 ? 14.899 18.131 0.517   1.00 0.00 ? 57 LYS A CA   9  
ATOM   6177  C C    . LYS A 1 40 ? 14.567 19.492 1.114   1.00 0.00 ? 57 LYS A C    9  
ATOM   6178  O O    . LYS A 1 40 ? 15.000 19.818 2.219   1.00 0.00 ? 57 LYS A O    9  
ATOM   6179  C CB   . LYS A 1 40 ? 16.075 18.253 -0.452  1.00 0.00 ? 57 LYS A CB   9  
ATOM   6180  C CG   . LYS A 1 40 ? 17.326 18.876 0.154   1.00 0.00 ? 57 LYS A CG   9  
ATOM   6181  C CD   . LYS A 1 40 ? 18.469 18.910 -0.850  1.00 0.00 ? 57 LYS A CD   9  
ATOM   6182  C CE   . LYS A 1 40 ? 19.704 19.577 -0.263  1.00 0.00 ? 57 LYS A CE   9  
ATOM   6183  N NZ   . LYS A 1 40 ? 20.839 19.595 -1.226  1.00 0.00 ? 57 LYS A NZ   9  
ATOM   6184  H H    . LYS A 1 40 ? 13.844 17.201 -1.097  1.00 0.00 ? 57 LYS A H    9  
ATOM   6185  H HA   . LYS A 1 40 ? 15.198 17.492 1.348   1.00 0.00 ? 57 LYS A HA   9  
ATOM   6186  H HB2  . LYS A 1 40 ? 16.305 17.248 -0.805  1.00 0.00 ? 57 LYS A HB2  9  
ATOM   6187  H HB3  . LYS A 1 40 ? 15.737 18.863 -1.291  1.00 0.00 ? 57 LYS A HB3  9  
ATOM   6188  H HG2  . LYS A 1 40 ? 17.089 19.892 0.469   1.00 0.00 ? 57 LYS A HG2  9  
ATOM   6189  H HG3  . LYS A 1 40 ? 17.622 18.286 1.020   1.00 0.00 ? 57 LYS A HG3  9  
ATOM   6190  H HD2  . LYS A 1 40 ? 18.711 17.886 -1.138  1.00 0.00 ? 57 LYS A HD2  9  
ATOM   6191  H HD3  . LYS A 1 40 ? 18.142 19.465 -1.730  1.00 0.00 ? 57 LYS A HD3  9  
ATOM   6192  H HE2  . LYS A 1 40 ? 19.444 20.598 0.010   1.00 0.00 ? 57 LYS A HE2  9  
ATOM   6193  H HE3  . LYS A 1 40 ? 19.996 19.027 0.631   1.00 0.00 ? 57 LYS A HE3  9  
ATOM   6194  H HZ1  . LYS A 1 40 ? 20.569 20.106 -2.054  1.00 0.00 ? 57 LYS A HZ1  9  
ATOM   6195  H HZ2  . LYS A 1 40 ? 21.636 20.044 -0.798  1.00 0.00 ? 57 LYS A HZ2  9  
ATOM   6196  H HZ3  . LYS A 1 40 ? 21.081 18.648 -1.479  1.00 0.00 ? 57 LYS A HZ3  9  
ATOM   6197  N N    . PHE A 1 41 ? 13.798 20.284 0.376   1.00 0.00 ? 58 PHE A N    9  
ATOM   6198  C CA   . PHE A 1 41 ? 13.445 21.632 0.809   1.00 0.00 ? 58 PHE A CA   9  
ATOM   6199  C C    . PHE A 1 41 ? 11.979 21.715 1.212   1.00 0.00 ? 58 PHE A C    9  
ATOM   6200  O O    . PHE A 1 41 ? 11.323 22.735 0.996   1.00 0.00 ? 58 PHE A O    9  
ATOM   6201  C CB   . PHE A 1 41 ? 13.747 22.645 -0.297  1.00 0.00 ? 58 PHE A CB   9  
ATOM   6202  C CG   . PHE A 1 41 ? 15.185 22.661 -0.730  1.00 0.00 ? 58 PHE A CG   9  
ATOM   6203  C CD1  . PHE A 1 41 ? 16.167 23.188 0.095   1.00 0.00 ? 58 PHE A CD1  9  
ATOM   6204  C CD2  . PHE A 1 41 ? 15.558 22.146 -1.963  1.00 0.00 ? 58 PHE A CD2  9  
ATOM   6205  C CE1  . PHE A 1 41 ? 17.490 23.204 -0.302  1.00 0.00 ? 58 PHE A CE1  9  
ATOM   6206  C CE2  . PHE A 1 41 ? 16.882 22.160 -2.361  1.00 0.00 ? 58 PHE A CE2  9  
ATOM   6207  C CZ   . PHE A 1 41 ? 17.847 22.689 -1.533  1.00 0.00 ? 58 PHE A CZ   9  
ATOM   6208  H H    . PHE A 1 41 ? 13.446 19.945 -0.508  1.00 0.00 ? 58 PHE A H    9  
ATOM   6209  H HA   . PHE A 1 41 ? 14.026 21.899 1.693   1.00 0.00 ? 58 PHE A HA   9  
ATOM   6210  H HB2  . PHE A 1 41 ? 13.156 22.419 -1.184  1.00 0.00 ? 58 PHE A HB2  9  
ATOM   6211  H HB3  . PHE A 1 41 ? 13.514 23.653 0.045   1.00 0.00 ? 58 PHE A HB3  9  
ATOM   6212  H HD1  . PHE A 1 41 ? 15.885 23.595 1.066   1.00 0.00 ? 58 PHE A HD1  9  
ATOM   6213  H HD2  . PHE A 1 41 ? 14.794 21.728 -2.619  1.00 0.00 ? 58 PHE A HD2  9  
ATOM   6214  H HE1  . PHE A 1 41 ? 18.252 23.624 0.354   1.00 0.00 ? 58 PHE A HE1  9  
ATOM   6215  H HE2  . PHE A 1 41 ? 17.162 21.752 -3.333  1.00 0.00 ? 58 PHE A HE2  9  
ATOM   6216  H HZ   . PHE A 1 41 ? 18.890 22.700 -1.846  1.00 0.00 ? 58 PHE A HZ   9  
ATOM   6217  N N    . LEU A 1 42 ? 11.469 20.638 1.797   1.00 0.00 ? 59 LEU A N    9  
ATOM   6218  C CA   . LEU A 1 42 ? 10.076 20.585 2.226   1.00 0.00 ? 59 LEU A CA   9  
ATOM   6219  C C    . LEU A 1 42 ? 9.765  21.694 3.222   1.00 0.00 ? 59 LEU A C    9  
ATOM   6220  O O    . LEU A 1 42 ? 10.432 21.827 4.248   1.00 0.00 ? 59 LEU A O    9  
ATOM   6221  C CB   . LEU A 1 42 ? 9.762  19.214 2.839   1.00 0.00 ? 59 LEU A CB   9  
ATOM   6222  C CG   . LEU A 1 42 ? 8.298  19.000 3.243   1.00 0.00 ? 59 LEU A CG   9  
ATOM   6223  C CD1  . LEU A 1 42 ? 7.401  19.070 2.014   1.00 0.00 ? 59 LEU A CD1  9  
ATOM   6224  C CD2  . LEU A 1 42 ? 8.153  17.655 3.939   1.00 0.00 ? 59 LEU A CD2  9  
ATOM   6225  H H    . LEU A 1 42 ? 12.061 19.833 1.950   1.00 0.00 ? 59 LEU A H    9  
ATOM   6226  H HA   . LEU A 1 42 ? 9.424  20.747 1.369   1.00 0.00 ? 59 LEU A HA   9  
ATOM   6227  H HB2  . LEU A 1 42 ? 10.013 18.580 1.991   1.00 0.00 ? 59 LEU A HB2  9  
ATOM   6228  H HB3  . LEU A 1 42 ? 10.424 18.984 3.674   1.00 0.00 ? 59 LEU A HB3  9  
ATOM   6229  H HG   . LEU A 1 42 ? 8.043  19.778 3.964   1.00 0.00 ? 59 LEU A HG   9  
ATOM   6230  H HD11 . LEU A 1 42 ? 6.363  18.918 2.310   1.00 0.00 ? 59 LEU A HD11 9  
ATOM   6231  H HD12 . LEU A 1 42 ? 7.503  20.049 1.545   1.00 0.00 ? 59 LEU A HD12 9  
ATOM   6232  H HD13 . LEU A 1 42 ? 7.694  18.296 1.306   1.00 0.00 ? 59 LEU A HD13 9  
ATOM   6233  H HD21 . LEU A 1 42 ? 8.781  17.637 4.831   1.00 0.00 ? 59 LEU A HD21 9  
ATOM   6234  H HD22 . LEU A 1 42 ? 7.112  17.505 4.227   1.00 0.00 ? 59 LEU A HD22 9  
ATOM   6235  H HD23 . LEU A 1 42 ? 8.462  16.859 3.262   1.00 0.00 ? 59 LEU A HD23 9  
ATOM   6236  N N    . LEU A 1 43 ? 8.747  22.491 2.913   1.00 0.00 ? 60 LEU A N    9  
ATOM   6237  C CA   . LEU A 1 43 ? 8.323  23.571 3.796   1.00 0.00 ? 60 LEU A CA   9  
ATOM   6238  C C    . LEU A 1 43 ? 7.654  23.027 5.051   1.00 0.00 ? 60 LEU A C    9  
ATOM   6239  O O    . LEU A 1 43 ? 6.652  22.316 4.973   1.00 0.00 ? 60 LEU A O    9  
ATOM   6240  C CB   . LEU A 1 43 ? 7.375  24.522 3.054   1.00 0.00 ? 60 LEU A CB   9  
ATOM   6241  C CG   . LEU A 1 43 ? 6.873  25.716 3.875   1.00 0.00 ? 60 LEU A CG   9  
ATOM   6242  C CD1  . LEU A 1 43 ? 8.038  26.628 4.236   1.00 0.00 ? 60 LEU A CD1  9  
ATOM   6243  C CD2  . LEU A 1 43 ? 5.821  26.474 3.081   1.00 0.00 ? 60 LEU A CD2  9  
ATOM   6244  H H    . LEU A 1 43 ? 8.253  22.343 2.045   1.00 0.00 ? 60 LEU A H    9  
ATOM   6245  H HA   . LEU A 1 43 ? 9.196  24.133 4.129   1.00 0.00 ? 60 LEU A HA   9  
ATOM   6246  H HB2  . LEU A 1 43 ? 8.046  24.864 2.269   1.00 0.00 ? 60 LEU A HB2  9  
ATOM   6247  H HB3  . LEU A 1 43 ? 6.536  23.987 2.608   1.00 0.00 ? 60 LEU A HB3  9  
ATOM   6248  H HG   . LEU A 1 43 ? 6.393  25.315 4.769   1.00 0.00 ? 60 LEU A HG   9  
ATOM   6249  H HD11 . LEU A 1 43 ? 7.673  27.473 4.820   1.00 0.00 ? 60 LEU A HD11 9  
ATOM   6250  H HD12 . LEU A 1 43 ? 8.768  26.072 4.824   1.00 0.00 ? 60 LEU A HD12 9  
ATOM   6251  H HD13 . LEU A 1 43 ? 8.509  26.994 3.324   1.00 0.00 ? 60 LEU A HD13 9  
ATOM   6252  H HD21 . LEU A 1 43 ? 4.985  25.811 2.857   1.00 0.00 ? 60 LEU A HD21 9  
ATOM   6253  H HD22 . LEU A 1 43 ? 5.464  27.323 3.666   1.00 0.00 ? 60 LEU A HD22 9  
ATOM   6254  H HD23 . LEU A 1 43 ? 6.258  26.833 2.148   1.00 0.00 ? 60 LEU A HD23 9  
ATOM   6255  N N    . ASP A 1 44 ? 8.213  23.365 6.208   1.00 0.00 ? 61 ASP A N    9  
ATOM   6256  C CA   . ASP A 1 44 ? 7.654  22.936 7.484   1.00 0.00 ? 61 ASP A CA   9  
ATOM   6257  C C    . ASP A 1 44 ? 6.522  23.854 7.926   1.00 0.00 ? 61 ASP A C    9  
ATOM   6258  O O    . ASP A 1 44 ? 6.717  24.739 8.759   1.00 0.00 ? 61 ASP A O    9  
ATOM   6259  C CB   . ASP A 1 44 ? 8.743  22.890 8.559   1.00 0.00 ? 61 ASP A CB   9  
ATOM   6260  C CG   . ASP A 1 44 ? 8.290  22.302 9.889   1.00 0.00 ? 61 ASP A CG   9  
ATOM   6261  O OD1  . ASP A 1 44 ? 7.149  21.917 9.988   1.00 0.00 ? 61 ASP A OD1  9  
ATOM   6262  O OD2  . ASP A 1 44 ? 9.122  22.097 10.739  1.00 0.00 ? 61 ASP A OD2  9  
ATOM   6263  H H    . ASP A 1 44 ? 9.048  23.935 6.203   1.00 0.00 ? 61 ASP A H    9  
ATOM   6264  H HA   . ASP A 1 44 ? 7.224  21.939 7.382   1.00 0.00 ? 61 ASP A HA   9  
ATOM   6265  H HB2  . ASP A 1 44 ? 9.655  22.388 8.233   1.00 0.00 ? 61 ASP A HB2  9  
ATOM   6266  H HB3  . ASP A 1 44 ? 8.937  23.956 8.681   1.00 0.00 ? 61 ASP A HB3  9  
ATOM   6267  N N    . ARG A 1 45 ? 5.338  23.637 7.364   1.00 0.00 ? 62 ARG A N    9  
ATOM   6268  C CA   . ARG A 1 45 ? 4.168  24.439 7.705   1.00 0.00 ? 62 ARG A CA   9  
ATOM   6269  C C    . ARG A 1 45 ? 3.690  24.141 9.120   1.00 0.00 ? 62 ARG A C    9  
ATOM   6270  O O    . ARG A 1 45 ? 4.247  24.640 10.059  1.00 0.00 ? 62 ARG A O    9  
ATOM   6271  C CB   . ARG A 1 45 ? 3.045  24.277 6.692   1.00 0.00 ? 62 ARG A CB   9  
ATOM   6272  C CG   . ARG A 1 45 ? 3.342  24.844 5.312   1.00 0.00 ? 62 ARG A CG   9  
ATOM   6273  C CD   . ARG A 1 45 ? 2.148  24.990 4.441   1.00 0.00 ? 62 ARG A CD   9  
ATOM   6274  N NE   . ARG A 1 45 ? 1.123  25.879 4.966   1.00 0.00 ? 62 ARG A NE   9  
ATOM   6275  C CZ   . ARG A 1 45 ? -0.137 25.957 4.495   1.00 0.00 ? 62 ARG A CZ   9  
ATOM   6276  N NH1  . ARG A 1 45 ? -0.523 25.232 3.468   1.00 0.00 ? 62 ARG A NH1  9  
ATOM   6277  N NH2  . ARG A 1 45 ? -0.970 26.801 5.078   1.00 0.00 ? 62 ARG A NH2  9  
ATOM   6278  O OXT  . ARG A 1 45 ? 2.758  23.408 9.296   1.00 0.00 ? 62 ARG A OXT  9  
ATOM   6279  H H    . ARG A 1 45 ? 5.245  22.897 6.682   1.00 0.00 ? 62 ARG A H    9  
ATOM   6280  H HA   . ARG A 1 45 ? 4.428  25.497 7.681   1.00 0.00 ? 62 ARG A HA   9  
ATOM   6281  H HB2  . ARG A 1 45 ? 2.846  23.210 6.606   1.00 0.00 ? 62 ARG A HB2  9  
ATOM   6282  H HB3  . ARG A 1 45 ? 2.170  24.777 7.105   1.00 0.00 ? 62 ARG A HB3  9  
ATOM   6283  H HG2  . ARG A 1 45 ? 3.791  25.830 5.432   1.00 0.00 ? 62 ARG A HG2  9  
ATOM   6284  H HG3  . ARG A 1 45 ? 4.046  24.181 4.809   1.00 0.00 ? 62 ARG A HG3  9  
ATOM   6285  H HD2  . ARG A 1 45 ? 2.460  25.386 3.476   1.00 0.00 ? 62 ARG A HD2  9  
ATOM   6286  H HD3  . ARG A 1 45 ? 1.690  24.011 4.301   1.00 0.00 ? 62 ARG A HD3  9  
ATOM   6287  H HE   . ARG A 1 45 ? 1.175  26.546 5.724   1.00 0.00 ? 62 ARG A HE   9  
ATOM   6288  H HH11 . ARG A 1 45 ? 0.132  24.605 3.022   1.00 0.00 ? 62 ARG A HH11 9  
ATOM   6289  H HH12 . ARG A 1 45 ? -1.471 25.306 3.130   1.00 0.00 ? 62 ARG A HH12 9  
ATOM   6290  H HH21 . ARG A 1 45 ? -0.652 27.364 5.856   1.00 0.00 ? 62 ARG A HH21 9  
ATOM   6291  H HH22 . ARG A 1 45 ? -1.919 26.880 4.745   1.00 0.00 ? 62 ARG A HH22 9  
ATOM   6292  N N    . PRO A 1 1  ? 0.028  0.046  -0.454  1.00 0.00 ? 18 PRO A N    10 
ATOM   6293  C CA   . PRO A 1 1  ? 1.346  0.084  0.167   1.00 0.00 ? 18 PRO A CA   10 
ATOM   6294  C C    . PRO A 1 1  ? 1.981  1.461  0.030   1.00 0.00 ? 18 PRO A C    10 
ATOM   6295  O O    . PRO A 1 1  ? 1.634  2.229  -0.868  1.00 0.00 ? 18 PRO A O    10 
ATOM   6296  C CB   . PRO A 1 1  ? 2.141  -0.994 -0.577  1.00 0.00 ? 18 PRO A CB   10 
ATOM   6297  C CG   . PRO A 1 1  ? 1.536  -1.029 -1.939  1.00 0.00 ? 18 PRO A CG   10 
ATOM   6298  C CD   . PRO A 1 1  ? 0.069  -0.758 -1.731  1.00 0.00 ? 18 PRO A CD   10 
ATOM   6299  H H2   . PRO A 1 1  ? -0.154 -0.590 -1.204  1.00 0.00 ? 18 PRO A H2   10 
ATOM   6300  H H3   . PRO A 1 1  ? -0.778 -0.174 0.096   1.00 0.00 ? 18 PRO A H3   10 
ATOM   6301  H HA   . PRO A 1 1  ? 1.313  -0.107 1.250   1.00 0.00 ? 18 PRO A HA   10 
ATOM   6302  H HB2  . PRO A 1 1  ? 3.212  -0.746 -0.623  1.00 0.00 ? 18 PRO A HB2  10 
ATOM   6303  H HB3  . PRO A 1 1  ? 2.059  -1.972 -0.080  1.00 0.00 ? 18 PRO A HB3  10 
ATOM   6304  H HG2  . PRO A 1 1  ? 1.988  -0.270 -2.595  1.00 0.00 ? 18 PRO A HG2  10 
ATOM   6305  H HG3  . PRO A 1 1  ? 1.694  -2.005 -2.419  1.00 0.00 ? 18 PRO A HG3  10 
ATOM   6306  H HD2  . PRO A 1 1  ? -0.371 -0.190 -2.564  1.00 0.00 ? 18 PRO A HD2  10 
ATOM   6307  H HD3  . PRO A 1 1  ? -0.514 -1.685 -1.629  1.00 0.00 ? 18 PRO A HD3  10 
ATOM   6308  N N    . THR A 1 2  ? 2.913  1.769  0.926   1.00 0.00 ? 19 THR A N    10 
ATOM   6309  C CA   . THR A 1 2  ? 3.579  3.067  0.923   1.00 0.00 ? 19 THR A CA   10 
ATOM   6310  C C    . THR A 1 2  ? 5.067  2.921  0.632   1.00 0.00 ? 19 THR A C    10 
ATOM   6311  O O    . THR A 1 2  ? 5.755  2.113  1.254   1.00 0.00 ? 19 THR A O    10 
ATOM   6312  C CB   . THR A 1 2  ? 3.399  3.796  2.267   1.00 0.00 ? 19 THR A CB   10 
ATOM   6313  O OG1  . THR A 1 2  ? 2.003  4.006  2.517   1.00 0.00 ? 19 THR A OG1  10 
ATOM   6314  C CG2  . THR A 1 2  ? 4.113  5.139  2.245   1.00 0.00 ? 19 THR A CG2  10 
ATOM   6315  H H    . THR A 1 2  ? 3.168  1.088  1.626   1.00 0.00 ? 19 THR A H    10 
ATOM   6316  H HA   . THR A 1 2  ? 3.168  3.690  0.129   1.00 0.00 ? 19 THR A HA   10 
ATOM   6317  H HB   . THR A 1 2  ? 3.811  3.179  3.065   1.00 0.00 ? 19 THR A HB   10 
ATOM   6318  H HG1  . THR A 1 2  ? 1.892  4.461  3.355   1.00 0.00 ? 19 THR A HG1  10 
ATOM   6319  H HG21 . THR A 1 2  ? 3.700  5.757  1.450   1.00 0.00 ? 19 THR A HG21 10 
ATOM   6320  H HG22 . THR A 1 2  ? 3.975  5.640  3.203   1.00 0.00 ? 19 THR A HG22 10 
ATOM   6321  H HG23 . THR A 1 2  ? 5.177  4.981  2.068   1.00 0.00 ? 19 THR A HG23 10 
ATOM   6322  N N    . ARG A 1 3  ? 5.558  3.710  -0.318  1.00 0.00 ? 20 ARG A N    10 
ATOM   6323  C CA   . ARG A 1 3  ? 6.971  3.692  -0.675  1.00 0.00 ? 20 ARG A CA   10 
ATOM   6324  C C    . ARG A 1 3  ? 7.632  5.032  -0.376  1.00 0.00 ? 20 ARG A C    10 
ATOM   6325  O O    . ARG A 1 3  ? 7.132  6.084  -0.773  1.00 0.00 ? 20 ARG A O    10 
ATOM   6326  C CB   . ARG A 1 3  ? 7.194  3.272  -2.120  1.00 0.00 ? 20 ARG A CB   10 
ATOM   6327  C CG   . ARG A 1 3  ? 8.648  3.263  -2.567  1.00 0.00 ? 20 ARG A CG   10 
ATOM   6328  C CD   . ARG A 1 3  ? 8.855  2.816  -3.967  1.00 0.00 ? 20 ARG A CD   10 
ATOM   6329  N NE   . ARG A 1 3  ? 10.239 2.843  -4.411  1.00 0.00 ? 20 ARG A NE   10 
ATOM   6330  C CZ   . ARG A 1 3  ? 10.660 2.457  -5.631  1.00 0.00 ? 20 ARG A CZ   10 
ATOM   6331  N NH1  . ARG A 1 3  ? 9.817  1.979  -6.519  1.00 0.00 ? 20 ARG A NH1  10 
ATOM   6332  N NH2  . ARG A 1 3  ? 11.950 2.550  -5.905  1.00 0.00 ? 20 ARG A NH2  10 
ATOM   6333  H H    . ARG A 1 3  ? 4.936  4.338  -0.807  1.00 0.00 ? 20 ARG A H    10 
ATOM   6334  H HA   . ARG A 1 3  ? 7.494  2.947  -0.073  1.00 0.00 ? 20 ARG A HA   10 
ATOM   6335  H HB2  . ARG A 1 3  ? 6.779  2.271  -2.228  1.00 0.00 ? 20 ARG A HB2  10 
ATOM   6336  H HB3  . ARG A 1 3  ? 6.632  3.967  -2.743  1.00 0.00 ? 20 ARG A HB3  10 
ATOM   6337  H HG2  . ARG A 1 3  ? 9.046  4.273  -2.474  1.00 0.00 ? 20 ARG A HG2  10 
ATOM   6338  H HG3  . ARG A 1 3  ? 9.207  2.591  -1.912  1.00 0.00 ? 20 ARG A HG3  10 
ATOM   6339  H HD2  . ARG A 1 3  ? 8.501  1.790  -4.068  1.00 0.00 ? 20 ARG A HD2  10 
ATOM   6340  H HD3  . ARG A 1 3  ? 8.286  3.463  -4.634  1.00 0.00 ? 20 ARG A HD3  10 
ATOM   6341  H HE   . ARG A 1 3  ? 11.069 3.138  -3.914  1.00 0.00 ? 20 ARG A HE   10 
ATOM   6342  H HH11 . ARG A 1 3  ? 8.836  1.897  -6.287  1.00 0.00 ? 20 ARG A HH11 10 
ATOM   6343  H HH12 . ARG A 1 3  ? 10.152 1.694  -7.427  1.00 0.00 ? 20 ARG A HH12 10 
ATOM   6344  H HH21 . ARG A 1 3  ? 12.588 2.903  -5.204  1.00 0.00 ? 20 ARG A HH21 10 
ATOM   6345  H HH22 . ARG A 1 3  ? 12.293 2.267  -6.810  1.00 0.00 ? 20 ARG A HH22 10 
ATOM   6346  N N    . THR A 1 4  ? 8.758  4.985  0.328   1.00 0.00 ? 21 THR A N    10 
ATOM   6347  C CA   . THR A 1 4  ? 9.486  6.197  0.690   1.00 0.00 ? 21 THR A CA   10 
ATOM   6348  C C    . THR A 1 4  ? 10.592 6.495  -0.313  1.00 0.00 ? 21 THR A C    10 
ATOM   6349  O O    . THR A 1 4  ? 11.535 5.718  -0.462  1.00 0.00 ? 21 THR A O    10 
ATOM   6350  C CB   . THR A 1 4  ? 10.098 6.088  2.099   1.00 0.00 ? 21 THR A CB   10 
ATOM   6351  O OG1  . THR A 1 4  ? 9.055  5.894  3.063   1.00 0.00 ? 21 THR A OG1  10 
ATOM   6352  C CG2  . THR A 1 4  ? 10.873 7.352  2.442   1.00 0.00 ? 21 THR A CG2  10 
ATOM   6353  H H    . THR A 1 4  ? 9.121  4.089  0.619   1.00 0.00 ? 21 THR A H    10 
ATOM   6354  H HA   . THR A 1 4  ? 8.810  7.052  0.668   1.00 0.00 ? 21 THR A HA   10 
ATOM   6355  H HB   . THR A 1 4  ? 10.771 5.231  2.127   1.00 0.00 ? 21 THR A HB   10 
ATOM   6356  H HG1  . THR A 1 4  ? 9.440  5.827  3.940   1.00 0.00 ? 21 THR A HG1  10 
ATOM   6357  H HG21 . THR A 1 4  ? 10.201 8.208  2.414   1.00 0.00 ? 21 THR A HG21 10 
ATOM   6358  H HG22 . THR A 1 4  ? 11.298 7.255  3.441   1.00 0.00 ? 21 THR A HG22 10 
ATOM   6359  H HG23 . THR A 1 4  ? 11.674 7.495  1.717   1.00 0.00 ? 21 THR A HG23 10 
ATOM   6360  N N    . VAL A 1 5  ? 10.472 7.627  -0.998  1.00 0.00 ? 22 VAL A N    10 
ATOM   6361  C CA   . VAL A 1 5  ? 11.493 8.060  -1.945  1.00 0.00 ? 22 VAL A CA   10 
ATOM   6362  C C    . VAL A 1 5  ? 11.975 9.471  -1.629  1.00 0.00 ? 22 VAL A C    10 
ATOM   6363  O O    . VAL A 1 5  ? 11.171 10.381 -1.429  1.00 0.00 ? 22 VAL A O    10 
ATOM   6364  C CB   . VAL A 1 5  ? 10.973 8.020  -3.395  1.00 0.00 ? 22 VAL A CB   10 
ATOM   6365  C CG1  . VAL A 1 5  ? 12.020 8.569  -4.352  1.00 0.00 ? 22 VAL A CG1  10 
ATOM   6366  C CG2  . VAL A 1 5  ? 10.591 6.599  -3.784  1.00 0.00 ? 22 VAL A CG2  10 
ATOM   6367  H H    . VAL A 1 5  ? 9.654  8.202  -0.861  1.00 0.00 ? 22 VAL A H    10 
ATOM   6368  H HA   . VAL A 1 5  ? 12.386 7.438  -1.878  1.00 0.00 ? 22 VAL A HA   10 
ATOM   6369  H HB   . VAL A 1 5  ? 10.067 8.621  -3.463  1.00 0.00 ? 22 VAL A HB   10 
ATOM   6370  H HG11 . VAL A 1 5  ? 11.637 8.533  -5.371  1.00 0.00 ? 22 VAL A HG11 10 
ATOM   6371  H HG12 . VAL A 1 5  ? 12.249 9.601  -4.087  1.00 0.00 ? 22 VAL A HG12 10 
ATOM   6372  H HG13 . VAL A 1 5  ? 12.927 7.968  -4.285  1.00 0.00 ? 22 VAL A HG13 10 
ATOM   6373  H HG21 . VAL A 1 5  ? 9.810  6.237  -3.117  1.00 0.00 ? 22 VAL A HG21 10 
ATOM   6374  H HG22 . VAL A 1 5  ? 10.226 6.589  -4.810  1.00 0.00 ? 22 VAL A HG22 10 
ATOM   6375  H HG23 . VAL A 1 5  ? 11.466 5.954  -3.703  1.00 0.00 ? 22 VAL A HG23 10 
ATOM   6376  N N    . ALA A 1 6  ? 13.292 9.645  -1.585  1.00 0.00 ? 23 ALA A N    10 
ATOM   6377  C CA   . ALA A 1 6  ? 13.883 10.953 -1.327  1.00 0.00 ? 23 ALA A CA   10 
ATOM   6378  C C    . ALA A 1 6  ? 14.186 11.685 -2.629  1.00 0.00 ? 23 ALA A C    10 
ATOM   6379  O O    . ALA A 1 6  ? 14.738 11.106 -3.564  1.00 0.00 ? 23 ALA A O    10 
ATOM   6380  C CB   . ALA A 1 6  ? 15.145 10.807 -0.490  1.00 0.00 ? 23 ALA A CB   10 
ATOM   6381  H H    . ALA A 1 6  ? 13.898 8.851  -1.733  1.00 0.00 ? 23 ALA A H    10 
ATOM   6382  H HA   . ALA A 1 6  ? 13.165 11.557 -0.774  1.00 0.00 ? 23 ALA A HA   10 
ATOM   6383  H HB1  . ALA A 1 6  ? 15.867 10.192 -1.025  1.00 0.00 ? 23 ALA A HB1  10 
ATOM   6384  H HB2  . ALA A 1 6  ? 15.574 11.793 -0.308  1.00 0.00 ? 23 ALA A HB2  10 
ATOM   6385  H HB3  . ALA A 1 6  ? 14.899 10.336 0.462   1.00 0.00 ? 23 ALA A HB3  10 
ATOM   6386  N N    . ILE A 1 7  ? 13.822 12.962 -2.681  1.00 0.00 ? 24 ILE A N    10 
ATOM   6387  C CA   . ILE A 1 7  ? 14.097 13.790 -3.850  1.00 0.00 ? 24 ILE A CA   10 
ATOM   6388  C C    . ILE A 1 7  ? 14.646 15.151 -3.444  1.00 0.00 ? 24 ILE A C    10 
ATOM   6389  O O    . ILE A 1 7  ? 14.659 15.499 -2.263  1.00 0.00 ? 24 ILE A O    10 
ATOM   6390  C CB   . ILE A 1 7  ? 12.835 13.990 -4.708  1.00 0.00 ? 24 ILE A CB   10 
ATOM   6391  C CG1  . ILE A 1 7  ? 11.741 14.685 -3.895  1.00 0.00 ? 24 ILE A CG1  10 
ATOM   6392  C CG2  . ILE A 1 7  ? 12.338 12.656 -5.244  1.00 0.00 ? 24 ILE A CG2  10 
ATOM   6393  C CD1  . ILE A 1 7  ? 10.546 15.111 -4.717  1.00 0.00 ? 24 ILE A CD1  10 
ATOM   6394  H H    . ILE A 1 7  ? 13.344 13.370 -1.891  1.00 0.00 ? 24 ILE A H    10 
ATOM   6395  H HA   . ILE A 1 7  ? 14.883 13.345 -4.459  1.00 0.00 ? 24 ILE A HA   10 
ATOM   6396  H HB   . ILE A 1 7  ? 13.074 14.651 -5.542  1.00 0.00 ? 24 ILE A HB   10 
ATOM   6397  H HG12 . ILE A 1 7  ? 11.420 13.989 -3.121  1.00 0.00 ? 24 ILE A HG12 10 
ATOM   6398  H HG13 . ILE A 1 7  ? 12.191 15.562 -3.429  1.00 0.00 ? 24 ILE A HG13 10 
ATOM   6399  H HG21 . ILE A 1 7  ? 11.446 12.816 -5.849  1.00 0.00 ? 24 ILE A HG21 10 
ATOM   6400  H HG22 . ILE A 1 7  ? 13.114 12.199 -5.858  1.00 0.00 ? 24 ILE A HG22 10 
ATOM   6401  H HG23 . ILE A 1 7  ? 12.098 11.996 -4.411  1.00 0.00 ? 24 ILE A HG23 10 
ATOM   6402  H HD11 . ILE A 1 7  ? 10.093 14.236 -5.182  1.00 0.00 ? 24 ILE A HD11 10 
ATOM   6403  H HD12 . ILE A 1 7  ? 9.812  15.596 -4.071  1.00 0.00 ? 24 ILE A HD12 10 
ATOM   6404  H HD13 . ILE A 1 7  ? 10.864 15.808 -5.491  1.00 0.00 ? 24 ILE A HD13 10 
ATOM   6405  N N    . SER A 1 8  ? 15.099 15.918 -4.429  1.00 0.00 ? 25 SER A N    10 
ATOM   6406  C CA   . SER A 1 8  ? 15.626 17.254 -4.180  1.00 0.00 ? 25 SER A CA   10 
ATOM   6407  C C    . SER A 1 8  ? 14.501 18.262 -3.983  1.00 0.00 ? 25 SER A C    10 
ATOM   6408  O O    . SER A 1 8  ? 14.477 18.993 -2.993  1.00 0.00 ? 25 SER A O    10 
ATOM   6409  C CB   . SER A 1 8  ? 16.526 17.683 -5.323  1.00 0.00 ? 25 SER A CB   10 
ATOM   6410  O OG   . SER A 1 8  ? 17.681 16.894 -5.408  1.00 0.00 ? 25 SER A OG   10 
ATOM   6411  H H    . SER A 1 8  ? 15.079 15.566 -5.376  1.00 0.00 ? 25 SER A H    10 
ATOM   6412  H HA   . SER A 1 8  ? 16.315 17.297 -3.335  1.00 0.00 ? 25 SER A HA   10 
ATOM   6413  H HB2  . SER A 1 8  ? 15.969 17.597 -6.256  1.00 0.00 ? 25 SER A HB2  10 
ATOM   6414  H HB3  . SER A 1 8  ? 16.816 18.721 -5.169  1.00 0.00 ? 25 SER A HB3  10 
ATOM   6415  H HG   . SER A 1 8  ? 18.221 17.197 -6.142  1.00 0.00 ? 25 SER A HG   10 
ATOM   6416  N N    . ASP A 1 9  ? 13.572 18.297 -4.932  1.00 0.00 ? 26 ASP A N    10 
ATOM   6417  C CA   . ASP A 1 9  ? 12.488 19.271 -4.908  1.00 0.00 ? 26 ASP A CA   10 
ATOM   6418  C C    . ASP A 1 9  ? 11.353 18.855 -5.835  1.00 0.00 ? 26 ASP A C    10 
ATOM   6419  O O    . ASP A 1 9  ? 11.527 17.999 -6.700  1.00 0.00 ? 26 ASP A O    10 
ATOM   6420  C CB   . ASP A 1 9  ? 13.005 20.658 -5.299  1.00 0.00 ? 26 ASP A CB   10 
ATOM   6421  C CG   . ASP A 1 9  ? 12.150 21.813 -4.795  1.00 0.00 ? 26 ASP A CG   10 
ATOM   6422  O OD1  . ASP A 1 9  ? 11.148 21.557 -4.172  1.00 0.00 ? 26 ASP A OD1  10 
ATOM   6423  O OD2  . ASP A 1 9  ? 12.585 22.936 -4.897  1.00 0.00 ? 26 ASP A OD2  10 
ATOM   6424  H H    . ASP A 1 9  ? 13.617 17.630 -5.690  1.00 0.00 ? 26 ASP A H    10 
ATOM   6425  H HA   . ASP A 1 9  ? 12.065 19.328 -3.904  1.00 0.00 ? 26 ASP A HA   10 
ATOM   6426  H HB2  . ASP A 1 9  ? 14.046 20.828 -5.021  1.00 0.00 ? 26 ASP A HB2  10 
ATOM   6427  H HB3  . ASP A 1 9  ? 12.924 20.593 -6.384  1.00 0.00 ? 26 ASP A HB3  10 
ATOM   6428  N N    . ALA A 1 10 ? 10.189 19.469 -5.647  1.00 0.00 ? 27 ALA A N    10 
ATOM   6429  C CA   . ALA A 1 10 ? 9.037  19.201 -6.500  1.00 0.00 ? 27 ALA A CA   10 
ATOM   6430  C C    . ALA A 1 10 ? 9.302  19.634 -7.936  1.00 0.00 ? 27 ALA A C    10 
ATOM   6431  O O    . ALA A 1 10 ? 8.785  19.036 -8.880  1.00 0.00 ? 27 ALA A O    10 
ATOM   6432  C CB   . ALA A 1 10 ? 7.800  19.899 -5.952  1.00 0.00 ? 27 ALA A CB   10 
ATOM   6433  H H    . ALA A 1 10 ? 10.100 20.137 -4.894  1.00 0.00 ? 27 ALA A H    10 
ATOM   6434  H HA   . ALA A 1 10 ? 8.853  18.127 -6.513  1.00 0.00 ? 27 ALA A HA   10 
ATOM   6435  H HB1  . ALA A 1 10 ? 7.972  20.973 -5.918  1.00 0.00 ? 27 ALA A HB1  10 
ATOM   6436  H HB2  . ALA A 1 10 ? 6.949  19.689 -6.600  1.00 0.00 ? 27 ALA A HB2  10 
ATOM   6437  H HB3  . ALA A 1 10 ? 7.590  19.531 -4.947  1.00 0.00 ? 27 ALA A HB3  10 
ATOM   6438  N N    . ALA A 1 11 ? 10.109 20.677 -8.094  1.00 0.00 ? 28 ALA A N    10 
ATOM   6439  C CA   . ALA A 1 11 ? 10.557 21.107 -9.414  1.00 0.00 ? 28 ALA A CA   10 
ATOM   6440  C C    . ALA A 1 11 ? 11.406 20.034 -10.084 1.00 0.00 ? 28 ALA A C    10 
ATOM   6441  O O    . ALA A 1 11 ? 11.496 19.978 -11.311 1.00 0.00 ? 28 ALA A O    10 
ATOM   6442  C CB   . ALA A 1 11 ? 11.330 22.413 -9.312  1.00 0.00 ? 28 ALA A CB   10 
ATOM   6443  H H    . ALA A 1 11 ? 10.423 21.185 -7.280  1.00 0.00 ? 28 ALA A H    10 
ATOM   6444  H HA   . ALA A 1 11 ? 9.681  21.269 -10.044 1.00 0.00 ? 28 ALA A HA   10 
ATOM   6445  H HB1  . ALA A 1 11 ? 12.201 22.271 -8.674  1.00 0.00 ? 28 ALA A HB1  10 
ATOM   6446  H HB2  . ALA A 1 11 ? 11.656 22.720 -10.306 1.00 0.00 ? 28 ALA A HB2  10 
ATOM   6447  H HB3  . ALA A 1 11 ? 10.688 23.184 -8.888  1.00 0.00 ? 28 ALA A HB3  10 
ATOM   6448  N N    . GLN A 1 12 ? 12.025 19.185 -9.272  1.00 0.00 ? 29 GLN A N    10 
ATOM   6449  C CA   . GLN A 1 12 ? 12.870 18.112 -9.786  1.00 0.00 ? 29 GLN A CA   10 
ATOM   6450  C C    . GLN A 1 12 ? 12.132 16.780 -9.782  1.00 0.00 ? 29 GLN A C    10 
ATOM   6451  O O    . GLN A 1 12 ? 12.740 15.723 -9.945  1.00 0.00 ? 29 GLN A O    10 
ATOM   6452  C CB   . GLN A 1 12 ? 14.151 17.996 -8.956  1.00 0.00 ? 29 GLN A CB   10 
ATOM   6453  C CG   . GLN A 1 12 ? 14.932 19.293 -8.828  1.00 0.00 ? 29 GLN A CG   10 
ATOM   6454  C CD   . GLN A 1 12 ? 15.429 19.802 -10.168 1.00 0.00 ? 29 GLN A CD   10 
ATOM   6455  O OE1  . GLN A 1 12 ? 15.968 19.041 -10.976 1.00 0.00 ? 29 GLN A OE1  10 
ATOM   6456  N NE2  . GLN A 1 12 ? 15.256 21.096 -10.410 1.00 0.00 ? 29 GLN A NE2  10 
ATOM   6457  H H    . GLN A 1 12 ? 11.909 19.284 -8.274  1.00 0.00 ? 29 GLN A H    10 
ATOM   6458  H HA   . GLN A 1 12 ? 13.132 18.319 -10.823 1.00 0.00 ? 29 GLN A HA   10 
ATOM   6459  H HB2  . GLN A 1 12 ? 13.854 17.645 -7.966  1.00 0.00 ? 29 GLN A HB2  10 
ATOM   6460  H HB3  . GLN A 1 12 ? 14.770 17.239 -9.436  1.00 0.00 ? 29 GLN A HB3  10 
ATOM   6461  H HG2  . GLN A 1 12 ? 14.566 20.148 -8.260  1.00 0.00 ? 29 GLN A HG2  10 
ATOM   6462  H HG3  . GLN A 1 12 ? 15.770 18.838 -8.299  1.00 0.00 ? 29 GLN A HG3  10 
ATOM   6463  H HE21 . GLN A 1 12 ? 14.815 21.678 -9.726  1.00 0.00 ? 29 GLN A HE21 10 
ATOM   6464  H HE22 . GLN A 1 12 ? 15.564 21.490 -11.277 1.00 0.00 ? 29 GLN A HE22 10 
ATOM   6465  N N    . LEU A 1 13 ? 10.818 16.838 -9.596  1.00 0.00 ? 30 LEU A N    10 
ATOM   6466  C CA   . LEU A 1 13 ? 9.997  15.634 -9.545  1.00 0.00 ? 30 LEU A CA   10 
ATOM   6467  C C    . LEU A 1 13 ? 9.190  15.463 -10.826 1.00 0.00 ? 30 LEU A C    10 
ATOM   6468  O O    . LEU A 1 13 ? 8.276  16.240 -11.103 1.00 0.00 ? 30 LEU A O    10 
ATOM   6469  C CB   . LEU A 1 13 ? 9.064  15.678 -8.329  1.00 0.00 ? 30 LEU A CB   10 
ATOM   6470  C CG   . LEU A 1 13 ? 8.138  14.466 -8.171  1.00 0.00 ? 30 LEU A CG   10 
ATOM   6471  C CD1  . LEU A 1 13 ? 8.962  13.198 -7.990  1.00 0.00 ? 30 LEU A CD1  10 
ATOM   6472  C CD2  . LEU A 1 13 ? 7.214  14.682 -6.982  1.00 0.00 ? 30 LEU A CD2  10 
ATOM   6473  H H    . LEU A 1 13 ? 10.376 17.740 -9.487  1.00 0.00 ? 30 LEU A H    10 
ATOM   6474  H HA   . LEU A 1 13 ? 10.639 14.758 -9.467  1.00 0.00 ? 30 LEU A HA   10 
ATOM   6475  H HB2  . LEU A 1 13 ? 9.810  15.684 -7.535  1.00 0.00 ? 30 LEU A HB2  10 
ATOM   6476  H HB3  . LEU A 1 13 ? 8.489  16.603 -8.295  1.00 0.00 ? 30 LEU A HB3  10 
ATOM   6477  H HG   . LEU A 1 13 ? 7.520  14.412 -9.068  1.00 0.00 ? 30 LEU A HG   10 
ATOM   6478  H HD11 . LEU A 1 13 ? 8.296  12.343 -7.880  1.00 0.00 ? 30 LEU A HD11 10 
ATOM   6479  H HD12 . LEU A 1 13 ? 9.599  13.051 -8.863  1.00 0.00 ? 30 LEU A HD12 10 
ATOM   6480  H HD13 . LEU A 1 13 ? 9.583  13.293 -7.099  1.00 0.00 ? 30 LEU A HD13 10 
ATOM   6481  H HD21 . LEU A 1 13 ? 6.614  15.578 -7.145  1.00 0.00 ? 30 LEU A HD21 10 
ATOM   6482  H HD22 . LEU A 1 13 ? 6.556  13.820 -6.872  1.00 0.00 ? 30 LEU A HD22 10 
ATOM   6483  H HD23 . LEU A 1 13 ? 7.809  14.805 -6.076  1.00 0.00 ? 30 LEU A HD23 10 
ATOM   6484  N N    . PRO A 1 14 ? 9.533  14.442 -11.604 1.00 0.00 ? 31 PRO A N    10 
ATOM   6485  C CA   . PRO A 1 14 ? 8.871  14.196 -12.880 1.00 0.00 ? 31 PRO A CA   10 
ATOM   6486  C C    . PRO A 1 14 ? 7.383  13.935 -12.688 1.00 0.00 ? 31 PRO A C    10 
ATOM   6487  O O    . PRO A 1 14 ? 6.971  13.339 -11.692 1.00 0.00 ? 31 PRO A O    10 
ATOM   6488  C CB   . PRO A 1 14 ? 9.602  12.976 -13.451 1.00 0.00 ? 31 PRO A CB   10 
ATOM   6489  C CG   . PRO A 1 14 ? 10.934 12.995 -12.783 1.00 0.00 ? 31 PRO A CG   10 
ATOM   6490  C CD   . PRO A 1 14 ? 10.676 13.510 -11.392 1.00 0.00 ? 31 PRO A CD   10 
ATOM   6491  H HA   . PRO A 1 14 ? 8.922  15.059 -13.560 1.00 0.00 ? 31 PRO A HA   10 
ATOM   6492  H HB2  . PRO A 1 14 ? 9.059  12.044 -13.233 1.00 0.00 ? 31 PRO A HB2  10 
ATOM   6493  H HB3  . PRO A 1 14 ? 9.703  13.042 -14.543 1.00 0.00 ? 31 PRO A HB3  10 
ATOM   6494  H HG2  . PRO A 1 14 ? 11.380 11.989 -12.756 1.00 0.00 ? 31 PRO A HG2  10 
ATOM   6495  H HG3  . PRO A 1 14 ? 11.639 13.645 -13.321 1.00 0.00 ? 31 PRO A HG3  10 
ATOM   6496  H HD2  . PRO A 1 14 ? 10.413 12.704 -10.691 1.00 0.00 ? 31 PRO A HD2  10 
ATOM   6497  H HD3  . PRO A 1 14 ? 11.550 14.029 -10.971 1.00 0.00 ? 31 PRO A HD3  10 
ATOM   6498  N N    . HIS A 1 15 ? 6.580  14.384 -13.646 1.00 0.00 ? 32 HIS A N    10 
ATOM   6499  C CA   . HIS A 1 15 ? 5.166  14.031 -13.690 1.00 0.00 ? 32 HIS A CA   10 
ATOM   6500  C C    . HIS A 1 15 ? 4.975  12.574 -14.093 1.00 0.00 ? 32 HIS A C    10 
ATOM   6501  O O    . HIS A 1 15 ? 5.821  11.992 -14.770 1.00 0.00 ? 32 HIS A O    10 
ATOM   6502  C CB   . HIS A 1 15 ? 4.409  14.946 -14.657 1.00 0.00 ? 32 HIS A CB   10 
ATOM   6503  C CG   . HIS A 1 15 ? 4.094  16.294 -14.087 1.00 0.00 ? 32 HIS A CG   10 
ATOM   6504  N ND1  . HIS A 1 15 ? 3.131  16.486 -13.119 1.00 0.00 ? 32 HIS A ND1  10 
ATOM   6505  C CD2  . HIS A 1 15 ? 4.613  17.517 -14.350 1.00 0.00 ? 32 HIS A CD2  10 
ATOM   6506  C CE1  . HIS A 1 15 ? 3.072  17.770 -12.810 1.00 0.00 ? 32 HIS A CE1  10 
ATOM   6507  N NE2  . HIS A 1 15 ? 3.961  18.416 -13.543 1.00 0.00 ? 32 HIS A NE2  10 
ATOM   6508  H H    . HIS A 1 15 ? 6.958  14.986 -14.363 1.00 0.00 ? 32 HIS A H    10 
ATOM   6509  H HA   . HIS A 1 15 ? 4.732  14.137 -12.696 1.00 0.00 ? 32 HIS A HA   10 
ATOM   6510  H HB2  . HIS A 1 15 ? 5.003  15.119 -15.555 1.00 0.00 ? 32 HIS A HB2  10 
ATOM   6511  H HB3  . HIS A 1 15 ? 3.457  14.494 -14.934 1.00 0.00 ? 32 HIS A HB3  10 
ATOM   6512  H HD1  . HIS A 1 15 ? 2.611  15.770 -12.652 1.00 0.00 ? 32 HIS A HD1  10 
ATOM   6513  H HD2  . HIS A 1 15 ? 5.389  17.861 -15.034 1.00 0.00 ? 32 HIS A HD2  10 
ATOM   6514  H HE1  . HIS A 1 15 ? 2.369  18.128 -12.058 1.00 0.00 ? 32 HIS A HE1  10 
ATOM   6515  N N    . ASP A 1 16 ? 3.858  11.992 -13.673 1.00 0.00 ? 33 ASP A N    10 
ATOM   6516  C CA   . ASP A 1 16 ? 2.827  12.735 -12.958 1.00 0.00 ? 33 ASP A CA   10 
ATOM   6517  C C    . ASP A 1 16 ? 3.037  12.658 -11.452 1.00 0.00 ? 33 ASP A C    10 
ATOM   6518  O O    . ASP A 1 16 ? 3.556  11.667 -10.937 1.00 0.00 ? 33 ASP A O    10 
ATOM   6519  C CB   . ASP A 1 16 ? 1.436  12.211 -13.323 1.00 0.00 ? 33 ASP A CB   10 
ATOM   6520  C CG   . ASP A 1 16 ? 1.057  12.397 -14.786 1.00 0.00 ? 33 ASP A CG   10 
ATOM   6521  O OD1  . ASP A 1 16 ? 1.231  13.481 -15.290 1.00 0.00 ? 33 ASP A OD1  10 
ATOM   6522  O OD2  . ASP A 1 16 ? 0.746  11.423 -15.428 1.00 0.00 ? 33 ASP A OD2  10 
ATOM   6523  H H    . ASP A 1 16 ? 3.718  11.007 -13.853 1.00 0.00 ? 33 ASP A H    10 
ATOM   6524  H HA   . ASP A 1 16 ? 2.882  13.791 -13.225 1.00 0.00 ? 33 ASP A HA   10 
ATOM   6525  H HB2  . ASP A 1 16 ? 1.275  11.171 -13.037 1.00 0.00 ? 33 ASP A HB2  10 
ATOM   6526  H HB3  . ASP A 1 16 ? 0.817  12.860 -12.702 1.00 0.00 ? 33 ASP A HB3  10 
ATOM   6527  N N    . TYR A 1 17 ? 2.628  13.709 -10.748 1.00 0.00 ? 34 TYR A N    10 
ATOM   6528  C CA   . TYR A 1 17 ? 2.666  13.716 -9.290  1.00 0.00 ? 34 TYR A CA   10 
ATOM   6529  C C    . TYR A 1 17 ? 1.645  14.691 -8.719  1.00 0.00 ? 34 TYR A C    10 
ATOM   6530  O O    . TYR A 1 17 ? 1.114  15.540 -9.435  1.00 0.00 ? 34 TYR A O    10 
ATOM   6531  C CB   . TYR A 1 17 ? 4.067  14.073 -8.792  1.00 0.00 ? 34 TYR A CB   10 
ATOM   6532  C CG   . TYR A 1 17 ? 4.475  15.501 -9.079  1.00 0.00 ? 34 TYR A CG   10 
ATOM   6533  C CD1  . TYR A 1 17 ? 4.151  16.524 -8.201  1.00 0.00 ? 34 TYR A CD1  10 
ATOM   6534  C CD2  . TYR A 1 17 ? 5.186  15.820 -10.226 1.00 0.00 ? 34 TYR A CD2  10 
ATOM   6535  C CE1  . TYR A 1 17 ? 4.521  17.830 -8.458  1.00 0.00 ? 34 TYR A CE1  10 
ATOM   6536  C CE2  . TYR A 1 17 ? 5.562  17.122 -10.494 1.00 0.00 ? 34 TYR A CE2  10 
ATOM   6537  C CZ   . TYR A 1 17 ? 5.228  18.125 -9.607  1.00 0.00 ? 34 TYR A CZ   10 
ATOM   6538  O OH   . TYR A 1 17 ? 5.601  19.423 -9.868  1.00 0.00 ? 34 TYR A OH   10 
ATOM   6539  H H    . TYR A 1 17 ? 2.284  14.524 -11.235 1.00 0.00 ? 34 TYR A H    10 
ATOM   6540  H HA   . TYR A 1 17 ? 2.401  12.729 -8.908  1.00 0.00 ? 34 TYR A HA   10 
ATOM   6541  H HB2  . TYR A 1 17 ? 4.081  13.900 -7.715  1.00 0.00 ? 34 TYR A HB2  10 
ATOM   6542  H HB3  . TYR A 1 17 ? 4.765  13.390 -9.277  1.00 0.00 ? 34 TYR A HB3  10 
ATOM   6543  H HD1  . TYR A 1 17 ? 3.595  16.284 -7.296  1.00 0.00 ? 34 TYR A HD1  10 
ATOM   6544  H HD2  . TYR A 1 17 ? 5.446  15.023 -10.923 1.00 0.00 ? 34 TYR A HD2  10 
ATOM   6545  H HE1  . TYR A 1 17 ? 4.260  18.624 -7.759  1.00 0.00 ? 34 TYR A HE1  10 
ATOM   6546  H HE2  . TYR A 1 17 ? 6.119  17.353 -11.403 1.00 0.00 ? 34 TYR A HE2  10 
ATOM   6547  H HH   . TYR A 1 17 ? 6.087  19.516 -10.691 1.00 0.00 ? 34 TYR A HH   10 
ATOM   6548  N N    . CYS A 1 18 ? 1.373  14.564 -7.424  1.00 0.00 ? 35 CYS A N    10 
ATOM   6549  C CA   . CYS A 1 18 ? 0.469  15.479 -6.737  1.00 0.00 ? 35 CYS A CA   10 
ATOM   6550  C C    . CYS A 1 18 ? 1.046  15.923 -5.399  1.00 0.00 ? 35 CYS A C    10 
ATOM   6551  O O    . CYS A 1 18 ? 2.097  15.443 -4.976  1.00 0.00 ? 35 CYS A O    10 
ATOM   6552  C CB   . CYS A 1 18 ? -0.781 14.625 -6.529  1.00 0.00 ? 35 CYS A CB   10 
ATOM   6553  S SG   . CYS A 1 18 ? -1.553 14.039 -8.055  1.00 0.00 ? 35 CYS A SG   10 
ATOM   6554  H H    . CYS A 1 18 ? 1.804  13.816 -6.902  1.00 0.00 ? 35 CYS A H    10 
ATOM   6555  H HA   . CYS A 1 18 ? 0.200  16.352 -7.334  1.00 0.00 ? 35 CYS A HA   10 
ATOM   6556  H HB2  . CYS A 1 18 ? -0.537 13.733 -5.951  1.00 0.00 ? 35 CYS A HB2  10 
ATOM   6557  H HB3  . CYS A 1 18 ? -1.546 15.199 -6.005  1.00 0.00 ? 35 CYS A HB3  10 
ATOM   6558  H HG   . CYS A 1 18 ? -2.543 13.377 -7.466  1.00 0.00 ? 35 CYS A HG   10 
ATOM   6559  N N    . THR A 1 19 ? 0.352  16.843 -4.737  1.00 0.00 ? 36 THR A N    10 
ATOM   6560  C CA   . THR A 1 19 ? 0.783  17.337 -3.435  1.00 0.00 ? 36 THR A CA   10 
ATOM   6561  C C    . THR A 1 19 ? -0.412 17.678 -2.553  1.00 0.00 ? 36 THR A C    10 
ATOM   6562  O O    . THR A 1 19 ? -1.473 18.059 -3.048  1.00 0.00 ? 36 THR A O    10 
ATOM   6563  C CB   . THR A 1 19 ? 1.680  18.582 -3.571  1.00 0.00 ? 36 THR A CB   10 
ATOM   6564  O OG1  . THR A 1 19 ? 2.190  18.949 -2.283  1.00 0.00 ? 36 THR A OG1  10 
ATOM   6565  C CG2  . THR A 1 19 ? 0.892  19.746 -4.151  1.00 0.00 ? 36 THR A CG2  10 
ATOM   6566  H H    . THR A 1 19 ? -0.496 17.208 -5.147  1.00 0.00 ? 36 THR A H    10 
ATOM   6567  H HA   . THR A 1 19 ? 1.340  16.560 -2.911  1.00 0.00 ? 36 THR A HA   10 
ATOM   6568  H HB   . THR A 1 19 ? 2.516  18.346 -4.230  1.00 0.00 ? 36 THR A HB   10 
ATOM   6569  H HG1  . THR A 1 19 ? 2.750  19.724 -2.370  1.00 0.00 ? 36 THR A HG1  10 
ATOM   6570  H HG21 . THR A 1 19 ? 0.057  19.983 -3.493  1.00 0.00 ? 36 THR A HG21 10 
ATOM   6571  H HG22 . THR A 1 19 ? 1.544  20.615 -4.240  1.00 0.00 ? 36 THR A HG22 10 
ATOM   6572  H HG23 . THR A 1 19 ? 0.513  19.473 -5.136  1.00 0.00 ? 36 THR A HG23 10 
HETATM 6573  N N    . TPO A 1 20 ? -0.232 17.542 -1.244  1.00 0.00 ? 37 TPO A N    10 
HETATM 6574  C CA   . TPO A 1 20 ? -1.273 17.897 -0.286  1.00 0.00 ? 37 TPO A CA   10 
HETATM 6575  C CB   . TPO A 1 20 ? -1.261 16.960 0.935   1.00 0.00 ? 37 TPO A CB   10 
HETATM 6576  C CG2  . TPO A 1 20 ? -1.191 15.507 0.493   1.00 0.00 ? 37 TPO A CG2  10 
HETATM 6577  O OG1  . TPO A 1 20 ? -0.126 17.260 1.759   1.00 0.00 ? 37 TPO A OG1  10 
HETATM 6578  P P    . TPO A 1 20 ? -0.133 16.893 3.329   1.00 0.00 ? 37 TPO A P    10 
HETATM 6579  O O1P  . TPO A 1 20 ? 1.230  17.347 3.915   1.00 0.00 ? 37 TPO A O1P  10 
HETATM 6580  O O2P  . TPO A 1 20 ? -0.320 15.358 3.443   1.00 0.00 ? 37 TPO A O2P  10 
HETATM 6581  O O3P  . TPO A 1 20 ? -1.315 17.661 3.977   1.00 0.00 ? 37 TPO A O3P  10 
HETATM 6582  C C    . TPO A 1 20 ? -1.118 19.336 0.187   1.00 0.00 ? 37 TPO A C    10 
HETATM 6583  O O    . TPO A 1 20 ? -0.066 19.949 0.007   1.00 0.00 ? 37 TPO A O    10 
HETATM 6584  H H    . TPO A 1 20 ? 0.648  17.182 -0.903  1.00 0.00 ? 37 TPO A H    10 
HETATM 6585  H HA   . TPO A 1 20 ? -2.251 17.834 -0.765  1.00 0.00 ? 37 TPO A HA   10 
HETATM 6586  H HB   . TPO A 1 20 ? -2.170 17.119 1.514   1.00 0.00 ? 37 TPO A HB   10 
HETATM 6587  H HG21 . TPO A 1 20 ? -1.183 14.860 1.370   1.00 0.00 ? 37 TPO A HG21 10 
HETATM 6588  H HG22 . TPO A 1 20 ? -2.058 15.273 -0.124  1.00 0.00 ? 37 TPO A HG22 10 
HETATM 6589  H HG23 . TPO A 1 20 ? -0.281 15.346 -0.084  1.00 0.00 ? 37 TPO A HG23 10 
ATOM   6590  N N    . PRO A 1 21 ? -2.171 19.871 0.795   1.00 0.00 ? 38 PRO A N    10 
ATOM   6591  C CA   . PRO A 1 21 ? -2.180 21.262 1.232   1.00 0.00 ? 38 PRO A CA   10 
ATOM   6592  C C    . PRO A 1 21 ? -0.996 21.562 2.142   1.00 0.00 ? 38 PRO A C    10 
ATOM   6593  O O    . PRO A 1 21 ? -0.484 22.681 2.162   1.00 0.00 ? 38 PRO A O    10 
ATOM   6594  C CB   . PRO A 1 21 ? -3.520 21.418 1.958   1.00 0.00 ? 38 PRO A CB   10 
ATOM   6595  C CG   . PRO A 1 21 ? -4.413 20.415 1.310   1.00 0.00 ? 38 PRO A CG   10 
ATOM   6596  C CD   . PRO A 1 21 ? -3.529 19.238 0.996   1.00 0.00 ? 38 PRO A CD   10 
ATOM   6597  H HA   . PRO A 1 21 ? -2.083 21.970 0.396   1.00 0.00 ? 38 PRO A HA   10 
ATOM   6598  H HB2  . PRO A 1 21 ? -3.418 21.223 3.036   1.00 0.00 ? 38 PRO A HB2  10 
ATOM   6599  H HB3  . PRO A 1 21 ? -3.921 22.436 1.850   1.00 0.00 ? 38 PRO A HB3  10 
ATOM   6600  H HG2  . PRO A 1 21 ? -5.236 20.124 1.981   1.00 0.00 ? 38 PRO A HG2  10 
ATOM   6601  H HG3  . PRO A 1 21 ? -4.871 20.821 0.397   1.00 0.00 ? 38 PRO A HG3  10 
ATOM   6602  H HD2  . PRO A 1 21 ? -3.505 18.504 1.817   1.00 0.00 ? 38 PRO A HD2  10 
ATOM   6603  H HD3  . PRO A 1 21 ? -3.856 18.700 0.095   1.00 0.00 ? 38 PRO A HD3  10 
ATOM   6604  N N    . GLY A 1 22 ? -0.565 20.555 2.894   1.00 0.00 ? 39 GLY A N    10 
ATOM   6605  C CA   . GLY A 1 22 ? 0.572  20.704 3.794   1.00 0.00 ? 39 GLY A CA   10 
ATOM   6606  C C    . GLY A 1 22 ? 1.858  20.966 3.020   1.00 0.00 ? 39 GLY A C    10 
ATOM   6607  O O    . GLY A 1 22 ? 2.748  21.669 3.499   1.00 0.00 ? 39 GLY A O    10 
ATOM   6608  H H    . GLY A 1 22 ? -1.037 19.663 2.841   1.00 0.00 ? 39 GLY A H    10 
ATOM   6609  H HA2  . GLY A 1 22 ? 0.385  21.540 4.468   1.00 0.00 ? 39 GLY A HA2  10 
ATOM   6610  H HA3  . GLY A 1 22 ? 0.688  19.790 4.376   1.00 0.00 ? 39 GLY A HA3  10 
ATOM   6611  N N    . GLY A 1 23 ? 1.948  20.399 1.823   1.00 0.00 ? 40 GLY A N    10 
ATOM   6612  C CA   . GLY A 1 23 ? 3.096  20.621 0.954   1.00 0.00 ? 40 GLY A CA   10 
ATOM   6613  C C    . GLY A 1 23 ? 3.900  19.341 0.763   1.00 0.00 ? 40 GLY A C    10 
ATOM   6614  O O    . GLY A 1 23 ? 5.041  19.375 0.303   1.00 0.00 ? 40 GLY A O    10 
ATOM   6615  H H    . GLY A 1 23 ? 1.201  19.796 1.506   1.00 0.00 ? 40 GLY A H    10 
ATOM   6616  H HA2  . GLY A 1 23 ? 2.746  20.968 -0.019  1.00 0.00 ? 40 GLY A HA2  10 
ATOM   6617  H HA3  . GLY A 1 23 ? 3.739  21.381 1.399   1.00 0.00 ? 40 GLY A HA3  10 
ATOM   6618  N N    . THR A 1 24 ? 3.297  18.212 1.121   1.00 0.00 ? 41 THR A N    10 
ATOM   6619  C CA   . THR A 1 24 ? 3.943  16.914 0.958   1.00 0.00 ? 41 THR A CA   10 
ATOM   6620  C C    . THR A 1 24 ? 3.692  16.346 -0.433  1.00 0.00 ? 41 THR A C    10 
ATOM   6621  O O    . THR A 1 24 ? 2.547  16.240 -0.874  1.00 0.00 ? 41 THR A O    10 
ATOM   6622  C CB   . THR A 1 24 ? 3.452  15.903 2.010   1.00 0.00 ? 41 THR A CB   10 
ATOM   6623  O OG1  . THR A 1 24 ? 3.810  16.361 3.321   1.00 0.00 ? 41 THR A OG1  10 
ATOM   6624  C CG2  . THR A 1 24 ? 4.074  14.536 1.768   1.00 0.00 ? 41 THR A CG2  10 
ATOM   6625  H H    . THR A 1 24 ? 2.369  18.253 1.517   1.00 0.00 ? 41 THR A H    10 
ATOM   6626  H HA   . THR A 1 24 ? 5.023  17.024 1.055   1.00 0.00 ? 41 THR A HA   10 
ATOM   6627  H HB   . THR A 1 24 ? 2.367  15.824 1.948   1.00 0.00 ? 41 THR A HB   10 
ATOM   6628  H HG1  . THR A 1 24 ? 3.093  16.887 3.683   1.00 0.00 ? 41 THR A HG1  10 
ATOM   6629  H HG21 . THR A 1 24 ? 5.159  14.616 1.832   1.00 0.00 ? 41 THR A HG21 10 
ATOM   6630  H HG22 . THR A 1 24 ? 3.716  13.836 2.521   1.00 0.00 ? 41 THR A HG22 10 
ATOM   6631  H HG23 . THR A 1 24 ? 3.794  14.181 0.776   1.00 0.00 ? 41 THR A HG23 10 
ATOM   6632  N N    . LEU A 1 25 ? 4.768  15.982 -1.121  1.00 0.00 ? 42 LEU A N    10 
ATOM   6633  C CA   . LEU A 1 25 ? 4.669  15.453 -2.477  1.00 0.00 ? 42 LEU A CA   10 
ATOM   6634  C C    . LEU A 1 25 ? 4.429  13.950 -2.466  1.00 0.00 ? 42 LEU A C    10 
ATOM   6635  O O    . LEU A 1 25 ? 4.968  13.231 -1.624  1.00 0.00 ? 42 LEU A O    10 
ATOM   6636  C CB   . LEU A 1 25 ? 5.940  15.785 -3.268  1.00 0.00 ? 42 LEU A CB   10 
ATOM   6637  C CG   . LEU A 1 25 ? 5.950  17.166 -3.938  1.00 0.00 ? 42 LEU A CG   10 
ATOM   6638  C CD1  . LEU A 1 25 ? 4.913  17.214 -5.051  1.00 0.00 ? 42 LEU A CD1  10 
ATOM   6639  C CD2  . LEU A 1 25 ? 5.673  18.238 -2.895  1.00 0.00 ? 42 LEU A CD2  10 
ATOM   6640  H H    . LEU A 1 25 ? 5.679  16.073 -0.694  1.00 0.00 ? 42 LEU A H    10 
ATOM   6641  H HA   . LEU A 1 25 ? 3.813  15.900 -2.980  1.00 0.00 ? 42 LEU A HA   10 
ATOM   6642  H HB2  . LEU A 1 25 ? 6.666  15.758 -2.459  1.00 0.00 ? 42 LEU A HB2  10 
ATOM   6643  H HB3  . LEU A 1 25 ? 6.177  15.008 -3.996  1.00 0.00 ? 42 LEU A HB3  10 
ATOM   6644  H HG   . LEU A 1 25 ? 6.956  17.330 -4.326  1.00 0.00 ? 42 LEU A HG   10 
ATOM   6645  H HD11 . LEU A 1 25 ? 4.928  18.198 -5.520  1.00 0.00 ? 42 LEU A HD11 10 
ATOM   6646  H HD12 . LEU A 1 25 ? 5.144  16.453 -5.798  1.00 0.00 ? 42 LEU A HD12 10 
ATOM   6647  H HD13 . LEU A 1 25 ? 3.924  17.027 -4.635  1.00 0.00 ? 42 LEU A HD13 10 
ATOM   6648  H HD21 . LEU A 1 25 ? 6.443  18.204 -2.123  1.00 0.00 ? 42 LEU A HD21 10 
ATOM   6649  H HD22 . LEU A 1 25 ? 5.682  19.220 -3.372  1.00 0.00 ? 42 LEU A HD22 10 
ATOM   6650  H HD23 . LEU A 1 25 ? 4.697  18.063 -2.443  1.00 0.00 ? 42 LEU A HD23 10 
ATOM   6651  N N    . PHE A 1 26 ? 3.615  13.479 -3.404  1.00 0.00 ? 43 PHE A N    10 
ATOM   6652  C CA   . PHE A 1 26 ? 3.348  12.052 -3.542  1.00 0.00 ? 43 PHE A CA   10 
ATOM   6653  C C    . PHE A 1 26 ? 2.927  11.705 -4.964  1.00 0.00 ? 43 PHE A C    10 
ATOM   6654  O O    . PHE A 1 26 ? 2.582  12.585 -5.751  1.00 0.00 ? 43 PHE A O    10 
ATOM   6655  C CB   . PHE A 1 26 ? 2.268  11.613 -2.551  1.00 0.00 ? 43 PHE A CB   10 
ATOM   6656  C CG   . PHE A 1 26 ? 0.912  12.193 -2.836  1.00 0.00 ? 43 PHE A CG   10 
ATOM   6657  C CD1  . PHE A 1 26 ? 0.565  13.450 -2.365  1.00 0.00 ? 43 PHE A CD1  10 
ATOM   6658  C CD2  . PHE A 1 26 ? -0.020 11.482 -3.579  1.00 0.00 ? 43 PHE A CD2  10 
ATOM   6659  C CE1  . PHE A 1 26 ? -0.682 13.984 -2.626  1.00 0.00 ? 43 PHE A CE1  10 
ATOM   6660  C CE2  . PHE A 1 26 ? -1.268 12.014 -3.842  1.00 0.00 ? 43 PHE A CE2  10 
ATOM   6661  C CZ   . PHE A 1 26 ? -1.599 13.264 -3.365  1.00 0.00 ? 43 PHE A CZ   10 
ATOM   6662  H H    . PHE A 1 26 ? 3.171  14.126 -4.040  1.00 0.00 ? 43 PHE A H    10 
ATOM   6663  H HA   . PHE A 1 26 ? 4.257  11.484 -3.340  1.00 0.00 ? 43 PHE A HA   10 
ATOM   6664  H HB2  . PHE A 1 26 ? 2.156  10.530 -2.574  1.00 0.00 ? 43 PHE A HB2  10 
ATOM   6665  H HB3  . PHE A 1 26 ? 2.535  11.927 -1.542  1.00 0.00 ? 43 PHE A HB3  10 
ATOM   6666  H HD1  . PHE A 1 26 ? 1.290  14.018 -1.781  1.00 0.00 ? 43 PHE A HD1  10 
ATOM   6667  H HD2  . PHE A 1 26 ? 0.241  10.492 -3.955  1.00 0.00 ? 43 PHE A HD2  10 
ATOM   6668  H HE1  . PHE A 1 26 ? -0.941 14.973 -2.249  1.00 0.00 ? 43 PHE A HE1  10 
ATOM   6669  H HE2  . PHE A 1 26 ? -1.990 11.445 -4.426  1.00 0.00 ? 43 PHE A HE2  10 
ATOM   6670  H HZ   . PHE A 1 26 ? -2.582 13.685 -3.574  1.00 0.00 ? 43 PHE A HZ   10 
ATOM   6671  N N    . SER A 1 27 ? 2.958  10.415 -5.286  1.00 0.00 ? 44 SER A N    10 
ATOM   6672  C CA   . SER A 1 27 ? 2.438  9.932  -6.560  1.00 0.00 ? 44 SER A CA   10 
ATOM   6673  C C    . SER A 1 27 ? 2.081  8.454  -6.484  1.00 0.00 ? 44 SER A C    10 
ATOM   6674  O O    . SER A 1 27 ? 2.821  7.655  -5.909  1.00 0.00 ? 44 SER A O    10 
ATOM   6675  C CB   . SER A 1 27 ? 3.450  10.175 -7.662  1.00 0.00 ? 44 SER A CB   10 
ATOM   6676  O OG   . SER A 1 27 ? 2.984  9.740  -8.910  1.00 0.00 ? 44 SER A OG   10 
ATOM   6677  H H    . SER A 1 27 ? 3.350  9.755  -4.632  1.00 0.00 ? 44 SER A H    10 
ATOM   6678  H HA   . SER A 1 27 ? 1.582  10.503 -6.923  1.00 0.00 ? 44 SER A HA   10 
ATOM   6679  H HB2  . SER A 1 27 ? 3.659  11.244 -7.715  1.00 0.00 ? 44 SER A HB2  10 
ATOM   6680  H HB3  . SER A 1 27 ? 4.367  9.639  -7.420  1.00 0.00 ? 44 SER A HB3  10 
ATOM   6681  H HG   . SER A 1 27 ? 3.138  10.426 -9.566  1.00 0.00 ? 44 SER A HG   10 
ATOM   6682  N N    . THR A 1 28 ? 0.942  8.094  -7.066  1.00 0.00 ? 45 THR A N    10 
ATOM   6683  C CA   . THR A 1 28 ? 0.469  6.716  -7.039  1.00 0.00 ? 45 THR A CA   10 
ATOM   6684  C C    . THR A 1 28 ? 0.564  6.073  -8.416  1.00 0.00 ? 45 THR A C    10 
ATOM   6685  O O    . THR A 1 28 ? 0.061  6.615  -9.401  1.00 0.00 ? 45 THR A O    10 
ATOM   6686  C CB   . THR A 1 28 ? -0.986 6.627  -6.541  1.00 0.00 ? 45 THR A CB   10 
ATOM   6687  O OG1  . THR A 1 28 ? -1.072 7.158  -5.213  1.00 0.00 ? 45 THR A OG1  10 
ATOM   6688  C CG2  . THR A 1 28 ? -1.460 5.181  -6.537  1.00 0.00 ? 45 THR A CG2  10 
ATOM   6689  H H    . THR A 1 28 ? 0.389  8.795  -7.540  1.00 0.00 ? 45 THR A H    10 
ATOM   6690  H HA   . THR A 1 28 ? 1.101  6.122  -6.378  1.00 0.00 ? 45 THR A HA   10 
ATOM   6691  H HB   . THR A 1 28 ? -1.622 7.214  -7.202  1.00 0.00 ? 45 THR A HB   10 
ATOM   6692  H HG1  . THR A 1 28 ? -0.793 8.077  -5.219  1.00 0.00 ? 45 THR A HG1  10 
ATOM   6693  H HG21 . THR A 1 28 ? -0.824 4.592  -5.876  1.00 0.00 ? 45 THR A HG21 10 
ATOM   6694  H HG22 . THR A 1 28 ? -2.490 5.139  -6.183  1.00 0.00 ? 45 THR A HG22 10 
ATOM   6695  H HG23 . THR A 1 28 ? -1.405 4.778  -7.547  1.00 0.00 ? 45 THR A HG23 10 
HETATM 6696  N N    . TPO A 1 29 ? 1.212  4.915  -8.481  1.00 0.00 ? 46 TPO A N    10 
HETATM 6697  C CA   . TPO A 1 29 ? 1.414  4.219  -9.746  1.00 0.00 ? 46 TPO A CA   10 
HETATM 6698  C CB   . TPO A 1 29 ? 2.714  3.395  -9.736  1.00 0.00 ? 46 TPO A CB   10 
HETATM 6699  C CG2  . TPO A 1 29 ? 3.886  4.250  -9.279  1.00 0.00 ? 46 TPO A CG2  10 
HETATM 6700  O OG1  . TPO A 1 29 ? 2.569  2.278  -8.848  1.00 0.00 ? 46 TPO A OG1  10 
HETATM 6701  P P    . TPO A 1 29 ? 3.491  0.966  -9.022  1.00 0.00 ? 46 TPO A P    10 
HETATM 6702  O O1P  . TPO A 1 29 ? 3.080  -0.037 -7.913  1.00 0.00 ? 46 TPO A O1P  10 
HETATM 6703  O O2P  . TPO A 1 29 ? 4.967  1.416  -8.865  1.00 0.00 ? 46 TPO A O2P  10 
HETATM 6704  O O3P  . TPO A 1 29 ? 3.218  0.395  -10.438 1.00 0.00 ? 46 TPO A O3P  10 
HETATM 6705  C C    . TPO A 1 29 ? 0.243  3.297  -10.061 1.00 0.00 ? 46 TPO A C    10 
HETATM 6706  O O    . TPO A 1 29 ? -0.568 2.988  -9.188  1.00 0.00 ? 46 TPO A O    10 
HETATM 6707  H H    . TPO A 1 29 ? 1.573  4.506  -7.632  1.00 0.00 ? 46 TPO A H    10 
HETATM 6708  H HA   . TPO A 1 29 ? 1.465  4.942  -10.561 1.00 0.00 ? 46 TPO A HA   10 
HETATM 6709  H HB   . TPO A 1 29 ? 2.907  3.024  -10.743 1.00 0.00 ? 46 TPO A HB   10 
HETATM 6710  H HG21 . TPO A 1 29 ? 4.795  3.651  -9.279  1.00 0.00 ? 46 TPO A HG21 10 
HETATM 6711  H HG22 . TPO A 1 29 ? 4.006  5.094  -9.959  1.00 0.00 ? 46 TPO A HG22 10 
HETATM 6712  H HG23 . TPO A 1 29 ? 3.694  4.621  -8.273  1.00 0.00 ? 46 TPO A HG23 10 
ATOM   6713  N N    . PRO A 1 30 ? 0.159  2.861  -11.313 1.00 0.00 ? 47 PRO A N    10 
ATOM   6714  C CA   . PRO A 1 30 ? -0.950 2.029  -11.763 1.00 0.00 ? 47 PRO A CA   10 
ATOM   6715  C C    . PRO A 1 30 ? -1.071 0.768  -10.917 1.00 0.00 ? 47 PRO A C    10 
ATOM   6716  O O    . PRO A 1 30 ? -2.162 0.221  -10.752 1.00 0.00 ? 47 PRO A O    10 
ATOM   6717  C CB   . PRO A 1 30 ? -0.613 1.713  -13.223 1.00 0.00 ? 47 PRO A CB   10 
ATOM   6718  C CG   . PRO A 1 30 ? 0.224  2.863  -13.669 1.00 0.00 ? 47 PRO A CG   10 
ATOM   6719  C CD   . PRO A 1 30 ? 1.048  3.247  -12.469 1.00 0.00 ? 47 PRO A CD   10 
ATOM   6720  H HA   . PRO A 1 30 ? -1.924 2.530  -11.666 1.00 0.00 ? 47 PRO A HA   10 
ATOM   6721  H HB2  . PRO A 1 30 ? -0.065 0.763  -13.314 1.00 0.00 ? 47 PRO A HB2  10 
ATOM   6722  H HB3  . PRO A 1 30 ? -1.522 1.621  -13.836 1.00 0.00 ? 47 PRO A HB3  10 
ATOM   6723  H HG2  . PRO A 1 30 ? 0.868  2.583  -14.516 1.00 0.00 ? 47 PRO A HG2  10 
ATOM   6724  H HG3  . PRO A 1 30 ? -0.401 3.703  -14.004 1.00 0.00 ? 47 PRO A HG3  10 
ATOM   6725  H HD2  . PRO A 1 30 ? 2.005  2.707  -12.432 1.00 0.00 ? 47 PRO A HD2  10 
ATOM   6726  H HD3  . PRO A 1 30 ? 1.284  4.321  -12.451 1.00 0.00 ? 47 PRO A HD3  10 
ATOM   6727  N N    . GLY A 1 31 ? 0.056  0.311  -10.381 1.00 0.00 ? 48 GLY A N    10 
ATOM   6728  C CA   . GLY A 1 31 ? 0.078  -0.890 -9.554  1.00 0.00 ? 48 GLY A CA   10 
ATOM   6729  C C    . GLY A 1 31 ? -0.709 -0.687 -8.266  1.00 0.00 ? 48 GLY A C    10 
ATOM   6730  O O    . GLY A 1 31 ? -1.203 -1.645 -7.672  1.00 0.00 ? 48 GLY A O    10 
ATOM   6731  H H    . GLY A 1 31 ? 0.919  0.808  -10.552 1.00 0.00 ? 48 GLY A H    10 
ATOM   6732  H HA2  . GLY A 1 31 ? -0.361 -1.716 -10.113 1.00 0.00 ? 48 GLY A HA2  10 
ATOM   6733  H HA3  . GLY A 1 31 ? 1.111  -1.132 -9.305  1.00 0.00 ? 48 GLY A HA3  10 
ATOM   6734  N N    . GLY A 1 32 ? -0.823 0.566  -7.840  1.00 0.00 ? 49 GLY A N    10 
ATOM   6735  C CA   . GLY A 1 32 ? -1.603 0.905  -6.655  1.00 0.00 ? 49 GLY A CA   10 
ATOM   6736  C C    . GLY A 1 32 ? -0.708 1.423  -5.536  1.00 0.00 ? 49 GLY A C    10 
ATOM   6737  O O    . GLY A 1 32 ? -1.190 1.986  -4.554  1.00 0.00 ? 49 GLY A O    10 
ATOM   6738  H H    . GLY A 1 32 ? -0.357 1.303  -8.350  1.00 0.00 ? 49 GLY A H    10 
ATOM   6739  H HA2  . GLY A 1 32 ? -2.330 1.675  -6.915  1.00 0.00 ? 49 GLY A HA2  10 
ATOM   6740  H HA3  . GLY A 1 32 ? -2.127 0.014  -6.309  1.00 0.00 ? 49 GLY A HA3  10 
ATOM   6741  N N    . THR A 1 33 ? 0.596  1.228  -5.691  1.00 0.00 ? 50 THR A N    10 
ATOM   6742  C CA   . THR A 1 33 ? 1.562  1.672  -4.692  1.00 0.00 ? 50 THR A CA   10 
ATOM   6743  C C    . THR A 1 33 ? 1.615  3.193  -4.617  1.00 0.00 ? 50 THR A C    10 
ATOM   6744  O O    . THR A 1 33 ? 1.746  3.870  -5.636  1.00 0.00 ? 50 THR A O    10 
ATOM   6745  C CB   . THR A 1 33 ? 2.972  1.133  -4.990  1.00 0.00 ? 50 THR A CB   10 
ATOM   6746  O OG1  . THR A 1 33 ? 2.939  -0.300 -5.042  1.00 0.00 ? 50 THR A OG1  10 
ATOM   6747  C CG2  . THR A 1 33 ? 3.951  1.575  -3.913  1.00 0.00 ? 50 THR A CG2  10 
ATOM   6748  H H    . THR A 1 33 ? 0.929  0.760  -6.522  1.00 0.00 ? 50 THR A H    10 
ATOM   6749  H HA   . THR A 1 33 ? 1.257  1.325  -3.704  1.00 0.00 ? 50 THR A HA   10 
ATOM   6750  H HB   . THR A 1 33 ? 3.301  1.514  -5.957  1.00 0.00 ? 50 THR A HB   10 
ATOM   6751  H HG1  . THR A 1 33 ? 2.959  -0.586 -5.958  1.00 0.00 ? 50 THR A HG1  10 
ATOM   6752  H HG21 . THR A 1 33 ? 3.624  1.192  -2.947  1.00 0.00 ? 50 THR A HG21 10 
ATOM   6753  H HG22 . THR A 1 33 ? 4.943  1.184  -4.141  1.00 0.00 ? 50 THR A HG22 10 
ATOM   6754  H HG23 . THR A 1 33 ? 3.987  2.663  -3.879  1.00 0.00 ? 50 THR A HG23 10 
ATOM   6755  N N    . ARG A 1 34 ? 1.514  3.724  -3.403  1.00 0.00 ? 51 ARG A N    10 
ATOM   6756  C CA   . ARG A 1 34 ? 1.605  5.163  -3.187  1.00 0.00 ? 51 ARG A CA   10 
ATOM   6757  C C    . ARG A 1 34 ? 3.007  5.566  -2.750  1.00 0.00 ? 51 ARG A C    10 
ATOM   6758  O O    . ARG A 1 34 ? 3.480  5.157  -1.690  1.00 0.00 ? 51 ARG A O    10 
ATOM   6759  C CB   . ARG A 1 34 ? 0.551  5.663  -2.210  1.00 0.00 ? 51 ARG A CB   10 
ATOM   6760  C CG   . ARG A 1 34 ? 0.528  7.171  -2.013  1.00 0.00 ? 51 ARG A CG   10 
ATOM   6761  C CD   . ARG A 1 34 ? -0.539 7.652  -1.097  1.00 0.00 ? 51 ARG A CD   10 
ATOM   6762  N NE   . ARG A 1 34 ? -0.588 9.096  -0.936  1.00 0.00 ? 51 ARG A NE   10 
ATOM   6763  C CZ   . ARG A 1 34 ? -1.337 9.739  -0.019  1.00 0.00 ? 51 ARG A CZ   10 
ATOM   6764  N NH1  . ARG A 1 34 ? -2.129 9.074  0.794   1.00 0.00 ? 51 ARG A NH1  10 
ATOM   6765  N NH2  . ARG A 1 34 ? -1.274 11.058 0.026   1.00 0.00 ? 51 ARG A NH2  10 
ATOM   6766  H H    . ARG A 1 34 ? 1.370  3.115  -2.611  1.00 0.00 ? 51 ARG A H    10 
ATOM   6767  H HA   . ARG A 1 34 ? 1.406  5.689  -4.120  1.00 0.00 ? 51 ARG A HA   10 
ATOM   6768  H HB2  . ARG A 1 34 ? -0.416 5.336  -2.589  1.00 0.00 ? 51 ARG A HB2  10 
ATOM   6769  H HB3  . ARG A 1 34 ? 0.749  5.180  -1.253  1.00 0.00 ? 51 ARG A HB3  10 
ATOM   6770  H HG2  . ARG A 1 34 ? 1.489  7.482  -1.601  1.00 0.00 ? 51 ARG A HG2  10 
ATOM   6771  H HG3  . ARG A 1 34 ? 0.378  7.646  -2.983  1.00 0.00 ? 51 ARG A HG3  10 
ATOM   6772  H HD2  . ARG A 1 34 ? -1.506 7.334  -1.484  1.00 0.00 ? 51 ARG A HD2  10 
ATOM   6773  H HD3  . ARG A 1 34 ? -0.382 7.218  -0.111  1.00 0.00 ? 51 ARG A HD3  10 
ATOM   6774  H HE   . ARG A 1 34 ? -0.101 9.819  -1.448  1.00 0.00 ? 51 ARG A HE   10 
ATOM   6775  H HH11 . ARG A 1 34 ? -2.180 8.067  0.735   1.00 0.00 ? 51 ARG A HH11 10 
ATOM   6776  H HH12 . ARG A 1 34 ? -2.684 9.574  1.474   1.00 0.00 ? 51 ARG A HH12 10 
ATOM   6777  H HH21 . ARG A 1 34 ? -0.674 11.554 -0.618  1.00 0.00 ? 51 ARG A HH21 10 
ATOM   6778  H HH22 . ARG A 1 34 ? -1.826 11.564 0.703   1.00 0.00 ? 51 ARG A HH22 10 
ATOM   6779  N N    . ILE A 1 35 ? 3.668  6.373  -3.573  1.00 0.00 ? 52 ILE A N    10 
ATOM   6780  C CA   . ILE A 1 35 ? 5.015  6.843  -3.267  1.00 0.00 ? 52 ILE A CA   10 
ATOM   6781  C C    . ILE A 1 35 ? 4.980  8.207  -2.589  1.00 0.00 ? 52 ILE A C    10 
ATOM   6782  O O    . ILE A 1 35 ? 4.450  9.172  -3.140  1.00 0.00 ? 52 ILE A O    10 
ATOM   6783  C CB   . ILE A 1 35 ? 5.883  6.932  -4.534  1.00 0.00 ? 52 ILE A CB   10 
ATOM   6784  C CG1  . ILE A 1 35 ? 6.002  5.558  -5.199  1.00 0.00 ? 52 ILE A CG1  10 
ATOM   6785  C CG2  . ILE A 1 35 ? 7.260  7.485  -4.198  1.00 0.00 ? 52 ILE A CG2  10 
ATOM   6786  C CD1  . ILE A 1 35 ? 6.641  5.594  -6.569  1.00 0.00 ? 52 ILE A CD1  10 
ATOM   6787  H H    . ILE A 1 35 ? 3.228  6.667  -4.432  1.00 0.00 ? 52 ILE A H    10 
ATOM   6788  H HA   . ILE A 1 35 ? 5.495  6.187  -2.543  1.00 0.00 ? 52 ILE A HA   10 
ATOM   6789  H HB   . ILE A 1 35 ? 5.395  7.588  -5.255  1.00 0.00 ? 52 ILE A HB   10 
ATOM   6790  H HG12 . ILE A 1 35 ? 6.596  4.928  -4.537  1.00 0.00 ? 52 ILE A HG12 10 
ATOM   6791  H HG13 . ILE A 1 35 ? 4.994  5.150  -5.279  1.00 0.00 ? 52 ILE A HG13 10 
ATOM   6792  H HG21 . ILE A 1 35 ? 7.861  7.540  -5.105  1.00 0.00 ? 52 ILE A HG21 10 
ATOM   6793  H HG22 . ILE A 1 35 ? 7.157  8.480  -3.769  1.00 0.00 ? 52 ILE A HG22 10 
ATOM   6794  H HG23 . ILE A 1 35 ? 7.750  6.829  -3.478  1.00 0.00 ? 52 ILE A HG23 10 
ATOM   6795  H HD11 . ILE A 1 35 ? 7.648  6.001  -6.490  1.00 0.00 ? 52 ILE A HD11 10 
ATOM   6796  H HD12 . ILE A 1 35 ? 6.689  4.584  -6.974  1.00 0.00 ? 52 ILE A HD12 10 
ATOM   6797  H HD13 . ILE A 1 35 ? 6.046  6.223  -7.231  1.00 0.00 ? 52 ILE A HD13 10 
ATOM   6798  N N    . ILE A 1 36 ? 5.549  8.280  -1.390  1.00 0.00 ? 53 ILE A N    10 
ATOM   6799  C CA   . ILE A 1 36 ? 5.667  9.545  -0.675  1.00 0.00 ? 53 ILE A CA   10 
ATOM   6800  C C    . ILE A 1 36 ? 7.064  10.134 -0.824  1.00 0.00 ? 53 ILE A C    10 
ATOM   6801  O O    . ILE A 1 36 ? 8.060  9.479  -0.519  1.00 0.00 ? 53 ILE A O    10 
ATOM   6802  C CB   . ILE A 1 36 ? 5.348  9.380  0.822   1.00 0.00 ? 53 ILE A CB   10 
ATOM   6803  C CG1  . ILE A 1 36 ? 3.970  8.738  1.006   1.00 0.00 ? 53 ILE A CG1  10 
ATOM   6804  C CG2  . ILE A 1 36 ? 5.412  10.724 1.532   1.00 0.00 ? 53 ILE A CG2  10 
ATOM   6805  C CD1  . ILE A 1 36 ? 2.840  9.529  0.387   1.00 0.00 ? 53 ILE A CD1  10 
ATOM   6806  H H    . ILE A 1 36 ? 5.908  7.439  -0.965  1.00 0.00 ? 53 ILE A H    10 
ATOM   6807  H HA   . ILE A 1 36 ? 5.003  10.294 -1.106  1.00 0.00 ? 53 ILE A HA   10 
ATOM   6808  H HB   . ILE A 1 36 ? 6.073  8.700  1.267   1.00 0.00 ? 53 ILE A HB   10 
ATOM   6809  H HG12 . ILE A 1 36 ? 4.010  7.747  0.555   1.00 0.00 ? 53 ILE A HG12 10 
ATOM   6810  H HG13 . ILE A 1 36 ? 3.799  8.641  2.079   1.00 0.00 ? 53 ILE A HG13 10 
ATOM   6811  H HG21 . ILE A 1 36 ? 5.183  10.589 2.589   1.00 0.00 ? 53 ILE A HG21 10 
ATOM   6812  H HG22 . ILE A 1 36 ? 6.412  11.143 1.427   1.00 0.00 ? 53 ILE A HG22 10 
ATOM   6813  H HG23 . ILE A 1 36 ? 4.685  11.404 1.087   1.00 0.00 ? 53 ILE A HG23 10 
ATOM   6814  H HD11 . ILE A 1 36 ? 3.009  9.626  -0.684  1.00 0.00 ? 53 ILE A HD11 10 
ATOM   6815  H HD12 . ILE A 1 36 ? 1.896  9.012  0.559   1.00 0.00 ? 53 ILE A HD12 10 
ATOM   6816  H HD13 . ILE A 1 36 ? 2.798  10.520 0.839   1.00 0.00 ? 53 ILE A HD13 10 
ATOM   6817  N N    . TYR A 1 37 ? 7.130  11.374 -1.296  1.00 0.00 ? 54 TYR A N    10 
ATOM   6818  C CA   . TYR A 1 37 ? 8.401  11.988 -1.663  1.00 0.00 ? 54 TYR A CA   10 
ATOM   6819  C C    . TYR A 1 37 ? 8.893  12.930 -0.572  1.00 0.00 ? 54 TYR A C    10 
ATOM   6820  O O    . TYR A 1 37 ? 8.194  13.866 -0.183  1.00 0.00 ? 54 TYR A O    10 
ATOM   6821  C CB   . TYR A 1 37 ? 8.268  12.744 -2.988  1.00 0.00 ? 54 TYR A CB   10 
ATOM   6822  C CG   . TYR A 1 37 ? 8.012  11.849 -4.180  1.00 0.00 ? 54 TYR A CG   10 
ATOM   6823  C CD1  . TYR A 1 37 ? 9.039  11.110 -4.748  1.00 0.00 ? 54 TYR A CD1  10 
ATOM   6824  C CD2  . TYR A 1 37 ? 6.746  11.748 -4.737  1.00 0.00 ? 54 TYR A CD2  10 
ATOM   6825  C CE1  . TYR A 1 37 ? 8.813  10.292 -5.837  1.00 0.00 ? 54 TYR A CE1  10 
ATOM   6826  C CE2  . TYR A 1 37 ? 6.507  10.933 -5.826  1.00 0.00 ? 54 TYR A CE2  10 
ATOM   6827  C CZ   . TYR A 1 37 ? 7.544  10.206 -6.374  1.00 0.00 ? 54 TYR A CZ   10 
ATOM   6828  O OH   . TYR A 1 37 ? 7.312  9.393  -7.459  1.00 0.00 ? 54 TYR A OH   10 
ATOM   6829  H H    . TYR A 1 37 ? 6.278  11.907 -1.403  1.00 0.00 ? 54 TYR A H    10 
ATOM   6830  H HA   . TYR A 1 37 ? 9.165  11.219 -1.776  1.00 0.00 ? 54 TYR A HA   10 
ATOM   6831  H HB2  . TYR A 1 37 ? 7.442  13.447 -2.877  1.00 0.00 ? 54 TYR A HB2  10 
ATOM   6832  H HB3  . TYR A 1 37 ? 9.196  13.294 -3.139  1.00 0.00 ? 54 TYR A HB3  10 
ATOM   6833  H HD1  . TYR A 1 37 ? 10.039 11.182 -4.319  1.00 0.00 ? 54 TYR A HD1  10 
ATOM   6834  H HD2  . TYR A 1 37 ? 5.932  12.325 -4.298  1.00 0.00 ? 54 TYR A HD2  10 
ATOM   6835  H HE1  . TYR A 1 37 ? 9.633  9.717  -6.268  1.00 0.00 ? 54 TYR A HE1  10 
ATOM   6836  H HE2  . TYR A 1 37 ? 5.507  10.863 -6.252  1.00 0.00 ? 54 TYR A HE2  10 
ATOM   6837  H HH   . TYR A 1 37 ? 8.100  8.935  -7.760  1.00 0.00 ? 54 TYR A HH   10 
ATOM   6838  N N    . ASP A 1 38 ? 10.101 12.676 -0.079  1.00 0.00 ? 55 ASP A N    10 
ATOM   6839  C CA   . ASP A 1 38 ? 10.730 13.557 0.899   1.00 0.00 ? 55 ASP A CA   10 
ATOM   6840  C C    . ASP A 1 38 ? 11.697 14.524 0.229   1.00 0.00 ? 55 ASP A C    10 
ATOM   6841  O O    . ASP A 1 38 ? 12.793 14.138 -0.178  1.00 0.00 ? 55 ASP A O    10 
ATOM   6842  C CB   . ASP A 1 38 ? 11.460 12.737 1.966   1.00 0.00 ? 55 ASP A CB   10 
ATOM   6843  C CG   . ASP A 1 38 ? 12.115 13.570 3.059   1.00 0.00 ? 55 ASP A CG   10 
ATOM   6844  O OD1  . ASP A 1 38 ? 12.098 14.773 2.953   1.00 0.00 ? 55 ASP A OD1  10 
ATOM   6845  O OD2  . ASP A 1 38 ? 12.486 13.010 4.064   1.00 0.00 ? 55 ASP A OD2  10 
ATOM   6846  H H    . ASP A 1 38 ? 10.597 11.854 -0.390  1.00 0.00 ? 55 ASP A H    10 
ATOM   6847  H HA   . ASP A 1 38 ? 9.970  14.167 1.388   1.00 0.00 ? 55 ASP A HA   10 
ATOM   6848  H HB2  . ASP A 1 38 ? 10.839 11.965 2.421   1.00 0.00 ? 55 ASP A HB2  10 
ATOM   6849  H HB3  . ASP A 1 38 ? 12.233 12.271 1.354   1.00 0.00 ? 55 ASP A HB3  10 
ATOM   6850  N N    . ARG A 1 39 ? 11.285 15.782 0.117   1.00 0.00 ? 56 ARG A N    10 
ATOM   6851  C CA   . ARG A 1 39 ? 12.088 16.794 -0.559  1.00 0.00 ? 56 ARG A CA   10 
ATOM   6852  C C    . ARG A 1 39 ? 13.239 17.263 0.321   1.00 0.00 ? 56 ARG A C    10 
ATOM   6853  O O    . ARG A 1 39 ? 13.056 17.527 1.510   1.00 0.00 ? 56 ARG A O    10 
ATOM   6854  C CB   . ARG A 1 39 ? 11.246 17.964 -1.045  1.00 0.00 ? 56 ARG A CB   10 
ATOM   6855  C CG   . ARG A 1 39 ? 10.270 17.630 -2.162  1.00 0.00 ? 56 ARG A CG   10 
ATOM   6856  C CD   . ARG A 1 39 ? 9.132  18.576 -2.285  1.00 0.00 ? 56 ARG A CD   10 
ATOM   6857  N NE   . ARG A 1 39 ? 9.521  19.965 -2.468  1.00 0.00 ? 56 ARG A NE   10 
ATOM   6858  C CZ   . ARG A 1 39 ? 8.844  21.021 -1.976  1.00 0.00 ? 56 ARG A CZ   10 
ATOM   6859  N NH1  . ARG A 1 39 ? 7.726  20.855 -1.305  1.00 0.00 ? 56 ARG A NH1  10 
ATOM   6860  N NH2  . ARG A 1 39 ? 9.322  22.231 -2.207  1.00 0.00 ? 56 ARG A NH2  10 
ATOM   6861  H H    . ARG A 1 39 ? 10.393 16.044 0.511   1.00 0.00 ? 56 ARG A H    10 
ATOM   6862  H HA   . ARG A 1 39 ? 12.538 16.369 -1.458  1.00 0.00 ? 56 ARG A HA   10 
ATOM   6863  H HB2  . ARG A 1 39 ? 10.694 18.337 -0.184  1.00 0.00 ? 56 ARG A HB2  10 
ATOM   6864  H HB3  . ARG A 1 39 ? 11.939 18.731 -1.393  1.00 0.00 ? 56 ARG A HB3  10 
ATOM   6865  H HG2  . ARG A 1 39 ? 10.811 17.630 -3.109  1.00 0.00 ? 56 ARG A HG2  10 
ATOM   6866  H HG3  . ARG A 1 39 ? 9.862  16.635 -1.978  1.00 0.00 ? 56 ARG A HG3  10 
ATOM   6867  H HD2  . ARG A 1 39 ? 8.526  18.292 -3.144  1.00 0.00 ? 56 ARG A HD2  10 
ATOM   6868  H HD3  . ARG A 1 39 ? 8.528  18.523 -1.380  1.00 0.00 ? 56 ARG A HD3  10 
ATOM   6869  H HE   . ARG A 1 39 ? 10.315 20.353 -2.962  1.00 0.00 ? 56 ARG A HE   10 
ATOM   6870  H HH11 . ARG A 1 39 ? 7.365  19.924 -1.153  1.00 0.00 ? 56 ARG A HH11 10 
ATOM   6871  H HH12 . ARG A 1 39 ? 7.233  21.660 -0.945  1.00 0.00 ? 56 ARG A HH12 10 
ATOM   6872  H HH21 . ARG A 1 39 ? 10.173 22.342 -2.741  1.00 0.00 ? 56 ARG A HH21 10 
ATOM   6873  H HH22 . ARG A 1 39 ? 8.834  23.040 -1.851  1.00 0.00 ? 56 ARG A HH22 10 
ATOM   6874  N N    . LYS A 1 40 ? 14.425 17.364 -0.269  1.00 0.00 ? 57 LYS A N    10 
ATOM   6875  C CA   . LYS A 1 40 ? 15.536 18.067 0.361   1.00 0.00 ? 57 LYS A CA   10 
ATOM   6876  C C    . LYS A 1 40 ? 15.151 19.496 0.722   1.00 0.00 ? 57 LYS A C    10 
ATOM   6877  O O    . LYS A 1 40 ? 15.516 19.999 1.785   1.00 0.00 ? 57 LYS A O    10 
ATOM   6878  C CB   . LYS A 1 40 ? 16.760 18.068 -0.557  1.00 0.00 ? 57 LYS A CB   10 
ATOM   6879  C CG   . LYS A 1 40 ? 17.960 18.826 -0.005  1.00 0.00 ? 57 LYS A CG   10 
ATOM   6880  C CD   . LYS A 1 40 ? 19.140 18.766 -0.964  1.00 0.00 ? 57 LYS A CD   10 
ATOM   6881  C CE   . LYS A 1 40 ? 20.320 19.572 -0.441  1.00 0.00 ? 57 LYS A CE   10 
ATOM   6882  N NZ   . LYS A 1 40 ? 21.491 19.502 -1.356  1.00 0.00 ? 57 LYS A NZ   10 
ATOM   6883  H H    . LYS A 1 40 ? 14.561 16.944 -1.176  1.00 0.00 ? 57 LYS A H    10 
ATOM   6884  H HA   . LYS A 1 40 ? 15.803 17.573 1.296   1.00 0.00 ? 57 LYS A HA   10 
ATOM   6885  H HB2  . LYS A 1 40 ? 17.034 17.027 -0.725  1.00 0.00 ? 57 LYS A HB2  10 
ATOM   6886  H HB3  . LYS A 1 40 ? 16.450 18.518 -1.501  1.00 0.00 ? 57 LYS A HB3  10 
ATOM   6887  H HG2  . LYS A 1 40 ? 17.671 19.866 0.150   1.00 0.00 ? 57 LYS A HG2  10 
ATOM   6888  H HG3  . LYS A 1 40 ? 18.242 18.381 0.948   1.00 0.00 ? 57 LYS A HG3  10 
ATOM   6889  H HD2  . LYS A 1 40 ? 19.437 17.723 -1.084  1.00 0.00 ? 57 LYS A HD2  10 
ATOM   6890  H HD3  . LYS A 1 40 ? 18.826 19.166 -1.927  1.00 0.00 ? 57 LYS A HD3  10 
ATOM   6891  H HE2  . LYS A 1 40 ? 20.005 20.610 -0.335  1.00 0.00 ? 57 LYS A HE2  10 
ATOM   6892  H HE3  . LYS A 1 40 ? 20.598 19.177 0.535   1.00 0.00 ? 57 LYS A HE3  10 
ATOM   6893  H HZ1  . LYS A 1 40 ? 21.234 19.869 -2.261  1.00 0.00 ? 57 LYS A HZ1  10 
ATOM   6894  H HZ2  . LYS A 1 40 ? 22.250 20.049 -0.974  1.00 0.00 ? 57 LYS A HZ2  10 
ATOM   6895  H HZ3  . LYS A 1 40 ? 21.785 18.540 -1.455  1.00 0.00 ? 57 LYS A HZ3  10 
ATOM   6896  N N    . PHE A 1 41 ? 14.411 20.147 -0.170  1.00 0.00 ? 58 PHE A N    10 
ATOM   6897  C CA   . PHE A 1 41 ? 13.932 21.502 0.074   1.00 0.00 ? 58 PHE A CA   10 
ATOM   6898  C C    . PHE A 1 41 ? 12.448 21.510 0.415   1.00 0.00 ? 58 PHE A C    10 
ATOM   6899  O O    . PHE A 1 41 ? 11.705 22.389 -0.021  1.00 0.00 ? 58 PHE A O    10 
ATOM   6900  C CB   . PHE A 1 41 ? 14.197 22.390 -1.144  1.00 0.00 ? 58 PHE A CB   10 
ATOM   6901  C CG   . PHE A 1 41 ? 15.647 22.471 -1.532  1.00 0.00 ? 58 PHE A CG   10 
ATOM   6902  C CD1  . PHE A 1 41 ? 16.550 23.179 -0.754  1.00 0.00 ? 58 PHE A CD1  10 
ATOM   6903  C CD2  . PHE A 1 41 ? 16.109 21.837 -2.675  1.00 0.00 ? 58 PHE A CD2  10 
ATOM   6904  C CE1  . PHE A 1 41 ? 17.882 23.255 -1.109  1.00 0.00 ? 58 PHE A CE1  10 
ATOM   6905  C CE2  . PHE A 1 41 ? 17.443 21.911 -3.034  1.00 0.00 ? 58 PHE A CE2  10 
ATOM   6906  C CZ   . PHE A 1 41 ? 18.329 22.619 -2.251  1.00 0.00 ? 58 PHE A CZ   10 
ATOM   6907  H H    . PHE A 1 41 ? 14.174 19.690 -1.039  1.00 0.00 ? 58 PHE A H    10 
ATOM   6908  H HA   . PHE A 1 41 ? 14.451 21.928 0.934   1.00 0.00 ? 58 PHE A HA   10 
ATOM   6909  H HB2  . PHE A 1 41 ? 13.663 22.005 -2.012  1.00 0.00 ? 58 PHE A HB2  10 
ATOM   6910  H HB3  . PHE A 1 41 ? 13.872 23.409 -0.942  1.00 0.00 ? 58 PHE A HB3  10 
ATOM   6911  H HD1  . PHE A 1 41 ? 16.196 23.681 0.148   1.00 0.00 ? 58 PHE A HD1  10 
ATOM   6912  H HD2  . PHE A 1 41 ? 15.409 21.277 -3.295  1.00 0.00 ? 58 PHE A HD2  10 
ATOM   6913  H HE1  . PHE A 1 41 ? 18.581 23.816 -0.489  1.00 0.00 ? 58 PHE A HE1  10 
ATOM   6914  H HE2  . PHE A 1 41 ? 17.792 21.408 -3.934  1.00 0.00 ? 58 PHE A HE2  10 
ATOM   6915  H HZ   . PHE A 1 41 ? 19.379 22.677 -2.531  1.00 0.00 ? 58 PHE A HZ   10 
ATOM   6916  N N    . LEU A 1 42 ? 12.021 20.524 1.197   1.00 0.00 ? 59 LEU A N    10 
ATOM   6917  C CA   . LEU A 1 42 ? 10.624 20.417 1.602   1.00 0.00 ? 59 LEU A CA   10 
ATOM   6918  C C    . LEU A 1 42 ? 10.167 21.670 2.339   1.00 0.00 ? 59 LEU A C    10 
ATOM   6919  O O    . LEU A 1 42 ? 10.761 22.062 3.343   1.00 0.00 ? 59 LEU A O    10 
ATOM   6920  C CB   . LEU A 1 42 ? 10.420 19.177 2.480   1.00 0.00 ? 59 LEU A CB   10 
ATOM   6921  C CG   . LEU A 1 42 ? 8.964  18.878 2.860   1.00 0.00 ? 59 LEU A CG   10 
ATOM   6922  C CD1  . LEU A 1 42 ? 8.154  18.557 1.612   1.00 0.00 ? 59 LEU A CD1  10 
ATOM   6923  C CD2  . LEU A 1 42 ? 8.924  17.719 3.844   1.00 0.00 ? 59 LEU A CD2  10 
ATOM   6924  H H    . LEU A 1 42 ? 12.681 19.831 1.520   1.00 0.00 ? 59 LEU A H    10 
ATOM   6925  H HA   . LEU A 1 42 ? 9.994  20.331 0.717   1.00 0.00 ? 59 LEU A HA   10 
ATOM   6926  H HB2  . LEU A 1 42 ? 10.793 18.413 1.798   1.00 0.00 ? 59 LEU A HB2  10 
ATOM   6927  H HB3  . LEU A 1 42 ? 11.048 19.205 3.370   1.00 0.00 ? 59 LEU A HB3  10 
ATOM   6928  H HG   . LEU A 1 42 ? 8.576  19.761 3.370   1.00 0.00 ? 59 LEU A HG   10 
ATOM   6929  H HD11 . LEU A 1 42 ? 7.122  18.347 1.892   1.00 0.00 ? 59 LEU A HD11 10 
ATOM   6930  H HD12 . LEU A 1 42 ? 8.179  19.409 0.933   1.00 0.00 ? 59 LEU A HD12 10 
ATOM   6931  H HD13 . LEU A 1 42 ? 8.580  17.685 1.117   1.00 0.00 ? 59 LEU A HD13 10 
ATOM   6932  H HD21 . LEU A 1 42 ? 9.486  17.981 4.741   1.00 0.00 ? 59 LEU A HD21 10 
ATOM   6933  H HD22 . LEU A 1 42 ? 7.888  17.508 4.115   1.00 0.00 ? 59 LEU A HD22 10 
ATOM   6934  H HD23 . LEU A 1 42 ? 9.365  16.835 3.385   1.00 0.00 ? 59 LEU A HD23 10 
ATOM   6935  N N    . LEU A 1 43 ? 9.109  22.293 1.834   1.00 0.00 ? 60 LEU A N    10 
ATOM   6936  C CA   . LEU A 1 43 ? 8.553  23.488 2.459   1.00 0.00 ? 60 LEU A CA   10 
ATOM   6937  C C    . LEU A 1 43 ? 7.630  23.127 3.616   1.00 0.00 ? 60 LEU A C    10 
ATOM   6938  O O    . LEU A 1 43 ? 7.403  23.933 4.517   1.00 0.00 ? 60 LEU A O    10 
ATOM   6939  C CB   . LEU A 1 43 ? 7.802  24.330 1.420   1.00 0.00 ? 60 LEU A CB   10 
ATOM   6940  C CG   . LEU A 1 43 ? 8.671  24.911 0.298   1.00 0.00 ? 60 LEU A CG   10 
ATOM   6941  C CD1  . LEU A 1 43 ? 7.798  25.637 -0.716  1.00 0.00 ? 60 LEU A CD1  10 
ATOM   6942  C CD2  . LEU A 1 43 ? 9.704  25.855 0.893   1.00 0.00 ? 60 LEU A CD2  10 
ATOM   6943  H H    . LEU A 1 43 ? 8.677  21.931 0.996   1.00 0.00 ? 60 LEU A H    10 
ATOM   6944  H HA   . LEU A 1 43 ? 9.359  24.086 2.882   1.00 0.00 ? 60 LEU A HA   10 
ATOM   6945  H HB2  . LEU A 1 43 ? 7.137  23.565 1.019   1.00 0.00 ? 60 LEU A HB2  10 
ATOM   6946  H HB3  . LEU A 1 43 ? 7.209  25.115 1.888   1.00 0.00 ? 60 LEU A HB3  10 
ATOM   6947  H HG   . LEU A 1 43 ? 9.205  24.080 -0.162  1.00 0.00 ? 60 LEU A HG   10 
ATOM   6948  H HD11 . LEU A 1 43 ? 8.424  26.047 -1.509  1.00 0.00 ? 60 LEU A HD11 10 
ATOM   6949  H HD12 . LEU A 1 43 ? 7.081  24.938 -1.147  1.00 0.00 ? 60 LEU A HD12 10 
ATOM   6950  H HD13 . LEU A 1 43 ? 7.263  26.447 -0.222  1.00 0.00 ? 60 LEU A HD13 10 
ATOM   6951  H HD21 . LEU A 1 43 ? 10.336 25.309 1.595   1.00 0.00 ? 60 LEU A HD21 10 
ATOM   6952  H HD22 . LEU A 1 43 ? 10.323 26.268 0.095   1.00 0.00 ? 60 LEU A HD22 10 
ATOM   6953  H HD23 . LEU A 1 43 ? 9.198  26.667 1.417   1.00 0.00 ? 60 LEU A HD23 10 
ATOM   6954  N N    . ASP A 1 44 ? 7.101  21.908 3.585   1.00 0.00 ? 61 ASP A N    10 
ATOM   6955  C CA   . ASP A 1 44 ? 6.243  21.418 4.657   1.00 0.00 ? 61 ASP A CA   10 
ATOM   6956  C C    . ASP A 1 44 ? 7.034  21.204 5.941   1.00 0.00 ? 61 ASP A C    10 
ATOM   6957  O O    . ASP A 1 44 ? 7.895  20.326 6.012   1.00 0.00 ? 61 ASP A O    10 
ATOM   6958  C CB   . ASP A 1 44 ? 5.555  20.116 4.241   1.00 0.00 ? 61 ASP A CB   10 
ATOM   6959  C CG   . ASP A 1 44 ? 4.563  19.575 5.262   1.00 0.00 ? 61 ASP A CG   10 
ATOM   6960  O OD1  . ASP A 1 44 ? 4.480  20.130 6.331   1.00 0.00 ? 61 ASP A OD1  10 
ATOM   6961  O OD2  . ASP A 1 44 ? 3.790  18.714 4.911   1.00 0.00 ? 61 ASP A OD2  10 
ATOM   6962  H H    . ASP A 1 44 ? 7.297  21.306 2.798   1.00 0.00 ? 61 ASP A H    10 
ATOM   6963  H HA   . ASP A 1 44 ? 5.477  22.160 4.885   1.00 0.00 ? 61 ASP A HA   10 
ATOM   6964  H HB2  . ASP A 1 44 ? 5.075  20.171 3.263   1.00 0.00 ? 61 ASP A HB2  10 
ATOM   6965  H HB3  . ASP A 1 44 ? 6.418  19.452 4.186   1.00 0.00 ? 61 ASP A HB3  10 
ATOM   6966  N N    . ARG A 1 45 ? 6.738  22.011 6.954   1.00 0.00 ? 62 ARG A N    10 
ATOM   6967  C CA   . ARG A 1 45 ? 7.421  21.911 8.238   1.00 0.00 ? 62 ARG A CA   10 
ATOM   6968  C C    . ARG A 1 45 ? 7.023  20.637 8.975   1.00 0.00 ? 62 ARG A C    10 
ATOM   6969  O O    . ARG A 1 45 ? 7.530  19.591 8.680   1.00 0.00 ? 62 ARG A O    10 
ATOM   6970  C CB   . ARG A 1 45 ? 7.204  23.145 9.102   1.00 0.00 ? 62 ARG A CB   10 
ATOM   6971  C CG   . ARG A 1 45 ? 7.974  23.152 10.413  1.00 0.00 ? 62 ARG A CG   10 
ATOM   6972  C CD   . ARG A 1 45 ? 7.791  24.383 11.224  1.00 0.00 ? 62 ARG A CD   10 
ATOM   6973  N NE   . ARG A 1 45 ? 8.550  24.405 12.464  1.00 0.00 ? 62 ARG A NE   10 
ATOM   6974  C CZ   . ARG A 1 45 ? 8.544  25.423 13.346  1.00 0.00 ? 62 ARG A CZ   10 
ATOM   6975  N NH1  . ARG A 1 45 ? 7.853  26.517 13.113  1.00 0.00 ? 62 ARG A NH1  10 
ATOM   6976  N NH2  . ARG A 1 45 ? 9.271  25.303 14.443  1.00 0.00 ? 62 ARG A NH2  10 
ATOM   6977  O OXT  . ARG A 1 45 ? 6.205  20.682 9.851   1.00 0.00 ? 62 ARG A OXT  10 
ATOM   6978  H H    . ARG A 1 45 ? 6.022  22.712 6.832   1.00 0.00 ? 62 ARG A H    10 
ATOM   6979  H HA   . ARG A 1 45 ? 8.498  21.855 8.081   1.00 0.00 ? 62 ARG A HA   10 
ATOM   6980  H HB2  . ARG A 1 45 ? 7.500  24.006 8.505   1.00 0.00 ? 62 ARG A HB2  10 
ATOM   6981  H HB3  . ARG A 1 45 ? 6.135  23.200 9.314   1.00 0.00 ? 62 ARG A HB3  10 
ATOM   6982  H HG2  . ARG A 1 45 ? 7.645  22.303 11.013  1.00 0.00 ? 62 ARG A HG2  10 
ATOM   6983  H HG3  . ARG A 1 45 ? 9.037  23.049 10.191  1.00 0.00 ? 62 ARG A HG3  10 
ATOM   6984  H HD2  . ARG A 1 45 ? 8.105  25.244 10.634  1.00 0.00 ? 62 ARG A HD2  10 
ATOM   6985  H HD3  . ARG A 1 45 ? 6.738  24.483 11.483  1.00 0.00 ? 62 ARG A HD3  10 
ATOM   6986  H HE   . ARG A 1 45 ? 9.171  23.707 12.852  1.00 0.00 ? 62 ARG A HE   10 
ATOM   6987  H HH11 . ARG A 1 45 ? 7.315  26.600 12.262  1.00 0.00 ? 62 ARG A HH11 10 
ATOM   6988  H HH12 . ARG A 1 45 ? 7.861  27.269 13.787  1.00 0.00 ? 62 ARG A HH12 10 
ATOM   6989  H HH21 . ARG A 1 45 ? 9.811  24.463 14.599  1.00 0.00 ? 62 ARG A HH21 10 
ATOM   6990  H HH22 . ARG A 1 45 ? 9.285  26.051 15.120  1.00 0.00 ? 62 ARG A HH22 10 
ATOM   6991  N N    . PRO A 1 1  ? -0.266 -0.122 -0.326  1.00 0.00 ? 18 PRO A N    11 
ATOM   6992  C CA   . PRO A 1 1  ? 1.183  -0.087 -0.174  1.00 0.00 ? 18 PRO A CA   11 
ATOM   6993  C C    . PRO A 1 1  ? 1.739  1.292  -0.504  1.00 0.00 ? 18 PRO A C    11 
ATOM   6994  O O    . PRO A 1 1  ? 1.203  2.001  -1.357  1.00 0.00 ? 18 PRO A O    11 
ATOM   6995  C CB   . PRO A 1 1  ? 1.687  -1.159 -1.146  1.00 0.00 ? 18 PRO A CB   11 
ATOM   6996  C CG   . PRO A 1 1  ? 0.657  -1.199 -2.223  1.00 0.00 ? 18 PRO A CG   11 
ATOM   6997  C CD   . PRO A 1 1  ? -0.654 -0.935 -1.530  1.00 0.00 ? 18 PRO A CD   11 
ATOM   6998  H H2   . PRO A 1 1  ? -0.686 -0.754 -0.977  1.00 0.00 ? 18 PRO A H2   11 
ATOM   6999  H H3   . PRO A 1 1  ? -0.846 -0.346 0.457   1.00 0.00 ? 18 PRO A H3   11 
ATOM   7000  H HA   . PRO A 1 1  ? 1.509  -0.284 0.858   1.00 0.00 ? 18 PRO A HA   11 
ATOM   7001  H HB2  . PRO A 1 1  ? 2.678  -0.903 -1.551  1.00 0.00 ? 18 PRO A HB2  11 
ATOM   7002  H HB3  . PRO A 1 1  ? 1.784  -2.137 -0.652  1.00 0.00 ? 18 PRO A HB3  11 
ATOM   7003  H HG2  . PRO A 1 1  ? 0.857  -0.439 -2.993  1.00 0.00 ? 18 PRO A HG2  11 
ATOM   7004  H HG3  . PRO A 1 1  ? 0.648  -2.176 -2.728  1.00 0.00 ? 18 PRO A HG3  11 
ATOM   7005  H HD2  . PRO A 1 1  ? -1.356 -0.376 -2.167  1.00 0.00 ? 18 PRO A HD2  11 
ATOM   7006  H HD3  . PRO A 1 1  ? -1.161 -1.864 -1.231  1.00 0.00 ? 18 PRO A HD3  11 
ATOM   7007  N N    . THR A 1 2  ? 2.817  1.669  0.176   1.00 0.00 ? 19 THR A N    11 
ATOM   7008  C CA   . THR A 1 2  ? 3.454  2.960  -0.053  1.00 0.00 ? 19 THR A CA   11 
ATOM   7009  C C    . THR A 1 2  ? 4.955  2.803  -0.263  1.00 0.00 ? 19 THR A C    11 
ATOM   7010  O O    . THR A 1 2  ? 5.521  1.741  -0.003  1.00 0.00 ? 19 THR A O    11 
ATOM   7011  C CB   . THR A 1 2  ? 3.209  3.928  1.119   1.00 0.00 ? 19 THR A CB   11 
ATOM   7012  O OG1  . THR A 1 2  ? 3.787  3.390  2.315   1.00 0.00 ? 19 THR A OG1  11 
ATOM   7013  C CG2  . THR A 1 2  ? 1.717  4.139  1.331   1.00 0.00 ? 19 THR A CG2  11 
ATOM   7014  H H    . THR A 1 2  ? 3.204  1.044  0.869   1.00 0.00 ? 19 THR A H    11 
ATOM   7015  H HA   . THR A 1 2  ? 3.061  3.409  -0.966  1.00 0.00 ? 19 THR A HA   11 
ATOM   7016  H HB   . THR A 1 2  ? 3.682  4.883  0.895   1.00 0.00 ? 19 THR A HB   11 
ATOM   7017  H HG1  . THR A 1 2  ? 3.632  3.995  3.044   1.00 0.00 ? 19 THR A HG1  11 
ATOM   7018  H HG21 . THR A 1 2  ? 1.244  3.185  1.556   1.00 0.00 ? 19 THR A HG21 11 
ATOM   7019  H HG22 . THR A 1 2  ? 1.564  4.827  2.163   1.00 0.00 ? 19 THR A HG22 11 
ATOM   7020  H HG23 . THR A 1 2  ? 1.278  4.559  0.427   1.00 0.00 ? 19 THR A HG23 11 
ATOM   7021  N N    . ARG A 1 3  ? 5.596  3.867  -0.734  1.00 0.00 ? 20 ARG A N    11 
ATOM   7022  C CA   . ARG A 1 3  ? 7.040  3.863  -0.942  1.00 0.00 ? 20 ARG A CA   11 
ATOM   7023  C C    . ARG A 1 3  ? 7.655  5.202  -0.561  1.00 0.00 ? 20 ARG A C    11 
ATOM   7024  O O    . ARG A 1 3  ? 7.187  6.257  -0.991  1.00 0.00 ? 20 ARG A O    11 
ATOM   7025  C CB   . ARG A 1 3  ? 7.413  3.462  -2.361  1.00 0.00 ? 20 ARG A CB   11 
ATOM   7026  C CG   . ARG A 1 3  ? 8.908  3.414  -2.639  1.00 0.00 ? 20 ARG A CG   11 
ATOM   7027  C CD   . ARG A 1 3  ? 9.260  2.998  -4.021  1.00 0.00 ? 20 ARG A CD   11 
ATOM   7028  N NE   . ARG A 1 3  ? 10.687 2.993  -4.304  1.00 0.00 ? 20 ARG A NE   11 
ATOM   7029  C CZ   . ARG A 1 3  ? 11.240 2.535  -5.444  1.00 0.00 ? 20 ARG A CZ   11 
ATOM   7030  N NH1  . ARG A 1 3  ? 10.497 2.010  -6.393  1.00 0.00 ? 20 ARG A NH1  11 
ATOM   7031  N NH2  . ARG A 1 3  ? 12.553 2.605  -5.573  1.00 0.00 ? 20 ARG A NH2  11 
ATOM   7032  H H    . ARG A 1 3  ? 5.070  4.700  -0.954  1.00 0.00 ? 20 ARG A H    11 
ATOM   7033  H HA   . ARG A 1 3  ? 7.502  3.114  -0.298  1.00 0.00 ? 20 ARG A HA   11 
ATOM   7034  H HB2  . ARG A 1 3  ? 6.983  2.477  -2.537  1.00 0.00 ? 20 ARG A HB2  11 
ATOM   7035  H HB3  . ARG A 1 3  ? 6.948  4.186  -3.030  1.00 0.00 ? 20 ARG A HB3  11 
ATOM   7036  H HG2  . ARG A 1 3  ? 9.324  4.407  -2.471  1.00 0.00 ? 20 ARG A HG2  11 
ATOM   7037  H HG3  . ARG A 1 3  ? 9.366  2.706  -1.948  1.00 0.00 ? 20 ARG A HG3  11 
ATOM   7038  H HD2  . ARG A 1 3  ? 8.891  1.987  -4.192  1.00 0.00 ? 20 ARG A HD2  11 
ATOM   7039  H HD3  . ARG A 1 3  ? 8.790  3.681  -4.727  1.00 0.00 ? 20 ARG A HD3  11 
ATOM   7040  H HE   . ARG A 1 3  ? 11.457 3.313  -3.733  1.00 0.00 ? 20 ARG A HE   11 
ATOM   7041  H HH11 . ARG A 1 3  ? 9.496  1.946  -6.271  1.00 0.00 ? 20 ARG A HH11 11 
ATOM   7042  H HH12 . ARG A 1 3  ? 10.930 1.671  -7.239  1.00 0.00 ? 20 ARG A HH12 11 
ATOM   7043  H HH21 . ARG A 1 3  ? 13.110 2.995  -4.826  1.00 0.00 ? 20 ARG A HH21 11 
ATOM   7044  H HH22 . ARG A 1 3  ? 12.992 2.268  -6.416  1.00 0.00 ? 20 ARG A HH22 11 
ATOM   7045  N N    . THR A 1 4  ? 8.708  5.156  0.249   1.00 0.00 ? 21 THR A N    11 
ATOM   7046  C CA   . THR A 1 4  ? 9.363  6.369  0.724   1.00 0.00 ? 21 THR A CA   11 
ATOM   7047  C C    . THR A 1 4  ? 10.535 6.749  -0.172  1.00 0.00 ? 21 THR A C    11 
ATOM   7048  O O    . THR A 1 4  ? 11.525 6.020  -0.257  1.00 0.00 ? 21 THR A O    11 
ATOM   7049  C CB   . THR A 1 4  ? 9.866  6.209  2.171   1.00 0.00 ? 21 THR A CB   11 
ATOM   7050  O OG1  . THR A 1 4  ? 8.757  5.934  3.037   1.00 0.00 ? 21 THR A OG1  11 
ATOM   7051  C CG2  . THR A 1 4  ? 10.565 7.477  2.635   1.00 0.00 ? 21 THR A CG2  11 
ATOM   7052  H H    . THR A 1 4  ? 9.062  4.257  0.543   1.00 0.00 ? 21 THR A H    11 
ATOM   7053  H HA   . THR A 1 4  ? 8.664  7.204  0.688   1.00 0.00 ? 21 THR A HA   11 
ATOM   7054  H HB   . THR A 1 4  ? 10.565 5.374  2.213   1.00 0.00 ? 21 THR A HB   11 
ATOM   7055  H HG1  . THR A 1 4  ? 9.074  5.835  3.939   1.00 0.00 ? 21 THR A HG1  11 
ATOM   7056  H HG21 . THR A 1 4  ? 9.867  8.312  2.595   1.00 0.00 ? 21 THR A HG21 11 
ATOM   7057  H HG22 . THR A 1 4  ? 10.913 7.345  3.659   1.00 0.00 ? 21 THR A HG22 11 
ATOM   7058  H HG23 . THR A 1 4  ? 11.415 7.682  1.985   1.00 0.00 ? 21 THR A HG23 11 
ATOM   7059  N N    . VAL A 1 5  ? 10.418 7.892  -0.837  1.00 0.00 ? 22 VAL A N    11 
ATOM   7060  C CA   . VAL A 1 5  ? 11.492 8.399  -1.683  1.00 0.00 ? 22 VAL A CA   11 
ATOM   7061  C C    . VAL A 1 5  ? 11.883 9.817  -1.288  1.00 0.00 ? 22 VAL A C    11 
ATOM   7062  O O    . VAL A 1 5  ? 11.040 10.713 -1.239  1.00 0.00 ? 22 VAL A O    11 
ATOM   7063  C CB   . VAL A 1 5  ? 11.094 8.383  -3.171  1.00 0.00 ? 22 VAL A CB   11 
ATOM   7064  C CG1  . VAL A 1 5  ? 12.200 8.985  -4.025  1.00 0.00 ? 22 VAL A CG1  11 
ATOM   7065  C CG2  . VAL A 1 5  ? 10.785 6.964  -3.625  1.00 0.00 ? 22 VAL A CG2  11 
ATOM   7066  H H    . VAL A 1 5  ? 9.564  8.425  -0.754  1.00 0.00 ? 22 VAL A H    11 
ATOM   7067  H HA   . VAL A 1 5  ? 12.404 7.813  -1.561  1.00 0.00 ? 22 VAL A HA   11 
ATOM   7068  H HB   . VAL A 1 5  ? 10.180 8.963  -3.300  1.00 0.00 ? 22 VAL A HB   11 
ATOM   7069  H HG11 . VAL A 1 5  ? 11.902 8.966  -5.073  1.00 0.00 ? 22 VAL A HG11 11 
ATOM   7070  H HG12 . VAL A 1 5  ? 12.377 10.015 -3.717  1.00 0.00 ? 22 VAL A HG12 11 
ATOM   7071  H HG13 . VAL A 1 5  ? 13.114 8.405  -3.898  1.00 0.00 ? 22 VAL A HG13 11 
ATOM   7072  H HG21 . VAL A 1 5  ? 9.961  6.565  -3.034  1.00 0.00 ? 22 VAL A HG21 11 
ATOM   7073  H HG22 . VAL A 1 5  ? 10.505 6.972  -4.678  1.00 0.00 ? 22 VAL A HG22 11 
ATOM   7074  H HG23 . VAL A 1 5  ? 11.667 6.339  -3.488  1.00 0.00 ? 22 VAL A HG23 11 
ATOM   7075  N N    . ALA A 1 6  ? 13.166 10.015 -1.005  1.00 0.00 ? 23 ALA A N    11 
ATOM   7076  C CA   . ALA A 1 6  ? 13.681 11.335 -0.666  1.00 0.00 ? 23 ALA A CA   11 
ATOM   7077  C C    . ALA A 1 6  ? 14.109 12.098 -1.913  1.00 0.00 ? 23 ALA A C    11 
ATOM   7078  O O    . ALA A 1 6  ? 14.712 11.528 -2.824  1.00 0.00 ? 23 ALA A O    11 
ATOM   7079  C CB   . ALA A 1 6  ? 14.842 11.217 0.311   1.00 0.00 ? 23 ALA A CB   11 
ATOM   7080  H H    . ALA A 1 6  ? 13.801 9.230  -1.026  1.00 0.00 ? 23 ALA A H    11 
ATOM   7081  H HA   . ALA A 1 6  ? 12.886 11.910 -0.192  1.00 0.00 ? 23 ALA A HA   11 
ATOM   7082  H HB1  . ALA A 1 6  ? 15.641 10.632 -0.143  1.00 0.00 ? 23 ALA A HB1  11 
ATOM   7083  H HB2  . ALA A 1 6  ? 15.215 12.212 0.554   1.00 0.00 ? 23 ALA A HB2  11 
ATOM   7084  H HB3  . ALA A 1 6  ? 14.503 10.725 1.222   1.00 0.00 ? 23 ALA A HB3  11 
ATOM   7085  N N    . ILE A 1 7  ? 13.795 13.387 -1.950  1.00 0.00 ? 24 ILE A N    11 
ATOM   7086  C CA   . ILE A 1 7  ? 14.124 14.224 -3.097  1.00 0.00 ? 24 ILE A CA   11 
ATOM   7087  C C    . ILE A 1 7  ? 14.713 15.558 -2.656  1.00 0.00 ? 24 ILE A C    11 
ATOM   7088  O O    . ILE A 1 7  ? 14.643 15.919 -1.481  1.00 0.00 ? 24 ILE A O    11 
ATOM   7089  C CB   . ILE A 1 7  ? 12.889 14.485 -3.979  1.00 0.00 ? 24 ILE A CB   11 
ATOM   7090  C CG1  . ILE A 1 7  ? 11.815 15.234 -3.186  1.00 0.00 ? 24 ILE A CG1  11 
ATOM   7091  C CG2  . ILE A 1 7  ? 12.338 13.177 -4.524  1.00 0.00 ? 24 ILE A CG2  11 
ATOM   7092  C CD1  . ILE A 1 7  ? 10.647 15.697 -4.026  1.00 0.00 ? 24 ILE A CD1  11 
ATOM   7093  H H    . ILE A 1 7  ? 13.314 13.799 -1.163  1.00 0.00 ? 24 ILE A H    11 
ATOM   7094  H HA   . ILE A 1 7  ? 14.907 13.762 -3.697  1.00 0.00 ? 24 ILE A HA   11 
ATOM   7095  H HB   . ILE A 1 7  ? 13.175 15.133 -4.808  1.00 0.00 ? 24 ILE A HB   11 
ATOM   7096  H HG12 . ILE A 1 7  ? 11.458 14.560 -2.408  1.00 0.00 ? 24 ILE A HG12 11 
ATOM   7097  H HG13 . ILE A 1 7  ? 12.295 16.097 -2.724  1.00 0.00 ? 24 ILE A HG13 11 
ATOM   7098  H HG21 . ILE A 1 7  ? 11.466 13.381 -5.145  1.00 0.00 ? 24 ILE A HG21 11 
ATOM   7099  H HG22 . ILE A 1 7  ? 13.102 12.683 -5.124  1.00 0.00 ? 24 ILE A HG22 11 
ATOM   7100  H HG23 . ILE A 1 7  ? 12.051 12.529 -3.696  1.00 0.00 ? 24 ILE A HG23 11 
ATOM   7101  H HD11 . ILE A 1 7  ? 10.164 14.836 -4.486  1.00 0.00 ? 24 ILE A HD11 11 
ATOM   7102  H HD12 . ILE A 1 7  ? 9.927  16.219 -3.394  1.00 0.00 ? 24 ILE A HD12 11 
ATOM   7103  H HD13 . ILE A 1 7  ? 11.002 16.374 -4.804  1.00 0.00 ? 24 ILE A HD13 11 
ATOM   7104  N N    . SER A 1 8  ? 15.292 16.286 -3.604  1.00 0.00 ? 25 SER A N    11 
ATOM   7105  C CA   . SER A 1 8  ? 15.830 17.613 -3.330  1.00 0.00 ? 25 SER A CA   11 
ATOM   7106  C C    . SER A 1 8  ? 14.872 18.702 -3.793  1.00 0.00 ? 25 SER A C    11 
ATOM   7107  O O    . SER A 1 8  ? 14.856 19.803 -3.242  1.00 0.00 ? 25 SER A O    11 
ATOM   7108  C CB   . SER A 1 8  ? 17.181 17.778 -4.000  1.00 0.00 ? 25 SER A CB   11 
ATOM   7109  O OG   . SER A 1 8  ? 17.086 17.720 -5.397  1.00 0.00 ? 25 SER A OG   11 
ATOM   7110  H H    . SER A 1 8  ? 15.363 15.910 -4.539  1.00 0.00 ? 25 SER A H    11 
ATOM   7111  H HA   . SER A 1 8  ? 16.089 17.767 -2.281  1.00 0.00 ? 25 SER A HA   11 
ATOM   7112  H HB2  . SER A 1 8  ? 17.596 18.743 -3.713  1.00 0.00 ? 25 SER A HB2  11 
ATOM   7113  H HB3  . SER A 1 8  ? 17.841 16.983 -3.656  1.00 0.00 ? 25 SER A HB3  11 
ATOM   7114  H HG   . SER A 1 8  ? 17.958 17.829 -5.781  1.00 0.00 ? 25 SER A HG   11 
ATOM   7115  N N    . ASP A 1 9  ? 14.073 18.389 -4.807  1.00 0.00 ? 26 ASP A N    11 
ATOM   7116  C CA   . ASP A 1 9  ? 13.127 19.349 -5.363  1.00 0.00 ? 26 ASP A CA   11 
ATOM   7117  C C    . ASP A 1 9  ? 12.094 18.658 -6.244  1.00 0.00 ? 26 ASP A C    11 
ATOM   7118  O O    . ASP A 1 9  ? 12.312 17.541 -6.712  1.00 0.00 ? 26 ASP A O    11 
ATOM   7119  C CB   . ASP A 1 9  ? 13.865 20.427 -6.162  1.00 0.00 ? 26 ASP A CB   11 
ATOM   7120  C CG   . ASP A 1 9  ? 13.086 21.724 -6.335  1.00 0.00 ? 26 ASP A CG   11 
ATOM   7121  O OD1  . ASP A 1 9  ? 11.976 21.795 -5.867  1.00 0.00 ? 26 ASP A OD1  11 
ATOM   7122  O OD2  . ASP A 1 9  ? 13.663 22.682 -6.793  1.00 0.00 ? 26 ASP A OD2  11 
ATOM   7123  H H    . ASP A 1 9  ? 14.122 17.461 -5.204  1.00 0.00 ? 26 ASP A H    11 
ATOM   7124  H HA   . ASP A 1 9  ? 12.575 19.831 -4.557  1.00 0.00 ? 26 ASP A HA   11 
ATOM   7125  H HB2  . ASP A 1 9  ? 14.860 20.649 -5.777  1.00 0.00 ? 26 ASP A HB2  11 
ATOM   7126  H HB3  . ASP A 1 9  ? 13.950 19.924 -7.127  1.00 0.00 ? 26 ASP A HB3  11 
ATOM   7127  N N    . ALA A 1 10 ? 10.970 19.330 -6.467  1.00 0.00 ? 27 ALA A N    11 
ATOM   7128  C CA   . ALA A 1 10 ? 9.923  18.805 -7.335  1.00 0.00 ? 27 ALA A CA   11 
ATOM   7129  C C    . ALA A 1 10 ? 10.312 18.927 -8.802  1.00 0.00 ? 27 ALA A C    11 
ATOM   7130  O O    . ALA A 1 10 ? 9.683  18.325 -9.673  1.00 0.00 ? 27 ALA A O    11 
ATOM   7131  C CB   . ALA A 1 10 ? 8.607  19.522 -7.070  1.00 0.00 ? 27 ALA A CB   11 
ATOM   7132  H H    . ALA A 1 10 ? 10.837 20.228 -6.023  1.00 0.00 ? 27 ALA A H    11 
ATOM   7133  H HA   . ALA A 1 10 ? 9.790  17.744 -7.120  1.00 0.00 ? 27 ALA A HA   11 
ATOM   7134  H HB1  . ALA A 1 10 ? 8.727  20.587 -7.265  1.00 0.00 ? 27 ALA A HB1  11 
ATOM   7135  H HB2  . ALA A 1 10 ? 7.835  19.118 -7.726  1.00 0.00 ? 27 ALA A HB2  11 
ATOM   7136  H HB3  . ALA A 1 10 ? 8.313  19.373 -6.031  1.00 0.00 ? 27 ALA A HB3  11 
ATOM   7137  N N    . ALA A 1 11 ? 11.351 19.709 -9.071  1.00 0.00 ? 28 ALA A N    11 
ATOM   7138  C CA   . ALA A 1 11 ? 11.879 19.844 -10.423 1.00 0.00 ? 28 ALA A CA   11 
ATOM   7139  C C    . ALA A 1 11 ? 12.399 18.511 -10.947 1.00 0.00 ? 28 ALA A C    11 
ATOM   7140  O O    . ALA A 1 11 ? 12.501 18.306 -12.156 1.00 0.00 ? 28 ALA A O    11 
ATOM   7141  C CB   . ALA A 1 11 ? 12.978 20.896 -10.461 1.00 0.00 ? 28 ALA A CB   11 
ATOM   7142  H H    . ALA A 1 11 ? 11.787 20.223 -8.319  1.00 0.00 ? 28 ALA A H    11 
ATOM   7143  H HA   . ALA A 1 11 ? 11.072 20.160 -11.084 1.00 0.00 ? 28 ALA A HA   11 
ATOM   7144  H HB1  . ALA A 1 11 ? 13.786 20.602 -9.793  1.00 0.00 ? 28 ALA A HB1  11 
ATOM   7145  H HB2  . ALA A 1 11 ? 13.361 20.984 -11.477 1.00 0.00 ? 28 ALA A HB2  11 
ATOM   7146  H HB3  . ALA A 1 11 ? 12.573 21.856 -10.141 1.00 0.00 ? 28 ALA A HB3  11 
ATOM   7147  N N    . GLN A 1 12 ? 12.726 17.607 -10.030 1.00 0.00 ? 29 GLN A N    11 
ATOM   7148  C CA   . GLN A 1 12 ? 13.256 16.300 -10.397 1.00 0.00 ? 29 GLN A CA   11 
ATOM   7149  C C    . GLN A 1 12 ? 12.135 15.287 -10.594 1.00 0.00 ? 29 GLN A C    11 
ATOM   7150  O O    . GLN A 1 12 ? 12.379 14.142 -10.975 1.00 0.00 ? 29 GLN A O    11 
ATOM   7151  C CB   . GLN A 1 12 ? 14.226 15.794 -9.327  1.00 0.00 ? 29 GLN A CB   11 
ATOM   7152  C CG   . GLN A 1 12 ? 15.411 16.712 -9.078  1.00 0.00 ? 29 GLN A CG   11 
ATOM   7153  C CD   . GLN A 1 12 ? 16.261 16.909 -10.319 1.00 0.00 ? 29 GLN A CD   11 
ATOM   7154  O OE1  . GLN A 1 12 ? 16.609 15.947 -11.009 1.00 0.00 ? 29 GLN A OE1  11 
ATOM   7155  N NE2  . GLN A 1 12 ? 16.605 18.159 -10.609 1.00 0.00 ? 29 GLN A NE2  11 
ATOM   7156  H H    . GLN A 1 12 ? 12.605 17.832 -9.052  1.00 0.00 ? 29 GLN A H    11 
ATOM   7157  H HA   . GLN A 1 12 ? 13.778 16.372 -11.351 1.00 0.00 ? 29 GLN A HA   11 
ATOM   7158  H HB2  . GLN A 1 12 ? 13.650 15.678 -8.408  1.00 0.00 ? 29 GLN A HB2  11 
ATOM   7159  H HB3  . GLN A 1 12 ? 14.580 14.819 -9.658  1.00 0.00 ? 29 GLN A HB3  11 
ATOM   7160  H HG2  . GLN A 1 12 ? 15.316 17.677 -8.582  1.00 0.00 ? 29 GLN A HG2  11 
ATOM   7161  H HG3  . GLN A 1 12 ? 15.925 16.013 -8.416  1.00 0.00 ? 29 GLN A HG3  11 
ATOM   7162  H HE21 . GLN A 1 12 ? 16.303 18.910 -10.020 1.00 0.00 ? 29 GLN A HE21 11 
ATOM   7163  H HE22 . GLN A 1 12 ? 17.165 18.350 -11.415 1.00 0.00 ? 29 GLN A HE22 11 
ATOM   7164  N N    . LEU A 1 13 ? 10.905 15.715 -10.332 1.00 0.00 ? 30 LEU A N    11 
ATOM   7165  C CA   . LEU A 1 13 ? 9.746  14.838 -10.452 1.00 0.00 ? 30 LEU A CA   11 
ATOM   7166  C C    . LEU A 1 13 ? 9.072  14.998 -11.809 1.00 0.00 ? 30 LEU A C    11 
ATOM   7167  O O    . LEU A 1 13 ? 9.250  16.011 -12.484 1.00 0.00 ? 30 LEU A O    11 
ATOM   7168  C CB   . LEU A 1 13 ? 8.747  15.121 -9.323  1.00 0.00 ? 30 LEU A CB   11 
ATOM   7169  C CG   . LEU A 1 13 ? 9.293  14.918 -7.903  1.00 0.00 ? 30 LEU A CG   11 
ATOM   7170  C CD1  . LEU A 1 13 ? 8.207  15.218 -6.879  1.00 0.00 ? 30 LEU A CD1  11 
ATOM   7171  C CD2  . LEU A 1 13 ? 9.799  13.491 -7.751  1.00 0.00 ? 30 LEU A CD2  11 
ATOM   7172  H H    . LEU A 1 13 ? 10.769 16.672 -10.042 1.00 0.00 ? 30 LEU A H    11 
ATOM   7173  H HA   . LEU A 1 13 ? 10.067 13.799 -10.388 1.00 0.00 ? 30 LEU A HA   11 
ATOM   7174  H HB2  . LEU A 1 13 ? 8.567  16.178 -9.507  1.00 0.00 ? 30 LEU A HB2  11 
ATOM   7175  H HB3  . LEU A 1 13 ? 7.819  14.566 -9.456  1.00 0.00 ? 30 LEU A HB3  11 
ATOM   7176  H HG   . LEU A 1 13 ? 10.145 15.588 -7.785  1.00 0.00 ? 30 LEU A HG   11 
ATOM   7177  H HD11 . LEU A 1 13 ? 8.603  15.072 -5.874  1.00 0.00 ? 30 LEU A HD11 11 
ATOM   7178  H HD12 . LEU A 1 13 ? 7.876  16.251 -6.991  1.00 0.00 ? 30 LEU A HD12 11 
ATOM   7179  H HD13 . LEU A 1 13 ? 7.363  14.547 -7.037  1.00 0.00 ? 30 LEU A HD13 11 
ATOM   7180  H HD21 . LEU A 1 13 ? 10.594 13.308 -8.474  1.00 0.00 ? 30 LEU A HD21 11 
ATOM   7181  H HD22 . LEU A 1 13 ? 10.187 13.350 -6.742  1.00 0.00 ? 30 LEU A HD22 11 
ATOM   7182  H HD23 . LEU A 1 13 ? 8.980  12.794 -7.927  1.00 0.00 ? 30 LEU A HD23 11 
ATOM   7183  N N    . PRO A 1 14 ? 8.297  13.993 -12.202 1.00 0.00 ? 31 PRO A N    11 
ATOM   7184  C CA   . PRO A 1 14 ? 7.507  14.067 -13.425 1.00 0.00 ? 31 PRO A CA   11 
ATOM   7185  C C    . PRO A 1 14 ? 6.393  15.099 -13.298 1.00 0.00 ? 31 PRO A C    11 
ATOM   7186  O O    . PRO A 1 14 ? 6.291  15.795 -12.288 1.00 0.00 ? 31 PRO A O    11 
ATOM   7187  C CB   . PRO A 1 14 ? 6.961  12.647 -13.604 1.00 0.00 ? 31 PRO A CB   11 
ATOM   7188  C CG   . PRO A 1 14 ? 6.893  12.098 -12.220 1.00 0.00 ? 31 PRO A CG   11 
ATOM   7189  C CD   . PRO A 1 14 ? 8.079  12.681 -11.500 1.00 0.00 ? 31 PRO A CD   11 
ATOM   7190  H HA   . PRO A 1 14 ? 8.098  14.393 -14.294 1.00 0.00 ? 31 PRO A HA   11 
ATOM   7191  H HB2  . PRO A 1 14 ? 5.969  12.654 -14.079 1.00 0.00 ? 31 PRO A HB2  11 
ATOM   7192  H HB3  . PRO A 1 14 ? 7.619  12.039 -14.242 1.00 0.00 ? 31 PRO A HB3  11 
ATOM   7193  H HG2  . PRO A 1 14 ? 5.952  12.380 -11.726 1.00 0.00 ? 31 PRO A HG2  11 
ATOM   7194  H HG3  . PRO A 1 14 ? 6.936  10.999 -12.226 1.00 0.00 ? 31 PRO A HG3  11 
ATOM   7195  H HD2  . PRO A 1 14 ? 7.883  12.831 -10.428 1.00 0.00 ? 31 PRO A HD2  11 
ATOM   7196  H HD3  . PRO A 1 14 ? 8.970  12.040 -11.577 1.00 0.00 ? 31 PRO A HD3  11 
ATOM   7197  N N    . HIS A 1 15 ? 5.560  15.191 -14.330 1.00 0.00 ? 32 HIS A N    11 
ATOM   7198  C CA   . HIS A 1 15 ? 4.428  16.109 -14.320 1.00 0.00 ? 32 HIS A CA   11 
ATOM   7199  C C    . HIS A 1 15 ? 3.155  15.408 -13.863 1.00 0.00 ? 32 HIS A C    11 
ATOM   7200  O O    . HIS A 1 15 ? 2.060  15.962 -13.962 1.00 0.00 ? 32 HIS A O    11 
ATOM   7201  C CB   . HIS A 1 15 ? 4.217  16.726 -15.706 1.00 0.00 ? 32 HIS A CB   11 
ATOM   7202  C CG   . HIS A 1 15 ? 5.344  17.607 -16.150 1.00 0.00 ? 32 HIS A CG   11 
ATOM   7203  N ND1  . HIS A 1 15 ? 5.433  18.113 -17.430 1.00 0.00 ? 32 HIS A ND1  11 
ATOM   7204  C CD2  . HIS A 1 15 ? 6.429  18.069 -15.486 1.00 0.00 ? 32 HIS A CD2  11 
ATOM   7205  C CE1  . HIS A 1 15 ? 6.524  18.851 -17.533 1.00 0.00 ? 32 HIS A CE1  11 
ATOM   7206  N NE2  . HIS A 1 15 ? 7.146  18.840 -16.368 1.00 0.00 ? 32 HIS A NE2  11 
ATOM   7207  H H    . HIS A 1 15 ? 5.716  14.611 -15.141 1.00 0.00 ? 32 HIS A H    11 
ATOM   7208  H HA   . HIS A 1 15 ? 4.613  16.912 -13.605 1.00 0.00 ? 32 HIS A HA   11 
ATOM   7209  H HB2  . HIS A 1 15 ? 4.123  15.941 -16.457 1.00 0.00 ? 32 HIS A HB2  11 
ATOM   7210  H HB3  . HIS A 1 15 ? 3.319  17.343 -15.711 1.00 0.00 ? 32 HIS A HB3  11 
ATOM   7211  H HD1  . HIS A 1 15 ? 4.747  18.019 -18.151 1.00 0.00 ? 32 HIS A HD1  11 
ATOM   7212  H HD2  . HIS A 1 15 ? 6.784  17.936 -14.464 1.00 0.00 ? 32 HIS A HD2  11 
ATOM   7213  H HE1  . HIS A 1 15 ? 6.774  19.344 -18.472 1.00 0.00 ? 32 HIS A HE1  11 
ATOM   7214  N N    . ASP A 1 16 ? 3.305  14.186 -13.364 1.00 0.00 ? 33 ASP A N    11 
ATOM   7215  C CA   . ASP A 1 16 ? 2.161  13.378 -12.960 1.00 0.00 ? 33 ASP A CA   11 
ATOM   7216  C C    . ASP A 1 16 ? 2.236  13.019 -11.481 1.00 0.00 ? 33 ASP A C    11 
ATOM   7217  O O    . ASP A 1 16 ? 2.347  11.847 -11.122 1.00 0.00 ? 33 ASP A O    11 
ATOM   7218  C CB   . ASP A 1 16 ? 2.077  12.105 -13.805 1.00 0.00 ? 33 ASP A CB   11 
ATOM   7219  C CG   . ASP A 1 16 ? 0.789  11.312 -13.623 1.00 0.00 ? 33 ASP A CG   11 
ATOM   7220  O OD1  . ASP A 1 16 ? -0.133 11.839 -13.048 1.00 0.00 ? 33 ASP A OD1  11 
ATOM   7221  O OD2  . ASP A 1 16 ? 0.682  10.253 -14.194 1.00 0.00 ? 33 ASP A OD2  11 
ATOM   7222  H H    . ASP A 1 16 ? 4.236  13.807 -13.263 1.00 0.00 ? 33 ASP A H    11 
ATOM   7223  H HA   . ASP A 1 16 ? 1.241  13.947 -13.094 1.00 0.00 ? 33 ASP A HA   11 
ATOM   7224  H HB2  . ASP A 1 16 ? 2.250  12.277 -14.868 1.00 0.00 ? 33 ASP A HB2  11 
ATOM   7225  H HB3  . ASP A 1 16 ? 2.912  11.542 -13.387 1.00 0.00 ? 33 ASP A HB3  11 
ATOM   7226  N N    . TYR A 1 17 ? 2.173  14.035 -10.627 1.00 0.00 ? 34 TYR A N    11 
ATOM   7227  C CA   . TYR A 1 17 ? 2.143  13.824 -9.185  1.00 0.00 ? 34 TYR A CA   11 
ATOM   7228  C C    . TYR A 1 17 ? 1.175  14.784 -8.507  1.00 0.00 ? 34 TYR A C    11 
ATOM   7229  O O    . TYR A 1 17 ? 0.677  15.721 -9.130  1.00 0.00 ? 34 TYR A O    11 
ATOM   7230  C CB   . TYR A 1 17 ? 3.545  13.984 -8.591  1.00 0.00 ? 34 TYR A CB   11 
ATOM   7231  C CG   . TYR A 1 17 ? 4.069  15.403 -8.632  1.00 0.00 ? 34 TYR A CG   11 
ATOM   7232  C CD1  . TYR A 1 17 ? 3.744  16.312 -7.636  1.00 0.00 ? 34 TYR A CD1  11 
ATOM   7233  C CD2  . TYR A 1 17 ? 4.888  15.828 -9.667  1.00 0.00 ? 34 TYR A CD2  11 
ATOM   7234  C CE1  . TYR A 1 17 ? 4.219  17.608 -7.669  1.00 0.00 ? 34 TYR A CE1  11 
ATOM   7235  C CE2  . TYR A 1 17 ? 5.370  17.122 -9.710  1.00 0.00 ? 34 TYR A CE2  11 
ATOM   7236  C CZ   . TYR A 1 17 ? 5.034  18.010 -8.708  1.00 0.00 ? 34 TYR A CZ   11 
ATOM   7237  O OH   . TYR A 1 17 ? 5.512  19.300 -8.746  1.00 0.00 ? 34 TYR A OH   11 
ATOM   7238  H H    . TYR A 1 17 ? 2.146  14.979 -10.987 1.00 0.00 ? 34 TYR A H    11 
ATOM   7239  H HA   . TYR A 1 17 ? 1.786  12.816 -8.966  1.00 0.00 ? 34 TYR A HA   11 
ATOM   7240  H HB2  . TYR A 1 17 ? 3.498  13.644 -7.555  1.00 0.00 ? 34 TYR A HB2  11 
ATOM   7241  H HB3  . TYR A 1 17 ? 4.211  13.334 -9.158  1.00 0.00 ? 34 TYR A HB3  11 
ATOM   7242  H HD1  . TYR A 1 17 ? 3.101  15.987 -6.817  1.00 0.00 ? 34 TYR A HD1  11 
ATOM   7243  H HD2  . TYR A 1 17 ? 5.150  15.123 -10.455 1.00 0.00 ? 34 TYR A HD2  11 
ATOM   7244  H HE1  . TYR A 1 17 ? 3.956  18.312 -6.879  1.00 0.00 ? 34 TYR A HE1  11 
ATOM   7245  H HE2  . TYR A 1 17 ? 6.012  17.438 -10.533 1.00 0.00 ? 34 TYR A HE2  11 
ATOM   7246  H HH   . TYR A 1 17 ? 6.067  19.472 -9.509  1.00 0.00 ? 34 TYR A HH   11 
ATOM   7247  N N    . CYS A 1 18 ? 0.913  14.546 -7.226  1.00 0.00 ? 35 CYS A N    11 
ATOM   7248  C CA   . CYS A 1 18 ? 0.041  15.417 -6.448  1.00 0.00 ? 35 CYS A CA   11 
ATOM   7249  C C    . CYS A 1 18 ? 0.696  15.820 -5.133  1.00 0.00 ? 35 CYS A C    11 
ATOM   7250  O O    . CYS A 1 18 ? 1.782  15.346 -4.798  1.00 0.00 ? 35 CYS A O    11 
ATOM   7251  C CB   . CYS A 1 18 ? -1.180 14.532 -6.193  1.00 0.00 ? 35 CYS A CB   11 
ATOM   7252  S SG   . CYS A 1 18 ? -2.064 14.027 -7.687  1.00 0.00 ? 35 CYS A SG   11 
ATOM   7253  H H    . CYS A 1 18 ? 1.329  13.741 -6.780  1.00 0.00 ? 35 CYS A H    11 
ATOM   7254  H HA   . CYS A 1 18 ? -0.281 16.306 -6.991  1.00 0.00 ? 35 CYS A HA   11 
ATOM   7255  H HB2  . CYS A 1 18 ? -0.879 13.611 -5.693  1.00 0.00 ? 35 CYS A HB2  11 
ATOM   7256  H HB3  . CYS A 1 18 ? -1.906 15.061 -5.576  1.00 0.00 ? 35 CYS A HB3  11 
ATOM   7257  H HG   . CYS A 1 18 ? -2.998 13.316 -7.063  1.00 0.00 ? 35 CYS A HG   11 
ATOM   7258  N N    . THR A 1 19 ? 0.029  16.698 -4.391  1.00 0.00 ? 36 THR A N    11 
ATOM   7259  C CA   . THR A 1 19 ? 0.528  17.139 -3.093  1.00 0.00 ? 36 THR A CA   11 
ATOM   7260  C C    . THR A 1 19 ? -0.618 17.514 -2.162  1.00 0.00 ? 36 THR A C    11 
ATOM   7261  O O    . THR A 1 19 ? -1.676 17.957 -2.609  1.00 0.00 ? 36 THR A O    11 
ATOM   7262  C CB   . THR A 1 19 ? 1.478  18.343 -3.231  1.00 0.00 ? 36 THR A CB   11 
ATOM   7263  O OG1  . THR A 1 19 ? 2.024  18.673 -1.948  1.00 0.00 ? 36 THR A OG1  11 
ATOM   7264  C CG2  . THR A 1 19 ? 0.735  19.548 -3.788  1.00 0.00 ? 36 THR A CG2  11 
ATOM   7265  H H    . THR A 1 19 ? -0.845 17.069 -4.734  1.00 0.00 ? 36 THR A H    11 
ATOM   7266  H HA   . THR A 1 19 ? 1.066  16.323 -2.608  1.00 0.00 ? 36 THR A HA   11 
ATOM   7267  H HB   . THR A 1 19 ? 2.292  18.076 -3.905  1.00 0.00 ? 36 THR A HB   11 
ATOM   7268  H HG1  . THR A 1 19 ? 2.616  19.424 -2.037  1.00 0.00 ? 36 THR A HG1  11 
ATOM   7269  H HG21 . THR A 1 19 ? -0.078 19.815 -3.114  1.00 0.00 ? 36 THR A HG21 11 
ATOM   7270  H HG22 . THR A 1 19 ? 1.422  20.388 -3.879  1.00 0.00 ? 36 THR A HG22 11 
ATOM   7271  H HG23 . THR A 1 19 ? 0.327  19.302 -4.769  1.00 0.00 ? 36 THR A HG23 11 
HETATM 7272  N N    . TPO A 1 20 ? -0.401 17.333 -0.863  1.00 0.00 ? 37 TPO A N    11 
HETATM 7273  C CA   . TPO A 1 20 ? -1.396 17.700 0.138   1.00 0.00 ? 37 TPO A CA   11 
HETATM 7274  C CB   . TPO A 1 20 ? -1.387 16.724 1.328   1.00 0.00 ? 37 TPO A CB   11 
HETATM 7275  C CG2  . TPO A 1 20 ? -1.431 15.285 0.837   1.00 0.00 ? 37 TPO A CG2  11 
HETATM 7276  O OG1  . TPO A 1 20 ? -0.200 16.923 2.106   1.00 0.00 ? 37 TPO A OG1  11 
HETATM 7277  P P    . TPO A 1 20 ? -0.138 16.445 3.645   1.00 0.00 ? 37 TPO A P    11 
HETATM 7278  O O1P  . TPO A 1 20 ? 1.271  16.808 4.184   1.00 0.00 ? 37 TPO A O1P  11 
HETATM 7279  O O2P  . TPO A 1 20 ? -0.378 14.913 3.662   1.00 0.00 ? 37 TPO A O2P  11 
HETATM 7280  O O3P  . TPO A 1 20 ? -1.253 17.207 4.409   1.00 0.00 ? 37 TPO A O3P  11 
HETATM 7281  C C    . TPO A 1 20 ? -1.161 19.114 0.653   1.00 0.00 ? 37 TPO A C    11 
HETATM 7282  O O    . TPO A 1 20 ? -0.089 19.687 0.457   1.00 0.00 ? 37 TPO A O    11 
HETATM 7283  H H    . TPO A 1 20 ? 0.474  16.930 -0.562  1.00 0.00 ? 37 TPO A H    11 
HETATM 7284  H HA   . TPO A 1 20 ? -2.390 17.696 -0.310  1.00 0.00 ? 37 TPO A HA   11 
HETATM 7285  H HB   . TPO A 1 20 ? -2.258 16.920 1.953   1.00 0.00 ? 37 TPO A HB   11 
HETATM 7286  H HG21 . TPO A 1 20 ? -1.426 14.609 1.693   1.00 0.00 ? 37 TPO A HG21 11 
HETATM 7287  H HG22 . TPO A 1 20 ? -2.339 15.127 0.255   1.00 0.00 ? 37 TPO A HG22 11 
HETATM 7288  H HG23 . TPO A 1 20 ? -0.561 15.087 0.213   1.00 0.00 ? 37 TPO A HG23 11 
ATOM   7289  N N    . PRO A 1 21 ? -2.170 19.673 1.314   1.00 0.00 ? 38 PRO A N    11 
ATOM   7290  C CA   . PRO A 1 21 ? -2.095 21.041 1.811   1.00 0.00 ? 38 PRO A CA   11 
ATOM   7291  C C    . PRO A 1 21 ? -0.885 21.233 2.717   1.00 0.00 ? 38 PRO A C    11 
ATOM   7292  O O    . PRO A 1 21 ? -0.324 22.326 2.797   1.00 0.00 ? 38 PRO A O    11 
ATOM   7293  C CB   . PRO A 1 21 ? -3.415 21.238 2.564   1.00 0.00 ? 38 PRO A CB   11 
ATOM   7294  C CG   . PRO A 1 21 ? -4.364 20.300 1.901   1.00 0.00 ? 38 PRO A CG   11 
ATOM   7295  C CD   . PRO A 1 21 ? -3.543 19.093 1.535   1.00 0.00 ? 38 PRO A CD   11 
ATOM   7296  H HA   . PRO A 1 21 ? -1.968 21.780 1.007   1.00 0.00 ? 38 PRO A HA   11 
ATOM   7297  H HB2  . PRO A 1 21 ? -3.307 21.006 3.634   1.00 0.00 ? 38 PRO A HB2  11 
ATOM   7298  H HB3  . PRO A 1 21 ? -3.767 22.278 2.494   1.00 0.00 ? 38 PRO A HB3  11 
ATOM   7299  H HG2  . PRO A 1 21 ? -5.189 20.027 2.574   1.00 0.00 ? 38 PRO A HG2  11 
ATOM   7300  H HG3  . PRO A 1 21 ? -4.816 20.757 1.008   1.00 0.00 ? 38 PRO A HG3  11 
ATOM   7301  H HD2  . PRO A 1 21 ? -3.532 18.338 2.335   1.00 0.00 ? 38 PRO A HD2  11 
ATOM   7302  H HD3  . PRO A 1 21 ? -3.917 18.595 0.629   1.00 0.00 ? 38 PRO A HD3  11 
ATOM   7303  N N    . GLY A 1 22 ? -0.486 20.164 3.397   1.00 0.00 ? 39 GLY A N    11 
ATOM   7304  C CA   . GLY A 1 22 ? 0.658  20.213 4.300   1.00 0.00 ? 39 GLY A CA   11 
ATOM   7305  C C    . GLY A 1 22 ? 1.951  20.471 3.538   1.00 0.00 ? 39 GLY A C    11 
ATOM   7306  O O    . GLY A 1 22 ? 2.905  21.025 4.084   1.00 0.00 ? 39 GLY A O    11 
ATOM   7307  H H    . GLY A 1 22 ? -0.988 19.295 3.287   1.00 0.00 ? 39 GLY A H    11 
ATOM   7308  H HA2  . GLY A 1 22 ? 0.506  21.015 5.023   1.00 0.00 ? 39 GLY A HA2  11 
ATOM   7309  H HA3  . GLY A 1 22 ? 0.738  19.262 4.826   1.00 0.00 ? 39 GLY A HA3  11 
ATOM   7310  N N    . GLY A 1 23 ? 1.976  20.066 2.272   1.00 0.00 ? 40 GLY A N    11 
ATOM   7311  C CA   . GLY A 1 23 ? 3.122  20.322 1.408   1.00 0.00 ? 40 GLY A CA   11 
ATOM   7312  C C    . GLY A 1 23 ? 3.888  19.040 1.112   1.00 0.00 ? 40 GLY A C    11 
ATOM   7313  O O    . GLY A 1 23 ? 5.036  19.078 0.670   1.00 0.00 ? 40 GLY A O    11 
ATOM   7314  H H    . GLY A 1 23 ? 1.181  19.566 1.900   1.00 0.00 ? 40 GLY A H    11 
ATOM   7315  H HA2  . GLY A 1 23 ? 2.771  20.751 0.469   1.00 0.00 ? 40 GLY A HA2  11 
ATOM   7316  H HA3  . GLY A 1 23 ? 3.789  21.028 1.902   1.00 0.00 ? 40 GLY A HA3  11 
ATOM   7317  N N    . THR A 1 24 ? 3.246  17.903 1.360   1.00 0.00 ? 41 THR A N    11 
ATOM   7318  C CA   . THR A 1 24 ? 3.853  16.606 1.090   1.00 0.00 ? 41 THR A CA   11 
ATOM   7319  C C    . THR A 1 24 ? 3.460  16.088 -0.288  1.00 0.00 ? 41 THR A C    11 
ATOM   7320  O O    . THR A 1 24 ? 2.278  15.909 -0.581  1.00 0.00 ? 41 THR A O    11 
ATOM   7321  C CB   . THR A 1 24 ? 3.453  15.563 2.151   1.00 0.00 ? 41 THR A CB   11 
ATOM   7322  O OG1  . THR A 1 24 ? 3.900  15.996 3.443   1.00 0.00 ? 41 THR A OG1  11 
ATOM   7323  C CG2  . THR A 1 24 ? 4.073  14.212 1.832   1.00 0.00 ? 41 THR A CG2  11 
ATOM   7324  H H    . THR A 1 24 ? 2.312  17.939 1.743   1.00 0.00 ? 41 THR A H    11 
ATOM   7325  H HA   . THR A 1 24 ? 4.939  16.700 1.086   1.00 0.00 ? 41 THR A HA   11 
ATOM   7326  H HB   . THR A 1 24 ? 2.368  15.470 2.165   1.00 0.00 ? 41 THR A HB   11 
ATOM   7327  H HG1  . THR A 1 24 ? 3.155  16.345 3.938   1.00 0.00 ? 41 THR A HG1  11 
ATOM   7328  H HG21 . THR A 1 24 ? 5.158  14.304 1.819   1.00 0.00 ? 41 THR A HG21 11 
ATOM   7329  H HG22 . THR A 1 24 ? 3.780  13.488 2.592   1.00 0.00 ? 41 THR A HG22 11 
ATOM   7330  H HG23 . THR A 1 24 ? 3.726  13.874 0.855   1.00 0.00 ? 41 THR A HG23 11 
ATOM   7331  N N    . LEU A 1 25 ? 4.460  15.849 -1.131  1.00 0.00 ? 42 LEU A N    11 
ATOM   7332  C CA   . LEU A 1 25 ? 4.220  15.369 -2.486  1.00 0.00 ? 42 LEU A CA   11 
ATOM   7333  C C    . LEU A 1 25 ? 4.084  13.853 -2.518  1.00 0.00 ? 42 LEU A C    11 
ATOM   7334  O O    . LEU A 1 25 ? 4.663  13.151 -1.689  1.00 0.00 ? 42 LEU A O    11 
ATOM   7335  C CB   . LEU A 1 25 ? 5.351  15.824 -3.418  1.00 0.00 ? 42 LEU A CB   11 
ATOM   7336  C CG   . LEU A 1 25 ? 5.214  17.251 -3.962  1.00 0.00 ? 42 LEU A CG   11 
ATOM   7337  C CD1  . LEU A 1 25 ? 5.308  18.256 -2.822  1.00 0.00 ? 42 LEU A CD1  11 
ATOM   7338  C CD2  . LEU A 1 25 ? 6.300  17.507 -4.997  1.00 0.00 ? 42 LEU A CD2  11 
ATOM   7339  H H    . LEU A 1 25 ? 5.409  16.004 -0.825  1.00 0.00 ? 42 LEU A H    11 
ATOM   7340  H HA   . LEU A 1 25 ? 3.276  15.771 -2.854  1.00 0.00 ? 42 LEU A HA   11 
ATOM   7341  H HB2  . LEU A 1 25 ? 6.186  15.767 -2.721  1.00 0.00 ? 42 LEU A HB2  11 
ATOM   7342  H HB3  . LEU A 1 25 ? 5.510  15.119 -4.234  1.00 0.00 ? 42 LEU A HB3  11 
ATOM   7343  H HG   . LEU A 1 25 ? 4.251  17.314 -4.468  1.00 0.00 ? 42 LEU A HG   11 
ATOM   7344  H HD11 . LEU A 1 25 ? 5.210  19.267 -3.218  1.00 0.00 ? 42 LEU A HD11 11 
ATOM   7345  H HD12 . LEU A 1 25 ? 4.507  18.070 -2.106  1.00 0.00 ? 42 LEU A HD12 11 
ATOM   7346  H HD13 . LEU A 1 25 ? 6.271  18.154 -2.326  1.00 0.00 ? 42 LEU A HD13 11 
ATOM   7347  H HD21 . LEU A 1 25 ? 6.197  16.796 -5.816  1.00 0.00 ? 42 LEU A HD21 11 
ATOM   7348  H HD22 . LEU A 1 25 ? 6.201  18.521 -5.383  1.00 0.00 ? 42 LEU A HD22 11 
ATOM   7349  H HD23 . LEU A 1 25 ? 7.280  17.388 -4.533  1.00 0.00 ? 42 LEU A HD23 11 
ATOM   7350  N N    . PHE A 1 26 ? 3.317  13.352 -3.481  1.00 0.00 ? 43 PHE A N    11 
ATOM   7351  C CA   . PHE A 1 26 ? 3.152  11.914 -3.659  1.00 0.00 ? 43 PHE A CA   11 
ATOM   7352  C C    . PHE A 1 26 ? 2.670  11.585 -5.066  1.00 0.00 ? 43 PHE A C    11 
ATOM   7353  O O    . PHE A 1 26 ? 1.983  12.387 -5.700  1.00 0.00 ? 43 PHE A O    11 
ATOM   7354  C CB   . PHE A 1 26 ? 2.173  11.357 -2.624  1.00 0.00 ? 43 PHE A CB   11 
ATOM   7355  C CG   . PHE A 1 26 ? 0.776  11.891 -2.761  1.00 0.00 ? 43 PHE A CG   11 
ATOM   7356  C CD1  . PHE A 1 26 ? 0.417  13.094 -2.173  1.00 0.00 ? 43 PHE A CD1  11 
ATOM   7357  C CD2  . PHE A 1 26 ? -0.182 11.192 -3.479  1.00 0.00 ? 43 PHE A CD2  11 
ATOM   7358  C CE1  . PHE A 1 26 ? -0.867 13.587 -2.296  1.00 0.00 ? 43 PHE A CE1  11 
ATOM   7359  C CE2  . PHE A 1 26 ? -1.468 11.683 -3.606  1.00 0.00 ? 43 PHE A CE2  11 
ATOM   7360  C CZ   . PHE A 1 26 ? -1.811 12.881 -3.015  1.00 0.00 ? 43 PHE A CZ   11 
ATOM   7361  H H    . PHE A 1 26 ? 2.836  13.984 -4.105  1.00 0.00 ? 43 PHE A H    11 
ATOM   7362  H HA   . PHE A 1 26 ? 4.113  11.413 -3.535  1.00 0.00 ? 43 PHE A HA   11 
ATOM   7363  H HB2  . PHE A 1 26 ? 2.103  10.274 -2.719  1.00 0.00 ? 43 PHE A HB2  11 
ATOM   7364  H HB3  . PHE A 1 26 ? 2.507  11.611 -1.619  1.00 0.00 ? 43 PHE A HB3  11 
ATOM   7365  H HD1  . PHE A 1 26 ? 1.163  13.653 -1.605  1.00 0.00 ? 43 PHE A HD1  11 
ATOM   7366  H HD2  . PHE A 1 26 ? 0.089  10.244 -3.946  1.00 0.00 ? 43 PHE A HD2  11 
ATOM   7367  H HE1  . PHE A 1 26 ? -1.137 14.534 -1.829  1.00 0.00 ? 43 PHE A HE1  11 
ATOM   7368  H HE2  . PHE A 1 26 ? -2.211 11.123 -4.173  1.00 0.00 ? 43 PHE A HE2  11 
ATOM   7369  H HZ   . PHE A 1 26 ? -2.823 13.269 -3.114  1.00 0.00 ? 43 PHE A HZ   11 
ATOM   7370  N N    . SER A 1 27 ? 3.034  10.403 -5.549  1.00 0.00 ? 44 SER A N    11 
ATOM   7371  C CA   . SER A 1 27 ? 2.548  9.918  -6.835  1.00 0.00 ? 44 SER A CA   11 
ATOM   7372  C C    . SER A 1 27 ? 2.324  8.412  -6.809  1.00 0.00 ? 44 SER A C    11 
ATOM   7373  O O    . SER A 1 27 ? 3.200  7.652  -6.395  1.00 0.00 ? 44 SER A O    11 
ATOM   7374  C CB   . SER A 1 27 ? 3.525  10.288 -7.936  1.00 0.00 ? 44 SER A CB   11 
ATOM   7375  O OG   . SER A 1 27 ? 3.075  9.881  -9.198  1.00 0.00 ? 44 SER A OG   11 
ATOM   7376  H H    . SER A 1 27 ? 3.663  9.824  -5.012  1.00 0.00 ? 44 SER A H    11 
ATOM   7377  H HA   . SER A 1 27 ? 1.641  10.422 -7.174  1.00 0.00 ? 44 SER A HA   11 
ATOM   7378  H HB2  . SER A 1 27 ? 3.655  11.370 -7.936  1.00 0.00 ? 44 SER A HB2  11 
ATOM   7379  H HB3  . SER A 1 27 ? 4.481  9.808  -7.728  1.00 0.00 ? 44 SER A HB3  11 
ATOM   7380  H HG   . SER A 1 27 ? 2.849  10.655 -9.721  1.00 0.00 ? 44 SER A HG   11 
ATOM   7381  N N    . THR A 1 28 ? 1.146  7.986  -7.252  1.00 0.00 ? 45 THR A N    11 
ATOM   7382  C CA   . THR A 1 28 ? 0.795  6.571  -7.254  1.00 0.00 ? 45 THR A CA   11 
ATOM   7383  C C    . THR A 1 28 ? 1.199  5.905  -8.563  1.00 0.00 ? 45 THR A C    11 
ATOM   7384  O O    . THR A 1 28 ? 1.471  6.579  -9.556  1.00 0.00 ? 45 THR A O    11 
ATOM   7385  C CB   . THR A 1 28 ? -0.714 6.363  -7.028  1.00 0.00 ? 45 THR A CB   11 
ATOM   7386  O OG1  . THR A 1 28 ? -1.443 6.888  -8.145  1.00 0.00 ? 45 THR A OG1  11 
ATOM   7387  C CG2  . THR A 1 28 ? -1.165 7.066  -5.758  1.00 0.00 ? 45 THR A CG2  11 
ATOM   7388  H H    . THR A 1 28 ? 0.477  8.659  -7.596  1.00 0.00 ? 45 THR A H    11 
ATOM   7389  H HA   . THR A 1 28 ? 1.340  6.055  -6.464  1.00 0.00 ? 45 THR A HA   11 
ATOM   7390  H HB   . THR A 1 28 ? -0.917 5.296  -6.943  1.00 0.00 ? 45 THR A HB   11 
ATOM   7391  H HG1  . THR A 1 28 ? -1.201 6.406  -8.940  1.00 0.00 ? 45 THR A HG1  11 
ATOM   7392  H HG21 . THR A 1 28 ? -0.965 8.134  -5.843  1.00 0.00 ? 45 THR A HG21 11 
ATOM   7393  H HG22 . THR A 1 28 ? -2.234 6.908  -5.616  1.00 0.00 ? 45 THR A HG22 11 
ATOM   7394  H HG23 . THR A 1 28 ? -0.620 6.662  -4.905  1.00 0.00 ? 45 THR A HG23 11 
HETATM 7395  N N    . TPO A 1 29 ? 1.234  4.577  -8.559  1.00 0.00 ? 46 TPO A N    11 
HETATM 7396  C CA   . TPO A 1 29 ? 1.525  3.815  -9.767  1.00 0.00 ? 46 TPO A CA   11 
HETATM 7397  C CB   . TPO A 1 29 ? 2.855  3.047  -9.646  1.00 0.00 ? 46 TPO A CB   11 
HETATM 7398  C CG2  . TPO A 1 29 ? 3.963  3.973  -9.166  1.00 0.00 ? 46 TPO A CG2  11 
HETATM 7399  O OG1  . TPO A 1 29 ? 2.703  1.968  -8.714  1.00 0.00 ? 46 TPO A OG1  11 
HETATM 7400  P P    . TPO A 1 29 ? 3.674  0.682  -8.785  1.00 0.00 ? 46 TPO A P    11 
HETATM 7401  O O1P  . TPO A 1 29 ? 3.243  -0.284 -7.649  1.00 0.00 ? 46 TPO A O1P  11 
HETATM 7402  O O2P  . TPO A 1 29 ? 5.126  1.188  -8.583  1.00 0.00 ? 46 TPO A O2P  11 
HETATM 7403  O O3P  . TPO A 1 29 ? 3.484  0.037  -10.183 1.00 0.00 ? 46 TPO A O3P  11 
HETATM 7404  C C    . TPO A 1 29 ? 0.408  2.827  -10.077 1.00 0.00 ? 46 TPO A C    11 
HETATM 7405  O O    . TPO A 1 29 ? -0.426 2.529  -9.222  1.00 0.00 ? 46 TPO A O    11 
HETATM 7406  H H    . TPO A 1 29 ? 1.056  4.082  -7.697  1.00 0.00 ? 46 TPO A H    11 
HETATM 7407  H HA   . TPO A 1 29 ? 1.588  4.487  -10.623 1.00 0.00 ? 46 TPO A HA   11 
HETATM 7408  H HB   . TPO A 1 29 ? 3.119  2.640  -10.620 1.00 0.00 ? 46 TPO A HB   11 
HETATM 7409  H HG21 . TPO A 1 29 ? 4.894  3.413  -9.088  1.00 0.00 ? 46 TPO A HG21 11 
HETATM 7410  H HG22 . TPO A 1 29 ? 4.087  4.789  -9.879  1.00 0.00 ? 46 TPO A HG22 11 
HETATM 7411  H HG23 . TPO A 1 29 ? 3.699  4.381  -8.192  1.00 0.00 ? 46 TPO A HG23 11 
ATOM   7412  N N    . PRO A 1 30 ? 0.397  2.320  -11.306 1.00 0.00 ? 47 PRO A N    11 
ATOM   7413  C CA   . PRO A 1 30 ? -0.658 1.418  -11.753 1.00 0.00 ? 47 PRO A CA   11 
ATOM   7414  C C    . PRO A 1 30 ? -0.770 0.205  -10.838 1.00 0.00 ? 47 PRO A C    11 
ATOM   7415  O O    . PRO A 1 30 ? -1.849 -0.363 -10.675 1.00 0.00 ? 47 PRO A O    11 
ATOM   7416  C CB   . PRO A 1 30 ? -0.240 1.030  -13.175 1.00 0.00 ? 47 PRO A CB   11 
ATOM   7417  C CG   . PRO A 1 30 ? 0.569  2.188  -13.654 1.00 0.00 ? 47 PRO A CG   11 
ATOM   7418  C CD   . PRO A 1 30 ? 1.318  2.679  -12.443 1.00 0.00 ? 47 PRO A CD   11 
ATOM   7419  H HA   . PRO A 1 30 ? -1.654 1.883  -11.731 1.00 0.00 ? 47 PRO A HA   11 
ATOM   7420  H HB2  . PRO A 1 30 ? 0.350  0.102  -13.183 1.00 0.00 ? 47 PRO A HB2  11 
ATOM   7421  H HB3  . PRO A 1 30 ? -1.115 0.862  -13.821 1.00 0.00 ? 47 PRO A HB3  11 
ATOM   7422  H HG2  . PRO A 1 30 ? 1.262  1.885  -14.452 1.00 0.00 ? 47 PRO A HG2  11 
ATOM   7423  H HG3  . PRO A 1 30 ? -0.074 2.977  -14.069 1.00 0.00 ? 47 PRO A HG3  11 
ATOM   7424  H HD2  . PRO A 1 30 ? 2.295  2.188  -12.332 1.00 0.00 ? 47 PRO A HD2  11 
ATOM   7425  H HD3  . PRO A 1 30 ? 1.504  3.762  -12.482 1.00 0.00 ? 47 PRO A HD3  11 
ATOM   7426  N N    . GLY A 1 31 ? 0.351  -0.185 -10.243 1.00 0.00 ? 48 GLY A N    11 
ATOM   7427  C CA   . GLY A 1 31 ? 0.383  -1.339 -9.352  1.00 0.00 ? 48 GLY A CA   11 
ATOM   7428  C C    . GLY A 1 31 ? -0.456 -1.096 -8.105  1.00 0.00 ? 48 GLY A C    11 
ATOM   7429  O O    . GLY A 1 31 ? -0.963 -2.037 -7.493  1.00 0.00 ? 48 GLY A O    11 
ATOM   7430  H H    . GLY A 1 31 ? 1.203  0.329  -10.411 1.00 0.00 ? 48 GLY A H    11 
ATOM   7431  H HA2  . GLY A 1 31 ? -0.009 -2.208 -9.881  1.00 0.00 ? 48 GLY A HA2  11 
ATOM   7432  H HA3  . GLY A 1 31 ? 1.414  -1.532 -9.055  1.00 0.00 ? 48 GLY A HA3  11 
ATOM   7433  N N    . GLY A 1 32 ? -0.599 0.170  -7.731  1.00 0.00 ? 49 GLY A N    11 
ATOM   7434  C CA   . GLY A 1 32 ? -1.421 0.544  -6.588  1.00 0.00 ? 49 GLY A CA   11 
ATOM   7435  C C    . GLY A 1 32 ? -0.564 1.038  -5.430  1.00 0.00 ? 49 GLY A C    11 
ATOM   7436  O O    . GLY A 1 32 ? -1.051 1.210  -4.312  1.00 0.00 ? 49 GLY A O    11 
ATOM   7437  H H    . GLY A 1 32 ? -0.126 0.894  -8.254  1.00 0.00 ? 49 GLY A H    11 
ATOM   7438  H HA2  . GLY A 1 32 ? -2.107 1.338  -6.886  1.00 0.00 ? 49 GLY A HA2  11 
ATOM   7439  H HA3  . GLY A 1 32 ? -1.993 -0.324 -6.260  1.00 0.00 ? 49 GLY A HA3  11 
ATOM   7440  N N    . THR A 1 33 ? 0.717  1.265  -5.703  1.00 0.00 ? 50 THR A N    11 
ATOM   7441  C CA   . THR A 1 33 ? 1.642  1.755  -4.689  1.00 0.00 ? 50 THR A CA   11 
ATOM   7442  C C    . THR A 1 33 ? 1.758  3.274  -4.738  1.00 0.00 ? 50 THR A C    11 
ATOM   7443  O O    . THR A 1 33 ? 1.977  3.854  -5.801  1.00 0.00 ? 50 THR A O    11 
ATOM   7444  C CB   . THR A 1 33 ? 3.042  1.137  -4.855  1.00 0.00 ? 50 THR A CB   11 
ATOM   7445  O OG1  . THR A 1 33 ? 2.953  -0.291 -4.754  1.00 0.00 ? 50 THR A OG1  11 
ATOM   7446  C CG2  . THR A 1 33 ? 3.986  1.659  -3.782  1.00 0.00 ? 50 THR A CG2  11 
ATOM   7447  H H    . THR A 1 33 ? 1.058  1.092  -6.638  1.00 0.00 ? 50 THR A H    11 
ATOM   7448  H HA   . THR A 1 33 ? 1.265  1.507  -3.696  1.00 0.00 ? 50 THR A HA   11 
ATOM   7449  H HB   . THR A 1 33 ? 3.431  1.399  -5.839  1.00 0.00 ? 50 THR A HB   11 
ATOM   7450  H HG1  . THR A 1 33 ? 3.013  -0.677 -5.631  1.00 0.00 ? 50 THR A HG1  11 
ATOM   7451  H HG21 . THR A 1 33 ? 3.598  1.396  -2.799  1.00 0.00 ? 50 THR A HG21 11 
ATOM   7452  H HG22 . THR A 1 33 ? 4.970  1.211  -3.917  1.00 0.00 ? 50 THR A HG22 11 
ATOM   7453  H HG23 . THR A 1 33 ? 4.065  2.743  -3.864  1.00 0.00 ? 50 THR A HG23 11 
ATOM   7454  N N    . ARG A 1 34 ? 1.612  3.911  -3.582  1.00 0.00 ? 51 ARG A N    11 
ATOM   7455  C CA   . ARG A 1 34 ? 1.773  5.356  -3.478  1.00 0.00 ? 51 ARG A CA   11 
ATOM   7456  C C    . ARG A 1 34 ? 3.198  5.725  -3.087  1.00 0.00 ? 51 ARG A C    11 
ATOM   7457  O O    . ARG A 1 34 ? 3.649  5.419  -1.984  1.00 0.00 ? 51 ARG A O    11 
ATOM   7458  C CB   . ARG A 1 34 ? 0.757  5.981  -2.534  1.00 0.00 ? 51 ARG A CB   11 
ATOM   7459  C CG   . ARG A 1 34 ? 0.930  7.474  -2.305  1.00 0.00 ? 51 ARG A CG   11 
ATOM   7460  C CD   . ARG A 1 34 ? -0.137 8.094  -1.477  1.00 0.00 ? 51 ARG A CD   11 
ATOM   7461  N NE   . ARG A 1 34 ? -1.455 8.092  -2.093  1.00 0.00 ? 51 ARG A NE   11 
ATOM   7462  C CZ   . ARG A 1 34 ? -2.565 8.604  -1.527  1.00 0.00 ? 51 ARG A CZ   11 
ATOM   7463  N NH1  . ARG A 1 34 ? -2.531 9.125  -0.320  1.00 0.00 ? 51 ARG A NH1  11 
ATOM   7464  N NH2  . ARG A 1 34 ? -3.696 8.546  -2.206  1.00 0.00 ? 51 ARG A NH2  11 
ATOM   7465  H H    . ARG A 1 34 ? 1.382  3.381  -2.754  1.00 0.00 ? 51 ARG A H    11 
ATOM   7466  H HA   . ARG A 1 34 ? 1.588  5.819  -4.449  1.00 0.00 ? 51 ARG A HA   11 
ATOM   7467  H HB2  . ARG A 1 34 ? -0.229 5.793  -2.956  1.00 0.00 ? 51 ARG A HB2  11 
ATOM   7468  H HB3  . ARG A 1 34 ? 0.848  5.460  -1.580  1.00 0.00 ? 51 ARG A HB3  11 
ATOM   7469  H HG2  . ARG A 1 34 ? 1.883  7.641  -1.803  1.00 0.00 ? 51 ARG A HG2  11 
ATOM   7470  H HG3  . ARG A 1 34 ? 0.937  7.974  -3.275  1.00 0.00 ? 51 ARG A HG3  11 
ATOM   7471  H HD2  . ARG A 1 34 ? -0.216 7.552  -0.536  1.00 0.00 ? 51 ARG A HD2  11 
ATOM   7472  H HD3  . ARG A 1 34 ? 0.128  9.131  -1.278  1.00 0.00 ? 51 ARG A HD3  11 
ATOM   7473  H HE   . ARG A 1 34 ? -1.746 7.729  -2.992  1.00 0.00 ? 51 ARG A HE   11 
ATOM   7474  H HH11 . ARG A 1 34 ? -1.661 9.146  0.194   1.00 0.00 ? 51 ARG A HH11 11 
ATOM   7475  H HH12 . ARG A 1 34 ? -3.374 9.503  0.087   1.00 0.00 ? 51 ARG A HH12 11 
ATOM   7476  H HH21 . ARG A 1 34 ? -3.709 8.126  -3.125  1.00 0.00 ? 51 ARG A HH21 11 
ATOM   7477  H HH22 . ARG A 1 34 ? -4.543 8.922  -1.805  1.00 0.00 ? 51 ARG A HH22 11 
ATOM   7478  N N    . ILE A 1 35 ? 3.905  6.384  -4.000  1.00 0.00 ? 52 ILE A N    11 
ATOM   7479  C CA   . ILE A 1 35 ? 5.252  6.866  -3.723  1.00 0.00 ? 52 ILE A CA   11 
ATOM   7480  C C    . ILE A 1 35 ? 5.222  8.239  -3.063  1.00 0.00 ? 52 ILE A C    11 
ATOM   7481  O O    . ILE A 1 35 ? 4.910  9.241  -3.706  1.00 0.00 ? 52 ILE A O    11 
ATOM   7482  C CB   . ILE A 1 35 ? 6.100  6.943  -5.007  1.00 0.00 ? 52 ILE A CB   11 
ATOM   7483  C CG1  . ILE A 1 35 ? 6.208  5.562  -5.658  1.00 0.00 ? 52 ILE A CG1  11 
ATOM   7484  C CG2  . ILE A 1 35 ? 7.481  7.500  -4.700  1.00 0.00 ? 52 ILE A CG2  11 
ATOM   7485  C CD1  . ILE A 1 35 ? 6.842  5.582  -7.030  1.00 0.00 ? 52 ILE A CD1  11 
ATOM   7486  H H    . ILE A 1 35 ? 3.497  6.556  -4.908  1.00 0.00 ? 52 ILE A H    11 
ATOM   7487  H HA   . ILE A 1 35 ? 5.749  6.223  -2.999  1.00 0.00 ? 52 ILE A HA   11 
ATOM   7488  H HB   . ILE A 1 35 ? 5.597  7.590  -5.725  1.00 0.00 ? 52 ILE A HB   11 
ATOM   7489  H HG12 . ILE A 1 35 ? 6.801  4.935  -4.993  1.00 0.00 ? 52 ILE A HG12 11 
ATOM   7490  H HG13 . ILE A 1 35 ? 5.197  5.157  -5.730  1.00 0.00 ? 52 ILE A HG13 11 
ATOM   7491  H HG21 . ILE A 1 35 ? 8.066  7.547  -5.618  1.00 0.00 ? 52 ILE A HG21 11 
ATOM   7492  H HG22 . ILE A 1 35 ? 7.385  8.501  -4.280  1.00 0.00 ? 52 ILE A HG22 11 
ATOM   7493  H HG23 . ILE A 1 35 ? 7.984  6.852  -3.982  1.00 0.00 ? 52 ILE A HG23 11 
ATOM   7494  H HD11 . ILE A 1 35 ? 7.851  5.984  -6.959  1.00 0.00 ? 52 ILE A HD11 11 
ATOM   7495  H HD12 . ILE A 1 35 ? 6.884  4.567  -7.427  1.00 0.00 ? 52 ILE A HD12 11 
ATOM   7496  H HD13 . ILE A 1 35 ? 6.247  6.207  -7.697  1.00 0.00 ? 52 ILE A HD13 11 
ATOM   7497  N N    . ILE A 1 36 ? 5.548  8.279  -1.776  1.00 0.00 ? 53 ILE A N    11 
ATOM   7498  C CA   . ILE A 1 36 ? 5.525  9.523  -1.017  1.00 0.00 ? 53 ILE A CA   11 
ATOM   7499  C C    . ILE A 1 36 ? 6.888  10.203 -1.035  1.00 0.00 ? 53 ILE A C    11 
ATOM   7500  O O    . ILE A 1 36 ? 7.897  9.602  -0.667  1.00 0.00 ? 53 ILE A O    11 
ATOM   7501  C CB   . ILE A 1 36 ? 5.097  9.288  0.444   1.00 0.00 ? 53 ILE A CB   11 
ATOM   7502  C CG1  . ILE A 1 36 ? 3.690  8.689  0.498   1.00 0.00 ? 53 ILE A CG1  11 
ATOM   7503  C CG2  . ILE A 1 36 ? 5.158  10.586 1.231   1.00 0.00 ? 53 ILE A CG2  11 
ATOM   7504  C CD1  . ILE A 1 36 ? 3.290  8.194  1.869   1.00 0.00 ? 53 ILE A CD1  11 
ATOM   7505  H H    . ILE A 1 36 ? 5.817  7.424  -1.310  1.00 0.00 ? 53 ILE A H    11 
ATOM   7506  H HA   . ILE A 1 36 ? 4.850  10.243 -1.480  1.00 0.00 ? 53 ILE A HA   11 
ATOM   7507  H HB   . ILE A 1 36 ? 5.768  8.556  0.895   1.00 0.00 ? 53 ILE A HB   11 
ATOM   7508  H HG12 . ILE A 1 36 ? 2.995  9.462  0.173   1.00 0.00 ? 53 ILE A HG12 11 
ATOM   7509  H HG13 . ILE A 1 36 ? 3.664  7.858  -0.209  1.00 0.00 ? 53 ILE A HG13 11 
ATOM   7510  H HG21 . ILE A 1 36 ? 4.853  10.403 2.261   1.00 0.00 ? 53 ILE A HG21 11 
ATOM   7511  H HG22 . ILE A 1 36 ? 6.176  10.973 1.219   1.00 0.00 ? 53 ILE A HG22 11 
ATOM   7512  H HG23 . ILE A 1 36 ? 4.487  11.318 0.779   1.00 0.00 ? 53 ILE A HG23 11 
ATOM   7513  H HD11 . ILE A 1 36 ? 3.314  9.022  2.577   1.00 0.00 ? 53 ILE A HD11 11 
ATOM   7514  H HD12 . ILE A 1 36 ? 2.281  7.783  1.829   1.00 0.00 ? 53 ILE A HD12 11 
ATOM   7515  H HD13 . ILE A 1 36 ? 3.983  7.419  2.195   1.00 0.00 ? 53 ILE A HD13 11 
ATOM   7516  N N    . TYR A 1 37 ? 6.910  11.461 -1.464  1.00 0.00 ? 54 TYR A N    11 
ATOM   7517  C CA   . TYR A 1 37 ? 8.163  12.166 -1.706  1.00 0.00 ? 54 TYR A CA   11 
ATOM   7518  C C    . TYR A 1 37 ? 8.509  13.088 -0.545  1.00 0.00 ? 54 TYR A C    11 
ATOM   7519  O O    . TYR A 1 37 ? 7.747  13.996 -0.212  1.00 0.00 ? 54 TYR A O    11 
ATOM   7520  C CB   . TYR A 1 37 ? 8.084  12.967 -3.008  1.00 0.00 ? 54 TYR A CB   11 
ATOM   7521  C CG   . TYR A 1 37 ? 7.912  12.113 -4.243  1.00 0.00 ? 54 TYR A CG   11 
ATOM   7522  C CD1  . TYR A 1 37 ? 8.989  11.438 -4.797  1.00 0.00 ? 54 TYR A CD1  11 
ATOM   7523  C CD2  . TYR A 1 37 ? 6.672  11.985 -4.854  1.00 0.00 ? 54 TYR A CD2  11 
ATOM   7524  C CE1  . TYR A 1 37 ? 8.838  10.656 -5.926  1.00 0.00 ? 54 TYR A CE1  11 
ATOM   7525  C CE2  . TYR A 1 37 ? 6.510  11.206 -5.984  1.00 0.00 ? 54 TYR A CE2  11 
ATOM   7526  C CZ   . TYR A 1 37 ? 7.596  10.543 -6.517  1.00 0.00 ? 54 TYR A CZ   11 
ATOM   7527  O OH   . TYR A 1 37 ? 7.441  9.767  -7.643  1.00 0.00 ? 54 TYR A OH   11 
ATOM   7528  H H    . TYR A 1 37 ? 6.036  11.940 -1.627  1.00 0.00 ? 54 TYR A H    11 
ATOM   7529  H HA   . TYR A 1 37 ? 8.980  11.449 -1.788  1.00 0.00 ? 54 TYR A HA   11 
ATOM   7530  H HB2  . TYR A 1 37 ? 7.237  13.649 -2.916  1.00 0.00 ? 54 TYR A HB2  11 
ATOM   7531  H HB3  . TYR A 1 37 ? 9.006  13.542 -3.088  1.00 0.00 ? 54 TYR A HB3  11 
ATOM   7532  H HD1  . TYR A 1 37 ? 9.967  11.531 -4.326  1.00 0.00 ? 54 TYR A HD1  11 
ATOM   7533  H HD2  . TYR A 1 37 ? 5.819  12.512 -4.428  1.00 0.00 ? 54 TYR A HD2  11 
ATOM   7534  H HE1  . TYR A 1 37 ? 9.698  10.133 -6.345  1.00 0.00 ? 54 TYR A HE1  11 
ATOM   7535  H HE2  . TYR A 1 37 ? 5.531  11.115 -6.453  1.00 0.00 ? 54 TYR A HE2  11 
ATOM   7536  H HH   . TYR A 1 37 ? 8.258  9.352  -7.929  1.00 0.00 ? 54 TYR A HH   11 
ATOM   7537  N N    . ASP A 1 38 ? 9.663  12.851 0.069   1.00 0.00 ? 55 ASP A N    11 
ATOM   7538  C CA   . ASP A 1 38 ? 10.148 13.706 1.146   1.00 0.00 ? 55 ASP A CA   11 
ATOM   7539  C C    . ASP A 1 38 ? 11.197 14.688 0.638   1.00 0.00 ? 55 ASP A C    11 
ATOM   7540  O O    . ASP A 1 38 ? 12.342 14.313 0.383   1.00 0.00 ? 55 ASP A O    11 
ATOM   7541  C CB   . ASP A 1 38 ? 10.727 12.862 2.283   1.00 0.00 ? 55 ASP A CB   11 
ATOM   7542  C CG   . ASP A 1 38 ? 11.229 13.668 3.473   1.00 0.00 ? 55 ASP A CG   11 
ATOM   7543  O OD1  . ASP A 1 38 ? 11.223 14.874 3.395   1.00 0.00 ? 55 ASP A OD1  11 
ATOM   7544  O OD2  . ASP A 1 38 ? 11.465 13.084 4.504   1.00 0.00 ? 55 ASP A OD2  11 
ATOM   7545  H H    . ASP A 1 38 ? 10.218 12.057 -0.216  1.00 0.00 ? 55 ASP A H    11 
ATOM   7546  H HA   . ASP A 1 38 ? 9.327  14.306 1.540   1.00 0.00 ? 55 ASP A HA   11 
ATOM   7547  H HB2  . ASP A 1 38 ? 10.051 12.082 2.633   1.00 0.00 ? 55 ASP A HB2  11 
ATOM   7548  H HB3  . ASP A 1 38 ? 11.575 12.405 1.771   1.00 0.00 ? 55 ASP A HB3  11 
ATOM   7549  N N    . ARG A 1 39 ? 10.799 15.947 0.493   1.00 0.00 ? 56 ARG A N    11 
ATOM   7550  C CA   . ARG A 1 39 ? 11.686 16.975 -0.042  1.00 0.00 ? 56 ARG A CA   11 
ATOM   7551  C C    . ARG A 1 39 ? 12.577 17.556 1.049   1.00 0.00 ? 56 ARG A C    11 
ATOM   7552  O O    . ARG A 1 39 ? 12.098 18.231 1.960   1.00 0.00 ? 56 ARG A O    11 
ATOM   7553  C CB   . ARG A 1 39 ? 10.922 18.065 -0.778  1.00 0.00 ? 56 ARG A CB   11 
ATOM   7554  C CG   . ARG A 1 39 ? 11.792 19.133 -1.421  1.00 0.00 ? 56 ARG A CG   11 
ATOM   7555  C CD   . ARG A 1 39 ? 11.036 20.190 -2.138  1.00 0.00 ? 56 ARG A CD   11 
ATOM   7556  N NE   . ARG A 1 39 ? 11.837 21.332 -2.549  1.00 0.00 ? 56 ARG A NE   11 
ATOM   7557  C CZ   . ARG A 1 39 ? 11.342 22.555 -2.824  1.00 0.00 ? 56 ARG A CZ   11 
ATOM   7558  N NH1  . ARG A 1 39 ? 10.051 22.791 -2.771  1.00 0.00 ? 56 ARG A NH1  11 
ATOM   7559  N NH2  . ARG A 1 39 ? 12.191 23.506 -3.173  1.00 0.00 ? 56 ARG A NH2  11 
ATOM   7560  H H    . ARG A 1 39 ? 9.858  16.200 0.761   1.00 0.00 ? 56 ARG A H    11 
ATOM   7561  H HA   . ARG A 1 39 ? 12.351 16.536 -0.785  1.00 0.00 ? 56 ARG A HA   11 
ATOM   7562  H HB2  . ARG A 1 39 ? 10.328 17.574 -1.547  1.00 0.00 ? 56 ARG A HB2  11 
ATOM   7563  H HB3  . ARG A 1 39 ? 10.258 18.534 -0.051  1.00 0.00 ? 56 ARG A HB3  11 
ATOM   7564  H HG2  . ARG A 1 39 ? 12.385 19.614 -0.643  1.00 0.00 ? 56 ARG A HG2  11 
ATOM   7565  H HG3  . ARG A 1 39 ? 12.458 18.650 -2.138  1.00 0.00 ? 56 ARG A HG3  11 
ATOM   7566  H HD2  . ARG A 1 39 ? 10.594 19.761 -3.037  1.00 0.00 ? 56 ARG A HD2  11 
ATOM   7567  H HD3  . ARG A 1 39 ? 10.246 20.563 -1.487  1.00 0.00 ? 56 ARG A HD3  11 
ATOM   7568  H HE   . ARG A 1 39 ? 12.837 21.401 -2.690  1.00 0.00 ? 56 ARG A HE   11 
ATOM   7569  H HH11 . ARG A 1 39 ? 9.414  22.048 -2.519  1.00 0.00 ? 56 ARG A HH11 11 
ATOM   7570  H HH12 . ARG A 1 39 ? 9.700  23.714 -2.980  1.00 0.00 ? 56 ARG A HH12 11 
ATOM   7571  H HH21 . ARG A 1 39 ? 13.179 23.303 -3.227  1.00 0.00 ? 56 ARG A HH21 11 
ATOM   7572  H HH22 . ARG A 1 39 ? 11.847 24.432 -3.385  1.00 0.00 ? 56 ARG A HH22 11 
ATOM   7573  N N    . LYS A 1 40 ? 13.875 17.290 0.950   1.00 0.00 ? 57 LYS A N    11 
ATOM   7574  C CA   . LYS A 1 40 ? 14.834 17.786 1.928   1.00 0.00 ? 57 LYS A CA   11 
ATOM   7575  C C    . LYS A 1 40 ? 14.735 19.298 2.079   1.00 0.00 ? 57 LYS A C    11 
ATOM   7576  O O    . LYS A 1 40 ? 14.830 19.829 3.186   1.00 0.00 ? 57 LYS A O    11 
ATOM   7577  C CB   . LYS A 1 40 ? 16.257 17.390 1.530   1.00 0.00 ? 57 LYS A CB   11 
ATOM   7578  C CG   . LYS A 1 40 ? 17.338 17.888 2.481   1.00 0.00 ? 57 LYS A CG   11 
ATOM   7579  C CD   . LYS A 1 40 ? 18.714 17.393 2.062   1.00 0.00 ? 57 LYS A CD   11 
ATOM   7580  C CE   . LYS A 1 40 ? 19.801 17.939 2.977   1.00 0.00 ? 57 LYS A CE   11 
ATOM   7581  N NZ   . LYS A 1 40 ? 21.152 17.445 2.592   1.00 0.00 ? 57 LYS A NZ   11 
ATOM   7582  H H    . LYS A 1 40 ? 14.204 16.729 0.177   1.00 0.00 ? 57 LYS A H    11 
ATOM   7583  H HA   . LYS A 1 40 ? 14.616 17.361 2.908   1.00 0.00 ? 57 LYS A HA   11 
ATOM   7584  H HB2  . LYS A 1 40 ? 16.286 16.300 1.489   1.00 0.00 ? 57 LYS A HB2  11 
ATOM   7585  H HB3  . LYS A 1 40 ? 16.436 17.795 0.535   1.00 0.00 ? 57 LYS A HB3  11 
ATOM   7586  H HG2  . LYS A 1 40 ? 17.326 18.978 2.477   1.00 0.00 ? 57 LYS A HG2  11 
ATOM   7587  H HG3  . LYS A 1 40 ? 17.111 17.527 3.484   1.00 0.00 ? 57 LYS A HG3  11 
ATOM   7588  H HD2  . LYS A 1 40 ? 18.719 16.302 2.103   1.00 0.00 ? 57 LYS A HD2  11 
ATOM   7589  H HD3  . LYS A 1 40 ? 18.904 17.718 1.040   1.00 0.00 ? 57 LYS A HD3  11 
ATOM   7590  H HE2  . LYS A 1 40 ? 19.782 19.026 2.919   1.00 0.00 ? 57 LYS A HE2  11 
ATOM   7591  H HE3  . LYS A 1 40 ? 19.579 17.626 3.996   1.00 0.00 ? 57 LYS A HE3  11 
ATOM   7592  H HZ1  . LYS A 1 40 ? 21.359 17.737 1.647   1.00 0.00 ? 57 LYS A HZ1  11 
ATOM   7593  H HZ2  . LYS A 1 40 ? 21.842 17.830 3.221   1.00 0.00 ? 57 LYS A HZ2  11 
ATOM   7594  H HZ3  . LYS A 1 40 ? 21.170 16.437 2.645   1.00 0.00 ? 57 LYS A HZ3  11 
ATOM   7595  N N    . PHE A 1 41 ? 14.544 19.988 0.960   1.00 0.00 ? 58 PHE A N    11 
ATOM   7596  C CA   . PHE A 1 41 ? 14.545 21.447 0.949   1.00 0.00 ? 58 PHE A CA   11 
ATOM   7597  C C    . PHE A 1 41 ? 13.136 21.996 0.765   1.00 0.00 ? 58 PHE A C    11 
ATOM   7598  O O    . PHE A 1 41 ? 12.941 23.028 0.123   1.00 0.00 ? 58 PHE A O    11 
ATOM   7599  C CB   . PHE A 1 41 ? 15.462 21.972 -0.155  1.00 0.00 ? 58 PHE A CB   11 
ATOM   7600  C CG   . PHE A 1 41 ? 16.887 21.514 -0.030  1.00 0.00 ? 58 PHE A CG   11 
ATOM   7601  C CD1  . PHE A 1 41 ? 17.731 22.078 0.915   1.00 0.00 ? 58 PHE A CD1  11 
ATOM   7602  C CD2  . PHE A 1 41 ? 17.387 20.517 -0.854  1.00 0.00 ? 58 PHE A CD2  11 
ATOM   7603  C CE1  . PHE A 1 41 ? 19.043 21.659 1.033   1.00 0.00 ? 58 PHE A CE1  11 
ATOM   7604  C CE2  . PHE A 1 41 ? 18.697 20.094 -0.739  1.00 0.00 ? 58 PHE A CE2  11 
ATOM   7605  C CZ   . PHE A 1 41 ? 19.525 20.665 0.204   1.00 0.00 ? 58 PHE A CZ   11 
ATOM   7606  H H    . PHE A 1 41 ? 14.394 19.490 0.094   1.00 0.00 ? 58 PHE A H    11 
ATOM   7607  H HA   . PHE A 1 41 ? 14.902 21.824 1.908   1.00 0.00 ? 58 PHE A HA   11 
ATOM   7608  H HB2  . PHE A 1 41 ? 15.112 21.633 -1.129  1.00 0.00 ? 58 PHE A HB2  11 
ATOM   7609  H HB3  . PHE A 1 41 ? 15.483 23.061 -0.138  1.00 0.00 ? 58 PHE A HB3  11 
ATOM   7610  H HD1  . PHE A 1 41 ? 17.350 22.863 1.570   1.00 0.00 ? 58 PHE A HD1  11 
ATOM   7611  H HD2  . PHE A 1 41 ? 16.732 20.067 -1.600  1.00 0.00 ? 58 PHE A HD2  11 
ATOM   7612  H HE1  . PHE A 1 41 ? 19.696 22.111 1.778   1.00 0.00 ? 58 PHE A HE1  11 
ATOM   7613  H HE2  . PHE A 1 41 ? 19.076 19.310 -1.393  1.00 0.00 ? 58 PHE A HE2  11 
ATOM   7614  H HZ   . PHE A 1 41 ? 20.558 20.332 0.297   1.00 0.00 ? 58 PHE A HZ   11 
ATOM   7615  N N    . LEU A 1 42 ? 12.156 21.301 1.334   1.00 0.00 ? 59 LEU A N    11 
ATOM   7616  C CA   . LEU A 1 42 ? 10.763 21.718 1.233   1.00 0.00 ? 59 LEU A CA   11 
ATOM   7617  C C    . LEU A 1 42 ? 10.575 23.139 1.749   1.00 0.00 ? 59 LEU A C    11 
ATOM   7618  O O    . LEU A 1 42 ? 10.863 23.432 2.909   1.00 0.00 ? 59 LEU A O    11 
ATOM   7619  C CB   . LEU A 1 42 ? 9.862  20.746 2.005   1.00 0.00 ? 59 LEU A CB   11 
ATOM   7620  C CG   . LEU A 1 42 ? 8.355  20.997 1.861   1.00 0.00 ? 59 LEU A CG   11 
ATOM   7621  C CD1  . LEU A 1 42 ? 7.927  20.787 0.414   1.00 0.00 ? 59 LEU A CD1  11 
ATOM   7622  C CD2  . LEU A 1 42 ? 7.592  20.066 2.790   1.00 0.00 ? 59 LEU A CD2  11 
ATOM   7623  H H    . LEU A 1 42 ? 12.383 20.463 1.849   1.00 0.00 ? 59 LEU A H    11 
ATOM   7624  H HA   . LEU A 1 42 ? 10.459 21.726 0.187   1.00 0.00 ? 59 LEU A HA   11 
ATOM   7625  H HB2  . LEU A 1 42 ? 10.135 19.817 1.507   1.00 0.00 ? 59 LEU A HB2  11 
ATOM   7626  H HB3  . LEU A 1 42 ? 10.138 20.688 3.058   1.00 0.00 ? 59 LEU A HB3  11 
ATOM   7627  H HG   . LEU A 1 42 ? 8.165  22.021 2.186   1.00 0.00 ? 59 LEU A HG   11 
ATOM   7628  H HD11 . LEU A 1 42 ? 6.856  20.968 0.322   1.00 0.00 ? 59 LEU A HD11 11 
ATOM   7629  H HD12 . LEU A 1 42 ? 8.469  21.480 -0.229  1.00 0.00 ? 59 LEU A HD12 11 
ATOM   7630  H HD13 . LEU A 1 42 ? 8.149  19.764 0.115   1.00 0.00 ? 59 LEU A HD13 11 
ATOM   7631  H HD21 . LEU A 1 42 ? 7.893  20.253 3.822   1.00 0.00 ? 59 LEU A HD21 11 
ATOM   7632  H HD22 . LEU A 1 42 ? 6.522  20.246 2.687   1.00 0.00 ? 59 LEU A HD22 11 
ATOM   7633  H HD23 . LEU A 1 42 ? 7.813  19.030 2.530   1.00 0.00 ? 59 LEU A HD23 11 
ATOM   7634  N N    . LEU A 1 43 ? 10.087 24.018 0.881   1.00 0.00 ? 60 LEU A N    11 
ATOM   7635  C CA   . LEU A 1 43 ? 9.843  25.407 1.251   1.00 0.00 ? 60 LEU A CA   11 
ATOM   7636  C C    . LEU A 1 43 ? 8.443  25.587 1.824   1.00 0.00 ? 60 LEU A C    11 
ATOM   7637  O O    . LEU A 1 43 ? 8.147  26.599 2.459   1.00 0.00 ? 60 LEU A O    11 
ATOM   7638  C CB   . LEU A 1 43 ? 10.044 26.323 0.037   1.00 0.00 ? 60 LEU A CB   11 
ATOM   7639  C CG   . LEU A 1 43 ? 11.459 26.320 -0.555  1.00 0.00 ? 60 LEU A CG   11 
ATOM   7640  C CD1  . LEU A 1 43 ? 11.508 27.206 -1.793  1.00 0.00 ? 60 LEU A CD1  11 
ATOM   7641  C CD2  . LEU A 1 43 ? 12.451 26.803 0.493   1.00 0.00 ? 60 LEU A CD2  11 
ATOM   7642  H H    . LEU A 1 43 ? 9.880  23.717 -0.061  1.00 0.00 ? 60 LEU A H    11 
ATOM   7643  H HA   . LEU A 1 43 ? 10.539 25.702 2.035   1.00 0.00 ? 60 LEU A HA   11 
ATOM   7644  H HB2  . LEU A 1 43 ? 9.348  25.854 -0.656  1.00 0.00 ? 60 LEU A HB2  11 
ATOM   7645  H HB3  . LEU A 1 43 ? 9.719  27.343 0.243   1.00 0.00 ? 60 LEU A HB3  11 
ATOM   7646  H HG   . LEU A 1 43 ? 11.707 25.287 -0.797  1.00 0.00 ? 60 LEU A HG   11 
ATOM   7647  H HD11 . LEU A 1 43 ? 12.517 27.198 -2.207  1.00 0.00 ? 60 LEU A HD11 11 
ATOM   7648  H HD12 . LEU A 1 43 ? 10.808 26.829 -2.538  1.00 0.00 ? 60 LEU A HD12 11 
ATOM   7649  H HD13 . LEU A 1 43 ? 11.236 28.225 -1.522  1.00 0.00 ? 60 LEU A HD13 11 
ATOM   7650  H HD21 . LEU A 1 43 ? 12.418 26.140 1.357   1.00 0.00 ? 60 LEU A HD21 11 
ATOM   7651  H HD22 . LEU A 1 43 ? 13.455 26.800 0.070   1.00 0.00 ? 60 LEU A HD22 11 
ATOM   7652  H HD23 . LEU A 1 43 ? 12.189 27.815 0.802   1.00 0.00 ? 60 LEU A HD23 11 
ATOM   7653  N N    . ASP A 1 44 ? 7.585  24.598 1.597   1.00 0.00 ? 61 ASP A N    11 
ATOM   7654  C CA   . ASP A 1 44 ? 6.226  24.628 2.124   1.00 0.00 ? 61 ASP A CA   11 
ATOM   7655  C C    . ASP A 1 44 ? 6.221  24.499 3.642   1.00 0.00 ? 61 ASP A C    11 
ATOM   7656  O O    . ASP A 1 44 ? 7.017  23.754 4.214   1.00 0.00 ? 61 ASP A O    11 
ATOM   7657  C CB   . ASP A 1 44 ? 5.384  23.513 1.499   1.00 0.00 ? 61 ASP A CB   11 
ATOM   7658  C CG   . ASP A 1 44 ? 5.009  23.749 0.042   1.00 0.00 ? 61 ASP A CG   11 
ATOM   7659  O OD1  . ASP A 1 44 ? 5.216  24.840 -0.435  1.00 0.00 ? 61 ASP A OD1  11 
ATOM   7660  O OD2  . ASP A 1 44 ? 4.669  22.801 -0.623  1.00 0.00 ? 61 ASP A OD2  11 
ATOM   7661  H H    . ASP A 1 44 ? 7.882  23.807 1.044   1.00 0.00 ? 61 ASP A H    11 
ATOM   7662  H HA   . ASP A 1 44 ? 5.761  25.586 1.893   1.00 0.00 ? 61 ASP A HA   11 
ATOM   7663  H HB2  . ASP A 1 44 ? 5.828  22.523 1.603   1.00 0.00 ? 61 ASP A HB2  11 
ATOM   7664  H HB3  . ASP A 1 44 ? 4.489  23.578 2.119   1.00 0.00 ? 61 ASP A HB3  11 
ATOM   7665  N N    . ARG A 1 45 ? 5.319  25.227 4.290   1.00 0.00 ? 62 ARG A N    11 
ATOM   7666  C CA   . ARG A 1 45 ? 5.211  25.199 5.743   1.00 0.00 ? 62 ARG A CA   11 
ATOM   7667  C C    . ARG A 1 45 ? 4.664  23.863 6.229   1.00 0.00 ? 62 ARG A C    11 
ATOM   7668  O O    . ARG A 1 45 ? 5.390  22.912 6.314   1.00 0.00 ? 62 ARG A O    11 
ATOM   7669  C CB   . ARG A 1 45 ? 4.394  26.365 6.282   1.00 0.00 ? 62 ARG A CB   11 
ATOM   7670  C CG   . ARG A 1 45 ? 4.330  26.454 7.798   1.00 0.00 ? 62 ARG A CG   11 
ATOM   7671  C CD   . ARG A 1 45 ? 3.571  27.623 8.310   1.00 0.00 ? 62 ARG A CD   11 
ATOM   7672  N NE   . ARG A 1 45 ? 3.533  27.729 9.761   1.00 0.00 ? 62 ARG A NE   11 
ATOM   7673  C CZ   . ARG A 1 45 ? 2.911  28.712 10.440  1.00 0.00 ? 62 ARG A CZ   11 
ATOM   7674  N NH1  . ARG A 1 45 ? 2.308  29.696 9.809   1.00 0.00 ? 62 ARG A NH1  11 
ATOM   7675  N NH2  . ARG A 1 45 ? 2.944  28.676 11.761  1.00 0.00 ? 62 ARG A NH2  11 
ATOM   7676  O OXT  . ARG A 1 45 ? 3.506  23.762 6.528   1.00 0.00 ? 62 ARG A OXT  11 
ATOM   7677  H H    . ARG A 1 45 ? 4.691  25.816 3.762   1.00 0.00 ? 62 ARG A H    11 
ATOM   7678  H HA   . ARG A 1 45 ? 6.200  25.309 6.189   1.00 0.00 ? 62 ARG A HA   11 
ATOM   7679  H HB2  . ARG A 1 45 ? 4.841  27.276 5.886   1.00 0.00 ? 62 ARG A HB2  11 
ATOM   7680  H HB3  . ARG A 1 45 ? 3.384  26.254 5.886   1.00 0.00 ? 62 ARG A HB3  11 
ATOM   7681  H HG2  . ARG A 1 45 ? 3.853  25.552 8.180   1.00 0.00 ? 62 ARG A HG2  11 
ATOM   7682  H HG3  . ARG A 1 45 ? 5.348  26.518 8.184   1.00 0.00 ? 62 ARG A HG3  11 
ATOM   7683  H HD2  . ARG A 1 45 ? 4.027  28.536 7.929   1.00 0.00 ? 62 ARG A HD2  11 
ATOM   7684  H HD3  . ARG A 1 45 ? 2.541  27.558 7.961   1.00 0.00 ? 62 ARG A HD3  11 
ATOM   7685  H HE   . ARG A 1 45 ? 3.939  27.123 10.461  1.00 0.00 ? 62 ARG A HE   11 
ATOM   7686  H HH11 . ARG A 1 45 ? 2.308  29.718 8.799   1.00 0.00 ? 62 ARG A HH11 11 
ATOM   7687  H HH12 . ARG A 1 45 ? 1.848  30.423 10.336  1.00 0.00 ? 62 ARG A HH12 11 
ATOM   7688  H HH21 . ARG A 1 45 ? 3.428  27.923 12.230  1.00 0.00 ? 62 ARG A HH21 11 
ATOM   7689  H HH22 . ARG A 1 45 ? 2.487  29.400 12.294  1.00 0.00 ? 62 ARG A HH22 11 
ATOM   7690  N N    . PRO A 1 1  ? -0.332 -0.034 -0.409  1.00 0.00 ? 18 PRO A N    12 
ATOM   7691  C CA   . PRO A 1 1  ? 1.102  0.005  -0.148  1.00 0.00 ? 18 PRO A CA   12 
ATOM   7692  C C    . PRO A 1 1  ? 1.669  1.397  -0.394  1.00 0.00 ? 18 PRO A C    12 
ATOM   7693  O O    . PRO A 1 1  ? 1.165  2.145  -1.232  1.00 0.00 ? 18 PRO A O    12 
ATOM   7694  C CB   . PRO A 1 1  ? 1.685  -1.033 -1.112  1.00 0.00 ? 18 PRO A CB   12 
ATOM   7695  C CG   . PRO A 1 1  ? 0.740  -1.044 -2.265  1.00 0.00 ? 18 PRO A CG   12 
ATOM   7696  C CD   . PRO A 1 1  ? -0.622 -0.810 -1.665  1.00 0.00 ? 18 PRO A CD   12 
ATOM   7697  H H2   . PRO A 1 1  ? -0.697 -0.648 -1.108  1.00 0.00 ? 18 PRO A H2   12 
ATOM   7698  H H3   . PRO A 1 1  ? -0.966 -0.286 0.322   1.00 0.00 ? 18 PRO A H3   12 
ATOM   7699  H HA   . PRO A 1 1  ? 1.351  -0.222 0.898   1.00 0.00 ? 18 PRO A HA   12 
ATOM   7700  H HB2  . PRO A 1 1  ? 2.701  -0.759 -1.434  1.00 0.00 ? 18 PRO A HB2  12 
ATOM   7701  H HB3  . PRO A 1 1  ? 1.753  -2.026 -0.643  1.00 0.00 ? 18 PRO A HB3  12 
ATOM   7702  H HG2  . PRO A 1 1  ? 0.991  -0.259 -2.992  1.00 0.00 ? 18 PRO A HG2  12 
ATOM   7703  H HG3  . PRO A 1 1  ? 0.776  -2.003 -2.800  1.00 0.00 ? 18 PRO A HG3  12 
ATOM   7704  H HD2  . PRO A 1 1  ? -1.278 -0.237 -2.335  1.00 0.00 ? 18 PRO A HD2  12 
ATOM   7705  H HD3  . PRO A 1 1  ? -1.142 -1.752 -1.434  1.00 0.00 ? 18 PRO A HD3  12 
ATOM   7706  N N    . THR A 1 2  ? 2.721  1.741  0.343   1.00 0.00 ? 19 THR A N    12 
ATOM   7707  C CA   . THR A 1 2  ? 3.375  3.034  0.188   1.00 0.00 ? 19 THR A CA   12 
ATOM   7708  C C    . THR A 1 2  ? 4.880  2.874  0.015   1.00 0.00 ? 19 THR A C    12 
ATOM   7709  O O    . THR A 1 2  ? 5.430  1.798  0.250   1.00 0.00 ? 19 THR A O    12 
ATOM   7710  C CB   . THR A 1 2  ? 3.102  3.953  1.393   1.00 0.00 ? 19 THR A CB   12 
ATOM   7711  O OG1  . THR A 1 2  ? 3.656  3.368  2.579   1.00 0.00 ? 19 THR A OG1  12 
ATOM   7712  C CG2  . THR A 1 2  ? 1.606  4.155  1.583   1.00 0.00 ? 19 THR A CG2  12 
ATOM   7713  H H    . THR A 1 2  ? 3.076  1.089  1.027   1.00 0.00 ? 19 THR A H    12 
ATOM   7714  H HA   . THR A 1 2  ? 3.011  3.526  -0.715  1.00 0.00 ? 19 THR A HA   12 
ATOM   7715  H HB   . THR A 1 2  ? 3.578  4.917  1.219   1.00 0.00 ? 19 THR A HB   12 
ATOM   7716  H HG1  . THR A 1 2  ? 3.485  3.942  3.329   1.00 0.00 ? 19 THR A HG1  12 
ATOM   7717  H HG21 . THR A 1 2  ? 1.130  3.192  1.759   1.00 0.00 ? 19 THR A HG21 12 
ATOM   7718  H HG22 . THR A 1 2  ? 1.434  4.807  2.439   1.00 0.00 ? 19 THR A HG22 12 
ATOM   7719  H HG23 . THR A 1 2  ? 1.185  4.611  0.687   1.00 0.00 ? 19 THR A HG23 12 
ATOM   7720  N N    . ARG A 1 3  ? 5.541  3.950  -0.397  1.00 0.00 ? 20 ARG A N    12 
ATOM   7721  C CA   . ARG A 1 3  ? 6.988  3.937  -0.577  1.00 0.00 ? 20 ARG A CA   12 
ATOM   7722  C C    . ARG A 1 3  ? 7.599  5.287  -0.221  1.00 0.00 ? 20 ARG A C    12 
ATOM   7723  O O    . ARG A 1 3  ? 7.098  6.334  -0.631  1.00 0.00 ? 20 ARG A O    12 
ATOM   7724  C CB   . ARG A 1 3  ? 7.387  3.498  -1.978  1.00 0.00 ? 20 ARG A CB   12 
ATOM   7725  C CG   . ARG A 1 3  ? 8.885  3.367  -2.204  1.00 0.00 ? 20 ARG A CG   12 
ATOM   7726  C CD   . ARG A 1 3  ? 9.260  2.893  -3.562  1.00 0.00 ? 20 ARG A CD   12 
ATOM   7727  N NE   . ARG A 1 3  ? 10.692 2.845  -3.808  1.00 0.00 ? 20 ARG A NE   12 
ATOM   7728  C CZ   . ARG A 1 3  ? 11.266 2.249  -4.872  1.00 0.00 ? 20 ARG A CZ   12 
ATOM   7729  N NH1  . ARG A 1 3  ? 10.539 1.619  -5.769  1.00 0.00 ? 20 ARG A NH1  12 
ATOM   7730  N NH2  . ARG A 1 3  ? 12.582 2.295  -4.978  1.00 0.00 ? 20 ARG A NH2  12 
ATOM   7731  H H    . ARG A 1 3  ? 5.028  4.799  -0.589  1.00 0.00 ? 20 ARG A H    12 
ATOM   7732  H HA   . ARG A 1 3  ? 7.437  3.206  0.095   1.00 0.00 ? 20 ARG A HA   12 
ATOM   7733  H HB2  . ARG A 1 3  ? 6.911  2.535  -2.157  1.00 0.00 ? 20 ARG A HB2  12 
ATOM   7734  H HB3  . ARG A 1 3  ? 6.984  4.237  -2.671  1.00 0.00 ? 20 ARG A HB3  12 
ATOM   7735  H HG2  . ARG A 1 3  ? 9.346  4.343  -2.051  1.00 0.00 ? 20 ARG A HG2  12 
ATOM   7736  H HG3  . ARG A 1 3  ? 9.284  2.658  -1.478  1.00 0.00 ? 20 ARG A HG3  12 
ATOM   7737  H HD2  . ARG A 1 3  ? 8.870  1.885  -3.704  1.00 0.00 ? 20 ARG A HD2  12 
ATOM   7738  H HD3  . ARG A 1 3  ? 8.823  3.560  -4.303  1.00 0.00 ? 20 ARG A HD3  12 
ATOM   7739  H HE   . ARG A 1 3  ? 11.453 3.224  -3.262  1.00 0.00 ? 20 ARG A HE   12 
ATOM   7740  H HH11 . ARG A 1 3  ? 9.535  1.579  -5.664  1.00 0.00 ? 20 ARG A HH11 12 
ATOM   7741  H HH12 . ARG A 1 3  ? 10.988 1.179  -6.559  1.00 0.00 ? 20 ARG A HH12 12 
ATOM   7742  H HH21 . ARG A 1 3  ? 13.127 2.767  -4.271  1.00 0.00 ? 20 ARG A HH21 12 
ATOM   7743  H HH22 . ARG A 1 3  ? 13.037 1.856  -5.765  1.00 0.00 ? 20 ARG A HH22 12 
ATOM   7744  N N    . THR A 1 4  ? 8.685  5.255  0.545   1.00 0.00 ? 21 THR A N    12 
ATOM   7745  C CA   . THR A 1 4  ? 9.373  6.475  0.949   1.00 0.00 ? 21 THR A CA   12 
ATOM   7746  C C    . THR A 1 4  ? 10.581 6.747  0.062   1.00 0.00 ? 21 THR A C    12 
ATOM   7747  O O    . THR A 1 4  ? 11.524 5.957  0.022   1.00 0.00 ? 21 THR A O    12 
ATOM   7748  C CB   . THR A 1 4  ? 9.833  6.404  2.418   1.00 0.00 ? 21 THR A CB   12 
ATOM   7749  O OG1  . THR A 1 4  ? 8.693  6.235  3.270   1.00 0.00 ? 21 THR A OG1  12 
ATOM   7750  C CG2  . THR A 1 4  ? 10.569 7.676  2.807   1.00 0.00 ? 21 THR A CG2  12 
ATOM   7751  H H    . THR A 1 4  ? 9.043  4.362  0.853   1.00 0.00 ? 21 THR A H    12 
ATOM   7752  H HA   . THR A 1 4  ? 8.707  7.330  0.833   1.00 0.00 ? 21 THR A HA   12 
ATOM   7753  H HB   . THR A 1 4  ? 10.497 5.549  2.539   1.00 0.00 ? 21 THR A HB   12 
ATOM   7754  H HG1  . THR A 1 4  ? 8.982  6.191  4.185   1.00 0.00 ? 21 THR A HG1  12 
ATOM   7755  H HG21 . THR A 1 4  ? 9.906  8.531  2.686   1.00 0.00 ? 21 THR A HG21 12 
ATOM   7756  H HG22 . THR A 1 4  ? 10.886 7.607  3.848   1.00 0.00 ? 21 THR A HG22 12 
ATOM   7757  H HG23 . THR A 1 4  ? 11.443 7.801  2.168   1.00 0.00 ? 21 THR A HG23 12 
ATOM   7758  N N    . VAL A 1 5  ? 10.546 7.869  -0.649  1.00 0.00 ? 22 VAL A N    12 
ATOM   7759  C CA   . VAL A 1 5  ? 11.648 8.259  -1.520  1.00 0.00 ? 22 VAL A CA   12 
ATOM   7760  C C    . VAL A 1 5  ? 12.084 9.693  -1.249  1.00 0.00 ? 22 VAL A C    12 
ATOM   7761  O O    . VAL A 1 5  ? 11.259 10.606 -1.214  1.00 0.00 ? 22 VAL A O    12 
ATOM   7762  C CB   . VAL A 1 5  ? 11.270 8.120  -3.007  1.00 0.00 ? 22 VAL A CB   12 
ATOM   7763  C CG1  . VAL A 1 5  ? 12.411 8.597  -3.893  1.00 0.00 ? 22 VAL A CG1  12 
ATOM   7764  C CG2  . VAL A 1 5  ? 10.912 6.678  -3.333  1.00 0.00 ? 22 VAL A CG2  12 
ATOM   7765  H H    . VAL A 1 5  ? 9.734  8.467  -0.584  1.00 0.00 ? 22 VAL A H    12 
ATOM   7766  H HA   . VAL A 1 5  ? 12.537 7.656  -1.329  1.00 0.00 ? 22 VAL A HA   12 
ATOM   7767  H HB   . VAL A 1 5  ? 10.382 8.719  -3.204  1.00 0.00 ? 22 VAL A HB   12 
ATOM   7768  H HG11 . VAL A 1 5  ? 12.127 8.492  -4.940  1.00 0.00 ? 22 VAL A HG11 12 
ATOM   7769  H HG12 . VAL A 1 5  ? 12.625 9.644  -3.679  1.00 0.00 ? 22 VAL A HG12 12 
ATOM   7770  H HG13 . VAL A 1 5  ? 13.300 7.997  -3.697  1.00 0.00 ? 22 VAL A HG13 12 
ATOM   7771  H HG21 . VAL A 1 5  ? 10.065 6.365  -2.722  1.00 0.00 ? 22 VAL A HG21 12 
ATOM   7772  H HG22 . VAL A 1 5  ? 10.648 6.597  -4.386  1.00 0.00 ? 22 VAL A HG22 12 
ATOM   7773  H HG23 . VAL A 1 5  ? 11.767 6.035  -3.123  1.00 0.00 ? 22 VAL A HG23 12 
ATOM   7774  N N    . ALA A 1 6  ? 13.384 9.884  -1.056  1.00 0.00 ? 23 ALA A N    12 
ATOM   7775  C CA   . ALA A 1 6  ? 13.942 11.218 -0.860  1.00 0.00 ? 23 ALA A CA   12 
ATOM   7776  C C    . ALA A 1 6  ? 14.305 11.864 -2.191  1.00 0.00 ? 23 ALA A C    12 
ATOM   7777  O O    . ALA A 1 6  ? 14.866 11.216 -3.074  1.00 0.00 ? 23 ALA A O    12 
ATOM   7778  C CB   . ALA A 1 6  ? 15.158 11.154 0.052   1.00 0.00 ? 23 ALA A CB   12 
ATOM   7779  H H    . ALA A 1 6  ? 14.004 9.086  -1.046  1.00 0.00 ? 23 ALA A H    12 
ATOM   7780  H HA   . ALA A 1 6  ? 13.186 11.846 -0.389  1.00 0.00 ? 23 ALA A HA   12 
ATOM   7781  H HB1  . ALA A 1 6  ? 15.917 10.516 -0.398  1.00 0.00 ? 23 ALA A HB1  12 
ATOM   7782  H HB2  . ALA A 1 6  ? 15.561 12.158 0.188   1.00 0.00 ? 23 ALA A HB2  12 
ATOM   7783  H HB3  . ALA A 1 6  ? 14.867 10.746 1.020   1.00 0.00 ? 23 ALA A HB3  12 
ATOM   7784  N N    . ILE A 1 7  ? 13.981 13.146 -2.328  1.00 0.00 ? 24 ILE A N    12 
ATOM   7785  C CA   . ILE A 1 7  ? 14.210 13.864 -3.576  1.00 0.00 ? 24 ILE A CA   12 
ATOM   7786  C C    . ILE A 1 7  ? 14.826 15.233 -3.318  1.00 0.00 ? 24 ILE A C    12 
ATOM   7787  O O    . ILE A 1 7  ? 14.818 15.726 -2.190  1.00 0.00 ? 24 ILE A O    12 
ATOM   7788  C CB   . ILE A 1 7  ? 12.905 14.041 -4.374  1.00 0.00 ? 24 ILE A CB   12 
ATOM   7789  C CG1  . ILE A 1 7  ? 11.889 14.852 -3.564  1.00 0.00 ? 24 ILE A CG1  12 
ATOM   7790  C CG2  . ILE A 1 7  ? 12.326 12.686 -4.752  1.00 0.00 ? 24 ILE A CG2  12 
ATOM   7791  C CD1  . ILE A 1 7  ? 10.665 15.258 -4.351  1.00 0.00 ? 24 ILE A CD1  12 
ATOM   7792  H H    . ILE A 1 7  ? 13.566 13.634 -1.547  1.00 0.00 ? 24 ILE A H    12 
ATOM   7793  H HA   . ILE A 1 7  ? 14.942 13.343 -4.190  1.00 0.00 ? 24 ILE A HA   12 
ATOM   7794  H HB   . ILE A 1 7  ? 13.115 14.613 -5.277  1.00 0.00 ? 24 ILE A HB   12 
ATOM   7795  H HG12 . ILE A 1 7  ? 11.589 14.240 -2.714  1.00 0.00 ? 24 ILE A HG12 12 
ATOM   7796  H HG13 . ILE A 1 7  ? 12.402 15.744 -3.203  1.00 0.00 ? 24 ILE A HG13 12 
ATOM   7797  H HG21 . ILE A 1 7  ? 11.404 12.828 -5.315  1.00 0.00 ? 24 ILE A HG21 12 
ATOM   7798  H HG22 . ILE A 1 7  ? 13.045 12.143 -5.366  1.00 0.00 ? 24 ILE A HG22 12 
ATOM   7799  H HG23 . ILE A 1 7  ? 12.115 12.114 -3.850  1.00 0.00 ? 24 ILE A HG23 12 
ATOM   7800  H HD11 . ILE A 1 7  ? 10.152 14.369 -4.712  1.00 0.00 ? 24 ILE A HD11 12 
ATOM   7801  H HD12 . ILE A 1 7  ? 9.993  15.830 -3.711  1.00 0.00 ? 24 ILE A HD12 12 
ATOM   7802  H HD13 . ILE A 1 7  ? 10.966 15.873 -5.202  1.00 0.00 ? 24 ILE A HD13 12 
ATOM   7803  N N    . SER A 1 8  ? 15.359 15.844 -4.370  1.00 0.00 ? 25 SER A N    12 
ATOM   7804  C CA   . SER A 1 8  ? 15.967 17.164 -4.264  1.00 0.00 ? 25 SER A CA   12 
ATOM   7805  C C    . SER A 1 8  ? 14.927 18.265 -4.427  1.00 0.00 ? 25 SER A C    12 
ATOM   7806  O O    . SER A 1 8  ? 14.964 19.277 -3.727  1.00 0.00 ? 25 SER A O    12 
ATOM   7807  C CB   . SER A 1 8  ? 17.066 17.319 -5.296  1.00 0.00 ? 25 SER A CB   12 
ATOM   7808  O OG   . SER A 1 8  ? 18.106 16.399 -5.101  1.00 0.00 ? 25 SER A OG   12 
ATOM   7809  H H    . SER A 1 8  ? 15.342 15.382 -5.269  1.00 0.00 ? 25 SER A H    12 
ATOM   7810  H HA   . SER A 1 8  ? 16.520 17.312 -3.335  1.00 0.00 ? 25 SER A HA   12 
ATOM   7811  H HB2  . SER A 1 8  ? 16.638 17.164 -6.287  1.00 0.00 ? 25 SER A HB2  12 
ATOM   7812  H HB3  . SER A 1 8  ? 17.469 18.329 -5.230  1.00 0.00 ? 25 SER A HB3  12 
ATOM   7813  H HG   . SER A 1 8  ? 18.778 16.530 -5.774  1.00 0.00 ? 25 SER A HG   12 
ATOM   7814  N N    . ASP A 1 9  ? 13.999 18.062 -5.357  1.00 0.00 ? 26 ASP A N    12 
ATOM   7815  C CA   . ASP A 1 9  ? 12.964 19.051 -5.635  1.00 0.00 ? 26 ASP A CA   12 
ATOM   7816  C C    . ASP A 1 9  ? 11.807 18.434 -6.411  1.00 0.00 ? 26 ASP A C    12 
ATOM   7817  O O    . ASP A 1 9  ? 11.918 17.324 -6.930  1.00 0.00 ? 26 ASP A O    12 
ATOM   7818  C CB   . ASP A 1 9  ? 13.548 20.233 -6.413  1.00 0.00 ? 26 ASP A CB   12 
ATOM   7819  C CG   . ASP A 1 9  ? 12.759 21.529 -6.272  1.00 0.00 ? 26 ASP A CG   12 
ATOM   7820  O OD1  . ASP A 1 9  ? 11.762 21.523 -5.590  1.00 0.00 ? 26 ASP A OD1  12 
ATOM   7821  O OD2  . ASP A 1 9  ? 13.240 22.544 -6.715  1.00 0.00 ? 26 ASP A OD2  12 
ATOM   7822  H H    . ASP A 1 9  ? 14.011 17.201 -5.884  1.00 0.00 ? 26 ASP A H    12 
ATOM   7823  H HA   . ASP A 1 9  ? 12.547 19.422 -4.699  1.00 0.00 ? 26 ASP A HA   12 
ATOM   7824  H HB2  . ASP A 1 9  ? 14.599 20.422 -6.193  1.00 0.00 ? 26 ASP A HB2  12 
ATOM   7825  H HB3  . ASP A 1 9  ? 13.451 19.858 -7.432  1.00 0.00 ? 26 ASP A HB3  12 
ATOM   7826  N N    . ALA A 1 10 ? 10.697 19.160 -6.485  1.00 0.00 ? 27 ALA A N    12 
ATOM   7827  C CA   . ALA A 1 10 ? 9.550  18.727 -7.272  1.00 0.00 ? 27 ALA A CA   12 
ATOM   7828  C C    . ALA A 1 10 ? 9.880  18.705 -8.760  1.00 0.00 ? 27 ALA A C    12 
ATOM   7829  O O    . ALA A 1 10 ? 9.220  18.019 -9.541  1.00 0.00 ? 27 ALA A O    12 
ATOM   7830  C CB   . ALA A 1 10 ? 8.353  19.628 -7.005  1.00 0.00 ? 27 ALA A CB   12 
ATOM   7831  H H    . ALA A 1 10 ? 10.647 20.035 -5.982  1.00 0.00 ? 27 ALA A H    12 
ATOM   7832  H HA   . ALA A 1 10 ? 9.290  17.708 -6.982  1.00 0.00 ? 27 ALA A HA   12 
ATOM   7833  H HB1  . ALA A 1 10 ? 8.602  20.653 -7.276  1.00 0.00 ? 27 ALA A HB1  12 
ATOM   7834  H HB2  . ALA A 1 10 ? 7.504  19.292 -7.601  1.00 0.00 ? 27 ALA A HB2  12 
ATOM   7835  H HB3  . ALA A 1 10 ? 8.093  19.585 -5.948  1.00 0.00 ? 27 ALA A HB3  12 
ATOM   7836  N N    . ALA A 1 11 ? 10.904 19.458 -9.144  1.00 0.00 ? 28 ALA A N    12 
ATOM   7837  C CA   . ALA A 1 11 ? 11.386 19.451 -10.520 1.00 0.00 ? 28 ALA A CA   12 
ATOM   7838  C C    . ALA A 1 11 ? 11.911 18.076 -10.913 1.00 0.00 ? 28 ALA A C    12 
ATOM   7839  O O    . ALA A 1 11 ? 12.011 17.754 -12.097 1.00 0.00 ? 28 ALA A O    12 
ATOM   7840  C CB   . ALA A 1 11 ? 12.463 20.508 -10.710 1.00 0.00 ? 28 ALA A CB   12 
ATOM   7841  H H    . ALA A 1 11 ? 11.361 20.052 -8.467  1.00 0.00 ? 28 ALA A H    12 
ATOM   7842  H HA   . ALA A 1 11 ? 10.553 19.682 -11.184 1.00 0.00 ? 28 ALA A HA   12 
ATOM   7843  H HB1  . ALA A 1 11 ? 13.298 20.301 -10.042 1.00 0.00 ? 28 ALA A HB1  12 
ATOM   7844  H HB2  . ALA A 1 11 ? 12.813 20.490 -11.742 1.00 0.00 ? 28 ALA A HB2  12 
ATOM   7845  H HB3  . ALA A 1 11 ? 12.052 21.492 -10.484 1.00 0.00 ? 28 ALA A HB3  12 
ATOM   7846  N N    . GLN A 1 12 ? 12.247 17.269 -9.913  1.00 0.00 ? 29 GLN A N    12 
ATOM   7847  C CA   . GLN A 1 12 ? 12.793 15.939 -10.152 1.00 0.00 ? 29 GLN A CA   12 
ATOM   7848  C C    . GLN A 1 12 ? 11.685 14.902 -10.275 1.00 0.00 ? 29 GLN A C    12 
ATOM   7849  O O    . GLN A 1 12 ? 11.947 13.726 -10.525 1.00 0.00 ? 29 GLN A O    12 
ATOM   7850  C CB   . GLN A 1 12 ? 13.749 15.541 -9.024  1.00 0.00 ? 29 GLN A CB   12 
ATOM   7851  C CG   . GLN A 1 12 ? 14.909 16.502 -8.823  1.00 0.00 ? 29 GLN A CG   12 
ATOM   7852  C CD   . GLN A 1 12 ? 15.780 16.625 -10.059 1.00 0.00 ? 29 GLN A CD   12 
ATOM   7853  O OE1  . GLN A 1 12 ? 16.162 15.622 -10.669 1.00 0.00 ? 29 GLN A OE1  12 
ATOM   7854  N NE2  . GLN A 1 12 ? 16.100 17.857 -10.435 1.00 0.00 ? 29 GLN A NE2  12 
ATOM   7855  H H    . GLN A 1 12 ? 12.121 17.586 -8.962  1.00 0.00 ? 29 GLN A H    12 
ATOM   7856  H HA   . GLN A 1 12 ? 13.332 15.930 -11.099 1.00 0.00 ? 29 GLN A HA   12 
ATOM   7857  H HB2  . GLN A 1 12 ? 13.154 15.484 -8.113  1.00 0.00 ? 29 GLN A HB2  12 
ATOM   7858  H HB3  . GLN A 1 12 ? 14.131 14.550 -9.270  1.00 0.00 ? 29 GLN A HB3  12 
ATOM   7859  H HG2  . GLN A 1 12 ? 14.783 17.498 -8.402  1.00 0.00 ? 29 GLN A HG2  12 
ATOM   7860  H HG3  . GLN A 1 12 ? 15.423 15.866 -8.101  1.00 0.00 ? 29 GLN A HG3  12 
ATOM   7861  H HE21 . GLN A 1 12 ? 15.771 18.642 -9.911  1.00 0.00 ? 29 GLN A HE21 12 
ATOM   7862  H HE22 . GLN A 1 12 ? 16.673 18.001 -11.243 1.00 0.00 ? 29 GLN A HE22 12 
ATOM   7863  N N    . LEU A 1 13 ? 10.445 15.346 -10.099 1.00 0.00 ? 30 LEU A N    12 
ATOM   7864  C CA   . LEU A 1 13 ? 9.293  14.454 -10.176 1.00 0.00 ? 30 LEU A CA   12 
ATOM   7865  C C    . LEU A 1 13 ? 8.612  14.550 -11.534 1.00 0.00 ? 30 LEU A C    12 
ATOM   7866  O O    . LEU A 1 13 ? 8.621  15.605 -12.170 1.00 0.00 ? 30 LEU A O    12 
ATOM   7867  C CB   . LEU A 1 13 ? 8.297  14.776 -9.055  1.00 0.00 ? 30 LEU A CB   12 
ATOM   7868  C CG   . LEU A 1 13 ? 8.853  14.644 -7.630  1.00 0.00 ? 30 LEU A CG   12 
ATOM   7869  C CD1  . LEU A 1 13 ? 7.760  14.949 -6.614  1.00 0.00 ? 30 LEU A CD1  12 
ATOM   7870  C CD2  . LEU A 1 13 ? 9.403  13.241 -7.427  1.00 0.00 ? 30 LEU A CD2  12 
ATOM   7871  H H    . LEU A 1 13 ? 10.295 16.325 -9.906  1.00 0.00 ? 30 LEU A H    12 
ATOM   7872  H HA   . LEU A 1 13 ? 9.624  13.421 -10.069 1.00 0.00 ? 30 LEU A HA   12 
ATOM   7873  H HB2  . LEU A 1 13 ? 8.104  15.822 -9.285  1.00 0.00 ? 30 LEU A HB2  12 
ATOM   7874  H HB3  . LEU A 1 13 ? 7.375  14.205 -9.157  1.00 0.00 ? 30 LEU A HB3  12 
ATOM   7875  H HG   . LEU A 1 13 ? 9.684  15.344 -7.540  1.00 0.00 ? 30 LEU A HG   12 
ATOM   7876  H HD11 . LEU A 1 13 ? 8.165  14.854 -5.606  1.00 0.00 ? 30 LEU A HD11 12 
ATOM   7877  H HD12 . LEU A 1 13 ? 7.398  15.967 -6.763  1.00 0.00 ? 30 LEU A HD12 12 
ATOM   7878  H HD13 . LEU A 1 13 ? 6.938  14.248 -6.743  1.00 0.00 ? 30 LEU A HD13 12 
ATOM   7879  H HD21 . LEU A 1 13 ? 10.201 13.054 -8.145  1.00 0.00 ? 30 LEU A HD21 12 
ATOM   7880  H HD22 . LEU A 1 13 ? 9.798  13.149 -6.414  1.00 0.00 ? 30 LEU A HD22 12 
ATOM   7881  H HD23 . LEU A 1 13 ? 8.605  12.512 -7.573  1.00 0.00 ? 30 LEU A HD23 12 
ATOM   7882  N N    . PRO A 1 14 ? 8.021  13.445 -11.974 1.00 0.00 ? 31 PRO A N    12 
ATOM   7883  C CA   . PRO A 1 14 ? 7.155  13.454 -13.147 1.00 0.00 ? 31 PRO A CA   12 
ATOM   7884  C C    . PRO A 1 14 ? 6.053  14.497 -13.011 1.00 0.00 ? 31 PRO A C    12 
ATOM   7885  O O    . PRO A 1 14 ? 5.544  14.736 -11.917 1.00 0.00 ? 31 PRO A O    12 
ATOM   7886  C CB   . PRO A 1 14 ? 6.596  12.029 -13.210 1.00 0.00 ? 31 PRO A CB   12 
ATOM   7887  C CG   . PRO A 1 14 ? 7.569  11.213 -12.430 1.00 0.00 ? 31 PRO A CG   12 
ATOM   7888  C CD   . PRO A 1 14 ? 8.045  12.112 -11.321 1.00 0.00 ? 31 PRO A CD   12 
ATOM   7889  H HA   . PRO A 1 14 ? 7.690  13.725 -14.069 1.00 0.00 ? 31 PRO A HA   12 
ATOM   7890  H HB2  . PRO A 1 14 ? 5.588  11.973 -12.773 1.00 0.00 ? 31 PRO A HB2  12 
ATOM   7891  H HB3  . PRO A 1 14 ? 6.518  11.671 -14.248 1.00 0.00 ? 31 PRO A HB3  12 
ATOM   7892  H HG2  . PRO A 1 14 ? 7.095  10.305 -12.027 1.00 0.00 ? 31 PRO A HG2  12 
ATOM   7893  H HG3  . PRO A 1 14 ? 8.409  10.884 -13.062 1.00 0.00 ? 31 PRO A HG3  12 
ATOM   7894  H HD2  . PRO A 1 14 ? 7.385  12.076 -10.443 1.00 0.00 ? 31 PRO A HD2  12 
ATOM   7895  H HD3  . PRO A 1 14 ? 9.055  11.846 -10.975 1.00 0.00 ? 31 PRO A HD3  12 
ATOM   7896  N N    . HIS A 1 15 ? 5.689  15.115 -14.129 1.00 0.00 ? 32 HIS A N    12 
ATOM   7897  C CA   . HIS A 1 15 ? 4.834  16.295 -14.109 1.00 0.00 ? 32 HIS A CA   12 
ATOM   7898  C C    . HIS A 1 15 ? 3.467  15.975 -13.517 1.00 0.00 ? 32 HIS A C    12 
ATOM   7899  O O    . HIS A 1 15 ? 2.730  16.873 -13.111 1.00 0.00 ? 32 HIS A O    12 
ATOM   7900  C CB   . HIS A 1 15 ? 4.671  16.871 -15.519 1.00 0.00 ? 32 HIS A CB   12 
ATOM   7901  C CG   . HIS A 1 15 ? 5.911  17.519 -16.051 1.00 0.00 ? 32 HIS A CG   12 
ATOM   7902  N ND1  . HIS A 1 15 ? 5.988  18.046 -17.324 1.00 0.00 ? 32 HIS A ND1  12 
ATOM   7903  C CD2  . HIS A 1 15 ? 7.124  17.722 -15.486 1.00 0.00 ? 32 HIS A CD2  12 
ATOM   7904  C CE1  . HIS A 1 15 ? 7.195  18.548 -17.516 1.00 0.00 ? 32 HIS A CE1  12 
ATOM   7905  N NE2  . HIS A 1 15 ? 7.903  18.364 -16.418 1.00 0.00 ? 32 HIS A NE2  12 
ATOM   7906  H H    . HIS A 1 15 ? 6.014  14.758 -15.017 1.00 0.00 ? 32 HIS A H    12 
ATOM   7907  H HA   . HIS A 1 15 ? 5.277  17.057 -13.470 1.00 0.00 ? 32 HIS A HA   12 
ATOM   7908  H HB2  . HIS A 1 15 ? 4.407  16.078 -16.221 1.00 0.00 ? 32 HIS A HB2  12 
ATOM   7909  H HB3  . HIS A 1 15 ? 3.893  17.634 -15.526 1.00 0.00 ? 32 HIS A HB3  12 
ATOM   7910  H HD2  . HIS A 1 15 ? 7.534  17.479 -14.505 1.00 0.00 ? 32 HIS A HD2  12 
ATOM   7911  H HE1  . HIS A 1 15 ? 7.456  19.016 -18.466 1.00 0.00 ? 32 HIS A HE1  12 
ATOM   7912  H HE2  . HIS A 1 15 ? 8.862  18.646 -16.275 1.00 0.00 ? 32 HIS A HE2  12 
ATOM   7913  N N    . ASP A 1 16 ? 3.136  14.689 -13.469 1.00 0.00 ? 33 ASP A N    12 
ATOM   7914  C CA   . ASP A 1 16 ? 1.831  14.252 -12.987 1.00 0.00 ? 33 ASP A CA   12 
ATOM   7915  C C    . ASP A 1 16 ? 1.867  13.953 -11.494 1.00 0.00 ? 33 ASP A C    12 
ATOM   7916  O O    . ASP A 1 16 ? 0.959  13.319 -10.956 1.00 0.00 ? 33 ASP A O    12 
ATOM   7917  C CB   . ASP A 1 16 ? 1.361  13.017 -13.758 1.00 0.00 ? 33 ASP A CB   12 
ATOM   7918  C CG   . ASP A 1 16 ? 2.232  11.783 -13.563 1.00 0.00 ? 33 ASP A CG   12 
ATOM   7919  O OD1  . ASP A 1 16 ? 3.197  11.870 -12.841 1.00 0.00 ? 33 ASP A OD1  12 
ATOM   7920  O OD2  . ASP A 1 16 ? 1.841  10.728 -14.005 1.00 0.00 ? 33 ASP A OD2  12 
ATOM   7921  H H    . ASP A 1 16 ? 3.805  13.996 -13.774 1.00 0.00 ? 33 ASP A H    12 
ATOM   7922  H HA   . ASP A 1 16 ? 1.100  15.049 -13.127 1.00 0.00 ? 33 ASP A HA   12 
ATOM   7923  H HB2  . ASP A 1 16 ? 0.318  12.757 -13.572 1.00 0.00 ? 33 ASP A HB2  12 
ATOM   7924  H HB3  . ASP A 1 16 ? 1.468  13.377 -14.782 1.00 0.00 ? 33 ASP A HB3  12 
ATOM   7925  N N    . TYR A 1 17 ? 2.920  14.414 -10.829 1.00 0.00 ? 34 TYR A N    12 
ATOM   7926  C CA   . TYR A 1 17 ? 3.033  14.278 -9.382  1.00 0.00 ? 34 TYR A CA   12 
ATOM   7927  C C    . TYR A 1 17 ? 1.927  15.045 -8.668  1.00 0.00 ? 34 TYR A C    12 
ATOM   7928  O O    . TYR A 1 17 ? 1.325  15.956 -9.236  1.00 0.00 ? 34 TYR A O    12 
ATOM   7929  C CB   . TYR A 1 17 ? 4.403  14.765 -8.903  1.00 0.00 ? 34 TYR A CB   12 
ATOM   7930  C CG   . TYR A 1 17 ? 4.520  16.270 -8.811  1.00 0.00 ? 34 TYR A CG   12 
ATOM   7931  C CD1  . TYR A 1 17 ? 4.070  16.953 -7.692  1.00 0.00 ? 34 TYR A CD1  12 
ATOM   7932  C CD2  . TYR A 1 17 ? 5.085  17.003 -9.846  1.00 0.00 ? 34 TYR A CD2  12 
ATOM   7933  C CE1  . TYR A 1 17 ? 4.176  18.328 -7.604  1.00 0.00 ? 34 TYR A CE1  12 
ATOM   7934  C CE2  . TYR A 1 17 ? 5.196  18.377 -9.768  1.00 0.00 ? 34 TYR A CE2  12 
ATOM   7935  C CZ   . TYR A 1 17 ? 4.740  19.037 -8.645  1.00 0.00 ? 34 TYR A CZ   12 
ATOM   7936  O OH   . TYR A 1 17 ? 4.849  20.406 -8.562  1.00 0.00 ? 34 TYR A OH   12 
ATOM   7937  H H    . TYR A 1 17 ? 3.664  14.870 -11.339 1.00 0.00 ? 34 TYR A H    12 
ATOM   7938  H HA   . TYR A 1 17 ? 2.917  13.231 -9.098  1.00 0.00 ? 34 TYR A HA   12 
ATOM   7939  H HB2  . TYR A 1 17 ? 4.575  14.326 -7.919  1.00 0.00 ? 34 TYR A HB2  12 
ATOM   7940  H HB3  . TYR A 1 17 ? 5.143  14.383 -9.606  1.00 0.00 ? 34 TYR A HB3  12 
ATOM   7941  H HD1  . TYR A 1 17 ? 3.626  16.387 -6.873  1.00 0.00 ? 34 TYR A HD1  12 
ATOM   7942  H HD2  . TYR A 1 17 ? 5.442  16.476 -10.730 1.00 0.00 ? 34 TYR A HD2  12 
ATOM   7943  H HE1  . TYR A 1 17 ? 3.817  18.852 -6.717  1.00 0.00 ? 34 TYR A HE1  12 
ATOM   7944  H HE2  . TYR A 1 17 ? 5.640  18.935 -10.592 1.00 0.00 ? 34 TYR A HE2  12 
ATOM   7945  H HH   . TYR A 1 17 ? 5.255  20.797 -9.339  1.00 0.00 ? 34 TYR A HH   12 
ATOM   7946  N N    . CYS A 1 18 ? 1.664  14.672 -7.421  1.00 0.00 ? 35 CYS A N    12 
ATOM   7947  C CA   . CYS A 1 18 ? 0.616  15.311 -6.635  1.00 0.00 ? 35 CYS A CA   12 
ATOM   7948  C C    . CYS A 1 18 ? 1.159  15.824 -5.307  1.00 0.00 ? 35 CYS A C    12 
ATOM   7949  O O    . CYS A 1 18 ? 2.273  15.485 -4.908  1.00 0.00 ? 35 CYS A O    12 
ATOM   7950  C CB   . CYS A 1 18 ? -0.378 14.172 -6.406  1.00 0.00 ? 35 CYS A CB   12 
ATOM   7951  S SG   . CYS A 1 18 ? -1.048 13.447 -7.922  1.00 0.00 ? 35 CYS A SG   12 
ATOM   7952  H H    . CYS A 1 18 ? 2.204  13.925 -7.007  1.00 0.00 ? 35 CYS A H    12 
ATOM   7953  H HA   . CYS A 1 18 ? 0.107  16.116 -7.165  1.00 0.00 ? 35 CYS A HA   12 
ATOM   7954  H HB2  . CYS A 1 18 ? 0.103  13.354 -5.868  1.00 0.00 ? 35 CYS A HB2  12 
ATOM   7955  H HB3  . CYS A 1 18 ? -1.236 14.528 -5.837  1.00 0.00 ? 35 CYS A HB3  12 
ATOM   7956  H HG   . CYS A 1 18 ? -1.820 12.550 -7.316  1.00 0.00 ? 35 CYS A HG   12 
ATOM   7957  N N    . THR A 1 19 ? 0.364  16.643 -4.626  1.00 0.00 ? 36 THR A N    12 
ATOM   7958  C CA   . THR A 1 19 ? 0.759  17.195 -3.335  1.00 0.00 ? 36 THR A CA   12 
ATOM   7959  C C    . THR A 1 19 ? -0.456 17.448 -2.451  1.00 0.00 ? 36 THR A C    12 
ATOM   7960  O O    . THR A 1 19 ? -1.544 17.743 -2.943  1.00 0.00 ? 36 THR A O    12 
ATOM   7961  C CB   . THR A 1 19 ? 1.545  18.508 -3.499  1.00 0.00 ? 36 THR A CB   12 
ATOM   7962  O OG1  . THR A 1 19 ? 2.062  18.920 -2.226  1.00 0.00 ? 36 THR A OG1  12 
ATOM   7963  C CG2  . THR A 1 19 ? 0.647  19.602 -4.056  1.00 0.00 ? 36 THR A CG2  12 
ATOM   7964  H H    . THR A 1 19 ? -0.536 16.889 -5.012  1.00 0.00 ? 36 THR A H    12 
ATOM   7965  H HA   . THR A 1 19 ? 1.383  16.477 -2.803  1.00 0.00 ? 36 THR A HA   12 
ATOM   7966  H HB   . THR A 1 19 ? 2.378  18.339 -4.181  1.00 0.00 ? 36 THR A HB   12 
ATOM   7967  H HG1  . THR A 1 19 ? 2.552  19.740 -2.331  1.00 0.00 ? 36 THR A HG1  12 
ATOM   7968  H HG21 . THR A 1 19 ? -0.185 19.771 -3.374  1.00 0.00 ? 36 THR A HG21 12 
ATOM   7969  H HG22 . THR A 1 19 ? 1.221  20.522 -4.165  1.00 0.00 ? 36 THR A HG22 12 
ATOM   7970  H HG23 . THR A 1 19 ? 0.262  19.296 -5.028  1.00 0.00 ? 36 THR A HG23 12 
HETATM 7971  N N    . TPO A 1 20 ? -0.261 17.331 -1.141  1.00 0.00 ? 37 TPO A N    12 
HETATM 7972  C CA   . TPO A 1 20 ? -1.327 17.599 -0.182  1.00 0.00 ? 37 TPO A CA   12 
HETATM 7973  C CB   . TPO A 1 20 ? -1.246 16.654 1.031   1.00 0.00 ? 37 TPO A CB   12 
HETATM 7974  C CG2  . TPO A 1 20 ? -1.099 15.211 0.574   1.00 0.00 ? 37 TPO A CG2  12 
HETATM 7975  O OG1  . TPO A 1 20 ? -0.121 17.011 1.844   1.00 0.00 ? 37 TPO A OG1  12 
HETATM 7976  P P    . TPO A 1 20 ? -0.076 16.607 3.405   1.00 0.00 ? 37 TPO A P    12 
HETATM 7977  O O1P  . TPO A 1 20 ? 1.262  17.139 3.980   1.00 0.00 ? 37 TPO A O1P  12 
HETATM 7978  O O2P  . TPO A 1 20 ? -0.156 15.060 3.483   1.00 0.00 ? 37 TPO A O2P  12 
HETATM 7979  O O3P  . TPO A 1 20 ? -1.297 17.275 4.089   1.00 0.00 ? 37 TPO A O3P  12 
HETATM 7980  C C    . TPO A 1 20 ? -1.279 19.042 0.307   1.00 0.00 ? 37 TPO A C    12 
HETATM 7981  O O    . TPO A 1 20 ? -0.275 19.733 0.132   1.00 0.00 ? 37 TPO A O    12 
HETATM 7982  H H    . TPO A 1 20 ? 0.647  17.051 -0.801  1.00 0.00 ? 37 TPO A H    12 
HETATM 7983  H HA   . TPO A 1 20 ? -2.297 17.468 -0.663  1.00 0.00 ? 37 TPO A HA   12 
HETATM 7984  H HB   . TPO A 1 20 ? -2.157 16.756 1.621   1.00 0.00 ? 37 TPO A HB   12 
HETATM 7985  H HG21 . TPO A 1 20 ? -1.043 14.558 1.444   1.00 0.00 ? 37 TPO A HG21 12 
HETATM 7986  H HG22 . TPO A 1 20 ? -1.959 14.933 -0.036  1.00 0.00 ? 37 TPO A HG22 12 
HETATM 7987  H HG23 . TPO A 1 20 ? -0.188 15.108 -0.015  1.00 0.00 ? 37 TPO A HG23 12 
ATOM   7988  N N    . PRO A 1 21 ? -2.369 19.490 0.920   1.00 0.00 ? 38 PRO A N    12 
ATOM   7989  C CA   . PRO A 1 21 ? -2.478 20.870 1.378   1.00 0.00 ? 38 PRO A CA   12 
ATOM   7990  C C    . PRO A 1 21 ? -1.318 21.238 2.295   1.00 0.00 ? 38 PRO A C    12 
ATOM   7991  O O    . PRO A 1 21 ? -0.893 22.392 2.338   1.00 0.00 ? 38 PRO A O    12 
ATOM   7992  C CB   . PRO A 1 21 ? -3.825 20.917 2.106   1.00 0.00 ? 38 PRO A CB   12 
ATOM   7993  C CG   . PRO A 1 21 ? -4.642 19.861 1.443   1.00 0.00 ? 38 PRO A CG   12 
ATOM   7994  C CD   . PRO A 1 21 ? -3.674 18.756 1.114   1.00 0.00 ? 38 PRO A CD   12 
ATOM   7995  H HA   . PRO A 1 21 ? -2.430 21.596 0.554   1.00 0.00 ? 38 PRO A HA   12 
ATOM   7996  H HB2  . PRO A 1 21 ? -3.711 20.717 3.180   1.00 0.00 ? 38 PRO A HB2  12 
ATOM   7997  H HB3  . PRO A 1 21 ? -4.300 21.905 2.010   1.00 0.00 ? 38 PRO A HB3  12 
ATOM   7998  H HG2  . PRO A 1 21 ? -5.442 19.501 2.108   1.00 0.00 ? 38 PRO A HG2  12 
ATOM   7999  H HG3  . PRO A 1 21 ? -5.128 20.244 0.534   1.00 0.00 ? 38 PRO A HG3  12 
ATOM   8000  H HD2  . PRO A 1 21 ? -3.596 18.015 1.924   1.00 0.00 ? 38 PRO A HD2  12 
ATOM   8001  H HD3  . PRO A 1 21 ? -3.962 18.207 0.205   1.00 0.00 ? 38 PRO A HD3  12 
ATOM   8002  N N    . GLY A 1 22 ? -0.812 20.251 3.026   1.00 0.00 ? 39 GLY A N    12 
ATOM   8003  C CA   . GLY A 1 22 ? 0.317  20.464 3.924   1.00 0.00 ? 39 GLY A CA   12 
ATOM   8004  C C    . GLY A 1 22 ? 1.576  20.832 3.148   1.00 0.00 ? 39 GLY A C    12 
ATOM   8005  O O    . GLY A 1 22 ? 2.419  21.584 3.637   1.00 0.00 ? 39 GLY A O    12 
ATOM   8006  H H    . GLY A 1 22 ? -1.220 19.329 2.959   1.00 0.00 ? 39 GLY A H    12 
ATOM   8007  H HA2  . GLY A 1 22 ? 0.076  21.273 4.614   1.00 0.00 ? 39 GLY A HA2  12 
ATOM   8008  H HA3  . GLY A 1 22 ? 0.502  19.550 4.487   1.00 0.00 ? 39 GLY A HA3  12 
ATOM   8009  N N    . GLY A 1 23 ? 1.696  20.299 1.937   1.00 0.00 ? 40 GLY A N    12 
ATOM   8010  C CA   . GLY A 1 23 ? 2.816  20.625 1.064   1.00 0.00 ? 40 GLY A CA   12 
ATOM   8011  C C    . GLY A 1 23 ? 3.724  19.419 0.859   1.00 0.00 ? 40 GLY A C    12 
ATOM   8012  O O    . GLY A 1 23 ? 4.853  19.553 0.386   1.00 0.00 ? 40 GLY A O    12 
ATOM   8013  H H    . GLY A 1 23 ? 0.992  19.650 1.614   1.00 0.00 ? 40 GLY A H    12 
ATOM   8014  H HA2  . GLY A 1 23 ? 2.432  20.949 0.097   1.00 0.00 ? 40 GLY A HA2  12 
ATOM   8015  H HA3  . GLY A 1 23 ? 3.395  21.432 1.513   1.00 0.00 ? 40 GLY A HA3  12 
ATOM   8016  N N    . THR A 1 24 ? 3.225  18.241 1.217   1.00 0.00 ? 41 THR A N    12 
ATOM   8017  C CA   . THR A 1 24 ? 3.978  17.005 1.045   1.00 0.00 ? 41 THR A CA   12 
ATOM   8018  C C    . THR A 1 24 ? 3.745  16.406 -0.337  1.00 0.00 ? 41 THR A C    12 
ATOM   8019  O O    . THR A 1 24 ? 2.604  16.250 -0.771  1.00 0.00 ? 41 THR A O    12 
ATOM   8020  C CB   . THR A 1 24 ? 3.607  15.962 2.115   1.00 0.00 ? 41 THR A CB   12 
ATOM   8021  O OG1  . THR A 1 24 ? 3.947  16.463 3.413   1.00 0.00 ? 41 THR A OG1  12 
ATOM   8022  C CG2  . THR A 1 24 ? 4.348  14.656 1.868   1.00 0.00 ? 41 THR A CG2  12 
ATOM   8023  H H    . THR A 1 24 ? 2.300  18.201 1.621   1.00 0.00 ? 41 THR A H    12 
ATOM   8024  H HA   . THR A 1 24 ? 5.047  17.211 1.114   1.00 0.00 ? 41 THR A HA   12 
ATOM   8025  H HB   . THR A 1 24 ? 2.532  15.781 2.075   1.00 0.00 ? 41 THR A HB   12 
ATOM   8026  H HG1  . THR A 1 24 ? 3.284  17.098 3.695   1.00 0.00 ? 41 THR A HG1  12 
ATOM   8027  H HG21 . THR A 1 24 ? 5.422  14.836 1.908   1.00 0.00 ? 41 THR A HG21 12 
ATOM   8028  H HG22 . THR A 1 24 ? 4.071  13.932 2.634   1.00 0.00 ? 41 THR A HG22 12 
ATOM   8029  H HG23 . THR A 1 24 ? 4.082  14.268 0.886   1.00 0.00 ? 41 THR A HG23 12 
ATOM   8030  N N    . LEU A 1 25 ? 4.832  16.073 -1.023  1.00 0.00 ? 42 LEU A N    12 
ATOM   8031  C CA   . LEU A 1 25 ? 4.749  15.540 -2.378  1.00 0.00 ? 42 LEU A CA   12 
ATOM   8032  C C    . LEU A 1 25 ? 4.526  14.033 -2.364  1.00 0.00 ? 42 LEU A C    12 
ATOM   8033  O O    . LEU A 1 25 ? 5.016  13.331 -1.480  1.00 0.00 ? 42 LEU A O    12 
ATOM   8034  C CB   . LEU A 1 25 ? 6.023  15.884 -3.161  1.00 0.00 ? 42 LEU A CB   12 
ATOM   8035  C CG   . LEU A 1 25 ? 6.297  17.383 -3.335  1.00 0.00 ? 42 LEU A CG   12 
ATOM   8036  C CD1  . LEU A 1 25 ? 7.669  17.594 -3.960  1.00 0.00 ? 42 LEU A CD1  12 
ATOM   8037  C CD2  . LEU A 1 25 ? 5.210  18.002 -4.200  1.00 0.00 ? 42 LEU A CD2  12 
ATOM   8038  H H    . LEU A 1 25 ? 5.739  16.191 -0.596  1.00 0.00 ? 42 LEU A H    12 
ATOM   8039  H HA   . LEU A 1 25 ? 3.891  15.975 -2.890  1.00 0.00 ? 42 LEU A HA   12 
ATOM   8040  H HB2  . LEU A 1 25 ? 6.764  15.443 -2.496  1.00 0.00 ? 42 LEU A HB2  12 
ATOM   8041  H HB3  . LEU A 1 25 ? 6.052  15.377 -4.126  1.00 0.00 ? 42 LEU A HB3  12 
ATOM   8042  H HG   . LEU A 1 25 ? 6.237  17.840 -2.347  1.00 0.00 ? 42 LEU A HG   12 
ATOM   8043  H HD11 . LEU A 1 25 ? 7.856  18.662 -4.078  1.00 0.00 ? 42 LEU A HD11 12 
ATOM   8044  H HD12 . LEU A 1 25 ? 8.434  17.163 -3.312  1.00 0.00 ? 42 LEU A HD12 12 
ATOM   8045  H HD13 . LEU A 1 25 ? 7.703  17.109 -4.934  1.00 0.00 ? 42 LEU A HD13 12 
ATOM   8046  H HD21 . LEU A 1 25 ? 4.240  17.865 -3.721  1.00 0.00 ? 42 LEU A HD21 12 
ATOM   8047  H HD22 . LEU A 1 25 ? 5.406  19.068 -4.322  1.00 0.00 ? 42 LEU A HD22 12 
ATOM   8048  H HD23 . LEU A 1 25 ? 5.203  17.520 -5.177  1.00 0.00 ? 42 LEU A HD23 12 
ATOM   8049  N N    . PHE A 1 26 ? 3.784  13.541 -3.351  1.00 0.00 ? 43 PHE A N    12 
ATOM   8050  C CA   . PHE A 1 26 ? 3.580  12.107 -3.514  1.00 0.00 ? 43 PHE A CA   12 
ATOM   8051  C C    . PHE A 1 26 ? 3.141  11.772 -4.934  1.00 0.00 ? 43 PHE A C    12 
ATOM   8052  O O    . PHE A 1 26 ? 2.652  12.634 -5.663  1.00 0.00 ? 43 PHE A O    12 
ATOM   8053  C CB   . PHE A 1 26 ? 2.545  11.596 -2.509  1.00 0.00 ? 43 PHE A CB   12 
ATOM   8054  C CG   . PHE A 1 26 ? 1.150  12.083 -2.777  1.00 0.00 ? 43 PHE A CG   12 
ATOM   8055  C CD1  . PHE A 1 26 ? 0.727  13.316 -2.304  1.00 0.00 ? 43 PHE A CD1  12 
ATOM   8056  C CD2  . PHE A 1 26 ? 0.256  11.308 -3.502  1.00 0.00 ? 43 PHE A CD2  12 
ATOM   8057  C CE1  . PHE A 1 26 ? -0.557 13.764 -2.547  1.00 0.00 ? 43 PHE A CE1  12 
ATOM   8058  C CE2  . PHE A 1 26 ? -1.028 11.755 -3.747  1.00 0.00 ? 43 PHE A CE2  12 
ATOM   8059  C CZ   . PHE A 1 26 ? -1.435 12.982 -3.270  1.00 0.00 ? 43 PHE A CZ   12 
ATOM   8060  H H    . PHE A 1 26 ? 3.350  14.178 -4.003  1.00 0.00 ? 43 PHE A H    12 
ATOM   8061  H HA   . PHE A 1 26 ? 4.519  11.578 -3.346  1.00 0.00 ? 43 PHE A HA   12 
ATOM   8062  H HB2  . PHE A 1 26 ? 2.506  10.508 -2.532  1.00 0.00 ? 43 PHE A HB2  12 
ATOM   8063  H HB3  . PHE A 1 26 ? 2.804  11.929 -1.504  1.00 0.00 ? 43 PHE A HB3  12 
ATOM   8064  H HD1  . PHE A 1 26 ? 1.420  13.934 -1.733  1.00 0.00 ? 43 PHE A HD1  12 
ATOM   8065  H HD2  . PHE A 1 26 ? 0.577  10.337 -3.878  1.00 0.00 ? 43 PHE A HD2  12 
ATOM   8066  H HE1  . PHE A 1 26 ? -0.877 14.735 -2.170  1.00 0.00 ? 43 PHE A HE1  12 
ATOM   8067  H HE2  . PHE A 1 26 ? -1.720 11.136 -4.319  1.00 0.00 ? 43 PHE A HE2  12 
ATOM   8068  H HZ   . PHE A 1 26 ? -2.446 13.336 -3.465  1.00 0.00 ? 43 PHE A HZ   12 
ATOM   8069  N N    . SER A 1 27 ? 3.319  10.513 -5.320  1.00 0.00 ? 44 SER A N    12 
ATOM   8070  C CA   . SER A 1 27 ? 2.797  10.020 -6.590  1.00 0.00 ? 44 SER A CA   12 
ATOM   8071  C C    . SER A 1 27 ? 2.443  8.541  -6.504  1.00 0.00 ? 44 SER A C    12 
ATOM   8072  O O    . SER A 1 27 ? 3.247  7.726  -6.052  1.00 0.00 ? 44 SER A O    12 
ATOM   8073  C CB   . SER A 1 27 ? 3.807  10.258 -7.696  1.00 0.00 ? 44 SER A CB   12 
ATOM   8074  O OG   . SER A 1 27 ? 3.343  9.806  -8.939  1.00 0.00 ? 44 SER A OG   12 
ATOM   8075  H H    . SER A 1 27 ? 3.828  9.881  -4.720  1.00 0.00 ? 44 SER A H    12 
ATOM   8076  H HA   . SER A 1 27 ? 1.939  10.587 -6.954  1.00 0.00 ? 44 SER A HA   12 
ATOM   8077  H HB2  . SER A 1 27 ? 4.007  11.328 -7.761  1.00 0.00 ? 44 SER A HB2  12 
ATOM   8078  H HB3  . SER A 1 27 ? 4.728  9.732  -7.448  1.00 0.00 ? 44 SER A HB3  12 
ATOM   8079  H HG   . SER A 1 27 ? 4.009  9.975  -9.609  1.00 0.00 ? 44 SER A HG   12 
ATOM   8080  N N    . THR A 1 28 ? 1.235  8.201  -6.940  1.00 0.00 ? 45 THR A N    12 
ATOM   8081  C CA   . THR A 1 28 ? 0.776  6.817  -6.921  1.00 0.00 ? 45 THR A CA   12 
ATOM   8082  C C    . THR A 1 28 ? 0.911  6.173  -8.294  1.00 0.00 ? 45 THR A C    12 
ATOM   8083  O O    . THR A 1 28 ? 0.392  6.685  -9.285  1.00 0.00 ? 45 THR A O    12 
ATOM   8084  C CB   . THR A 1 28 ? -0.690 6.715  -6.459  1.00 0.00 ? 45 THR A CB   12 
ATOM   8085  O OG1  . THR A 1 28 ? -0.816 7.253  -5.136  1.00 0.00 ? 45 THR A OG1  12 
ATOM   8086  C CG2  . THR A 1 28 ? -1.149 5.265  -6.459  1.00 0.00 ? 45 THR A CG2  12 
ATOM   8087  H H    . THR A 1 28 ? 0.620  8.919  -7.294  1.00 0.00 ? 45 THR A H    12 
ATOM   8088  H HA   . THR A 1 28 ? 1.397  6.232  -6.242  1.00 0.00 ? 45 THR A HA   12 
ATOM   8089  H HB   . THR A 1 28 ? -1.316 7.294  -7.139  1.00 0.00 ? 45 THR A HB   12 
ATOM   8090  H HG1  . THR A 1 28 ? -0.548 8.175  -5.140  1.00 0.00 ? 45 THR A HG1  12 
ATOM   8091  H HG21 . THR A 1 28 ? -0.524 4.687  -5.780  1.00 0.00 ? 45 THR A HG21 12 
ATOM   8092  H HG22 . THR A 1 28 ? -2.187 5.214  -6.131  1.00 0.00 ? 45 THR A HG22 12 
ATOM   8093  H HG23 . THR A 1 28 ? -1.065 4.858  -7.466  1.00 0.00 ? 45 THR A HG23 12 
HETATM 8094  N N    . TPO A 1 29 ? 1.613  5.046  -8.347  1.00 0.00 ? 46 TPO A N    12 
HETATM 8095  C CA   . TPO A 1 29 ? 1.856  4.352  -9.606  1.00 0.00 ? 46 TPO A CA   12 
HETATM 8096  C CB   . TPO A 1 29 ? 3.159  3.531  -9.557  1.00 0.00 ? 46 TPO A CB   12 
HETATM 8097  C CG2  . TPO A 1 29 ? 4.316  4.396  -9.081  1.00 0.00 ? 46 TPO A CG2  12 
HETATM 8098  O OG1  . TPO A 1 29 ? 2.995  2.424  -8.662  1.00 0.00 ? 46 TPO A OG1  12 
HETATM 8099  P P    . TPO A 1 29 ? 3.937  1.121  -8.790  1.00 0.00 ? 46 TPO A P    12 
HETATM 8100  O O1P  . TPO A 1 29 ? 3.500  0.126  -7.684  1.00 0.00 ? 46 TPO A O1P  12 
HETATM 8101  O O2P  . TPO A 1 29 ? 5.402  1.590  -8.587  1.00 0.00 ? 46 TPO A O2P  12 
HETATM 8102  O O3P  . TPO A 1 29 ? 3.719  0.531  -10.207 1.00 0.00 ? 46 TPO A O3P  12 
HETATM 8103  C C    . TPO A 1 29 ? 0.698  3.427  -9.957  1.00 0.00 ? 46 TPO A C    12 
HETATM 8104  O O    . TPO A 1 29 ? -0.134 3.109  -9.109  1.00 0.00 ? 46 TPO A O    12 
HETATM 8105  H H    . TPO A 1 29 ? 1.987  4.659  -7.492  1.00 0.00 ? 46 TPO A H    12 
HETATM 8106  H HA   . TPO A 1 29 ? 1.929  5.076  -10.417 1.00 0.00 ? 46 TPO A HA   12 
HETATM 8107  H HB   . TPO A 1 29 ? 3.375  3.153  -10.555 1.00 0.00 ? 46 TPO A HB   12 
HETATM 8108  H HG21 . TPO A 1 29 ? 5.227  3.799  -9.054  1.00 0.00 ? 46 TPO A HG21 12 
HETATM 8109  H HG22 . TPO A 1 29 ? 4.449  5.234  -9.766  1.00 0.00 ? 46 TPO A HG22 12 
HETATM 8110  H HG23 . TPO A 1 29 ? 4.099  4.774  -8.083  1.00 0.00 ? 46 TPO A HG23 12 
ATOM   8111  N N    . PRO A 1 30 ? 0.650  2.998  -11.215 1.00 0.00 ? 47 PRO A N    12 
ATOM   8112  C CA   . PRO A 1 30 ? -0.439 2.158  -11.697 1.00 0.00 ? 47 PRO A CA   12 
ATOM   8113  C C    . PRO A 1 30 ? -0.568 0.891  -10.861 1.00 0.00 ? 47 PRO A C    12 
ATOM   8114  O O    . PRO A 1 30 ? -1.655 0.326  -10.735 1.00 0.00 ? 47 PRO A O    12 
ATOM   8115  C CB   . PRO A 1 30 ? -0.062 1.855  -13.150 1.00 0.00 ? 47 PRO A CB   12 
ATOM   8116  C CG   . PRO A 1 30 ? 0.778  3.014  -13.566 1.00 0.00 ? 47 PRO A CG   12 
ATOM   8117  C CD   . PRO A 1 30 ? 1.566  3.394  -12.341 1.00 0.00 ? 47 PRO A CD   12 
ATOM   8118  H HA   . PRO A 1 30 ? -1.421 2.648  -11.621 1.00 0.00 ? 47 PRO A HA   12 
ATOM   8119  H HB2  . PRO A 1 30 ? 0.494  0.909  -13.234 1.00 0.00 ? 47 PRO A HB2  12 
ATOM   8120  H HB3  . PRO A 1 30 ? -0.955 1.761  -13.787 1.00 0.00 ? 47 PRO A HB3  12 
ATOM   8121  H HG2  . PRO A 1 30 ? 1.445  2.743  -14.397 1.00 0.00 ? 47 PRO A HG2  12 
ATOM   8122  H HG3  . PRO A 1 30 ? 0.155  3.852  -13.913 1.00 0.00 ? 47 PRO A HG3  12 
ATOM   8123  H HD2  . PRO A 1 30 ? 2.525  2.861  -12.281 1.00 0.00 ? 47 PRO A HD2  12 
ATOM   8124  H HD3  . PRO A 1 30 ? 1.795  4.471  -12.312 1.00 0.00 ? 47 PRO A HD3  12 
ATOM   8125  N N    . GLY A 1 31 ? 0.548  0.447  -10.292 1.00 0.00 ? 48 GLY A N    12 
ATOM   8126  C CA   . GLY A 1 31 ? 0.562  -0.756 -9.468  1.00 0.00 ? 48 GLY A CA   12 
ATOM   8127  C C    . GLY A 1 31 ? -0.271 -0.567 -8.207  1.00 0.00 ? 48 GLY A C    12 
ATOM   8128  O O    . GLY A 1 31 ? -0.789 -1.532 -7.643  1.00 0.00 ? 48 GLY A O    12 
ATOM   8129  H H    . GLY A 1 31 ? 1.409  0.955  -10.435 1.00 0.00 ? 48 GLY A H    12 
ATOM   8130  H HA2  . GLY A 1 31 ? 0.153  -1.586 -10.043 1.00 0.00 ? 48 GLY A HA2  12 
ATOM   8131  H HA3  . GLY A 1 31 ? 1.589  -0.981 -9.184  1.00 0.00 ? 48 GLY A HA3  12 
ATOM   8132  N N    . GLY A 1 32 ? -0.397 0.680  -7.768  1.00 0.00 ? 49 GLY A N    12 
ATOM   8133  C CA   . GLY A 1 32 ? -1.232 1.007  -6.617  1.00 0.00 ? 49 GLY A CA   12 
ATOM   8134  C C    . GLY A 1 32 ? -0.384 1.413  -5.418  1.00 0.00 ? 49 GLY A C    12 
ATOM   8135  O O    . GLY A 1 32 ? -0.890 1.543  -4.304  1.00 0.00 ? 49 GLY A O    12 
ATOM   8136  H H    . GLY A 1 32 ? 0.097  1.422  -8.243  1.00 0.00 ? 49 GLY A H    12 
ATOM   8137  H HA2  . GLY A 1 32 ? -1.893 1.833  -6.880  1.00 0.00 ? 49 GLY A HA2  12 
ATOM   8138  H HA3  . GLY A 1 32 ? -1.829 0.136  -6.351  1.00 0.00 ? 49 GLY A HA3  12 
ATOM   8139  N N    . THR A 1 33 ? 0.908  1.610  -5.655  1.00 0.00 ? 50 THR A N    12 
ATOM   8140  C CA   . THR A 1 33 ? 1.828  2.009  -4.596  1.00 0.00 ? 50 THR A CA   12 
ATOM   8141  C C    . THR A 1 33 ? 1.951  3.526  -4.516  1.00 0.00 ? 50 THR A C    12 
ATOM   8142  O O    . THR A 1 33 ? 2.332  4.178  -5.488  1.00 0.00 ? 50 THR A O    12 
ATOM   8143  C CB   . THR A 1 33 ? 3.228  1.401  -4.804  1.00 0.00 ? 50 THR A CB   12 
ATOM   8144  O OG1  . THR A 1 33 ? 3.132  -0.029 -4.825  1.00 0.00 ? 50 THR A OG1  12 
ATOM   8145  C CG2  . THR A 1 33 ? 4.165  1.827  -3.685  1.00 0.00 ? 50 THR A CG2  12 
ATOM   8146  H H    . THR A 1 33 ? 1.264  1.479  -6.591  1.00 0.00 ? 50 THR A H    12 
ATOM   8147  H HA   . THR A 1 33 ? 1.445  1.680  -3.631  1.00 0.00 ? 50 THR A HA   12 
ATOM   8148  H HB   . THR A 1 33 ? 3.625  1.743  -5.759  1.00 0.00 ? 50 THR A HB   12 
ATOM   8149  H HG1  . THR A 1 33 ? 3.214  -0.341 -5.729  1.00 0.00 ? 50 THR A HG1  12 
ATOM   8150  H HG21 . THR A 1 33 ? 3.771  1.483  -2.730  1.00 0.00 ? 50 THR A HG21 12 
ATOM   8151  H HG22 . THR A 1 33 ? 5.149  1.388  -3.849  1.00 0.00 ? 50 THR A HG22 12 
ATOM   8152  H HG23 . THR A 1 33 ? 4.249  2.913  -3.674  1.00 0.00 ? 50 THR A HG23 12 
ATOM   8153  N N    . ARG A 1 34 ? 1.628  4.080  -3.353  1.00 0.00 ? 51 ARG A N    12 
ATOM   8154  C CA   . ARG A 1 34 ? 1.749  5.515  -3.129  1.00 0.00 ? 51 ARG A CA   12 
ATOM   8155  C C    . ARG A 1 34 ? 3.162  5.889  -2.701  1.00 0.00 ? 51 ARG A C    12 
ATOM   8156  O O    . ARG A 1 34 ? 3.559  5.649  -1.561  1.00 0.00 ? 51 ARG A O    12 
ATOM   8157  C CB   . ARG A 1 34 ? 0.713  6.031  -2.141  1.00 0.00 ? 51 ARG A CB   12 
ATOM   8158  C CG   . ARG A 1 34 ? 0.789  7.522  -1.854  1.00 0.00 ? 51 ARG A CG   12 
ATOM   8159  C CD   . ARG A 1 34 ? -0.276 8.028  -0.951  1.00 0.00 ? 51 ARG A CD   12 
ATOM   8160  N NE   . ARG A 1 34 ? -0.148 9.432  -0.596  1.00 0.00 ? 51 ARG A NE   12 
ATOM   8161  C CZ   . ARG A 1 34 ? -0.978 10.089 0.239   1.00 0.00 ? 51 ARG A CZ   12 
ATOM   8162  N NH1  . ARG A 1 34 ? -2.015 9.486  0.775   1.00 0.00 ? 51 ARG A NH1  12 
ATOM   8163  N NH2  . ARG A 1 34 ? -0.735 11.365 0.485   1.00 0.00 ? 51 ARG A NH2  12 
ATOM   8164  H H    . ARG A 1 34 ? 1.288  3.492  -2.605  1.00 0.00 ? 51 ARG A H    12 
ATOM   8165  H HA   . ARG A 1 34 ? 1.554  6.052  -4.058  1.00 0.00 ? 51 ARG A HA   12 
ATOM   8166  H HB2  . ARG A 1 34 ? -0.266 5.794  -2.554  1.00 0.00 ? 51 ARG A HB2  12 
ATOM   8167  H HB3  . ARG A 1 34 ? 0.858  5.481  -1.211  1.00 0.00 ? 51 ARG A HB3  12 
ATOM   8168  H HG2  . ARG A 1 34 ? 1.753  7.739  -1.391  1.00 0.00 ? 51 ARG A HG2  12 
ATOM   8169  H HG3  . ARG A 1 34 ? 0.712  8.061  -2.800  1.00 0.00 ? 51 ARG A HG3  12 
ATOM   8170  H HD2  . ARG A 1 34 ? -1.243 7.901  -1.437  1.00 0.00 ? 51 ARG A HD2  12 
ATOM   8171  H HD3  . ARG A 1 34 ? -0.257 7.454  -0.025  1.00 0.00 ? 51 ARG A HD3  12 
ATOM   8172  H HE   . ARG A 1 34 ? 0.538  10.113 -0.893  1.00 0.00 ? 51 ARG A HE   12 
ATOM   8173  H HH11 . ARG A 1 34 ? -2.197 8.515  0.563   1.00 0.00 ? 51 ARG A HH11 12 
ATOM   8174  H HH12 . ARG A 1 34 ? -2.626 9.995  1.398   1.00 0.00 ? 51 ARG A HH12 12 
ATOM   8175  H HH21 . ARG A 1 34 ? 0.057  11.818 0.050   1.00 0.00 ? 51 ARG A HH21 12 
ATOM   8176  H HH22 . ARG A 1 34 ? -1.341 11.880 1.106   1.00 0.00 ? 51 ARG A HH22 12 
ATOM   8177  N N    . ILE A 1 35 ? 3.918  6.476  -3.622  1.00 0.00 ? 52 ILE A N    12 
ATOM   8178  C CA   . ILE A 1 35 ? 5.280  6.909  -3.333  1.00 0.00 ? 52 ILE A CA   12 
ATOM   8179  C C    . ILE A 1 35 ? 5.297  8.300  -2.713  1.00 0.00 ? 52 ILE A C    12 
ATOM   8180  O O    . ILE A 1 35 ? 5.095  9.300  -3.402  1.00 0.00 ? 52 ILE A O    12 
ATOM   8181  C CB   . ILE A 1 35 ? 6.153  6.913  -4.601  1.00 0.00 ? 52 ILE A CB   12 
ATOM   8182  C CG1  . ILE A 1 35 ? 6.180  5.518  -5.235  1.00 0.00 ? 52 ILE A CG1  12 
ATOM   8183  C CG2  . ILE A 1 35 ? 7.562  7.381  -4.276  1.00 0.00 ? 52 ILE A CG2  12 
ATOM   8184  C CD1  . ILE A 1 35 ? 6.846  5.476  -6.591  1.00 0.00 ? 52 ILE A CD1  12 
ATOM   8185  H H    . ILE A 1 35 ? 3.539  6.628  -4.545  1.00 0.00 ? 52 ILE A H    12 
ATOM   8186  H HA   . ILE A 1 35 ? 5.736  6.266  -2.582  1.00 0.00 ? 52 ILE A HA   12 
ATOM   8187  H HB   . ILE A 1 35 ? 5.708  7.582  -5.337  1.00 0.00 ? 52 ILE A HB   12 
ATOM   8188  H HG12 . ILE A 1 35 ? 6.713  4.861  -4.548  1.00 0.00 ? 52 ILE A HG12 12 
ATOM   8189  H HG13 . ILE A 1 35 ? 5.147  5.184  -5.327  1.00 0.00 ? 52 ILE A HG13 12 
ATOM   8190  H HG21 . ILE A 1 35 ? 8.166  7.377  -5.184  1.00 0.00 ? 52 ILE A HG21 12 
ATOM   8191  H HG22 . ILE A 1 35 ? 7.526  8.391  -3.870  1.00 0.00 ? 52 ILE A HG22 12 
ATOM   8192  H HG23 . ILE A 1 35 ? 8.008  6.711  -3.542  1.00 0.00 ? 52 ILE A HG23 12 
ATOM   8193  H HD11 . ILE A 1 35 ? 7.879  5.809  -6.500  1.00 0.00 ? 52 ILE A HD11 12 
ATOM   8194  H HD12 . ILE A 1 35 ? 6.828  4.456  -6.975  1.00 0.00 ? 52 ILE A HD12 12 
ATOM   8195  H HD13 . ILE A 1 35 ? 6.313  6.133  -7.280  1.00 0.00 ? 52 ILE A HD13 12 
ATOM   8196  N N    . ILE A 1 36 ? 5.537  8.358  -1.408  1.00 0.00 ? 53 ILE A N    12 
ATOM   8197  C CA   . ILE A 1 36 ? 5.599  9.628  -0.695  1.00 0.00 ? 53 ILE A CA   12 
ATOM   8198  C C    . ILE A 1 36 ? 7.009  10.203 -0.713  1.00 0.00 ? 53 ILE A C    12 
ATOM   8199  O O    . ILE A 1 36 ? 7.966  9.537  -0.320  1.00 0.00 ? 53 ILE A O    12 
ATOM   8200  C CB   . ILE A 1 36 ? 5.133  9.479  0.765   1.00 0.00 ? 53 ILE A CB   12 
ATOM   8201  C CG1  . ILE A 1 36 ? 3.682  8.997  0.817   1.00 0.00 ? 53 ILE A CG1  12 
ATOM   8202  C CG2  . ILE A 1 36 ? 5.286  10.798 1.509   1.00 0.00 ? 53 ILE A CG2  12 
ATOM   8203  C CD1  . ILE A 1 36 ? 3.223  8.588  2.198   1.00 0.00 ? 53 ILE A CD1  12 
ATOM   8204  H H    . ILE A 1 36 ? 5.682  7.499  -0.896  1.00 0.00 ? 53 ILE A H    12 
ATOM   8205  H HA   . ILE A 1 36 ? 4.987  10.379 -1.195  1.00 0.00 ? 53 ILE A HA   12 
ATOM   8206  H HB   . ILE A 1 36 ? 5.736  8.715  1.254   1.00 0.00 ? 53 ILE A HB   12 
ATOM   8207  H HG12 . ILE A 1 36 ? 3.056  9.810  0.453   1.00 0.00 ? 53 ILE A HG12 12 
ATOM   8208  H HG13 . ILE A 1 36 ? 3.599  8.146  0.141   1.00 0.00 ? 53 ILE A HG13 12 
ATOM   8209  H HG21 . ILE A 1 36 ? 4.953  10.675 2.539   1.00 0.00 ? 53 ILE A HG21 12 
ATOM   8210  H HG22 . ILE A 1 36 ? 6.332  11.101 1.500   1.00 0.00 ? 53 ILE A HG22 12 
ATOM   8211  H HG23 . ILE A 1 36 ? 4.682  11.563 1.021   1.00 0.00 ? 53 ILE A HG23 12 
ATOM   8212  H HD11 . ILE A 1 36 ? 3.304  9.438  2.875   1.00 0.00 ? 53 ILE A HD11 12 
ATOM   8213  H HD12 . ILE A 1 36 ? 2.185  8.257  2.155   1.00 0.00 ? 53 ILE A HD12 12 
ATOM   8214  H HD13 . ILE A 1 36 ? 3.848  7.772  2.564   1.00 0.00 ? 53 ILE A HD13 12 
ATOM   8215  N N    . TYR A 1 37 ? 7.130  11.444 -1.174  1.00 0.00 ? 54 TYR A N    12 
ATOM   8216  C CA   . TYR A 1 37 ? 8.435  12.032 -1.454  1.00 0.00 ? 54 TYR A CA   12 
ATOM   8217  C C    . TYR A 1 37 ? 8.869  12.967 -0.334  1.00 0.00 ? 54 TYR A C    12 
ATOM   8218  O O    . TYR A 1 37 ? 8.125  13.863 0.064   1.00 0.00 ? 54 TYR A O    12 
ATOM   8219  C CB   . TYR A 1 37 ? 8.406  12.786 -2.786  1.00 0.00 ? 54 TYR A CB   12 
ATOM   8220  C CG   . TYR A 1 37 ? 8.187  11.897 -3.989  1.00 0.00 ? 54 TYR A CG   12 
ATOM   8221  C CD1  . TYR A 1 37 ? 9.198  11.073 -4.458  1.00 0.00 ? 54 TYR A CD1  12 
ATOM   8222  C CD2  . TYR A 1 37 ? 6.969  11.887 -4.655  1.00 0.00 ? 54 TYR A CD2  12 
ATOM   8223  C CE1  . TYR A 1 37 ? 9.004  10.258 -5.557  1.00 0.00 ? 54 TYR A CE1  12 
ATOM   8224  C CE2  . TYR A 1 37 ? 6.763  11.076 -5.755  1.00 0.00 ? 54 TYR A CE2  12 
ATOM   8225  C CZ   . TYR A 1 37 ? 7.784  10.262 -6.203  1.00 0.00 ? 54 TYR A CZ   12 
ATOM   8226  O OH   . TYR A 1 37 ? 7.585  9.454  -7.298  1.00 0.00 ? 54 TYR A OH   12 
ATOM   8227  H H    . TYR A 1 37 ? 6.298  11.993 -1.334  1.00 0.00 ? 54 TYR A H    12 
ATOM   8228  H HA   . TYR A 1 37 ? 9.189  11.247 -1.515  1.00 0.00 ? 54 TYR A HA   12 
ATOM   8229  H HB2  . TYR A 1 37 ? 7.601  13.520 -2.724  1.00 0.00 ? 54 TYR A HB2  12 
ATOM   8230  H HB3  . TYR A 1 37 ? 9.361  13.302 -2.884  1.00 0.00 ? 54 TYR A HB3  12 
ATOM   8231  H HD1  . TYR A 1 37 ? 10.159 11.073 -3.943  1.00 0.00 ? 54 TYR A HD1  12 
ATOM   8232  H HD2  . TYR A 1 37 ? 6.167  12.531 -4.295  1.00 0.00 ? 54 TYR A HD2  12 
ATOM   8233  H HE1  . TYR A 1 37 ? 9.811  9.615  -5.909  1.00 0.00 ? 54 TYR A HE1  12 
ATOM   8234  H HE2  . TYR A 1 37 ? 5.802  11.077 -6.267  1.00 0.00 ? 54 TYR A HE2  12 
ATOM   8235  H HH   . TYR A 1 37 ? 8.358  8.932  -7.524  1.00 0.00 ? 54 TYR A HH   12 
ATOM   8236  N N    . ASP A 1 38 ? 10.079 12.753 0.174   1.00 0.00 ? 55 ASP A N    12 
ATOM   8237  C CA   . ASP A 1 38 ? 10.679 13.668 1.136   1.00 0.00 ? 55 ASP A CA   12 
ATOM   8238  C C    . ASP A 1 38 ? 11.600 14.668 0.448   1.00 0.00 ? 55 ASP A C    12 
ATOM   8239  O O    . ASP A 1 38 ? 12.710 14.325 0.040   1.00 0.00 ? 55 ASP A O    12 
ATOM   8240  C CB   . ASP A 1 38 ? 11.453 12.890 2.205   1.00 0.00 ? 55 ASP A CB   12 
ATOM   8241  C CG   . ASP A 1 38 ? 12.080 13.761 3.286   1.00 0.00 ? 55 ASP A CG   12 
ATOM   8242  O OD1  . ASP A 1 38 ? 12.016 14.961 3.165   1.00 0.00 ? 55 ASP A OD1  12 
ATOM   8243  O OD2  . ASP A 1 38 ? 12.476 13.227 4.294   1.00 0.00 ? 55 ASP A OD2  12 
ATOM   8244  H H    . ASP A 1 38 ? 10.596 11.935 -0.117  1.00 0.00 ? 55 ASP A H    12 
ATOM   8245  H HA   . ASP A 1 38 ? 9.899  14.251 1.628   1.00 0.00 ? 55 ASP A HA   12 
ATOM   8246  H HB2  . ASP A 1 38 ? 10.870 12.096 2.671   1.00 0.00 ? 55 ASP A HB2  12 
ATOM   8247  H HB3  . ASP A 1 38 ? 12.240 12.452 1.591   1.00 0.00 ? 55 ASP A HB3  12 
ATOM   8248  N N    . ARG A 1 39 ? 11.132 15.904 0.322   1.00 0.00 ? 56 ARG A N    12 
ATOM   8249  C CA   . ARG A 1 39 ? 11.858 16.926 -0.423  1.00 0.00 ? 56 ARG A CA   12 
ATOM   8250  C C    . ARG A 1 39 ? 12.982 17.524 0.414   1.00 0.00 ? 56 ARG A C    12 
ATOM   8251  O O    . ARG A 1 39 ? 12.774 17.904 1.566   1.00 0.00 ? 56 ARG A O    12 
ATOM   8252  C CB   . ARG A 1 39 ? 10.934 18.005 -0.969  1.00 0.00 ? 56 ARG A CB   12 
ATOM   8253  C CG   . ARG A 1 39 ? 11.478 18.768 -2.165  1.00 0.00 ? 56 ARG A CG   12 
ATOM   8254  C CD   . ARG A 1 39 ? 10.546 19.783 -2.721  1.00 0.00 ? 56 ARG A CD   12 
ATOM   8255  N NE   . ARG A 1 39 ? 10.445 21.002 -1.935  1.00 0.00 ? 56 ARG A NE   12 
ATOM   8256  C CZ   . ARG A 1 39 ? 9.627  22.032 -2.223  1.00 0.00 ? 56 ARG A CZ   12 
ATOM   8257  N NH1  . ARG A 1 39 ? 8.865  22.013 -3.295  1.00 0.00 ? 56 ARG A NH1  12 
ATOM   8258  N NH2  . ARG A 1 39 ? 9.627  23.076 -1.413  1.00 0.00 ? 56 ARG A NH2  12 
ATOM   8259  H H    . ARG A 1 39 ? 10.250 16.143 0.753   1.00 0.00 ? 56 ARG A H    12 
ATOM   8260  H HA   . ARG A 1 39 ? 12.328 16.479 -1.300  1.00 0.00 ? 56 ARG A HA   12 
ATOM   8261  H HB2  . ARG A 1 39 ? 10.002 17.515 -1.248  1.00 0.00 ? 56 ARG A HB2  12 
ATOM   8262  H HB3  . ARG A 1 39 ? 10.747 18.704 -0.153  1.00 0.00 ? 56 ARG A HB3  12 
ATOM   8263  H HG2  . ARG A 1 39 ? 12.392 19.281 -1.864  1.00 0.00 ? 56 ARG A HG2  12 
ATOM   8264  H HG3  . ARG A 1 39 ? 11.707 18.053 -2.956  1.00 0.00 ? 56 ARG A HG3  12 
ATOM   8265  H HD2  . ARG A 1 39 ? 10.881 20.064 -3.718  1.00 0.00 ? 56 ARG A HD2  12 
ATOM   8266  H HD3  . ARG A 1 39 ? 9.548  19.350 -2.781  1.00 0.00 ? 56 ARG A HD3  12 
ATOM   8267  H HE   . ARG A 1 39 ? 10.939 21.270 -1.093  1.00 0.00 ? 56 ARG A HE   12 
ATOM   8268  H HH11 . ARG A 1 39 ? 8.889  21.215 -3.915  1.00 0.00 ? 56 ARG A HH11 12 
ATOM   8269  H HH12 . ARG A 1 39 ? 8.258  22.795 -3.493  1.00 0.00 ? 56 ARG A HH12 12 
ATOM   8270  H HH21 . ARG A 1 39 ? 10.232 23.083 -0.603  1.00 0.00 ? 56 ARG A HH21 12 
ATOM   8271  H HH22 . ARG A 1 39 ? 9.023  23.862 -1.606  1.00 0.00 ? 56 ARG A HH22 12 
ATOM   8272  N N    . LYS A 1 40 ? 14.171 17.605 -0.172  1.00 0.00 ? 57 LYS A N    12 
ATOM   8273  C CA   . LYS A 1 40 ? 15.299 18.267 0.472   1.00 0.00 ? 57 LYS A CA   12 
ATOM   8274  C C    . LYS A 1 40 ? 14.902 19.639 1.002   1.00 0.00 ? 57 LYS A C    12 
ATOM   8275  O O    . LYS A 1 40 ? 15.325 20.042 2.086   1.00 0.00 ? 57 LYS A O    12 
ATOM   8276  C CB   . LYS A 1 40 ? 16.470 18.399 -0.503  1.00 0.00 ? 57 LYS A CB   12 
ATOM   8277  C CG   . LYS A 1 40 ? 17.694 19.098 0.075   1.00 0.00 ? 57 LYS A CG   12 
ATOM   8278  C CD   . LYS A 1 40 ? 18.837 19.133 -0.928  1.00 0.00 ? 57 LYS A CD   12 
ATOM   8279  C CE   . LYS A 1 40 ? 20.040 19.879 -0.372  1.00 0.00 ? 57 LYS A CE   12 
ATOM   8280  N NZ   . LYS A 1 40 ? 21.176 19.898 -1.333  1.00 0.00 ? 57 LYS A NZ   12 
ATOM   8281  H H    . LYS A 1 40 ? 14.297 17.197 -1.087  1.00 0.00 ? 57 LYS A H    12 
ATOM   8282  H HA   . LYS A 1 40 ? 15.627 17.684 1.333   1.00 0.00 ? 57 LYS A HA   12 
ATOM   8283  H HB2  . LYS A 1 40 ? 16.743 17.390 -0.812  1.00 0.00 ? 57 LYS A HB2  12 
ATOM   8284  H HB3  . LYS A 1 40 ? 16.108 18.957 -1.365  1.00 0.00 ? 57 LYS A HB3  12 
ATOM   8285  H HG2  . LYS A 1 40 ? 17.414 20.119 0.343   1.00 0.00 ? 57 LYS A HG2  12 
ATOM   8286  H HG3  . LYS A 1 40 ? 18.010 18.562 0.969   1.00 0.00 ? 57 LYS A HG3  12 
ATOM   8287  H HD2  . LYS A 1 40 ? 19.123 18.107 -1.164  1.00 0.00 ? 57 LYS A HD2  12 
ATOM   8288  H HD3  . LYS A 1 40 ? 18.490 19.629 -1.835  1.00 0.00 ? 57 LYS A HD3  12 
ATOM   8289  H HE2  . LYS A 1 40 ? 19.736 20.901 -0.149  1.00 0.00 ? 57 LYS A HE2  12 
ATOM   8290  H HE3  . LYS A 1 40 ? 20.352 19.385 0.549   1.00 0.00 ? 57 LYS A HE3  12 
ATOM   8291  H HZ1  . LYS A 1 40 ? 20.887 20.357 -2.186  1.00 0.00 ? 57 LYS A HZ1  12 
ATOM   8292  H HZ2  . LYS A 1 40 ? 21.952 20.401 -0.927  1.00 0.00 ? 57 LYS A HZ2  12 
ATOM   8293  H HZ3  . LYS A 1 40 ? 21.460 18.951 -1.539  1.00 0.00 ? 57 LYS A HZ3  12 
ATOM   8294  N N    . PHE A 1 41 ? 14.088 20.353 0.232   1.00 0.00 ? 58 PHE A N    12 
ATOM   8295  C CA   . PHE A 1 41 ? 13.659 21.695 0.608   1.00 0.00 ? 58 PHE A CA   12 
ATOM   8296  C C    . PHE A 1 41 ? 12.188 21.711 1.005   1.00 0.00 ? 58 PHE A C    12 
ATOM   8297  O O    . PHE A 1 41 ? 11.485 22.696 0.778   1.00 0.00 ? 58 PHE A O    12 
ATOM   8298  C CB   . PHE A 1 41 ? 13.905 22.676 -0.538  1.00 0.00 ? 58 PHE A CB   12 
ATOM   8299  C CG   . PHE A 1 41 ? 15.338 22.736 -0.987  1.00 0.00 ? 58 PHE A CG   12 
ATOM   8300  C CD1  . PHE A 1 41 ? 16.293 23.388 -0.222  1.00 0.00 ? 58 PHE A CD1  12 
ATOM   8301  C CD2  . PHE A 1 41 ? 15.734 22.138 -2.175  1.00 0.00 ? 58 PHE A CD2  12 
ATOM   8302  C CE1  . PHE A 1 41 ? 17.611 23.445 -0.634  1.00 0.00 ? 58 PHE A CE1  12 
ATOM   8303  C CE2  . PHE A 1 41 ? 17.051 22.192 -2.588  1.00 0.00 ? 58 PHE A CE2  12 
ATOM   8304  C CZ   . PHE A 1 41 ? 17.989 22.846 -1.819  1.00 0.00 ? 58 PHE A CZ   12 
ATOM   8305  H H    . PHE A 1 41 ? 13.759 19.956 -0.636  1.00 0.00 ? 58 PHE A H    12 
ATOM   8306  H HA   . PHE A 1 41 ? 14.219 22.031 1.482   1.00 0.00 ? 58 PHE A HA   12 
ATOM   8307  H HB2  . PHE A 1 41 ? 13.318 22.391 -1.410  1.00 0.00 ? 58 PHE A HB2  12 
ATOM   8308  H HB3  . PHE A 1 41 ? 13.633 23.685 -0.232  1.00 0.00 ? 58 PHE A HB3  12 
ATOM   8309  H HD1  . PHE A 1 41 ? 15.994 23.861 0.713   1.00 0.00 ? 58 PHE A HD1  12 
ATOM   8310  H HD2  . PHE A 1 41 ? 14.991 21.622 -2.784  1.00 0.00 ? 58 PHE A HD2  12 
ATOM   8311  H HE1  . PHE A 1 41 ? 18.352 23.962 -0.025  1.00 0.00 ? 58 PHE A HE1  12 
ATOM   8312  H HE2  . PHE A 1 41 ? 17.348 21.718 -3.524  1.00 0.00 ? 58 PHE A HE2  12 
ATOM   8313  H HZ   . PHE A 1 41 ? 19.028 22.888 -2.144  1.00 0.00 ? 58 PHE A HZ   12 
ATOM   8314  N N    . LEU A 1 42 ? 11.728 20.615 1.598   1.00 0.00 ? 59 LEU A N    12 
ATOM   8315  C CA   . LEU A 1 42 ? 10.333 20.490 2.002   1.00 0.00 ? 59 LEU A CA   12 
ATOM   8316  C C    . LEU A 1 42 ? 9.943  21.590 2.981   1.00 0.00 ? 59 LEU A C    12 
ATOM   8317  O O    . LEU A 1 42 ? 10.546 21.731 4.045   1.00 0.00 ? 59 LEU A O    12 
ATOM   8318  C CB   . LEU A 1 42 ? 10.082 19.110 2.623   1.00 0.00 ? 59 LEU A CB   12 
ATOM   8319  C CG   . LEU A 1 42 ? 8.618  18.803 2.961   1.00 0.00 ? 59 LEU A CG   12 
ATOM   8320  C CD1  . LEU A 1 42 ? 7.779  18.789 1.689   1.00 0.00 ? 59 LEU A CD1  12 
ATOM   8321  C CD2  . LEU A 1 42 ? 8.531  17.464 3.678   1.00 0.00 ? 59 LEU A CD2  12 
ATOM   8322  H H    . LEU A 1 42 ? 12.361 19.847 1.773   1.00 0.00 ? 59 LEU A H    12 
ATOM   8323  H HA   . LEU A 1 42 ? 9.689  20.608 1.132   1.00 0.00 ? 59 LEU A HA   12 
ATOM   8324  H HB2  . LEU A 1 42 ? 10.414 18.482 1.798   1.00 0.00 ? 59 LEU A HB2  12 
ATOM   8325  H HB3  . LEU A 1 42 ? 10.717 18.937 3.491   1.00 0.00 ? 59 LEU A HB3  12 
ATOM   8326  H HG   . LEU A 1 42 ? 8.275  19.574 3.652   1.00 0.00 ? 59 LEU A HG   12 
ATOM   8327  H HD11 . LEU A 1 42 ? 6.741  18.571 1.939   1.00 0.00 ? 59 LEU A HD11 12 
ATOM   8328  H HD12 . LEU A 1 42 ? 7.838  19.765 1.205   1.00 0.00 ? 59 LEU A HD12 12 
ATOM   8329  H HD13 . LEU A 1 42 ? 8.158  18.024 1.012   1.00 0.00 ? 59 LEU A HD13 12 
ATOM   8330  H HD21 . LEU A 1 42 ? 9.114  17.505 4.598   1.00 0.00 ? 59 LEU A HD21 12 
ATOM   8331  H HD22 . LEU A 1 42 ? 7.489  17.247 3.919   1.00 0.00 ? 59 LEU A HD22 12 
ATOM   8332  H HD23 . LEU A 1 42 ? 8.926  16.679 3.032   1.00 0.00 ? 59 LEU A HD23 12 
ATOM   8333  N N    . LEU A 1 43 ? 8.930  22.368 2.616   1.00 0.00 ? 60 LEU A N    12 
ATOM   8334  C CA   . LEU A 1 43 ? 8.455  23.457 3.462   1.00 0.00 ? 60 LEU A CA   12 
ATOM   8335  C C    . LEU A 1 43 ? 7.456  22.954 4.496   1.00 0.00 ? 60 LEU A C    12 
ATOM   8336  O O    . LEU A 1 43 ? 7.135  23.655 5.456   1.00 0.00 ? 60 LEU A O    12 
ATOM   8337  C CB   . LEU A 1 43 ? 7.827  24.561 2.603   1.00 0.00 ? 60 LEU A CB   12 
ATOM   8338  C CG   . LEU A 1 43 ? 8.782  25.245 1.619   1.00 0.00 ? 60 LEU A CG   12 
ATOM   8339  C CD1  . LEU A 1 43 ? 8.021  26.256 0.769   1.00 0.00 ? 60 LEU A CD1  12 
ATOM   8340  C CD2  . LEU A 1 43 ? 9.905  25.925 2.387   1.00 0.00 ? 60 LEU A CD2  12 
ATOM   8341  H H    . LEU A 1 43 ? 8.476  22.202 1.728   1.00 0.00 ? 60 LEU A H    12 
ATOM   8342  H HA   . LEU A 1 43 ? 9.292  23.876 4.020   1.00 0.00 ? 60 LEU A HA   12 
ATOM   8343  H HB2  . LEU A 1 43 ? 7.092  23.967 2.061   1.00 0.00 ? 60 LEU A HB2  12 
ATOM   8344  H HB3  . LEU A 1 43 ? 7.313  25.304 3.213   1.00 0.00 ? 60 LEU A HB3  12 
ATOM   8345  H HG   . LEU A 1 43 ? 9.226  24.464 1.001   1.00 0.00 ? 60 LEU A HG   12 
ATOM   8346  H HD11 . LEU A 1 43 ? 8.708  26.736 0.072   1.00 0.00 ? 60 LEU A HD11 12 
ATOM   8347  H HD12 . LEU A 1 43 ? 7.238  25.744 0.210   1.00 0.00 ? 60 LEU A HD12 12 
ATOM   8348  H HD13 . LEU A 1 43 ? 7.575  27.010 1.416   1.00 0.00 ? 60 LEU A HD13 12 
ATOM   8349  H HD21 . LEU A 1 43 ? 10.454 25.181 2.966   1.00 0.00 ? 60 LEU A HD21 12 
ATOM   8350  H HD22 . LEU A 1 43 ? 10.585 26.410 1.686   1.00 0.00 ? 60 LEU A HD22 12 
ATOM   8351  H HD23 . LEU A 1 43 ? 9.486  26.671 3.062   1.00 0.00 ? 60 LEU A HD23 12 
ATOM   8352  N N    . ASP A 1 44 ? 6.964  21.737 4.293   1.00 0.00 ? 61 ASP A N    12 
ATOM   8353  C CA   . ASP A 1 44 ? 6.044  21.115 5.239   1.00 0.00 ? 61 ASP A CA   12 
ATOM   8354  C C    . ASP A 1 44 ? 6.790  20.543 6.437   1.00 0.00 ? 61 ASP A C    12 
ATOM   8355  O O    . ASP A 1 44 ? 7.414  19.485 6.345   1.00 0.00 ? 61 ASP A O    12 
ATOM   8356  C CB   . ASP A 1 44 ? 5.231  20.016 4.551   1.00 0.00 ? 61 ASP A CB   12 
ATOM   8357  C CG   . ASP A 1 44 ? 4.206  19.337 5.449   1.00 0.00 ? 61 ASP A CG   12 
ATOM   8358  O OD1  . ASP A 1 44 ? 4.202  19.609 6.626   1.00 0.00 ? 61 ASP A OD1  12 
ATOM   8359  O OD2  . ASP A 1 44 ? 3.337  18.675 4.932   1.00 0.00 ? 61 ASP A OD2  12 
ATOM   8360  H H    . ASP A 1 44 ? 7.235  21.228 3.463   1.00 0.00 ? 61 ASP A H    12 
ATOM   8361  H HA   . ASP A 1 44 ? 5.355  21.864 5.631   1.00 0.00 ? 61 ASP A HA   12 
ATOM   8362  H HB2  . ASP A 1 44 ? 4.746  20.344 3.631   1.00 0.00 ? 61 ASP A HB2  12 
ATOM   8363  H HB3  . ASP A 1 44 ? 6.027  19.310 4.312   1.00 0.00 ? 61 ASP A HB3  12 
ATOM   8364  N N    . ARG A 1 45 ? 6.721  21.247 7.562   1.00 0.00 ? 62 ARG A N    12 
ATOM   8365  C CA   . ARG A 1 45 ? 7.387  20.808 8.782   1.00 0.00 ? 62 ARG A CA   12 
ATOM   8366  C C    . ARG A 1 45 ? 6.708  19.576 9.367   1.00 0.00 ? 62 ARG A C    12 
ATOM   8367  O O    . ARG A 1 45 ? 6.938  18.491 8.910   1.00 0.00 ? 62 ARG A O    12 
ATOM   8368  C CB   . ARG A 1 45 ? 7.496  21.924 9.811   1.00 0.00 ? 62 ARG A CB   12 
ATOM   8369  C CG   . ARG A 1 45 ? 8.273  21.564 11.066  1.00 0.00 ? 62 ARG A CG   12 
ATOM   8370  C CD   . ARG A 1 45 ? 8.414  22.677 12.039  1.00 0.00 ? 62 ARG A CD   12 
ATOM   8371  N NE   . ARG A 1 45 ? 9.182  22.344 13.228  1.00 0.00 ? 62 ARG A NE   12 
ATOM   8372  C CZ   . ARG A 1 45 ? 9.443  23.201 14.235  1.00 0.00 ? 62 ARG A CZ   12 
ATOM   8373  N NH1  . ARG A 1 45 ? 9.033  24.449 14.186  1.00 0.00 ? 62 ARG A NH1  12 
ATOM   8374  N NH2  . ARG A 1 45 ? 10.144 22.759 15.265  1.00 0.00 ? 62 ARG A NH2  12 
ATOM   8375  O OXT  . ARG A 1 45 ? 5.945  19.691 10.286  1.00 0.00 ? 62 ARG A OXT  12 
ATOM   8376  H H    . ARG A 1 45 ? 6.195  22.108 7.571   1.00 0.00 ? 62 ARG A H    12 
ATOM   8377  H HA   . ARG A 1 45 ? 8.414  20.519 8.560   1.00 0.00 ? 62 ARG A HA   12 
ATOM   8378  H HB2  . ARG A 1 45 ? 7.981  22.765 9.316   1.00 0.00 ? 62 ARG A HB2  12 
ATOM   8379  H HB3  . ARG A 1 45 ? 6.479  22.202 10.086  1.00 0.00 ? 62 ARG A HB3  12 
ATOM   8380  H HG2  . ARG A 1 45 ? 7.761  20.742 11.568  1.00 0.00 ? 62 ARG A HG2  12 
ATOM   8381  H HG3  . ARG A 1 45 ? 9.274  21.244 10.775  1.00 0.00 ? 62 ARG A HG3  12 
ATOM   8382  H HD2  . ARG A 1 45 ? 8.913  23.514 11.552  1.00 0.00 ? 62 ARG A HD2  12 
ATOM   8383  H HD3  . ARG A 1 45 ? 7.422  22.989 12.367  1.00 0.00 ? 62 ARG A HD3  12 
ATOM   8384  H HE   . ARG A 1 45 ? 9.622  21.472 13.488  1.00 0.00 ? 62 ARG A HE   12 
ATOM   8385  H HH11 . ARG A 1 45 ? 8.514  24.777 13.383  1.00 0.00 ? 62 ARG A HH11 12 
ATOM   8386  H HH12 . ARG A 1 45 ? 9.240  25.076 14.950  1.00 0.00 ? 62 ARG A HH12 12 
ATOM   8387  H HH21 . ARG A 1 45 ? 10.466 21.801 15.280  1.00 0.00 ? 62 ARG A HH21 12 
ATOM   8388  H HH22 . ARG A 1 45 ? 10.354 23.380 16.033  1.00 0.00 ? 62 ARG A HH22 12 
ATOM   8389  N N    . PRO A 1 1  ? -0.242 -0.105 -1.053  1.00 0.00 ? 18 PRO A N    13 
ATOM   8390  C CA   . PRO A 1 1  ? 1.057  -0.016 -0.397  1.00 0.00 ? 18 PRO A CA   13 
ATOM   8391  C C    . PRO A 1 1  ? 1.599  1.407  -0.441  1.00 0.00 ? 18 PRO A C    13 
ATOM   8392  O O    . PRO A 1 1  ? 1.244  2.190  -1.323  1.00 0.00 ? 18 PRO A O    13 
ATOM   8393  C CB   . PRO A 1 1  ? 1.939  -0.994 -1.179  1.00 0.00 ? 18 PRO A CB   13 
ATOM   8394  C CG   . PRO A 1 1  ? 1.364  -0.995 -2.554  1.00 0.00 ? 18 PRO A CG   13 
ATOM   8395  C CD   . PRO A 1 1  ? -0.120 -0.835 -2.366  1.00 0.00 ? 18 PRO A CD   13 
ATOM   8396  H H2   . PRO A 1 1  ? -0.364 -0.709 -1.841  1.00 0.00 ? 18 PRO A H2   13 
ATOM   8397  H H3   . PRO A 1 1  ? -1.043 -0.409 -0.538  1.00 0.00 ? 18 PRO A H3   13 
ATOM   8398  H HA   . PRO A 1 1  ? 1.012  -0.269 0.672   1.00 0.00 ? 18 PRO A HA   13 
ATOM   8399  H HB2  . PRO A 1 1  ? 2.990  -0.670 -1.187  1.00 0.00 ? 18 PRO A HB2  13 
ATOM   8400  H HB3  . PRO A 1 1  ? 1.915  -2.000 -0.737  1.00 0.00 ? 18 PRO A HB3  13 
ATOM   8401  H HG2  . PRO A 1 1  ? 1.777  -0.173 -3.158  1.00 0.00 ? 18 PRO A HG2  13 
ATOM   8402  H HG3  . PRO A 1 1  ? 1.598  -1.932 -3.083  1.00 0.00 ? 18 PRO A HG3  13 
ATOM   8403  H HD2  . PRO A 1 1  ? -0.583 -0.256 -3.179  1.00 0.00 ? 18 PRO A HD2  13 
ATOM   8404  H HD3  . PRO A 1 1  ? -0.641 -1.803 -2.326  1.00 0.00 ? 18 PRO A HD3  13 
ATOM   8405  N N    . THR A 1 2  ? 2.461  1.736  0.515   1.00 0.00 ? 19 THR A N    13 
ATOM   8406  C CA   . THR A 1 2  ? 3.033  3.074  0.603   1.00 0.00 ? 19 THR A CA   13 
ATOM   8407  C C    . THR A 1 2  ? 4.552  3.016  0.712   1.00 0.00 ? 19 THR A C    13 
ATOM   8408  O O    . THR A 1 2  ? 5.103  2.168  1.412   1.00 0.00 ? 19 THR A O    13 
ATOM   8409  C CB   . THR A 1 2  ? 2.472  3.851  1.808   1.00 0.00 ? 19 THR A CB   13 
ATOM   8410  O OG1  . THR A 1 2  ? 1.046  3.945  1.697   1.00 0.00 ? 19 THR A OG1  13 
ATOM   8411  C CG2  . THR A 1 2  ? 3.065  5.251  1.863   1.00 0.00 ? 19 THR A CG2  13 
ATOM   8412  H H    . THR A 1 2  ? 2.726  1.042  1.199   1.00 0.00 ? 19 THR A H    13 
ATOM   8413  H HA   . THR A 1 2  ? 2.811  3.631  -0.307  1.00 0.00 ? 19 THR A HA   13 
ATOM   8414  H HB   . THR A 1 2  ? 2.723  3.315  2.723   1.00 0.00 ? 19 THR A HB   13 
ATOM   8415  H HG1  . THR A 1 2  ? 0.698  4.429  2.451   1.00 0.00 ? 19 THR A HG1  13 
ATOM   8416  H HG21 . THR A 1 2  ? 2.815  5.787  0.949   1.00 0.00 ? 19 THR A HG21 13 
ATOM   8417  H HG22 . THR A 1 2  ? 2.657  5.784  2.722   1.00 0.00 ? 19 THR A HG22 13 
ATOM   8418  H HG23 . THR A 1 2  ? 4.149  5.182  1.959   1.00 0.00 ? 19 THR A HG23 13 
ATOM   8419  N N    . ARG A 1 3  ? 5.225  3.927  0.014   1.00 0.00 ? 20 ARG A N    13 
ATOM   8420  C CA   . ARG A 1 3  ? 6.681  3.975  0.023   1.00 0.00 ? 20 ARG A CA   13 
ATOM   8421  C C    . ARG A 1 3  ? 7.183  5.385  0.311   1.00 0.00 ? 20 ARG A C    13 
ATOM   8422  O O    . ARG A 1 3  ? 6.443  6.359  0.170   1.00 0.00 ? 20 ARG A O    13 
ATOM   8423  C CB   . ARG A 1 3  ? 7.284  3.421  -1.260  1.00 0.00 ? 20 ARG A CB   13 
ATOM   8424  C CG   . ARG A 1 3  ? 6.943  1.968  -1.550  1.00 0.00 ? 20 ARG A CG   13 
ATOM   8425  C CD   . ARG A 1 3  ? 7.578  0.994  -0.625  1.00 0.00 ? 20 ARG A CD   13 
ATOM   8426  N NE   . ARG A 1 3  ? 7.299  -0.399 -0.932  1.00 0.00 ? 20 ARG A NE   13 
ATOM   8427  C CZ   . ARG A 1 3  ? 6.248  -1.093 -0.454  1.00 0.00 ? 20 ARG A CZ   13 
ATOM   8428  N NH1  . ARG A 1 3  ? 5.397  -0.542 0.382   1.00 0.00 ? 20 ARG A NH1  13 
ATOM   8429  N NH2  . ARG A 1 3  ? 6.109  -2.352 -0.829  1.00 0.00 ? 20 ARG A NH2  13 
ATOM   8430  H H    . ARG A 1 3  ? 4.713  4.601  -0.537  1.00 0.00 ? 20 ARG A H    13 
ATOM   8431  H HA   . ARG A 1 3  ? 7.067  3.340  0.821   1.00 0.00 ? 20 ARG A HA   13 
ATOM   8432  H HB2  . ARG A 1 3  ? 6.922  4.045  -2.076  1.00 0.00 ? 20 ARG A HB2  13 
ATOM   8433  H HB3  . ARG A 1 3  ? 8.364  3.526  -1.174  1.00 0.00 ? 20 ARG A HB3  13 
ATOM   8434  H HG2  . ARG A 1 3  ? 5.862  1.844  -1.478  1.00 0.00 ? 20 ARG A HG2  13 
ATOM   8435  H HG3  . ARG A 1 3  ? 7.269  1.732  -2.563  1.00 0.00 ? 20 ARG A HG3  13 
ATOM   8436  H HD2  . ARG A 1 3  ? 8.659  1.126  -0.659  1.00 0.00 ? 20 ARG A HD2  13 
ATOM   8437  H HD3  . ARG A 1 3  ? 7.222  1.183  0.388   1.00 0.00 ? 20 ARG A HD3  13 
ATOM   8438  H HE   . ARG A 1 3  ? 7.811  -1.045 -1.520  1.00 0.00 ? 20 ARG A HE   13 
ATOM   8439  H HH11 . ARG A 1 3  ? 5.527  0.417  0.673   1.00 0.00 ? 20 ARG A HH11 13 
ATOM   8440  H HH12 . ARG A 1 3  ? 4.615  -1.078 0.730   1.00 0.00 ? 20 ARG A HH12 13 
ATOM   8441  H HH21 . ARG A 1 3  ? 6.782  -2.767 -1.459  1.00 0.00 ? 20 ARG A HH21 13 
ATOM   8442  H HH22 . ARG A 1 3  ? 5.330  -2.895 -0.485  1.00 0.00 ? 20 ARG A HH22 13 
ATOM   8443  N N    . THR A 1 4  ? 8.445  5.487  0.715   1.00 0.00 ? 21 THR A N    13 
ATOM   8444  C CA   . THR A 1 4  ? 9.052  6.780  1.010   1.00 0.00 ? 21 THR A CA   13 
ATOM   8445  C C    . THR A 1 4  ? 10.338 6.979  0.218   1.00 0.00 ? 21 THR A C    13 
ATOM   8446  O O    . THR A 1 4  ? 11.257 6.165  0.295   1.00 0.00 ? 21 THR A O    13 
ATOM   8447  C CB   . THR A 1 4  ? 9.358  6.930  2.512   1.00 0.00 ? 21 THR A CB   13 
ATOM   8448  O OG1  . THR A 1 4  ? 8.145  6.801  3.264   1.00 0.00 ? 21 THR A OG1  13 
ATOM   8449  C CG2  . THR A 1 4  ? 9.985  8.287  2.796   1.00 0.00 ? 21 THR A CG2  13 
ATOM   8450  H H    . THR A 1 4  ? 8.998  4.649  0.819   1.00 0.00 ? 21 THR A H    13 
ATOM   8451  H HA   . THR A 1 4  ? 8.377  7.582  0.710   1.00 0.00 ? 21 THR A HA   13 
ATOM   8452  H HB   . THR A 1 4  ? 10.048 6.142  2.814   1.00 0.00 ? 21 THR A HB   13 
ATOM   8453  H HG1  . THR A 1 4  ? 8.338  6.895  4.201   1.00 0.00 ? 21 THR A HG1  13 
ATOM   8454  H HG21 . THR A 1 4  ? 9.296  9.074  2.495   1.00 0.00 ? 21 THR A HG21 13 
ATOM   8455  H HG22 . THR A 1 4  ? 10.194 8.373  3.862   1.00 0.00 ? 21 THR A HG22 13 
ATOM   8456  H HG23 . THR A 1 4  ? 10.914 8.382  2.234   1.00 0.00 ? 21 THR A HG23 13 
ATOM   8457  N N    . VAL A 1 5  ? 10.396 8.066  -0.543  1.00 0.00 ? 22 VAL A N    13 
ATOM   8458  C CA   . VAL A 1 5  ? 11.569 8.375  -1.351  1.00 0.00 ? 22 VAL A CA   13 
ATOM   8459  C C    . VAL A 1 5  ? 12.032 9.809  -1.126  1.00 0.00 ? 22 VAL A C    13 
ATOM   8460  O O    . VAL A 1 5  ? 11.236 10.746 -1.193  1.00 0.00 ? 22 VAL A O    13 
ATOM   8461  C CB   . VAL A 1 5  ? 11.293 8.165  -2.851  1.00 0.00 ? 22 VAL A CB   13 
ATOM   8462  C CG1  . VAL A 1 5  ? 12.505 8.570  -3.678  1.00 0.00 ? 22 VAL A CG1  13 
ATOM   8463  C CG2  . VAL A 1 5  ? 10.923 6.715  -3.128  1.00 0.00 ? 22 VAL A CG2  13 
ATOM   8464  H H    . VAL A 1 5  ? 9.606  8.696  -0.561  1.00 0.00 ? 22 VAL A H    13 
ATOM   8465  H HA   . VAL A 1 5  ? 12.421 7.758  -1.064  1.00 0.00 ? 22 VAL A HA   13 
ATOM   8466  H HB   . VAL A 1 5  ? 10.435 8.771  -3.142  1.00 0.00 ? 22 VAL A HB   13 
ATOM   8467  H HG11 . VAL A 1 5  ? 12.292 8.416  -4.736  1.00 0.00 ? 22 VAL A HG11 13 
ATOM   8468  H HG12 . VAL A 1 5  ? 12.728 9.623  -3.503  1.00 0.00 ? 22 VAL A HG12 13 
ATOM   8469  H HG13 . VAL A 1 5  ? 13.362 7.964  -3.388  1.00 0.00 ? 22 VAL A HG13 13 
ATOM   8470  H HG21 . VAL A 1 5  ? 10.029 6.454  -2.563  1.00 0.00 ? 22 VAL A HG21 13 
ATOM   8471  H HG22 . VAL A 1 5  ? 10.732 6.584  -4.192  1.00 0.00 ? 22 VAL A HG22 13 
ATOM   8472  H HG23 . VAL A 1 5  ? 11.746 6.067  -2.824  1.00 0.00 ? 22 VAL A HG23 13 
ATOM   8473  N N    . ALA A 1 6  ? 13.323 9.974  -0.857  1.00 0.00 ? 23 ALA A N    13 
ATOM   8474  C CA   . ALA A 1 6  ? 13.912 11.300 -0.712  1.00 0.00 ? 23 ALA A CA   13 
ATOM   8475  C C    . ALA A 1 6  ? 14.327 11.869 -2.062  1.00 0.00 ? 23 ALA A C    13 
ATOM   8476  O O    . ALA A 1 6  ? 14.892 11.164 -2.897  1.00 0.00 ? 23 ALA A O    13 
ATOM   8477  C CB   . ALA A 1 6  ? 15.102 11.250 0.235   1.00 0.00 ? 23 ALA A CB   13 
ATOM   8478  H H    . ALA A 1 6  ? 13.911 9.160  -0.753  1.00 0.00 ? 23 ALA A H    13 
ATOM   8479  H HA   . ALA A 1 6  ? 13.162 11.971 -0.292  1.00 0.00 ? 23 ALA A HA   13 
ATOM   8480  H HB1  . ALA A 1 6  ? 15.854 10.570 -0.163  1.00 0.00 ? 23 ALA A HB1  13 
ATOM   8481  H HB2  . ALA A 1 6  ? 15.530 12.247 0.333   1.00 0.00 ? 23 ALA A HB2  13 
ATOM   8482  H HB3  . ALA A 1 6  ? 14.775 10.897 1.214   1.00 0.00 ? 23 ALA A HB3  13 
ATOM   8483  N N    . ILE A 1 7  ? 14.043 13.151 -2.270  1.00 0.00 ? 24 ILE A N    13 
ATOM   8484  C CA   . ILE A 1 7  ? 14.304 13.795 -3.552  1.00 0.00 ? 24 ILE A CA   13 
ATOM   8485  C C    . ILE A 1 7  ? 14.959 15.157 -3.361  1.00 0.00 ? 24 ILE A C    13 
ATOM   8486  O O    . ILE A 1 7  ? 14.958 15.708 -2.260  1.00 0.00 ? 24 ILE A O    13 
ATOM   8487  C CB   . ILE A 1 7  ? 13.012 13.968 -4.370  1.00 0.00 ? 24 ILE A CB   13 
ATOM   8488  C CG1  . ILE A 1 7  ? 12.013 14.848 -3.614  1.00 0.00 ? 24 ILE A CG1  13 
ATOM   8489  C CG2  . ILE A 1 7  ? 12.398 12.613 -4.687  1.00 0.00 ? 24 ILE A CG2  13 
ATOM   8490  C CD1  . ILE A 1 7  ? 10.803 15.240 -4.430  1.00 0.00 ? 24 ILE A CD1  13 
ATOM   8491  H H    . ILE A 1 7  ? 13.637 13.693 -1.521  1.00 0.00 ? 24 ILE A H    13 
ATOM   8492  H HA   . ILE A 1 7  ? 15.026 13.220 -4.131  1.00 0.00 ? 24 ILE A HA   13 
ATOM   8493  H HB   . ILE A 1 7  ? 13.246 14.487 -5.300  1.00 0.00 ? 24 ILE A HB   13 
ATOM   8494  H HG12 . ILE A 1 7  ? 11.694 14.292 -2.732  1.00 0.00 ? 24 ILE A HG12 13 
ATOM   8495  H HG13 . ILE A 1 7  ? 12.547 15.746 -3.301  1.00 0.00 ? 24 ILE A HG13 13 
ATOM   8496  H HG21 . ILE A 1 7  ? 11.485 12.753 -5.266  1.00 0.00 ? 24 ILE A HG21 13 
ATOM   8497  H HG22 . ILE A 1 7  ? 13.105 12.019 -5.264  1.00 0.00 ? 24 ILE A HG22 13 
ATOM   8498  H HG23 . ILE A 1 7  ? 12.161 12.094 -3.758  1.00 0.00 ? 24 ILE A HG23 13 
ATOM   8499  H HD11 . ILE A 1 7  ? 10.269 14.343 -4.742  1.00 0.00 ? 24 ILE A HD11 13 
ATOM   8500  H HD12 . ILE A 1 7  ? 10.142 15.863 -3.827  1.00 0.00 ? 24 ILE A HD12 13 
ATOM   8501  H HD13 . ILE A 1 7  ? 11.122 15.797 -5.311  1.00 0.00 ? 24 ILE A HD13 13 
ATOM   8502  N N    . SER A 1 8  ? 15.518 15.696 -4.439  1.00 0.00 ? 25 SER A N    13 
ATOM   8503  C CA   . SER A 1 8  ? 16.173 16.997 -4.393  1.00 0.00 ? 25 SER A CA   13 
ATOM   8504  C C    . SER A 1 8  ? 15.173 18.125 -4.613  1.00 0.00 ? 25 SER A C    13 
ATOM   8505  O O    . SER A 1 8  ? 15.246 19.168 -3.963  1.00 0.00 ? 25 SER A O    13 
ATOM   8506  C CB   . SER A 1 8  ? 17.279 17.062 -5.429  1.00 0.00 ? 25 SER A CB   13 
ATOM   8507  O OG   . SER A 1 8  ? 18.276 16.105 -5.196  1.00 0.00 ? 25 SER A OG   13 
ATOM   8508  H H    . SER A 1 8  ? 15.489 15.190 -5.313  1.00 0.00 ? 25 SER A H    13 
ATOM   8509  H HA   . SER A 1 8  ? 16.730 17.170 -3.471  1.00 0.00 ? 25 SER A HA   13 
ATOM   8510  H HB2  . SER A 1 8  ? 16.844 16.889 -6.413  1.00 0.00 ? 25 SER A HB2  13 
ATOM   8511  H HB3  . SER A 1 8  ? 17.727 18.054 -5.401  1.00 0.00 ? 25 SER A HB3  13 
ATOM   8512  H HG   . SER A 1 8  ? 18.954 16.179 -5.871  1.00 0.00 ? 25 SER A HG   13 
ATOM   8513  N N    . ASP A 1 9  ? 14.240 17.910 -5.534  1.00 0.00 ? 26 ASP A N    13 
ATOM   8514  C CA   . ASP A 1 9  ? 13.246 18.923 -5.868  1.00 0.00 ? 26 ASP A CA   13 
ATOM   8515  C C    . ASP A 1 9  ? 12.053 18.307 -6.588  1.00 0.00 ? 26 ASP A C    13 
ATOM   8516  O O    . ASP A 1 9  ? 12.135 17.194 -7.107  1.00 0.00 ? 26 ASP A O    13 
ATOM   8517  C CB   . ASP A 1 9  ? 13.870 20.022 -6.731  1.00 0.00 ? 26 ASP A CB   13 
ATOM   8518  C CG   . ASP A 1 9  ? 13.126 21.351 -6.691  1.00 0.00 ? 26 ASP A CG   13 
ATOM   8519  O OD1  . ASP A 1 9  ? 12.132 21.433 -6.008  1.00 0.00 ? 26 ASP A OD1  13 
ATOM   8520  O OD2  . ASP A 1 9  ? 13.639 22.312 -7.213  1.00 0.00 ? 26 ASP A OD2  13 
ATOM   8521  H H    . ASP A 1 9  ? 14.218 17.022 -6.015  1.00 0.00 ? 26 ASP A H    13 
ATOM   8522  H HA   . ASP A 1 9  ? 12.857 19.375 -4.955  1.00 0.00 ? 26 ASP A HA   13 
ATOM   8523  H HB2  . ASP A 1 9  ? 14.926 20.192 -6.523  1.00 0.00 ? 26 ASP A HB2  13 
ATOM   8524  H HB3  . ASP A 1 9  ? 13.760 19.575 -7.719  1.00 0.00 ? 26 ASP A HB3  13 
ATOM   8525  N N    . ALA A 1 10 ? 10.943 19.036 -6.613  1.00 0.00 ? 27 ALA A N    13 
ATOM   8526  C CA   . ALA A 1 10 ? 9.752  18.596 -7.331  1.00 0.00 ? 27 ALA A CA   13 
ATOM   8527  C C    . ALA A 1 10 ? 9.999  18.552 -8.834  1.00 0.00 ? 27 ALA A C    13 
ATOM   8528  O O    . ALA A 1 10 ? 9.307  17.844 -9.566  1.00 0.00 ? 27 ALA A O    13 
ATOM   8529  C CB   . ALA A 1 10 ? 8.574  19.504 -7.010  1.00 0.00 ? 27 ALA A CB   13 
ATOM   8530  H H    . ALA A 1 10 ? 10.923 19.920 -6.124  1.00 0.00 ? 27 ALA A H    13 
ATOM   8531  H HA   . ALA A 1 10 ? 9.508  17.583 -7.012  1.00 0.00 ? 27 ALA A HA   13 
ATOM   8532  H HB1  . ALA A 1 10 ? 8.808  20.524 -7.309  1.00 0.00 ? 27 ALA A HB1  13 
ATOM   8533  H HB2  . ALA A 1 10 ? 7.694  19.161 -7.553  1.00 0.00 ? 27 ALA A HB2  13 
ATOM   8534  H HB3  . ALA A 1 10 ? 8.373  19.475 -5.939  1.00 0.00 ? 27 ALA A HB3  13 
ATOM   8535  N N    . ALA A 1 11 ? 10.989 19.313 -9.288  1.00 0.00 ? 28 ALA A N    13 
ATOM   8536  C CA   . ALA A 1 11 ? 11.389 19.293 -10.689 1.00 0.00 ? 28 ALA A CA   13 
ATOM   8537  C C    . ALA A 1 11 ? 11.917 17.921 -11.091 1.00 0.00 ? 28 ALA A C    13 
ATOM   8538  O O    . ALA A 1 11 ? 11.948 17.580 -12.274 1.00 0.00 ? 28 ALA A O    13 
ATOM   8539  C CB   . ALA A 1 11 ? 12.434 20.365 -10.957 1.00 0.00 ? 28 ALA A CB   13 
ATOM   8540  H H    . ALA A 1 11 ? 11.476 19.922 -8.646  1.00 0.00 ? 28 ALA A H    13 
ATOM   8541  H HA   . ALA A 1 11 ? 10.514 19.498 -11.306 1.00 0.00 ? 28 ALA A HA   13 
ATOM   8542  H HB1  . ALA A 1 11 ? 13.311 20.183 -10.337 1.00 0.00 ? 28 ALA A HB1  13 
ATOM   8543  H HB2  . ALA A 1 11 ? 12.723 20.337 -12.009 1.00 0.00 ? 28 ALA A HB2  13 
ATOM   8544  H HB3  . ALA A 1 11 ? 12.019 21.345 -10.722 1.00 0.00 ? 28 ALA A HB3  13 
ATOM   8545  N N    . GLN A 1 12 ? 12.330 17.138 -10.101 1.00 0.00 ? 29 GLN A N    13 
ATOM   8546  C CA   . GLN A 1 12 ? 12.891 15.816 -10.352 1.00 0.00 ? 29 GLN A CA   13 
ATOM   8547  C C    . GLN A 1 12 ? 11.795 14.760 -10.433 1.00 0.00 ? 29 GLN A C    13 
ATOM   8548  O O    . GLN A 1 12 ? 12.063 13.596 -10.732 1.00 0.00 ? 29 GLN A O    13 
ATOM   8549  C CB   . GLN A 1 12 ? 13.891 15.440 -9.256  1.00 0.00 ? 29 GLN A CB   13 
ATOM   8550  C CG   . GLN A 1 12 ? 15.050 16.411 -9.111  1.00 0.00 ? 29 GLN A CG   13 
ATOM   8551  C CD   . GLN A 1 12 ? 15.874 16.522 -10.379 1.00 0.00 ? 29 GLN A CD   13 
ATOM   8552  O OE1  . GLN A 1 12 ? 16.229 15.514 -10.996 1.00 0.00 ? 29 GLN A OE1  13 
ATOM   8553  N NE2  . GLN A 1 12 ? 16.188 17.750 -10.775 1.00 0.00 ? 29 GLN A NE2  13 
ATOM   8554  H H    . GLN A 1 12 ? 12.255 17.468 -9.149  1.00 0.00 ? 29 GLN A H    13 
ATOM   8555  H HA   . GLN A 1 12 ? 13.398 15.812 -11.318 1.00 0.00 ? 29 GLN A HA   13 
ATOM   8556  H HB2  . GLN A 1 12 ? 13.331 15.392 -8.322  1.00 0.00 ? 29 GLN A HB2  13 
ATOM   8557  H HB3  . GLN A 1 12 ? 14.271 14.449 -9.503  1.00 0.00 ? 29 GLN A HB3  13 
ATOM   8558  H HG2  . GLN A 1 12 ? 14.932 17.413 -8.700  1.00 0.00 ? 29 GLN A HG2  13 
ATOM   8559  H HG3  . GLN A 1 12 ? 15.595 15.790 -8.399  1.00 0.00 ? 29 GLN A HG3  13 
ATOM   8560  H HE21 . GLN A 1 12 ? 15.881 18.541 -10.244 1.00 0.00 ? 29 GLN A HE21 13 
ATOM   8561  H HE22 . GLN A 1 12 ? 16.731 17.887 -11.605 1.00 0.00 ? 29 GLN A HE22 13 
ATOM   8562  N N    . LEU A 1 13 ? 10.562 15.174 -10.166 1.00 0.00 ? 30 LEU A N    13 
ATOM   8563  C CA   . LEU A 1 13 ? 9.424  14.261 -10.200 1.00 0.00 ? 30 LEU A CA   13 
ATOM   8564  C C    . LEU A 1 13 ? 8.751  14.271 -11.567 1.00 0.00 ? 30 LEU A C    13 
ATOM   8565  O O    . LEU A 1 13 ? 8.625  15.319 -12.200 1.00 0.00 ? 30 LEU A O    13 
ATOM   8566  C CB   . LEU A 1 13 ? 8.416  14.632 -9.105  1.00 0.00 ? 30 LEU A CB   13 
ATOM   8567  C CG   . LEU A 1 13 ? 8.950  14.550 -7.670  1.00 0.00 ? 30 LEU A CG   13 
ATOM   8568  C CD1  . LEU A 1 13 ? 7.851  14.919 -6.682  1.00 0.00 ? 30 LEU A CD1  13 
ATOM   8569  C CD2  . LEU A 1 13 ? 9.468  13.146 -7.400  1.00 0.00 ? 30 LEU A CD2  13 
ATOM   8570  H H    . LEU A 1 13 ? 10.407 16.144 -9.934  1.00 0.00 ? 30 LEU A H    13 
ATOM   8571  H HA   . LEU A 1 13 ? 9.768  13.242 -10.031 1.00 0.00 ? 30 LEU A HA   13 
ATOM   8572  H HB2  . LEU A 1 13 ? 8.233  15.671 -9.377  1.00 0.00 ? 30 LEU A HB2  13 
ATOM   8573  H HB3  . LEU A 1 13 ? 7.490  14.065 -9.200  1.00 0.00 ? 30 LEU A HB3  13 
ATOM   8574  H HG   . LEU A 1 13 ? 9.794  15.236 -7.598  1.00 0.00 ? 30 LEU A HG   13 
ATOM   8575  H HD11 . LEU A 1 13 ? 8.239  14.857 -5.665  1.00 0.00 ? 30 LEU A HD11 13 
ATOM   8576  H HD12 . LEU A 1 13 ? 7.511  15.935 -6.878  1.00 0.00 ? 30 LEU A HD12 13 
ATOM   8577  H HD13 . LEU A 1 13 ? 7.016  14.228 -6.793  1.00 0.00 ? 30 LEU A HD13 13 
ATOM   8578  H HD21 . LEU A 1 13 ? 10.272 12.914 -8.099  1.00 0.00 ? 30 LEU A HD21 13 
ATOM   8579  H HD22 . LEU A 1 13 ? 9.848  13.088 -6.379  1.00 0.00 ? 30 LEU A HD22 13 
ATOM   8580  H HD23 . LEU A 1 13 ? 8.658  12.427 -7.528  1.00 0.00 ? 30 LEU A HD23 13 
ATOM   8581  N N    . PRO A 1 14 ? 8.320  13.097 -12.015 1.00 0.00 ? 31 PRO A N    13 
ATOM   8582  C CA   . PRO A 1 14 ? 7.484  12.993 -13.205 1.00 0.00 ? 31 PRO A CA   13 
ATOM   8583  C C    . PRO A 1 14 ? 6.264  13.900 -13.104 1.00 0.00 ? 31 PRO A C    13 
ATOM   8584  O O    . PRO A 1 14 ? 5.667  14.035 -12.035 1.00 0.00 ? 31 PRO A O    13 
ATOM   8585  C CB   . PRO A 1 14 ? 7.097  11.511 -13.262 1.00 0.00 ? 31 PRO A CB   13 
ATOM   8586  C CG   . PRO A 1 14 ? 8.157  10.820 -12.475 1.00 0.00 ? 31 PRO A CG   13 
ATOM   8587  C CD   . PRO A 1 14 ? 8.515  11.773 -11.366 1.00 0.00 ? 31 PRO A CD   13 
ATOM   8588  H HA   . PRO A 1 14 ? 8.002  13.316 -14.119 1.00 0.00 ? 31 PRO A HA   13 
ATOM   8589  H HB2  . PRO A 1 14 ? 6.101  11.338 -12.827 1.00 0.00 ? 31 PRO A HB2  13 
ATOM   8590  H HB3  . PRO A 1 14 ? 7.066  11.142 -14.298 1.00 0.00 ? 31 PRO A HB3  13 
ATOM   8591  H HG2  . PRO A 1 14 ? 7.793  9.863  -12.072 1.00 0.00 ? 31 PRO A HG2  13 
ATOM   8592  H HG3  . PRO A 1 14 ? 9.034  10.594 -13.100 1.00 0.00 ? 31 PRO A HG3  13 
ATOM   8593  H HD2  . PRO A 1 14 ? 7.865  11.652 -10.487 1.00 0.00 ? 31 PRO A HD2  13 
ATOM   8594  H HD3  . PRO A 1 14 ? 9.551  11.638 -11.019 1.00 0.00 ? 31 PRO A HD3  13 
ATOM   8595  N N    . HIS A 1 15 ? 5.900  14.520 -14.221 1.00 0.00 ? 32 HIS A N    13 
ATOM   8596  C CA   . HIS A 1 15 ? 4.869  15.551 -14.222 1.00 0.00 ? 32 HIS A CA   13 
ATOM   8597  C C    . HIS A 1 15 ? 3.682  15.145 -13.360 1.00 0.00 ? 32 HIS A C    13 
ATOM   8598  O O    . HIS A 1 15 ? 3.128  15.962 -12.625 1.00 0.00 ? 32 HIS A O    13 
ATOM   8599  C CB   . HIS A 1 15 ? 4.401  15.846 -15.651 1.00 0.00 ? 32 HIS A CB   13 
ATOM   8600  C CG   . HIS A 1 15 ? 3.449  16.997 -15.747 1.00 0.00 ? 32 HIS A CG   13 
ATOM   8601  N ND1  . HIS A 1 15 ? 2.958  17.458 -16.951 1.00 0.00 ? 32 HIS A ND1  13 
ATOM   8602  C CD2  . HIS A 1 15 ? 2.896  17.780 -14.791 1.00 0.00 ? 32 HIS A CD2  13 
ATOM   8603  C CE1  . HIS A 1 15 ? 2.144  18.476 -16.730 1.00 0.00 ? 32 HIS A CE1  13 
ATOM   8604  N NE2  . HIS A 1 15 ? 2.090  18.690 -15.427 1.00 0.00 ? 32 HIS A NE2  13 
ATOM   8605  H H    . HIS A 1 15 ? 6.349  14.272 -15.090 1.00 0.00 ? 32 HIS A H    13 
ATOM   8606  H HA   . HIS A 1 15 ? 5.268  16.469 -13.790 1.00 0.00 ? 32 HIS A HA   13 
ATOM   8607  H HB2  . HIS A 1 15 ? 5.255  16.096 -16.282 1.00 0.00 ? 32 HIS A HB2  13 
ATOM   8608  H HB3  . HIS A 1 15 ? 3.887  14.979 -16.064 1.00 0.00 ? 32 HIS A HB3  13 
ATOM   8609  H HD1  . HIS A 1 15 ? 3.115  17.048 -17.850 1.00 0.00 ? 32 HIS A HD1  13 
ATOM   8610  H HD2  . HIS A 1 15 ? 2.985  17.795 -13.705 1.00 0.00 ? 32 HIS A HD2  13 
ATOM   8611  H HE1  . HIS A 1 15 ? 1.650  18.982 -17.559 1.00 0.00 ? 32 HIS A HE1  13 
ATOM   8612  N N    . ASP A 1 16 ? 3.295  13.878 -13.454 1.00 0.00 ? 33 ASP A N    13 
ATOM   8613  C CA   . ASP A 1 16 ? 2.139  13.372 -12.722 1.00 0.00 ? 33 ASP A CA   13 
ATOM   8614  C C    . ASP A 1 16 ? 2.458  13.195 -11.244 1.00 0.00 ? 33 ASP A C    13 
ATOM   8615  O O    . ASP A 1 16 ? 2.723  12.083 -10.785 1.00 0.00 ? 33 ASP A O    13 
ATOM   8616  C CB   . ASP A 1 16 ? 1.663  12.048 -13.321 1.00 0.00 ? 33 ASP A CB   13 
ATOM   8617  C CG   . ASP A 1 16 ? 0.347  11.536 -12.749 1.00 0.00 ? 33 ASP A CG   13 
ATOM   8618  O OD1  . ASP A 1 16 ? -0.251 12.237 -11.967 1.00 0.00 ? 33 ASP A OD1  13 
ATOM   8619  O OD2  . ASP A 1 16 ? -0.127 10.526 -13.214 1.00 0.00 ? 33 ASP A OD2  13 
ATOM   8620  H H    . ASP A 1 16 ? 3.815  13.247 -14.047 1.00 0.00 ? 33 ASP A H    13 
ATOM   8621  H HA   . ASP A 1 16 ? 1.323  14.094 -12.778 1.00 0.00 ? 33 ASP A HA   13 
ATOM   8622  H HB2  . ASP A 1 16 ? 1.606  12.057 -14.409 1.00 0.00 ? 33 ASP A HB2  13 
ATOM   8623  H HB3  . ASP A 1 16 ? 2.474  11.391 -13.005 1.00 0.00 ? 33 ASP A HB3  13 
ATOM   8624  N N    . TYR A 1 17 ? 2.432  14.296 -10.501 1.00 0.00 ? 34 TYR A N    13 
ATOM   8625  C CA   . TYR A 1 17 ? 2.559  14.244 -9.049  1.00 0.00 ? 34 TYR A CA   13 
ATOM   8626  C C    . TYR A 1 17 ? 1.618  15.236 -8.378  1.00 0.00 ? 34 TYR A C    13 
ATOM   8627  O O    . TYR A 1 17 ? 1.084  16.136 -9.026  1.00 0.00 ? 34 TYR A O    13 
ATOM   8628  C CB   . TYR A 1 17 ? 4.004  14.524 -8.628  1.00 0.00 ? 34 TYR A CB   13 
ATOM   8629  C CG   . TYR A 1 17 ? 4.425  15.966 -8.803  1.00 0.00 ? 34 TYR A CG   13 
ATOM   8630  C CD1  . TYR A 1 17 ? 4.223  16.895 -7.793  1.00 0.00 ? 34 TYR A CD1  13 
ATOM   8631  C CD2  . TYR A 1 17 ? 5.026  16.394 -9.978  1.00 0.00 ? 34 TYR A CD2  13 
ATOM   8632  C CE1  . TYR A 1 17 ? 4.605  18.213 -7.948  1.00 0.00 ? 34 TYR A CE1  13 
ATOM   8633  C CE2  . TYR A 1 17 ? 5.414  17.709 -10.143 1.00 0.00 ? 34 TYR A CE2  13 
ATOM   8634  C CZ   . TYR A 1 17 ? 5.202  18.616 -9.126  1.00 0.00 ? 34 TYR A CZ   13 
ATOM   8635  O OH   . TYR A 1 17 ? 5.586  19.928 -9.286  1.00 0.00 ? 34 TYR A OH   13 
ATOM   8636  H H    . TYR A 1 17 ? 2.321  15.191 -10.953 1.00 0.00 ? 34 TYR A H    13 
ATOM   8637  H HA   . TYR A 1 17 ? 2.277  13.255 -8.688  1.00 0.00 ? 34 TYR A HA   13 
ATOM   8638  H HB2  . TYR A 1 17 ? 4.094  14.244 -7.578  1.00 0.00 ? 34 TYR A HB2  13 
ATOM   8639  H HB3  . TYR A 1 17 ? 4.645  13.883 -9.232  1.00 0.00 ? 34 TYR A HB3  13 
ATOM   8640  H HD1  . TYR A 1 17 ? 3.752  16.570 -6.866  1.00 0.00 ? 34 TYR A HD1  13 
ATOM   8641  H HD2  . TYR A 1 17 ? 5.191  15.672 -10.778 1.00 0.00 ? 34 TYR A HD2  13 
ATOM   8642  H HE1  . TYR A 1 17 ? 4.440  18.933 -7.146  1.00 0.00 ? 34 TYR A HE1  13 
ATOM   8643  H HE2  . TYR A 1 17 ? 5.884  18.026 -11.075 1.00 0.00 ? 34 TYR A HE2  13 
ATOM   8644  H HH   . TYR A 1 17 ? 5.990  20.100 -10.139 1.00 0.00 ? 34 TYR A HH   13 
ATOM   8645  N N    . CYS A 1 18 ? 1.421  15.068 -7.075  1.00 0.00 ? 35 CYS A N    13 
ATOM   8646  C CA   . CYS A 1 18 ? 0.501  15.914 -6.324  1.00 0.00 ? 35 CYS A CA   13 
ATOM   8647  C C    . CYS A 1 18 ? 1.085  16.295 -4.969  1.00 0.00 ? 35 CYS A C    13 
ATOM   8648  O O    . CYS A 1 18 ? 2.103  15.747 -4.545  1.00 0.00 ? 35 CYS A O    13 
ATOM   8649  C CB   . CYS A 1 18 ? -0.721 15.013 -6.150  1.00 0.00 ? 35 CYS A CB   13 
ATOM   8650  S SG   . CYS A 1 18 ? -1.500 14.499 -7.700  1.00 0.00 ? 35 CYS A SG   13 
ATOM   8651  H H    . CYS A 1 18 ? 1.920  14.335 -6.593  1.00 0.00 ? 35 CYS A H    13 
ATOM   8652  H HA   . CYS A 1 18 ? 0.198  16.811 -6.864  1.00 0.00 ? 35 CYS A HA   13 
ATOM   8653  H HB2  . CYS A 1 18 ? -0.443 14.095 -5.632  1.00 0.00 ? 35 CYS A HB2  13 
ATOM   8654  H HB3  . CYS A 1 18 ? -1.494 15.531 -5.582  1.00 0.00 ? 35 CYS A HB3  13 
ATOM   8655  H HG   . CYS A 1 18 ? -2.462 13.773 -7.137  1.00 0.00 ? 35 CYS A HG   13 
ATOM   8656  N N    . THR A 1 19 ? 0.435  17.236 -4.294  1.00 0.00 ? 36 THR A N    13 
ATOM   8657  C CA   . THR A 1 19 ? 0.783  17.572 -2.919  1.00 0.00 ? 36 THR A CA   13 
ATOM   8658  C C    . THR A 1 19 ? -0.407 17.385 -1.987  1.00 0.00 ? 36 THR A C    13 
ATOM   8659  O O    . THR A 1 19 ? -1.560 17.490 -2.408  1.00 0.00 ? 36 THR A O    13 
ATOM   8660  C CB   . THR A 1 19 ? 1.290  19.022 -2.802  1.00 0.00 ? 36 THR A CB   13 
ATOM   8661  O OG1  . THR A 1 19 ? 0.277  19.924 -3.270  1.00 0.00 ? 36 THR A OG1  13 
ATOM   8662  C CG2  . THR A 1 19 ? 2.554  19.214 -3.626  1.00 0.00 ? 36 THR A CG2  13 
ATOM   8663  H H    . THR A 1 19 ? -0.321 17.732 -4.745  1.00 0.00 ? 36 THR A H    13 
ATOM   8664  H HA   . THR A 1 19 ? 1.563  16.900 -2.561  1.00 0.00 ? 36 THR A HA   13 
ATOM   8665  H HB   . THR A 1 19 ? 1.503  19.240 -1.756  1.00 0.00 ? 36 THR A HB   13 
ATOM   8666  H HG1  . THR A 1 19 ? 0.595  20.826 -3.195  1.00 0.00 ? 36 THR A HG1  13 
ATOM   8667  H HG21 . THR A 1 19 ? 2.341  18.997 -4.673  1.00 0.00 ? 36 THR A HG21 13 
ATOM   8668  H HG22 . THR A 1 19 ? 2.896  20.243 -3.531  1.00 0.00 ? 36 THR A HG22 13 
ATOM   8669  H HG23 . THR A 1 19 ? 3.329  18.537 -3.266  1.00 0.00 ? 36 THR A HG23 13 
HETATM 8670  N N    . TPO A 1 20 ? -0.122 17.105 -0.720  1.00 0.00 ? 37 TPO A N    13 
HETATM 8671  C CA   . TPO A 1 20 ? -1.161 17.027 0.300   1.00 0.00 ? 37 TPO A CA   13 
HETATM 8672  C CB   . TPO A 1 20 ? -0.753 16.089 1.452   1.00 0.00 ? 37 TPO A CB   13 
HETATM 8673  C CG2  . TPO A 1 20 ? -0.268 14.755 0.906   1.00 0.00 ? 37 TPO A CG2  13 
HETATM 8674  O OG1  . TPO A 1 20 ? 0.294  16.698 2.218   1.00 0.00 ? 37 TPO A OG1  13 
HETATM 8675  P P    . TPO A 1 20 ? 0.511  16.306 3.767   1.00 0.00 ? 37 TPO A P    13 
HETATM 8676  O O1P  . TPO A 1 20 ? 1.713  17.136 4.290   1.00 0.00 ? 37 TPO A O1P  13 
HETATM 8677  O O2P  . TPO A 1 20 ? 0.804  14.784 3.820   1.00 0.00 ? 37 TPO A O2P  13 
HETATM 8678  O O3P  . TPO A 1 20 ? -0.798 16.660 4.520   1.00 0.00 ? 37 TPO A O3P  13 
HETATM 8679  C C    . TPO A 1 20 ? -1.480 18.404 0.868   1.00 0.00 ? 37 TPO A C    13 
HETATM 8680  O O    . TPO A 1 20 ? -0.723 19.356 0.677   1.00 0.00 ? 37 TPO A O    13 
HETATM 8681  H H    . TPO A 1 20 ? 0.839  16.944 -0.456  1.00 0.00 ? 37 TPO A H    13 
HETATM 8682  H HA   . TPO A 1 20 ? -2.085 16.655 -0.143  1.00 0.00 ? 37 TPO A HA   13 
HETATM 8683  H HB   . TPO A 1 20 ? -1.616 15.926 2.097   1.00 0.00 ? 37 TPO A HB   13 
HETATM 8684  H HG21 . TPO A 1 20 ? 0.016  14.107 1.736   1.00 0.00 ? 37 TPO A HG21 13 
HETATM 8685  H HG22 . TPO A 1 20 ? -1.066 14.285 0.333   1.00 0.00 ? 37 TPO A HG22 13 
HETATM 8686  H HG23 . TPO A 1 20 ? 0.595  14.919 0.262   1.00 0.00 ? 37 TPO A HG23 13 
ATOM   8687  N N    . PRO A 1 21 ? -2.605 18.503 1.569   1.00 0.00 ? 38 PRO A N    13 
ATOM   8688  C CA   . PRO A 1 21 ? -3.048 19.774 2.130   1.00 0.00 ? 38 PRO A CA   13 
ATOM   8689  C C    . PRO A 1 21 ? -1.951 20.418 2.968   1.00 0.00 ? 38 PRO A C    13 
ATOM   8690  O O    . PRO A 1 21 ? -1.853 21.643 3.043   1.00 0.00 ? 38 PRO A O    13 
ATOM   8691  C CB   . PRO A 1 21 ? -4.274 19.404 2.972   1.00 0.00 ? 38 PRO A CB   13 
ATOM   8692  C CG   . PRO A 1 21 ? -4.838 18.200 2.298   1.00 0.00 ? 38 PRO A CG   13 
ATOM   8693  C CD   . PRO A 1 21 ? -3.646 17.427 1.799   1.00 0.00 ? 38 PRO A CD   13 
ATOM   8694  H HA   . PRO A 1 21 ? -3.291 20.519 1.359   1.00 0.00 ? 38 PRO A HA   13 
ATOM   8695  H HB2  . PRO A 1 21 ? -3.996 19.184 4.014   1.00 0.00 ? 38 PRO A HB2  13 
ATOM   8696  H HB3  . PRO A 1 21 ? -5.006 20.224 3.001   1.00 0.00 ? 38 PRO A HB3  13 
ATOM   8697  H HG2  . PRO A 1 21 ? -5.436 17.596 2.997   1.00 0.00 ? 38 PRO A HG2  13 
ATOM   8698  H HG3  . PRO A 1 21 ? -5.501 18.484 1.467   1.00 0.00 ? 38 PRO A HG3  13 
ATOM   8699  H HD2  . PRO A 1 21 ? -3.293 16.687 2.533   1.00 0.00 ? 38 PRO A HD2  13 
ATOM   8700  H HD3  . PRO A 1 21 ? -3.864 16.879 0.870   1.00 0.00 ? 38 PRO A HD3  13 
ATOM   8701  N N    . GLY A 1 22 ? -1.127 19.587 3.595   1.00 0.00 ? 39 GLY A N    13 
ATOM   8702  C CA   . GLY A 1 22 ? 0.012  20.072 4.365   1.00 0.00 ? 39 GLY A CA   13 
ATOM   8703  C C    . GLY A 1 22 ? 1.112  20.597 3.450   1.00 0.00 ? 39 GLY A C    13 
ATOM   8704  O O    . GLY A 1 22 ? 1.824  21.539 3.797   1.00 0.00 ? 39 GLY A O    13 
ATOM   8705  H H    . GLY A 1 22 ? -1.294 18.592 3.539   1.00 0.00 ? 39 GLY A H    13 
ATOM   8706  H HA2  . GLY A 1 22 ? -0.319 20.877 5.021   1.00 0.00 ? 39 GLY A HA2  13 
ATOM   8707  H HA3  . GLY A 1 22 ? 0.410  19.255 4.966   1.00 0.00 ? 39 GLY A HA3  13 
ATOM   8708  N N    . GLY A 1 23 ? 1.243  19.984 2.280   1.00 0.00 ? 40 GLY A N    13 
ATOM   8709  C CA   . GLY A 1 23 ? 2.183  20.455 1.269   1.00 0.00 ? 40 GLY A CA   13 
ATOM   8710  C C    . GLY A 1 23 ? 3.327  19.468 1.078   1.00 0.00 ? 40 GLY A C    13 
ATOM   8711  O O    . GLY A 1 23 ? 4.457  19.862 0.792   1.00 0.00 ? 40 GLY A O    13 
ATOM   8712  H H    . GLY A 1 23 ? 0.679  19.169 2.084   1.00 0.00 ? 40 GLY A H    13 
ATOM   8713  H HA2  . GLY A 1 23 ? 1.657  20.575 0.321   1.00 0.00 ? 40 GLY A HA2  13 
ATOM   8714  H HA3  . GLY A 1 23 ? 2.591  21.415 1.582   1.00 0.00 ? 40 GLY A HA3  13 
ATOM   8715  N N    . THR A 1 24 ? 3.028  18.184 1.239   1.00 0.00 ? 41 THR A N    13 
ATOM   8716  C CA   . THR A 1 24 ? 4.016  17.133 1.028   1.00 0.00 ? 41 THR A CA   13 
ATOM   8717  C C    . THR A 1 24 ? 3.816  16.451 -0.318  1.00 0.00 ? 41 THR A C    13 
ATOM   8718  O O    . THR A 1 24 ? 2.697  16.089 -0.682  1.00 0.00 ? 41 THR A O    13 
ATOM   8719  C CB   . THR A 1 24 ? 3.961  16.073 2.143   1.00 0.00 ? 41 THR A CB   13 
ATOM   8720  O OG1  . THR A 1 24 ? 4.289  16.680 3.400   1.00 0.00 ? 41 THR A OG1  13 
ATOM   8721  C CG2  . THR A 1 24 ? 4.943  14.946 1.857   1.00 0.00 ? 41 THR A CG2  13 
ATOM   8722  H H    . THR A 1 24 ? 2.090  17.928 1.515   1.00 0.00 ? 41 THR A H    13 
ATOM   8723  H HA   . THR A 1 24 ? 5.017  17.567 1.008   1.00 0.00 ? 41 THR A HA   13 
ATOM   8724  H HB   . THR A 1 24 ? 2.951  15.667 2.198   1.00 0.00 ? 41 THR A HB   13 
ATOM   8725  H HG1  . THR A 1 24 ? 3.635  17.351 3.610   1.00 0.00 ? 41 THR A HG1  13 
ATOM   8726  H HG21 . THR A 1 24 ? 5.954  15.351 1.804   1.00 0.00 ? 41 THR A HG21 13 
ATOM   8727  H HG22 . THR A 1 24 ? 4.890  14.207 2.655   1.00 0.00 ? 41 THR A HG22 13 
ATOM   8728  H HG23 . THR A 1 24 ? 4.690  14.476 0.907   1.00 0.00 ? 41 THR A HG23 13 
ATOM   8729  N N    . LEU A 1 25 ? 4.908  16.276 -1.056  1.00 0.00 ? 42 LEU A N    13 
ATOM   8730  C CA   . LEU A 1 25 ? 4.847  15.677 -2.384  1.00 0.00 ? 42 LEU A CA   13 
ATOM   8731  C C    . LEU A 1 25 ? 4.512  14.193 -2.304  1.00 0.00 ? 42 LEU A C    13 
ATOM   8732  O O    . LEU A 1 25 ? 4.967  13.492 -1.401  1.00 0.00 ? 42 LEU A O    13 
ATOM   8733  C CB   . LEU A 1 25 ? 6.177  15.885 -3.121  1.00 0.00 ? 42 LEU A CB   13 
ATOM   8734  C CG   . LEU A 1 25 ? 6.472  17.331 -3.540  1.00 0.00 ? 42 LEU A CG   13 
ATOM   8735  C CD1  . LEU A 1 25 ? 7.953  17.491 -3.852  1.00 0.00 ? 42 LEU A CD1  13 
ATOM   8736  C CD2  . LEU A 1 25 ? 5.624  17.692 -4.749  1.00 0.00 ? 42 LEU A CD2  13 
ATOM   8737  H H    . LEU A 1 25 ? 5.802  16.566 -0.688  1.00 0.00 ? 42 LEU A H    13 
ATOM   8738  H HA   . LEU A 1 25 ? 4.048  16.144 -2.959  1.00 0.00 ? 42 LEU A HA   13 
ATOM   8739  H HB2  . LEU A 1 25 ? 6.865  15.576 -2.334  1.00 0.00 ? 42 LEU A HB2  13 
ATOM   8740  H HB3  . LEU A 1 25 ? 6.275  15.213 -3.973  1.00 0.00 ? 42 LEU A HB3  13 
ATOM   8741  H HG   . LEU A 1 25 ? 6.169  17.976 -2.714  1.00 0.00 ? 42 LEU A HG   13 
ATOM   8742  H HD11 . LEU A 1 25 ? 8.154  18.522 -4.149  1.00 0.00 ? 42 LEU A HD11 13 
ATOM   8743  H HD12 . LEU A 1 25 ? 8.540  17.250 -2.966  1.00 0.00 ? 42 LEU A HD12 13 
ATOM   8744  H HD13 . LEU A 1 25 ? 8.229  16.820 -4.664  1.00 0.00 ? 42 LEU A HD13 13 
ATOM   8745  H HD21 . LEU A 1 25 ? 4.568  17.598 -4.495  1.00 0.00 ? 42 LEU A HD21 13 
ATOM   8746  H HD22 . LEU A 1 25 ? 5.834  18.721 -5.045  1.00 0.00 ? 42 LEU A HD22 13 
ATOM   8747  H HD23 . LEU A 1 25 ? 5.860  17.021 -5.574  1.00 0.00 ? 42 LEU A HD23 13 
ATOM   8748  N N    . PHE A 1 26 ? 3.713  13.721 -3.255  1.00 0.00 ? 43 PHE A N    13 
ATOM   8749  C CA   . PHE A 1 26 ? 3.499  12.289 -3.434  1.00 0.00 ? 43 PHE A CA   13 
ATOM   8750  C C    . PHE A 1 26 ? 3.051  11.973 -4.854  1.00 0.00 ? 43 PHE A C    13 
ATOM   8751  O O    . PHE A 1 26 ? 2.565  12.846 -5.572  1.00 0.00 ? 43 PHE A O    13 
ATOM   8752  C CB   . PHE A 1 26 ? 2.466  11.775 -2.429  1.00 0.00 ? 43 PHE A CB   13 
ATOM   8753  C CG   . PHE A 1 26 ? 1.063  12.230 -2.716  1.00 0.00 ? 43 PHE A CG   13 
ATOM   8754  C CD1  . PHE A 1 26 ? 0.600  13.444 -2.232  1.00 0.00 ? 43 PHE A CD1  13 
ATOM   8755  C CD2  . PHE A 1 26 ? 0.204  11.445 -3.471  1.00 0.00 ? 43 PHE A CD2  13 
ATOM   8756  C CE1  . PHE A 1 26 ? -0.690 13.864 -2.493  1.00 0.00 ? 43 PHE A CE1  13 
ATOM   8757  C CE2  . PHE A 1 26 ? -1.086 11.864 -3.736  1.00 0.00 ? 43 PHE A CE2  13 
ATOM   8758  C CZ   . PHE A 1 26 ? -1.533 13.073 -3.247  1.00 0.00 ? 43 PHE A CZ   13 
ATOM   8759  H H    . PHE A 1 26 ? 3.243  14.369 -3.870  1.00 0.00 ? 43 PHE A H    13 
ATOM   8760  H HA   . PHE A 1 26 ? 4.435  11.752 -3.276  1.00 0.00 ? 43 PHE A HA   13 
ATOM   8761  H HB2  . PHE A 1 26 ? 2.446  10.685 -2.436  1.00 0.00 ? 43 PHE A HB2  13 
ATOM   8762  H HB3  . PHE A 1 26 ? 2.709  12.127 -1.428  1.00 0.00 ? 43 PHE A HB3  13 
ATOM   8763  H HD1  . PHE A 1 26 ? 1.267  14.069 -1.637  1.00 0.00 ? 43 PHE A HD1  13 
ATOM   8764  H HD2  . PHE A 1 26 ? 0.558  10.489 -3.857  1.00 0.00 ? 43 PHE A HD2  13 
ATOM   8765  H HE1  . PHE A 1 26 ? -1.042 14.820 -2.107  1.00 0.00 ? 43 PHE A HE1  13 
ATOM   8766  H HE2  . PHE A 1 26 ? -1.750 11.237 -4.331  1.00 0.00 ? 43 PHE A HE2  13 
ATOM   8767  H HZ   . PHE A 1 26 ? -2.550 13.403 -3.456  1.00 0.00 ? 43 PHE A HZ   13 
ATOM   8768  N N    . SER A 1 27 ? 3.219  10.717 -5.256  1.00 0.00 ? 44 SER A N    13 
ATOM   8769  C CA   . SER A 1 27 ? 2.709  10.248 -6.539  1.00 0.00 ? 44 SER A CA   13 
ATOM   8770  C C    . SER A 1 27 ? 2.365  8.766  -6.486  1.00 0.00 ? 44 SER A C    13 
ATOM   8771  O O    . SER A 1 27 ? 3.088  7.971  -5.884  1.00 0.00 ? 44 SER A O    13 
ATOM   8772  C CB   . SER A 1 27 ? 3.723  10.517 -7.634  1.00 0.00 ? 44 SER A CB   13 
ATOM   8773  O OG   . SER A 1 27 ? 3.265  10.096 -8.890  1.00 0.00 ? 44 SER A OG   13 
ATOM   8774  H H    . SER A 1 27 ? 3.713  10.071 -4.657  1.00 0.00 ? 44 SER A H    13 
ATOM   8775  H HA   . SER A 1 27 ? 1.848  10.816 -6.896  1.00 0.00 ? 44 SER A HA   13 
ATOM   8776  H HB2  . SER A 1 27 ? 3.920  11.588 -7.670  1.00 0.00 ? 44 SER A HB2  13 
ATOM   8777  H HB3  . SER A 1 27 ? 4.643  9.986  -7.395  1.00 0.00 ? 44 SER A HB3  13 
ATOM   8778  H HG   . SER A 1 27 ? 2.888  10.842 -9.360  1.00 0.00 ? 44 SER A HG   13 
ATOM   8779  N N    . THR A 1 28 ? 1.256  8.397  -7.119  1.00 0.00 ? 45 THR A N    13 
ATOM   8780  C CA   . THR A 1 28 ? 0.816  7.007  -7.148  1.00 0.00 ? 45 THR A CA   13 
ATOM   8781  C C    . THR A 1 28 ? 0.999  6.400  -8.532  1.00 0.00 ? 45 THR A C    13 
ATOM   8782  O O    . THR A 1 28 ? 0.502  6.931  -9.525  1.00 0.00 ? 45 THR A O    13 
ATOM   8783  C CB   . THR A 1 28 ? -0.660 6.874  -6.731  1.00 0.00 ? 45 THR A CB   13 
ATOM   8784  O OG1  . THR A 1 28 ? -0.831 7.372  -5.398  1.00 0.00 ? 45 THR A OG1  13 
ATOM   8785  C CG2  . THR A 1 28 ? -1.100 5.419  -6.784  1.00 0.00 ? 45 THR A CG2  13 
ATOM   8786  H H    . THR A 1 28 ? 0.705  9.098  -7.594  1.00 0.00 ? 45 THR A H    13 
ATOM   8787  H HA   . THR A 1 28 ? 1.426  6.413  -6.467  1.00 0.00 ? 45 THR A HA   13 
ATOM   8788  H HB   . THR A 1 28 ? -1.275 7.464  -7.410  1.00 0.00 ? 45 THR A HB   13 
ATOM   8789  H HG1  . THR A 1 28 ? -0.573 8.298  -5.367  1.00 0.00 ? 45 THR A HG1  13 
ATOM   8790  H HG21 . THR A 1 28 ? -0.488 4.830  -6.104  1.00 0.00 ? 45 THR A HG21 13 
ATOM   8791  H HG22 . THR A 1 28 ? -2.147 5.346  -6.487  1.00 0.00 ? 45 THR A HG22 13 
ATOM   8792  H HG23 . THR A 1 28 ? -0.983 5.041  -7.800  1.00 0.00 ? 45 THR A HG23 13 
HETATM 8793  N N    . TPO A 1 29 ? 1.714  5.282  -8.592  1.00 0.00 ? 46 TPO A N    13 
HETATM 8794  C CA   . TPO A 1 29 ? 2.016  4.631  -9.862  1.00 0.00 ? 46 TPO A CA   13 
HETATM 8795  C CB   . TPO A 1 29 ? 3.322  3.820  -9.786  1.00 0.00 ? 46 TPO A CB   13 
HETATM 8796  C CG2  . TPO A 1 29 ? 4.448  4.674  -9.222  1.00 0.00 ? 46 TPO A CG2  13 
HETATM 8797  O OG1  . TPO A 1 29 ? 3.128  2.675  -8.945  1.00 0.00 ? 46 TPO A OG1  13 
HETATM 8798  P P    . TPO A 1 29 ? 4.071  1.375  -9.100  1.00 0.00 ? 46 TPO A P    13 
HETATM 8799  O O1P  . TPO A 1 29 ? 3.597  0.335  -8.052  1.00 0.00 ? 46 TPO A O1P  13 
HETATM 8800  O O2P  . TPO A 1 29 ? 5.530  1.830  -8.832  1.00 0.00 ? 46 TPO A O2P  13 
HETATM 8801  O O3P  . TPO A 1 29 ? 3.895  0.847  -10.547 1.00 0.00 ? 46 TPO A O3P  13 
HETATM 8802  C C    . TPO A 1 29 ? 0.882  3.710  -10.292 1.00 0.00 ? 46 TPO A C    13 
HETATM 8803  O O    . TPO A 1 29 ? 0.010  3.368  -9.493  1.00 0.00 ? 46 TPO A O    13 
HETATM 8804  H H    . TPO A 1 29 ? 2.058  4.871  -7.735  1.00 0.00 ? 46 TPO A H    13 
HETATM 8805  H HA   . TPO A 1 29 ? 2.117  5.383  -10.646 1.00 0.00 ? 46 TPO A HA   13 
HETATM 8806  H HB   . TPO A 1 29 ? 3.590  3.483  -10.787 1.00 0.00 ? 46 TPO A HB   13 
HETATM 8807  H HG21 . TPO A 1 29 ? 5.363  4.083  -9.175  1.00 0.00 ? 46 TPO A HG21 13 
HETATM 8808  H HG22 . TPO A 1 29 ? 4.606  5.539  -9.865  1.00 0.00 ? 46 TPO A HG22 13 
HETATM 8809  H HG23 . TPO A 1 29 ? 4.181  5.009  -8.220  1.00 0.00 ? 46 TPO A HG23 13 
ATOM   8810  N N    . PRO A 1 30 ? 0.899  3.310  -11.559 1.00 0.00 ? 47 PRO A N    13 
ATOM   8811  C CA   . PRO A 1 30 ? -0.164 2.483  -12.117 1.00 0.00 ? 47 PRO A CA   13 
ATOM   8812  C C    . PRO A 1 30 ? -0.347 1.204  -11.309 1.00 0.00 ? 47 PRO A C    13 
ATOM   8813  O O    . PRO A 1 30 ? -1.448 0.655  -11.238 1.00 0.00 ? 47 PRO A O    13 
ATOM   8814  C CB   . PRO A 1 30 ? 0.295  2.198  -13.550 1.00 0.00 ? 47 PRO A CB   13 
ATOM   8815  C CG   . PRO A 1 30 ? 1.151  3.366  -13.905 1.00 0.00 ? 47 PRO A CG   13 
ATOM   8816  C CD   . PRO A 1 30 ? 1.869  3.735  -12.634 1.00 0.00 ? 47 PRO A CD   13 
ATOM   8817  H HA   . PRO A 1 30 ? -1.146 2.978  -12.091 1.00 0.00 ? 47 PRO A HA   13 
ATOM   8818  H HB2  . PRO A 1 30 ? 0.860  1.257  -13.614 1.00 0.00 ? 47 PRO A HB2  13 
ATOM   8819  H HB3  . PRO A 1 30 ? -0.560 2.108  -14.237 1.00 0.00 ? 47 PRO A HB3  13 
ATOM   8820  H HG2  . PRO A 1 30 ? 1.864  3.110  -14.701 1.00 0.00 ? 47 PRO A HG2  13 
ATOM   8821  H HG3  . PRO A 1 30 ? 0.544  4.207  -14.274 1.00 0.00 ? 47 PRO A HG3  13 
ATOM   8822  H HD2  . PRO A 1 30 ? 2.830  3.209  -12.531 1.00 0.00 ? 47 PRO A HD2  13 
ATOM   8823  H HD3  . PRO A 1 30 ? 2.084  4.812  -12.574 1.00 0.00 ? 47 PRO A HD3  13 
ATOM   8824  N N    . GLY A 1 31 ? 0.736  0.734  -10.701 1.00 0.00 ? 48 GLY A N    13 
ATOM   8825  C CA   . GLY A 1 31 ? 0.696  -0.480 -9.894  1.00 0.00 ? 48 GLY A CA   13 
ATOM   8826  C C    . GLY A 1 31 ? -0.185 -0.295 -8.664  1.00 0.00 ? 48 GLY A C    13 
ATOM   8827  O O    . GLY A 1 31 ? -0.734 -1.259 -8.132  1.00 0.00 ? 48 GLY A O    13 
ATOM   8828  H H    . GLY A 1 31 ? 1.610  1.229  -10.801 1.00 0.00 ? 48 GLY A H    13 
ATOM   8829  H HA2  . GLY A 1 31 ? 0.297  -1.296 -10.497 1.00 0.00 ? 48 GLY A HA2  13 
ATOM   8830  H HA3  . GLY A 1 31 ? 1.707  -0.728 -9.572  1.00 0.00 ? 48 GLY A HA3  13 
ATOM   8831  N N    . GLY A 1 32 ? -0.315 0.949  -8.218  1.00 0.00 ? 49 GLY A N    13 
ATOM   8832  C CA   . GLY A 1 32 ? -1.186 1.273  -7.095  1.00 0.00 ? 49 GLY A CA   13 
ATOM   8833  C C    . GLY A 1 32 ? -0.380 1.725  -5.885  1.00 0.00 ? 49 GLY A C    13 
ATOM   8834  O O    . GLY A 1 32 ? -0.943 2.141  -4.872  1.00 0.00 ? 49 GLY A O    13 
ATOM   8835  H H    . GLY A 1 32 ? 0.203  1.690  -8.669  1.00 0.00 ? 49 GLY A H    13 
ATOM   8836  H HA2  . GLY A 1 32 ? -1.865 2.075  -7.390  1.00 0.00 ? 49 GLY A HA2  13 
ATOM   8837  H HA3  . GLY A 1 32 ? -1.765 0.390  -6.827  1.00 0.00 ? 49 GLY A HA3  13 
ATOM   8838  N N    . THR A 1 33 ? 0.941  1.641  -5.996  1.00 0.00 ? 50 THR A N    13 
ATOM   8839  C CA   . THR A 1 33 ? 1.828  2.039  -4.909  1.00 0.00 ? 50 THR A CA   13 
ATOM   8840  C C    . THR A 1 33 ? 1.886  3.555  -4.772  1.00 0.00 ? 50 THR A C    13 
ATOM   8841  O O    . THR A 1 33 ? 2.190  4.264  -5.732  1.00 0.00 ? 50 THR A O    13 
ATOM   8842  C CB   . THR A 1 33 ? 3.255  1.498  -5.117  1.00 0.00 ? 50 THR A CB   13 
ATOM   8843  O OG1  . THR A 1 33 ? 3.216  0.069  -5.221  1.00 0.00 ? 50 THR A OG1  13 
ATOM   8844  C CG2  . THR A 1 33 ? 4.151  1.894  -3.953  1.00 0.00 ? 50 THR A CG2  13 
ATOM   8845  H H    . THR A 1 33 ? 1.342  1.293  -6.855  1.00 0.00 ? 50 THR A H    13 
ATOM   8846  H HA   . THR A 1 33 ? 1.445  1.658  -3.962  1.00 0.00 ? 50 THR A HA   13 
ATOM   8847  H HB   . THR A 1 33 ? 3.659  1.911  -6.042  1.00 0.00 ? 50 THR A HB   13 
ATOM   8848  H HG1  . THR A 1 33 ? 3.329  -0.188 -6.139  1.00 0.00 ? 50 THR A HG1  13 
ATOM   8849  H HG21 . THR A 1 33 ? 3.748  1.481  -3.029  1.00 0.00 ? 50 THR A HG21 13 
ATOM   8850  H HG22 . THR A 1 33 ? 5.154  1.503  -4.118  1.00 0.00 ? 50 THR A HG22 13 
ATOM   8851  H HG23 . THR A 1 33 ? 4.191  2.980  -3.879  1.00 0.00 ? 50 THR A HG23 13 
ATOM   8852  N N    . ARG A 1 34 ? 1.593  4.048  -3.573  1.00 0.00 ? 51 ARG A N    13 
ATOM   8853  C CA   . ARG A 1 34 ? 1.683  5.475  -3.289  1.00 0.00 ? 51 ARG A CA   13 
ATOM   8854  C C    . ARG A 1 34 ? 3.052  5.841  -2.730  1.00 0.00 ? 51 ARG A C    13 
ATOM   8855  O O    . ARG A 1 34 ? 3.404  5.448  -1.619  1.00 0.00 ? 51 ARG A O    13 
ATOM   8856  C CB   . ARG A 1 34 ? 0.563  5.949  -2.374  1.00 0.00 ? 51 ARG A CB   13 
ATOM   8857  C CG   . ARG A 1 34 ? 0.586  7.434  -2.050  1.00 0.00 ? 51 ARG A CG   13 
ATOM   8858  C CD   . ARG A 1 34 ? -0.542 7.895  -1.202  1.00 0.00 ? 51 ARG A CD   13 
ATOM   8859  N NE   . ARG A 1 34 ? -0.482 9.299  -0.829  1.00 0.00 ? 51 ARG A NE   13 
ATOM   8860  C CZ   . ARG A 1 34 ? -1.320 9.895  0.040   1.00 0.00 ? 51 ARG A CZ   13 
ATOM   8861  N NH1  . ARG A 1 34 ? -2.305 9.228  0.600   1.00 0.00 ? 51 ARG A NH1  13 
ATOM   8862  N NH2  . ARG A 1 34 ? -1.142 11.179 0.298   1.00 0.00 ? 51 ARG A NH2  13 
ATOM   8863  H H    . ARG A 1 34 ? 1.301  3.417  -2.840  1.00 0.00 ? 51 ARG A H    13 
ATOM   8864  H HA   . ARG A 1 34 ? 1.562  6.043  -4.211  1.00 0.00 ? 51 ARG A HA   13 
ATOM   8865  H HB2  . ARG A 1 34 ? -0.376 5.703  -2.867  1.00 0.00 ? 51 ARG A HB2  13 
ATOM   8866  H HB3  . ARG A 1 34 ? 0.648  5.379  -1.448  1.00 0.00 ? 51 ARG A HB3  13 
ATOM   8867  H HG2  . ARG A 1 34 ? 1.515  7.661  -1.525  1.00 0.00 ? 51 ARG A HG2  13 
ATOM   8868  H HG3  . ARG A 1 34 ? 0.554  7.993  -2.986  1.00 0.00 ? 51 ARG A HG3  13 
ATOM   8869  H HD2  . ARG A 1 34 ? -1.477 7.740  -1.741  1.00 0.00 ? 51 ARG A HD2  13 
ATOM   8870  H HD3  . ARG A 1 34 ? -0.553 7.313  -0.281  1.00 0.00 ? 51 ARG A HD3  13 
ATOM   8871  H HE   . ARG A 1 34 ? 0.155  10.020 -1.137  1.00 0.00 ? 51 ARG A HE   13 
ATOM   8872  H HH11 . ARG A 1 34 ? -2.439 8.251  0.378   1.00 0.00 ? 51 ARG A HH11 13 
ATOM   8873  H HH12 . ARG A 1 34 ? -2.923 9.693  1.248   1.00 0.00 ? 51 ARG A HH12 13 
ATOM   8874  H HH21 . ARG A 1 34 ? -0.391 11.683 -0.155  1.00 0.00 ? 51 ARG A HH21 13 
ATOM   8875  H HH22 . ARG A 1 34 ? -1.756 11.651 0.945   1.00 0.00 ? 51 ARG A HH22 13 
ATOM   8876  N N    . ILE A 1 35 ? 3.820  6.595  -3.509  1.00 0.00 ? 52 ILE A N    13 
ATOM   8877  C CA   . ILE A 1 35 ? 5.151  7.021  -3.090  1.00 0.00 ? 52 ILE A CA   13 
ATOM   8878  C C    . ILE A 1 35 ? 5.124  8.438  -2.532  1.00 0.00 ? 52 ILE A C    13 
ATOM   8879  O O    . ILE A 1 35 ? 4.852  9.396  -3.255  1.00 0.00 ? 52 ILE A O    13 
ATOM   8880  C CB   . ILE A 1 35 ? 6.157  6.956  -4.253  1.00 0.00 ? 52 ILE A CB   13 
ATOM   8881  C CG1  . ILE A 1 35 ? 6.260  5.527  -4.792  1.00 0.00 ? 52 ILE A CG1  13 
ATOM   8882  C CG2  . ILE A 1 35 ? 7.521  7.459  -3.806  1.00 0.00 ? 52 ILE A CG2  13 
ATOM   8883  C CD1  . ILE A 1 35 ? 7.052  5.412  -6.074  1.00 0.00 ? 52 ILE A CD1  13 
ATOM   8884  H H    . ILE A 1 35 ? 3.474  6.879  -4.414  1.00 0.00 ? 52 ILE A H    13 
ATOM   8885  H HA   . ILE A 1 35 ? 5.509  6.406  -2.267  1.00 0.00 ? 52 ILE A HA   13 
ATOM   8886  H HB   . ILE A 1 35 ? 5.792  7.575  -5.073  1.00 0.00 ? 52 ILE A HB   13 
ATOM   8887  H HG12 . ILE A 1 35 ? 6.731  4.922  -4.018  1.00 0.00 ? 52 ILE A HG12 13 
ATOM   8888  H HG13 . ILE A 1 35 ? 5.243  5.171  -4.960  1.00 0.00 ? 52 ILE A HG13 13 
ATOM   8889  H HG21 . ILE A 1 35 ? 8.221  7.406  -4.639  1.00 0.00 ? 52 ILE A HG21 13 
ATOM   8890  H HG22 . ILE A 1 35 ? 7.436  8.491  -3.469  1.00 0.00 ? 52 ILE A HG22 13 
ATOM   8891  H HG23 . ILE A 1 35 ? 7.886  6.840  -2.986  1.00 0.00 ? 52 ILE A HG23 13 
ATOM   8892  H HD11 . ILE A 1 35 ? 8.068  5.767  -5.907  1.00 0.00 ? 52 ILE A HD11 13 
ATOM   8893  H HD12 . ILE A 1 35 ? 7.080  4.370  -6.394  1.00 0.00 ? 52 ILE A HD12 13 
ATOM   8894  H HD13 . ILE A 1 35 ? 6.580  6.016  -6.849  1.00 0.00 ? 52 ILE A HD13 13 
ATOM   8895  N N    . ILE A 1 36 ? 5.409  8.565  -1.241  1.00 0.00 ? 53 ILE A N    13 
ATOM   8896  C CA   . ILE A 1 36 ? 5.508  9.872  -0.603  1.00 0.00 ? 53 ILE A CA   13 
ATOM   8897  C C    . ILE A 1 36 ? 6.938  10.396 -0.641  1.00 0.00 ? 53 ILE A C    13 
ATOM   8898  O O    . ILE A 1 36 ? 7.877  9.695  -0.260  1.00 0.00 ? 53 ILE A O    13 
ATOM   8899  C CB   . ILE A 1 36 ? 5.027  9.826  0.859   1.00 0.00 ? 53 ILE A CB   13 
ATOM   8900  C CG1  . ILE A 1 36 ? 3.555  9.410  0.923   1.00 0.00 ? 53 ILE A CG1  13 
ATOM   8901  C CG2  . ILE A 1 36 ? 5.232  11.176 1.529   1.00 0.00 ? 53 ILE A CG2  13 
ATOM   8902  C CD1  . ILE A 1 36 ? 3.065  9.110  2.321   1.00 0.00 ? 53 ILE A CD1  13 
ATOM   8903  H H    . ILE A 1 36 ? 5.560  7.734  -0.686  1.00 0.00 ? 53 ILE A H    13 
ATOM   8904  H HA   . ILE A 1 36 ? 4.928  10.613 -1.152  1.00 0.00 ? 53 ILE A HA   13 
ATOM   8905  H HB   . ILE A 1 36 ? 5.592  9.064  1.395   1.00 0.00 ? 53 ILE A HB   13 
ATOM   8906  H HG12 . ILE A 1 36 ? 2.969  10.226 0.501   1.00 0.00 ? 53 ILE A HG12 13 
ATOM   8907  H HG13 . ILE A 1 36 ? 3.442  8.523  0.300   1.00 0.00 ? 53 ILE A HG13 13 
ATOM   8908  H HG21 . ILE A 1 36 ? 4.885  11.126 2.561   1.00 0.00 ? 53 ILE A HG21 13 
ATOM   8909  H HG22 . ILE A 1 36 ? 6.290  11.433 1.514   1.00 0.00 ? 53 ILE A HG22 13 
ATOM   8910  H HG23 . ILE A 1 36 ? 4.665  11.939 0.993   1.00 0.00 ? 53 ILE A HG23 13 
ATOM   8911  H HD11 . ILE A 1 36 ? 3.177  9.995  2.945   1.00 0.00 ? 53 ILE A HD11 13 
ATOM   8912  H HD12 . ILE A 1 36 ? 2.015  8.822  2.287   1.00 0.00 ? 53 ILE A HD12 13 
ATOM   8913  H HD13 . ILE A 1 36 ? 3.651  8.293  2.745   1.00 0.00 ? 53 ILE A HD13 13 
ATOM   8914  N N    . TYR A 1 37 ? 7.098  11.633 -1.101  1.00 0.00 ? 54 TYR A N    13 
ATOM   8915  C CA   . TYR A 1 37 ? 8.419  12.175 -1.395  1.00 0.00 ? 54 TYR A CA   13 
ATOM   8916  C C    . TYR A 1 37 ? 8.869  13.147 -0.311  1.00 0.00 ? 54 TYR A C    13 
ATOM   8917  O O    . TYR A 1 37 ? 8.116  14.033 0.093   1.00 0.00 ? 54 TYR A O    13 
ATOM   8918  C CB   . TYR A 1 37 ? 8.420  12.872 -2.757  1.00 0.00 ? 54 TYR A CB   13 
ATOM   8919  C CG   . TYR A 1 37 ? 8.166  11.942 -3.922  1.00 0.00 ? 54 TYR A CG   13 
ATOM   8920  C CD1  . TYR A 1 37 ? 9.156  11.083 -4.376  1.00 0.00 ? 54 TYR A CD1  13 
ATOM   8921  C CD2  . TYR A 1 37 ? 6.936  11.925 -4.566  1.00 0.00 ? 54 TYR A CD2  13 
ATOM   8922  C CE1  . TYR A 1 37 ? 8.929  10.231 -5.439  1.00 0.00 ? 54 TYR A CE1  13 
ATOM   8923  C CE2  . TYR A 1 37 ? 6.698  11.076 -5.630  1.00 0.00 ? 54 TYR A CE2  13 
ATOM   8924  C CZ   . TYR A 1 37 ? 7.699  10.231 -6.064  1.00 0.00 ? 54 TYR A CZ   13 
ATOM   8925  O OH   . TYR A 1 37 ? 7.468  9.385  -7.125  1.00 0.00 ? 54 TYR A OH   13 
ATOM   8926  H H    . TYR A 1 37 ? 6.284  12.210 -1.251  1.00 0.00 ? 54 TYR A H    13 
ATOM   8927  H HA   . TYR A 1 37 ? 9.154  11.370 -1.415  1.00 0.00 ? 54 TYR A HA   13 
ATOM   8928  H HB2  . TYR A 1 37 ? 7.644  13.639 -2.729  1.00 0.00 ? 54 TYR A HB2  13 
ATOM   8929  H HB3  . TYR A 1 37 ? 9.395  13.345 -2.877  1.00 0.00 ? 54 TYR A HB3  13 
ATOM   8930  H HD1  . TYR A 1 37 ? 10.125 11.087 -3.878  1.00 0.00 ? 54 TYR A HD1  13 
ATOM   8931  H HD2  . TYR A 1 37 ? 6.152  12.596 -4.218  1.00 0.00 ? 54 TYR A HD2  13 
ATOM   8932  H HE1  . TYR A 1 37 ? 9.719  9.563  -5.780  1.00 0.00 ? 54 TYR A HE1  13 
ATOM   8933  H HE2  . TYR A 1 37 ? 5.728  11.075 -6.126  1.00 0.00 ? 54 TYR A HE2  13 
ATOM   8934  H HH   . TYR A 1 37 ? 8.228  8.841  -7.343  1.00 0.00 ? 54 TYR A HH   13 
ATOM   8935  N N    . ASP A 1 38 ? 10.100 12.974 0.157   1.00 0.00 ? 55 ASP A N    13 
ATOM   8936  C CA   . ASP A 1 38 ? 10.706 13.919 1.087   1.00 0.00 ? 55 ASP A CA   13 
ATOM   8937  C C    . ASP A 1 38 ? 11.667 14.859 0.371   1.00 0.00 ? 55 ASP A C    13 
ATOM   8938  O O    . ASP A 1 38 ? 12.776 14.467 0.006   1.00 0.00 ? 55 ASP A O    13 
ATOM   8939  C CB   . ASP A 1 38 ? 11.435 13.176 2.209   1.00 0.00 ? 55 ASP A CB   13 
ATOM   8940  C CG   . ASP A 1 38 ? 12.066 14.081 3.258   1.00 0.00 ? 55 ASP A CG   13 
ATOM   8941  O OD1  . ASP A 1 38 ? 12.030 15.276 3.082   1.00 0.00 ? 55 ASP A OD1  13 
ATOM   8942  O OD2  . ASP A 1 38 ? 12.436 13.586 4.295   1.00 0.00 ? 55 ASP A OD2  13 
ATOM   8943  H H    . ASP A 1 38 ? 10.631 12.168 -0.140  1.00 0.00 ? 55 ASP A H    13 
ATOM   8944  H HA   . ASP A 1 38 ? 9.932  14.547 1.532   1.00 0.00 ? 55 ASP A HA   13 
ATOM   8945  H HB2  . ASP A 1 38 ? 10.820 12.423 2.703   1.00 0.00 ? 55 ASP A HB2  13 
ATOM   8946  H HB3  . ASP A 1 38 ? 12.220 12.684 1.634   1.00 0.00 ? 55 ASP A HB3  13 
ATOM   8947  N N    . ARG A 1 39 ? 11.237 16.100 0.174   1.00 0.00 ? 56 ARG A N    13 
ATOM   8948  C CA   . ARG A 1 39 ? 12.013 17.068 -0.592  1.00 0.00 ? 56 ARG A CA   13 
ATOM   8949  C C    . ARG A 1 39 ? 13.129 17.670 0.251   1.00 0.00 ? 56 ARG A C    13 
ATOM   8950  O O    . ARG A 1 39 ? 12.899 18.111 1.378   1.00 0.00 ? 56 ARG A O    13 
ATOM   8951  C CB   . ARG A 1 39 ? 11.137 18.146 -1.210  1.00 0.00 ? 56 ARG A CB   13 
ATOM   8952  C CG   . ARG A 1 39 ? 11.738 18.843 -2.422  1.00 0.00 ? 56 ARG A CG   13 
ATOM   8953  C CD   . ARG A 1 39 ? 10.856 19.868 -3.038  1.00 0.00 ? 56 ARG A CD   13 
ATOM   8954  N NE   . ARG A 1 39 ? 10.769 21.113 -2.294  1.00 0.00 ? 56 ARG A NE   13 
ATOM   8955  C CZ   . ARG A 1 39 ? 10.013 22.168 -2.654  1.00 0.00 ? 56 ARG A CZ   13 
ATOM   8956  N NH1  . ARG A 1 39 ? 9.307  22.150 -3.763  1.00 0.00 ? 56 ARG A NH1  13 
ATOM   8957  N NH2  . ARG A 1 39 ? 10.016 23.235 -1.873  1.00 0.00 ? 56 ARG A NH2  13 
ATOM   8958  H H    . ARG A 1 39 ? 10.349 16.381 0.565   1.00 0.00 ? 56 ARG A H    13 
ATOM   8959  H HA   . ARG A 1 39 ? 12.495 16.570 -1.434  1.00 0.00 ? 56 ARG A HA   13 
ATOM   8960  H HB2  . ARG A 1 39 ? 10.200 17.670 -1.497  1.00 0.00 ? 56 ARG A HB2  13 
ATOM   8961  H HB3  . ARG A 1 39 ? 10.945 18.885 -0.431  1.00 0.00 ? 56 ARG A HB3  13 
ATOM   8962  H HG2  . ARG A 1 39 ? 12.661 19.333 -2.117  1.00 0.00 ? 56 ARG A HG2  13 
ATOM   8963  H HG3  . ARG A 1 39 ? 11.959 18.089 -3.178  1.00 0.00 ? 56 ARG A HG3  13 
ATOM   8964  H HD2  . ARG A 1 39 ? 11.234 20.107 -4.031  1.00 0.00 ? 56 ARG A HD2  13 
ATOM   8965  H HD3  . ARG A 1 39 ? 9.848  19.465 -3.120  1.00 0.00 ? 56 ARG A HD3  13 
ATOM   8966  H HE   . ARG A 1 39 ? 11.229 21.385 -1.435  1.00 0.00 ? 56 ARG A HE   13 
ATOM   8967  H HH11 . ARG A 1 39 ? 9.329  21.333 -4.358  1.00 0.00 ? 56 ARG A HH11 13 
ATOM   8968  H HH12 . ARG A 1 39 ? 8.747  22.950 -4.015  1.00 0.00 ? 56 ARG A HH12 13 
ATOM   8969  H HH21 . ARG A 1 39 ? 10.579 23.240 -1.033  1.00 0.00 ? 56 ARG A HH21 13 
ATOM   8970  H HH22 . ARG A 1 39 ? 9.459  24.039 -2.120  1.00 0.00 ? 56 ARG A HH22 13 
ATOM   8971  N N    . LYS A 1 40 ? 14.337 17.687 -0.300  1.00 0.00 ? 57 LYS A N    13 
ATOM   8972  C CA   . LYS A 1 40 ? 15.468 18.337 0.353   1.00 0.00 ? 57 LYS A CA   13 
ATOM   8973  C C    . LYS A 1 40 ? 15.100 19.735 0.832   1.00 0.00 ? 57 LYS A C    13 
ATOM   8974  O O    . LYS A 1 40 ? 15.504 20.157 1.914   1.00 0.00 ? 57 LYS A O    13 
ATOM   8975  C CB   . LYS A 1 40 ? 16.668 18.404 -0.593  1.00 0.00 ? 57 LYS A CB   13 
ATOM   8976  C CG   . LYS A 1 40 ? 17.901 19.069 0.000   1.00 0.00 ? 57 LYS A CG   13 
ATOM   8977  C CD   . LYS A 1 40 ? 19.072 19.031 -0.970  1.00 0.00 ? 57 LYS A CD   13 
ATOM   8978  C CE   . LYS A 1 40 ? 20.289 19.745 -0.400  1.00 0.00 ? 57 LYS A CE   13 
ATOM   8979  N NZ   . LYS A 1 40 ? 21.451 19.692 -1.328  1.00 0.00 ? 57 LYS A NZ   13 
ATOM   8980  H H    . LYS A 1 40 ? 14.476 17.240 -1.194  1.00 0.00 ? 57 LYS A H    13 
ATOM   8981  H HA   . LYS A 1 40 ? 15.757 17.771 1.241   1.00 0.00 ? 57 LYS A HA   13 
ATOM   8982  H HB2  . LYS A 1 40 ? 16.909 17.378 -0.876  1.00 0.00 ? 57 LYS A HB2  13 
ATOM   8983  H HB3  . LYS A 1 40 ? 16.348 18.956 -1.477  1.00 0.00 ? 57 LYS A HB3  13 
ATOM   8984  H HG2  . LYS A 1 40 ? 17.657 20.106 0.234   1.00 0.00 ? 57 LYS A HG2  13 
ATOM   8985  H HG3  . LYS A 1 40 ? 18.172 18.545 0.916   1.00 0.00 ? 57 LYS A HG3  13 
ATOM   8986  H HD2  . LYS A 1 40 ? 19.323 17.989 -1.172  1.00 0.00 ? 57 LYS A HD2  13 
ATOM   8987  H HD3  . LYS A 1 40 ? 18.770 19.517 -1.899  1.00 0.00 ? 57 LYS A HD3  13 
ATOM   8988  H HE2  . LYS A 1 40 ? 20.020 20.784 -0.214  1.00 0.00 ? 57 LYS A HE2  13 
ATOM   8989  H HE3  . LYS A 1 40 ? 20.555 19.265 0.542   1.00 0.00 ? 57 LYS A HE3  13 
ATOM   8990  H HZ1  . LYS A 1 40 ? 21.205 20.138 -2.201  1.00 0.00 ? 57 LYS A HZ1  13 
ATOM   8991  H HZ2  . LYS A 1 40 ? 22.235 20.176 -0.913  1.00 0.00 ? 57 LYS A HZ2  13 
ATOM   8992  H HZ3  . LYS A 1 40 ? 21.702 18.729 -1.501  1.00 0.00 ? 57 LYS A HZ3  13 
ATOM   8993  N N    . PHE A 1 41 ? 14.330 20.450 0.017   1.00 0.00 ? 58 PHE A N    13 
ATOM   8994  C CA   . PHE A 1 41 ? 13.938 21.817 0.338   1.00 0.00 ? 58 PHE A CA   13 
ATOM   8995  C C    . PHE A 1 41 ? 12.454 21.901 0.669   1.00 0.00 ? 58 PHE A C    13 
ATOM   8996  O O    . PHE A 1 41 ? 11.800 22.906 0.384   1.00 0.00 ? 58 PHE A O    13 
ATOM   8997  C CB   . PHE A 1 41 ? 14.273 22.755 -0.823  1.00 0.00 ? 58 PHE A CB   13 
ATOM   8998  C CG   . PHE A 1 41 ? 15.725 22.751 -1.207  1.00 0.00 ? 58 PHE A CG   13 
ATOM   8999  C CD1  . PHE A 1 41 ? 16.667 23.398 -0.422  1.00 0.00 ? 58 PHE A CD1  13 
ATOM   9000  C CD2  . PHE A 1 41 ? 16.153 22.098 -2.355  1.00 0.00 ? 58 PHE A CD2  13 
ATOM   9001  C CE1  . PHE A 1 41 ? 18.003 23.396 -0.774  1.00 0.00 ? 58 PHE A CE1  13 
ATOM   9002  C CE2  . PHE A 1 41 ? 17.489 22.093 -2.708  1.00 0.00 ? 58 PHE A CE2  13 
ATOM   9003  C CZ   . PHE A 1 41 ? 18.414 22.742 -1.918  1.00 0.00 ? 58 PHE A CZ   13 
ATOM   9004  H H    . PHE A 1 41 ? 14.009 20.035 -0.846  1.00 0.00 ? 58 PHE A H    13 
ATOM   9005  H HA   . PHE A 1 41 ? 14.474 22.157 1.225   1.00 0.00 ? 58 PHE A HA   13 
ATOM   9006  H HB2  . PHE A 1 41 ? 13.715 22.465 -1.712  1.00 0.00 ? 58 PHE A HB2  13 
ATOM   9007  H HB3  . PHE A 1 41 ? 14.024 23.782 -0.559  1.00 0.00 ? 58 PHE A HB3  13 
ATOM   9008  H HD1  . PHE A 1 41 ? 16.343 23.914 0.483   1.00 0.00 ? 58 PHE A HD1  13 
ATOM   9009  H HD2  . PHE A 1 41 ? 15.421 21.586 -2.979  1.00 0.00 ? 58 PHE A HD2  13 
ATOM   9010  H HE1  . PHE A 1 41 ? 18.733 23.909 -0.148  1.00 0.00 ? 58 PHE A HE1  13 
ATOM   9011  H HE2  . PHE A 1 41 ? 17.811 21.578 -3.611  1.00 0.00 ? 58 PHE A HE2  13 
ATOM   9012  H HZ   . PHE A 1 41 ? 19.468 22.739 -2.196  1.00 0.00 ? 58 PHE A HZ   13 
ATOM   9013  N N    . LEU A 1 42 ? 11.927 20.841 1.271   1.00 0.00 ? 59 LEU A N    13 
ATOM   9014  C CA   . LEU A 1 42 ? 10.508 20.776 1.604   1.00 0.00 ? 59 LEU A CA   13 
ATOM   9015  C C    . LEU A 1 42 ? 10.105 21.921 2.525   1.00 0.00 ? 59 LEU A C    13 
ATOM   9016  O O    . LEU A 1 42 ? 10.638 22.062 3.625   1.00 0.00 ? 59 LEU A O    13 
ATOM   9017  C CB   . LEU A 1 42 ? 10.178 19.427 2.254   1.00 0.00 ? 59 LEU A CB   13 
ATOM   9018  C CG   . LEU A 1 42 ? 8.686  19.171 2.505   1.00 0.00 ? 59 LEU A CG   13 
ATOM   9019  C CD1  . LEU A 1 42 ? 7.934  19.132 1.182   1.00 0.00 ? 59 LEU A CD1  13 
ATOM   9020  C CD2  . LEU A 1 42 ? 8.515  17.862 3.262   1.00 0.00 ? 59 LEU A CD2  13 
ATOM   9021  H H    . LEU A 1 42 ? 12.523 20.060 1.504   1.00 0.00 ? 59 LEU A H    13 
ATOM   9022  H HA   . LEU A 1 42 ? 9.915  20.885 0.697   1.00 0.00 ? 59 LEU A HA   13 
ATOM   9023  H HB2  . LEU A 1 42 ? 10.546 18.760 1.475   1.00 0.00 ? 59 LEU A HB2  13 
ATOM   9024  H HB3  . LEU A 1 42 ? 10.750 19.268 3.168   1.00 0.00 ? 59 LEU A HB3  13 
ATOM   9025  H HG   . LEU A 1 42 ? 8.322  19.975 3.144   1.00 0.00 ? 59 LEU A HG   13 
ATOM   9026  H HD11 . LEU A 1 42 ? 6.876  18.949 1.370   1.00 0.00 ? 59 LEU A HD11 13 
ATOM   9027  H HD12 . LEU A 1 42 ? 8.050  20.086 0.668   1.00 0.00 ? 59 LEU A HD12 13 
ATOM   9028  H HD13 . LEU A 1 42 ? 8.334  18.332 0.560   1.00 0.00 ? 59 LEU A HD13 13 
ATOM   9029  H HD21 . LEU A 1 42 ? 9.037  17.923 4.217   1.00 0.00 ? 59 LEU A HD21 13 
ATOM   9030  H HD22 . LEU A 1 42 ? 7.454  17.682 3.440   1.00 0.00 ? 59 LEU A HD22 13 
ATOM   9031  H HD23 . LEU A 1 42 ? 8.929  17.044 2.673   1.00 0.00 ? 59 LEU A HD23 13 
ATOM   9032  N N    . LEU A 1 43 ? 9.162  22.737 2.067   1.00 0.00 ? 60 LEU A N    13 
ATOM   9033  C CA   . LEU A 1 43 ? 8.671  23.859 2.857   1.00 0.00 ? 60 LEU A CA   13 
ATOM   9034  C C    . LEU A 1 43 ? 7.738  23.387 3.965   1.00 0.00 ? 60 LEU A C    13 
ATOM   9035  O O    . LEU A 1 43 ? 7.584  24.055 4.987   1.00 0.00 ? 60 LEU A O    13 
ATOM   9036  C CB   . LEU A 1 43 ? 7.956  24.872 1.954   1.00 0.00 ? 60 LEU A CB   13 
ATOM   9037  C CG   . LEU A 1 43 ? 8.851  25.572 0.922   1.00 0.00 ? 60 LEU A CG   13 
ATOM   9038  C CD1  . LEU A 1 43 ? 8.008  26.465 0.022   1.00 0.00 ? 60 LEU A CD1  13 
ATOM   9039  C CD2  . LEU A 1 43 ? 9.916  26.385 1.643   1.00 0.00 ? 60 LEU A CD2  13 
ATOM   9040  H H    . LEU A 1 43 ? 8.776  22.576 1.148   1.00 0.00 ? 60 LEU A H    13 
ATOM   9041  H HA   . LEU A 1 43 ? 9.508  24.355 3.349   1.00 0.00 ? 60 LEU A HA   13 
ATOM   9042  H HB2  . LEU A 1 43 ? 7.262  24.201 1.451   1.00 0.00 ? 60 LEU A HB2  13 
ATOM   9043  H HB3  . LEU A 1 43 ? 7.397  25.606 2.533   1.00 0.00 ? 60 LEU A HB3  13 
ATOM   9044  H HG   . LEU A 1 43 ? 9.355  24.794 0.350   1.00 0.00 ? 60 LEU A HG   13 
ATOM   9045  H HD11 . LEU A 1 43 ? 8.652  26.957 -0.708  1.00 0.00 ? 60 LEU A HD11 13 
ATOM   9046  H HD12 . LEU A 1 43 ? 7.267  25.859 -0.502  1.00 0.00 ? 60 LEU A HD12 13 
ATOM   9047  H HD13 . LEU A 1 43 ? 7.501  27.217 0.625   1.00 0.00 ? 60 LEU A HD13 13 
ATOM   9048  H HD21 . LEU A 1 43 ? 10.525 25.723 2.259   1.00 0.00 ? 60 LEU A HD21 13 
ATOM   9049  H HD22 . LEU A 1 43 ? 10.551 26.882 0.908   1.00 0.00 ? 60 LEU A HD22 13 
ATOM   9050  H HD23 . LEU A 1 43 ? 9.438  27.133 2.275   1.00 0.00 ? 60 LEU A HD23 13 
ATOM   9051  N N    . ASP A 1 44 ? 7.117  22.231 3.755   1.00 0.00 ? 61 ASP A N    13 
ATOM   9052  C CA   . ASP A 1 44 ? 6.243  21.638 4.760   1.00 0.00 ? 61 ASP A CA   13 
ATOM   9053  C C    . ASP A 1 44 ? 7.034  21.186 5.982   1.00 0.00 ? 61 ASP A C    13 
ATOM   9054  O O    . ASP A 1 44 ? 7.801  20.225 5.916   1.00 0.00 ? 61 ASP A O    13 
ATOM   9055  C CB   . ASP A 1 44 ? 5.470  20.457 4.169   1.00 0.00 ? 61 ASP A CB   13 
ATOM   9056  C CG   . ASP A 1 44 ? 4.470  19.818 5.123   1.00 0.00 ? 61 ASP A CG   13 
ATOM   9057  O OD1  . ASP A 1 44 ? 4.442  20.204 6.268   1.00 0.00 ? 61 ASP A OD1  13 
ATOM   9058  O OD2  . ASP A 1 44 ? 3.640  19.068 4.668   1.00 0.00 ? 61 ASP A OD2  13 
ATOM   9059  H H    . ASP A 1 44 ? 7.255  21.751 2.877   1.00 0.00 ? 61 ASP A H    13 
ATOM   9060  H HA   . ASP A 1 44 ? 5.528  22.381 5.112   1.00 0.00 ? 61 ASP A HA   13 
ATOM   9061  H HB2  . ASP A 1 44 ? 4.974  20.691 3.227   1.00 0.00 ? 61 ASP A HB2  13 
ATOM   9062  H HB3  . ASP A 1 44 ? 6.291  19.763 3.986   1.00 0.00 ? 61 ASP A HB3  13 
ATOM   9063  N N    . ARG A 1 45 ? 6.845  21.885 7.095   1.00 0.00 ? 62 ARG A N    13 
ATOM   9064  C CA   . ARG A 1 45 ? 7.539  21.556 8.335   1.00 0.00 ? 62 ARG A CA   13 
ATOM   9065  C C    . ARG A 1 45 ? 7.027  20.246 8.921   1.00 0.00 ? 62 ARG A C    13 
ATOM   9066  O O    . ARG A 1 45 ? 7.415  19.200 8.482   1.00 0.00 ? 62 ARG A O    13 
ATOM   9067  C CB   . ARG A 1 45 ? 7.468  22.687 9.350   1.00 0.00 ? 62 ARG A CB   13 
ATOM   9068  C CG   . ARG A 1 45 ? 8.262  22.451 10.625  1.00 0.00 ? 62 ARG A CG   13 
ATOM   9069  C CD   . ARG A 1 45 ? 8.225  23.583 11.587  1.00 0.00 ? 62 ARG A CD   13 
ATOM   9070  N NE   . ARG A 1 45 ? 9.006  23.373 12.795  1.00 0.00 ? 62 ARG A NE   13 
ATOM   9071  C CZ   . ARG A 1 45 ? 9.124  24.267 13.795  1.00 0.00 ? 62 ARG A CZ   13 
ATOM   9072  N NH1  . ARG A 1 45 ? 8.545  25.445 13.722  1.00 0.00 ? 62 ARG A NH1  13 
ATOM   9073  N NH2  . ARG A 1 45 ? 9.857  23.938 14.845  1.00 0.00 ? 62 ARG A NH2  13 
ATOM   9074  O OXT  . ARG A 1 45 ? 6.235  20.263 9.823   1.00 0.00 ? 62 ARG A OXT  13 
ATOM   9075  H H    . ARG A 1 45 ? 6.202  22.665 7.083   1.00 0.00 ? 62 ARG A H    13 
ATOM   9076  H HA   . ARG A 1 45 ? 8.601  21.412 8.135   1.00 0.00 ? 62 ARG A HA   13 
ATOM   9077  H HB2  . ARG A 1 45 ? 7.841  23.582 8.855   1.00 0.00 ? 62 ARG A HB2  13 
ATOM   9078  H HB3  . ARG A 1 45 ? 6.416  22.822 9.602   1.00 0.00 ? 62 ARG A HB3  13 
ATOM   9079  H HG2  . ARG A 1 45 ? 7.859  21.572 11.127  1.00 0.00 ? 62 ARG A HG2  13 
ATOM   9080  H HG3  . ARG A 1 45 ? 9.303  22.271 10.357  1.00 0.00 ? 62 ARG A HG3  13 
ATOM   9081  H HD2  . ARG A 1 45 ? 8.613  24.476 11.098  1.00 0.00 ? 62 ARG A HD2  13 
ATOM   9082  H HD3  . ARG A 1 45 ? 7.193  23.755 11.891  1.00 0.00 ? 62 ARG A HD3  13 
ATOM   9083  H HE   . ARG A 1 45 ? 9.559  22.574 13.074  1.00 0.00 ? 62 ARG A HE   13 
ATOM   9084  H HH11 . ARG A 1 45 ? 8.003  25.689 12.905  1.00 0.00 ? 62 ARG A HH11 13 
ATOM   9085  H HH12 . ARG A 1 45 ? 8.645  26.102 14.483  1.00 0.00 ? 62 ARG A HH12 13 
ATOM   9086  H HH21 . ARG A 1 45 ? 10.310 23.035 14.877  1.00 0.00 ? 62 ARG A HH21 13 
ATOM   9087  H HH22 . ARG A 1 45 ? 9.961  24.589 15.608  1.00 0.00 ? 62 ARG A HH22 13 
ATOM   9088  N N    . PRO A 1 1  ? 0.300  -0.927 -0.898  1.00 0.00 ? 18 PRO A N    14 
ATOM   9089  C CA   . PRO A 1 1  ? 1.691  -0.797 -0.480  1.00 0.00 ? 18 PRO A CA   14 
ATOM   9090  C C    . PRO A 1 1  ? 2.156  0.651  -0.562  1.00 0.00 ? 18 PRO A C    14 
ATOM   9091  O O    . PRO A 1 1  ? 1.664  1.426  -1.382  1.00 0.00 ? 18 PRO A O    14 
ATOM   9092  C CB   . PRO A 1 1  ? 2.458  -1.705 -1.446  1.00 0.00 ? 18 PRO A CB   14 
ATOM   9093  C CG   . PRO A 1 1  ? 1.637  -1.702 -2.690  1.00 0.00 ? 18 PRO A CG   14 
ATOM   9094  C CD   . PRO A 1 1  ? 0.207  -1.627 -2.224  1.00 0.00 ? 18 PRO A CD   14 
ATOM   9095  H H2   . PRO A 1 1  ? 0.064  -1.510 -1.675  1.00 0.00 ? 18 PRO A H2   14 
ATOM   9096  H H3   . PRO A 1 1  ? -0.382 -1.287 -0.260  1.00 0.00 ? 18 PRO A H3   14 
ATOM   9097  H HA   . PRO A 1 1  ? 1.850  -1.086 0.569   1.00 0.00 ? 18 PRO A HA   14 
ATOM   9098  H HB2  . PRO A 1 1  ? 3.472  -1.324 -1.637  1.00 0.00 ? 18 PRO A HB2  14 
ATOM   9099  H HB3  . PRO A 1 1  ? 2.568  -2.722 -1.042  1.00 0.00 ? 18 PRO A HB3  14 
ATOM   9100  H HG2  . PRO A 1 1  ? 1.889  -0.846 -3.332  1.00 0.00 ? 18 PRO A HG2  14 
ATOM   9101  H HG3  . PRO A 1 1  ? 1.811  -2.612 -3.283  1.00 0.00 ? 18 PRO A HG3  14 
ATOM   9102  H HD2  . PRO A 1 1  ? -0.428 -1.060 -2.921  1.00 0.00 ? 18 PRO A HD2  14 
ATOM   9103  H HD3  . PRO A 1 1  ? -0.247 -2.622 -2.113  1.00 0.00 ? 18 PRO A HD3  14 
ATOM   9104  N N    . THR A 1 2  ? 3.107  1.011  0.293   1.00 0.00 ? 19 THR A N    14 
ATOM   9105  C CA   . THR A 1 2  ? 3.623  2.374  0.336   1.00 0.00 ? 19 THR A CA   14 
ATOM   9106  C C    . THR A 1 2  ? 5.146  2.389  0.287   1.00 0.00 ? 19 THR A C    14 
ATOM   9107  O O    . THR A 1 2  ? 5.805  1.572  0.930   1.00 0.00 ? 19 THR A O    14 
ATOM   9108  C CB   . THR A 1 2  ? 3.154  3.116  1.601   1.00 0.00 ? 19 THR A CB   14 
ATOM   9109  O OG1  . THR A 1 2  ? 1.721  3.148  1.636   1.00 0.00 ? 19 THR A OG1  14 
ATOM   9110  C CG2  . THR A 1 2  ? 3.689  4.540  1.615   1.00 0.00 ? 19 THR A CG2  14 
ATOM   9111  H H    . THR A 1 2  ? 3.483  0.323  0.929   1.00 0.00 ? 19 THR A H    14 
ATOM   9112  H HA   . THR A 1 2  ? 3.281  2.926  -0.539  1.00 0.00 ? 19 THR A HA   14 
ATOM   9113  H HB   . THR A 1 2  ? 3.518  2.584  2.480   1.00 0.00 ? 19 THR A HB   14 
ATOM   9114  H HG1  . THR A 1 2  ? 1.430  3.609  2.427   1.00 0.00 ? 19 THR A HG1  14 
ATOM   9115  H HG21 . THR A 1 2  ? 3.324  5.072  0.737   1.00 0.00 ? 19 THR A HG21 14 
ATOM   9116  H HG22 . THR A 1 2  ? 3.346  5.048  2.516   1.00 0.00 ? 19 THR A HG22 14 
ATOM   9117  H HG23 . THR A 1 2  ? 4.778  4.518  1.600   1.00 0.00 ? 19 THR A HG23 14 
ATOM   9118  N N    . ARG A 1 3  ? 5.699  3.322  -0.479  1.00 0.00 ? 20 ARG A N    14 
ATOM   9119  C CA   . ARG A 1 3  ? 7.145  3.431  -0.630  1.00 0.00 ? 20 ARG A CA   14 
ATOM   9120  C C    . ARG A 1 3  ? 7.616  4.861  -0.402  1.00 0.00 ? 20 ARG A C    14 
ATOM   9121  O O    . ARG A 1 3  ? 7.027  5.810  -0.920  1.00 0.00 ? 20 ARG A O    14 
ATOM   9122  C CB   . ARG A 1 3  ? 7.624  2.894  -1.971  1.00 0.00 ? 20 ARG A CB   14 
ATOM   9123  C CG   . ARG A 1 3  ? 7.382  1.409  -2.188  1.00 0.00 ? 20 ARG A CG   14 
ATOM   9124  C CD   . ARG A 1 3  ? 8.174  0.523  -1.295  1.00 0.00 ? 20 ARG A CD   14 
ATOM   9125  N NE   . ARG A 1 3  ? 7.986  -0.898 -1.537  1.00 0.00 ? 20 ARG A NE   14 
ATOM   9126  C CZ   . ARG A 1 3  ? 7.019  -1.648 -0.974  1.00 0.00 ? 20 ARG A CZ   14 
ATOM   9127  N NH1  . ARG A 1 3  ? 6.174  -1.129 -0.113  1.00 0.00 ? 20 ARG A NH1  14 
ATOM   9128  N NH2  . ARG A 1 3  ? 6.956  -2.930 -1.295  1.00 0.00 ? 20 ARG A NH2  14 
ATOM   9129  H H    . ARG A 1 3  ? 5.102  3.973  -0.970  1.00 0.00 ? 20 ARG A H    14 
ATOM   9130  H HA   . ARG A 1 3  ? 7.642  2.818  0.121   1.00 0.00 ? 20 ARG A HA   14 
ATOM   9131  H HB2  . ARG A 1 3  ? 7.105  3.458  -2.744  1.00 0.00 ? 20 ARG A HB2  14 
ATOM   9132  H HB3  . ARG A 1 3  ? 8.693  3.096  -2.031  1.00 0.00 ? 20 ARG A HB3  14 
ATOM   9133  H HG2  . ARG A 1 3  ? 6.327  1.200  -2.018  1.00 0.00 ? 20 ARG A HG2  14 
ATOM   9134  H HG3  . ARG A 1 3  ? 7.639  1.163  -3.219  1.00 0.00 ? 20 ARG A HG3  14 
ATOM   9135  H HD2  . ARG A 1 3  ? 9.232  0.741  -1.429  1.00 0.00 ? 20 ARG A HD2  14 
ATOM   9136  H HD3  . ARG A 1 3  ? 7.890  0.720  -0.261  1.00 0.00 ? 20 ARG A HD3  14 
ATOM   9137  H HE   . ARG A 1 3  ? 8.514  -1.527 -2.128  1.00 0.00 ? 20 ARG A HE   14 
ATOM   9138  H HH11 . ARG A 1 3  ? 6.245  -0.153 0.137   1.00 0.00 ? 20 ARG A HH11 14 
ATOM   9139  H HH12 . ARG A 1 3  ? 5.455  -1.709 0.298   1.00 0.00 ? 20 ARG A HH12 14 
ATOM   9140  H HH21 . ARG A 1 3  ? 7.625  -3.317 -1.947  1.00 0.00 ? 20 ARG A HH21 14 
ATOM   9141  H HH22 . ARG A 1 3  ? 6.241  -3.514 -0.889  1.00 0.00 ? 20 ARG A HH22 14 
ATOM   9142  N N    . THR A 1 4  ? 8.683  5.011  0.376   1.00 0.00 ? 21 THR A N    14 
ATOM   9143  C CA   . THR A 1 4  ? 9.222  6.328  0.693   1.00 0.00 ? 21 THR A CA   14 
ATOM   9144  C C    . THR A 1 4  ? 10.397 6.675  -0.211  1.00 0.00 ? 21 THR A C    14 
ATOM   9145  O O    . THR A 1 4  ? 11.391 5.950  -0.261  1.00 0.00 ? 21 THR A O    14 
ATOM   9146  C CB   . THR A 1 4  ? 9.675  6.414  2.162   1.00 0.00 ? 21 THR A CB   14 
ATOM   9147  O OG1  . THR A 1 4  ? 8.555  6.174  3.025   1.00 0.00 ? 21 THR A OG1  14 
ATOM   9148  C CG2  . THR A 1 4  ? 10.256 7.787  2.461   1.00 0.00 ? 21 THR A CG2  14 
ATOM   9149  H H    . THR A 1 4  ? 9.133  4.190  0.756   1.00 0.00 ? 21 THR A H    14 
ATOM   9150  H HA   . THR A 1 4  ? 8.462  7.090  0.516   1.00 0.00 ? 21 THR A HA   14 
ATOM   9151  H HB   . THR A 1 4  ? 10.432 5.652  2.344   1.00 0.00 ? 21 THR A HB   14 
ATOM   9152  H HG1  . THR A 1 4  ? 8.841  6.226  3.940   1.00 0.00 ? 21 THR A HG1  14 
ATOM   9153  H HG21 . THR A 1 4  ? 9.499  8.549  2.280   1.00 0.00 ? 21 THR A HG21 14 
ATOM   9154  H HG22 . THR A 1 4  ? 10.572 7.829  3.504   1.00 0.00 ? 21 THR A HG22 14 
ATOM   9155  H HG23 . THR A 1 4  ? 11.115 7.968  1.814   1.00 0.00 ? 21 THR A HG23 14 
ATOM   9156  N N    . VAL A 1 5  ? 10.278 7.789  -0.926  1.00 0.00 ? 22 VAL A N    14 
ATOM   9157  C CA   . VAL A 1 5  ? 11.345 8.252  -1.806  1.00 0.00 ? 22 VAL A CA   14 
ATOM   9158  C C    . VAL A 1 5  ? 11.748 9.684  -1.477  1.00 0.00 ? 22 VAL A C    14 
ATOM   9159  O O    . VAL A 1 5  ? 10.910 10.585 -1.457  1.00 0.00 ? 22 VAL A O    14 
ATOM   9160  C CB   . VAL A 1 5  ? 10.931 8.174  -3.287  1.00 0.00 ? 22 VAL A CB   14 
ATOM   9161  C CG1  . VAL A 1 5  ? 12.026 8.739  -4.178  1.00 0.00 ? 22 VAL A CG1  14 
ATOM   9162  C CG2  . VAL A 1 5  ? 10.617 6.737  -3.677  1.00 0.00 ? 22 VAL A CG2  14 
ATOM   9163  H H    . VAL A 1 5  ? 9.427  8.329  -0.858  1.00 0.00 ? 22 VAL A H    14 
ATOM   9164  H HA   . VAL A 1 5  ? 12.255 7.667  -1.668  1.00 0.00 ? 22 VAL A HA   14 
ATOM   9165  H HB   . VAL A 1 5  ? 10.015 8.747  -3.429  1.00 0.00 ? 22 VAL A HB   14 
ATOM   9166  H HG11 . VAL A 1 5  ? 11.716 8.676  -5.221  1.00 0.00 ? 22 VAL A HG11 14 
ATOM   9167  H HG12 . VAL A 1 5  ? 12.206 9.782  -3.916  1.00 0.00 ? 22 VAL A HG12 14 
ATOM   9168  H HG13 . VAL A 1 5  ? 12.942 8.166  -4.037  1.00 0.00 ? 22 VAL A HG13 14 
ATOM   9169  H HG21 . VAL A 1 5  ? 9.801  6.362  -3.061  1.00 0.00 ? 22 VAL A HG21 14 
ATOM   9170  H HG22 . VAL A 1 5  ? 10.325 6.700  -4.727  1.00 0.00 ? 22 VAL A HG22 14 
ATOM   9171  H HG23 . VAL A 1 5  ? 11.501 6.119  -3.524  1.00 0.00 ? 22 VAL A HG23 14 
ATOM   9172  N N    . ALA A 1 6  ? 13.036 9.886  -1.219  1.00 0.00 ? 23 ALA A N    14 
ATOM   9173  C CA   . ALA A 1 6  ? 13.564 11.221 -0.959  1.00 0.00 ? 23 ALA A CA   14 
ATOM   9174  C C    . ALA A 1 6  ? 13.935 11.928 -2.256  1.00 0.00 ? 23 ALA A C    14 
ATOM   9175  O O    . ALA A 1 6  ? 14.392 11.298 -3.209  1.00 0.00 ? 23 ALA A O    14 
ATOM   9176  C CB   . ALA A 1 6  ? 14.768 11.142 -0.032  1.00 0.00 ? 23 ALA A CB   14 
ATOM   9177  H H    . ALA A 1 6  ? 13.664 9.097  -1.202  1.00 0.00 ? 23 ALA A H    14 
ATOM   9178  H HA   . ALA A 1 6  ? 12.790 11.815 -0.474  1.00 0.00 ? 23 ALA A HA   14 
ATOM   9179  H HB1  . ALA A 1 6  ? 15.546 10.537 -0.496  1.00 0.00 ? 23 ALA A HB1  14 
ATOM   9180  H HB2  . ALA A 1 6  ? 15.151 12.146 0.152   1.00 0.00 ? 23 ALA A HB2  14 
ATOM   9181  H HB3  . ALA A 1 6  ? 14.470 10.688 0.914   1.00 0.00 ? 23 ALA A HB3  14 
ATOM   9182  N N    . ILE A 1 7  ? 13.733 13.241 -2.286  1.00 0.00 ? 24 ILE A N    14 
ATOM   9183  C CA   . ILE A 1 7  ? 14.032 14.036 -3.470  1.00 0.00 ? 24 ILE A CA   14 
ATOM   9184  C C    . ILE A 1 7  ? 14.421 15.460 -3.096  1.00 0.00 ? 24 ILE A C    14 
ATOM   9185  O O    . ILE A 1 7  ? 13.899 16.023 -2.134  1.00 0.00 ? 24 ILE A O    14 
ATOM   9186  C CB   . ILE A 1 7  ? 12.836 14.078 -4.440  1.00 0.00 ? 24 ILE A CB   14 
ATOM   9187  C CG1  . ILE A 1 7  ? 13.252 14.702 -5.774  1.00 0.00 ? 24 ILE A CG1  14 
ATOM   9188  C CG2  . ILE A 1 7  ? 11.681 14.852 -3.824  1.00 0.00 ? 24 ILE A CG2  14 
ATOM   9189  C CD1  . ILE A 1 7  ? 14.205 13.846 -6.579  1.00 0.00 ? 24 ILE A CD1  14 
ATOM   9190  H H    . ILE A 1 7  ? 13.363 13.701 -1.466  1.00 0.00 ? 24 ILE A H    14 
ATOM   9191  H HA   . ILE A 1 7  ? 14.905 13.639 -3.989  1.00 0.00 ? 24 ILE A HA   14 
ATOM   9192  H HB   . ILE A 1 7  ? 12.517 13.059 -4.655  1.00 0.00 ? 24 ILE A HB   14 
ATOM   9193  H HG12 . ILE A 1 7  ? 12.344 14.874 -6.350  1.00 0.00 ? 24 ILE A HG12 14 
ATOM   9194  H HG13 . ILE A 1 7  ? 13.725 15.659 -5.552  1.00 0.00 ? 24 ILE A HG13 14 
ATOM   9195  H HG21 . ILE A 1 7  ? 10.844 14.873 -4.522  1.00 0.00 ? 24 ILE A HG21 14 
ATOM   9196  H HG22 . ILE A 1 7  ? 11.370 14.367 -2.900  1.00 0.00 ? 24 ILE A HG22 14 
ATOM   9197  H HG23 . ILE A 1 7  ? 11.998 15.873 -3.609  1.00 0.00 ? 24 ILE A HG23 14 
ATOM   9198  H HD11 . ILE A 1 7  ? 13.733 12.891 -6.803  1.00 0.00 ? 24 ILE A HD11 14 
ATOM   9199  H HD12 . ILE A 1 7  ? 14.454 14.354 -7.510  1.00 0.00 ? 24 ILE A HD12 14 
ATOM   9200  H HD13 . ILE A 1 7  ? 15.116 13.676 -6.004  1.00 0.00 ? 24 ILE A HD13 14 
ATOM   9201  N N    . SER A 1 8  ? 15.342 16.038 -3.861  1.00 0.00 ? 25 SER A N    14 
ATOM   9202  C CA   . SER A 1 8  ? 15.779 17.409 -3.630  1.00 0.00 ? 25 SER A CA   14 
ATOM   9203  C C    . SER A 1 8  ? 14.613 18.385 -3.735  1.00 0.00 ? 25 SER A C    14 
ATOM   9204  O O    . SER A 1 8  ? 14.323 19.123 -2.795  1.00 0.00 ? 25 SER A O    14 
ATOM   9205  C CB   . SER A 1 8  ? 16.871 17.782 -4.613  1.00 0.00 ? 25 SER A CB   14 
ATOM   9206  O OG   . SER A 1 8  ? 18.045 17.048 -4.400  1.00 0.00 ? 25 SER A OG   14 
ATOM   9207  H H    . SER A 1 8  ? 15.748 15.513 -4.622  1.00 0.00 ? 25 SER A H    14 
ATOM   9208  H HA   . SER A 1 8  ? 16.291 17.545 -2.676  1.00 0.00 ? 25 SER A HA   14 
ATOM   9209  H HB2  . SER A 1 8  ? 16.511 17.588 -5.624  1.00 0.00 ? 25 SER A HB2  14 
ATOM   9210  H HB3  . SER A 1 8  ? 17.092 18.842 -4.505  1.00 0.00 ? 25 SER A HB3  14 
ATOM   9211  H HG   . SER A 1 8  ? 18.709 17.313 -5.041  1.00 0.00 ? 25 SER A HG   14 
ATOM   9212  N N    . ASP A 1 9  ? 13.949 18.382 -4.886  1.00 0.00 ? 26 ASP A N    14 
ATOM   9213  C CA   . ASP A 1 9  ? 12.833 19.288 -5.129  1.00 0.00 ? 26 ASP A CA   14 
ATOM   9214  C C    . ASP A 1 9  ? 11.728 18.601 -5.923  1.00 0.00 ? 26 ASP A C    14 
ATOM   9215  O O    . ASP A 1 9  ? 11.962 17.587 -6.581  1.00 0.00 ? 26 ASP A O    14 
ATOM   9216  C CB   . ASP A 1 9  ? 13.309 20.540 -5.867  1.00 0.00 ? 26 ASP A CB   14 
ATOM   9217  C CG   . ASP A 1 9  ? 14.021 21.557 -4.985  1.00 0.00 ? 26 ASP A CG   14 
ATOM   9218  O OD1  . ASP A 1 9  ? 13.382 22.124 -4.130  1.00 0.00 ? 26 ASP A OD1  14 
ATOM   9219  O OD2  . ASP A 1 9  ? 15.222 21.646 -5.065  1.00 0.00 ? 26 ASP A OD2  14 
ATOM   9220  H H    . ASP A 1 9  ? 14.224 17.735 -5.612  1.00 0.00 ? 26 ASP A H    14 
ATOM   9221  H HA   . ASP A 1 9  ? 12.390 19.590 -4.179  1.00 0.00 ? 26 ASP A HA   14 
ATOM   9222  H HB2  . ASP A 1 9  ? 13.925 20.323 -6.740  1.00 0.00 ? 26 ASP A HB2  14 
ATOM   9223  H HB3  . ASP A 1 9  ? 12.350 20.948 -6.190  1.00 0.00 ? 26 ASP A HB3  14 
ATOM   9224  N N    . ALA A 1 10 ? 10.524 19.159 -5.855  1.00 0.00 ? 27 ALA A N    14 
ATOM   9225  C CA   . ALA A 1 10 ? 9.394  18.635 -6.614  1.00 0.00 ? 27 ALA A CA   14 
ATOM   9226  C C    . ALA A 1 10 ? 9.623  18.781 -8.113  1.00 0.00 ? 27 ALA A C    14 
ATOM   9227  O O    . ALA A 1 10 ? 9.075  18.021 -8.911  1.00 0.00 ? 27 ALA A O    14 
ATOM   9228  C CB   . ALA A 1 10 ? 8.109  19.336 -6.200  1.00 0.00 ? 27 ALA A CB   14 
ATOM   9229  H H    . ALA A 1 10 ? 10.388 19.967 -5.265  1.00 0.00 ? 27 ALA A H    14 
ATOM   9230  H HA   . ALA A 1 10 ? 9.295  17.570 -6.403  1.00 0.00 ? 27 ALA A HA   14 
ATOM   9231  H HB1  . ALA A 1 10 ? 8.198  20.404 -6.390  1.00 0.00 ? 27 ALA A HB1  14 
ATOM   9232  H HB2  . ALA A 1 10 ? 7.275  18.933 -6.775  1.00 0.00 ? 27 ALA A HB2  14 
ATOM   9233  H HB3  . ALA A 1 10 ? 7.929  19.169 -5.138  1.00 0.00 ? 27 ALA A HB3  14 
ATOM   9234  N N    . ALA A 1 11 ? 10.434 19.764 -8.490  1.00 0.00 ? 28 ALA A N    14 
ATOM   9235  C CA   . ALA A 1 11 ? 10.799 19.962 -9.888  1.00 0.00 ? 28 ALA A CA   14 
ATOM   9236  C C    . ALA A 1 11 ? 11.566 18.765 -10.432 1.00 0.00 ? 28 ALA A C    14 
ATOM   9237  O O    . ALA A 1 11 ? 11.609 18.540 -11.642 1.00 0.00 ? 28 ALA A O    14 
ATOM   9238  C CB   . ALA A 1 11 ? 11.615 21.236 -10.047 1.00 0.00 ? 28 ALA A CB   14 
ATOM   9239  H H    . ALA A 1 11 ? 10.808 20.389 -7.790  1.00 0.00 ? 28 ALA A H    14 
ATOM   9240  H HA   . ALA A 1 11 ? 9.886  20.058 -10.477 1.00 0.00 ? 28 ALA A HA   14 
ATOM   9241  H HB1  . ALA A 1 11 ? 12.523 21.163 -9.451  1.00 0.00 ? 28 ALA A HB1  14 
ATOM   9242  H HB2  . ALA A 1 11 ? 11.879 21.371 -11.096 1.00 0.00 ? 28 ALA A HB2  14 
ATOM   9243  H HB3  . ALA A 1 11 ? 11.027 22.091 -9.709  1.00 0.00 ? 28 ALA A HB3  14 
ATOM   9244  N N    . GLN A 1 12 ? 12.173 17.998 -9.532  1.00 0.00 ? 29 GLN A N    14 
ATOM   9245  C CA   . GLN A 1 12 ? 13.015 16.875 -9.925  1.00 0.00 ? 29 GLN A CA   14 
ATOM   9246  C C    . GLN A 1 12 ? 12.226 15.572 -9.935  1.00 0.00 ? 29 GLN A C    14 
ATOM   9247  O O    . GLN A 1 12 ? 12.786 14.497 -10.150 1.00 0.00 ? 29 GLN A O    14 
ATOM   9248  C CB   . GLN A 1 12 ? 14.212 16.746 -8.980  1.00 0.00 ? 29 GLN A CB   14 
ATOM   9249  C CG   . GLN A 1 12 ? 15.076 17.994 -8.896  1.00 0.00 ? 29 GLN A CG   14 
ATOM   9250  C CD   . GLN A 1 12 ? 15.675 18.375 -10.237 1.00 0.00 ? 29 GLN A CD   14 
ATOM   9251  O OE1  . GLN A 1 12 ? 16.232 17.531 -10.945 1.00 0.00 ? 29 GLN A OE1  14 
ATOM   9252  N NE2  . GLN A 1 12 ? 15.568 19.650 -10.592 1.00 0.00 ? 29 GLN A NE2  14 
ATOM   9253  H H    . GLN A 1 12 ? 12.047 18.199 -8.550  1.00 0.00 ? 29 GLN A H    14 
ATOM   9254  H HA   . GLN A 1 12 ? 13.375 17.027 -10.942 1.00 0.00 ? 29 GLN A HA   14 
ATOM   9255  H HB2  . GLN A 1 12 ? 13.812 16.508 -7.995  1.00 0.00 ? 29 GLN A HB2  14 
ATOM   9256  H HB3  . GLN A 1 12 ? 14.810 15.910 -9.341  1.00 0.00 ? 29 GLN A HB3  14 
ATOM   9257  H HG2  . GLN A 1 12 ? 14.744 18.909 -8.406  1.00 0.00 ? 29 GLN A HG2  14 
ATOM   9258  H HG3  . GLN A 1 12 ? 15.852 17.521 -8.293  1.00 0.00 ? 29 GLN A HG3  14 
ATOM   9259  H HE21 . GLN A 1 12 ? 15.110 20.301 -9.986  1.00 0.00 ? 29 GLN A HE21 14 
ATOM   9260  H HE22 . GLN A 1 12 ? 15.944 19.960 -11.465 1.00 0.00 ? 29 GLN A HE22 14 
ATOM   9261  N N    . LEU A 1 13 ? 10.922 15.674 -9.701  1.00 0.00 ? 30 LEU A N    14 
ATOM   9262  C CA   . LEU A 1 13 ? 10.049 14.506 -9.702  1.00 0.00 ? 30 LEU A CA   14 
ATOM   9263  C C    . LEU A 1 13 ? 9.365  14.331 -11.051 1.00 0.00 ? 30 LEU A C    14 
ATOM   9264  O O    . LEU A 1 13 ? 8.746  15.261 -11.569 1.00 0.00 ? 30 LEU A O    14 
ATOM   9265  C CB   . LEU A 1 13 ? 9.006  14.622 -8.584  1.00 0.00 ? 30 LEU A CB   14 
ATOM   9266  C CG   . LEU A 1 13 ? 9.562  14.524 -7.158  1.00 0.00 ? 30 LEU A CG   14 
ATOM   9267  C CD1  . LEU A 1 13 ? 8.438  14.696 -6.146  1.00 0.00 ? 30 LEU A CD1  14 
ATOM   9268  C CD2  . LEU A 1 13 ? 10.253 13.181 -6.974  1.00 0.00 ? 30 LEU A CD2  14 
ATOM   9269  H H    . LEU A 1 13 ? 10.525 16.585 -9.518  1.00 0.00 ? 30 LEU A H    14 
ATOM   9270  H HA   . LEU A 1 13 ? 10.643 13.607 -9.538  1.00 0.00 ? 30 LEU A HA   14 
ATOM   9271  H HB2  . LEU A 1 13 ? 8.652  15.634 -8.778  1.00 0.00 ? 30 LEU A HB2  14 
ATOM   9272  H HB3  . LEU A 1 13 ? 8.186  13.919 -8.723  1.00 0.00 ? 30 LEU A HB3  14 
ATOM   9273  H HG   . LEU A 1 13 ? 10.317 15.304 -7.050  1.00 0.00 ? 30 LEU A HG   14 
ATOM   9274  H HD11 . LEU A 1 13 ? 8.843  14.624 -5.136  1.00 0.00 ? 30 LEU A HD11 14 
ATOM   9275  H HD12 . LEU A 1 13 ? 7.974  15.673 -6.281  1.00 0.00 ? 30 LEU A HD12 14 
ATOM   9276  H HD13 . LEU A 1 13 ? 7.692  13.916 -6.294  1.00 0.00 ? 30 LEU A HD13 14 
ATOM   9277  H HD21 . LEU A 1 13 ? 11.070 13.090 -7.689  1.00 0.00 ? 30 LEU A HD21 14 
ATOM   9278  H HD22 . LEU A 1 13 ? 10.648 13.111 -5.960  1.00 0.00 ? 30 LEU A HD22 14 
ATOM   9279  H HD23 . LEU A 1 13 ? 9.535  12.376 -7.139  1.00 0.00 ? 30 LEU A HD23 14 
ATOM   9280  N N    . PRO A 1 14 ? 9.478  13.134 -11.617 1.00 0.00 ? 31 PRO A N    14 
ATOM   9281  C CA   . PRO A 1 14 ? 8.752  12.788 -12.833 1.00 0.00 ? 31 PRO A CA   14 
ATOM   9282  C C    . PRO A 1 14 ? 7.256  13.020 -12.665 1.00 0.00 ? 31 PRO A C    14 
ATOM   9283  O O    . PRO A 1 14 ? 6.678  12.686 -11.630 1.00 0.00 ? 31 PRO A O    14 
ATOM   9284  C CB   . PRO A 1 14 ? 9.085  11.310 -13.060 1.00 0.00 ? 31 PRO A CB   14 
ATOM   9285  C CG   . PRO A 1 14 ? 10.368 11.102 -12.332 1.00 0.00 ? 31 PRO A CG   14 
ATOM   9286  C CD   . PRO A 1 14 ? 10.286 11.986 -11.116 1.00 0.00 ? 31 PRO A CD   14 
ATOM   9287  H HA   . PRO A 1 14 ? 9.041  13.411 -13.692 1.00 0.00 ? 31 PRO A HA   14 
ATOM   9288  H HB2  . PRO A 1 14 ? 8.293  10.654 -12.668 1.00 0.00 ? 31 PRO A HB2  14 
ATOM   9289  H HB3  . PRO A 1 14 ? 9.192  11.082 -14.131 1.00 0.00 ? 31 PRO A HB3  14 
ATOM   9290  H HG2  . PRO A 1 14 ? 10.499 10.048 -12.047 1.00 0.00 ? 31 PRO A HG2  14 
ATOM   9291  H HG3  . PRO A 1 14 ? 11.230 11.374 -12.960 1.00 0.00 ? 31 PRO A HG3  14 
ATOM   9292  H HD2  . PRO A 1 14 ? 9.797  11.483 -10.270 1.00 0.00 ? 31 PRO A HD2  14 
ATOM   9293  H HD3  . PRO A 1 14 ? 11.278 12.308 -10.769 1.00 0.00 ? 31 PRO A HD3  14 
ATOM   9294  N N    . HIS A 1 15 ? 6.633  13.593 -13.689 1.00 0.00 ? 32 HIS A N    14 
ATOM   9295  C CA   . HIS A 1 15 ? 5.192  13.817 -13.680 1.00 0.00 ? 32 HIS A CA   14 
ATOM   9296  C C    . HIS A 1 15 ? 4.439  12.576 -14.143 1.00 0.00 ? 32 HIS A C    14 
ATOM   9297  O O    . HIS A 1 15 ? 4.983  11.739 -14.862 1.00 0.00 ? 32 HIS A O    14 
ATOM   9298  C CB   . HIS A 1 15 ? 4.824  15.012 -14.567 1.00 0.00 ? 32 HIS A CB   14 
ATOM   9299  C CG   . HIS A 1 15 ? 5.113  16.339 -13.936 1.00 0.00 ? 32 HIS A CG   14 
ATOM   9300  N ND1  . HIS A 1 15 ? 4.298  16.898 -12.973 1.00 0.00 ? 32 HIS A ND1  14 
ATOM   9301  C CD2  . HIS A 1 15 ? 6.123  17.219 -14.131 1.00 0.00 ? 32 HIS A CD2  14 
ATOM   9302  C CE1  . HIS A 1 15 ? 4.797  18.064 -12.603 1.00 0.00 ? 32 HIS A CE1  14 
ATOM   9303  N NE2  . HIS A 1 15 ? 5.903  18.282 -13.291 1.00 0.00 ? 32 HIS A NE2  14 
ATOM   9304  H H    . HIS A 1 15 ? 7.170  13.881 -14.494 1.00 0.00 ? 32 HIS A H    14 
ATOM   9305  H HA   . HIS A 1 15 ? 4.858  14.021 -12.664 1.00 0.00 ? 32 HIS A HA   14 
ATOM   9306  H HB2  . HIS A 1 15 ? 5.394  14.980 -15.497 1.00 0.00 ? 32 HIS A HB2  14 
ATOM   9307  H HB3  . HIS A 1 15 ? 3.759  14.998 -14.793 1.00 0.00 ? 32 HIS A HB3  14 
ATOM   9308  H HD1  . HIS A 1 15 ? 3.502  16.465 -12.549 1.00 0.00 ? 32 HIS A HD1  14 
ATOM   9309  H HD2  . HIS A 1 15 ? 6.994  17.212 -14.787 1.00 0.00 ? 32 HIS A HD2  14 
ATOM   9310  H HE1  . HIS A 1 15 ? 4.297  18.666 -11.844 1.00 0.00 ? 32 HIS A HE1  14 
ATOM   9311  N N    . ASP A 1 16 ? 3.183  12.462 -13.724 1.00 0.00 ? 33 ASP A N    14 
ATOM   9312  C CA   . ASP A 1 16 ? 2.570  13.465 -12.860 1.00 0.00 ? 33 ASP A CA   14 
ATOM   9313  C C    . ASP A 1 16 ? 2.682  13.069 -11.393 1.00 0.00 ? 33 ASP A C    14 
ATOM   9314  O O    . ASP A 1 16 ? 3.193  11.998 -11.066 1.00 0.00 ? 33 ASP A O    14 
ATOM   9315  C CB   . ASP A 1 16 ? 1.101  13.672 -13.238 1.00 0.00 ? 33 ASP A CB   14 
ATOM   9316  C CG   . ASP A 1 16 ? 0.211  12.460 -12.994 1.00 0.00 ? 33 ASP A CG   14 
ATOM   9317  O OD1  . ASP A 1 16 ? 0.651  11.548 -12.335 1.00 0.00 ? 33 ASP A OD1  14 
ATOM   9318  O OD2  . ASP A 1 16 ? -0.946 12.522 -13.332 1.00 0.00 ? 33 ASP A OD2  14 
ATOM   9319  H H    . ASP A 1 16 ? 2.639  11.662 -14.012 1.00 0.00 ? 33 ASP A H    14 
ATOM   9320  H HA   . ASP A 1 16 ? 3.094  14.414 -12.966 1.00 0.00 ? 33 ASP A HA   14 
ATOM   9321  H HB2  . ASP A 1 16 ? 0.653  14.550 -12.772 1.00 0.00 ? 33 ASP A HB2  14 
ATOM   9322  H HB3  . ASP A 1 16 ? 1.200  13.839 -14.310 1.00 0.00 ? 33 ASP A HB3  14 
ATOM   9323  N N    . TYR A 1 17 ? 2.201  13.940 -10.512 1.00 0.00 ? 34 TYR A N    14 
ATOM   9324  C CA   . TYR A 1 17 ? 2.120  13.627 -9.091  1.00 0.00 ? 34 TYR A CA   14 
ATOM   9325  C C    . TYR A 1 17 ? 1.219  14.614 -8.360  1.00 0.00 ? 34 TYR A C    14 
ATOM   9326  O O    . TYR A 1 17 ? 0.782  15.612 -8.933  1.00 0.00 ? 34 TYR A O    14 
ATOM   9327  C CB   . TYR A 1 17 ? 3.516  13.626 -8.462  1.00 0.00 ? 34 TYR A CB   14 
ATOM   9328  C CG   . TYR A 1 17 ? 4.261  14.932 -8.620  1.00 0.00 ? 34 TYR A CG   14 
ATOM   9329  C CD1  . TYR A 1 17 ? 4.034  15.990 -7.751  1.00 0.00 ? 34 TYR A CD1  14 
ATOM   9330  C CD2  . TYR A 1 17 ? 5.190  15.103 -9.635  1.00 0.00 ? 34 TYR A CD2  14 
ATOM   9331  C CE1  . TYR A 1 17 ? 4.710  17.187 -7.891  1.00 0.00 ? 34 TYR A CE1  14 
ATOM   9332  C CE2  . TYR A 1 17 ? 5.874  16.294 -9.783  1.00 0.00 ? 34 TYR A CE2  14 
ATOM   9333  C CZ   . TYR A 1 17 ? 5.631  17.334 -8.909  1.00 0.00 ? 34 TYR A CZ   14 
ATOM   9334  O OH   . TYR A 1 17 ? 6.309  18.522 -9.052  1.00 0.00 ? 34 TYR A OH   14 
ATOM   9335  H H    . TYR A 1 17 ? 1.884  14.843 -10.836 1.00 0.00 ? 34 TYR A H    14 
ATOM   9336  H HA   . TYR A 1 17 ? 1.675  12.640 -8.954  1.00 0.00 ? 34 TYR A HA   14 
ATOM   9337  H HB2  . TYR A 1 17 ? 3.391  13.403 -7.401  1.00 0.00 ? 34 TYR A HB2  14 
ATOM   9338  H HB3  . TYR A 1 17 ? 4.081  12.825 -8.937  1.00 0.00 ? 34 TYR A HB3  14 
ATOM   9339  H HD1  . TYR A 1 17 ? 3.305  15.867 -6.950  1.00 0.00 ? 34 TYR A HD1  14 
ATOM   9340  H HD2  . TYR A 1 17 ? 5.376  14.278 -10.322 1.00 0.00 ? 34 TYR A HD2  14 
ATOM   9341  H HE1  . TYR A 1 17 ? 4.522  18.009 -7.203  1.00 0.00 ? 34 TYR A HE1  14 
ATOM   9342  H HE2  . TYR A 1 17 ? 6.599  16.409 -10.589 1.00 0.00 ? 34 TYR A HE2  14 
ATOM   9343  H HH   . TYR A 1 17 ? 7.093  18.444 -9.601  1.00 0.00 ? 34 TYR A HH   14 
ATOM   9344  N N    . CYS A 1 18 ? 0.944  14.329 -7.091  1.00 0.00 ? 35 CYS A N    14 
ATOM   9345  C CA   . CYS A 1 18 ? 0.042  15.156 -6.299  1.00 0.00 ? 35 CYS A CA   14 
ATOM   9346  C C    . CYS A 1 18 ? 0.780  15.833 -5.151  1.00 0.00 ? 35 CYS A C    14 
ATOM   9347  O O    . CYS A 1 18 ? 1.750  15.293 -4.619  1.00 0.00 ? 35 CYS A O    14 
ATOM   9348  C CB   . CYS A 1 18 ? -0.966 14.138 -5.763  1.00 0.00 ? 35 CYS A CB   14 
ATOM   9349  S SG   . CYS A 1 18 ? -1.911 13.276 -7.042  1.00 0.00 ? 35 CYS A SG   14 
ATOM   9350  H H    . CYS A 1 18 ? 1.372  13.520 -6.665  1.00 0.00 ? 35 CYS A H    14 
ATOM   9351  H HA   . CYS A 1 18 ? -0.494 15.900 -6.887  1.00 0.00 ? 35 CYS A HA   14 
ATOM   9352  H HB2  . CYS A 1 18 ? -0.453 13.363 -5.193  1.00 0.00 ? 35 CYS A HB2  14 
ATOM   9353  H HB3  . CYS A 1 18 ? -1.699 14.633 -5.128  1.00 0.00 ? 35 CYS A HB3  14 
ATOM   9354  H HG   . CYS A 1 18 ? -2.626 12.530 -6.206  1.00 0.00 ? 35 CYS A HG   14 
ATOM   9355  N N    . THR A 1 19 ? 0.316  17.021 -4.775  1.00 0.00 ? 36 THR A N    14 
ATOM   9356  C CA   . THR A 1 19 ? 0.914  17.762 -3.672  1.00 0.00 ? 36 THR A CA   14 
ATOM   9357  C C    . THR A 1 19 ? -0.131 18.583 -2.928  1.00 0.00 ? 36 THR A C    14 
ATOM   9358  O O    . THR A 1 19 ? -1.094 19.065 -3.525  1.00 0.00 ? 36 THR A O    14 
ATOM   9359  C CB   . THR A 1 19 ? 2.034  18.699 -4.161  1.00 0.00 ? 36 THR A CB   14 
ATOM   9360  O OG1  . THR A 1 19 ? 2.676  19.310 -3.036  1.00 0.00 ? 36 THR A OG1  14 
ATOM   9361  C CG2  . THR A 1 19 ? 1.465  19.782 -5.067  1.00 0.00 ? 36 THR A CG2  14 
ATOM   9362  H H    . THR A 1 19 ? -0.472 17.419 -5.266  1.00 0.00 ? 36 THR A H    14 
ATOM   9363  H HA   . THR A 1 19 ? 1.334  17.067 -2.944  1.00 0.00 ? 36 THR A HA   14 
ATOM   9364  H HB   . THR A 1 19 ? 2.769  18.114 -4.714  1.00 0.00 ? 36 THR A HB   14 
ATOM   9365  H HG1  . THR A 1 19 ? 3.372  19.896 -3.344  1.00 0.00 ? 36 THR A HG1  14 
ATOM   9366  H HG21 . THR A 1 19 ? 0.732  20.367 -4.514  1.00 0.00 ? 36 THR A HG21 14 
ATOM   9367  H HG22 . THR A 1 19 ? 2.271  20.433 -5.402  1.00 0.00 ? 36 THR A HG22 14 
ATOM   9368  H HG23 . THR A 1 19 ? 0.987  19.320 -5.929  1.00 0.00 ? 36 THR A HG23 14 
HETATM 9369  N N    . TPO A 1 20 ? 0.063  18.739 -1.623  1.00 0.00 ? 37 TPO A N    14 
HETATM 9370  C CA   . TPO A 1 20 ? -0.832 19.549 -0.806  1.00 0.00 ? 37 TPO A CA   14 
HETATM 9371  C CB   . TPO A 1 20 ? -1.375 18.755 0.395   1.00 0.00 ? 37 TPO A CB   14 
HETATM 9372  C CG2  . TPO A 1 20 ? -1.875 17.389 -0.052  1.00 0.00 ? 37 TPO A CG2  14 
HETATM 9373  O OG1  . TPO A 1 20 ? -0.337 18.585 1.369   1.00 0.00 ? 37 TPO A OG1  14 
HETATM 9374  P P    . TPO A 1 20 ? -0.701 18.345 2.923   1.00 0.00 ? 37 TPO A P    14 
HETATM 9375  O O1P  . TPO A 1 20 ? 0.638  18.203 3.692   1.00 0.00 ? 37 TPO A O1P  14 
HETATM 9376  O O2P  . TPO A 1 20 ? -1.546 17.047 3.003   1.00 0.00 ? 37 TPO A O2P  14 
HETATM 9377  O O3P  . TPO A 1 20 ? -1.506 19.581 3.403   1.00 0.00 ? 37 TPO A O3P  14 
HETATM 9378  C C    . TPO A 1 20 ? -0.130 20.802 -0.297  1.00 0.00 ? 37 TPO A C    14 
HETATM 9379  O O    . TPO A 1 20 ? 1.098  20.883 -0.303  1.00 0.00 ? 37 TPO A O    14 
HETATM 9380  H H    . TPO A 1 20 ? 0.852  18.285 -1.187  1.00 0.00 ? 37 TPO A H    14 
HETATM 9381  H HA   . TPO A 1 20 ? -1.674 19.891 -1.410  1.00 0.00 ? 37 TPO A HA   14 
HETATM 9382  H HB   . TPO A 1 20 ? -2.197 19.311 0.846   1.00 0.00 ? 37 TPO A HB   14 
HETATM 9383  H HG21 . TPO A 1 20 ? -2.256 16.842 0.811   1.00 0.00 ? 37 TPO A HG21 14 
HETATM 9384  H HG22 . TPO A 1 20 ? -2.672 17.514 -0.784  1.00 0.00 ? 37 TPO A HG22 14 
HETATM 9385  H HG23 . TPO A 1 20 ? -1.054 16.832 -0.501  1.00 0.00 ? 37 TPO A HG23 14 
ATOM   9386  N N    . PRO A 1 21 ? -0.917 21.777 0.142   1.00 0.00 ? 38 PRO A N    14 
ATOM   9387  C CA   . PRO A 1 21 ? -0.378 23.065 0.566   1.00 0.00 ? 38 PRO A CA   14 
ATOM   9388  C C    . PRO A 1 21 ? 0.639  22.894 1.686   1.00 0.00 ? 38 PRO A C    14 
ATOM   9389  O O    . PRO A 1 21 ? 1.564  23.695 1.825   1.00 0.00 ? 38 PRO A O    14 
ATOM   9390  C CB   . PRO A 1 21 ? -1.610 23.855 1.020   1.00 0.00 ? 38 PRO A CB   14 
ATOM   9391  C CG   . PRO A 1 21 ? -2.736 23.271 0.237   1.00 0.00 ? 38 PRO A CG   14 
ATOM   9392  C CD   . PRO A 1 21 ? -2.420 21.803 0.117   1.00 0.00 ? 38 PRO A CD   14 
ATOM   9393  H HA   . PRO A 1 21 ? 0.167  23.583 -0.237  1.00 0.00 ? 38 PRO A HA   14 
ATOM   9394  H HB2  . PRO A 1 21 ? -1.780 23.749 2.102   1.00 0.00 ? 38 PRO A HB2  14 
ATOM   9395  H HB3  . PRO A 1 21 ? -1.498 24.930 0.816   1.00 0.00 ? 38 PRO A HB3  14 
ATOM   9396  H HG2  . PRO A 1 21 ? -3.698 23.426 0.748   1.00 0.00 ? 38 PRO A HG2  14 
ATOM   9397  H HG3  . PRO A 1 21 ? -2.817 23.740 -0.753  1.00 0.00 ? 38 PRO A HG3  14 
ATOM   9398  H HD2  . PRO A 1 21 ? -2.840 21.218 0.947   1.00 0.00 ? 38 PRO A HD2  14 
ATOM   9399  H HD3  . PRO A 1 21 ? -2.811 21.368 -0.814  1.00 0.00 ? 38 PRO A HD3  14 
ATOM   9400  N N    . GLY A 1 22 ? 0.462  21.848 2.485   1.00 0.00 ? 39 GLY A N    14 
ATOM   9401  C CA   . GLY A 1 22 ? 1.352  21.584 3.610   1.00 0.00 ? 39 GLY A CA   14 
ATOM   9402  C C    . GLY A 1 22 ? 2.763  21.264 3.134   1.00 0.00 ? 39 GLY A C    14 
ATOM   9403  O O    . GLY A 1 22 ? 3.734  21.467 3.861   1.00 0.00 ? 39 GLY A O    14 
ATOM   9404  H H    . GLY A 1 22 ? -0.307 21.218 2.308   1.00 0.00 ? 39 GLY A H    14 
ATOM   9405  H HA2  . GLY A 1 22 ? 1.385  22.464 4.252   1.00 0.00 ? 39 GLY A HA2  14 
ATOM   9406  H HA3  . GLY A 1 22 ? 0.967  20.736 4.176   1.00 0.00 ? 39 GLY A HA3  14 
ATOM   9407  N N    . GLY A 1 23 ? 2.869  20.762 1.908   1.00 0.00 ? 40 GLY A N    14 
ATOM   9408  C CA   . GLY A 1 23 ? 4.166  20.490 1.300   1.00 0.00 ? 40 GLY A CA   14 
ATOM   9409  C C    . GLY A 1 23 ? 4.413  18.993 1.176   1.00 0.00 ? 40 GLY A C    14 
ATOM   9410  O O    . GLY A 1 23 ? 5.525  18.560 0.876   1.00 0.00 ? 40 GLY A O    14 
ATOM   9411  H H    . GLY A 1 23 ? 2.029  20.564 1.384   1.00 0.00 ? 40 GLY A H    14 
ATOM   9412  H HA2  . GLY A 1 23 ? 4.196  20.939 0.308   1.00 0.00 ? 40 GLY A HA2  14 
ATOM   9413  H HA3  . GLY A 1 23 ? 4.948  20.928 1.920   1.00 0.00 ? 40 GLY A HA3  14 
ATOM   9414  N N    . THR A 1 24 ? 3.368  18.205 1.407   1.00 0.00 ? 41 THR A N    14 
ATOM   9415  C CA   . THR A 1 24 ? 3.453  16.757 1.260   1.00 0.00 ? 41 THR A CA   14 
ATOM   9416  C C    . THR A 1 24 ? 3.209  16.333 -0.182  1.00 0.00 ? 41 THR A C    14 
ATOM   9417  O O    . THR A 1 24 ? 2.207  16.712 -0.789  1.00 0.00 ? 41 THR A O    14 
ATOM   9418  C CB   . THR A 1 24 ? 2.444  16.036 2.175   1.00 0.00 ? 41 THR A CB   14 
ATOM   9419  O OG1  . THR A 1 24 ? 2.739  16.337 3.545   1.00 0.00 ? 41 THR A OG1  14 
ATOM   9420  C CG2  . THR A 1 24 ? 2.513  14.532 1.963   1.00 0.00 ? 41 THR A CG2  14 
ATOM   9421  H H    . THR A 1 24 ? 2.491  18.620 1.690   1.00 0.00 ? 41 THR A H    14 
ATOM   9422  H HA   . THR A 1 24 ? 4.458  16.419 1.515   1.00 0.00 ? 41 THR A HA   14 
ATOM   9423  H HB   . THR A 1 24 ? 1.440  16.389 1.942   1.00 0.00 ? 41 THR A HB   14 
ATOM   9424  H HG1  . THR A 1 24 ? 2.157  17.037 3.851   1.00 0.00 ? 41 THR A HG1  14 
ATOM   9425  H HG21 . THR A 1 24 ? 3.517  14.178 2.196   1.00 0.00 ? 41 THR A HG21 14 
ATOM   9426  H HG22 . THR A 1 24 ? 1.793  14.040 2.617   1.00 0.00 ? 41 THR A HG22 14 
ATOM   9427  H HG23 . THR A 1 24 ? 2.279  14.300 0.924   1.00 0.00 ? 41 THR A HG23 14 
ATOM   9428  N N    . LEU A 1 25 ? 4.129  15.545 -0.725  1.00 0.00 ? 42 LEU A N    14 
ATOM   9429  C CA   . LEU A 1 25 ? 4.018  15.073 -2.101  1.00 0.00 ? 42 LEU A CA   14 
ATOM   9430  C C    . LEU A 1 25 ? 3.843  13.561 -2.153  1.00 0.00 ? 42 LEU A C    14 
ATOM   9431  O O    . LEU A 1 25 ? 4.405  12.832 -1.333  1.00 0.00 ? 42 LEU A O    14 
ATOM   9432  C CB   . LEU A 1 25 ? 5.254  15.494 -2.907  1.00 0.00 ? 42 LEU A CB   14 
ATOM   9433  C CG   . LEU A 1 25 ? 5.153  16.867 -3.585  1.00 0.00 ? 42 LEU A CG   14 
ATOM   9434  C CD1  . LEU A 1 25 ? 5.525  17.965 -2.599  1.00 0.00 ? 42 LEU A CD1  14 
ATOM   9435  C CD2  . LEU A 1 25 ? 6.067  16.901 -4.801  1.00 0.00 ? 42 LEU A CD2  14 
ATOM   9436  H H    . LEU A 1 25 ? 4.926  15.264 -0.173  1.00 0.00 ? 42 LEU A H    14 
ATOM   9437  H HA   . LEU A 1 25 ? 3.131  15.503 -2.564  1.00 0.00 ? 42 LEU A HA   14 
ATOM   9438  H HB2  . LEU A 1 25 ? 5.986  15.528 -2.103  1.00 0.00 ? 42 LEU A HB2  14 
ATOM   9439  H HB3  . LEU A 1 25 ? 5.543  14.733 -3.631  1.00 0.00 ? 42 LEU A HB3  14 
ATOM   9440  H HG   . LEU A 1 25 ? 4.127  16.980 -3.936  1.00 0.00 ? 42 LEU A HG   14 
ATOM   9441  H HD11 . LEU A 1 25 ? 5.451  18.936 -3.090  1.00 0.00 ? 42 LEU A HD11 14 
ATOM   9442  H HD12 . LEU A 1 25 ? 4.845  17.937 -1.748  1.00 0.00 ? 42 LEU A HD12 14 
ATOM   9443  H HD13 . LEU A 1 25 ? 6.547  17.811 -2.252  1.00 0.00 ? 42 LEU A HD13 14 
ATOM   9444  H HD21 . LEU A 1 25 ? 5.765  16.126 -5.505  1.00 0.00 ? 42 LEU A HD21 14 
ATOM   9445  H HD22 . LEU A 1 25 ? 5.994  17.877 -5.283  1.00 0.00 ? 42 LEU A HD22 14 
ATOM   9446  H HD23 . LEU A 1 25 ? 7.097  16.726 -4.489  1.00 0.00 ? 42 LEU A HD23 14 
ATOM   9447  N N    . PHE A 1 26 ? 3.060  13.093 -3.120  1.00 0.00 ? 43 PHE A N    14 
ATOM   9448  C CA   . PHE A 1 26 ? 2.822  11.665 -3.290  1.00 0.00 ? 43 PHE A CA   14 
ATOM   9449  C C    . PHE A 1 26 ? 2.324  11.353 -4.695  1.00 0.00 ? 43 PHE A C    14 
ATOM   9450  O O    . PHE A 1 26 ? 1.743  12.209 -5.362  1.00 0.00 ? 43 PHE A O    14 
ATOM   9451  C CB   . PHE A 1 26 ? 1.816  11.164 -2.251  1.00 0.00 ? 43 PHE A CB   14 
ATOM   9452  C CG   . PHE A 1 26 ? 0.490  11.868 -2.303  1.00 0.00 ? 43 PHE A CG   14 
ATOM   9453  C CD1  . PHE A 1 26 ? 0.298  13.067 -1.632  1.00 0.00 ? 43 PHE A CD1  14 
ATOM   9454  C CD2  . PHE A 1 26 ? -0.567 11.334 -3.024  1.00 0.00 ? 43 PHE A CD2  14 
ATOM   9455  C CE1  . PHE A 1 26 ? -0.921 13.714 -1.678  1.00 0.00 ? 43 PHE A CE1  14 
ATOM   9456  C CE2  . PHE A 1 26 ? -1.787 11.981 -3.072  1.00 0.00 ? 43 PHE A CE2  14 
ATOM   9457  C CZ   . PHE A 1 26 ? -1.965 13.171 -2.399  1.00 0.00 ? 43 PHE A CZ   14 
ATOM   9458  H H    . PHE A 1 26 ? 2.620  13.745 -3.754  1.00 0.00 ? 43 PHE A H    14 
ATOM   9459  H HA   . PHE A 1 26 ? 3.756  11.116 -3.162  1.00 0.00 ? 43 PHE A HA   14 
ATOM   9460  H HB2  . PHE A 1 26 ? 1.613  10.105 -2.406  1.00 0.00 ? 43 PHE A HB2  14 
ATOM   9461  H HB3  . PHE A 1 26 ? 2.209  11.314 -1.247  1.00 0.00 ? 43 PHE A HB3  14 
ATOM   9462  H HD1  . PHE A 1 26 ? 1.122  13.496 -1.063  1.00 0.00 ? 43 PHE A HD1  14 
ATOM   9463  H HD2  . PHE A 1 26 ? -0.428 10.392 -3.556  1.00 0.00 ? 43 PHE A HD2  14 
ATOM   9464  H HE1  . PHE A 1 26 ? -1.060 14.656 -1.146  1.00 0.00 ? 43 PHE A HE1  14 
ATOM   9465  H HE2  . PHE A 1 26 ? -2.610 11.550 -3.643  1.00 0.00 ? 43 PHE A HE2  14 
ATOM   9466  H HZ   . PHE A 1 26 ? -2.925 13.682 -2.438  1.00 0.00 ? 43 PHE A HZ   14 
ATOM   9467  N N    . SER A 1 27 ? 2.555  10.122 -5.139  1.00 0.00 ? 44 SER A N    14 
ATOM   9468  C CA   . SER A 1 27 ? 2.030  9.659  -6.418  1.00 0.00 ? 44 SER A CA   14 
ATOM   9469  C C    . SER A 1 27 ? 1.815  8.151  -6.410  1.00 0.00 ? 44 SER A C    14 
ATOM   9470  O O    . SER A 1 27 ? 2.693  7.390  -6.003  1.00 0.00 ? 44 SER A O    14 
ATOM   9471  C CB   . SER A 1 27 ? 2.969  10.052 -7.542  1.00 0.00 ? 44 SER A CB   14 
ATOM   9472  O OG   . SER A 1 27 ? 2.478  9.668  -8.796  1.00 0.00 ? 44 SER A OG   14 
ATOM   9473  H H    . SER A 1 27 ? 3.108  9.492  -4.576  1.00 0.00 ? 44 SER A H    14 
ATOM   9474  H HA   . SER A 1 27 ? 1.110  10.163 -6.717  1.00 0.00 ? 44 SER A HA   14 
ATOM   9475  H HB2  . SER A 1 27 ? 3.095  11.135 -7.526  1.00 0.00 ? 44 SER A HB2  14 
ATOM   9476  H HB3  . SER A 1 27 ? 3.933  9.573  -7.375  1.00 0.00 ? 44 SER A HB3  14 
ATOM   9477  H HG   . SER A 1 27 ? 2.668  10.357 -9.438  1.00 0.00 ? 44 SER A HG   14 
ATOM   9478  N N    . THR A 1 28 ? 0.641  7.723  -6.864  1.00 0.00 ? 45 THR A N    14 
ATOM   9479  C CA   . THR A 1 28 ? 0.318  6.303  -6.934  1.00 0.00 ? 45 THR A CA   14 
ATOM   9480  C C    . THR A 1 28 ? 0.458  5.777  -8.357  1.00 0.00 ? 45 THR A C    14 
ATOM   9481  O O    . THR A 1 28 ? -0.140 6.315  -9.290  1.00 0.00 ? 45 THR A O    14 
ATOM   9482  C CB   . THR A 1 28 ? -1.111 6.023  -6.433  1.00 0.00 ? 45 THR A CB   14 
ATOM   9483  O OG1  . THR A 1 28 ? -1.233 6.446  -5.068  1.00 0.00 ? 45 THR A OG1  14 
ATOM   9484  C CG2  . THR A 1 28 ? -1.429 4.539  -6.530  1.00 0.00 ? 45 THR A CG2  14 
ATOM   9485  H H    . THR A 1 28 ? -0.046 8.400  -7.167  1.00 0.00 ? 45 THR A H    14 
ATOM   9486  H HA   . THR A 1 28 ? 1.020  5.734  -6.325  1.00 0.00 ? 45 THR A HA   14 
ATOM   9487  H HB   . THR A 1 28 ? -1.818 6.585  -7.043  1.00 0.00 ? 45 THR A HB   14 
ATOM   9488  H HG1  . THR A 1 28 ? -1.055 7.388  -5.009  1.00 0.00 ? 45 THR A HG1  14 
ATOM   9489  H HG21 . THR A 1 28 ? -0.724 3.976  -5.920  1.00 0.00 ? 45 THR A HG21 14 
ATOM   9490  H HG22 . THR A 1 28 ? -2.442 4.361  -6.172  1.00 0.00 ? 45 THR A HG22 14 
ATOM   9491  H HG23 . THR A 1 28 ? -1.348 4.217  -7.568  1.00 0.00 ? 45 THR A HG23 14 
HETATM 9492  N N    . TPO A 1 29 ? 1.251  4.723  -8.517  1.00 0.00 ? 46 TPO A N    14 
HETATM 9493  C CA   . TPO A 1 29 ? 1.514  4.156  -9.834  1.00 0.00 ? 46 TPO A CA   14 
HETATM 9494  C CB   . TPO A 1 29 ? 2.881  3.448  -9.883  1.00 0.00 ? 46 TPO A CB   14 
HETATM 9495  C CG2  . TPO A 1 29 ? 3.974  4.365  -9.356  1.00 0.00 ? 46 TPO A CG2  14 
HETATM 9496  O OG1  . TPO A 1 29 ? 2.835  2.259  -9.084  1.00 0.00 ? 46 TPO A OG1  14 
HETATM 9497  P P    . TPO A 1 29 ? 3.866  1.048  -9.356  1.00 0.00 ? 46 TPO A P    14 
HETATM 9498  O O1P  . TPO A 1 29 ? 3.547  -0.069 -8.328  1.00 0.00 ? 46 TPO A O1P  14 
HETATM 9499  O O2P  . TPO A 1 29 ? 5.298  1.610  -9.160  1.00 0.00 ? 46 TPO A O2P  14 
HETATM 9500  O O3P  . TPO A 1 29 ? 3.636  0.565  -10.812 1.00 0.00 ? 46 TPO A O3P  14 
HETATM 9501  C C    . TPO A 1 29 ? 0.427  3.165  -10.233 1.00 0.00 ? 46 TPO A C    14 
HETATM 9502  O O    . TPO A 1 29 ? -0.352 2.713  -9.395  1.00 0.00 ? 46 TPO A O    14 
HETATM 9503  H H    . TPO A 1 29 ? 1.684  4.305  -7.706  1.00 0.00 ? 46 TPO A H    14 
HETATM 9504  H HA   . TPO A 1 29 ? 1.502  4.944  -10.586 1.00 0.00 ? 46 TPO A HA   14 
HETATM 9505  H HB   . TPO A 1 29 ? 3.102  3.175  -10.914 1.00 0.00 ? 46 TPO A HB   14 
HETATM 9506  H HG21 . TPO A 1 29 ? 4.932  3.848  -9.400  1.00 0.00 ? 46 TPO A HG21 14 
HETATM 9507  H HG22 . TPO A 1 29 ? 4.019  5.265  -9.969  1.00 0.00 ? 46 TPO A HG22 14 
HETATM 9508  H HG23 . TPO A 1 29 ? 3.754  4.638  -8.326  1.00 0.00 ? 46 TPO A HG23 14 
ATOM   9509  N N    . PRO A 1 30 ? 0.380  2.832  -11.518 1.00 0.00 ? 47 PRO A N    14 
ATOM   9510  C CA   . PRO A 1 30 ? -0.655 1.950  -12.045 1.00 0.00 ? 47 PRO A CA   14 
ATOM   9511  C C    . PRO A 1 30 ? -0.669 0.616  -11.308 1.00 0.00 ? 47 PRO A C    14 
ATOM   9512  O O    . PRO A 1 30 ? -1.709 -0.033 -11.201 1.00 0.00 ? 47 PRO A O    14 
ATOM   9513  C CB   . PRO A 1 30 ? -0.293 1.788  -13.524 1.00 0.00 ? 47 PRO A CB   14 
ATOM   9514  C CG   . PRO A 1 30 ? 0.442  3.040  -13.865 1.00 0.00 ? 47 PRO A CG   14 
ATOM   9515  C CD   . PRO A 1 30 ? 1.229  3.389  -12.631 1.00 0.00 ? 47 PRO A CD   14 
ATOM   9516  H HA   . PRO A 1 30 ? -1.669 2.358  -11.913 1.00 0.00 ? 47 PRO A HA   14 
ATOM   9517  H HB2  . PRO A 1 30 ? 0.334  0.900  -13.691 1.00 0.00 ? 47 PRO A HB2  14 
ATOM   9518  H HB3  . PRO A 1 30 ? -1.191 1.671  -14.149 1.00 0.00 ? 47 PRO A HB3  14 
ATOM   9519  H HG2  . PRO A 1 30 ? 1.107  2.887  -14.728 1.00 0.00 ? 47 PRO A HG2  14 
ATOM   9520  H HG3  . PRO A 1 30 ? -0.254 3.848  -14.134 1.00 0.00 ? 47 PRO A HG3  14 
ATOM   9521  H HD2  . PRO A 1 30 ? 2.231  2.935  -12.634 1.00 0.00 ? 47 PRO A HD2  14 
ATOM   9522  H HD3  . PRO A 1 30 ? 1.369  4.474  -12.521 1.00 0.00 ? 47 PRO A HD3  14 
ATOM   9523  N N    . GLY A 1 31 ? 0.492  0.213  -10.804 1.00 0.00 ? 48 GLY A N    14 
ATOM   9524  C CA   . GLY A 1 31 ? 0.615  -1.045 -10.078 1.00 0.00 ? 48 GLY A CA   14 
ATOM   9525  C C    . GLY A 1 31 ? -0.191 -1.018 -8.786  1.00 0.00 ? 48 GLY A C    14 
ATOM   9526  O O    . GLY A 1 31 ? -0.615 -2.059 -8.285  1.00 0.00 ? 48 GLY A O    14 
ATOM   9527  H H    . GLY A 1 31 ? 1.310  0.793  -10.925 1.00 0.00 ? 48 GLY A H    14 
ATOM   9528  H HA2  . GLY A 1 31 ? 0.249  -1.857 -10.707 1.00 0.00 ? 48 GLY A HA2  14 
ATOM   9529  H HA3  . GLY A 1 31 ? 1.664  -1.217 -9.838  1.00 0.00 ? 48 GLY A HA3  14 
ATOM   9530  N N    . GLY A 1 32 ? -0.399 0.180  -8.249  1.00 0.00 ? 49 GLY A N    14 
ATOM   9531  C CA   . GLY A 1 32 ? -1.212 0.352  -7.051  1.00 0.00 ? 49 GLY A CA   14 
ATOM   9532  C C    . GLY A 1 32 ? -0.352 0.732  -5.853  1.00 0.00 ? 49 GLY A C    14 
ATOM   9533  O O    . GLY A 1 32 ? -0.832 0.769  -4.720  1.00 0.00 ? 49 GLY A O    14 
ATOM   9534  H H    . GLY A 1 32 ? 0.017  0.992  -8.684  1.00 0.00 ? 49 GLY A H    14 
ATOM   9535  H HA2  . GLY A 1 32 ? -1.944 1.142  -7.228  1.00 0.00 ? 49 GLY A HA2  14 
ATOM   9536  H HA3  . GLY A 1 32 ? -1.731 -0.580 -6.836  1.00 0.00 ? 49 GLY A HA3  14 
ATOM   9537  N N    . THR A 1 33 ? 0.920  1.014  -6.109  1.00 0.00 ? 50 THR A N    14 
ATOM   9538  C CA   . THR A 1 33 ? 1.850  1.393  -5.052  1.00 0.00 ? 50 THR A CA   14 
ATOM   9539  C C    . THR A 1 33 ? 1.882  2.905  -4.863  1.00 0.00 ? 50 THR A C    14 
ATOM   9540  O O    . THR A 1 33 ? 2.121  3.653  -5.811  1.00 0.00 ? 50 THR A O    14 
ATOM   9541  C CB   . THR A 1 33 ? 3.275  0.892  -5.345  1.00 0.00 ? 50 THR A CB   14 
ATOM   9542  O OG1  . THR A 1 33 ? 3.265  -0.534 -5.484  1.00 0.00 ? 50 THR A OG1  14 
ATOM   9543  C CG2  . THR A 1 33 ? 4.220  1.280  -4.217  1.00 0.00 ? 50 THR A CG2  14 
ATOM   9544  H H    . THR A 1 33 ? 1.253  0.964  -7.062  1.00 0.00 ? 50 THR A H    14 
ATOM   9545  H HA   . THR A 1 33 ? 1.519  0.971  -4.102  1.00 0.00 ? 50 THR A HA   14 
ATOM   9546  H HB   . THR A 1 33 ? 3.622  1.337  -6.277  1.00 0.00 ? 50 THR A HB   14 
ATOM   9547  H HG1  . THR A 1 33 ? 3.339  -0.765 -6.413  1.00 0.00 ? 50 THR A HG1  14 
ATOM   9548  H HG21 . THR A 1 33 ? 3.875  0.835  -3.286  1.00 0.00 ? 50 THR A HG21 14 
ATOM   9549  H HG22 . THR A 1 33 ? 5.223  0.918  -4.444  1.00 0.00 ? 50 THR A HG22 14 
ATOM   9550  H HG23 . THR A 1 33 ? 4.239  2.366  -4.117  1.00 0.00 ? 50 THR A HG23 14 
ATOM   9551  N N    . ARG A 1 34 ? 1.641  3.348  -3.634  1.00 0.00 ? 51 ARG A N    14 
ATOM   9552  C CA   . ARG A 1 34 ? 1.661  4.770  -3.315  1.00 0.00 ? 51 ARG A CA   14 
ATOM   9553  C C    . ARG A 1 34 ? 3.050  5.216  -2.874  1.00 0.00 ? 51 ARG A C    14 
ATOM   9554  O O    . ARG A 1 34 ? 3.547  4.792  -1.831  1.00 0.00 ? 51 ARG A O    14 
ATOM   9555  C CB   . ARG A 1 34 ? 0.605  5.143  -2.285  1.00 0.00 ? 51 ARG A CB   14 
ATOM   9556  C CG   . ARG A 1 34 ? 0.514  6.628  -1.970  1.00 0.00 ? 51 ARG A CG   14 
ATOM   9557  C CD   . ARG A 1 34 ? -0.578 6.989  -1.031  1.00 0.00 ? 51 ARG A CD   14 
ATOM   9558  N NE   . ARG A 1 34 ? -0.663 8.408  -0.723  1.00 0.00 ? 51 ARG A NE   14 
ATOM   9559  C CZ   . ARG A 1 34 ? -1.420 8.933  0.261   1.00 0.00 ? 51 ARG A CZ   14 
ATOM   9560  N NH1  . ARG A 1 34 ? -2.183 8.169  1.009   1.00 0.00 ? 51 ARG A NH1  14 
ATOM   9561  N NH2  . ARG A 1 34 ? -1.391 10.242 0.439   1.00 0.00 ? 51 ARG A NH2  14 
ATOM   9562  H H    . ARG A 1 34 ? 1.437  2.682  -2.902  1.00 0.00 ? 51 ARG A H    14 
ATOM   9563  H HA   . ARG A 1 34 ? 1.417  5.351  -4.204  1.00 0.00 ? 51 ARG A HA   14 
ATOM   9564  H HB2  . ARG A 1 34 ? -0.353 4.799  -2.674  1.00 0.00 ? 51 ARG A HB2  14 
ATOM   9565  H HB3  . ARG A 1 34 ? 0.843  4.597  -1.372  1.00 0.00 ? 51 ARG A HB3  14 
ATOM   9566  H HG2  . ARG A 1 34 ? 1.458  6.947  -1.527  1.00 0.00 ? 51 ARG A HG2  14 
ATOM   9567  H HG3  . ARG A 1 34 ? 0.350  7.170  -2.903  1.00 0.00 ? 51 ARG A HG3  14 
ATOM   9568  H HD2  . ARG A 1 34 ? -1.532 6.692  -1.465  1.00 0.00 ? 51 ARG A HD2  14 
ATOM   9569  H HD3  . ARG A 1 34 ? -0.426 6.460  -0.091  1.00 0.00 ? 51 ARG A HD3  14 
ATOM   9570  H HE   . ARG A 1 34 ? -0.202 9.192  -1.164  1.00 0.00 ? 51 ARG A HE   14 
ATOM   9571  H HH11 . ARG A 1 34 ? -2.208 7.172  0.848   1.00 0.00 ? 51 ARG A HH11 14 
ATOM   9572  H HH12 . ARG A 1 34 ? -2.743 8.582  1.741   1.00 0.00 ? 51 ARG A HH12 14 
ATOM   9573  H HH21 . ARG A 1 34 ? -0.811 10.817 -0.158  1.00 0.00 ? 51 ARG A HH21 14 
ATOM   9574  H HH22 . ARG A 1 34 ? -1.948 10.662 1.168   1.00 0.00 ? 51 ARG A HH22 14 
ATOM   9575  N N    . ILE A 1 35 ? 3.672  6.073  -3.676  1.00 0.00 ? 52 ILE A N    14 
ATOM   9576  C CA   . ILE A 1 35 ? 4.995  6.598  -3.356  1.00 0.00 ? 52 ILE A CA   14 
ATOM   9577  C C    . ILE A 1 35 ? 4.896  7.942  -2.645  1.00 0.00 ? 52 ILE A C    14 
ATOM   9578  O O    . ILE A 1 35 ? 4.366  8.908  -3.194  1.00 0.00 ? 52 ILE A O    14 
ATOM   9579  C CB   . ILE A 1 35 ? 5.860  6.760  -4.620  1.00 0.00 ? 52 ILE A CB   14 
ATOM   9580  C CG1  . ILE A 1 35 ? 6.050  5.408  -5.313  1.00 0.00 ? 52 ILE A CG1  14 
ATOM   9581  C CG2  . ILE A 1 35 ? 7.205  7.375  -4.268  1.00 0.00 ? 52 ILE A CG2  14 
ATOM   9582  C CD1  . ILE A 1 35 ? 6.699  5.505  -6.674  1.00 0.00 ? 52 ILE A CD1  14 
ATOM   9583  H H    . ILE A 1 35 ? 3.219  6.367  -4.529  1.00 0.00 ? 52 ILE A H    14 
ATOM   9584  H HA   . ILE A 1 35 ? 5.506  5.948  -2.648  1.00 0.00 ? 52 ILE A HA   14 
ATOM   9585  H HB   . ILE A 1 35 ? 5.338  7.403  -5.328  1.00 0.00 ? 52 ILE A HB   14 
ATOM   9586  H HG12 . ILE A 1 35 ? 6.667  4.792  -4.658  1.00 0.00 ? 52 ILE A HG12 14 
ATOM   9587  H HG13 . ILE A 1 35 ? 5.064  4.952  -5.411  1.00 0.00 ? 52 ILE A HG13 14 
ATOM   9588  H HG21 . ILE A 1 35 ? 7.803  7.482  -5.173  1.00 0.00 ? 52 ILE A HG21 14 
ATOM   9589  H HG22 . ILE A 1 35 ? 7.050  8.355  -3.820  1.00 0.00 ? 52 ILE A HG22 14 
ATOM   9590  H HG23 . ILE A 1 35 ? 7.727  6.731  -3.562  1.00 0.00 ? 52 ILE A HG23 14 
ATOM   9591  H HD11 . ILE A 1 35 ? 7.685  5.958  -6.577  1.00 0.00 ? 52 ILE A HD11 14 
ATOM   9592  H HD12 . ILE A 1 35 ? 6.800  4.507  -7.103  1.00 0.00 ? 52 ILE A HD12 14 
ATOM   9593  H HD13 . ILE A 1 35 ? 6.081  6.119  -7.330  1.00 0.00 ? 52 ILE A HD13 14 
ATOM   9594  N N    . ILE A 1 36 ? 5.409  7.997  -1.421  1.00 0.00 ? 53 ILE A N    14 
ATOM   9595  C CA   . ILE A 1 36 ? 5.436  9.238  -0.657  1.00 0.00 ? 53 ILE A CA   14 
ATOM   9596  C C    . ILE A 1 36 ? 6.783  9.939  -0.792  1.00 0.00 ? 53 ILE A C    14 
ATOM   9597  O O    . ILE A 1 36 ? 7.829  9.352  -0.515  1.00 0.00 ? 53 ILE A O    14 
ATOM   9598  C CB   . ILE A 1 36 ? 5.144  8.991  0.834   1.00 0.00 ? 53 ILE A CB   14 
ATOM   9599  C CG1  . ILE A 1 36 ? 3.829  8.227  1.001   1.00 0.00 ? 53 ILE A CG1  14 
ATOM   9600  C CG2  . ILE A 1 36 ? 5.098  10.308 1.594   1.00 0.00 ? 53 ILE A CG2  14 
ATOM   9601  C CD1  . ILE A 1 36 ? 2.629  8.941  0.421   1.00 0.00 ? 53 ILE A CD1  14 
ATOM   9602  H H    . ILE A 1 36 ? 5.790  7.157  -1.010  1.00 0.00 ? 53 ILE A H    14 
ATOM   9603  H HA   . ILE A 1 36 ? 4.714  9.950  -1.055  1.00 0.00 ? 53 ILE A HA   14 
ATOM   9604  H HB   . ILE A 1 36 ? 5.928  8.358  1.250   1.00 0.00 ? 53 ILE A HB   14 
ATOM   9605  H HG12 . ILE A 1 36 ? 3.949  7.262  0.509   1.00 0.00 ? 53 ILE A HG12 14 
ATOM   9606  H HG13 . ILE A 1 36 ? 3.677  8.071  2.069   1.00 0.00 ? 53 ILE A HG13 14 
ATOM   9607  H HG21 . ILE A 1 36 ? 4.890  10.114 2.646   1.00 0.00 ? 53 ILE A HG21 14 
ATOM   9608  H HG22 . ILE A 1 36 ? 6.059  10.814 1.501   1.00 0.00 ? 53 ILE A HG22 14 
ATOM   9609  H HG23 . ILE A 1 36 ? 4.313  10.940 1.179   1.00 0.00 ? 53 ILE A HG23 14 
ATOM   9610  H HD11 . ILE A 1 36 ? 2.779  9.097  -0.646  1.00 0.00 ? 53 ILE A HD11 14 
ATOM   9611  H HD12 . ILE A 1 36 ? 1.734  8.339  0.578   1.00 0.00 ? 53 ILE A HD12 14 
ATOM   9612  H HD13 . ILE A 1 36 ? 2.507  9.907  0.914   1.00 0.00 ? 53 ILE A HD13 14 
ATOM   9613  N N    . TYR A 1 37 ? 6.749  11.197 -1.218  1.00 0.00 ? 54 TYR A N    14 
ATOM   9614  C CA   . TYR A 1 37 ? 7.966  11.919 -1.568  1.00 0.00 ? 54 TYR A CA   14 
ATOM   9615  C C    . TYR A 1 37 ? 8.381  12.872 -0.454  1.00 0.00 ? 54 TYR A C    14 
ATOM   9616  O O    . TYR A 1 37 ? 7.576  13.671 0.024   1.00 0.00 ? 54 TYR A O    14 
ATOM   9617  C CB   . TYR A 1 37 ? 7.772  12.692 -2.875  1.00 0.00 ? 54 TYR A CB   14 
ATOM   9618  C CG   . TYR A 1 37 ? 7.538  11.809 -4.081  1.00 0.00 ? 54 TYR A CG   14 
ATOM   9619  C CD1  . TYR A 1 37 ? 8.590  11.143 -4.689  1.00 0.00 ? 54 TYR A CD1  14 
ATOM   9620  C CD2  . TYR A 1 37 ? 6.265  11.647 -4.608  1.00 0.00 ? 54 TYR A CD2  14 
ATOM   9621  C CE1  . TYR A 1 37 ? 8.383  10.335 -5.790  1.00 0.00 ? 54 TYR A CE1  14 
ATOM   9622  C CE2  . TYR A 1 37 ? 6.045  10.841 -5.708  1.00 0.00 ? 54 TYR A CE2  14 
ATOM   9623  C CZ   . TYR A 1 37 ? 7.107  10.187 -6.298  1.00 0.00 ? 54 TYR A CZ   14 
ATOM   9624  O OH   . TYR A 1 37 ? 6.896  9.385  -7.395  1.00 0.00 ? 54 TYR A OH   14 
ATOM   9625  H H    . TYR A 1 37 ? 5.857  11.664 -1.302  1.00 0.00 ? 54 TYR A H    14 
ATOM   9626  H HA   . TYR A 1 37 ? 8.789  11.217 -1.699  1.00 0.00 ? 54 TYR A HA   14 
ATOM   9627  H HB2  . TYR A 1 37 ? 6.915  13.353 -2.736  1.00 0.00 ? 54 TYR A HB2  14 
ATOM   9628  H HB3  . TYR A 1 37 ? 8.670  13.291 -3.031  1.00 0.00 ? 54 TYR A HB3  14 
ATOM   9629  H HD1  . TYR A 1 37 ? 9.595  11.264 -4.283  1.00 0.00 ? 54 TYR A HD1  14 
ATOM   9630  H HD2  . TYR A 1 37 ? 5.430  12.167 -4.138  1.00 0.00 ? 54 TYR A HD2  14 
ATOM   9631  H HE1  . TYR A 1 37 ? 9.223  9.819  -6.254  1.00 0.00 ? 54 TYR A HE1  14 
ATOM   9632  H HE2  . TYR A 1 37 ? 5.040  10.723 -6.112  1.00 0.00 ? 54 TYR A HE2  14 
ATOM   9633  H HH   . TYR A 1 37 ? 7.701  8.979  -7.725  1.00 0.00 ? 54 TYR A HH   14 
ATOM   9634  N N    . ASP A 1 38 ? 9.642  12.782 -0.045  1.00 0.00 ? 55 ASP A N    14 
ATOM   9635  C CA   . ASP A 1 38 ? 10.188 13.689 0.957   1.00 0.00 ? 55 ASP A CA   14 
ATOM   9636  C C    . ASP A 1 38 ? 11.075 14.749 0.316   1.00 0.00 ? 55 ASP A C    14 
ATOM   9637  O O    . ASP A 1 38 ? 12.206 14.469 -0.082  1.00 0.00 ? 55 ASP A O    14 
ATOM   9638  C CB   . ASP A 1 38 ? 10.979 12.910 2.012   1.00 0.00 ? 55 ASP A CB   14 
ATOM   9639  C CG   . ASP A 1 38 ? 11.555 13.769 3.128   1.00 0.00 ? 55 ASP A CG   14 
ATOM   9640  O OD1  . ASP A 1 38 ? 11.422 14.968 3.057   1.00 0.00 ? 55 ASP A OD1  14 
ATOM   9641  O OD2  . ASP A 1 38 ? 11.981 13.218 4.115   1.00 0.00 ? 55 ASP A OD2  14 
ATOM   9642  H H    . ASP A 1 38 ? 10.237 12.068 -0.440  1.00 0.00 ? 55 ASP A H    14 
ATOM   9643  H HA   . ASP A 1 38 ? 9.377  14.222 1.454   1.00 0.00 ? 55 ASP A HA   14 
ATOM   9644  H HB2  . ASP A 1 38 ? 10.422 12.077 2.444   1.00 0.00 ? 55 ASP A HB2  14 
ATOM   9645  H HB3  . ASP A 1 38 ? 11.791 12.524 1.395   1.00 0.00 ? 55 ASP A HB3  14 
ATOM   9646  N N    . ARG A 1 39 ? 10.556 15.968 0.220   1.00 0.00 ? 56 ARG A N    14 
ATOM   9647  C CA   . ARG A 1 39 ? 11.279 17.061 -0.418  1.00 0.00 ? 56 ARG A CA   14 
ATOM   9648  C C    . ARG A 1 39 ? 12.310 17.664 0.528   1.00 0.00 ? 56 ARG A C    14 
ATOM   9649  O O    . ARG A 1 39 ? 11.961 18.233 1.562   1.00 0.00 ? 56 ARG A O    14 
ATOM   9650  C CB   . ARG A 1 39 ? 10.342 18.124 -0.972  1.00 0.00 ? 56 ARG A CB   14 
ATOM   9651  C CG   . ARG A 1 39 ? 11.027 19.238 -1.750  1.00 0.00 ? 56 ARG A CG   14 
ATOM   9652  C CD   . ARG A 1 39 ? 10.096 20.229 -2.348  1.00 0.00 ? 56 ARG A CD   14 
ATOM   9653  N NE   . ARG A 1 39 ? 10.749 21.331 -3.034  1.00 0.00 ? 56 ARG A NE   14 
ATOM   9654  C CZ   . ARG A 1 39 ? 10.139 22.477 -3.394  1.00 0.00 ? 56 ARG A CZ   14 
ATOM   9655  N NH1  . ARG A 1 39 ? 8.856  22.661 -3.170  1.00 0.00 ? 56 ARG A NH1  14 
ATOM   9656  N NH2  . ARG A 1 39 ? 10.859 23.404 -4.000  1.00 0.00 ? 56 ARG A NH2  14 
ATOM   9657  H H    . ARG A 1 39 ? 9.634  16.142 0.598   1.00 0.00 ? 56 ARG A H    14 
ATOM   9658  H HA   . ARG A 1 39 ? 11.831 16.685 -1.279  1.00 0.00 ? 56 ARG A HA   14 
ATOM   9659  H HB2  . ARG A 1 39 ? 9.632  17.616 -1.622  1.00 0.00 ? 56 ARG A HB2  14 
ATOM   9660  H HB3  . ARG A 1 39 ? 9.813  18.555 -0.122  1.00 0.00 ? 56 ARG A HB3  14 
ATOM   9661  H HG2  . ARG A 1 39 ? 11.697 19.771 -1.075  1.00 0.00 ? 56 ARG A HG2  14 
ATOM   9662  H HG3  . ARG A 1 39 ? 11.606 18.789 -2.558  1.00 0.00 ? 56 ARG A HG3  14 
ATOM   9663  H HD2  . ARG A 1 39 ? 9.461  19.723 -3.074  1.00 0.00 ? 56 ARG A HD2  14 
ATOM   9664  H HD3  . ARG A 1 39 ? 9.477  20.654 -1.559  1.00 0.00 ? 56 ARG A HD3  14 
ATOM   9665  H HE   . ARG A 1 39 ? 11.709 21.423 -3.338  1.00 0.00 ? 56 ARG A HE   14 
ATOM   9666  H HH11 . ARG A 1 39 ? 8.316  21.934 -2.723  1.00 0.00 ? 56 ARG A HH11 14 
ATOM   9667  H HH12 . ARG A 1 39 ? 8.417  23.526 -3.449  1.00 0.00 ? 56 ARG A HH12 14 
ATOM   9668  H HH21 . ARG A 1 39 ? 11.841 23.240 -4.180  1.00 0.00 ? 56 ARG A HH21 14 
ATOM   9669  H HH22 . ARG A 1 39 ? 10.427 24.272 -4.281  1.00 0.00 ? 56 ARG A HH22 14 
ATOM   9670  N N    . LYS A 1 40 ? 13.583 17.537 0.168   1.00 0.00 ? 57 LYS A N    14 
ATOM   9671  C CA   . LYS A 1 40 ? 14.671 17.988 1.025   1.00 0.00 ? 57 LYS A CA   14 
ATOM   9672  C C    . LYS A 1 40 ? 14.691 19.508 1.135   1.00 0.00 ? 57 LYS A C    14 
ATOM   9673  O O    . LYS A 1 40 ? 14.972 20.059 2.199   1.00 0.00 ? 57 LYS A O    14 
ATOM   9674  C CB   . LYS A 1 40 ? 16.014 17.481 0.499   1.00 0.00 ? 57 LYS A CB   14 
ATOM   9675  C CG   . LYS A 1 40 ? 16.201 15.973 0.598   1.00 0.00 ? 57 LYS A CG   14 
ATOM   9676  C CD   . LYS A 1 40 ? 17.543 15.542 0.026   1.00 0.00 ? 57 LYS A CD   14 
ATOM   9677  C CE   . LYS A 1 40 ? 17.711 14.031 0.085   1.00 0.00 ? 57 LYS A CE   14 
ATOM   9678  N NZ   . LYS A 1 40 ? 19.029 13.597 -0.452  1.00 0.00 ? 57 LYS A NZ   14 
ATOM   9679  H H    . LYS A 1 40 ? 13.801 17.115 -0.725  1.00 0.00 ? 57 LYS A H    14 
ATOM   9680  H HA   . LYS A 1 40 ? 14.527 17.606 2.037   1.00 0.00 ? 57 LYS A HA   14 
ATOM   9681  H HB2  . LYS A 1 40 ? 16.084 17.787 -0.546  1.00 0.00 ? 57 LYS A HB2  14 
ATOM   9682  H HB3  . LYS A 1 40 ? 16.793 17.982 1.074   1.00 0.00 ? 57 LYS A HB3  14 
ATOM   9683  H HG2  . LYS A 1 40 ? 16.143 15.686 1.649   1.00 0.00 ? 57 LYS A HG2  14 
ATOM   9684  H HG3  . LYS A 1 40 ? 15.398 15.487 0.046   1.00 0.00 ? 57 LYS A HG3  14 
ATOM   9685  H HD2  . LYS A 1 40 ? 17.602 15.876 -1.010  1.00 0.00 ? 57 LYS A HD2  14 
ATOM   9686  H HD3  . LYS A 1 40 ? 18.336 16.017 0.605   1.00 0.00 ? 57 LYS A HD3  14 
ATOM   9687  H HE2  . LYS A 1 40 ? 17.620 13.716 1.123   1.00 0.00 ? 57 LYS A HE2  14 
ATOM   9688  H HE3  . LYS A 1 40 ? 16.913 13.577 -0.503  1.00 0.00 ? 57 LYS A HE3  14 
ATOM   9689  H HZ1  . LYS A 1 40 ? 19.768 14.016 0.093   1.00 0.00 ? 57 LYS A HZ1  14 
ATOM   9690  H HZ2  . LYS A 1 40 ? 19.100 12.590 -0.396  1.00 0.00 ? 57 LYS A HZ2  14 
ATOM   9691  H HZ3  . LYS A 1 40 ? 19.115 13.887 -1.415  1.00 0.00 ? 57 LYS A HZ3  14 
ATOM   9692  N N    . PHE A 1 41 ? 14.393 20.180 0.029   1.00 0.00 ? 58 PHE A N    14 
ATOM   9693  C CA   . PHE A 1 41 ? 14.384 21.637 -0.004  1.00 0.00 ? 58 PHE A CA   14 
ATOM   9694  C C    . PHE A 1 41 ? 12.960 22.179 -0.023  1.00 0.00 ? 58 PHE A C    14 
ATOM   9695  O O    . PHE A 1 41 ? 12.655 23.124 -0.752  1.00 0.00 ? 58 PHE A O    14 
ATOM   9696  C CB   . PHE A 1 41 ? 15.158 22.150 -1.219  1.00 0.00 ? 58 PHE A CB   14 
ATOM   9697  C CG   . PHE A 1 41 ? 16.618 21.796 -1.201  1.00 0.00 ? 58 PHE A CG   14 
ATOM   9698  C CD1  . PHE A 1 41 ? 17.480 22.391 -0.292  1.00 0.00 ? 58 PHE A CD1  14 
ATOM   9699  C CD2  . PHE A 1 41 ? 17.132 20.865 -2.091  1.00 0.00 ? 58 PHE A CD2  14 
ATOM   9700  C CE1  . PHE A 1 41 ? 18.823 22.068 -0.274  1.00 0.00 ? 58 PHE A CE1  14 
ATOM   9701  C CE2  . PHE A 1 41 ? 18.475 20.538 -2.075  1.00 0.00 ? 58 PHE A CE2  14 
ATOM   9702  C CZ   . PHE A 1 41 ? 19.320 21.140 -1.167  1.00 0.00 ? 58 PHE A CZ   14 
ATOM   9703  H H    . PHE A 1 41 ? 14.166 19.668 -0.812  1.00 0.00 ? 58 PHE A H    14 
ATOM   9704  H HA   . PHE A 1 41 ? 14.852 22.030 0.899   1.00 0.00 ? 58 PHE A HA   14 
ATOM   9705  H HB2  . PHE A 1 41 ? 14.746 21.725 -2.133  1.00 0.00 ? 58 PHE A HB2  14 
ATOM   9706  H HB3  . PHE A 1 41 ? 15.103 23.237 -1.267  1.00 0.00 ? 58 PHE A HB3  14 
ATOM   9707  H HD1  . PHE A 1 41 ? 17.087 23.125 0.413   1.00 0.00 ? 58 PHE A HD1  14 
ATOM   9708  H HD2  . PHE A 1 41 ? 16.463 20.390 -2.810  1.00 0.00 ? 58 PHE A HD2  14 
ATOM   9709  H HE1  . PHE A 1 41 ? 19.490 22.545 0.444   1.00 0.00 ? 58 PHE A HE1  14 
ATOM   9710  H HE2  . PHE A 1 41 ? 18.865 19.805 -2.780  1.00 0.00 ? 58 PHE A HE2  14 
ATOM   9711  H HZ   . PHE A 1 41 ? 20.378 20.882 -1.152  1.00 0.00 ? 58 PHE A HZ   14 
ATOM   9712  N N    . LEU A 1 42 ? 12.091 21.575 0.780   1.00 0.00 ? 59 LEU A N    14 
ATOM   9713  C CA   . LEU A 1 42 ? 10.701 22.006 0.868   1.00 0.00 ? 59 LEU A CA   14 
ATOM   9714  C C    . LEU A 1 42 ? 10.599 23.433 1.390   1.00 0.00 ? 59 LEU A C    14 
ATOM   9715  O O    . LEU A 1 42 ? 11.103 23.748 2.468   1.00 0.00 ? 59 LEU A O    14 
ATOM   9716  C CB   . LEU A 1 42 ? 9.906  21.051 1.767   1.00 0.00 ? 59 LEU A CB   14 
ATOM   9717  C CG   . LEU A 1 42 ? 8.407  21.357 1.882   1.00 0.00 ? 59 LEU A CG   14 
ATOM   9718  C CD1  . LEU A 1 42 ? 7.734  21.185 0.527   1.00 0.00 ? 59 LEU A CD1  14 
ATOM   9719  C CD2  . LEU A 1 42 ? 7.778  20.438 2.918   1.00 0.00 ? 59 LEU A CD2  14 
ATOM   9720  H H    . LEU A 1 42 ? 12.402 20.797 1.345   1.00 0.00 ? 59 LEU A H    14 
ATOM   9721  H HA   . LEU A 1 42 ? 10.256 22.007 -0.126  1.00 0.00 ? 59 LEU A HA   14 
ATOM   9722  H HB2  . LEU A 1 42 ? 10.057 20.124 1.218   1.00 0.00 ? 59 LEU A HB2  14 
ATOM   9723  H HB3  . LEU A 1 42 ? 10.353 20.963 2.758   1.00 0.00 ? 59 LEU A HB3  14 
ATOM   9724  H HG   . LEU A 1 42 ? 8.313  22.382 2.243   1.00 0.00 ? 59 LEU A HG   14 
ATOM   9725  H HD11 . LEU A 1 42 ? 6.671  21.404 0.617   1.00 0.00 ? 59 LEU A HD11 14 
ATOM   9726  H HD12 . LEU A 1 42 ? 8.185  21.869 -0.193  1.00 0.00 ? 59 LEU A HD12 14 
ATOM   9727  H HD13 . LEU A 1 42 ? 7.864  20.159 0.185   1.00 0.00 ? 59 LEU A HD13 14 
ATOM   9728  H HD21 . LEU A 1 42 ? 8.255  20.599 3.885   1.00 0.00 ? 59 LEU A HD21 14 
ATOM   9729  H HD22 . LEU A 1 42 ? 6.712  20.658 2.998   1.00 0.00 ? 59 LEU A HD22 14 
ATOM   9730  H HD23 . LEU A 1 42 ? 7.912  19.400 2.614   1.00 0.00 ? 59 LEU A HD23 14 
ATOM   9731  N N    . LEU A 1 43 ? 9.943  24.294 0.618   1.00 0.00 ? 60 LEU A N    14 
ATOM   9732  C CA   . LEU A 1 43 ? 9.759  25.687 1.010   1.00 0.00 ? 60 LEU A CA   14 
ATOM   9733  C C    . LEU A 1 43 ? 8.475  25.868 1.809   1.00 0.00 ? 60 LEU A C    14 
ATOM   9734  O O    . LEU A 1 43 ? 8.337  26.825 2.573   1.00 0.00 ? 60 LEU A O    14 
ATOM   9735  C CB   . LEU A 1 43 ? 9.748  26.589 -0.230  1.00 0.00 ? 60 LEU A CB   14 
ATOM   9736  C CG   . LEU A 1 43 ? 11.043 26.583 -1.054  1.00 0.00 ? 60 LEU A CG   14 
ATOM   9737  C CD1  . LEU A 1 43 ? 10.879 27.454 -2.290  1.00 0.00 ? 60 LEU A CD1  14 
ATOM   9738  C CD2  . LEU A 1 43 ? 12.195 27.079 -0.192  1.00 0.00 ? 60 LEU A CD2  14 
ATOM   9739  H H    . LEU A 1 43 ? 9.563  23.976 -0.261  1.00 0.00 ? 60 LEU A H    14 
ATOM   9740  H HA   . LEU A 1 43 ? 10.575 25.994 1.663   1.00 0.00 ? 60 LEU A HA   14 
ATOM   9741  H HB2  . LEU A 1 43 ? 8.947  26.109 -0.791  1.00 0.00 ? 60 LEU A HB2  14 
ATOM   9742  H HB3  . LEU A 1 43 ? 9.459  27.610 0.016   1.00 0.00 ? 60 LEU A HB3  14 
ATOM   9743  H HG   . LEU A 1 43 ? 11.250 25.547 -1.323  1.00 0.00 ? 60 LEU A HG   14 
ATOM   9744  H HD11 . LEU A 1 43 ? 11.803 27.443 -2.869  1.00 0.00 ? 60 LEU A HD11 14 
ATOM   9745  H HD12 . LEU A 1 43 ? 10.065 27.068 -2.903  1.00 0.00 ? 60 LEU A HD12 14 
ATOM   9746  H HD13 . LEU A 1 43 ? 10.654 28.476 -1.988  1.00 0.00 ? 60 LEU A HD13 14 
ATOM   9747  H HD21 . LEU A 1 43 ? 12.312 26.425 0.672   1.00 0.00 ? 60 LEU A HD21 14 
ATOM   9748  H HD22 . LEU A 1 43 ? 13.115 27.073 -0.779  1.00 0.00 ? 60 LEU A HD22 14 
ATOM   9749  H HD23 . LEU A 1 43 ? 11.986 28.094 0.147   1.00 0.00 ? 60 LEU A HD23 14 
ATOM   9750  N N    . ASP A 1 44 ? 7.535  24.946 1.627   1.00 0.00 ? 61 ASP A N    14 
ATOM   9751  C CA   . ASP A 1 44 ? 6.272  24.985 2.356   1.00 0.00 ? 61 ASP A CA   14 
ATOM   9752  C C    . ASP A 1 44 ? 6.476  24.664 3.830   1.00 0.00 ? 61 ASP A C    14 
ATOM   9753  O O    . ASP A 1 44 ? 7.325  23.846 4.185   1.00 0.00 ? 61 ASP A O    14 
ATOM   9754  C CB   . ASP A 1 44 ? 5.267  24.009 1.739   1.00 0.00 ? 61 ASP A CB   14 
ATOM   9755  C CG   . ASP A 1 44 ? 4.697  24.457 0.400   1.00 0.00 ? 61 ASP A CG   14 
ATOM   9756  O OD1  . ASP A 1 44 ? 4.915  25.586 0.030   1.00 0.00 ? 61 ASP A OD1  14 
ATOM   9757  O OD2  . ASP A 1 44 ? 4.185  23.627 -0.312  1.00 0.00 ? 61 ASP A OD2  14 
ATOM   9758  H H    . ASP A 1 44 ? 7.700  24.199 0.969   1.00 0.00 ? 61 ASP A H    14 
ATOM   9759  H HA   . ASP A 1 44 ? 5.853  25.991 2.313   1.00 0.00 ? 61 ASP A HA   14 
ATOM   9760  H HB2  . ASP A 1 44 ? 5.649  22.992 1.649   1.00 0.00 ? 61 ASP A HB2  14 
ATOM   9761  H HB3  . ASP A 1 44 ? 4.483  24.039 2.495   1.00 0.00 ? 61 ASP A HB3  14 
ATOM   9762  N N    . ARG A 1 45 ? 5.693  25.311 4.686   1.00 0.00 ? 62 ARG A N    14 
ATOM   9763  C CA   . ARG A 1 45 ? 5.787  25.095 6.125   1.00 0.00 ? 62 ARG A CA   14 
ATOM   9764  C C    . ARG A 1 45 ? 5.250  23.723 6.512   1.00 0.00 ? 62 ARG A C    14 
ATOM   9765  O O    . ARG A 1 45 ? 5.935  22.749 6.371   1.00 0.00 ? 62 ARG A O    14 
ATOM   9766  C CB   . ARG A 1 45 ? 5.108  26.203 6.917   1.00 0.00 ? 62 ARG A CB   14 
ATOM   9767  C CG   . ARG A 1 45 ? 5.254  26.092 8.427   1.00 0.00 ? 62 ARG A CG   14 
ATOM   9768  C CD   . ARG A 1 45 ? 4.628  27.205 9.185   1.00 0.00 ? 62 ARG A CD   14 
ATOM   9769  N NE   . ARG A 1 45 ? 4.789  27.116 10.628  1.00 0.00 ? 62 ARG A NE   14 
ATOM   9770  C CZ   . ARG A 1 45 ? 4.312  28.018 11.508  1.00 0.00 ? 62 ARG A CZ   14 
ATOM   9771  N NH1  . ARG A 1 45 ? 3.678  29.093 11.098  1.00 0.00 ? 62 ARG A NH1  14 
ATOM   9772  N NH2  . ARG A 1 45 ? 4.519  27.803 12.796  1.00 0.00 ? 62 ARG A NH2  14 
ATOM   9773  O OXT  . ARG A 1 45 ? 4.141  23.617 6.959   1.00 0.00 ? 62 ARG A OXT  14 
ATOM   9774  H H    . ARG A 1 45 ? 5.015  25.969 4.330   1.00 0.00 ? 62 ARG A H    14 
ATOM   9775  H HA   . ARG A 1 45 ? 6.833  25.118 6.434   1.00 0.00 ? 62 ARG A HA   14 
ATOM   9776  H HB2  . ARG A 1 45 ? 5.541  27.145 6.582   1.00 0.00 ? 62 ARG A HB2  14 
ATOM   9777  H HB3  . ARG A 1 45 ? 4.050  26.177 6.657   1.00 0.00 ? 62 ARG A HB3  14 
ATOM   9778  H HG2  . ARG A 1 45 ? 4.791  25.161 8.752   1.00 0.00 ? 62 ARG A HG2  14 
ATOM   9779  H HG3  . ARG A 1 45 ? 6.317  26.075 8.671   1.00 0.00 ? 62 ARG A HG3  14 
ATOM   9780  H HD2  . ARG A 1 45 ? 5.073  28.147 8.865   1.00 0.00 ? 62 ARG A HD2  14 
ATOM   9781  H HD3  . ARG A 1 45 ? 3.559  27.218 8.976   1.00 0.00 ? 62 ARG A HD3  14 
ATOM   9782  H HE   . ARG A 1 45 ? 5.255  26.410 11.182  1.00 0.00 ? 62 ARG A HE   14 
ATOM   9783  H HH11 . ARG A 1 45 ? 3.543  29.252 10.110  1.00 0.00 ? 62 ARG A HH11 14 
ATOM   9784  H HH12 . ARG A 1 45 ? 3.328  29.758 11.774  1.00 0.00 ? 62 ARG A HH12 14 
ATOM   9785  H HH21 . ARG A 1 45 ? 5.025  26.979 13.092  1.00 0.00 ? 62 ARG A HH21 14 
ATOM   9786  H HH22 . ARG A 1 45 ? 4.173  28.463 13.477  1.00 0.00 ? 62 ARG A HH22 14 
ATOM   9787  N N    . PRO A 1 1  ? -0.318 -0.919 -0.406  1.00 0.00 ? 18 PRO A N    15 
ATOM   9788  C CA   . PRO A 1 1  ? 1.112  -0.802 -0.146  1.00 0.00 ? 18 PRO A CA   15 
ATOM   9789  C C    . PRO A 1 1  ? 1.591  0.631  -0.338  1.00 0.00 ? 18 PRO A C    15 
ATOM   9790  O O    . PRO A 1 1  ? 1.203  1.302  -1.294  1.00 0.00 ? 18 PRO A O    15 
ATOM   9791  C CB   . PRO A 1 1  ? 1.755  -1.765 -1.148  1.00 0.00 ? 18 PRO A CB   15 
ATOM   9792  C CG   . PRO A 1 1  ? 0.804  -1.796 -2.296  1.00 0.00 ? 18 PRO A CG   15 
ATOM   9793  C CD   . PRO A 1 1  ? -0.564 -1.664 -1.684  1.00 0.00 ? 18 PRO A CD   15 
ATOM   9794  H H2   . PRO A 1 1  ? -0.646 -1.528 -1.129  1.00 0.00 ? 18 PRO A H2   15 
ATOM   9795  H H3   . PRO A 1 1  ? -0.933 -1.238 0.315   1.00 0.00 ? 18 PRO A H3   15 
ATOM   9796  H HA   . PRO A 1 1  ? 1.377  -1.052 0.892   1.00 0.00 ? 18 PRO A HA   15 
ATOM   9797  H HB2  . PRO A 1 1  ? 2.748  -1.414 -1.464  1.00 0.00 ? 18 PRO A HB2  15 
ATOM   9798  H HB3  . PRO A 1 1  ? 1.890  -2.767 -0.715  1.00 0.00 ? 18 PRO A HB3  15 
ATOM   9799  H HG2  . PRO A 1 1  ? 1.004  -0.976 -3.000  1.00 0.00 ? 18 PRO A HG2  15 
ATOM   9800  H HG3  . PRO A 1 1  ? 0.896  -2.735 -2.862  1.00 0.00 ? 18 PRO A HG3  15 
ATOM   9801  H HD2  . PRO A 1 1  ? -1.257 -1.106 -2.331  1.00 0.00 ? 18 PRO A HD2  15 
ATOM   9802  H HD3  . PRO A 1 1  ? -1.027 -2.642 -1.486  1.00 0.00 ? 18 PRO A HD3  15 
ATOM   9803  N N    . THR A 1 2  ? 2.437  1.095  0.576   1.00 0.00 ? 19 THR A N    15 
ATOM   9804  C CA   . THR A 1 2  ? 2.980  2.445  0.502   1.00 0.00 ? 19 THR A CA   15 
ATOM   9805  C C    . THR A 1 2  ? 4.495  2.440  0.666   1.00 0.00 ? 19 THR A C    15 
ATOM   9806  O O    . THR A 1 2  ? 5.064  1.505  1.231   1.00 0.00 ? 19 THR A O    15 
ATOM   9807  C CB   . THR A 1 2  ? 2.362  3.363  1.572   1.00 0.00 ? 19 THR A CB   15 
ATOM   9808  O OG1  . THR A 1 2  ? 2.723  2.890  2.877   1.00 0.00 ? 19 THR A OG1  15 
ATOM   9809  C CG2  . THR A 1 2  ? 0.846  3.384  1.447   1.00 0.00 ? 19 THR A CG2  15 
ATOM   9810  H H    . THR A 1 2  ? 2.710  0.496  1.343   1.00 0.00 ? 19 THR A H    15 
ATOM   9811  H HA   . THR A 1 2  ? 2.778  2.871  -0.481  1.00 0.00 ? 19 THR A HA   15 
ATOM   9812  H HB   . THR A 1 2  ? 2.751  4.372  1.442   1.00 0.00 ? 19 THR A HB   15 
ATOM   9813  H HG1  . THR A 1 2  ? 2.338  3.464  3.543   1.00 0.00 ? 19 THR A HG1  15 
ATOM   9814  H HG21 . THR A 1 2  ? 0.457  2.376  1.579   1.00 0.00 ? 19 THR A HG21 15 
ATOM   9815  H HG22 . THR A 1 2  ? 0.428  4.038  2.211   1.00 0.00 ? 19 THR A HG22 15 
ATOM   9816  H HG23 . THR A 1 2  ? 0.570  3.754  0.460   1.00 0.00 ? 19 THR A HG23 15 
ATOM   9817  N N    . ARG A 1 3  ? 5.143  3.488  0.169   1.00 0.00 ? 20 ARG A N    15 
ATOM   9818  C CA   . ARG A 1 3  ? 6.577  3.663  0.362   1.00 0.00 ? 20 ARG A CA   15 
ATOM   9819  C C    . ARG A 1 3  ? 6.954  5.139  0.380   1.00 0.00 ? 20 ARG A C    15 
ATOM   9820  O O    . ARG A 1 3  ? 6.162  5.996  -0.015  1.00 0.00 ? 20 ARG A O    15 
ATOM   9821  C CB   . ARG A 1 3  ? 7.393  2.893  -0.666  1.00 0.00 ? 20 ARG A CB   15 
ATOM   9822  C CG   . ARG A 1 3  ? 7.109  3.259  -2.114  1.00 0.00 ? 20 ARG A CG   15 
ATOM   9823  C CD   . ARG A 1 3  ? 7.923  2.511  -3.106  1.00 0.00 ? 20 ARG A CD   15 
ATOM   9824  N NE   . ARG A 1 3  ? 9.307  2.944  -3.199  1.00 0.00 ? 20 ARG A NE   15 
ATOM   9825  C CZ   . ARG A 1 3  ? 10.243 2.356  -3.970  1.00 0.00 ? 20 ARG A CZ   15 
ATOM   9826  N NH1  . ARG A 1 3  ? 9.958  1.292  -4.688  1.00 0.00 ? 20 ARG A NH1  15 
ATOM   9827  N NH2  . ARG A 1 3  ? 11.463 2.866  -3.970  1.00 0.00 ? 20 ARG A NH2  15 
ATOM   9828  H H    . ARG A 1 3  ? 4.629  4.179  -0.357  1.00 0.00 ? 20 ARG A H    15 
ATOM   9829  H HA   . ARG A 1 3  ? 6.872  3.256  1.329   1.00 0.00 ? 20 ARG A HA   15 
ATOM   9830  H HB2  . ARG A 1 3  ? 8.443  3.084  -0.447  1.00 0.00 ? 20 ARG A HB2  15 
ATOM   9831  H HB3  . ARG A 1 3  ? 7.178  1.835  -0.515  1.00 0.00 ? 20 ARG A HB3  15 
ATOM   9832  H HG2  . ARG A 1 3  ? 6.057  3.058  -2.322  1.00 0.00 ? 20 ARG A HG2  15 
ATOM   9833  H HG3  . ARG A 1 3  ? 7.309  4.323  -2.248  1.00 0.00 ? 20 ARG A HG3  15 
ATOM   9834  H HD2  . ARG A 1 3  ? 7.928  1.455  -2.835  1.00 0.00 ? 20 ARG A HD2  15 
ATOM   9835  H HD3  . ARG A 1 3  ? 7.476  2.630  -4.093  1.00 0.00 ? 20 ARG A HD3  15 
ATOM   9836  H HE   . ARG A 1 3  ? 9.776  3.709  -2.733  1.00 0.00 ? 20 ARG A HE   15 
ATOM   9837  H HH11 . ARG A 1 3  ? 9.026  0.904  -4.664  1.00 0.00 ? 20 ARG A HH11 15 
ATOM   9838  H HH12 . ARG A 1 3  ? 10.674 0.867  -5.259  1.00 0.00 ? 20 ARG A HH12 15 
ATOM   9839  H HH21 . ARG A 1 3  ? 11.669 3.674  -3.400  1.00 0.00 ? 20 ARG A HH21 15 
ATOM   9840  H HH22 . ARG A 1 3  ? 12.182 2.445  -4.539  1.00 0.00 ? 20 ARG A HH22 15 
ATOM   9841  N N    . THR A 1 4  ? 8.166  5.429  0.840   1.00 0.00 ? 21 THR A N    15 
ATOM   9842  C CA   . THR A 1 4  ? 8.640  6.805  0.933   1.00 0.00 ? 21 THR A CA   15 
ATOM   9843  C C    . THR A 1 4  ? 9.958  6.985  0.190   1.00 0.00 ? 21 THR A C    15 
ATOM   9844  O O    . THR A 1 4  ? 10.901 6.218  0.385   1.00 0.00 ? 21 THR A O    15 
ATOM   9845  C CB   . THR A 1 4  ? 8.825  7.241  2.398   1.00 0.00 ? 21 THR A CB   15 
ATOM   9846  O OG1  . THR A 1 4  ? 7.578  7.129  3.094   1.00 0.00 ? 21 THR A OG1  15 
ATOM   9847  C CG2  . THR A 1 4  ? 9.313  8.680  2.470   1.00 0.00 ? 21 THR A CG2  15 
ATOM   9848  H H    . THR A 1 4  ? 8.774  4.679  1.133   1.00 0.00 ? 21 THR A H    15 
ATOM   9849  H HA   . THR A 1 4  ? 7.924  7.476  0.457   1.00 0.00 ? 21 THR A HA   15 
ATOM   9850  H HB   . THR A 1 4  ? 9.556  6.587  2.873   1.00 0.00 ? 21 THR A HB   15 
ATOM   9851  H HG1  . THR A 1 4  ? 7.696  7.396  4.008   1.00 0.00 ? 21 THR A HG1  15 
ATOM   9852  H HG21 . THR A 1 4  ? 8.583  9.335  1.995   1.00 0.00 ? 21 THR A HG21 15 
ATOM   9853  H HG22 . THR A 1 4  ? 9.438  8.970  3.512   1.00 0.00 ? 21 THR A HG22 15 
ATOM   9854  H HG23 . THR A 1 4  ? 10.268 8.766  1.950   1.00 0.00 ? 21 THR A HG23 15 
ATOM   9855  N N    . VAL A 1 5  ? 10.017 8.002  -0.662  1.00 0.00 ? 22 VAL A N    15 
ATOM   9856  C CA   . VAL A 1 5  ? 11.239 8.321  -1.390  1.00 0.00 ? 22 VAL A CA   15 
ATOM   9857  C C    . VAL A 1 5  ? 11.716 9.734  -1.075  1.00 0.00 ? 22 VAL A C    15 
ATOM   9858  O O    . VAL A 1 5  ? 10.947 10.692 -1.160  1.00 0.00 ? 22 VAL A O    15 
ATOM   9859  C CB   . VAL A 1 5  ? 11.043 8.185  -2.912  1.00 0.00 ? 22 VAL A CB   15 
ATOM   9860  C CG1  . VAL A 1 5  ? 12.311 8.585  -3.651  1.00 0.00 ? 22 VAL A CG1  15 
ATOM   9861  C CG2  . VAL A 1 5  ? 10.645 6.762  -3.272  1.00 0.00 ? 22 VAL A CG2  15 
ATOM   9862  H H    . VAL A 1 5  ? 9.195  8.570  -0.809  1.00 0.00 ? 22 VAL A H    15 
ATOM   9863  H HA   . VAL A 1 5  ? 12.063 7.674  -1.087  1.00 0.00 ? 22 VAL A HA   15 
ATOM   9864  H HB   . VAL A 1 5  ? 10.222 8.831  -3.223  1.00 0.00 ? 22 VAL A HB   15 
ATOM   9865  H HG11 . VAL A 1 5  ? 12.154 8.483  -4.725  1.00 0.00 ? 22 VAL A HG11 15 
ATOM   9866  H HG12 . VAL A 1 5  ? 12.555 9.622  -3.418  1.00 0.00 ? 22 VAL A HG12 15 
ATOM   9867  H HG13 . VAL A 1 5  ? 13.131 7.938  -3.342  1.00 0.00 ? 22 VAL A HG13 15 
ATOM   9868  H HG21 . VAL A 1 5  ? 9.712  6.506  -2.770  1.00 0.00 ? 22 VAL A HG21 15 
ATOM   9869  H HG22 . VAL A 1 5  ? 10.510 6.683  -4.350  1.00 0.00 ? 22 VAL A HG22 15 
ATOM   9870  H HG23 . VAL A 1 5  ? 11.428 6.074  -2.953  1.00 0.00 ? 22 VAL A HG23 15 
ATOM   9871  N N    . ALA A 1 6  ? 12.987 9.856  -0.710  1.00 0.00 ? 23 ALA A N    15 
ATOM   9872  C CA   . ALA A 1 6  ? 13.580 11.156 -0.419  1.00 0.00 ? 23 ALA A CA   15 
ATOM   9873  C C    . ALA A 1 6  ? 14.038 11.849 -1.696  1.00 0.00 ? 23 ALA A C    15 
ATOM   9874  O O    . ALA A 1 6  ? 14.606 11.218 -2.588  1.00 0.00 ? 23 ALA A O    15 
ATOM   9875  C CB   . ALA A 1 6  ? 14.740 11.005 0.553   1.00 0.00 ? 23 ALA A CB   15 
ATOM   9876  H H    . ALA A 1 6  ? 13.558 9.026  -0.632  1.00 0.00 ? 23 ALA A H    15 
ATOM   9877  H HA   . ALA A 1 6  ? 12.822 11.791 0.040   1.00 0.00 ? 23 ALA A HA   15 
ATOM   9878  H HB1  . ALA A 1 6  ? 15.500 10.361 0.113   1.00 0.00 ? 23 ALA A HB1  15 
ATOM   9879  H HB2  . ALA A 1 6  ? 15.171 11.985 0.758   1.00 0.00 ? 23 ALA A HB2  15 
ATOM   9880  H HB3  . ALA A 1 6  ? 14.381 10.564 1.482   1.00 0.00 ? 23 ALA A HB3  15 
ATOM   9881  N N    . ILE A 1 7  ? 13.790 13.153 -1.778  1.00 0.00 ? 24 ILE A N    15 
ATOM   9882  C CA   . ILE A 1 7  ? 14.164 13.931 -2.952  1.00 0.00 ? 24 ILE A CA   15 
ATOM   9883  C C    . ILE A 1 7  ? 14.845 15.236 -2.555  1.00 0.00 ? 24 ILE A C    15 
ATOM   9884  O O    . ILE A 1 7  ? 14.802 15.639 -1.392  1.00 0.00 ? 24 ILE A O    15 
ATOM   9885  C CB   . ILE A 1 7  ? 12.942 14.249 -3.833  1.00 0.00 ? 24 ILE A CB   15 
ATOM   9886  C CG1  . ILE A 1 7  ? 11.935 15.105 -3.061  1.00 0.00 ? 24 ILE A CG1  15 
ATOM   9887  C CG2  . ILE A 1 7  ? 12.289 12.963 -4.319  1.00 0.00 ? 24 ILE A CG2  15 
ATOM   9888  C CD1  . ILE A 1 7  ? 10.786 15.605 -3.904  1.00 0.00 ? 24 ILE A CD1  15 
ATOM   9889  H H    . ILE A 1 7  ? 13.330 13.615 -1.007  1.00 0.00 ? 24 ILE A H    15 
ATOM   9890  H HA   . ILE A 1 7  ? 14.909 13.400 -3.544  1.00 0.00 ? 24 ILE A HA   15 
ATOM   9891  H HB   . ILE A 1 7  ? 13.265 14.839 -4.689  1.00 0.00 ? 24 ILE A HB   15 
ATOM   9892  H HG12 . ILE A 1 7  ? 11.549 14.496 -2.244  1.00 0.00 ? 24 ILE A HG12 15 
ATOM   9893  H HG13 . ILE A 1 7  ? 12.481 15.956 -2.651  1.00 0.00 ? 24 ILE A HG13 15 
ATOM   9894  H HG21 . ILE A 1 7  ? 11.427 13.206 -4.940  1.00 0.00 ? 24 ILE A HG21 15 
ATOM   9895  H HG22 . ILE A 1 7  ? 13.007 12.390 -4.904  1.00 0.00 ? 24 ILE A HG22 15 
ATOM   9896  H HG23 . ILE A 1 7  ? 11.965 12.373 -3.463  1.00 0.00 ? 24 ILE A HG23 15 
ATOM   9897  H HD11 . ILE A 1 7  ? 10.238 14.757 -4.314  1.00 0.00 ? 24 ILE A HD11 15 
ATOM   9898  H HD12 . ILE A 1 7  ? 10.114 16.205 -3.289  1.00 0.00 ? 24 ILE A HD12 15 
ATOM   9899  H HD13 . ILE A 1 7  ? 11.170 16.217 -4.721  1.00 0.00 ? 24 ILE A HD13 15 
ATOM   9900  N N    . SER A 1 8  ? 15.471 15.890 -3.526  1.00 0.00 ? 25 SER A N    15 
ATOM   9901  C CA   . SER A 1 8  ? 16.129 17.169 -3.287  1.00 0.00 ? 25 SER A CA   15 
ATOM   9902  C C    . SER A 1 8  ? 15.428 18.297 -4.034  1.00 0.00 ? 25 SER A C    15 
ATOM   9903  O O    . SER A 1 8  ? 15.532 19.464 -3.656  1.00 0.00 ? 25 SER A O    15 
ATOM   9904  C CB   . SER A 1 8  ? 17.586 17.091 -3.697  1.00 0.00 ? 25 SER A CB   15 
ATOM   9905  O OG   . SER A 1 8  ? 17.736 16.811 -5.062  1.00 0.00 ? 25 SER A OG   15 
ATOM   9906  H H    . SER A 1 8  ? 15.492 15.492 -4.454  1.00 0.00 ? 25 SER A H    15 
ATOM   9907  H HA   . SER A 1 8  ? 16.215 17.421 -2.230  1.00 0.00 ? 25 SER A HA   15 
ATOM   9908  H HB2  . SER A 1 8  ? 18.063 18.046 -3.477  1.00 0.00 ? 25 SER A HB2  15 
ATOM   9909  H HB3  . SER A 1 8  ? 18.070 16.304 -3.119  1.00 0.00 ? 25 SER A HB3  15 
ATOM   9910  H HG   . SER A 1 8  ? 18.670 16.775 -5.281  1.00 0.00 ? 25 SER A HG   15 
ATOM   9911  N N    . ASP A 1 9  ? 14.714 17.942 -5.096  1.00 0.00 ? 26 ASP A N    15 
ATOM   9912  C CA   . ASP A 1 9  ? 14.054 18.931 -5.941  1.00 0.00 ? 26 ASP A CA   15 
ATOM   9913  C C    . ASP A 1 9  ? 12.775 18.370 -6.549  1.00 0.00 ? 26 ASP A C    15 
ATOM   9914  O O    . ASP A 1 9  ? 12.821 17.566 -7.481  1.00 0.00 ? 26 ASP A O    15 
ATOM   9915  C CB   . ASP A 1 9  ? 14.999 19.407 -7.047  1.00 0.00 ? 26 ASP A CB   15 
ATOM   9916  C CG   . ASP A 1 9  ? 14.461 20.564 -7.879  1.00 0.00 ? 26 ASP A CG   15 
ATOM   9917  O OD1  . ASP A 1 9  ? 13.355 20.983 -7.632  1.00 0.00 ? 26 ASP A OD1  15 
ATOM   9918  O OD2  . ASP A 1 9  ? 15.214 21.120 -8.642  1.00 0.00 ? 26 ASP A OD2  15 
ATOM   9919  H H    . ASP A 1 9  ? 14.624 16.963 -5.325  1.00 0.00 ? 26 ASP A H    15 
ATOM   9920  H HA   . ASP A 1 9  ? 13.759 19.792 -5.340  1.00 0.00 ? 26 ASP A HA   15 
ATOM   9921  H HB2  . ASP A 1 9  ? 15.998 19.651 -6.689  1.00 0.00 ? 26 ASP A HB2  15 
ATOM   9922  H HB3  . ASP A 1 9  ? 15.041 18.508 -7.662  1.00 0.00 ? 26 ASP A HB3  15 
ATOM   9923  N N    . ALA A 1 10 ? 11.635 18.799 -6.018  1.00 0.00 ? 27 ALA A N    15 
ATOM   9924  C CA   . ALA A 1 10 ? 10.342 18.314 -6.486  1.00 0.00 ? 27 ALA A CA   15 
ATOM   9925  C C    . ALA A 1 10 ? 10.067 18.767 -7.913  1.00 0.00 ? 27 ALA A C    15 
ATOM   9926  O O    . ALA A 1 10 ? 9.280  18.148 -8.630  1.00 0.00 ? 27 ALA A O    15 
ATOM   9927  C CB   . ALA A 1 10 ? 9.233  18.781 -5.554  1.00 0.00 ? 27 ALA A CB   15 
ATOM   9928  H H    . ALA A 1 10 ? 11.665 19.478 -5.272  1.00 0.00 ? 27 ALA A H    15 
ATOM   9929  H HA   . ALA A 1 10 ? 10.358 17.224 -6.488  1.00 0.00 ? 27 ALA A HA   15 
ATOM   9930  H HB1  . ALA A 1 10 ? 9.214  19.870 -5.528  1.00 0.00 ? 27 ALA A HB1  15 
ATOM   9931  H HB2  . ALA A 1 10 ? 8.275  18.411 -5.917  1.00 0.00 ? 27 ALA A HB2  15 
ATOM   9932  H HB3  . ALA A 1 10 ? 9.414  18.397 -4.550  1.00 0.00 ? 27 ALA A HB3  15 
ATOM   9933  N N    . ALA A 1 11 ? 10.719 19.850 -8.321  1.00 0.00 ? 28 ALA A N    15 
ATOM   9934  C CA   . ALA A 1 11 ? 10.517 20.411 -9.651  1.00 0.00 ? 28 ALA A CA   15 
ATOM   9935  C C    . ALA A 1 11 ? 10.994 19.450 -10.733 1.00 0.00 ? 28 ALA A C    15 
ATOM   9936  O O    . ALA A 1 11 ? 10.559 19.528 -11.882 1.00 0.00 ? 28 ALA A O    15 
ATOM   9937  C CB   . ALA A 1 11 ? 11.229 21.750 -9.776  1.00 0.00 ? 28 ALA A CB   15 
ATOM   9938  H H    . ALA A 1 11 ? 11.372 20.296 -7.692  1.00 0.00 ? 28 ALA A H    15 
ATOM   9939  H HA   . ALA A 1 11 ? 9.449  20.569 -9.805  1.00 0.00 ? 28 ALA A HA   15 
ATOM   9940  H HB1  . ALA A 1 11 ? 12.295 21.612 -9.608  1.00 0.00 ? 28 ALA A HB1  15 
ATOM   9941  H HB2  . ALA A 1 11 ? 11.068 22.156 -10.775 1.00 0.00 ? 28 ALA A HB2  15 
ATOM   9942  H HB3  . ALA A 1 11 ? 10.831 22.444 -9.034  1.00 0.00 ? 28 ALA A HB3  15 
ATOM   9943  N N    . GLN A 1 12 ? 11.891 18.545 -10.359 1.00 0.00 ? 29 GLN A N    15 
ATOM   9944  C CA   . GLN A 1 12 ? 12.463 17.596 -11.306 1.00 0.00 ? 29 GLN A CA   15 
ATOM   9945  C C    . GLN A 1 12 ? 11.569 16.373 -11.467 1.00 0.00 ? 29 GLN A C    15 
ATOM   9946  O O    . GLN A 1 12 ? 11.834 15.504 -12.298 1.00 0.00 ? 29 GLN A O    15 
ATOM   9947  C CB   . GLN A 1 12 ? 13.859 17.159 -10.852 1.00 0.00 ? 29 GLN A CB   15 
ATOM   9948  C CG   . GLN A 1 12 ? 14.888 18.276 -10.841 1.00 0.00 ? 29 GLN A CG   15 
ATOM   9949  C CD   . GLN A 1 12 ? 16.251 17.802 -10.375 1.00 0.00 ? 29 GLN A CD   15 
ATOM   9950  O OE1  . GLN A 1 12 ? 16.478 16.603 -10.190 1.00 0.00 ? 29 GLN A OE1  15 
ATOM   9951  N NE2  . GLN A 1 12 ? 17.169 18.743 -10.179 1.00 0.00 ? 29 GLN A NE2  15 
ATOM   9952  H H    . GLN A 1 12 ? 12.186 18.514 -9.393  1.00 0.00 ? 29 GLN A H    15 
ATOM   9953  H HA   . GLN A 1 12 ? 12.534 18.060 -12.290 1.00 0.00 ? 29 GLN A HA   15 
ATOM   9954  H HB2  . GLN A 1 12 ? 13.749 16.749 -9.848  1.00 0.00 ? 29 GLN A HB2  15 
ATOM   9955  H HB3  . GLN A 1 12 ? 14.178 16.370 -11.532 1.00 0.00 ? 29 GLN A HB3  15 
ATOM   9956  H HG2  . GLN A 1 12 ? 15.038 18.948 -11.687 1.00 0.00 ? 29 GLN A HG2  15 
ATOM   9957  H HG3  . GLN A 1 12 ? 14.415 18.822 -10.025 1.00 0.00 ? 29 GLN A HG3  15 
ATOM   9958  H HE21 . GLN A 1 12 ? 16.942 19.704 -10.340 1.00 0.00 ? 29 GLN A HE21 15 
ATOM   9959  H HE22 . GLN A 1 12 ? 18.087 18.491 -9.871  1.00 0.00 ? 29 GLN A HE22 15 
ATOM   9960  N N    . LEU A 1 13 ? 10.508 16.312 -10.670 1.00 0.00 ? 30 LEU A N    15 
ATOM   9961  C CA   . LEU A 1 13 ? 9.560  15.207 -10.740 1.00 0.00 ? 30 LEU A CA   15 
ATOM   9962  C C    . LEU A 1 13 ? 8.462  15.487 -11.758 1.00 0.00 ? 30 LEU A C    15 
ATOM   9963  O O    . LEU A 1 13 ? 8.148  16.642 -12.044 1.00 0.00 ? 30 LEU A O    15 
ATOM   9964  C CB   . LEU A 1 13 ? 8.951  14.944 -9.357  1.00 0.00 ? 30 LEU A CB   15 
ATOM   9965  C CG   . LEU A 1 13 ? 9.948  14.506 -8.276  1.00 0.00 ? 30 LEU A CG   15 
ATOM   9966  C CD1  . LEU A 1 13 ? 9.240  14.375 -6.935  1.00 0.00 ? 30 LEU A CD1  15 
ATOM   9967  C CD2  . LEU A 1 13 ? 10.587 13.186 -8.680  1.00 0.00 ? 30 LEU A CD2  15 
ATOM   9968  H H    . LEU A 1 13 ? 10.356 17.050 -9.998  1.00 0.00 ? 30 LEU A H    15 
ATOM   9969  H HA   . LEU A 1 13 ? 10.073 14.307 -11.078 1.00 0.00 ? 30 LEU A HA   15 
ATOM   9970  H HB2  . LEU A 1 13 ? 8.575  15.941 -9.136  1.00 0.00 ? 30 LEU A HB2  15 
ATOM   9971  H HB3  . LEU A 1 13 ? 8.116  14.245 -9.410  1.00 0.00 ? 30 LEU A HB3  15 
ATOM   9972  H HG   . LEU A 1 13 ? 10.735 15.260 -8.238  1.00 0.00 ? 30 LEU A HG   15 
ATOM   9973  H HD11 . LEU A 1 13 ? 9.955  14.064 -6.174  1.00 0.00 ? 30 LEU A HD11 15 
ATOM   9974  H HD12 . LEU A 1 13 ? 8.810  15.337 -6.656  1.00 0.00 ? 30 LEU A HD12 15 
ATOM   9975  H HD13 . LEU A 1 13 ? 8.448  13.631 -7.013  1.00 0.00 ? 30 LEU A HD13 15 
ATOM   9976  H HD21 . LEU A 1 13 ? 11.112 13.309 -9.628  1.00 0.00 ? 30 LEU A HD21 15 
ATOM   9977  H HD22 . LEU A 1 13 ? 11.296 12.876 -7.911  1.00 0.00 ? 30 LEU A HD22 15 
ATOM   9978  H HD23 . LEU A 1 13 ? 9.814  12.425 -8.789  1.00 0.00 ? 30 LEU A HD23 15 
ATOM   9979  N N    . PRO A 1 14 ? 7.882  14.423 -12.303 1.00 0.00 ? 31 PRO A N    15 
ATOM   9980  C CA   . PRO A 1 14 ? 6.749  14.548 -13.210 1.00 0.00 ? 31 PRO A CA   15 
ATOM   9981  C C    . PRO A 1 14 ? 5.662  15.435 -12.615 1.00 0.00 ? 31 PRO A C    15 
ATOM   9982  O O    . PRO A 1 14 ? 5.439  15.432 -11.405 1.00 0.00 ? 31 PRO A O    15 
ATOM   9983  C CB   . PRO A 1 14 ? 6.271  13.108 -13.415 1.00 0.00 ? 31 PRO A CB   15 
ATOM   9984  C CG   . PRO A 1 14 ? 7.484  12.276 -13.174 1.00 0.00 ? 31 PRO A CG   15 
ATOM   9985  C CD   . PRO A 1 14 ? 8.249  12.990 -12.091 1.00 0.00 ? 31 PRO A CD   15 
ATOM   9986  H HA   . PRO A 1 14 ? 7.017  15.030 -14.162 1.00 0.00 ? 31 PRO A HA   15 
ATOM   9987  H HB2  . PRO A 1 14 ? 5.463  12.848 -12.714 1.00 0.00 ? 31 PRO A HB2  15 
ATOM   9988  H HB3  . PRO A 1 14 ? 5.877  12.954 -14.431 1.00 0.00 ? 31 PRO A HB3  15 
ATOM   9989  H HG2  . PRO A 1 14 ? 7.212  11.257 -12.860 1.00 0.00 ? 31 PRO A HG2  15 
ATOM   9990  H HG3  . PRO A 1 14 ? 8.088  12.181 -14.088 1.00 0.00 ? 31 PRO A HG3  15 
ATOM   9991  H HD2  . PRO A 1 14 ? 7.959  12.652 -11.085 1.00 0.00 ? 31 PRO A HD2  15 
ATOM   9992  H HD3  . PRO A 1 14 ? 9.335  12.839 -12.181 1.00 0.00 ? 31 PRO A HD3  15 
ATOM   9993  N N    . HIS A 1 15 ? 4.986  16.192 -13.473 1.00 0.00 ? 32 HIS A N    15 
ATOM   9994  C CA   . HIS A 1 15 ? 4.057  17.220 -13.021 1.00 0.00 ? 32 HIS A CA   15 
ATOM   9995  C C    . HIS A 1 15 ? 2.645  16.663 -12.883 1.00 0.00 ? 32 HIS A C    15 
ATOM   9996  O O    . HIS A 1 15 ? 1.721  17.378 -12.494 1.00 0.00 ? 32 HIS A O    15 
ATOM   9997  C CB   . HIS A 1 15 ? 4.057  18.412 -13.984 1.00 0.00 ? 32 HIS A CB   15 
ATOM   9998  C CG   . HIS A 1 15 ? 5.368  19.132 -14.049 1.00 0.00 ? 32 HIS A CG   15 
ATOM   9999  N ND1  . HIS A 1 15 ? 5.917  19.776 -12.960 1.00 0.00 ? 32 HIS A ND1  15 
ATOM   10000 C CD2  . HIS A 1 15 ? 6.237  19.311 -15.071 1.00 0.00 ? 32 HIS A CD2  15 
ATOM   10001 C CE1  . HIS A 1 15 ? 7.070  20.319 -13.311 1.00 0.00 ? 32 HIS A CE1  15 
ATOM   10002 N NE2  . HIS A 1 15 ? 7.286  20.052 -14.586 1.00 0.00 ? 32 HIS A NE2  15 
ATOM   10003 H H    . HIS A 1 15 ? 5.121  16.051 -14.465 1.00 0.00 ? 32 HIS A H    15 
ATOM   10004 H HA   . HIS A 1 15 ? 4.350  17.570 -12.032 1.00 0.00 ? 32 HIS A HA   15 
ATOM   10005 H HB2  . HIS A 1 15 ? 3.836  18.076 -14.998 1.00 0.00 ? 32 HIS A HB2  15 
ATOM   10006 H HB3  . HIS A 1 15 ? 3.313  19.145 -13.675 1.00 0.00 ? 32 HIS A HB3  15 
ATOM   10007 H HD1  . HIS A 1 15 ? 5.558  19.770 -12.026 1.00 0.00 ? 32 HIS A HD1  15 
ATOM   10008 H HD2  . HIS A 1 15 ? 6.232  18.990 -16.113 1.00 0.00 ? 32 HIS A HD2  15 
ATOM   10009 H HE1  . HIS A 1 15 ? 7.664  20.876 -12.586 1.00 0.00 ? 32 HIS A HE1  15 
ATOM   10010 N N    . ASP A 1 16 ? 2.485  15.384 -13.202 1.00 0.00 ? 33 ASP A N    15 
ATOM   10011 C CA   . ASP A 1 16 ? 1.225  14.688 -12.970 1.00 0.00 ? 33 ASP A CA   15 
ATOM   10012 C C    . ASP A 1 16 ? 1.147  14.150 -11.547 1.00 0.00 ? 33 ASP A C    15 
ATOM   10013 O O    . ASP A 1 16 ? 0.193  13.460 -11.185 1.00 0.00 ? 33 ASP A O    15 
ATOM   10014 C CB   . ASP A 1 16 ? 1.050  13.546 -13.974 1.00 0.00 ? 33 ASP A CB   15 
ATOM   10015 C CG   . ASP A 1 16 ? 2.081  12.433 -13.847 1.00 0.00 ? 33 ASP A CG   15 
ATOM   10016 O OD1  . ASP A 1 16 ? 2.947  12.544 -13.013 1.00 0.00 ? 33 ASP A OD1  15 
ATOM   10017 O OD2  . ASP A 1 16 ? 1.905  11.414 -14.471 1.00 0.00 ? 33 ASP A OD2  15 
ATOM   10018 H H    . ASP A 1 16 ? 3.257  14.880 -13.616 1.00 0.00 ? 33 ASP A H    15 
ATOM   10019 H HA   . ASP A 1 16 ? 0.392  15.384 -13.084 1.00 0.00 ? 33 ASP A HA   15 
ATOM   10020 H HB2  . ASP A 1 16 ? 0.048  13.116 -13.972 1.00 0.00 ? 33 ASP A HB2  15 
ATOM   10021 H HB3  . ASP A 1 16 ? 1.212  14.086 -14.908 1.00 0.00 ? 33 ASP A HB3  15 
ATOM   10022 N N    . TYR A 1 17 ? 2.155  14.470 -10.742 1.00 0.00 ? 34 TYR A N    15 
ATOM   10023 C CA   . TYR A 1 17 ? 2.129  14.154 -9.319  1.00 0.00 ? 34 TYR A CA   15 
ATOM   10024 C C    . TYR A 1 17 ? 1.107  15.012 -8.585  1.00 0.00 ? 34 TYR A C    15 
ATOM   10025 O O    . TYR A 1 17 ? 0.698  16.065 -9.075  1.00 0.00 ? 34 TYR A O    15 
ATOM   10026 C CB   . TYR A 1 17 ? 3.516  14.347 -8.703  1.00 0.00 ? 34 TYR A CB   15 
ATOM   10027 C CG   . TYR A 1 17 ? 4.500  13.252 -9.051  1.00 0.00 ? 34 TYR A CG   15 
ATOM   10028 C CD1  . TYR A 1 17 ? 4.209  12.321 -10.038 1.00 0.00 ? 34 TYR A CD1  15 
ATOM   10029 C CD2  . TYR A 1 17 ? 5.717  13.154 -8.394  1.00 0.00 ? 34 TYR A CD2  15 
ATOM   10030 C CE1  . TYR A 1 17 ? 5.104  11.319 -10.360 1.00 0.00 ? 34 TYR A CE1  15 
ATOM   10031 C CE2  . TYR A 1 17 ? 6.619  12.156 -8.707  1.00 0.00 ? 34 TYR A CE2  15 
ATOM   10032 C CZ   . TYR A 1 17 ? 6.309  11.240 -9.692  1.00 0.00 ? 34 TYR A CZ   15 
ATOM   10033 O OH   . TYR A 1 17 ? 7.204  10.245 -10.010 1.00 0.00 ? 34 TYR A OH   15 
ATOM   10034 H H    . TYR A 1 17 ? 2.960  14.943 -11.127 1.00 0.00 ? 34 TYR A H    15 
ATOM   10035 H HA   . TYR A 1 17 ? 1.826  13.117 -9.175  1.00 0.00 ? 34 TYR A HA   15 
ATOM   10036 H HB2  . TYR A 1 17 ? 3.897  15.306 -9.059  1.00 0.00 ? 34 TYR A HB2  15 
ATOM   10037 H HB3  . TYR A 1 17 ? 3.386  14.388 -7.622  1.00 0.00 ? 34 TYR A HB3  15 
ATOM   10038 H HD1  . TYR A 1 17 ? 3.255  12.389 -10.562 1.00 0.00 ? 34 TYR A HD1  15 
ATOM   10039 H HD2  . TYR A 1 17 ? 5.956  13.881 -7.617  1.00 0.00 ? 34 TYR A HD2  15 
ATOM   10040 H HE1  . TYR A 1 17 ? 4.861  10.594 -11.138 1.00 0.00 ? 34 TYR A HE1  15 
ATOM   10041 H HE2  . TYR A 1 17 ? 7.570  12.095 -8.178  1.00 0.00 ? 34 TYR A HE2  15 
ATOM   10042 H HH   . TYR A 1 17 ? 7.536  9.779  -9.238  1.00 0.00 ? 34 TYR A HH   15 
ATOM   10043 N N    . CYS A 1 18 ? 0.697  14.556 -7.405  1.00 0.00 ? 35 CYS A N    15 
ATOM   10044 C CA   . CYS A 1 18 ? -0.215 15.320 -6.563  1.00 0.00 ? 35 CYS A CA   15 
ATOM   10045 C C    . CYS A 1 18 ? 0.496  15.865 -5.332  1.00 0.00 ? 35 CYS A C    15 
ATOM   10046 O O    . CYS A 1 18 ? 1.516  15.325 -4.903  1.00 0.00 ? 35 CYS A O    15 
ATOM   10047 C CB   . CYS A 1 18 ? -1.259 14.276 -6.164  1.00 0.00 ? 35 CYS A CB   15 
ATOM   10048 S SG   . CYS A 1 18 ? -2.171 13.559 -7.551  1.00 0.00 ? 35 CYS A SG   15 
ATOM   10049 H H    . CYS A 1 18 ? 1.028  13.658 -7.084  1.00 0.00 ? 35 CYS A H    15 
ATOM   10050 H HA   . CYS A 1 18 ? -0.718 16.130 -7.092  1.00 0.00 ? 35 CYS A HA   15 
ATOM   10051 H HB2  . CYS A 1 18 ? -0.780 13.440 -5.652  1.00 0.00 ? 35 CYS A HB2  15 
ATOM   10052 H HB3  . CYS A 1 18 ? -2.008 14.723 -5.510  1.00 0.00 ? 35 CYS A HB3  15 
ATOM   10053 H HG   . CYS A 1 18 ? -2.929 12.751 -6.816  1.00 0.00 ? 35 CYS A HG   15 
ATOM   10054 N N    . THR A 1 19 ? -0.046 16.938 -4.768  1.00 0.00 ? 36 THR A N    15 
ATOM   10055 C CA   . THR A 1 19 ? 0.575  17.603 -3.628  1.00 0.00 ? 36 THR A CA   15 
ATOM   10056 C C    . THR A 1 19 ? -0.449 17.914 -2.546  1.00 0.00 ? 36 THR A C    15 
ATOM   10057 O O    . THR A 1 19 ? -1.537 18.415 -2.832  1.00 0.00 ? 36 THR A O    15 
ATOM   10058 C CB   . THR A 1 19 ? 1.275  18.909 -4.049  1.00 0.00 ? 36 THR A CB   15 
ATOM   10059 O OG1  . THR A 1 19 ? 2.256  18.626 -5.056  1.00 0.00 ? 36 THR A OG1  15 
ATOM   10060 C CG2  . THR A 1 19 ? 1.957  19.557 -2.854  1.00 0.00 ? 36 THR A CG2  15 
ATOM   10061 H H    . THR A 1 19 ? -0.912 17.304 -5.138  1.00 0.00 ? 36 THR A H    15 
ATOM   10062 H HA   . THR A 1 19 ? 1.314  16.941 -3.174  1.00 0.00 ? 36 THR A HA   15 
ATOM   10063 H HB   . THR A 1 19 ? 0.533  19.593 -4.459  1.00 0.00 ? 36 THR A HB   15 
ATOM   10064 H HG1  . THR A 1 19 ? 2.689  19.441 -5.318  1.00 0.00 ? 36 THR A HG1  15 
ATOM   10065 H HG21 . THR A 1 19 ? 2.700  18.874 -2.444  1.00 0.00 ? 36 THR A HG21 15 
ATOM   10066 H HG22 . THR A 1 19 ? 2.445  20.479 -3.170  1.00 0.00 ? 36 THR A HG22 15 
ATOM   10067 H HG23 . THR A 1 19 ? 1.211  19.784 -2.090  1.00 0.00 ? 36 THR A HG23 15 
HETATM 10068 N N    . TPO A 1 20 ? -0.097 17.614 -1.300  1.00 0.00 ? 37 TPO A N    15 
HETATM 10069 C CA   . TPO A 1 20 ? -0.978 17.879 -0.170  1.00 0.00 ? 37 TPO A CA   15 
HETATM 10070 C CB   . TPO A 1 20 ? -0.707 16.911 0.998   1.00 0.00 ? 37 TPO A CB   15 
HETATM 10071 C CG2  . TPO A 1 20 ? -0.699 15.471 0.506   1.00 0.00 ? 37 TPO A CG2  15 
HETATM 10072 O OG1  . TPO A 1 20 ? 0.562  17.216 1.590   1.00 0.00 ? 37 TPO A OG1  15 
HETATM 10073 P P    . TPO A 1 20 ? 0.888  16.774 3.106   1.00 0.00 ? 37 TPO A P    15 
HETATM 10074 O O1P  . TPO A 1 20 ? 2.327  17.254 3.428   1.00 0.00 ? 37 TPO A O1P  15 
HETATM 10075 O O2P  . TPO A 1 20 ? 0.775  15.228 3.169   1.00 0.00 ? 37 TPO A O2P  15 
HETATM 10076 O O3P  . TPO A 1 20 ? -0.160 17.460 4.021   1.00 0.00 ? 37 TPO A O3P  15 
HETATM 10077 C C    . TPO A 1 20 ? -0.824 19.311 0.326   1.00 0.00 ? 37 TPO A C    15 
HETATM 10078 O O    . TPO A 1 20 ? 0.147  19.992 -0.006  1.00 0.00 ? 37 TPO A O    15 
HETATM 10079 H H    . TPO A 1 20 ? 0.805  17.192 -1.133  1.00 0.00 ? 37 TPO A H    15 
HETATM 10080 H HA   . TPO A 1 20 ? -2.018 17.770 -0.478  1.00 0.00 ? 37 TPO A HA   15 
HETATM 10081 H HB   . TPO A 1 20 ? -1.487 17.033 1.748   1.00 0.00 ? 37 TPO A HB   15 
HETATM 10082 H HG21 . TPO A 1 20 ? -0.506 14.802 1.344   1.00 0.00 ? 37 TPO A HG21 15 
HETATM 10083 H HG22 . TPO A 1 20 ? -1.667 15.233 0.065   1.00 0.00 ? 37 TPO A HG22 15 
HETATM 10084 H HG23 . TPO A 1 20 ? 0.081  15.348 -0.244  1.00 0.00 ? 37 TPO A HG23 15 
ATOM   10085 N N    . PRO A 1 21 ? -1.786 19.763 1.122   1.00 0.00 ? 38 PRO A N    15 
ATOM   10086 C CA   . PRO A 1 21 ? -1.785 21.132 1.624   1.00 0.00 ? 38 PRO A CA   15 
ATOM   10087 C C    . PRO A 1 21 ? -0.486 21.450 2.353   1.00 0.00 ? 38 PRO A C    15 
ATOM   10088 O O    . PRO A 1 21 ? -0.037 22.596 2.371   1.00 0.00 ? 38 PRO A O    15 
ATOM   10089 C CB   . PRO A 1 21 ? -2.998 21.190 2.558   1.00 0.00 ? 38 PRO A CB   15 
ATOM   10090 C CG   . PRO A 1 21 ? -3.932 20.160 2.017   1.00 0.00 ? 38 PRO A CG   15 
ATOM   10091 C CD   . PRO A 1 21 ? -3.051 19.045 1.520   1.00 0.00 ? 38 PRO A CD   15 
ATOM   10092 H HA   . PRO A 1 21 ? -1.849 21.881 0.821   1.00 0.00 ? 38 PRO A HA   15 
ATOM   10093 H HB2  . PRO A 1 21 ? -2.718 20.966 3.597   1.00 0.00 ? 38 PRO A HB2  15 
ATOM   10094 H HB3  . PRO A 1 21 ? -3.462 22.187 2.556   1.00 0.00 ? 38 PRO A HB3  15 
ATOM   10095 H HG2  . PRO A 1 21 ? -4.622 19.801 2.796   1.00 0.00 ? 38 PRO A HG2  15 
ATOM   10096 H HG3  . PRO A 1 21 ? -4.548 20.570 1.204   1.00 0.00 ? 38 PRO A HG3  15 
ATOM   10097 H HD2  . PRO A 1 21 ? -2.852 18.293 2.298   1.00 0.00 ? 38 PRO A HD2  15 
ATOM   10098 H HD3  . PRO A 1 21 ? -3.495 18.514 0.665   1.00 0.00 ? 38 PRO A HD3  15 
ATOM   10099 N N    . GLY A 1 22 ? 0.115  20.428 2.954   1.00 0.00 ? 39 GLY A N    15 
ATOM   10100 C CA   . GLY A 1 22 ? 1.361  20.598 3.691   1.00 0.00 ? 39 GLY A CA   15 
ATOM   10101 C C    . GLY A 1 22 ? 2.517  20.919 2.752   1.00 0.00 ? 39 GLY A C    15 
ATOM   10102 O O    . GLY A 1 22 ? 3.506  21.530 3.156   1.00 0.00 ? 39 GLY A O    15 
ATOM   10103 H H    . GLY A 1 22 ? -0.303 19.510 2.899   1.00 0.00 ? 39 GLY A H    15 
ATOM   10104 H HA2  . GLY A 1 22 ? 1.246  21.415 4.404   1.00 0.00 ? 39 GLY A HA2  15 
ATOM   10105 H HA3  . GLY A 1 22 ? 1.585  19.677 4.229   1.00 0.00 ? 39 GLY A HA3  15 
ATOM   10106 N N    . GLY A 1 23 ? 2.387  20.502 1.497   1.00 0.00 ? 40 GLY A N    15 
ATOM   10107 C CA   . GLY A 1 23 ? 3.386  20.808 0.481   1.00 0.00 ? 40 GLY A CA   15 
ATOM   10108 C C    . GLY A 1 23 ? 4.270  19.601 0.197   1.00 0.00 ? 40 GLY A C    15 
ATOM   10109 O O    . GLY A 1 23 ? 5.453  19.744 -0.115  1.00 0.00 ? 40 GLY A O    15 
ATOM   10110 H H    . GLY A 1 23 ? 1.574  19.960 1.241   1.00 0.00 ? 40 GLY A H    15 
ATOM   10111 H HA2  . GLY A 1 23 ? 2.880  21.101 -0.439  1.00 0.00 ? 40 GLY A HA2  15 
ATOM   10112 H HA3  . GLY A 1 23 ? 4.009  21.630 0.829   1.00 0.00 ? 40 GLY A HA3  15 
ATOM   10113 N N    . THR A 1 24 ? 3.692  18.409 0.309   1.00 0.00 ? 41 THR A N    15 
ATOM   10114 C CA   . THR A 1 24 ? 4.418  17.176 0.035   1.00 0.00 ? 41 THR A CA   15 
ATOM   10115 C C    . THR A 1 24 ? 3.860  16.469 -1.193  1.00 0.00 ? 41 THR A C    15 
ATOM   10116 O O    . THR A 1 24 ? 2.651  16.261 -1.306  1.00 0.00 ? 41 THR A O    15 
ATOM   10117 C CB   . THR A 1 24 ? 4.368  16.212 1.235   1.00 0.00 ? 41 THR A CB   15 
ATOM   10118 O OG1  . THR A 1 24 ? 4.940  16.849 2.386   1.00 0.00 ? 41 THR A OG1  15 
ATOM   10119 C CG2  . THR A 1 24 ? 5.141  14.939 0.930   1.00 0.00 ? 41 THR A CG2  15 
ATOM   10120 H H    . THR A 1 24 ? 2.723  18.358 0.590   1.00 0.00 ? 41 THR A H    15 
ATOM   10121 H HA   . THR A 1 24 ? 5.461  17.403 -0.187  1.00 0.00 ? 41 THR A HA   15 
ATOM   10122 H HB   . THR A 1 24 ? 3.329  15.963 1.449   1.00 0.00 ? 41 THR A HB   15 
ATOM   10123 H HG1  . THR A 1 24 ? 4.264  16.960 3.059   1.00 0.00 ? 41 THR A HG1  15 
ATOM   10124 H HG21 . THR A 1 24 ? 6.181  15.187 0.719   1.00 0.00 ? 41 THR A HG21 15 
ATOM   10125 H HG22 . THR A 1 24 ? 5.095  14.271 1.790   1.00 0.00 ? 41 THR A HG22 15 
ATOM   10126 H HG23 . THR A 1 24 ? 4.703  14.446 0.063   1.00 0.00 ? 41 THR A HG23 15 
ATOM   10127 N N    . LEU A 1 25 ? 4.746  16.099 -2.111  1.00 0.00 ? 42 LEU A N    15 
ATOM   10128 C CA   . LEU A 1 25 ? 4.343  15.421 -3.337  1.00 0.00 ? 42 LEU A CA   15 
ATOM   10129 C C    . LEU A 1 25 ? 4.102  13.936 -3.092  1.00 0.00 ? 42 LEU A C    15 
ATOM   10130 O O    . LEU A 1 25 ? 4.732  13.332 -2.224  1.00 0.00 ? 42 LEU A O    15 
ATOM   10131 C CB   . LEU A 1 25 ? 5.404  15.618 -4.426  1.00 0.00 ? 42 LEU A CB   15 
ATOM   10132 C CG   . LEU A 1 25 ? 5.208  16.851 -5.315  1.00 0.00 ? 42 LEU A CG   15 
ATOM   10133 C CD1  . LEU A 1 25 ? 5.570  18.114 -4.544  1.00 0.00 ? 42 LEU A CD1  15 
ATOM   10134 C CD2  . LEU A 1 25 ? 6.063  16.719 -6.567  1.00 0.00 ? 42 LEU A CD2  15 
ATOM   10135 H H    . LEU A 1 25 ? 5.725  16.294 -1.956  1.00 0.00 ? 42 LEU A H    15 
ATOM   10136 H HA   . LEU A 1 25 ? 3.397  15.833 -3.688  1.00 0.00 ? 42 LEU A HA   15 
ATOM   10137 H HB2  . LEU A 1 25 ? 6.282  15.747 -3.795  1.00 0.00 ? 42 LEU A HB2  15 
ATOM   10138 H HB3  . LEU A 1 25 ? 5.526  14.724 -5.038  1.00 0.00 ? 42 LEU A HB3  15 
ATOM   10139 H HG   . LEU A 1 25 ? 4.162  16.863 -5.626  1.00 0.00 ? 42 LEU A HG   15 
ATOM   10140 H HD11 . LEU A 1 25 ? 5.427  18.985 -5.183  1.00 0.00 ? 42 LEU A HD11 15 
ATOM   10141 H HD12 . LEU A 1 25 ? 4.931  18.201 -3.666  1.00 0.00 ? 42 LEU A HD12 15 
ATOM   10142 H HD13 . LEU A 1 25 ? 6.613  18.062 -4.231  1.00 0.00 ? 42 LEU A HD13 15 
ATOM   10143 H HD21 . LEU A 1 25 ? 5.767  15.825 -7.116  1.00 0.00 ? 42 LEU A HD21 15 
ATOM   10144 H HD22 . LEU A 1 25 ? 5.922  17.596 -7.198  1.00 0.00 ? 42 LEU A HD22 15 
ATOM   10145 H HD23 . LEU A 1 25 ? 7.113  16.640 -6.284  1.00 0.00 ? 42 LEU A HD23 15 
ATOM   10146 N N    . PHE A 1 26 ? 3.189  13.356 -3.862  1.00 0.00 ? 43 PHE A N    15 
ATOM   10147 C CA   . PHE A 1 26 ? 2.966  11.915 -3.831  1.00 0.00 ? 43 PHE A CA   15 
ATOM   10148 C C    . PHE A 1 26 ? 2.389  11.418 -5.150  1.00 0.00 ? 43 PHE A C    15 
ATOM   10149 O O    . PHE A 1 26 ? 1.752  12.176 -5.885  1.00 0.00 ? 43 PHE A O    15 
ATOM   10150 C CB   . PHE A 1 26 ? 2.034  11.542 -2.676  1.00 0.00 ? 43 PHE A CB   15 
ATOM   10151 C CG   . PHE A 1 26 ? 0.643  12.092 -2.818  1.00 0.00 ? 43 PHE A CG   15 
ATOM   10152 C CD1  . PHE A 1 26 ? 0.348  13.385 -2.413  1.00 0.00 ? 43 PHE A CD1  15 
ATOM   10153 C CD2  . PHE A 1 26 ? -0.372 11.318 -3.358  1.00 0.00 ? 43 PHE A CD2  15 
ATOM   10154 C CE1  . PHE A 1 26 ? -0.930 13.892 -2.542  1.00 0.00 ? 43 PHE A CE1  15 
ATOM   10155 C CE2  . PHE A 1 26 ? -1.651 11.823 -3.489  1.00 0.00 ? 43 PHE A CE2  15 
ATOM   10156 C CZ   . PHE A 1 26 ? -1.931 13.109 -3.080  1.00 0.00 ? 43 PHE A CZ   15 
ATOM   10157 H H    . PHE A 1 26 ? 2.635  13.926 -4.485  1.00 0.00 ? 43 PHE A H    15 
ATOM   10158 H HA   . PHE A 1 26 ? 3.916  11.396 -3.694  1.00 0.00 ? 43 PHE A HA   15 
ATOM   10159 H HB2  . PHE A 1 26 ? 1.937  10.460 -2.607  1.00 0.00 ? 43 PHE A HB2  15 
ATOM   10160 H HB3  . PHE A 1 26 ? 2.429  11.931 -1.738  1.00 0.00 ? 43 PHE A HB3  15 
ATOM   10161 H HD1  . PHE A 1 26 ? 1.139  14.004 -1.987  1.00 0.00 ? 43 PHE A HD1  15 
ATOM   10162 H HD2  . PHE A 1 26 ? -0.151 10.300 -3.680  1.00 0.00 ? 43 PHE A HD2  15 
ATOM   10163 H HE1  . PHE A 1 26 ? -1.149 14.909 -2.218  1.00 0.00 ? 43 PHE A HE1  15 
ATOM   10164 H HE2  . PHE A 1 26 ? -2.441 11.203 -3.916  1.00 0.00 ? 43 PHE A HE2  15 
ATOM   10165 H HZ   . PHE A 1 26 ? -2.939 13.508 -3.185  1.00 0.00 ? 43 PHE A HZ   15 
ATOM   10166 N N    . SER A 1 27 ? 2.614  10.143 -5.447  1.00 0.00 ? 44 SER A N    15 
ATOM   10167 C CA   . SER A 1 27 ? 2.083  9.533  -6.660  1.00 0.00 ? 44 SER A CA   15 
ATOM   10168 C C    . SER A 1 27 ? 1.691  8.081  -6.420  1.00 0.00 ? 44 SER A C    15 
ATOM   10169 O O    . SER A 1 27 ? 1.887  7.548  -5.329  1.00 0.00 ? 44 SER A O    15 
ATOM   10170 C CB   . SER A 1 27 ? 3.101  9.628  -7.780  1.00 0.00 ? 44 SER A CB   15 
ATOM   10171 O OG   . SER A 1 27 ? 4.176  8.749  -7.591  1.00 0.00 ? 44 SER A OG   15 
ATOM   10172 H H    . SER A 1 27 ? 3.167  9.582  -4.815  1.00 0.00 ? 44 SER A H    15 
ATOM   10173 H HA   . SER A 1 27 ? 1.240  10.080 -7.086  1.00 0.00 ? 44 SER A HA   15 
ATOM   10174 H HB2  . SER A 1 27 ? 2.607  9.386  -8.721  1.00 0.00 ? 44 SER A HB2  15 
ATOM   10175 H HB3  . SER A 1 27 ? 3.480  10.648 -7.822  1.00 0.00 ? 44 SER A HB3  15 
ATOM   10176 H HG   . SER A 1 27 ? 3.842  7.857  -7.471  1.00 0.00 ? 44 SER A HG   15 
ATOM   10177 N N    . THR A 1 28 ? 1.139  7.445  -7.448  1.00 0.00 ? 45 THR A N    15 
ATOM   10178 C CA   . THR A 1 28 ? 0.784  6.033  -7.374  1.00 0.00 ? 45 THR A CA   15 
ATOM   10179 C C    . THR A 1 28 ? 1.114  5.313  -8.676  1.00 0.00 ? 45 THR A C    15 
ATOM   10180 O O    . THR A 1 28 ? 0.747  5.768  -9.759  1.00 0.00 ? 45 THR A O    15 
ATOM   10181 C CB   . THR A 1 28 ? -0.712 5.841  -7.059  1.00 0.00 ? 45 THR A CB   15 
ATOM   10182 O OG1  . THR A 1 28 ? -1.036 6.519  -5.838  1.00 0.00 ? 45 THR A OG1  15 
ATOM   10183 C CG2  . THR A 1 28 ? -1.042 4.363  -6.918  1.00 0.00 ? 45 THR A CG2  15 
ATOM   10184 H H    . THR A 1 28 ? 0.958  7.953  -8.302  1.00 0.00 ? 45 THR A H    15 
ATOM   10185 H HA   . THR A 1 28 ? 1.370  5.546  -6.595  1.00 0.00 ? 45 THR A HA   15 
ATOM   10186 H HB   . THR A 1 28 ? -1.302 6.269  -7.870  1.00 0.00 ? 45 THR A HB   15 
ATOM   10187 H HG1  . THR A 1 28 ? -1.199 7.447  -6.021  1.00 0.00 ? 45 THR A HG1  15 
ATOM   10188 H HG21 . THR A 1 28 ? -0.453 3.936  -6.109  1.00 0.00 ? 45 THR A HG21 15 
ATOM   10189 H HG22 . THR A 1 28 ? -2.103 4.249  -6.696  1.00 0.00 ? 45 THR A HG22 15 
ATOM   10190 H HG23 . THR A 1 28 ? -0.807 3.848  -7.849  1.00 0.00 ? 45 THR A HG23 15 
HETATM 10191 N N    . TPO A 1 29 ? 1.810  4.187  -8.562  1.00 0.00 ? 46 TPO A N    15 
HETATM 10192 C CA   . TPO A 1 29 ? 2.236  3.429  -9.732  1.00 0.00 ? 46 TPO A CA   15 
HETATM 10193 C CB   . TPO A 1 29 ? 3.548  2.668  -9.466  1.00 0.00 ? 46 TPO A CB   15 
HETATM 10194 C CG2  . TPO A 1 29 ? 4.586  3.593  -8.849  1.00 0.00 ? 46 TPO A CG2  15 
HETATM 10195 O OG1  . TPO A 1 29 ? 3.296  1.575  -8.572  1.00 0.00 ? 46 TPO A OG1  15 
HETATM 10196 P P    . TPO A 1 29 ? 4.256  0.279  -8.571  1.00 0.00 ? 46 TPO A P    15 
HETATM 10197 O O1P  . TPO A 1 29 ? 3.708  -0.699 -7.499  1.00 0.00 ? 46 TPO A O1P  15 
HETATM 10198 O O2P  . TPO A 1 29 ? 5.687  0.764  -8.220  1.00 0.00 ? 46 TPO A O2P  15 
HETATM 10199 O O3P  . TPO A 1 29 ? 4.196  -0.340 -9.992  1.00 0.00 ? 46 TPO A O3P  15 
HETATM 10200 C C    . TPO A 1 29 ? 1.165  2.437  -10.167 1.00 0.00 ? 46 TPO A C    15 
HETATM 10201 O O    . TPO A 1 29 ? 0.245  2.131  -9.409  1.00 0.00 ? 46 TPO A O    15 
HETATM 10202 H H    . TPO A 1 29 ? 2.049  3.847  -7.642  1.00 0.00 ? 46 TPO A H    15 
HETATM 10203 H HA   . TPO A 1 29 ? 2.391  4.105  -10.573 1.00 0.00 ? 46 TPO A HA   15 
HETATM 10204 H HB   . TPO A 1 29 ? 3.928  2.274  -10.408 1.00 0.00 ? 46 TPO A HB   15 
HETATM 10205 H HG21 . TPO A 1 29 ? 5.506  3.037  -8.667  1.00 0.00 ? 46 TPO A HG21 15 
HETATM 10206 H HG22 . TPO A 1 29 ? 4.789  4.418  -9.531  1.00 0.00 ? 46 TPO A HG22 15 
HETATM 10207 H HG23 . TPO A 1 29 ? 4.207  3.986  -7.906  1.00 0.00 ? 46 TPO A HG23 15 
ATOM   10208 N N    . PRO A 1 30 ? 1.291  1.938  -11.393 1.00 0.00 ? 47 PRO A N    15 
ATOM   10209 C CA   . PRO A 1 30 ? 0.288  1.047  -11.963 1.00 0.00 ? 47 PRO A CA   15 
ATOM   10210 C C    . PRO A 1 30 ? 0.072  -0.177 -11.081 1.00 0.00 ? 47 PRO A C    15 
ATOM   10211 O O    . PRO A 1 30 ? -1.020 -0.742 -11.043 1.00 0.00 ? 47 PRO A O    15 
ATOM   10212 C CB   . PRO A 1 30 ? 0.855  0.675  -13.336 1.00 0.00 ? 47 PRO A CB   15 
ATOM   10213 C CG   . PRO A 1 30 ? 1.713  1.835  -13.710 1.00 0.00 ? 47 PRO A CG   15 
ATOM   10214 C CD   . PRO A 1 30 ? 2.328  2.308  -12.419 1.00 0.00 ? 47 PRO A CD   15 
ATOM   10215 H HA   . PRO A 1 30 ? -0.704 1.517  -12.042 1.00 0.00 ? 47 PRO A HA   15 
ATOM   10216 H HB2  . PRO A 1 30 ? 1.439  -0.255 -13.293 1.00 0.00 ? 47 PRO A HB2  15 
ATOM   10217 H HB3  . PRO A 1 30 ? 0.054  0.519  -14.074 1.00 0.00 ? 47 PRO A HB3  15 
ATOM   10218 H HG2  . PRO A 1 30 ? 2.488  1.540  -14.432 1.00 0.00 ? 47 PRO A HG2  15 
ATOM   10219 H HG3  . PRO A 1 30 ? 1.121  2.633  -14.181 1.00 0.00 ? 47 PRO A HG3  15 
ATOM   10220 H HD2  . PRO A 1 30 ? 3.288  1.813  -12.211 1.00 0.00 ? 47 PRO A HD2  15 
ATOM   10221 H HD3  . PRO A 1 30 ? 2.519  3.391  -12.422 1.00 0.00 ? 47 PRO A HD3  15 
ATOM   10222 N N    . GLY A 1 31 ? 1.122  -0.582 -10.374 1.00 0.00 ? 48 GLY A N    15 
ATOM   10223 C CA   . GLY A 1 31 ? 1.054  -1.747 -9.501  1.00 0.00 ? 48 GLY A CA   15 
ATOM   10224 C C    . GLY A 1 31 ? 0.088  -1.515 -8.346  1.00 0.00 ? 48 GLY A C    15 
ATOM   10225 O O    . GLY A 1 31 ? -0.478 -2.460 -7.797  1.00 0.00 ? 48 GLY A O    15 
ATOM   10226 H H    . GLY A 1 31 ? 1.990  -0.070 -10.445 1.00 0.00 ? 48 GLY A H    15 
ATOM   10227 H HA2  . GLY A 1 31 ? 0.715  -2.607 -10.079 1.00 0.00 ? 48 GLY A HA2  15 
ATOM   10228 H HA3  . GLY A 1 31 ? 2.045  -1.950 -9.100  1.00 0.00 ? 48 GLY A HA3  15 
ATOM   10229 N N    . GLY A 1 32 ? -0.097 -0.250 -7.982  1.00 0.00 ? 49 GLY A N    15 
ATOM   10230 C CA   . GLY A 1 32 ? -1.039 0.114  -6.932  1.00 0.00 ? 49 GLY A CA   15 
ATOM   10231 C C    . GLY A 1 32 ? -0.312 0.535  -5.661  1.00 0.00 ? 49 GLY A C    15 
ATOM   10232 O O    . GLY A 1 32 ? -0.912 0.618  -4.589  1.00 0.00 ? 49 GLY A O    15 
ATOM   10233 H H    . GLY A 1 32 ? 0.430  0.477  -8.446  1.00 0.00 ? 49 GLY A H    15 
ATOM   10234 H HA2  . GLY A 1 32 ? -1.657 0.944  -7.279  1.00 0.00 ? 49 GLY A HA2  15 
ATOM   10235 H HA3  . GLY A 1 32 ? -1.675 -0.742 -6.711  1.00 0.00 ? 49 GLY A HA3  15 
ATOM   10236 N N    . THR A 1 33 ? 0.983  0.800  -5.787  1.00 0.00 ? 50 THR A N    15 
ATOM   10237 C CA   . THR A 1 33 ? 1.790  1.235  -4.653  1.00 0.00 ? 50 THR A CA   15 
ATOM   10238 C C    . THR A 1 33 ? 1.878  2.755  -4.589  1.00 0.00 ? 50 THR A C    15 
ATOM   10239 O O    . THR A 1 33 ? 2.189  3.410  -5.584  1.00 0.00 ? 50 THR A O    15 
ATOM   10240 C CB   . THR A 1 33 ? 3.213  0.651  -4.715  1.00 0.00 ? 50 THR A CB   15 
ATOM   10241 O OG1  . THR A 1 33 ? 3.147  -0.781 -4.701  1.00 0.00 ? 50 THR A OG1  15 
ATOM   10242 C CG2  . THR A 1 33 ? 4.038  1.128  -3.529  1.00 0.00 ? 50 THR A CG2  15 
ATOM   10243 H H    . THR A 1 33 ? 1.421  0.698  -6.692  1.00 0.00 ? 50 THR A H    15 
ATOM   10244 H HA   . THR A 1 33 ? 1.322  0.915  -3.722  1.00 0.00 ? 50 THR A HA   15 
ATOM   10245 H HB   . THR A 1 33 ? 3.689  0.975  -5.641  1.00 0.00 ? 50 THR A HB   15 
ATOM   10246 H HG1  . THR A 1 33 ? 3.279  -1.115 -5.591  1.00 0.00 ? 50 THR A HG1  15 
ATOM   10247 H HG21 . THR A 1 33 ? 3.564  0.804  -2.603  1.00 0.00 ? 50 THR A HG21 15 
ATOM   10248 H HG22 . THR A 1 33 ? 5.040  0.706  -3.591  1.00 0.00 ? 50 THR A HG22 15 
ATOM   10249 H HG23 . THR A 1 33 ? 4.100  2.216  -3.543  1.00 0.00 ? 50 THR A HG23 15 
ATOM   10250 N N    . ARG A 1 34 ? 1.603  3.310  -3.414  1.00 0.00 ? 51 ARG A N    15 
ATOM   10251 C CA   . ARG A 1 34 ? 1.668  4.753  -3.215  1.00 0.00 ? 51 ARG A CA   15 
ATOM   10252 C C    . ARG A 1 34 ? 3.071  5.191  -2.816  1.00 0.00 ? 51 ARG A C    15 
ATOM   10253 O O    . ARG A 1 34 ? 3.725  4.544  -1.998  1.00 0.00 ? 51 ARG A O    15 
ATOM   10254 C CB   . ARG A 1 34 ? 0.627  5.242  -2.219  1.00 0.00 ? 51 ARG A CB   15 
ATOM   10255 C CG   . ARG A 1 34 ? -0.817 5.040  -2.650  1.00 0.00 ? 51 ARG A CG   15 
ATOM   10256 C CD   . ARG A 1 34 ? -1.823 5.502  -1.660  1.00 0.00 ? 51 ARG A CD   15 
ATOM   10257 N NE   . ARG A 1 34 ? -3.201 5.220  -2.025  1.00 0.00 ? 51 ARG A NE   15 
ATOM   10258 C CZ   . ARG A 1 34 ? -4.269 5.484  -1.246  1.00 0.00 ? 51 ARG A CZ   15 
ATOM   10259 N NH1  . ARG A 1 34 ? -4.120 5.999  -0.046  1.00 0.00 ? 51 ARG A NH1  15 
ATOM   10260 N NH2  . ARG A 1 34 ? -5.470 5.189  -1.712  1.00 0.00 ? 51 ARG A NH2  15 
ATOM   10261 H H    . ARG A 1 34 ? 1.342  2.718  -2.639  1.00 0.00 ? 51 ARG A H    15 
ATOM   10262 H HA   . ARG A 1 34 ? 1.436  5.266  -4.149  1.00 0.00 ? 51 ARG A HA   15 
ATOM   10263 H HB2  . ARG A 1 34 ? 0.802  4.706  -1.287  1.00 0.00 ? 51 ARG A HB2  15 
ATOM   10264 H HB3  . ARG A 1 34 ? 0.809  6.305  -2.064  1.00 0.00 ? 51 ARG A HB3  15 
ATOM   10265 H HG2  . ARG A 1 34 ? -0.982 5.590  -3.577  1.00 0.00 ? 51 ARG A HG2  15 
ATOM   10266 H HG3  . ARG A 1 34 ? -0.980 3.976  -2.825  1.00 0.00 ? 51 ARG A HG3  15 
ATOM   10267 H HD2  . ARG A 1 34 ? -1.631 5.011  -0.706  1.00 0.00 ? 51 ARG A HD2  15 
ATOM   10268 H HD3  . ARG A 1 34 ? -1.730 6.580  -1.538  1.00 0.00 ? 51 ARG A HD3  15 
ATOM   10269 H HE   . ARG A 1 34 ? -3.573 4.806  -2.870  1.00 0.00 ? 51 ARG A HE   15 
ATOM   10270 H HH11 . ARG A 1 34 ? -3.194 6.204  0.302   1.00 0.00 ? 51 ARG A HH11 15 
ATOM   10271 H HH12 . ARG A 1 34 ? -4.933 6.190  0.522   1.00 0.00 ? 51 ARG A HH12 15 
ATOM   10272 H HH21 . ARG A 1 34 ? -5.566 4.777  -2.630  1.00 0.00 ? 51 ARG A HH21 15 
ATOM   10273 H HH22 . ARG A 1 34 ? -6.286 5.376  -1.149  1.00 0.00 ? 51 ARG A HH22 15 
ATOM   10274 N N    . ILE A 1 35 ? 3.529  6.294  -3.399  1.00 0.00 ? 52 ILE A N    15 
ATOM   10275 C CA   . ILE A 1 35 ? 4.861  6.814  -3.114  1.00 0.00 ? 52 ILE A CA   15 
ATOM   10276 C C    . ILE A 1 35 ? 4.792  8.238  -2.576  1.00 0.00 ? 52 ILE A C    15 
ATOM   10277 O O    . ILE A 1 35 ? 4.308  9.145  -3.253  1.00 0.00 ? 52 ILE A O    15 
ATOM   10278 C CB   . ILE A 1 35 ? 5.756  6.791  -4.365  1.00 0.00 ? 52 ILE A CB   15 
ATOM   10279 C CG1  . ILE A 1 35 ? 5.871  5.367  -4.914  1.00 0.00 ? 52 ILE A CG1  15 
ATOM   10280 C CG2  . ILE A 1 35 ? 7.134  7.353  -4.045  1.00 0.00 ? 52 ILE A CG2  15 
ATOM   10281 C CD1  . ILE A 1 35 ? 6.590  5.279  -6.241  1.00 0.00 ? 52 ILE A CD1  15 
ATOM   10282 H H    . ILE A 1 35 ? 2.940  6.783  -4.056  1.00 0.00 ? 52 ILE A H    15 
ATOM   10283 H HA   . ILE A 1 35 ? 5.335  6.241  -2.318  1.00 0.00 ? 52 ILE A HA   15 
ATOM   10284 H HB   . ILE A 1 35 ? 5.292  7.392  -5.146  1.00 0.00 ? 52 ILE A HB   15 
ATOM   10285 H HG12 . ILE A 1 35 ? 6.405  4.775  -4.172  1.00 0.00 ? 52 ILE A HG12 15 
ATOM   10286 H HG13 . ILE A 1 35 ? 4.857  4.980  -5.025  1.00 0.00 ? 52 ILE A HG13 15 
ATOM   10287 H HG21 . ILE A 1 35 ? 7.754  7.330  -4.940  1.00 0.00 ? 52 ILE A HG21 15 
ATOM   10288 H HG22 . ILE A 1 35 ? 7.034  8.382  -3.700  1.00 0.00 ? 52 ILE A HG22 15 
ATOM   10289 H HG23 . ILE A 1 35 ? 7.599  6.752  -3.264  1.00 0.00 ? 52 ILE A HG23 15 
ATOM   10290 H HD11 . ILE A 1 35 ? 7.603  5.664  -6.132  1.00 0.00 ? 52 ILE A HD11 15 
ATOM   10291 H HD12 . ILE A 1 35 ? 6.631  4.239  -6.565  1.00 0.00 ? 52 ILE A HD12 15 
ATOM   10292 H HD13 . ILE A 1 35 ? 6.055  5.870  -6.986  1.00 0.00 ? 52 ILE A HD13 15 
ATOM   10293 N N    . ILE A 1 36 ? 5.279  8.428  -1.353  1.00 0.00 ? 53 ILE A N    15 
ATOM   10294 C CA   . ILE A 1 36 ? 5.369  9.758  -0.763  1.00 0.00 ? 53 ILE A CA   15 
ATOM   10295 C C    . ILE A 1 36 ? 6.760  10.350 -0.951  1.00 0.00 ? 53 ILE A C    15 
ATOM   10296 O O    . ILE A 1 36 ? 7.762  9.737  -0.584  1.00 0.00 ? 53 ILE A O    15 
ATOM   10297 C CB   . ILE A 1 36 ? 5.030  9.733  0.739   1.00 0.00 ? 53 ILE A CB   15 
ATOM   10298 C CG1  . ILE A 1 36 ? 3.595  9.248  0.955   1.00 0.00 ? 53 ILE A CG1  15 
ATOM   10299 C CG2  . ILE A 1 36 ? 5.228  11.112 1.350   1.00 0.00 ? 53 ILE A CG2  15 
ATOM   10300 C CD1  . ILE A 1 36 ? 3.256  8.968  2.400   1.00 0.00 ? 53 ILE A CD1  15 
ATOM   10301 H H    . ILE A 1 36 ? 5.593  7.630  -0.821  1.00 0.00 ? 53 ILE A H    15 
ATOM   10302 H HA   . ILE A 1 36 ? 4.702  10.451 -1.274  1.00 0.00 ? 53 ILE A HA   15 
ATOM   10303 H HB   . ILE A 1 36 ? 5.683  9.018  1.238   1.00 0.00 ? 53 ILE A HB   15 
ATOM   10304 H HG12 . ILE A 1 36 ? 2.930  10.020 0.568   1.00 0.00 ? 53 ILE A HG12 15 
ATOM   10305 H HG13 . ILE A 1 36 ? 3.470  8.336  0.369   1.00 0.00 ? 53 ILE A HG13 15 
ATOM   10306 H HG21 . ILE A 1 36 ? 4.984  11.077 2.412   1.00 0.00 ? 53 ILE A HG21 15 
ATOM   10307 H HG22 . ILE A 1 36 ? 6.266  11.420 1.227   1.00 0.00 ? 53 ILE A HG22 15 
ATOM   10308 H HG23 . ILE A 1 36 ? 4.575  11.828 0.851   1.00 0.00 ? 53 ILE A HG23 15 
ATOM   10309 H HD11 . ILE A 1 36 ? 3.380  9.878  2.986   1.00 0.00 ? 53 ILE A HD11 15 
ATOM   10310 H HD12 . ILE A 1 36 ? 2.223  8.628  2.474   1.00 0.00 ? 53 ILE A HD12 15 
ATOM   10311 H HD13 . ILE A 1 36 ? 3.921  8.194  2.788   1.00 0.00 ? 53 ILE A HD13 15 
ATOM   10312 N N    . TYR A 1 37 ? 6.815  11.547 -1.527  1.00 0.00 ? 54 TYR A N    15 
ATOM   10313 C CA   . TYR A 1 37 ? 8.084  12.159 -1.901  1.00 0.00 ? 54 TYR A CA   15 
ATOM   10314 C C    . TYR A 1 37 ? 8.500  13.223 -0.893  1.00 0.00 ? 54 TYR A C    15 
ATOM   10315 O O    . TYR A 1 37 ? 7.927  14.313 -0.854  1.00 0.00 ? 54 TYR A O    15 
ATOM   10316 C CB   . TYR A 1 37 ? 7.992  12.771 -3.300  1.00 0.00 ? 54 TYR A CB   15 
ATOM   10317 C CG   . TYR A 1 37 ? 7.750  11.756 -4.397  1.00 0.00 ? 54 TYR A CG   15 
ATOM   10318 C CD1  . TYR A 1 37 ? 8.804  11.051 -4.958  1.00 0.00 ? 54 TYR A CD1  15 
ATOM   10319 C CD2  . TYR A 1 37 ? 6.470  11.509 -4.870  1.00 0.00 ? 54 TYR A CD2  15 
ATOM   10320 C CE1  . TYR A 1 37 ? 8.590  10.123 -5.959  1.00 0.00 ? 54 TYR A CE1  15 
ATOM   10321 C CE2  . TYR A 1 37 ? 6.243  10.584 -5.870  1.00 0.00 ? 54 TYR A CE2  15 
ATOM   10322 C CZ   . TYR A 1 37 ? 7.308  9.894  -6.413  1.00 0.00 ? 54 TYR A CZ   15 
ATOM   10323 O OH   . TYR A 1 37 ? 7.089  8.971  -7.411  1.00 0.00 ? 54 TYR A OH   15 
ATOM   10324 H H    . TYR A 1 37 ? 5.955  12.045 -1.710  1.00 0.00 ? 54 TYR A H    15 
ATOM   10325 H HA   . TYR A 1 37 ? 8.873  11.407 -1.901  1.00 0.00 ? 54 TYR A HA   15 
ATOM   10326 H HB2  . TYR A 1 37 ? 7.174  13.491 -3.286  1.00 0.00 ? 54 TYR A HB2  15 
ATOM   10327 H HB3  . TYR A 1 37 ? 8.931  13.291 -3.487  1.00 0.00 ? 54 TYR A HB3  15 
ATOM   10328 H HD1  . TYR A 1 37 ? 9.815  11.237 -4.595  1.00 0.00 ? 54 TYR A HD1  15 
ATOM   10329 H HD2  . TYR A 1 37 ? 5.633  12.060 -4.436  1.00 0.00 ? 54 TYR A HD2  15 
ATOM   10330 H HE1  . TYR A 1 37 ? 9.432  9.578  -6.385  1.00 0.00 ? 54 TYR A HE1  15 
ATOM   10331 H HE2  . TYR A 1 37 ? 5.232  10.400 -6.232  1.00 0.00 ? 54 TYR A HE2  15 
ATOM   10332 H HH   . TYR A 1 37 ? 6.168  8.712  -7.487  1.00 0.00 ? 54 TYR A HH   15 
ATOM   10333 N N    . ASP A 1 38 ? 9.499  12.902 -0.078  1.00 0.00 ? 55 ASP A N    15 
ATOM   10334 C CA   . ASP A 1 38 ? 9.928  13.789 0.997   1.00 0.00 ? 55 ASP A CA   15 
ATOM   10335 C C    . ASP A 1 38 ? 11.119 14.636 0.569   1.00 0.00 ? 55 ASP A C    15 
ATOM   10336 O O    . ASP A 1 38 ? 12.238 14.135 0.448   1.00 0.00 ? 55 ASP A O    15 
ATOM   10337 C CB   . ASP A 1 38 ? 10.278 12.984 2.250   1.00 0.00 ? 55 ASP A CB   15 
ATOM   10338 C CG   . ASP A 1 38 ? 10.800 13.821 3.410   1.00 0.00 ? 55 ASP A CG   15 
ATOM   10339 O OD1  . ASP A 1 38 ? 11.084 14.977 3.202   1.00 0.00 ? 55 ASP A OD1  15 
ATOM   10340 O OD2  . ASP A 1 38 ? 10.764 13.347 4.520   1.00 0.00 ? 55 ASP A OD2  15 
ATOM   10341 H H    . ASP A 1 38 ? 9.974  12.020 -0.207  1.00 0.00 ? 55 ASP A H    15 
ATOM   10342 H HA   . ASP A 1 38 ? 9.125  14.486 1.242   1.00 0.00 ? 55 ASP A HA   15 
ATOM   10343 H HB2  . ASP A 1 38 ? 9.464  12.348 2.599   1.00 0.00 ? 55 ASP A HB2  15 
ATOM   10344 H HB3  . ASP A 1 38 ? 11.084 12.361 1.858   1.00 0.00 ? 55 ASP A HB3  15 
ATOM   10345 N N    . ARG A 1 39 ? 10.874 15.921 0.341   1.00 0.00 ? 56 ARG A N    15 
ATOM   10346 C CA   . ARG A 1 39 ? 11.927 16.840 -0.078  1.00 0.00 ? 56 ARG A CA   15 
ATOM   10347 C C    . ARG A 1 39 ? 12.734 17.334 1.115   1.00 0.00 ? 56 ARG A C    15 
ATOM   10348 O O    . ARG A 1 39 ? 12.191 17.949 2.032   1.00 0.00 ? 56 ARG A O    15 
ATOM   10349 C CB   . ARG A 1 39 ? 11.383 17.998 -0.901  1.00 0.00 ? 56 ARG A CB   15 
ATOM   10350 C CG   . ARG A 1 39 ? 12.443 18.875 -1.550  1.00 0.00 ? 56 ARG A CG   15 
ATOM   10351 C CD   . ARG A 1 39 ? 11.902 19.926 -2.449  1.00 0.00 ? 56 ARG A CD   15 
ATOM   10352 N NE   . ARG A 1 39 ? 12.913 20.677 -3.174  1.00 0.00 ? 56 ARG A NE   15 
ATOM   10353 C CZ   . ARG A 1 39 ? 12.681 21.822 -3.847  1.00 0.00 ? 56 ARG A CZ   15 
ATOM   10354 N NH1  . ARG A 1 39 ? 11.470 22.329 -3.921  1.00 0.00 ? 56 ARG A NH1  15 
ATOM   10355 N NH2  . ARG A 1 39 ? 13.699 22.409 -4.451  1.00 0.00 ? 56 ARG A NH2  15 
ATOM   10356 H H    . ARG A 1 39 ? 9.934  16.272 0.460   1.00 0.00 ? 56 ARG A H    15 
ATOM   10357 H HA   . ARG A 1 39 ? 12.628 16.323 -0.735  1.00 0.00 ? 56 ARG A HA   15 
ATOM   10358 H HB2  . ARG A 1 39 ? 10.748 17.570 -1.675  1.00 0.00 ? 56 ARG A HB2  15 
ATOM   10359 H HB3  . ARG A 1 39 ? 10.777 18.608 -0.230  1.00 0.00 ? 56 ARG A HB3  15 
ATOM   10360 H HG2  . ARG A 1 39 ? 13.015 19.367 -0.764  1.00 0.00 ? 56 ARG A HG2  15 
ATOM   10361 H HG3  . ARG A 1 39 ? 13.106 18.238 -2.137  1.00 0.00 ? 56 ARG A HG3  15 
ATOM   10362 H HD2  . ARG A 1 39 ? 11.251 19.458 -3.188  1.00 0.00 ? 56 ARG A HD2  15 
ATOM   10363 H HD3  . ARG A 1 39 ? 11.328 20.637 -1.858  1.00 0.00 ? 56 ARG A HD3  15 
ATOM   10364 H HE   . ARG A 1 39 ? 13.899 20.485 -3.292  1.00 0.00 ? 56 ARG A HE   15 
ATOM   10365 H HH11 . ARG A 1 39 ? 10.699 21.858 -3.470  1.00 0.00 ? 56 ARG A HH11 15 
ATOM   10366 H HH12 . ARG A 1 39 ? 11.317 23.188 -4.431  1.00 0.00 ? 56 ARG A HH12 15 
ATOM   10367 H HH21 . ARG A 1 39 ? 14.620 21.995 -4.399  1.00 0.00 ? 56 ARG A HH21 15 
ATOM   10368 H HH22 . ARG A 1 39 ? 13.553 23.266 -4.962  1.00 0.00 ? 56 ARG A HH22 15 
ATOM   10369 N N    . LYS A 1 40 ? 14.034 17.059 1.097   1.00 0.00 ? 57 LYS A N    15 
ATOM   10370 C CA   . LYS A 1 40 ? 14.915 17.452 2.191   1.00 0.00 ? 57 LYS A CA   15 
ATOM   10371 C C    . LYS A 1 40 ? 15.100 18.964 2.233   1.00 0.00 ? 57 LYS A C    15 
ATOM   10372 O O    . LYS A 1 40 ? 15.327 19.541 3.296   1.00 0.00 ? 57 LYS A O    15 
ATOM   10373 C CB   . LYS A 1 40 ? 16.272 16.759 2.061   1.00 0.00 ? 57 LYS A CB   15 
ATOM   10374 C CG   . LYS A 1 40 ? 16.240 15.258 2.321   1.00 0.00 ? 57 LYS A CG   15 
ATOM   10375 C CD   . LYS A 1 40 ? 17.626 14.644 2.192   1.00 0.00 ? 57 LYS A CD   15 
ATOM   10376 C CE   . LYS A 1 40 ? 17.599 13.151 2.479   1.00 0.00 ? 57 LYS A CE   15 
ATOM   10377 N NZ   . LYS A 1 40 ? 18.948 12.536 2.352   1.00 0.00 ? 57 LYS A NZ   15 
ATOM   10378 H H    . LYS A 1 40 ? 14.423 16.566 0.306   1.00 0.00 ? 57 LYS A H    15 
ATOM   10379 H HA   . LYS A 1 40 ? 14.469 17.168 3.145   1.00 0.00 ? 57 LYS A HA   15 
ATOM   10380 H HB2  . LYS A 1 40 ? 16.629 16.944 1.047   1.00 0.00 ? 57 LYS A HB2  15 
ATOM   10381 H HB3  . LYS A 1 40 ? 16.945 17.236 2.774   1.00 0.00 ? 57 LYS A HB3  15 
ATOM   10382 H HG2  . LYS A 1 40 ? 15.860 15.090 3.330   1.00 0.00 ? 57 LYS A HG2  15 
ATOM   10383 H HG3  . LYS A 1 40 ? 15.569 14.796 1.598   1.00 0.00 ? 57 LYS A HG3  15 
ATOM   10384 H HD2  . LYS A 1 40 ? 17.988 14.815 1.177   1.00 0.00 ? 57 LYS A HD2  15 
ATOM   10385 H HD3  . LYS A 1 40 ? 18.291 15.137 2.901   1.00 0.00 ? 57 LYS A HD3  15 
ATOM   10386 H HE2  . LYS A 1 40 ? 17.227 13.003 3.491   1.00 0.00 ? 57 LYS A HE2  15 
ATOM   10387 H HE3  . LYS A 1 40 ? 16.918 12.679 1.770   1.00 0.00 ? 57 LYS A HE3  15 
ATOM   10388 H HZ1  . LYS A 1 40 ? 19.580 12.971 3.009   1.00 0.00 ? 57 LYS A HZ1  15 
ATOM   10389 H HZ2  . LYS A 1 40 ? 18.887 11.547 2.549   1.00 0.00 ? 57 LYS A HZ2  15 
ATOM   10390 H HZ3  . LYS A 1 40 ? 19.294 12.671 1.412   1.00 0.00 ? 57 LYS A HZ3  15 
ATOM   10391 N N    . PHE A 1 41 ? 15.004 19.598 1.070   1.00 0.00 ? 58 PHE A N    15 
ATOM   10392 C CA   . PHE A 1 41 ? 15.099 21.051 0.979   1.00 0.00 ? 58 PHE A CA   15 
ATOM   10393 C C    . PHE A 1 41 ? 13.958 21.726 1.730   1.00 0.00 ? 58 PHE A C    15 
ATOM   10394 O O    . PHE A 1 41 ? 14.169 22.701 2.452   1.00 0.00 ? 58 PHE A O    15 
ATOM   10395 C CB   . PHE A 1 41 ? 15.103 21.496 -0.484  1.00 0.00 ? 58 PHE A CB   15 
ATOM   10396 C CG   . PHE A 1 41 ? 15.165 22.986 -0.664  1.00 0.00 ? 58 PHE A CG   15 
ATOM   10397 C CD1  . PHE A 1 41 ? 16.360 23.671 -0.495  1.00 0.00 ? 58 PHE A CD1  15 
ATOM   10398 C CD2  . PHE A 1 41 ? 14.030 23.707 -1.001  1.00 0.00 ? 58 PHE A CD2  15 
ATOM   10399 C CE1  . PHE A 1 41 ? 16.419 25.042 -0.661  1.00 0.00 ? 58 PHE A CE1  15 
ATOM   10400 C CE2  . PHE A 1 41 ? 14.085 25.077 -1.167  1.00 0.00 ? 58 PHE A CE2  15 
ATOM   10401 C CZ   . PHE A 1 41 ? 15.281 25.745 -0.997  1.00 0.00 ? 58 PHE A CZ   15 
ATOM   10402 H H    . PHE A 1 41 ? 14.859 19.062 0.226   1.00 0.00 ? 58 PHE A H    15 
ATOM   10403 H HA   . PHE A 1 41 ? 16.024 21.391 1.450   1.00 0.00 ? 58 PHE A HA   15 
ATOM   10404 H HB2  . PHE A 1 41 ? 15.970 21.083 -1.000  1.00 0.00 ? 58 PHE A HB2  15 
ATOM   10405 H HB3  . PHE A 1 41 ? 14.193 21.161 -0.980  1.00 0.00 ? 58 PHE A HB3  15 
ATOM   10406 H HD1  . PHE A 1 41 ? 17.260 23.114 -0.230  1.00 0.00 ? 58 PHE A HD1  15 
ATOM   10407 H HD2  . PHE A 1 41 ? 13.085 23.180 -1.136  1.00 0.00 ? 58 PHE A HD2  15 
ATOM   10408 H HE1  . PHE A 1 41 ? 17.364 25.566 -0.525  1.00 0.00 ? 58 PHE A HE1  15 
ATOM   10409 H HE2  . PHE A 1 41 ? 13.186 25.632 -1.433  1.00 0.00 ? 58 PHE A HE2  15 
ATOM   10410 H HZ   . PHE A 1 41 ? 15.327 26.825 -1.126  1.00 0.00 ? 58 PHE A HZ   15 
ATOM   10411 N N    . LEU A 1 42 ? 12.750 21.202 1.554   1.00 0.00 ? 59 LEU A N    15 
ATOM   10412 C CA   . LEU A 1 42 ? 11.572 21.757 2.211   1.00 0.00 ? 59 LEU A CA   15 
ATOM   10413 C C    . LEU A 1 42 ? 11.294 21.050 3.531   1.00 0.00 ? 59 LEU A C    15 
ATOM   10414 O O    . LEU A 1 42 ? 10.364 21.407 4.253   1.00 0.00 ? 59 LEU A O    15 
ATOM   10415 C CB   . LEU A 1 42 ? 10.353 21.658 1.285   1.00 0.00 ? 59 LEU A CB   15 
ATOM   10416 C CG   . LEU A 1 42 ? 10.447 22.479 -0.008  1.00 0.00 ? 59 LEU A CG   15 
ATOM   10417 C CD1  . LEU A 1 42 ? 9.221  22.229 -0.875  1.00 0.00 ? 59 LEU A CD1  15 
ATOM   10418 C CD2  . LEU A 1 42 ? 10.572 23.956 0.337   1.00 0.00 ? 59 LEU A CD2  15 
ATOM   10419 H H    . LEU A 1 42 ? 12.645 20.399 0.951   1.00 0.00 ? 59 LEU A H    15 
ATOM   10420 H HA   . LEU A 1 42 ? 11.749 22.804 2.452   1.00 0.00 ? 59 LEU A HA   15 
ATOM   10421 H HB2  . LEU A 1 42 ? 10.392 20.594 1.055   1.00 0.00 ? 59 LEU A HB2  15 
ATOM   10422 H HB3  . LEU A 1 42 ? 9.426  21.882 1.812   1.00 0.00 ? 59 LEU A HB3  15 
ATOM   10423 H HG   . LEU A 1 42 ? 11.362 22.178 -0.518  1.00 0.00 ? 59 LEU A HG   15 
ATOM   10424 H HD11 . LEU A 1 42 ? 9.296  22.816 -1.790  1.00 0.00 ? 59 LEU A HD11 15 
ATOM   10425 H HD12 . LEU A 1 42 ? 9.164  21.170 -1.128  1.00 0.00 ? 59 LEU A HD12 15 
ATOM   10426 H HD13 . LEU A 1 42 ? 8.324  22.520 -0.329  1.00 0.00 ? 59 LEU A HD13 15 
ATOM   10427 H HD21 . LEU A 1 42 ? 11.470 24.116 0.934   1.00 0.00 ? 59 LEU A HD21 15 
ATOM   10428 H HD22 . LEU A 1 42 ? 10.639 24.539 -0.582  1.00 0.00 ? 59 LEU A HD22 15 
ATOM   10429 H HD23 . LEU A 1 42 ? 9.697  24.273 0.905   1.00 0.00 ? 59 LEU A HD23 15 
ATOM   10430 N N    . LEU A 1 43 ? 12.106 20.045 3.841   1.00 0.00 ? 60 LEU A N    15 
ATOM   10431 C CA   . LEU A 1 43 ? 11.969 19.308 5.092   1.00 0.00 ? 60 LEU A CA   15 
ATOM   10432 C C    . LEU A 1 43 ? 10.559 18.753 5.254   1.00 0.00 ? 60 LEU A C    15 
ATOM   10433 O O    . LEU A 1 43 ? 9.950  18.878 6.316   1.00 0.00 ? 60 LEU A O    15 
ATOM   10434 C CB   . LEU A 1 43 ? 12.327 20.209 6.280   1.00 0.00 ? 60 LEU A CB   15 
ATOM   10435 C CG   . LEU A 1 43 ? 13.769 20.732 6.291   1.00 0.00 ? 60 LEU A CG   15 
ATOM   10436 C CD1  . LEU A 1 43 ? 13.967 21.696 7.453   1.00 0.00 ? 60 LEU A CD1  15 
ATOM   10437 C CD2  . LEU A 1 43 ? 14.735 19.561 6.392   1.00 0.00 ? 60 LEU A CD2  15 
ATOM   10438 H H    . LEU A 1 43 ? 12.836 19.784 3.194   1.00 0.00 ? 60 LEU A H    15 
ATOM   10439 H HA   . LEU A 1 43 ? 12.641 18.449 5.085   1.00 0.00 ? 60 LEU A HA   15 
ATOM   10440 H HB2  . LEU A 1 43 ? 11.634 21.028 6.097   1.00 0.00 ? 60 LEU A HB2  15 
ATOM   10441 H HB3  . LEU A 1 43 ? 12.087 19.736 7.232   1.00 0.00 ? 60 LEU A HB3  15 
ATOM   10442 H HG   . LEU A 1 43 ? 13.942 21.225 5.334   1.00 0.00 ? 60 LEU A HG   15 
ATOM   10443 H HD11 . LEU A 1 43 ? 14.993 22.062 7.453   1.00 0.00 ? 60 LEU A HD11 15 
ATOM   10444 H HD12 . LEU A 1 43 ? 13.282 22.538 7.347   1.00 0.00 ? 60 LEU A HD12 15 
ATOM   10445 H HD13 . LEU A 1 43 ? 13.766 21.181 8.391   1.00 0.00 ? 60 LEU A HD13 15 
ATOM   10446 H HD21 . LEU A 1 43 ? 14.596 18.899 5.537   1.00 0.00 ? 60 LEU A HD21 15 
ATOM   10447 H HD22 . LEU A 1 43 ? 15.760 19.934 6.400   1.00 0.00 ? 60 LEU A HD22 15 
ATOM   10448 H HD23 . LEU A 1 43 ? 14.543 19.009 7.313   1.00 0.00 ? 60 LEU A HD23 15 
ATOM   10449 N N    . ASP A 1 44 ? 10.046 18.138 4.194   1.00 0.00 ? 61 ASP A N    15 
ATOM   10450 C CA   . ASP A 1 44 ? 8.691  17.601 4.201   1.00 0.00 ? 61 ASP A CA   15 
ATOM   10451 C C    . ASP A 1 44 ? 8.487  16.637 5.364   1.00 0.00 ? 61 ASP A C    15 
ATOM   10452 O O    . ASP A 1 44 ? 9.333  15.783 5.629   1.00 0.00 ? 61 ASP A O    15 
ATOM   10453 C CB   . ASP A 1 44 ? 8.384  16.899 2.876   1.00 0.00 ? 61 ASP A CB   15 
ATOM   10454 C CG   . ASP A 1 44 ? 8.245  17.838 1.685   1.00 0.00 ? 61 ASP A CG   15 
ATOM   10455 O OD1  . ASP A 1 44 ? 8.154  19.024 1.896   1.00 0.00 ? 61 ASP A OD1  15 
ATOM   10456 O OD2  . ASP A 1 44 ? 8.387  17.382 0.576   1.00 0.00 ? 61 ASP A OD2  15 
ATOM   10457 H H    . ASP A 1 44 ? 10.608 18.041 3.361   1.00 0.00 ? 61 ASP A H    15 
ATOM   10458 H HA   . ASP A 1 44 ? 7.973  18.410 4.342   1.00 0.00 ? 61 ASP A HA   15 
ATOM   10459 H HB2  . ASP A 1 44 ? 9.089  16.105 2.632   1.00 0.00 ? 61 ASP A HB2  15 
ATOM   10460 H HB3  . ASP A 1 44 ? 7.412  16.464 3.111   1.00 0.00 ? 61 ASP A HB3  15 
ATOM   10461 N N    . ARG A 1 45 ? 7.361  16.780 6.053   1.00 0.00 ? 62 ARG A N    15 
ATOM   10462 C CA   . ARG A 1 45 ? 7.059  15.942 7.208   1.00 0.00 ? 62 ARG A CA   15 
ATOM   10463 C C    . ARG A 1 45 ? 6.302  14.686 6.796   1.00 0.00 ? 62 ARG A C    15 
ATOM   10464 O O    . ARG A 1 45 ? 6.898  13.751 6.335   1.00 0.00 ? 62 ARG A O    15 
ATOM   10465 C CB   . ARG A 1 45 ? 6.316  16.708 8.294   1.00 0.00 ? 62 ARG A CB   15 
ATOM   10466 C CG   . ARG A 1 45 ? 7.107  17.838 8.934   1.00 0.00 ? 62 ARG A CG   15 
ATOM   10467 C CD   . ARG A 1 45 ? 6.344  18.629 9.934   1.00 0.00 ? 62 ARG A CD   15 
ATOM   10468 N NE   . ARG A 1 45 ? 7.087  19.730 10.524  1.00 0.00 ? 62 ARG A NE   15 
ATOM   10469 C CZ   . ARG A 1 45 ? 6.560  20.650 11.356  1.00 0.00 ? 62 ARG A CZ   15 
ATOM   10470 N NH1  . ARG A 1 45 ? 5.284  20.628 11.667  1.00 0.00 ? 62 ARG A NH1  15 
ATOM   10471 N NH2  . ARG A 1 45 ? 7.357  21.591 11.832  1.00 0.00 ? 62 ARG A NH2  15 
ATOM   10472 O OXT  . ARG A 1 45 ? 5.111  14.631 6.931   1.00 0.00 ? 62 ARG A OXT  15 
ATOM   10473 H H    . ARG A 1 45 ? 6.697  17.486 5.771   1.00 0.00 ? 62 ARG A H    15 
ATOM   10474 H HA   . ARG A 1 45 ? 7.986  15.608 7.674   1.00 0.00 ? 62 ARG A HA   15 
ATOM   10475 H HB2  . ARG A 1 45 ? 5.415  17.114 7.838   1.00 0.00 ? 62 ARG A HB2  15 
ATOM   10476 H HB3  . ARG A 1 45 ? 6.041  15.984 9.061   1.00 0.00 ? 62 ARG A HB3  15 
ATOM   10477 H HG2  . ARG A 1 45 ? 7.977  17.412 9.436   1.00 0.00 ? 62 ARG A HG2  15 
ATOM   10478 H HG3  . ARG A 1 45 ? 7.438  18.518 8.148   1.00 0.00 ? 62 ARG A HG3  15 
ATOM   10479 H HD2  . ARG A 1 45 ? 5.463  19.052 9.452   1.00 0.00 ? 62 ARG A HD2  15 
ATOM   10480 H HD3  . ARG A 1 45 ? 6.036  17.971 10.744  1.00 0.00 ? 62 ARG A HD3  15 
ATOM   10481 H HE   . ARG A 1 45 ? 8.063  19.980 10.421  1.00 0.00 ? 62 ARG A HE   15 
ATOM   10482 H HH11 . ARG A 1 45 ? 4.684  19.913 11.281  1.00 0.00 ? 62 ARG A HH11 15 
ATOM   10483 H HH12 . ARG A 1 45 ? 4.908  21.327 12.293  1.00 0.00 ? 62 ARG A HH12 15 
ATOM   10484 H HH21 . ARG A 1 45 ? 8.333  21.604 11.568  1.00 0.00 ? 62 ARG A HH21 15 
ATOM   10485 H HH22 . ARG A 1 45 ? 6.988  22.293 12.456  1.00 0.00 ? 62 ARG A HH22 15 
ATOM   10486 N N    . PRO A 1 1  ? 0.000  0.000  0.000   1.00 0.00 ? 18 PRO A N    16 
ATOM   10487 C CA   . PRO A 1 1  ? 1.458  0.000  0.000   1.00 0.00 ? 18 PRO A CA   16 
ATOM   10488 C C    . PRO A 1 1  ? 2.009  1.420  0.000   1.00 0.00 ? 18 PRO A C    16 
ATOM   10489 O O    . PRO A 1 1  ? 1.604  2.253  -0.810  1.00 0.00 ? 18 PRO A O    16 
ATOM   10490 C CB   . PRO A 1 1  ? 1.832  -0.764 -1.274  1.00 0.00 ? 18 PRO A CB   16 
ATOM   10491 C CG   . PRO A 1 1  ? 0.594  -1.510 -1.638  1.00 0.00 ? 18 PRO A CG   16 
ATOM   10492 C CD   . PRO A 1 1  ? -0.545 -0.627 -1.202  1.00 0.00 ? 18 PRO A CD   16 
ATOM   10493 H H2   . PRO A 1 1  ? -0.500 -0.433 -0.750  1.00 0.00 ? 18 PRO A H2   16 
ATOM   10494 H H3   . PRO A 1 1  ? -0.500 -0.433 0.750   1.00 0.00 ? 18 PRO A H3   16 
ATOM   10495 H HA   . PRO A 1 1  ? 1.884  -0.469 0.899   1.00 0.00 ? 18 PRO A HA   16 
ATOM   10496 H HB2  . PRO A 1 1  ? 2.136  -0.079 -2.080  1.00 0.00 ? 18 PRO A HB2  16 
ATOM   10497 H HB3  . PRO A 1 1  ? 2.674  -1.450 -1.100  1.00 0.00 ? 18 PRO A HB3  16 
ATOM   10498 H HG2  . PRO A 1 1  ? 0.551  -1.706 -2.719  1.00 0.00 ? 18 PRO A HG2  16 
ATOM   10499 H HG3  . PRO A 1 1  ? 0.555  -2.485 -1.132  1.00 0.00 ? 18 PRO A HG3  16 
ATOM   10500 H HD2  . PRO A 1 1  ? -0.810 0.118  -1.966  1.00 0.00 ? 18 PRO A HD2  16 
ATOM   10501 H HD3  . PRO A 1 1  ? -1.458 -1.203 -0.985  1.00 0.00 ? 18 PRO A HD3  16 
ATOM   10502 N N    . THR A 1 2  ? 2.935  1.690  0.914   1.00 0.00 ? 19 THR A N    16 
ATOM   10503 C CA   . THR A 1 2  ? 3.543  3.011  1.022   1.00 0.00 ? 19 THR A CA   16 
ATOM   10504 C C    . THR A 1 2  ? 5.048  2.945  0.795   1.00 0.00 ? 19 THR A C    16 
ATOM   10505 O O    . THR A 1 2  ? 5.752  2.184  1.458   1.00 0.00 ? 19 THR A O    16 
ATOM   10506 C CB   . THR A 1 2  ? 3.268  3.649  2.396   1.00 0.00 ? 19 THR A CB   16 
ATOM   10507 O OG1  . THR A 1 2  ? 1.854  3.787  2.588   1.00 0.00 ? 19 THR A OG1  16 
ATOM   10508 C CG2  . THR A 1 2  ? 3.924  5.018  2.489   1.00 0.00 ? 19 THR A CG2  16 
ATOM   10509 H H    . THR A 1 2  ? 3.225  0.962  1.550   1.00 0.00 ? 19 THR A H    16 
ATOM   10510 H HA   . THR A 1 2  ? 3.143  3.666  0.247   1.00 0.00 ? 19 THR A HA   16 
ATOM   10511 H HB   . THR A 1 2  ? 3.670  3.001  3.174   1.00 0.00 ? 19 THR A HB   16 
ATOM   10512 H HG1  . THR A 1 2  ? 1.685  4.182  3.446   1.00 0.00 ? 19 THR A HG1  16 
ATOM   10513 H HG21 . THR A 1 2  ? 3.522  5.667  1.712   1.00 0.00 ? 19 THR A HG21 16 
ATOM   10514 H HG22 . THR A 1 2  ? 3.719  5.453  3.467   1.00 0.00 ? 19 THR A HG22 16 
ATOM   10515 H HG23 . THR A 1 2  ? 5.001  4.915  2.355   1.00 0.00 ? 19 THR A HG23 16 
ATOM   10516 N N    . ARG A 1 3  ? 5.535  3.748  -0.144  1.00 0.00 ? 20 ARG A N    16 
ATOM   10517 C CA   . ARG A 1 3  ? 6.964  3.815  -0.429  1.00 0.00 ? 20 ARG A CA   16 
ATOM   10518 C C    . ARG A 1 3  ? 7.540  5.171  -0.042  1.00 0.00 ? 20 ARG A C    16 
ATOM   10519 O O    . ARG A 1 3  ? 7.002  6.214  -0.414  1.00 0.00 ? 20 ARG A O    16 
ATOM   10520 C CB   . ARG A 1 3  ? 7.277  3.470  -1.878  1.00 0.00 ? 20 ARG A CB   16 
ATOM   10521 C CG   . ARG A 1 3  ? 8.754  3.502  -2.238  1.00 0.00 ? 20 ARG A CG   16 
ATOM   10522 C CD   . ARG A 1 3  ? 9.050  3.123  -3.643  1.00 0.00 ? 20 ARG A CD   16 
ATOM   10523 N NE   . ARG A 1 3  ? 10.461 3.155  -3.991  1.00 0.00 ? 20 ARG A NE   16 
ATOM   10524 C CZ   . ARG A 1 3  ? 10.950 2.926  -5.226  1.00 0.00 ? 20 ARG A CZ   16 
ATOM   10525 N NH1  . ARG A 1 3  ? 10.152 2.610  -6.222  1.00 0.00 ? 20 ARG A NH1  16 
ATOM   10526 N NH2  . ARG A 1 3  ? 12.257 3.002  -5.404  1.00 0.00 ? 20 ARG A NH2  16 
ATOM   10527 H H    . ARG A 1 3  ? 4.900  4.327  -0.675  1.00 0.00 ? 20 ARG A H    16 
ATOM   10528 H HA   . ARG A 1 3  ? 7.494  3.071  0.166   1.00 0.00 ? 20 ARG A HA   16 
ATOM   10529 H HB2  . ARG A 1 3  ? 6.884  2.471  -2.059  1.00 0.00 ? 20 ARG A HB2  16 
ATOM   10530 H HB3  . ARG A 1 3  ? 6.741  4.189  -2.498  1.00 0.00 ? 20 ARG A HB3  16 
ATOM   10531 H HG2  . ARG A 1 3  ? 9.128  4.514  -2.077  1.00 0.00 ? 20 ARG A HG2  16 
ATOM   10532 H HG3  . ARG A 1 3  ? 9.285  2.810  -1.583  1.00 0.00 ? 20 ARG A HG3  16 
ATOM   10533 H HD2  . ARG A 1 3  ? 8.693  2.109  -3.818  1.00 0.00 ? 20 ARG A HD2  16 
ATOM   10534 H HD3  . ARG A 1 3  ? 8.532  3.810  -4.312  1.00 0.00 ? 20 ARG A HD3  16 
ATOM   10535 H HE   . ARG A 1 3  ? 11.265 3.344  -3.407  1.00 0.00 ? 20 ARG A HE   16 
ATOM   10536 H HH11 . ARG A 1 3  ? 9.157  2.538  -6.066  1.00 0.00 ? 20 ARG A HH11 16 
ATOM   10537 H HH12 . ARG A 1 3  ? 10.538 2.441  -7.140  1.00 0.00 ? 20 ARG A HH12 16 
ATOM   10538 H HH21 . ARG A 1 3  ? 12.858 3.228  -4.623  1.00 0.00 ? 20 ARG A HH21 16 
ATOM   10539 H HH22 . ARG A 1 3  ? 12.650 2.834  -6.318  1.00 0.00 ? 20 ARG A HH22 16 
ATOM   10540 N N    . THR A 1 4  ? 8.636  5.150  0.708   1.00 0.00 ? 21 THR A N    16 
ATOM   10541 C CA   . THR A 1 4  ? 9.293  6.378  1.139   1.00 0.00 ? 21 THR A CA   16 
ATOM   10542 C C    . THR A 1 4  ? 10.475 6.715  0.239   1.00 0.00 ? 21 THR A C    16 
ATOM   10543 O O    . THR A 1 4  ? 11.461 5.979  0.191   1.00 0.00 ? 21 THR A O    16 
ATOM   10544 C CB   . THR A 1 4  ? 9.784  6.275  2.596   1.00 0.00 ? 21 THR A CB   16 
ATOM   10545 O OG1  . THR A 1 4  ? 8.666  6.047  3.464   1.00 0.00 ? 21 THR A OG1  16 
ATOM   10546 C CG2  . THR A 1 4  ? 10.491 7.556  3.012   1.00 0.00 ? 21 THR A CG2  16 
ATOM   10547 H H    . THR A 1 4  ? 9.024  4.260  0.987   1.00 0.00 ? 21 THR A H    16 
ATOM   10548 H HA   . THR A 1 4  ? 8.599  7.214  1.063   1.00 0.00 ? 21 THR A HA   16 
ATOM   10549 H HB   . THR A 1 4  ? 10.474 5.436  2.679   1.00 0.00 ? 21 THR A HB   16 
ATOM   10550 H HG1  . THR A 1 4  ? 8.974  5.981  4.371   1.00 0.00 ? 21 THR A HG1  16 
ATOM   10551 H HG21 . THR A 1 4  ? 9.800  8.394  2.930   1.00 0.00 ? 21 THR A HG21 16 
ATOM   10552 H HG22 . THR A 1 4  ? 10.830 7.464  4.043   1.00 0.00 ? 21 THR A HG22 16 
ATOM   10553 H HG23 . THR A 1 4  ? 11.348 7.726  2.360   1.00 0.00 ? 21 THR A HG23 16 
ATOM   10554 N N    . VAL A 1 5  ? 10.370 7.832  -0.473  1.00 0.00 ? 22 VAL A N    16 
ATOM   10555 C CA   . VAL A 1 5  ? 11.462 8.312  -1.310  1.00 0.00 ? 22 VAL A CA   16 
ATOM   10556 C C    . VAL A 1 5  ? 11.868 9.730  -0.927  1.00 0.00 ? 22 VAL A C    16 
ATOM   10557 O O    . VAL A 1 5  ? 11.025 10.621 -0.824  1.00 0.00 ? 22 VAL A O    16 
ATOM   10558 C CB   . VAL A 1 5  ? 11.085 8.283  -2.803  1.00 0.00 ? 22 VAL A CB   16 
ATOM   10559 C CG1  . VAL A 1 5  ? 12.220 8.839  -3.650  1.00 0.00 ? 22 VAL A CG1  16 
ATOM   10560 C CG2  . VAL A 1 5  ? 10.742 6.867  -3.239  1.00 0.00 ? 22 VAL A CG2  16 
ATOM   10561 H H    . VAL A 1 5  ? 9.511  8.362  -0.433  1.00 0.00 ? 22 VAL A H    16 
ATOM   10562 H HA   . VAL A 1 5  ? 12.364 7.715  -1.168  1.00 0.00 ? 22 VAL A HA   16 
ATOM   10563 H HB   . VAL A 1 5  ? 10.190 8.886  -2.954  1.00 0.00 ? 22 VAL A HB   16 
ATOM   10564 H HG11 . VAL A 1 5  ? 11.936 8.811  -4.703  1.00 0.00 ? 22 VAL A HG11 16 
ATOM   10565 H HG12 . VAL A 1 5  ? 12.422 9.869  -3.357  1.00 0.00 ? 22 VAL A HG12 16 
ATOM   10566 H HG13 . VAL A 1 5  ? 13.115 8.236  -3.501  1.00 0.00 ? 22 VAL A HG13 16 
ATOM   10567 H HG21 . VAL A 1 5  ? 9.898  6.500  -2.653  1.00 0.00 ? 22 VAL A HG21 16 
ATOM   10568 H HG22 . VAL A 1 5  ? 10.477 6.864  -4.295  1.00 0.00 ? 22 VAL A HG22 16 
ATOM   10569 H HG23 . VAL A 1 5  ? 11.604 6.219  -3.078  1.00 0.00 ? 22 VAL A HG23 16 
ATOM   10570 N N    . ALA A 1 6  ? 13.164 9.932  -0.716  1.00 0.00 ? 23 ALA A N    16 
ATOM   10571 C CA   . ALA A 1 6  ? 13.692 11.254 -0.399  1.00 0.00 ? 23 ALA A CA   16 
ATOM   10572 C C    . ALA A 1 6  ? 14.178 11.968 -1.654  1.00 0.00 ? 23 ALA A C    16 
ATOM   10573 O O    . ALA A 1 6  ? 14.856 11.376 -2.494  1.00 0.00 ? 23 ALA A O    16 
ATOM   10574 C CB   . ALA A 1 6  ? 14.815 11.145 0.622   1.00 0.00 ? 23 ALA A CB   16 
ATOM   10575 H H    . ALA A 1 6  ? 13.801 9.150  -0.778  1.00 0.00 ? 23 ALA A H    16 
ATOM   10576 H HA   . ALA A 1 6  ? 12.890 11.857 0.028   1.00 0.00 ? 23 ALA A HA   16 
ATOM   10577 H HB1  . ALA A 1 6  ? 15.618 10.532 0.215   1.00 0.00 ? 23 ALA A HB1  16 
ATOM   10578 H HB2  . ALA A 1 6  ? 15.197 12.141 0.847   1.00 0.00 ? 23 ALA A HB2  16 
ATOM   10579 H HB3  . ALA A 1 6  ? 14.434 10.688 1.535   1.00 0.00 ? 23 ALA A HB3  16 
ATOM   10580 N N    . ILE A 1 7  ? 13.828 13.244 -1.775  1.00 0.00 ? 24 ILE A N    16 
ATOM   10581 C CA   . ILE A 1 7  ? 14.231 14.043 -2.926  1.00 0.00 ? 24 ILE A CA   16 
ATOM   10582 C C    . ILE A 1 7  ? 14.820 15.379 -2.491  1.00 0.00 ? 24 ILE A C    16 
ATOM   10583 O O    . ILE A 1 7  ? 14.708 15.768 -1.328  1.00 0.00 ? 24 ILE A O    16 
ATOM   10584 C CB   . ILE A 1 7  ? 13.048 14.300 -3.878  1.00 0.00 ? 24 ILE A CB   16 
ATOM   10585 C CG1  . ILE A 1 7  ? 11.949 15.090 -3.162  1.00 0.00 ? 24 ILE A CG1  16 
ATOM   10586 C CG2  . ILE A 1 7  ? 12.501 12.986 -4.414  1.00 0.00 ? 24 ILE A CG2  16 
ATOM   10587 C CD1  . ILE A 1 7  ? 10.842 15.563 -4.077  1.00 0.00 ? 24 ILE A CD1  16 
ATOM   10588 H H    . ILE A 1 7  ? 13.268 13.672 -1.051  1.00 0.00 ? 24 ILE A H    16 
ATOM   10589 H HA   . ILE A 1 7  ? 15.035 13.552 -3.472  1.00 0.00 ? 24 ILE A HA   16 
ATOM   10590 H HB   . ILE A 1 7  ? 13.388 14.918 -4.708  1.00 0.00 ? 24 ILE A HB   16 
ATOM   10591 H HG12 . ILE A 1 7  ? 11.532 14.441 -2.393  1.00 0.00 ? 24 ILE A HG12 16 
ATOM   10592 H HG13 . ILE A 1 7  ? 12.423 15.952 -2.691  1.00 0.00 ? 24 ILE A HG13 16 
ATOM   10593 H HG21 . ILE A 1 7  ? 11.665 13.186 -5.084  1.00 0.00 ? 24 ILE A HG21 16 
ATOM   10594 H HG22 . ILE A 1 7  ? 13.285 12.461 -4.958  1.00 0.00 ? 24 ILE A HG22 16 
ATOM   10595 H HG23 . ILE A 1 7  ? 12.160 12.368 -3.583  1.00 0.00 ? 24 ILE A HG23 16 
ATOM   10596 H HD11 . ILE A 1 7  ? 10.366 14.703 -4.547  1.00 0.00 ? 24 ILE A HD11 16 
ATOM   10597 H HD12 . ILE A 1 7  ? 10.101 16.114 -3.498  1.00 0.00 ? 24 ILE A HD12 16 
ATOM   10598 H HD13 . ILE A 1 7  ? 11.258 16.213 -4.847  1.00 0.00 ? 24 ILE A HD13 16 
ATOM   10599 N N    . SER A 1 8  ? 15.447 16.078 -3.430  1.00 0.00 ? 25 SER A N    16 
ATOM   10600 C CA   . SER A 1 8  ? 16.047 17.376 -3.147  1.00 0.00 ? 25 SER A CA   16 
ATOM   10601 C C    . SER A 1 8  ? 15.233 18.506 -3.766  1.00 0.00 ? 25 SER A C    16 
ATOM   10602 O O    . SER A 1 8  ? 15.243 19.633 -3.272  1.00 0.00 ? 25 SER A O    16 
ATOM   10603 C CB   . SER A 1 8  ? 17.474 17.414 -3.657  1.00 0.00 ? 25 SER A CB   16 
ATOM   10604 O OG   . SER A 1 8  ? 17.541 17.259 -5.048  1.00 0.00 ? 25 SER A OG   16 
ATOM   10605 H H    . SER A 1 8  ? 15.510 15.700 -4.365  1.00 0.00 ? 25 SER A H    16 
ATOM   10606 H HA   . SER A 1 8  ? 16.192 17.563 -2.082  1.00 0.00 ? 25 SER A HA   16 
ATOM   10607 H HB2  . SER A 1 8  ? 17.916 18.373 -3.386  1.00 0.00 ? 25 SER A HB2  16 
ATOM   10608 H HB3  . SER A 1 8  ? 18.036 16.610 -3.183  1.00 0.00 ? 25 SER A HB3  16 
ATOM   10609 H HG   . SER A 1 8  ? 18.459 17.289 -5.329  1.00 0.00 ? 25 SER A HG   16 
ATOM   10610 N N    . ASP A 1 9  ? 14.528 18.196 -4.849  1.00 0.00 ? 26 ASP A N    16 
ATOM   10611 C CA   . ASP A 1 9  ? 13.770 19.202 -5.583  1.00 0.00 ? 26 ASP A CA   16 
ATOM   10612 C C    . ASP A 1 9  ? 12.588 18.577 -6.312  1.00 0.00 ? 26 ASP A C    16 
ATOM   10613 O O    . ASP A 1 9  ? 12.764 17.812 -7.260  1.00 0.00 ? 26 ASP A O    16 
ATOM   10614 C CB   . ASP A 1 9  ? 14.674 19.933 -6.579  1.00 0.00 ? 26 ASP A CB   16 
ATOM   10615 C CG   . ASP A 1 9  ? 14.009 21.103 -7.291  1.00 0.00 ? 26 ASP A CG   16 
ATOM   10616 O OD1  . ASP A 1 9  ? 12.855 21.353 -7.031  1.00 0.00 ? 26 ASP A OD1  16 
ATOM   10617 O OD2  . ASP A 1 9  ? 14.697 21.831 -7.965  1.00 0.00 ? 26 ASP A OD2  16 
ATOM   10618 H H    . ASP A 1 9  ? 14.517 17.239 -5.171  1.00 0.00 ? 26 ASP A H    16 
ATOM   10619 H HA   . ASP A 1 9  ? 13.356 19.932 -4.888  1.00 0.00 ? 26 ASP A HA   16 
ATOM   10620 H HB2  . ASP A 1 9  ? 15.620 20.262 -6.146  1.00 0.00 ? 26 ASP A HB2  16 
ATOM   10621 H HB3  . ASP A 1 9  ? 14.860 19.131 -7.294  1.00 0.00 ? 26 ASP A HB3  16 
ATOM   10622 N N    . ALA A 1 10 ? 11.381 18.908 -5.864  1.00 0.00 ? 27 ALA A N    16 
ATOM   10623 C CA   . ALA A 1 10 ? 10.167 18.364 -6.460  1.00 0.00 ? 27 ALA A CA   16 
ATOM   10624 C C    . ALA A 1 10 ? 10.003 18.831 -7.901  1.00 0.00 ? 27 ALA A C    16 
ATOM   10625 O O    . ALA A 1 10 ? 9.330  18.182 -8.701  1.00 0.00 ? 27 ALA A O    16 
ATOM   10626 C CB   . ALA A 1 10 ? 8.951  18.752 -5.632  1.00 0.00 ? 27 ALA A CB   16 
ATOM   10627 H H    . ALA A 1 10 ? 11.304 19.553 -5.091  1.00 0.00 ? 27 ALA A H    16 
ATOM   10628 H HA   . ALA A 1 10 ? 10.243 17.277 -6.478  1.00 0.00 ? 27 ALA A HA   16 
ATOM   10629 H HB1  . ALA A 1 10 ? 8.869  19.837 -5.592  1.00 0.00 ? 27 ALA A HB1  16 
ATOM   10630 H HB2  . ALA A 1 10 ? 8.053  18.338 -6.090  1.00 0.00 ? 27 ALA A HB2  16 
ATOM   10631 H HB3  . ALA A 1 10 ? 9.057  18.358 -4.622  1.00 0.00 ? 27 ALA A HB3  16 
ATOM   10632 N N    . ALA A 1 11 ? 10.623 19.961 -8.225  1.00 0.00 ? 28 ALA A N    16 
ATOM   10633 C CA   . ALA A 1 11 ? 10.540 20.522 -9.568  1.00 0.00 ? 28 ALA A CA   16 
ATOM   10634 C C    . ALA A 1 11 ? 11.231 19.621 -10.584 1.00 0.00 ? 28 ALA A C    16 
ATOM   10635 O O    . ALA A 1 11 ? 10.968 19.707 -11.784 1.00 0.00 ? 28 ALA A O    16 
ATOM   10636 C CB   . ALA A 1 11 ? 11.142 21.919 -9.597  1.00 0.00 ? 28 ALA A CB   16 
ATOM   10637 H H    . ALA A 1 11 ? 11.164 20.444 -7.523  1.00 0.00 ? 28 ALA A H    16 
ATOM   10638 H HA   . ALA A 1 11 ? 9.491  20.590 -9.855  1.00 0.00 ? 28 ALA A HA   16 
ATOM   10639 H HB1  . ALA A 1 11 ? 12.188 21.870 -9.298  1.00 0.00 ? 28 ALA A HB1  16 
ATOM   10640 H HB2  . ALA A 1 11 ? 11.073 22.323 -10.607 1.00 0.00 ? 28 ALA A HB2  16 
ATOM   10641 H HB3  . ALA A 1 11 ? 10.597 22.565 -8.910  1.00 0.00 ? 28 ALA A HB3  16 
ATOM   10642 N N    . GLN A 1 12 ? 12.116 18.758 -10.097 1.00 0.00 ? 29 GLN A N    16 
ATOM   10643 C CA   . GLN A 1 12 ? 12.856 17.849 -10.964 1.00 0.00 ? 29 GLN A CA   16 
ATOM   10644 C C    . GLN A 1 12 ? 12.082 16.558 -11.198 1.00 0.00 ? 29 GLN A C    16 
ATOM   10645 O O    . GLN A 1 12 ? 12.502 15.703 -11.978 1.00 0.00 ? 29 GLN A O    16 
ATOM   10646 C CB   . GLN A 1 12 ? 14.225 17.527 -10.358 1.00 0.00 ? 29 GLN A CB   16 
ATOM   10647 C CG   . GLN A 1 12 ? 15.123 18.738 -10.172 1.00 0.00 ? 29 GLN A CG   16 
ATOM   10648 C CD   . GLN A 1 12 ? 15.423 19.442 -11.482 1.00 0.00 ? 29 GLN A CD   16 
ATOM   10649 O OE1  . GLN A 1 12 ? 15.747 18.803 -12.487 1.00 0.00 ? 29 GLN A OE1  16 
ATOM   10650 N NE2  . GLN A 1 12 ? 15.322 20.766 -11.477 1.00 0.00 ? 29 GLN A NE2  16 
ATOM   10651 H H    . GLN A 1 12 ? 12.279 18.731 -9.101  1.00 0.00 ? 29 GLN A H    16 
ATOM   10652 H HA   . GLN A 1 12 ? 12.995 18.309 -11.942 1.00 0.00 ? 29 GLN A HA   16 
ATOM   10653 H HB2  . GLN A 1 12 ? 14.039 17.054 -9.394  1.00 0.00 ? 29 GLN A HB2  16 
ATOM   10654 H HB3  . GLN A 1 12 ? 14.705 16.812 -11.026 1.00 0.00 ? 29 GLN A HB3  16 
ATOM   10655 H HG2  . GLN A 1 12 ? 14.937 19.501 -9.417  1.00 0.00 ? 29 GLN A HG2  16 
ATOM   10656 H HG3  . GLN A 1 12 ? 15.999 18.153 -9.887  1.00 0.00 ? 29 GLN A HG3  16 
ATOM   10657 H HE21 . GLN A 1 12 ? 15.058 21.245 -10.639 1.00 0.00 ? 29 GLN A HE21 16 
ATOM   10658 H HE22 . GLN A 1 12 ? 15.508 21.286 -12.312 1.00 0.00 ? 29 GLN A HE22 16 
ATOM   10659 N N    . LEU A 1 13 ? 10.948 16.423 -10.519 1.00 0.00 ? 30 LEU A N    16 
ATOM   10660 C CA   . LEU A 1 13 ? 10.092 15.253 -10.681 1.00 0.00 ? 30 LEU A CA   16 
ATOM   10661 C C    . LEU A 1 13 ? 8.946  15.538 -11.642 1.00 0.00 ? 30 LEU A C    16 
ATOM   10662 O O    . LEU A 1 13 ? 8.623  16.695 -11.913 1.00 0.00 ? 30 LEU A O    16 
ATOM   10663 C CB   . LEU A 1 13 ? 9.548  14.802 -9.320  1.00 0.00 ? 30 LEU A CB   16 
ATOM   10664 C CG   . LEU A 1 13 ? 10.500 13.929 -8.492  1.00 0.00 ? 30 LEU A CG   16 
ATOM   10665 C CD1  . LEU A 1 13 ? 11.670 14.764 -7.990  1.00 0.00 ? 30 LEU A CD1  16 
ATOM   10666 C CD2  . LEU A 1 13 ? 9.740  13.309 -7.329  1.00 0.00 ? 30 LEU A CD2  16 
ATOM   10667 H H    . LEU A 1 13 ? 10.671 17.149 -9.873  1.00 0.00 ? 30 LEU A H    16 
ATOM   10668 H HA   . LEU A 1 13 ? 10.668 14.438 -11.119 1.00 0.00 ? 30 LEU A HA   16 
ATOM   10669 H HB2  . LEU A 1 13 ? 9.426  15.775 -8.846  1.00 0.00 ? 30 LEU A HB2  16 
ATOM   10670 H HB3  . LEU A 1 13 ? 8.575  14.320 -9.414  1.00 0.00 ? 30 LEU A HB3  16 
ATOM   10671 H HG   . LEU A 1 13 ? 10.840 13.118 -9.138  1.00 0.00 ? 30 LEU A HG   16 
ATOM   10672 H HD11 . LEU A 1 13 ? 12.341 14.135 -7.404  1.00 0.00 ? 30 LEU A HD11 16 
ATOM   10673 H HD12 . LEU A 1 13 ? 12.213 15.178 -8.840  1.00 0.00 ? 30 LEU A HD12 16 
ATOM   10674 H HD13 . LEU A 1 13 ? 11.296 15.575 -7.366  1.00 0.00 ? 30 LEU A HD13 16 
ATOM   10675 H HD21 . LEU A 1 13 ? 8.926  12.695 -7.711  1.00 0.00 ? 30 LEU A HD21 16 
ATOM   10676 H HD22 . LEU A 1 13 ? 10.418 12.688 -6.742  1.00 0.00 ? 30 LEU A HD22 16 
ATOM   10677 H HD23 . LEU A 1 13 ? 9.333  14.100 -6.698  1.00 0.00 ? 30 LEU A HD23 16 
ATOM   10678 N N    . PRO A 1 14 ? 8.334  14.477 -12.156 1.00 0.00 ? 31 PRO A N    16 
ATOM   10679 C CA   . PRO A 1 14 ? 7.200  14.611 -13.063 1.00 0.00 ? 31 PRO A CA   16 
ATOM   10680 C C    . PRO A 1 14 ? 6.105  15.476 -12.452 1.00 0.00 ? 31 PRO A C    16 
ATOM   10681 O O    . PRO A 1 14 ? 5.879  15.446 -11.242 1.00 0.00 ? 31 PRO A O    16 
ATOM   10682 C CB   . PRO A 1 14 ? 6.733  13.170 -13.295 1.00 0.00 ? 31 PRO A CB   16 
ATOM   10683 C CG   . PRO A 1 14 ? 7.952  12.343 -13.062 1.00 0.00 ? 31 PRO A CG   16 
ATOM   10684 C CD   . PRO A 1 14 ? 8.703  13.041 -11.959 1.00 0.00 ? 31 PRO A CD   16 
ATOM   10685 H HA   . PRO A 1 14 ? 7.465  15.113 -14.005 1.00 0.00 ? 31 PRO A HA   16 
ATOM   10686 H HB2  . PRO A 1 14 ? 5.925  12.892 -12.603 1.00 0.00 ? 31 PRO A HB2  16 
ATOM   10687 H HB3  . PRO A 1 14 ? 6.346  13.031 -14.315 1.00 0.00 ? 31 PRO A HB3  16 
ATOM   10688 H HG2  . PRO A 1 14 ? 7.686  11.316 -12.771 1.00 0.00 ? 31 PRO A HG2  16 
ATOM   10689 H HG3  . PRO A 1 14 ? 8.564  12.272 -13.973 1.00 0.00 ? 31 PRO A HG3  16 
ATOM   10690 H HD2  . PRO A 1 14 ? 8.402  12.686 -10.962 1.00 0.00 ? 31 PRO A HD2  16 
ATOM   10691 H HD3  . PRO A 1 14 ? 9.790  12.893 -12.039 1.00 0.00 ? 31 PRO A HD3  16 
ATOM   10692 N N    . HIS A 1 15 ? 5.428  16.247 -13.296 1.00 0.00 ? 32 HIS A N    16 
ATOM   10693 C CA   . HIS A 1 15 ? 4.500  17.269 -12.824 1.00 0.00 ? 32 HIS A CA   16 
ATOM   10694 C C    . HIS A 1 15 ? 3.067  16.753 -12.823 1.00 0.00 ? 32 HIS A C    16 
ATOM   10695 O O    . HIS A 1 15 ? 2.140  17.467 -12.440 1.00 0.00 ? 32 HIS A O    16 
ATOM   10696 C CB   . HIS A 1 15 ? 4.601  18.532 -13.685 1.00 0.00 ? 32 HIS A CB   16 
ATOM   10697 C CG   . HIS A 1 15 ? 5.938  19.203 -13.614 1.00 0.00 ? 32 HIS A CG   16 
ATOM   10698 N ND1  . HIS A 1 15 ? 6.473  19.669 -12.431 1.00 0.00 ? 32 HIS A ND1  16 
ATOM   10699 C CD2  . HIS A 1 15 ? 6.846  19.486 -14.577 1.00 0.00 ? 32 HIS A CD2  16 
ATOM   10700 C CE1  . HIS A 1 15 ? 7.655  20.211 -12.671 1.00 0.00 ? 32 HIS A CE1  16 
ATOM   10701 N NE2  . HIS A 1 15 ? 7.904  20.113 -13.964 1.00 0.00 ? 32 HIS A NE2  16 
ATOM   10702 H H    . HIS A 1 15 ? 5.559  16.123 -14.289 1.00 0.00 ? 32 HIS A H    16 
ATOM   10703 H HA   . HIS A 1 15 ? 4.736  17.529 -11.793 1.00 0.00 ? 32 HIS A HA   16 
ATOM   10704 H HB2  . HIS A 1 15 ? 4.432  18.286 -14.734 1.00 0.00 ? 32 HIS A HB2  16 
ATOM   10705 H HB3  . HIS A 1 15 ? 3.865  19.267 -13.361 1.00 0.00 ? 32 HIS A HB3  16 
ATOM   10706 H HD1  . HIS A 1 15 ? 6.084  19.549 -11.518 1.00 0.00 ? 32 HIS A HD1  16 
ATOM   10707 H HD2  . HIS A 1 15 ? 6.863  19.312 -15.653 1.00 0.00 ? 32 HIS A HD2  16 
ATOM   10708 H HE1  . HIS A 1 15 ? 8.244  20.639 -11.860 1.00 0.00 ? 32 HIS A HE1  16 
ATOM   10709 N N    . ASP A 1 16 ? 2.891  15.508 -13.255 1.00 0.00 ? 33 ASP A N    16 
ATOM   10710 C CA   . ASP A 1 16 ? 1.605  14.832 -13.138 1.00 0.00 ? 33 ASP A CA   16 
ATOM   10711 C C    . ASP A 1 16 ? 1.444  14.186 -11.768 1.00 0.00 ? 33 ASP A C    16 
ATOM   10712 O O    . ASP A 1 16 ? 0.449  13.512 -11.501 1.00 0.00 ? 33 ASP A O    16 
ATOM   10713 C CB   . ASP A 1 16 ? 1.452  13.777 -14.237 1.00 0.00 ? 33 ASP A CB   16 
ATOM   10714 C CG   . ASP A 1 16 ? 2.469  12.645 -14.169 1.00 0.00 ? 33 ASP A CG   16 
ATOM   10715 O OD1  . ASP A 1 16 ? 3.329  12.696 -13.322 1.00 0.00 ? 33 ASP A OD1  16 
ATOM   10716 O OD2  . ASP A 1 16 ? 2.286  11.668 -14.855 1.00 0.00 ? 33 ASP A OD2  16 
ATOM   10717 H H    . ASP A 1 16 ? 3.668  15.019 -13.674 1.00 0.00 ? 33 ASP A H    16 
ATOM   10718 H HA   . ASP A 1 16 ? 0.796  15.556 -13.236 1.00 0.00 ? 33 ASP A HA   16 
ATOM   10719 H HB2  . ASP A 1 16 ? 0.447  13.359 -14.301 1.00 0.00 ? 33 ASP A HB2  16 
ATOM   10720 H HB3  . ASP A 1 16 ? 1.649  14.389 -15.118 1.00 0.00 ? 33 ASP A HB3  16 
ATOM   10721 N N    . TYR A 1 17 ? 2.430  14.396 -10.902 1.00 0.00 ? 34 TYR A N    16 
ATOM   10722 C CA   . TYR A 1 17 ? 2.326  13.980 -9.508  1.00 0.00 ? 34 TYR A CA   16 
ATOM   10723 C C    . TYR A 1 17 ? 1.403  14.905 -8.724  1.00 0.00 ? 34 TYR A C    16 
ATOM   10724 O O    . TYR A 1 17 ? 1.101  16.014 -9.164  1.00 0.00 ? 34 TYR A O    16 
ATOM   10725 C CB   . TYR A 1 17 ? 3.710  13.944 -8.856  1.00 0.00 ? 34 TYR A CB   16 
ATOM   10726 C CG   . TYR A 1 17 ? 4.601  12.835 -9.369  1.00 0.00 ? 34 TYR A CG   16 
ATOM   10727 C CD1  . TYR A 1 17 ? 4.184  12.005 -10.400 1.00 0.00 ? 34 TYR A CD1  16 
ATOM   10728 C CD2  . TYR A 1 17 ? 5.858  12.622 -8.823  1.00 0.00 ? 34 TYR A CD2  16 
ATOM   10729 C CE1  . TYR A 1 17 ? 4.993  10.990 -10.872 1.00 0.00 ? 34 TYR A CE1  16 
ATOM   10730 C CE2  . TYR A 1 17 ? 6.676  11.610 -9.287  1.00 0.00 ? 34 TYR A CE2  16 
ATOM   10731 C CZ   . TYR A 1 17 ? 6.240  10.796 -10.313 1.00 0.00 ? 34 TYR A CZ   16 
ATOM   10732 O OH   . TYR A 1 17 ? 7.052  9.788  -10.780 1.00 0.00 ? 34 TYR A OH   16 
ATOM   10733 H H    . TYR A 1 17 ? 3.272  14.855 -11.216 1.00 0.00 ? 34 TYR A H    16 
ATOM   10734 H HA   . TYR A 1 17 ? 1.888  12.983 -9.451  1.00 0.00 ? 34 TYR A HA   16 
ATOM   10735 H HB2  . TYR A 1 17 ? 4.183  14.908 -9.048  1.00 0.00 ? 34 TYR A HB2  16 
ATOM   10736 H HB3  . TYR A 1 17 ? 3.558  13.821 -7.784  1.00 0.00 ? 34 TYR A HB3  16 
ATOM   10737 H HD1  . TYR A 1 17 ? 3.198  12.164 -10.837 1.00 0.00 ? 34 TYR A HD1  16 
ATOM   10738 H HD2  . TYR A 1 17 ? 6.196  13.268 -8.012  1.00 0.00 ? 34 TYR A HD2  16 
ATOM   10739 H HE1  . TYR A 1 17 ? 4.653  10.346 -11.683 1.00 0.00 ? 34 TYR A HE1  16 
ATOM   10740 H HE2  . TYR A 1 17 ? 7.660  11.458 -8.844  1.00 0.00 ? 34 TYR A HE2  16 
ATOM   10741 H HH   . TYR A 1 17 ? 6.652  9.284  -11.493 1.00 0.00 ? 34 TYR A HH   16 
ATOM   10742 N N    . CYS A 1 18 ? 0.958  14.441 -7.561  1.00 0.00 ? 35 CYS A N    16 
ATOM   10743 C CA   . CYS A 1 18 ? 0.026  15.204 -6.739  1.00 0.00 ? 35 CYS A CA   16 
ATOM   10744 C C    . CYS A 1 18 ? 0.662  15.606 -5.415  1.00 0.00 ? 35 CYS A C    16 
ATOM   10745 O O    . CYS A 1 18 ? 1.528  14.905 -4.893  1.00 0.00 ? 35 CYS A O    16 
ATOM   10746 C CB   . CYS A 1 18 ? -1.113 14.210 -6.510  1.00 0.00 ? 35 CYS A CB   16 
ATOM   10747 S SG   . CYS A 1 18 ? -1.980 13.703 -8.014  1.00 0.00 ? 35 CYS A SG   16 
ATOM   10748 H H    . CYS A 1 18 ? 1.273  13.538 -7.239  1.00 0.00 ? 35 CYS A H    16 
ATOM   10749 H HA   . CYS A 1 18 ? -0.375 16.084 -7.242  1.00 0.00 ? 35 CYS A HA   16 
ATOM   10750 H HB2  . CYS A 1 18 ? -0.729 13.294 -6.058  1.00 0.00 ? 35 CYS A HB2  16 
ATOM   10751 H HB3  . CYS A 1 18 ? -1.869 14.648 -5.858  1.00 0.00 ? 35 CYS A HB3  16 
ATOM   10752 H HG   . CYS A 1 18 ? -2.840 12.888 -7.411  1.00 0.00 ? 35 CYS A HG   16 
ATOM   10753 N N    . THR A 1 19 ? 0.227  16.740 -4.876  1.00 0.00 ? 36 THR A N    16 
ATOM   10754 C CA   . THR A 1 19 ? 0.746  17.233 -3.606  1.00 0.00 ? 36 THR A CA   16 
ATOM   10755 C C    . THR A 1 19 ? -0.322 17.189 -2.520  1.00 0.00 ? 36 THR A C    16 
ATOM   10756 O O    . THR A 1 19 ? -1.513 17.319 -2.803  1.00 0.00 ? 36 THR A O    16 
ATOM   10757 C CB   . THR A 1 19 ? 1.276  18.674 -3.732  1.00 0.00 ? 36 THR A CB   16 
ATOM   10758 O OG1  . THR A 1 19 ? 0.222  19.535 -4.183  1.00 0.00 ? 36 THR A OG1  16 
ATOM   10759 C CG2  . THR A 1 19 ? 2.431  18.732 -4.720  1.00 0.00 ? 36 THR A CG2  16 
ATOM   10760 H H    . THR A 1 19 ? -0.481 17.275 -5.359  1.00 0.00 ? 36 THR A H    16 
ATOM   10761 H HA   . THR A 1 19 ? 1.558  16.591 -3.265  1.00 0.00 ? 36 THR A HA   16 
ATOM   10762 H HB   . THR A 1 19 ? 1.617  19.013 -2.754  1.00 0.00 ? 36 THR A HB   16 
ATOM   10763 H HG1  . THR A 1 19 ? 0.554  20.433 -4.258  1.00 0.00 ? 36 THR A HG1  16 
ATOM   10764 H HG21 . THR A 1 19 ? 2.090  18.394 -5.698  1.00 0.00 ? 36 THR A HG21 16 
ATOM   10765 H HG22 . THR A 1 19 ? 2.792  19.758 -4.795  1.00 0.00 ? 36 THR A HG22 16 
ATOM   10766 H HG23 . THR A 1 19 ? 3.238  18.087 -4.374  1.00 0.00 ? 36 THR A HG23 16 
HETATM 10767 N N    . TPO A 1 20 ? 0.111  17.006 -1.278  1.00 0.00 ? 37 TPO A N    16 
HETATM 10768 C CA   . TPO A 1 20 ? -0.787 17.094 -0.133  1.00 0.00 ? 37 TPO A CA   16 
HETATM 10769 C CB   . TPO A 1 20 ? -0.318 16.190 1.023   1.00 0.00 ? 37 TPO A CB   16 
HETATM 10770 C CG2  . TPO A 1 20 ? -0.011 14.790 0.514   1.00 0.00 ? 37 TPO A CG2  16 
HETATM 10771 O OG1  . TPO A 1 20 ? 0.860  16.746 1.621   1.00 0.00 ? 37 TPO A OG1  16 
HETATM 10772 P P    . TPO A 1 20 ? 1.249  16.395 3.147   1.00 0.00 ? 37 TPO A P    16 
HETATM 10773 O O1P  . TPO A 1 20 ? 2.562  17.153 3.473   1.00 0.00 ? 37 TPO A O1P  16 
HETATM 10774 O O2P  . TPO A 1 20 ? 1.441  14.859 3.231   1.00 0.00 ? 37 TPO A O2P  16 
HETATM 10775 O O3P  . TPO A 1 20 ? 0.077  16.874 4.043   1.00 0.00 ? 37 TPO A O3P  16 
HETATM 10776 C C    . TPO A 1 20 ? -0.899 18.527 0.371   1.00 0.00 ? 37 TPO A C    16 
HETATM 10777 O O    . TPO A 1 20 ? -0.095 19.386 0.010   1.00 0.00 ? 37 TPO A O    16 
HETATM 10778 H H    . TPO A 1 20 ? 1.088  16.800 -1.123  1.00 0.00 ? 37 TPO A H    16 
HETATM 10779 H HA   . TPO A 1 20 ? -1.792 16.791 -0.428  1.00 0.00 ? 37 TPO A HA   16 
HETATM 10780 H HB   . TPO A 1 20 ? -1.106 16.138 1.774   1.00 0.00 ? 37 TPO A HB   16 
HETATM 10781 H HG21 . TPO A 1 20 ? 0.318  14.166 1.345   1.00 0.00 ? 37 TPO A HG21 16 
HETATM 10782 H HG22 . TPO A 1 20 ? -0.908 14.360 0.069   1.00 0.00 ? 37 TPO A HG22 16 
HETATM 10783 H HG23 . TPO A 1 20 ? 0.777  14.841 -0.235  1.00 0.00 ? 37 TPO A HG23 16 
ATOM   10784 N N    . PRO A 1 21 ? -1.901 18.778 1.206   1.00 0.00 ? 38 PRO A N    16 
ATOM   10785 C CA   . PRO A 1 21 ? -2.146 20.118 1.728   1.00 0.00 ? 38 PRO A CA   16 
ATOM   10786 C C    . PRO A 1 21 ? -0.897 20.690 2.385   1.00 0.00 ? 38 PRO A C    16 
ATOM   10787 O O    . PRO A 1 21 ? -0.674 21.900 2.369   1.00 0.00 ? 38 PRO A O    16 
ATOM   10788 C CB   . PRO A 1 21 ? -3.288 19.926 2.730   1.00 0.00 ? 38 PRO A CB   16 
ATOM   10789 C CG   . PRO A 1 21 ? -4.037 18.743 2.218   1.00 0.00 ? 38 PRO A CG   16 
ATOM   10790 C CD   . PRO A 1 21 ? -2.990 17.824 1.647   1.00 0.00 ? 38 PRO A CD   16 
ATOM   10791 H HA   . PRO A 1 21 ? -2.408 20.840 0.940   1.00 0.00 ? 38 PRO A HA   16 
ATOM   10792 H HB2  . PRO A 1 21 ? -2.907 19.746 3.746   1.00 0.00 ? 38 PRO A HB2  16 
ATOM   10793 H HB3  . PRO A 1 21 ? -3.934 20.815 2.781   1.00 0.00 ? 38 PRO A HB3  16 
ATOM   10794 H HG2  . PRO A 1 21 ? -4.600 18.249 3.024   1.00 0.00 ? 38 PRO A HG2  16 
ATOM   10795 H HG3  . PRO A 1 21 ? -4.767 19.037 1.449   1.00 0.00 ? 38 PRO A HG3  16 
ATOM   10796 H HD2  . PRO A 1 21 ? -2.613 17.109 2.393   1.00 0.00 ? 38 PRO A HD2  16 
ATOM   10797 H HD3  . PRO A 1 21 ? -3.372 17.234 0.801   1.00 0.00 ? 38 PRO A HD3  16 
ATOM   10798 N N    . GLY A 1 22 ? -0.083 19.812 2.962   1.00 0.00 ? 39 GLY A N    16 
ATOM   10799 C CA   . GLY A 1 22 ? 1.173  20.222 3.579   1.00 0.00 ? 39 GLY A CA   16 
ATOM   10800 C C    . GLY A 1 22 ? 2.196  20.631 2.527   1.00 0.00 ? 39 GLY A C    16 
ATOM   10801 O O    . GLY A 1 22 ? 3.066  21.462 2.784   1.00 0.00 ? 39 GLY A O    16 
ATOM   10802 H H    . GLY A 1 22 ? -0.341 18.836 2.974   1.00 0.00 ? 39 GLY A H    16 
ATOM   10803 H HA2  . GLY A 1 22 ? 0.985  21.068 4.240   1.00 0.00 ? 39 GLY A HA2  16 
ATOM   10804 H HA3  . GLY A 1 22 ? 1.573  19.391 4.159   1.00 0.00 ? 39 GLY A HA3  16 
ATOM   10805 N N    . GLY A 1 23 ? 2.085  20.042 1.341   1.00 0.00 ? 40 GLY A N    16 
ATOM   10806 C CA   . GLY A 1 23 ? 2.913  20.438 0.208   1.00 0.00 ? 40 GLY A CA   16 
ATOM   10807 C C    . GLY A 1 23 ? 3.940  19.364 -0.126  1.00 0.00 ? 40 GLY A C    16 
ATOM   10808 O O    . GLY A 1 23 ? 5.001  19.656 -0.678  1.00 0.00 ? 40 GLY A O    16 
ATOM   10809 H H    . GLY A 1 23 ? 1.409  19.301 1.221   1.00 0.00 ? 40 GLY A H    16 
ATOM   10810 H HA2  . GLY A 1 23 ? 2.274  20.602 -0.660  1.00 0.00 ? 40 GLY A HA2  16 
ATOM   10811 H HA3  . GLY A 1 23 ? 3.433  21.363 0.454   1.00 0.00 ? 40 GLY A HA3  16 
ATOM   10812 N N    . THR A 1 24 ? 3.619  18.120 0.212   1.00 0.00 ? 41 THR A N    16 
ATOM   10813 C CA   . THR A 1 24 ? 4.500  16.995 -0.079  1.00 0.00 ? 41 THR A CA   16 
ATOM   10814 C C    . THR A 1 24 ? 4.065  16.268 -1.345  1.00 0.00 ? 41 THR A C    16 
ATOM   10815 O O    . THR A 1 24 ? 2.907  15.871 -1.477  1.00 0.00 ? 41 THR A O    16 
ATOM   10816 C CB   . THR A 1 24 ? 4.540  15.992 1.089   1.00 0.00 ? 41 THR A CB   16 
ATOM   10817 O OG1  . THR A 1 24 ? 5.062  16.637 2.258   1.00 0.00 ? 41 THR A OG1  16 
ATOM   10818 C CG2  . THR A 1 24 ? 5.417  14.800 0.738   1.00 0.00 ? 41 THR A CG2  16 
ATOM   10819 H H    . THR A 1 24 ? 2.741  17.949 0.683   1.00 0.00 ? 41 THR A H    16 
ATOM   10820 H HA   . THR A 1 24 ? 5.511  17.357 -0.264  1.00 0.00 ? 41 THR A HA   16 
ATOM   10821 H HB   . THR A 1 24 ? 3.527  15.649 1.296   1.00 0.00 ? 41 THR A HB   16 
ATOM   10822 H HG1  . THR A 1 24 ? 4.337  16.877 2.841   1.00 0.00 ? 41 THR A HG1  16 
ATOM   10823 H HG21 . THR A 1 24 ? 6.430  15.143 0.531   1.00 0.00 ? 41 THR A HG21 16 
ATOM   10824 H HG22 . THR A 1 24 ? 5.433  14.102 1.575   1.00 0.00 ? 41 THR A HG22 16 
ATOM   10825 H HG23 . THR A 1 24 ? 5.016  14.301 -0.145  1.00 0.00 ? 41 THR A HG23 16 
ATOM   10826 N N    . LEU A 1 25 ? 4.999  16.097 -2.273  1.00 0.00 ? 42 LEU A N    16 
ATOM   10827 C CA   . LEU A 1 25 ? 4.711  15.427 -3.536  1.00 0.00 ? 42 LEU A CA   16 
ATOM   10828 C C    . LEU A 1 25 ? 4.553  13.925 -3.340  1.00 0.00 ? 42 LEU A C    16 
ATOM   10829 O O    . LEU A 1 25 ? 5.254  13.318 -2.531  1.00 0.00 ? 42 LEU A O    16 
ATOM   10830 C CB   . LEU A 1 25 ? 5.820  15.719 -4.556  1.00 0.00 ? 42 LEU A CB   16 
ATOM   10831 C CG   . LEU A 1 25 ? 5.446  15.454 -6.020  1.00 0.00 ? 42 LEU A CG   16 
ATOM   10832 C CD1  . LEU A 1 25 ? 4.293  16.357 -6.436  1.00 0.00 ? 42 LEU A CD1  16 
ATOM   10833 C CD2  . LEU A 1 25 ? 6.661  15.688 -6.905  1.00 0.00 ? 42 LEU A CD2  16 
ATOM   10834 H H    . LEU A 1 25 ? 5.934  16.439 -2.100  1.00 0.00 ? 42 LEU A H    16 
ATOM   10835 H HA   . LEU A 1 25 ? 3.763  15.789 -3.933  1.00 0.00 ? 42 LEU A HA   16 
ATOM   10836 H HB2  . LEU A 1 25 ? 5.938  16.788 -4.388  1.00 0.00 ? 42 LEU A HB2  16 
ATOM   10837 H HB3  . LEU A 1 25 ? 6.747  15.206 -4.301  1.00 0.00 ? 42 LEU A HB3  16 
ATOM   10838 H HG   . LEU A 1 25 ? 5.174  14.401 -6.099  1.00 0.00 ? 42 LEU A HG   16 
ATOM   10839 H HD11 . LEU A 1 25 ? 4.035  16.161 -7.477  1.00 0.00 ? 42 LEU A HD11 16 
ATOM   10840 H HD12 . LEU A 1 25 ? 3.427  16.156 -5.805  1.00 0.00 ? 42 LEU A HD12 16 
ATOM   10841 H HD13 . LEU A 1 25 ? 4.589  17.399 -6.326  1.00 0.00 ? 42 LEU A HD13 16 
ATOM   10842 H HD21 . LEU A 1 25 ? 7.464  15.013 -6.608  1.00 0.00 ? 42 LEU A HD21 16 
ATOM   10843 H HD22 . LEU A 1 25 ? 6.395  15.498 -7.945  1.00 0.00 ? 42 LEU A HD22 16 
ATOM   10844 H HD23 . LEU A 1 25 ? 6.997  16.720 -6.798  1.00 0.00 ? 42 LEU A HD23 16 
ATOM   10845 N N    . PHE A 1 26 ? 3.628  13.330 -4.085  1.00 0.00 ? 43 PHE A N    16 
ATOM   10846 C CA   . PHE A 1 26 ? 3.472  11.881 -4.100  1.00 0.00 ? 43 PHE A CA   16 
ATOM   10847 C C    . PHE A 1 26 ? 2.903  11.402 -5.430  1.00 0.00 ? 43 PHE A C    16 
ATOM   10848 O O    . PHE A 1 26 ? 2.381  12.194 -6.214  1.00 0.00 ? 43 PHE A O    16 
ATOM   10849 C CB   . PHE A 1 26 ? 2.572  11.428 -2.949  1.00 0.00 ? 43 PHE A CB   16 
ATOM   10850 C CG   . PHE A 1 26 ? 1.144  11.877 -3.084  1.00 0.00 ? 43 PHE A CG   16 
ATOM   10851 C CD1  . PHE A 1 26 ? 0.736  13.102 -2.578  1.00 0.00 ? 43 PHE A CD1  16 
ATOM   10852 C CD2  . PHE A 1 26 ? 0.207  11.075 -3.717  1.00 0.00 ? 43 PHE A CD2  16 
ATOM   10853 C CE1  . PHE A 1 26 ? -0.576 13.515 -2.699  1.00 0.00 ? 43 PHE A CE1  16 
ATOM   10854 C CE2  . PHE A 1 26 ? -1.107 11.487 -3.842  1.00 0.00 ? 43 PHE A CE2  16 
ATOM   10855 C CZ   . PHE A 1 26 ? -1.498 12.707 -3.333  1.00 0.00 ? 43 PHE A CZ   16 
ATOM   10856 H H    . PHE A 1 26 ? 3.017  13.897 -4.656  1.00 0.00 ? 43 PHE A H    16 
ATOM   10857 H HA   . PHE A 1 26 ? 4.446  11.402 -3.989  1.00 0.00 ? 43 PHE A HA   16 
ATOM   10858 H HB2  . PHE A 1 26 ? 2.552  10.340 -2.893  1.00 0.00 ? 43 PHE A HB2  16 
ATOM   10859 H HB3  . PHE A 1 26 ? 2.937  11.833 -2.007  1.00 0.00 ? 43 PHE A HB3  16 
ATOM   10860 H HD1  . PHE A 1 26 ? 1.465  13.741 -2.078  1.00 0.00 ? 43 PHE A HD1  16 
ATOM   10861 H HD2  . PHE A 1 26 ? 0.516  10.110 -4.119  1.00 0.00 ? 43 PHE A HD2  16 
ATOM   10862 H HE1  . PHE A 1 26 ? -0.884 14.480 -2.297  1.00 0.00 ? 43 PHE A HE1  16 
ATOM   10863 H HE2  . PHE A 1 26 ? -1.833 10.847 -4.342  1.00 0.00 ? 43 PHE A HE2  16 
ATOM   10864 H HZ   . PHE A 1 26 ? -2.533 13.033 -3.431  1.00 0.00 ? 43 PHE A HZ   16 
ATOM   10865 N N    . SER A 1 27 ? 3.006  10.100 -5.677  1.00 0.00 ? 44 SER A N    16 
ATOM   10866 C CA   . SER A 1 27 ? 2.458  9.505  -6.890  1.00 0.00 ? 44 SER A CA   16 
ATOM   10867 C C    . SER A 1 27 ? 1.881  8.123  -6.613  1.00 0.00 ? 44 SER A C    16 
ATOM   10868 O O    . SER A 1 27 ? 2.131  7.535  -5.561  1.00 0.00 ? 44 SER A O    16 
ATOM   10869 C CB   . SER A 1 27 ? 3.527  9.426  -7.962  1.00 0.00 ? 44 SER A CB   16 
ATOM   10870 O OG   . SER A 1 27 ? 4.500  8.462  -7.666  1.00 0.00 ? 44 SER A OG   16 
ATOM   10871 H H    . SER A 1 27 ? 3.477  9.508  -5.008  1.00 0.00 ? 44 SER A H    16 
ATOM   10872 H HA   . SER A 1 27 ? 1.708  10.130 -7.378  1.00 0.00 ? 44 SER A HA   16 
ATOM   10873 H HB2  . SER A 1 27 ? 3.052  9.171  -8.909  1.00 0.00 ? 44 SER A HB2  16 
ATOM   10874 H HB3  . SER A 1 27 ? 4.008  10.400 -8.049  1.00 0.00 ? 44 SER A HB3  16 
ATOM   10875 H HG   . SER A 1 27 ? 5.373  8.833  -7.815  1.00 0.00 ? 44 SER A HG   16 
ATOM   10876 N N    . THR A 1 28 ? 1.108  7.609  -7.564  1.00 0.00 ? 45 THR A N    16 
ATOM   10877 C CA   . THR A 1 28 ? 0.540  6.271  -7.449  1.00 0.00 ? 45 THR A CA   16 
ATOM   10878 C C    . THR A 1 28 ? 0.691  5.495  -8.751  1.00 0.00 ? 45 THR A C    16 
ATOM   10879 O O    . THR A 1 28 ? 0.345  5.990  -9.824  1.00 0.00 ? 45 THR A O    16 
ATOM   10880 C CB   . THR A 1 28 ? -0.950 6.321  -7.063  1.00 0.00 ? 45 THR A CB   16 
ATOM   10881 O OG1  . THR A 1 28 ? -1.102 7.020  -5.821  1.00 0.00 ? 45 THR A OG1  16 
ATOM   10882 C CG2  . THR A 1 28 ? -1.512 4.914  -6.920  1.00 0.00 ? 45 THR A CG2  16 
ATOM   10883 H H    . THR A 1 28 ? 0.908  8.159  -8.387  1.00 0.00 ? 45 THR A H    16 
ATOM   10884 H HA   . THR A 1 28 ? 1.079  5.705  -6.688  1.00 0.00 ? 45 THR A HA   16 
ATOM   10885 H HB   . THR A 1 28 ? -1.500 6.853  -7.839  1.00 0.00 ? 45 THR A HB   16 
ATOM   10886 H HG1  . THR A 1 28 ? -0.784 7.921  -5.921  1.00 0.00 ? 45 THR A HG1  16 
ATOM   10887 H HG21 . THR A 1 28 ? -0.964 4.382  -6.144  1.00 0.00 ? 45 THR A HG21 16 
ATOM   10888 H HG22 . THR A 1 28 ? -2.565 4.970  -6.648  1.00 0.00 ? 45 THR A HG22 16 
ATOM   10889 H HG23 . THR A 1 28 ? -1.408 4.384  -7.867  1.00 0.00 ? 45 THR A HG23 16 
HETATM 10890 N N    . TPO A 1 29 ? 1.209  4.276  -8.650  1.00 0.00 ? 46 TPO A N    16 
HETATM 10891 C CA   . TPO A 1 29 ? 1.420  3.434  -9.822  1.00 0.00 ? 46 TPO A CA   16 
HETATM 10892 C CB   . TPO A 1 29 ? 2.713  2.606  -9.698  1.00 0.00 ? 46 TPO A CB   16 
HETATM 10893 C CG2  . TPO A 1 29 ? 3.874  3.492  -9.274  1.00 0.00 ? 46 TPO A CG2  16 
HETATM 10894 O OG1  . TPO A 1 29 ? 2.528  1.569  -8.727  1.00 0.00 ? 46 TPO A OG1  16 
HETATM 10895 P P    . TPO A 1 29 ? 3.434  0.235  -8.769  1.00 0.00 ? 46 TPO A P    16 
HETATM 10896 O O1P  . TPO A 1 29 ? 2.980  -0.668 -7.592  1.00 0.00 ? 46 TPO A O1P  16 
HETATM 10897 O O2P  . TPO A 1 29 ? 4.912  0.677  -8.611  1.00 0.00 ? 46 TPO A O2P  16 
HETATM 10898 O O3P  . TPO A 1 29 ? 3.186  -0.447 -10.140 1.00 0.00 ? 46 TPO A O3P  16 
HETATM 10899 C C    . TPO A 1 29 ? 0.244  2.490  -10.040 1.00 0.00 ? 46 TPO A C    16 
HETATM 10900 O O    . TPO A 1 29 ? -0.582 2.296  -9.149  1.00 0.00 ? 46 TPO A O    16 
HETATM 10901 H H    . TPO A 1 29 ? 1.464  3.923  -7.739  1.00 0.00 ? 46 TPO A H    16 
HETATM 10902 H HA   . TPO A 1 29 ? 1.487  4.055  -10.715 1.00 0.00 ? 46 TPO A HA   16 
HETATM 10903 H HB   . TPO A 1 29 ? 2.937  2.152  -10.663 1.00 0.00 ? 46 TPO A HB   16 
HETATM 10904 H HG21 . TPO A 1 29 ? 4.779  2.890  -9.193  1.00 0.00 ? 46 TPO A HG21 16 
HETATM 10905 H HG22 . TPO A 1 29 ? 4.024  4.275  -10.017 1.00 0.00 ? 46 TPO A HG22 16 
HETATM 10906 H HG23 . TPO A 1 29 ? 3.651  3.945  -8.309  1.00 0.00 ? 46 TPO A HG23 16 
ATOM   10907 N N    . PRO A 1 30 ? 0.175  1.905  -11.231 1.00 0.00 ? 47 PRO A N    16 
ATOM   10908 C CA   . PRO A 1 30 ? -0.945 1.047  -11.599 1.00 0.00 ? 47 PRO A CA   16 
ATOM   10909 C C    . PRO A 1 30 ? -1.114 -0.094 -10.604 1.00 0.00 ? 47 PRO A C    16 
ATOM   10910 O O    . PRO A 1 30 ? -2.223 -0.582 -10.388 1.00 0.00 ? 47 PRO A O    16 
ATOM   10911 C CB   . PRO A 1 30 ? -0.585 0.542  -13.000 1.00 0.00 ? 47 PRO A CB   16 
ATOM   10912 C CG   . PRO A 1 30 ? 0.280  1.614  -13.570 1.00 0.00 ? 47 PRO A CG   16 
ATOM   10913 C CD   . PRO A 1 30 ? 1.085  2.136  -12.410 1.00 0.00 ? 47 PRO A CD   16 
ATOM   10914 H HA   . PRO A 1 30 ? -1.909 1.577  -11.589 1.00 0.00 ? 47 PRO A HA   16 
ATOM   10915 H HB2  . PRO A 1 30 ? -0.052 -0.419 -12.958 1.00 0.00 ? 47 PRO A HB2  16 
ATOM   10916 H HB3  . PRO A 1 30 ? -1.483 0.386  -13.615 1.00 0.00 ? 47 PRO A HB3  16 
ATOM   10917 H HG2  . PRO A 1 30 ? 0.936  1.218  -14.360 1.00 0.00 ? 47 PRO A HG2  16 
ATOM   10918 H HG3  . PRO A 1 30 ? -0.324 2.413  -14.024 1.00 0.00 ? 47 PRO A HG3  16 
ATOM   10919 H HD2  . PRO A 1 30 ? 2.036  1.598  -12.288 1.00 0.00 ? 47 PRO A HD2  16 
ATOM   10920 H HD3  . PRO A 1 30 ? 1.331  3.203  -12.522 1.00 0.00 ? 47 PRO A HD3  16 
ATOM   10921 N N    . GLY A 1 31 ? -0.007 -0.516 -10.002 1.00 0.00 ? 48 GLY A N    16 
ATOM   10922 C CA   . GLY A 1 31 ? -0.030 -1.606 -9.033  1.00 0.00 ? 48 GLY A CA   16 
ATOM   10923 C C    . GLY A 1 31 ? -0.826 -1.222 -7.792  1.00 0.00 ? 48 GLY A C    16 
ATOM   10924 O O    . GLY A 1 31 ? -1.370 -2.084 -7.101  1.00 0.00 ? 48 GLY A O    16 
ATOM   10925 H H    . GLY A 1 31 ? 0.872  -0.071 -10.221 1.00 0.00 ? 48 GLY A H    16 
ATOM   10926 H HA2  . GLY A 1 31 ? -0.489 -2.481 -9.493  1.00 0.00 ? 48 GLY A HA2  16 
ATOM   10927 H HA3  . GLY A 1 31 ? 0.992  -1.844 -8.741  1.00 0.00 ? 48 GLY A HA3  16 
ATOM   10928 N N    . GLY A 1 32 ? -0.889 0.075  -7.514  1.00 0.00 ? 49 GLY A N    16 
ATOM   10929 C CA   . GLY A 1 32 ? -1.665 0.580  -6.387  1.00 0.00 ? 49 GLY A CA   16 
ATOM   10930 C C    . GLY A 1 32 ? -0.756 1.142  -5.301  1.00 0.00 ? 49 GLY A C    16 
ATOM   10931 O O    . GLY A 1 32 ? -1.229 1.697  -4.309  1.00 0.00 ? 49 GLY A O    16 
ATOM   10932 H H    . GLY A 1 32 ? -0.388 0.729  -8.098  1.00 0.00 ? 49 GLY A H    16 
ATOM   10933 H HA2  . GLY A 1 32 ? -2.330 1.369  -6.737  1.00 0.00 ? 49 GLY A HA2  16 
ATOM   10934 H HA3  . GLY A 1 32 ? -2.257 -0.234 -5.969  1.00 0.00 ? 49 GLY A HA3  16 
ATOM   10935 N N    . THR A 1 33 ? 0.550  0.995  -5.494  1.00 0.00 ? 50 THR A N    16 
ATOM   10936 C CA   . THR A 1 33 ? 1.528  1.493  -4.534  1.00 0.00 ? 50 THR A CA   16 
ATOM   10937 C C    . THR A 1 33 ? 1.574  3.016  -4.536  1.00 0.00 ? 50 THR A C    16 
ATOM   10938 O O    . THR A 1 33 ? 1.685  3.642  -5.590  1.00 0.00 ? 50 THR A O    16 
ATOM   10939 C CB   . THR A 1 33 ? 2.937  0.946  -4.827  1.00 0.00 ? 50 THR A CB   16 
ATOM   10940 O OG1  . THR A 1 33 ? 2.924  -0.485 -4.744  1.00 0.00 ? 50 THR A OG1  16 
ATOM   10941 C CG2  . THR A 1 33 ? 3.942  1.500  -3.829  1.00 0.00 ? 50 THR A CG2  16 
ATOM   10942 H H    . THR A 1 33 ? 0.874  0.526  -6.328  1.00 0.00 ? 50 THR A H    16 
ATOM   10943 H HA   . THR A 1 33 ? 1.240  1.194  -3.526  1.00 0.00 ? 50 THR A HA   16 
ATOM   10944 H HB   . THR A 1 33 ? 3.228  1.240  -5.836  1.00 0.00 ? 50 THR A HB   16 
ATOM   10945 H HG1  . THR A 1 33 ? 2.937  -0.857 -5.629  1.00 0.00 ? 50 THR A HG1  16 
ATOM   10946 H HG21 . THR A 1 33 ? 3.652  1.206  -2.821  1.00 0.00 ? 50 THR A HG21 16 
ATOM   10947 H HG22 . THR A 1 33 ? 4.932  1.102  -4.053  1.00 0.00 ? 50 THR A HG22 16 
ATOM   10948 H HG23 . THR A 1 33 ? 3.962  2.587  -3.899  1.00 0.00 ? 50 THR A HG23 16 
ATOM   10949 N N    . ARG A 1 34 ? 1.489  3.606  -3.348  1.00 0.00 ? 51 ARG A N    16 
ATOM   10950 C CA   . ARG A 1 34 ? 1.623  5.050  -3.200  1.00 0.00 ? 51 ARG A CA   16 
ATOM   10951 C C    . ARG A 1 34 ? 3.047  5.436  -2.819  1.00 0.00 ? 51 ARG A C    16 
ATOM   10952 O O    . ARG A 1 34 ? 3.542  5.051  -1.759  1.00 0.00 ? 51 ARG A O    16 
ATOM   10953 C CB   . ARG A 1 34 ? 0.610  5.623  -2.220  1.00 0.00 ? 51 ARG A CB   16 
ATOM   10954 C CG   . ARG A 1 34 ? 0.691  7.128  -2.022  1.00 0.00 ? 51 ARG A CG   16 
ATOM   10955 C CD   . ARG A 1 34 ? -0.325 7.679  -1.089  1.00 0.00 ? 51 ARG A CD   16 
ATOM   10956 N NE   . ARG A 1 34 ? -0.204 9.106  -0.840  1.00 0.00 ? 51 ARG A NE   16 
ATOM   10957 C CZ   . ARG A 1 34 ? -0.921 9.787  0.075   1.00 0.00 ? 51 ARG A CZ   16 
ATOM   10958 N NH1  . ARG A 1 34 ? -1.837 9.186  0.801   1.00 0.00 ? 51 ARG A NH1  16 
ATOM   10959 N NH2  . ARG A 1 34 ? -0.697 11.083 0.206   1.00 0.00 ? 51 ARG A NH2  16 
ATOM   10960 H H    . ARG A 1 34 ? 1.328  3.040  -2.528  1.00 0.00 ? 51 ARG A H    16 
ATOM   10961 H HA   . ARG A 1 34 ? 1.413  5.540  -4.151  1.00 0.00 ? 51 ARG A HA   16 
ATOM   10962 H HB2  . ARG A 1 34 ? -0.379 5.362  -2.595  1.00 0.00 ? 51 ARG A HB2  16 
ATOM   10963 H HB3  . ARG A 1 34 ? 0.778  5.127  -1.264  1.00 0.00 ? 51 ARG A HB3  16 
ATOM   10964 H HG2  . ARG A 1 34 ? 1.677  7.374  -1.628  1.00 0.00 ? 51 ARG A HG2  16 
ATOM   10965 H HG3  . ARG A 1 34 ? 0.556  7.612  -2.990  1.00 0.00 ? 51 ARG A HG3  16 
ATOM   10966 H HD2  . ARG A 1 34 ? -1.318 7.504  -1.503  1.00 0.00 ? 51 ARG A HD2  16 
ATOM   10967 H HD3  . ARG A 1 34 ? -0.237 7.171  -0.130  1.00 0.00 ? 51 ARG A HD3  16 
ATOM   10968 H HE   . ARG A 1 34 ? 0.400  9.788  -1.280  1.00 0.00 ? 51 ARG A HE   16 
ATOM   10969 H HH11 . ARG A 1 34 ? -2.009 8.198  0.677   1.00 0.00 ? 51 ARG A HH11 16 
ATOM   10970 H HH12 . ARG A 1 34 ? -2.364 9.714  1.482   1.00 0.00 ? 51 ARG A HH12 16 
ATOM   10971 H HH21 . ARG A 1 34 ? -0.001 11.533 -0.373  1.00 0.00 ? 51 ARG A HH21 16 
ATOM   10972 H HH22 . ARG A 1 34 ? -1.221 11.617 0.883   1.00 0.00 ? 51 ARG A HH22 16 
ATOM   10973 N N    . ILE A 1 35 ? 3.701  6.197  -3.689  1.00 0.00 ? 52 ILE A N    16 
ATOM   10974 C CA   . ILE A 1 35 ? 5.075  6.624  -3.451  1.00 0.00 ? 52 ILE A CA   16 
ATOM   10975 C C    . ILE A 1 35 ? 5.128  8.073  -2.983  1.00 0.00 ? 52 ILE A C    16 
ATOM   10976 O O    . ILE A 1 35 ? 4.772  8.989  -3.725  1.00 0.00 ? 52 ILE A O    16 
ATOM   10977 C CB   . ILE A 1 35 ? 5.941  6.471  -4.715  1.00 0.00 ? 52 ILE A CB   16 
ATOM   10978 C CG1  . ILE A 1 35 ? 5.923  5.019  -5.201  1.00 0.00 ? 52 ILE A CG1  16 
ATOM   10979 C CG2  . ILE A 1 35 ? 7.366  6.927  -4.442  1.00 0.00 ? 52 ILE A CG2  16 
ATOM   10980 C CD1  . ILE A 1 35 ? 6.567  4.820  -6.554  1.00 0.00 ? 52 ILE A CD1  16 
ATOM   10981 H H    . ILE A 1 35 ? 3.235  6.488  -4.536  1.00 0.00 ? 52 ILE A H    16 
ATOM   10982 H HA   . ILE A 1 35 ? 5.519  6.054  -2.636  1.00 0.00 ? 52 ILE A HA   16 
ATOM   10983 H HB   . ILE A 1 35 ? 5.513  7.074  -5.515  1.00 0.00 ? 52 ILE A HB   16 
ATOM   10984 H HG12 . ILE A 1 35 ? 6.448  4.421  -4.457  1.00 0.00 ? 52 ILE A HG12 16 
ATOM   10985 H HG13 . ILE A 1 35 ? 4.880  4.705  -5.246  1.00 0.00 ? 52 ILE A HG13 16 
ATOM   10986 H HG21 . ILE A 1 35 ? 7.964  6.811  -5.346  1.00 0.00 ? 52 ILE A HG21 16 
ATOM   10987 H HG22 . ILE A 1 35 ? 7.362  7.974  -4.142  1.00 0.00 ? 52 ILE A HG22 16 
ATOM   10988 H HG23 . ILE A 1 35 ? 7.795  6.322  -3.643  1.00 0.00 ? 52 ILE A HG23 16 
ATOM   10989 H HD11 . ILE A 1 35 ? 7.610  5.132  -6.511  1.00 0.00 ? 52 ILE A HD11 16 
ATOM   10990 H HD12 . ILE A 1 35 ? 6.516  3.767  -6.831  1.00 0.00 ? 52 ILE A HD12 16 
ATOM   10991 H HD13 . ILE A 1 35 ? 6.041  5.417  -7.300  1.00 0.00 ? 52 ILE A HD13 16 
ATOM   10992 N N    . ILE A 1 36 ? 5.576  8.274  -1.748  1.00 0.00 ? 53 ILE A N    16 
ATOM   10993 C CA   . ILE A 1 36 ? 5.631  9.608  -1.162  1.00 0.00 ? 53 ILE A CA   16 
ATOM   10994 C C    . ILE A 1 36 ? 7.034  10.194 -1.259  1.00 0.00 ? 53 ILE A C    16 
ATOM   10995 O O    . ILE A 1 36 ? 8.014  9.549  -0.888  1.00 0.00 ? 53 ILE A O    16 
ATOM   10996 C CB   . ILE A 1 36 ? 5.192  9.595  0.314   1.00 0.00 ? 53 ILE A CB   16 
ATOM   10997 C CG1  . ILE A 1 36 ? 3.742  9.118  0.435   1.00 0.00 ? 53 ILE A CG1  16 
ATOM   10998 C CG2  . ILE A 1 36 ? 5.355  10.976 0.930   1.00 0.00 ? 53 ILE A CG2  16 
ATOM   10999 C CD1  . ILE A 1 36 ? 3.305  8.846  1.856   1.00 0.00 ? 53 ILE A CD1  16 
ATOM   11000 H H    . ILE A 1 36 ? 5.885  7.483  -1.202  1.00 0.00 ? 53 ILE A H    16 
ATOM   11001 H HA   . ILE A 1 36 ? 5.003  10.300 -1.721  1.00 0.00 ? 53 ILE A HA   16 
ATOM   11002 H HB   . ILE A 1 36 ? 5.804  8.878  0.860   1.00 0.00 ? 53 ILE A HB   16 
ATOM   11003 H HG12 . ILE A 1 36 ? 3.109  9.892  0.002   1.00 0.00 ? 53 ILE A HG12 16 
ATOM   11004 H HG13 . ILE A 1 36 ? 3.651  8.205  -0.154  1.00 0.00 ? 53 ILE A HG13 16 
ATOM   11005 H HG21 . ILE A 1 36 ? 5.039  10.949 1.972   1.00 0.00 ? 53 ILE A HG21 16 
ATOM   11006 H HG22 . ILE A 1 36 ? 6.400  11.277 0.875   1.00 0.00 ? 53 ILE A HG22 16 
ATOM   11007 H HG23 . ILE A 1 36 ? 4.742  11.693 0.384   1.00 0.00 ? 53 ILE A HG23 16 
ATOM   11008 H HD11 . ILE A 1 36 ? 3.395  9.758  2.446   1.00 0.00 ? 53 ILE A HD11 16 
ATOM   11009 H HD12 . ILE A 1 36 ? 2.268  8.512  1.862   1.00 0.00 ? 53 ILE A HD12 16 
ATOM   11010 H HD13 . ILE A 1 36 ? 3.938  8.071  2.290   1.00 0.00 ? 53 ILE A HD13 16 
ATOM   11011 N N    . TYR A 1 37 ? 7.123  11.421 -1.761  1.00 0.00 ? 54 TYR A N    16 
ATOM   11012 C CA   . TYR A 1 37 ? 8.412  12.046 -2.034  1.00 0.00 ? 54 TYR A CA   16 
ATOM   11013 C C    . TYR A 1 37 ? 8.717  13.143 -1.021  1.00 0.00 ? 54 TYR A C    16 
ATOM   11014 O O    . TYR A 1 37 ? 8.223  14.264 -1.139  1.00 0.00 ? 54 TYR A O    16 
ATOM   11015 C CB   . TYR A 1 37 ? 8.440  12.619 -3.452  1.00 0.00 ? 54 TYR A CB   16 
ATOM   11016 C CG   . TYR A 1 37 ? 8.150  11.599 -4.531  1.00 0.00 ? 54 TYR A CG   16 
ATOM   11017 C CD1  . TYR A 1 37 ? 9.129  10.709 -4.949  1.00 0.00 ? 54 TYR A CD1  16 
ATOM   11018 C CD2  . TYR A 1 37 ? 6.901  11.530 -5.130  1.00 0.00 ? 54 TYR A CD2  16 
ATOM   11019 C CE1  . TYR A 1 37 ? 8.870  9.776  -5.934  1.00 0.00 ? 54 TYR A CE1  16 
ATOM   11020 C CE2  . TYR A 1 37 ? 6.631  10.600 -6.115  1.00 0.00 ? 54 TYR A CE2  16 
ATOM   11021 C CZ   . TYR A 1 37 ? 7.620  9.724  -6.515  1.00 0.00 ? 54 TYR A CZ   16 
ATOM   11022 O OH   . TYR A 1 37 ? 7.358  8.796  -7.497  1.00 0.00 ? 54 TYR A OH   16 
ATOM   11023 H H    . TYR A 1 37 ? 6.276  11.935 -1.960  1.00 0.00 ? 54 TYR A H    16 
ATOM   11024 H HA   . TYR A 1 37 ? 9.208  11.308 -1.941  1.00 0.00 ? 54 TYR A HA   16 
ATOM   11025 H HB2  . TYR A 1 37 ? 7.694  13.414 -3.495  1.00 0.00 ? 54 TYR A HB2  16 
ATOM   11026 H HB3  . TYR A 1 37 ? 9.432  13.042 -3.609  1.00 0.00 ? 54 TYR A HB3  16 
ATOM   11027 H HD1  . TYR A 1 37 ? 10.114 10.755 -4.486  1.00 0.00 ? 54 TYR A HD1  16 
ATOM   11028 H HD2  . TYR A 1 37 ? 6.125  12.225 -4.809  1.00 0.00 ? 54 TYR A HD2  16 
ATOM   11029 H HE1  . TYR A 1 37 ? 9.653  9.084  -6.248  1.00 0.00 ? 54 TYR A HE1  16 
ATOM   11030 H HE2  . TYR A 1 37 ? 5.645  10.557 -6.576  1.00 0.00 ? 54 TYR A HE2  16 
ATOM   11031 H HH   . TYR A 1 37 ? 8.102  8.216  -7.673  1.00 0.00 ? 54 TYR A HH   16 
ATOM   11032 N N    . ASP A 1 38 ? 9.534  12.813 -0.027  1.00 0.00 ? 55 ASP A N    16 
ATOM   11033 C CA   . ASP A 1 38 ? 9.889  13.763 1.020   1.00 0.00 ? 55 ASP A CA   16 
ATOM   11034 C C    . ASP A 1 38 ? 11.061 14.638 0.595   1.00 0.00 ? 55 ASP A C    16 
ATOM   11035 O O    . ASP A 1 38 ? 12.193 14.165 0.485   1.00 0.00 ? 55 ASP A O    16 
ATOM   11036 C CB   . ASP A 1 38 ? 10.226 13.028 2.320   1.00 0.00 ? 55 ASP A CB   16 
ATOM   11037 C CG   . ASP A 1 38 ? 10.555 13.942 3.493   1.00 0.00 ? 55 ASP A CG   16 
ATOM   11038 O OD1  . ASP A 1 38 ? 10.639 15.130 3.289   1.00 0.00 ? 55 ASP A OD1  16 
ATOM   11039 O OD2  . ASP A 1 38 ? 10.565 13.469 4.604   1.00 0.00 ? 55 ASP A OD2  16 
ATOM   11040 H H    . ASP A 1 38 ? 9.918  11.879 0.005   1.00 0.00 ? 55 ASP A H    16 
ATOM   11041 H HA   . ASP A 1 38 ? 9.052  14.436 1.208   1.00 0.00 ? 55 ASP A HA   16 
ATOM   11042 H HB2  . ASP A 1 38 ? 9.464  12.309 2.623   1.00 0.00 ? 55 ASP A HB2  16 
ATOM   11043 H HB3  . ASP A 1 38 ? 11.126 12.495 2.011   1.00 0.00 ? 55 ASP A HB3  16 
ATOM   11044 N N    . ARG A 1 39 ? 10.784 15.915 0.358   1.00 0.00 ? 56 ARG A N    16 
ATOM   11045 C CA   . ARG A 1 39 ? 11.813 16.856 -0.070  1.00 0.00 ? 56 ARG A CA   16 
ATOM   11046 C C    . ARG A 1 39 ? 12.607 17.382 1.119   1.00 0.00 ? 56 ARG A C    16 
ATOM   11047 O O    . ARG A 1 39 ? 12.056 18.031 2.008   1.00 0.00 ? 56 ARG A O    16 
ATOM   11048 C CB   . ARG A 1 39 ? 11.240 17.992 -0.904  1.00 0.00 ? 56 ARG A CB   16 
ATOM   11049 C CG   . ARG A 1 39 ? 12.271 18.966 -1.452  1.00 0.00 ? 56 ARG A CG   16 
ATOM   11050 C CD   . ARG A 1 39 ? 11.699 20.075 -2.257  1.00 0.00 ? 56 ARG A CD   16 
ATOM   11051 N NE   . ARG A 1 39 ? 12.686 20.978 -2.827  1.00 0.00 ? 56 ARG A NE   16 
ATOM   11052 C CZ   . ARG A 1 39 ? 12.405 22.184 -3.356  1.00 0.00 ? 56 ARG A CZ   16 
ATOM   11053 N NH1  . ARG A 1 39 ? 11.167 22.621 -3.425  1.00 0.00 ? 56 ARG A NH1  16 
ATOM   11054 N NH2  . ARG A 1 39 ? 13.405 22.908 -3.827  1.00 0.00 ? 56 ARG A NH2  16 
ATOM   11055 H H    . ARG A 1 39 ? 9.836  16.243 0.477   1.00 0.00 ? 56 ARG A H    16 
ATOM   11056 H HA   . ARG A 1 39 ? 12.527 16.351 -0.721  1.00 0.00 ? 56 ARG A HA   16 
ATOM   11057 H HB2  . ARG A 1 39 ? 10.699 17.538 -1.733  1.00 0.00 ? 56 ARG A HB2  16 
ATOM   11058 H HB3  . ARG A 1 39 ? 10.540 18.533 -0.266  1.00 0.00 ? 56 ARG A HB3  16 
ATOM   11059 H HG2  . ARG A 1 39 ? 12.814 19.405 -0.614  1.00 0.00 ? 56 ARG A HG2  16 
ATOM   11060 H HG3  . ARG A 1 39 ? 12.967 18.414 -2.085  1.00 0.00 ? 56 ARG A HG3  16 
ATOM   11061 H HD2  . ARG A 1 39 ? 11.127 19.654 -3.083  1.00 0.00 ? 56 ARG A HD2  16 
ATOM   11062 H HD3  . ARG A 1 39 ? 11.040 20.669 -1.625  1.00 0.00 ? 56 ARG A HD3  16 
ATOM   11063 H HE   . ARG A 1 39 ? 13.687 20.864 -2.919  1.00 0.00 ? 56 ARG A HE   16 
ATOM   11064 H HH11 . ARG A 1 39 ? 10.411 22.048 -3.077  1.00 0.00 ? 56 ARG A HH11 16 
ATOM   11065 H HH12 . ARG A 1 39 ? 10.976 23.529 -3.825  1.00 0.00 ? 56 ARG A HH12 16 
ATOM   11066 H HH21 . ARG A 1 39 ? 14.349 22.550 -3.783  1.00 0.00 ? 56 ARG A HH21 16 
ATOM   11067 H HH22 . ARG A 1 39 ? 13.222 23.816 -4.230  1.00 0.00 ? 56 ARG A HH22 16 
ATOM   11068 N N    . LYS A 1 40 ? 13.905 17.098 1.129   1.00 0.00 ? 57 LYS A N    16 
ATOM   11069 C CA   . LYS A 1 40 ? 14.778 17.540 2.210   1.00 0.00 ? 57 LYS A CA   16 
ATOM   11070 C C    . LYS A 1 40 ? 14.669 19.044 2.426   1.00 0.00 ? 57 LYS A C    16 
ATOM   11071 O O    . LYS A 1 40 ? 14.675 19.520 3.561   1.00 0.00 ? 57 LYS A O    16 
ATOM   11072 C CB   . LYS A 1 40 ? 16.229 17.155 1.918   1.00 0.00 ? 57 LYS A CB   16 
ATOM   11073 C CG   . LYS A 1 40 ? 17.223 17.596 2.984   1.00 0.00 ? 57 LYS A CG   16 
ATOM   11074 C CD   . LYS A 1 40 ? 18.628 17.107 2.667   1.00 0.00 ? 57 LYS A CD   16 
ATOM   11075 C CE   . LYS A 1 40 ? 19.632 17.593 3.702   1.00 0.00 ? 57 LYS A CE   16 
ATOM   11076 N NZ   . LYS A 1 40 ? 21.008 17.106 3.415   1.00 0.00 ? 57 LYS A NZ   16 
ATOM   11077 H H    . LYS A 1 40 ? 14.297 16.562 0.368   1.00 0.00 ? 57 LYS A H    16 
ATOM   11078 H HA   . LYS A 1 40 ? 14.474 17.069 3.145   1.00 0.00 ? 57 LYS A HA   16 
ATOM   11079 H HB2  . LYS A 1 40 ? 16.258 16.069 1.823   1.00 0.00 ? 57 LYS A HB2  16 
ATOM   11080 H HB3  . LYS A 1 40 ? 16.495 17.609 0.964   1.00 0.00 ? 57 LYS A HB3  16 
ATOM   11081 H HG2  . LYS A 1 40 ? 17.219 18.686 3.032   1.00 0.00 ? 57 LYS A HG2  16 
ATOM   11082 H HG3  . LYS A 1 40 ? 16.905 17.190 3.944   1.00 0.00 ? 57 LYS A HG3  16 
ATOM   11083 H HD2  . LYS A 1 40 ? 18.621 16.016 2.651   1.00 0.00 ? 57 LYS A HD2  16 
ATOM   11084 H HD3  . LYS A 1 40 ? 18.912 17.481 1.683   1.00 0.00 ? 57 LYS A HD3  16 
ATOM   11085 H HE2  . LYS A 1 40 ? 19.624 18.682 3.700   1.00 0.00 ? 57 LYS A HE2  16 
ATOM   11086 H HE3  . LYS A 1 40 ? 19.316 17.231 4.680   1.00 0.00 ? 57 LYS A HE3  16 
ATOM   11087 H HZ1  . LYS A 1 40 ? 21.302 17.443 2.509   1.00 0.00 ? 57 LYS A HZ1  16 
ATOM   11088 H HZ2  . LYS A 1 40 ? 21.641 17.450 4.123   1.00 0.00 ? 57 LYS A HZ2  16 
ATOM   11089 H HZ3  . LYS A 1 40 ? 21.016 16.096 3.418   1.00 0.00 ? 57 LYS A HZ3  16 
ATOM   11090 N N    . PHE A 1 41 ? 14.568 19.788 1.330   1.00 0.00 ? 58 PHE A N    16 
ATOM   11091 C CA   . PHE A 1 41 ? 14.559 21.245 1.391   1.00 0.00 ? 58 PHE A CA   16 
ATOM   11092 C C    . PHE A 1 41 ? 13.174 21.801 1.090   1.00 0.00 ? 58 PHE A C    16 
ATOM   11093 O O    . PHE A 1 41 ? 13.039 22.864 0.484   1.00 0.00 ? 58 PHE A O    16 
ATOM   11094 C CB   . PHE A 1 41 ? 15.583 21.827 0.415   1.00 0.00 ? 58 PHE A CB   16 
ATOM   11095 C CG   . PHE A 1 41 ? 16.984 21.333 0.640   1.00 0.00 ? 58 PHE A CG   16 
ATOM   11096 C CD1  . PHE A 1 41 ? 17.738 21.803 1.705   1.00 0.00 ? 58 PHE A CD1  16 
ATOM   11097 C CD2  . PHE A 1 41 ? 17.550 20.396 -0.212  1.00 0.00 ? 58 PHE A CD2  16 
ATOM   11098 C CE1  . PHE A 1 41 ? 19.027 21.351 1.913   1.00 0.00 ? 58 PHE A CE1  16 
ATOM   11099 C CE2  . PHE A 1 41 ? 18.839 19.941 -0.005  1.00 0.00 ? 58 PHE A CE2  16 
ATOM   11100 C CZ   . PHE A 1 41 ? 19.577 20.419 1.057   1.00 0.00 ? 58 PHE A CZ   16 
ATOM   11101 H H    . PHE A 1 41 ? 14.495 19.333 0.431   1.00 0.00 ? 58 PHE A H    16 
ATOM   11102 H HA   . PHE A 1 41 ? 14.813 21.574 2.399   1.00 0.00 ? 58 PHE A HA   16 
ATOM   11103 H HB2  . PHE A 1 41 ? 15.320 21.561 -0.608  1.00 0.00 ? 58 PHE A HB2  16 
ATOM   11104 H HB3  . PHE A 1 41 ? 15.617 22.911 0.509   1.00 0.00 ? 58 PHE A HB3  16 
ATOM   11105 H HD1  . PHE A 1 41 ? 17.303 22.539 2.381   1.00 0.00 ? 58 PHE A HD1  16 
ATOM   11106 H HD2  . PHE A 1 41 ? 16.967 20.020 -1.052  1.00 0.00 ? 58 PHE A HD2  16 
ATOM   11107 H HE1  . PHE A 1 41 ? 19.609 21.729 2.753   1.00 0.00 ? 58 PHE A HE1  16 
ATOM   11108 H HE2  . PHE A 1 41 ? 19.272 19.205 -0.682  1.00 0.00 ? 58 PHE A HE2  16 
ATOM   11109 H HZ   . PHE A 1 41 ? 20.592 20.060 1.221   1.00 0.00 ? 58 PHE A HZ   16 
ATOM   11110 N N    . LEU A 1 42 ? 12.145 21.076 1.516   1.00 0.00 ? 59 LEU A N    16 
ATOM   11111 C CA   . LEU A 1 42 ? 10.767 21.489 1.281   1.00 0.00 ? 59 LEU A CA   16 
ATOM   11112 C C    . LEU A 1 42 ? 10.482 22.844 1.917   1.00 0.00 ? 59 LEU A C    16 
ATOM   11113 O O    . LEU A 1 42 ? 10.607 23.010 3.130   1.00 0.00 ? 59 LEU A O    16 
ATOM   11114 C CB   . LEU A 1 42 ? 9.797  20.431 1.823   1.00 0.00 ? 59 LEU A CB   16 
ATOM   11115 C CG   . LEU A 1 42 ? 8.323  20.647 1.454   1.00 0.00 ? 59 LEU A CG   16 
ATOM   11116 C CD1  . LEU A 1 42 ? 8.147  20.576 -0.056  1.00 0.00 ? 59 LEU A CD1  16 
ATOM   11117 C CD2  . LEU A 1 42 ? 7.467  19.598 2.147   1.00 0.00 ? 59 LEU A CD2  16 
ATOM   11118 H H    . LEU A 1 42 ? 12.323 20.217 2.016   1.00 0.00 ? 59 LEU A H    16 
ATOM   11119 H HA   . LEU A 1 42 ? 10.599 21.608 0.212   1.00 0.00 ? 59 LEU A HA   16 
ATOM   11120 H HB2  . LEU A 1 42 ? 10.186 19.554 1.308   1.00 0.00 ? 59 LEU A HB2  16 
ATOM   11121 H HB3  . LEU A 1 42 ? 9.905  20.298 2.899   1.00 0.00 ? 59 LEU A HB3  16 
ATOM   11122 H HG   . LEU A 1 42 ? 8.033  21.624 1.842   1.00 0.00 ? 59 LEU A HG   16 
ATOM   11123 H HD11 . LEU A 1 42 ? 7.098  20.730 -0.308  1.00 0.00 ? 59 LEU A HD11 16 
ATOM   11124 H HD12 . LEU A 1 42 ? 8.751  21.350 -0.530  1.00 0.00 ? 59 LEU A HD12 16 
ATOM   11125 H HD13 . LEU A 1 42 ? 8.465  19.597 -0.414  1.00 0.00 ? 59 LEU A HD13 16 
ATOM   11126 H HD21 . LEU A 1 42 ? 7.587  19.685 3.227   1.00 0.00 ? 59 LEU A HD21 16 
ATOM   11127 H HD22 . LEU A 1 42 ? 6.420  19.753 1.885   1.00 0.00 ? 59 LEU A HD22 16 
ATOM   11128 H HD23 . LEU A 1 42 ? 7.779  18.603 1.827   1.00 0.00 ? 59 LEU A HD23 16 
ATOM   11129 N N    . LEU A 1 43 ? 10.098 23.810 1.090   1.00 0.00 ? 60 LEU A N    16 
ATOM   11130 C CA   . LEU A 1 43 ? 9.742  25.138 1.576   1.00 0.00 ? 60 LEU A CA   16 
ATOM   11131 C C    . LEU A 1 43 ? 8.230  25.309 1.652   1.00 0.00 ? 60 LEU A C    16 
ATOM   11132 O O    . LEU A 1 43 ? 7.734  26.283 2.220   1.00 0.00 ? 60 LEU A O    16 
ATOM   11133 C CB   . LEU A 1 43 ? 10.356 26.215 0.673   1.00 0.00 ? 60 LEU A CB   16 
ATOM   11134 C CG   . LEU A 1 43 ? 11.889 26.207 0.597   1.00 0.00 ? 60 LEU A CG   16 
ATOM   11135 C CD1  . LEU A 1 43 ? 12.368 27.274 -0.378  1.00 0.00 ? 60 LEU A CD1  16 
ATOM   11136 C CD2  . LEU A 1 43 ? 12.468 26.443 1.984   1.00 0.00 ? 60 LEU A CD2  16 
ATOM   11137 H H    . LEU A 1 43 ? 10.052 23.621 0.099   1.00 0.00 ? 60 LEU A H    16 
ATOM   11138 H HA   . LEU A 1 43 ? 10.119 25.269 2.589   1.00 0.00 ? 60 LEU A HA   16 
ATOM   11139 H HB2  . LEU A 1 43 ? 9.933  25.909 -0.282  1.00 0.00 ? 60 LEU A HB2  16 
ATOM   11140 H HB3  . LEU A 1 43 ? 9.993  27.211 0.928   1.00 0.00 ? 60 LEU A HB3  16 
ATOM   11141 H HG   . LEU A 1 43 ? 12.191 25.211 0.274   1.00 0.00 ? 60 LEU A HG   16 
ATOM   11142 H HD11 . LEU A 1 43 ? 13.457 27.261 -0.425  1.00 0.00 ? 60 LEU A HD11 16 
ATOM   11143 H HD12 . LEU A 1 43 ? 11.960 27.072 -1.368  1.00 0.00 ? 60 LEU A HD12 16 
ATOM   11144 H HD13 . LEU A 1 43 ? 12.033 28.254 -0.039  1.00 0.00 ? 60 LEU A HD13 16 
ATOM   11145 H HD21 . LEU A 1 43 ? 12.135 25.654 2.657   1.00 0.00 ? 60 LEU A HD21 16 
ATOM   11146 H HD22 . LEU A 1 43 ? 13.557 26.437 1.928   1.00 0.00 ? 60 LEU A HD22 16 
ATOM   11147 H HD23 . LEU A 1 43 ? 12.129 27.409 2.361   1.00 0.00 ? 60 LEU A HD23 16 
ATOM   11148 N N    . ASP A 1 44 ? 7.502  24.358 1.077   1.00 0.00 ? 61 ASP A N    16 
ATOM   11149 C CA   . ASP A 1 44 ? 6.045  24.404 1.076   1.00 0.00 ? 61 ASP A CA   16 
ATOM   11150 C C    . ASP A 1 44 ? 5.485  24.160 2.472   1.00 0.00 ? 61 ASP A C    16 
ATOM   11151 O O    . ASP A 1 44 ? 4.467  24.737 2.852   1.00 0.00 ? 61 ASP A O    16 
ATOM   11152 C CB   . ASP A 1 44 ? 5.477  23.377 0.094   1.00 0.00 ? 61 ASP A CB   16 
ATOM   11153 C CG   . ASP A 1 44 ? 5.663  23.739 -1.373  1.00 0.00 ? 61 ASP A CG   16 
ATOM   11154 O OD1  . ASP A 1 44 ? 6.001  24.865 -1.648  1.00 0.00 ? 61 ASP A OD1  16 
ATOM   11155 O OD2  . ASP A 1 44 ? 5.619  22.853 -2.193  1.00 0.00 ? 61 ASP A OD2  16 
ATOM   11156 H H    . ASP A 1 44 ? 7.970  23.583 0.629   1.00 0.00 ? 61 ASP A H    16 
ATOM   11157 H HA   . ASP A 1 44 ? 5.707  25.397 0.776   1.00 0.00 ? 61 ASP A HA   16 
ATOM   11158 H HB2  . ASP A 1 44 ? 5.840  22.364 0.267   1.00 0.00 ? 61 ASP A HB2  16 
ATOM   11159 H HB3  . ASP A 1 44 ? 4.418  23.432 0.350   1.00 0.00 ? 61 ASP A HB3  16 
ATOM   11160 N N    . ARG A 1 45 ? 6.157  23.301 3.231   1.00 0.00 ? 62 ARG A N    16 
ATOM   11161 C CA   . ARG A 1 45 ? 5.723  22.973 4.584   1.00 0.00 ? 62 ARG A CA   16 
ATOM   11162 C C    . ARG A 1 45 ? 6.397  23.873 5.612   1.00 0.00 ? 62 ARG A C    16 
ATOM   11163 O O    . ARG A 1 45 ? 5.982  24.983 5.801   1.00 0.00 ? 62 ARG A O    16 
ATOM   11164 C CB   . ARG A 1 45 ? 5.929  21.501 4.911   1.00 0.00 ? 62 ARG A CB   16 
ATOM   11165 C CG   . ARG A 1 45 ? 5.450  21.080 6.292   1.00 0.00 ? 62 ARG A CG   16 
ATOM   11166 C CD   . ARG A 1 45 ? 5.656  19.642 6.599   1.00 0.00 ? 62 ARG A CD   16 
ATOM   11167 N NE   . ARG A 1 45 ? 5.244  19.246 7.936   1.00 0.00 ? 62 ARG A NE   16 
ATOM   11168 C CZ   . ARG A 1 45 ? 5.495  18.044 8.489   1.00 0.00 ? 62 ARG A CZ   16 
ATOM   11169 N NH1  . ARG A 1 45 ? 6.119  17.104 7.814   1.00 0.00 ? 62 ARG A NH1  16 
ATOM   11170 N NH2  . ARG A 1 45 ? 5.074  17.824 9.723   1.00 0.00 ? 62 ARG A NH2  16 
ATOM   11171 O OXT  . ARG A 1 45 ? 7.342  23.471 6.233   1.00 0.00 ? 62 ARG A OXT  16 
ATOM   11172 H H    . ARG A 1 45 ? 6.989  22.864 2.862   1.00 0.00 ? 62 ARG A H    16 
ATOM   11173 H HA   . ARG A 1 45 ? 4.650  23.143 4.679   1.00 0.00 ? 62 ARG A HA   16 
ATOM   11174 H HB2  . ARG A 1 45 ? 5.393  20.929 4.155   1.00 0.00 ? 62 ARG A HB2  16 
ATOM   11175 H HB3  . ARG A 1 45 ? 6.997  21.303 4.827   1.00 0.00 ? 62 ARG A HB3  16 
ATOM   11176 H HG2  . ARG A 1 45 ? 5.990  21.663 7.039   1.00 0.00 ? 62 ARG A HG2  16 
ATOM   11177 H HG3  . ARG A 1 45 ? 4.383  21.292 6.368   1.00 0.00 ? 62 ARG A HG3  16 
ATOM   11178 H HD2  . ARG A 1 45 ? 5.083  19.043 5.891   1.00 0.00 ? 62 ARG A HD2  16 
ATOM   11179 H HD3  . ARG A 1 45 ? 6.715  19.406 6.500   1.00 0.00 ? 62 ARG A HD3  16 
ATOM   11180 H HE   . ARG A 1 45 ? 4.734  19.770 8.635   1.00 0.00 ? 62 ARG A HE   16 
ATOM   11181 H HH11 . ARG A 1 45 ? 6.419  17.282 6.866   1.00 0.00 ? 62 ARG A HH11 16 
ATOM   11182 H HH12 . ARG A 1 45 ? 6.297  16.209 8.247   1.00 0.00 ? 62 ARG A HH12 16 
ATOM   11183 H HH21 . ARG A 1 45 ? 4.579  18.551 10.222  1.00 0.00 ? 62 ARG A HH21 16 
ATOM   11184 H HH22 . ARG A 1 45 ? 5.248  16.931 10.161  1.00 0.00 ? 62 ARG A HH22 16 
ATOM   11185 N N    . PRO A 1 1  ? -0.083 -0.677 -0.546  1.00 0.00 ? 18 PRO A N    17 
ATOM   11186 C CA   . PRO A 1 1  ? 1.294  -0.494 -0.105  1.00 0.00 ? 18 PRO A CA   17 
ATOM   11187 C C    . PRO A 1 1  ? 1.758  0.940  -0.326  1.00 0.00 ? 18 PRO A C    17 
ATOM   11188 O O    . PRO A 1 1  ? 1.483  1.538  -1.366  1.00 0.00 ? 18 PRO A O    17 
ATOM   11189 C CB   . PRO A 1 1  ? 2.092  -1.495 -0.946  1.00 0.00 ? 18 PRO A CB   17 
ATOM   11190 C CG   . PRO A 1 1  ? 1.310  -1.627 -2.208  1.00 0.00 ? 18 PRO A CG   17 
ATOM   11191 C CD   . PRO A 1 1  ? -0.133 -1.503 -1.798  1.00 0.00 ? 18 PRO A CD   17 
ATOM   11192 H H2   . PRO A 1 1  ? -0.294 -1.340 -1.264  1.00 0.00 ? 18 PRO A H2   17 
ATOM   11193 H H3   . PRO A 1 1  ? -0.782 -0.971 0.105   1.00 0.00 ? 18 PRO A H3   17 
ATOM   11194 H HA   . PRO A 1 1  ? 1.423  -0.670 0.973   1.00 0.00 ? 18 PRO A HA   17 
ATOM   11195 H HB2  . PRO A 1 1  ? 3.111  -1.131 -1.145  1.00 0.00 ? 18 PRO A HB2  17 
ATOM   11196 H HB3  . PRO A 1 1  ? 2.190  -2.464 -0.435  1.00 0.00 ? 18 PRO A HB3  17 
ATOM   11197 H HG2  . PRO A 1 1  ? 1.585  -0.844 -2.930  1.00 0.00 ? 18 PRO A HG2  17 
ATOM   11198 H HG3  . PRO A 1 1  ? 1.501  -2.595 -2.695  1.00 0.00 ? 18 PRO A HG3  17 
ATOM   11199 H HD2  . PRO A 1 1  ? -0.743 -1.005 -2.567  1.00 0.00 ? 18 PRO A HD2  17 
ATOM   11200 H HD3  . PRO A 1 1  ? -0.596 -2.481 -1.604  1.00 0.00 ? 18 PRO A HD3  17 
ATOM   11201 N N    . THR A 1 2  ? 2.462  1.487  0.658   1.00 0.00 ? 19 THR A N    17 
ATOM   11202 C CA   . THR A 1 2  ? 2.986  2.845  0.564   1.00 0.00 ? 19 THR A CA   17 
ATOM   11203 C C    . THR A 1 2  ? 4.433  2.912  1.034   1.00 0.00 ? 19 THR A C    17 
ATOM   11204 O O    . THR A 1 2  ? 4.782  2.364  2.081   1.00 0.00 ? 19 THR A O    17 
ATOM   11205 C CB   . THR A 1 2  ? 2.142  3.834  1.389   1.00 0.00 ? 19 THR A CB   17 
ATOM   11206 O OG1  . THR A 1 2  ? 0.783  3.802  0.934   1.00 0.00 ? 19 THR A OG1  17 
ATOM   11207 C CG2  . THR A 1 2  ? 2.686  5.247  1.247   1.00 0.00 ? 19 THR A CG2  17 
ATOM   11208 H H    . THR A 1 2  ? 2.640  0.948  1.494   1.00 0.00 ? 19 THR A H    17 
ATOM   11209 H HA   . THR A 1 2  ? 2.985  3.169  -0.477  1.00 0.00 ? 19 THR A HA   17 
ATOM   11210 H HB   . THR A 1 2  ? 2.173  3.538  2.437   1.00 0.00 ? 19 THR A HB   17 
ATOM   11211 H HG1  . THR A 1 2  ? 0.258  4.419  1.451   1.00 0.00 ? 19 THR A HG1  17 
ATOM   11212 H HG21 . THR A 1 2  ? 2.656  5.544  0.200   1.00 0.00 ? 19 THR A HG21 17 
ATOM   11213 H HG22 . THR A 1 2  ? 2.078  5.931  1.837   1.00 0.00 ? 19 THR A HG22 17 
ATOM   11214 H HG23 . THR A 1 2  ? 3.717  5.277  1.603   1.00 0.00 ? 19 THR A HG23 17 
ATOM   11215 N N    . ARG A 1 3  ? 5.273  3.586  0.256   1.00 0.00 ? 20 ARG A N    17 
ATOM   11216 C CA   . ARG A 1 3  ? 6.678  3.752  0.608   1.00 0.00 ? 20 ARG A CA   17 
ATOM   11217 C C    . ARG A 1 3  ? 7.108  5.208  0.480   1.00 0.00 ? 20 ARG A C    17 
ATOM   11218 O O    . ARG A 1 3  ? 6.647  5.926  -0.407  1.00 0.00 ? 20 ARG A O    17 
ATOM   11219 C CB   . ARG A 1 3  ? 7.583  2.830  -0.194  1.00 0.00 ? 20 ARG A CB   17 
ATOM   11220 C CG   . ARG A 1 3  ? 7.352  1.345  0.037   1.00 0.00 ? 20 ARG A CG   17 
ATOM   11221 C CD   . ARG A 1 3  ? 7.733  0.870  1.391   1.00 0.00 ? 20 ARG A CD   17 
ATOM   11222 N NE   . ARG A 1 3  ? 7.584  -0.563 1.592   1.00 0.00 ? 20 ARG A NE   17 
ATOM   11223 C CZ   . ARG A 1 3  ? 6.447  -1.165 1.992   1.00 0.00 ? 20 ARG A CZ   17 
ATOM   11224 N NH1  . ARG A 1 3  ? 5.371  -0.463 2.272   1.00 0.00 ? 20 ARG A NH1  17 
ATOM   11225 N NH2  . ARG A 1 3  ? 6.449  -2.480 2.119   1.00 0.00 ? 20 ARG A NH2  17 
ATOM   11226 H H    . ARG A 1 3  ? 4.928  3.992  -0.601  1.00 0.00 ? 20 ARG A H    17 
ATOM   11227 H HA   . ARG A 1 3  ? 6.832  3.473  1.651   1.00 0.00 ? 20 ARG A HA   17 
ATOM   11228 H HB2  . ARG A 1 3  ? 7.420  3.059  -1.246  1.00 0.00 ? 20 ARG A HB2  17 
ATOM   11229 H HB3  . ARG A 1 3  ? 8.610  3.079  0.076   1.00 0.00 ? 20 ARG A HB3  17 
ATOM   11230 H HG2  . ARG A 1 3  ? 6.292  1.133  -0.107  1.00 0.00 ? 20 ARG A HG2  17 
ATOM   11231 H HG3  . ARG A 1 3  ? 7.938  0.785  -0.693  1.00 0.00 ? 20 ARG A HG3  17 
ATOM   11232 H HD2  . ARG A 1 3  ? 8.779  1.118  1.572   1.00 0.00 ? 20 ARG A HD2  17 
ATOM   11233 H HD3  . ARG A 1 3  ? 7.108  1.370  2.132   1.00 0.00 ? 20 ARG A HD3  17 
ATOM   11234 H HE   . ARG A 1 3  ? 8.261  -1.304 1.473   1.00 0.00 ? 20 ARG A HE   17 
ATOM   11235 H HH11 . ARG A 1 3  ? 5.391  0.543  2.186   1.00 0.00 ? 20 ARG A HH11 17 
ATOM   11236 H HH12 . ARG A 1 3  ? 4.529  -0.934 2.569   1.00 0.00 ? 20 ARG A HH12 17 
ATOM   11237 H HH21 . ARG A 1 3  ? 7.291  -3.003 1.917   1.00 0.00 ? 20 ARG A HH21 17 
ATOM   11238 H HH22 . ARG A 1 3  ? 5.611  -2.957 2.418   1.00 0.00 ? 20 ARG A HH22 17 
ATOM   11239 N N    . THR A 1 4  ? 7.996  5.637  1.370   1.00 0.00 ? 21 THR A N    17 
ATOM   11240 C CA   . THR A 1 4  ? 8.423  7.030  1.414   1.00 0.00 ? 21 THR A CA   17 
ATOM   11241 C C    . THR A 1 4  ? 9.902  7.163  1.072   1.00 0.00 ? 21 THR A C    17 
ATOM   11242 O O    . THR A 1 4  ? 10.750 6.501  1.671   1.00 0.00 ? 21 THR A O    17 
ATOM   11243 C CB   . THR A 1 4  ? 8.170  7.656  2.798   1.00 0.00 ? 21 THR A CB   17 
ATOM   11244 O OG1  . THR A 1 4  ? 6.771  7.597  3.103   1.00 0.00 ? 21 THR A OG1  17 
ATOM   11245 C CG2  . THR A 1 4  ? 8.629  9.106  2.821   1.00 0.00 ? 21 THR A CG2  17 
ATOM   11246 H H    . THR A 1 4  ? 8.383  4.982  2.034   1.00 0.00 ? 21 THR A H    17 
ATOM   11247 H HA   . THR A 1 4  ? 7.881  7.608  0.666   1.00 0.00 ? 21 THR A HA   17 
ATOM   11248 H HB   . THR A 1 4  ? 8.720  7.090  3.550   1.00 0.00 ? 21 THR A HB   17 
ATOM   11249 H HG1  . THR A 1 4  ? 6.616  7.987  3.967   1.00 0.00 ? 21 THR A HG1  17 
ATOM   11250 H HG21 . THR A 1 4  ? 8.079  9.672  2.070   1.00 0.00 ? 21 THR A HG21 17 
ATOM   11251 H HG22 . THR A 1 4  ? 8.442  9.531  3.806   1.00 0.00 ? 21 THR A HG22 17 
ATOM   11252 H HG23 . THR A 1 4  ? 9.696  9.152  2.600   1.00 0.00 ? 21 THR A HG23 17 
ATOM   11253 N N    . VAL A 1 5  ? 10.205 8.022  0.105   1.00 0.00 ? 22 VAL A N    17 
ATOM   11254 C CA   . VAL A 1 5  ? 11.588 8.320  -0.250  1.00 0.00 ? 22 VAL A CA   17 
ATOM   11255 C C    . VAL A 1 5  ? 11.864 9.817  -0.184  1.00 0.00 ? 22 VAL A C    17 
ATOM   11256 O O    . VAL A 1 5  ? 10.944 10.631 -0.264  1.00 0.00 ? 22 VAL A O    17 
ATOM   11257 C CB   . VAL A 1 5  ? 11.932 7.806  -1.660  1.00 0.00 ? 22 VAL A CB   17 
ATOM   11258 C CG1  . VAL A 1 5  ? 11.777 6.295  -1.729  1.00 0.00 ? 22 VAL A CG1  17 
ATOM   11259 C CG2  . VAL A 1 5  ? 11.052 8.479  -2.703  1.00 0.00 ? 22 VAL A CG2  17 
ATOM   11260 H H    . VAL A 1 5  ? 9.459  8.481  -0.397  1.00 0.00 ? 22 VAL A H    17 
ATOM   11261 H HA   . VAL A 1 5  ? 12.284 7.876  0.462   1.00 0.00 ? 22 VAL A HA   17 
ATOM   11262 H HB   . VAL A 1 5  ? 12.962 8.077  -1.894  1.00 0.00 ? 22 VAL A HB   17 
ATOM   11263 H HG11 . VAL A 1 5  ? 12.025 5.948  -2.733  1.00 0.00 ? 22 VAL A HG11 17 
ATOM   11264 H HG12 . VAL A 1 5  ? 12.447 5.827  -1.009  1.00 0.00 ? 22 VAL A HG12 17 
ATOM   11265 H HG13 . VAL A 1 5  ? 10.748 6.023  -1.497  1.00 0.00 ? 22 VAL A HG13 17 
ATOM   11266 H HG21 . VAL A 1 5  ? 11.208 9.557  -2.671  1.00 0.00 ? 22 VAL A HG21 17 
ATOM   11267 H HG22 . VAL A 1 5  ? 11.309 8.105  -3.693  1.00 0.00 ? 22 VAL A HG22 17 
ATOM   11268 H HG23 . VAL A 1 5  ? 10.005 8.257  -2.491  1.00 0.00 ? 22 VAL A HG23 17 
ATOM   11269 N N    . ALA A 1 6  ? 13.135 10.174 -0.037  1.00 0.00 ? 23 ALA A N    17 
ATOM   11270 C CA   . ALA A 1 6  ? 13.537 11.574 0.010   1.00 0.00 ? 23 ALA A CA   17 
ATOM   11271 C C    . ALA A 1 6  ? 14.034 12.050 -1.348  1.00 0.00 ? 23 ALA A C    17 
ATOM   11272 O O    . ALA A 1 6  ? 14.808 11.361 -2.014  1.00 0.00 ? 23 ALA A O    17 
ATOM   11273 C CB   . ALA A 1 6  ? 14.607 11.782 1.072   1.00 0.00 ? 23 ALA A CB   17 
ATOM   11274 H H    . ALA A 1 6  ? 13.841 9.455  0.044   1.00 0.00 ? 23 ALA A H    17 
ATOM   11275 H HA   . ALA A 1 6  ? 12.668 12.179 0.269   1.00 0.00 ? 23 ALA A HA   17 
ATOM   11276 H HB1  . ALA A 1 6  ? 15.478 11.171 0.836   1.00 0.00 ? 23 ALA A HB1  17 
ATOM   11277 H HB2  . ALA A 1 6  ? 14.896 12.832 1.095   1.00 0.00 ? 23 ALA A HB2  17 
ATOM   11278 H HB3  . ALA A 1 6  ? 14.214 11.493 2.047   1.00 0.00 ? 23 ALA A HB3  17 
ATOM   11279 N N    . ILE A 1 7  ? 13.585 13.233 -1.756  1.00 0.00 ? 24 ILE A N    17 
ATOM   11280 C CA   . ILE A 1 7  ? 13.947 13.783 -3.057  1.00 0.00 ? 24 ILE A CA   17 
ATOM   11281 C C    . ILE A 1 7  ? 14.651 15.126 -2.909  1.00 0.00 ? 24 ILE A C    17 
ATOM   11282 O O    . ILE A 1 7  ? 14.140 16.038 -2.261  1.00 0.00 ? 24 ILE A O    17 
ATOM   11283 C CB   . ILE A 1 7  ? 12.713 13.957 -3.960  1.00 0.00 ? 24 ILE A CB   17 
ATOM   11284 C CG1  . ILE A 1 7  ? 11.975 12.625 -4.119  1.00 0.00 ? 24 ILE A CG1  17 
ATOM   11285 C CG2  . ILE A 1 7  ? 13.120 14.508 -5.318  1.00 0.00 ? 24 ILE A CG2  17 
ATOM   11286 C CD1  . ILE A 1 7  ? 12.782 11.560 -4.827  1.00 0.00 ? 24 ILE A CD1  17 
ATOM   11287 H H    . ILE A 1 7  ? 12.977 13.763 -1.149  1.00 0.00 ? 24 ILE A H    17 
ATOM   11288 H HA   . ILE A 1 7  ? 14.674 13.143 -3.555  1.00 0.00 ? 24 ILE A HA   17 
ATOM   11289 H HB   . ILE A 1 7  ? 12.017 14.646 -3.482  1.00 0.00 ? 24 ILE A HB   17 
ATOM   11290 H HG12 . ILE A 1 7  ? 11.713 12.279 -3.120  1.00 0.00 ? 24 ILE A HG12 17 
ATOM   11291 H HG13 . ILE A 1 7  ? 11.064 12.825 -4.683  1.00 0.00 ? 24 ILE A HG13 17 
ATOM   11292 H HG21 . ILE A 1 7  ? 12.237 14.624 -5.944  1.00 0.00 ? 24 ILE A HG21 17 
ATOM   11293 H HG22 . ILE A 1 7  ? 13.602 15.476 -5.188  1.00 0.00 ? 24 ILE A HG22 17 
ATOM   11294 H HG23 . ILE A 1 7  ? 13.816 13.818 -5.796  1.00 0.00 ? 24 ILE A HG23 17 
ATOM   11295 H HD11 . ILE A 1 7  ? 13.692 11.358 -4.263  1.00 0.00 ? 24 ILE A HD11 17 
ATOM   11296 H HD12 . ILE A 1 7  ? 12.193 10.646 -4.901  1.00 0.00 ? 24 ILE A HD12 17 
ATOM   11297 H HD13 . ILE A 1 7  ? 13.043 11.907 -5.827  1.00 0.00 ? 24 ILE A HD13 17 
ATOM   11298 N N    . SER A 1 8  ? 15.828 15.241 -3.517  1.00 0.00 ? 25 SER A N    17 
ATOM   11299 C CA   . SER A 1 8  ? 16.654 16.433 -3.366  1.00 0.00 ? 25 SER A CA   17 
ATOM   11300 C C    . SER A 1 8  ? 16.041 17.624 -4.090  1.00 0.00 ? 25 SER A C    17 
ATOM   11301 O O    . SER A 1 8  ? 16.220 18.771 -3.681  1.00 0.00 ? 25 SER A O    17 
ATOM   11302 C CB   . SER A 1 8  ? 18.055 16.165 -3.881  1.00 0.00 ? 25 SER A CB   17 
ATOM   11303 O OG   . SER A 1 8  ? 18.072 15.931 -5.262  1.00 0.00 ? 25 SER A OG   17 
ATOM   11304 H H    . SER A 1 8  ? 16.158 14.484 -4.098  1.00 0.00 ? 25 SER A H    17 
ATOM   11305 H HA   . SER A 1 8  ? 16.852 16.693 -2.325  1.00 0.00 ? 25 SER A HA   17 
ATOM   11306 H HB2  . SER A 1 8  ? 18.678 17.031 -3.660  1.00 0.00 ? 25 SER A HB2  17 
ATOM   11307 H HB3  . SER A 1 8  ? 18.455 15.291 -3.369  1.00 0.00 ? 25 SER A HB3  17 
ATOM   11308 H HG   . SER A 1 8  ? 18.974 15.768 -5.547  1.00 0.00 ? 25 SER A HG   17 
ATOM   11309 N N    . ASP A 1 9  ? 15.316 17.345 -5.169  1.00 0.00 ? 26 ASP A N    17 
ATOM   11310 C CA   . ASP A 1 9  ? 14.633 18.389 -5.923  1.00 0.00 ? 26 ASP A CA   17 
ATOM   11311 C C    . ASP A 1 9  ? 13.386 17.847 -6.609  1.00 0.00 ? 26 ASP A C    17 
ATOM   11312 O O    . ASP A 1 9  ? 13.460 17.299 -7.709  1.00 0.00 ? 26 ASP A O    17 
ATOM   11313 C CB   . ASP A 1 9  ? 15.576 19.006 -6.959  1.00 0.00 ? 26 ASP A CB   17 
ATOM   11314 C CG   . ASP A 1 9  ? 15.015 20.232 -7.669  1.00 0.00 ? 26 ASP A CG   17 
ATOM   11315 O OD1  . ASP A 1 9  ? 13.895 20.591 -7.395  1.00 0.00 ? 26 ASP A OD1  17 
ATOM   11316 O OD2  . ASP A 1 9  ? 15.760 20.887 -8.358  1.00 0.00 ? 26 ASP A OD2  17 
ATOM   11317 H H    . ASP A 1 9  ? 15.236 16.386 -5.473  1.00 0.00 ? 26 ASP A H    17 
ATOM   11318 H HA   . ASP A 1 9  ? 14.297 19.175 -5.246  1.00 0.00 ? 26 ASP A HA   17 
ATOM   11319 H HB2  . ASP A 1 9  ? 16.565 19.239 -6.562  1.00 0.00 ? 26 ASP A HB2  17 
ATOM   11320 H HB3  . ASP A 1 9  ? 15.652 18.180 -7.666  1.00 0.00 ? 26 ASP A HB3  17 
ATOM   11321 N N    . ALA A 1 10 ? 12.241 18.002 -5.954  1.00 0.00 ? 27 ALA A N    17 
ATOM   11322 C CA   . ALA A 1 10 ? 10.993 17.429 -6.443  1.00 0.00 ? 27 ALA A CA   17 
ATOM   11323 C C    . ALA A 1 10 ? 10.512 18.149 -7.697  1.00 0.00 ? 27 ALA A C    17 
ATOM   11324 O O    . ALA A 1 10 ? 9.644  17.653 -8.415  1.00 0.00 ? 27 ALA A O    17 
ATOM   11325 C CB   . ALA A 1 10 ? 9.927  17.476 -5.359  1.00 0.00 ? 27 ALA A CB   17 
ATOM   11326 H H    . ALA A 1 10 ? 12.235 18.530 -5.093  1.00 0.00 ? 27 ALA A H    17 
ATOM   11327 H HA   . ALA A 1 10 ? 11.169 16.388 -6.714  1.00 0.00 ? 27 ALA A HA   17 
ATOM   11328 H HB1  . ALA A 1 10 ? 9.750  18.510 -5.067  1.00 0.00 ? 27 ALA A HB1  17 
ATOM   11329 H HB2  . ALA A 1 10 ? 9.002  17.045 -5.742  1.00 0.00 ? 27 ALA A HB2  17 
ATOM   11330 H HB3  . ALA A 1 10 ? 10.262 16.904 -4.494  1.00 0.00 ? 27 ALA A HB3  17 
ATOM   11331 N N    . ALA A 1 11 ? 11.081 19.321 -7.956  1.00 0.00 ? 28 ALA A N    17 
ATOM   11332 C CA   . ALA A 1 11 ? 10.757 20.083 -9.156  1.00 0.00 ? 28 ALA A CA   17 
ATOM   11333 C C    . ALA A 1 11 ? 11.195 19.342 -10.414 1.00 0.00 ? 28 ALA A C    17 
ATOM   11334 O O    . ALA A 1 11 ? 10.696 19.607 -11.507 1.00 0.00 ? 28 ALA A O    17 
ATOM   11335 C CB   . ALA A 1 11 ? 11.399 21.461 -9.098  1.00 0.00 ? 28 ALA A CB   17 
ATOM   11336 H H    . ALA A 1 11 ? 11.756 19.695 -7.303  1.00 0.00 ? 28 ALA A H    17 
ATOM   11337 H HA   . ALA A 1 11 ? 9.675  20.205 -9.211  1.00 0.00 ? 28 ALA A HA   17 
ATOM   11338 H HB1  . ALA A 1 11 ? 12.480 21.356 -9.028  1.00 0.00 ? 28 ALA A HB1  17 
ATOM   11339 H HB2  . ALA A 1 11 ? 11.147 22.016 -10.002 1.00 0.00 ? 28 ALA A HB2  17 
ATOM   11340 H HB3  . ALA A 1 11 ? 11.028 22.000 -8.227  1.00 0.00 ? 28 ALA A HB3  17 
ATOM   11341 N N    . GLN A 1 12 ? 12.131 18.412 -10.250 1.00 0.00 ? 29 GLN A N    17 
ATOM   11342 C CA   . GLN A 1 12 ? 12.639 17.633 -11.373 1.00 0.00 ? 29 GLN A CA   17 
ATOM   11343 C C    . GLN A 1 12 ? 11.756 16.423 -11.650 1.00 0.00 ? 29 GLN A C    17 
ATOM   11344 O O    . GLN A 1 12 ? 11.969 15.696 -12.620 1.00 0.00 ? 29 GLN A O    17 
ATOM   11345 C CB   . GLN A 1 12 ? 14.074 17.173 -11.099 1.00 0.00 ? 29 GLN A CB   17 
ATOM   11346 C CG   . GLN A 1 12 ? 15.074 18.307 -10.952 1.00 0.00 ? 29 GLN A CG   17 
ATOM   11347 C CD   . GLN A 1 12 ? 16.475 17.809 -10.656 1.00 0.00 ? 29 GLN A CD   17 
ATOM   11348 O OE1  . GLN A 1 12 ? 16.737 16.602 -10.673 1.00 0.00 ? 29 GLN A OE1  17 
ATOM   11349 N NE2  . GLN A 1 12 ? 17.386 18.734 -10.378 1.00 0.00 ? 29 GLN A NE2  17 
ATOM   11350 H H    . GLN A 1 12 ? 12.498 18.241 -9.325  1.00 0.00 ? 29 GLN A H    17 
ATOM   11351 H HA   . GLN A 1 12 ? 12.624 18.242 -12.276 1.00 0.00 ? 29 GLN A HA   17 
ATOM   11352 H HB2  . GLN A 1 12 ? 14.046 16.585 -10.182 1.00 0.00 ? 29 GLN A HB2  17 
ATOM   11353 H HB3  . GLN A 1 12 ? 14.364 16.532 -11.931 1.00 0.00 ? 29 GLN A HB3  17 
ATOM   11354 H HG2  . GLN A 1 12 ? 15.154 19.120 -11.673 1.00 0.00 ? 29 GLN A HG2  17 
ATOM   11355 H HG3  . GLN A 1 12 ? 14.640 18.686 -10.026 1.00 0.00 ? 29 GLN A HG3  17 
ATOM   11356 H HE21 . GLN A 1 12 ? 17.130 19.702 -10.373 1.00 0.00 ? 29 GLN A HE21 17 
ATOM   11357 H HE22 . GLN A 1 12 ? 18.328 18.465 -10.173 1.00 0.00 ? 29 GLN A HE22 17 
ATOM   11358 N N    . LEU A 1 13 ? 10.763 16.213 -10.791 1.00 0.00 ? 30 LEU A N    17 
ATOM   11359 C CA   . LEU A 1 13 ? 9.829  15.106 -10.957 1.00 0.00 ? 30 LEU A CA   17 
ATOM   11360 C C    . LEU A 1 13 ? 8.679  15.489 -11.880 1.00 0.00 ? 30 LEU A C    17 
ATOM   11361 O O    . LEU A 1 13 ? 8.356  16.668 -12.029 1.00 0.00 ? 30 LEU A O    17 
ATOM   11362 C CB   . LEU A 1 13 ? 9.292  14.658 -9.592  1.00 0.00 ? 30 LEU A CB   17 
ATOM   11363 C CG   . LEU A 1 13 ? 10.352 14.139 -8.612  1.00 0.00 ? 30 LEU A CG   17 
ATOM   11364 C CD1  . LEU A 1 13 ? 9.710  13.824 -7.267  1.00 0.00 ? 30 LEU A CD1  17 
ATOM   11365 C CD2  . LEU A 1 13 ? 11.021 12.903 -9.193  1.00 0.00 ? 30 LEU A CD2  17 
ATOM   11366 H H    . LEU A 1 13 ? 10.653 16.837 -10.005 1.00 0.00 ? 30 LEU A H    17 
ATOM   11367 H HA   . LEU A 1 13 ? 10.338 14.267 -11.429 1.00 0.00 ? 30 LEU A HA   17 
ATOM   11368 H HB2  . LEU A 1 13 ? 8.889  15.606 -9.239  1.00 0.00 ? 30 LEU A HB2  17 
ATOM   11369 H HB3  . LEU A 1 13 ? 8.483  13.935 -9.694  1.00 0.00 ? 30 LEU A HB3  17 
ATOM   11370 H HG   . LEU A 1 13 ? 11.111 14.915 -8.516  1.00 0.00 ? 30 LEU A HG   17 
ATOM   11371 H HD11 . LEU A 1 13 ? 10.470 13.456 -6.578  1.00 0.00 ? 30 LEU A HD11 17 
ATOM   11372 H HD12 . LEU A 1 13 ? 9.258  14.727 -6.860  1.00 0.00 ? 30 LEU A HD12 17 
ATOM   11373 H HD13 . LEU A 1 13 ? 8.943  13.061 -7.401  1.00 0.00 ? 30 LEU A HD13 17 
ATOM   11374 H HD21 . LEU A 1 13 ? 11.497 13.157 -10.140 1.00 0.00 ? 30 LEU A HD21 17 
ATOM   11375 H HD22 . LEU A 1 13 ? 11.775 12.536 -8.496  1.00 0.00 ? 30 LEU A HD22 17 
ATOM   11376 H HD23 . LEU A 1 13 ? 10.273 12.128 -9.360  1.00 0.00 ? 30 LEU A HD23 17 
ATOM   11377 N N    . PRO A 1 14 ? 8.063  14.486 -12.497 1.00 0.00 ? 31 PRO A N    17 
ATOM   11378 C CA   . PRO A 1 14 ? 6.901  14.710 -13.347 1.00 0.00 ? 31 PRO A CA   17 
ATOM   11379 C C    . PRO A 1 14 ? 5.845  15.542 -12.630 1.00 0.00 ? 31 PRO A C    17 
ATOM   11380 O O    . PRO A 1 14 ? 5.663  15.421 -11.418 1.00 0.00 ? 31 PRO A O    17 
ATOM   11381 C CB   . PRO A 1 14 ? 6.399  13.299 -13.672 1.00 0.00 ? 31 PRO A CB   17 
ATOM   11382 C CG   . PRO A 1 14 ? 7.612  12.440 -13.566 1.00 0.00 ? 31 PRO A CG   17 
ATOM   11383 C CD   . PRO A 1 14 ? 8.428  13.036 -12.451 1.00 0.00 ? 31 PRO A CD   17 
ATOM   11384 H HA   . PRO A 1 14 ? 7.140  15.279 -14.257 1.00 0.00 ? 31 PRO A HA   17 
ATOM   11385 H HB2  . PRO A 1 14 ? 5.619  12.975 -12.966 1.00 0.00 ? 31 PRO A HB2  17 
ATOM   11386 H HB3  . PRO A 1 14 ? 5.961  13.248 -14.680 1.00 0.00 ? 31 PRO A HB3  17 
ATOM   11387 H HG2  . PRO A 1 14 ? 7.343  11.396 -13.344 1.00 0.00 ? 31 PRO A HG2  17 
ATOM   11388 H HG3  . PRO A 1 14 ? 8.177  12.432 -14.510 1.00 0.00 ? 31 PRO A HG3  17 
ATOM   11389 H HD2  . PRO A 1 14 ? 8.180  12.599 -11.473 1.00 0.00 ? 31 PRO A HD2  17 
ATOM   11390 H HD3  . PRO A 1 14 ? 9.507  12.893 -12.602 1.00 0.00 ? 31 PRO A HD3  17 
ATOM   11391 N N    . HIS A 1 15 ? 5.151  16.387 -13.385 1.00 0.00 ? 32 HIS A N    17 
ATOM   11392 C CA   . HIS A 1 15 ? 4.270  17.390 -12.800 1.00 0.00 ? 32 HIS A CA   17 
ATOM   11393 C C    . HIS A 1 15 ? 2.839  16.875 -12.701 1.00 0.00 ? 32 HIS A C    17 
ATOM   11394 O O    . HIS A 1 15 ? 1.945  17.584 -12.238 1.00 0.00 ? 32 HIS A O    17 
ATOM   11395 C CB   . HIS A 1 15 ? 4.305  18.684 -13.619 1.00 0.00 ? 32 HIS A CB   17 
ATOM   11396 C CG   . HIS A 1 15 ? 5.643  19.356 -13.625 1.00 0.00 ? 32 HIS A CG   17 
ATOM   11397 N ND1  . HIS A 1 15 ? 6.257  19.800 -12.472 1.00 0.00 ? 32 HIS A ND1  17 
ATOM   11398 C CD2  . HIS A 1 15 ? 6.484  19.661 -14.640 1.00 0.00 ? 32 HIS A CD2  17 
ATOM   11399 C CE1  . HIS A 1 15 ? 7.420  20.348 -12.780 1.00 0.00 ? 32 HIS A CE1  17 
ATOM   11400 N NE2  . HIS A 1 15 ? 7.580  20.278 -14.088 1.00 0.00 ? 32 HIS A NE2  17 
ATOM   11401 H H    . HIS A 1 15 ? 5.237  16.332 -14.390 1.00 0.00 ? 32 HIS A H    17 
ATOM   11402 H HA   . HIS A 1 15 ? 4.591  17.612 -11.783 1.00 0.00 ? 32 HIS A HA   17 
ATOM   11403 H HB2  . HIS A 1 15 ? 4.056  18.478 -14.660 1.00 0.00 ? 32 HIS A HB2  17 
ATOM   11404 H HB3  . HIS A 1 15 ? 3.595  19.405 -13.213 1.00 0.00 ? 32 HIS A HB3  17 
ATOM   11405 H HD1  . HIS A 1 15 ? 5.930  19.661 -11.537 1.00 0.00 ? 32 HIS A HD1  17 
ATOM   11406 H HD2  . HIS A 1 15 ? 6.428  19.509 -15.719 1.00 0.00 ? 32 HIS A HD2  17 
ATOM   11407 H HE1  . HIS A 1 15 ? 8.062  20.761 -12.002 1.00 0.00 ? 32 HIS A HE1  17 
ATOM   11408 N N    . ASP A 1 16 ? 2.629  15.639 -13.139 1.00 0.00 ? 33 ASP A N    17 
ATOM   11409 C CA   . ASP A 1 16 ? 1.347  14.969 -12.957 1.00 0.00 ? 33 ASP A CA   17 
ATOM   11410 C C    . ASP A 1 16 ? 1.263  14.306 -11.588 1.00 0.00 ? 33 ASP A C    17 
ATOM   11411 O O    . ASP A 1 16 ? 0.291  13.615 -11.281 1.00 0.00 ? 33 ASP A O    17 
ATOM   11412 C CB   . ASP A 1 16 ? 1.122  13.931 -14.058 1.00 0.00 ? 33 ASP A CB   17 
ATOM   11413 C CG   . ASP A 1 16 ? 2.128  12.787 -14.060 1.00 0.00 ? 33 ASP A CG   17 
ATOM   11414 O OD1  . ASP A 1 16 ? 3.030  12.814 -13.257 1.00 0.00 ? 33 ASP A OD1  17 
ATOM   11415 O OD2  . ASP A 1 16 ? 1.899  11.824 -14.753 1.00 0.00 ? 33 ASP A OD2  17 
ATOM   11416 H H    . ASP A 1 16 ? 3.377  15.150 -13.611 1.00 0.00 ? 33 ASP A H    17 
ATOM   11417 H HA   . ASP A 1 16 ? 0.539  15.700 -12.997 1.00 0.00 ? 33 ASP A HA   17 
ATOM   11418 H HB2  . ASP A 1 16 ? 0.111  13.524 -14.072 1.00 0.00 ? 33 ASP A HB2  17 
ATOM   11419 H HB3  . ASP A 1 16 ? 1.278  14.552 -14.941 1.00 0.00 ? 33 ASP A HB3  17 
ATOM   11420 N N    . TYR A 1 17 ? 2.286  14.519 -10.768 1.00 0.00 ? 34 TYR A N    17 
ATOM   11421 C CA   . TYR A 1 17 ? 2.249  14.104 -9.371  1.00 0.00 ? 34 TYR A CA   17 
ATOM   11422 C C    . TYR A 1 17 ? 1.291  14.973 -8.565  1.00 0.00 ? 34 TYR A C    17 
ATOM   11423 O O    . TYR A 1 17 ? 0.933  16.073 -8.985  1.00 0.00 ? 34 TYR A O    17 
ATOM   11424 C CB   . TYR A 1 17 ? 3.650  14.159 -8.758  1.00 0.00 ? 34 TYR A CB   17 
ATOM   11425 C CG   . TYR A 1 17 ? 4.594  13.103 -9.288  1.00 0.00 ? 34 TYR A CG   17 
ATOM   11426 C CD1  . TYR A 1 17 ? 4.240  12.309 -10.370 1.00 0.00 ? 34 TYR A CD1  17 
ATOM   11427 C CD2  . TYR A 1 17 ? 5.838  12.905 -8.707  1.00 0.00 ? 34 TYR A CD2  17 
ATOM   11428 C CE1  . TYR A 1 17 ? 5.098  11.344 -10.859 1.00 0.00 ? 34 TYR A CE1  17 
ATOM   11429 C CE2  . TYR A 1 17 ? 6.704  11.941 -9.188  1.00 0.00 ? 34 TYR A CE2  17 
ATOM   11430 C CZ   . TYR A 1 17 ? 6.329  11.162 -10.264 1.00 0.00 ? 34 TYR A CZ   17 
ATOM   11431 O OH   . TYR A 1 17 ? 7.190  10.202 -10.747 1.00 0.00 ? 34 TYR A OH   17 
ATOM   11432 H H    . TYR A 1 17 ? 3.113  14.980 -11.123 1.00 0.00 ? 34 TYR A H    17 
ATOM   11433 H HA   . TYR A 1 17 ? 1.877  13.081 -9.298  1.00 0.00 ? 34 TYR A HA   17 
ATOM   11434 H HB2  . TYR A 1 17 ? 4.057  15.150 -8.971  1.00 0.00 ? 34 TYR A HB2  17 
ATOM   11435 H HB3  . TYR A 1 17 ? 3.536  14.037 -7.682  1.00 0.00 ? 34 TYR A HB3  17 
ATOM   11436 H HD1  . TYR A 1 17 ? 3.265  12.459 -10.835 1.00 0.00 ? 34 TYR A HD1  17 
ATOM   11437 H HD2  . TYR A 1 17 ? 6.126  13.522 -7.858  1.00 0.00 ? 34 TYR A HD2  17 
ATOM   11438 H HE1  . TYR A 1 17 ? 4.805  10.727 -11.708 1.00 0.00 ? 34 TYR A HE1  17 
ATOM   11439 H HE2  . TYR A 1 17 ? 7.676  11.799 -8.716  1.00 0.00 ? 34 TYR A HE2  17 
ATOM   11440 H HH   . TYR A 1 17 ? 8.016  10.161 -10.262 1.00 0.00 ? 34 TYR A HH   17 
ATOM   11441 N N    . CYS A 1 18 ? 0.881  14.471 -7.405  1.00 0.00 ? 35 CYS A N    17 
ATOM   11442 C CA   . CYS A 1 18 ? -0.091 15.167 -6.571  1.00 0.00 ? 35 CYS A CA   17 
ATOM   11443 C C    . CYS A 1 18 ? 0.527  15.603 -5.249  1.00 0.00 ? 35 CYS A C    17 
ATOM   11444 O O    . CYS A 1 18 ? 1.392  14.918 -4.702  1.00 0.00 ? 35 CYS A O    17 
ATOM   11445 C CB   . CYS A 1 18 ? -1.162 14.100 -6.339  1.00 0.00 ? 35 CYS A CB   17 
ATOM   11446 S SG   . CYS A 1 18 ? -1.994 13.534 -7.842  1.00 0.00 ? 35 CYS A SG   17 
ATOM   11447 H H    . CYS A 1 18 ? 1.253  13.586 -7.092  1.00 0.00 ? 35 CYS A H    17 
ATOM   11448 H HA   . CYS A 1 18 ? -0.553 16.022 -7.065  1.00 0.00 ? 35 CYS A HA   17 
ATOM   11449 H HB2  . CYS A 1 18 ? -0.719 13.213 -5.886  1.00 0.00 ? 35 CYS A HB2  17 
ATOM   11450 H HB3  . CYS A 1 18 ? -1.945 14.488 -5.688  1.00 0.00 ? 35 CYS A HB3  17 
ATOM   11451 H HG   . CYS A 1 18 ? -2.798 12.665 -7.237  1.00 0.00 ? 35 CYS A HG   17 
ATOM   11452 N N    . THR A 1 19 ? 0.079  16.745 -4.740  1.00 0.00 ? 36 THR A N    17 
ATOM   11453 C CA   . THR A 1 19 ? 0.618  17.296 -3.502  1.00 0.00 ? 36 THR A CA   17 
ATOM   11454 C C    . THR A 1 19 ? -0.458 17.392 -2.427  1.00 0.00 ? 36 THR A C    17 
ATOM   11455 O O    . THR A 1 19 ? -1.577 17.832 -2.693  1.00 0.00 ? 36 THR A O    17 
ATOM   11456 C CB   . THR A 1 19 ? 1.232  18.690 -3.724  1.00 0.00 ? 36 THR A CB   17 
ATOM   11457 O OG1  . THR A 1 19 ? 2.283  18.604 -4.695  1.00 0.00 ? 36 THR A OG1  17 
ATOM   11458 C CG2  . THR A 1 19 ? 1.794  19.239 -2.422  1.00 0.00 ? 36 THR A CG2  17 
ATOM   11459 H H    . THR A 1 19 ? -0.653 17.246 -5.223  1.00 0.00 ? 36 THR A H    17 
ATOM   11460 H HA   . THR A 1 19 ? 1.389  16.633 -3.108  1.00 0.00 ? 36 THR A HA   17 
ATOM   11461 H HB   . THR A 1 19 ? 0.460  19.363 -4.097  1.00 0.00 ? 36 THR A HB   17 
ATOM   11462 H HG1  . THR A 1 19 ? 2.664  19.474 -4.831  1.00 0.00 ? 36 THR A HG1  17 
ATOM   11463 H HG21 . THR A 1 19 ? 2.567  18.567 -2.049  1.00 0.00 ? 36 THR A HG21 17 
ATOM   11464 H HG22 . THR A 1 19 ? 2.224  20.225 -2.598  1.00 0.00 ? 36 THR A HG22 17 
ATOM   11465 H HG23 . THR A 1 19 ? 0.995  19.316 -1.685  1.00 0.00 ? 36 THR A HG23 17 
HETATM 11466 N N    . TPO A 1 20 ? -0.114 16.976 -1.214  1.00 0.00 ? 37 TPO A N    17 
HETATM 11467 C CA   . TPO A 1 20 ? -1.048 17.019 -0.095  1.00 0.00 ? 37 TPO A CA   17 
HETATM 11468 C CB   . TPO A 1 20 ? -0.674 15.995 0.992   1.00 0.00 ? 37 TPO A CB   17 
HETATM 11469 C CG2  . TPO A 1 20 ? -0.469 14.617 0.380   1.00 0.00 ? 37 TPO A CG2  17 
HETATM 11470 O OG1  . TPO A 1 20 ? 0.531  16.407 1.648   1.00 0.00 ? 37 TPO A OG1  17 
HETATM 11471 P P    . TPO A 1 20 ? 0.876  15.887 3.136   1.00 0.00 ? 37 TPO A P    17 
HETATM 11472 O O1P  . TPO A 1 20 ? 2.234  16.515 3.541   1.00 0.00 ? 37 TPO A O1P  17 
HETATM 11473 O O2P  . TPO A 1 20 ? 0.959  14.339 3.074   1.00 0.00 ? 37 TPO A O2P  17 
HETATM 11474 O O3P  . TPO A 1 20 ? -0.271 16.359 4.066   1.00 0.00 ? 37 TPO A O3P  17 
HETATM 11475 C C    . TPO A 1 20 ? -1.098 18.409 0.527   1.00 0.00 ? 37 TPO A C    17 
HETATM 11476 O O    . TPO A 1 20 ? -0.209 19.231 0.306   1.00 0.00 ? 37 TPO A O    17 
HETATM 11477 H H    . TPO A 1 20 ? 0.820  16.621 -1.062  1.00 0.00 ? 37 TPO A H    17 
HETATM 11478 H HA   . TPO A 1 20 ? -2.055 16.803 -0.448  1.00 0.00 ? 37 TPO A HA   17 
HETATM 11479 H HB   . TPO A 1 20 ? -1.479 15.949 1.727   1.00 0.00 ? 37 TPO A HB   17 
HETATM 11480 H HG21 . TPO A 1 20 ? -0.206 13.908 1.164   1.00 0.00 ? 37 TPO A HG21 17 
HETATM 11481 H HG22 . TPO A 1 20 ? -1.388 14.297 -0.109  1.00 0.00 ? 37 TPO A HG22 17 
HETATM 11482 H HG23 . TPO A 1 20 ? 0.336  14.663 -0.352  1.00 0.00 ? 37 TPO A HG23 17 
ATOM   11483 N N    . PRO A 1 21 ? -2.143 18.666 1.306   1.00 0.00 ? 38 PRO A N    17 
ATOM   11484 C CA   . PRO A 1 21 ? -2.331 19.969 1.931   1.00 0.00 ? 38 PRO A CA   17 
ATOM   11485 C C    . PRO A 1 21 ? -1.110 20.368 2.750   1.00 0.00 ? 38 PRO A C    17 
ATOM   11486 O O    . PRO A 1 21 ? -0.798 21.552 2.880   1.00 0.00 ? 38 PRO A O    17 
ATOM   11487 C CB   . PRO A 1 21 ? -3.576 19.790 2.804   1.00 0.00 ? 38 PRO A CB   17 
ATOM   11488 C CG   . PRO A 1 21 ? -4.352 18.711 2.127   1.00 0.00 ? 38 PRO A CG   17 
ATOM   11489 C CD   . PRO A 1 21 ? -3.320 17.765 1.575   1.00 0.00 ? 38 PRO A CD   17 
ATOM   11490 H HA   . PRO A 1 21 ? -2.457 20.779 1.198   1.00 0.00 ? 38 PRO A HA   17 
ATOM   11491 H HB2  . PRO A 1 21 ? -3.310 19.503 3.833   1.00 0.00 ? 38 PRO A HB2  17 
ATOM   11492 H HB3  . PRO A 1 21 ? -4.161 20.720 2.869   1.00 0.00 ? 38 PRO A HB3  17 
ATOM   11493 H HG2  . PRO A 1 21 ? -5.020 18.198 2.835   1.00 0.00 ? 38 PRO A HG2  17 
ATOM   11494 H HG3  . PRO A 1 21 ? -4.985 19.120 1.326   1.00 0.00 ? 38 PRO A HG3  17 
ATOM   11495 H HD2  . PRO A 1 21 ? -3.058 16.970 2.288   1.00 0.00 ? 38 PRO A HD2  17 
ATOM   11496 H HD3  . PRO A 1 21 ? -3.662 17.269 0.653   1.00 0.00 ? 38 PRO A HD3  17 
ATOM   11497 N N    . GLY A 1 22 ? -0.422 19.374 3.300   1.00 0.00 ? 39 GLY A N    17 
ATOM   11498 C CA   . GLY A 1 22 ? 0.771  19.619 4.101   1.00 0.00 ? 39 GLY A CA   17 
ATOM   11499 C C    . GLY A 1 22 ? 1.912  20.147 3.242   1.00 0.00 ? 39 GLY A C    17 
ATOM   11500 O O    . GLY A 1 22 ? 2.776  20.882 3.722   1.00 0.00 ? 39 GLY A O    17 
ATOM   11501 H H    . GLY A 1 22 ? -0.734 18.423 3.160   1.00 0.00 ? 39 GLY A H    17 
ATOM   11502 H HA2  . GLY A 1 22 ? 0.539  20.353 4.872   1.00 0.00 ? 39 GLY A HA2  17 
ATOM   11503 H HA3  . GLY A 1 22 ? 1.083  18.686 4.571   1.00 0.00 ? 39 GLY A HA3  17 
ATOM   11504 N N    . GLY A 1 23 ? 1.913  19.767 1.969   1.00 0.00 ? 40 GLY A N    17 
ATOM   11505 C CA   . GLY A 1 23 ? 2.901  20.266 1.020   1.00 0.00 ? 40 GLY A CA   17 
ATOM   11506 C C    . GLY A 1 23 ? 3.932  19.195 0.686   1.00 0.00 ? 40 GLY A C    17 
ATOM   11507 O O    . GLY A 1 23 ? 5.116  19.489 0.524   1.00 0.00 ? 40 GLY A O    17 
ATOM   11508 H H    . GLY A 1 23 ? 1.208  19.118 1.648   1.00 0.00 ? 40 GLY A H    17 
ATOM   11509 H HA2  . GLY A 1 23 ? 2.396  20.570 0.104   1.00 0.00 ? 40 GLY A HA2  17 
ATOM   11510 H HA3  . GLY A 1 23 ? 3.410  21.126 1.455   1.00 0.00 ? 40 GLY A HA3  17 
ATOM   11511 N N    . THR A 1 24 ? 3.475  17.951 0.586   1.00 0.00 ? 41 THR A N    17 
ATOM   11512 C CA   . THR A 1 24 ? 4.346  16.843 0.216   1.00 0.00 ? 41 THR A CA   17 
ATOM   11513 C C    . THR A 1 24 ? 3.900  16.203 -1.092  1.00 0.00 ? 41 THR A C    17 
ATOM   11514 O O    . THR A 1 24 ? 2.734  15.838 -1.249  1.00 0.00 ? 41 THR A O    17 
ATOM   11515 C CB   . THR A 1 24 ? 4.386  15.765 1.315   1.00 0.00 ? 41 THR A CB   17 
ATOM   11516 O OG1  . THR A 1 24 ? 4.873  16.340 2.535   1.00 0.00 ? 41 THR A OG1  17 
ATOM   11517 C CG2  . THR A 1 24 ? 5.294  14.616 0.904   1.00 0.00 ? 41 THR A CG2  17 
ATOM   11518 H H    . THR A 1 24 ? 2.498  17.771 0.769   1.00 0.00 ? 41 THR A H    17 
ATOM   11519 H HA   . THR A 1 24 ? 5.360  17.209 0.050   1.00 0.00 ? 41 THR A HA   17 
ATOM   11520 H HB   . THR A 1 24 ? 3.377  15.389 1.479   1.00 0.00 ? 41 THR A HB   17 
ATOM   11521 H HG1  . THR A 1 24 ? 4.132  16.539 3.113   1.00 0.00 ? 41 THR A HG1  17 
ATOM   11522 H HG21 . THR A 1 24 ? 6.303  14.991 0.740   1.00 0.00 ? 41 THR A HG21 17 
ATOM   11523 H HG22 . THR A 1 24 ? 5.309  13.865 1.693   1.00 0.00 ? 41 THR A HG22 17 
ATOM   11524 H HG23 . THR A 1 24 ? 4.919  14.169 -0.017  1.00 0.00 ? 41 THR A HG23 17 
ATOM   11525 N N    . LEU A 1 25 ? 4.833  16.068 -2.028  1.00 0.00 ? 42 LEU A N    17 
ATOM   11526 C CA   . LEU A 1 25 ? 4.545  15.440 -3.313  1.00 0.00 ? 42 LEU A CA   17 
ATOM   11527 C C    . LEU A 1 25 ? 4.434  13.928 -3.174  1.00 0.00 ? 42 LEU A C    17 
ATOM   11528 O O    . LEU A 1 25 ? 5.158  13.312 -2.391  1.00 0.00 ? 42 LEU A O    17 
ATOM   11529 C CB   . LEU A 1 25 ? 5.628  15.804 -4.335  1.00 0.00 ? 42 LEU A CB   17 
ATOM   11530 C CG   . LEU A 1 25 ? 5.237  15.596 -5.803  1.00 0.00 ? 42 LEU A CG   17 
ATOM   11531 C CD1  . LEU A 1 25 ? 4.051  16.482 -6.159  1.00 0.00 ? 42 LEU A CD1  17 
ATOM   11532 C CD2  . LEU A 1 25 ? 6.429  15.906 -6.696  1.00 0.00 ? 42 LEU A CD2  17 
ATOM   11533 H H    . LEU A 1 25 ? 5.765  16.410 -1.846  1.00 0.00 ? 42 LEU A H    17 
ATOM   11534 H HA   . LEU A 1 25 ? 3.580  15.789 -3.681  1.00 0.00 ? 42 LEU A HA   17 
ATOM   11535 H HB2  . LEU A 1 25 ? 5.724  16.868 -4.122  1.00 0.00 ? 42 LEU A HB2  17 
ATOM   11536 H HB3  . LEU A 1 25 ? 6.572  15.304 -4.117  1.00 0.00 ? 42 LEU A HB3  17 
ATOM   11537 H HG   . LEU A 1 25 ? 4.994  14.539 -5.926  1.00 0.00 ? 42 LEU A HG   17 
ATOM   11538 H HD11 . LEU A 1 25 ? 3.780  16.326 -7.203  1.00 0.00 ? 42 LEU A HD11 17 
ATOM   11539 H HD12 . LEU A 1 25 ? 3.203  16.226 -5.523  1.00 0.00 ? 42 LEU A HD12 17 
ATOM   11540 H HD13 . LEU A 1 25 ? 4.319  17.526 -6.006  1.00 0.00 ? 42 LEU A HD13 17 
ATOM   11541 H HD21 . LEU A 1 25 ? 7.257  15.242 -6.444  1.00 0.00 ? 42 LEU A HD21 17 
ATOM   11542 H HD22 . LEU A 1 25 ? 6.150  15.756 -7.740  1.00 0.00 ? 42 LEU A HD22 17 
ATOM   11543 H HD23 . LEU A 1 25 ? 6.736  16.941 -6.547  1.00 0.00 ? 42 LEU A HD23 17 
ATOM   11544 N N    . PHE A 1 26 ? 3.523  13.334 -3.936  1.00 0.00 ? 43 PHE A N    17 
ATOM   11545 C CA   . PHE A 1 26 ? 3.401  11.882 -3.996  1.00 0.00 ? 43 PHE A CA   17 
ATOM   11546 C C    . PHE A 1 26 ? 2.850  11.430 -5.342  1.00 0.00 ? 43 PHE A C    17 
ATOM   11547 O O    . PHE A 1 26 ? 2.315  12.233 -6.106  1.00 0.00 ? 43 PHE A O    17 
ATOM   11548 C CB   . PHE A 1 26 ? 2.506  11.374 -2.863  1.00 0.00 ? 43 PHE A CB   17 
ATOM   11549 C CG   . PHE A 1 26 ? 1.059  11.741 -3.023  1.00 0.00 ? 43 PHE A CG   17 
ATOM   11550 C CD1  . PHE A 1 26 ? 0.586  12.967 -2.582  1.00 0.00 ? 43 PHE A CD1  17 
ATOM   11551 C CD2  . PHE A 1 26 ? 0.167  10.860 -3.619  1.00 0.00 ? 43 PHE A CD2  17 
ATOM   11552 C CE1  . PHE A 1 26 ? -0.746 13.306 -2.727  1.00 0.00 ? 43 PHE A CE1  17 
ATOM   11553 C CE2  . PHE A 1 26 ? -1.165 11.198 -3.766  1.00 0.00 ? 43 PHE A CE2  17 
ATOM   11554 C CZ   . PHE A 1 26 ? -1.621 12.419 -3.320  1.00 0.00 ? 43 PHE A CZ   17 
ATOM   11555 H H    . PHE A 1 26 ? 2.898  13.902 -4.490  1.00 0.00 ? 43 PHE A H    17 
ATOM   11556 H HA   . PHE A 1 26 ? 4.386  11.424 -3.894  1.00 0.00 ? 43 PHE A HA   17 
ATOM   11557 H HB2  . PHE A 1 26 ? 2.549  10.287 -2.810  1.00 0.00 ? 43 PHE A HB2  17 
ATOM   11558 H HB3  . PHE A 1 26 ? 2.831  11.795 -1.912  1.00 0.00 ? 43 PHE A HB3  17 
ATOM   11559 H HD1  . PHE A 1 26 ? 1.278  13.667 -2.112  1.00 0.00 ? 43 PHE A HD1  17 
ATOM   11560 H HD2  . PHE A 1 26 ? 0.527  9.894  -3.970  1.00 0.00 ? 43 PHE A HD2  17 
ATOM   11561 H HE1  . PHE A 1 26 ? -1.105 14.273 -2.374  1.00 0.00 ? 43 PHE A HE1  17 
ATOM   11562 H HE2  . PHE A 1 26 ? -1.855 10.496 -4.236  1.00 0.00 ? 43 PHE A HE2  17 
ATOM   11563 H HZ   . PHE A 1 26 ? -2.671 12.687 -3.438  1.00 0.00 ? 43 PHE A HZ   17 
ATOM   11564 N N    . SER A 1 27 ? 2.984  10.139 -5.626  1.00 0.00 ? 44 SER A N    17 
ATOM   11565 C CA   . SER A 1 27 ? 2.433  9.563  -6.847  1.00 0.00 ? 44 SER A CA   17 
ATOM   11566 C C    . SER A 1 27 ? 2.155  8.075  -6.677  1.00 0.00 ? 44 SER A C    17 
ATOM   11567 O O    . SER A 1 27 ? 2.939  7.353  -6.060  1.00 0.00 ? 44 SER A O    17 
ATOM   11568 C CB   . SER A 1 27 ? 3.381  9.794  -8.008  1.00 0.00 ? 44 SER A CB   17 
ATOM   11569 O OG   . SER A 1 27 ? 2.886  9.259  -9.205  1.00 0.00 ? 44 SER A OG   17 
ATOM   11570 H H    . SER A 1 27 ? 3.481  9.542  -4.981  1.00 0.00 ? 44 SER A H    17 
ATOM   11571 H HA   . SER A 1 27 ? 1.534  10.070 -7.198  1.00 0.00 ? 44 SER A HA   17 
ATOM   11572 H HB2  . SER A 1 27 ? 3.526  10.867 -8.131  1.00 0.00 ? 44 SER A HB2  17 
ATOM   11573 H HB3  . SER A 1 27 ? 4.336  9.323  -7.778  1.00 0.00 ? 44 SER A HB3  17 
ATOM   11574 H HG   . SER A 1 27 ? 2.047  9.674  -9.418  1.00 0.00 ? 44 SER A HG   17 
ATOM   11575 N N    . THR A 1 28 ? 1.033  7.621  -7.227  1.00 0.00 ? 45 THR A N    17 
ATOM   11576 C CA   . THR A 1 28 ? 0.661  6.213  -7.156  1.00 0.00 ? 45 THR A CA   17 
ATOM   11577 C C    . THR A 1 28 ? 0.744  5.552  -8.526  1.00 0.00 ? 45 THR A C    17 
ATOM   11578 O O    . THR A 1 28 ? 0.184  6.051  -9.501  1.00 0.00 ? 45 THR A O    17 
ATOM   11579 C CB   . THR A 1 28 ? -0.763 6.032  -6.596  1.00 0.00 ? 45 THR A CB   17 
ATOM   11580 O OG1  . THR A 1 28 ? -0.832 6.584  -5.275  1.00 0.00 ? 45 THR A OG1  17 
ATOM   11581 C CG2  . THR A 1 28 ? -1.134 4.559  -6.547  1.00 0.00 ? 45 THR A CG2  17 
ATOM   11582 H H    . THR A 1 28 ? 0.424  8.268  -7.706  1.00 0.00 ? 45 THR A H    17 
ATOM   11583 H HA   . THR A 1 28 ? 1.359  5.678  -6.512  1.00 0.00 ? 45 THR A HA   17 
ATOM   11584 H HB   . THR A 1 28 ? -1.466 6.563  -7.238  1.00 0.00 ? 45 THR A HB   17 
ATOM   11585 H HG1  . THR A 1 28 ? -0.618 7.519  -5.307  1.00 0.00 ? 45 THR A HG1  17 
ATOM   11586 H HG21 . THR A 1 28 ? -0.431 4.029  -5.904  1.00 0.00 ? 45 THR A HG21 17 
ATOM   11587 H HG22 . THR A 1 28 ? -2.142 4.451  -6.149  1.00 0.00 ? 45 THR A HG22 17 
ATOM   11588 H HG23 . THR A 1 28 ? -1.092 4.140  -7.552  1.00 0.00 ? 45 THR A HG23 17 
HETATM 11589 N N    . TPO A 1 29 ? 1.446  4.426  -8.592  1.00 0.00 ? 46 TPO A N    17 
HETATM 11590 C CA   . TPO A 1 29 ? 1.664  3.731  -9.855  1.00 0.00 ? 46 TPO A CA   17 
HETATM 11591 C CB   . TPO A 1 29 ? 2.965  2.910  -9.831  1.00 0.00 ? 46 TPO A CB   17 
HETATM 11592 C CG2  . TPO A 1 29 ? 4.131  3.770  -9.368  1.00 0.00 ? 46 TPO A CG2  17 
HETATM 11593 O OG1  . TPO A 1 29 ? 2.815  1.795  -8.942  1.00 0.00 ? 46 TPO A OG1  17 
HETATM 11594 P P    . TPO A 1 29 ? 3.738  0.484  -9.108  1.00 0.00 ? 46 TPO A P    17 
HETATM 11595 O O1P  . TPO A 1 29 ? 3.321  -0.517 -7.999  1.00 0.00 ? 46 TPO A O1P  17 
HETATM 11596 O O2P  . TPO A 1 29 ? 5.214  0.933  -8.946  1.00 0.00 ? 46 TPO A O2P  17 
HETATM 11597 O O3P  . TPO A 1 29 ? 3.470  -0.091 -10.524 1.00 0.00 ? 46 TPO A O3P  17 
HETATM 11598 C C    . TPO A 1 29 ? 0.498  2.806  -10.182 1.00 0.00 ? 46 TPO A C    17 
HETATM 11599 O O    . TPO A 1 29 ? -0.316 2.487  -9.316  1.00 0.00 ? 46 TPO A O    17 
HETATM 11600 H H    . TPO A 1 29 ? 1.839  4.041  -7.745  1.00 0.00 ? 46 TPO A H    17 
HETATM 11601 H HA   . TPO A 1 29 ? 1.721  4.455  -10.668 1.00 0.00 ? 46 TPO A HA   17 
HETATM 11602 H HB   . TPO A 1 29 ? 3.168  2.537  -10.835 1.00 0.00 ? 46 TPO A HB   17 
HETATM 11603 H HG21 . TPO A 1 29 ? 5.043  3.173  -9.358  1.00 0.00 ? 46 TPO A HG21 17 
HETATM 11604 H HG22 . TPO A 1 29 ? 4.255  4.612  -10.049 1.00 0.00 ? 46 TPO A HG22 17 
HETATM 11605 H HG23 . TPO A 1 29 ? 3.929  4.142  -8.363  1.00 0.00 ? 46 TPO A HG23 17 
ATOM   11606 N N    . PRO A 1 30 ? 0.424  2.380  -11.439 1.00 0.00 ? 47 PRO A N    17 
ATOM   11607 C CA   . PRO A 1 30 ? -0.682 1.549  -11.901 1.00 0.00 ? 47 PRO A CA   17 
ATOM   11608 C C    . PRO A 1 30 ? -0.804 0.279  -11.068 1.00 0.00 ? 47 PRO A C    17 
ATOM   11609 O O    . PRO A 1 30 ? -1.893 -0.274 -10.918 1.00 0.00 ? 47 PRO A O    17 
ATOM   11610 C CB   . PRO A 1 30 ? -0.338 1.248  -13.364 1.00 0.00 ? 47 PRO A CB   17 
ATOM   11611 C CG   . PRO A 1 30 ? 0.500  2.404  -13.794 1.00 0.00 ? 47 PRO A CG   17 
ATOM   11612 C CD   . PRO A 1 30 ? 1.316  2.776  -12.583 1.00 0.00 ? 47 PRO A CD   17 
ATOM   11613 H HA   . PRO A 1 30 ? -1.658 2.047  -11.804 1.00 0.00 ? 47 PRO A HA   17 
ATOM   11614 H HB2  . PRO A 1 30 ? 0.211  0.301  -13.463 1.00 0.00 ? 47 PRO A HB2  17 
ATOM   11615 H HB3  . PRO A 1 30 ? -1.245 1.163  -13.981 1.00 0.00 ? 47 PRO A HB3  17 
ATOM   11616 H HG2  . PRO A 1 30 ? 1.148  2.133  -14.639 1.00 0.00 ? 47 PRO A HG2  17 
ATOM   11617 H HG3  . PRO A 1 30 ? -0.125 3.247  -14.124 1.00 0.00 ? 47 PRO A HG3  17 
ATOM   11618 H HD2  . PRO A 1 30 ? 2.275  2.237  -12.547 1.00 0.00 ? 47 PRO A HD2  17 
ATOM   11619 H HD3  . PRO A 1 30 ? 1.550  3.851  -12.555 1.00 0.00 ? 47 PRO A HD3  17 
ATOM   11620 N N    . GLY A 1 31 ? 0.321  -0.178 -10.529 1.00 0.00 ? 48 GLY A N    17 
ATOM   11621 C CA   . GLY A 1 31 ? 0.344  -1.388 -9.716  1.00 0.00 ? 48 GLY A CA   17 
ATOM   11622 C C    . GLY A 1 31 ? -0.458 -1.205 -8.433  1.00 0.00 ? 48 GLY A C    17 
ATOM   11623 O O    . GLY A 1 31 ? -0.963 -2.171 -7.862  1.00 0.00 ? 48 GLY A O    17 
ATOM   11624 H H    . GLY A 1 31 ? 1.183  0.325  -10.687 1.00 0.00 ? 48 GLY A H    17 
ATOM   11625 H HA2  . GLY A 1 31 ? -0.086 -2.211 -10.288 1.00 0.00 ? 48 GLY A HA2  17 
ATOM   11626 H HA3  . GLY A 1 31 ? 1.375  -1.625 -9.459  1.00 0.00 ? 48 GLY A HA3  17 
ATOM   11627 N N    . GLY A 1 32 ? -0.572 0.041  -7.986  1.00 0.00 ? 49 GLY A N    17 
ATOM   11628 C CA   . GLY A 1 32 ? -1.368 0.362  -6.807  1.00 0.00 ? 49 GLY A CA   17 
ATOM   11629 C C    . GLY A 1 32 ? -0.480 0.735  -5.627  1.00 0.00 ? 49 GLY A C    17 
ATOM   11630 O O    . GLY A 1 32 ? -0.950 0.839  -4.494  1.00 0.00 ? 49 GLY A O    17 
ATOM   11631 H H    . GLY A 1 32 ? -0.094 0.785  -8.474  1.00 0.00 ? 49 GLY A H    17 
ATOM   11632 H HA2  . GLY A 1 32 ? -2.024 1.203  -7.039  1.00 0.00 ? 49 GLY A HA2  17 
ATOM   11633 H HA3  . GLY A 1 32 ? -1.971 -0.504 -6.538  1.00 0.00 ? 49 GLY A HA3  17 
ATOM   11634 N N    . THR A 1 33 ? 0.804  0.934  -5.899  1.00 0.00 ? 50 THR A N    17 
ATOM   11635 C CA   . THR A 1 33 ? 1.759  1.310  -4.863  1.00 0.00 ? 50 THR A CA   17 
ATOM   11636 C C    . THR A 1 33 ? 1.943  2.820  -4.806  1.00 0.00 ? 50 THR A C    17 
ATOM   11637 O O    . THR A 1 33 ? 2.247  3.457  -5.814  1.00 0.00 ? 50 THR A O    17 
ATOM   11638 C CB   . THR A 1 33 ? 3.129  0.644  -5.087  1.00 0.00 ? 50 THR A CB   17 
ATOM   11639 O OG1  . THR A 1 33 ? 2.974  -0.781 -5.104  1.00 0.00 ? 50 THR A OG1  17 
ATOM   11640 C CG2  . THR A 1 33 ? 4.098  1.031  -3.981  1.00 0.00 ? 50 THR A CG2  17 
ATOM   11641 H H    . THR A 1 33 ? 1.129  0.821  -6.850  1.00 0.00 ? 50 THR A H    17 
ATOM   11642 H HA   . THR A 1 33 ? 1.380  1.008  -3.886  1.00 0.00 ? 50 THR A HA   17 
ATOM   11643 H HB   . THR A 1 33 ? 3.527  0.968  -6.048  1.00 0.00 ? 50 THR A HB   17 
ATOM   11644 H HG1  . THR A 1 33 ? 2.960  -1.090 -6.013  1.00 0.00 ? 50 THR A HG1  17 
ATOM   11645 H HG21 . THR A 1 33 ? 3.701  0.706  -3.020  1.00 0.00 ? 50 THR A HG21 17 
ATOM   11646 H HG22 . THR A 1 33 ? 5.061  0.552  -4.157  1.00 0.00 ? 50 THR A HG22 17 
ATOM   11647 H HG23 . THR A 1 33 ? 4.226  2.113  -3.973  1.00 0.00 ? 50 THR A HG23 17 
ATOM   11648 N N    . ARG A 1 34 ? 1.756  3.390  -3.620  1.00 0.00 ? 51 ARG A N    17 
ATOM   11649 C CA   . ARG A 1 34 ? 1.931  4.824  -3.422  1.00 0.00 ? 51 ARG A CA   17 
ATOM   11650 C C    . ARG A 1 34 ? 3.368  5.155  -3.039  1.00 0.00 ? 51 ARG A C    17 
ATOM   11651 O O    . ARG A 1 34 ? 3.934  4.549  -2.130  1.00 0.00 ? 51 ARG A O    17 
ATOM   11652 C CB   . ARG A 1 34 ? 0.941  5.389  -2.415  1.00 0.00 ? 51 ARG A CB   17 
ATOM   11653 C CG   . ARG A 1 34 ? 1.106  6.872  -2.121  1.00 0.00 ? 51 ARG A CG   17 
ATOM   11654 C CD   . ARG A 1 34 ? 0.128  7.414  -1.142  1.00 0.00 ? 51 ARG A CD   17 
ATOM   11655 N NE   . ARG A 1 34 ? 0.338  8.809  -0.790  1.00 0.00 ? 51 ARG A NE   17 
ATOM   11656 C CZ   . ARG A 1 34 ? -0.363 9.476  0.147   1.00 0.00 ? 51 ARG A CZ   17 
ATOM   11657 N NH1  . ARG A 1 34 ? -1.342 8.893  0.803   1.00 0.00 ? 51 ARG A NH1  17 
ATOM   11658 N NH2  . ARG A 1 34 ? -0.056 10.741 0.375   1.00 0.00 ? 51 ARG A NH2  17 
ATOM   11659 H H    . ARG A 1 34 ? 1.486  2.814  -2.835  1.00 0.00 ? 51 ARG A H    17 
ATOM   11660 H HA   . ARG A 1 34 ? 1.729  5.353  -4.354  1.00 0.00 ? 51 ARG A HA   17 
ATOM   11661 H HB2  . ARG A 1 34 ? -0.056 5.211  -2.814  1.00 0.00 ? 51 ARG A HB2  17 
ATOM   11662 H HB3  . ARG A 1 34 ? 1.070  4.825  -1.492  1.00 0.00 ? 51 ARG A HB3  17 
ATOM   11663 H HG2  . ARG A 1 34 ? 2.107  7.038  -1.722  1.00 0.00 ? 51 ARG A HG2  17 
ATOM   11664 H HG3  . ARG A 1 34 ? 0.990  7.425  -3.054  1.00 0.00 ? 51 ARG A HG3  17 
ATOM   11665 H HD2  . ARG A 1 34 ? -0.875 7.329  -1.559  1.00 0.00 ? 51 ARG A HD2  17 
ATOM   11666 H HD3  . ARG A 1 34 ? 0.189  6.834  -0.222  1.00 0.00 ? 51 ARG A HD3  17 
ATOM   11667 H HE   . ARG A 1 34 ? 1.000  9.475  -1.164  1.00 0.00 ? 51 ARG A HE   17 
ATOM   11668 H HH11 . ARG A 1 34 ? -1.575 7.930  0.605   1.00 0.00 ? 51 ARG A HH11 17 
ATOM   11669 H HH12 . ARG A 1 34 ? -1.855 9.409  1.502   1.00 0.00 ? 51 ARG A HH12 17 
ATOM   11670 H HH21 . ARG A 1 34 ? 0.688  11.180 -0.151  1.00 0.00 ? 51 ARG A HH21 17 
ATOM   11671 H HH22 . ARG A 1 34 ? -0.566 11.264 1.071   1.00 0.00 ? 51 ARG A HH22 17 
ATOM   11672 N N    . ILE A 1 35 ? 3.954  6.123  -3.737  1.00 0.00 ? 52 ILE A N    17 
ATOM   11673 C CA   . ILE A 1 35 ? 5.296  6.592  -3.419  1.00 0.00 ? 52 ILE A CA   17 
ATOM   11674 C C    . ILE A 1 35 ? 5.275  8.042  -2.952  1.00 0.00 ? 52 ILE A C    17 
ATOM   11675 O O    . ILE A 1 35 ? 4.850  8.935  -3.686  1.00 0.00 ? 52 ILE A O    17 
ATOM   11676 C CB   . ILE A 1 35 ? 6.241  6.465  -4.627  1.00 0.00 ? 52 ILE A CB   17 
ATOM   11677 C CG1  . ILE A 1 35 ? 6.318  5.009  -5.094  1.00 0.00 ? 52 ILE A CG1  17 
ATOM   11678 C CG2  . ILE A 1 35 ? 7.626  6.988  -4.276  1.00 0.00 ? 52 ILE A CG2  17 
ATOM   11679 C CD1  . ILE A 1 35 ? 7.047  4.826  -6.405  1.00 0.00 ? 52 ILE A CD1  17 
ATOM   11680 H H    . ILE A 1 35 ? 3.455  6.542  -4.510  1.00 0.00 ? 52 ILE A H    17 
ATOM   11681 H HA   . ILE A 1 35 ? 5.708  6.037  -2.577  1.00 0.00 ? 52 ILE A HA   17 
ATOM   11682 H HB   . ILE A 1 35 ? 5.835  7.040  -5.458  1.00 0.00 ? 52 ILE A HB   17 
ATOM   11683 H HG12 . ILE A 1 35 ? 6.826  4.444  -4.314  1.00 0.00 ? 52 ILE A HG12 17 
ATOM   11684 H HG13 . ILE A 1 35 ? 5.294  4.648  -5.194  1.00 0.00 ? 52 ILE A HG13 17 
ATOM   11685 H HG21 . ILE A 1 35 ? 8.282  6.889  -5.141  1.00 0.00 ? 52 ILE A HG21 17 
ATOM   11686 H HG22 . ILE A 1 35 ? 7.558  8.036  -3.991  1.00 0.00 ? 52 ILE A HG22 17 
ATOM   11687 H HG23 . ILE A 1 35 ? 8.033  6.411  -3.446  1.00 0.00 ? 52 ILE A HG23 17 
ATOM   11688 H HD11 . ILE A 1 35 ? 8.070  5.185  -6.307  1.00 0.00 ? 52 ILE A HD11 17 
ATOM   11689 H HD12 . ILE A 1 35 ? 7.059  3.768  -6.671  1.00 0.00 ? 52 ILE A HD12 17 
ATOM   11690 H HD13 . ILE A 1 35 ? 6.537  5.389  -7.188  1.00 0.00 ? 52 ILE A HD13 17 
ATOM   11691 N N    . ILE A 1 36 ? 5.737  8.271  -1.728  1.00 0.00 ? 53 ILE A N    17 
ATOM   11692 C CA   . ILE A 1 36 ? 5.778  9.615  -1.163  1.00 0.00 ? 53 ILE A CA   17 
ATOM   11693 C C    . ILE A 1 36 ? 7.144  10.257 -1.370  1.00 0.00 ? 53 ILE A C    17 
ATOM   11694 O O    . ILE A 1 36 ? 8.178  9.614  -1.189  1.00 0.00 ? 53 ILE A O    17 
ATOM   11695 C CB   . ILE A 1 36 ? 5.448  9.606  0.340   1.00 0.00 ? 53 ILE A CB   17 
ATOM   11696 C CG1  . ILE A 1 36 ? 4.019  9.107  0.570   1.00 0.00 ? 53 ILE A CG1  17 
ATOM   11697 C CG2  . ILE A 1 36 ? 5.630  10.996 0.933   1.00 0.00 ? 53 ILE A CG2  17 
ATOM   11698 C CD1  . ILE A 1 36 ? 3.697  8.822  2.019   1.00 0.00 ? 53 ILE A CD1  17 
ATOM   11699 H H    . ILE A 1 36 ? 6.068  7.495  -1.173  1.00 0.00 ? 53 ILE A H    17 
ATOM   11700 H HA   . ILE A 1 36 ? 5.082  10.272 -1.684  1.00 0.00 ? 53 ILE A HA   17 
ATOM   11701 H HB   . ILE A 1 36 ? 6.111  8.906  0.846   1.00 0.00 ? 53 ILE A HB   17 
ATOM   11702 H HG12 . ILE A 1 36 ? 3.342  9.872  0.191   1.00 0.00 ? 53 ILE A HG12 17 
ATOM   11703 H HG13 . ILE A 1 36 ? 3.897  8.195  -0.015  1.00 0.00 ? 53 ILE A HG13 17 
ATOM   11704 H HG21 . ILE A 1 36 ? 5.392  10.973 1.996   1.00 0.00 ? 53 ILE A HG21 17 
ATOM   11705 H HG22 . ILE A 1 36 ? 6.664  11.315 0.800   1.00 0.00 ? 53 ILE A HG22 17 
ATOM   11706 H HG23 . ILE A 1 36 ? 4.967  11.698 0.428   1.00 0.00 ? 53 ILE A HG23 17 
ATOM   11707 H HD11 . ILE A 1 36 ? 3.817  9.732  2.605   1.00 0.00 ? 53 ILE A HD11 17 
ATOM   11708 H HD12 . ILE A 1 36 ? 2.668  8.472  2.102   1.00 0.00 ? 53 ILE A HD12 17 
ATOM   11709 H HD13 . ILE A 1 36 ? 4.372  8.055  2.399   1.00 0.00 ? 53 ILE A HD13 17 
ATOM   11710 N N    . TYR A 1 37 ? 7.142  11.531 -1.750  1.00 0.00 ? 54 TYR A N    17 
ATOM   11711 C CA   . TYR A 1 37 ? 8.375  12.231 -2.092  1.00 0.00 ? 54 TYR A CA   17 
ATOM   11712 C C    . TYR A 1 37 ? 8.658  13.359 -1.109  1.00 0.00 ? 54 TYR A C    17 
ATOM   11713 O O    . TYR A 1 37 ? 8.152  14.471 -1.264  1.00 0.00 ? 54 TYR A O    17 
ATOM   11714 C CB   . TYR A 1 37 ? 8.301  12.782 -3.517  1.00 0.00 ? 54 TYR A CB   17 
ATOM   11715 C CG   . TYR A 1 37 ? 7.993  11.735 -4.564  1.00 0.00 ? 54 TYR A CG   17 
ATOM   11716 C CD1  . TYR A 1 37 ? 8.950  10.803 -4.940  1.00 0.00 ? 54 TYR A CD1  17 
ATOM   11717 C CD2  . TYR A 1 37 ? 6.749  11.681 -5.176  1.00 0.00 ? 54 TYR A CD2  17 
ATOM   11718 C CE1  . TYR A 1 37 ? 8.676  9.845  -5.896  1.00 0.00 ? 54 TYR A CE1  17 
ATOM   11719 C CE2  . TYR A 1 37 ? 6.463  10.726 -6.132  1.00 0.00 ? 54 TYR A CE2  17 
ATOM   11720 C CZ   . TYR A 1 37 ? 7.431  9.809  -6.490  1.00 0.00 ? 54 TYR A CZ   17 
ATOM   11721 O OH   . TYR A 1 37 ? 7.152  8.856  -7.444  1.00 0.00 ? 54 TYR A OH   17 
ATOM   11722 H H    . TYR A 1 37 ? 6.263  12.026 -1.804  1.00 0.00 ? 54 TYR A H    17 
ATOM   11723 H HA   . TYR A 1 37 ? 9.220  11.544 -2.027  1.00 0.00 ? 54 TYR A HA   17 
ATOM   11724 H HB2  . TYR A 1 37 ? 7.521  13.546 -3.528  1.00 0.00 ? 54 TYR A HB2  17 
ATOM   11725 H HB3  . TYR A 1 37 ? 9.264  13.242 -3.735  1.00 0.00 ? 54 TYR A HB3  17 
ATOM   11726 H HD1  . TYR A 1 37 ? 9.931  10.836 -4.467  1.00 0.00 ? 54 TYR A HD1  17 
ATOM   11727 H HD2  . TYR A 1 37 ? 5.990  12.409 -4.888  1.00 0.00 ? 54 TYR A HD2  17 
ATOM   11728 H HE1  . TYR A 1 37 ? 9.441  9.120  -6.177  1.00 0.00 ? 54 TYR A HE1  17 
ATOM   11729 H HE2  . TYR A 1 37 ? 5.481  10.695 -6.604  1.00 0.00 ? 54 TYR A HE2  17 
ATOM   11730 H HH   . TYR A 1 37 ? 7.894  8.271  -7.617  1.00 0.00 ? 54 TYR A HH   17 
ATOM   11731 N N    . ASP A 1 38 ? 9.468  13.068 -0.098  1.00 0.00 ? 55 ASP A N    17 
ATOM   11732 C CA   . ASP A 1 38 ? 9.800  14.051 0.927   1.00 0.00 ? 55 ASP A CA   17 
ATOM   11733 C C    . ASP A 1 38 ? 10.865 15.021 0.434   1.00 0.00 ? 55 ASP A C    17 
ATOM   11734 O O    . ASP A 1 38 ? 12.020 14.644 0.240   1.00 0.00 ? 55 ASP A O    17 
ATOM   11735 C CB   . ASP A 1 38 ? 10.273 13.355 2.206   1.00 0.00 ? 55 ASP A CB   17 
ATOM   11736 C CG   . ASP A 1 38 ? 10.573 14.299 3.362   1.00 0.00 ? 55 ASP A CG   17 
ATOM   11737 O OD1  . ASP A 1 38 ? 10.520 15.489 3.160   1.00 0.00 ? 55 ASP A OD1  17 
ATOM   11738 O OD2  . ASP A 1 38 ? 10.698 13.830 4.468   1.00 0.00 ? 55 ASP A OD2  17 
ATOM   11739 H H    . ASP A 1 38 ? 9.865  12.141 -0.036  1.00 0.00 ? 55 ASP A H    17 
ATOM   11740 H HA   . ASP A 1 38 ? 8.919  14.649 1.162   1.00 0.00 ? 55 ASP A HA   17 
ATOM   11741 H HB2  . ASP A 1 38 ? 9.600  12.566 2.546   1.00 0.00 ? 55 ASP A HB2  17 
ATOM   11742 H HB3  . ASP A 1 38 ? 11.203 12.911 1.849   1.00 0.00 ? 55 ASP A HB3  17 
ATOM   11743 N N    . ARG A 1 39 ? 10.469 16.275 0.234   1.00 0.00 ? 56 ARG A N    17 
ATOM   11744 C CA   . ARG A 1 39 ? 11.390 17.302 -0.235  1.00 0.00 ? 56 ARG A CA   17 
ATOM   11745 C C    . ARG A 1 39 ? 12.533 17.510 0.749   1.00 0.00 ? 56 ARG A C    17 
ATOM   11746 O O    . ARG A 1 39 ? 12.308 17.773 1.931   1.00 0.00 ? 56 ARG A O    17 
ATOM   11747 C CB   . ARG A 1 39 ? 10.679 18.612 -0.547  1.00 0.00 ? 56 ARG A CB   17 
ATOM   11748 C CG   . ARG A 1 39 ? 9.804  18.584 -1.790  1.00 0.00 ? 56 ARG A CG   17 
ATOM   11749 C CD   . ARG A 1 39 ? 9.215  19.898 -2.154  1.00 0.00 ? 56 ARG A CD   17 
ATOM   11750 N NE   . ARG A 1 39 ? 8.086  20.300 -1.332  1.00 0.00 ? 56 ARG A NE   17 
ATOM   11751 C CZ   . ARG A 1 39 ? 7.583  21.550 -1.282  1.00 0.00 ? 56 ARG A CZ   17 
ATOM   11752 N NH1  . ARG A 1 39 ? 8.127  22.527 -1.971  1.00 0.00 ? 56 ARG A NH1  17 
ATOM   11753 N NH2  . ARG A 1 39 ? 6.540  21.771 -0.500  1.00 0.00 ? 56 ARG A NH2  17 
ATOM   11754 H H    . ARG A 1 39 ? 9.506  16.520 0.412   1.00 0.00 ? 56 ARG A H    17 
ATOM   11755 H HA   . ARG A 1 39 ? 11.845 16.990 -1.176  1.00 0.00 ? 56 ARG A HA   17 
ATOM   11756 H HB2  . ARG A 1 39 ? 10.065 18.853 0.319   1.00 0.00 ? 56 ARG A HB2  17 
ATOM   11757 H HB3  . ARG A 1 39 ? 11.451 19.372 -0.668  1.00 0.00 ? 56 ARG A HB3  17 
ATOM   11758 H HG2  . ARG A 1 39 ? 10.407 18.242 -2.631  1.00 0.00 ? 56 ARG A HG2  17 
ATOM   11759 H HG3  . ARG A 1 39 ? 8.986  17.883 -1.621  1.00 0.00 ? 56 ARG A HG3  17 
ATOM   11760 H HD2  . ARG A 1 39 ? 9.980  20.668 -2.055  1.00 0.00 ? 56 ARG A HD2  17 
ATOM   11761 H HD3  . ARG A 1 39 ? 8.871  19.858 -3.186  1.00 0.00 ? 56 ARG A HD3  17 
ATOM   11762 H HE   . ARG A 1 39 ? 7.520  19.750 -0.700  1.00 0.00 ? 56 ARG A HE   17 
ATOM   11763 H HH11 . ARG A 1 39 ? 8.934  22.345 -2.550  1.00 0.00 ? 56 ARG A HH11 17 
ATOM   11764 H HH12 . ARG A 1 39 ? 7.736  23.457 -1.920  1.00 0.00 ? 56 ARG A HH12 17 
ATOM   11765 H HH21 . ARG A 1 39 ? 6.145  21.012 0.038   1.00 0.00 ? 56 ARG A HH21 17 
ATOM   11766 H HH22 . ARG A 1 39 ? 6.145  22.698 -0.442  1.00 0.00 ? 56 ARG A HH22 17 
ATOM   11767 N N    . LYS A 1 40 ? 13.761 17.389 0.257   1.00 0.00 ? 57 LYS A N    17 
ATOM   11768 C CA   . LYS A 1 40 ? 14.942 17.656 1.070   1.00 0.00 ? 57 LYS A CA   17 
ATOM   11769 C C    . LYS A 1 40 ? 14.887 19.050 1.681   1.00 0.00 ? 57 LYS A C    17 
ATOM   11770 O O    . LYS A 1 40 ? 15.244 19.243 2.844   1.00 0.00 ? 57 LYS A O    17 
ATOM   11771 C CB   . LYS A 1 40 ? 16.214 17.498 0.235   1.00 0.00 ? 57 LYS A CB   17 
ATOM   11772 C CG   . LYS A 1 40 ? 17.506 17.748 1.001   1.00 0.00 ? 57 LYS A CG   17 
ATOM   11773 C CD   . LYS A 1 40 ? 18.725 17.529 0.119   1.00 0.00 ? 57 LYS A CD   17 
ATOM   11774 C CE   . LYS A 1 40 ? 20.014 17.820 0.873   1.00 0.00 ? 57 LYS A CE   17 
ATOM   11775 N NZ   . LYS A 1 40 ? 21.216 17.605 0.021   1.00 0.00 ? 57 LYS A NZ   17 
ATOM   11776 H H    . LYS A 1 40 ? 13.880 17.106 -0.705  1.00 0.00 ? 57 LYS A H    17 
ATOM   11777 H HA   . LYS A 1 40 ? 14.983 16.953 1.903   1.00 0.00 ? 57 LYS A HA   17 
ATOM   11778 H HB2  . LYS A 1 40 ? 16.216 16.479 -0.155  1.00 0.00 ? 57 LYS A HB2  17 
ATOM   11779 H HB3  . LYS A 1 40 ? 16.143 18.202 -0.594  1.00 0.00 ? 57 LYS A HB3  17 
ATOM   11780 H HG2  . LYS A 1 40 ? 17.499 18.777 1.365   1.00 0.00 ? 57 LYS A HG2  17 
ATOM   11781 H HG3  . LYS A 1 40 ? 17.543 17.065 1.849   1.00 0.00 ? 57 LYS A HG3  17 
ATOM   11782 H HD2  . LYS A 1 40 ? 18.727 16.492 -0.219  1.00 0.00 ? 57 LYS A HD2  17 
ATOM   11783 H HD3  . LYS A 1 40 ? 18.652 18.191 -0.744  1.00 0.00 ? 57 LYS A HD3  17 
ATOM   11784 H HE2  . LYS A 1 40 ? 19.988 18.857 1.207   1.00 0.00 ? 57 LYS A HE2  17 
ATOM   11785 H HE3  . LYS A 1 40 ? 20.060 17.161 1.738   1.00 0.00 ? 57 LYS A HE3  17 
ATOM   11786 H HZ1  . LYS A 1 40 ? 21.174 18.217 -0.781  1.00 0.00 ? 57 LYS A HZ1  17 
ATOM   11787 H HZ2  . LYS A 1 40 ? 22.049 17.809 0.558   1.00 0.00 ? 57 LYS A HZ2  17 
ATOM   11788 H HZ3  . LYS A 1 40 ? 21.242 16.644 -0.289  1.00 0.00 ? 57 LYS A HZ3  17 
ATOM   11789 N N    . PHE A 1 41 ? 14.439 20.020 0.891   1.00 0.00 ? 58 PHE A N    17 
ATOM   11790 C CA   . PHE A 1 41 ? 14.323 21.396 1.358   1.00 0.00 ? 58 PHE A CA   17 
ATOM   11791 C C    . PHE A 1 41 ? 13.206 22.132 0.629   1.00 0.00 ? 58 PHE A C    17 
ATOM   11792 O O    . PHE A 1 41 ? 12.720 21.675 -0.405  1.00 0.00 ? 58 PHE A O    17 
ATOM   11793 C CB   . PHE A 1 41 ? 15.649 22.137 1.176   1.00 0.00 ? 58 PHE A CB   17 
ATOM   11794 C CG   . PHE A 1 41 ? 16.087 22.249 -0.257  1.00 0.00 ? 58 PHE A CG   17 
ATOM   11795 C CD1  . PHE A 1 41 ? 16.822 21.236 -0.855  1.00 0.00 ? 58 PHE A CD1  17 
ATOM   11796 C CD2  . PHE A 1 41 ? 15.765 23.369 -1.010  1.00 0.00 ? 58 PHE A CD2  17 
ATOM   11797 C CE1  . PHE A 1 41 ? 17.227 21.339 -2.170  1.00 0.00 ? 58 PHE A CE1  17 
ATOM   11798 C CE2  . PHE A 1 41 ? 16.168 23.473 -2.328  1.00 0.00 ? 58 PHE A CE2  17 
ATOM   11799 C CZ   . PHE A 1 41 ? 16.900 22.459 -2.909  1.00 0.00 ? 58 PHE A CZ   17 
ATOM   11800 H H    . PHE A 1 41 ? 14.173 19.798 -0.058  1.00 0.00 ? 58 PHE A H    17 
ATOM   11801 H HA   . PHE A 1 41 ? 14.061 21.407 2.418   1.00 0.00 ? 58 PHE A HA   17 
ATOM   11802 H HB2  . PHE A 1 41 ? 15.566 23.153 1.557   1.00 0.00 ? 58 PHE A HB2  17 
ATOM   11803 H HB3  . PHE A 1 41 ? 16.445 21.615 1.705   1.00 0.00 ? 58 PHE A HB3  17 
ATOM   11804 H HD1  . PHE A 1 41 ? 17.081 20.351 -0.272  1.00 0.00 ? 58 PHE A HD1  17 
ATOM   11805 H HD2  . PHE A 1 41 ? 15.188 24.171 -0.551  1.00 0.00 ? 58 PHE A HD2  17 
ATOM   11806 H HE1  . PHE A 1 41 ? 17.805 20.535 -2.629  1.00 0.00 ? 58 PHE A HE1  17 
ATOM   11807 H HE2  . PHE A 1 41 ? 15.908 24.358 -2.909  1.00 0.00 ? 58 PHE A HE2  17 
ATOM   11808 H HZ   . PHE A 1 41 ? 17.217 22.540 -3.947  1.00 0.00 ? 58 PHE A HZ   17 
ATOM   11809 N N    . LEU A 1 42 ? 12.804 23.275 1.174   1.00 0.00 ? 59 LEU A N    17 
ATOM   11810 C CA   . LEU A 1 42 ? 11.724 24.063 0.592   1.00 0.00 ? 59 LEU A CA   17 
ATOM   11811 C C    . LEU A 1 42 ? 12.107 24.591 -0.785  1.00 0.00 ? 59 LEU A C    17 
ATOM   11812 O O    . LEU A