data_2MY9
# 
_entry.id   2MY9 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_code 
_database_2.database_id 
RCSB104194   RCSB  
2MY9         PDB   
25448        BMRB  
D_1000104194 WWPDB 
# 
loop_
_pdbx_database_related.content_type 
_pdbx_database_related.db_id 
_pdbx_database_related.db_name 
_pdbx_database_related.details 
unspecified 2lkt  PDB  'Solution structure of N-terminal domain of human TIG3 in 2 M UREA' 
unspecified 25448 BMRB .                                                                   
# 
_pdbx_database_status.deposit_site                    BMRB 
_pdbx_database_status.entry_id                        2MY9 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2015-01-21 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  REL 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Wei, H.'  1 
'Wang, L.' 2 
'Xia, B.'  3 
# 
_citation.id                        primary 
_citation.title                     'Structural and functional characterization of tumor suppressors TIG3 and H-REV107.' 
_citation.journal_abbrev            'Febs Lett.' 
_citation.journal_volume            589 
_citation.page_first                1179 
_citation.page_last                 1186 
_citation.year                      2015 
_citation.journal_id_ASTM           FEBLAL 
_citation.country                   NE 
_citation.journal_id_ISSN           0014-5793 
_citation.journal_id_CSD            0165 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   25871522 
_citation.pdbx_database_id_DOI      10.1016/j.febslet.2015.04.002 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Wei, H.'  1 
primary 'Wang, L.' 2 
primary 'Ren, X.'  3 
primary 'Yu, W.'   4 
primary 'Lin, J.'  5 
primary 'Jin, C.'  6 
primary 'Xia, B.'  7 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'Retinoic acid receptor responder protein 3' 
_entity.formula_weight             14050.886 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    3.1.1.- 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'N-terminal domain (UNP residues 1-125)' 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
'HRAS-like suppressor 4, HRSL4, RAR-responsive protein TIG3, Retinoid-inducible gene 1 protein, Tazarotene-induced gene 3 protein' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MASPHQEPKPGDLIEIFRLGYEHWALYIGDGYVIHLAPPSEYPGAGSSSVFSVLSNSAEVKRERLEDVVGGCCYRVNNSL
DHEYQPRPVEVIISSAKEMVGQKMKYSIVSRNCEHFVTQLRYGKS
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MASPHQEPKPGDLIEIFRLGYEHWALYIGDGYVIHLAPPSEYPGAGSSSVFSVLSNSAEVKRERLEDVVGGCCYRVNNSL
DHEYQPRPVEVIISSAKEMVGQKMKYSIVSRNCEHFVTQLRYGKS
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ALA n 
1 3   SER n 
1 4   PRO n 
1 5   HIS n 
1 6   GLN n 
1 7   GLU n 
1 8   PRO n 
1 9   LYS n 
1 10  PRO n 
1 11  GLY n 
1 12  ASP n 
1 13  LEU n 
1 14  ILE n 
1 15  GLU n 
1 16  ILE n 
1 17  PHE n 
1 18  ARG n 
1 19  LEU n 
1 20  GLY n 
1 21  TYR n 
1 22  GLU n 
1 23  HIS n 
1 24  TRP n 
1 25  ALA n 
1 26  LEU n 
1 27  TYR n 
1 28  ILE n 
1 29  GLY n 
1 30  ASP n 
1 31  GLY n 
1 32  TYR n 
1 33  VAL n 
1 34  ILE n 
1 35  HIS n 
1 36  LEU n 
1 37  ALA n 
1 38  PRO n 
1 39  PRO n 
1 40  SER n 
1 41  GLU n 
1 42  TYR n 
1 43  PRO n 
1 44  GLY n 
1 45  ALA n 
1 46  GLY n 
1 47  SER n 
1 48  SER n 
1 49  SER n 
1 50  VAL n 
1 51  PHE n 
1 52  SER n 
1 53  VAL n 
1 54  LEU n 
1 55  SER n 
1 56  ASN n 
1 57  SER n 
1 58  ALA n 
1 59  GLU n 
1 60  VAL n 
1 61  LYS n 
1 62  ARG n 
1 63  GLU n 
1 64  ARG n 
1 65  LEU n 
1 66  GLU n 
1 67  ASP n 
1 68  VAL n 
1 69  VAL n 
1 70  GLY n 
1 71  GLY n 
1 72  CYS n 
1 73  CYS n 
1 74  TYR n 
1 75  ARG n 
1 76  VAL n 
1 77  ASN n 
1 78  ASN n 
1 79  SER n 
1 80  LEU n 
1 81  ASP n 
1 82  HIS n 
1 83  GLU n 
1 84  TYR n 
1 85  GLN n 
1 86  PRO n 
1 87  ARG n 
1 88  PRO n 
1 89  VAL n 
1 90  GLU n 
1 91  VAL n 
1 92  ILE n 
1 93  ILE n 
1 94  SER n 
1 95  SER n 
1 96  ALA n 
1 97  LYS n 
1 98  GLU n 
1 99  MET n 
1 100 VAL n 
1 101 GLY n 
1 102 GLN n 
1 103 LYS n 
1 104 MET n 
1 105 LYS n 
1 106 TYR n 
1 107 SER n 
1 108 ILE n 
1 109 VAL n 
1 110 SER n 
1 111 ARG n 
1 112 ASN n 
1 113 CYS n 
1 114 GLU n 
1 115 HIS n 
1 116 PHE n 
1 117 VAL n 
1 118 THR n 
1 119 GLN n 
1 120 LEU n 
1 121 ARG n 
1 122 TYR n 
1 123 GLY n 
1 124 LYS n 
1 125 SER n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'RARRES3, RIG1, TIG3' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               Rosetta 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               pET21a 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    HRSL4_HUMAN 
_struct_ref.pdbx_db_accession          Q9UL19 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MASPHQEPKPGDLIEIFRLGYEHWALYIGDGYVIHLAPPSEYPGAGSSSVFSVLSNSAEVKRERLEDVVGGCCYRVNNSL
DHEYQPRPVEVIISSAKEMVGQKMKYSIVSRNCEHFVTQLRYGKS
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2MY9 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 125 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q9UL19 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  125 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       125 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.type 
1 1 1 '2D 1H-15N HSQC'  
1 2 1 '2D 1H-13C HSQC'  
1 3 1 '3D CBCA(CO)NH'   
1 4 1 '3D HNCA'         
1 5 1 '3D HNCACB'       
1 6 1 '3D HBHA(CO)NH'   
1 7 1 '3D 1H-15N NOESY' 
1 8 1 '3D 1H-13C NOESY' 
1 9 1 '3D HCCH-COSY'    
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      100 
_pdbx_nmr_exptl_sample_conditions.pH                  7.0 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature         308 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_sample_details.contents         
'0.5 mM [U-13C; U-15N] TIG3N, 0.03% DSS, 20 mM DTT, 50 mM sodium chloride, 50 mM potassium chloride, 90% H2O/10% D2O' 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.solvent_system   '90% H2O/10% D2O' 
# 
loop_
_pdbx_nmr_spectrometer.field_strength 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.type 
800 Bruker Avance 1 'Bruker Avance' 
500 Bruker Avance 2 'Bruker Avance' 
600 Bruker Avance 3 'Bruker Avance' 
# 
_pdbx_nmr_refine.entry_id           2MY9 
_pdbx_nmr_refine.method             'DGSA-distance geometry simulated annealing' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy' 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.entry_id                                      2MY9 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.entry_id             2MY9 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.authors 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.ordinal 
'Case, Darden, Cheatham, III, Simmerling, Wang, Duke, Luo, ... and Kollman' refinement                  AMBER       9.0 1  
'Guntert, Mumenthaler and Wuthrich'                                         'structure solution'        CYANA       3.0 2  
'Guntert, Braun and Wuthrich'                                               'structure solution'        DYANA       3.0 3  
'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax'                         processing                  NMRDraw     ?   4  
'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax'                         processing                  NMRPipe     ?   5  
'Johnson, One Moon Scientific'                                              'data analysis'             NMRView     5   6  
'Laskowski and MacArthur'                                                   'data analysis'             ProcheckNMR ?   7  
'Cornilescu, Delaglio and Bax'                                              'geometry optimization'     TALOS       ?   8  
'Duggan, Legge, Dyson & Wright'                                             'chemical shift assignment' SANE        ?   9  
'Bruker Biospin'                                                            collection                  TOPSPIN     3.0 10 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.entry_id                   2MY9 
_exptl.method                     'SOLUTION NMR' 
_exptl.method_details             ? 
# 
_struct.entry_id                  2MY9 
_struct.title                     'Solution structure of N-terminal domain of human TIG3' 
_struct.pdbx_descriptor           'Retinoic acid receptor responder protein 3 (E.C.3.1.1.-)' 
_struct.pdbx_model_details        'lowest energy, model1' 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2MY9 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'TIG3, H-REV107 family, NlpC/P60, phospholipase, HYDROLASE' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 GLU A 41  ? ALA A 45  ? GLU A 41  ALA A 45  5 ? 5  
HELX_P HELX_P2 2 LEU A 65  ? GLY A 70  ? LEU A 65  GLY A 70  1 ? 6  
HELX_P HELX_P3 3 ASN A 78  ? GLU A 83  ? ASN A 78  GLU A 83  5 ? 6  
HELX_P HELX_P4 4 PRO A 88  ? VAL A 100 ? PRO A 88  VAL A 100 1 ? 13 
HELX_P HELX_P5 5 TYR A 106 ? SER A 110 ? TYR A 106 SER A 110 5 ? 5  
HELX_P HELX_P6 6 ASN A 112 ? GLY A 123 ? ASN A 112 GLY A 123 1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   6 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 CYS A 73  ? VAL A 76  ? CYS A 73  VAL A 76  
A 2 LEU A 13  ? PHE A 17  ? LEU A 13  PHE A 17  
A 3 GLU A 22  ? GLY A 29  ? GLU A 22  GLY A 29  
A 4 TYR A 32  ? ALA A 37  ? TYR A 32  ALA A 37  
A 5 ALA A 58  ? ARG A 64  ? ALA A 58  ARG A 64  
A 6 LYS A 103 ? MET A 104 ? LYS A 103 MET A 104 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O ARG A 75 ? O ARG A 75 N GLU A 15  ? N GLU A 15  
A 2 3 N ILE A 16 ? N ILE A 16 O HIS A 23  ? O HIS A 23  
A 3 4 N LEU A 26 ? N LEU A 26 O ILE A 34  ? O ILE A 34  
A 4 5 N VAL A 33 ? N VAL A 33 O GLU A 63  ? O GLU A 63  
A 5 6 N ALA A 58 ? N ALA A 58 O MET A 104 ? O MET A 104 
# 
_atom_sites.entry_id                    2MY9 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . MET A 1 1   ? 17.531  14.159  12.237  1.00 1.00 ? 1   MET A N    1  
ATOM 2     C CA   . MET A 1 1   ? 16.343  13.291  11.967  1.00 1.00 ? 1   MET A CA   1  
ATOM 3     C C    . MET A 1 1   ? 16.050  13.176  10.461  1.00 1.00 ? 1   MET A C    1  
ATOM 4     O O    . MET A 1 1   ? 16.499  14.015  9.678   1.00 1.00 ? 1   MET A O    1  
ATOM 5     C CB   . MET A 1 1   ? 15.089  13.727  12.768  1.00 1.00 ? 1   MET A CB   1  
ATOM 6     C CG   . MET A 1 1   ? 14.476  15.077  12.349  1.00 1.00 ? 1   MET A CG   1  
ATOM 7     S SD   . MET A 1 1   ? 12.993  15.532  13.296  1.00 1.00 ? 1   MET A SD   1  
ATOM 8     C CE   . MET A 1 1   ? 12.582  17.104  12.488  1.00 1.00 ? 1   MET A CE   1  
ATOM 9     H H1   . MET A 1 1   ? 18.348  13.796  11.768  1.00 1.00 ? 1   MET A H1   1  
ATOM 10    H H2   . MET A 1 1   ? 17.380  15.100  11.902  1.00 1.00 ? 1   MET A H2   1  
ATOM 11    H H3   . MET A 1 1   ? 17.732  14.197  13.227  1.00 1.00 ? 1   MET A H3   1  
ATOM 12    H HA   . MET A 1 1   ? 16.591  12.282  12.310  1.00 1.00 ? 1   MET A HA   1  
ATOM 13    H HB2  . MET A 1 1   ? 14.319  12.960  12.661  1.00 1.00 ? 1   MET A HB2  1  
ATOM 14    H HB3  . MET A 1 1   ? 15.347  13.777  13.828  1.00 1.00 ? 1   MET A HB3  1  
ATOM 15    H HG2  . MET A 1 1   ? 15.213  15.870  12.483  1.00 1.00 ? 1   MET A HG2  1  
ATOM 16    H HG3  . MET A 1 1   ? 14.198  15.040  11.295  1.00 1.00 ? 1   MET A HG3  1  
ATOM 17    H HE1  . MET A 1 1   ? 11.686  17.525  12.946  1.00 1.00 ? 1   MET A HE1  1  
ATOM 18    H HE2  . MET A 1 1   ? 13.405  17.808  12.606  1.00 1.00 ? 1   MET A HE2  1  
ATOM 19    H HE3  . MET A 1 1   ? 12.395  16.936  11.428  1.00 1.00 ? 1   MET A HE3  1  
ATOM 20    N N    . ALA A 1 2   ? 15.285  12.157  10.051  1.00 1.00 ? 2   ALA A N    1  
ATOM 21    C CA   . ALA A 1 2   ? 14.831  11.971  8.665   1.00 1.00 ? 2   ALA A CA   1  
ATOM 22    C C    . ALA A 1 2   ? 13.689  12.941  8.284   1.00 1.00 ? 2   ALA A C    1  
ATOM 23    O O    . ALA A 1 2   ? 13.020  13.510  9.147   1.00 1.00 ? 2   ALA A O    1  
ATOM 24    C CB   . ALA A 1 2   ? 14.415  10.503  8.487   1.00 1.00 ? 2   ALA A CB   1  
ATOM 25    H H    . ALA A 1 2   ? 14.934  11.502  10.737  1.00 1.00 ? 2   ALA A H    1  
ATOM 26    H HA   . ALA A 1 2   ? 15.667  12.169  7.987   1.00 1.00 ? 2   ALA A HA   1  
ATOM 27    H HB1  . ALA A 1 2   ? 15.246  9.844   8.745   1.00 1.00 ? 2   ALA A HB1  1  
ATOM 28    H HB2  . ALA A 1 2   ? 13.559  10.271  9.127   1.00 1.00 ? 2   ALA A HB2  1  
ATOM 29    H HB3  . ALA A 1 2   ? 14.137  10.320  7.449   1.00 1.00 ? 2   ALA A HB3  1  
ATOM 30    N N    . SER A 1 3   ? 13.446  13.118  6.984   1.00 1.00 ? 3   SER A N    1  
ATOM 31    C CA   . SER A 1 3   ? 12.393  14.009  6.463   1.00 1.00 ? 3   SER A CA   1  
ATOM 32    C C    . SER A 1 3   ? 10.966  13.510  6.803   1.00 1.00 ? 3   SER A C    1  
ATOM 33    O O    . SER A 1 3   ? 10.722  12.294  6.760   1.00 1.00 ? 3   SER A O    1  
ATOM 34    C CB   . SER A 1 3   ? 12.535  14.160  4.939   1.00 1.00 ? 3   SER A CB   1  
ATOM 35    O OG   . SER A 1 3   ? 13.824  14.659  4.594   1.00 1.00 ? 3   SER A OG   1  
ATOM 36    H H    . SER A 1 3   ? 14.037  12.652  6.311   1.00 1.00 ? 3   SER A H    1  
ATOM 37    H HA   . SER A 1 3   ? 12.546  14.997  6.906   1.00 1.00 ? 3   SER A HA   1  
ATOM 38    H HB2  . SER A 1 3   ? 12.378  13.190  4.462   1.00 1.00 ? 3   SER A HB2  1  
ATOM 39    H HB3  . SER A 1 3   ? 11.772  14.855  4.580   1.00 1.00 ? 3   SER A HB3  1  
ATOM 40    H HG   . SER A 1 3   ? 13.885  14.761  3.619   1.00 1.00 ? 3   SER A HG   1  
ATOM 41    N N    . PRO A 1 4   ? 10.005  14.414  7.105   1.00 1.00 ? 4   PRO A N    1  
ATOM 42    C CA   . PRO A 1 4   ? 8.637   14.041  7.475   1.00 1.00 ? 4   PRO A CA   1  
ATOM 43    C C    . PRO A 1 4   ? 7.758   13.654  6.271   1.00 1.00 ? 4   PRO A C    1  
ATOM 44    O O    . PRO A 1 4   ? 6.755   12.964  6.450   1.00 1.00 ? 4   PRO A O    1  
ATOM 45    C CB   . PRO A 1 4   ? 8.074   15.276  8.190   1.00 1.00 ? 4   PRO A CB   1  
ATOM 46    C CG   . PRO A 1 4   ? 8.792   16.436  7.505   1.00 1.00 ? 4   PRO A CG   1  
ATOM 47    C CD   . PRO A 1 4   ? 10.182  15.856  7.239   1.00 1.00 ? 4   PRO A CD   1  
ATOM 48    H HA   . PRO A 1 4   ? 8.654   13.202  8.172   1.00 1.00 ? 4   PRO A HA   1  
ATOM 49    H HB2  . PRO A 1 4   ? 6.991   15.353  8.093   1.00 1.00 ? 4   PRO A HB2  1  
ATOM 50    H HB3  . PRO A 1 4   ? 8.358   15.243  9.243   1.00 1.00 ? 4   PRO A HB3  1  
ATOM 51    H HG2  . PRO A 1 4   ? 8.300   16.670  6.560   1.00 1.00 ? 4   PRO A HG2  1  
ATOM 52    H HG3  . PRO A 1 4   ? 8.839   17.320  8.141   1.00 1.00 ? 4   PRO A HG3  1  
ATOM 53    H HD2  . PRO A 1 4   ? 10.600  16.297  6.332   1.00 1.00 ? 4   PRO A HD2  1  
ATOM 54    H HD3  . PRO A 1 4   ? 10.831  16.065  8.093   1.00 1.00 ? 4   PRO A HD3  1  
ATOM 55    N N    . HIS A 1 5   ? 8.104   14.090  5.054   1.00 1.00 ? 5   HIS A N    1  
ATOM 56    C CA   . HIS A 1 5   ? 7.400   13.779  3.801   1.00 1.00 ? 5   HIS A CA   1  
ATOM 57    C C    . HIS A 1 5   ? 8.384   13.257  2.727   1.00 1.00 ? 5   HIS A C    1  
ATOM 58    O O    . HIS A 1 5   ? 9.600   13.458  2.828   1.00 1.00 ? 5   HIS A O    1  
ATOM 59    C CB   . HIS A 1 5   ? 6.685   15.052  3.298   1.00 1.00 ? 5   HIS A CB   1  
ATOM 60    C CG   . HIS A 1 5   ? 5.602   15.629  4.185   1.00 1.00 ? 5   HIS A CG   1  
ATOM 61    N ND1  . HIS A 1 5   ? 5.056   15.074  5.322   1.00 1.00 ? 5   HIS A ND1  1  
ATOM 62    C CD2  . HIS A 1 5   ? 4.955   16.819  3.978   1.00 1.00 ? 5   HIS A CD2  1  
ATOM 63    C CE1  . HIS A 1 5   ? 4.118   15.914  5.791   1.00 1.00 ? 5   HIS A CE1  1  
ATOM 64    N NE2  . HIS A 1 5   ? 4.010   16.998  4.998   1.00 1.00 ? 5   HIS A NE2  1  
ATOM 65    H H    . HIS A 1 5   ? 8.948   14.640  4.956   1.00 1.00 ? 5   HIS A H    1  
ATOM 66    H HA   . HIS A 1 5   ? 6.656   12.995  3.967   1.00 1.00 ? 5   HIS A HA   1  
ATOM 67    H HB2  . HIS A 1 5   ? 7.435   15.829  3.131   1.00 1.00 ? 5   HIS A HB2  1  
ATOM 68    H HB3  . HIS A 1 5   ? 6.226   14.838  2.331   1.00 1.00 ? 5   HIS A HB3  1  
ATOM 69    H HD1  . HIS A 1 5   ? 5.347   14.209  5.765   1.00 1.00 ? 5   HIS A HD1  1  
ATOM 70    H HD2  . HIS A 1 5   ? 5.147   17.499  3.156   1.00 1.00 ? 5   HIS A HD2  1  
ATOM 71    H HE1  . HIS A 1 5   ? 3.534   15.741  6.687   1.00 1.00 ? 5   HIS A HE1  1  
ATOM 72    N N    . GLN A 1 6   ? 7.865   12.610  1.674   1.00 1.00 ? 6   GLN A N    1  
ATOM 73    C CA   . GLN A 1 6   ? 8.658   12.184  0.512   1.00 1.00 ? 6   GLN A CA   1  
ATOM 74    C C    . GLN A 1 6   ? 8.925   13.360  -0.448  1.00 1.00 ? 6   GLN A C    1  
ATOM 75    O O    . GLN A 1 6   ? 8.156   14.322  -0.505  1.00 1.00 ? 6   GLN A O    1  
ATOM 76    C CB   . GLN A 1 6   ? 7.935   11.051  -0.245  1.00 1.00 ? 6   GLN A CB   1  
ATOM 77    C CG   . GLN A 1 6   ? 7.812   9.744   0.562   1.00 1.00 ? 6   GLN A CG   1  
ATOM 78    C CD   . GLN A 1 6   ? 7.190   8.595   -0.242  1.00 1.00 ? 6   GLN A CD   1  
ATOM 79    O OE1  . GLN A 1 6   ? 6.545   8.777   -1.268  1.00 1.00 ? 6   GLN A OE1  1  
ATOM 80    N NE2  . GLN A 1 6   ? 7.367   7.358   0.172   1.00 1.00 ? 6   GLN A NE2  1  
ATOM 81    H H    . GLN A 1 6   ? 6.861   12.496  1.618   1.00 1.00 ? 6   GLN A H    1  
ATOM 82    H HA   . GLN A 1 6   ? 9.628   11.814  0.853   1.00 1.00 ? 6   GLN A HA   1  
ATOM 83    H HB2  . GLN A 1 6   ? 6.937   11.389  -0.533  1.00 1.00 ? 6   GLN A HB2  1  
ATOM 84    H HB3  . GLN A 1 6   ? 8.491   10.831  -1.160  1.00 1.00 ? 6   GLN A HB3  1  
ATOM 85    H HG2  . GLN A 1 6   ? 8.807   9.438   0.893   1.00 1.00 ? 6   GLN A HG2  1  
ATOM 86    H HG3  . GLN A 1 6   ? 7.199   9.916   1.448   1.00 1.00 ? 6   GLN A HG3  1  
ATOM 87    H HE21 . GLN A 1 6   ? 7.893   7.162   1.012   1.00 1.00 ? 6   GLN A HE21 1  
ATOM 88    H HE22 . GLN A 1 6   ? 6.977   6.609   -0.379  1.00 1.00 ? 6   GLN A HE22 1  
ATOM 89    N N    . GLU A 1 7   ? 9.991   13.250  -1.250  1.00 1.00 ? 7   GLU A N    1  
ATOM 90    C CA   . GLU A 1 7   ? 10.291  14.151  -2.370  1.00 1.00 ? 7   GLU A CA   1  
ATOM 91    C C    . GLU A 1 7   ? 10.703  13.318  -3.604  1.00 1.00 ? 7   GLU A C    1  
ATOM 92    O O    . GLU A 1 7   ? 11.554  12.432  -3.468  1.00 1.00 ? 7   GLU A O    1  
ATOM 93    C CB   . GLU A 1 7   ? 11.413  15.126  -1.982  1.00 1.00 ? 7   GLU A CB   1  
ATOM 94    C CG   . GLU A 1 7   ? 11.694  16.174  -3.066  1.00 1.00 ? 7   GLU A CG   1  
ATOM 95    C CD   . GLU A 1 7   ? 12.937  16.999  -2.710  1.00 1.00 ? 7   GLU A CD   1  
ATOM 96    O OE1  . GLU A 1 7   ? 12.815  18.012  -1.982  1.00 1.00 ? 7   GLU A OE1  1  
ATOM 97    O OE2  . GLU A 1 7   ? 14.049  16.629  -3.163  1.00 1.00 ? 7   GLU A OE2  1  
ATOM 98    H H    . GLU A 1 7   ? 10.601  12.447  -1.151  1.00 1.00 ? 7   GLU A H    1  
ATOM 99    H HA   . GLU A 1 7   ? 9.403   14.740  -2.586  1.00 1.00 ? 7   GLU A HA   1  
ATOM 100   H HB2  . GLU A 1 7   ? 11.120  15.646  -1.069  1.00 1.00 ? 7   GLU A HB2  1  
ATOM 101   H HB3  . GLU A 1 7   ? 12.323  14.562  -1.787  1.00 1.00 ? 7   GLU A HB3  1  
ATOM 102   H HG2  . GLU A 1 7   ? 11.864  15.682  -4.024  1.00 1.00 ? 7   GLU A HG2  1  
ATOM 103   H HG3  . GLU A 1 7   ? 10.824  16.826  -3.168  1.00 1.00 ? 7   GLU A HG3  1  
ATOM 104   N N    . PRO A 1 8   ? 10.126  13.582  -4.794  1.00 1.00 ? 8   PRO A N    1  
ATOM 105   C CA   . PRO A 1 8   ? 10.415  12.841  -6.015  1.00 1.00 ? 8   PRO A CA   1  
ATOM 106   C C    . PRO A 1 8   ? 11.727  13.291  -6.670  1.00 1.00 ? 8   PRO A C    1  
ATOM 107   O O    . PRO A 1 8   ? 12.061  14.475  -6.698  1.00 1.00 ? 8   PRO A O    1  
ATOM 108   C CB   . PRO A 1 8   ? 9.214   13.089  -6.927  1.00 1.00 ? 8   PRO A CB   1  
ATOM 109   C CG   . PRO A 1 8   ? 8.781   14.501  -6.540  1.00 1.00 ? 8   PRO A CG   1  
ATOM 110   C CD   . PRO A 1 8   ? 9.059   14.544  -5.040  1.00 1.00 ? 8   PRO A CD   1  
ATOM 111   H HA   . PRO A 1 8   ? 10.477  11.778  -5.799  1.00 1.00 ? 8   PRO A HA   1  
ATOM 112   H HB2  . PRO A 1 8   ? 9.472   13.014  -7.983  1.00 1.00 ? 8   PRO A HB2  1  
ATOM 113   H HB3  . PRO A 1 8   ? 8.422   12.382  -6.677  1.00 1.00 ? 8   PRO A HB3  1  
ATOM 114   H HG2  . PRO A 1 8   ? 9.404   15.233  -7.054  1.00 1.00 ? 8   PRO A HG2  1  
ATOM 115   H HG3  . PRO A 1 8   ? 7.728   14.671  -6.755  1.00 1.00 ? 8   PRO A HG3  1  
ATOM 116   H HD2  . PRO A 1 8   ? 9.358   15.549  -4.737  1.00 1.00 ? 8   PRO A HD2  1  
ATOM 117   H HD3  . PRO A 1 8   ? 8.167   14.241  -4.491  1.00 1.00 ? 8   PRO A HD3  1  
ATOM 118   N N    . LYS A 1 9   ? 12.445  12.323  -7.242  1.00 1.00 ? 9   LYS A N    1  
ATOM 119   C CA   . LYS A 1 9   ? 13.671  12.492  -8.029  1.00 1.00 ? 9   LYS A CA   1  
ATOM 120   C C    . LYS A 1 9   ? 13.550  11.845  -9.430  1.00 1.00 ? 9   LYS A C    1  
ATOM 121   O O    . LYS A 1 9   ? 12.672  11.000  -9.637  1.00 1.00 ? 9   LYS A O    1  
ATOM 122   C CB   . LYS A 1 9   ? 14.845  11.874  -7.242  1.00 1.00 ? 9   LYS A CB   1  
ATOM 123   C CG   . LYS A 1 9   ? 15.277  12.686  -6.009  1.00 1.00 ? 9   LYS A CG   1  
ATOM 124   C CD   . LYS A 1 9   ? 15.713  14.122  -6.364  1.00 1.00 ? 9   LYS A CD   1  
ATOM 125   C CE   . LYS A 1 9   ? 16.658  14.737  -5.314  1.00 1.00 ? 9   LYS A CE   1  
ATOM 126   N NZ   . LYS A 1 9   ? 16.047  14.861  -3.961  1.00 1.00 ? 9   LYS A NZ   1  
ATOM 127   H H    . LYS A 1 9   ? 12.118  11.367  -7.123  1.00 1.00 ? 9   LYS A H    1  
ATOM 128   H HA   . LYS A 1 9   ? 13.844  13.556  -8.180  1.00 1.00 ? 9   LYS A HA   1  
ATOM 129   H HB2  . LYS A 1 9   ? 14.566  10.870  -6.918  1.00 1.00 ? 9   LYS A HB2  1  
ATOM 130   H HB3  . LYS A 1 9   ? 15.715  11.762  -7.890  1.00 1.00 ? 9   LYS A HB3  1  
ATOM 131   H HG2  . LYS A 1 9   ? 14.450  12.720  -5.295  1.00 1.00 ? 9   LYS A HG2  1  
ATOM 132   H HG3  . LYS A 1 9   ? 16.111  12.162  -5.542  1.00 1.00 ? 9   LYS A HG3  1  
ATOM 133   H HD2  . LYS A 1 9   ? 16.237  14.105  -7.323  1.00 1.00 ? 9   LYS A HD2  1  
ATOM 134   H HD3  . LYS A 1 9   ? 14.834  14.758  -6.485  1.00 1.00 ? 9   LYS A HD3  1  
ATOM 135   H HE2  . LYS A 1 9   ? 17.560  14.119  -5.256  1.00 1.00 ? 9   LYS A HE2  1  
ATOM 136   H HE3  . LYS A 1 9   ? 16.971  15.726  -5.663  1.00 1.00 ? 9   LYS A HE3  1  
ATOM 137   H HZ1  . LYS A 1 9   ? 15.724  13.968  -3.613  1.00 1.00 ? 9   LYS A HZ1  1  
ATOM 138   H HZ2  . LYS A 1 9   ? 16.721  15.217  -3.295  1.00 1.00 ? 9   LYS A HZ2  1  
ATOM 139   H HZ3  . LYS A 1 9   ? 15.259  15.511  -3.948  1.00 1.00 ? 9   LYS A HZ3  1  
ATOM 140   N N    . PRO A 1 10  ? 14.402  12.243  -10.406 1.00 1.00 ? 10  PRO A N    1  
ATOM 141   C CA   . PRO A 1 10  ? 14.390  11.715  -11.770 1.00 1.00 ? 10  PRO A CA   1  
ATOM 142   C C    . PRO A 1 10  ? 14.284  10.186  -11.814 1.00 1.00 ? 10  PRO A C    1  
ATOM 143   O O    . PRO A 1 10  ? 15.031  9.494   -11.124 1.00 1.00 ? 10  PRO A O    1  
ATOM 144   C CB   . PRO A 1 10  ? 15.677  12.233  -12.423 1.00 1.00 ? 10  PRO A CB   1  
ATOM 145   C CG   . PRO A 1 10  ? 15.880  13.575  -11.731 1.00 1.00 ? 10  PRO A CG   1  
ATOM 146   C CD   . PRO A 1 10  ? 15.422  13.285  -10.302 1.00 1.00 ? 10  PRO A CD   1  
ATOM 147   H HA   . PRO A 1 10  ? 13.546  12.162  -12.295 1.00 1.00 ? 10  PRO A HA   1  
ATOM 148   H HB2  . PRO A 1 10  ? 16.517  11.575  -12.193 1.00 1.00 ? 10  PRO A HB2  1  
ATOM 149   H HB3  . PRO A 1 10  ? 15.577  12.360  -13.498 1.00 1.00 ? 10  PRO A HB3  1  
ATOM 150   H HG2  . PRO A 1 10  ? 16.920  13.901  -11.771 1.00 1.00 ? 10  PRO A HG2  1  
ATOM 151   H HG3  . PRO A 1 10  ? 15.226  14.326  -12.183 1.00 1.00 ? 10  PRO A HG3  1  
ATOM 152   H HD2  . PRO A 1 10  ? 16.275  12.911  -9.733  1.00 1.00 ? 10  PRO A HD2  1  
ATOM 153   H HD3  . PRO A 1 10  ? 15.033  14.198  -9.855  1.00 1.00 ? 10  PRO A HD3  1  
ATOM 154   N N    . GLY A 1 11  ? 13.332  9.679   -12.608 1.00 1.00 ? 11  GLY A N    1  
ATOM 155   C CA   . GLY A 1 11  ? 13.061  8.249   -12.802 1.00 1.00 ? 11  GLY A CA   1  
ATOM 156   C C    . GLY A 1 11  ? 12.001  7.661   -11.868 1.00 1.00 ? 11  GLY A C    1  
ATOM 157   O O    . GLY A 1 11  ? 11.571  6.532   -12.105 1.00 1.00 ? 11  GLY A O    1  
ATOM 158   H H    . GLY A 1 11  ? 12.699  10.324  -13.072 1.00 1.00 ? 11  GLY A H    1  
ATOM 159   H HA2  . GLY A 1 11  ? 12.723  8.086   -13.826 1.00 1.00 ? 11  GLY A HA2  1  
ATOM 160   H HA3  . GLY A 1 11  ? 13.971  7.676   -12.628 1.00 1.00 ? 11  GLY A HA3  1  
ATOM 161   N N    . ASP A 1 12  ? 11.578  8.384   -10.828 1.00 1.00 ? 12  ASP A N    1  
ATOM 162   C CA   . ASP A 1 12  ? 10.607  7.891   -9.849  1.00 1.00 ? 12  ASP A CA   1  
ATOM 163   C C    . ASP A 1 12  ? 9.221   7.632   -10.458 1.00 1.00 ? 12  ASP A C    1  
ATOM 164   O O    . ASP A 1 12  ? 8.681   8.429   -11.231 1.00 1.00 ? 12  ASP A O    1  
ATOM 165   C CB   . ASP A 1 12  ? 10.497  8.839   -8.644  1.00 1.00 ? 12  ASP A CB   1  
ATOM 166   C CG   . ASP A 1 12  ? 11.674  8.740   -7.649  1.00 1.00 ? 12  ASP A CG   1  
ATOM 167   O OD1  . ASP A 1 12  ? 12.500  7.797   -7.735  1.00 1.00 ? 12  ASP A OD1  1  
ATOM 168   O OD2  . ASP A 1 12  ? 11.736  9.595   -6.736  1.00 1.00 ? 12  ASP A OD2  1  
ATOM 169   H H    . ASP A 1 12  ? 12.003  9.284   -10.653 1.00 1.00 ? 12  ASP A H    1  
ATOM 170   H HA   . ASP A 1 12  ? 10.974  6.934   -9.478  1.00 1.00 ? 12  ASP A HA   1  
ATOM 171   H HB2  . ASP A 1 12  ? 10.385  9.865   -9.001  1.00 1.00 ? 12  ASP A HB2  1  
ATOM 172   H HB3  . ASP A 1 12  ? 9.580   8.599   -8.106  1.00 1.00 ? 12  ASP A HB3  1  
ATOM 173   N N    . LEU A 1 13  ? 8.628   6.508   -10.053 1.00 1.00 ? 13  LEU A N    1  
ATOM 174   C CA   . LEU A 1 13  ? 7.247   6.149   -10.349 1.00 1.00 ? 13  LEU A CA   1  
ATOM 175   C C    . LEU A 1 13  ? 6.345   6.799   -9.299  1.00 1.00 ? 13  LEU A C    1  
ATOM 176   O O    . LEU A 1 13  ? 6.453   6.518   -8.105  1.00 1.00 ? 13  LEU A O    1  
ATOM 177   C CB   . LEU A 1 13  ? 7.112   4.614   -10.370 1.00 1.00 ? 13  LEU A CB   1  
ATOM 178   C CG   . LEU A 1 13  ? 7.889   3.943   -11.521 1.00 1.00 ? 13  LEU A CG   1  
ATOM 179   C CD1  . LEU A 1 13  ? 7.904   2.423   -11.334 1.00 1.00 ? 13  LEU A CD1  1  
ATOM 180   C CD2  . LEU A 1 13  ? 7.262   4.268   -12.884 1.00 1.00 ? 13  LEU A CD2  1  
ATOM 181   H H    . LEU A 1 13  ? 9.125   5.931   -9.383  1.00 1.00 ? 13  LEU A H    1  
ATOM 182   H HA   . LEU A 1 13  ? 6.967   6.556   -11.319 1.00 1.00 ? 13  LEU A HA   1  
ATOM 183   H HB2  . LEU A 1 13  ? 7.479   4.220   -9.417  1.00 1.00 ? 13  LEU A HB2  1  
ATOM 184   H HB3  . LEU A 1 13  ? 6.055   4.350   -10.448 1.00 1.00 ? 13  LEU A HB3  1  
ATOM 185   H HG   . LEU A 1 13  ? 8.921   4.292   -11.517 1.00 1.00 ? 13  LEU A HG   1  
ATOM 186   H HD11 . LEU A 1 13  ? 8.503   1.972   -12.122 1.00 1.00 ? 13  LEU A HD11 1  
ATOM 187   H HD12 . LEU A 1 13  ? 8.348   2.167   -10.373 1.00 1.00 ? 13  LEU A HD12 1  
ATOM 188   H HD13 . LEU A 1 13  ? 6.889   2.024   -11.377 1.00 1.00 ? 13  LEU A HD13 1  
ATOM 189   H HD21 . LEU A 1 13  ? 7.253   5.344   -13.056 1.00 1.00 ? 13  LEU A HD21 1  
ATOM 190   H HD22 . LEU A 1 13  ? 7.838   3.792   -13.678 1.00 1.00 ? 13  LEU A HD22 1  
ATOM 191   H HD23 . LEU A 1 13  ? 6.240   3.896   -12.907 1.00 1.00 ? 13  LEU A HD23 1  
ATOM 192   N N    . ILE A 1 14  ? 5.454   7.677   -9.755  1.00 1.00 ? 14  ILE A N    1  
ATOM 193   C CA   . ILE A 1 14  ? 4.522   8.412   -8.899  1.00 1.00 ? 14  ILE A CA   1  
ATOM 194   C C    . ILE A 1 14  ? 3.222   7.623   -8.860  1.00 1.00 ? 14  ILE A C    1  
ATOM 195   O O    . ILE A 1 14  ? 2.678   7.296   -9.912  1.00 1.00 ? 14  ILE A O    1  
ATOM 196   C CB   . ILE A 1 14  ? 4.298   9.850   -9.418  1.00 1.00 ? 14  ILE A CB   1  
ATOM 197   C CG1  . ILE A 1 14  ? 5.615   10.632  -9.635  1.00 1.00 ? 14  ILE A CG1  1  
ATOM 198   C CG2  . ILE A 1 14  ? 3.365   10.619  -8.465  1.00 1.00 ? 14  ILE A CG2  1  
ATOM 199   C CD1  . ILE A 1 14  ? 6.518   10.757  -8.400  1.00 1.00 ? 14  ILE A CD1  1  
ATOM 200   H H    . ILE A 1 14  ? 5.332   7.757   -10.764 1.00 1.00 ? 14  ILE A H    1  
ATOM 201   H HA   . ILE A 1 14  ? 4.922   8.464   -7.884  1.00 1.00 ? 14  ILE A HA   1  
ATOM 202   H HB   . ILE A 1 14  ? 3.797   9.785   -10.386 1.00 1.00 ? 14  ILE A HB   1  
ATOM 203   H HG12 . ILE A 1 14  ? 6.185   10.151  -10.431 1.00 1.00 ? 14  ILE A HG12 1  
ATOM 204   H HG13 . ILE A 1 14  ? 5.372   11.637  -9.983  1.00 1.00 ? 14  ILE A HG13 1  
ATOM 205   H HG21 . ILE A 1 14  ? 2.389   10.141  -8.432  1.00 1.00 ? 14  ILE A HG21 1  
ATOM 206   H HG22 . ILE A 1 14  ? 3.777   10.635  -7.455  1.00 1.00 ? 14  ILE A HG22 1  
ATOM 207   H HG23 . ILE A 1 14  ? 3.230   11.641  -8.818  1.00 1.00 ? 14  ILE A HG23 1  
ATOM 208   H HD11 . ILE A 1 14  ? 6.000   11.288  -7.602  1.00 1.00 ? 14  ILE A HD11 1  
ATOM 209   H HD12 . ILE A 1 14  ? 6.822   9.769   -8.053  1.00 1.00 ? 14  ILE A HD12 1  
ATOM 210   H HD13 . ILE A 1 14  ? 7.413   11.317  -8.664  1.00 1.00 ? 14  ILE A HD13 1  
ATOM 211   N N    . GLU A 1 15  ? 2.749   7.339   -7.654  1.00 1.00 ? 15  GLU A N    1  
ATOM 212   C CA   . GLU A 1 15  ? 1.525   6.620   -7.335  1.00 1.00 ? 15  GLU A CA   1  
ATOM 213   C C    . GLU A 1 15  ? 0.521   7.637   -6.779  1.00 1.00 ? 15  GLU A C    1  
ATOM 214   O O    . GLU A 1 15  ? 0.779   8.276   -5.761  1.00 1.00 ? 15  GLU A O    1  
ATOM 215   C CB   . GLU A 1 15  ? 1.906   5.558   -6.294  1.00 1.00 ? 15  GLU A CB   1  
ATOM 216   C CG   . GLU A 1 15  ? 0.741   4.753   -5.720  1.00 1.00 ? 15  GLU A CG   1  
ATOM 217   C CD   . GLU A 1 15  ? 1.284   3.811   -4.639  1.00 1.00 ? 15  GLU A CD   1  
ATOM 218   O OE1  . GLU A 1 15  ? 1.696   4.300   -3.561  1.00 1.00 ? 15  GLU A OE1  1  
ATOM 219   O OE2  . GLU A 1 15  ? 1.338   2.581   -4.872  1.00 1.00 ? 15  GLU A OE2  1  
ATOM 220   H H    . GLU A 1 15  ? 3.264   7.690   -6.854  1.00 1.00 ? 15  GLU A H    1  
ATOM 221   H HA   . GLU A 1 15  ? 1.114   6.135   -8.222  1.00 1.00 ? 15  GLU A HA   1  
ATOM 222   H HB2  . GLU A 1 15  ? 2.609   4.859   -6.750  1.00 1.00 ? 15  GLU A HB2  1  
ATOM 223   H HB3  . GLU A 1 15  ? 2.422   6.048   -5.465  1.00 1.00 ? 15  GLU A HB3  1  
ATOM 224   H HG2  . GLU A 1 15  ? 0.004   5.423   -5.282  1.00 1.00 ? 15  GLU A HG2  1  
ATOM 225   H HG3  . GLU A 1 15  ? 0.260   4.185   -6.519  1.00 1.00 ? 15  GLU A HG3  1  
ATOM 226   N N    . ILE A 1 16  ? -0.605  7.832   -7.465  1.00 1.00 ? 16  ILE A N    1  
ATOM 227   C CA   . ILE A 1 16  ? -1.587  8.899   -7.207  1.00 1.00 ? 16  ILE A CA   1  
ATOM 228   C C    . ILE A 1 16  ? -2.910  8.264   -6.755  1.00 1.00 ? 16  ILE A C    1  
ATOM 229   O O    . ILE A 1 16  ? -3.427  7.368   -7.423  1.00 1.00 ? 16  ILE A O    1  
ATOM 230   C CB   . ILE A 1 16  ? -1.787  9.768   -8.479  1.00 1.00 ? 16  ILE A CB   1  
ATOM 231   C CG1  . ILE A 1 16  ? -0.445  10.271  -9.070  1.00 1.00 ? 16  ILE A CG1  1  
ATOM 232   C CG2  . ILE A 1 16  ? -2.717  10.959  -8.166  1.00 1.00 ? 16  ILE A CG2  1  
ATOM 233   C CD1  . ILE A 1 16  ? -0.568  10.972  -10.432 1.00 1.00 ? 16  ILE A CD1  1  
ATOM 234   H H    . ILE A 1 16  ? -0.758  7.266   -8.299  1.00 1.00 ? 16  ILE A H    1  
ATOM 235   H HA   . ILE A 1 16  ? -1.226  9.540   -6.405  1.00 1.00 ? 16  ILE A HA   1  
ATOM 236   H HB   . ILE A 1 16  ? -2.275  9.151   -9.235  1.00 1.00 ? 16  ILE A HB   1  
ATOM 237   H HG12 . ILE A 1 16  ? 0.032   10.950  -8.361  1.00 1.00 ? 16  ILE A HG12 1  
ATOM 238   H HG13 . ILE A 1 16  ? 0.222   9.425   -9.229  1.00 1.00 ? 16  ILE A HG13 1  
ATOM 239   H HG21 . ILE A 1 16  ? -3.667  10.601  -7.772  1.00 1.00 ? 16  ILE A HG21 1  
ATOM 240   H HG22 . ILE A 1 16  ? -2.255  11.622  -7.434  1.00 1.00 ? 16  ILE A HG22 1  
ATOM 241   H HG23 . ILE A 1 16  ? -2.933  11.526  -9.072  1.00 1.00 ? 16  ILE A HG23 1  
ATOM 242   H HD11 . ILE A 1 16  ? -1.061  10.311  -11.145 1.00 1.00 ? 16  ILE A HD11 1  
ATOM 243   H HD12 . ILE A 1 16  ? -1.134  11.900  -10.350 1.00 1.00 ? 16  ILE A HD12 1  
ATOM 244   H HD13 . ILE A 1 16  ? 0.431   11.210  -10.803 1.00 1.00 ? 16  ILE A HD13 1  
ATOM 245   N N    . PHE A 1 17  ? -3.468  8.743   -5.642  1.00 1.00 ? 17  PHE A N    1  
ATOM 246   C CA   . PHE A 1 17  ? -4.713  8.264   -5.044  1.00 1.00 ? 17  PHE A CA   1  
ATOM 247   C C    . PHE A 1 17  ? -5.831  9.290   -5.276  1.00 1.00 ? 17  PHE A C    1  
ATOM 248   O O    . PHE A 1 17  ? -5.879  10.339  -4.628  1.00 1.00 ? 17  PHE A O    1  
ATOM 249   C CB   . PHE A 1 17  ? -4.492  8.002   -3.545  1.00 1.00 ? 17  PHE A CB   1  
ATOM 250   C CG   . PHE A 1 17  ? -3.505  6.889   -3.250  1.00 1.00 ? 17  PHE A CG   1  
ATOM 251   C CD1  . PHE A 1 17  ? -2.129  7.171   -3.133  1.00 1.00 ? 17  PHE A CD1  1  
ATOM 252   C CD2  . PHE A 1 17  ? -3.960  5.563   -3.107  1.00 1.00 ? 17  PHE A CD2  1  
ATOM 253   C CE1  . PHE A 1 17  ? -1.217  6.134   -2.874  1.00 1.00 ? 17  PHE A CE1  1  
ATOM 254   C CE2  . PHE A 1 17  ? -3.045  4.528   -2.844  1.00 1.00 ? 17  PHE A CE2  1  
ATOM 255   C CZ   . PHE A 1 17  ? -1.676  4.814   -2.727  1.00 1.00 ? 17  PHE A CZ   1  
ATOM 256   H H    . PHE A 1 17  ? -3.007  9.520   -5.182  1.00 1.00 ? 17  PHE A H    1  
ATOM 257   H HA   . PHE A 1 17  ? -5.007  7.322   -5.508  1.00 1.00 ? 17  PHE A HA   1  
ATOM 258   H HB2  . PHE A 1 17  ? -4.150  8.916   -3.062  1.00 1.00 ? 17  PHE A HB2  1  
ATOM 259   H HB3  . PHE A 1 17  ? -5.452  7.741   -3.096  1.00 1.00 ? 17  PHE A HB3  1  
ATOM 260   H HD1  . PHE A 1 17  ? -1.772  8.185   -3.252  1.00 1.00 ? 17  PHE A HD1  1  
ATOM 261   H HD2  . PHE A 1 17  ? -5.013  5.338   -3.198  1.00 1.00 ? 17  PHE A HD2  1  
ATOM 262   H HE1  . PHE A 1 17  ? -0.161  6.348   -2.803  1.00 1.00 ? 17  PHE A HE1  1  
ATOM 263   H HE2  . PHE A 1 17  ? -3.396  3.511   -2.735  1.00 1.00 ? 17  PHE A HE2  1  
ATOM 264   H HZ   . PHE A 1 17  ? -0.975  4.015   -2.532  1.00 1.00 ? 17  PHE A HZ   1  
ATOM 265   N N    . ARG A 1 18  ? -6.730  8.966   -6.210  1.00 1.00 ? 18  ARG A N    1  
ATOM 266   C CA   . ARG A 1 18  ? -7.956  9.717   -6.514  1.00 1.00 ? 18  ARG A CA   1  
ATOM 267   C C    . ARG A 1 18  ? -9.104  9.279   -5.578  1.00 1.00 ? 18  ARG A C    1  
ATOM 268   O O    . ARG A 1 18  ? -8.934  8.385   -4.745  1.00 1.00 ? 18  ARG A O    1  
ATOM 269   C CB   . ARG A 1 18  ? -8.343  9.511   -8.000  1.00 1.00 ? 18  ARG A CB   1  
ATOM 270   C CG   . ARG A 1 18  ? -7.188  9.713   -9.001  1.00 1.00 ? 18  ARG A CG   1  
ATOM 271   C CD   . ARG A 1 18  ? -7.658  9.620   -10.461 1.00 1.00 ? 18  ARG A CD   1  
ATOM 272   N NE   . ARG A 1 18  ? -8.539  10.747  -10.833 1.00 1.00 ? 18  ARG A NE   1  
ATOM 273   C CZ   . ARG A 1 18  ? -9.331  10.815  -11.901 1.00 1.00 ? 18  ARG A CZ   1  
ATOM 274   N NH1  . ARG A 1 18  ? -9.412  9.839   -12.783 1.00 1.00 ? 18  ARG A NH1  1  
ATOM 275   N NH2  . ARG A 1 18  ? -10.066 11.889  -12.098 1.00 1.00 ? 18  ARG A NH2  1  
ATOM 276   H H    . ARG A 1 18  ? -6.643  8.052   -6.640  1.00 1.00 ? 18  ARG A H    1  
ATOM 277   H HA   . ARG A 1 18  ? -7.770  10.780  -6.348  1.00 1.00 ? 18  ARG A HA   1  
ATOM 278   H HB2  . ARG A 1 18  ? -8.738  8.503   -8.130  1.00 1.00 ? 18  ARG A HB2  1  
ATOM 279   H HB3  . ARG A 1 18  ? -9.143  10.209  -8.245  1.00 1.00 ? 18  ARG A HB3  1  
ATOM 280   H HG2  . ARG A 1 18  ? -6.716  10.681  -8.839  1.00 1.00 ? 18  ARG A HG2  1  
ATOM 281   H HG3  . ARG A 1 18  ? -6.438  8.938   -8.841  1.00 1.00 ? 18  ARG A HG3  1  
ATOM 282   H HD2  . ARG A 1 18  ? -6.780  9.639   -11.111 1.00 1.00 ? 18  ARG A HD2  1  
ATOM 283   H HD3  . ARG A 1 18  ? -8.175  8.670   -10.603 1.00 1.00 ? 18  ARG A HD3  1  
ATOM 284   H HE   . ARG A 1 18  ? -8.513  11.562  -10.235 1.00 1.00 ? 18  ARG A HE   1  
ATOM 285   H HH11 . ARG A 1 18  ? -8.854  9.008   -12.676 1.00 1.00 ? 18  ARG A HH11 1  
ATOM 286   H HH12 . ARG A 1 18  ? -10.020 9.923   -13.584 1.00 1.00 ? 18  ARG A HH12 1  
ATOM 287   H HH21 . ARG A 1 18  ? -10.042 12.656  -11.444 1.00 1.00 ? 18  ARG A HH21 1  
ATOM 288   H HH22 . ARG A 1 18  ? -10.670 11.961  -12.904 1.00 1.00 ? 18  ARG A HH22 1  
ATOM 289   N N    . LEU A 1 19  ? -10.301 9.857   -5.744  1.00 1.00 ? 19  LEU A N    1  
ATOM 290   C CA   . LEU A 1 19  ? -11.524 9.397   -5.079  1.00 1.00 ? 19  LEU A CA   1  
ATOM 291   C C    . LEU A 1 19  ? -11.979 8.048   -5.675  1.00 1.00 ? 19  LEU A C    1  
ATOM 292   O O    . LEU A 1 19  ? -12.547 8.006   -6.770  1.00 1.00 ? 19  LEU A O    1  
ATOM 293   C CB   . LEU A 1 19  ? -12.626 10.478  -5.176  1.00 1.00 ? 19  LEU A CB   1  
ATOM 294   C CG   . LEU A 1 19  ? -12.297 11.832  -4.508  1.00 1.00 ? 19  LEU A CG   1  
ATOM 295   C CD1  . LEU A 1 19  ? -13.462 12.807  -4.732  1.00 1.00 ? 19  LEU A CD1  1  
ATOM 296   C CD2  . LEU A 1 19  ? -12.028 11.696  -3.001  1.00 1.00 ? 19  LEU A CD2  1  
ATOM 297   H H    . LEU A 1 19  ? -10.389 10.605  -6.413  1.00 1.00 ? 19  LEU A H    1  
ATOM 298   H HA   . LEU A 1 19  ? -11.303 9.234   -4.026  1.00 1.00 ? 19  LEU A HA   1  
ATOM 299   H HB2  . LEU A 1 19  ? -12.846 10.659  -6.232  1.00 1.00 ? 19  LEU A HB2  1  
ATOM 300   H HB3  . LEU A 1 19  ? -13.534 10.079  -4.719  1.00 1.00 ? 19  LEU A HB3  1  
ATOM 301   H HG   . LEU A 1 19  ? -11.410 12.256  -4.977  1.00 1.00 ? 19  LEU A HG   1  
ATOM 302   H HD11 . LEU A 1 19  ? -14.370 12.418  -4.272  1.00 1.00 ? 19  LEU A HD11 1  
ATOM 303   H HD12 . LEU A 1 19  ? -13.227 13.776  -4.289  1.00 1.00 ? 19  LEU A HD12 1  
ATOM 304   H HD13 . LEU A 1 19  ? -13.630 12.944  -5.802  1.00 1.00 ? 19  LEU A HD13 1  
ATOM 305   H HD21 . LEU A 1 19  ? -11.866 12.683  -2.568  1.00 1.00 ? 19  LEU A HD21 1  
ATOM 306   H HD22 . LEU A 1 19  ? -12.880 11.227  -2.504  1.00 1.00 ? 19  LEU A HD22 1  
ATOM 307   H HD23 . LEU A 1 19  ? -11.134 11.100  -2.826  1.00 1.00 ? 19  LEU A HD23 1  
ATOM 308   N N    . GLY A 1 20  ? -11.713 6.947   -4.959  1.00 1.00 ? 20  GLY A N    1  
ATOM 309   C CA   . GLY A 1 20  ? -12.157 5.585   -5.307  1.00 1.00 ? 20  GLY A CA   1  
ATOM 310   C C    . GLY A 1 20  ? -11.292 4.841   -6.339  1.00 1.00 ? 20  GLY A C    1  
ATOM 311   O O    . GLY A 1 20  ? -11.643 3.720   -6.706  1.00 1.00 ? 20  GLY A O    1  
ATOM 312   H H    . GLY A 1 20  ? -11.209 7.063   -4.088  1.00 1.00 ? 20  GLY A H    1  
ATOM 313   H HA2  . GLY A 1 20  ? -12.162 4.976   -4.401  1.00 1.00 ? 20  GLY A HA2  1  
ATOM 314   H HA3  . GLY A 1 20  ? -13.167 5.633   -5.715  1.00 1.00 ? 20  GLY A HA3  1  
ATOM 315   N N    . TYR A 1 21  ? -10.179 5.429   -6.798  1.00 1.00 ? 21  TYR A N    1  
ATOM 316   C CA   . TYR A 1 21  ? -9.297  4.894   -7.845  1.00 1.00 ? 21  TYR A CA   1  
ATOM 317   C C    . TYR A 1 21  ? -7.832  5.344   -7.671  1.00 1.00 ? 21  TYR A C    1  
ATOM 318   O O    . TYR A 1 21  ? -7.563  6.364   -7.034  1.00 1.00 ? 21  TYR A O    1  
ATOM 319   C CB   . TYR A 1 21  ? -9.801  5.333   -9.237  1.00 1.00 ? 21  TYR A CB   1  
ATOM 320   C CG   . TYR A 1 21  ? -11.166 4.803   -9.640  1.00 1.00 ? 21  TYR A CG   1  
ATOM 321   C CD1  . TYR A 1 21  ? -11.299 3.483   -10.115 1.00 1.00 ? 21  TYR A CD1  1  
ATOM 322   C CD2  . TYR A 1 21  ? -12.303 5.631   -9.544  1.00 1.00 ? 21  TYR A CD2  1  
ATOM 323   C CE1  . TYR A 1 21  ? -12.563 2.988   -10.489 1.00 1.00 ? 21  TYR A CE1  1  
ATOM 324   C CE2  . TYR A 1 21  ? -13.571 5.142   -9.912  1.00 1.00 ? 21  TYR A CE2  1  
ATOM 325   C CZ   . TYR A 1 21  ? -13.705 3.815   -10.385 1.00 1.00 ? 21  TYR A CZ   1  
ATOM 326   O OH   . TYR A 1 21  ? -14.936 3.341   -10.735 1.00 1.00 ? 21  TYR A OH   1  
ATOM 327   H H    . TYR A 1 21  ? -9.904  6.302   -6.386  1.00 1.00 ? 21  TYR A H    1  
ATOM 328   H HA   . TYR A 1 21  ? -9.317  3.810   -7.780  1.00 1.00 ? 21  TYR A HA   1  
ATOM 329   H HB2  . TYR A 1 21  ? -9.816  6.424   -9.277  1.00 1.00 ? 21  TYR A HB2  1  
ATOM 330   H HB3  . TYR A 1 21  ? -9.086  4.999   -9.990  1.00 1.00 ? 21  TYR A HB3  1  
ATOM 331   H HD1  . TYR A 1 21  ? -10.427 2.848   -10.193 1.00 1.00 ? 21  TYR A HD1  1  
ATOM 332   H HD2  . TYR A 1 21  ? -12.202 6.646   -9.183  1.00 1.00 ? 21  TYR A HD2  1  
ATOM 333   H HE1  . TYR A 1 21  ? -12.660 1.974   -10.851 1.00 1.00 ? 21  TYR A HE1  1  
ATOM 334   H HE2  . TYR A 1 21  ? -14.443 5.776   -9.829  1.00 1.00 ? 21  TYR A HE2  1  
ATOM 335   H HH   . TYR A 1 21  ? -14.917 2.425   -11.049 1.00 1.00 ? 21  TYR A HH   1  
ATOM 336   N N    . GLU A 1 22  ? -6.885  4.634   -8.298  1.00 1.00 ? 22  GLU A N    1  
ATOM 337   C CA   . GLU A 1 22  ? -5.462  5.005   -8.338  1.00 1.00 ? 22  GLU A CA   1  
ATOM 338   C C    . GLU A 1 22  ? -4.989  5.295   -9.778  1.00 1.00 ? 22  GLU A C    1  
ATOM 339   O O    . GLU A 1 22  ? -5.584  4.826   -10.751 1.00 1.00 ? 22  GLU A O    1  
ATOM 340   C CB   . GLU A 1 22  ? -4.582  3.909   -7.709  1.00 1.00 ? 22  GLU A CB   1  
ATOM 341   C CG   . GLU A 1 22  ? -4.790  3.714   -6.198  1.00 1.00 ? 22  GLU A CG   1  
ATOM 342   C CD   . GLU A 1 22  ? -6.073  2.937   -5.857  1.00 1.00 ? 22  GLU A CD   1  
ATOM 343   O OE1  . GLU A 1 22  ? -6.222  1.773   -6.303  1.00 1.00 ? 22  GLU A OE1  1  
ATOM 344   O OE2  . GLU A 1 22  ? -6.935  3.467   -5.117  1.00 1.00 ? 22  GLU A OE2  1  
ATOM 345   H H    . GLU A 1 22  ? -7.165  3.832   -8.843  1.00 1.00 ? 22  GLU A H    1  
ATOM 346   H HA   . GLU A 1 22  ? -5.314  5.915   -7.760  1.00 1.00 ? 22  GLU A HA   1  
ATOM 347   H HB2  . GLU A 1 22  ? -4.739  2.964   -8.230  1.00 1.00 ? 22  GLU A HB2  1  
ATOM 348   H HB3  . GLU A 1 22  ? -3.539  4.194   -7.851  1.00 1.00 ? 22  GLU A HB3  1  
ATOM 349   H HG2  . GLU A 1 22  ? -3.938  3.158   -5.803  1.00 1.00 ? 22  GLU A HG2  1  
ATOM 350   H HG3  . GLU A 1 22  ? -4.796  4.692   -5.716  1.00 1.00 ? 22  GLU A HG3  1  
ATOM 351   N N    . HIS A 1 23  ? -3.905  6.064   -9.915  1.00 1.00 ? 23  HIS A N    1  
ATOM 352   C CA   . HIS A 1 23  ? -3.289  6.433   -11.195 1.00 1.00 ? 23  HIS A CA   1  
ATOM 353   C C    . HIS A 1 23  ? -1.755  6.591   -11.062 1.00 1.00 ? 23  HIS A C    1  
ATOM 354   O O    . HIS A 1 23  ? -1.255  6.767   -9.952  1.00 1.00 ? 23  HIS A O    1  
ATOM 355   C CB   . HIS A 1 23  ? -3.964  7.723   -11.708 1.00 1.00 ? 23  HIS A CB   1  
ATOM 356   C CG   . HIS A 1 23  ? -3.922  7.875   -13.207 1.00 1.00 ? 23  HIS A CG   1  
ATOM 357   N ND1  . HIS A 1 23  ? -2.980  8.556   -13.949 1.00 1.00 ? 23  HIS A ND1  1  
ATOM 358   C CD2  . HIS A 1 23  ? -4.831  7.351   -14.090 1.00 1.00 ? 23  HIS A CD2  1  
ATOM 359   C CE1  . HIS A 1 23  ? -3.316  8.440   -15.246 1.00 1.00 ? 23  HIS A CE1  1  
ATOM 360   N NE2  . HIS A 1 23  ? -4.434  7.705   -15.384 1.00 1.00 ? 23  HIS A NE2  1  
ATOM 361   H H    . HIS A 1 23  ? -3.463  6.423   -9.069  1.00 1.00 ? 23  HIS A H    1  
ATOM 362   H HA   . HIS A 1 23  ? -3.475  5.631   -11.915 1.00 1.00 ? 23  HIS A HA   1  
ATOM 363   H HB2  . HIS A 1 23  ? -5.020  7.710   -11.425 1.00 1.00 ? 23  HIS A HB2  1  
ATOM 364   H HB3  . HIS A 1 23  ? -3.517  8.599   -11.233 1.00 1.00 ? 23  HIS A HB3  1  
ATOM 365   H HD1  . HIS A 1 23  ? -2.197  9.090   -13.593 1.00 1.00 ? 23  HIS A HD1  1  
ATOM 366   H HD2  . HIS A 1 23  ? -5.700  6.761   -13.826 1.00 1.00 ? 23  HIS A HD2  1  
ATOM 367   H HE1  . HIS A 1 23  ? -2.770  8.890   -16.065 1.00 1.00 ? 23  HIS A HE1  1  
ATOM 368   N N    . TRP A 1 24  ? -0.998  6.549   -12.171 1.00 1.00 ? 24  TRP A N    1  
ATOM 369   C CA   . TRP A 1 24  ? 0.479   6.539   -12.153 1.00 1.00 ? 24  TRP A CA   1  
ATOM 370   C C    . TRP A 1 24  ? 1.134   7.464   -13.193 1.00 1.00 ? 24  TRP A C    1  
ATOM 371   O O    . TRP A 1 24  ? 0.548   7.754   -14.238 1.00 1.00 ? 24  TRP A O    1  
ATOM 372   C CB   . TRP A 1 24  ? 0.974   5.091   -12.307 1.00 1.00 ? 24  TRP A CB   1  
ATOM 373   C CG   . TRP A 1 24  ? 0.812   4.241   -11.081 1.00 1.00 ? 24  TRP A CG   1  
ATOM 374   C CD1  . TRP A 1 24  ? 1.765   4.060   -10.140 1.00 1.00 ? 24  TRP A CD1  1  
ATOM 375   C CD2  . TRP A 1 24  ? -0.348  3.476   -10.621 1.00 1.00 ? 24  TRP A CD2  1  
ATOM 376   N NE1  . TRP A 1 24  ? 1.290   3.236   -9.140  1.00 1.00 ? 24  TRP A NE1  1  
ATOM 377   C CE2  . TRP A 1 24  ? -0.017  2.865   -9.372  1.00 1.00 ? 24  TRP A CE2  1  
ATOM 378   C CE3  . TRP A 1 24  ? -1.646  3.233   -11.124 1.00 1.00 ? 24  TRP A CE3  1  
ATOM 379   C CZ2  . TRP A 1 24  ? -0.924  2.066   -8.663  1.00 1.00 ? 24  TRP A CZ2  1  
ATOM 380   C CZ3  . TRP A 1 24  ? -2.565  2.434   -10.419 1.00 1.00 ? 24  TRP A CZ3  1  
ATOM 381   C CH2  . TRP A 1 24  ? -2.208  1.854   -9.189  1.00 1.00 ? 24  TRP A CH2  1  
ATOM 382   H H    . TRP A 1 24  ? -1.450  6.424   -13.067 1.00 1.00 ? 24  TRP A H    1  
ATOM 383   H HA   . TRP A 1 24  ? 0.821   6.897   -11.184 1.00 1.00 ? 24  TRP A HA   1  
ATOM 384   H HB2  . TRP A 1 24  ? 0.458   4.616   -13.144 1.00 1.00 ? 24  TRP A HB2  1  
ATOM 385   H HB3  . TRP A 1 24  ? 2.037   5.103   -12.549 1.00 1.00 ? 24  TRP A HB3  1  
ATOM 386   H HD1  . TRP A 1 24  ? 2.753   4.505   -10.166 1.00 1.00 ? 24  TRP A HD1  1  
ATOM 387   H HE1  . TRP A 1 24  ? 1.847   2.942   -8.346  1.00 1.00 ? 24  TRP A HE1  1  
ATOM 388   H HE3  . TRP A 1 24  ? -1.930  3.663   -12.073 1.00 1.00 ? 24  TRP A HE3  1  
ATOM 389   H HZ2  . TRP A 1 24  ? -0.636  1.619   -7.723  1.00 1.00 ? 24  TRP A HZ2  1  
ATOM 390   H HZ3  . TRP A 1 24  ? -3.555  2.268   -10.825 1.00 1.00 ? 24  TRP A HZ3  1  
ATOM 391   H HH2  . TRP A 1 24  ? -2.918  1.243   -8.650  1.00 1.00 ? 24  TRP A HH2  1  
ATOM 392   N N    . ALA A 1 25  ? 2.372   7.899   -12.911 1.00 1.00 ? 25  ALA A N    1  
ATOM 393   C CA   . ALA A 1 25  ? 3.189   8.778   -13.772 1.00 1.00 ? 25  ALA A CA   1  
ATOM 394   C C    . ALA A 1 25  ? 4.707   8.568   -13.571 1.00 1.00 ? 25  ALA A C    1  
ATOM 395   O O    . ALA A 1 25  ? 5.128   8.050   -12.537 1.00 1.00 ? 25  ALA A O    1  
ATOM 396   C CB   . ALA A 1 25  ? 2.775   10.239  -13.504 1.00 1.00 ? 25  ALA A CB   1  
ATOM 397   H H    . ALA A 1 25  ? 2.770   7.626   -12.014 1.00 1.00 ? 25  ALA A H    1  
ATOM 398   H HA   . ALA A 1 25  ? 2.971   8.549   -14.820 1.00 1.00 ? 25  ALA A HA   1  
ATOM 399   H HB1  . ALA A 1 25  ? 3.004   10.517  -12.474 1.00 1.00 ? 25  ALA A HB1  1  
ATOM 400   H HB2  . ALA A 1 25  ? 3.317   10.907  -14.178 1.00 1.00 ? 25  ALA A HB2  1  
ATOM 401   H HB3  . ALA A 1 25  ? 1.705   10.365  -13.676 1.00 1.00 ? 25  ALA A HB3  1  
ATOM 402   N N    . LEU A 1 26  ? 5.524   8.977   -14.551 1.00 1.00 ? 26  LEU A N    1  
ATOM 403   C CA   . LEU A 1 26  ? 6.996   8.926   -14.531 1.00 1.00 ? 26  LEU A CA   1  
ATOM 404   C C    . LEU A 1 26  ? 7.535   10.341  -14.262 1.00 1.00 ? 26  LEU A C    1  
ATOM 405   O O    . LEU A 1 26  ? 7.347   11.229  -15.087 1.00 1.00 ? 26  LEU A O    1  
ATOM 406   C CB   . LEU A 1 26  ? 7.473   8.359   -15.901 1.00 1.00 ? 26  LEU A CB   1  
ATOM 407   C CG   . LEU A 1 26  ? 8.902   7.780   -16.010 1.00 1.00 ? 26  LEU A CG   1  
ATOM 408   C CD1  . LEU A 1 26  ? 10.007  8.771   -15.631 1.00 1.00 ? 26  LEU A CD1  1  
ATOM 409   C CD2  . LEU A 1 26  ? 9.052   6.499   -15.180 1.00 1.00 ? 26  LEU A CD2  1  
ATOM 410   H H    . LEU A 1 26  ? 5.099   9.419   -15.367 1.00 1.00 ? 26  LEU A H    1  
ATOM 411   H HA   . LEU A 1 26  ? 7.332   8.267   -13.726 1.00 1.00 ? 26  LEU A HA   1  
ATOM 412   H HB2  . LEU A 1 26  ? 6.792   7.556   -16.195 1.00 1.00 ? 26  LEU A HB2  1  
ATOM 413   H HB3  . LEU A 1 26  ? 7.371   9.131   -16.669 1.00 1.00 ? 26  LEU A HB3  1  
ATOM 414   H HG   . LEU A 1 26  ? 9.056   7.517   -17.061 1.00 1.00 ? 26  LEU A HG   1  
ATOM 415   H HD11 . LEU A 1 26  ? 10.004  8.956   -14.559 1.00 1.00 ? 26  LEU A HD11 1  
ATOM 416   H HD12 . LEU A 1 26  ? 10.979  8.363   -15.913 1.00 1.00 ? 26  LEU A HD12 1  
ATOM 417   H HD13 . LEU A 1 26  ? 9.850   9.706   -16.166 1.00 1.00 ? 26  LEU A HD13 1  
ATOM 418   H HD21 . LEU A 1 26  ? 8.965   6.725   -14.116 1.00 1.00 ? 26  LEU A HD21 1  
ATOM 419   H HD22 . LEU A 1 26  ? 8.282   5.780   -15.462 1.00 1.00 ? 26  LEU A HD22 1  
ATOM 420   H HD23 . LEU A 1 26  ? 10.029  6.056   -15.368 1.00 1.00 ? 26  LEU A HD23 1  
ATOM 421   N N    . TYR A 1 27  ? 8.200   10.581  -13.134 1.00 1.00 ? 27  TYR A N    1  
ATOM 422   C CA   . TYR A 1 27  ? 8.771   11.896  -12.796 1.00 1.00 ? 27  TYR A CA   1  
ATOM 423   C C    . TYR A 1 27  ? 10.140  12.120  -13.454 1.00 1.00 ? 27  TYR A C    1  
ATOM 424   O O    . TYR A 1 27  ? 11.023  11.269  -13.378 1.00 1.00 ? 27  TYR A O    1  
ATOM 425   C CB   . TYR A 1 27  ? 8.834   12.036  -11.270 1.00 1.00 ? 27  TYR A CB   1  
ATOM 426   C CG   . TYR A 1 27  ? 9.312   13.385  -10.770 1.00 1.00 ? 27  TYR A CG   1  
ATOM 427   C CD1  . TYR A 1 27  ? 10.684  13.604  -10.561 1.00 1.00 ? 27  TYR A CD1  1  
ATOM 428   C CD2  . TYR A 1 27  ? 8.391   14.411  -10.483 1.00 1.00 ? 27  TYR A CD2  1  
ATOM 429   C CE1  . TYR A 1 27  ? 11.142  14.824  -10.030 1.00 1.00 ? 27  TYR A CE1  1  
ATOM 430   C CE2  . TYR A 1 27  ? 8.844   15.652  -9.992  1.00 1.00 ? 27  TYR A CE2  1  
ATOM 431   C CZ   . TYR A 1 27  ? 10.220  15.858  -9.751  1.00 1.00 ? 27  TYR A CZ   1  
ATOM 432   O OH   . TYR A 1 27  ? 10.652  17.041  -9.235  1.00 1.00 ? 27  TYR A OH   1  
ATOM 433   H H    . TYR A 1 27  ? 8.362   9.815   -12.488 1.00 1.00 ? 27  TYR A H    1  
ATOM 434   H HA   . TYR A 1 27  ? 8.108   12.674  -13.168 1.00 1.00 ? 27  TYR A HA   1  
ATOM 435   H HB2  . TYR A 1 27  ? 7.832   11.873  -10.881 1.00 1.00 ? 27  TYR A HB2  1  
ATOM 436   H HB3  . TYR A 1 27  ? 9.482   11.259  -10.859 1.00 1.00 ? 27  TYR A HB3  1  
ATOM 437   H HD1  . TYR A 1 27  ? 11.383  12.815  -10.788 1.00 1.00 ? 27  TYR A HD1  1  
ATOM 438   H HD2  . TYR A 1 27  ? 7.335   14.244  -10.627 1.00 1.00 ? 27  TYR A HD2  1  
ATOM 439   H HE1  . TYR A 1 27  ? 12.193  14.968  -9.825  1.00 1.00 ? 27  TYR A HE1  1  
ATOM 440   H HE2  . TYR A 1 27  ? 8.138   16.441  -9.764  1.00 1.00 ? 27  TYR A HE2  1  
ATOM 441   H HH   . TYR A 1 27  ? 11.598  17.055  -9.020  1.00 1.00 ? 27  TYR A HH   1  
ATOM 442   N N    . ILE A 1 28  ? 10.335  13.280  -14.093 1.00 1.00 ? 28  ILE A N    1  
ATOM 443   C CA   . ILE A 1 28  ? 11.517  13.543  -14.947 1.00 1.00 ? 28  ILE A CA   1  
ATOM 444   C C    . ILE A 1 28  ? 12.484  14.614  -14.402 1.00 1.00 ? 28  ILE A C    1  
ATOM 445   O O    . ILE A 1 28  ? 13.506  14.876  -15.036 1.00 1.00 ? 28  ILE A O    1  
ATOM 446   C CB   . ILE A 1 28  ? 11.076  13.827  -16.407 1.00 1.00 ? 28  ILE A CB   1  
ATOM 447   C CG1  . ILE A 1 28  ? 10.333  15.168  -16.566 1.00 1.00 ? 28  ILE A CG1  1  
ATOM 448   C CG2  . ILE A 1 28  ? 10.224  12.659  -16.949 1.00 1.00 ? 28  ILE A CG2  1  
ATOM 449   C CD1  . ILE A 1 28  ? 10.124  15.533  -18.037 1.00 1.00 ? 28  ILE A CD1  1  
ATOM 450   H H    . ILE A 1 28  ? 9.580   13.966  -14.076 1.00 1.00 ? 28  ILE A H    1  
ATOM 451   H HA   . ILE A 1 28  ? 12.126  12.639  -14.989 1.00 1.00 ? 28  ILE A HA   1  
ATOM 452   H HB   . ILE A 1 28  ? 11.983  13.875  -17.014 1.00 1.00 ? 28  ILE A HB   1  
ATOM 453   H HG12 . ILE A 1 28  ? 9.362   15.112  -16.077 1.00 1.00 ? 28  ILE A HG12 1  
ATOM 454   H HG13 . ILE A 1 28  ? 10.912  15.969  -16.105 1.00 1.00 ? 28  ILE A HG13 1  
ATOM 455   H HG21 . ILE A 1 28  ? 9.209   12.681  -16.541 1.00 1.00 ? 28  ILE A HG21 1  
ATOM 456   H HG22 . ILE A 1 28  ? 10.165  12.717  -18.033 1.00 1.00 ? 28  ILE A HG22 1  
ATOM 457   H HG23 . ILE A 1 28  ? 10.687  11.712  -16.692 1.00 1.00 ? 28  ILE A HG23 1  
ATOM 458   H HD11 . ILE A 1 28  ? 9.423   14.839  -18.499 1.00 1.00 ? 28  ILE A HD11 1  
ATOM 459   H HD12 . ILE A 1 28  ? 9.728   16.546  -18.102 1.00 1.00 ? 28  ILE A HD12 1  
ATOM 460   H HD13 . ILE A 1 28  ? 11.079  15.483  -18.563 1.00 1.00 ? 28  ILE A HD13 1  
ATOM 461   N N    . GLY A 1 29  ? 12.184  15.208  -13.240 1.00 1.00 ? 29  GLY A N    1  
ATOM 462   C CA   . GLY A 1 29  ? 12.950  16.317  -12.645 1.00 1.00 ? 29  GLY A CA   1  
ATOM 463   C C    . GLY A 1 29  ? 12.294  17.685  -12.858 1.00 1.00 ? 29  GLY A C    1  
ATOM 464   O O    . GLY A 1 29  ? 11.373  17.831  -13.659 1.00 1.00 ? 29  GLY A O    1  
ATOM 465   H H    . GLY A 1 29  ? 11.319  14.944  -12.787 1.00 1.00 ? 29  GLY A H    1  
ATOM 466   H HA2  . GLY A 1 29  ? 13.041  16.161  -11.569 1.00 1.00 ? 29  GLY A HA2  1  
ATOM 467   H HA3  . GLY A 1 29  ? 13.954  16.367  -13.067 1.00 1.00 ? 29  GLY A HA3  1  
ATOM 468   N N    . ASP A 1 30  ? 12.765  18.684  -12.102 1.00 1.00 ? 30  ASP A N    1  
ATOM 469   C CA   . ASP A 1 30  ? 12.363  20.103  -12.195 1.00 1.00 ? 30  ASP A CA   1  
ATOM 470   C C    . ASP A 1 30  ? 10.857  20.352  -11.930 1.00 1.00 ? 30  ASP A C    1  
ATOM 471   O O    . ASP A 1 30  ? 10.298  21.374  -12.334 1.00 1.00 ? 30  ASP A O    1  
ATOM 472   C CB   . ASP A 1 30  ? 12.863  20.693  -13.530 1.00 1.00 ? 30  ASP A CB   1  
ATOM 473   C CG   . ASP A 1 30  ? 12.880  22.236  -13.549 1.00 1.00 ? 30  ASP A CG   1  
ATOM 474   O OD1  . ASP A 1 30  ? 13.387  22.849  -12.578 1.00 1.00 ? 30  ASP A OD1  1  
ATOM 475   O OD2  . ASP A 1 30  ? 12.445  22.830  -14.566 1.00 1.00 ? 30  ASP A OD2  1  
ATOM 476   H H    . ASP A 1 30  ? 13.522  18.471  -11.468 1.00 1.00 ? 30  ASP A H    1  
ATOM 477   H HA   . ASP A 1 30  ? 12.891  20.621  -11.394 1.00 1.00 ? 30  ASP A HA   1  
ATOM 478   H HB2  . ASP A 1 30  ? 13.883  20.344  -13.705 1.00 1.00 ? 30  ASP A HB2  1  
ATOM 479   H HB3  . ASP A 1 30  ? 12.245  20.317  -14.344 1.00 1.00 ? 30  ASP A HB3  1  
ATOM 480   N N    . GLY A 1 31  ? 10.189  19.402  -11.255 1.00 1.00 ? 31  GLY A N    1  
ATOM 481   C CA   . GLY A 1 31  ? 8.757   19.422  -10.945 1.00 1.00 ? 31  GLY A CA   1  
ATOM 482   C C    . GLY A 1 31  ? 7.865   18.780  -12.010 1.00 1.00 ? 31  GLY A C    1  
ATOM 483   O O    . GLY A 1 31  ? 6.651   18.760  -11.832 1.00 1.00 ? 31  GLY A O    1  
ATOM 484   H H    . GLY A 1 31  ? 10.722  18.608  -10.925 1.00 1.00 ? 31  GLY A H    1  
ATOM 485   H HA2  . GLY A 1 31  ? 8.595   18.873  -10.018 1.00 1.00 ? 31  GLY A HA2  1  
ATOM 486   H HA3  . GLY A 1 31  ? 8.421   20.452  -10.818 1.00 1.00 ? 31  GLY A HA3  1  
ATOM 487   N N    . TYR A 1 32  ? 8.417   18.257  -13.108 1.00 1.00 ? 32  TYR A N    1  
ATOM 488   C CA   . TYR A 1 32  ? 7.645   17.705  -14.229 1.00 1.00 ? 32  TYR A CA   1  
ATOM 489   C C    . TYR A 1 32  ? 7.476   16.176  -14.185 1.00 1.00 ? 32  TYR A C    1  
ATOM 490   O O    . TYR A 1 32  ? 8.325   15.433  -13.689 1.00 1.00 ? 32  TYR A O    1  
ATOM 491   C CB   . TYR A 1 32  ? 8.273   18.138  -15.563 1.00 1.00 ? 32  TYR A CB   1  
ATOM 492   C CG   . TYR A 1 32  ? 8.101   19.612  -15.873 1.00 1.00 ? 32  TYR A CG   1  
ATOM 493   C CD1  . TYR A 1 32  ? 6.952   20.057  -16.554 1.00 1.00 ? 32  TYR A CD1  1  
ATOM 494   C CD2  . TYR A 1 32  ? 9.080   20.537  -15.472 1.00 1.00 ? 32  TYR A CD2  1  
ATOM 495   C CE1  . TYR A 1 32  ? 6.776   21.428  -16.824 1.00 1.00 ? 32  TYR A CE1  1  
ATOM 496   C CE2  . TYR A 1 32  ? 8.914   21.908  -15.739 1.00 1.00 ? 32  TYR A CE2  1  
ATOM 497   C CZ   . TYR A 1 32  ? 7.757   22.360  -16.413 1.00 1.00 ? 32  TYR A CZ   1  
ATOM 498   O OH   . TYR A 1 32  ? 7.574   23.689  -16.654 1.00 1.00 ? 32  TYR A OH   1  
ATOM 499   H H    . TYR A 1 32  ? 9.428   18.277  -13.194 1.00 1.00 ? 32  TYR A H    1  
ATOM 500   H HA   . TYR A 1 32  ? 6.641   18.130  -14.193 1.00 1.00 ? 32  TYR A HA   1  
ATOM 501   H HB2  . TYR A 1 32  ? 9.338   17.892  -15.557 1.00 1.00 ? 32  TYR A HB2  1  
ATOM 502   H HB3  . TYR A 1 32  ? 7.816   17.569  -16.373 1.00 1.00 ? 32  TYR A HB3  1  
ATOM 503   H HD1  . TYR A 1 32  ? 6.195   19.352  -16.866 1.00 1.00 ? 32  TYR A HD1  1  
ATOM 504   H HD2  . TYR A 1 32  ? 9.958   20.193  -14.945 1.00 1.00 ? 32  TYR A HD2  1  
ATOM 505   H HE1  . TYR A 1 32  ? 5.892   21.775  -17.340 1.00 1.00 ? 32  TYR A HE1  1  
ATOM 506   H HE2  . TYR A 1 32  ? 9.672   22.611  -15.424 1.00 1.00 ? 32  TYR A HE2  1  
ATOM 507   H HH   . TYR A 1 32  ? 8.333   24.229  -16.377 1.00 1.00 ? 32  TYR A HH   1  
ATOM 508   N N    . VAL A 1 33  ? 6.378   15.707  -14.784 1.00 1.00 ? 33  VAL A N    1  
ATOM 509   C CA   . VAL A 1 33  ? 6.040   14.287  -14.965 1.00 1.00 ? 33  VAL A CA   1  
ATOM 510   C C    . VAL A 1 33  ? 5.608   14.004  -16.399 1.00 1.00 ? 33  VAL A C    1  
ATOM 511   O O    . VAL A 1 33  ? 5.103   14.880  -17.094 1.00 1.00 ? 33  VAL A O    1  
ATOM 512   C CB   . VAL A 1 33  ? 4.892   13.839  -14.031 1.00 1.00 ? 33  VAL A CB   1  
ATOM 513   C CG1  . VAL A 1 33  ? 5.331   13.760  -12.567 1.00 1.00 ? 33  VAL A CG1  1  
ATOM 514   C CG2  . VAL A 1 33  ? 3.656   14.751  -14.114 1.00 1.00 ? 33  VAL A CG2  1  
ATOM 515   H H    . VAL A 1 33  ? 5.733   16.388  -15.203 1.00 1.00 ? 33  VAL A H    1  
ATOM 516   H HA   . VAL A 1 33  ? 6.920   13.682  -14.753 1.00 1.00 ? 33  VAL A HA   1  
ATOM 517   H HB   . VAL A 1 33  ? 4.583   12.839  -14.328 1.00 1.00 ? 33  VAL A HB   1  
ATOM 518   H HG11 . VAL A 1 33  ? 6.127   13.027  -12.463 1.00 1.00 ? 33  VAL A HG11 1  
ATOM 519   H HG12 . VAL A 1 33  ? 5.683   14.733  -12.225 1.00 1.00 ? 33  VAL A HG12 1  
ATOM 520   H HG13 . VAL A 1 33  ? 4.488   13.439  -11.956 1.00 1.00 ? 33  VAL A HG13 1  
ATOM 521   H HG21 . VAL A 1 33  ? 3.337   14.864  -15.150 1.00 1.00 ? 33  VAL A HG21 1  
ATOM 522   H HG22 . VAL A 1 33  ? 2.840   14.308  -13.540 1.00 1.00 ? 33  VAL A HG22 1  
ATOM 523   H HG23 . VAL A 1 33  ? 3.878   15.736  -13.707 1.00 1.00 ? 33  VAL A HG23 1  
ATOM 524   N N    . ILE A 1 34  ? 5.774   12.754  -16.816 1.00 1.00 ? 34  ILE A N    1  
ATOM 525   C CA   . ILE A 1 34  ? 5.233   12.190  -18.059 1.00 1.00 ? 34  ILE A CA   1  
ATOM 526   C C    . ILE A 1 34  ? 4.171   11.156  -17.664 1.00 1.00 ? 34  ILE A C    1  
ATOM 527   O O    . ILE A 1 34  ? 4.351   10.397  -16.716 1.00 1.00 ? 34  ILE A O    1  
ATOM 528   C CB   . ILE A 1 34  ? 6.392   11.679  -18.947 1.00 1.00 ? 34  ILE A CB   1  
ATOM 529   C CG1  . ILE A 1 34  ? 7.099   12.929  -19.527 1.00 1.00 ? 34  ILE A CG1  1  
ATOM 530   C CG2  . ILE A 1 34  ? 5.857   10.747  -20.055 1.00 1.00 ? 34  ILE A CG2  1  
ATOM 531   C CD1  . ILE A 1 34  ? 8.336   12.657  -20.390 1.00 1.00 ? 34  ILE A CD1  1  
ATOM 532   H H    . ILE A 1 34  ? 6.236   12.102  -16.177 1.00 1.00 ? 34  ILE A H    1  
ATOM 533   H HA   . ILE A 1 34  ? 4.709   12.971  -18.608 1.00 1.00 ? 34  ILE A HA   1  
ATOM 534   H HB   . ILE A 1 34  ? 7.110   11.135  -18.325 1.00 1.00 ? 34  ILE A HB   1  
ATOM 535   H HG12 . ILE A 1 34  ? 6.386   13.493  -20.126 1.00 1.00 ? 34  ILE A HG12 1  
ATOM 536   H HG13 . ILE A 1 34  ? 7.417   13.566  -18.703 1.00 1.00 ? 34  ILE A HG13 1  
ATOM 537   H HG21 . ILE A 1 34  ? 6.648   10.459  -20.746 1.00 1.00 ? 34  ILE A HG21 1  
ATOM 538   H HG22 . ILE A 1 34  ? 5.466   9.829   -19.614 1.00 1.00 ? 34  ILE A HG22 1  
ATOM 539   H HG23 . ILE A 1 34  ? 5.060   11.239  -20.612 1.00 1.00 ? 34  ILE A HG23 1  
ATOM 540   H HD11 . ILE A 1 34  ? 8.802   13.605  -20.660 1.00 1.00 ? 34  ILE A HD11 1  
ATOM 541   H HD12 . ILE A 1 34  ? 9.052   12.055  -19.839 1.00 1.00 ? 34  ILE A HD12 1  
ATOM 542   H HD13 . ILE A 1 34  ? 8.056   12.144  -21.307 1.00 1.00 ? 34  ILE A HD13 1  
ATOM 543   N N    . HIS A 1 35  ? 3.037   11.143  -18.357 1.00 1.00 ? 35  HIS A N    1  
ATOM 544   C CA   . HIS A 1 35  ? 1.839   10.391  -17.963 1.00 1.00 ? 35  HIS A CA   1  
ATOM 545   C C    . HIS A 1 35  ? 0.984   10.020  -19.187 1.00 1.00 ? 35  HIS A C    1  
ATOM 546   O O    . HIS A 1 35  ? 1.080   10.674  -20.220 1.00 1.00 ? 35  HIS A O    1  
ATOM 547   C CB   . HIS A 1 35  ? 1.044   11.279  -16.973 1.00 1.00 ? 35  HIS A CB   1  
ATOM 548   C CG   . HIS A 1 35  ? 0.726   12.665  -17.500 1.00 1.00 ? 35  HIS A CG   1  
ATOM 549   N ND1  . HIS A 1 35  ? -0.464  13.087  -18.047 1.00 1.00 ? 35  HIS A ND1  1  
ATOM 550   C CD2  . HIS A 1 35  ? 1.590   13.730  -17.562 1.00 1.00 ? 35  HIS A CD2  1  
ATOM 551   C CE1  . HIS A 1 35  ? -0.314  14.366  -18.434 1.00 1.00 ? 35  HIS A CE1  1  
ATOM 552   N NE2  . HIS A 1 35  ? 0.934   14.796  -18.181 1.00 1.00 ? 35  HIS A NE2  1  
ATOM 553   H H    . HIS A 1 35  ? 2.935   11.762  -19.166 1.00 1.00 ? 35  HIS A H    1  
ATOM 554   H HA   . HIS A 1 35  ? 2.127   9.463   -17.461 1.00 1.00 ? 35  HIS A HA   1  
ATOM 555   H HB2  . HIS A 1 35  ? 0.113   10.778  -16.697 1.00 1.00 ? 35  HIS A HB2  1  
ATOM 556   H HB3  . HIS A 1 35  ? 1.630   11.396  -16.060 1.00 1.00 ? 35  HIS A HB3  1  
ATOM 557   H HD1  . HIS A 1 35  ? -1.312  12.542  -18.143 1.00 1.00 ? 35  HIS A HD1  1  
ATOM 558   H HD2  . HIS A 1 35  ? 2.613   13.735  -17.219 1.00 1.00 ? 35  HIS A HD2  1  
ATOM 559   H HE1  . HIS A 1 35  ? -1.088  14.964  -18.898 1.00 1.00 ? 35  HIS A HE1  1  
ATOM 560   N N    . LEU A 1 36  ? 0.117   9.008   -19.067 1.00 1.00 ? 36  LEU A N    1  
ATOM 561   C CA   . LEU A 1 36  ? -0.889  8.677   -20.086 1.00 1.00 ? 36  LEU A CA   1  
ATOM 562   C C    . LEU A 1 36  ? -2.218  9.345   -19.702 1.00 1.00 ? 36  LEU A C    1  
ATOM 563   O O    . LEU A 1 36  ? -2.698  9.146   -18.589 1.00 1.00 ? 36  LEU A O    1  
ATOM 564   C CB   . LEU A 1 36  ? -1.006  7.137   -20.155 1.00 1.00 ? 36  LEU A CB   1  
ATOM 565   C CG   . LEU A 1 36  ? -1.969  6.593   -21.230 1.00 1.00 ? 36  LEU A CG   1  
ATOM 566   C CD1  . LEU A 1 36  ? -1.425  6.830   -22.647 1.00 1.00 ? 36  LEU A CD1  1  
ATOM 567   C CD2  . LEU A 1 36  ? -2.182  5.090   -21.010 1.00 1.00 ? 36  LEU A CD2  1  
ATOM 568   H H    . LEU A 1 36  ? 0.045   8.523   -18.180 1.00 1.00 ? 36  LEU A H    1  
ATOM 569   H HA   . LEU A 1 36  ? -0.571  9.064   -21.056 1.00 1.00 ? 36  LEU A HA   1  
ATOM 570   H HB2  . LEU A 1 36  ? -0.012  6.721   -20.342 1.00 1.00 ? 36  LEU A HB2  1  
ATOM 571   H HB3  . LEU A 1 36  ? -1.337  6.776   -19.178 1.00 1.00 ? 36  LEU A HB3  1  
ATOM 572   H HG   . LEU A 1 36  ? -2.936  7.088   -21.137 1.00 1.00 ? 36  LEU A HG   1  
ATOM 573   H HD11 . LEU A 1 36  ? -0.447  6.360   -22.754 1.00 1.00 ? 36  LEU A HD11 1  
ATOM 574   H HD12 . LEU A 1 36  ? -2.104  6.405   -23.386 1.00 1.00 ? 36  LEU A HD12 1  
ATOM 575   H HD13 . LEU A 1 36  ? -1.328  7.894   -22.836 1.00 1.00 ? 36  LEU A HD13 1  
ATOM 576   H HD21 . LEU A 1 36  ? -1.235  4.556   -21.080 1.00 1.00 ? 36  LEU A HD21 1  
ATOM 577   H HD22 . LEU A 1 36  ? -2.616  4.914   -20.026 1.00 1.00 ? 36  LEU A HD22 1  
ATOM 578   H HD23 . LEU A 1 36  ? -2.868  4.699   -21.761 1.00 1.00 ? 36  LEU A HD23 1  
ATOM 579   N N    . ALA A 1 37  ? -2.836  10.108  -20.607 1.00 1.00 ? 37  ALA A N    1  
ATOM 580   C CA   . ALA A 1 37  ? -4.187  10.642  -20.416 1.00 1.00 ? 37  ALA A CA   1  
ATOM 581   C C    . ALA A 1 37  ? -5.219  9.527   -20.699 1.00 1.00 ? 37  ALA A C    1  
ATOM 582   O O    . ALA A 1 37  ? -5.100  8.890   -21.749 1.00 1.00 ? 37  ALA A O    1  
ATOM 583   C CB   . ALA A 1 37  ? -4.359  11.855  -21.338 1.00 1.00 ? 37  ALA A CB   1  
ATOM 584   H H    . ALA A 1 37  ? -2.401  10.248  -21.518 1.00 1.00 ? 37  ALA A H    1  
ATOM 585   H HA   . ALA A 1 37  ? -4.286  10.984  -19.385 1.00 1.00 ? 37  ALA A HA   1  
ATOM 586   H HB1  . ALA A 1 37  ? -3.631  12.620  -21.065 1.00 1.00 ? 37  ALA A HB1  1  
ATOM 587   H HB2  . ALA A 1 37  ? -4.201  11.578  -22.384 1.00 1.00 ? 37  ALA A HB2  1  
ATOM 588   H HB3  . ALA A 1 37  ? -5.362  12.268  -21.225 1.00 1.00 ? 37  ALA A HB3  1  
ATOM 589   N N    . PRO A 1 38  ? -6.201  9.263   -19.810 1.00 1.00 ? 38  PRO A N    1  
ATOM 590   C CA   . PRO A 1 38  ? -7.122  8.139   -19.960 1.00 1.00 ? 38  PRO A CA   1  
ATOM 591   C C    . PRO A 1 38  ? -8.154  8.384   -21.084 1.00 1.00 ? 38  PRO A C    1  
ATOM 592   O O    . PRO A 1 38  ? -8.542  9.535   -21.304 1.00 1.00 ? 38  PRO A O    1  
ATOM 593   C CB   . PRO A 1 38  ? -7.796  7.973   -18.593 1.00 1.00 ? 38  PRO A CB   1  
ATOM 594   C CG   . PRO A 1 38  ? -7.759  9.384   -18.006 1.00 1.00 ? 38  PRO A CG   1  
ATOM 595   C CD   . PRO A 1 38  ? -6.443  9.944   -18.545 1.00 1.00 ? 38  PRO A CD   1  
ATOM 596   H HA   . PRO A 1 38  ? -6.538  7.244   -20.170 1.00 1.00 ? 38  PRO A HA   1  
ATOM 597   H HB2  . PRO A 1 38  ? -8.817  7.598   -18.678 1.00 1.00 ? 38  PRO A HB2  1  
ATOM 598   H HB3  . PRO A 1 38  ? -7.198  7.306   -17.972 1.00 1.00 ? 38  PRO A HB3  1  
ATOM 599   H HG2  . PRO A 1 38  ? -8.594  9.967   -18.399 1.00 1.00 ? 38  PRO A HG2  1  
ATOM 600   H HG3  . PRO A 1 38  ? -7.778  9.371   -16.917 1.00 1.00 ? 38  PRO A HG3  1  
ATOM 601   H HD2  . PRO A 1 38  ? -6.527  11.024  -18.684 1.00 1.00 ? 38  PRO A HD2  1  
ATOM 602   H HD3  . PRO A 1 38  ? -5.638  9.713   -17.844 1.00 1.00 ? 38  PRO A HD3  1  
ATOM 603   N N    . PRO A 1 39  ? -8.623  7.324   -21.778 1.00 1.00 ? 39  PRO A N    1  
ATOM 604   C CA   . PRO A 1 39  ? -9.632  7.409   -22.830 1.00 1.00 ? 39  PRO A CA   1  
ATOM 605   C C    . PRO A 1 39  ? -11.057 7.272   -22.262 1.00 1.00 ? 39  PRO A C    1  
ATOM 606   O O    . PRO A 1 39  ? -11.271 7.324   -21.052 1.00 1.00 ? 39  PRO A O    1  
ATOM 607   C CB   . PRO A 1 39  ? -9.271  6.267   -23.778 1.00 1.00 ? 39  PRO A CB   1  
ATOM 608   C CG   . PRO A 1 39  ? -8.770  5.183   -22.835 1.00 1.00 ? 39  PRO A CG   1  
ATOM 609   C CD   . PRO A 1 39  ? -8.178  5.940   -21.644 1.00 1.00 ? 39  PRO A CD   1  
ATOM 610   H HA   . PRO A 1 39  ? -9.556  8.348   -23.378 1.00 1.00 ? 39  PRO A HA   1  
ATOM 611   H HB2  . PRO A 1 39  ? -10.109 5.923   -24.384 1.00 1.00 ? 39  PRO A HB2  1  
ATOM 612   H HB3  . PRO A 1 39  ? -8.456  6.586   -24.424 1.00 1.00 ? 39  PRO A HB3  1  
ATOM 613   H HG2  . PRO A 1 39  ? -9.608  4.577   -22.502 1.00 1.00 ? 39  PRO A HG2  1  
ATOM 614   H HG3  . PRO A 1 39  ? -8.015  4.580   -23.337 1.00 1.00 ? 39  PRO A HG3  1  
ATOM 615   H HD2  . PRO A 1 39  ? -8.546  5.509   -20.710 1.00 1.00 ? 39  PRO A HD2  1  
ATOM 616   H HD3  . PRO A 1 39  ? -7.092  5.876   -21.673 1.00 1.00 ? 39  PRO A HD3  1  
ATOM 617   N N    . SER A 1 40  ? -12.048 7.086   -23.140 1.00 1.00 ? 40  SER A N    1  
ATOM 618   C CA   . SER A 1 40  ? -13.470 6.969   -22.786 1.00 1.00 ? 40  SER A CA   1  
ATOM 619   C C    . SER A 1 40  ? -14.234 6.040   -23.757 1.00 1.00 ? 40  SER A C    1  
ATOM 620   O O    . SER A 1 40  ? -13.648 5.446   -24.664 1.00 1.00 ? 40  SER A O    1  
ATOM 621   C CB   . SER A 1 40  ? -14.068 8.388   -22.723 1.00 1.00 ? 40  SER A CB   1  
ATOM 622   O OG   . SER A 1 40  ? -15.401 8.381   -22.215 1.00 1.00 ? 40  SER A OG   1  
ATOM 623   H H    . SER A 1 40  ? -11.823 7.054   -24.134 1.00 1.00 ? 40  SER A H    1  
ATOM 624   H HA   . SER A 1 40  ? -13.561 6.531   -21.793 1.00 1.00 ? 40  SER A HA   1  
ATOM 625   H HB2  . SER A 1 40  ? -13.447 9.000   -22.064 1.00 1.00 ? 40  SER A HB2  1  
ATOM 626   H HB3  . SER A 1 40  ? -14.055 8.836   -23.717 1.00 1.00 ? 40  SER A HB3  1  
ATOM 627   H HG   . SER A 1 40  ? -15.694 9.303   -22.033 1.00 1.00 ? 40  SER A HG   1  
ATOM 628   N N    . GLU A 1 41  ? -15.552 5.915   -23.579 1.00 1.00 ? 41  GLU A N    1  
ATOM 629   C CA   . GLU A 1 41  ? -16.473 5.090   -24.378 1.00 1.00 ? 41  GLU A CA   1  
ATOM 630   C C    . GLU A 1 41  ? -17.133 5.883   -25.529 1.00 1.00 ? 41  GLU A C    1  
ATOM 631   O O    . GLU A 1 41  ? -18.024 5.373   -26.204 1.00 1.00 ? 41  GLU A O    1  
ATOM 632   C CB   . GLU A 1 41  ? -17.570 4.526   -23.449 1.00 1.00 ? 41  GLU A CB   1  
ATOM 633   C CG   . GLU A 1 41  ? -17.040 3.649   -22.307 1.00 1.00 ? 41  GLU A CG   1  
ATOM 634   C CD   . GLU A 1 41  ? -18.196 3.143   -21.430 1.00 1.00 ? 41  GLU A CD   1  
ATOM 635   O OE1  . GLU A 1 41  ? -18.576 3.839   -20.457 1.00 1.00 ? 41  GLU A OE1  1  
ATOM 636   O OE2  . GLU A 1 41  ? -18.730 2.040   -21.698 1.00 1.00 ? 41  GLU A OE2  1  
ATOM 637   H H    . GLU A 1 41  ? -15.961 6.480   -22.839 1.00 1.00 ? 41  GLU A H    1  
ATOM 638   H HA   . GLU A 1 41  ? -15.921 4.257   -24.817 1.00 1.00 ? 41  GLU A HA   1  
ATOM 639   H HB2  . GLU A 1 41  ? -18.131 5.359   -23.024 1.00 1.00 ? 41  GLU A HB2  1  
ATOM 640   H HB3  . GLU A 1 41  ? -18.257 3.920   -24.042 1.00 1.00 ? 41  GLU A HB3  1  
ATOM 641   H HG2  . GLU A 1 41  ? -16.504 2.801   -22.732 1.00 1.00 ? 41  GLU A HG2  1  
ATOM 642   H HG3  . GLU A 1 41  ? -16.341 4.222   -21.694 1.00 1.00 ? 41  GLU A HG3  1  
ATOM 643   N N    . TYR A 1 42  ? -16.709 7.133   -25.777 1.00 1.00 ? 42  TYR A N    1  
ATOM 644   C CA   . TYR A 1 42  ? -17.386 8.095   -26.670 1.00 1.00 ? 42  TYR A CA   1  
ATOM 645   C C    . TYR A 1 42  ? -18.056 7.597   -27.978 1.00 1.00 ? 42  TYR A C    1  
ATOM 646   O O    . TYR A 1 42  ? -19.240 7.892   -28.146 1.00 1.00 ? 42  TYR A O    1  
ATOM 647   C CB   . TYR A 1 42  ? -16.554 9.381   -26.849 1.00 1.00 ? 42  TYR A CB   1  
ATOM 648   C CG   . TYR A 1 42  ? -17.369 10.654  -27.046 1.00 1.00 ? 42  TYR A CG   1  
ATOM 649   C CD1  . TYR A 1 42  ? -18.385 11.000  -26.130 1.00 1.00 ? 42  TYR A CD1  1  
ATOM 650   C CD2  . TYR A 1 42  ? -17.068 11.537  -28.103 1.00 1.00 ? 42  TYR A CD2  1  
ATOM 651   C CE1  . TYR A 1 42  ? -19.124 12.188  -26.295 1.00 1.00 ? 42  TYR A CE1  1  
ATOM 652   C CE2  . TYR A 1 42  ? -17.796 12.732  -28.270 1.00 1.00 ? 42  TYR A CE2  1  
ATOM 653   C CZ   . TYR A 1 42  ? -18.836 13.058  -27.369 1.00 1.00 ? 42  TYR A CZ   1  
ATOM 654   O OH   . TYR A 1 42  ? -19.550 14.212  -27.518 1.00 1.00 ? 42  TYR A OH   1  
ATOM 655   H H    . TYR A 1 42  ? -16.007 7.502   -25.149 1.00 1.00 ? 42  TYR A H    1  
ATOM 656   H HA   . TYR A 1 42  ? -18.215 8.383   -26.063 1.00 1.00 ? 42  TYR A HA   1  
ATOM 657   H HB2  . TYR A 1 42  ? -15.948 9.538   -25.954 1.00 1.00 ? 42  TYR A HB2  1  
ATOM 658   H HB3  . TYR A 1 42  ? -15.879 9.249   -27.694 1.00 1.00 ? 42  TYR A HB3  1  
ATOM 659   H HD1  . TYR A 1 42  ? -18.607 10.360  -25.289 1.00 1.00 ? 42  TYR A HD1  1  
ATOM 660   H HD2  . TYR A 1 42  ? -16.267 11.305  -28.789 1.00 1.00 ? 42  TYR A HD2  1  
ATOM 661   H HE1  . TYR A 1 42  ? -19.909 12.439  -25.595 1.00 1.00 ? 42  TYR A HE1  1  
ATOM 662   H HE2  . TYR A 1 42  ? -17.554 13.404  -29.080 1.00 1.00 ? 42  TYR A HE2  1  
ATOM 663   H HH   . TYR A 1 42  ? -19.265 14.746  -28.278 1.00 1.00 ? 42  TYR A HH   1  
ATOM 664   N N    . PRO A 1 43  ? -17.396 6.815   -28.861 1.00 1.00 ? 43  PRO A N    1  
ATOM 665   C CA   . PRO A 1 43  ? -17.989 6.345   -30.120 1.00 1.00 ? 43  PRO A CA   1  
ATOM 666   C C    . PRO A 1 43  ? -19.141 5.342   -29.937 1.00 1.00 ? 43  PRO A C    1  
ATOM 667   O O    . PRO A 1 43  ? -19.889 5.105   -30.885 1.00 1.00 ? 43  PRO A O    1  
ATOM 668   C CB   . PRO A 1 43  ? -16.829 5.736   -30.916 1.00 1.00 ? 43  PRO A CB   1  
ATOM 669   C CG   . PRO A 1 43  ? -15.835 5.304   -29.840 1.00 1.00 ? 43  PRO A CG   1  
ATOM 670   C CD   . PRO A 1 43  ? -16.023 6.357   -28.750 1.00 1.00 ? 43  PRO A CD   1  
ATOM 671   H HA   . PRO A 1 43  ? -18.375 7.196   -30.678 1.00 1.00 ? 43  PRO A HA   1  
ATOM 672   H HB2  . PRO A 1 43  ? -17.144 4.889   -31.527 1.00 1.00 ? 43  PRO A HB2  1  
ATOM 673   H HB3  . PRO A 1 43  ? -16.379 6.502   -31.548 1.00 1.00 ? 43  PRO A HB3  1  
ATOM 674   H HG2  . PRO A 1 43  ? -16.120 4.324   -29.458 1.00 1.00 ? 43  PRO A HG2  1  
ATOM 675   H HG3  . PRO A 1 43  ? -14.813 5.290   -30.217 1.00 1.00 ? 43  PRO A HG3  1  
ATOM 676   H HD2  . PRO A 1 43  ? -15.838 5.908   -27.779 1.00 1.00 ? 43  PRO A HD2  1  
ATOM 677   H HD3  . PRO A 1 43  ? -15.356 7.198   -28.907 1.00 1.00 ? 43  PRO A HD3  1  
ATOM 678   N N    . GLY A 1 44  ? -19.304 4.767   -28.736 1.00 1.00 ? 44  GLY A N    1  
ATOM 679   C CA   . GLY A 1 44  ? -20.389 3.859   -28.359 1.00 1.00 ? 44  GLY A CA   1  
ATOM 680   C C    . GLY A 1 44  ? -21.266 4.407   -27.227 1.00 1.00 ? 44  GLY A C    1  
ATOM 681   O O    . GLY A 1 44  ? -21.895 3.614   -26.525 1.00 1.00 ? 44  GLY A O    1  
ATOM 682   H H    . GLY A 1 44  ? -18.668 5.015   -27.984 1.00 1.00 ? 44  GLY A H    1  
ATOM 683   H HA2  . GLY A 1 44  ? -21.028 3.645   -29.215 1.00 1.00 ? 44  GLY A HA2  1  
ATOM 684   H HA3  . GLY A 1 44  ? -19.948 2.929   -28.000 1.00 1.00 ? 44  GLY A HA3  1  
ATOM 685   N N    . ALA A 1 45  ? -21.296 5.734   -27.024 1.00 1.00 ? 45  ALA A N    1  
ATOM 686   C CA   . ALA A 1 45  ? -22.125 6.387   -26.004 1.00 1.00 ? 45  ALA A CA   1  
ATOM 687   C C    . ALA A 1 45  ? -23.621 6.036   -26.163 1.00 1.00 ? 45  ALA A C    1  
ATOM 688   O O    . ALA A 1 45  ? -24.118 5.857   -27.280 1.00 1.00 ? 45  ALA A O    1  
ATOM 689   C CB   . ALA A 1 45  ? -21.883 7.903   -26.040 1.00 1.00 ? 45  ALA A CB   1  
ATOM 690   H H    . ALA A 1 45  ? -20.732 6.320   -27.625 1.00 1.00 ? 45  ALA A H    1  
ATOM 691   H HA   . ALA A 1 45  ? -21.806 6.014   -25.026 1.00 1.00 ? 45  ALA A HA   1  
ATOM 692   H HB1  . ALA A 1 45  ? -22.445 8.387   -25.240 1.00 1.00 ? 45  ALA A HB1  1  
ATOM 693   H HB2  . ALA A 1 45  ? -20.824 8.120   -25.896 1.00 1.00 ? 45  ALA A HB2  1  
ATOM 694   H HB3  . ALA A 1 45  ? -22.207 8.311   -26.997 1.00 1.00 ? 45  ALA A HB3  1  
ATOM 695   N N    . GLY A 1 46  ? -24.341 5.947   -25.037 1.00 1.00 ? 46  GLY A N    1  
ATOM 696   C CA   . GLY A 1 46  ? -25.709 5.415   -24.978 1.00 1.00 ? 46  GLY A CA   1  
ATOM 697   C C    . GLY A 1 46  ? -26.685 6.115   -25.926 1.00 1.00 ? 46  GLY A C    1  
ATOM 698   O O    . GLY A 1 46  ? -26.759 7.342   -25.955 1.00 1.00 ? 46  GLY A O    1  
ATOM 699   H H    . GLY A 1 46  ? -23.885 6.164   -24.161 1.00 1.00 ? 46  GLY A H    1  
ATOM 700   H HA2  . GLY A 1 46  ? -25.664 4.359   -25.240 1.00 1.00 ? 46  GLY A HA2  1  
ATOM 701   H HA3  . GLY A 1 46  ? -26.093 5.494   -23.962 1.00 1.00 ? 46  GLY A HA3  1  
ATOM 702   N N    . SER A 1 47  ? -27.410 5.312   -26.714 1.00 1.00 ? 47  SER A N    1  
ATOM 703   C CA   . SER A 1 47  ? -28.412 5.723   -27.725 1.00 1.00 ? 47  SER A CA   1  
ATOM 704   C C    . SER A 1 47  ? -27.780 6.257   -29.040 1.00 1.00 ? 47  SER A C    1  
ATOM 705   O O    . SER A 1 47  ? -28.493 6.580   -29.996 1.00 1.00 ? 47  SER A O    1  
ATOM 706   C CB   . SER A 1 47  ? -29.421 6.724   -27.124 1.00 1.00 ? 47  SER A CB   1  
ATOM 707   O OG   . SER A 1 47  ? -30.694 6.647   -27.761 1.00 1.00 ? 47  SER A OG   1  
ATOM 708   H H    . SER A 1 47  ? -27.272 4.316   -26.601 1.00 1.00 ? 47  SER A H    1  
ATOM 709   H HA   . SER A 1 47  ? -28.980 4.836   -28.005 1.00 1.00 ? 47  SER A HA   1  
ATOM 710   H HB2  . SER A 1 47  ? -29.553 6.495   -26.067 1.00 1.00 ? 47  SER A HB2  1  
ATOM 711   H HB3  . SER A 1 47  ? -29.023 7.740   -27.206 1.00 1.00 ? 47  SER A HB3  1  
ATOM 712   H HG   . SER A 1 47  ? -31.303 7.306   -27.354 1.00 1.00 ? 47  SER A HG   1  
ATOM 713   N N    . SER A 1 48  ? -26.446 6.337   -29.125 1.00 1.00 ? 48  SER A N    1  
ATOM 714   C CA   . SER A 1 48  ? -25.689 6.846   -30.282 1.00 1.00 ? 48  SER A CA   1  
ATOM 715   C C    . SER A 1 48  ? -24.676 5.813   -30.836 1.00 1.00 ? 48  SER A C    1  
ATOM 716   O O    . SER A 1 48  ? -24.458 4.742   -30.262 1.00 1.00 ? 48  SER A O    1  
ATOM 717   C CB   . SER A 1 48  ? -24.952 8.140   -29.887 1.00 1.00 ? 48  SER A CB   1  
ATOM 718   O OG   . SER A 1 48  ? -25.837 9.157   -29.422 1.00 1.00 ? 48  SER A OG   1  
ATOM 719   H H    . SER A 1 48  ? -25.895 6.009   -28.338 1.00 1.00 ? 48  SER A H    1  
ATOM 720   H HA   . SER A 1 48  ? -26.370 7.094   -31.098 1.00 1.00 ? 48  SER A HA   1  
ATOM 721   H HB2  . SER A 1 48  ? -24.214 7.913   -29.116 1.00 1.00 ? 48  SER A HB2  1  
ATOM 722   H HB3  . SER A 1 48  ? -24.420 8.523   -30.758 1.00 1.00 ? 48  SER A HB3  1  
ATOM 723   H HG   . SER A 1 48  ? -26.282 8.855   -28.601 1.00 1.00 ? 48  SER A HG   1  
ATOM 724   N N    . SER A 1 49  ? -24.027 6.136   -31.961 1.00 1.00 ? 49  SER A N    1  
ATOM 725   C CA   . SER A 1 49  ? -22.936 5.351   -32.568 1.00 1.00 ? 49  SER A CA   1  
ATOM 726   C C    . SER A 1 49  ? -22.022 6.264   -33.413 1.00 1.00 ? 49  SER A C    1  
ATOM 727   O O    . SER A 1 49  ? -22.215 7.480   -33.438 1.00 1.00 ? 49  SER A O    1  
ATOM 728   C CB   . SER A 1 49  ? -23.515 4.188   -33.396 1.00 1.00 ? 49  SER A CB   1  
ATOM 729   O OG   . SER A 1 49  ? -22.482 3.322   -33.864 1.00 1.00 ? 49  SER A OG   1  
ATOM 730   H H    . SER A 1 49  ? -24.237 7.024   -32.414 1.00 1.00 ? 49  SER A H    1  
ATOM 731   H HA   . SER A 1 49  ? -22.318 4.920   -31.780 1.00 1.00 ? 49  SER A HA   1  
ATOM 732   H HB2  . SER A 1 49  ? -24.200 3.614   -32.770 1.00 1.00 ? 49  SER A HB2  1  
ATOM 733   H HB3  . SER A 1 49  ? -24.077 4.590   -34.242 1.00 1.00 ? 49  SER A HB3  1  
ATOM 734   H HG   . SER A 1 49  ? -22.886 2.512   -34.252 1.00 1.00 ? 49  SER A HG   1  
ATOM 735   N N    . VAL A 1 50  ? -21.047 5.703   -34.134 1.00 1.00 ? 50  VAL A N    1  
ATOM 736   C CA   . VAL A 1 50  ? -19.983 6.447   -34.851 1.00 1.00 ? 50  VAL A CA   1  
ATOM 737   C C    . VAL A 1 50  ? -20.496 7.507   -35.848 1.00 1.00 ? 50  VAL A C    1  
ATOM 738   O O    . VAL A 1 50  ? -19.770 8.447   -36.172 1.00 1.00 ? 50  VAL A O    1  
ATOM 739   C CB   . VAL A 1 50  ? -18.995 5.505   -35.580 1.00 1.00 ? 50  VAL A CB   1  
ATOM 740   C CG1  . VAL A 1 50  ? -18.234 4.629   -34.576 1.00 1.00 ? 50  VAL A CG1  1  
ATOM 741   C CG2  . VAL A 1 50  ? -19.666 4.622   -36.645 1.00 1.00 ? 50  VAL A CG2  1  
ATOM 742   H H    . VAL A 1 50  ? -21.022 4.682   -34.113 1.00 1.00 ? 50  VAL A H    1  
ATOM 743   H HA   . VAL A 1 50  ? -19.415 6.978   -34.085 1.00 1.00 ? 50  VAL A HA   1  
ATOM 744   H HB   . VAL A 1 50  ? -18.252 6.122   -36.085 1.00 1.00 ? 50  VAL A HB   1  
ATOM 745   H HG11 . VAL A 1 50  ? -17.729 5.267   -33.851 1.00 1.00 ? 50  VAL A HG11 1  
ATOM 746   H HG12 . VAL A 1 50  ? -18.914 3.953   -34.055 1.00 1.00 ? 50  VAL A HG12 1  
ATOM 747   H HG13 . VAL A 1 50  ? -17.481 4.036   -35.099 1.00 1.00 ? 50  VAL A HG13 1  
ATOM 748   H HG21 . VAL A 1 50  ? -20.147 5.241   -37.400 1.00 1.00 ? 50  VAL A HG21 1  
ATOM 749   H HG22 . VAL A 1 50  ? -18.914 4.000   -37.136 1.00 1.00 ? 50  VAL A HG22 1  
ATOM 750   H HG23 . VAL A 1 50  ? -20.413 3.970   -36.190 1.00 1.00 ? 50  VAL A HG23 1  
ATOM 751   N N    . PHE A 1 51  ? -21.747 7.379   -36.310 1.00 1.00 ? 51  PHE A N    1  
ATOM 752   C CA   . PHE A 1 51  ? -22.407 8.336   -37.209 1.00 1.00 ? 51  PHE A CA   1  
ATOM 753   C C    . PHE A 1 51  ? -23.076 9.513   -36.466 1.00 1.00 ? 51  PHE A C    1  
ATOM 754   O O    . PHE A 1 51  ? -23.313 10.561  -37.067 1.00 1.00 ? 51  PHE A O    1  
ATOM 755   C CB   . PHE A 1 51  ? -23.439 7.571   -38.055 1.00 1.00 ? 51  PHE A CB   1  
ATOM 756   C CG   . PHE A 1 51  ? -22.868 6.374   -38.798 1.00 1.00 ? 51  PHE A CG   1  
ATOM 757   C CD1  . PHE A 1 51  ? -21.999 6.570   -39.889 1.00 1.00 ? 51  PHE A CD1  1  
ATOM 758   C CD2  . PHE A 1 51  ? -23.181 5.065   -38.383 1.00 1.00 ? 51  PHE A CD2  1  
ATOM 759   C CE1  . PHE A 1 51  ? -21.441 5.464   -40.559 1.00 1.00 ? 51  PHE A CE1  1  
ATOM 760   C CE2  . PHE A 1 51  ? -22.626 3.960   -39.053 1.00 1.00 ? 51  PHE A CE2  1  
ATOM 761   C CZ   . PHE A 1 51  ? -21.754 4.159   -40.137 1.00 1.00 ? 51  PHE A CZ   1  
ATOM 762   H H    . PHE A 1 51  ? -22.282 6.576   -36.005 1.00 1.00 ? 51  PHE A H    1  
ATOM 763   H HA   . PHE A 1 51  ? -21.661 8.761   -37.882 1.00 1.00 ? 51  PHE A HA   1  
ATOM 764   H HB2  . PHE A 1 51  ? -24.253 7.235   -37.409 1.00 1.00 ? 51  PHE A HB2  1  
ATOM 765   H HB3  . PHE A 1 51  ? -23.867 8.255   -38.789 1.00 1.00 ? 51  PHE A HB3  1  
ATOM 766   H HD1  . PHE A 1 51  ? -21.752 7.572   -40.209 1.00 1.00 ? 51  PHE A HD1  1  
ATOM 767   H HD2  . PHE A 1 51  ? -23.845 4.901   -37.547 1.00 1.00 ? 51  PHE A HD2  1  
ATOM 768   H HE1  . PHE A 1 51  ? -20.772 5.616   -41.395 1.00 1.00 ? 51  PHE A HE1  1  
ATOM 769   H HE2  . PHE A 1 51  ? -22.868 2.956   -38.729 1.00 1.00 ? 51  PHE A HE2  1  
ATOM 770   H HZ   . PHE A 1 51  ? -21.325 3.308   -40.649 1.00 1.00 ? 51  PHE A HZ   1  
ATOM 771   N N    . SER A 1 52  ? -23.387 9.354   -35.176 1.00 1.00 ? 52  SER A N    1  
ATOM 772   C CA   . SER A 1 52  ? -24.131 10.318  -34.346 1.00 1.00 ? 52  SER A CA   1  
ATOM 773   C C    . SER A 1 52  ? -23.360 10.813  -33.100 1.00 1.00 ? 52  SER A C    1  
ATOM 774   O O    . SER A 1 52  ? -23.745 11.826  -32.511 1.00 1.00 ? 52  SER A O    1  
ATOM 775   C CB   . SER A 1 52  ? -25.467 9.681   -33.935 1.00 1.00 ? 52  SER A CB   1  
ATOM 776   O OG   . SER A 1 52  ? -25.305 8.371   -33.388 1.00 1.00 ? 52  SER A OG   1  
ATOM 777   H H    . SER A 1 52  ? -23.193 8.450   -34.755 1.00 1.00 ? 52  SER A H    1  
ATOM 778   H HA   . SER A 1 52  ? -24.364 11.209  -34.930 1.00 1.00 ? 52  SER A HA   1  
ATOM 779   H HB2  . SER A 1 52  ? -25.969 10.322  -33.210 1.00 1.00 ? 52  SER A HB2  1  
ATOM 780   H HB3  . SER A 1 52  ? -26.099 9.612   -34.822 1.00 1.00 ? 52  SER A HB3  1  
ATOM 781   H HG   . SER A 1 52  ? -26.160 7.897   -33.497 1.00 1.00 ? 52  SER A HG   1  
ATOM 782   N N    . VAL A 1 53  ? -22.252 10.162  -32.727 1.00 1.00 ? 53  VAL A N    1  
ATOM 783   C CA   . VAL A 1 53  ? -21.289 10.601  -31.702 1.00 1.00 ? 53  VAL A CA   1  
ATOM 784   C C    . VAL A 1 53  ? -19.859 10.287  -32.161 1.00 1.00 ? 53  VAL A C    1  
ATOM 785   O O    . VAL A 1 53  ? -19.628 9.287   -32.841 1.00 1.00 ? 53  VAL A O    1  
ATOM 786   C CB   . VAL A 1 53  ? -21.616 9.989   -30.315 1.00 1.00 ? 53  VAL A CB   1  
ATOM 787   C CG1  . VAL A 1 53  ? -21.476 8.457   -30.275 1.00 1.00 ? 53  VAL A CG1  1  
ATOM 788   C CG2  . VAL A 1 53  ? -20.771 10.633  -29.205 1.00 1.00 ? 53  VAL A CG2  1  
ATOM 789   H H    . VAL A 1 53  ? -22.049 9.277   -33.194 1.00 1.00 ? 53  VAL A H    1  
ATOM 790   H HA   . VAL A 1 53  ? -21.366 11.685  -31.615 1.00 1.00 ? 53  VAL A HA   1  
ATOM 791   H HB   . VAL A 1 53  ? -22.660 10.226  -30.088 1.00 1.00 ? 53  VAL A HB   1  
ATOM 792   H HG11 . VAL A 1 53  ? -21.716 8.088   -29.278 1.00 1.00 ? 53  VAL A HG11 1  
ATOM 793   H HG12 . VAL A 1 53  ? -22.170 8.006   -30.975 1.00 1.00 ? 53  VAL A HG12 1  
ATOM 794   H HG13 . VAL A 1 53  ? -20.461 8.159   -30.533 1.00 1.00 ? 53  VAL A HG13 1  
ATOM 795   H HG21 . VAL A 1 53  ? -19.722 10.371  -29.323 1.00 1.00 ? 53  VAL A HG21 1  
ATOM 796   H HG22 . VAL A 1 53  ? -20.880 11.717  -29.236 1.00 1.00 ? 53  VAL A HG22 1  
ATOM 797   H HG23 . VAL A 1 53  ? -21.110 10.277  -28.231 1.00 1.00 ? 53  VAL A HG23 1  
ATOM 798   N N    . LEU A 1 54  ? -18.908 11.168  -31.831 1.00 1.00 ? 54  LEU A N    1  
ATOM 799   C CA   . LEU A 1 54  ? -17.520 11.102  -32.310 1.00 1.00 ? 54  LEU A CA   1  
ATOM 800   C C    . LEU A 1 54  ? -16.663 10.093  -31.521 1.00 1.00 ? 54  LEU A C    1  
ATOM 801   O O    . LEU A 1 54  ? -17.093 9.498   -30.531 1.00 1.00 ? 54  LEU A O    1  
ATOM 802   C CB   . LEU A 1 54  ? -16.904 12.521  -32.287 1.00 1.00 ? 54  LEU A CB   1  
ATOM 803   C CG   . LEU A 1 54  ? -17.667 13.595  -33.096 1.00 1.00 ? 54  LEU A CG   1  
ATOM 804   C CD1  . LEU A 1 54  ? -16.943 14.940  -32.955 1.00 1.00 ? 54  LEU A CD1  1  
ATOM 805   C CD2  . LEU A 1 54  ? -17.786 13.228  -34.583 1.00 1.00 ? 54  LEU A CD2  1  
ATOM 806   H H    . LEU A 1 54  ? -19.162 11.951  -31.245 1.00 1.00 ? 54  LEU A H    1  
ATOM 807   H HA   . LEU A 1 54  ? -17.524 10.750  -33.343 1.00 1.00 ? 54  LEU A HA   1  
ATOM 808   H HB2  . LEU A 1 54  ? -16.834 12.850  -31.251 1.00 1.00 ? 54  LEU A HB2  1  
ATOM 809   H HB3  . LEU A 1 54  ? -15.886 12.467  -32.677 1.00 1.00 ? 54  LEU A HB3  1  
ATOM 810   H HG   . LEU A 1 54  ? -18.673 13.709  -32.688 1.00 1.00 ? 54  LEU A HG   1  
ATOM 811   H HD11 . LEU A 1 54  ? -17.495 15.715  -33.490 1.00 1.00 ? 54  LEU A HD11 1  
ATOM 812   H HD12 . LEU A 1 54  ? -16.884 15.217  -31.902 1.00 1.00 ? 54  LEU A HD12 1  
ATOM 813   H HD13 . LEU A 1 54  ? -15.933 14.871  -33.364 1.00 1.00 ? 54  LEU A HD13 1  
ATOM 814   H HD21 . LEU A 1 54  ? -18.408 12.343  -34.703 1.00 1.00 ? 54  LEU A HD21 1  
ATOM 815   H HD22 . LEU A 1 54  ? -18.252 14.047  -35.133 1.00 1.00 ? 54  LEU A HD22 1  
ATOM 816   H HD23 . LEU A 1 54  ? -16.796 13.037  -35.000 1.00 1.00 ? 54  LEU A HD23 1  
ATOM 817   N N    . SER A 1 55  ? -15.424 9.889   -31.964 1.00 1.00 ? 55  SER A N    1  
ATOM 818   C CA   . SER A 1 55  ? -14.432 9.043   -31.290 1.00 1.00 ? 55  SER A CA   1  
ATOM 819   C C    . SER A 1 55  ? -13.645 9.774   -30.175 1.00 1.00 ? 55  SER A C    1  
ATOM 820   O O    . SER A 1 55  ? -13.833 10.965  -29.919 1.00 1.00 ? 55  SER A O    1  
ATOM 821   C CB   . SER A 1 55  ? -13.489 8.442   -32.345 1.00 1.00 ? 55  SER A CB   1  
ATOM 822   O OG   . SER A 1 55  ? -12.830 9.460   -33.092 1.00 1.00 ? 55  SER A OG   1  
ATOM 823   H H    . SER A 1 55  ? -15.097 10.408  -32.769 1.00 1.00 ? 55  SER A H    1  
ATOM 824   H HA   . SER A 1 55  ? -14.946 8.212   -30.814 1.00 1.00 ? 55  SER A HA   1  
ATOM 825   H HB2  . SER A 1 55  ? -12.753 7.806   -31.851 1.00 1.00 ? 55  SER A HB2  1  
ATOM 826   H HB3  . SER A 1 55  ? -14.077 7.817   -33.021 1.00 1.00 ? 55  SER A HB3  1  
ATOM 827   H HG   . SER A 1 55  ? -12.256 9.051   -33.778 1.00 1.00 ? 55  SER A HG   1  
ATOM 828   N N    . ASN A 1 56  ? -12.749 9.043   -29.499 1.00 1.00 ? 56  ASN A N    1  
ATOM 829   C CA   . ASN A 1 56  ? -11.793 9.559   -28.509 1.00 1.00 ? 56  ASN A CA   1  
ATOM 830   C C    . ASN A 1 56  ? -10.496 8.721   -28.518 1.00 1.00 ? 56  ASN A C    1  
ATOM 831   O O    . ASN A 1 56  ? -10.427 7.694   -29.192 1.00 1.00 ? 56  ASN A O    1  
ATOM 832   C CB   . ASN A 1 56  ? -12.454 9.577   -27.114 1.00 1.00 ? 56  ASN A CB   1  
ATOM 833   C CG   . ASN A 1 56  ? -12.638 8.180   -26.528 1.00 1.00 ? 56  ASN A CG   1  
ATOM 834   O OD1  . ASN A 1 56  ? -11.720 7.602   -25.963 1.00 1.00 ? 56  ASN A OD1  1  
ATOM 835   N ND2  . ASN A 1 56  ? -13.808 7.583   -26.648 1.00 1.00 ? 56  ASN A ND2  1  
ATOM 836   H H    . ASN A 1 56  ? -12.608 8.079   -29.769 1.00 1.00 ? 56  ASN A H    1  
ATOM 837   H HA   . ASN A 1 56  ? -11.525 10.582  -28.775 1.00 1.00 ? 56  ASN A HA   1  
ATOM 838   H HB2  . ASN A 1 56  ? -11.829 10.149  -26.427 1.00 1.00 ? 56  ASN A HB2  1  
ATOM 839   H HB3  . ASN A 1 56  ? -13.417 10.083  -27.173 1.00 1.00 ? 56  ASN A HB3  1  
ATOM 840   H HD21 . ASN A 1 56  ? -14.603 8.052   -27.063 1.00 1.00 ? 56  ASN A HD21 1  
ATOM 841   H HD22 . ASN A 1 56  ? -13.895 6.652   -26.252 1.00 1.00 ? 56  ASN A HD22 1  
ATOM 842   N N    . SER A 1 57  ? -9.484  9.097   -27.735 1.00 1.00 ? 57  SER A N    1  
ATOM 843   C CA   . SER A 1 57  ? -8.273  8.282   -27.530 1.00 1.00 ? 57  SER A CA   1  
ATOM 844   C C    . SER A 1 57  ? -7.470  8.712   -26.292 1.00 1.00 ? 57  SER A C    1  
ATOM 845   O O    . SER A 1 57  ? -7.651  9.808   -25.754 1.00 1.00 ? 57  SER A O    1  
ATOM 846   C CB   . SER A 1 57  ? -7.370  8.302   -28.780 1.00 1.00 ? 57  SER A CB   1  
ATOM 847   O OG   . SER A 1 57  ? -7.000  9.622   -29.173 1.00 1.00 ? 57  SER A OG   1  
ATOM 848   H H    . SER A 1 57  ? -9.559  9.956   -27.202 1.00 1.00 ? 57  SER A H    1  
ATOM 849   H HA   . SER A 1 57  ? -8.577  7.247   -27.365 1.00 1.00 ? 57  SER A HA   1  
ATOM 850   H HB2  . SER A 1 57  ? -6.467  7.731   -28.566 1.00 1.00 ? 57  SER A HB2  1  
ATOM 851   H HB3  . SER A 1 57  ? -7.883  7.806   -29.606 1.00 1.00 ? 57  SER A HB3  1  
ATOM 852   H HG   . SER A 1 57  ? -7.792  10.101  -29.500 1.00 1.00 ? 57  SER A HG   1  
ATOM 853   N N    . ALA A 1 58  ? -6.571  7.830   -25.846 1.00 1.00 ? 58  ALA A N    1  
ATOM 854   C CA   . ALA A 1 58  ? -5.563  8.120   -24.831 1.00 1.00 ? 58  ALA A CA   1  
ATOM 855   C C    . ALA A 1 58  ? -4.310  8.695   -25.505 1.00 1.00 ? 58  ALA A C    1  
ATOM 856   O O    . ALA A 1 58  ? -4.030  8.383   -26.662 1.00 1.00 ? 58  ALA A O    1  
ATOM 857   C CB   . ALA A 1 58  ? -5.274  6.813   -24.086 1.00 1.00 ? 58  ALA A CB   1  
ATOM 858   H H    . ALA A 1 58  ? -6.446  6.964   -26.363 1.00 1.00 ? 58  ALA A H    1  
ATOM 859   H HA   . ALA A 1 58  ? -5.928  8.861   -24.114 1.00 1.00 ? 58  ALA A HA   1  
ATOM 860   H HB1  . ALA A 1 58  ? -6.152  6.526   -23.518 1.00 1.00 ? 58  ALA A HB1  1  
ATOM 861   H HB2  . ALA A 1 58  ? -5.047  6.018   -24.794 1.00 1.00 ? 58  ALA A HB2  1  
ATOM 862   H HB3  . ALA A 1 58  ? -4.437  6.942   -23.399 1.00 1.00 ? 58  ALA A HB3  1  
ATOM 863   N N    . GLU A 1 59  ? -3.527  9.499   -24.784 1.00 1.00 ? 59  GLU A N    1  
ATOM 864   C CA   . GLU A 1 59  ? -2.306  10.110  -25.315 1.00 1.00 ? 59  GLU A CA   1  
ATOM 865   C C    . GLU A 1 59  ? -1.259  10.238  -24.217 1.00 1.00 ? 59  GLU A C    1  
ATOM 866   O O    . GLU A 1 59  ? -1.603  10.606  -23.096 1.00 1.00 ? 59  GLU A O    1  
ATOM 867   C CB   . GLU A 1 59  ? -2.616  11.492  -25.922 1.00 1.00 ? 59  GLU A CB   1  
ATOM 868   C CG   . GLU A 1 59  ? -1.458  11.993  -26.795 1.00 1.00 ? 59  GLU A CG   1  
ATOM 869   C CD   . GLU A 1 59  ? -1.862  13.240  -27.593 1.00 1.00 ? 59  GLU A CD   1  
ATOM 870   O OE1  . GLU A 1 59  ? -1.856  14.359  -27.029 1.00 1.00 ? 59  GLU A OE1  1  
ATOM 871   O OE2  . GLU A 1 59  ? -2.189  13.099  -28.796 1.00 1.00 ? 59  GLU A OE2  1  
ATOM 872   H H    . GLU A 1 59  ? -3.773  9.682   -23.820 1.00 1.00 ? 59  GLU A H    1  
ATOM 873   H HA   . GLU A 1 59  ? -1.906  9.468   -26.097 1.00 1.00 ? 59  GLU A HA   1  
ATOM 874   H HB2  . GLU A 1 59  ? -3.507  11.412  -26.544 1.00 1.00 ? 59  GLU A HB2  1  
ATOM 875   H HB3  . GLU A 1 59  ? -2.804  12.208  -25.117 1.00 1.00 ? 59  GLU A HB3  1  
ATOM 876   H HG2  . GLU A 1 59  ? -0.599  12.225  -26.165 1.00 1.00 ? 59  GLU A HG2  1  
ATOM 877   H HG3  . GLU A 1 59  ? -1.162  11.206  -27.489 1.00 1.00 ? 59  GLU A HG3  1  
ATOM 878   N N    . VAL A 1 60  ? 0.001   9.944   -24.526 1.00 1.00 ? 60  VAL A N    1  
ATOM 879   C CA   . VAL A 1 60  ? 1.111   10.204  -23.598 1.00 1.00 ? 60  VAL A CA   1  
ATOM 880   C C    . VAL A 1 60  ? 1.445   11.695  -23.638 1.00 1.00 ? 60  VAL A C    1  
ATOM 881   O O    . VAL A 1 60  ? 1.634   12.267  -24.710 1.00 1.00 ? 60  VAL A O    1  
ATOM 882   C CB   . VAL A 1 60  ? 2.362   9.375   -23.928 1.00 1.00 ? 60  VAL A CB   1  
ATOM 883   C CG1  . VAL A 1 60  ? 3.461   9.587   -22.872 1.00 1.00 ? 60  VAL A CG1  1  
ATOM 884   C CG2  . VAL A 1 60  ? 2.052   7.870   -23.999 1.00 1.00 ? 60  VAL A CG2  1  
ATOM 885   H H    . VAL A 1 60  ? 0.216   9.624   -25.476 1.00 1.00 ? 60  VAL A H    1  
ATOM 886   H HA   . VAL A 1 60  ? 0.787   9.930   -22.596 1.00 1.00 ? 60  VAL A HA   1  
ATOM 887   H HB   . VAL A 1 60  ? 2.720   9.708   -24.898 1.00 1.00 ? 60  VAL A HB   1  
ATOM 888   H HG11 . VAL A 1 60  ? 4.346   9.006   -23.132 1.00 1.00 ? 60  VAL A HG11 1  
ATOM 889   H HG12 . VAL A 1 60  ? 3.754   10.632  -22.814 1.00 1.00 ? 60  VAL A HG12 1  
ATOM 890   H HG13 . VAL A 1 60  ? 3.091   9.285   -21.892 1.00 1.00 ? 60  VAL A HG13 1  
ATOM 891   H HG21 . VAL A 1 60  ? 2.954   7.315   -24.242 1.00 1.00 ? 60  VAL A HG21 1  
ATOM 892   H HG22 . VAL A 1 60  ? 1.670   7.523   -23.039 1.00 1.00 ? 60  VAL A HG22 1  
ATOM 893   H HG23 . VAL A 1 60  ? 1.313   7.663   -24.774 1.00 1.00 ? 60  VAL A HG23 1  
ATOM 894   N N    . LYS A 1 61  ? 1.522   12.323  -22.466 1.00 1.00 ? 61  LYS A N    1  
ATOM 895   C CA   . LYS A 1 61  ? 1.684   13.768  -22.278 1.00 1.00 ? 61  LYS A CA   1  
ATOM 896   C C    . LYS A 1 61  ? 2.722   14.096  -21.184 1.00 1.00 ? 61  LYS A C    1  
ATOM 897   O O    . LYS A 1 61  ? 3.085   13.243  -20.372 1.00 1.00 ? 61  LYS A O    1  
ATOM 898   C CB   . LYS A 1 61  ? 0.294   14.364  -21.951 1.00 1.00 ? 61  LYS A CB   1  
ATOM 899   C CG   . LYS A 1 61  ? -0.673  14.337  -23.152 1.00 1.00 ? 61  LYS A CG   1  
ATOM 900   C CD   . LYS A 1 61  ? -2.020  14.968  -22.778 1.00 1.00 ? 61  LYS A CD   1  
ATOM 901   C CE   . LYS A 1 61  ? -2.977  15.030  -23.977 1.00 1.00 ? 61  LYS A CE   1  
ATOM 902   N NZ   . LYS A 1 61  ? -4.188  15.855  -23.691 1.00 1.00 ? 61  LYS A NZ   1  
ATOM 903   H H    . LYS A 1 61  ? 1.352   11.764  -21.629 1.00 1.00 ? 61  LYS A H    1  
ATOM 904   H HA   . LYS A 1 61  ? 2.046   14.218  -23.202 1.00 1.00 ? 61  LYS A HA   1  
ATOM 905   H HB2  . LYS A 1 61  ? -0.148  13.799  -21.131 1.00 1.00 ? 61  LYS A HB2  1  
ATOM 906   H HB3  . LYS A 1 61  ? 0.412   15.403  -21.629 1.00 1.00 ? 61  LYS A HB3  1  
ATOM 907   H HG2  . LYS A 1 61  ? -0.232  14.895  -23.979 1.00 1.00 ? 61  LYS A HG2  1  
ATOM 908   H HG3  . LYS A 1 61  ? -0.843  13.308  -23.470 1.00 1.00 ? 61  LYS A HG3  1  
ATOM 909   H HD2  . LYS A 1 61  ? -2.481  14.361  -22.001 1.00 1.00 ? 61  LYS A HD2  1  
ATOM 910   H HD3  . LYS A 1 61  ? -1.844  15.978  -22.398 1.00 1.00 ? 61  LYS A HD3  1  
ATOM 911   H HE2  . LYS A 1 61  ? -2.443  15.450  -24.836 1.00 1.00 ? 61  LYS A HE2  1  
ATOM 912   H HE3  . LYS A 1 61  ? -3.275  14.007  -24.233 1.00 1.00 ? 61  LYS A HE3  1  
ATOM 913   H HZ1  . LYS A 1 61  ? -3.934  16.816  -23.487 1.00 1.00 ? 61  LYS A HZ1  1  
ATOM 914   H HZ2  . LYS A 1 61  ? -4.811  15.873  -24.490 1.00 1.00 ? 61  LYS A HZ2  1  
ATOM 915   H HZ3  . LYS A 1 61  ? -4.715  15.496  -22.904 1.00 1.00 ? 61  LYS A HZ3  1  
ATOM 916   N N    . ARG A 1 62  ? 3.228   15.337  -21.189 1.00 1.00 ? 62  ARG A N    1  
ATOM 917   C CA   . ARG A 1 62  ? 4.120   15.916  -20.167 1.00 1.00 ? 62  ARG A CA   1  
ATOM 918   C C    . ARG A 1 62  ? 3.440   17.115  -19.483 1.00 1.00 ? 62  ARG A C    1  
ATOM 919   O O    . ARG A 1 62  ? 3.011   18.037  -20.176 1.00 1.00 ? 62  ARG A O    1  
ATOM 920   C CB   . ARG A 1 62  ? 5.435   16.356  -20.846 1.00 1.00 ? 62  ARG A CB   1  
ATOM 921   C CG   . ARG A 1 62  ? 6.485   16.906  -19.861 1.00 1.00 ? 62  ARG A CG   1  
ATOM 922   C CD   . ARG A 1 62  ? 7.780   17.349  -20.566 1.00 1.00 ? 62  ARG A CD   1  
ATOM 923   N NE   . ARG A 1 62  ? 7.553   18.474  -21.496 1.00 1.00 ? 62  ARG A NE   1  
ATOM 924   C CZ   . ARG A 1 62  ? 7.550   19.777  -21.217 1.00 1.00 ? 62  ARG A CZ   1  
ATOM 925   N NH1  . ARG A 1 62  ? 7.770   20.246  -20.003 1.00 1.00 ? 62  ARG A NH1  1  
ATOM 926   N NH2  . ARG A 1 62  ? 7.318   20.644  -22.179 1.00 1.00 ? 62  ARG A NH2  1  
ATOM 927   H H    . ARG A 1 62  ? 2.932   15.954  -21.933 1.00 1.00 ? 62  ARG A H    1  
ATOM 928   H HA   . ARG A 1 62  ? 4.350   15.161  -19.418 1.00 1.00 ? 62  ARG A HA   1  
ATOM 929   H HB2  . ARG A 1 62  ? 5.859   15.499  -21.368 1.00 1.00 ? 62  ARG A HB2  1  
ATOM 930   H HB3  . ARG A 1 62  ? 5.209   17.120  -21.593 1.00 1.00 ? 62  ARG A HB3  1  
ATOM 931   H HG2  . ARG A 1 62  ? 6.077   17.761  -19.321 1.00 1.00 ? 62  ARG A HG2  1  
ATOM 932   H HG3  . ARG A 1 62  ? 6.728   16.127  -19.138 1.00 1.00 ? 62  ARG A HG3  1  
ATOM 933   H HD2  . ARG A 1 62  ? 8.523   17.628  -19.818 1.00 1.00 ? 62  ARG A HD2  1  
ATOM 934   H HD3  . ARG A 1 62  ? 8.192   16.501  -21.120 1.00 1.00 ? 62  ARG A HD3  1  
ATOM 935   H HE   . ARG A 1 62  ? 7.422   18.223  -22.469 1.00 1.00 ? 62  ARG A HE   1  
ATOM 936   H HH11 . ARG A 1 62  ? 7.977   19.627  -19.237 1.00 1.00 ? 62  ARG A HH11 1  
ATOM 937   H HH12 . ARG A 1 62  ? 7.769   21.241  -19.832 1.00 1.00 ? 62  ARG A HH12 1  
ATOM 938   H HH21 . ARG A 1 62  ? 7.147   20.335  -23.124 1.00 1.00 ? 62  ARG A HH21 1  
ATOM 939   H HH22 . ARG A 1 62  ? 7.314   21.636  -21.989 1.00 1.00 ? 62  ARG A HH22 1  
ATOM 940   N N    . GLU A 1 63  ? 3.416   17.140  -18.148 1.00 1.00 ? 63  GLU A N    1  
ATOM 941   C CA   . GLU A 1 63  ? 2.906   18.260  -17.341 1.00 1.00 ? 63  GLU A CA   1  
ATOM 942   C C    . GLU A 1 63  ? 3.662   18.378  -16.011 1.00 1.00 ? 63  GLU A C    1  
ATOM 943   O O    . GLU A 1 63  ? 4.490   17.528  -15.674 1.00 1.00 ? 63  GLU A O    1  
ATOM 944   C CB   . GLU A 1 63  ? 1.391   18.107  -17.079 1.00 1.00 ? 63  GLU A CB   1  
ATOM 945   C CG   . GLU A 1 63  ? 0.485   18.581  -18.221 1.00 1.00 ? 63  GLU A CG   1  
ATOM 946   C CD   . GLU A 1 63  ? 0.624   20.083  -18.555 1.00 1.00 ? 63  GLU A CD   1  
ATOM 947   O OE1  . GLU A 1 63  ? 1.158   20.874  -17.739 1.00 1.00 ? 63  GLU A OE1  1  
ATOM 948   O OE2  . GLU A 1 63  ? 0.166   20.490  -19.651 1.00 1.00 ? 63  GLU A OE2  1  
ATOM 949   H H    . GLU A 1 63  ? 3.789   16.345  -17.640 1.00 1.00 ? 63  GLU A H    1  
ATOM 950   H HA   . GLU A 1 63  ? 3.070   19.187  -17.887 1.00 1.00 ? 63  GLU A HA   1  
ATOM 951   H HB2  . GLU A 1 63  ? 1.184   17.060  -16.881 1.00 1.00 ? 63  GLU A HB2  1  
ATOM 952   H HB3  . GLU A 1 63  ? 1.099   18.657  -16.185 1.00 1.00 ? 63  GLU A HB3  1  
ATOM 953   H HG2  . GLU A 1 63  ? 0.695   17.988  -19.106 1.00 1.00 ? 63  GLU A HG2  1  
ATOM 954   H HG3  . GLU A 1 63  ? -0.550  18.386  -17.937 1.00 1.00 ? 63  GLU A HG3  1  
ATOM 955   N N    . ARG A 1 64  ? 3.382   19.432  -15.237 1.00 1.00 ? 64  ARG A N    1  
ATOM 956   C CA   . ARG A 1 64  ? 3.883   19.590  -13.868 1.00 1.00 ? 64  ARG A CA   1  
ATOM 957   C C    . ARG A 1 64  ? 3.179   18.611  -12.917 1.00 1.00 ? 64  ARG A C    1  
ATOM 958   O O    . ARG A 1 64  ? 1.973   18.386  -13.018 1.00 1.00 ? 64  ARG A O    1  
ATOM 959   C CB   . ARG A 1 64  ? 3.717   21.049  -13.400 1.00 1.00 ? 64  ARG A CB   1  
ATOM 960   C CG   . ARG A 1 64  ? 4.578   22.014  -14.235 1.00 1.00 ? 64  ARG A CG   1  
ATOM 961   C CD   . ARG A 1 64  ? 4.427   23.469  -13.777 1.00 1.00 ? 64  ARG A CD   1  
ATOM 962   N NE   . ARG A 1 64  ? 5.196   24.377  -14.647 1.00 1.00 ? 64  ARG A NE   1  
ATOM 963   C CZ   . ARG A 1 64  ? 5.210   25.705  -14.592 1.00 1.00 ? 64  ARG A CZ   1  
ATOM 964   N NH1  . ARG A 1 64  ? 4.537   26.377  -13.680 1.00 1.00 ? 64  ARG A NH1  1  
ATOM 965   N NH2  . ARG A 1 64  ? 5.916   26.385  -15.471 1.00 1.00 ? 64  ARG A NH2  1  
ATOM 966   H H    . ARG A 1 64  ? 2.706   20.106  -15.576 1.00 1.00 ? 64  ARG A H    1  
ATOM 967   H HA   . ARG A 1 64  ? 4.946   19.362  -13.865 1.00 1.00 ? 64  ARG A HA   1  
ATOM 968   H HB2  . ARG A 1 64  ? 2.668   21.338  -13.477 1.00 1.00 ? 64  ARG A HB2  1  
ATOM 969   H HB3  . ARG A 1 64  ? 4.028   21.125  -12.356 1.00 1.00 ? 64  ARG A HB3  1  
ATOM 970   H HG2  . ARG A 1 64  ? 5.626   21.721  -14.148 1.00 1.00 ? 64  ARG A HG2  1  
ATOM 971   H HG3  . ARG A 1 64  ? 4.282   21.950  -15.283 1.00 1.00 ? 64  ARG A HG3  1  
ATOM 972   H HD2  . ARG A 1 64  ? 3.371   23.740  -13.814 1.00 1.00 ? 64  ARG A HD2  1  
ATOM 973   H HD3  . ARG A 1 64  ? 4.778   23.559  -12.747 1.00 1.00 ? 64  ARG A HD3  1  
ATOM 974   H HE   . ARG A 1 64  ? 5.767   23.945  -15.363 1.00 1.00 ? 64  ARG A HE   1  
ATOM 975   H HH11 . ARG A 1 64  ? 3.997   25.886  -12.985 1.00 1.00 ? 64  ARG A HH11 1  
ATOM 976   H HH12 . ARG A 1 64  ? 4.559   27.385  -13.661 1.00 1.00 ? 64  ARG A HH12 1  
ATOM 977   H HH21 . ARG A 1 64  ? 6.430   25.906  -16.196 1.00 1.00 ? 64  ARG A HH21 1  
ATOM 978   H HH22 . ARG A 1 64  ? 5.935   27.393  -15.443 1.00 1.00 ? 64  ARG A HH22 1  
ATOM 979   N N    . LEU A 1 65  ? 3.915   18.063  -11.945 1.00 1.00 ? 65  LEU A N    1  
ATOM 980   C CA   . LEU A 1 65  ? 3.392   17.132  -10.929 1.00 1.00 ? 65  LEU A CA   1  
ATOM 981   C C    . LEU A 1 65  ? 2.156   17.699  -10.218 1.00 1.00 ? 65  LEU A C    1  
ATOM 982   O O    . LEU A 1 65  ? 1.121   17.037  -10.210 1.00 1.00 ? 65  LEU A O    1  
ATOM 983   C CB   . LEU A 1 65  ? 4.541   16.794  -9.954  1.00 1.00 ? 65  LEU A CB   1  
ATOM 984   C CG   . LEU A 1 65  ? 4.153   15.900  -8.757  1.00 1.00 ? 65  LEU A CG   1  
ATOM 985   C CD1  . LEU A 1 65  ? 3.569   14.545  -9.181  1.00 1.00 ? 65  LEU A CD1  1  
ATOM 986   C CD2  . LEU A 1 65  ? 5.403   15.659  -7.904  1.00 1.00 ? 65  LEU A CD2  1  
ATOM 987   H H    . LEU A 1 65  ? 4.909   18.287  -11.925 1.00 1.00 ? 65  LEU A H    1  
ATOM 988   H HA   . LEU A 1 65  ? 3.072   16.217  -11.430 1.00 1.00 ? 65  LEU A HA   1  
ATOM 989   H HB2  . LEU A 1 65  ? 5.340   16.303  -10.514 1.00 1.00 ? 65  LEU A HB2  1  
ATOM 990   H HB3  . LEU A 1 65  ? 4.954   17.724  -9.554  1.00 1.00 ? 65  LEU A HB3  1  
ATOM 991   H HG   . LEU A 1 65  ? 3.417   16.418  -8.143  1.00 1.00 ? 65  LEU A HG   1  
ATOM 992   H HD11 . LEU A 1 65  ? 2.699   14.683  -9.823  1.00 1.00 ? 65  LEU A HD11 1  
ATOM 993   H HD12 . LEU A 1 65  ? 4.321   13.965  -9.712  1.00 1.00 ? 65  LEU A HD12 1  
ATOM 994   H HD13 . LEU A 1 65  ? 3.260   13.992  -8.294  1.00 1.00 ? 65  LEU A HD13 1  
ATOM 995   H HD21 . LEU A 1 65  ? 5.150   15.042  -7.044  1.00 1.00 ? 65  LEU A HD21 1  
ATOM 996   H HD22 . LEU A 1 65  ? 6.163   15.148  -8.496  1.00 1.00 ? 65  LEU A HD22 1  
ATOM 997   H HD23 . LEU A 1 65  ? 5.803   16.608  -7.549  1.00 1.00 ? 65  LEU A HD23 1  
ATOM 998   N N    . GLU A 1 66  ? 2.246   18.936  -9.711  1.00 1.00 ? 66  GLU A N    1  
ATOM 999   C CA   . GLU A 1 66  ? 1.138   19.636  -9.030  1.00 1.00 ? 66  GLU A CA   1  
ATOM 1000  C C    . GLU A 1 66  ? -0.114  19.670  -9.912  1.00 1.00 ? 66  GLU A C    1  
ATOM 1001  O O    . GLU A 1 66  ? -1.204  19.309  -9.471  1.00 1.00 ? 66  GLU A O    1  
ATOM 1002  C CB   . GLU A 1 66  ? 1.498   21.093  -8.663  1.00 1.00 ? 66  GLU A CB   1  
ATOM 1003  C CG   . GLU A 1 66  ? 2.902   21.257  -8.090  1.00 1.00 ? 66  GLU A CG   1  
ATOM 1004  C CD   . GLU A 1 66  ? 3.116   22.675  -7.536  1.00 1.00 ? 66  GLU A CD   1  
ATOM 1005  O OE1  . GLU A 1 66  ? 3.522   23.575  -8.309  1.00 1.00 ? 66  GLU A OE1  1  
ATOM 1006  O OE2  . GLU A 1 66  ? 2.888   22.898  -6.324  1.00 1.00 ? 66  GLU A OE2  1  
ATOM 1007  H H    . GLU A 1 66  ? 3.146   19.396  -9.755  1.00 1.00 ? 66  GLU A H    1  
ATOM 1008  H HA   . GLU A 1 66  ? 0.909   19.101  -8.106  1.00 1.00 ? 66  GLU A HA   1  
ATOM 1009  H HB2  . GLU A 1 66  ? 1.426   21.730  -9.545  1.00 1.00 ? 66  GLU A HB2  1  
ATOM 1010  H HB3  . GLU A 1 66  ? 0.772   21.448  -7.932  1.00 1.00 ? 66  GLU A HB3  1  
ATOM 1011  H HG2  . GLU A 1 66  ? 3.055   20.514  -7.306  1.00 1.00 ? 66  GLU A HG2  1  
ATOM 1012  H HG3  . GLU A 1 66  ? 3.606   21.071  -8.905  1.00 1.00 ? 66  GLU A HG3  1  
ATOM 1013  N N    . ASP A 1 67  ? 0.067   20.055  -11.180 1.00 1.00 ? 67  ASP A N    1  
ATOM 1014  C CA   . ASP A 1 67  ? -1.026  20.145  -12.149 1.00 1.00 ? 67  ASP A CA   1  
ATOM 1015  C C    . ASP A 1 67  ? -1.660  18.767  -12.430 1.00 1.00 ? 67  ASP A C    1  
ATOM 1016  O O    . ASP A 1 67  ? -2.883  18.656  -12.529 1.00 1.00 ? 67  ASP A O    1  
ATOM 1017  C CB   . ASP A 1 67  ? -0.525  20.786  -13.450 1.00 1.00 ? 67  ASP A CB   1  
ATOM 1018  C CG   . ASP A 1 67  ? -1.678  21.002  -14.445 1.00 1.00 ? 67  ASP A CG   1  
ATOM 1019  O OD1  . ASP A 1 67  ? -2.425  21.999  -14.286 1.00 1.00 ? 67  ASP A OD1  1  
ATOM 1020  O OD2  . ASP A 1 67  ? -1.834  20.185  -15.382 1.00 1.00 ? 67  ASP A OD2  1  
ATOM 1021  H H    . ASP A 1 67  ? 0.986   20.375  -11.455 1.00 1.00 ? 67  ASP A H    1  
ATOM 1022  H HA   . ASP A 1 67  ? -1.780  20.798  -11.714 1.00 1.00 ? 67  ASP A HA   1  
ATOM 1023  H HB2  . ASP A 1 67  ? -0.067  21.748  -13.223 1.00 1.00 ? 67  ASP A HB2  1  
ATOM 1024  H HB3  . ASP A 1 67  ? 0.237   20.147  -13.898 1.00 1.00 ? 67  ASP A HB3  1  
ATOM 1025  N N    . VAL A 1 68  ? -0.832  17.720  -12.512 1.00 1.00 ? 68  VAL A N    1  
ATOM 1026  C CA   . VAL A 1 68  ? -1.264  16.337  -12.737 1.00 1.00 ? 68  VAL A CA   1  
ATOM 1027  C C    . VAL A 1 68  ? -2.007  15.761  -11.525 1.00 1.00 ? 68  VAL A C    1  
ATOM 1028  O O    . VAL A 1 68  ? -3.069  15.164  -11.714 1.00 1.00 ? 68  VAL A O    1  
ATOM 1029  C CB   . VAL A 1 68  ? -0.087  15.430  -13.163 1.00 1.00 ? 68  VAL A CB   1  
ATOM 1030  C CG1  . VAL A 1 68  ? -0.412  13.927  -13.125 1.00 1.00 ? 68  VAL A CG1  1  
ATOM 1031  C CG2  . VAL A 1 68  ? 0.318   15.795  -14.597 1.00 1.00 ? 68  VAL A CG2  1  
ATOM 1032  H H    . VAL A 1 68  ? 0.162   17.911  -12.463 1.00 1.00 ? 68  VAL A H    1  
ATOM 1033  H HA   . VAL A 1 68  ? -1.966  16.372  -13.567 1.00 1.00 ? 68  VAL A HA   1  
ATOM 1034  H HB   . VAL A 1 68  ? 0.758   15.606  -12.496 1.00 1.00 ? 68  VAL A HB   1  
ATOM 1035  H HG11 . VAL A 1 68  ? -1.291  13.716  -13.735 1.00 1.00 ? 68  VAL A HG11 1  
ATOM 1036  H HG12 . VAL A 1 68  ? 0.434   13.353  -13.507 1.00 1.00 ? 68  VAL A HG12 1  
ATOM 1037  H HG13 . VAL A 1 68  ? -0.596  13.609  -12.100 1.00 1.00 ? 68  VAL A HG13 1  
ATOM 1038  H HG21 . VAL A 1 68  ? -0.544  15.729  -15.261 1.00 1.00 ? 68  VAL A HG21 1  
ATOM 1039  H HG22 . VAL A 1 68  ? 0.712   16.806  -14.618 1.00 1.00 ? 68  VAL A HG22 1  
ATOM 1040  H HG23 . VAL A 1 68  ? 1.079   15.109  -14.966 1.00 1.00 ? 68  VAL A HG23 1  
ATOM 1041  N N    . VAL A 1 69  ? -1.495  15.930  -10.299 1.00 1.00 ? 69  VAL A N    1  
ATOM 1042  C CA   . VAL A 1 69  ? -2.143  15.393  -9.102  1.00 1.00 ? 69  VAL A CA   1  
ATOM 1043  C C    . VAL A 1 69  ? -3.390  16.188  -8.685  1.00 1.00 ? 69  VAL A C    1  
ATOM 1044  O O    . VAL A 1 69  ? -4.358  15.583  -8.229  1.00 1.00 ? 69  VAL A O    1  
ATOM 1045  C CB   . VAL A 1 69  ? -1.166  15.239  -7.921  1.00 1.00 ? 69  VAL A CB   1  
ATOM 1046  C CG1  . VAL A 1 69  ? -0.002  14.311  -8.300  1.00 1.00 ? 69  VAL A CG1  1  
ATOM 1047  C CG2  . VAL A 1 69  ? -0.641  16.555  -7.329  1.00 1.00 ? 69  VAL A CG2  1  
ATOM 1048  H H    . VAL A 1 69  ? -0.593  16.385  -10.172 1.00 1.00 ? 69  VAL A H    1  
ATOM 1049  H HA   . VAL A 1 69  ? -2.469  14.386  -9.359  1.00 1.00 ? 69  VAL A HA   1  
ATOM 1050  H HB   . VAL A 1 69  ? -1.718  14.742  -7.142  1.00 1.00 ? 69  VAL A HB   1  
ATOM 1051  H HG11 . VAL A 1 69  ? 0.568   14.726  -9.128  1.00 1.00 ? 69  VAL A HG11 1  
ATOM 1052  H HG12 . VAL A 1 69  ? 0.664   14.181  -7.451  1.00 1.00 ? 69  VAL A HG12 1  
ATOM 1053  H HG13 . VAL A 1 69  ? -0.388  13.334  -8.585  1.00 1.00 ? 69  VAL A HG13 1  
ATOM 1054  H HG21 . VAL A 1 69  ? -0.135  17.140  -8.088  1.00 1.00 ? 69  VAL A HG21 1  
ATOM 1055  H HG22 . VAL A 1 69  ? -1.463  17.137  -6.916  1.00 1.00 ? 69  VAL A HG22 1  
ATOM 1056  H HG23 . VAL A 1 69  ? 0.058   16.340  -6.522  1.00 1.00 ? 69  VAL A HG23 1  
ATOM 1057  N N    . GLY A 1 70  ? -3.411  17.518  -8.856  1.00 1.00 ? 70  GLY A N    1  
ATOM 1058  C CA   . GLY A 1 70  ? -4.556  18.359  -8.492  1.00 1.00 ? 70  GLY A CA   1  
ATOM 1059  C C    . GLY A 1 70  ? -4.876  18.268  -6.997  1.00 1.00 ? 70  GLY A C    1  
ATOM 1060  O O    . GLY A 1 70  ? -4.004  18.496  -6.155  1.00 1.00 ? 70  GLY A O    1  
ATOM 1061  H H    . GLY A 1 70  ? -2.587  17.985  -9.222  1.00 1.00 ? 70  GLY A H    1  
ATOM 1062  H HA2  . GLY A 1 70  ? -4.352  19.401  -8.744  1.00 1.00 ? 70  GLY A HA2  1  
ATOM 1063  H HA3  . GLY A 1 70  ? -5.429  18.034  -9.061  1.00 1.00 ? 70  GLY A HA3  1  
ATOM 1064  N N    . GLY A 1 71  ? -6.121  17.906  -6.667  1.00 1.00 ? 71  GLY A N    1  
ATOM 1065  C CA   . GLY A 1 71  ? -6.579  17.662  -5.287  1.00 1.00 ? 71  GLY A CA   1  
ATOM 1066  C C    . GLY A 1 71  ? -6.311  16.244  -4.760  1.00 1.00 ? 71  GLY A C    1  
ATOM 1067  O O    . GLY A 1 71  ? -6.538  15.984  -3.577  1.00 1.00 ? 71  GLY A O    1  
ATOM 1068  H H    . GLY A 1 71  ? -6.788  17.763  -7.415  1.00 1.00 ? 71  GLY A H    1  
ATOM 1069  H HA2  . GLY A 1 71  ? -6.083  18.361  -4.608  1.00 1.00 ? 71  GLY A HA2  1  
ATOM 1070  H HA3  . GLY A 1 71  ? -7.656  17.823  -5.244  1.00 1.00 ? 71  GLY A HA3  1  
ATOM 1071  N N    . CYS A 1 72  ? -5.837  15.325  -5.611  1.00 1.00 ? 72  CYS A N    1  
ATOM 1072  C CA   . CYS A 1 72  ? -5.529  13.934  -5.255  1.00 1.00 ? 72  CYS A CA   1  
ATOM 1073  C C    . CYS A 1 72  ? -4.232  13.833  -4.425  1.00 1.00 ? 72  CYS A C    1  
ATOM 1074  O O    . CYS A 1 72  ? -3.290  14.609  -4.626  1.00 1.00 ? 72  CYS A O    1  
ATOM 1075  C CB   . CYS A 1 72  ? -5.419  13.102  -6.546  1.00 1.00 ? 72  CYS A CB   1  
ATOM 1076  S SG   . CYS A 1 72  ? -6.925  13.293  -7.553  1.00 1.00 ? 72  CYS A SG   1  
ATOM 1077  H H    . CYS A 1 72  ? -5.653  15.607  -6.565  1.00 1.00 ? 72  CYS A H    1  
ATOM 1078  H HA   . CYS A 1 72  ? -6.353  13.528  -4.661  1.00 1.00 ? 72  CYS A HA   1  
ATOM 1079  H HB2  . CYS A 1 72  ? -4.548  13.431  -7.116  1.00 1.00 ? 72  CYS A HB2  1  
ATOM 1080  H HB3  . CYS A 1 72  ? -5.270  12.050  -6.299  1.00 1.00 ? 72  CYS A HB3  1  
ATOM 1081  H HG   . CYS A 1 72  ? -6.446  12.732  -8.678  1.00 1.00 ? 72  CYS A HG   1  
ATOM 1082  N N    . CYS A 1 73  ? -4.162  12.847  -3.526  1.00 1.00 ? 73  CYS A N    1  
ATOM 1083  C CA   . CYS A 1 73  ? -2.940  12.505  -2.782  1.00 1.00 ? 73  CYS A CA   1  
ATOM 1084  C C    . CYS A 1 73  ? -1.952  11.726  -3.672  1.00 1.00 ? 73  CYS A C    1  
ATOM 1085  O O    . CYS A 1 73  ? -2.345  11.147  -4.684  1.00 1.00 ? 73  CYS A O    1  
ATOM 1086  C CB   . CYS A 1 73  ? -3.330  11.707  -1.521  1.00 1.00 ? 73  CYS A CB   1  
ATOM 1087  S SG   . CYS A 1 73  ? -4.402  12.712  -0.447  1.00 1.00 ? 73  CYS A SG   1  
ATOM 1088  H H    . CYS A 1 73  ? -4.951  12.221  -3.445  1.00 1.00 ? 73  CYS A H    1  
ATOM 1089  H HA   . CYS A 1 73  ? -2.442  13.424  -2.469  1.00 1.00 ? 73  CYS A HA   1  
ATOM 1090  H HB2  . CYS A 1 73  ? -3.860  10.796  -1.805  1.00 1.00 ? 73  CYS A HB2  1  
ATOM 1091  H HB3  . CYS A 1 73  ? -2.434  11.416  -0.965  1.00 1.00 ? 73  CYS A HB3  1  
ATOM 1092  H HG   . CYS A 1 73  ? -3.526  13.698  -0.180  1.00 1.00 ? 73  CYS A HG   1  
ATOM 1093  N N    . TYR A 1 74  ? -0.675  11.661  -3.286  1.00 1.00 ? 74  TYR A N    1  
ATOM 1094  C CA   . TYR A 1 74  ? 0.345   10.903  -4.033  1.00 1.00 ? 74  TYR A CA   1  
ATOM 1095  C C    . TYR A 1 74  ? 1.570   10.485  -3.193  1.00 1.00 ? 74  TYR A C    1  
ATOM 1096  O O    . TYR A 1 74  ? 1.850   11.067  -2.142  1.00 1.00 ? 74  TYR A O    1  
ATOM 1097  C CB   . TYR A 1 74  ? 0.775   11.678  -5.296  1.00 1.00 ? 74  TYR A CB   1  
ATOM 1098  C CG   . TYR A 1 74  ? 1.650   12.889  -5.030  1.00 1.00 ? 74  TYR A CG   1  
ATOM 1099  C CD1  . TYR A 1 74  ? 1.066   14.125  -4.692  1.00 1.00 ? 74  TYR A CD1  1  
ATOM 1100  C CD2  . TYR A 1 74  ? 3.053   12.780  -5.119  1.00 1.00 ? 74  TYR A CD2  1  
ATOM 1101  C CE1  . TYR A 1 74  ? 1.878   15.250  -4.445  1.00 1.00 ? 74  TYR A CE1  1  
ATOM 1102  C CE2  . TYR A 1 74  ? 3.869   13.898  -4.864  1.00 1.00 ? 74  TYR A CE2  1  
ATOM 1103  C CZ   . TYR A 1 74  ? 3.284   15.141  -4.533  1.00 1.00 ? 74  TYR A CZ   1  
ATOM 1104  O OH   . TYR A 1 74  ? 4.076   16.227  -4.301  1.00 1.00 ? 74  TYR A OH   1  
ATOM 1105  H H    . TYR A 1 74  ? -0.388  12.148  -2.445  1.00 1.00 ? 74  TYR A H    1  
ATOM 1106  H HA   . TYR A 1 74  ? -0.131  9.979   -4.360  1.00 1.00 ? 74  TYR A HA   1  
ATOM 1107  H HB2  . TYR A 1 74  ? 1.320   10.997  -5.952  1.00 1.00 ? 74  TYR A HB2  1  
ATOM 1108  H HB3  . TYR A 1 74  ? -0.106  11.998  -5.851  1.00 1.00 ? 74  TYR A HB3  1  
ATOM 1109  H HD1  . TYR A 1 74  ? -0.009  14.213  -4.624  1.00 1.00 ? 74  TYR A HD1  1  
ATOM 1110  H HD2  . TYR A 1 74  ? 3.510   11.833  -5.373  1.00 1.00 ? 74  TYR A HD2  1  
ATOM 1111  H HE1  . TYR A 1 74  ? 1.423   16.197  -4.186  1.00 1.00 ? 74  TYR A HE1  1  
ATOM 1112  H HE2  . TYR A 1 74  ? 4.946   13.811  -4.920  1.00 1.00 ? 74  TYR A HE2  1  
ATOM 1113  H HH   . TYR A 1 74  ? 3.575   17.028  -4.072  1.00 1.00 ? 74  TYR A HH   1  
ATOM 1114  N N    . ARG A 1 75  ? 2.302   9.479   -3.692  1.00 1.00 ? 75  ARG A N    1  
ATOM 1115  C CA   . ARG A 1 75  ? 3.535   8.918   -3.118  1.00 1.00 ? 75  ARG A CA   1  
ATOM 1116  C C    . ARG A 1 75  ? 4.516   8.505   -4.227  1.00 1.00 ? 75  ARG A C    1  
ATOM 1117  O O    . ARG A 1 75  ? 4.125   8.345   -5.381  1.00 1.00 ? 75  ARG A O    1  
ATOM 1118  C CB   . ARG A 1 75  ? 3.211   7.656   -2.283  1.00 1.00 ? 75  ARG A CB   1  
ATOM 1119  C CG   . ARG A 1 75  ? 2.155   7.845   -1.180  1.00 1.00 ? 75  ARG A CG   1  
ATOM 1120  C CD   . ARG A 1 75  ? 2.082   6.652   -0.212  1.00 1.00 ? 75  ARG A CD   1  
ATOM 1121  N NE   . ARG A 1 75  ? 1.813   5.365   -0.888  1.00 1.00 ? 75  ARG A NE   1  
ATOM 1122  C CZ   . ARG A 1 75  ? 1.613   4.190   -0.305  1.00 1.00 ? 75  ARG A CZ   1  
ATOM 1123  N NH1  . ARG A 1 75  ? 1.576   4.032   1.003   1.00 1.00 ? 75  ARG A NH1  1  
ATOM 1124  N NH2  . ARG A 1 75  ? 1.447   3.146   -1.077  1.00 1.00 ? 75  ARG A NH2  1  
ATOM 1125  H H    . ARG A 1 75  ? 1.963   9.049   -4.551  1.00 1.00 ? 75  ARG A H    1  
ATOM 1126  H HA   . ARG A 1 75  ? 4.014   9.665   -2.478  1.00 1.00 ? 75  ARG A HA   1  
ATOM 1127  H HB2  . ARG A 1 75  ? 2.867   6.873   -2.958  1.00 1.00 ? 75  ARG A HB2  1  
ATOM 1128  H HB3  . ARG A 1 75  ? 4.133   7.306   -1.813  1.00 1.00 ? 75  ARG A HB3  1  
ATOM 1129  H HG2  . ARG A 1 75  ? 2.405   8.733   -0.600  1.00 1.00 ? 75  ARG A HG2  1  
ATOM 1130  H HG3  . ARG A 1 75  ? 1.177   7.994   -1.636  1.00 1.00 ? 75  ARG A HG3  1  
ATOM 1131  H HD2  . ARG A 1 75  ? 3.026   6.581   0.328   1.00 1.00 ? 75  ARG A HD2  1  
ATOM 1132  H HD3  . ARG A 1 75  ? 1.291   6.850   0.512   1.00 1.00 ? 75  ARG A HD3  1  
ATOM 1133  H HE   . ARG A 1 75  ? 1.817   5.337   -1.907  1.00 1.00 ? 75  ARG A HE   1  
ATOM 1134  H HH11 . ARG A 1 75  ? 1.695   4.821   1.618   1.00 1.00 ? 75  ARG A HH11 1  
ATOM 1135  H HH12 . ARG A 1 75  ? 1.424   3.119   1.406   1.00 1.00 ? 75  ARG A HH12 1  
ATOM 1136  H HH21 . ARG A 1 75  ? 1.500   3.303   -2.086  1.00 1.00 ? 75  ARG A HH21 1  
ATOM 1137  H HH22 . ARG A 1 75  ? 1.288   2.225   -0.703  1.00 1.00 ? 75  ARG A HH22 1  
ATOM 1138  N N    . VAL A 1 76  ? 5.783   8.301   -3.876  1.00 1.00 ? 76  VAL A N    1  
ATOM 1139  C CA   . VAL A 1 76  ? 6.797   7.670   -4.739  1.00 1.00 ? 76  VAL A CA   1  
ATOM 1140  C C    . VAL A 1 76  ? 6.778   6.177   -4.391  1.00 1.00 ? 76  VAL A C    1  
ATOM 1141  O O    . VAL A 1 76  ? 6.850   5.833   -3.210  1.00 1.00 ? 76  VAL A O    1  
ATOM 1142  C CB   . VAL A 1 76  ? 8.212   8.253   -4.510  1.00 1.00 ? 76  VAL A CB   1  
ATOM 1143  C CG1  . VAL A 1 76  ? 9.293   7.437   -5.241  1.00 1.00 ? 76  VAL A CG1  1  
ATOM 1144  C CG2  . VAL A 1 76  ? 8.280   9.720   -4.970  1.00 1.00 ? 76  VAL A CG2  1  
ATOM 1145  H H    . VAL A 1 76  ? 6.030   8.470   -2.896  1.00 1.00 ? 76  VAL A H    1  
ATOM 1146  H HA   . VAL A 1 76  ? 6.534   7.809   -5.786  1.00 1.00 ? 76  VAL A HA   1  
ATOM 1147  H HB   . VAL A 1 76  ? 8.435   8.224   -3.442  1.00 1.00 ? 76  VAL A HB   1  
ATOM 1148  H HG11 . VAL A 1 76  ? 10.262  7.923   -5.131  1.00 1.00 ? 76  VAL A HG11 1  
ATOM 1149  H HG12 . VAL A 1 76  ? 9.376   6.440   -4.811  1.00 1.00 ? 76  VAL A HG12 1  
ATOM 1150  H HG13 . VAL A 1 76  ? 9.050   7.354   -6.299  1.00 1.00 ? 76  VAL A HG13 1  
ATOM 1151  H HG21 . VAL A 1 76  ? 7.518   10.312  -4.465  1.00 1.00 ? 76  VAL A HG21 1  
ATOM 1152  H HG22 . VAL A 1 76  ? 9.258   10.131  -4.725  1.00 1.00 ? 76  VAL A HG22 1  
ATOM 1153  H HG23 . VAL A 1 76  ? 8.129   9.781   -6.048  1.00 1.00 ? 76  VAL A HG23 1  
ATOM 1154  N N    . ASN A 1 77  ? 6.687   5.297   -5.392  1.00 1.00 ? 77  ASN A N    1  
ATOM 1155  C CA   . ASN A 1 77  ? 6.626   3.848   -5.168  1.00 1.00 ? 77  ASN A CA   1  
ATOM 1156  C C    . ASN A 1 77  ? 7.296   3.060   -6.312  1.00 1.00 ? 77  ASN A C    1  
ATOM 1157  O O    . ASN A 1 77  ? 6.647   2.596   -7.250  1.00 1.00 ? 77  ASN A O    1  
ATOM 1158  C CB   . ASN A 1 77  ? 5.167   3.418   -4.892  1.00 1.00 ? 77  ASN A CB   1  
ATOM 1159  C CG   . ASN A 1 77  ? 5.070   2.013   -4.297  1.00 1.00 ? 77  ASN A CG   1  
ATOM 1160  O OD1  . ASN A 1 77  ? 6.062   1.393   -3.921  1.00 1.00 ? 77  ASN A OD1  1  
ATOM 1161  N ND2  . ASN A 1 77  ? 3.871   1.481   -4.155  1.00 1.00 ? 77  ASN A ND2  1  
ATOM 1162  H H    . ASN A 1 77  ? 6.625   5.641   -6.347  1.00 1.00 ? 77  ASN A H    1  
ATOM 1163  H HA   . ASN A 1 77  ? 7.200   3.630   -4.266  1.00 1.00 ? 77  ASN A HA   1  
ATOM 1164  H HB2  . ASN A 1 77  ? 4.712   4.104   -4.178  1.00 1.00 ? 77  ASN A HB2  1  
ATOM 1165  H HB3  . ASN A 1 77  ? 4.585   3.467   -5.813  1.00 1.00 ? 77  ASN A HB3  1  
ATOM 1166  H HD21 . ASN A 1 77  ? 3.033   1.994   -4.437  1.00 1.00 ? 77  ASN A HD21 1  
ATOM 1167  H HD22 . ASN A 1 77  ? 3.792   0.556   -3.765  1.00 1.00 ? 77  ASN A HD22 1  
ATOM 1168  N N    . ASN A 1 78  ? 8.626   2.917   -6.232  1.00 1.00 ? 78  ASN A N    1  
ATOM 1169  C CA   . ASN A 1 78  ? 9.473   2.297   -7.266  1.00 1.00 ? 78  ASN A CA   1  
ATOM 1170  C C    . ASN A 1 78  ? 9.459   0.751   -7.200  1.00 1.00 ? 78  ASN A C    1  
ATOM 1171  O O    . ASN A 1 78  ? 10.502  0.105   -7.098  1.00 1.00 ? 78  ASN A O    1  
ATOM 1172  C CB   . ASN A 1 78  ? 10.898  2.891   -7.179  1.00 1.00 ? 78  ASN A CB   1  
ATOM 1173  C CG   . ASN A 1 78  ? 10.971  4.389   -7.484  1.00 1.00 ? 78  ASN A CG   1  
ATOM 1174  O OD1  . ASN A 1 78  ? 10.078  4.976   -8.083  1.00 1.00 ? 78  ASN A OD1  1  
ATOM 1175  N ND2  . ASN A 1 78  ? 12.048  5.044   -7.095  1.00 1.00 ? 78  ASN A ND2  1  
ATOM 1176  H H    . ASN A 1 78  ? 9.090   3.311   -5.425  1.00 1.00 ? 78  ASN A H    1  
ATOM 1177  H HA   . ASN A 1 78  ? 9.068   2.567   -8.242  1.00 1.00 ? 78  ASN A HA   1  
ATOM 1178  H HB2  . ASN A 1 78  ? 11.303  2.702   -6.182  1.00 1.00 ? 78  ASN A HB2  1  
ATOM 1179  H HB3  . ASN A 1 78  ? 11.542  2.386   -7.902  1.00 1.00 ? 78  ASN A HB3  1  
ATOM 1180  H HD21 . ASN A 1 78  ? 12.791  4.569   -6.606  1.00 1.00 ? 78  ASN A HD21 1  
ATOM 1181  H HD22 . ASN A 1 78  ? 12.131  6.035   -7.325  1.00 1.00 ? 78  ASN A HD22 1  
ATOM 1182  N N    . SER A 1 79  ? 8.274   0.133   -7.245  1.00 1.00 ? 79  SER A N    1  
ATOM 1183  C CA   . SER A 1 79  ? 8.073   -1.314  -7.011  1.00 1.00 ? 79  SER A CA   1  
ATOM 1184  C C    . SER A 1 79  ? 8.831   -2.202  -8.011  1.00 1.00 ? 79  SER A C    1  
ATOM 1185  O O    . SER A 1 79  ? 9.296   -3.290  -7.665  1.00 1.00 ? 79  SER A O    1  
ATOM 1186  C CB   . SER A 1 79  ? 6.573   -1.645  -7.112  1.00 1.00 ? 79  SER A CB   1  
ATOM 1187  O OG   . SER A 1 79  ? 5.787   -0.761  -6.322  1.00 1.00 ? 79  SER A OG   1  
ATOM 1188  H H    . SER A 1 79  ? 7.435   0.702   -7.315  1.00 1.00 ? 79  SER A H    1  
ATOM 1189  H HA   . SER A 1 79  ? 8.415   -1.570  -6.006  1.00 1.00 ? 79  SER A HA   1  
ATOM 1190  H HB2  . SER A 1 79  ? 6.254   -1.564  -8.154  1.00 1.00 ? 79  SER A HB2  1  
ATOM 1191  H HB3  . SER A 1 79  ? 6.414   -2.674  -6.783  1.00 1.00 ? 79  SER A HB3  1  
ATOM 1192  H HG   . SER A 1 79  ? 4.847   -1.044  -6.354  1.00 1.00 ? 79  SER A HG   1  
ATOM 1193  N N    . LEU A 1 80  ? 8.999   -1.723  -9.252  1.00 1.00 ? 80  LEU A N    1  
ATOM 1194  C CA   . LEU A 1 80  ? 9.608   -2.485  -10.347 1.00 1.00 ? 80  LEU A CA   1  
ATOM 1195  C C    . LEU A 1 80  ? 11.106  -2.750  -10.162 1.00 1.00 ? 80  LEU A C    1  
ATOM 1196  O O    . LEU A 1 80  ? 11.660  -3.584  -10.868 1.00 1.00 ? 80  LEU A O    1  
ATOM 1197  C CB   . LEU A 1 80  ? 9.351   -1.801  -11.701 1.00 1.00 ? 80  LEU A CB   1  
ATOM 1198  C CG   . LEU A 1 80  ? 7.896   -1.379  -11.987 1.00 1.00 ? 80  LEU A CG   1  
ATOM 1199  C CD1  . LEU A 1 80  ? 7.835   -0.725  -13.367 1.00 1.00 ? 80  LEU A CD1  1  
ATOM 1200  C CD2  . LEU A 1 80  ? 6.927   -2.567  -11.915 1.00 1.00 ? 80  LEU A CD2  1  
ATOM 1201  H H    . LEU A 1 80  ? 8.615   -0.812  -9.458  1.00 1.00 ? 80  LEU A H    1  
ATOM 1202  H HA   . LEU A 1 80  ? 9.129   -3.462  -10.365 1.00 1.00 ? 80  LEU A HA   1  
ATOM 1203  H HB2  . LEU A 1 80  ? 9.992   -0.919  -11.772 1.00 1.00 ? 80  LEU A HB2  1  
ATOM 1204  H HB3  . LEU A 1 80  ? 9.658   -2.512  -12.473 1.00 1.00 ? 80  LEU A HB3  1  
ATOM 1205  H HG   . LEU A 1 80  ? 7.585   -0.637  -11.255 1.00 1.00 ? 80  LEU A HG   1  
ATOM 1206  H HD11 . LEU A 1 80  ? 6.830   -0.336  -13.529 1.00 1.00 ? 80  LEU A HD11 1  
ATOM 1207  H HD12 . LEU A 1 80  ? 8.541   0.099   -13.429 1.00 1.00 ? 80  LEU A HD12 1  
ATOM 1208  H HD13 . LEU A 1 80  ? 8.082   -1.449  -14.144 1.00 1.00 ? 80  LEU A HD13 1  
ATOM 1209  H HD21 . LEU A 1 80  ? 6.892   -2.950  -10.896 1.00 1.00 ? 80  LEU A HD21 1  
ATOM 1210  H HD22 . LEU A 1 80  ? 5.924   -2.241  -12.197 1.00 1.00 ? 80  LEU A HD22 1  
ATOM 1211  H HD23 . LEU A 1 80  ? 7.251   -3.360  -12.590 1.00 1.00 ? 80  LEU A HD23 1  
ATOM 1212  N N    . ASP A 1 81  ? 11.763  -2.103  -9.198  1.00 1.00 ? 81  ASP A N    1  
ATOM 1213  C CA   . ASP A 1 81  ? 13.157  -2.395  -8.829  1.00 1.00 ? 81  ASP A CA   1  
ATOM 1214  C C    . ASP A 1 81  ? 13.361  -3.842  -8.354  1.00 1.00 ? 81  ASP A C    1  
ATOM 1215  O O    . ASP A 1 81  ? 14.438  -4.420  -8.493  1.00 1.00 ? 81  ASP A O    1  
ATOM 1216  C CB   . ASP A 1 81  ? 13.573  -1.454  -7.699  1.00 1.00 ? 81  ASP A CB   1  
ATOM 1217  C CG   . ASP A 1 81  ? 15.104  -1.347  -7.626  1.00 1.00 ? 81  ASP A CG   1  
ATOM 1218  O OD1  . ASP A 1 81  ? 15.709  -0.880  -8.623  1.00 1.00 ? 81  ASP A OD1  1  
ATOM 1219  O OD2  . ASP A 1 81  ? 15.688  -1.709  -6.577  1.00 1.00 ? 81  ASP A OD2  1  
ATOM 1220  H H    . ASP A 1 81  ? 11.254  -1.417  -8.653  1.00 1.00 ? 81  ASP A H    1  
ATOM 1221  H HA   . ASP A 1 81  ? 13.787  -2.236  -9.702  1.00 1.00 ? 81  ASP A HA   1  
ATOM 1222  H HB2  . ASP A 1 81  ? 13.165  -0.460  -7.873  1.00 1.00 ? 81  ASP A HB2  1  
ATOM 1223  H HB3  . ASP A 1 81  ? 13.153  -1.843  -6.760  1.00 1.00 ? 81  ASP A HB3  1  
ATOM 1224  N N    . HIS A 1 82  ? 12.303  -4.424  -7.794  1.00 1.00 ? 82  HIS A N    1  
ATOM 1225  C CA   . HIS A 1 82  ? 12.235  -5.820  -7.370  1.00 1.00 ? 82  HIS A CA   1  
ATOM 1226  C C    . HIS A 1 82  ? 11.957  -6.780  -8.557  1.00 1.00 ? 82  HIS A C    1  
ATOM 1227  O O    . HIS A 1 82  ? 12.159  -7.994  -8.440  1.00 1.00 ? 82  HIS A O    1  
ATOM 1228  C CB   . HIS A 1 82  ? 11.138  -5.848  -6.298  1.00 1.00 ? 82  HIS A CB   1  
ATOM 1229  C CG   . HIS A 1 82  ? 10.881  -7.196  -5.672  1.00 1.00 ? 82  HIS A CG   1  
ATOM 1230  N ND1  . HIS A 1 82  ? 9.992   -8.141  -6.129  1.00 1.00 ? 82  HIS A ND1  1  
ATOM 1231  C CD2  . HIS A 1 82  ? 11.458  -7.700  -4.535  1.00 1.00 ? 82  HIS A CD2  1  
ATOM 1232  C CE1  . HIS A 1 82  ? 10.040  -9.196  -5.297  1.00 1.00 ? 82  HIS A CE1  1  
ATOM 1233  N NE2  . HIS A 1 82  ? 10.919  -8.976  -4.300  1.00 1.00 ? 82  HIS A NE2  1  
ATOM 1234  H H    . HIS A 1 82  ? 11.459  -3.868  -7.710  1.00 1.00 ? 82  HIS A H    1  
ATOM 1235  H HA   . HIS A 1 82  ? 13.185  -6.115  -6.919  1.00 1.00 ? 82  HIS A HA   1  
ATOM 1236  H HB2  . HIS A 1 82  ? 11.411  -5.123  -5.521  1.00 1.00 ? 82  HIS A HB2  1  
ATOM 1237  H HB3  . HIS A 1 82  ? 10.205  -5.506  -6.746  1.00 1.00 ? 82  HIS A HB3  1  
ATOM 1238  H HD1  . HIS A 1 82  ? 9.423   -8.076  -6.976  1.00 1.00 ? 82  HIS A HD1  1  
ATOM 1239  H HD2  . HIS A 1 82  ? 12.197  -7.192  -3.924  1.00 1.00 ? 82  HIS A HD2  1  
ATOM 1240  H HE1  . HIS A 1 82  ? 9.448   -10.099 -5.419  1.00 1.00 ? 82  HIS A HE1  1  
ATOM 1241  N N    . GLU A 1 83  ? 11.526  -6.241  -9.705  1.00 1.00 ? 83  GLU A N    1  
ATOM 1242  C CA   . GLU A 1 83  ? 11.103  -6.992  -10.888 1.00 1.00 ? 83  GLU A CA   1  
ATOM 1243  C C    . GLU A 1 83  ? 12.197  -7.024  -11.967 1.00 1.00 ? 83  GLU A C    1  
ATOM 1244  O O    . GLU A 1 83  ? 12.514  -8.088  -12.502 1.00 1.00 ? 83  GLU A O    1  
ATOM 1245  C CB   . GLU A 1 83  ? 9.803   -6.390  -11.460 1.00 1.00 ? 83  GLU A CB   1  
ATOM 1246  C CG   . GLU A 1 83  ? 8.647   -6.352  -10.446 1.00 1.00 ? 83  GLU A CG   1  
ATOM 1247  C CD   . GLU A 1 83  ? 8.369   -7.725  -9.809  1.00 1.00 ? 83  GLU A CD   1  
ATOM 1248  O OE1  . GLU A 1 83  ? 7.970   -8.665  -10.540 1.00 1.00 ? 83  GLU A OE1  1  
ATOM 1249  O OE2  . GLU A 1 83  ? 8.523   -7.867  -8.571  1.00 1.00 ? 83  GLU A OE2  1  
ATOM 1250  H H    . GLU A 1 83  ? 11.517  -5.233  -9.776  1.00 1.00 ? 83  GLU A H    1  
ATOM 1251  H HA   . GLU A 1 83  ? 10.900  -8.022  -10.609 1.00 1.00 ? 83  GLU A HA   1  
ATOM 1252  H HB2  . GLU A 1 83  ? 9.985   -5.368  -11.810 1.00 1.00 ? 83  GLU A HB2  1  
ATOM 1253  H HB3  . GLU A 1 83  ? 9.500   -6.982  -12.326 1.00 1.00 ? 83  GLU A HB3  1  
ATOM 1254  H HG2  . GLU A 1 83  ? 8.880   -5.628  -9.664  1.00 1.00 ? 83  GLU A HG2  1  
ATOM 1255  H HG3  . GLU A 1 83  ? 7.747   -6.003  -10.958 1.00 1.00 ? 83  GLU A HG3  1  
ATOM 1256  N N    . TYR A 1 84  ? 12.797  -5.863  -12.263 1.00 1.00 ? 84  TYR A N    1  
ATOM 1257  C CA   . TYR A 1 84  ? 13.803  -5.666  -13.318 1.00 1.00 ? 84  TYR A CA   1  
ATOM 1258  C C    . TYR A 1 84  ? 15.143  -5.107  -12.793 1.00 1.00 ? 84  TYR A C    1  
ATOM 1259  O O    . TYR A 1 84  ? 15.245  -4.614  -11.668 1.00 1.00 ? 84  TYR A O    1  
ATOM 1260  C CB   . TYR A 1 84  ? 13.213  -4.746  -14.408 1.00 1.00 ? 84  TYR A CB   1  
ATOM 1261  C CG   . TYR A 1 84  ? 11.782  -5.084  -14.794 1.00 1.00 ? 84  TYR A CG   1  
ATOM 1262  C CD1  . TYR A 1 84  ? 11.453  -6.370  -15.268 1.00 1.00 ? 84  TYR A CD1  1  
ATOM 1263  C CD2  . TYR A 1 84  ? 10.762  -4.137  -14.582 1.00 1.00 ? 84  TYR A CD2  1  
ATOM 1264  C CE1  . TYR A 1 84  ? 10.110  -6.718  -15.502 1.00 1.00 ? 84  TYR A CE1  1  
ATOM 1265  C CE2  . TYR A 1 84  ? 9.417   -4.481  -14.809 1.00 1.00 ? 84  TYR A CE2  1  
ATOM 1266  C CZ   . TYR A 1 84  ? 9.084   -5.775  -15.273 1.00 1.00 ? 84  TYR A CZ   1  
ATOM 1267  O OH   . TYR A 1 84  ? 7.784   -6.121  -15.486 1.00 1.00 ? 84  TYR A OH   1  
ATOM 1268  H H    . TYR A 1 84  ? 12.438  -5.036  -11.802 1.00 1.00 ? 84  TYR A H    1  
ATOM 1269  H HA   . TYR A 1 84  ? 14.018  -6.628  -13.787 1.00 1.00 ? 84  TYR A HA   1  
ATOM 1270  H HB2  . TYR A 1 84  ? 13.246  -3.718  -14.042 1.00 1.00 ? 84  TYR A HB2  1  
ATOM 1271  H HB3  . TYR A 1 84  ? 13.832  -4.797  -15.304 1.00 1.00 ? 84  TYR A HB3  1  
ATOM 1272  H HD1  . TYR A 1 84  ? 12.231  -7.105  -15.420 1.00 1.00 ? 84  TYR A HD1  1  
ATOM 1273  H HD2  . TYR A 1 84  ? 11.012  -3.152  -14.215 1.00 1.00 ? 84  TYR A HD2  1  
ATOM 1274  H HE1  . TYR A 1 84  ? 9.857   -7.711  -15.844 1.00 1.00 ? 84  TYR A HE1  1  
ATOM 1275  H HE2  . TYR A 1 84  ? 8.645   -3.756  -14.612 1.00 1.00 ? 84  TYR A HE2  1  
ATOM 1276  H HH   . TYR A 1 84  ? 7.157   -5.409  -15.292 1.00 1.00 ? 84  TYR A HH   1  
ATOM 1277  N N    . GLN A 1 85  ? 16.181  -5.154  -13.639 1.00 1.00 ? 85  GLN A N    1  
ATOM 1278  C CA   . GLN A 1 85  ? 17.531  -4.658  -13.335 1.00 1.00 ? 85  GLN A CA   1  
ATOM 1279  C C    . GLN A 1 85  ? 17.554  -3.123  -13.158 1.00 1.00 ? 85  GLN A C    1  
ATOM 1280  O O    . GLN A 1 85  ? 16.619  -2.445  -13.599 1.00 1.00 ? 85  GLN A O    1  
ATOM 1281  C CB   . GLN A 1 85  ? 18.491  -5.111  -14.459 1.00 1.00 ? 85  GLN A CB   1  
ATOM 1282  C CG   . GLN A 1 85  ? 18.791  -6.622  -14.429 1.00 1.00 ? 85  GLN A CG   1  
ATOM 1283  C CD   . GLN A 1 85  ? 19.608  -7.051  -13.204 1.00 1.00 ? 85  GLN A CD   1  
ATOM 1284  O OE1  . GLN A 1 85  ? 20.760  -6.677  -13.030 1.00 1.00 ? 85  GLN A OE1  1  
ATOM 1285  N NE2  . GLN A 1 85  ? 19.043  -7.819  -12.293 1.00 1.00 ? 85  GLN A NE2  1  
ATOM 1286  H H    . GLN A 1 85  ? 16.028  -5.558  -14.551 1.00 1.00 ? 85  GLN A H    1  
ATOM 1287  H HA   . GLN A 1 85  ? 17.850  -5.110  -12.395 1.00 1.00 ? 85  GLN A HA   1  
ATOM 1288  H HB2  . GLN A 1 85  ? 18.057  -4.851  -15.427 1.00 1.00 ? 85  GLN A HB2  1  
ATOM 1289  H HB3  . GLN A 1 85  ? 19.436  -4.572  -14.385 1.00 1.00 ? 85  GLN A HB3  1  
ATOM 1290  H HG2  . GLN A 1 85  ? 17.851  -7.174  -14.451 1.00 1.00 ? 85  GLN A HG2  1  
ATOM 1291  H HG3  . GLN A 1 85  ? 19.351  -6.889  -15.325 1.00 1.00 ? 85  GLN A HG3  1  
ATOM 1292  H HE21 . GLN A 1 85  ? 18.103  -8.168  -12.415 1.00 1.00 ? 85  GLN A HE21 1  
ATOM 1293  H HE22 . GLN A 1 85  ? 19.594  -8.097  -11.493 1.00 1.00 ? 85  GLN A HE22 1  
ATOM 1294  N N    . PRO A 1 86  ? 18.595  -2.541  -12.522 1.00 1.00 ? 86  PRO A N    1  
ATOM 1295  C CA   . PRO A 1 86  ? 18.767  -1.091  -12.429 1.00 1.00 ? 86  PRO A CA   1  
ATOM 1296  C C    . PRO A 1 86  ? 19.147  -0.498  -13.797 1.00 1.00 ? 86  PRO A C    1  
ATOM 1297  O O    . PRO A 1 86  ? 20.322  -0.355  -14.139 1.00 1.00 ? 86  PRO A O    1  
ATOM 1298  C CB   . PRO A 1 86  ? 19.824  -0.871  -11.340 1.00 1.00 ? 86  PRO A CB   1  
ATOM 1299  C CG   . PRO A 1 86  ? 20.675  -2.136  -11.415 1.00 1.00 ? 86  PRO A CG   1  
ATOM 1300  C CD   . PRO A 1 86  ? 19.654  -3.214  -11.771 1.00 1.00 ? 86  PRO A CD   1  
ATOM 1301  H HA   . PRO A 1 86  ? 17.842  -0.622  -12.096 1.00 1.00 ? 86  PRO A HA   1  
ATOM 1302  H HB2  . PRO A 1 86  ? 20.417  0.030   -11.497 1.00 1.00 ? 86  PRO A HB2  1  
ATOM 1303  H HB3  . PRO A 1 86  ? 19.332  -0.823  -10.367 1.00 1.00 ? 86  PRO A HB3  1  
ATOM 1304  H HG2  . PRO A 1 86  ? 21.408  -2.041  -12.216 1.00 1.00 ? 86  PRO A HG2  1  
ATOM 1305  H HG3  . PRO A 1 86  ? 21.170  -2.346  -10.467 1.00 1.00 ? 86  PRO A HG3  1  
ATOM 1306  H HD2  . PRO A 1 86  ? 20.139  -4.000  -12.349 1.00 1.00 ? 86  PRO A HD2  1  
ATOM 1307  H HD3  . PRO A 1 86  ? 19.230  -3.629  -10.852 1.00 1.00 ? 86  PRO A HD3  1  
ATOM 1308  N N    . ARG A 1 87  ? 18.120  -0.157  -14.591 1.00 1.00 ? 87  ARG A N    1  
ATOM 1309  C CA   . ARG A 1 87  ? 18.256  0.503   -15.897 1.00 1.00 ? 87  ARG A CA   1  
ATOM 1310  C C    . ARG A 1 87  ? 18.815  1.943   -15.749 1.00 1.00 ? 87  ARG A C    1  
ATOM 1311  O O    . ARG A 1 87  ? 18.556  2.592   -14.729 1.00 1.00 ? 87  ARG A O    1  
ATOM 1312  C CB   . ARG A 1 87  ? 16.888  0.488   -16.613 1.00 1.00 ? 87  ARG A CB   1  
ATOM 1313  C CG   . ARG A 1 87  ? 16.656  -0.758  -17.486 1.00 1.00 ? 87  ARG A CG   1  
ATOM 1314  C CD   . ARG A 1 87  ? 16.595  -2.123  -16.782 1.00 1.00 ? 87  ARG A CD   1  
ATOM 1315  N NE   . ARG A 1 87  ? 16.799  -3.231  -17.743 1.00 1.00 ? 87  ARG A NE   1  
ATOM 1316  C CZ   . ARG A 1 87  ? 15.927  -3.800  -18.573 1.00 1.00 ? 87  ARG A CZ   1  
ATOM 1317  N NH1  . ARG A 1 87  ? 14.696  -3.365  -18.729 1.00 1.00 ? 87  ARG A NH1  1  
ATOM 1318  N NH2  . ARG A 1 87  ? 16.301  -4.834  -19.289 1.00 1.00 ? 87  ARG A NH2  1  
ATOM 1319  H H    . ARG A 1 87  ? 17.179  -0.362  -14.268 1.00 1.00 ? 87  ARG A H    1  
ATOM 1320  H HA   . ARG A 1 87  ? 18.968  -0.079  -16.484 1.00 1.00 ? 87  ARG A HA   1  
ATOM 1321  H HB2  . ARG A 1 87  ? 16.083  0.578   -15.882 1.00 1.00 ? 87  ARG A HB2  1  
ATOM 1322  H HB3  . ARG A 1 87  ? 16.822  1.359   -17.267 1.00 1.00 ? 87  ARG A HB3  1  
ATOM 1323  H HG2  . ARG A 1 87  ? 15.717  -0.610  -18.015 1.00 1.00 ? 87  ARG A HG2  1  
ATOM 1324  H HG3  . ARG A 1 87  ? 17.459  -0.795  -18.218 1.00 1.00 ? 87  ARG A HG3  1  
ATOM 1325  H HD2  . ARG A 1 87  ? 17.397  -2.180  -16.048 1.00 1.00 ? 87  ARG A HD2  1  
ATOM 1326  H HD3  . ARG A 1 87  ? 15.647  -2.236  -16.252 1.00 1.00 ? 87  ARG A HD3  1  
ATOM 1327  H HE   . ARG A 1 87  ? 17.734  -3.625  -17.750 1.00 1.00 ? 87  ARG A HE   1  
ATOM 1328  H HH11 . ARG A 1 87  ? 14.367  -2.528  -18.260 1.00 1.00 ? 87  ARG A HH11 1  
ATOM 1329  H HH12 . ARG A 1 87  ? 14.067  -3.823  -19.380 1.00 1.00 ? 87  ARG A HH12 1  
ATOM 1330  H HH21 . ARG A 1 87  ? 17.236  -5.210  -19.209 1.00 1.00 ? 87  ARG A HH21 1  
ATOM 1331  H HH22 . ARG A 1 87  ? 15.663  -5.274  -19.935 1.00 1.00 ? 87  ARG A HH22 1  
ATOM 1332  N N    . PRO A 1 88  ? 19.541  2.473   -16.763 1.00 1.00 ? 88  PRO A N    1  
ATOM 1333  C CA   . PRO A 1 88  ? 20.114  3.823   -16.731 1.00 1.00 ? 88  PRO A CA   1  
ATOM 1334  C C    . PRO A 1 88  ? 19.001  4.871   -16.857 1.00 1.00 ? 88  PRO A C    1  
ATOM 1335  O O    . PRO A 1 88  ? 18.326  4.945   -17.882 1.00 1.00 ? 88  PRO A O    1  
ATOM 1336  C CB   . PRO A 1 88  ? 21.126  3.876   -17.880 1.00 1.00 ? 88  PRO A CB   1  
ATOM 1337  C CG   . PRO A 1 88  ? 20.574  2.864   -18.881 1.00 1.00 ? 88  PRO A CG   1  
ATOM 1338  C CD   . PRO A 1 88  ? 19.923  1.801   -18.003 1.00 1.00 ? 88  PRO A CD   1  
ATOM 1339  H HA   . PRO A 1 88  ? 20.659  3.978   -15.799 1.00 1.00 ? 88  PRO A HA   1  
ATOM 1340  H HB2  . PRO A 1 88  ? 21.214  4.872   -18.312 1.00 1.00 ? 88  PRO A HB2  1  
ATOM 1341  H HB3  . PRO A 1 88  ? 22.099  3.533   -17.524 1.00 1.00 ? 88  PRO A HB3  1  
ATOM 1342  H HG2  . PRO A 1 88  ? 19.805  3.337   -19.486 1.00 1.00 ? 88  PRO A HG2  1  
ATOM 1343  H HG3  . PRO A 1 88  ? 21.361  2.449   -19.511 1.00 1.00 ? 88  PRO A HG3  1  
ATOM 1344  H HD2  . PRO A 1 88  ? 19.055  1.392   -18.524 1.00 1.00 ? 88  PRO A HD2  1  
ATOM 1345  H HD3  . PRO A 1 88  ? 20.645  1.010   -17.786 1.00 1.00 ? 88  PRO A HD3  1  
ATOM 1346  N N    . VAL A 1 89  ? 18.820  5.690   -15.817 1.00 1.00 ? 89  VAL A N    1  
ATOM 1347  C CA   . VAL A 1 89  ? 17.661  6.600   -15.681 1.00 1.00 ? 89  VAL A CA   1  
ATOM 1348  C C    . VAL A 1 89  ? 17.487  7.586   -16.839 1.00 1.00 ? 89  VAL A C    1  
ATOM 1349  O O    . VAL A 1 89  ? 16.355  7.876   -17.223 1.00 1.00 ? 89  VAL A O    1  
ATOM 1350  C CB   . VAL A 1 89  ? 17.673  7.314   -14.312 1.00 1.00 ? 89  VAL A CB   1  
ATOM 1351  C CG1  . VAL A 1 89  ? 18.796  8.355   -14.161 1.00 1.00 ? 89  VAL A CG1  1  
ATOM 1352  C CG2  . VAL A 1 89  ? 16.316  7.962   -14.029 1.00 1.00 ? 89  VAL A CG2  1  
ATOM 1353  H H    . VAL A 1 89  ? 19.417  5.548   -15.000 1.00 1.00 ? 89  VAL A H    1  
ATOM 1354  H HA   . VAL A 1 89  ? 16.785  5.954   -15.690 1.00 1.00 ? 89  VAL A HA   1  
ATOM 1355  H HB   . VAL A 1 89  ? 17.831  6.550   -13.551 1.00 1.00 ? 89  VAL A HB   1  
ATOM 1356  H HG11 . VAL A 1 89  ? 18.799  8.743   -13.143 1.00 1.00 ? 89  VAL A HG11 1  
ATOM 1357  H HG12 . VAL A 1 89  ? 19.765  7.895   -14.360 1.00 1.00 ? 89  VAL A HG12 1  
ATOM 1358  H HG13 . VAL A 1 89  ? 18.641  9.189   -14.847 1.00 1.00 ? 89  VAL A HG13 1  
ATOM 1359  H HG21 . VAL A 1 89  ? 16.146  8.816   -14.684 1.00 1.00 ? 89  VAL A HG21 1  
ATOM 1360  H HG22 . VAL A 1 89  ? 15.521  7.232   -14.178 1.00 1.00 ? 89  VAL A HG22 1  
ATOM 1361  H HG23 . VAL A 1 89  ? 16.296  8.300   -12.996 1.00 1.00 ? 89  VAL A HG23 1  
ATOM 1362  N N    . GLU A 1 90  ? 18.586  8.020   -17.465 1.00 1.00 ? 90  GLU A N    1  
ATOM 1363  C CA   . GLU A 1 90  ? 18.534  8.886   -18.650 1.00 1.00 ? 90  GLU A CA   1  
ATOM 1364  C C    . GLU A 1 90  ? 17.790  8.223   -19.816 1.00 1.00 ? 90  GLU A C    1  
ATOM 1365  O O    . GLU A 1 90  ? 17.027  8.884   -20.514 1.00 1.00 ? 90  GLU A O    1  
ATOM 1366  C CB   . GLU A 1 90  ? 19.951  9.334   -19.052 1.00 1.00 ? 90  GLU A CB   1  
ATOM 1367  C CG   . GLU A 1 90  ? 20.907  8.221   -19.507 1.00 1.00 ? 90  GLU A CG   1  
ATOM 1368  C CD   . GLU A 1 90  ? 22.316  8.781   -19.756 1.00 1.00 ? 90  GLU A CD   1  
ATOM 1369  O OE1  . GLU A 1 90  ? 22.609  9.206   -20.897 1.00 1.00 ? 90  GLU A OE1  1  
ATOM 1370  O OE2  . GLU A 1 90  ? 23.143  8.790   -18.812 1.00 1.00 ? 90  GLU A OE2  1  
ATOM 1371  H H    . GLU A 1 90  ? 19.491  7.783   -17.075 1.00 1.00 ? 90  GLU A H    1  
ATOM 1372  H HA   . GLU A 1 90  ? 17.976  9.782   -18.376 1.00 1.00 ? 90  GLU A HA   1  
ATOM 1373  H HB2  . GLU A 1 90  ? 19.861  10.053  -19.862 1.00 1.00 ? 90  GLU A HB2  1  
ATOM 1374  H HB3  . GLU A 1 90  ? 20.394  9.840   -18.195 1.00 1.00 ? 90  GLU A HB3  1  
ATOM 1375  H HG2  . GLU A 1 90  ? 20.959  7.443   -18.744 1.00 1.00 ? 90  GLU A HG2  1  
ATOM 1376  H HG3  . GLU A 1 90  ? 20.532  7.774   -20.428 1.00 1.00 ? 90  GLU A HG3  1  
ATOM 1377  N N    . VAL A 1 91  ? 17.932  6.902   -19.983 1.00 1.00 ? 91  VAL A N    1  
ATOM 1378  C CA   . VAL A 1 91  ? 17.238  6.140   -21.036 1.00 1.00 ? 91  VAL A CA   1  
ATOM 1379  C C    . VAL A 1 91  ? 15.764  5.908   -20.674 1.00 1.00 ? 91  VAL A C    1  
ATOM 1380  O O    . VAL A 1 91  ? 14.921  5.928   -21.562 1.00 1.00 ? 91  VAL A O    1  
ATOM 1381  C CB   . VAL A 1 91  ? 17.947  4.811   -21.395 1.00 1.00 ? 91  VAL A CB   1  
ATOM 1382  C CG1  . VAL A 1 91  ? 17.336  4.166   -22.653 1.00 1.00 ? 91  VAL A CG1  1  
ATOM 1383  C CG2  . VAL A 1 91  ? 19.451  5.005   -21.655 1.00 1.00 ? 91  VAL A CG2  1  
ATOM 1384  H H    . VAL A 1 91  ? 18.549  6.414   -19.341 1.00 1.00 ? 91  VAL A H    1  
ATOM 1385  H HA   . VAL A 1 91  ? 17.268  6.763   -21.925 1.00 1.00 ? 91  VAL A HA   1  
ATOM 1386  H HB   . VAL A 1 91  ? 17.831  4.119   -20.563 1.00 1.00 ? 91  VAL A HB   1  
ATOM 1387  H HG11 . VAL A 1 91  ? 16.300  3.881   -22.472 1.00 1.00 ? 91  VAL A HG11 1  
ATOM 1388  H HG12 . VAL A 1 91  ? 17.379  4.863   -23.491 1.00 1.00 ? 91  VAL A HG12 1  
ATOM 1389  H HG13 . VAL A 1 91  ? 17.890  3.265   -22.915 1.00 1.00 ? 91  VAL A HG13 1  
ATOM 1390  H HG21 . VAL A 1 91  ? 19.902  4.053   -21.938 1.00 1.00 ? 91  VAL A HG21 1  
ATOM 1391  H HG22 . VAL A 1 91  ? 19.606  5.728   -22.455 1.00 1.00 ? 91  VAL A HG22 1  
ATOM 1392  H HG23 . VAL A 1 91  ? 19.954  5.353   -20.755 1.00 1.00 ? 91  VAL A HG23 1  
ATOM 1393  N N    . ILE A 1 92  ? 15.419  5.767   -19.383 1.00 1.00 ? 92  ILE A N    1  
ATOM 1394  C CA   . ILE A 1 92  ? 14.007  5.686   -18.936 1.00 1.00 ? 92  ILE A CA   1  
ATOM 1395  C C    . ILE A 1 92  ? 13.284  7.011   -19.223 1.00 1.00 ? 92  ILE A C    1  
ATOM 1396  O O    . ILE A 1 92  ? 12.213  7.018   -19.816 1.00 1.00 ? 92  ILE A O    1  
ATOM 1397  C CB   . ILE A 1 92  ? 13.924  5.297   -17.435 1.00 1.00 ? 92  ILE A CB   1  
ATOM 1398  C CG1  . ILE A 1 92  ? 14.763  4.037   -17.117 1.00 1.00 ? 92  ILE A CG1  1  
ATOM 1399  C CG2  . ILE A 1 92  ? 12.455  5.067   -17.025 1.00 1.00 ? 92  ILE A CG2  1  
ATOM 1400  C CD1  . ILE A 1 92  ? 14.793  3.702   -15.621 1.00 1.00 ? 92  ILE A CD1  1  
ATOM 1401  H H    . ILE A 1 92  ? 16.158  5.713   -18.686 1.00 1.00 ? 92  ILE A H    1  
ATOM 1402  H HA   . ILE A 1 92  ? 13.488  4.918   -19.520 1.00 1.00 ? 92  ILE A HA   1  
ATOM 1403  H HB   . ILE A 1 92  ? 14.318  6.122   -16.838 1.00 1.00 ? 92  ILE A HB   1  
ATOM 1404  H HG12 . ILE A 1 92  ? 14.374  3.180   -17.670 1.00 1.00 ? 92  ILE A HG12 1  
ATOM 1405  H HG13 . ILE A 1 92  ? 15.795  4.191   -17.422 1.00 1.00 ? 92  ILE A HG13 1  
ATOM 1406  H HG21 . ILE A 1 92  ? 12.372  4.961   -15.942 1.00 1.00 ? 92  ILE A HG21 1  
ATOM 1407  H HG22 . ILE A 1 92  ? 11.836  5.917   -17.312 1.00 1.00 ? 92  ILE A HG22 1  
ATOM 1408  H HG23 . ILE A 1 92  ? 12.071  4.162   -17.498 1.00 1.00 ? 92  ILE A HG23 1  
ATOM 1409  H HD11 . ILE A 1 92  ? 13.822  3.332   -15.295 1.00 1.00 ? 92  ILE A HD11 1  
ATOM 1410  H HD12 . ILE A 1 92  ? 15.541  2.930   -15.444 1.00 1.00 ? 92  ILE A HD12 1  
ATOM 1411  H HD13 . ILE A 1 92  ? 15.056  4.592   -15.049 1.00 1.00 ? 92  ILE A HD13 1  
ATOM 1412  N N    . ILE A 1 93  ? 13.903  8.145   -18.885 1.00 1.00 ? 93  ILE A N    1  
ATOM 1413  C CA   . ILE A 1 93  ? 13.386  9.490   -19.196 1.00 1.00 ? 93  ILE A CA   1  
ATOM 1414  C C    . ILE A 1 93  ? 13.375  9.753   -20.705 1.00 1.00 ? 93  ILE A C    1  
ATOM 1415  O O    . ILE A 1 93  ? 12.423  10.328  -21.209 1.00 1.00 ? 93  ILE A O    1  
ATOM 1416  C CB   . ILE A 1 93  ? 14.169  10.556  -18.388 1.00 1.00 ? 93  ILE A CB   1  
ATOM 1417  C CG1  . ILE A 1 93  ? 13.778  10.430  -16.895 1.00 1.00 ? 93  ILE A CG1  1  
ATOM 1418  C CG2  . ILE A 1 93  ? 13.872  11.985  -18.885 1.00 1.00 ? 93  ILE A CG2  1  
ATOM 1419  C CD1  . ILE A 1 93  ? 14.674  11.204  -15.922 1.00 1.00 ? 93  ILE A CD1  1  
ATOM 1420  H H    . ILE A 1 93  ? 14.765  8.071   -18.360 1.00 1.00 ? 93  ILE A H    1  
ATOM 1421  H HA   . ILE A 1 93  ? 12.344  9.523   -18.889 1.00 1.00 ? 93  ILE A HA   1  
ATOM 1422  H HB   . ILE A 1 93  ? 15.238  10.362  -18.511 1.00 1.00 ? 93  ILE A HB   1  
ATOM 1423  H HG12 . ILE A 1 93  ? 12.752  10.782  -16.773 1.00 1.00 ? 93  ILE A HG12 1  
ATOM 1424  H HG13 . ILE A 1 93  ? 13.813  9.382   -16.592 1.00 1.00 ? 93  ILE A HG13 1  
ATOM 1425  H HG21 . ILE A 1 93  ? 14.383  12.723  -18.268 1.00 1.00 ? 93  ILE A HG21 1  
ATOM 1426  H HG22 . ILE A 1 93  ? 14.232  12.113  -19.904 1.00 1.00 ? 93  ILE A HG22 1  
ATOM 1427  H HG23 . ILE A 1 93  ? 12.797  12.177  -18.855 1.00 1.00 ? 93  ILE A HG23 1  
ATOM 1428  H HD11 . ILE A 1 93  ? 14.342  11.003  -14.902 1.00 1.00 ? 93  ILE A HD11 1  
ATOM 1429  H HD12 . ILE A 1 93  ? 15.711  10.882  -16.026 1.00 1.00 ? 93  ILE A HD12 1  
ATOM 1430  H HD13 . ILE A 1 93  ? 14.605  12.276  -16.096 1.00 1.00 ? 93  ILE A HD13 1  
ATOM 1431  N N    . SER A 1 94  ? 14.376  9.292   -21.444 1.00 1.00 ? 94  SER A N    1  
ATOM 1432  C CA   . SER A 1 94  ? 14.387  9.411   -22.912 1.00 1.00 ? 94  SER A CA   1  
ATOM 1433  C C    . SER A 1 94  ? 13.254  8.591   -23.542 1.00 1.00 ? 94  SER A C    1  
ATOM 1434  O O    . SER A 1 94  ? 12.589  9.047   -24.463 1.00 1.00 ? 94  SER A O    1  
ATOM 1435  C CB   . SER A 1 94  ? 15.736  8.982   -23.505 1.00 1.00 ? 94  SER A CB   1  
ATOM 1436  O OG   . SER A 1 94  ? 16.802  9.793   -23.028 1.00 1.00 ? 94  SER A OG   1  
ATOM 1437  H H    . SER A 1 94  ? 15.180  8.898   -20.974 1.00 1.00 ? 94  SER A H    1  
ATOM 1438  H HA   . SER A 1 94  ? 14.217  10.448  -23.170 1.00 1.00 ? 94  SER A HA   1  
ATOM 1439  H HB2  . SER A 1 94  ? 15.930  7.937   -23.258 1.00 1.00 ? 94  SER A HB2  1  
ATOM 1440  H HB3  . SER A 1 94  ? 15.686  9.072   -24.592 1.00 1.00 ? 94  SER A HB3  1  
ATOM 1441  H HG   . SER A 1 94  ? 16.978  9.541   -22.094 1.00 1.00 ? 94  SER A HG   1  
ATOM 1442  N N    . SER A 1 95  ? 12.972  7.410   -22.994 1.00 1.00 ? 95  SER A N    1  
ATOM 1443  C CA   . SER A 1 95  ? 11.828  6.584   -23.378 1.00 1.00 ? 95  SER A CA   1  
ATOM 1444  C C    . SER A 1 95  ? 10.505  7.286   -23.064 1.00 1.00 ? 95  SER A C    1  
ATOM 1445  O O    . SER A 1 95  ? 9.622   7.322   -23.916 1.00 1.00 ? 95  SER A O    1  
ATOM 1446  C CB   . SER A 1 95  ? 11.905  5.223   -22.670 1.00 1.00 ? 95  SER A CB   1  
ATOM 1447  O OG   . SER A 1 95  ? 12.917  4.408   -23.250 1.00 1.00 ? 95  SER A OG   1  
ATOM 1448  H H    . SER A 1 95  ? 13.563  7.089   -22.238 1.00 1.00 ? 95  SER A H    1  
ATOM 1449  H HA   . SER A 1 95  ? 11.858  6.417   -24.450 1.00 1.00 ? 95  SER A HA   1  
ATOM 1450  H HB2  . SER A 1 95  ? 12.117  5.377   -21.611 1.00 1.00 ? 95  SER A HB2  1  
ATOM 1451  H HB3  . SER A 1 95  ? 10.944  4.716   -22.771 1.00 1.00 ? 95  SER A HB3  1  
ATOM 1452  H HG   . SER A 1 95  ? 13.798  4.764   -23.025 1.00 1.00 ? 95  SER A HG   1  
ATOM 1453  N N    . ALA A 1 96  ? 10.374  7.910   -21.885 1.00 1.00 ? 96  ALA A N    1  
ATOM 1454  C CA   . ALA A 1 96  ? 9.218   8.727   -21.536 1.00 1.00 ? 96  ALA A CA   1  
ATOM 1455  C C    . ALA A 1 96  ? 9.022   9.860   -22.564 1.00 1.00 ? 96  ALA A C    1  
ATOM 1456  O O    . ALA A 1 96  ? 7.948   10.008  -23.149 1.00 1.00 ? 96  ALA A O    1  
ATOM 1457  C CB   . ALA A 1 96  ? 9.438   9.226   -20.097 1.00 1.00 ? 96  ALA A CB   1  
ATOM 1458  H H    . ALA A 1 96  ? 11.118  7.839   -21.197 1.00 1.00 ? 96  ALA A H    1  
ATOM 1459  H HA   . ALA A 1 96  ? 8.332   8.094   -21.554 1.00 1.00 ? 96  ALA A HA   1  
ATOM 1460  H HB1  . ALA A 1 96  ? 8.510   9.618   -19.690 1.00 1.00 ? 96  ALA A HB1  1  
ATOM 1461  H HB2  . ALA A 1 96  ? 9.770   8.403   -19.459 1.00 1.00 ? 96  ALA A HB2  1  
ATOM 1462  H HB3  . ALA A 1 96  ? 10.200  10.005  -20.072 1.00 1.00 ? 96  ALA A HB3  1  
ATOM 1463  N N    . LYS A 1 97  ? 10.085  10.616  -22.859 1.00 1.00 ? 97  LYS A N    1  
ATOM 1464  C CA   . LYS A 1 97  ? 10.071  11.718  -23.830 1.00 1.00 ? 97  LYS A CA   1  
ATOM 1465  C C    . LYS A 1 97  ? 9.731   11.254  -25.258 1.00 1.00 ? 97  LYS A C    1  
ATOM 1466  O O    . LYS A 1 97  ? 8.945   11.907  -25.943 1.00 1.00 ? 97  LYS A O    1  
ATOM 1467  C CB   . LYS A 1 97  ? 11.435  12.421  -23.787 1.00 1.00 ? 97  LYS A CB   1  
ATOM 1468  C CG   . LYS A 1 97  ? 11.621  13.270  -22.518 1.00 1.00 ? 97  LYS A CG   1  
ATOM 1469  C CD   . LYS A 1 97  ? 13.071  13.770  -22.450 1.00 1.00 ? 97  LYS A CD   1  
ATOM 1470  C CE   . LYS A 1 97  ? 13.253  14.790  -21.311 1.00 1.00 ? 97  LYS A CE   1  
ATOM 1471  N NZ   . LYS A 1 97  ? 14.636  15.350  -21.286 1.00 1.00 ? 97  LYS A NZ   1  
ATOM 1472  H H    . LYS A 1 97  ? 10.960  10.427  -22.373 1.00 1.00 ? 97  LYS A H    1  
ATOM 1473  H HA   . LYS A 1 97  ? 9.304   12.430  -23.541 1.00 1.00 ? 97  LYS A HA   1  
ATOM 1474  H HB2  . LYS A 1 97  ? 12.226  11.673  -23.854 1.00 1.00 ? 97  LYS A HB2  1  
ATOM 1475  H HB3  . LYS A 1 97  ? 11.526  13.080  -24.654 1.00 1.00 ? 97  LYS A HB3  1  
ATOM 1476  H HG2  . LYS A 1 97  ? 10.937  14.120  -22.555 1.00 1.00 ? 97  LYS A HG2  1  
ATOM 1477  H HG3  . LYS A 1 97  ? 11.400  12.680  -21.629 1.00 1.00 ? 97  LYS A HG3  1  
ATOM 1478  H HD2  . LYS A 1 97  ? 13.719  12.905  -22.290 1.00 1.00 ? 97  LYS A HD2  1  
ATOM 1479  H HD3  . LYS A 1 97  ? 13.331  14.239  -23.400 1.00 1.00 ? 97  LYS A HD3  1  
ATOM 1480  H HE2  . LYS A 1 97  ? 12.533  15.602  -21.449 1.00 1.00 ? 97  LYS A HE2  1  
ATOM 1481  H HE3  . LYS A 1 97  ? 13.022  14.304  -20.356 1.00 1.00 ? 97  LYS A HE3  1  
ATOM 1482  H HZ1  . LYS A 1 97  ? 14.856  15.828  -22.149 1.00 1.00 ? 97  LYS A HZ1  1  
ATOM 1483  H HZ2  . LYS A 1 97  ? 14.744  16.023  -20.537 1.00 1.00 ? 97  LYS A HZ2  1  
ATOM 1484  H HZ3  . LYS A 1 97  ? 15.333  14.628  -21.151 1.00 1.00 ? 97  LYS A HZ3  1  
ATOM 1485  N N    . GLU A 1 98  ? 10.267  10.110  -25.684 1.00 1.00 ? 98  GLU A N    1  
ATOM 1486  C CA   . GLU A 1 98  ? 9.942   9.485   -26.968 1.00 1.00 ? 98  GLU A CA   1  
ATOM 1487  C C    . GLU A 1 98  ? 8.487   8.993   -27.028 1.00 1.00 ? 98  GLU A C    1  
ATOM 1488  O O    . GLU A 1 98  ? 7.855   9.050   -28.087 1.00 1.00 ? 98  GLU A O    1  
ATOM 1489  C CB   . GLU A 1 98  ? 10.913  8.332   -27.275 1.00 1.00 ? 98  GLU A CB   1  
ATOM 1490  C CG   . GLU A 1 98  ? 12.298  8.811   -27.726 1.00 1.00 ? 98  GLU A CG   1  
ATOM 1491  C CD   . GLU A 1 98  ? 12.252  9.465   -29.117 1.00 1.00 ? 98  GLU A CD   1  
ATOM 1492  O OE1  . GLU A 1 98  ? 12.184  8.732   -30.132 1.00 1.00 ? 98  GLU A OE1  1  
ATOM 1493  O OE2  . GLU A 1 98  ? 12.298  10.717  -29.207 1.00 1.00 ? 98  GLU A OE2  1  
ATOM 1494  H H    . GLU A 1 98  ? 10.956  9.672   -25.089 1.00 1.00 ? 98  GLU A H    1  
ATOM 1495  H HA   . GLU A 1 98  ? 10.053  10.243  -27.735 1.00 1.00 ? 98  GLU A HA   1  
ATOM 1496  H HB2  . GLU A 1 98  ? 11.017  7.702   -26.390 1.00 1.00 ? 98  GLU A HB2  1  
ATOM 1497  H HB3  . GLU A 1 98  ? 10.495  7.714   -28.069 1.00 1.00 ? 98  GLU A HB3  1  
ATOM 1498  H HG2  . GLU A 1 98  ? 12.701  9.517   -27.001 1.00 1.00 ? 98  GLU A HG2  1  
ATOM 1499  H HG3  . GLU A 1 98  ? 12.971  7.952   -27.759 1.00 1.00 ? 98  GLU A HG3  1  
ATOM 1500  N N    . MET A 1 99  ? 7.927   8.548   -25.899 1.00 1.00 ? 99  MET A N    1  
ATOM 1501  C CA   . MET A 1 99  ? 6.527   8.150   -25.795 1.00 1.00 ? 99  MET A CA   1  
ATOM 1502  C C    . MET A 1 99  ? 5.573   9.347   -25.805 1.00 1.00 ? 99  MET A C    1  
ATOM 1503  O O    . MET A 1 99  ? 4.539   9.259   -26.461 1.00 1.00 ? 99  MET A O    1  
ATOM 1504  C CB   . MET A 1 99  ? 6.316   7.242   -24.578 1.00 1.00 ? 99  MET A CB   1  
ATOM 1505  C CG   . MET A 1 99  ? 6.965   5.865   -24.801 1.00 1.00 ? 99  MET A CG   1  
ATOM 1506  S SD   . MET A 1 99  ? 6.102   4.757   -25.951 1.00 1.00 ? 99  MET A SD   1  
ATOM 1507  C CE   . MET A 1 99  ? 4.815   4.135   -24.842 1.00 1.00 ? 99  MET A CE   1  
ATOM 1508  H H    . MET A 1 99  ? 8.520   8.411   -25.089 1.00 1.00 ? 99  MET A H    1  
ATOM 1509  H HA   . MET A 1 99  ? 6.291   7.557   -26.669 1.00 1.00 ? 99  MET A HA   1  
ATOM 1510  H HB2  . MET A 1 99  ? 6.734   7.713   -23.685 1.00 1.00 ? 99  MET A HB2  1  
ATOM 1511  H HB3  . MET A 1 99  ? 5.247   7.110   -24.435 1.00 1.00 ? 99  MET A HB3  1  
ATOM 1512  H HG2  . MET A 1 99  ? 7.980   6.010   -25.174 1.00 1.00 ? 99  MET A HG2  1  
ATOM 1513  H HG3  . MET A 1 99  ? 7.060   5.355   -23.845 1.00 1.00 ? 99  MET A HG3  1  
ATOM 1514  H HE1  . MET A 1 99  ? 4.114   4.935   -24.602 1.00 1.00 ? 99  MET A HE1  1  
ATOM 1515  H HE2  . MET A 1 99  ? 4.272   3.328   -25.335 1.00 1.00 ? 99  MET A HE2  1  
ATOM 1516  H HE3  . MET A 1 99  ? 5.268   3.755   -23.924 1.00 1.00 ? 99  MET A HE3  1  
ATOM 1517  N N    . VAL A 1 100 ? 5.906   10.466  -25.148 1.00 1.00 ? 100 VAL A N    1  
ATOM 1518  C CA   . VAL A 1 100 ? 5.132   11.729  -25.237 1.00 1.00 ? 100 VAL A CA   1  
ATOM 1519  C C    . VAL A 1 100 ? 4.803   12.083  -26.694 1.00 1.00 ? 100 VAL A C    1  
ATOM 1520  O O    . VAL A 1 100 ? 5.680   12.136  -27.556 1.00 1.00 ? 100 VAL A O    1  
ATOM 1521  C CB   . VAL A 1 100 ? 5.811   12.929  -24.534 1.00 1.00 ? 100 VAL A CB   1  
ATOM 1522  C CG1  . VAL A 1 100 ? 5.095   14.272  -24.775 1.00 1.00 ? 100 VAL A CG1  1  
ATOM 1523  C CG2  . VAL A 1 100 ? 5.823   12.724  -23.018 1.00 1.00 ? 100 VAL A CG2  1  
ATOM 1524  H H    . VAL A 1 100 ? 6.726   10.418  -24.547 1.00 1.00 ? 100 VAL A H    1  
ATOM 1525  H HA   . VAL A 1 100 ? 4.186   11.557  -24.731 1.00 1.00 ? 100 VAL A HA   1  
ATOM 1526  H HB   . VAL A 1 100 ? 6.837   13.017  -24.879 1.00 1.00 ? 100 VAL A HB   1  
ATOM 1527  H HG11 . VAL A 1 100 ? 4.045   14.196  -24.494 1.00 1.00 ? 100 VAL A HG11 1  
ATOM 1528  H HG12 . VAL A 1 100 ? 5.562   15.058  -24.177 1.00 1.00 ? 100 VAL A HG12 1  
ATOM 1529  H HG13 . VAL A 1 100 ? 5.167   14.558  -25.826 1.00 1.00 ? 100 VAL A HG13 1  
ATOM 1530  H HG21 . VAL A 1 100 ? 6.424   13.501  -22.552 1.00 1.00 ? 100 VAL A HG21 1  
ATOM 1531  H HG22 . VAL A 1 100 ? 4.808   12.776  -22.625 1.00 1.00 ? 100 VAL A HG22 1  
ATOM 1532  H HG23 . VAL A 1 100 ? 6.245   11.756  -22.770 1.00 1.00 ? 100 VAL A HG23 1  
ATOM 1533  N N    . GLY A 1 101 ? 3.510   12.318  -26.942 1.00 1.00 ? 101 GLY A N    1  
ATOM 1534  C CA   . GLY A 1 101 ? 2.925   12.603  -28.253 1.00 1.00 ? 101 GLY A CA   1  
ATOM 1535  C C    . GLY A 1 101 ? 2.289   11.385  -28.930 1.00 1.00 ? 101 GLY A C    1  
ATOM 1536  O O    . GLY A 1 101 ? 1.549   11.562  -29.895 1.00 1.00 ? 101 GLY A O    1  
ATOM 1537  H H    . GLY A 1 101 ? 2.868   12.247  -26.157 1.00 1.00 ? 101 GLY A H    1  
ATOM 1538  H HA2  . GLY A 1 101 ? 2.138   13.349  -28.125 1.00 1.00 ? 101 GLY A HA2  1  
ATOM 1539  H HA3  . GLY A 1 101 ? 3.691   12.993  -28.926 1.00 1.00 ? 101 GLY A HA3  1  
ATOM 1540  N N    . GLN A 1 102 ? 2.540   10.163  -28.439 1.00 1.00 ? 102 GLN A N    1  
ATOM 1541  C CA   . GLN A 1 102 ? 1.951   8.938   -28.963 1.00 1.00 ? 102 GLN A CA   1  
ATOM 1542  C C    . GLN A 1 102 ? 0.567   8.675   -28.346 1.00 1.00 ? 102 GLN A C    1  
ATOM 1543  O O    . GLN A 1 102 ? 0.329   8.939   -27.163 1.00 1.00 ? 102 GLN A O    1  
ATOM 1544  C CB   . GLN A 1 102 ? 2.900   7.735   -28.778 1.00 1.00 ? 102 GLN A CB   1  
ATOM 1545  C CG   . GLN A 1 102 ? 4.249   7.925   -29.506 1.00 1.00 ? 102 GLN A CG   1  
ATOM 1546  C CD   . GLN A 1 102 ? 5.133   6.674   -29.478 1.00 1.00 ? 102 GLN A CD   1  
ATOM 1547  O OE1  . GLN A 1 102 ? 4.703   5.562   -29.767 1.00 1.00 ? 102 GLN A OE1  1  
ATOM 1548  N NE2  . GLN A 1 102 ? 6.408   6.794   -29.158 1.00 1.00 ? 102 GLN A NE2  1  
ATOM 1549  H H    . GLN A 1 102 ? 3.164   10.056  -27.656 1.00 1.00 ? 102 GLN A H    1  
ATOM 1550  H HA   . GLN A 1 102 ? 1.820   9.082   -30.031 1.00 1.00 ? 102 GLN A HA   1  
ATOM 1551  H HB2  . GLN A 1 102 ? 3.072   7.560   -27.715 1.00 1.00 ? 102 GLN A HB2  1  
ATOM 1552  H HB3  . GLN A 1 102 ? 2.408   6.849   -29.181 1.00 1.00 ? 102 GLN A HB3  1  
ATOM 1553  H HG2  . GLN A 1 102 ? 4.068   8.180   -30.549 1.00 1.00 ? 102 GLN A HG2  1  
ATOM 1554  H HG3  . GLN A 1 102 ? 4.793   8.753   -29.056 1.00 1.00 ? 102 GLN A HG3  1  
ATOM 1555  H HE21 . GLN A 1 102 ? 6.806   7.696   -28.909 1.00 1.00 ? 102 GLN A HE21 1  
ATOM 1556  H HE22 . GLN A 1 102 ? 6.976   5.962   -29.150 1.00 1.00 ? 102 GLN A HE22 1  
ATOM 1557  N N    . LYS A 1 103 ? -0.343  8.144   -29.169 1.00 1.00 ? 103 LYS A N    1  
ATOM 1558  C CA   . LYS A 1 103 ? -1.721  7.784   -28.804 1.00 1.00 ? 103 LYS A CA   1  
ATOM 1559  C C    . LYS A 1 103 ? -1.897  6.290   -28.465 1.00 1.00 ? 103 LYS A C    1  
ATOM 1560  O O    . LYS A 1 103 ? -1.117  5.439   -28.902 1.00 1.00 ? 103 LYS A O    1  
ATOM 1561  C CB   . LYS A 1 103 ? -2.671  8.183   -29.949 1.00 1.00 ? 103 LYS A CB   1  
ATOM 1562  C CG   . LYS A 1 103 ? -2.980  9.687   -29.935 1.00 1.00 ? 103 LYS A CG   1  
ATOM 1563  C CD   . LYS A 1 103 ? -3.982  10.031  -31.046 1.00 1.00 ? 103 LYS A CD   1  
ATOM 1564  C CE   . LYS A 1 103 ? -4.621  11.411  -30.851 1.00 1.00 ? 103 LYS A CE   1  
ATOM 1565  N NZ   . LYS A 1 103 ? -3.666  12.532  -31.069 1.00 1.00 ? 103 LYS A NZ   1  
ATOM 1566  H H    . LYS A 1 103 ? -0.052  7.936   -30.114 1.00 1.00 ? 103 LYS A H    1  
ATOM 1567  H HA   . LYS A 1 103 ? -2.010  8.357   -27.928 1.00 1.00 ? 103 LYS A HA   1  
ATOM 1568  H HB2  . LYS A 1 103 ? -2.241  7.892   -30.910 1.00 1.00 ? 103 LYS A HB2  1  
ATOM 1569  H HB3  . LYS A 1 103 ? -3.615  7.648   -29.828 1.00 1.00 ? 103 LYS A HB3  1  
ATOM 1570  H HG2  . LYS A 1 103 ? -3.414  9.948   -28.968 1.00 1.00 ? 103 LYS A HG2  1  
ATOM 1571  H HG3  . LYS A 1 103 ? -2.059  10.254  -30.078 1.00 1.00 ? 103 LYS A HG3  1  
ATOM 1572  H HD2  . LYS A 1 103 ? -3.488  9.976   -32.020 1.00 1.00 ? 103 LYS A HD2  1  
ATOM 1573  H HD3  . LYS A 1 103 ? -4.789  9.294   -31.036 1.00 1.00 ? 103 LYS A HD3  1  
ATOM 1574  H HE2  . LYS A 1 103 ? -5.454  11.500  -31.554 1.00 1.00 ? 103 LYS A HE2  1  
ATOM 1575  H HE3  . LYS A 1 103 ? -5.031  11.456  -29.836 1.00 1.00 ? 103 LYS A HE3  1  
ATOM 1576  H HZ1  . LYS A 1 103 ? -2.988  12.592  -30.304 1.00 1.00 ? 103 LYS A HZ1  1  
ATOM 1577  H HZ2  . LYS A 1 103 ? -3.169  12.440  -31.945 1.00 1.00 ? 103 LYS A HZ2  1  
ATOM 1578  H HZ3  . LYS A 1 103 ? -4.154  13.418  -31.089 1.00 1.00 ? 103 LYS A HZ3  1  
ATOM 1579  N N    . MET A 1 104 ? -2.968  5.971   -27.725 1.00 1.00 ? 104 MET A N    1  
ATOM 1580  C CA   . MET A 1 104 ? -3.442  4.611   -27.401 1.00 1.00 ? 104 MET A CA   1  
ATOM 1581  C C    . MET A 1 104 ? -4.982  4.536   -27.519 1.00 1.00 ? 104 MET A C    1  
ATOM 1582  O O    . MET A 1 104 ? -5.653  5.565   -27.595 1.00 1.00 ? 104 MET A O    1  
ATOM 1583  C CB   . MET A 1 104 ? -2.920  4.174   -26.013 1.00 1.00 ? 104 MET A CB   1  
ATOM 1584  C CG   . MET A 1 104 ? -1.386  4.193   -25.922 1.00 1.00 ? 104 MET A CG   1  
ATOM 1585  S SD   . MET A 1 104 ? -0.717  3.647   -24.332 1.00 1.00 ? 104 MET A SD   1  
ATOM 1586  C CE   . MET A 1 104 ? 1.022   4.081   -24.600 1.00 1.00 ? 104 MET A CE   1  
ATOM 1587  H H    . MET A 1 104 ? -3.569  6.741   -27.436 1.00 1.00 ? 104 MET A H    1  
ATOM 1588  H HA   . MET A 1 104 ? -3.044  3.914   -28.140 1.00 1.00 ? 104 MET A HA   1  
ATOM 1589  H HB2  . MET A 1 104 ? -3.309  4.834   -25.245 1.00 1.00 ? 104 MET A HB2  1  
ATOM 1590  H HB3  . MET A 1 104 ? -3.264  3.160   -25.796 1.00 1.00 ? 104 MET A HB3  1  
ATOM 1591  H HG2  . MET A 1 104 ? -0.973  3.562   -26.709 1.00 1.00 ? 104 MET A HG2  1  
ATOM 1592  H HG3  . MET A 1 104 ? -1.035  5.212   -26.087 1.00 1.00 ? 104 MET A HG3  1  
ATOM 1593  H HE1  . MET A 1 104 ? 1.607   3.801   -23.723 1.00 1.00 ? 104 MET A HE1  1  
ATOM 1594  H HE2  . MET A 1 104 ? 1.407   3.542   -25.467 1.00 1.00 ? 104 MET A HE2  1  
ATOM 1595  H HE3  . MET A 1 104 ? 1.120   5.154   -24.768 1.00 1.00 ? 104 MET A HE3  1  
ATOM 1596  N N    . LYS A 1 105 ? -5.537  3.319   -27.563 1.00 1.00 ? 105 LYS A N    1  
ATOM 1597  C CA   . LYS A 1 105 ? -6.952  3.033   -27.898 1.00 1.00 ? 105 LYS A CA   1  
ATOM 1598  C C    . LYS A 1 105 ? -8.008  3.526   -26.874 1.00 1.00 ? 105 LYS A C    1  
ATOM 1599  O O    . LYS A 1 105 ? -7.706  4.236   -25.918 1.00 1.00 ? 105 LYS A O    1  
ATOM 1600  C CB   . LYS A 1 105 ? -7.078  1.520   -28.209 1.00 1.00 ? 105 LYS A CB   1  
ATOM 1601  C CG   . LYS A 1 105 ? -6.205  1.064   -29.393 1.00 1.00 ? 105 LYS A CG   1  
ATOM 1602  C CD   . LYS A 1 105 ? -6.436  -0.428  -29.694 1.00 1.00 ? 105 LYS A CD   1  
ATOM 1603  C CE   . LYS A 1 105 ? -5.517  -0.968  -30.804 1.00 1.00 ? 105 LYS A CE   1  
ATOM 1604  N NZ   . LYS A 1 105 ? -5.837  -0.421  -32.156 1.00 1.00 ? 105 LYS A NZ   1  
ATOM 1605  H H    . LYS A 1 105 ? -4.921  2.524   -27.445 1.00 1.00 ? 105 LYS A H    1  
ATOM 1606  H HA   . LYS A 1 105 ? -7.195  3.570   -28.817 1.00 1.00 ? 105 LYS A HA   1  
ATOM 1607  H HB2  . LYS A 1 105 ? -6.810  0.943   -27.321 1.00 1.00 ? 105 LYS A HB2  1  
ATOM 1608  H HB3  . LYS A 1 105 ? -8.114  1.285   -28.465 1.00 1.00 ? 105 LYS A HB3  1  
ATOM 1609  H HG2  . LYS A 1 105 ? -6.462  1.662   -30.269 1.00 1.00 ? 105 LYS A HG2  1  
ATOM 1610  H HG3  . LYS A 1 105 ? -5.150  1.219   -29.160 1.00 1.00 ? 105 LYS A HG3  1  
ATOM 1611  H HD2  . LYS A 1 105 ? -6.236  -0.998  -28.785 1.00 1.00 ? 105 LYS A HD2  1  
ATOM 1612  H HD3  . LYS A 1 105 ? -7.481  -0.591  -29.970 1.00 1.00 ? 105 LYS A HD3  1  
ATOM 1613  H HE2  . LYS A 1 105 ? -4.479  -0.737  -30.547 1.00 1.00 ? 105 LYS A HE2  1  
ATOM 1614  H HE3  . LYS A 1 105 ? -5.614  -2.058  -30.826 1.00 1.00 ? 105 LYS A HE3  1  
ATOM 1615  H HZ1  . LYS A 1 105 ? -6.795  -0.621  -32.417 1.00 1.00 ? 105 LYS A HZ1  1  
ATOM 1616  H HZ2  . LYS A 1 105 ? -5.700  0.582   -32.201 1.00 1.00 ? 105 LYS A HZ2  1  
ATOM 1617  H HZ3  . LYS A 1 105 ? -5.240  -0.837  -32.860 1.00 1.00 ? 105 LYS A HZ3  1  
ATOM 1618  N N    . TYR A 1 106 ? -9.276  3.167   -27.119 1.00 1.00 ? 106 TYR A N    1  
ATOM 1619  C CA   . TYR A 1 106 ? -10.472 3.575   -26.352 1.00 1.00 ? 106 TYR A CA   1  
ATOM 1620  C C    . TYR A 1 106 ? -10.524 2.986   -24.923 1.00 1.00 ? 106 TYR A C    1  
ATOM 1621  O O    . TYR A 1 106 ? -9.606  2.295   -24.485 1.00 1.00 ? 106 TYR A O    1  
ATOM 1622  C CB   . TYR A 1 106 ? -11.731 3.151   -27.141 1.00 1.00 ? 106 TYR A CB   1  
ATOM 1623  C CG   . TYR A 1 106 ? -11.715 3.426   -28.635 1.00 1.00 ? 106 TYR A CG   1  
ATOM 1624  C CD1  . TYR A 1 106 ? -11.721 4.750   -29.107 1.00 1.00 ? 106 TYR A CD1  1  
ATOM 1625  C CD2  . TYR A 1 106 ? -11.691 2.356   -29.554 1.00 1.00 ? 106 TYR A CD2  1  
ATOM 1626  C CE1  . TYR A 1 106 ? -11.695 5.009   -30.491 1.00 1.00 ? 106 TYR A CE1  1  
ATOM 1627  C CE2  . TYR A 1 106 ? -11.673 2.609   -30.940 1.00 1.00 ? 106 TYR A CE2  1  
ATOM 1628  C CZ   . TYR A 1 106 ? -11.672 3.941   -31.414 1.00 1.00 ? 106 TYR A CZ   1  
ATOM 1629  O OH   . TYR A 1 106 ? -11.652 4.206   -32.750 1.00 1.00 ? 106 TYR A OH   1  
ATOM 1630  H H    . TYR A 1 106 ? -9.435  2.589   -27.933 1.00 1.00 ? 106 TYR A H    1  
ATOM 1631  H HA   . TYR A 1 106 ? -10.479 4.662   -26.267 1.00 1.00 ? 106 TYR A HA   1  
ATOM 1632  H HB2  . TYR A 1 106 ? -11.896 2.083   -26.993 1.00 1.00 ? 106 TYR A HB2  1  
ATOM 1633  H HB3  . TYR A 1 106 ? -12.601 3.664   -26.727 1.00 1.00 ? 106 TYR A HB3  1  
ATOM 1634  H HD1  . TYR A 1 106 ? -11.735 5.572   -28.405 1.00 1.00 ? 106 TYR A HD1  1  
ATOM 1635  H HD2  . TYR A 1 106 ? -11.693 1.335   -29.199 1.00 1.00 ? 106 TYR A HD2  1  
ATOM 1636  H HE1  . TYR A 1 106 ? -11.676 6.024   -30.858 1.00 1.00 ? 106 TYR A HE1  1  
ATOM 1637  H HE2  . TYR A 1 106 ? -11.655 1.785   -31.640 1.00 1.00 ? 106 TYR A HE2  1  
ATOM 1638  H HH   . TYR A 1 106 ? -11.640 3.407   -33.301 1.00 1.00 ? 106 TYR A HH   1  
ATOM 1639  N N    . SER A 1 107 ? -11.649 3.181   -24.224 1.00 1.00 ? 107 SER A N    1  
ATOM 1640  C CA   . SER A 1 107 ? -12.021 2.551   -22.932 1.00 1.00 ? 107 SER A CA   1  
ATOM 1641  C C    . SER A 1 107 ? -11.492 1.120   -22.723 1.00 1.00 ? 107 SER A C    1  
ATOM 1642  O O    . SER A 1 107 ? -10.967 0.802   -21.656 1.00 1.00 ? 107 SER A O    1  
ATOM 1643  C CB   . SER A 1 107 ? -13.555 2.504   -22.847 1.00 1.00 ? 107 SER A CB   1  
ATOM 1644  O OG   . SER A 1 107 ? -14.088 1.891   -24.019 1.00 1.00 ? 107 SER A OG   1  
ATOM 1645  H H    . SER A 1 107 ? -12.371 3.761   -24.654 1.00 1.00 ? 107 SER A H    1  
ATOM 1646  H HA   . SER A 1 107 ? -11.650 3.160   -22.105 1.00 1.00 ? 107 SER A HA   1  
ATOM 1647  H HB2  . SER A 1 107 ? -13.853 1.938   -21.961 1.00 1.00 ? 107 SER A HB2  1  
ATOM 1648  H HB3  . SER A 1 107 ? -13.944 3.517   -22.754 1.00 1.00 ? 107 SER A HB3  1  
ATOM 1649  H HG   . SER A 1 107 ? -15.041 1.690   -23.895 1.00 1.00 ? 107 SER A HG   1  
ATOM 1650  N N    . ILE A 1 108 ? -11.554 0.274   -23.764 1.00 1.00 ? 108 ILE A N    1  
ATOM 1651  C CA   . ILE A 1 108 ? -11.090 -1.129  -23.767 1.00 1.00 ? 108 ILE A CA   1  
ATOM 1652  C C    . ILE A 1 108 ? -9.616  -1.348  -23.372 1.00 1.00 ? 108 ILE A C    1  
ATOM 1653  O O    . ILE A 1 108 ? -9.249  -2.492  -23.094 1.00 1.00 ? 108 ILE A O    1  
ATOM 1654  C CB   . ILE A 1 108 ? -11.464 -1.841  -25.095 1.00 1.00 ? 108 ILE A CB   1  
ATOM 1655  C CG1  . ILE A 1 108 ? -11.058 -1.134  -26.409 1.00 1.00 ? 108 ILE A CG1  1  
ATOM 1656  C CG2  . ILE A 1 108 ? -12.984 -2.083  -25.126 1.00 1.00 ? 108 ILE A CG2  1  
ATOM 1657  C CD1  . ILE A 1 108 ? -9.560  -0.867  -26.570 1.00 1.00 ? 108 ILE A CD1  1  
ATOM 1658  H H    . ILE A 1 108 ? -12.085 0.602   -24.565 1.00 1.00 ? 108 ILE A H    1  
ATOM 1659  H HA   . ILE A 1 108 ? -11.637 -1.643  -22.972 1.00 1.00 ? 108 ILE A HA   1  
ATOM 1660  H HB   . ILE A 1 108 ? -10.992 -2.826  -25.094 1.00 1.00 ? 108 ILE A HB   1  
ATOM 1661  H HG12 . ILE A 1 108 ? -11.363 -1.771  -27.241 1.00 1.00 ? 108 ILE A HG12 1  
ATOM 1662  H HG13 . ILE A 1 108 ? -11.591 -0.189  -26.503 1.00 1.00 ? 108 ILE A HG13 1  
ATOM 1663  H HG21 . ILE A 1 108 ? -13.291 -2.642  -24.241 1.00 1.00 ? 108 ILE A HG21 1  
ATOM 1664  H HG22 . ILE A 1 108 ? -13.523 -1.136  -25.160 1.00 1.00 ? 108 ILE A HG22 1  
ATOM 1665  H HG23 . ILE A 1 108 ? -13.246 -2.669  -26.007 1.00 1.00 ? 108 ILE A HG23 1  
ATOM 1666  H HD11 . ILE A 1 108 ? -8.984  -1.765  -26.338 1.00 1.00 ? 108 ILE A HD11 1  
ATOM 1667  H HD12 . ILE A 1 108 ? -9.361  -0.583  -27.605 1.00 1.00 ? 108 ILE A HD12 1  
ATOM 1668  H HD13 . ILE A 1 108 ? -9.249  -0.046  -25.926 1.00 1.00 ? 108 ILE A HD13 1  
ATOM 1669  N N    . VAL A 1 109 ? -8.782  -0.302  -23.282 1.00 1.00 ? 109 VAL A N    1  
ATOM 1670  C CA   . VAL A 1 109 ? -7.426  -0.419  -22.695 1.00 1.00 ? 109 VAL A CA   1  
ATOM 1671  C C    . VAL A 1 109 ? -7.463  -0.715  -21.181 1.00 1.00 ? 109 VAL A C    1  
ATOM 1672  O O    . VAL A 1 109 ? -6.485  -1.238  -20.648 1.00 1.00 ? 109 VAL A O    1  
ATOM 1673  C CB   . VAL A 1 109 ? -6.515  0.808   -22.951 1.00 1.00 ? 109 VAL A CB   1  
ATOM 1674  C CG1  . VAL A 1 109 ? -6.323  1.056   -24.453 1.00 1.00 ? 109 VAL A CG1  1  
ATOM 1675  C CG2  . VAL A 1 109 ? -6.994  2.087   -22.245 1.00 1.00 ? 109 VAL A CG2  1  
ATOM 1676  H H    . VAL A 1 109 ? -9.131  0.608   -23.576 1.00 1.00 ? 109 VAL A H    1  
ATOM 1677  H HA   . VAL A 1 109 ? -6.944  -1.270  -23.177 1.00 1.00 ? 109 VAL A HA   1  
ATOM 1678  H HB   . VAL A 1 109 ? -5.531  0.574   -22.546 1.00 1.00 ? 109 VAL A HB   1  
ATOM 1679  H HG11 . VAL A 1 109 ? -5.606  1.863   -24.605 1.00 1.00 ? 109 VAL A HG11 1  
ATOM 1680  H HG12 . VAL A 1 109 ? -5.940  0.152   -24.931 1.00 1.00 ? 109 VAL A HG12 1  
ATOM 1681  H HG13 . VAL A 1 109 ? -7.265  1.333   -24.921 1.00 1.00 ? 109 VAL A HG13 1  
ATOM 1682  H HG21 . VAL A 1 109 ? -8.027  2.306   -22.504 1.00 1.00 ? 109 VAL A HG21 1  
ATOM 1683  H HG22 . VAL A 1 109 ? -6.923  1.963   -21.167 1.00 1.00 ? 109 VAL A HG22 1  
ATOM 1684  H HG23 . VAL A 1 109 ? -6.360  2.927   -22.531 1.00 1.00 ? 109 VAL A HG23 1  
ATOM 1685  N N    . SER A 1 110 ? -8.573  -0.400  -20.490 1.00 1.00 ? 110 SER A N    1  
ATOM 1686  C CA   . SER A 1 110 ? -8.777  -0.639  -19.049 1.00 1.00 ? 110 SER A CA   1  
ATOM 1687  C C    . SER A 1 110 ? -7.682  0.048   -18.192 1.00 1.00 ? 110 SER A C    1  
ATOM 1688  O O    . SER A 1 110 ? -7.212  1.137   -18.537 1.00 1.00 ? 110 SER A O    1  
ATOM 1689  C CB   . SER A 1 110 ? -8.906  -2.158  -18.807 1.00 1.00 ? 110 SER A CB   1  
ATOM 1690  O OG   . SER A 1 110 ? -9.406  -2.437  -17.505 1.00 1.00 ? 110 SER A OG   1  
ATOM 1691  H H    . SER A 1 110 ? -9.347  0.031   -20.992 1.00 1.00 ? 110 SER A H    1  
ATOM 1692  H HA   . SER A 1 110 ? -9.728  -0.194  -18.751 1.00 1.00 ? 110 SER A HA   1  
ATOM 1693  H HB2  . SER A 1 110 ? -9.596  -2.575  -19.544 1.00 1.00 ? 110 SER A HB2  1  
ATOM 1694  H HB3  . SER A 1 110 ? -7.933  -2.636  -18.938 1.00 1.00 ? 110 SER A HB3  1  
ATOM 1695  H HG   . SER A 1 110 ? -9.615  -3.394  -17.430 1.00 1.00 ? 110 SER A HG   1  
ATOM 1696  N N    . ARG A 1 111 ? -7.252  -0.565  -17.079 1.00 1.00 ? 111 ARG A N    1  
ATOM 1697  C CA   . ARG A 1 111 ? -6.076  -0.132  -16.315 1.00 1.00 ? 111 ARG A CA   1  
ATOM 1698  C C    . ARG A 1 111 ? -4.827  -0.209  -17.200 1.00 1.00 ? 111 ARG A C    1  
ATOM 1699  O O    . ARG A 1 111 ? -4.412  -1.300  -17.599 1.00 1.00 ? 111 ARG A O    1  
ATOM 1700  C CB   . ARG A 1 111 ? -5.904  -1.003  -15.061 1.00 1.00 ? 111 ARG A CB   1  
ATOM 1701  C CG   . ARG A 1 111 ? -6.810  -0.539  -13.910 1.00 1.00 ? 111 ARG A CG   1  
ATOM 1702  C CD   . ARG A 1 111 ? -6.442  -1.206  -12.579 1.00 1.00 ? 111 ARG A CD   1  
ATOM 1703  N NE   . ARG A 1 111 ? -5.069  -0.855  -12.181 1.00 1.00 ? 111 ARG A NE   1  
ATOM 1704  C CZ   . ARG A 1 111 ? -4.423  -1.201  -11.079 1.00 1.00 ? 111 ARG A CZ   1  
ATOM 1705  N NH1  . ARG A 1 111 ? -4.981  -1.892  -10.107 1.00 1.00 ? 111 ARG A NH1  1  
ATOM 1706  N NH2  . ARG A 1 111 ? -3.168  -0.830  -10.985 1.00 1.00 ? 111 ARG A NH2  1  
ATOM 1707  H H    . ARG A 1 111 ? -7.711  -1.428  -16.813 1.00 1.00 ? 111 ARG A H    1  
ATOM 1708  H HA   . ARG A 1 111 ? -6.196  0.906   -16.002 1.00 1.00 ? 111 ARG A HA   1  
ATOM 1709  H HB2  . ARG A 1 111 ? -6.103  -2.052  -15.295 1.00 1.00 ? 111 ARG A HB2  1  
ATOM 1710  H HB3  . ARG A 1 111 ? -4.863  -0.934  -14.752 1.00 1.00 ? 111 ARG A HB3  1  
ATOM 1711  H HG2  . ARG A 1 111 ? -6.714  0.543   -13.786 1.00 1.00 ? 111 ARG A HG2  1  
ATOM 1712  H HG3  . ARG A 1 111 ? -7.848  -0.768  -14.154 1.00 1.00 ? 111 ARG A HG3  1  
ATOM 1713  H HD2  . ARG A 1 111 ? -7.140  -0.868  -11.814 1.00 1.00 ? 111 ARG A HD2  1  
ATOM 1714  H HD3  . ARG A 1 111 ? -6.533  -2.288  -12.684 1.00 1.00 ? 111 ARG A HD3  1  
ATOM 1715  H HE   . ARG A 1 111 ? -4.509  -0.332  -12.857 1.00 1.00 ? 111 ARG A HE   1  
ATOM 1716  H HH11 . ARG A 1 111 ? -5.944  -2.180  -10.177 1.00 1.00 ? 111 ARG A HH11 1  
ATOM 1717  H HH12 . ARG A 1 111 ? -4.453  -2.145  -9.285  1.00 1.00 ? 111 ARG A HH12 1  
ATOM 1718  H HH21 . ARG A 1 111 ? -2.777  -0.306  -11.769 1.00 1.00 ? 111 ARG A HH21 1  
ATOM 1719  H HH22 . ARG A 1 111 ? -2.609  -1.050  -10.177 1.00 1.00 ? 111 ARG A HH22 1  
ATOM 1720  N N    . ASN A 1 112 ? -4.251  0.954   -17.526 1.00 1.00 ? 112 ASN A N    1  
ATOM 1721  C CA   . ASN A 1 112 ? -3.174  1.048   -18.517 1.00 1.00 ? 112 ASN A CA   1  
ATOM 1722  C C    . ASN A 1 112 ? -2.063  2.070   -18.203 1.00 1.00 ? 112 ASN A C    1  
ATOM 1723  O O    . ASN A 1 112 ? -0.984  1.952   -18.775 1.00 1.00 ? 112 ASN A O    1  
ATOM 1724  C CB   . ASN A 1 112 ? -3.819  1.312   -19.889 1.00 1.00 ? 112 ASN A CB   1  
ATOM 1725  C CG   . ASN A 1 112 ? -2.902  0.901   -21.038 1.00 1.00 ? 112 ASN A CG   1  
ATOM 1726  O OD1  . ASN A 1 112 ? -2.328  1.729   -21.728 1.00 1.00 ? 112 ASN A OD1  1  
ATOM 1727  N ND2  . ASN A 1 112 ? -2.748  -0.393  -21.276 1.00 1.00 ? 112 ASN A ND2  1  
ATOM 1728  H H    . ASN A 1 112 ? -4.706  1.799   -17.214 1.00 1.00 ? 112 ASN A H    1  
ATOM 1729  H HA   . ASN A 1 112 ? -2.675  0.083   -18.561 1.00 1.00 ? 112 ASN A HA   1  
ATOM 1730  H HB2  . ASN A 1 112 ? -4.738  0.734   -19.978 1.00 1.00 ? 112 ASN A HB2  1  
ATOM 1731  H HB3  . ASN A 1 112 ? -4.080  2.367   -19.980 1.00 1.00 ? 112 ASN A HB3  1  
ATOM 1732  H HD21 . ASN A 1 112 ? -3.246  -1.083  -20.733 1.00 1.00 ? 112 ASN A HD21 1  
ATOM 1733  H HD22 . ASN A 1 112 ? -2.155  -0.673  -22.044 1.00 1.00 ? 112 ASN A HD22 1  
ATOM 1734  N N    . CYS A 1 113 ? -2.251  3.046   -17.302 1.00 1.00 ? 113 CYS A N    1  
ATOM 1735  C CA   . CYS A 1 113 ? -1.213  4.046   -16.985 1.00 1.00 ? 113 CYS A CA   1  
ATOM 1736  C C    . CYS A 1 113 ? -0.007  3.443   -16.238 1.00 1.00 ? 113 CYS A C    1  
ATOM 1737  O O    . CYS A 1 113 ? 1.137   3.762   -16.569 1.00 1.00 ? 113 CYS A O    1  
ATOM 1738  C CB   . CYS A 1 113 ? -1.867  5.229   -16.248 1.00 1.00 ? 113 CYS A CB   1  
ATOM 1739  S SG   . CYS A 1 113 ? -2.713  4.678   -14.737 1.00 1.00 ? 113 CYS A SG   1  
ATOM 1740  H H    . CYS A 1 113 ? -3.130  3.098   -16.806 1.00 1.00 ? 113 CYS A H    1  
ATOM 1741  H HA   . CYS A 1 113 ? -0.815  4.432   -17.926 1.00 1.00 ? 113 CYS A HA   1  
ATOM 1742  H HB2  . CYS A 1 113 ? -1.118  5.988   -15.996 1.00 1.00 ? 113 CYS A HB2  1  
ATOM 1743  H HB3  . CYS A 1 113 ? -2.605  5.705   -16.904 1.00 1.00 ? 113 CYS A HB3  1  
ATOM 1744  H HG   . CYS A 1 113 ? -3.520  5.754   -14.655 1.00 1.00 ? 113 CYS A HG   1  
ATOM 1745  N N    . GLU A 1 114 ? -0.243  2.508   -15.315 1.00 1.00 ? 114 GLU A N    1  
ATOM 1746  C CA   . GLU A 1 114 ? 0.813   1.708   -14.679 1.00 1.00 ? 114 GLU A CA   1  
ATOM 1747  C C    . GLU A 1 114 ? 1.517   0.813   -15.704 1.00 1.00 ? 114 GLU A C    1  
ATOM 1748  O O    . GLU A 1 114 ? 2.743   0.786   -15.743 1.00 1.00 ? 114 GLU A O    1  
ATOM 1749  C CB   . GLU A 1 114 ? 0.302   0.931   -13.447 1.00 1.00 ? 114 GLU A CB   1  
ATOM 1750  C CG   . GLU A 1 114 ? -0.578  -0.301  -13.698 1.00 1.00 ? 114 GLU A CG   1  
ATOM 1751  C CD   . GLU A 1 114 ? -1.897  0.063   -14.366 1.00 1.00 ? 114 GLU A CD   1  
ATOM 1752  O OE1  . GLU A 1 114 ? -1.894  0.213   -15.612 1.00 1.00 ? 114 GLU A OE1  1  
ATOM 1753  O OE2  . GLU A 1 114 ? -2.898  0.220   -13.634 1.00 1.00 ? 114 GLU A OE2  1  
ATOM 1754  H H    . GLU A 1 114 ? -1.208  2.237   -15.165 1.00 1.00 ? 114 GLU A H    1  
ATOM 1755  H HA   . GLU A 1 114 ? 1.559   2.397   -14.291 1.00 1.00 ? 114 GLU A HA   1  
ATOM 1756  H HB2  . GLU A 1 114 ? 1.177   0.592   -12.890 1.00 1.00 ? 114 GLU A HB2  1  
ATOM 1757  H HB3  . GLU A 1 114 ? -0.237  1.621   -12.805 1.00 1.00 ? 114 GLU A HB3  1  
ATOM 1758  H HG2  . GLU A 1 114 ? -0.040  -1.026  -14.309 1.00 1.00 ? 114 GLU A HG2  1  
ATOM 1759  H HG3  . GLU A 1 114 ? -0.780  -0.780  -12.740 1.00 1.00 ? 114 GLU A HG3  1  
ATOM 1760  N N    . HIS A 1 115 ? 0.777   0.153   -16.599 1.00 1.00 ? 115 HIS A N    1  
ATOM 1761  C CA   . HIS A 1 115 ? 1.369   -0.651  -17.679 1.00 1.00 ? 115 HIS A CA   1  
ATOM 1762  C C    . HIS A 1 115 ? 2.233   0.209   -18.625 1.00 1.00 ? 115 HIS A C    1  
ATOM 1763  O O    . HIS A 1 115 ? 3.316   -0.212  -19.040 1.00 1.00 ? 115 HIS A O    1  
ATOM 1764  C CB   . HIS A 1 115 ? 0.261   -1.378  -18.459 1.00 1.00 ? 115 HIS A CB   1  
ATOM 1765  C CG   . HIS A 1 115 ? -0.455  -2.445  -17.663 1.00 1.00 ? 115 HIS A CG   1  
ATOM 1766  N ND1  . HIS A 1 115 ? -1.509  -2.263  -16.796 1.00 1.00 ? 115 HIS A ND1  1  
ATOM 1767  C CD2  . HIS A 1 115 ? -0.181  -3.787  -17.676 1.00 1.00 ? 115 HIS A CD2  1  
ATOM 1768  C CE1  . HIS A 1 115 ? -1.854  -3.462  -16.299 1.00 1.00 ? 115 HIS A CE1  1  
ATOM 1769  N NE2  . HIS A 1 115 ? -1.067  -4.431  -16.802 1.00 1.00 ? 115 HIS A NE2  1  
ATOM 1770  H H    . HIS A 1 115 ? -0.240  0.187   -16.494 1.00 1.00 ? 115 HIS A H    1  
ATOM 1771  H HA   . HIS A 1 115 ? 2.035   -1.399  -17.241 1.00 1.00 ? 115 HIS A HA   1  
ATOM 1772  H HB2  . HIS A 1 115 ? -0.467  -0.656  -18.825 1.00 1.00 ? 115 HIS A HB2  1  
ATOM 1773  H HB3  . HIS A 1 115 ? 0.707   -1.858  -19.332 1.00 1.00 ? 115 HIS A HB3  1  
ATOM 1774  H HD1  . HIS A 1 115 ? -1.930  -1.374  -16.529 1.00 1.00 ? 115 HIS A HD1  1  
ATOM 1775  H HD2  . HIS A 1 115 ? 0.594   -4.265  -18.262 1.00 1.00 ? 115 HIS A HD2  1  
ATOM 1776  H HE1  . HIS A 1 115 ? -2.648  -3.619  -15.579 1.00 1.00 ? 115 HIS A HE1  1  
ATOM 1777  N N    . PHE A 1 116 ? 1.790   1.429   -18.941 1.00 1.00 ? 116 PHE A N    1  
ATOM 1778  C CA   . PHE A 1 116 ? 2.570   2.420   -19.673 1.00 1.00 ? 116 PHE A CA   1  
ATOM 1779  C C    . PHE A 1 116 ? 3.867   2.753   -18.925 1.00 1.00 ? 116 PHE A C    1  
ATOM 1780  O O    . PHE A 1 116 ? 4.939   2.492   -19.464 1.00 1.00 ? 116 PHE A O    1  
ATOM 1781  C CB   . PHE A 1 116 ? 1.703   3.660   -19.958 1.00 1.00 ? 116 PHE A CB   1  
ATOM 1782  C CG   . PHE A 1 116 ? 2.513   4.894   -20.291 1.00 1.00 ? 116 PHE A CG   1  
ATOM 1783  C CD1  . PHE A 1 116 ? 3.315   4.903   -21.444 1.00 1.00 ? 116 PHE A CD1  1  
ATOM 1784  C CD2  . PHE A 1 116 ? 2.556   5.982   -19.398 1.00 1.00 ? 116 PHE A CD2  1  
ATOM 1785  C CE1  . PHE A 1 116 ? 4.165   5.989   -21.698 1.00 1.00 ? 116 PHE A CE1  1  
ATOM 1786  C CE2  . PHE A 1 116 ? 3.414   7.067   -19.650 1.00 1.00 ? 116 PHE A CE2  1  
ATOM 1787  C CZ   . PHE A 1 116 ? 4.228   7.064   -20.796 1.00 1.00 ? 116 PHE A CZ   1  
ATOM 1788  H H    . PHE A 1 116 ? 0.854   1.687   -18.654 1.00 1.00 ? 116 PHE A H    1  
ATOM 1789  H HA   . PHE A 1 116 ? 2.862   1.987   -20.629 1.00 1.00 ? 116 PHE A HA   1  
ATOM 1790  H HB2  . PHE A 1 116 ? 1.035   3.440   -20.793 1.00 1.00 ? 116 PHE A HB2  1  
ATOM 1791  H HB3  . PHE A 1 116 ? 1.076   3.879   -19.099 1.00 1.00 ? 116 PHE A HB3  1  
ATOM 1792  H HD1  . PHE A 1 116 ? 3.313   4.057   -22.117 1.00 1.00 ? 116 PHE A HD1  1  
ATOM 1793  H HD2  . PHE A 1 116 ? 1.949   5.980   -18.504 1.00 1.00 ? 116 PHE A HD2  1  
ATOM 1794  H HE1  . PHE A 1 116 ? 4.786   5.982   -22.577 1.00 1.00 ? 116 PHE A HE1  1  
ATOM 1795  H HE2  . PHE A 1 116 ? 3.468   7.892   -18.954 1.00 1.00 ? 116 PHE A HE2  1  
ATOM 1796  H HZ   . PHE A 1 116 ? 4.908   7.885   -20.980 1.00 1.00 ? 116 PHE A HZ   1  
ATOM 1797  N N    . VAL A 1 117 ? 3.809   3.258   -17.682 1.00 1.00 ? 117 VAL A N    1  
ATOM 1798  C CA   . VAL A 1 117 ? 5.055   3.638   -16.968 1.00 1.00 ? 117 VAL A CA   1  
ATOM 1799  C C    . VAL A 1 117 ? 5.960   2.437   -16.634 1.00 1.00 ? 117 VAL A C    1  
ATOM 1800  O O    . VAL A 1 117 ? 7.168   2.614   -16.486 1.00 1.00 ? 117 VAL A O    1  
ATOM 1801  C CB   . VAL A 1 117 ? 4.847   4.546   -15.737 1.00 1.00 ? 117 VAL A CB   1  
ATOM 1802  C CG1  . VAL A 1 117 ? 4.168   5.866   -16.139 1.00 1.00 ? 117 VAL A CG1  1  
ATOM 1803  C CG2  . VAL A 1 117 ? 4.054   3.892   -14.601 1.00 1.00 ? 117 VAL A CG2  1  
ATOM 1804  H H    . VAL A 1 117 ? 2.890   3.430   -17.262 1.00 1.00 ? 117 VAL A H    1  
ATOM 1805  H HA   . VAL A 1 117 ? 5.619   4.243   -17.677 1.00 1.00 ? 117 VAL A HA   1  
ATOM 1806  H HB   . VAL A 1 117 ? 5.829   4.801   -15.346 1.00 1.00 ? 117 VAL A HB   1  
ATOM 1807  H HG11 . VAL A 1 117 ? 3.147   5.685   -16.469 1.00 1.00 ? 117 VAL A HG11 1  
ATOM 1808  H HG12 . VAL A 1 117 ? 4.145   6.533   -15.282 1.00 1.00 ? 117 VAL A HG12 1  
ATOM 1809  H HG13 . VAL A 1 117 ? 4.730   6.347   -16.942 1.00 1.00 ? 117 VAL A HG13 1  
ATOM 1810  H HG21 . VAL A 1 117 ? 4.488   2.931   -14.333 1.00 1.00 ? 117 VAL A HG21 1  
ATOM 1811  H HG22 . VAL A 1 117 ? 4.064   4.542   -13.727 1.00 1.00 ? 117 VAL A HG22 1  
ATOM 1812  H HG23 . VAL A 1 117 ? 3.023   3.754   -14.907 1.00 1.00 ? 117 VAL A HG23 1  
ATOM 1813  N N    . THR A 1 118 ? 5.404   1.216   -16.596 1.00 1.00 ? 118 THR A N    1  
ATOM 1814  C CA   . THR A 1 118 ? 6.156   -0.049  -16.509 1.00 1.00 ? 118 THR A CA   1  
ATOM 1815  C C    . THR A 1 118 ? 7.012   -0.259  -17.742 1.00 1.00 ? 118 THR A C    1  
ATOM 1816  O O    . THR A 1 118 ? 8.206   -0.506  -17.623 1.00 1.00 ? 118 THR A O    1  
ATOM 1817  C CB   . THR A 1 118 ? 5.224   -1.227  -16.257 1.00 1.00 ? 118 THR A CB   1  
ATOM 1818  O OG1  . THR A 1 118 ? 4.617   -1.069  -14.999 1.00 1.00 ? 118 THR A OG1  1  
ATOM 1819  C CG2  . THR A 1 118 ? 5.914   -2.592  -16.270 1.00 1.00 ? 118 THR A CG2  1  
ATOM 1820  H H    . THR A 1 118 ? 4.390   1.160   -16.636 1.00 1.00 ? 118 THR A H    1  
ATOM 1821  H HA   . THR A 1 118 ? 6.820   -0.018  -15.673 1.00 1.00 ? 118 THR A HA   1  
ATOM 1822  H HB   . THR A 1 118 ? 4.476   -1.208  -17.027 1.00 1.00 ? 118 THR A HB   1  
ATOM 1823  H HG1  . THR A 1 118 ? 3.931   -0.379  -15.078 1.00 1.00 ? 118 THR A HG1  1  
ATOM 1824  H HG21 . THR A 1 118 ? 6.294   -2.816  -17.267 1.00 1.00 ? 118 THR A HG21 1  
ATOM 1825  H HG22 . THR A 1 118 ? 6.738   -2.605  -15.559 1.00 1.00 ? 118 THR A HG22 1  
ATOM 1826  H HG23 . THR A 1 118 ? 5.194   -3.363  -15.993 1.00 1.00 ? 118 THR A HG23 1  
ATOM 1827  N N    . GLN A 1 119 ? 6.422   -0.114  -18.929 1.00 1.00 ? 119 GLN A N    1  
ATOM 1828  C CA   . GLN A 1 119 ? 7.110   -0.318  -20.203 1.00 1.00 ? 119 GLN A CA   1  
ATOM 1829  C C    . GLN A 1 119 ? 8.289   0.648   -20.403 1.00 1.00 ? 119 GLN A C    1  
ATOM 1830  O O    . GLN A 1 119 ? 9.244   0.288   -21.088 1.00 1.00 ? 119 GLN A O    1  
ATOM 1831  C CB   . GLN A 1 119 ? 6.095   -0.222  -21.351 1.00 1.00 ? 119 GLN A CB   1  
ATOM 1832  C CG   . GLN A 1 119 ? 5.251   -1.505  -21.454 1.00 1.00 ? 119 GLN A CG   1  
ATOM 1833  C CD   . GLN A 1 119 ? 4.046   -1.311  -22.374 1.00 1.00 ? 119 GLN A CD   1  
ATOM 1834  O OE1  . GLN A 1 119 ? 4.063   -1.640  -23.553 1.00 1.00 ? 119 GLN A OE1  1  
ATOM 1835  N NE2  . GLN A 1 119 ? 2.966   -0.753  -21.867 1.00 1.00 ? 119 GLN A NE2  1  
ATOM 1836  H H    . GLN A 1 119 ? 5.436   0.113   -18.945 1.00 1.00 ? 119 GLN A H    1  
ATOM 1837  H HA   . GLN A 1 119 ? 7.531   -1.321  -20.207 1.00 1.00 ? 119 GLN A HA   1  
ATOM 1838  H HB2  . GLN A 1 119 ? 5.454   0.647   -21.203 1.00 1.00 ? 119 GLN A HB2  1  
ATOM 1839  H HB3  . GLN A 1 119 ? 6.626   -0.089  -22.297 1.00 1.00 ? 119 GLN A HB3  1  
ATOM 1840  H HG2  . GLN A 1 119 ? 5.871   -2.317  -21.841 1.00 1.00 ? 119 GLN A HG2  1  
ATOM 1841  H HG3  . GLN A 1 119 ? 4.892   -1.798  -20.467 1.00 1.00 ? 119 GLN A HG3  1  
ATOM 1842  H HE21 . GLN A 1 119 ? 2.962   -0.498  -20.885 1.00 1.00 ? 119 GLN A HE21 1  
ATOM 1843  H HE22 . GLN A 1 119 ? 2.162   -0.625  -22.464 1.00 1.00 ? 119 GLN A HE22 1  
ATOM 1844  N N    . LEU A 1 120 ? 8.281   1.823   -19.762 1.00 1.00 ? 120 LEU A N    1  
ATOM 1845  C CA   . LEU A 1 120 ? 9.391   2.788   -19.834 1.00 1.00 ? 120 LEU A CA   1  
ATOM 1846  C C    . LEU A 1 120 ? 10.700  2.252   -19.215 1.00 1.00 ? 120 LEU A C    1  
ATOM 1847  O O    . LEU A 1 120 ? 11.777  2.558   -19.729 1.00 1.00 ? 120 LEU A O    1  
ATOM 1848  C CB   . LEU A 1 120 ? 8.970   4.117   -19.169 1.00 1.00 ? 120 LEU A CB   1  
ATOM 1849  C CG   . LEU A 1 120 ? 7.698   4.766   -19.749 1.00 1.00 ? 120 LEU A CG   1  
ATOM 1850  C CD1  . LEU A 1 120 ? 7.399   6.059   -18.984 1.00 1.00 ? 120 LEU A CD1  1  
ATOM 1851  C CD2  . LEU A 1 120 ? 7.819   5.062   -21.248 1.00 1.00 ? 120 LEU A CD2  1  
ATOM 1852  H H    . LEU A 1 120 ? 7.454   2.065   -19.229 1.00 1.00 ? 120 LEU A H    1  
ATOM 1853  H HA   . LEU A 1 120 ? 9.615   2.973   -20.889 1.00 1.00 ? 120 LEU A HA   1  
ATOM 1854  H HB2  . LEU A 1 120 ? 8.820   3.942   -18.102 1.00 1.00 ? 120 LEU A HB2  1  
ATOM 1855  H HB3  . LEU A 1 120 ? 9.796   4.825   -19.271 1.00 1.00 ? 120 LEU A HB3  1  
ATOM 1856  H HG   . LEU A 1 120 ? 6.855   4.098   -19.601 1.00 1.00 ? 120 LEU A HG   1  
ATOM 1857  H HD11 . LEU A 1 120 ? 7.320   5.845   -17.917 1.00 1.00 ? 120 LEU A HD11 1  
ATOM 1858  H HD12 . LEU A 1 120 ? 8.194   6.781   -19.147 1.00 1.00 ? 120 LEU A HD12 1  
ATOM 1859  H HD13 . LEU A 1 120 ? 6.456   6.487   -19.321 1.00 1.00 ? 120 LEU A HD13 1  
ATOM 1860  H HD21 . LEU A 1 120 ? 6.968   5.657   -21.577 1.00 1.00 ? 120 LEU A HD21 1  
ATOM 1861  H HD22 . LEU A 1 120 ? 8.738   5.608   -21.455 1.00 1.00 ? 120 LEU A HD22 1  
ATOM 1862  H HD23 . LEU A 1 120 ? 7.818   4.128   -21.815 1.00 1.00 ? 120 LEU A HD23 1  
ATOM 1863  N N    . ARG A 1 121 ? 10.615  1.452   -18.136 1.00 1.00 ? 121 ARG A N    1  
ATOM 1864  C CA   . ARG A 1 121 ? 11.769  0.765   -17.521 1.00 1.00 ? 121 ARG A CA   1  
ATOM 1865  C C    . ARG A 1 121 ? 11.949  -0.663  -18.055 1.00 1.00 ? 121 ARG A C    1  
ATOM 1866  O O    . ARG A 1 121 ? 13.077  -1.090  -18.286 1.00 1.00 ? 121 ARG A O    1  
ATOM 1867  C CB   . ARG A 1 121 ? 11.627  0.796   -15.984 1.00 1.00 ? 121 ARG A CB   1  
ATOM 1868  C CG   . ARG A 1 121 ? 12.849  0.163   -15.283 1.00 1.00 ? 121 ARG A CG   1  
ATOM 1869  C CD   . ARG A 1 121 ? 12.839  0.361   -13.760 1.00 1.00 ? 121 ARG A CD   1  
ATOM 1870  N NE   . ARG A 1 121 ? 13.921  -0.413  -13.111 1.00 1.00 ? 121 ARG A NE   1  
ATOM 1871  C CZ   . ARG A 1 121 ? 14.348  -0.291  -11.855 1.00 1.00 ? 121 ARG A CZ   1  
ATOM 1872  N NH1  . ARG A 1 121 ? 13.863  0.601   -11.018 1.00 1.00 ? 121 ARG A NH1  1  
ATOM 1873  N NH2  . ARG A 1 121 ? 15.290  -1.084  -11.409 1.00 1.00 ? 121 ARG A NH2  1  
ATOM 1874  H H    . ARG A 1 121 ? 9.688   1.267   -17.763 1.00 1.00 ? 121 ARG A H    1  
ATOM 1875  H HA   . ARG A 1 121 ? 12.682  1.313   -17.775 1.00 1.00 ? 121 ARG A HA   1  
ATOM 1876  H HB2  . ARG A 1 121 ? 11.542  1.836   -15.667 1.00 1.00 ? 121 ARG A HB2  1  
ATOM 1877  H HB3  . ARG A 1 121 ? 10.720  0.265   -15.681 1.00 1.00 ? 121 ARG A HB3  1  
ATOM 1878  H HG2  . ARG A 1 121 ? 12.867  -0.907  -15.492 1.00 1.00 ? 121 ARG A HG2  1  
ATOM 1879  H HG3  . ARG A 1 121 ? 13.760  0.604   -15.694 1.00 1.00 ? 121 ARG A HG3  1  
ATOM 1880  H HD2  . ARG A 1 121 ? 12.960  1.424   -13.546 1.00 1.00 ? 121 ARG A HD2  1  
ATOM 1881  H HD3  . ARG A 1 121 ? 11.875  0.028   -13.362 1.00 1.00 ? 121 ARG A HD3  1  
ATOM 1882  H HE   . ARG A 1 121 ? 14.363  -1.139  -13.665 1.00 1.00 ? 121 ARG A HE   1  
ATOM 1883  H HH11 . ARG A 1 121 ? 13.142  1.245   -11.302 1.00 1.00 ? 121 ARG A HH11 1  
ATOM 1884  H HH12 . ARG A 1 121 ? 14.249  0.674   -10.087 1.00 1.00 ? 121 ARG A HH12 1  
ATOM 1885  H HH21 . ARG A 1 121 ? 15.679  -1.803  -12.006 1.00 1.00 ? 121 ARG A HH21 1  
ATOM 1886  H HH22 . ARG A 1 121 ? 15.587  -1.018  -10.434 1.00 1.00 ? 121 ARG A HH22 1  
ATOM 1887  N N    . TYR A 1 122 ? 10.867  -1.419  -18.249 1.00 1.00 ? 122 TYR A N    1  
ATOM 1888  C CA   . TYR A 1 122 ? 10.914  -2.820  -18.707 1.00 1.00 ? 122 TYR A CA   1  
ATOM 1889  C C    . TYR A 1 122 ? 11.418  -2.944  -20.158 1.00 1.00 ? 122 TYR A C    1  
ATOM 1890  O O    . TYR A 1 122 ? 12.309  -3.748  -20.431 1.00 1.00 ? 122 TYR A O    1  
ATOM 1891  C CB   . TYR A 1 122 ? 9.511   -3.431  -18.546 1.00 1.00 ? 122 TYR A CB   1  
ATOM 1892  C CG   . TYR A 1 122 ? 9.336   -4.830  -19.115 1.00 1.00 ? 122 TYR A CG   1  
ATOM 1893  C CD1  . TYR A 1 122 ? 10.203  -5.870  -18.726 1.00 1.00 ? 122 TYR A CD1  1  
ATOM 1894  C CD2  . TYR A 1 122 ? 8.310   -5.087  -20.046 1.00 1.00 ? 122 TYR A CD2  1  
ATOM 1895  C CE1  . TYR A 1 122 ? 10.047  -7.164  -19.259 1.00 1.00 ? 122 TYR A CE1  1  
ATOM 1896  C CE2  . TYR A 1 122 ? 8.147   -6.376  -20.584 1.00 1.00 ? 122 TYR A CE2  1  
ATOM 1897  C CZ   . TYR A 1 122 ? 9.018   -7.420  -20.193 1.00 1.00 ? 122 TYR A CZ   1  
ATOM 1898  O OH   . TYR A 1 122 ? 8.853   -8.669  -20.718 1.00 1.00 ? 122 TYR A OH   1  
ATOM 1899  H H    . TYR A 1 122 ? 9.959   -1.034  -17.998 1.00 1.00 ? 122 TYR A H    1  
ATOM 1900  H HA   . TYR A 1 122 ? 11.601  -3.379  -18.069 1.00 1.00 ? 122 TYR A HA   1  
ATOM 1901  H HB2  . TYR A 1 122 ? 9.260   -3.452  -17.487 1.00 1.00 ? 122 TYR A HB2  1  
ATOM 1902  H HB3  . TYR A 1 122 ? 8.791   -2.771  -19.028 1.00 1.00 ? 122 TYR A HB3  1  
ATOM 1903  H HD1  . TYR A 1 122 ? 10.991  -5.679  -18.013 1.00 1.00 ? 122 TYR A HD1  1  
ATOM 1904  H HD2  . TYR A 1 122 ? 7.639   -4.295  -20.350 1.00 1.00 ? 122 TYR A HD2  1  
ATOM 1905  H HE1  . TYR A 1 122 ? 10.718  -7.958  -18.954 1.00 1.00 ? 122 TYR A HE1  1  
ATOM 1906  H HE2  . TYR A 1 122 ? 7.362   -6.571  -21.301 1.00 1.00 ? 122 TYR A HE2  1  
ATOM 1907  H HH   . TYR A 1 122 ? 9.497   -9.312  -20.377 1.00 1.00 ? 122 TYR A HH   1  
ATOM 1908  N N    . GLY A 1 123 ? 10.915  -2.086  -21.054 1.00 1.00 ? 123 GLY A N    1  
ATOM 1909  C CA   . GLY A 1 123 ? 11.245  -2.032  -22.486 1.00 1.00 ? 123 GLY A CA   1  
ATOM 1910  C C    . GLY A 1 123 ? 12.329  -1.006  -22.828 1.00 1.00 ? 123 GLY A C    1  
ATOM 1911  O O    . GLY A 1 123 ? 12.295  -0.421  -23.911 1.00 1.00 ? 123 GLY A O    1  
ATOM 1912  H H    . GLY A 1 123 ? 10.249  -1.395  -20.724 1.00 1.00 ? 123 GLY A H    1  
ATOM 1913  H HA2  . GLY A 1 123 ? 11.589  -3.010  -22.828 1.00 1.00 ? 123 GLY A HA2  1  
ATOM 1914  H HA3  . GLY A 1 123 ? 10.350  -1.752  -23.042 1.00 1.00 ? 123 GLY A HA3  1  
ATOM 1915  N N    . LYS A 1 124 ? 13.286  -0.773  -21.915 1.00 1.00 ? 124 LYS A N    1  
ATOM 1916  C CA   . LYS A 1 124 ? 14.406  0.167   -22.100 1.00 1.00 ? 124 LYS A CA   1  
ATOM 1917  C C    . LYS A 1 124 ? 15.208  -0.121  -23.386 1.00 1.00 ? 124 LYS A C    1  
ATOM 1918  O O    . LYS A 1 124 ? 15.498  0.794   -24.162 1.00 1.00 ? 124 LYS A O    1  
ATOM 1919  C CB   . LYS A 1 124 ? 15.260  0.105   -20.809 1.00 1.00 ? 124 LYS A CB   1  
ATOM 1920  C CG   . LYS A 1 124 ? 16.477  1.045   -20.723 1.00 1.00 ? 124 LYS A CG   1  
ATOM 1921  C CD   . LYS A 1 124 ? 17.747  0.654   -21.508 1.00 1.00 ? 124 LYS A CD   1  
ATOM 1922  C CE   . LYS A 1 124 ? 18.282  -0.760  -21.197 1.00 1.00 ? 124 LYS A CE   1  
ATOM 1923  N NZ   . LYS A 1 124 ? 19.464  -1.113  -22.040 1.00 1.00 ? 124 LYS A NZ   1  
ATOM 1924  H H    . LYS A 1 124 ? 13.228  -1.266  -21.035 1.00 1.00 ? 124 LYS A H    1  
ATOM 1925  H HA   . LYS A 1 124 ? 13.998  1.169   -22.206 1.00 1.00 ? 124 LYS A HA   1  
ATOM 1926  H HB2  . LYS A 1 124 ? 14.599  0.386   -19.983 1.00 1.00 ? 124 LYS A HB2  1  
ATOM 1927  H HB3  . LYS A 1 124 ? 15.576  -0.922  -20.625 1.00 1.00 ? 124 LYS A HB3  1  
ATOM 1928  H HG2  . LYS A 1 124 ? 16.162  2.041   -21.027 1.00 1.00 ? 124 LYS A HG2  1  
ATOM 1929  H HG3  . LYS A 1 124 ? 16.752  1.120   -19.671 1.00 1.00 ? 124 LYS A HG3  1  
ATOM 1930  H HD2  . LYS A 1 124 ? 17.560  0.744   -22.577 1.00 1.00 ? 124 LYS A HD2  1  
ATOM 1931  H HD3  . LYS A 1 124 ? 18.525  1.383   -21.267 1.00 1.00 ? 124 LYS A HD3  1  
ATOM 1932  H HE2  . LYS A 1 124 ? 18.559  -0.816  -20.136 1.00 1.00 ? 124 LYS A HE2  1  
ATOM 1933  H HE3  . LYS A 1 124 ? 17.490  -1.498  -21.372 1.00 1.00 ? 124 LYS A HE3  1  
ATOM 1934  H HZ1  . LYS A 1 124 ? 19.808  -2.040  -21.810 1.00 1.00 ? 124 LYS A HZ1  1  
ATOM 1935  H HZ2  . LYS A 1 124 ? 19.217  -1.145  -23.023 1.00 1.00 ? 124 LYS A HZ2  1  
ATOM 1936  H HZ3  . LYS A 1 124 ? 20.231  -0.459  -21.923 1.00 1.00 ? 124 LYS A HZ3  1  
ATOM 1937  N N    . SER A 1 125 ? 15.575  -1.392  -23.585 1.00 1.00 ? 125 SER A N    1  
ATOM 1938  C CA   . SER A 1 125 ? 16.381  -1.904  -24.709 1.00 1.00 ? 125 SER A CA   1  
ATOM 1939  C C    . SER A 1 125 ? 15.626  -1.892  -26.046 1.00 1.00 ? 125 SER A C    1  
ATOM 1940  O O    . SER A 1 125 ? 16.165  -1.322  -27.023 1.00 1.00 ? 125 SER A O    1  
ATOM 1941  C CB   . SER A 1 125 ? 16.880  -3.316  -24.408 1.00 1.00 ? 125 SER A CB   1  
ATOM 1942  O OG   . SER A 1 125 ? 17.634  -3.301  -23.202 1.00 1.00 ? 125 SER A OG   1  
ATOM 1943  O OXT  . SER A 1 125 ? 14.514  -2.463  -26.126 1.00 1.00 ? 125 SER A OXT  1  
ATOM 1944  H H    . SER A 1 125 ? 15.279  -2.062  -22.897 1.00 1.00 ? 125 SER A H    1  
ATOM 1945  H HA   . SER A 1 125 ? 17.248  -1.260  -24.820 1.00 1.00 ? 125 SER A HA   1  
ATOM 1946  H HB2  . SER A 1 125 ? 16.026  -3.993  -24.311 1.00 1.00 ? 125 SER A HB2  1  
ATOM 1947  H HB3  . SER A 1 125 ? 17.506  -3.659  -25.238 1.00 1.00 ? 125 SER A HB3  1  
ATOM 1948  H HG   . SER A 1 125 ? 17.954  -4.209  -23.009 1.00 1.00 ? 125 SER A HG   1  
ATOM 1949  N N    . MET A 1 1   ? 3.277   24.431  8.581   1.00 1.00 ? 1   MET A N    2  
ATOM 1950  C CA   . MET A 1 1   ? 3.236   23.045  8.024   1.00 1.00 ? 1   MET A CA   2  
ATOM 1951  C C    . MET A 1 1   ? 4.609   22.363  8.156   1.00 1.00 ? 1   MET A C    2  
ATOM 1952  O O    . MET A 1 1   ? 5.642   23.015  7.987   1.00 1.00 ? 1   MET A O    2  
ATOM 1953  C CB   . MET A 1 1   ? 2.731   23.046  6.559   1.00 1.00 ? 1   MET A CB   2  
ATOM 1954  C CG   . MET A 1 1   ? 2.528   21.649  5.952   1.00 1.00 ? 1   MET A CG   2  
ATOM 1955  S SD   . MET A 1 1   ? 1.388   20.564  6.860   1.00 1.00 ? 1   MET A SD   2  
ATOM 1956  C CE   . MET A 1 1   ? 1.486   19.085  5.817   1.00 1.00 ? 1   MET A CE   2  
ATOM 1957  H H1   . MET A 1 1   ? 2.368   24.869  8.527   1.00 1.00 ? 1   MET A H1   2  
ATOM 1958  H H2   . MET A 1 1   ? 3.560   24.419  9.549   1.00 1.00 ? 1   MET A H2   2  
ATOM 1959  H H3   . MET A 1 1   ? 3.934   25.005  8.071   1.00 1.00 ? 1   MET A H3   2  
ATOM 1960  H HA   . MET A 1 1   ? 2.524   22.470  8.623   1.00 1.00 ? 1   MET A HA   2  
ATOM 1961  H HB2  . MET A 1 1   ? 1.773   23.567  6.516   1.00 1.00 ? 1   MET A HB2  2  
ATOM 1962  H HB3  . MET A 1 1   ? 3.436   23.590  5.926   1.00 1.00 ? 1   MET A HB3  2  
ATOM 1963  H HG2  . MET A 1 1   ? 2.144   21.777  4.939   1.00 1.00 ? 1   MET A HG2  2  
ATOM 1964  H HG3  . MET A 1 1   ? 3.494   21.148  5.868   1.00 1.00 ? 1   MET A HG3  2  
ATOM 1965  H HE1  . MET A 1 1   ? 0.838   18.308  6.224   1.00 1.00 ? 1   MET A HE1  2  
ATOM 1966  H HE2  . MET A 1 1   ? 1.158   19.326  4.805   1.00 1.00 ? 1   MET A HE2  2  
ATOM 1967  H HE3  . MET A 1 1   ? 2.512   18.716  5.788   1.00 1.00 ? 1   MET A HE3  2  
ATOM 1968  N N    . ALA A 1 2   ? 4.637   21.058  8.462   1.00 1.00 ? 2   ALA A N    2  
ATOM 1969  C CA   . ALA A 1 2   ? 5.870   20.266  8.597   1.00 1.00 ? 2   ALA A CA   2  
ATOM 1970  C C    . ALA A 1 2   ? 6.543   19.953  7.240   1.00 1.00 ? 2   ALA A C    2  
ATOM 1971  O O    . ALA A 1 2   ? 5.934   20.074  6.177   1.00 1.00 ? 2   ALA A O    2  
ATOM 1972  C CB   . ALA A 1 2   ? 5.527   18.981  9.368   1.00 1.00 ? 2   ALA A CB   2  
ATOM 1973  H H    . ALA A 1 2   ? 3.764   20.561  8.578   1.00 1.00 ? 2   ALA A H    2  
ATOM 1974  H HA   . ALA A 1 2   ? 6.590   20.833  9.194   1.00 1.00 ? 2   ALA A HA   2  
ATOM 1975  H HB1  . ALA A 1 2   ? 5.074   19.229  10.329  1.00 1.00 ? 2   ALA A HB1  2  
ATOM 1976  H HB2  . ALA A 1 2   ? 4.833   18.367  8.792   1.00 1.00 ? 2   ALA A HB2  2  
ATOM 1977  H HB3  . ALA A 1 2   ? 6.435   18.402  9.554   1.00 1.00 ? 2   ALA A HB3  2  
ATOM 1978  N N    . SER A 1 3   ? 7.807   19.527  7.277   1.00 1.00 ? 3   SER A N    2  
ATOM 1979  C CA   . SER A 1 3   ? 8.583   19.136  6.086   1.00 1.00 ? 3   SER A CA   2  
ATOM 1980  C C    . SER A 1 3   ? 8.012   17.876  5.391   1.00 1.00 ? 3   SER A C    2  
ATOM 1981  O O    . SER A 1 3   ? 7.494   16.982  6.078   1.00 1.00 ? 3   SER A O    2  
ATOM 1982  C CB   . SER A 1 3   ? 10.053  18.890  6.477   1.00 1.00 ? 3   SER A CB   2  
ATOM 1983  O OG   . SER A 1 3   ? 10.624  20.049  7.081   1.00 1.00 ? 3   SER A OG   2  
ATOM 1984  H H    . SER A 1 3   ? 8.276   19.471  8.173   1.00 1.00 ? 3   SER A H    2  
ATOM 1985  H HA   . SER A 1 3   ? 8.563   19.970  5.382   1.00 1.00 ? 3   SER A HA   2  
ATOM 1986  H HB2  . SER A 1 3   ? 10.100  18.049  7.173   1.00 1.00 ? 3   SER A HB2  2  
ATOM 1987  H HB3  . SER A 1 3   ? 10.624  18.631  5.583   1.00 1.00 ? 3   SER A HB3  2  
ATOM 1988  H HG   . SER A 1 3   ? 11.565  19.869  7.309   1.00 1.00 ? 3   SER A HG   2  
ATOM 1989  N N    . PRO A 1 4   ? 8.128   17.755  4.049   1.00 1.00 ? 4   PRO A N    2  
ATOM 1990  C CA   . PRO A 1 4   ? 7.631   16.595  3.308   1.00 1.00 ? 4   PRO A CA   2  
ATOM 1991  C C    . PRO A 1 4   ? 8.409   15.330  3.694   1.00 1.00 ? 4   PRO A C    2  
ATOM 1992  O O    . PRO A 1 4   ? 9.637   15.331  3.757   1.00 1.00 ? 4   PRO A O    2  
ATOM 1993  C CB   . PRO A 1 4   ? 7.779   16.946  1.823   1.00 1.00 ? 4   PRO A CB   2  
ATOM 1994  C CG   . PRO A 1 4   ? 8.920   17.962  1.809   1.00 1.00 ? 4   PRO A CG   2  
ATOM 1995  C CD   . PRO A 1 4   ? 8.735   18.710  3.129   1.00 1.00 ? 4   PRO A CD   2  
ATOM 1996  H HA   . PRO A 1 4   ? 6.571   16.452  3.530   1.00 1.00 ? 4   PRO A HA   2  
ATOM 1997  H HB2  . PRO A 1 4   ? 8.008   16.073  1.212   1.00 1.00 ? 4   PRO A HB2  2  
ATOM 1998  H HB3  . PRO A 1 4   ? 6.862   17.423  1.473   1.00 1.00 ? 4   PRO A HB3  2  
ATOM 1999  H HG2  . PRO A 1 4   ? 9.877   17.437  1.818   1.00 1.00 ? 4   PRO A HG2  2  
ATOM 2000  H HG3  . PRO A 1 4   ? 8.859   18.631  0.950   1.00 1.00 ? 4   PRO A HG3  2  
ATOM 2001  H HD2  . PRO A 1 4   ? 9.701   19.067  3.489   1.00 1.00 ? 4   PRO A HD2  2  
ATOM 2002  H HD3  . PRO A 1 4   ? 8.051   19.548  2.981   1.00 1.00 ? 4   PRO A HD3  2  
ATOM 2003  N N    . HIS A 1 5   ? 7.682   14.241  3.959   1.00 1.00 ? 5   HIS A N    2  
ATOM 2004  C CA   . HIS A 1 5   ? 8.270   12.974  4.430   1.00 1.00 ? 5   HIS A CA   2  
ATOM 2005  C C    . HIS A 1 5   ? 8.810   12.091  3.278   1.00 1.00 ? 5   HIS A C    2  
ATOM 2006  O O    . HIS A 1 5   ? 9.458   11.070  3.522   1.00 1.00 ? 5   HIS A O    2  
ATOM 2007  C CB   . HIS A 1 5   ? 7.215   12.234  5.270   1.00 1.00 ? 5   HIS A CB   2  
ATOM 2008  C CG   . HIS A 1 5   ? 6.852   12.885  6.592   1.00 1.00 ? 5   HIS A CG   2  
ATOM 2009  N ND1  . HIS A 1 5   ? 6.946   14.218  6.940   1.00 1.00 ? 5   HIS A ND1  2  
ATOM 2010  C CD2  . HIS A 1 5   ? 6.348   12.228  7.686   1.00 1.00 ? 5   HIS A CD2  2  
ATOM 2011  C CE1  . HIS A 1 5   ? 6.510   14.356  8.204   1.00 1.00 ? 5   HIS A CE1  2  
ATOM 2012  N NE2  . HIS A 1 5   ? 6.134   13.165  8.708   1.00 1.00 ? 5   HIS A NE2  2  
ATOM 2013  H H    . HIS A 1 5   ? 6.670   14.293  3.884   1.00 1.00 ? 5   HIS A H    2  
ATOM 2014  H HA   . HIS A 1 5   ? 9.125   13.191  5.076   1.00 1.00 ? 5   HIS A HA   2  
ATOM 2015  H HB2  . HIS A 1 5   ? 6.308   12.098  4.678   1.00 1.00 ? 5   HIS A HB2  2  
ATOM 2016  H HB3  . HIS A 1 5   ? 7.599   11.235  5.500   1.00 1.00 ? 5   HIS A HB3  2  
ATOM 2017  H HD1  . HIS A 1 5   ? 7.276   14.981  6.358   1.00 1.00 ? 5   HIS A HD1  2  
ATOM 2018  H HD2  . HIS A 1 5   ? 6.151   11.164  7.742   1.00 1.00 ? 5   HIS A HD2  2  
ATOM 2019  H HE1  . HIS A 1 5   ? 6.467   15.302  8.734   1.00 1.00 ? 5   HIS A HE1  2  
ATOM 2020  N N    . GLN A 1 6   ? 8.560   12.482  2.022   1.00 1.00 ? 6   GLN A N    2  
ATOM 2021  C CA   . GLN A 1 6   ? 8.984   11.796  0.797   1.00 1.00 ? 6   GLN A CA   2  
ATOM 2022  C C    . GLN A 1 6   ? 9.010   12.807  -0.364  1.00 1.00 ? 6   GLN A C    2  
ATOM 2023  O O    . GLN A 1 6   ? 8.088   13.615  -0.497  1.00 1.00 ? 6   GLN A O    2  
ATOM 2024  C CB   . GLN A 1 6   ? 8.013   10.626  0.516   1.00 1.00 ? 6   GLN A CB   2  
ATOM 2025  C CG   . GLN A 1 6   ? 8.395   9.791   -0.719  1.00 1.00 ? 6   GLN A CG   2  
ATOM 2026  C CD   . GLN A 1 6   ? 7.415   8.642   -0.963  1.00 1.00 ? 6   GLN A CD   2  
ATOM 2027  O OE1  . GLN A 1 6   ? 6.540   8.714   -1.817  1.00 1.00 ? 6   GLN A OE1  2  
ATOM 2028  N NE2  . GLN A 1 6   ? 7.510   7.547   -0.240  1.00 1.00 ? 6   GLN A NE2  2  
ATOM 2029  H H    . GLN A 1 6   ? 8.042   13.340  1.898   1.00 1.00 ? 6   GLN A H    2  
ATOM 2030  H HA   . GLN A 1 6   ? 9.990   11.395  0.944   1.00 1.00 ? 6   GLN A HA   2  
ATOM 2031  H HB2  . GLN A 1 6   ? 7.994   9.969   1.386   1.00 1.00 ? 6   GLN A HB2  2  
ATOM 2032  H HB3  . GLN A 1 6   ? 7.007   11.025  0.372   1.00 1.00 ? 6   GLN A HB3  2  
ATOM 2033  H HG2  . GLN A 1 6   ? 8.401   10.425  -1.606  1.00 1.00 ? 6   GLN A HG2  2  
ATOM 2034  H HG3  . GLN A 1 6   ? 9.397   9.380   -0.584  1.00 1.00 ? 6   GLN A HG3  2  
ATOM 2035  H HE21 . GLN A 1 6   ? 8.221   7.456   0.474   1.00 1.00 ? 6   GLN A HE21 2  
ATOM 2036  H HE22 . GLN A 1 6   ? 6.851   6.801   -0.407  1.00 1.00 ? 6   GLN A HE22 2  
ATOM 2037  N N    . GLU A 1 7   ? 10.045  12.752  -1.215  1.00 1.00 ? 7   GLU A N    2  
ATOM 2038  C CA   . GLU A 1 7   ? 10.182  13.592  -2.416  1.00 1.00 ? 7   GLU A CA   2  
ATOM 2039  C C    . GLU A 1 7   ? 10.661  12.748  -3.619  1.00 1.00 ? 7   GLU A C    2  
ATOM 2040  O O    . GLU A 1 7   ? 11.546  11.901  -3.440  1.00 1.00 ? 7   GLU A O    2  
ATOM 2041  C CB   . GLU A 1 7   ? 11.174  14.745  -2.168  1.00 1.00 ? 7   GLU A CB   2  
ATOM 2042  C CG   . GLU A 1 7   ? 10.701  15.740  -1.098  1.00 1.00 ? 7   GLU A CG   2  
ATOM 2043  C CD   . GLU A 1 7   ? 11.678  16.917  -0.983  1.00 1.00 ? 7   GLU A CD   2  
ATOM 2044  O OE1  . GLU A 1 7   ? 12.680  16.811  -0.235  1.00 1.00 ? 7   GLU A OE1  2  
ATOM 2045  O OE2  . GLU A 1 7   ? 11.457  17.963  -1.639  1.00 1.00 ? 7   GLU A OE2  2  
ATOM 2046  H H    . GLU A 1 7   ? 10.777  12.072  -1.058  1.00 1.00 ? 7   GLU A H    2  
ATOM 2047  H HA   . GLU A 1 7   ? 9.210   14.027  -2.644  1.00 1.00 ? 7   GLU A HA   2  
ATOM 2048  H HB2  . GLU A 1 7   ? 12.138  14.332  -1.869  1.00 1.00 ? 7   GLU A HB2  2  
ATOM 2049  H HB3  . GLU A 1 7   ? 11.310  15.288  -3.101  1.00 1.00 ? 7   GLU A HB3  2  
ATOM 2050  H HG2  . GLU A 1 7   ? 9.711   16.113  -1.371  1.00 1.00 ? 7   GLU A HG2  2  
ATOM 2051  H HG3  . GLU A 1 7   ? 10.626  15.236  -0.135  1.00 1.00 ? 7   GLU A HG3  2  
ATOM 2052  N N    . PRO A 1 8   ? 10.106  12.961  -4.833  1.00 1.00 ? 8   PRO A N    2  
ATOM 2053  C CA   . PRO A 1 8   ? 10.440  12.187  -6.028  1.00 1.00 ? 8   PRO A CA   2  
ATOM 2054  C C    . PRO A 1 8   ? 11.745  12.641  -6.690  1.00 1.00 ? 8   PRO A C    2  
ATOM 2055  O O    . PRO A 1 8   ? 12.144  13.803  -6.600  1.00 1.00 ? 8   PRO A O    2  
ATOM 2056  C CB   . PRO A 1 8   ? 9.252   12.371  -6.973  1.00 1.00 ? 8   PRO A CB   2  
ATOM 2057  C CG   . PRO A 1 8   ? 8.775   13.781  -6.635  1.00 1.00 ? 8   PRO A CG   2  
ATOM 2058  C CD   . PRO A 1 8   ? 9.007   13.872  -5.129  1.00 1.00 ? 8   PRO A CD   2  
ATOM 2059  H HA   . PRO A 1 8   ? 10.530  11.132  -5.775  1.00 1.00 ? 8   PRO A HA   2  
ATOM 2060  H HB2  . PRO A 1 8   ? 9.534   12.271  -8.021  1.00 1.00 ? 8   PRO A HB2  2  
ATOM 2061  H HB3  . PRO A 1 8   ? 8.474   11.651  -6.722  1.00 1.00 ? 8   PRO A HB3  2  
ATOM 2062  H HG2  . PRO A 1 8   ? 9.403   14.515  -7.138  1.00 1.00 ? 8   PRO A HG2  2  
ATOM 2063  H HG3  . PRO A 1 8   ? 7.725   13.924  -6.889  1.00 1.00 ? 8   PRO A HG3  2  
ATOM 2064  H HD2  . PRO A 1 8   ? 9.258   14.897  -4.848  1.00 1.00 ? 8   PRO A HD2  2  
ATOM 2065  H HD3  . PRO A 1 8   ? 8.109   13.544  -4.601  1.00 1.00 ? 8   PRO A HD3  2  
ATOM 2066  N N    . LYS A 1 9   ? 12.388  11.702  -7.390  1.00 1.00 ? 9   LYS A N    2  
ATOM 2067  C CA   . LYS A 1 9   ? 13.622  11.886  -8.163  1.00 1.00 ? 9   LYS A CA   2  
ATOM 2068  C C    . LYS A 1 9   ? 13.516  11.332  -9.606  1.00 1.00 ? 9   LYS A C    2  
ATOM 2069  O O    . LYS A 1 9   ? 12.594  10.566  -9.902  1.00 1.00 ? 9   LYS A O    2  
ATOM 2070  C CB   . LYS A 1 9   ? 14.776  11.209  -7.390  1.00 1.00 ? 9   LYS A CB   2  
ATOM 2071  C CG   . LYS A 1 9   ? 15.204  11.973  -6.129  1.00 1.00 ? 9   LYS A CG   2  
ATOM 2072  C CD   . LYS A 1 9   ? 15.829  13.346  -6.443  1.00 1.00 ? 9   LYS A CD   2  
ATOM 2073  C CE   . LYS A 1 9   ? 16.373  13.970  -5.148  1.00 1.00 ? 9   LYS A CE   2  
ATOM 2074  N NZ   . LYS A 1 9   ? 17.018  15.294  -5.386  1.00 1.00 ? 9   LYS A NZ   2  
ATOM 2075  H H    . LYS A 1 9   ? 12.025  10.751  -7.348  1.00 1.00 ? 9   LYS A H    2  
ATOM 2076  H HA   . LYS A 1 9   ? 13.809  12.953  -8.257  1.00 1.00 ? 9   LYS A HA   2  
ATOM 2077  H HB2  . LYS A 1 9   ? 14.460  10.206  -7.100  1.00 1.00 ? 9   LYS A HB2  2  
ATOM 2078  H HB3  . LYS A 1 9   ? 15.648  11.089  -8.031  1.00 1.00 ? 9   LYS A HB3  2  
ATOM 2079  H HG2  . LYS A 1 9   ? 14.341  12.102  -5.470  1.00 1.00 ? 9   LYS A HG2  2  
ATOM 2080  H HG3  . LYS A 1 9   ? 15.939  11.364  -5.603  1.00 1.00 ? 9   LYS A HG3  2  
ATOM 2081  H HD2  . LYS A 1 9   ? 16.639  13.214  -7.166  1.00 1.00 ? 9   LYS A HD2  2  
ATOM 2082  H HD3  . LYS A 1 9   ? 15.078  14.012  -6.876  1.00 1.00 ? 9   LYS A HD3  2  
ATOM 2083  H HE2  . LYS A 1 9   ? 15.545  14.084  -4.440  1.00 1.00 ? 9   LYS A HE2  2  
ATOM 2084  H HE3  . LYS A 1 9   ? 17.098  13.281  -4.702  1.00 1.00 ? 9   LYS A HE3  2  
ATOM 2085  H HZ1  . LYS A 1 9   ? 17.364  15.685  -4.519  1.00 1.00 ? 9   LYS A HZ1  2  
ATOM 2086  H HZ2  . LYS A 1 9   ? 17.806  15.211  -6.015  1.00 1.00 ? 9   LYS A HZ2  2  
ATOM 2087  H HZ3  . LYS A 1 9   ? 16.365  15.956  -5.785  1.00 1.00 ? 9   LYS A HZ3  2  
ATOM 2088  N N    . PRO A 1 10  ? 14.427  11.737  -10.524 1.00 1.00 ? 10  PRO A N    2  
ATOM 2089  C CA   . PRO A 1 10  ? 14.454  11.286  -11.918 1.00 1.00 ? 10  PRO A CA   2  
ATOM 2090  C C    . PRO A 1 10  ? 14.270  9.768   -12.075 1.00 1.00 ? 10  PRO A C    2  
ATOM 2091  O O    . PRO A 1 10  ? 14.961  8.990   -11.421 1.00 1.00 ? 10  PRO A O    2  
ATOM 2092  C CB   . PRO A 1 10  ? 15.800  11.776  -12.468 1.00 1.00 ? 10  PRO A CB   2  
ATOM 2093  C CG   . PRO A 1 10  ? 16.002  13.086  -11.717 1.00 1.00 ? 10  PRO A CG   2  
ATOM 2094  C CD   . PRO A 1 10  ? 15.473  12.741  -10.328 1.00 1.00 ? 10  PRO A CD   2  
ATOM 2095  H HA   . PRO A 1 10  ? 13.662  11.806  -12.456 1.00 1.00 ? 10  PRO A HA   2  
ATOM 2096  H HB2  . PRO A 1 10  ? 16.599  11.079  -12.203 1.00 1.00 ? 10  PRO A HB2  2  
ATOM 2097  H HB3  . PRO A 1 10  ? 15.776  11.942  -13.543 1.00 1.00 ? 10  PRO A HB3  2  
ATOM 2098  H HG2  . PRO A 1 10  ? 17.051  13.385  -11.691 1.00 1.00 ? 10  PRO A HG2  2  
ATOM 2099  H HG3  . PRO A 1 10  ? 15.392  13.871  -12.170 1.00 1.00 ? 10  PRO A HG3  2  
ATOM 2100  H HD2  . PRO A 1 10  ? 16.287  12.318  -9.739  1.00 1.00 ? 10  PRO A HD2  2  
ATOM 2101  H HD3  . PRO A 1 10  ? 15.091  13.644  -9.853  1.00 1.00 ? 10  PRO A HD3  2  
ATOM 2102  N N    . GLY A 1 11  ? 13.323  9.367   -12.934 1.00 1.00 ? 11  GLY A N    2  
ATOM 2103  C CA   . GLY A 1 11  ? 13.013  7.968   -13.262 1.00 1.00 ? 11  GLY A CA   2  
ATOM 2104  C C    . GLY A 1 11  ? 11.988  7.295   -12.345 1.00 1.00 ? 11  GLY A C    2  
ATOM 2105  O O    . GLY A 1 11  ? 11.645  6.139   -12.593 1.00 1.00 ? 11  GLY A O    2  
ATOM 2106  H H    . GLY A 1 11  ? 12.727  10.073  -13.361 1.00 1.00 ? 11  GLY A H    2  
ATOM 2107  H HA2  . GLY A 1 11  ? 12.615  7.927   -14.275 1.00 1.00 ? 11  GLY A HA2  2  
ATOM 2108  H HA3  . GLY A 1 11  ? 13.923  7.369   -13.207 1.00 1.00 ? 11  GLY A HA3  2  
ATOM 2109  N N    . ASP A 1 12  ? 11.510  7.962   -11.295 1.00 1.00 ? 12  ASP A N    2  
ATOM 2110  C CA   . ASP A 1 12  ? 10.597  7.379   -10.308 1.00 1.00 ? 12  ASP A CA   2  
ATOM 2111  C C    . ASP A 1 12  ? 9.186   7.116   -10.862 1.00 1.00 ? 12  ASP A C    2  
ATOM 2112  O O    . ASP A 1 12  ? 8.636   7.909   -11.628 1.00 1.00 ? 12  ASP A O    2  
ATOM 2113  C CB   . ASP A 1 12  ? 10.495  8.265   -9.057  1.00 1.00 ? 12  ASP A CB   2  
ATOM 2114  C CG   . ASP A 1 12  ? 11.711  8.196   -8.110  1.00 1.00 ? 12  ASP A CG   2  
ATOM 2115  O OD1  . ASP A 1 12  ? 12.653  7.398   -8.344  1.00 1.00 ? 12  ASP A OD1  2  
ATOM 2116  O OD2  . ASP A 1 12  ? 11.686  8.914   -7.083  1.00 1.00 ? 12  ASP A OD2  2  
ATOM 2117  H H    . ASP A 1 12  ? 11.876  8.885   -11.103 1.00 1.00 ? 12  ASP A H    2  
ATOM 2118  H HA   . ASP A 1 12  ? 11.009  6.419   -10.008 1.00 1.00 ? 12  ASP A HA   2  
ATOM 2119  H HB2  . ASP A 1 12  ? 10.315  9.300   -9.358  1.00 1.00 ? 12  ASP A HB2  2  
ATOM 2120  H HB3  . ASP A 1 12  ? 9.616   7.947   -8.491  1.00 1.00 ? 12  ASP A HB3  2  
ATOM 2121  N N    . LEU A 1 13  ? 8.586   6.011   -10.411 1.00 1.00 ? 13  LEU A N    2  
ATOM 2122  C CA   . LEU A 1 13  ? 7.180   5.681   -10.632 1.00 1.00 ? 13  LEU A CA   2  
ATOM 2123  C C    . LEU A 1 13  ? 6.344   6.337   -9.526  1.00 1.00 ? 13  LEU A C    2  
ATOM 2124  O O    . LEU A 1 13  ? 6.616   6.127   -8.345  1.00 1.00 ? 13  LEU A O    2  
ATOM 2125  C CB   . LEU A 1 13  ? 6.971   4.148   -10.609 1.00 1.00 ? 13  LEU A CB   2  
ATOM 2126  C CG   . LEU A 1 13  ? 7.571   3.306   -11.752 1.00 1.00 ? 13  LEU A CG   2  
ATOM 2127  C CD1  . LEU A 1 13  ? 7.370   3.982   -13.109 1.00 1.00 ? 13  LEU A CD1  2  
ATOM 2128  C CD2  . LEU A 1 13  ? 9.051   2.955   -11.550 1.00 1.00 ? 13  LEU A CD2  2  
ATOM 2129  H H    . LEU A 1 13  ? 9.105   5.433   -9.756  1.00 1.00 ? 13  LEU A H    2  
ATOM 2130  H HA   . LEU A 1 13  ? 6.853   6.086   -11.590 1.00 1.00 ? 13  LEU A HA   2  
ATOM 2131  H HB2  . LEU A 1 13  ? 7.336   3.754   -9.660  1.00 1.00 ? 13  LEU A HB2  2  
ATOM 2132  H HB3  . LEU A 1 13  ? 5.892   3.975   -10.629 1.00 1.00 ? 13  LEU A HB3  2  
ATOM 2133  H HG   . LEU A 1 13  ? 7.026   2.362   -11.776 1.00 1.00 ? 13  LEU A HG   2  
ATOM 2134  H HD11 . LEU A 1 13  ? 8.017   4.851   -13.190 1.00 1.00 ? 13  LEU A HD11 2  
ATOM 2135  H HD12 . LEU A 1 13  ? 7.605   3.285   -13.911 1.00 1.00 ? 13  LEU A HD12 2  
ATOM 2136  H HD13 . LEU A 1 13  ? 6.333   4.303   -13.193 1.00 1.00 ? 13  LEU A HD13 2  
ATOM 2137  H HD21 . LEU A 1 13  ? 9.384   2.305   -12.359 1.00 1.00 ? 13  LEU A HD21 2  
ATOM 2138  H HD22 . LEU A 1 13  ? 9.667   3.853   -11.537 1.00 1.00 ? 13  LEU A HD22 2  
ATOM 2139  H HD23 . LEU A 1 13  ? 9.172   2.419   -10.609 1.00 1.00 ? 13  LEU A HD23 2  
ATOM 2140  N N    . ILE A 1 14  ? 5.309   7.097   -9.892  1.00 1.00 ? 14  ILE A N    2  
ATOM 2141  C CA   . ILE A 1 14  ? 4.408   7.766   -8.938  1.00 1.00 ? 14  ILE A CA   2  
ATOM 2142  C C    . ILE A 1 14  ? 2.989   7.214   -9.101  1.00 1.00 ? 14  ILE A C    2  
ATOM 2143  O O    . ILE A 1 14  ? 2.455   7.215   -10.211 1.00 1.00 ? 14  ILE A O    2  
ATOM 2144  C CB   . ILE A 1 14  ? 4.455   9.305   -9.129  1.00 1.00 ? 14  ILE A CB   2  
ATOM 2145  C CG1  . ILE A 1 14  ? 5.879   9.836   -8.818  1.00 1.00 ? 14  ILE A CG1  2  
ATOM 2146  C CG2  . ILE A 1 14  ? 3.406   10.013  -8.240  1.00 1.00 ? 14  ILE A CG2  2  
ATOM 2147  C CD1  . ILE A 1 14  ? 6.029   11.363  -8.894  1.00 1.00 ? 14  ILE A CD1  2  
ATOM 2148  H H    . ILE A 1 14  ? 5.110   7.211   -10.886 1.00 1.00 ? 14  ILE A H    2  
ATOM 2149  H HA   . ILE A 1 14  ? 4.730   7.548   -7.920  1.00 1.00 ? 14  ILE A HA   2  
ATOM 2150  H HB   . ILE A 1 14  ? 4.216   9.534   -10.169 1.00 1.00 ? 14  ILE A HB   2  
ATOM 2151  H HG12 . ILE A 1 14  ? 6.169   9.509   -7.819  1.00 1.00 ? 14  ILE A HG12 2  
ATOM 2152  H HG13 . ILE A 1 14  ? 6.581   9.404   -9.531  1.00 1.00 ? 14  ILE A HG13 2  
ATOM 2153  H HG21 . ILE A 1 14  ? 2.404   9.639   -8.443  1.00 1.00 ? 14  ILE A HG21 2  
ATOM 2154  H HG22 . ILE A 1 14  ? 3.641   9.860   -7.188  1.00 1.00 ? 14  ILE A HG22 2  
ATOM 2155  H HG23 . ILE A 1 14  ? 3.382   11.082  -8.458  1.00 1.00 ? 14  ILE A HG23 2  
ATOM 2156  H HD11 . ILE A 1 14  ? 7.079   11.626  -8.772  1.00 1.00 ? 14  ILE A HD11 2  
ATOM 2157  H HD12 . ILE A 1 14  ? 5.680   11.729  -9.862  1.00 1.00 ? 14  ILE A HD12 2  
ATOM 2158  H HD13 . ILE A 1 14  ? 5.468   11.845  -8.092  1.00 1.00 ? 14  ILE A HD13 2  
ATOM 2159  N N    . GLU A 1 15  ? 2.390   6.784   -7.991  1.00 1.00 ? 15  GLU A N    2  
ATOM 2160  C CA   . GLU A 1 15  ? 0.974   6.431   -7.886  1.00 1.00 ? 15  GLU A CA   2  
ATOM 2161  C C    . GLU A 1 15  ? 0.196   7.690   -7.504  1.00 1.00 ? 15  GLU A C    2  
ATOM 2162  O O    . GLU A 1 15  ? 0.605   8.413   -6.596  1.00 1.00 ? 15  GLU A O    2  
ATOM 2163  C CB   . GLU A 1 15  ? 0.748   5.382   -6.785  1.00 1.00 ? 15  GLU A CB   2  
ATOM 2164  C CG   . GLU A 1 15  ? 1.263   3.992   -7.157  1.00 1.00 ? 15  GLU A CG   2  
ATOM 2165  C CD   . GLU A 1 15  ? 1.024   3.017   -6.001  1.00 1.00 ? 15  GLU A CD   2  
ATOM 2166  O OE1  . GLU A 1 15  ? 1.824   3.033   -5.037  1.00 1.00 ? 15  GLU A OE1  2  
ATOM 2167  O OE2  . GLU A 1 15  ? 0.056   2.225   -6.035  1.00 1.00 ? 15  GLU A OE2  2  
ATOM 2168  H H    . GLU A 1 15  ? 2.890   6.895   -7.114  1.00 1.00 ? 15  GLU A H    2  
ATOM 2169  H HA   . GLU A 1 15  ? 0.605   6.047   -8.837  1.00 1.00 ? 15  GLU A HA   2  
ATOM 2170  H HB2  . GLU A 1 15  ? 1.233   5.714   -5.865  1.00 1.00 ? 15  GLU A HB2  2  
ATOM 2171  H HB3  . GLU A 1 15  ? -0.325  5.302   -6.595  1.00 1.00 ? 15  GLU A HB3  2  
ATOM 2172  H HG2  . GLU A 1 15  ? 0.735   3.649   -8.045  1.00 1.00 ? 15  GLU A HG2  2  
ATOM 2173  H HG3  . GLU A 1 15  ? 2.328   4.040   -7.377  1.00 1.00 ? 15  GLU A HG3  2  
ATOM 2174  N N    . ILE A 1 16  ? -0.925  7.951   -8.172  1.00 1.00 ? 16  ILE A N    2  
ATOM 2175  C CA   . ILE A 1 16  ? -1.788  9.116   -7.941  1.00 1.00 ? 16  ILE A CA   2  
ATOM 2176  C C    . ILE A 1 16  ? -3.196  8.615   -7.606  1.00 1.00 ? 16  ILE A C    2  
ATOM 2177  O O    . ILE A 1 16  ? -3.846  7.958   -8.420  1.00 1.00 ? 16  ILE A O    2  
ATOM 2178  C CB   . ILE A 1 16  ? -1.788  10.043  -9.181  1.00 1.00 ? 16  ILE A CB   2  
ATOM 2179  C CG1  . ILE A 1 16  ? -0.352  10.460  -9.593  1.00 1.00 ? 16  ILE A CG1  2  
ATOM 2180  C CG2  . ILE A 1 16  ? -2.664  11.276  -8.885  1.00 1.00 ? 16  ILE A CG2  2  
ATOM 2181  C CD1  . ILE A 1 16  ? -0.268  11.205  -10.933 1.00 1.00 ? 16  ILE A CD1  2  
ATOM 2182  H H    . ILE A 1 16  ? -1.173  7.329   -8.941  1.00 1.00 ? 16  ILE A H    2  
ATOM 2183  H HA   . ILE A 1 16  ? -1.418  9.684   -7.088  1.00 1.00 ? 16  ILE A HA   2  
ATOM 2184  H HB   . ILE A 1 16  ? -2.230  9.497   -10.016 1.00 1.00 ? 16  ILE A HB   2  
ATOM 2185  H HG12 . ILE A 1 16  ? 0.084   11.080  -8.810  1.00 1.00 ? 16  ILE A HG12 2  
ATOM 2186  H HG13 . ILE A 1 16  ? 0.272   9.573   -9.703  1.00 1.00 ? 16  ILE A HG13 2  
ATOM 2187  H HG21 . ILE A 1 16  ? -2.255  11.833  -8.040  1.00 1.00 ? 16  ILE A HG21 2  
ATOM 2188  H HG22 . ILE A 1 16  ? -2.721  11.928  -9.755  1.00 1.00 ? 16  ILE A HG22 2  
ATOM 2189  H HG23 . ILE A 1 16  ? -3.682  10.971  -8.642  1.00 1.00 ? 16  ILE A HG23 2  
ATOM 2190  H HD11 . ILE A 1 16  ? -0.808  12.148  -10.885 1.00 1.00 ? 16  ILE A HD11 2  
ATOM 2191  H HD12 . ILE A 1 16  ? 0.778   11.416  -11.162 1.00 1.00 ? 16  ILE A HD12 2  
ATOM 2192  H HD13 . ILE A 1 16  ? -0.686  10.589  -11.731 1.00 1.00 ? 16  ILE A HD13 2  
ATOM 2193  N N    . PHE A 1 17  ? -3.692  8.949   -6.420  1.00 1.00 ? 17  PHE A N    2  
ATOM 2194  C CA   . PHE A 1 17  ? -4.938  8.426   -5.852  1.00 1.00 ? 17  PHE A CA   2  
ATOM 2195  C C    . PHE A 1 17  ? -6.132  9.313   -6.235  1.00 1.00 ? 17  PHE A C    2  
ATOM 2196  O O    . PHE A 1 17  ? -6.807  9.894   -5.380  1.00 1.00 ? 17  PHE A O    2  
ATOM 2197  C CB   . PHE A 1 17  ? -4.748  8.243   -4.338  1.00 1.00 ? 17  PHE A CB   2  
ATOM 2198  C CG   . PHE A 1 17  ? -3.575  7.343   -4.002  1.00 1.00 ? 17  PHE A CG   2  
ATOM 2199  C CD1  . PHE A 1 17  ? -3.659  5.962   -4.261  1.00 1.00 ? 17  PHE A CD1  2  
ATOM 2200  C CD2  . PHE A 1 17  ? -2.383  7.887   -3.486  1.00 1.00 ? 17  PHE A CD2  2  
ATOM 2201  C CE1  . PHE A 1 17  ? -2.547  5.132   -4.029  1.00 1.00 ? 17  PHE A CE1  2  
ATOM 2202  C CE2  . PHE A 1 17  ? -1.275  7.056   -3.246  1.00 1.00 ? 17  PHE A CE2  2  
ATOM 2203  C CZ   . PHE A 1 17  ? -1.356  5.679   -3.526  1.00 1.00 ? 17  PHE A CZ   2  
ATOM 2204  H H    . PHE A 1 17  ? -3.150  9.588   -5.851  1.00 1.00 ? 17  PHE A H    2  
ATOM 2205  H HA   . PHE A 1 17  ? -5.128  7.440   -6.280  1.00 1.00 ? 17  PHE A HA   2  
ATOM 2206  H HB2  . PHE A 1 17  ? -4.607  9.221   -3.874  1.00 1.00 ? 17  PHE A HB2  2  
ATOM 2207  H HB3  . PHE A 1 17  ? -5.655  7.808   -3.917  1.00 1.00 ? 17  PHE A HB3  2  
ATOM 2208  H HD1  . PHE A 1 17  ? -4.573  5.539   -4.650  1.00 1.00 ? 17  PHE A HD1  2  
ATOM 2209  H HD2  . PHE A 1 17  ? -2.314  8.944   -3.279  1.00 1.00 ? 17  PHE A HD2  2  
ATOM 2210  H HE1  . PHE A 1 17  ? -2.613  4.074   -4.238  1.00 1.00 ? 17  PHE A HE1  2  
ATOM 2211  H HE2  . PHE A 1 17  ? -0.366  7.478   -2.842  1.00 1.00 ? 17  PHE A HE2  2  
ATOM 2212  H HZ   . PHE A 1 17  ? -0.505  5.038   -3.349  1.00 1.00 ? 17  PHE A HZ   2  
ATOM 2213  N N    . ARG A 1 18  ? -6.364  9.442   -7.546  1.00 1.00 ? 18  ARG A N    2  
ATOM 2214  C CA   . ARG A 1 18  ? -7.514  10.154  -8.123  1.00 1.00 ? 18  ARG A CA   2  
ATOM 2215  C C    . ARG A 1 18  ? -8.840  9.426   -7.814  1.00 1.00 ? 18  ARG A C    2  
ATOM 2216  O O    . ARG A 1 18  ? -8.852  8.221   -7.549  1.00 1.00 ? 18  ARG A O    2  
ATOM 2217  C CB   . ARG A 1 18  ? -7.250  10.346  -9.633  1.00 1.00 ? 18  ARG A CB   2  
ATOM 2218  C CG   . ARG A 1 18  ? -8.315  11.168  -10.377 1.00 1.00 ? 18  ARG A CG   2  
ATOM 2219  C CD   . ARG A 1 18  ? -7.821  11.630  -11.755 1.00 1.00 ? 18  ARG A CD   2  
ATOM 2220  N NE   . ARG A 1 18  ? -8.866  12.407  -12.448 1.00 1.00 ? 18  ARG A NE   2  
ATOM 2221  C CZ   . ARG A 1 18  ? -9.394  12.182  -13.650 1.00 1.00 ? 18  ARG A CZ   2  
ATOM 2222  N NH1  . ARG A 1 18  ? -9.036  11.174  -14.420 1.00 1.00 ? 18  ARG A NH1  2  
ATOM 2223  N NH2  . ARG A 1 18  ? -10.322 12.998  -14.104 1.00 1.00 ? 18  ARG A NH2  2  
ATOM 2224  H H    . ARG A 1 18  ? -5.746  8.941   -8.177  1.00 1.00 ? 18  ARG A H    2  
ATOM 2225  H HA   . ARG A 1 18  ? -7.557  11.139  -7.648  1.00 1.00 ? 18  ARG A HA   2  
ATOM 2226  H HB2  . ARG A 1 18  ? -6.287  10.850  -9.742  1.00 1.00 ? 18  ARG A HB2  2  
ATOM 2227  H HB3  . ARG A 1 18  ? -7.169  9.368   -10.107 1.00 1.00 ? 18  ARG A HB3  2  
ATOM 2228  H HG2  . ARG A 1 18  ? -9.213  10.562  -10.510 1.00 1.00 ? 18  ARG A HG2  2  
ATOM 2229  H HG3  . ARG A 1 18  ? -8.574  12.047  -9.787  1.00 1.00 ? 18  ARG A HG3  2  
ATOM 2230  H HD2  . ARG A 1 18  ? -6.942  12.266  -11.625 1.00 1.00 ? 18  ARG A HD2  2  
ATOM 2231  H HD3  . ARG A 1 18  ? -7.523  10.761  -12.339 1.00 1.00 ? 18  ARG A HD3  2  
ATOM 2232  H HE   . ARG A 1 18  ? -9.209  13.217  -11.949 1.00 1.00 ? 18  ARG A HE   2  
ATOM 2233  H HH11 . ARG A 1 18  ? -8.332  10.505  -14.125 1.00 1.00 ? 18  ARG A HH11 2  
ATOM 2234  H HH12 . ARG A 1 18  ? -9.474  11.036  -15.316 1.00 1.00 ? 18  ARG A HH12 2  
ATOM 2235  H HH21 . ARG A 1 18  ? -10.635 13.779  -13.550 1.00 1.00 ? 18  ARG A HH21 2  
ATOM 2236  H HH22 . ARG A 1 18  ? -10.745 12.843  -15.007 1.00 1.00 ? 18  ARG A HH22 2  
ATOM 2237  N N    . LEU A 1 19  ? -9.957  10.165  -7.838  1.00 1.00 ? 19  LEU A N    2  
ATOM 2238  C CA   . LEU A 1 19  ? -11.311 9.649   -7.591  1.00 1.00 ? 19  LEU A CA   2  
ATOM 2239  C C    . LEU A 1 19  ? -11.667 8.499   -8.562  1.00 1.00 ? 19  LEU A C    2  
ATOM 2240  O O    . LEU A 1 19  ? -11.363 8.569   -9.756  1.00 1.00 ? 19  LEU A O    2  
ATOM 2241  C CB   . LEU A 1 19  ? -12.300 10.831  -7.699  1.00 1.00 ? 19  LEU A CB   2  
ATOM 2242  C CG   . LEU A 1 19  ? -13.777 10.502  -7.398  1.00 1.00 ? 19  LEU A CG   2  
ATOM 2243  C CD1  . LEU A 1 19  ? -13.982 10.035  -5.950  1.00 1.00 ? 19  LEU A CD1  2  
ATOM 2244  C CD2  . LEU A 1 19  ? -14.638 11.747  -7.654  1.00 1.00 ? 19  LEU A CD2  2  
ATOM 2245  H H    . LEU A 1 19  ? -9.862  11.151  -8.032  1.00 1.00 ? 19  LEU A H    2  
ATOM 2246  H HA   . LEU A 1 19  ? -11.336 9.255   -6.572  1.00 1.00 ? 19  LEU A HA   2  
ATOM 2247  H HB2  . LEU A 1 19  ? -11.979 11.619  -7.012  1.00 1.00 ? 19  LEU A HB2  2  
ATOM 2248  H HB3  . LEU A 1 19  ? -12.240 11.235  -8.713  1.00 1.00 ? 19  LEU A HB3  2  
ATOM 2249  H HG   . LEU A 1 19  ? -14.117 9.716   -8.070  1.00 1.00 ? 19  LEU A HG   2  
ATOM 2250  H HD11 . LEU A 1 19  ? -15.045 9.874   -5.766  1.00 1.00 ? 19  LEU A HD11 2  
ATOM 2251  H HD12 . LEU A 1 19  ? -13.461 9.095   -5.774  1.00 1.00 ? 19  LEU A HD12 2  
ATOM 2252  H HD13 . LEU A 1 19  ? -13.614 10.789  -5.253  1.00 1.00 ? 19  LEU A HD13 2  
ATOM 2253  H HD21 . LEU A 1 19  ? -14.339 12.559  -6.989  1.00 1.00 ? 19  LEU A HD21 2  
ATOM 2254  H HD22 . LEU A 1 19  ? -14.521 12.073  -8.688  1.00 1.00 ? 19  LEU A HD22 2  
ATOM 2255  H HD23 . LEU A 1 19  ? -15.688 11.513  -7.481  1.00 1.00 ? 19  LEU A HD23 2  
ATOM 2256  N N    . GLY A 1 20  ? -12.317 7.448   -8.045  1.00 1.00 ? 20  GLY A N    2  
ATOM 2257  C CA   . GLY A 1 20  ? -12.768 6.270   -8.806  1.00 1.00 ? 20  GLY A CA   2  
ATOM 2258  C C    . GLY A 1 20  ? -11.666 5.223   -8.997  1.00 1.00 ? 20  GLY A C    2  
ATOM 2259  O O    . GLY A 1 20  ? -11.857 4.061   -8.643  1.00 1.00 ? 20  GLY A O    2  
ATOM 2260  H H    . GLY A 1 20  ? -12.514 7.449   -7.053  1.00 1.00 ? 20  GLY A H    2  
ATOM 2261  H HA2  . GLY A 1 20  ? -13.597 5.795   -8.278  1.00 1.00 ? 20  GLY A HA2  2  
ATOM 2262  H HA3  . GLY A 1 20  ? -13.100 6.580   -9.798  1.00 1.00 ? 20  GLY A HA3  2  
ATOM 2263  N N    . TYR A 1 21  ? -10.518 5.636   -9.541  1.00 1.00 ? 21  TYR A N    2  
ATOM 2264  C CA   . TYR A 1 21  ? -9.374  4.783   -9.876  1.00 1.00 ? 21  TYR A CA   2  
ATOM 2265  C C    . TYR A 1 21  ? -8.032  5.511   -9.712  1.00 1.00 ? 21  TYR A C    2  
ATOM 2266  O O    . TYR A 1 21  ? -7.897  6.681   -10.082 1.00 1.00 ? 21  TYR A O    2  
ATOM 2267  C CB   . TYR A 1 21  ? -9.496  4.269   -11.326 1.00 1.00 ? 21  TYR A CB   2  
ATOM 2268  C CG   . TYR A 1 21  ? -10.716 3.410   -11.603 1.00 1.00 ? 21  TYR A CG   2  
ATOM 2269  C CD1  . TYR A 1 21  ? -10.687 2.034   -11.312 1.00 1.00 ? 21  TYR A CD1  2  
ATOM 2270  C CD2  . TYR A 1 21  ? -11.886 3.993   -12.132 1.00 1.00 ? 21  TYR A CD2  2  
ATOM 2271  C CE1  . TYR A 1 21  ? -11.833 1.242   -11.517 1.00 1.00 ? 21  TYR A CE1  2  
ATOM 2272  C CE2  . TYR A 1 21  ? -13.037 3.208   -12.338 1.00 1.00 ? 21  TYR A CE2  2  
ATOM 2273  C CZ   . TYR A 1 21  ? -13.016 1.830   -12.023 1.00 1.00 ? 21  TYR A CZ   2  
ATOM 2274  O OH   . TYR A 1 21  ? -14.129 1.063   -12.207 1.00 1.00 ? 21  TYR A OH   2  
ATOM 2275  H H    . TYR A 1 21  ? -10.426 6.615   -9.755  1.00 1.00 ? 21  TYR A H    2  
ATOM 2276  H HA   . TYR A 1 21  ? -9.377  3.935   -9.199  1.00 1.00 ? 21  TYR A HA   2  
ATOM 2277  H HB2  . TYR A 1 21  ? -9.500  5.121   -12.006 1.00 1.00 ? 21  TYR A HB2  2  
ATOM 2278  H HB3  . TYR A 1 21  ? -8.608  3.681   -11.561 1.00 1.00 ? 21  TYR A HB3  2  
ATOM 2279  H HD1  . TYR A 1 21  ? -9.784  1.590   -10.916 1.00 1.00 ? 21  TYR A HD1  2  
ATOM 2280  H HD2  . TYR A 1 21  ? -11.908 5.049   -12.366 1.00 1.00 ? 21  TYR A HD2  2  
ATOM 2281  H HE1  . TYR A 1 21  ? -11.818 0.187   -11.284 1.00 1.00 ? 21  TYR A HE1  2  
ATOM 2282  H HE2  . TYR A 1 21  ? -13.937 3.657   -12.733 1.00 1.00 ? 21  TYR A HE2  2  
ATOM 2283  H HH   . TYR A 1 21  ? -14.888 1.566   -12.544 1.00 1.00 ? 21  TYR A HH   2  
ATOM 2284  N N    . GLU A 1 22  ? -7.010  4.795   -9.236  1.00 1.00 ? 22  GLU A N    2  
ATOM 2285  C CA   . GLU A 1 22  ? -5.624  5.272   -9.212  1.00 1.00 ? 22  GLU A CA   2  
ATOM 2286  C C    . GLU A 1 22  ? -5.105  5.533   -10.640 1.00 1.00 ? 22  GLU A C    2  
ATOM 2287  O O    . GLU A 1 22  ? -5.522  4.895   -11.607 1.00 1.00 ? 22  GLU A O    2  
ATOM 2288  C CB   . GLU A 1 22  ? -4.687  4.285   -8.487  1.00 1.00 ? 22  GLU A CB   2  
ATOM 2289  C CG   . GLU A 1 22  ? -5.140  3.892   -7.074  1.00 1.00 ? 22  GLU A CG   2  
ATOM 2290  C CD   . GLU A 1 22  ? -6.009  2.623   -7.093  1.00 1.00 ? 22  GLU A CD   2  
ATOM 2291  O OE1  . GLU A 1 22  ? -7.220  2.713   -7.401  1.00 1.00 ? 22  GLU A OE1  2  
ATOM 2292  O OE2  . GLU A 1 22  ? -5.482  1.513   -6.858  1.00 1.00 ? 22  GLU A OE2  2  
ATOM 2293  H H    . GLU A 1 22  ? -7.204  3.880   -8.837  1.00 1.00 ? 22  GLU A H    2  
ATOM 2294  H HA   . GLU A 1 22  ? -5.606  6.213   -8.664  1.00 1.00 ? 22  GLU A HA   2  
ATOM 2295  H HB2  . GLU A 1 22  ? -4.580  3.380   -9.085  1.00 1.00 ? 22  GLU A HB2  2  
ATOM 2296  H HB3  . GLU A 1 22  ? -3.703  4.749   -8.411  1.00 1.00 ? 22  GLU A HB3  2  
ATOM 2297  H HG2  . GLU A 1 22  ? -4.254  3.703   -6.468  1.00 1.00 ? 22  GLU A HG2  2  
ATOM 2298  H HG3  . GLU A 1 22  ? -5.681  4.718   -6.613  1.00 1.00 ? 22  GLU A HG3  2  
ATOM 2299  N N    . HIS A 1 23  ? -4.209  6.508   -10.778 1.00 1.00 ? 23  HIS A N    2  
ATOM 2300  C CA   . HIS A 1 23  ? -3.506  6.870   -12.015 1.00 1.00 ? 23  HIS A CA   2  
ATOM 2301  C C    . HIS A 1 23  ? -1.978  6.817   -11.765 1.00 1.00 ? 23  HIS A C    2  
ATOM 2302  O O    . HIS A 1 23  ? -1.541  6.778   -10.616 1.00 1.00 ? 23  HIS A O    2  
ATOM 2303  C CB   . HIS A 1 23  ? -3.978  8.268   -12.471 1.00 1.00 ? 23  HIS A CB   2  
ATOM 2304  C CG   . HIS A 1 23  ? -5.412  8.343   -12.950 1.00 1.00 ? 23  HIS A CG   2  
ATOM 2305  N ND1  . HIS A 1 23  ? -6.531  7.896   -12.287 1.00 1.00 ? 23  HIS A ND1  2  
ATOM 2306  C CD2  . HIS A 1 23  ? -5.853  8.937   -14.101 1.00 1.00 ? 23  HIS A CD2  2  
ATOM 2307  C CE1  . HIS A 1 23  ? -7.614  8.207   -13.009 1.00 1.00 ? 23  HIS A CE1  2  
ATOM 2308  N NE2  . HIS A 1 23  ? -7.252  8.845   -14.135 1.00 1.00 ? 23  HIS A NE2  2  
ATOM 2309  H H    . HIS A 1 23  ? -3.885  6.968   -9.926  1.00 1.00 ? 23  HIS A H    2  
ATOM 2310  H HA   . HIS A 1 23  ? -3.741  6.154   -12.807 1.00 1.00 ? 23  HIS A HA   2  
ATOM 2311  H HB2  . HIS A 1 23  ? -3.861  8.977   -11.650 1.00 1.00 ? 23  HIS A HB2  2  
ATOM 2312  H HB3  . HIS A 1 23  ? -3.333  8.606   -13.288 1.00 1.00 ? 23  HIS A HB3  2  
ATOM 2313  H HD1  . HIS A 1 23  ? -6.559  7.385   -11.411 1.00 1.00 ? 23  HIS A HD1  2  
ATOM 2314  H HD2  . HIS A 1 23  ? -5.229  9.416   -14.844 1.00 1.00 ? 23  HIS A HD2  2  
ATOM 2315  H HE1  . HIS A 1 23  ? -8.632  7.965   -12.731 1.00 1.00 ? 23  HIS A HE1  2  
ATOM 2316  N N    . TRP A 1 24  ? -1.155  6.821   -12.824 1.00 1.00 ? 24  TRP A N    2  
ATOM 2317  C CA   . TRP A 1 24  ? 0.304   6.638   -12.727 1.00 1.00 ? 24  TRP A CA   2  
ATOM 2318  C C    . TRP A 1 24  ? 1.090   7.658   -13.565 1.00 1.00 ? 24  TRP A C    2  
ATOM 2319  O O    . TRP A 1 24  ? 0.646   8.059   -14.642 1.00 1.00 ? 24  TRP A O    2  
ATOM 2320  C CB   . TRP A 1 24  ? 0.663   5.210   -13.166 1.00 1.00 ? 24  TRP A CB   2  
ATOM 2321  C CG   . TRP A 1 24  ? 0.498   4.145   -12.125 1.00 1.00 ? 24  TRP A CG   2  
ATOM 2322  C CD1  . TRP A 1 24  ? 1.504   3.644   -11.375 1.00 1.00 ? 24  TRP A CD1  2  
ATOM 2323  C CD2  . TRP A 1 24  ? -0.709  3.441   -11.690 1.00 1.00 ? 24  TRP A CD2  2  
ATOM 2324  N NE1  . TRP A 1 24  ? 1.013   2.683   -10.517 1.00 1.00 ? 24  TRP A NE1  2  
ATOM 2325  C CE2  . TRP A 1 24  ? -0.348  2.537   -10.646 1.00 1.00 ? 24  TRP A CE2  2  
ATOM 2326  C CE3  . TRP A 1 24  ? -2.072  3.467   -12.062 1.00 1.00 ? 24  TRP A CE3  2  
ATOM 2327  C CZ2  . TRP A 1 24  ? -1.283  1.721   -9.993  1.00 1.00 ? 24  TRP A CZ2  2  
ATOM 2328  C CZ3  . TRP A 1 24  ? -3.022  2.666   -11.402 1.00 1.00 ? 24  TRP A CZ3  2  
ATOM 2329  C CH2  . TRP A 1 24  ? -2.632  1.792   -10.371 1.00 1.00 ? 24  TRP A CH2  2  
ATOM 2330  H H    . TRP A 1 24  ? -1.546  6.943   -13.749 1.00 1.00 ? 24  TRP A H    2  
ATOM 2331  H HA   . TRP A 1 24  ? 0.628   6.760   -11.693 1.00 1.00 ? 24  TRP A HA   2  
ATOM 2332  H HB2  . TRP A 1 24  ? 0.081   4.939   -14.043 1.00 1.00 ? 24  TRP A HB2  2  
ATOM 2333  H HB3  . TRP A 1 24  ? 1.706   5.197   -13.472 1.00 1.00 ? 24  TRP A HB3  2  
ATOM 2334  H HD1  . TRP A 1 24  ? 2.542   3.953   -11.436 1.00 1.00 ? 24  TRP A HD1  2  
ATOM 2335  H HE1  . TRP A 1 24  ? 1.586   2.168   -9.860  1.00 1.00 ? 24  TRP A HE1  2  
ATOM 2336  H HE3  . TRP A 1 24  ? -2.395  4.122   -12.855 1.00 1.00 ? 24  TRP A HE3  2  
ATOM 2337  H HZ2  . TRP A 1 24  ? -0.965  1.053   -9.207  1.00 1.00 ? 24  TRP A HZ2  2  
ATOM 2338  H HZ3  . TRP A 1 24  ? -4.064  2.731   -11.678 1.00 1.00 ? 24  TRP A HZ3  2  
ATOM 2339  H HH2  . TRP A 1 24  ? -3.366  1.178   -9.869  1.00 1.00 ? 24  TRP A HH2  2  
ATOM 2340  N N    . ALA A 1 25  ? 2.292   8.022   -13.098 1.00 1.00 ? 25  ALA A N    2  
ATOM 2341  C CA   . ALA A 1 25  ? 3.214   8.925   -13.802 1.00 1.00 ? 25  ALA A CA   2  
ATOM 2342  C C    . ALA A 1 25  ? 4.696   8.527   -13.628 1.00 1.00 ? 25  ALA A C    2  
ATOM 2343  O O    . ALA A 1 25  ? 5.075   7.942   -12.613 1.00 1.00 ? 25  ALA A O    2  
ATOM 2344  C CB   . ALA A 1 25  ? 2.958   10.355  -13.307 1.00 1.00 ? 25  ALA A CB   2  
ATOM 2345  H H    . ALA A 1 25  ? 2.574   7.671   -12.184 1.00 1.00 ? 25  ALA A H    2  
ATOM 2346  H HA   . ALA A 1 25  ? 2.997   8.894   -14.871 1.00 1.00 ? 25  ALA A HA   2  
ATOM 2347  H HB1  . ALA A 1 25  ? 3.568   11.054  -13.876 1.00 1.00 ? 25  ALA A HB1  2  
ATOM 2348  H HB2  . ALA A 1 25  ? 1.907   10.617  -13.445 1.00 1.00 ? 25  ALA A HB2  2  
ATOM 2349  H HB3  . ALA A 1 25  ? 3.207   10.440  -12.246 1.00 1.00 ? 25  ALA A HB3  2  
ATOM 2350  N N    . LEU A 1 26  ? 5.520   8.862   -14.625 1.00 1.00 ? 26  LEU A N    2  
ATOM 2351  C CA   . LEU A 1 26  ? 6.987   8.775   -14.615 1.00 1.00 ? 26  LEU A CA   2  
ATOM 2352  C C    . LEU A 1 26  ? 7.552   10.174  -14.314 1.00 1.00 ? 26  LEU A C    2  
ATOM 2353  O O    . LEU A 1 26  ? 7.342   11.097  -15.096 1.00 1.00 ? 26  LEU A O    2  
ATOM 2354  C CB   . LEU A 1 26  ? 7.431   8.238   -16.003 1.00 1.00 ? 26  LEU A CB   2  
ATOM 2355  C CG   . LEU A 1 26  ? 8.862   7.677   -16.150 1.00 1.00 ? 26  LEU A CG   2  
ATOM 2356  C CD1  . LEU A 1 26  ? 9.966   8.686   -15.814 1.00 1.00 ? 26  LEU A CD1  2  
ATOM 2357  C CD2  . LEU A 1 26  ? 9.049   6.407   -15.317 1.00 1.00 ? 26  LEU A CD2  2  
ATOM 2358  H H    . LEU A 1 26  ? 5.103   9.308   -15.439 1.00 1.00 ? 26  LEU A H    2  
ATOM 2359  H HA   . LEU A 1 26  ? 7.304   8.084   -13.831 1.00 1.00 ? 26  LEU A HA   2  
ATOM 2360  H HB2  . LEU A 1 26  ? 6.749   7.436   -16.291 1.00 1.00 ? 26  LEU A HB2  2  
ATOM 2361  H HB3  . LEU A 1 26  ? 7.305   9.023   -16.756 1.00 1.00 ? 26  LEU A HB3  2  
ATOM 2362  H HG   . LEU A 1 26  ? 8.988   7.408   -17.201 1.00 1.00 ? 26  LEU A HG   2  
ATOM 2363  H HD11 . LEU A 1 26  ? 9.771   9.622   -16.336 1.00 1.00 ? 26  LEU A HD11 2  
ATOM 2364  H HD12 . LEU A 1 26  ? 10.004  8.859   -14.739 1.00 1.00 ? 26  LEU A HD12 2  
ATOM 2365  H HD13 . LEU A 1 26  ? 10.932  8.299   -16.140 1.00 1.00 ? 26  LEU A HD13 2  
ATOM 2366  H HD21 . LEU A 1 26  ? 9.011   6.645   -14.253 1.00 1.00 ? 26  LEU A HD21 2  
ATOM 2367  H HD22 . LEU A 1 26  ? 8.270   5.684   -15.562 1.00 1.00 ? 26  LEU A HD22 2  
ATOM 2368  H HD23 . LEU A 1 26  ? 10.018  5.960   -15.537 1.00 1.00 ? 26  LEU A HD23 2  
ATOM 2369  N N    . TYR A 1 27  ? 8.261   10.361  -13.203 1.00 1.00 ? 27  TYR A N    2  
ATOM 2370  C CA   . TYR A 1 27  ? 8.861   11.651  -12.832 1.00 1.00 ? 27  TYR A CA   2  
ATOM 2371  C C    . TYR A 1 27  ? 10.205  11.894  -13.535 1.00 1.00 ? 27  TYR A C    2  
ATOM 2372  O O    . TYR A 1 27  ? 11.072  11.026  -13.548 1.00 1.00 ? 27  TYR A O    2  
ATOM 2373  C CB   . TYR A 1 27  ? 8.992   11.707  -11.307 1.00 1.00 ? 27  TYR A CB   2  
ATOM 2374  C CG   . TYR A 1 27  ? 9.427   13.050  -10.755 1.00 1.00 ? 27  TYR A CG   2  
ATOM 2375  C CD1  . TYR A 1 27  ? 10.795  13.333  -10.622 1.00 1.00 ? 27  TYR A CD1  2  
ATOM 2376  C CD2  . TYR A 1 27  ? 8.473   14.002  -10.344 1.00 1.00 ? 27  TYR A CD2  2  
ATOM 2377  C CE1  . TYR A 1 27  ? 11.219  14.541  -10.039 1.00 1.00 ? 27  TYR A CE1  2  
ATOM 2378  C CE2  . TYR A 1 27  ? 8.889   15.230  -9.792  1.00 1.00 ? 27  TYR A CE2  2  
ATOM 2379  C CZ   . TYR A 1 27  ? 10.266  15.494  -9.620  1.00 1.00 ? 27  TYR A CZ   2  
ATOM 2380  O OH   . TYR A 1 27  ? 10.687  16.651  -9.034  1.00 1.00 ? 27  TYR A OH   2  
ATOM 2381  H H    . TYR A 1 27  ? 8.417   9.567   -12.586 1.00 1.00 ? 27  TYR A H    2  
ATOM 2382  H HA   . TYR A 1 27  ? 8.192   12.452  -13.137 1.00 1.00 ? 27  TYR A HA   2  
ATOM 2383  H HB2  . TYR A 1 27  ? 8.023   11.455  -10.878 1.00 1.00 ? 27  TYR A HB2  2  
ATOM 2384  H HB3  . TYR A 1 27  ? 9.698   10.944  -10.982 1.00 1.00 ? 27  TYR A HB3  2  
ATOM 2385  H HD1  . TYR A 1 27  ? 11.523  12.608  -10.949 1.00 1.00 ? 27  TYR A HD1  2  
ATOM 2386  H HD2  . TYR A 1 27  ? 7.416   13.787  -10.436 1.00 1.00 ? 27  TYR A HD2  2  
ATOM 2387  H HE1  . TYR A 1 27  ? 12.268  14.738  -9.879  1.00 1.00 ? 27  TYR A HE1  2  
ATOM 2388  H HE2  . TYR A 1 27  ? 8.153   15.956  -9.473  1.00 1.00 ? 27  TYR A HE2  2  
ATOM 2389  H HH   . TYR A 1 27  ? 9.970   17.191  -8.675  1.00 1.00 ? 27  TYR A HH   2  
ATOM 2390  N N    . ILE A 1 28  ? 10.410  13.086  -14.108 1.00 1.00 ? 28  ILE A N    2  
ATOM 2391  C CA   . ILE A 1 28  ? 11.579  13.375  -14.977 1.00 1.00 ? 28  ILE A CA   2  
ATOM 2392  C C    . ILE A 1 28  ? 12.565  14.423  -14.422 1.00 1.00 ? 28  ILE A C    2  
ATOM 2393  O O    . ILE A 1 28  ? 13.549  14.738  -15.093 1.00 1.00 ? 28  ILE A O    2  
ATOM 2394  C CB   . ILE A 1 28  ? 11.109  13.706  -16.415 1.00 1.00 ? 28  ILE A CB   2  
ATOM 2395  C CG1  . ILE A 1 28  ? 10.333  15.034  -16.514 1.00 1.00 ? 28  ILE A CG1  2  
ATOM 2396  C CG2  . ILE A 1 28  ? 10.284  12.542  -16.996 1.00 1.00 ? 28  ILE A CG2  2  
ATOM 2397  C CD1  . ILE A 1 28  ? 10.113  15.483  -17.962 1.00 1.00 ? 28  ILE A CD1  2  
ATOM 2398  H H    . ILE A 1 28  ? 9.683   13.796  -14.016 1.00 1.00 ? 28  ILE A H    2  
ATOM 2399  H HA   . ILE A 1 28  ? 12.189  12.471  -15.059 1.00 1.00 ? 28  ILE A HA   2  
ATOM 2400  H HB   . ILE A 1 28  ? 12.007  13.802  -17.028 1.00 1.00 ? 28  ILE A HB   2  
ATOM 2401  H HG12 . ILE A 1 28  ? 9.362   14.925  -16.034 1.00 1.00 ? 28  ILE A HG12 2  
ATOM 2402  H HG13 . ILE A 1 28  ? 10.886  15.820  -16.001 1.00 1.00 ? 28  ILE A HG13 2  
ATOM 2403  H HG21 . ILE A 1 28  ? 9.275   12.518  -16.570 1.00 1.00 ? 28  ILE A HG21 2  
ATOM 2404  H HG22 . ILE A 1 28  ? 10.207  12.648  -18.076 1.00 1.00 ? 28  ILE A HG22 2  
ATOM 2405  H HG23 . ILE A 1 28  ? 10.776  11.595  -16.789 1.00 1.00 ? 28  ILE A HG23 2  
ATOM 2406  H HD11 . ILE A 1 28  ? 11.068  15.506  -18.491 1.00 1.00 ? 28  ILE A HD11 2  
ATOM 2407  H HD12 . ILE A 1 28  ? 9.438   14.794  -18.469 1.00 1.00 ? 28  ILE A HD12 2  
ATOM 2408  H HD13 . ILE A 1 28  ? 9.676   16.478  -17.966 1.00 1.00 ? 28  ILE A HD13 2  
ATOM 2409  N N    . GLY A 1 29  ? 12.334  14.938  -13.208 1.00 1.00 ? 29  GLY A N    2  
ATOM 2410  C CA   . GLY A 1 29  ? 13.138  16.010  -12.592 1.00 1.00 ? 29  GLY A CA   2  
ATOM 2411  C C    . GLY A 1 29  ? 12.514  17.398  -12.771 1.00 1.00 ? 29  GLY A C    2  
ATOM 2412  O O    . GLY A 1 29  ? 11.571  17.576  -13.542 1.00 1.00 ? 29  GLY A O    2  
ATOM 2413  H H    . GLY A 1 29  ? 11.497  14.648  -12.721 1.00 1.00 ? 29  GLY A H    2  
ATOM 2414  H HA2  . GLY A 1 29  ? 13.237  15.826  -11.520 1.00 1.00 ? 29  GLY A HA2  2  
ATOM 2415  H HA3  . GLY A 1 29  ? 14.138  16.044  -13.029 1.00 1.00 ? 29  GLY A HA3  2  
ATOM 2416  N N    . ASP A 1 30  ? 13.025  18.375  -12.016 1.00 1.00 ? 30  ASP A N    2  
ATOM 2417  C CA   . ASP A 1 30  ? 12.661  19.808  -12.087 1.00 1.00 ? 30  ASP A CA   2  
ATOM 2418  C C    . ASP A 1 30  ? 11.178  20.104  -11.740 1.00 1.00 ? 30  ASP A C    2  
ATOM 2419  O O    . ASP A 1 30  ? 10.645  21.163  -12.075 1.00 1.00 ? 30  ASP A O    2  
ATOM 2420  C CB   . ASP A 1 30  ? 13.094  20.383  -13.452 1.00 1.00 ? 30  ASP A CB   2  
ATOM 2421  C CG   . ASP A 1 30  ? 13.156  21.924  -13.478 1.00 1.00 ? 30  ASP A CG   2  
ATOM 2422  O OD1  . ASP A 1 30  ? 13.766  22.523  -12.559 1.00 1.00 ? 30  ASP A OD1  2  
ATOM 2423  O OD2  . ASP A 1 30  ? 12.646  22.531  -14.451 1.00 1.00 ? 30  ASP A OD2  2  
ATOM 2424  H H    . ASP A 1 30  ? 13.795  18.133  -11.401 1.00 1.00 ? 30  ASP A H    2  
ATOM 2425  H HA   . ASP A 1 30  ? 13.253  20.312  -11.323 1.00 1.00 ? 30  ASP A HA   2  
ATOM 2426  H HB2  . ASP A 1 30  ? 14.090  20.004  -13.689 1.00 1.00 ? 30  ASP A HB2  2  
ATOM 2427  H HB3  . ASP A 1 30  ? 12.409  20.027  -14.225 1.00 1.00 ? 30  ASP A HB3  2  
ATOM 2428  N N    . GLY A 1 31  ? 10.501  19.152  -11.079 1.00 1.00 ? 31  GLY A N    2  
ATOM 2429  C CA   . GLY A 1 31  ? 9.069   19.203  -10.757 1.00 1.00 ? 31  GLY A CA   2  
ATOM 2430  C C    . GLY A 1 31  ? 8.160   18.599  -11.826 1.00 1.00 ? 31  GLY A C    2  
ATOM 2431  O O    . GLY A 1 31  ? 6.948   18.572  -11.631 1.00 1.00 ? 31  GLY A O    2  
ATOM 2432  H H    . GLY A 1 31  ? 11.018  18.327  -10.802 1.00 1.00 ? 31  GLY A H    2  
ATOM 2433  H HA2  . GLY A 1 31  ? 8.883   18.655  -9.834  1.00 1.00 ? 31  GLY A HA2  2  
ATOM 2434  H HA3  . GLY A 1 31  ? 8.761   20.240  -10.620 1.00 1.00 ? 31  GLY A HA3  2  
ATOM 2435  N N    . TYR A 1 32  ? 8.694   18.114  -12.950 1.00 1.00 ? 32  TYR A N    2  
ATOM 2436  C CA   . TYR A 1 32  ? 7.907   17.599  -14.079 1.00 1.00 ? 32  TYR A CA   2  
ATOM 2437  C C    . TYR A 1 32  ? 7.695   16.075  -14.072 1.00 1.00 ? 32  TYR A C    2  
ATOM 2438  O O    . TYR A 1 32  ? 8.515   15.298  -13.578 1.00 1.00 ? 32  TYR A O    2  
ATOM 2439  C CB   . TYR A 1 32  ? 8.539   18.049  -15.409 1.00 1.00 ? 32  TYR A CB   2  
ATOM 2440  C CG   . TYR A 1 32  ? 8.245   19.491  -15.771 1.00 1.00 ? 32  TYR A CG   2  
ATOM 2441  C CD1  . TYR A 1 32  ? 9.027   20.529  -15.235 1.00 1.00 ? 32  TYR A CD1  2  
ATOM 2442  C CD2  . TYR A 1 32  ? 7.186   19.795  -16.650 1.00 1.00 ? 32  TYR A CD2  2  
ATOM 2443  C CE1  . TYR A 1 32  ? 8.752   21.869  -15.566 1.00 1.00 ? 32  TYR A CE1  2  
ATOM 2444  C CE2  . TYR A 1 32  ? 6.907   21.133  -16.992 1.00 1.00 ? 32  TYR A CE2  2  
ATOM 2445  C CZ   . TYR A 1 32  ? 7.693   22.176  -16.445 1.00 1.00 ? 32  TYR A CZ   2  
ATOM 2446  O OH   . TYR A 1 32  ? 7.421   23.478  -16.749 1.00 1.00 ? 32  TYR A OH   2  
ATOM 2447  H H    . TYR A 1 32  ? 9.704   18.131  -13.048 1.00 1.00 ? 32  TYR A H    2  
ATOM 2448  H HA   . TYR A 1 32  ? 6.914   18.041  -14.027 1.00 1.00 ? 32  TYR A HA   2  
ATOM 2449  H HB2  . TYR A 1 32  ? 9.619   17.899  -15.372 1.00 1.00 ? 32  TYR A HB2  2  
ATOM 2450  H HB3  . TYR A 1 32  ? 8.159   17.422  -16.216 1.00 1.00 ? 32  TYR A HB3  2  
ATOM 2451  H HD1  . TYR A 1 32  ? 9.843   20.302  -14.563 1.00 1.00 ? 32  TYR A HD1  2  
ATOM 2452  H HD2  . TYR A 1 32  ? 6.582   19.003  -17.070 1.00 1.00 ? 32  TYR A HD2  2  
ATOM 2453  H HE1  . TYR A 1 32  ? 9.359   22.663  -15.149 1.00 1.00 ? 32  TYR A HE1  2  
ATOM 2454  H HE2  . TYR A 1 32  ? 6.091   21.366  -17.660 1.00 1.00 ? 32  TYR A HE2  2  
ATOM 2455  H HH   . TYR A 1 32  ? 6.709   23.582  -17.402 1.00 1.00 ? 32  TYR A HH   2  
ATOM 2456  N N    . VAL A 1 33  ? 6.601   15.651  -14.705 1.00 1.00 ? 33  VAL A N    2  
ATOM 2457  C CA   . VAL A 1 33  ? 6.209   14.250  -14.909 1.00 1.00 ? 33  VAL A CA   2  
ATOM 2458  C C    . VAL A 1 33  ? 5.755   14.010  -16.344 1.00 1.00 ? 33  VAL A C    2  
ATOM 2459  O O    . VAL A 1 33  ? 5.323   14.928  -17.036 1.00 1.00 ? 33  VAL A O    2  
ATOM 2460  C CB   . VAL A 1 33  ? 5.042   13.829  -13.987 1.00 1.00 ? 33  VAL A CB   2  
ATOM 2461  C CG1  . VAL A 1 33  ? 5.476   13.650  -12.532 1.00 1.00 ? 33  VAL A CG1  2  
ATOM 2462  C CG2  . VAL A 1 33  ? 3.856   14.804  -14.028 1.00 1.00 ? 33  VAL A CG2  2  
ATOM 2463  H H    . VAL A 1 33  ? 5.981   16.364  -15.108 1.00 1.00 ? 33  VAL A H    2  
ATOM 2464  H HA   . VAL A 1 33  ? 7.061   13.600  -14.714 1.00 1.00 ? 33  VAL A HA   2  
ATOM 2465  H HB   . VAL A 1 33  ? 4.681   12.864  -14.332 1.00 1.00 ? 33  VAL A HB   2  
ATOM 2466  H HG11 . VAL A 1 33  ? 4.614   13.356  -11.935 1.00 1.00 ? 33  VAL A HG11 2  
ATOM 2467  H HG12 . VAL A 1 33  ? 6.217   12.857  -12.462 1.00 1.00 ? 33  VAL A HG12 2  
ATOM 2468  H HG13 . VAL A 1 33  ? 5.890   14.579  -12.147 1.00 1.00 ? 33  VAL A HG13 2  
ATOM 2469  H HG21 . VAL A 1 33  ? 4.123   15.751  -13.568 1.00 1.00 ? 33  VAL A HG21 2  
ATOM 2470  H HG22 . VAL A 1 33  ? 3.563   14.989  -15.062 1.00 1.00 ? 33  VAL A HG22 2  
ATOM 2471  H HG23 . VAL A 1 33  ? 3.012   14.372  -13.489 1.00 1.00 ? 33  VAL A HG23 2  
ATOM 2472  N N    . ILE A 1 34  ? 5.815   12.750  -16.761 1.00 1.00 ? 34  ILE A N    2  
ATOM 2473  C CA   . ILE A 1 34  ? 5.232   12.222  -17.998 1.00 1.00 ? 34  ILE A CA   2  
ATOM 2474  C C    . ILE A 1 34  ? 4.154   11.212  -17.582 1.00 1.00 ? 34  ILE A C    2  
ATOM 2475  O O    . ILE A 1 34  ? 4.342   10.442  -16.644 1.00 1.00 ? 34  ILE A O    2  
ATOM 2476  C CB   . ILE A 1 34  ? 6.360   11.680  -18.906 1.00 1.00 ? 34  ILE A CB   2  
ATOM 2477  C CG1  . ILE A 1 34  ? 7.089   12.913  -19.495 1.00 1.00 ? 34  ILE A CG1  2  
ATOM 2478  C CG2  . ILE A 1 34  ? 5.778   10.763  -20.002 1.00 1.00 ? 34  ILE A CG2  2  
ATOM 2479  C CD1  . ILE A 1 34  ? 8.301   12.624  -20.387 1.00 1.00 ? 34  ILE A CD1  2  
ATOM 2480  H H    . ILE A 1 34  ? 6.232   12.067  -16.122 1.00 1.00 ? 34  ILE A H    2  
ATOM 2481  H HA   . ILE A 1 34  ? 4.713   13.023  -18.526 1.00 1.00 ? 34  ILE A HA   2  
ATOM 2482  H HB   . ILE A 1 34  ? 7.074   11.114  -18.300 1.00 1.00 ? 34  ILE A HB   2  
ATOM 2483  H HG12 . ILE A 1 34  ? 6.377   13.506  -20.067 1.00 1.00 ? 34  ILE A HG12 2  
ATOM 2484  H HG13 . ILE A 1 34  ? 7.444   13.535  -18.675 1.00 1.00 ? 34  ILE A HG13 2  
ATOM 2485  H HG21 . ILE A 1 34  ? 5.375   9.853   -19.554 1.00 1.00 ? 34  ILE A HG21 2  
ATOM 2486  H HG22 . ILE A 1 34  ? 4.978   11.275  -20.539 1.00 1.00 ? 34  ILE A HG22 2  
ATOM 2487  H HG23 . ILE A 1 34  ? 6.545   10.466  -20.714 1.00 1.00 ? 34  ILE A HG23 2  
ATOM 2488  H HD11 . ILE A 1 34  ? 8.771   13.568  -20.670 1.00 1.00 ? 34  ILE A HD11 2  
ATOM 2489  H HD12 . ILE A 1 34  ? 9.026   12.017  -19.848 1.00 1.00 ? 34  ILE A HD12 2  
ATOM 2490  H HD13 . ILE A 1 34  ? 7.993   12.106  -21.290 1.00 1.00 ? 34  ILE A HD13 2  
ATOM 2491  N N    . HIS A 1 35  ? 3.001   11.223  -18.244 1.00 1.00 ? 35  HIS A N    2  
ATOM 2492  C CA   . HIS A 1 35  ? 1.806   10.496  -17.811 1.00 1.00 ? 35  HIS A CA   2  
ATOM 2493  C C    . HIS A 1 35  ? 0.885   10.163  -18.996 1.00 1.00 ? 35  HIS A C    2  
ATOM 2494  O O    . HIS A 1 35  ? 0.816   10.930  -19.952 1.00 1.00 ? 35  HIS A O    2  
ATOM 2495  C CB   . HIS A 1 35  ? 1.075   11.392  -16.781 1.00 1.00 ? 35  HIS A CB   2  
ATOM 2496  C CG   . HIS A 1 35  ? 0.841   12.818  -17.249 1.00 1.00 ? 35  HIS A CG   2  
ATOM 2497  N ND1  . HIS A 1 35  ? -0.319  13.336  -17.782 1.00 1.00 ? 35  HIS A ND1  2  
ATOM 2498  C CD2  . HIS A 1 35  ? 1.767   13.829  -17.271 1.00 1.00 ? 35  HIS A CD2  2  
ATOM 2499  C CE1  . HIS A 1 35  ? -0.085  14.617  -18.123 1.00 1.00 ? 35  HIS A CE1  2  
ATOM 2500  N NE2  . HIS A 1 35  ? 1.185   14.962  -17.845 1.00 1.00 ? 35  HIS A NE2  2  
ATOM 2501  H H    . HIS A 1 35  ? 2.879   11.871  -19.028 1.00 1.00 ? 35  HIS A H    2  
ATOM 2502  H HA   . HIS A 1 35  ? 2.094   9.559   -17.330 1.00 1.00 ? 35  HIS A HA   2  
ATOM 2503  H HB2  . HIS A 1 35  ? 0.117   10.936  -16.517 1.00 1.00 ? 35  HIS A HB2  2  
ATOM 2504  H HB3  . HIS A 1 35  ? 1.669   11.431  -15.866 1.00 1.00 ? 35  HIS A HB3  2  
ATOM 2505  H HD1  . HIS A 1 35  ? -1.195  12.846  -17.903 1.00 1.00 ? 35  HIS A HD1  2  
ATOM 2506  H HD2  . HIS A 1 35  ? 2.791   13.749  -16.937 1.00 1.00 ? 35  HIS A HD2  2  
ATOM 2507  H HE1  . HIS A 1 35  ? -0.816  15.278  -18.565 1.00 1.00 ? 35  HIS A HE1  2  
ATOM 2508  N N    . LEU A 1 36  ? 0.145   9.049   -18.930 1.00 1.00 ? 36  LEU A N    2  
ATOM 2509  C CA   . LEU A 1 36  ? -0.921  8.734   -19.889 1.00 1.00 ? 36  LEU A CA   2  
ATOM 2510  C C    . LEU A 1 36  ? -2.226  9.404   -19.413 1.00 1.00 ? 36  LEU A C    2  
ATOM 2511  O O    . LEU A 1 36  ? -2.594  9.272   -18.247 1.00 1.00 ? 36  LEU A O    2  
ATOM 2512  C CB   . LEU A 1 36  ? -1.015  7.196   -20.006 1.00 1.00 ? 36  LEU A CB   2  
ATOM 2513  C CG   . LEU A 1 36  ? -2.086  6.649   -20.971 1.00 1.00 ? 36  LEU A CG   2  
ATOM 2514  C CD1  . LEU A 1 36  ? -1.802  7.070   -22.422 1.00 1.00 ? 36  LEU A CD1  2  
ATOM 2515  C CD2  . LEU A 1 36  ? -2.121  5.115   -20.896 1.00 1.00 ? 36  LEU A CD2  2  
ATOM 2516  H H    . LEU A 1 36  ? 0.209   8.463   -18.107 1.00 1.00 ? 36  LEU A H    2  
ATOM 2517  H HA   . LEU A 1 36  ? -0.657  9.154   -20.863 1.00 1.00 ? 36  LEU A HA   2  
ATOM 2518  H HB2  . LEU A 1 36  ? -0.044  6.822   -20.335 1.00 1.00 ? 36  LEU A HB2  2  
ATOM 2519  H HB3  . LEU A 1 36  ? -1.204  6.786   -19.012 1.00 1.00 ? 36  LEU A HB3  2  
ATOM 2520  H HG   . LEU A 1 36  ? -3.068  7.024   -20.681 1.00 1.00 ? 36  LEU A HG   2  
ATOM 2521  H HD11 . LEU A 1 36  ? -1.895  8.149   -22.519 1.00 1.00 ? 36  LEU A HD11 2  
ATOM 2522  H HD12 . LEU A 1 36  ? -0.795  6.765   -22.711 1.00 1.00 ? 36  LEU A HD12 2  
ATOM 2523  H HD13 . LEU A 1 36  ? -2.526  6.606   -23.091 1.00 1.00 ? 36  LEU A HD13 2  
ATOM 2524  H HD21 . LEU A 1 36  ? -1.155  4.706   -21.188 1.00 1.00 ? 36  LEU A HD21 2  
ATOM 2525  H HD22 . LEU A 1 36  ? -2.354  4.798   -19.879 1.00 1.00 ? 36  LEU A HD22 2  
ATOM 2526  H HD23 . LEU A 1 36  ? -2.889  4.728   -21.567 1.00 1.00 ? 36  LEU A HD23 2  
ATOM 2527  N N    . ALA A 1 37  ? -2.917  10.134  -20.295 1.00 1.00 ? 37  ALA A N    2  
ATOM 2528  C CA   . ALA A 1 37  ? -4.122  10.903  -19.973 1.00 1.00 ? 37  ALA A CA   2  
ATOM 2529  C C    . ALA A 1 37  ? -5.367  10.249  -20.612 1.00 1.00 ? 37  ALA A C    2  
ATOM 2530  O O    . ALA A 1 37  ? -5.402  10.151  -21.843 1.00 1.00 ? 37  ALA A O    2  
ATOM 2531  C CB   . ALA A 1 37  ? -3.915  12.336  -20.487 1.00 1.00 ? 37  ALA A CB   2  
ATOM 2532  H H    . ALA A 1 37  ? -2.566  10.225  -21.247 1.00 1.00 ? 37  ALA A H    2  
ATOM 2533  H HA   . ALA A 1 37  ? -4.249  10.971  -18.892 1.00 1.00 ? 37  ALA A HA   2  
ATOM 2534  H HB1  . ALA A 1 37  ? -3.035  12.774  -20.014 1.00 1.00 ? 37  ALA A HB1  2  
ATOM 2535  H HB2  . ALA A 1 37  ? -3.773  12.336  -21.570 1.00 1.00 ? 37  ALA A HB2  2  
ATOM 2536  H HB3  . ALA A 1 37  ? -4.785  12.949  -20.247 1.00 1.00 ? 37  ALA A HB3  2  
ATOM 2537  N N    . PRO A 1 38  ? -6.378  9.817   -19.822 1.00 1.00 ? 38  PRO A N    2  
ATOM 2538  C CA   . PRO A 1 38  ? -7.673  9.343   -20.326 1.00 1.00 ? 38  PRO A CA   2  
ATOM 2539  C C    . PRO A 1 38  ? -8.439  10.416  -21.136 1.00 1.00 ? 38  PRO A C    2  
ATOM 2540  O O    . PRO A 1 38  ? -8.061  11.593  -21.085 1.00 1.00 ? 38  PRO A O    2  
ATOM 2541  C CB   . PRO A 1 38  ? -8.471  8.916   -19.084 1.00 1.00 ? 38  PRO A CB   2  
ATOM 2542  C CG   . PRO A 1 38  ? -7.404  8.638   -18.031 1.00 1.00 ? 38  PRO A CG   2  
ATOM 2543  C CD   . PRO A 1 38  ? -6.327  9.660   -18.373 1.00 1.00 ? 38  PRO A CD   2  
ATOM 2544  H HA   . PRO A 1 38  ? -7.490  8.471   -20.952 1.00 1.00 ? 38  PRO A HA   2  
ATOM 2545  H HB2  . PRO A 1 38  ? -9.103  9.739   -18.744 1.00 1.00 ? 38  PRO A HB2  2  
ATOM 2546  H HB3  . PRO A 1 38  ? -9.077  8.033   -19.277 1.00 1.00 ? 38  PRO A HB3  2  
ATOM 2547  H HG2  . PRO A 1 38  ? -7.790  8.771   -17.020 1.00 1.00 ? 38  PRO A HG2  2  
ATOM 2548  H HG3  . PRO A 1 38  ? -7.010  7.631   -18.164 1.00 1.00 ? 38  PRO A HG3  2  
ATOM 2549  H HD2  . PRO A 1 38  ? -6.557  10.614  -17.894 1.00 1.00 ? 38  PRO A HD2  2  
ATOM 2550  H HD3  . PRO A 1 38  ? -5.360  9.288   -18.038 1.00 1.00 ? 38  PRO A HD3  2  
ATOM 2551  N N    . PRO A 1 39  ? -9.528  10.044  -21.846 1.00 1.00 ? 39  PRO A N    2  
ATOM 2552  C CA   . PRO A 1 39  ? -10.378 10.977  -22.585 1.00 1.00 ? 39  PRO A CA   2  
ATOM 2553  C C    . PRO A 1 39  ? -10.915 12.113  -21.701 1.00 1.00 ? 39  PRO A C    2  
ATOM 2554  O O    . PRO A 1 39  ? -11.422 11.874  -20.603 1.00 1.00 ? 39  PRO A O    2  
ATOM 2555  C CB   . PRO A 1 39  ? -11.532 10.145  -23.165 1.00 1.00 ? 39  PRO A CB   2  
ATOM 2556  C CG   . PRO A 1 39  ? -10.972 8.727   -23.215 1.00 1.00 ? 39  PRO A CG   2  
ATOM 2557  C CD   . PRO A 1 39  ? -10.020 8.683   -22.021 1.00 1.00 ? 39  PRO A CD   2  
ATOM 2558  H HA   . PRO A 1 39  ? -9.793  11.390  -23.409 1.00 1.00 ? 39  PRO A HA   2  
ATOM 2559  H HB2  . PRO A 1 39  ? -12.387 10.166  -22.489 1.00 1.00 ? 39  PRO A HB2  2  
ATOM 2560  H HB3  . PRO A 1 39  ? -11.825 10.495  -24.153 1.00 1.00 ? 39  PRO A HB3  2  
ATOM 2561  H HG2  . PRO A 1 39  ? -11.758 7.977   -23.132 1.00 1.00 ? 39  PRO A HG2  2  
ATOM 2562  H HG3  . PRO A 1 39  ? -10.413 8.587   -24.140 1.00 1.00 ? 39  PRO A HG3  2  
ATOM 2563  H HD2  . PRO A 1 39  ? -10.575 8.381   -21.130 1.00 1.00 ? 39  PRO A HD2  2  
ATOM 2564  H HD3  . PRO A 1 39  ? -9.211  7.981   -22.221 1.00 1.00 ? 39  PRO A HD3  2  
ATOM 2565  N N    . SER A 1 40  ? -10.832 13.352  -22.191 1.00 1.00 ? 40  SER A N    2  
ATOM 2566  C CA   . SER A 1 40  ? -11.336 14.548  -21.488 1.00 1.00 ? 40  SER A CA   2  
ATOM 2567  C C    . SER A 1 40  ? -12.844 14.794  -21.697 1.00 1.00 ? 40  SER A C    2  
ATOM 2568  O O    . SER A 1 40  ? -13.479 15.481  -20.892 1.00 1.00 ? 40  SER A O    2  
ATOM 2569  C CB   . SER A 1 40  ? -10.534 15.775  -21.951 1.00 1.00 ? 40  SER A CB   2  
ATOM 2570  O OG   . SER A 1 40  ? -10.576 15.929  -23.371 1.00 1.00 ? 40  SER A OG   2  
ATOM 2571  H H    . SER A 1 40  ? -10.376 13.513  -23.080 1.00 1.00 ? 40  SER A H    2  
ATOM 2572  H HA   . SER A 1 40  ? -11.178 14.431  -20.415 1.00 1.00 ? 40  SER A HA   2  
ATOM 2573  H HB2  . SER A 1 40  ? -10.936 16.668  -21.472 1.00 1.00 ? 40  SER A HB2  2  
ATOM 2574  H HB3  . SER A 1 40  ? -9.497  15.654  -21.636 1.00 1.00 ? 40  SER A HB3  2  
ATOM 2575  H HG   . SER A 1 40  ? -10.052 16.719  -23.626 1.00 1.00 ? 40  SER A HG   2  
ATOM 2576  N N    . GLU A 1 41  ? -13.420 14.220  -22.761 1.00 1.00 ? 41  GLU A N    2  
ATOM 2577  C CA   . GLU A 1 41  ? -14.820 14.331  -23.191 1.00 1.00 ? 41  GLU A CA   2  
ATOM 2578  C C    . GLU A 1 41  ? -15.074 13.377  -24.373 1.00 1.00 ? 41  GLU A C    2  
ATOM 2579  O O    . GLU A 1 41  ? -14.137 12.962  -25.063 1.00 1.00 ? 41  GLU A O    2  
ATOM 2580  C CB   . GLU A 1 41  ? -15.187 15.786  -23.567 1.00 1.00 ? 41  GLU A CB   2  
ATOM 2581  C CG   . GLU A 1 41  ? -16.412 16.317  -22.811 1.00 1.00 ? 41  GLU A CG   2  
ATOM 2582  C CD   . GLU A 1 41  ? -17.724 15.676  -23.291 1.00 1.00 ? 41  GLU A CD   2  
ATOM 2583  O OE1  . GLU A 1 41  ? -18.064 14.561  -22.830 1.00 1.00 ? 41  GLU A OE1  2  
ATOM 2584  O OE2  . GLU A 1 41  ? -18.429 16.292  -24.126 1.00 1.00 ? 41  GLU A OE2  2  
ATOM 2585  H H    . GLU A 1 41  ? -12.821 13.669  -23.358 1.00 1.00 ? 41  GLU A H    2  
ATOM 2586  H HA   . GLU A 1 41  ? -15.449 14.012  -22.359 1.00 1.00 ? 41  GLU A HA   2  
ATOM 2587  H HB2  . GLU A 1 41  ? -14.349 16.449  -23.348 1.00 1.00 ? 41  GLU A HB2  2  
ATOM 2588  H HB3  . GLU A 1 41  ? -15.374 15.860  -24.640 1.00 1.00 ? 41  GLU A HB3  2  
ATOM 2589  H HG2  . GLU A 1 41  ? -16.280 16.146  -21.739 1.00 1.00 ? 41  GLU A HG2  2  
ATOM 2590  H HG3  . GLU A 1 41  ? -16.462 17.399  -22.963 1.00 1.00 ? 41  GLU A HG3  2  
ATOM 2591  N N    . TYR A 1 42  ? -16.337 13.025  -24.630 1.00 1.00 ? 42  TYR A N    2  
ATOM 2592  C CA   . TYR A 1 42  ? -16.712 12.142  -25.739 1.00 1.00 ? 42  TYR A CA   2  
ATOM 2593  C C    . TYR A 1 42  ? -16.387 12.772  -27.127 1.00 1.00 ? 42  TYR A C    2  
ATOM 2594  O O    . TYR A 1 42  ? -16.614 13.980  -27.295 1.00 1.00 ? 42  TYR A O    2  
ATOM 2595  C CB   . TYR A 1 42  ? -18.195 11.768  -25.616 1.00 1.00 ? 42  TYR A CB   2  
ATOM 2596  C CG   . TYR A 1 42  ? -18.601 10.605  -26.498 1.00 1.00 ? 42  TYR A CG   2  
ATOM 2597  C CD1  . TYR A 1 42  ? -18.261 9.289   -26.129 1.00 1.00 ? 42  TYR A CD1  2  
ATOM 2598  C CD2  . TYR A 1 42  ? -19.307 10.833  -27.693 1.00 1.00 ? 42  TYR A CD2  2  
ATOM 2599  C CE1  . TYR A 1 42  ? -18.628 8.203   -26.947 1.00 1.00 ? 42  TYR A CE1  2  
ATOM 2600  C CE2  . TYR A 1 42  ? -19.673 9.755   -28.519 1.00 1.00 ? 42  TYR A CE2  2  
ATOM 2601  C CZ   . TYR A 1 42  ? -19.338 8.434   -28.148 1.00 1.00 ? 42  TYR A CZ   2  
ATOM 2602  O OH   . TYR A 1 42  ? -19.716 7.390   -28.939 1.00 1.00 ? 42  TYR A OH   2  
ATOM 2603  H H    . TYR A 1 42  ? -17.077 13.412  -24.050 1.00 1.00 ? 42  TYR A H    2  
ATOM 2604  H HA   . TYR A 1 42  ? -16.139 11.227  -25.604 1.00 1.00 ? 42  TYR A HA   2  
ATOM 2605  H HB2  . TYR A 1 42  ? -18.403 11.491  -24.579 1.00 1.00 ? 42  TYR A HB2  2  
ATOM 2606  H HB3  . TYR A 1 42  ? -18.804 12.642  -25.857 1.00 1.00 ? 42  TYR A HB3  2  
ATOM 2607  H HD1  . TYR A 1 42  ? -17.731 9.109   -25.201 1.00 1.00 ? 42  TYR A HD1  2  
ATOM 2608  H HD2  . TYR A 1 42  ? -19.589 11.837  -27.969 1.00 1.00 ? 42  TYR A HD2  2  
ATOM 2609  H HE1  . TYR A 1 42  ? -18.385 7.192   -26.650 1.00 1.00 ? 42  TYR A HE1  2  
ATOM 2610  H HE2  . TYR A 1 42  ? -20.234 9.932   -29.423 1.00 1.00 ? 42  TYR A HE2  2  
ATOM 2611  H HH   . TYR A 1 42  ? -19.446 6.526   -28.591 1.00 1.00 ? 42  TYR A HH   2  
ATOM 2612  N N    . PRO A 1 43  ? -15.869 12.005  -28.117 1.00 1.00 ? 43  PRO A N    2  
ATOM 2613  C CA   . PRO A 1 43  ? -15.409 12.544  -29.402 1.00 1.00 ? 43  PRO A CA   2  
ATOM 2614  C C    . PRO A 1 43  ? -16.483 13.265  -30.235 1.00 1.00 ? 43  PRO A C    2  
ATOM 2615  O O    . PRO A 1 43  ? -16.194 14.317  -30.804 1.00 1.00 ? 43  PRO A O    2  
ATOM 2616  C CB   . PRO A 1 43  ? -14.847 11.346  -30.174 1.00 1.00 ? 43  PRO A CB   2  
ATOM 2617  C CG   . PRO A 1 43  ? -14.383 10.405  -29.072 1.00 1.00 ? 43  PRO A CG   2  
ATOM 2618  C CD   . PRO A 1 43  ? -15.445 10.616  -27.996 1.00 1.00 ? 43  PRO A CD   2  
ATOM 2619  H HA   . PRO A 1 43  ? -14.593 13.240  -29.203 1.00 1.00 ? 43  PRO A HA   2  
ATOM 2620  H HB2  . PRO A 1 43  ? -15.636 10.858  -30.747 1.00 1.00 ? 43  PRO A HB2  2  
ATOM 2621  H HB3  . PRO A 1 43  ? -14.025 11.638  -30.831 1.00 1.00 ? 43  PRO A HB3  2  
ATOM 2622  H HG2  . PRO A 1 43  ? -14.350 9.370   -29.405 1.00 1.00 ? 43  PRO A HG2  2  
ATOM 2623  H HG3  . PRO A 1 43  ? -13.410 10.727  -28.698 1.00 1.00 ? 43  PRO A HG3  2  
ATOM 2624  H HD2  . PRO A 1 43  ? -16.293 9.956   -28.182 1.00 1.00 ? 43  PRO A HD2  2  
ATOM 2625  H HD3  . PRO A 1 43  ? -15.002 10.407  -27.026 1.00 1.00 ? 43  PRO A HD3  2  
ATOM 2626  N N    . GLY A 1 44  ? -17.702 12.709  -30.312 1.00 1.00 ? 44  GLY A N    2  
ATOM 2627  C CA   . GLY A 1 44  ? -18.832 13.292  -31.057 1.00 1.00 ? 44  GLY A CA   2  
ATOM 2628  C C    . GLY A 1 44  ? -19.819 14.058  -30.170 1.00 1.00 ? 44  GLY A C    2  
ATOM 2629  O O    . GLY A 1 44  ? -19.633 14.171  -28.958 1.00 1.00 ? 44  GLY A O    2  
ATOM 2630  H H    . GLY A 1 44  ? -17.868 11.844  -29.813 1.00 1.00 ? 44  GLY A H    2  
ATOM 2631  H HA2  . GLY A 1 44  ? -18.469 13.974  -31.829 1.00 1.00 ? 44  GLY A HA2  2  
ATOM 2632  H HA3  . GLY A 1 44  ? -19.393 12.492  -31.541 1.00 1.00 ? 44  GLY A HA3  2  
ATOM 2633  N N    . ALA A 1 45  ? -20.908 14.551  -30.775 1.00 1.00 ? 45  ALA A N    2  
ATOM 2634  C CA   . ALA A 1 45  ? -22.030 15.144  -30.032 1.00 1.00 ? 45  ALA A CA   2  
ATOM 2635  C C    . ALA A 1 45  ? -22.886 14.084  -29.300 1.00 1.00 ? 45  ALA A C    2  
ATOM 2636  O O    . ALA A 1 45  ? -23.514 14.396  -28.284 1.00 1.00 ? 45  ALA A O    2  
ATOM 2637  C CB   . ALA A 1 45  ? -22.866 15.989  -31.000 1.00 1.00 ? 45  ALA A CB   2  
ATOM 2638  H H    . ALA A 1 45  ? -20.978 14.479  -31.781 1.00 1.00 ? 45  ALA A H    2  
ATOM 2639  H HA   . ALA A 1 45  ? -21.628 15.813  -29.269 1.00 1.00 ? 45  ALA A HA   2  
ATOM 2640  H HB1  . ALA A 1 45  ? -22.237 16.734  -31.489 1.00 1.00 ? 45  ALA A HB1  2  
ATOM 2641  H HB2  . ALA A 1 45  ? -23.329 15.350  -31.748 1.00 1.00 ? 45  ALA A HB2  2  
ATOM 2642  H HB3  . ALA A 1 45  ? -23.653 16.502  -30.447 1.00 1.00 ? 45  ALA A HB3  2  
ATOM 2643  N N    . GLY A 1 46  ? -22.875 12.829  -29.782 1.00 1.00 ? 46  GLY A N    2  
ATOM 2644  C CA   . GLY A 1 46  ? -23.536 11.675  -29.156 1.00 1.00 ? 46  GLY A CA   2  
ATOM 2645  C C    . GLY A 1 46  ? -24.915 11.402  -29.749 1.00 1.00 ? 46  GLY A C    2  
ATOM 2646  O O    . GLY A 1 46  ? -25.118 11.515  -30.955 1.00 1.00 ? 46  GLY A O    2  
ATOM 2647  H H    . GLY A 1 46  ? -22.399 12.674  -30.659 1.00 1.00 ? 46  GLY A H    2  
ATOM 2648  H HA2  . GLY A 1 46  ? -22.936 10.779  -29.315 1.00 1.00 ? 46  GLY A HA2  2  
ATOM 2649  H HA3  . GLY A 1 46  ? -23.640 11.840  -28.084 1.00 1.00 ? 46  GLY A HA3  2  
ATOM 2650  N N    . SER A 1 47  ? -25.868 11.021  -28.902 1.00 1.00 ? 47  SER A N    2  
ATOM 2651  C CA   . SER A 1 47  ? -27.221 10.582  -29.302 1.00 1.00 ? 47  SER A CA   2  
ATOM 2652  C C    . SER A 1 47  ? -28.064 11.663  -30.005 1.00 1.00 ? 47  SER A C    2  
ATOM 2653  O O    . SER A 1 47  ? -29.060 11.345  -30.660 1.00 1.00 ? 47  SER A O    2  
ATOM 2654  C CB   . SER A 1 47  ? -27.979 10.087  -28.057 1.00 1.00 ? 47  SER A CB   2  
ATOM 2655  O OG   . SER A 1 47  ? -27.241 9.086   -27.360 1.00 1.00 ? 47  SER A OG   2  
ATOM 2656  H H    . SER A 1 47  ? -25.620 10.886  -27.929 1.00 1.00 ? 47  SER A H    2  
ATOM 2657  H HA   . SER A 1 47  ? -27.129 9.741   -29.992 1.00 1.00 ? 47  SER A HA   2  
ATOM 2658  H HB2  . SER A 1 47  ? -28.159 10.933  -27.392 1.00 1.00 ? 47  SER A HB2  2  
ATOM 2659  H HB3  . SER A 1 47  ? -28.942 9.674   -28.368 1.00 1.00 ? 47  SER A HB3  2  
ATOM 2660  H HG   . SER A 1 47  ? -27.766 8.771   -26.592 1.00 1.00 ? 47  SER A HG   2  
ATOM 2661  N N    . SER A 1 48  ? -27.678 12.938  -29.906 1.00 1.00 ? 48  SER A N    2  
ATOM 2662  C CA   . SER A 1 48  ? -28.300 14.048  -30.643 1.00 1.00 ? 48  SER A CA   2  
ATOM 2663  C C    . SER A 1 48  ? -27.909 14.081  -32.136 1.00 1.00 ? 48  SER A C    2  
ATOM 2664  O O    . SER A 1 48  ? -28.693 14.553  -32.964 1.00 1.00 ? 48  SER A O    2  
ATOM 2665  C CB   . SER A 1 48  ? -27.920 15.375  -29.969 1.00 1.00 ? 48  SER A CB   2  
ATOM 2666  O OG   . SER A 1 48  ? -26.506 15.513  -29.835 1.00 1.00 ? 48  SER A OG   2  
ATOM 2667  H H    . SER A 1 48  ? -26.867 13.163  -29.341 1.00 1.00 ? 48  SER A H    2  
ATOM 2668  H HA   . SER A 1 48  ? -29.386 13.951  -30.596 1.00 1.00 ? 48  SER A HA   2  
ATOM 2669  H HB2  . SER A 1 48  ? -28.313 16.202  -30.563 1.00 1.00 ? 48  SER A HB2  2  
ATOM 2670  H HB3  . SER A 1 48  ? -28.382 15.408  -28.979 1.00 1.00 ? 48  SER A HB3  2  
ATOM 2671  H HG   . SER A 1 48  ? -26.311 16.350  -29.364 1.00 1.00 ? 48  SER A HG   2  
ATOM 2672  N N    . SER A 1 49  ? -26.729 13.564  -32.503 1.00 1.00 ? 49  SER A N    2  
ATOM 2673  C CA   . SER A 1 49  ? -26.249 13.480  -33.891 1.00 1.00 ? 49  SER A CA   2  
ATOM 2674  C C    . SER A 1 49  ? -26.275 12.045  -34.445 1.00 1.00 ? 49  SER A C    2  
ATOM 2675  O O    . SER A 1 49  ? -26.773 11.825  -35.550 1.00 1.00 ? 49  SER A O    2  
ATOM 2676  C CB   . SER A 1 49  ? -24.817 14.023  -33.973 1.00 1.00 ? 49  SER A CB   2  
ATOM 2677  O OG   . SER A 1 49  ? -23.920 13.251  -33.178 1.00 1.00 ? 49  SER A OG   2  
ATOM 2678  H H    . SER A 1 49  ? -26.109 13.231  -31.772 1.00 1.00 ? 49  SER A H    2  
ATOM 2679  H HA   . SER A 1 49  ? -26.869 14.095  -34.547 1.00 1.00 ? 49  SER A HA   2  
ATOM 2680  H HB2  . SER A 1 49  ? -24.489 14.004  -35.014 1.00 1.00 ? 49  SER A HB2  2  
ATOM 2681  H HB3  . SER A 1 49  ? -24.807 15.058  -33.631 1.00 1.00 ? 49  SER A HB3  2  
ATOM 2682  H HG   . SER A 1 49  ? -23.004 13.431  -33.478 1.00 1.00 ? 49  SER A HG   2  
ATOM 2683  N N    . VAL A 1 50  ? -25.711 11.082  -33.700 1.00 1.00 ? 50  VAL A N    2  
ATOM 2684  C CA   . VAL A 1 50  ? -25.547 9.646   -34.004 1.00 1.00 ? 50  VAL A CA   2  
ATOM 2685  C C    . VAL A 1 50  ? -24.464 9.391   -35.066 1.00 1.00 ? 50  VAL A C    2  
ATOM 2686  O O    . VAL A 1 50  ? -23.602 8.535   -34.877 1.00 1.00 ? 50  VAL A O    2  
ATOM 2687  C CB   . VAL A 1 50  ? -26.860 8.927   -34.363 1.00 1.00 ? 50  VAL A CB   2  
ATOM 2688  C CG1  . VAL A 1 50  ? -26.673 7.404   -34.472 1.00 1.00 ? 50  VAL A CG1  2  
ATOM 2689  C CG2  . VAL A 1 50  ? -27.976 9.201   -33.334 1.00 1.00 ? 50  VAL A CG2  2  
ATOM 2690  H H    . VAL A 1 50  ? -25.292 11.407  -32.827 1.00 1.00 ? 50  VAL A H    2  
ATOM 2691  H HA   . VAL A 1 50  ? -25.229 9.174   -33.094 1.00 1.00 ? 50  VAL A HA   2  
ATOM 2692  H HB   . VAL A 1 50  ? -27.165 9.289   -35.327 1.00 1.00 ? 50  VAL A HB   2  
ATOM 2693  H HG11 . VAL A 1 50  ? -26.289 7.003   -33.531 1.00 1.00 ? 50  VAL A HG11 2  
ATOM 2694  H HG12 . VAL A 1 50  ? -27.626 6.926   -34.697 1.00 1.00 ? 50  VAL A HG12 2  
ATOM 2695  H HG13 . VAL A 1 50  ? -25.976 7.162   -35.276 1.00 1.00 ? 50  VAL A HG13 2  
ATOM 2696  H HG21 . VAL A 1 50  ? -28.875 8.647   -33.608 1.00 1.00 ? 50  VAL A HG21 2  
ATOM 2697  H HG22 . VAL A 1 50  ? -27.655 8.890   -32.339 1.00 1.00 ? 50  VAL A HG22 2  
ATOM 2698  H HG23 . VAL A 1 50  ? -28.225 10.263  -33.314 1.00 1.00 ? 50  VAL A HG23 2  
ATOM 2699  N N    . PHE A 1 51  ? -24.482 10.152  -36.164 1.00 1.00 ? 51  PHE A N    2  
ATOM 2700  C CA   . PHE A 1 51  ? -23.603 9.974   -37.322 1.00 1.00 ? 51  PHE A CA   2  
ATOM 2701  C C    . PHE A 1 51  ? -22.145 10.396  -37.062 1.00 1.00 ? 51  PHE A C    2  
ATOM 2702  O O    . PHE A 1 51  ? -21.217 9.750   -37.547 1.00 1.00 ? 51  PHE A O    2  
ATOM 2703  C CB   . PHE A 1 51  ? -24.208 10.765  -38.492 1.00 1.00 ? 51  PHE A CB   2  
ATOM 2704  C CG   . PHE A 1 51  ? -23.452 10.620  -39.799 1.00 1.00 ? 51  PHE A CG   2  
ATOM 2705  C CD1  . PHE A 1 51  ? -23.623 9.464   -40.584 1.00 1.00 ? 51  PHE A CD1  2  
ATOM 2706  C CD2  . PHE A 1 51  ? -22.577 11.636  -40.233 1.00 1.00 ? 51  PHE A CD2  2  
ATOM 2707  C CE1  . PHE A 1 51  ? -22.925 9.323   -41.797 1.00 1.00 ? 51  PHE A CE1  2  
ATOM 2708  C CE2  . PHE A 1 51  ? -21.880 11.496  -41.446 1.00 1.00 ? 51  PHE A CE2  2  
ATOM 2709  C CZ   . PHE A 1 51  ? -22.055 10.341  -42.229 1.00 1.00 ? 51  PHE A CZ   2  
ATOM 2710  H H    . PHE A 1 51  ? -25.241 10.823  -36.238 1.00 1.00 ? 51  PHE A H    2  
ATOM 2711  H HA   . PHE A 1 51  ? -23.592 8.916   -37.592 1.00 1.00 ? 51  PHE A HA   2  
ATOM 2712  H HB2  . PHE A 1 51  ? -25.235 10.431  -38.654 1.00 1.00 ? 51  PHE A HB2  2  
ATOM 2713  H HB3  . PHE A 1 51  ? -24.256 11.822  -38.222 1.00 1.00 ? 51  PHE A HB3  2  
ATOM 2714  H HD1  . PHE A 1 51  ? -24.294 8.680   -40.256 1.00 1.00 ? 51  PHE A HD1  2  
ATOM 2715  H HD2  . PHE A 1 51  ? -22.437 12.526  -39.636 1.00 1.00 ? 51  PHE A HD2  2  
ATOM 2716  H HE1  . PHE A 1 51  ? -23.056 8.433   -42.397 1.00 1.00 ? 51  PHE A HE1  2  
ATOM 2717  H HE2  . PHE A 1 51  ? -21.214 12.282  -41.778 1.00 1.00 ? 51  PHE A HE2  2  
ATOM 2718  H HZ   . PHE A 1 51  ? -21.518 10.237  -43.164 1.00 1.00 ? 51  PHE A HZ   2  
ATOM 2719  N N    . SER A 1 52  ? -21.918 11.458  -36.282 1.00 1.00 ? 52  SER A N    2  
ATOM 2720  C CA   . SER A 1 52  ? -20.591 12.082  -36.115 1.00 1.00 ? 52  SER A CA   2  
ATOM 2721  C C    . SER A 1 52  ? -19.723 11.454  -35.003 1.00 1.00 ? 52  SER A C    2  
ATOM 2722  O O    . SER A 1 52  ? -18.599 11.907  -34.766 1.00 1.00 ? 52  SER A O    2  
ATOM 2723  C CB   . SER A 1 52  ? -20.771 13.589  -35.885 1.00 1.00 ? 52  SER A CB   2  
ATOM 2724  O OG   . SER A 1 52  ? -21.535 13.864  -34.714 1.00 1.00 ? 52  SER A OG   2  
ATOM 2725  H H    . SER A 1 52  ? -22.709 11.959  -35.896 1.00 1.00 ? 52  SER A H    2  
ATOM 2726  H HA   . SER A 1 52  ? -20.029 11.970  -37.044 1.00 1.00 ? 52  SER A HA   2  
ATOM 2727  H HB2  . SER A 1 52  ? -19.791 14.060  -35.798 1.00 1.00 ? 52  SER A HB2  2  
ATOM 2728  H HB3  . SER A 1 52  ? -21.277 14.019  -36.751 1.00 1.00 ? 52  SER A HB3  2  
ATOM 2729  H HG   . SER A 1 52  ? -21.590 14.836  -34.603 1.00 1.00 ? 52  SER A HG   2  
ATOM 2730  N N    . VAL A 1 53  ? -20.221 10.415  -34.318 1.00 1.00 ? 53  VAL A N    2  
ATOM 2731  C CA   . VAL A 1 53  ? -19.513 9.733   -33.214 1.00 1.00 ? 53  VAL A CA   2  
ATOM 2732  C C    . VAL A 1 53  ? -18.278 8.960   -33.709 1.00 1.00 ? 53  VAL A C    2  
ATOM 2733  O O    . VAL A 1 53  ? -18.281 8.422   -34.817 1.00 1.00 ? 53  VAL A O    2  
ATOM 2734  C CB   . VAL A 1 53  ? -20.433 8.823   -32.368 1.00 1.00 ? 53  VAL A CB   2  
ATOM 2735  C CG1  . VAL A 1 53  ? -21.676 9.591   -31.881 1.00 1.00 ? 53  VAL A CG1  2  
ATOM 2736  C CG2  . VAL A 1 53  ? -20.851 7.528   -33.084 1.00 1.00 ? 53  VAL A CG2  2  
ATOM 2737  H H    . VAL A 1 53  ? -21.125 10.070  -34.615 1.00 1.00 ? 53  VAL A H    2  
ATOM 2738  H HA   . VAL A 1 53  ? -19.158 10.518  -32.545 1.00 1.00 ? 53  VAL A HA   2  
ATOM 2739  H HB   . VAL A 1 53  ? -19.866 8.535   -31.484 1.00 1.00 ? 53  VAL A HB   2  
ATOM 2740  H HG11 . VAL A 1 53  ? -21.373 10.529  -31.415 1.00 1.00 ? 53  VAL A HG11 2  
ATOM 2741  H HG12 . VAL A 1 53  ? -22.346 9.810   -32.712 1.00 1.00 ? 53  VAL A HG12 2  
ATOM 2742  H HG13 . VAL A 1 53  ? -22.213 8.992   -31.146 1.00 1.00 ? 53  VAL A HG13 2  
ATOM 2743  H HG21 . VAL A 1 53  ? -19.985 6.878   -33.216 1.00 1.00 ? 53  VAL A HG21 2  
ATOM 2744  H HG22 . VAL A 1 53  ? -21.588 6.990   -32.485 1.00 1.00 ? 53  VAL A HG22 2  
ATOM 2745  H HG23 . VAL A 1 53  ? -21.274 7.751   -34.061 1.00 1.00 ? 53  VAL A HG23 2  
ATOM 2746  N N    . LEU A 1 54  ? -17.237 8.892   -32.868 1.00 1.00 ? 54  LEU A N    2  
ATOM 2747  C CA   . LEU A 1 54  ? -15.958 8.214   -33.140 1.00 1.00 ? 54  LEU A CA   2  
ATOM 2748  C C    . LEU A 1 54  ? -15.461 7.456   -31.894 1.00 1.00 ? 54  LEU A C    2  
ATOM 2749  O O    . LEU A 1 54  ? -15.950 7.663   -30.781 1.00 1.00 ? 54  LEU A O    2  
ATOM 2750  C CB   . LEU A 1 54  ? -14.909 9.258   -33.590 1.00 1.00 ? 54  LEU A CB   2  
ATOM 2751  C CG   . LEU A 1 54  ? -15.181 9.952   -34.942 1.00 1.00 ? 54  LEU A CG   2  
ATOM 2752  C CD1  . LEU A 1 54  ? -14.167 11.086  -35.145 1.00 1.00 ? 54  LEU A CD1  2  
ATOM 2753  C CD2  . LEU A 1 54  ? -15.084 8.975   -36.124 1.00 1.00 ? 54  LEU A CD2  2  
ATOM 2754  H H    . LEU A 1 54  ? -17.333 9.326   -31.960 1.00 1.00 ? 54  LEU A H    2  
ATOM 2755  H HA   . LEU A 1 54  ? -16.094 7.469   -33.927 1.00 1.00 ? 54  LEU A HA   2  
ATOM 2756  H HB2  . LEU A 1 54  ? -14.838 10.027  -32.818 1.00 1.00 ? 54  LEU A HB2  2  
ATOM 2757  H HB3  . LEU A 1 54  ? -13.929 8.779   -33.650 1.00 1.00 ? 54  LEU A HB3  2  
ATOM 2758  H HG   . LEU A 1 54  ? -16.177 10.394  -34.929 1.00 1.00 ? 54  LEU A HG   2  
ATOM 2759  H HD11 . LEU A 1 54  ? -13.152 10.687  -35.168 1.00 1.00 ? 54  LEU A HD11 2  
ATOM 2760  H HD12 . LEU A 1 54  ? -14.371 11.600  -36.085 1.00 1.00 ? 54  LEU A HD12 2  
ATOM 2761  H HD13 . LEU A 1 54  ? -14.248 11.803  -34.326 1.00 1.00 ? 54  LEU A HD13 2  
ATOM 2762  H HD21 . LEU A 1 54  ? -15.839 8.195   -36.036 1.00 1.00 ? 54  LEU A HD21 2  
ATOM 2763  H HD22 . LEU A 1 54  ? -15.251 9.510   -37.059 1.00 1.00 ? 54  LEU A HD22 2  
ATOM 2764  H HD23 . LEU A 1 54  ? -14.096 8.516   -36.149 1.00 1.00 ? 54  LEU A HD23 2  
ATOM 2765  N N    . SER A 1 55  ? -14.471 6.580   -32.074 1.00 1.00 ? 55  SER A N    2  
ATOM 2766  C CA   . SER A 1 55  ? -13.841 5.817   -30.982 1.00 1.00 ? 55  SER A CA   2  
ATOM 2767  C C    . SER A 1 55  ? -13.005 6.700   -30.032 1.00 1.00 ? 55  SER A C    2  
ATOM 2768  O O    . SER A 1 55  ? -12.392 7.688   -30.447 1.00 1.00 ? 55  SER A O    2  
ATOM 2769  C CB   . SER A 1 55  ? -12.950 4.700   -31.548 1.00 1.00 ? 55  SER A CB   2  
ATOM 2770  O OG   . SER A 1 55  ? -13.687 3.835   -32.412 1.00 1.00 ? 55  SER A OG   2  
ATOM 2771  H H    . SER A 1 55  ? -14.130 6.419   -33.010 1.00 1.00 ? 55  SER A H    2  
ATOM 2772  H HA   . SER A 1 55  ? -14.627 5.341   -30.394 1.00 1.00 ? 55  SER A HA   2  
ATOM 2773  H HB2  . SER A 1 55  ? -12.121 5.149   -32.099 1.00 1.00 ? 55  SER A HB2  2  
ATOM 2774  H HB3  . SER A 1 55  ? -12.542 4.121   -30.715 1.00 1.00 ? 55  SER A HB3  2  
ATOM 2775  H HG   . SER A 1 55  ? -13.098 3.120   -32.743 1.00 1.00 ? 55  SER A HG   2  
ATOM 2776  N N    . ASN A 1 56  ? -12.950 6.324   -28.746 1.00 1.00 ? 56  ASN A N    2  
ATOM 2777  C CA   . ASN A 1 56  ? -12.205 7.053   -27.708 1.00 1.00 ? 56  ASN A CA   2  
ATOM 2778  C C    . ASN A 1 56  ? -10.703 6.684   -27.701 1.00 1.00 ? 56  ASN A C    2  
ATOM 2779  O O    . ASN A 1 56  ? -10.306 5.610   -28.158 1.00 1.00 ? 56  ASN A O    2  
ATOM 2780  C CB   . ASN A 1 56  ? -12.857 6.792   -26.335 1.00 1.00 ? 56  ASN A CB   2  
ATOM 2781  C CG   . ASN A 1 56  ? -14.128 7.614   -26.119 1.00 1.00 ? 56  ASN A CG   2  
ATOM 2782  O OD1  . ASN A 1 56  ? -14.131 8.593   -25.384 1.00 1.00 ? 56  ASN A OD1  2  
ATOM 2783  N ND2  . ASN A 1 56  ? -15.232 7.263   -26.752 1.00 1.00 ? 56  ASN A ND2  2  
ATOM 2784  H H    . ASN A 1 56  ? -13.388 5.451   -28.477 1.00 1.00 ? 56  ASN A H    2  
ATOM 2785  H HA   . ASN A 1 56  ? -12.270 8.125   -27.911 1.00 1.00 ? 56  ASN A HA   2  
ATOM 2786  H HB2  . ASN A 1 56  ? -13.084 5.731   -26.227 1.00 1.00 ? 56  ASN A HB2  2  
ATOM 2787  H HB3  . ASN A 1 56  ? -12.154 7.060   -25.545 1.00 1.00 ? 56  ASN A HB3  2  
ATOM 2788  H HD21 . ASN A 1 56  ? -15.242 6.462   -27.365 1.00 1.00 ? 56  ASN A HD21 2  
ATOM 2789  H HD22 . ASN A 1 56  ? -16.069 7.807   -26.600 1.00 1.00 ? 56  ASN A HD22 2  
ATOM 2790  N N    . SER A 1 57  ? -9.860  7.540   -27.118 1.00 1.00 ? 57  SER A N    2  
ATOM 2791  C CA   . SER A 1 57  ? -8.404  7.342   -27.032 1.00 1.00 ? 57  SER A CA   2  
ATOM 2792  C C    . SER A 1 57  ? -7.757  8.157   -25.893 1.00 1.00 ? 57  SER A C    2  
ATOM 2793  O O    . SER A 1 57  ? -8.243  9.223   -25.503 1.00 1.00 ? 57  SER A O    2  
ATOM 2794  C CB   . SER A 1 57  ? -7.731  7.661   -28.384 1.00 1.00 ? 57  SER A CB   2  
ATOM 2795  O OG   . SER A 1 57  ? -8.042  8.975   -28.843 1.00 1.00 ? 57  SER A OG   2  
ATOM 2796  H H    . SER A 1 57  ? -10.211 8.433   -26.791 1.00 1.00 ? 57  SER A H    2  
ATOM 2797  H HA   . SER A 1 57  ? -8.209  6.288   -26.819 1.00 1.00 ? 57  SER A HA   2  
ATOM 2798  H HB2  . SER A 1 57  ? -6.647  7.558   -28.280 1.00 1.00 ? 57  SER A HB2  2  
ATOM 2799  H HB3  . SER A 1 57  ? -8.072  6.938   -29.126 1.00 1.00 ? 57  SER A HB3  2  
ATOM 2800  H HG   . SER A 1 57  ? -7.765  9.076   -29.778 1.00 1.00 ? 57  SER A HG   2  
ATOM 2801  N N    . ALA A 1 58  ? -6.651  7.634   -25.354 1.00 1.00 ? 58  ALA A N    2  
ATOM 2802  C CA   . ALA A 1 58  ? -5.780  8.304   -24.383 1.00 1.00 ? 58  ALA A CA   2  
ATOM 2803  C C    . ALA A 1 58  ? -4.543  8.882   -25.094 1.00 1.00 ? 58  ALA A C    2  
ATOM 2804  O O    . ALA A 1 58  ? -4.201  8.441   -26.191 1.00 1.00 ? 58  ALA A O    2  
ATOM 2805  C CB   . ALA A 1 58  ? -5.415  7.269   -23.306 1.00 1.00 ? 58  ALA A CB   2  
ATOM 2806  H H    . ALA A 1 58  ? -6.281  6.783   -25.768 1.00 1.00 ? 58  ALA A H    2  
ATOM 2807  H HA   . ALA A 1 58  ? -6.298  9.134   -23.900 1.00 1.00 ? 58  ALA A HA   2  
ATOM 2808  H HB1  . ALA A 1 58  ? -4.745  7.714   -22.568 1.00 1.00 ? 58  ALA A HB1  2  
ATOM 2809  H HB2  . ALA A 1 58  ? -6.319  6.933   -22.795 1.00 1.00 ? 58  ALA A HB2  2  
ATOM 2810  H HB3  . ALA A 1 58  ? -4.924  6.406   -23.757 1.00 1.00 ? 58  ALA A HB3  2  
ATOM 2811  N N    . GLU A 1 59  ? -3.843  9.837   -24.479 1.00 1.00 ? 59  GLU A N    2  
ATOM 2812  C CA   . GLU A 1 59  ? -2.596  10.399  -25.022 1.00 1.00 ? 59  GLU A CA   2  
ATOM 2813  C C    . GLU A 1 59  ? -1.513  10.452  -23.949 1.00 1.00 ? 59  GLU A C    2  
ATOM 2814  O O    . GLU A 1 59  ? -1.811  10.781  -22.803 1.00 1.00 ? 59  GLU A O    2  
ATOM 2815  C CB   . GLU A 1 59  ? -2.842  11.802  -25.602 1.00 1.00 ? 59  GLU A CB   2  
ATOM 2816  C CG   . GLU A 1 59  ? -1.684  12.242  -26.509 1.00 1.00 ? 59  GLU A CG   2  
ATOM 2817  C CD   . GLU A 1 59  ? -1.966  13.597  -27.167 1.00 1.00 ? 59  GLU A CD   2  
ATOM 2818  O OE1  . GLU A 1 59  ? -1.664  14.642  -26.544 1.00 1.00 ? 59  GLU A OE1  2  
ATOM 2819  O OE2  . GLU A 1 59  ? -2.503  13.617  -28.299 1.00 1.00 ? 59  GLU A OE2  2  
ATOM 2820  H H    . GLU A 1 59  ? -4.159  10.160  -23.567 1.00 1.00 ? 59  GLU A H    2  
ATOM 2821  H HA   . GLU A 1 59  ? -2.236  9.757   -25.824 1.00 1.00 ? 59  GLU A HA   2  
ATOM 2822  H HB2  . GLU A 1 59  ? -3.758  11.784  -26.196 1.00 1.00 ? 59  GLU A HB2  2  
ATOM 2823  H HB3  . GLU A 1 59  ? -2.964  12.520  -24.785 1.00 1.00 ? 59  GLU A HB3  2  
ATOM 2824  H HG2  . GLU A 1 59  ? -0.766  12.312  -25.928 1.00 1.00 ? 59  GLU A HG2  2  
ATOM 2825  H HG3  . GLU A 1 59  ? -1.534  11.494  -27.288 1.00 1.00 ? 59  GLU A HG3  2  
ATOM 2826  N N    . VAL A 1 60  ? -0.262  10.155  -24.305 1.00 1.00 ? 60  VAL A N    2  
ATOM 2827  C CA   . VAL A 1 60  ? 0.880   10.379  -23.407 1.00 1.00 ? 60  VAL A CA   2  
ATOM 2828  C C    . VAL A 1 60  ? 1.237   11.868  -23.427 1.00 1.00 ? 60  VAL A C    2  
ATOM 2829  O O    . VAL A 1 60  ? 1.451   12.444  -24.491 1.00 1.00 ? 60  VAL A O    2  
ATOM 2830  C CB   . VAL A 1 60  ? 2.115   9.547   -23.797 1.00 1.00 ? 60  VAL A CB   2  
ATOM 2831  C CG1  . VAL A 1 60  ? 3.244   9.723   -22.766 1.00 1.00 ? 60  VAL A CG1  2  
ATOM 2832  C CG2  . VAL A 1 60  ? 1.788   8.048   -23.898 1.00 1.00 ? 60  VAL A CG2  2  
ATOM 2833  H H    . VAL A 1 60  ? -0.082  9.878   -25.277 1.00 1.00 ? 60  VAL A H    2  
ATOM 2834  H HA   . VAL A 1 60  ? 0.589   10.090  -22.398 1.00 1.00 ? 60  VAL A HA   2  
ATOM 2835  H HB   . VAL A 1 60  ? 2.450   9.898   -24.767 1.00 1.00 ? 60  VAL A HB   2  
ATOM 2836  H HG11 . VAL A 1 60  ? 3.545   10.763  -22.687 1.00 1.00 ? 60  VAL A HG11 2  
ATOM 2837  H HG12 . VAL A 1 60  ? 2.899   9.398   -21.783 1.00 1.00 ? 60  VAL A HG12 2  
ATOM 2838  H HG13 . VAL A 1 60  ? 4.118   9.143   -23.063 1.00 1.00 ? 60  VAL A HG13 2  
ATOM 2839  H HG21 . VAL A 1 60  ? 1.442   7.676   -22.932 1.00 1.00 ? 60  VAL A HG21 2  
ATOM 2840  H HG22 . VAL A 1 60  ? 1.019   7.878   -24.649 1.00 1.00 ? 60  VAL A HG22 2  
ATOM 2841  H HG23 . VAL A 1 60  ? 2.680   7.496   -24.195 1.00 1.00 ? 60  VAL A HG23 2  
ATOM 2842  N N    . LYS A 1 61  ? 1.308   12.486  -22.249 1.00 1.00 ? 61  LYS A N    2  
ATOM 2843  C CA   . LYS A 1 61  ? 1.526   13.923  -22.056 1.00 1.00 ? 61  LYS A CA   2  
ATOM 2844  C C    . LYS A 1 61  ? 2.613   14.206  -20.997 1.00 1.00 ? 61  LYS A C    2  
ATOM 2845  O O    . LYS A 1 61  ? 3.001   13.324  -20.228 1.00 1.00 ? 61  LYS A O    2  
ATOM 2846  C CB   . LYS A 1 61  ? 0.171   14.560  -21.682 1.00 1.00 ? 61  LYS A CB   2  
ATOM 2847  C CG   . LYS A 1 61  ? -0.817  14.610  -22.867 1.00 1.00 ? 61  LYS A CG   2  
ATOM 2848  C CD   . LYS A 1 61  ? -2.145  15.246  -22.425 1.00 1.00 ? 61  LYS A CD   2  
ATOM 2849  C CE   . LYS A 1 61  ? -3.212  15.404  -23.526 1.00 1.00 ? 61  LYS A CE   2  
ATOM 2850  N NZ   . LYS A 1 61  ? -2.782  16.297  -24.640 1.00 1.00 ? 61  LYS A NZ   2  
ATOM 2851  H H    . LYS A 1 61  ? 1.113   11.932  -21.415 1.00 1.00 ? 61  LYS A H    2  
ATOM 2852  H HA   . LYS A 1 61  ? 1.873   14.372  -22.990 1.00 1.00 ? 61  LYS A HA   2  
ATOM 2853  H HB2  . LYS A 1 61  ? -0.277  13.984  -20.867 1.00 1.00 ? 61  LYS A HB2  2  
ATOM 2854  H HB3  . LYS A 1 61  ? 0.332   15.582  -21.326 1.00 1.00 ? 61  LYS A HB3  2  
ATOM 2855  H HG2  . LYS A 1 61  ? -0.377  15.196  -23.674 1.00 1.00 ? 61  LYS A HG2  2  
ATOM 2856  H HG3  . LYS A 1 61  ? -1.019  13.600  -23.227 1.00 1.00 ? 61  LYS A HG3  2  
ATOM 2857  H HD2  . LYS A 1 61  ? -2.578  14.609  -21.657 1.00 1.00 ? 61  LYS A HD2  2  
ATOM 2858  H HD3  . LYS A 1 61  ? -1.945  16.225  -21.981 1.00 1.00 ? 61  LYS A HD3  2  
ATOM 2859  H HE2  . LYS A 1 61  ? -3.481  14.420  -23.920 1.00 1.00 ? 61  LYS A HE2  2  
ATOM 2860  H HE3  . LYS A 1 61  ? -4.113  15.819  -23.059 1.00 1.00 ? 61  LYS A HE3  2  
ATOM 2861  H HZ1  . LYS A 1 61  ? -2.366  17.155  -24.297 1.00 1.00 ? 61  LYS A HZ1  2  
ATOM 2862  H HZ2  . LYS A 1 61  ? -2.120  15.818  -25.258 1.00 1.00 ? 61  LYS A HZ2  2  
ATOM 2863  H HZ3  . LYS A 1 61  ? -3.569  16.551  -25.224 1.00 1.00 ? 61  LYS A HZ3  2  
ATOM 2864  N N    . ARG A 1 62  ? 3.131   15.440  -20.990 1.00 1.00 ? 62  ARG A N    2  
ATOM 2865  C CA   . ARG A 1 62  ? 4.091   15.977  -20.006 1.00 1.00 ? 62  ARG A CA   2  
ATOM 2866  C C    . ARG A 1 62  ? 3.506   17.218  -19.308 1.00 1.00 ? 62  ARG A C    2  
ATOM 2867  O O    . ARG A 1 62  ? 2.980   18.091  -19.991 1.00 1.00 ? 62  ARG A O    2  
ATOM 2868  C CB   . ARG A 1 62  ? 5.391   16.346  -20.751 1.00 1.00 ? 62  ARG A CB   2  
ATOM 2869  C CG   . ARG A 1 62  ? 6.527   16.837  -19.831 1.00 1.00 ? 62  ARG A CG   2  
ATOM 2870  C CD   . ARG A 1 62  ? 7.814   17.158  -20.612 1.00 1.00 ? 62  ARG A CD   2  
ATOM 2871  N NE   . ARG A 1 62  ? 7.623   18.282  -21.552 1.00 1.00 ? 62  ARG A NE   2  
ATOM 2872  C CZ   . ARG A 1 62  ? 7.783   19.583  -21.315 1.00 1.00 ? 62  ARG A CZ   2  
ATOM 2873  N NH1  . ARG A 1 62  ? 8.159   20.052  -20.143 1.00 1.00 ? 62  ARG A NH1  2  
ATOM 2874  N NH2  . ARG A 1 62  ? 7.566   20.448  -22.282 1.00 1.00 ? 62  ARG A NH2  2  
ATOM 2875  H H    . ARG A 1 62  ? 2.806   16.080  -21.706 1.00 1.00 ? 62  ARG A H    2  
ATOM 2876  H HA   . ARG A 1 62  ? 4.312   15.217  -19.259 1.00 1.00 ? 62  ARG A HA   2  
ATOM 2877  H HB2  . ARG A 1 62  ? 5.739   15.467  -21.293 1.00 1.00 ? 62  ARG A HB2  2  
ATOM 2878  H HB3  . ARG A 1 62  ? 5.169   17.123  -21.485 1.00 1.00 ? 62  ARG A HB3  2  
ATOM 2879  H HG2  . ARG A 1 62  ? 6.209   17.735  -19.301 1.00 1.00 ? 62  ARG A HG2  2  
ATOM 2880  H HG3  . ARG A 1 62  ? 6.747   16.061  -19.095 1.00 1.00 ? 62  ARG A HG3  2  
ATOM 2881  H HD2  . ARG A 1 62  ? 8.618   17.390  -19.916 1.00 1.00 ? 62  ARG A HD2  2  
ATOM 2882  H HD3  . ARG A 1 62  ? 8.120   16.270  -21.171 1.00 1.00 ? 62  ARG A HD3  2  
ATOM 2883  H HE   . ARG A 1 62  ? 7.381   18.029  -22.503 1.00 1.00 ? 62  ARG A HE   2  
ATOM 2884  H HH11 . ARG A 1 62  ? 8.364   19.430  -19.380 1.00 1.00 ? 62  ARG A HH11 2  
ATOM 2885  H HH12 . ARG A 1 62  ? 8.290   21.046  -20.009 1.00 1.00 ? 62  ARG A HH12 2  
ATOM 2886  H HH21 . ARG A 1 62  ? 7.288   20.136  -23.200 1.00 1.00 ? 62  ARG A HH21 2  
ATOM 2887  H HH22 . ARG A 1 62  ? 7.682   21.439  -22.122 1.00 1.00 ? 62  ARG A HH22 2  
ATOM 2888  N N    . GLU A 1 63  ? 3.680   17.345  -17.988 1.00 1.00 ? 63  GLU A N    2  
ATOM 2889  C CA   . GLU A 1 63  ? 3.340   18.542  -17.201 1.00 1.00 ? 63  GLU A CA   2  
ATOM 2890  C C    . GLU A 1 63  ? 4.031   18.512  -15.826 1.00 1.00 ? 63  GLU A C    2  
ATOM 2891  O O    . GLU A 1 63  ? 4.754   17.564  -15.501 1.00 1.00 ? 63  GLU A O    2  
ATOM 2892  C CB   . GLU A 1 63  ? 1.804   18.712  -17.063 1.00 1.00 ? 63  GLU A CB   2  
ATOM 2893  C CG   . GLU A 1 63  ? 1.212   19.878  -17.868 1.00 1.00 ? 63  GLU A CG   2  
ATOM 2894  C CD   . GLU A 1 63  ? 1.873   21.238  -17.568 1.00 1.00 ? 63  GLU A CD   2  
ATOM 2895  O OE1  . GLU A 1 63  ? 2.249   21.506  -16.403 1.00 1.00 ? 63  GLU A OE1  2  
ATOM 2896  O OE2  . GLU A 1 63  ? 2.031   22.047  -18.515 1.00 1.00 ? 63  GLU A OE2  2  
ATOM 2897  H H    . GLU A 1 63  ? 4.081   16.565  -17.476 1.00 1.00 ? 63  GLU A H    2  
ATOM 2898  H HA   . GLU A 1 63  ? 3.735   19.414  -17.722 1.00 1.00 ? 63  GLU A HA   2  
ATOM 2899  H HB2  . GLU A 1 63  ? 1.303   17.790  -17.358 1.00 1.00 ? 63  GLU A HB2  2  
ATOM 2900  H HB3  . GLU A 1 63  ? 1.538   18.882  -16.021 1.00 1.00 ? 63  GLU A HB3  2  
ATOM 2901  H HG2  . GLU A 1 63  ? 1.297   19.661  -18.932 1.00 1.00 ? 63  GLU A HG2  2  
ATOM 2902  H HG3  . GLU A 1 63  ? 0.149   19.949  -17.637 1.00 1.00 ? 63  GLU A HG3  2  
ATOM 2903  N N    . ARG A 1 64  ? 3.834   19.552  -15.011 1.00 1.00 ? 64  ARG A N    2  
ATOM 2904  C CA   . ARG A 1 64  ? 4.308   19.606  -13.627 1.00 1.00 ? 64  ARG A CA   2  
ATOM 2905  C C    . ARG A 1 64  ? 3.509   18.649  -12.731 1.00 1.00 ? 64  ARG A C    2  
ATOM 2906  O O    . ARG A 1 64  ? 2.288   18.538  -12.852 1.00 1.00 ? 64  ARG A O    2  
ATOM 2907  C CB   . ARG A 1 64  ? 4.252   21.049  -13.093 1.00 1.00 ? 64  ARG A CB   2  
ATOM 2908  C CG   . ARG A 1 64  ? 5.258   21.958  -13.822 1.00 1.00 ? 64  ARG A CG   2  
ATOM 2909  C CD   . ARG A 1 64  ? 5.276   23.380  -13.249 1.00 1.00 ? 64  ARG A CD   2  
ATOM 2910  N NE   . ARG A 1 64  ? 6.221   24.232  -13.996 1.00 1.00 ? 64  ARG A NE   2  
ATOM 2911  C CZ   . ARG A 1 64  ? 6.568   25.482  -13.712 1.00 1.00 ? 64  ARG A CZ   2  
ATOM 2912  N NH1  . ARG A 1 64  ? 6.077   26.125  -12.673 1.00 1.00 ? 64  ARG A NH1  2  
ATOM 2913  N NH2  . ARG A 1 64  ? 7.426   26.108  -14.489 1.00 1.00 ? 64  ARG A NH2  2  
ATOM 2914  H H    . ARG A 1 64  ? 3.244   20.314  -15.348 1.00 1.00 ? 64  ARG A H    2  
ATOM 2915  H HA   . ARG A 1 64  ? 5.349   19.294  -13.611 1.00 1.00 ? 64  ARG A HA   2  
ATOM 2916  H HB2  . ARG A 1 64  ? 3.243   21.448  -13.215 1.00 1.00 ? 64  ARG A HB2  2  
ATOM 2917  H HB3  . ARG A 1 64  ? 4.500   21.040  -12.031 1.00 1.00 ? 64  ARG A HB3  2  
ATOM 2918  H HG2  . ARG A 1 64  ? 6.259   21.530  -13.726 1.00 1.00 ? 64  ARG A HG2  2  
ATOM 2919  H HG3  . ARG A 1 64  ? 4.998   22.013  -14.881 1.00 1.00 ? 64  ARG A HG3  2  
ATOM 2920  H HD2  . ARG A 1 64  ? 4.272   23.805  -13.317 1.00 1.00 ? 64  ARG A HD2  2  
ATOM 2921  H HD3  . ARG A 1 64  ? 5.577   23.332  -12.200 1.00 1.00 ? 64  ARG A HD3  2  
ATOM 2922  H HE   . ARG A 1 64  ? 6.640   23.822  -14.823 1.00 1.00 ? 64  ARG A HE   2  
ATOM 2923  H HH11 . ARG A 1 64  ? 5.410   25.678  -12.064 1.00 1.00 ? 64  ARG A HH11 2  
ATOM 2924  H HH12 . ARG A 1 64  ? 6.350   27.077  -12.481 1.00 1.00 ? 64  ARG A HH12 2  
ATOM 2925  H HH21 . ARG A 1 64  ? 7.816   25.645  -15.298 1.00 1.00 ? 64  ARG A HH21 2  
ATOM 2926  H HH22 . ARG A 1 64  ? 7.696   27.061  -14.295 1.00 1.00 ? 64  ARG A HH22 2  
ATOM 2927  N N    . LEU A 1 65  ? 4.181   17.996  -11.777 1.00 1.00 ? 65  LEU A N    2  
ATOM 2928  C CA   . LEU A 1 65  ? 3.570   17.046  -10.831 1.00 1.00 ? 65  LEU A CA   2  
ATOM 2929  C C    . LEU A 1 65  ? 2.353   17.653  -10.121 1.00 1.00 ? 65  LEU A C    2  
ATOM 2930  O O    . LEU A 1 65  ? 1.275   17.065  -10.188 1.00 1.00 ? 65  LEU A O    2  
ATOM 2931  C CB   . LEU A 1 65  ? 4.654   16.569  -9.837  1.00 1.00 ? 65  LEU A CB   2  
ATOM 2932  C CG   . LEU A 1 65  ? 4.156   15.641  -8.705  1.00 1.00 ? 65  LEU A CG   2  
ATOM 2933  C CD1  . LEU A 1 65  ? 3.488   14.361  -9.226  1.00 1.00 ? 65  LEU A CD1  2  
ATOM 2934  C CD2  . LEU A 1 65  ? 5.352   15.258  -7.827  1.00 1.00 ? 65  LEU A CD2  2  
ATOM 2935  H H    . LEU A 1 65  ? 5.188   18.134  -11.740 1.00 1.00 ? 65  LEU A H    2  
ATOM 2936  H HA   . LEU A 1 65  ? 3.203   16.186  -11.400 1.00 1.00 ? 65  LEU A HA   2  
ATOM 2937  H HB2  . LEU A 1 65  ? 5.436   16.052  -10.397 1.00 1.00 ? 65  LEU A HB2  2  
ATOM 2938  H HB3  . LEU A 1 65  ? 5.118   17.444  -9.371  1.00 1.00 ? 65  LEU A HB3  2  
ATOM 2939  H HG   . LEU A 1 65  ? 3.438   16.178  -8.085  1.00 1.00 ? 65  LEU A HG   2  
ATOM 2940  H HD11 . LEU A 1 65  ? 4.211   13.755  -9.767  1.00 1.00 ? 65  LEU A HD11 2  
ATOM 2941  H HD12 . LEU A 1 65  ? 3.105   13.782  -8.383  1.00 1.00 ? 65  LEU A HD12 2  
ATOM 2942  H HD13 . LEU A 1 65  ? 2.655   14.601  -9.882  1.00 1.00 ? 65  LEU A HD13 2  
ATOM 2943  H HD21 . LEU A 1 65  ? 5.803   16.151  -7.395  1.00 1.00 ? 65  LEU A HD21 2  
ATOM 2944  H HD22 . LEU A 1 65  ? 5.027   14.603  -7.020  1.00 1.00 ? 65  LEU A HD22 2  
ATOM 2945  H HD23 . LEU A 1 65  ? 6.099   14.732  -8.422  1.00 1.00 ? 65  LEU A HD23 2  
ATOM 2946  N N    . GLU A 1 66  ? 2.508   18.840  -9.523  1.00 1.00 ? 66  GLU A N    2  
ATOM 2947  C CA   . GLU A 1 66  ? 1.427   19.560  -8.821  1.00 1.00 ? 66  GLU A CA   2  
ATOM 2948  C C    . GLU A 1 66  ? 0.216   19.750  -9.738  1.00 1.00 ? 66  GLU A C    2  
ATOM 2949  O O    . GLU A 1 66  ? -0.914  19.445  -9.362  1.00 1.00 ? 66  GLU A O    2  
ATOM 2950  C CB   . GLU A 1 66  ? 1.872   20.950  -8.323  1.00 1.00 ? 66  GLU A CB   2  
ATOM 2951  C CG   . GLU A 1 66  ? 3.268   20.959  -7.707  1.00 1.00 ? 66  GLU A CG   2  
ATOM 2952  C CD   . GLU A 1 66  ? 3.564   22.298  -7.014  1.00 1.00 ? 66  GLU A CD   2  
ATOM 2953  O OE1  . GLU A 1 66  ? 4.086   23.223  -7.677  1.00 1.00 ? 66  GLU A OE1  2  
ATOM 2954  O OE2  . GLU A 1 66  ? 3.277   22.435  -5.800  1.00 1.00 ? 66  GLU A OE2  2  
ATOM 2955  H H    . GLU A 1 66  ? 3.434   19.243  -9.508  1.00 1.00 ? 66  GLU A H    2  
ATOM 2956  H HA   . GLU A 1 66  ? 1.129   18.974  -7.951  1.00 1.00 ? 66  GLU A HA   2  
ATOM 2957  H HB2  . GLU A 1 66  ? 1.869   21.663  -9.148  1.00 1.00 ? 66  GLU A HB2  2  
ATOM 2958  H HB3  . GLU A 1 66  ? 1.151   21.298  -7.582  1.00 1.00 ? 66  GLU A HB3  2  
ATOM 2959  H HG2  . GLU A 1 66  ? 3.345   20.136  -6.993  1.00 1.00 ? 66  GLU A HG2  2  
ATOM 2960  H HG3  . GLU A 1 66  ? 3.979   20.801  -8.519  1.00 1.00 ? 66  GLU A HG3  2  
ATOM 2961  N N    . ASP A 1 67  ? 0.466   20.218  -10.967 1.00 1.00 ? 67  ASP A N    2  
ATOM 2962  C CA   . ASP A 1 67  ? -0.584  20.457  -11.957 1.00 1.00 ? 67  ASP A CA   2  
ATOM 2963  C C    . ASP A 1 67  ? -1.288  19.152  -12.378 1.00 1.00 ? 67  ASP A C    2  
ATOM 2964  O O    . ASP A 1 67  ? -2.512  19.124  -12.518 1.00 1.00 ? 67  ASP A O    2  
ATOM 2965  C CB   . ASP A 1 67  ? 0.001   21.172  -13.181 1.00 1.00 ? 67  ASP A CB   2  
ATOM 2966  C CG   . ASP A 1 67  ? -1.104  21.566  -14.176 1.00 1.00 ? 67  ASP A CG   2  
ATOM 2967  O OD1  . ASP A 1 67  ? -1.759  22.614  -13.960 1.00 1.00 ? 67  ASP A OD1  2  
ATOM 2968  O OD2  . ASP A 1 67  ? -1.317  20.832  -15.172 1.00 1.00 ? 67  ASP A OD2  2  
ATOM 2969  H H    . ASP A 1 67  ? 1.414   20.481  -11.193 1.00 1.00 ? 67  ASP A H    2  
ATOM 2970  H HA   . ASP A 1 67  ? -1.313  21.114  -11.487 1.00 1.00 ? 67  ASP A HA   2  
ATOM 2971  H HB2  . ASP A 1 67  ? 0.527   22.067  -12.849 1.00 1.00 ? 67  ASP A HB2  2  
ATOM 2972  H HB3  . ASP A 1 67  ? 0.726   20.523  -13.674 1.00 1.00 ? 67  ASP A HB3  2  
ATOM 2973  N N    . VAL A 1 68  ? -0.520  18.065  -12.527 1.00 1.00 ? 68  VAL A N    2  
ATOM 2974  C CA   . VAL A 1 68  ? -1.017  16.735  -12.893 1.00 1.00 ? 68  VAL A CA   2  
ATOM 2975  C C    . VAL A 1 68  ? -1.846  16.103  -11.768 1.00 1.00 ? 68  VAL A C    2  
ATOM 2976  O O    . VAL A 1 68  ? -2.920  15.571  -12.054 1.00 1.00 ? 68  VAL A O    2  
ATOM 2977  C CB   . VAL A 1 68  ? 0.129   15.801  -13.343 1.00 1.00 ? 68  VAL A CB   2  
ATOM 2978  C CG1  . VAL A 1 68  ? -0.283  14.324  -13.478 1.00 1.00 ? 68  VAL A CG1  2  
ATOM 2979  C CG2  . VAL A 1 68  ? 0.644   16.270  -14.709 1.00 1.00 ? 68  VAL A CG2  2  
ATOM 2980  H H    . VAL A 1 68  ? 0.482   18.192  -12.429 1.00 1.00 ? 68  VAL A H    2  
ATOM 2981  H HA   . VAL A 1 68  ? -1.671  16.876  -13.748 1.00 1.00 ? 68  VAL A HA   2  
ATOM 2982  H HB   . VAL A 1 68  ? 0.943   15.862  -12.615 1.00 1.00 ? 68  VAL A HB   2  
ATOM 2983  H HG11 . VAL A 1 68  ? -1.130  14.230  -14.159 1.00 1.00 ? 68  VAL A HG11 2  
ATOM 2984  H HG12 . VAL A 1 68  ? 0.552   13.738  -13.866 1.00 1.00 ? 68  VAL A HG12 2  
ATOM 2985  H HG13 . VAL A 1 68  ? -0.557  13.920  -12.504 1.00 1.00 ? 68  VAL A HG13 2  
ATOM 2986  H HG21 . VAL A 1 68  ? 1.426   15.608  -15.062 1.00 1.00 ? 68  VAL A HG21 2  
ATOM 2987  H HG22 . VAL A 1 68  ? -0.166  16.271  -15.442 1.00 1.00 ? 68  VAL A HG22 2  
ATOM 2988  H HG23 . VAL A 1 68  ? 1.049   17.271  -14.628 1.00 1.00 ? 68  VAL A HG23 2  
ATOM 2989  N N    . VAL A 1 69  ? -1.397  16.160  -10.505 1.00 1.00 ? 69  VAL A N    2  
ATOM 2990  C CA   . VAL A 1 69  ? -2.154  15.594  -9.390  1.00 1.00 ? 69  VAL A CA   2  
ATOM 2991  C C    . VAL A 1 69  ? -3.367  16.450  -8.998  1.00 1.00 ? 69  VAL A C    2  
ATOM 2992  O O    . VAL A 1 69  ? -4.409  15.891  -8.662  1.00 1.00 ? 69  VAL A O    2  
ATOM 2993  C CB   . VAL A 1 69  ? -1.266  15.305  -8.164  1.00 1.00 ? 69  VAL A CB   2  
ATOM 2994  C CG1  . VAL A 1 69  ? -0.137  14.331  -8.526  1.00 1.00 ? 69  VAL A CG1  2  
ATOM 2995  C CG2  . VAL A 1 69  ? -0.703  16.542  -7.452  1.00 1.00 ? 69  VAL A CG2  2  
ATOM 2996  H H    . VAL A 1 69  ? -0.482  16.551  -10.296 1.00 1.00 ? 69  VAL A H    2  
ATOM 2997  H HA   . VAL A 1 69  ? -2.528  14.628  -9.728  1.00 1.00 ? 69  VAL A HA   2  
ATOM 2998  H HB   . VAL A 1 69  ? -1.899  14.795  -7.459  1.00 1.00 ? 69  VAL A HB   2  
ATOM 2999  H HG11 . VAL A 1 69  ? 0.517   14.763  -9.277  1.00 1.00 ? 69  VAL A HG11 2  
ATOM 3000  H HG12 . VAL A 1 69  ? 0.450   14.095  -7.640  1.00 1.00 ? 69  VAL A HG12 2  
ATOM 3001  H HG13 . VAL A 1 69  ? -0.569  13.415  -8.920  1.00 1.00 ? 69  VAL A HG13 2  
ATOM 3002  H HG21 . VAL A 1 69  ? -0.117  17.133  -8.148  1.00 1.00 ? 69  VAL A HG21 2  
ATOM 3003  H HG22 . VAL A 1 69  ? -1.513  17.149  -7.051  1.00 1.00 ? 69  VAL A HG22 2  
ATOM 3004  H HG23 . VAL A 1 69  ? -0.063  16.237  -6.624  1.00 1.00 ? 69  VAL A HG23 2  
ATOM 3005  N N    . GLY A 1 70  ? -3.280  17.786  -9.061  1.00 1.00 ? 70  GLY A N    2  
ATOM 3006  C CA   . GLY A 1 70  ? -4.376  18.680  -8.674  1.00 1.00 ? 70  GLY A CA   2  
ATOM 3007  C C    . GLY A 1 70  ? -4.777  18.480  -7.210  1.00 1.00 ? 70  GLY A C    2  
ATOM 3008  O O    . GLY A 1 70  ? -3.954  18.642  -6.305  1.00 1.00 ? 70  GLY A O    2  
ATOM 3009  H H    . GLY A 1 70  ? -2.399  18.214  -9.333  1.00 1.00 ? 70  GLY A H    2  
ATOM 3010  H HA2  . GLY A 1 70  ? -4.080  19.719  -8.816  1.00 1.00 ? 70  GLY A HA2  2  
ATOM 3011  H HA3  . GLY A 1 70  ? -5.242  18.480  -9.309  1.00 1.00 ? 70  GLY A HA3  2  
ATOM 3012  N N    . GLY A 1 71  ? -6.040  18.096  -6.983  1.00 1.00 ? 71  GLY A N    2  
ATOM 3013  C CA   . GLY A 1 71  ? -6.582  17.748  -5.658  1.00 1.00 ? 71  GLY A CA   2  
ATOM 3014  C C    . GLY A 1 71  ? -6.349  16.293  -5.227  1.00 1.00 ? 71  GLY A C    2  
ATOM 3015  O O    . GLY A 1 71  ? -6.708  15.931  -4.105  1.00 1.00 ? 71  GLY A O    2  
ATOM 3016  H H    . GLY A 1 71  ? -6.664  18.023  -7.776  1.00 1.00 ? 71  GLY A H    2  
ATOM 3017  H HA2  . GLY A 1 71  ? -6.130  18.393  -4.901  1.00 1.00 ? 71  GLY A HA2  2  
ATOM 3018  H HA3  . GLY A 1 71  ? -7.661  17.907  -5.671  1.00 1.00 ? 71  GLY A HA3  2  
ATOM 3019  N N    . CYS A 1 72  ? -5.762  15.450  -6.088  1.00 1.00 ? 72  CYS A N    2  
ATOM 3020  C CA   . CYS A 1 72  ? -5.468  14.038  -5.806  1.00 1.00 ? 72  CYS A CA   2  
ATOM 3021  C C    . CYS A 1 72  ? -4.236  13.891  -4.889  1.00 1.00 ? 72  CYS A C    2  
ATOM 3022  O O    . CYS A 1 72  ? -3.274  14.663  -4.994  1.00 1.00 ? 72  CYS A O    2  
ATOM 3023  C CB   . CYS A 1 72  ? -5.224  13.275  -7.119  1.00 1.00 ? 72  CYS A CB   2  
ATOM 3024  S SG   . CYS A 1 72  ? -6.559  13.578  -8.319  1.00 1.00 ? 72  CYS A SG   2  
ATOM 3025  H H    . CYS A 1 72  ? -5.449  15.821  -6.975  1.00 1.00 ? 72  CYS A H    2  
ATOM 3026  H HA   . CYS A 1 72  ? -6.339  13.584  -5.324  1.00 1.00 ? 72  CYS A HA   2  
ATOM 3027  H HB2  . CYS A 1 72  ? -4.270  13.580  -7.556  1.00 1.00 ? 72  CYS A HB2  2  
ATOM 3028  H HB3  . CYS A 1 72  ? -5.167  12.206  -6.902  1.00 1.00 ? 72  CYS A HB3  2  
ATOM 3029  H HG   . CYS A 1 72  ? -6.190  14.818  -8.678  1.00 1.00 ? 72  CYS A HG   2  
ATOM 3030  N N    . CYS A 1 73  ? -4.232  12.862  -4.038  1.00 1.00 ? 73  CYS A N    2  
ATOM 3031  C CA   . CYS A 1 73  ? -3.046  12.460  -3.267  1.00 1.00 ? 73  CYS A CA   2  
ATOM 3032  C C    . CYS A 1 73  ? -2.082  11.654  -4.158  1.00 1.00 ? 73  CYS A C    2  
ATOM 3033  O O    . CYS A 1 73  ? -2.467  11.181  -5.227  1.00 1.00 ? 73  CYS A O    2  
ATOM 3034  C CB   . CYS A 1 73  ? -3.493  11.688  -2.010  1.00 1.00 ? 73  CYS A CB   2  
ATOM 3035  S SG   . CYS A 1 73  ? -4.459  12.791  -0.936  1.00 1.00 ? 73  CYS A SG   2  
ATOM 3036  H H    . CYS A 1 73  ? -5.046  12.264  -4.007  1.00 1.00 ? 73  CYS A H    2  
ATOM 3037  H HA   . CYS A 1 73  ? -2.509  13.356  -2.942  1.00 1.00 ? 73  CYS A HA   2  
ATOM 3038  H HB2  . CYS A 1 73  ? -4.099  10.823  -2.291  1.00 1.00 ? 73  CYS A HB2  2  
ATOM 3039  H HB3  . CYS A 1 73  ? -2.620  11.329  -1.459  1.00 1.00 ? 73  CYS A HB3  2  
ATOM 3040  H HG   . CYS A 1 73  ? -4.719  11.902  0.043   1.00 1.00 ? 73  CYS A HG   2  
ATOM 3041  N N    . TYR A 1 74  ? -0.839  11.446  -3.718  1.00 1.00 ? 74  TYR A N    2  
ATOM 3042  C CA   . TYR A 1 74  ? 0.176   10.697  -4.482  1.00 1.00 ? 74  TYR A CA   2  
ATOM 3043  C C    . TYR A 1 74  ? 1.346   10.168  -3.623  1.00 1.00 ? 74  TYR A C    2  
ATOM 3044  O O    . TYR A 1 74  ? 1.559   10.636  -2.503  1.00 1.00 ? 74  TYR A O    2  
ATOM 3045  C CB   . TYR A 1 74  ? 0.695   11.560  -5.651  1.00 1.00 ? 74  TYR A CB   2  
ATOM 3046  C CG   . TYR A 1 74  ? 1.537   12.753  -5.236  1.00 1.00 ? 74  TYR A CG   2  
ATOM 3047  C CD1  . TYR A 1 74  ? 0.918   13.976  -4.906  1.00 1.00 ? 74  TYR A CD1  2  
ATOM 3048  C CD2  . TYR A 1 74  ? 2.940   12.641  -5.175  1.00 1.00 ? 74  TYR A CD2  2  
ATOM 3049  C CE1  . TYR A 1 74  ? 1.698   15.082  -4.518  1.00 1.00 ? 74  TYR A CE1  2  
ATOM 3050  C CE2  . TYR A 1 74  ? 3.725   13.738  -4.776  1.00 1.00 ? 74  TYR A CE2  2  
ATOM 3051  C CZ   . TYR A 1 74  ? 3.106   14.965  -4.450  1.00 1.00 ? 74  TYR A CZ   2  
ATOM 3052  O OH   . TYR A 1 74  ? 3.874   16.027  -4.075  1.00 1.00 ? 74  TYR A OH   2  
ATOM 3053  H H    . TYR A 1 74  ? -0.561  11.842  -2.829  1.00 1.00 ? 74  TYR A H    2  
ATOM 3054  H HA   . TYR A 1 74  ? -0.320  9.822   -4.909  1.00 1.00 ? 74  TYR A HA   2  
ATOM 3055  H HB2  . TYR A 1 74  ? 1.290   10.934  -6.315  1.00 1.00 ? 74  TYR A HB2  2  
ATOM 3056  H HB3  . TYR A 1 74  ? -0.149  11.914  -6.244  1.00 1.00 ? 74  TYR A HB3  2  
ATOM 3057  H HD1  . TYR A 1 74  ? -0.159  14.068  -4.952  1.00 1.00 ? 74  TYR A HD1  2  
ATOM 3058  H HD2  . TYR A 1 74  ? 3.422   11.707  -5.424  1.00 1.00 ? 74  TYR A HD2  2  
ATOM 3059  H HE1  . TYR A 1 74  ? 1.219   16.017  -4.267  1.00 1.00 ? 74  TYR A HE1  2  
ATOM 3060  H HE2  . TYR A 1 74  ? 4.799   13.647  -4.720  1.00 1.00 ? 74  TYR A HE2  2  
ATOM 3061  H HH   . TYR A 1 74  ? 3.355   16.817  -3.854  1.00 1.00 ? 74  TYR A HH   2  
ATOM 3062  N N    . ARG A 1 75  ? 2.121   9.217   -4.169  1.00 1.00 ? 75  ARG A N    2  
ATOM 3063  C CA   . ARG A 1 75  ? 3.359   8.683   -3.564  1.00 1.00 ? 75  ARG A CA   2  
ATOM 3064  C C    . ARG A 1 75  ? 4.302   8.078   -4.615  1.00 1.00 ? 75  ARG A C    2  
ATOM 3065  O O    . ARG A 1 75  ? 3.853   7.663   -5.682  1.00 1.00 ? 75  ARG A O    2  
ATOM 3066  C CB   . ARG A 1 75  ? 3.037   7.654   -2.454  1.00 1.00 ? 75  ARG A CB   2  
ATOM 3067  C CG   . ARG A 1 75  ? 2.533   6.301   -2.988  1.00 1.00 ? 75  ARG A CG   2  
ATOM 3068  C CD   . ARG A 1 75  ? 2.182   5.319   -1.864  1.00 1.00 ? 75  ARG A CD   2  
ATOM 3069  N NE   . ARG A 1 75  ? 1.757   4.039   -2.451  1.00 1.00 ? 75  ARG A NE   2  
ATOM 3070  C CZ   . ARG A 1 75  ? 1.102   3.045   -1.875  1.00 1.00 ? 75  ARG A CZ   2  
ATOM 3071  N NH1  . ARG A 1 75  ? 0.813   3.022   -0.592  1.00 1.00 ? 75  ARG A NH1  2  
ATOM 3072  N NH2  . ARG A 1 75  ? 0.726   2.051   -2.646  1.00 1.00 ? 75  ARG A NH2  2  
ATOM 3073  H H    . ARG A 1 75  ? 1.851   8.861   -5.086  1.00 1.00 ? 75  ARG A H    2  
ATOM 3074  H HA   . ARG A 1 75  ? 3.882   9.518   -3.097  1.00 1.00 ? 75  ARG A HA   2  
ATOM 3075  H HB2  . ARG A 1 75  ? 3.940   7.478   -1.870  1.00 1.00 ? 75  ARG A HB2  2  
ATOM 3076  H HB3  . ARG A 1 75  ? 2.289   8.076   -1.782  1.00 1.00 ? 75  ARG A HB3  2  
ATOM 3077  H HG2  . ARG A 1 75  ? 1.652   6.465   -3.607  1.00 1.00 ? 75  ARG A HG2  2  
ATOM 3078  H HG3  . ARG A 1 75  ? 3.307   5.839   -3.604  1.00 1.00 ? 75  ARG A HG3  2  
ATOM 3079  H HD2  . ARG A 1 75  ? 3.058   5.159   -1.233  1.00 1.00 ? 75  ARG A HD2  2  
ATOM 3080  H HD3  . ARG A 1 75  ? 1.376   5.741   -1.258  1.00 1.00 ? 75  ARG A HD3  2  
ATOM 3081  H HE   . ARG A 1 75  ? 1.940   3.903   -3.448  1.00 1.00 ? 75  ARG A HE   2  
ATOM 3082  H HH11 . ARG A 1 75  ? 1.110   3.774   0.009   1.00 1.00 ? 75  ARG A HH11 2  
ATOM 3083  H HH12 . ARG A 1 75  ? 0.303   2.248   -0.193  1.00 1.00 ? 75  ARG A HH12 2  
ATOM 3084  H HH21 . ARG A 1 75  ? 0.935   2.130   -3.644  1.00 1.00 ? 75  ARG A HH21 2  
ATOM 3085  H HH22 . ARG A 1 75  ? 0.220   1.259   -2.282  1.00 1.00 ? 75  ARG A HH22 2  
ATOM 3086  N N    . VAL A 1 76  ? 5.589   7.968   -4.294  1.00 1.00 ? 76  VAL A N    2  
ATOM 3087  C CA   . VAL A 1 76  ? 6.585   7.216   -5.081  1.00 1.00 ? 76  VAL A CA   2  
ATOM 3088  C C    . VAL A 1 76  ? 6.465   5.729   -4.731  1.00 1.00 ? 76  VAL A C    2  
ATOM 3089  O O    . VAL A 1 76  ? 6.314   5.381   -3.560  1.00 1.00 ? 76  VAL A O    2  
ATOM 3090  C CB   . VAL A 1 76  ? 8.028   7.708   -4.818  1.00 1.00 ? 76  VAL A CB   2  
ATOM 3091  C CG1  . VAL A 1 76  ? 9.087   6.858   -5.544  1.00 1.00 ? 76  VAL A CG1  2  
ATOM 3092  C CG2  . VAL A 1 76  ? 8.187   9.174   -5.248  1.00 1.00 ? 76  VAL A CG2  2  
ATOM 3093  H H    . VAL A 1 76  ? 5.870   8.299   -3.366  1.00 1.00 ? 76  VAL A H    2  
ATOM 3094  H HA   . VAL A 1 76  ? 6.369   7.357   -6.140  1.00 1.00 ? 76  VAL A HA   2  
ATOM 3095  H HB   . VAL A 1 76  ? 8.227   7.643   -3.747  1.00 1.00 ? 76  VAL A HB   2  
ATOM 3096  H HG11 . VAL A 1 76  ? 8.872   6.816   -6.612  1.00 1.00 ? 76  VAL A HG11 2  
ATOM 3097  H HG12 . VAL A 1 76  ? 10.076  7.290   -5.391  1.00 1.00 ? 76  VAL A HG12 2  
ATOM 3098  H HG13 . VAL A 1 76  ? 9.103   5.846   -5.140  1.00 1.00 ? 76  VAL A HG13 2  
ATOM 3099  H HG21 . VAL A 1 76  ? 9.187   9.522   -4.993  1.00 1.00 ? 76  VAL A HG21 2  
ATOM 3100  H HG22 . VAL A 1 76  ? 8.031   9.265   -6.323  1.00 1.00 ? 76  VAL A HG22 2  
ATOM 3101  H HG23 . VAL A 1 76  ? 7.466   9.807   -4.730  1.00 1.00 ? 76  VAL A HG23 2  
ATOM 3102  N N    . ASN A 1 77  ? 6.563   4.858   -5.740  1.00 1.00 ? 77  ASN A N    2  
ATOM 3103  C CA   . ASN A 1 77  ? 6.539   3.402   -5.577  1.00 1.00 ? 77  ASN A CA   2  
ATOM 3104  C C    . ASN A 1 77  ? 7.351   2.706   -6.686  1.00 1.00 ? 77  ASN A C    2  
ATOM 3105  O O    . ASN A 1 77  ? 6.803   2.195   -7.664  1.00 1.00 ? 77  ASN A O    2  
ATOM 3106  C CB   . ASN A 1 77  ? 5.077   2.922   -5.494  1.00 1.00 ? 77  ASN A CB   2  
ATOM 3107  C CG   . ASN A 1 77  ? 4.944   1.438   -5.153  1.00 1.00 ? 77  ASN A CG   2  
ATOM 3108  O OD1  . ASN A 1 77  ? 5.912   0.695   -5.022  1.00 1.00 ? 77  ASN A OD1  2  
ATOM 3109  N ND2  . ASN A 1 77  ? 3.723   0.971   -4.984  1.00 1.00 ? 77  ASN A ND2  2  
ATOM 3110  H H    . ASN A 1 77  ? 6.655   5.229   -6.684  1.00 1.00 ? 77  ASN A H    2  
ATOM 3111  H HA   . ASN A 1 77  ? 7.015   3.159   -4.627  1.00 1.00 ? 77  ASN A HA   2  
ATOM 3112  H HB2  . ASN A 1 77  ? 4.563   3.489   -4.718  1.00 1.00 ? 77  ASN A HB2  2  
ATOM 3113  H HB3  . ASN A 1 77  ? 4.570   3.118   -6.439  1.00 1.00 ? 77  ASN A HB3  2  
ATOM 3114  H HD21 . ASN A 1 77  ? 2.939   1.622   -5.056  1.00 1.00 ? 77  ASN A HD21 2  
ATOM 3115  H HD22 . ASN A 1 77  ? 3.587   -0.000  -4.744  1.00 1.00 ? 77  ASN A HD22 2  
ATOM 3116  N N    . ASN A 1 78  ? 8.679   2.673   -6.517  1.00 1.00 ? 78  ASN A N    2  
ATOM 3117  C CA   . ASN A 1 78  ? 9.615   1.992   -7.424  1.00 1.00 ? 78  ASN A CA   2  
ATOM 3118  C C    . ASN A 1 78  ? 9.610   0.467   -7.186  1.00 1.00 ? 78  ASN A C    2  
ATOM 3119  O O    . ASN A 1 78  ? 10.579  -0.111  -6.696  1.00 1.00 ? 78  ASN A O    2  
ATOM 3120  C CB   . ASN A 1 78  ? 11.017  2.618   -7.284  1.00 1.00 ? 78  ASN A CB   2  
ATOM 3121  C CG   . ASN A 1 78  ? 11.105  4.059   -7.788  1.00 1.00 ? 78  ASN A CG   2  
ATOM 3122  O OD1  . ASN A 1 78  ? 10.259  4.549   -8.522  1.00 1.00 ? 78  ASN A OD1  2  
ATOM 3123  N ND2  . ASN A 1 78  ? 12.158  4.764   -7.425  1.00 1.00 ? 78  ASN A ND2  2  
ATOM 3124  H H    . ASN A 1 78  ? 9.061   3.111   -5.689  1.00 1.00 ? 78  ASN A H    2  
ATOM 3125  H HA   . ASN A 1 78  ? 9.280   2.154   -8.447  1.00 1.00 ? 78  ASN A HA   2  
ATOM 3126  H HB2  . ASN A 1 78  ? 11.326  2.582   -6.237  1.00 1.00 ? 78  ASN A HB2  2  
ATOM 3127  H HB3  . ASN A 1 78  ? 11.731  2.027   -7.860  1.00 1.00 ? 78  ASN A HB3  2  
ATOM 3128  H HD21 . ASN A 1 78  ? 12.857  4.370   -6.813  1.00 1.00 ? 78  ASN A HD21 2  
ATOM 3129  H HD22 . ASN A 1 78  ? 12.252  5.719   -7.764  1.00 1.00 ? 78  ASN A HD22 2  
ATOM 3130  N N    . SER A 1 79  ? 8.503   -0.199  -7.524  1.00 1.00 ? 79  SER A N    2  
ATOM 3131  C CA   . SER A 1 79  ? 8.260   -1.623  -7.235  1.00 1.00 ? 79  SER A CA   2  
ATOM 3132  C C    . SER A 1 79  ? 9.234   -2.569  -7.965  1.00 1.00 ? 79  SER A C    2  
ATOM 3133  O O    . SER A 1 79  ? 9.679   -3.573  -7.400  1.00 1.00 ? 79  SER A O    2  
ATOM 3134  C CB   . SER A 1 79  ? 6.808   -1.959  -7.614  1.00 1.00 ? 79  SER A CB   2  
ATOM 3135  O OG   . SER A 1 79  ? 6.533   -1.578  -8.961  1.00 1.00 ? 79  SER A OG   2  
ATOM 3136  H H    . SER A 1 79  ? 7.729   0.321   -7.930  1.00 1.00 ? 79  SER A H    2  
ATOM 3137  H HA   . SER A 1 79  ? 8.375   -1.793  -6.165  1.00 1.00 ? 79  SER A HA   2  
ATOM 3138  H HB2  . SER A 1 79  ? 6.639   -3.031  -7.493  1.00 1.00 ? 79  SER A HB2  2  
ATOM 3139  H HB3  . SER A 1 79  ? 6.135   -1.420  -6.945  1.00 1.00 ? 79  SER A HB3  2  
ATOM 3140  H HG   . SER A 1 79  ? 5.603   -1.796  -9.176  1.00 1.00 ? 79  SER A HG   2  
ATOM 3141  N N    . LEU A 1 80  ? 9.619   -2.224  -9.203  1.00 1.00 ? 80  LEU A N    2  
ATOM 3142  C CA   . LEU A 1 80  ? 10.464  -3.059  -10.062 1.00 1.00 ? 80  LEU A CA   2  
ATOM 3143  C C    . LEU A 1 80  ? 11.919  -3.177  -9.580  1.00 1.00 ? 80  LEU A C    2  
ATOM 3144  O O    . LEU A 1 80  ? 12.649  -4.032  -10.068 1.00 1.00 ? 80  LEU A O    2  
ATOM 3145  C CB   . LEU A 1 80  ? 10.400  -2.574  -11.522 1.00 1.00 ? 80  LEU A CB   2  
ATOM 3146  C CG   . LEU A 1 80  ? 8.996   -2.397  -12.136 1.00 1.00 ? 80  LEU A CG   2  
ATOM 3147  C CD1  . LEU A 1 80  ? 9.141   -2.021  -13.617 1.00 1.00 ? 80  LEU A CD1  2  
ATOM 3148  C CD2  . LEU A 1 80  ? 8.131   -3.658  -11.991 1.00 1.00 ? 80  LEU A CD2  2  
ATOM 3149  H H    . LEU A 1 80  ? 9.201   -1.397  -9.603  1.00 1.00 ? 80  LEU A H    2  
ATOM 3150  H HA   . LEU A 1 80  ? 10.059  -4.069  -10.029 1.00 1.00 ? 80  LEU A HA   2  
ATOM 3151  H HB2  . LEU A 1 80  ? 10.938  -1.626  -11.602 1.00 1.00 ? 80  LEU A HB2  2  
ATOM 3152  H HB3  . LEU A 1 80  ? 10.935  -3.318  -12.121 1.00 1.00 ? 80  LEU A HB3  2  
ATOM 3153  H HG   . LEU A 1 80  ? 8.487   -1.575  -11.631 1.00 1.00 ? 80  LEU A HG   2  
ATOM 3154  H HD11 . LEU A 1 80  ? 9.649   -2.819  -14.164 1.00 1.00 ? 80  LEU A HD11 2  
ATOM 3155  H HD12 . LEU A 1 80  ? 8.157   -1.861  -14.054 1.00 1.00 ? 80  LEU A HD12 2  
ATOM 3156  H HD13 . LEU A 1 80  ? 9.711   -1.097  -13.719 1.00 1.00 ? 80  LEU A HD13 2  
ATOM 3157  H HD21 . LEU A 1 80  ? 8.647   -4.520  -12.409 1.00 1.00 ? 80  LEU A HD21 2  
ATOM 3158  H HD22 . LEU A 1 80  ? 7.920   -3.842  -10.936 1.00 1.00 ? 80  LEU A HD22 2  
ATOM 3159  H HD23 . LEU A 1 80  ? 7.182   -3.516  -12.509 1.00 1.00 ? 80  LEU A HD23 2  
ATOM 3160  N N    . ASP A 1 81  ? 12.327  -2.377  -8.590  1.00 1.00 ? 81  ASP A N    2  
ATOM 3161  C CA   . ASP A 1 81  ? 13.610  -2.517  -7.877  1.00 1.00 ? 81  ASP A CA   2  
ATOM 3162  C C    . ASP A 1 81  ? 13.802  -3.932  -7.297  1.00 1.00 ? 81  ASP A C    2  
ATOM 3163  O O    . ASP A 1 81  ? 14.913  -4.455  -7.224  1.00 1.00 ? 81  ASP A O    2  
ATOM 3164  C CB   . ASP A 1 81  ? 13.606  -1.526  -6.706  1.00 1.00 ? 81  ASP A CB   2  
ATOM 3165  C CG   . ASP A 1 81  ? 14.957  -1.494  -5.974  1.00 1.00 ? 81  ASP A CG   2  
ATOM 3166  O OD1  . ASP A 1 81  ? 15.948  -0.987  -6.556  1.00 1.00 ? 81  ASP A OD1  2  
ATOM 3167  O OD2  . ASP A 1 81  ? 15.021  -1.950  -4.807  1.00 1.00 ? 81  ASP A OD2  2  
ATOM 3168  H H    . ASP A 1 81  ? 11.669  -1.687  -8.249  1.00 1.00 ? 81  ASP A H    2  
ATOM 3169  H HA   . ASP A 1 81  ? 14.439  -2.287  -8.552  1.00 1.00 ? 81  ASP A HA   2  
ATOM 3170  H HB2  . ASP A 1 81  ? 13.381  -0.523  -7.076  1.00 1.00 ? 81  ASP A HB2  2  
ATOM 3171  H HB3  . ASP A 1 81  ? 12.816  -1.832  -6.008  1.00 1.00 ? 81  ASP A HB3  2  
ATOM 3172  N N    . HIS A 1 82  ? 12.692  -4.553  -6.901  1.00 1.00 ? 82  HIS A N    2  
ATOM 3173  C CA   . HIS A 1 82  ? 12.626  -5.914  -6.376  1.00 1.00 ? 82  HIS A CA   2  
ATOM 3174  C C    . HIS A 1 82  ? 12.702  -6.993  -7.487  1.00 1.00 ? 82  HIS A C    2  
ATOM 3175  O O    . HIS A 1 82  ? 12.968  -8.166  -7.206  1.00 1.00 ? 82  HIS A O    2  
ATOM 3176  C CB   . HIS A 1 82  ? 11.311  -5.981  -5.586  1.00 1.00 ? 82  HIS A CB   2  
ATOM 3177  C CG   . HIS A 1 82  ? 11.065  -7.286  -4.871  1.00 1.00 ? 82  HIS A CG   2  
ATOM 3178  N ND1  . HIS A 1 82  ? 10.380  -8.368  -5.379  1.00 1.00 ? 82  HIS A ND1  2  
ATOM 3179  C CD2  . HIS A 1 82  ? 11.455  -7.615  -3.598  1.00 1.00 ? 82  HIS A CD2  2  
ATOM 3180  C CE1  . HIS A 1 82  ? 10.363  -9.328  -4.441  1.00 1.00 ? 82  HIS A CE1  2  
ATOM 3181  N NE2  . HIS A 1 82  ? 11.006  -8.917  -3.329  1.00 1.00 ? 82  HIS A NE2  2  
ATOM 3182  H H    . HIS A 1 82  ? 11.818  -4.047  -7.002  1.00 1.00 ? 82  HIS A H    2  
ATOM 3183  H HA   . HIS A 1 82  ? 13.461  -6.086  -5.692  1.00 1.00 ? 82  HIS A HA   2  
ATOM 3184  H HB2  . HIS A 1 82  ? 11.308  -5.166  -4.857  1.00 1.00 ? 82  HIS A HB2  2  
ATOM 3185  H HB3  . HIS A 1 82  ? 10.479  -5.803  -6.268  1.00 1.00 ? 82  HIS A HB3  2  
ATOM 3186  H HD1  . HIS A 1 82  ? 9.987   -8.440  -6.319  1.00 1.00 ? 82  HIS A HD1  2  
ATOM 3187  H HD2  . HIS A 1 82  ? 12.008  -6.976  -2.920  1.00 1.00 ? 82  HIS A HD2  2  
ATOM 3188  H HE1  . HIS A 1 82  ? 9.899   -10.300 -4.571  1.00 1.00 ? 82  HIS A HE1  2  
ATOM 3189  N N    . GLU A 1 83  ? 12.484  -6.603  -8.750  1.00 1.00 ? 83  GLU A N    2  
ATOM 3190  C CA   . GLU A 1 83  ? 12.319  -7.498  -9.898  1.00 1.00 ? 83  GLU A CA   2  
ATOM 3191  C C    . GLU A 1 83  ? 13.576  -7.548  -10.780 1.00 1.00 ? 83  GLU A C    2  
ATOM 3192  O O    . GLU A 1 83  ? 14.028  -8.634  -11.152 1.00 1.00 ? 83  GLU A O    2  
ATOM 3193  C CB   . GLU A 1 83  ? 11.104  -7.050  -10.734 1.00 1.00 ? 83  GLU A CB   2  
ATOM 3194  C CG   . GLU A 1 83  ? 9.785   -7.019  -9.946  1.00 1.00 ? 83  GLU A CG   2  
ATOM 3195  C CD   . GLU A 1 83  ? 9.460   -8.375  -9.294  1.00 1.00 ? 83  GLU A CD   2  
ATOM 3196  O OE1  . GLU A 1 83  ? 9.230   -9.368  -10.028 1.00 1.00 ? 83  GLU A OE1  2  
ATOM 3197  O OE2  . GLU A 1 83  ? 9.406   -8.451  -8.041  1.00 1.00 ? 83  GLU A OE2  2  
ATOM 3198  H H    . GLU A 1 83  ? 12.429  -5.609  -8.932  1.00 1.00 ? 83  GLU A H    2  
ATOM 3199  H HA   . GLU A 1 83  ? 12.127  -8.507  -9.546  1.00 1.00 ? 83  GLU A HA   2  
ATOM 3200  H HB2  . GLU A 1 83  ? 11.285  -6.051  -11.138 1.00 1.00 ? 83  GLU A HB2  2  
ATOM 3201  H HB3  . GLU A 1 83  ? 10.995  -7.734  -11.572 1.00 1.00 ? 83  GLU A HB3  2  
ATOM 3202  H HG2  . GLU A 1 83  ? 9.834   -6.243  -9.181  1.00 1.00 ? 83  GLU A HG2  2  
ATOM 3203  H HG3  . GLU A 1 83  ? 8.979   -6.747  -10.629 1.00 1.00 ? 83  GLU A HG3  2  
ATOM 3204  N N    . TYR A 1 84  ? 14.152  -6.381  -11.088 1.00 1.00 ? 84  TYR A N    2  
ATOM 3205  C CA   . TYR A 1 84  ? 15.310  -6.217  -11.987 1.00 1.00 ? 84  TYR A CA   2  
ATOM 3206  C C    . TYR A 1 84  ? 16.451  -5.383  -11.364 1.00 1.00 ? 84  TYR A C    2  
ATOM 3207  O O    . TYR A 1 84  ? 16.254  -4.637  -10.400 1.00 1.00 ? 84  TYR A O    2  
ATOM 3208  C CB   . TYR A 1 84  ? 14.842  -5.579  -13.312 1.00 1.00 ? 84  TYR A CB   2  
ATOM 3209  C CG   . TYR A 1 84  ? 13.537  -6.138  -13.852 1.00 1.00 ? 84  TYR A CG   2  
ATOM 3210  C CD1  . TYR A 1 84  ? 13.469  -7.466  -14.319 1.00 1.00 ? 84  TYR A CD1  2  
ATOM 3211  C CD2  . TYR A 1 84  ? 12.371  -5.354  -13.800 1.00 1.00 ? 84  TYR A CD2  2  
ATOM 3212  C CE1  . TYR A 1 84  ? 12.234  -8.018  -14.700 1.00 1.00 ? 84  TYR A CE1  2  
ATOM 3213  C CE2  . TYR A 1 84  ? 11.130  -5.899  -14.172 1.00 1.00 ? 84  TYR A CE2  2  
ATOM 3214  C CZ   . TYR A 1 84  ? 11.054  -7.240  -14.619 1.00 1.00 ? 84  TYR A CZ   2  
ATOM 3215  O OH   . TYR A 1 84  ? 9.853   -7.789  -14.964 1.00 1.00 ? 84  TYR A OH   2  
ATOM 3216  H H    . TYR A 1 84  ? 13.683  -5.541  -10.766 1.00 1.00 ? 84  TYR A H    2  
ATOM 3217  H HA   . TYR A 1 84  ? 15.722  -7.199  -12.221 1.00 1.00 ? 84  TYR A HA   2  
ATOM 3218  H HB2  . TYR A 1 84  ? 14.721  -4.507  -13.152 1.00 1.00 ? 84  TYR A HB2  2  
ATOM 3219  H HB3  . TYR A 1 84  ? 15.621  -5.709  -14.065 1.00 1.00 ? 84  TYR A HB3  2  
ATOM 3220  H HD1  . TYR A 1 84  ? 14.360  -8.077  -14.349 1.00 1.00 ? 84  TYR A HD1  2  
ATOM 3221  H HD2  . TYR A 1 84  ? 12.426  -4.336  -13.444 1.00 1.00 ? 84  TYR A HD2  2  
ATOM 3222  H HE1  . TYR A 1 84  ? 12.178  -9.042  -15.041 1.00 1.00 ? 84  TYR A HE1  2  
ATOM 3223  H HE2  . TYR A 1 84  ? 10.236  -5.298  -14.099 1.00 1.00 ? 84  TYR A HE2  2  
ATOM 3224  H HH   . TYR A 1 84  ? 9.109   -7.173  -14.873 1.00 1.00 ? 84  TYR A HH   2  
ATOM 3225  N N    . GLN A 1 85  ? 17.657  -5.482  -11.941 1.00 1.00 ? 85  GLN A N    2  
ATOM 3226  C CA   . GLN A 1 85  ? 18.796  -4.624  -11.583 1.00 1.00 ? 85  GLN A CA   2  
ATOM 3227  C C    . GLN A 1 85  ? 18.582  -3.177  -12.089 1.00 1.00 ? 85  GLN A C    2  
ATOM 3228  O O    . GLN A 1 85  ? 17.840  -2.988  -13.059 1.00 1.00 ? 85  GLN A O    2  
ATOM 3229  C CB   . GLN A 1 85  ? 20.102  -5.223  -12.138 1.00 1.00 ? 85  GLN A CB   2  
ATOM 3230  C CG   . GLN A 1 85  ? 20.523  -6.509  -11.403 1.00 1.00 ? 85  GLN A CG   2  
ATOM 3231  C CD   . GLN A 1 85  ? 20.874  -6.306  -9.922  1.00 1.00 ? 85  GLN A CD   2  
ATOM 3232  O OE1  . GLN A 1 85  ? 21.402  -5.280  -9.505  1.00 1.00 ? 85  GLN A OE1  2  
ATOM 3233  N NE2  . GLN A 1 85  ? 20.577  -7.261  -9.063  1.00 1.00 ? 85  GLN A NE2  2  
ATOM 3234  H H    . GLN A 1 85  ? 17.765  -6.093  -12.734 1.00 1.00 ? 85  GLN A H    2  
ATOM 3235  H HA   . GLN A 1 85  ? 18.858  -4.615  -10.499 1.00 1.00 ? 85  GLN A HA   2  
ATOM 3236  H HB2  . GLN A 1 85  ? 19.977  -5.441  -13.200 1.00 1.00 ? 85  GLN A HB2  2  
ATOM 3237  H HB3  . GLN A 1 85  ? 20.910  -4.493  -12.050 1.00 1.00 ? 85  GLN A HB3  2  
ATOM 3238  H HG2  . GLN A 1 85  ? 19.717  -7.233  -11.480 1.00 1.00 ? 85  GLN A HG2  2  
ATOM 3239  H HG3  . GLN A 1 85  ? 21.400  -6.924  -11.905 1.00 1.00 ? 85  GLN A HG3  2  
ATOM 3240  H HE21 . GLN A 1 85  ? 20.137  -8.114  -9.377  1.00 1.00 ? 85  GLN A HE21 2  
ATOM 3241  H HE22 . GLN A 1 85  ? 20.808  -7.123  -8.091  1.00 1.00 ? 85  GLN A HE22 2  
ATOM 3242  N N    . PRO A 1 86  ? 19.228  -2.155  -11.480 1.00 1.00 ? 86  PRO A N    2  
ATOM 3243  C CA   . PRO A 1 86  ? 19.070  -0.745  -11.848 1.00 1.00 ? 86  PRO A CA   2  
ATOM 3244  C C    . PRO A 1 86  ? 19.252  -0.480  -13.348 1.00 1.00 ? 86  PRO A C    2  
ATOM 3245  O O    . PRO A 1 86  ? 20.187  -0.987  -13.969 1.00 1.00 ? 86  PRO A O    2  
ATOM 3246  C CB   . PRO A 1 86  ? 20.098  0.024   -11.012 1.00 1.00 ? 86  PRO A CB   2  
ATOM 3247  C CG   . PRO A 1 86  ? 20.253  -0.850  -9.772  1.00 1.00 ? 86  PRO A CG   2  
ATOM 3248  C CD   . PRO A 1 86  ? 20.113  -2.262  -10.326 1.00 1.00 ? 86  PRO A CD   2  
ATOM 3249  H HA   . PRO A 1 86  ? 18.068  -0.438  -11.541 1.00 1.00 ? 86  PRO A HA   2  
ATOM 3250  H HB2  . PRO A 1 86  ? 21.058  0.079   -11.532 1.00 1.00 ? 86  PRO A HB2  2  
ATOM 3251  H HB3  . PRO A 1 86  ? 19.746  1.024   -10.759 1.00 1.00 ? 86  PRO A HB3  2  
ATOM 3252  H HG2  . PRO A 1 86  ? 21.219  -0.709  -9.289  1.00 1.00 ? 86  PRO A HG2  2  
ATOM 3253  H HG3  . PRO A 1 86  ? 19.437  -0.649  -9.078  1.00 1.00 ? 86  PRO A HG3  2  
ATOM 3254  H HD2  . PRO A 1 86  ? 21.092  -2.621  -10.648 1.00 1.00 ? 86  PRO A HD2  2  
ATOM 3255  H HD3  . PRO A 1 86  ? 19.705  -2.914  -9.553  1.00 1.00 ? 86  PRO A HD3  2  
ATOM 3256  N N    . ARG A 1 87  ? 18.331  0.302   -13.929 1.00 1.00 ? 87  ARG A N    2  
ATOM 3257  C CA   . ARG A 1 87  ? 18.334  0.717   -15.343 1.00 1.00 ? 87  ARG A CA   2  
ATOM 3258  C C    . ARG A 1 87  ? 18.923  2.148   -15.485 1.00 1.00 ? 87  ARG A C    2  
ATOM 3259  O O    . ARG A 1 87  ? 18.823  2.932   -14.537 1.00 1.00 ? 87  ARG A O    2  
ATOM 3260  C CB   . ARG A 1 87  ? 16.887  0.644   -15.893 1.00 1.00 ? 87  ARG A CB   2  
ATOM 3261  C CG   . ARG A 1 87  ? 16.149  -0.706  -15.747 1.00 1.00 ? 87  ARG A CG   2  
ATOM 3262  C CD   . ARG A 1 87  ? 16.735  -1.897  -16.523 1.00 1.00 ? 87  ARG A CD   2  
ATOM 3263  N NE   . ARG A 1 87  ? 17.972  -2.400  -15.900 1.00 1.00 ? 87  ARG A NE   2  
ATOM 3264  C CZ   . ARG A 1 87  ? 18.931  -3.120  -16.471 1.00 1.00 ? 87  ARG A CZ   2  
ATOM 3265  N NH1  . ARG A 1 87  ? 18.785  -3.666  -17.660 1.00 1.00 ? 87  ARG A NH1  2  
ATOM 3266  N NH2  . ARG A 1 87  ? 20.067  -3.292  -15.836 1.00 1.00 ? 87  ARG A NH2  2  
ATOM 3267  H H    . ARG A 1 87  ? 17.606  0.693   -13.337 1.00 1.00 ? 87  ARG A H    2  
ATOM 3268  H HA   . ARG A 1 87  ? 18.954  0.026   -15.912 1.00 1.00 ? 87  ARG A HA   2  
ATOM 3269  H HB2  . ARG A 1 87  ? 16.292  1.384   -15.362 1.00 1.00 ? 87  ARG A HB2  2  
ATOM 3270  H HB3  . ARG A 1 87  ? 16.887  0.924   -16.946 1.00 1.00 ? 87  ARG A HB3  2  
ATOM 3271  H HG2  . ARG A 1 87  ? 16.065  -0.966  -14.692 1.00 1.00 ? 87  ARG A HG2  2  
ATOM 3272  H HG3  . ARG A 1 87  ? 15.134  -0.550  -16.114 1.00 1.00 ? 87  ARG A HG3  2  
ATOM 3273  H HD2  . ARG A 1 87  ? 15.997  -2.699  -16.531 1.00 1.00 ? 87  ARG A HD2  2  
ATOM 3274  H HD3  . ARG A 1 87  ? 16.926  -1.590  -17.552 1.00 1.00 ? 87  ARG A HD3  2  
ATOM 3275  H HE   . ARG A 1 87  ? 18.064  -2.239  -14.899 1.00 1.00 ? 87  ARG A HE   2  
ATOM 3276  H HH11 . ARG A 1 87  ? 17.890  -3.638  -18.122 1.00 1.00 ? 87  ARG A HH11 2  
ATOM 3277  H HH12 . ARG A 1 87  ? 19.529  -4.214  -18.067 1.00 1.00 ? 87  ARG A HH12 2  
ATOM 3278  H HH21 . ARG A 1 87  ? 20.247  -2.768  -14.987 1.00 1.00 ? 87  ARG A HH21 2  
ATOM 3279  H HH22 . ARG A 1 87  ? 20.811  -3.836  -16.243 1.00 1.00 ? 87  ARG A HH22 2  
ATOM 3280  N N    . PRO A 1 88  ? 19.506  2.520   -16.649 1.00 1.00 ? 88  PRO A N    2  
ATOM 3281  C CA   . PRO A 1 88  ? 20.111  3.841   -16.859 1.00 1.00 ? 88  PRO A CA   2  
ATOM 3282  C C    . PRO A 1 88  ? 19.027  4.919   -17.004 1.00 1.00 ? 88  PRO A C    2  
ATOM 3283  O O    . PRO A 1 88  ? 18.314  4.961   -18.004 1.00 1.00 ? 88  PRO A O    2  
ATOM 3284  C CB   . PRO A 1 88  ? 20.992  3.701   -18.105 1.00 1.00 ? 88  PRO A CB   2  
ATOM 3285  C CG   . PRO A 1 88  ? 20.306  2.590   -18.894 1.00 1.00 ? 88  PRO A CG   2  
ATOM 3286  C CD   . PRO A 1 88  ? 19.729  1.674   -17.820 1.00 1.00 ? 88  PRO A CD   2  
ATOM 3287  H HA   . PRO A 1 88  ? 20.760  4.093   -16.017 1.00 1.00 ? 88  PRO A HA   2  
ATOM 3288  H HB2  . PRO A 1 88  ? 21.064  4.630   -18.675 1.00 1.00 ? 88  PRO A HB2  2  
ATOM 3289  H HB3  . PRO A 1 88  ? 21.987  3.364   -17.807 1.00 1.00 ? 88  PRO A HB3  2  
ATOM 3290  H HG2  . PRO A 1 88  ? 19.485  3.004   -19.471 1.00 1.00 ? 88  PRO A HG2  2  
ATOM 3291  H HG3  . PRO A 1 88  ? 21.007  2.062   -19.545 1.00 1.00 ? 88  PRO A HG3  2  
ATOM 3292  H HD2  . PRO A 1 88  ? 18.801  1.239   -18.188 1.00 1.00 ? 88  PRO A HD2  2  
ATOM 3293  H HD3  . PRO A 1 88  ? 20.457  0.897   -17.586 1.00 1.00 ? 88  PRO A HD3  2  
ATOM 3294  N N    . VAL A 1 89  ? 18.920  5.809   -16.010 1.00 1.00 ? 89  VAL A N    2  
ATOM 3295  C CA   . VAL A 1 89  ? 17.807  6.778   -15.867 1.00 1.00 ? 89  VAL A CA   2  
ATOM 3296  C C    . VAL A 1 89  ? 17.589  7.673   -17.090 1.00 1.00 ? 89  VAL A C    2  
ATOM 3297  O O    . VAL A 1 89  ? 16.446  7.972   -17.428 1.00 1.00 ? 89  VAL A O    2  
ATOM 3298  C CB   . VAL A 1 89  ? 17.960  7.618   -14.575 1.00 1.00 ? 89  VAL A CB   2  
ATOM 3299  C CG1  . VAL A 1 89  ? 19.176  8.561   -14.585 1.00 1.00 ? 89  VAL A CG1  2  
ATOM 3300  C CG2  . VAL A 1 89  ? 16.691  8.430   -14.284 1.00 1.00 ? 89  VAL A CG2  2  
ATOM 3301  H H    . VAL A 1 89  ? 19.537  5.677   -15.206 1.00 1.00 ? 89  VAL A H    2  
ATOM 3302  H HA   . VAL A 1 89  ? 16.902  6.182   -15.757 1.00 1.00 ? 89  VAL A HA   2  
ATOM 3303  H HB   . VAL A 1 89  ? 18.096  6.917   -13.753 1.00 1.00 ? 89  VAL A HB   2  
ATOM 3304  H HG11 . VAL A 1 89  ? 19.061  9.334   -15.347 1.00 1.00 ? 89  VAL A HG11 2  
ATOM 3305  H HG12 . VAL A 1 89  ? 19.274  9.045   -13.612 1.00 1.00 ? 89  VAL A HG12 2  
ATOM 3306  H HG13 . VAL A 1 89  ? 20.090  7.999   -14.779 1.00 1.00 ? 89  VAL A HG13 2  
ATOM 3307  H HG21 . VAL A 1 89  ? 16.553  9.211   -15.031 1.00 1.00 ? 89  VAL A HG21 2  
ATOM 3308  H HG22 . VAL A 1 89  ? 15.823  7.768   -14.292 1.00 1.00 ? 89  VAL A HG22 2  
ATOM 3309  H HG23 . VAL A 1 89  ? 16.782  8.893   -13.304 1.00 1.00 ? 89  VAL A HG23 2  
ATOM 3310  N N    . GLU A 1 90  ? 18.659  8.035   -17.805 1.00 1.00 ? 90  GLU A N    2  
ATOM 3311  C CA   . GLU A 1 90  ? 18.550  8.835   -19.028 1.00 1.00 ? 90  GLU A CA   2  
ATOM 3312  C C    . GLU A 1 90  ? 17.720  8.113   -20.102 1.00 1.00 ? 90  GLU A C    2  
ATOM 3313  O O    . GLU A 1 90  ? 16.889  8.739   -20.752 1.00 1.00 ? 90  GLU A O    2  
ATOM 3314  C CB   . GLU A 1 90  ? 19.945  9.234   -19.543 1.00 1.00 ? 90  GLU A CB   2  
ATOM 3315  C CG   . GLU A 1 90  ? 20.854  8.073   -19.983 1.00 1.00 ? 90  GLU A CG   2  
ATOM 3316  C CD   . GLU A 1 90  ? 22.253  8.588   -20.352 1.00 1.00 ? 90  GLU A CD   2  
ATOM 3317  O OE1  . GLU A 1 90  ? 22.471  8.961   -21.529 1.00 1.00 ? 90  GLU A OE1  2  
ATOM 3318  O OE2  . GLU A 1 90  ? 23.144  8.616   -19.471 1.00 1.00 ? 90  GLU A OE2  2  
ATOM 3319  H H    . GLU A 1 90  ? 19.581  7.797   -17.456 1.00 1.00 ? 90  GLU A H    2  
ATOM 3320  H HA   . GLU A 1 90  ? 18.022  9.755   -18.769 1.00 1.00 ? 90  GLU A HA   2  
ATOM 3321  H HB2  . GLU A 1 90  ? 19.813  9.906   -20.387 1.00 1.00 ? 90  GLU A HB2  2  
ATOM 3322  H HB3  . GLU A 1 90  ? 20.446  9.784   -18.746 1.00 1.00 ? 90  GLU A HB3  2  
ATOM 3323  H HG2  . GLU A 1 90  ? 20.941  7.341   -19.178 1.00 1.00 ? 90  GLU A HG2  2  
ATOM 3324  H HG3  . GLU A 1 90  ? 20.418  7.574   -20.850 1.00 1.00 ? 90  GLU A HG3  2  
ATOM 3325  N N    . VAL A 1 91  ? 17.861  6.787   -20.220 1.00 1.00 ? 91  VAL A N    2  
ATOM 3326  C CA   . VAL A 1 91  ? 17.105  5.970   -21.189 1.00 1.00 ? 91  VAL A CA   2  
ATOM 3327  C C    . VAL A 1 91  ? 15.629  5.868   -20.785 1.00 1.00 ? 91  VAL A C    2  
ATOM 3328  O O    . VAL A 1 91  ? 14.761  5.920   -21.651 1.00 1.00 ? 91  VAL A O    2  
ATOM 3329  C CB   . VAL A 1 91  ? 17.711  4.561   -21.396 1.00 1.00 ? 91  VAL A CB   2  
ATOM 3330  C CG1  . VAL A 1 91  ? 17.050  3.834   -22.577 1.00 1.00 ? 91  VAL A CG1  2  
ATOM 3331  C CG2  . VAL A 1 91  ? 19.227  4.601   -21.655 1.00 1.00 ? 91  VAL A CG2  2  
ATOM 3332  H H    . VAL A 1 91  ? 18.513  6.329   -19.596 1.00 1.00 ? 91  VAL A H    2  
ATOM 3333  H HA   . VAL A 1 91  ? 17.170  6.490   -22.142 1.00 1.00 ? 91  VAL A HA   2  
ATOM 3334  H HB   . VAL A 1 91  ? 17.537  3.975   -20.491 1.00 1.00 ? 91  VAL A HB   2  
ATOM 3335  H HG11 . VAL A 1 91  ? 17.200  4.402   -23.498 1.00 1.00 ? 91  VAL A HG11 2  
ATOM 3336  H HG12 . VAL A 1 91  ? 17.495  2.846   -22.689 1.00 1.00 ? 91  VAL A HG12 2  
ATOM 3337  H HG13 . VAL A 1 91  ? 15.981  3.713   -22.409 1.00 1.00 ? 91  VAL A HG13 2  
ATOM 3338  H HG21 . VAL A 1 91  ? 19.445  5.210   -22.535 1.00 1.00 ? 91  VAL A HG21 2  
ATOM 3339  H HG22 . VAL A 1 91  ? 19.748  5.019   -20.795 1.00 1.00 ? 91  VAL A HG22 2  
ATOM 3340  H HG23 . VAL A 1 91  ? 19.604  3.589   -21.813 1.00 1.00 ? 91  VAL A HG23 2  
ATOM 3341  N N    . ILE A 1 92  ? 15.324  5.787   -19.479 1.00 1.00 ? 92  ILE A N    2  
ATOM 3342  C CA   . ILE A 1 92  ? 13.935  5.821   -18.970 1.00 1.00 ? 92  ILE A CA   2  
ATOM 3343  C C    . ILE A 1 92  ? 13.259  7.137   -19.370 1.00 1.00 ? 92  ILE A C    2  
ATOM 3344  O O    . ILE A 1 92  ? 12.167  7.134   -19.928 1.00 1.00 ? 92  ILE A O    2  
ATOM 3345  C CB   . ILE A 1 92  ? 13.908  5.625   -17.428 1.00 1.00 ? 92  ILE A CB   2  
ATOM 3346  C CG1  . ILE A 1 92  ? 14.724  4.390   -16.973 1.00 1.00 ? 92  ILE A CG1  2  
ATOM 3347  C CG2  . ILE A 1 92  ? 12.450  5.521   -16.933 1.00 1.00 ? 92  ILE A CG2  2  
ATOM 3348  C CD1  . ILE A 1 92  ? 14.780  4.232   -15.451 1.00 1.00 ? 92  ILE A CD1  2  
ATOM 3349  H H    . ILE A 1 92  ? 16.086  5.712   -18.810 1.00 1.00 ? 92  ILE A H    2  
ATOM 3350  H HA   . ILE A 1 92  ? 13.363  5.017   -19.439 1.00 1.00 ? 92  ILE A HA   2  
ATOM 3351  H HB   . ILE A 1 92  ? 14.357  6.500   -16.952 1.00 1.00 ? 92  ILE A HB   2  
ATOM 3352  H HG12 . ILE A 1 92  ? 14.310  3.485   -17.420 1.00 1.00 ? 92  ILE A HG12 2  
ATOM 3353  H HG13 . ILE A 1 92  ? 15.755  4.491   -17.316 1.00 1.00 ? 92  ILE A HG13 2  
ATOM 3354  H HG21 . ILE A 1 92  ? 12.417  5.543   -15.844 1.00 1.00 ? 92  ILE A HG21 2  
ATOM 3355  H HG22 . ILE A 1 92  ? 11.855  6.359   -17.295 1.00 1.00 ? 92  ILE A HG22 2  
ATOM 3356  H HG23 . ILE A 1 92  ? 11.997  4.592   -17.284 1.00 1.00 ? 92  ILE A HG23 2  
ATOM 3357  H HD11 . ILE A 1 92  ? 13.818  3.892   -15.067 1.00 1.00 ? 92  ILE A HD11 2  
ATOM 3358  H HD12 . ILE A 1 92  ? 15.546  3.504   -15.192 1.00 1.00 ? 92  ILE A HD12 2  
ATOM 3359  H HD13 . ILE A 1 92  ? 15.038  5.186   -14.990 1.00 1.00 ? 92  ILE A HD13 2  
ATOM 3360  N N    . ILE A 1 93  ? 13.930  8.266   -19.134 1.00 1.00 ? 93  ILE A N    2  
ATOM 3361  C CA   . ILE A 1 93  ? 13.415  9.609   -19.437 1.00 1.00 ? 93  ILE A CA   2  
ATOM 3362  C C    . ILE A 1 93  ? 13.341  9.861   -20.945 1.00 1.00 ? 93  ILE A C    2  
ATOM 3363  O O    . ILE A 1 93  ? 12.347  10.404  -21.409 1.00 1.00 ? 93  ILE A O    2  
ATOM 3364  C CB   . ILE A 1 93  ? 14.230  10.666  -18.652 1.00 1.00 ? 93  ILE A CB   2  
ATOM 3365  C CG1  . ILE A 1 93  ? 13.915  10.503  -17.141 1.00 1.00 ? 93  ILE A CG1  2  
ATOM 3366  C CG2  . ILE A 1 93  ? 13.892  12.098  -19.111 1.00 1.00 ? 93  ILE A CG2  2  
ATOM 3367  C CD1  . ILE A 1 93  ? 14.807  11.314  -16.202 1.00 1.00 ? 93  ILE A CD1  2  
ATOM 3368  H H    . ILE A 1 93  ? 14.830  8.202   -18.674 1.00 1.00 ? 93  ILE A H    2  
ATOM 3369  H HA   . ILE A 1 93  ? 12.384  9.651   -19.091 1.00 1.00 ? 93  ILE A HA   2  
ATOM 3370  H HB   . ILE A 1 93  ? 15.295  10.488  -18.834 1.00 1.00 ? 93  ILE A HB   2  
ATOM 3371  H HG12 . ILE A 1 93  ? 12.878  10.791  -16.966 1.00 1.00 ? 93  ILE A HG12 2  
ATOM 3372  H HG13 . ILE A 1 93  ? 14.023  9.458   -16.846 1.00 1.00 ? 93  ILE A HG13 2  
ATOM 3373  H HG21 . ILE A 1 93  ? 14.444  12.832  -18.524 1.00 1.00 ? 93  ILE A HG21 2  
ATOM 3374  H HG22 . ILE A 1 93  ? 14.192  12.236  -20.149 1.00 1.00 ? 93  ILE A HG22 2  
ATOM 3375  H HG23 . ILE A 1 93  ? 12.821  12.283  -19.022 1.00 1.00 ? 93  ILE A HG23 2  
ATOM 3376  H HD11 . ILE A 1 93  ? 15.852  11.057  -16.377 1.00 1.00 ? 93  ILE A HD11 2  
ATOM 3377  H HD12 . ILE A 1 93  ? 14.666  12.383  -16.357 1.00 1.00 ? 93  ILE A HD12 2  
ATOM 3378  H HD13 . ILE A 1 93  ? 14.537  11.071  -15.173 1.00 1.00 ? 93  ILE A HD13 2  
ATOM 3379  N N    . SER A 1 94  ? 14.314  9.415   -21.733 1.00 1.00 ? 94  SER A N    2  
ATOM 3380  C CA   . SER A 1 94  ? 14.230  9.478   -23.197 1.00 1.00 ? 94  SER A CA   2  
ATOM 3381  C C    . SER A 1 94  ? 13.083  8.622   -23.749 1.00 1.00 ? 94  SER A C    2  
ATOM 3382  O O    . SER A 1 94  ? 12.378  9.048   -24.657 1.00 1.00 ? 94  SER A O    2  
ATOM 3383  C CB   . SER A 1 94  ? 15.557  9.068   -23.849 1.00 1.00 ? 94  SER A CB   2  
ATOM 3384  O OG   . SER A 1 94  ? 16.536  10.084  -23.667 1.00 1.00 ? 94  SER A OG   2  
ATOM 3385  H H    . SER A 1 94  ? 15.170  9.061   -21.316 1.00 1.00 ? 94  SER A H    2  
ATOM 3386  H HA   . SER A 1 94  ? 14.018  10.502  -23.479 1.00 1.00 ? 94  SER A HA   2  
ATOM 3387  H HB2  . SER A 1 94  ? 15.905  8.126   -23.415 1.00 1.00 ? 94  SER A HB2  2  
ATOM 3388  H HB3  . SER A 1 94  ? 15.398  8.924   -24.921 1.00 1.00 ? 94  SER A HB3  2  
ATOM 3389  H HG   . SER A 1 94  ? 17.389  9.793   -24.057 1.00 1.00 ? 94  SER A HG   2  
ATOM 3390  N N    . SER A 1 95  ? 12.837  7.449   -23.169 1.00 1.00 ? 95  SER A N    2  
ATOM 3391  C CA   . SER A 1 95  ? 11.687  6.606   -23.510 1.00 1.00 ? 95  SER A CA   2  
ATOM 3392  C C    . SER A 1 95  ? 10.367  7.320   -23.190 1.00 1.00 ? 95  SER A C    2  
ATOM 3393  O O    . SER A 1 95  ? 9.483   7.398   -24.042 1.00 1.00 ? 95  SER A O    2  
ATOM 3394  C CB   . SER A 1 95  ? 11.787  5.262   -22.776 1.00 1.00 ? 95  SER A CB   2  
ATOM 3395  O OG   . SER A 1 95  ? 10.839  4.337   -23.293 1.00 1.00 ? 95  SER A OG   2  
ATOM 3396  H H    . SER A 1 95  ? 13.455  7.141   -22.432 1.00 1.00 ? 95  SER A H    2  
ATOM 3397  H HA   . SER A 1 95  ? 11.706  6.407   -24.579 1.00 1.00 ? 95  SER A HA   2  
ATOM 3398  H HB2  . SER A 1 95  ? 12.791  4.860   -22.924 1.00 1.00 ? 95  SER A HB2  2  
ATOM 3399  H HB3  . SER A 1 95  ? 11.614  5.410   -21.710 1.00 1.00 ? 95  SER A HB3  2  
ATOM 3400  H HG   . SER A 1 95  ? 11.081  3.424   -23.034 1.00 1.00 ? 95  SER A HG   2  
ATOM 3401  N N    . ALA A 1 96  ? 10.260  7.941   -22.007 1.00 1.00 ? 96  ALA A N    2  
ATOM 3402  C CA   . ALA A 1 96  ? 9.113   8.751   -21.628 1.00 1.00 ? 96  ALA A CA   2  
ATOM 3403  C C    . ALA A 1 96  ? 8.892   9.899   -22.634 1.00 1.00 ? 96  ALA A C    2  
ATOM 3404  O O    . ALA A 1 96  ? 7.795   10.064  -23.169 1.00 1.00 ? 96  ALA A O    2  
ATOM 3405  C CB   . ALA A 1 96  ? 9.364   9.229   -20.188 1.00 1.00 ? 96  ALA A CB   2  
ATOM 3406  H H    . ALA A 1 96  ? 11.016  7.866   -21.334 1.00 1.00 ? 96  ALA A H    2  
ATOM 3407  H HA   . ALA A 1 96  ? 8.225   8.117   -21.637 1.00 1.00 ? 96  ALA A HA   2  
ATOM 3408  H HB1  . ALA A 1 96  ? 8.459   9.659   -19.766 1.00 1.00 ? 96  ALA A HB1  2  
ATOM 3409  H HB2  . ALA A 1 96  ? 9.668   8.388   -19.561 1.00 1.00 ? 96  ALA A HB2  2  
ATOM 3410  H HB3  . ALA A 1 96  ? 10.159  9.974   -20.168 1.00 1.00 ? 96  ALA A HB3  2  
ATOM 3411  N N    . LYS A 1 97  ? 9.945   10.659  -22.953 1.00 1.00 ? 97  LYS A N    2  
ATOM 3412  C CA   . LYS A 1 97  ? 9.896   11.763  -23.920 1.00 1.00 ? 97  LYS A CA   2  
ATOM 3413  C C    . LYS A 1 97  ? 9.515   11.310  -25.338 1.00 1.00 ? 97  LYS A C    2  
ATOM 3414  O O    . LYS A 1 97  ? 8.723   11.980  -26.001 1.00 1.00 ? 97  LYS A O    2  
ATOM 3415  C CB   . LYS A 1 97  ? 11.256  12.473  -23.919 1.00 1.00 ? 97  LYS A CB   2  
ATOM 3416  C CG   . LYS A 1 97  ? 11.469  13.335  -22.664 1.00 1.00 ? 97  LYS A CG   2  
ATOM 3417  C CD   . LYS A 1 97  ? 12.916  13.840  -22.635 1.00 1.00 ? 97  LYS A CD   2  
ATOM 3418  C CE   . LYS A 1 97  ? 13.128  14.865  -21.509 1.00 1.00 ? 97  LYS A CE   2  
ATOM 3419  N NZ   . LYS A 1 97  ? 14.504  15.448  -21.547 1.00 1.00 ? 97  LYS A NZ   2  
ATOM 3420  H H    . LYS A 1 97  ? 10.834  10.468  -22.498 1.00 1.00 ? 97  LYS A H    2  
ATOM 3421  H HA   . LYS A 1 97  ? 9.128   12.465  -23.607 1.00 1.00 ? 97  LYS A HA   2  
ATOM 3422  H HB2  . LYS A 1 97  ? 12.053  11.732  -24.000 1.00 1.00 ? 97  LYS A HB2  2  
ATOM 3423  H HB3  . LYS A 1 97  ? 11.315  13.125  -24.795 1.00 1.00 ? 97  LYS A HB3  2  
ATOM 3424  H HG2  . LYS A 1 97  ? 10.782  14.183  -22.695 1.00 1.00 ? 97  LYS A HG2  2  
ATOM 3425  H HG3  . LYS A 1 97  ? 11.276  12.751  -21.761 1.00 1.00 ? 97  LYS A HG3  2  
ATOM 3426  H HD2  . LYS A 1 97  ? 13.573  12.978  -22.494 1.00 1.00 ? 97  LYS A HD2  2  
ATOM 3427  H HD3  . LYS A 1 97  ? 13.147  14.306  -23.596 1.00 1.00 ? 97  LYS A HD3  2  
ATOM 3428  H HE2  . LYS A 1 97  ? 12.391  15.670  -21.627 1.00 1.00 ? 97  LYS A HE2  2  
ATOM 3429  H HE3  . LYS A 1 97  ? 12.940  14.386  -20.542 1.00 1.00 ? 97  LYS A HE3  2  
ATOM 3430  H HZ1  . LYS A 1 97  ? 14.632  16.136  -20.813 1.00 1.00 ? 97  LYS A HZ1  2  
ATOM 3431  H HZ2  . LYS A 1 97  ? 15.216  14.737  -21.428 1.00 1.00 ? 97  LYS A HZ2  2  
ATOM 3432  H HZ3  . LYS A 1 97  ? 14.685  15.916  -22.428 1.00 1.00 ? 97  LYS A HZ3  2  
ATOM 3433  N N    . GLU A 1 98  ? 10.019  10.159  -25.785 1.00 1.00 ? 98  GLU A N    2  
ATOM 3434  C CA   . GLU A 1 98  ? 9.640   9.544   -27.060 1.00 1.00 ? 98  GLU A CA   2  
ATOM 3435  C C    . GLU A 1 98  ? 8.171   9.090   -27.073 1.00 1.00 ? 98  GLU A C    2  
ATOM 3436  O O    . GLU A 1 98  ? 7.502   9.179   -28.106 1.00 1.00 ? 98  GLU A O    2  
ATOM 3437  C CB   . GLU A 1 98  ? 10.567  8.364   -27.396 1.00 1.00 ? 98  GLU A CB   2  
ATOM 3438  C CG   . GLU A 1 98  ? 11.945  8.808   -27.912 1.00 1.00 ? 98  GLU A CG   2  
ATOM 3439  C CD   . GLU A 1 98  ? 11.857  9.433   -29.313 1.00 1.00 ? 98  GLU A CD   2  
ATOM 3440  O OE1  . GLU A 1 98  ? 11.757  8.679   -30.309 1.00 1.00 ? 98  GLU A OE1  2  
ATOM 3441  O OE2  . GLU A 1 98  ? 11.899  10.682  -29.432 1.00 1.00 ? 98  GLU A OE2  2  
ATOM 3442  H H    . GLU A 1 98  ? 10.708  9.691   -25.208 1.00 1.00 ? 98  GLU A H    2  
ATOM 3443  H HA   . GLU A 1 98  ? 9.746   10.302  -27.828 1.00 1.00 ? 98  GLU A HA   2  
ATOM 3444  H HB2  . GLU A 1 98  ? 10.697  7.740   -26.510 1.00 1.00 ? 98  GLU A HB2  2  
ATOM 3445  H HB3  . GLU A 1 98  ? 10.101  7.750   -28.165 1.00 1.00 ? 98  GLU A HB3  2  
ATOM 3446  H HG2  . GLU A 1 98  ? 12.385  9.520   -27.215 1.00 1.00 ? 98  GLU A HG2  2  
ATOM 3447  H HG3  . GLU A 1 98  ? 12.599  7.934   -27.952 1.00 1.00 ? 98  GLU A HG3  2  
ATOM 3448  N N    . MET A 1 99  ? 7.648   8.640   -25.929 1.00 1.00 ? 99  MET A N    2  
ATOM 3449  C CA   . MET A 1 99  ? 6.243   8.268   -25.770 1.00 1.00 ? 99  MET A CA   2  
ATOM 3450  C C    . MET A 1 99  ? 5.310   9.486   -25.730 1.00 1.00 ? 99  MET A C    2  
ATOM 3451  O O    . MET A 1 99  ? 4.260   9.437   -26.364 1.00 1.00 ? 99  MET A O    2  
ATOM 3452  C CB   . MET A 1 99  ? 6.064   7.346   -24.558 1.00 1.00 ? 99  MET A CB   2  
ATOM 3453  C CG   . MET A 1 99  ? 6.717   5.978   -24.811 1.00 1.00 ? 99  MET A CG   2  
ATOM 3454  S SD   . MET A 1 99  ? 5.848   4.891   -25.967 1.00 1.00 ? 99  MET A SD   2  
ATOM 3455  C CE   . MET A 1 99  ? 4.657   4.156   -24.822 1.00 1.00 ? 99  MET A CE   2  
ATOM 3456  H H    . MET A 1 99  ? 8.271   8.468   -25.149 1.00 1.00 ? 99  MET A H    2  
ATOM 3457  H HA   . MET A 1 99  ? 5.960   7.694   -26.644 1.00 1.00 ? 99  MET A HA   2  
ATOM 3458  H HB2  . MET A 1 99  ? 6.503   7.805   -23.672 1.00 1.00 ? 99  MET A HB2  2  
ATOM 3459  H HB3  . MET A 1 99  ? 5.001   7.201   -24.382 1.00 1.00 ? 99  MET A HB3  2  
ATOM 3460  H HG2  . MET A 1 99  ? 7.729   6.127   -25.188 1.00 1.00 ? 99  MET A HG2  2  
ATOM 3461  H HG3  . MET A 1 99  ? 6.823   5.452   -23.865 1.00 1.00 ? 99  MET A HG3  2  
ATOM 3462  H HE1  . MET A 1 99  ? 4.109   3.355   -25.321 1.00 1.00 ? 99  MET A HE1  2  
ATOM 3463  H HE2  . MET A 1 99  ? 5.178   3.741   -23.957 1.00 1.00 ? 99  MET A HE2  2  
ATOM 3464  H HE3  . MET A 1 99  ? 3.949   4.912   -24.491 1.00 1.00 ? 99  MET A HE3  2  
ATOM 3465  N N    . VAL A 1 100 ? 5.683   10.581  -25.052 1.00 1.00 ? 100 VAL A N    2  
ATOM 3466  C CA   . VAL A 1 100 ? 4.937   11.863  -25.091 1.00 1.00 ? 100 VAL A CA   2  
ATOM 3467  C C    . VAL A 1 100 ? 4.580   12.264  -26.526 1.00 1.00 ? 100 VAL A C    2  
ATOM 3468  O O    . VAL A 1 100 ? 5.431   12.312  -27.414 1.00 1.00 ? 100 VAL A O    2  
ATOM 3469  C CB   . VAL A 1 100 ? 5.664   13.032  -24.387 1.00 1.00 ? 100 VAL A CB   2  
ATOM 3470  C CG1  . VAL A 1 100 ? 4.977   14.398  -24.572 1.00 1.00 ? 100 VAL A CG1  2  
ATOM 3471  C CG2  . VAL A 1 100 ? 5.717   12.787  -22.879 1.00 1.00 ? 100 VAL A CG2  2  
ATOM 3472  H H    . VAL A 1 100 ? 6.516   10.501  -24.472 1.00 1.00 ? 100 VAL A H    2  
ATOM 3473  H HA   . VAL A 1 100 ? 4.001   11.700  -24.562 1.00 1.00 ? 100 VAL A HA   2  
ATOM 3474  H HB   . VAL A 1 100 ? 6.684   13.101  -24.759 1.00 1.00 ? 100 VAL A HB   2  
ATOM 3475  H HG11 . VAL A 1 100 ? 3.942   14.352  -24.231 1.00 1.00 ? 100 VAL A HG11 2  
ATOM 3476  H HG12 . VAL A 1 100 ? 5.496   15.160  -23.991 1.00 1.00 ? 100 VAL A HG12 2  
ATOM 3477  H HG13 . VAL A 1 100 ? 5.004   14.702  -25.619 1.00 1.00 ? 100 VAL A HG13 2  
ATOM 3478  H HG21 . VAL A 1 100 ? 6.361   13.538  -22.419 1.00 1.00 ? 100 VAL A HG21 2  
ATOM 3479  H HG22 . VAL A 1 100 ? 4.717   12.853  -22.450 1.00 1.00 ? 100 VAL A HG22 2  
ATOM 3480  H HG23 . VAL A 1 100 ? 6.119   11.804  -22.669 1.00 1.00 ? 100 VAL A HG23 2  
ATOM 3481  N N    . GLY A 1 101 ? 3.291   12.557  -26.723 1.00 1.00 ? 101 GLY A N    2  
ATOM 3482  C CA   . GLY A 1 101 ? 2.686   12.918  -28.007 1.00 1.00 ? 101 GLY A CA   2  
ATOM 3483  C C    . GLY A 1 101 ? 2.002   11.740  -28.704 1.00 1.00 ? 101 GLY A C    2  
ATOM 3484  O O    . GLY A 1 101 ? 1.231   11.972  -29.635 1.00 1.00 ? 101 GLY A O    2  
ATOM 3485  H H    . GLY A 1 101 ? 2.666   12.483  -25.926 1.00 1.00 ? 101 GLY A H    2  
ATOM 3486  H HA2  . GLY A 1 101 ? 1.924   13.678  -27.832 1.00 1.00 ? 101 GLY A HA2  2  
ATOM 3487  H HA3  . GLY A 1 101 ? 3.449   13.313  -28.681 1.00 1.00 ? 101 GLY A HA3  2  
ATOM 3488  N N    . GLN A 1 102 ? 2.246   10.495  -28.273 1.00 1.00 ? 102 GLN A N    2  
ATOM 3489  C CA   . GLN A 1 102 ? 1.611   9.311   -28.834 1.00 1.00 ? 102 GLN A CA   2  
ATOM 3490  C C    . GLN A 1 102 ? 0.232   9.068   -28.204 1.00 1.00 ? 102 GLN A C    2  
ATOM 3491  O O    . GLN A 1 102 ? 0.026   9.245   -26.999 1.00 1.00 ? 102 GLN A O    2  
ATOM 3492  C CB   . GLN A 1 102 ? 2.514   8.072   -28.703 1.00 1.00 ? 102 GLN A CB   2  
ATOM 3493  C CG   . GLN A 1 102 ? 3.859   8.225   -29.445 1.00 1.00 ? 102 GLN A CG   2  
ATOM 3494  C CD   . GLN A 1 102 ? 4.689   6.937   -29.455 1.00 1.00 ? 102 GLN A CD   2  
ATOM 3495  O OE1  . GLN A 1 102 ? 4.201   5.850   -29.743 1.00 1.00 ? 102 GLN A OE1  2  
ATOM 3496  N NE2  . GLN A 1 102 ? 5.975   6.998   -29.172 1.00 1.00 ? 102 GLN A NE2  2  
ATOM 3497  H H    . GLN A 1 102 ? 2.895   10.340  -27.520 1.00 1.00 ? 102 GLN A H    2  
ATOM 3498  H HA   . GLN A 1 102 ? 1.473   9.502   -29.895 1.00 1.00 ? 102 GLN A HA   2  
ATOM 3499  H HB2  . GLN A 1 102 ? 2.698   7.856   -27.650 1.00 1.00 ? 102 GLN A HB2  2  
ATOM 3500  H HB3  . GLN A 1 102 ? 1.978   7.220   -29.127 1.00 1.00 ? 102 GLN A HB3  2  
ATOM 3501  H HG2  . GLN A 1 102 ? 3.670   8.514   -30.481 1.00 1.00 ? 102 GLN A HG2  2  
ATOM 3502  H HG3  . GLN A 1 102 ? 4.442   9.022   -28.983 1.00 1.00 ? 102 GLN A HG3  2  
ATOM 3503  H HE21 . GLN A 1 102 ? 6.417   7.878   -28.915 1.00 1.00 ? 102 GLN A HE21 2  
ATOM 3504  H HE22 . GLN A 1 102 ? 6.507   6.141   -29.188 1.00 1.00 ? 102 GLN A HE22 2  
ATOM 3505  N N    . LYS A 1 103 ? -0.707  8.619   -29.040 1.00 1.00 ? 103 LYS A N    2  
ATOM 3506  C CA   . LYS A 1 103 ? -2.056  8.191   -28.646 1.00 1.00 ? 103 LYS A CA   2  
ATOM 3507  C C    . LYS A 1 103 ? -2.147  6.666   -28.435 1.00 1.00 ? 103 LYS A C    2  
ATOM 3508  O O    . LYS A 1 103 ? -1.491  5.890   -29.135 1.00 1.00 ? 103 LYS A O    2  
ATOM 3509  C CB   . LYS A 1 103 ? -3.073  8.656   -29.700 1.00 1.00 ? 103 LYS A CB   2  
ATOM 3510  C CG   . LYS A 1 103 ? -3.365  10.159  -29.576 1.00 1.00 ? 103 LYS A CG   2  
ATOM 3511  C CD   . LYS A 1 103 ? -4.421  10.581  -30.606 1.00 1.00 ? 103 LYS A CD   2  
ATOM 3512  C CE   . LYS A 1 103 ? -5.007  11.971  -30.309 1.00 1.00 ? 103 LYS A CE   2  
ATOM 3513  N NZ   . LYS A 1 103 ? -4.039  13.080  -30.541 1.00 1.00 ? 103 LYS A NZ   2  
ATOM 3514  H H    . LYS A 1 103 ? -0.447  8.483   -30.009 1.00 1.00 ? 103 LYS A H    2  
ATOM 3515  H HA   . LYS A 1 103 ? -2.318  8.674   -27.706 1.00 1.00 ? 103 LYS A HA   2  
ATOM 3516  H HB2  . LYS A 1 103 ? -2.706  8.426   -30.702 1.00 1.00 ? 103 LYS A HB2  2  
ATOM 3517  H HB3  . LYS A 1 103 ? -4.011  8.116   -29.544 1.00 1.00 ? 103 LYS A HB3  2  
ATOM 3518  H HG2  . LYS A 1 103 ? -3.741  10.364  -28.571 1.00 1.00 ? 103 LYS A HG2  2  
ATOM 3519  H HG3  . LYS A 1 103 ? -2.447  10.730  -29.733 1.00 1.00 ? 103 LYS A HG3  2  
ATOM 3520  H HD2  . LYS A 1 103 ? -3.994  10.557  -31.610 1.00 1.00 ? 103 LYS A HD2  2  
ATOM 3521  H HD3  . LYS A 1 103 ? -5.246  9.867   -30.576 1.00 1.00 ? 103 LYS A HD3  2  
ATOM 3522  H HE2  . LYS A 1 103 ? -5.881  12.112  -30.952 1.00 1.00 ? 103 LYS A HE2  2  
ATOM 3523  H HE3  . LYS A 1 103 ? -5.349  11.980  -29.269 1.00 1.00 ? 103 LYS A HE3  2  
ATOM 3524  H HZ1  . LYS A 1 103 ? -3.570  12.998  -31.431 1.00 1.00 ? 103 LYS A HZ1  2  
ATOM 3525  H HZ2  . LYS A 1 103 ? -4.513  13.973  -30.525 1.00 1.00 ? 103 LYS A HZ2  2  
ATOM 3526  H HZ3  . LYS A 1 103 ? -3.339  13.123  -29.796 1.00 1.00 ? 103 LYS A HZ3  2  
ATOM 3527  N N    . MET A 1 104 ? -3.000  6.253   -27.493 1.00 1.00 ? 104 MET A N    2  
ATOM 3528  C CA   . MET A 1 104 ? -3.274  4.858   -27.113 1.00 1.00 ? 104 MET A CA   2  
ATOM 3529  C C    . MET A 1 104 ? -4.784  4.574   -27.184 1.00 1.00 ? 104 MET A C    2  
ATOM 3530  O O    . MET A 1 104 ? -5.598  5.478   -26.978 1.00 1.00 ? 104 MET A O    2  
ATOM 3531  C CB   . MET A 1 104 ? -2.759  4.589   -25.682 1.00 1.00 ? 104 MET A CB   2  
ATOM 3532  C CG   . MET A 1 104 ? -1.298  5.001   -25.439 1.00 1.00 ? 104 MET A CG   2  
ATOM 3533  S SD   . MET A 1 104 ? -0.067  4.154   -26.466 1.00 1.00 ? 104 MET A SD   2  
ATOM 3534  C CE   . MET A 1 104 ? 1.392   5.138   -26.030 1.00 1.00 ? 104 MET A CE   2  
ATOM 3535  H H    . MET A 1 104 ? -3.539  6.969   -27.015 1.00 1.00 ? 104 MET A H    2  
ATOM 3536  H HA   . MET A 1 104 ? -2.763  4.178   -27.798 1.00 1.00 ? 104 MET A HA   2  
ATOM 3537  H HB2  . MET A 1 104 ? -3.384  5.135   -24.975 1.00 1.00 ? 104 MET A HB2  2  
ATOM 3538  H HB3  . MET A 1 104 ? -2.863  3.524   -25.460 1.00 1.00 ? 104 MET A HB3  2  
ATOM 3539  H HG2  . MET A 1 104 ? -1.201  6.080   -25.588 1.00 1.00 ? 104 MET A HG2  2  
ATOM 3540  H HG3  . MET A 1 104 ? -1.057  4.797   -24.394 1.00 1.00 ? 104 MET A HG3  2  
ATOM 3541  H HE1  . MET A 1 104 ? 1.570   5.093   -24.954 1.00 1.00 ? 104 MET A HE1  2  
ATOM 3542  H HE2  . MET A 1 104 ? 2.267   4.749   -26.552 1.00 1.00 ? 104 MET A HE2  2  
ATOM 3543  H HE3  . MET A 1 104 ? 1.239   6.174   -26.330 1.00 1.00 ? 104 MET A HE3  2  
ATOM 3544  N N    . LYS A 1 105 ? -5.174  3.321   -27.429 1.00 1.00 ? 105 LYS A N    2  
ATOM 3545  C CA   . LYS A 1 105 ? -6.590  2.904   -27.405 1.00 1.00 ? 105 LYS A CA   2  
ATOM 3546  C C    . LYS A 1 105 ? -7.244  3.096   -26.018 1.00 1.00 ? 105 LYS A C    2  
ATOM 3547  O O    . LYS A 1 105 ? -6.561  3.153   -24.993 1.00 1.00 ? 105 LYS A O    2  
ATOM 3548  C CB   . LYS A 1 105 ? -6.717  1.459   -27.935 1.00 1.00 ? 105 LYS A CB   2  
ATOM 3549  C CG   . LYS A 1 105 ? -6.063  0.395   -27.034 1.00 1.00 ? 105 LYS A CG   2  
ATOM 3550  C CD   . LYS A 1 105 ? -6.216  -1.003  -27.650 1.00 1.00 ? 105 LYS A CD   2  
ATOM 3551  C CE   . LYS A 1 105 ? -5.556  -2.060  -26.751 1.00 1.00 ? 105 LYS A CE   2  
ATOM 3552  N NZ   . LYS A 1 105 ? -5.663  -3.425  -27.333 1.00 1.00 ? 105 LYS A NZ   2  
ATOM 3553  H H    . LYS A 1 105 ? -4.468  2.616   -27.597 1.00 1.00 ? 105 LYS A H    2  
ATOM 3554  H HA   . LYS A 1 105 ? -7.135  3.550   -28.096 1.00 1.00 ? 105 LYS A HA   2  
ATOM 3555  H HB2  . LYS A 1 105 ? -7.777  1.220   -28.046 1.00 1.00 ? 105 LYS A HB2  2  
ATOM 3556  H HB3  . LYS A 1 105 ? -6.266  1.416   -28.927 1.00 1.00 ? 105 LYS A HB3  2  
ATOM 3557  H HG2  . LYS A 1 105 ? -5.003  0.618   -26.913 1.00 1.00 ? 105 LYS A HG2  2  
ATOM 3558  H HG3  . LYS A 1 105 ? -6.542  0.399   -26.053 1.00 1.00 ? 105 LYS A HG3  2  
ATOM 3559  H HD2  . LYS A 1 105 ? -7.280  -1.228  -27.762 1.00 1.00 ? 105 LYS A HD2  2  
ATOM 3560  H HD3  . LYS A 1 105 ? -5.746  -1.011  -28.636 1.00 1.00 ? 105 LYS A HD3  2  
ATOM 3561  H HE2  . LYS A 1 105 ? -4.502  -1.798  -26.614 1.00 1.00 ? 105 LYS A HE2  2  
ATOM 3562  H HE3  . LYS A 1 105 ? -6.035  -2.031  -25.767 1.00 1.00 ? 105 LYS A HE3  2  
ATOM 3563  H HZ1  . LYS A 1 105 ? -5.207  -3.479  -28.233 1.00 1.00 ? 105 LYS A HZ1  2  
ATOM 3564  H HZ2  . LYS A 1 105 ? -5.228  -4.113  -26.728 1.00 1.00 ? 105 LYS A HZ2  2  
ATOM 3565  H HZ3  . LYS A 1 105 ? -6.629  -3.702  -27.455 1.00 1.00 ? 105 LYS A HZ3  2  
ATOM 3566  N N    . TYR A 1 106 ? -8.580  3.195   -25.975 1.00 1.00 ? 106 TYR A N    2  
ATOM 3567  C CA   . TYR A 1 106 ? -9.337  3.355   -24.719 1.00 1.00 ? 106 TYR A CA   2  
ATOM 3568  C C    . TYR A 1 106 ? -9.145  2.156   -23.763 1.00 1.00 ? 106 TYR A C    2  
ATOM 3569  O O    . TYR A 1 106 ? -9.181  0.999   -24.178 1.00 1.00 ? 106 TYR A O    2  
ATOM 3570  C CB   . TYR A 1 106 ? -10.819 3.659   -25.015 1.00 1.00 ? 106 TYR A CB   2  
ATOM 3571  C CG   . TYR A 1 106 ? -11.615 2.564   -25.710 1.00 1.00 ? 106 TYR A CG   2  
ATOM 3572  C CD1  . TYR A 1 106 ? -11.668 2.500   -27.118 1.00 1.00 ? 106 TYR A CD1  2  
ATOM 3573  C CD2  . TYR A 1 106 ? -12.338 1.626   -24.946 1.00 1.00 ? 106 TYR A CD2  2  
ATOM 3574  C CE1  . TYR A 1 106 ? -12.421 1.495   -27.756 1.00 1.00 ? 106 TYR A CE1  2  
ATOM 3575  C CE2  . TYR A 1 106 ? -13.092 0.618   -25.577 1.00 1.00 ? 106 TYR A CE2  2  
ATOM 3576  C CZ   . TYR A 1 106 ? -13.133 0.547   -26.989 1.00 1.00 ? 106 TYR A CZ   2  
ATOM 3577  O OH   . TYR A 1 106 ? -13.862 -0.421  -27.613 1.00 1.00 ? 106 TYR A OH   2  
ATOM 3578  H H    . TYR A 1 106 ? -9.099  3.120   -26.838 1.00 1.00 ? 106 TYR A H    2  
ATOM 3579  H HA   . TYR A 1 106 ? -8.938  4.239   -24.216 1.00 1.00 ? 106 TYR A HA   2  
ATOM 3580  H HB2  . TYR A 1 106 ? -11.316 3.902   -24.074 1.00 1.00 ? 106 TYR A HB2  2  
ATOM 3581  H HB3  . TYR A 1 106 ? -10.867 4.558   -25.629 1.00 1.00 ? 106 TYR A HB3  2  
ATOM 3582  H HD1  . TYR A 1 106 ? -11.138 3.227   -27.715 1.00 1.00 ? 106 TYR A HD1  2  
ATOM 3583  H HD2  . TYR A 1 106 ? -12.315 1.674   -23.867 1.00 1.00 ? 106 TYR A HD2  2  
ATOM 3584  H HE1  . TYR A 1 106 ? -12.458 1.448   -28.838 1.00 1.00 ? 106 TYR A HE1  2  
ATOM 3585  H HE2  . TYR A 1 106 ? -13.640 -0.101  -24.983 1.00 1.00 ? 106 TYR A HE2  2  
ATOM 3586  H HH   . TYR A 1 106 ? -14.319 -1.016  -26.999 1.00 1.00 ? 106 TYR A HH   2  
ATOM 3587  N N    . SER A 1 107 ? -8.930  2.441   -22.473 1.00 1.00 ? 107 SER A N    2  
ATOM 3588  C CA   . SER A 1 107 ? -8.538  1.425   -21.469 1.00 1.00 ? 107 SER A CA   2  
ATOM 3589  C C    . SER A 1 107 ? -9.660  1.047   -20.485 1.00 1.00 ? 107 SER A C    2  
ATOM 3590  O O    . SER A 1 107 ? -9.421  0.263   -19.571 1.00 1.00 ? 107 SER A O    2  
ATOM 3591  C CB   . SER A 1 107 ? -7.315  1.939   -20.691 1.00 1.00 ? 107 SER A CB   2  
ATOM 3592  O OG   . SER A 1 107 ? -6.194  2.145   -21.546 1.00 1.00 ? 107 SER A OG   2  
ATOM 3593  H H    . SER A 1 107 ? -8.881  3.418   -22.197 1.00 1.00 ? 107 SER A H    2  
ATOM 3594  H HA   . SER A 1 107 ? -8.231  0.501   -21.963 1.00 1.00 ? 107 SER A HA   2  
ATOM 3595  H HB2  . SER A 1 107 ? -7.565  2.872   -20.183 1.00 1.00 ? 107 SER A HB2  2  
ATOM 3596  H HB3  . SER A 1 107 ? -7.038  1.205   -19.934 1.00 1.00 ? 107 SER A HB3  2  
ATOM 3597  H HG   . SER A 1 107 ? -6.409  2.817   -22.228 1.00 1.00 ? 107 SER A HG   2  
ATOM 3598  N N    . ILE A 1 108 ? -10.857 1.647   -20.608 1.00 1.00 ? 108 ILE A N    2  
ATOM 3599  C CA   . ILE A 1 108 ? -12.083 1.547   -19.759 1.00 1.00 ? 108 ILE A CA   2  
ATOM 3600  C C    . ILE A 1 108 ? -11.920 1.927   -18.270 1.00 1.00 ? 108 ILE A C    2  
ATOM 3601  O O    . ILE A 1 108 ? -12.853 2.479   -17.687 1.00 1.00 ? 108 ILE A O    2  
ATOM 3602  C CB   . ILE A 1 108 ? -12.861 0.218   -19.951 1.00 1.00 ? 108 ILE A CB   2  
ATOM 3603  C CG1  . ILE A 1 108 ? -12.165 -1.045  -19.392 1.00 1.00 ? 108 ILE A CG1  2  
ATOM 3604  C CG2  . ILE A 1 108 ? -13.235 0.042   -21.436 1.00 1.00 ? 108 ILE A CG2  2  
ATOM 3605  C CD1  . ILE A 1 108 ? -13.111 -2.243  -19.234 1.00 1.00 ? 108 ILE A CD1  2  
ATOM 3606  H H    . ILE A 1 108 ? -10.940 2.268   -21.405 1.00 1.00 ? 108 ILE A H    2  
ATOM 3607  H HA   . ILE A 1 108 ? -12.766 2.322   -20.122 1.00 1.00 ? 108 ILE A HA   2  
ATOM 3608  H HB   . ILE A 1 108 ? -13.799 0.334   -19.401 1.00 1.00 ? 108 ILE A HB   2  
ATOM 3609  H HG12 . ILE A 1 108 ? -11.348 -1.340  -20.051 1.00 1.00 ? 108 ILE A HG12 2  
ATOM 3610  H HG13 . ILE A 1 108 ? -11.755 -0.827  -18.407 1.00 1.00 ? 108 ILE A HG13 2  
ATOM 3611  H HG21 . ILE A 1 108 ? -13.940 -0.781  -21.550 1.00 1.00 ? 108 ILE A HG21 2  
ATOM 3612  H HG22 . ILE A 1 108 ? -13.713 0.949   -21.813 1.00 1.00 ? 108 ILE A HG22 2  
ATOM 3613  H HG23 . ILE A 1 108 ? -12.346 -0.170  -22.031 1.00 1.00 ? 108 ILE A HG23 2  
ATOM 3614  H HD11 . ILE A 1 108 ? -13.955 -1.973  -18.602 1.00 1.00 ? 108 ILE A HD11 2  
ATOM 3615  H HD12 . ILE A 1 108 ? -13.481 -2.569  -20.205 1.00 1.00 ? 108 ILE A HD12 2  
ATOM 3616  H HD13 . ILE A 1 108 ? -12.572 -3.071  -18.774 1.00 1.00 ? 108 ILE A HD13 2  
ATOM 3617  N N    . VAL A 1 109 ? -10.746 1.698   -17.686 1.00 1.00 ? 109 VAL A N    2  
ATOM 3618  C CA   . VAL A 1 109 ? -10.291 2.149   -16.360 1.00 1.00 ? 109 VAL A CA   2  
ATOM 3619  C C    . VAL A 1 109 ? -8.824  2.595   -16.449 1.00 1.00 ? 109 VAL A C    2  
ATOM 3620  O O    . VAL A 1 109 ? -8.062  2.072   -17.261 1.00 1.00 ? 109 VAL A O    2  
ATOM 3621  C CB   . VAL A 1 109 ? -10.460 1.059   -15.271 1.00 1.00 ? 109 VAL A CB   2  
ATOM 3622  C CG1  . VAL A 1 109 ? -11.930 0.664   -15.075 1.00 1.00 ? 109 VAL A CG1  2  
ATOM 3623  C CG2  . VAL A 1 109 ? -9.646  -0.219  -15.544 1.00 1.00 ? 109 VAL A CG2  2  
ATOM 3624  H H    . VAL A 1 109 ? -10.075 1.180   -18.256 1.00 1.00 ? 109 VAL A H    2  
ATOM 3625  H HA   . VAL A 1 109 ? -10.882 3.016   -16.065 1.00 1.00 ? 109 VAL A HA   2  
ATOM 3626  H HB   . VAL A 1 109 ? -10.102 1.476   -14.329 1.00 1.00 ? 109 VAL A HB   2  
ATOM 3627  H HG11 . VAL A 1 109 ? -12.019 -0.014  -14.227 1.00 1.00 ? 109 VAL A HG11 2  
ATOM 3628  H HG12 . VAL A 1 109 ? -12.529 1.553   -14.884 1.00 1.00 ? 109 VAL A HG12 2  
ATOM 3629  H HG13 . VAL A 1 109 ? -12.312 0.156   -15.960 1.00 1.00 ? 109 VAL A HG13 2  
ATOM 3630  H HG21 . VAL A 1 109 ? -8.582  0.012   -15.596 1.00 1.00 ? 109 VAL A HG21 2  
ATOM 3631  H HG22 . VAL A 1 109 ? -9.798  -0.931  -14.731 1.00 1.00 ? 109 VAL A HG22 2  
ATOM 3632  H HG23 . VAL A 1 109 ? -9.960  -0.681  -16.483 1.00 1.00 ? 109 VAL A HG23 2  
ATOM 3633  N N    . SER A 1 110 ? -8.410  3.546   -15.610 1.00 1.00 ? 110 SER A N    2  
ATOM 3634  C CA   . SER A 1 110 ? -7.074  4.171   -15.695 1.00 1.00 ? 110 SER A CA   2  
ATOM 3635  C C    . SER A 1 110 ? -5.906  3.270   -15.265 1.00 1.00 ? 110 SER A C    2  
ATOM 3636  O O    . SER A 1 110 ? -4.751  3.625   -15.498 1.00 1.00 ? 110 SER A O    2  
ATOM 3637  C CB   . SER A 1 110 ? -7.062  5.482   -14.897 1.00 1.00 ? 110 SER A CB   2  
ATOM 3638  O OG   . SER A 1 110 ? -8.042  6.369   -15.415 1.00 1.00 ? 110 SER A OG   2  
ATOM 3639  H H    . SER A 1 110 ? -9.100  4.018   -15.028 1.00 1.00 ? 110 SER A H    2  
ATOM 3640  H HA   . SER A 1 110 ? -6.884  4.436   -16.737 1.00 1.00 ? 110 SER A HA   2  
ATOM 3641  H HB2  . SER A 1 110 ? -7.267  5.282   -13.844 1.00 1.00 ? 110 SER A HB2  2  
ATOM 3642  H HB3  . SER A 1 110 ? -6.077  5.948   -14.981 1.00 1.00 ? 110 SER A HB3  2  
ATOM 3643  H HG   . SER A 1 110 ? -7.853  7.267   -15.066 1.00 1.00 ? 110 SER A HG   2  
ATOM 3644  N N    . ARG A 1 111 ? -6.168  2.078   -14.707 1.00 1.00 ? 111 ARG A N    2  
ATOM 3645  C CA   . ARG A 1 111 ? -5.136  1.132   -14.232 1.00 1.00 ? 111 ARG A CA   2  
ATOM 3646  C C    . ARG A 1 111 ? -4.074  0.781   -15.290 1.00 1.00 ? 111 ARG A C    2  
ATOM 3647  O O    . ARG A 1 111 ? -2.907  0.584   -14.958 1.00 1.00 ? 111 ARG A O    2  
ATOM 3648  C CB   . ARG A 1 111 ? -5.790  -0.138  -13.651 1.00 1.00 ? 111 ARG A CB   2  
ATOM 3649  C CG   . ARG A 1 111 ? -6.677  0.188   -12.436 1.00 1.00 ? 111 ARG A CG   2  
ATOM 3650  C CD   . ARG A 1 111 ? -7.124  -1.067  -11.669 1.00 1.00 ? 111 ARG A CD   2  
ATOM 3651  N NE   . ARG A 1 111 ? -7.941  -0.694  -10.498 1.00 1.00 ? 111 ARG A NE   2  
ATOM 3652  C CZ   . ARG A 1 111 ? -7.509  -0.076  -9.400  1.00 1.00 ? 111 ARG A CZ   2  
ATOM 3653  N NH1  . ARG A 1 111 ? -6.234  0.077   -9.128  1.00 1.00 ? 111 ARG A NH1  2  
ATOM 3654  N NH2  . ARG A 1 111 ? -8.356  0.434   -8.539  1.00 1.00 ? 111 ARG A NH2  2  
ATOM 3655  H H    . ARG A 1 111 ? -7.140  1.846   -14.546 1.00 1.00 ? 111 ARG A H    2  
ATOM 3656  H HA   . ARG A 1 111 ? -4.596  1.622   -13.425 1.00 1.00 ? 111 ARG A HA   2  
ATOM 3657  H HB2  . ARG A 1 111 ? -6.389  -0.635  -14.418 1.00 1.00 ? 111 ARG A HB2  2  
ATOM 3658  H HB3  . ARG A 1 111 ? -5.001  -0.822  -13.333 1.00 1.00 ? 111 ARG A HB3  2  
ATOM 3659  H HG2  . ARG A 1 111 ? -6.114  0.833   -11.764 1.00 1.00 ? 111 ARG A HG2  2  
ATOM 3660  H HG3  . ARG A 1 111 ? -7.563  0.730   -12.767 1.00 1.00 ? 111 ARG A HG3  2  
ATOM 3661  H HD2  . ARG A 1 111 ? -7.715  -1.699  -12.335 1.00 1.00 ? 111 ARG A HD2  2  
ATOM 3662  H HD3  . ARG A 1 111 ? -6.254  -1.643  -11.348 1.00 1.00 ? 111 ARG A HD3  2  
ATOM 3663  H HE   . ARG A 1 111 ? -8.936  -0.875  -10.568 1.00 1.00 ? 111 ARG A HE   2  
ATOM 3664  H HH11 . ARG A 1 111 ? -5.528  -0.346  -9.704  1.00 1.00 ? 111 ARG A HH11 2  
ATOM 3665  H HH12 . ARG A 1 111 ? -5.967  0.553   -8.264  1.00 1.00 ? 111 ARG A HH12 2  
ATOM 3666  H HH21 . ARG A 1 111 ? -9.351  0.323   -8.646  1.00 1.00 ? 111 ARG A HH21 2  
ATOM 3667  H HH22 . ARG A 1 111 ? -7.993  1.086   -7.842  1.00 1.00 ? 111 ARG A HH22 2  
ATOM 3668  N N    . ASN A 1 112 ? -4.429  0.825   -16.580 1.00 1.00 ? 112 ASN A N    2  
ATOM 3669  C CA   . ASN A 1 112 ? -3.491  0.620   -17.695 1.00 1.00 ? 112 ASN A CA   2  
ATOM 3670  C C    . ASN A 1 112 ? -2.333  1.652   -17.740 1.00 1.00 ? 112 ASN A C    2  
ATOM 3671  O O    . ASN A 1 112 ? -1.285  1.374   -18.316 1.00 1.00 ? 112 ASN A O    2  
ATOM 3672  C CB   . ASN A 1 112 ? -4.297  0.593   -19.005 1.00 1.00 ? 112 ASN A CB   2  
ATOM 3673  C CG   . ASN A 1 112 ? -3.517  0.011   -20.187 1.00 1.00 ? 112 ASN A CG   2  
ATOM 3674  O OD1  . ASN A 1 112 ? -2.714  -0.902  -20.038 1.00 1.00 ? 112 ASN A OD1  2  
ATOM 3675  N ND2  . ASN A 1 112 ? -3.757  0.498   -21.389 1.00 1.00 ? 112 ASN A ND2  2  
ATOM 3676  H H    . ASN A 1 112 ? -5.406  0.990   -16.796 1.00 1.00 ? 112 ASN A H    2  
ATOM 3677  H HA   . ASN A 1 112 ? -3.039  -0.361  -17.553 1.00 1.00 ? 112 ASN A HA   2  
ATOM 3678  H HB2  . ASN A 1 112 ? -5.190  -0.021  -18.873 1.00 1.00 ? 112 ASN A HB2  2  
ATOM 3679  H HB3  . ASN A 1 112 ? -4.619  1.608   -19.246 1.00 1.00 ? 112 ASN A HB3  2  
ATOM 3680  H HD21 . ASN A 1 112 ? -4.489  1.192   -21.519 1.00 1.00 ? 112 ASN A HD21 2  
ATOM 3681  H HD22 . ASN A 1 112 ? -3.262  0.118   -22.181 1.00 1.00 ? 112 ASN A HD22 2  
ATOM 3682  N N    . CYS A 1 113 ? -2.457  2.809   -17.066 1.00 1.00 ? 113 CYS A N    2  
ATOM 3683  C CA   . CYS A 1 113 ? -1.352  3.768   -16.891 1.00 1.00 ? 113 CYS A CA   2  
ATOM 3684  C C    . CYS A 1 113 ? -0.140  3.152   -16.159 1.00 1.00 ? 113 CYS A C    2  
ATOM 3685  O O    . CYS A 1 113 ? 0.994   3.531   -16.455 1.00 1.00 ? 113 CYS A O    2  
ATOM 3686  C CB   . CYS A 1 113 ? -1.865  5.020   -16.155 1.00 1.00 ? 113 CYS A CB   2  
ATOM 3687  S SG   . CYS A 1 113 ? -3.190  5.831   -17.097 1.00 1.00 ? 113 CYS A SG   2  
ATOM 3688  H H    . CYS A 1 113 ? -3.345  3.019   -16.614 1.00 1.00 ? 113 CYS A H    2  
ATOM 3689  H HA   . CYS A 1 113 ? -1.002  4.076   -17.878 1.00 1.00 ? 113 CYS A HA   2  
ATOM 3690  H HB2  . CYS A 1 113 ? -2.243  4.753   -15.164 1.00 1.00 ? 113 CYS A HB2  2  
ATOM 3691  H HB3  . CYS A 1 113 ? -1.041  5.733   -16.041 1.00 1.00 ? 113 CYS A HB3  2  
ATOM 3692  H HG   . CYS A 1 113 ? -4.185  4.999   -16.737 1.00 1.00 ? 113 CYS A HG   2  
ATOM 3693  N N    . GLU A 1 114 ? -0.361  2.180   -15.265 1.00 1.00 ? 114 GLU A N    2  
ATOM 3694  C CA   . GLU A 1 114 ? 0.719   1.403   -14.651 1.00 1.00 ? 114 GLU A CA   2  
ATOM 3695  C C    . GLU A 1 114 ? 1.533   0.694   -15.739 1.00 1.00 ? 114 GLU A C    2  
ATOM 3696  O O    . GLU A 1 114 ? 2.722   0.963   -15.875 1.00 1.00 ? 114 GLU A O    2  
ATOM 3697  C CB   . GLU A 1 114 ? 0.161   0.402   -13.622 1.00 1.00 ? 114 GLU A CB   2  
ATOM 3698  C CG   . GLU A 1 114 ? 1.292   -0.276  -12.838 1.00 1.00 ? 114 GLU A CG   2  
ATOM 3699  C CD   . GLU A 1 114 ? 0.754   -1.194  -11.728 1.00 1.00 ? 114 GLU A CD   2  
ATOM 3700  O OE1  . GLU A 1 114 ? -0.039  -2.121  -12.026 1.00 1.00 ? 114 GLU A OE1  2  
ATOM 3701  O OE2  . GLU A 1 114 ? 1.160   -1.031  -10.552 1.00 1.00 ? 114 GLU A OE2  2  
ATOM 3702  H H    . GLU A 1 114 ? -1.316  1.909   -15.061 1.00 1.00 ? 114 GLU A H    2  
ATOM 3703  H HA   . GLU A 1 114 ? 1.378   2.091   -14.120 1.00 1.00 ? 114 GLU A HA   2  
ATOM 3704  H HB2  . GLU A 1 114 ? -0.484  0.927   -12.923 1.00 1.00 ? 114 GLU A HB2  2  
ATOM 3705  H HB3  . GLU A 1 114 ? -0.435  -0.357  -14.128 1.00 1.00 ? 114 GLU A HB3  2  
ATOM 3706  H HG2  . GLU A 1 114 ? 1.904   -0.869  -13.520 1.00 1.00 ? 114 GLU A HG2  2  
ATOM 3707  H HG3  . GLU A 1 114 ? 1.929   0.495   -12.401 1.00 1.00 ? 114 GLU A HG3  2  
ATOM 3708  N N    . HIS A 1 115 ? 0.890   -0.126  -16.582 1.00 1.00 ? 115 HIS A N    2  
ATOM 3709  C CA   . HIS A 1 115 ? 1.542   -0.823  -17.700 1.00 1.00 ? 115 HIS A CA   2  
ATOM 3710  C C    . HIS A 1 115 ? 2.262   0.141   -18.663 1.00 1.00 ? 115 HIS A C    2  
ATOM 3711  O O    . HIS A 1 115 ? 3.286   -0.220  -19.247 1.00 1.00 ? 115 HIS A O    2  
ATOM 3712  C CB   . HIS A 1 115 ? 0.502   -1.631  -18.500 1.00 1.00 ? 115 HIS A CB   2  
ATOM 3713  C CG   . HIS A 1 115 ? -0.416  -2.531  -17.705 1.00 1.00 ? 115 HIS A CG   2  
ATOM 3714  N ND1  . HIS A 1 115 ? -1.723  -2.815  -18.033 1.00 1.00 ? 115 HIS A ND1  2  
ATOM 3715  C CD2  . HIS A 1 115 ? -0.122  -3.246  -16.571 1.00 1.00 ? 115 HIS A CD2  2  
ATOM 3716  C CE1  . HIS A 1 115 ? -2.210  -3.670  -17.119 1.00 1.00 ? 115 HIS A CE1  2  
ATOM 3717  N NE2  . HIS A 1 115 ? -1.270  -3.964  -16.199 1.00 1.00 ? 115 HIS A NE2  2  
ATOM 3718  H H    . HIS A 1 115 ? -0.094  -0.302  -16.432 1.00 1.00 ? 115 HIS A H    2  
ATOM 3719  H HA   . HIS A 1 115 ? 2.297   -1.503  -17.302 1.00 1.00 ? 115 HIS A HA   2  
ATOM 3720  H HB2  . HIS A 1 115 ? -0.117  -0.932  -19.068 1.00 1.00 ? 115 HIS A HB2  2  
ATOM 3721  H HB3  . HIS A 1 115 ? 1.033   -2.249  -19.229 1.00 1.00 ? 115 HIS A HB3  2  
ATOM 3722  H HD1  . HIS A 1 115 ? -2.225  -2.449  -18.838 1.00 1.00 ? 115 HIS A HD1  2  
ATOM 3723  H HD2  . HIS A 1 115 ? 0.835   -3.258  -16.061 1.00 1.00 ? 115 HIS A HD2  2  
ATOM 3724  H HE1  . HIS A 1 115 ? -3.216  -4.070  -17.128 1.00 1.00 ? 115 HIS A HE1  2  
ATOM 3725  N N    . PHE A 1 116 ? 1.748   1.365   -18.838 1.00 1.00 ? 116 PHE A N    2  
ATOM 3726  C CA   . PHE A 1 116 ? 2.460   2.411   -19.559 1.00 1.00 ? 116 PHE A CA   2  
ATOM 3727  C C    . PHE A 1 116 ? 3.762   2.777   -18.829 1.00 1.00 ? 116 PHE A C    2  
ATOM 3728  O O    . PHE A 1 116 ? 4.830   2.650   -19.424 1.00 1.00 ? 116 PHE A O    2  
ATOM 3729  C CB   . PHE A 1 116 ? 1.542   3.620   -19.799 1.00 1.00 ? 116 PHE A CB   2  
ATOM 3730  C CG   . PHE A 1 116 ? 2.305   4.878   -20.165 1.00 1.00 ? 116 PHE A CG   2  
ATOM 3731  C CD1  . PHE A 1 116 ? 3.018   4.925   -21.374 1.00 1.00 ? 116 PHE A CD1  2  
ATOM 3732  C CD2  . PHE A 1 116 ? 2.392   5.950   -19.257 1.00 1.00 ? 116 PHE A CD2  2  
ATOM 3733  C CE1  . PHE A 1 116 ? 3.840   6.026   -21.657 1.00 1.00 ? 116 PHE A CE1  2  
ATOM 3734  C CE2  . PHE A 1 116 ? 3.216   7.051   -19.543 1.00 1.00 ? 116 PHE A CE2  2  
ATOM 3735  C CZ   . PHE A 1 116 ? 3.951   7.084   -20.740 1.00 1.00 ? 116 PHE A CZ   2  
ATOM 3736  H H    . PHE A 1 116 ? 0.859   1.587   -18.414 1.00 1.00 ? 116 PHE A H    2  
ATOM 3737  H HA   . PHE A 1 116 ? 2.744   2.012   -20.534 1.00 1.00 ? 116 PHE A HA   2  
ATOM 3738  H HB2  . PHE A 1 116 ? 0.842   3.375   -20.601 1.00 1.00 ? 116 PHE A HB2  2  
ATOM 3739  H HB3  . PHE A 1 116 ? 0.962   3.818   -18.904 1.00 1.00 ? 116 PHE A HB3  2  
ATOM 3740  H HD1  . PHE A 1 116 ? 2.968   4.102   -22.070 1.00 1.00 ? 116 PHE A HD1  2  
ATOM 3741  H HD2  . PHE A 1 116 ? 1.840   5.917   -18.329 1.00 1.00 ? 116 PHE A HD2  2  
ATOM 3742  H HE1  . PHE A 1 116 ? 4.401   6.044   -22.574 1.00 1.00 ? 116 PHE A HE1  2  
ATOM 3743  H HE2  . PHE A 1 116 ? 3.307   7.861   -18.834 1.00 1.00 ? 116 PHE A HE2  2  
ATOM 3744  H HZ   . PHE A 1 116 ? 4.609   7.916   -20.950 1.00 1.00 ? 116 PHE A HZ   2  
ATOM 3745  N N    . VAL A 1 117 ? 3.704   3.200   -17.558 1.00 1.00 ? 117 VAL A N    2  
ATOM 3746  C CA   . VAL A 1 117 ? 4.908   3.722   -16.879 1.00 1.00 ? 117 VAL A CA   2  
ATOM 3747  C C    . VAL A 1 117 ? 5.958   2.648   -16.556 1.00 1.00 ? 117 VAL A C    2  
ATOM 3748  O O    . VAL A 1 117 ? 7.147   2.963   -16.561 1.00 1.00 ? 117 VAL A O    2  
ATOM 3749  C CB   . VAL A 1 117 ? 4.615   4.570   -15.621 1.00 1.00 ? 117 VAL A CB   2  
ATOM 3750  C CG1  . VAL A 1 117 ? 3.785   5.819   -15.954 1.00 1.00 ? 117 VAL A CG1  2  
ATOM 3751  C CG2  . VAL A 1 117 ? 3.940   3.785   -14.488 1.00 1.00 ? 117 VAL A CG2  2  
ATOM 3752  H H    . VAL A 1 117 ? 2.801   3.188   -17.080 1.00 1.00 ? 117 VAL A H    2  
ATOM 3753  H HA   . VAL A 1 117 ? 5.376   4.405   -17.590 1.00 1.00 ? 117 VAL A HA   2  
ATOM 3754  H HB   . VAL A 1 117 ? 5.573   4.930   -15.248 1.00 1.00 ? 117 VAL A HB   2  
ATOM 3755  H HG11 . VAL A 1 117 ? 4.282   6.406   -16.726 1.00 1.00 ? 117 VAL A HG11 2  
ATOM 3756  H HG12 . VAL A 1 117 ? 2.789   5.532   -16.286 1.00 1.00 ? 117 VAL A HG12 2  
ATOM 3757  H HG13 . VAL A 1 117 ? 3.689   6.436   -15.067 1.00 1.00 ? 117 VAL A HG13 2  
ATOM 3758  H HG21 . VAL A 1 117 ? 4.517   2.895   -14.240 1.00 1.00 ? 117 VAL A HG21 2  
ATOM 3759  H HG22 . VAL A 1 117 ? 3.879   4.411   -13.595 1.00 1.00 ? 117 VAL A HG22 2  
ATOM 3760  H HG23 . VAL A 1 117 ? 2.939   3.488   -14.784 1.00 1.00 ? 117 VAL A HG23 2  
ATOM 3761  N N    . THR A 1 118 ? 5.567   1.383   -16.330 1.00 1.00 ? 118 THR A N    2  
ATOM 3762  C CA   . THR A 1 118 ? 6.510   0.277   -16.057 1.00 1.00 ? 118 THR A CA   2  
ATOM 3763  C C    . THR A 1 118 ? 7.358   -0.059  -17.275 1.00 1.00 ? 118 THR A C    2  
ATOM 3764  O O    . THR A 1 118 ? 8.566   -0.223  -17.140 1.00 1.00 ? 118 THR A O    2  
ATOM 3765  C CB   . THR A 1 118 ? 5.773   -0.982  -15.583 1.00 1.00 ? 118 THR A CB   2  
ATOM 3766  O OG1  . THR A 1 118 ? 4.756   -1.293  -16.506 1.00 1.00 ? 118 THR A OG1  2  
ATOM 3767  C CG2  . THR A 1 118 ? 5.157   -0.794  -14.195 1.00 1.00 ? 118 THR A CG2  2  
ATOM 3768  H H    . THR A 1 118 ? 4.571   1.158   -16.328 1.00 1.00 ? 118 THR A H    2  
ATOM 3769  H HA   . THR A 1 118 ? 7.205   0.581   -15.271 1.00 1.00 ? 118 THR A HA   2  
ATOM 3770  H HB   . THR A 1 118 ? 6.476   -1.813  -15.547 1.00 1.00 ? 118 THR A HB   2  
ATOM 3771  H HG1  . THR A 1 118 ? 4.425   -2.192  -16.323 1.00 1.00 ? 118 THR A HG1  2  
ATOM 3772  H HG21 . THR A 1 118 ? 4.448   0.033   -14.205 1.00 1.00 ? 118 THR A HG21 2  
ATOM 3773  H HG22 . THR A 1 118 ? 4.635   -1.703  -13.896 1.00 1.00 ? 118 THR A HG22 2  
ATOM 3774  H HG23 . THR A 1 118 ? 5.941   -0.585  -13.468 1.00 1.00 ? 118 THR A HG23 2  
ATOM 3775  N N    . GLN A 1 119 ? 6.760   -0.090  -18.464 1.00 1.00 ? 119 GLN A N    2  
ATOM 3776  C CA   . GLN A 1 119 ? 7.454   -0.371  -19.722 1.00 1.00 ? 119 GLN A CA   2  
ATOM 3777  C C    . GLN A 1 119 ? 8.521   0.682   -20.066 1.00 1.00 ? 119 GLN A C    2  
ATOM 3778  O O    . GLN A 1 119 ? 9.483   0.352   -20.754 1.00 1.00 ? 119 GLN A O    2  
ATOM 3779  C CB   . GLN A 1 119 ? 6.433   -0.521  -20.862 1.00 1.00 ? 119 GLN A CB   2  
ATOM 3780  C CG   . GLN A 1 119 ? 5.699   -1.872  -20.806 1.00 1.00 ? 119 GLN A CG   2  
ATOM 3781  C CD   . GLN A 1 119 ? 4.679   -2.003  -21.940 1.00 1.00 ? 119 GLN A CD   2  
ATOM 3782  O OE1  . GLN A 1 119 ? 4.910   -2.649  -22.957 1.00 1.00 ? 119 GLN A OE1  2  
ATOM 3783  N NE2  . GLN A 1 119 ? 3.525   -1.381  -21.820 1.00 1.00 ? 119 GLN A NE2  2  
ATOM 3784  H H    . GLN A 1 119 ? 5.755   0.015   -18.475 1.00 1.00 ? 119 GLN A H    2  
ATOM 3785  H HA   . GLN A 1 119 ? 7.982   -1.316  -19.612 1.00 1.00 ? 119 GLN A HA   2  
ATOM 3786  H HB2  . GLN A 1 119 ? 5.715   0.301   -20.827 1.00 1.00 ? 119 GLN A HB2  2  
ATOM 3787  H HB3  . GLN A 1 119 ? 6.957   -0.463  -21.820 1.00 1.00 ? 119 GLN A HB3  2  
ATOM 3788  H HG2  . GLN A 1 119 ? 6.423   -2.682  -20.889 1.00 1.00 ? 119 GLN A HG2  2  
ATOM 3789  H HG3  . GLN A 1 119 ? 5.185   -1.982  -19.849 1.00 1.00 ? 119 GLN A HG3  2  
ATOM 3790  H HE21 . GLN A 1 119 ? 3.339   -0.859  -20.965 1.00 1.00 ? 119 GLN A HE21 2  
ATOM 3791  H HE22 . GLN A 1 119 ? 2.845   -1.452  -22.561 1.00 1.00 ? 119 GLN A HE22 2  
ATOM 3792  N N    . LEU A 1 120 ? 8.424   1.912   -19.543 1.00 1.00 ? 120 LEU A N    2  
ATOM 3793  C CA   . LEU A 1 120 ? 9.472   2.937   -19.702 1.00 1.00 ? 120 LEU A CA   2  
ATOM 3794  C C    . LEU A 1 120 ? 10.794  2.536   -19.014 1.00 1.00 ? 120 LEU A C    2  
ATOM 3795  O O    . LEU A 1 120 ? 11.864  2.915   -19.487 1.00 1.00 ? 120 LEU A O    2  
ATOM 3796  C CB   . LEU A 1 120 ? 8.975   4.294   -19.163 1.00 1.00 ? 120 LEU A CB   2  
ATOM 3797  C CG   . LEU A 1 120 ? 7.649   4.789   -19.776 1.00 1.00 ? 120 LEU A CG   2  
ATOM 3798  C CD1  . LEU A 1 120 ? 7.214   6.085   -19.093 1.00 1.00 ? 120 LEU A CD1  2  
ATOM 3799  C CD2  . LEU A 1 120 ? 7.751   5.008   -21.290 1.00 1.00 ? 120 LEU A CD2  2  
ATOM 3800  H H    . LEU A 1 120 ? 7.596   2.136   -19.000 1.00 1.00 ? 120 LEU A H    2  
ATOM 3801  H HA   . LEU A 1 120 ? 9.698   3.042   -20.766 1.00 1.00 ? 120 LEU A HA   2  
ATOM 3802  H HB2  . LEU A 1 120 ? 8.852   4.218   -18.082 1.00 1.00 ? 120 LEU A HB2  2  
ATOM 3803  H HB3  . LEU A 1 120 ? 9.746   5.047   -19.352 1.00 1.00 ? 120 LEU A HB3  2  
ATOM 3804  H HG   . LEU A 1 120 ? 6.874   4.053   -19.587 1.00 1.00 ? 120 LEU A HG   2  
ATOM 3805  H HD11 . LEU A 1 120 ? 6.239   6.393   -19.465 1.00 1.00 ? 120 LEU A HD11 2  
ATOM 3806  H HD12 . LEU A 1 120 ? 7.141   5.924   -18.020 1.00 1.00 ? 120 LEU A HD12 2  
ATOM 3807  H HD13 . LEU A 1 120 ? 7.935   6.872   -19.293 1.00 1.00 ? 120 LEU A HD13 2  
ATOM 3808  H HD21 . LEU A 1 120 ? 6.828   5.462   -21.653 1.00 1.00 ? 120 LEU A HD21 2  
ATOM 3809  H HD22 . LEU A 1 120 ? 8.595   5.658   -21.520 1.00 1.00 ? 120 LEU A HD22 2  
ATOM 3810  H HD23 . LEU A 1 120 ? 7.885   4.056   -21.803 1.00 1.00 ? 120 LEU A HD23 2  
ATOM 3811  N N    . ARG A 1 121 ? 10.714  1.757   -17.924 1.00 1.00 ? 121 ARG A N    2  
ATOM 3812  C CA   . ARG A 1 121 ? 11.862  1.191   -17.198 1.00 1.00 ? 121 ARG A CA   2  
ATOM 3813  C C    . ARG A 1 121 ? 12.219  -0.216  -17.717 1.00 1.00 ? 121 ARG A C    2  
ATOM 3814  O O    . ARG A 1 121 ? 13.361  -0.453  -18.103 1.00 1.00 ? 121 ARG A O    2  
ATOM 3815  C CB   . ARG A 1 121 ? 11.542  1.225   -15.687 1.00 1.00 ? 121 ARG A CB   2  
ATOM 3816  C CG   . ARG A 1 121 ? 12.738  0.786   -14.821 1.00 1.00 ? 121 ARG A CG   2  
ATOM 3817  C CD   . ARG A 1 121 ? 12.483  0.850   -13.308 1.00 1.00 ? 121 ARG A CD   2  
ATOM 3818  N NE   . ARG A 1 121 ? 12.466  2.237   -12.785 1.00 1.00 ? 121 ARG A NE   2  
ATOM 3819  C CZ   . ARG A 1 121 ? 13.020  2.669   -11.652 1.00 1.00 ? 121 ARG A CZ   2  
ATOM 3820  N NH1  . ARG A 1 121 ? 13.703  1.875   -10.851 1.00 1.00 ? 121 ARG A NH1  2  
ATOM 3821  N NH2  . ARG A 1 121 ? 12.889  3.927   -11.295 1.00 1.00 ? 121 ARG A NH2  2  
ATOM 3822  H H    . ARG A 1 121 ? 9.785   1.492   -17.614 1.00 1.00 ? 121 ARG A H    2  
ATOM 3823  H HA   . ARG A 1 121 ? 12.737  1.822   -17.365 1.00 1.00 ? 121 ARG A HA   2  
ATOM 3824  H HB2  . ARG A 1 121 ? 11.264  2.245   -15.420 1.00 1.00 ? 121 ARG A HB2  2  
ATOM 3825  H HB3  . ARG A 1 121 ? 10.688  0.575   -15.479 1.00 1.00 ? 121 ARG A HB3  2  
ATOM 3826  H HG2  . ARG A 1 121 ? 12.985  -0.247  -15.068 1.00 1.00 ? 121 ARG A HG2  2  
ATOM 3827  H HG3  . ARG A 1 121 ? 13.607  1.403   -15.059 1.00 1.00 ? 121 ARG A HG3  2  
ATOM 3828  H HD2  . ARG A 1 121 ? 11.534  0.366   -13.073 1.00 1.00 ? 121 ARG A HD2  2  
ATOM 3829  H HD3  . ARG A 1 121 ? 13.278  0.279   -12.824 1.00 1.00 ? 121 ARG A HD3  2  
ATOM 3830  H HE   . ARG A 1 121 ? 11.956  2.925   -13.326 1.00 1.00 ? 121 ARG A HE   2  
ATOM 3831  H HH11 . ARG A 1 121 ? 13.829  0.900   -11.075 1.00 1.00 ? 121 ARG A HH11 2  
ATOM 3832  H HH12 . ARG A 1 121 ? 14.135  2.237   -10.012 1.00 1.00 ? 121 ARG A HH12 2  
ATOM 3833  H HH21 . ARG A 1 121 ? 12.368  4.583   -11.870 1.00 1.00 ? 121 ARG A HH21 2  
ATOM 3834  H HH22 . ARG A 1 121 ? 13.315  4.269   -10.447 1.00 1.00 ? 121 ARG A HH22 2  
ATOM 3835  N N    . TYR A 1 122 ? 11.261  -1.146  -17.760 1.00 1.00 ? 122 TYR A N    2  
ATOM 3836  C CA   . TYR A 1 122 ? 11.501  -2.549  -18.150 1.00 1.00 ? 122 TYR A CA   2  
ATOM 3837  C C    . TYR A 1 122 ? 11.850  -2.732  -19.644 1.00 1.00 ? 122 TYR A C    2  
ATOM 3838  O O    . TYR A 1 122 ? 12.674  -3.579  -19.993 1.00 1.00 ? 122 TYR A O    2  
ATOM 3839  C CB   . TYR A 1 122 ? 10.257  -3.371  -17.773 1.00 1.00 ? 122 TYR A CB   2  
ATOM 3840  C CG   . TYR A 1 122 ? 10.301  -4.825  -18.208 1.00 1.00 ? 122 TYR A CG   2  
ATOM 3841  C CD1  . TYR A 1 122 ? 11.273  -5.693  -17.674 1.00 1.00 ? 122 TYR A CD1  2  
ATOM 3842  C CD2  . TYR A 1 122 ? 9.384   -5.308  -19.166 1.00 1.00 ? 122 TYR A CD2  2  
ATOM 3843  C CE1  . TYR A 1 122 ? 11.335  -7.035  -18.095 1.00 1.00 ? 122 TYR A CE1  2  
ATOM 3844  C CE2  . TYR A 1 122 ? 9.440   -6.651  -19.590 1.00 1.00 ? 122 TYR A CE2  2  
ATOM 3845  C CZ   . TYR A 1 122 ? 10.415  -7.522  -19.048 1.00 1.00 ? 122 TYR A CZ   2  
ATOM 3846  O OH   . TYR A 1 122 ? 10.479  -8.823  -19.452 1.00 1.00 ? 122 TYR A OH   2  
ATOM 3847  H H    . TYR A 1 122 ? 10.332  -0.894  -17.436 1.00 1.00 ? 122 TYR A H    2  
ATOM 3848  H HA   . TYR A 1 122 ? 12.345  -2.936  -17.574 1.00 1.00 ? 122 TYR A HA   2  
ATOM 3849  H HB2  . TYR A 1 122 ? 10.139  -3.340  -16.688 1.00 1.00 ? 122 TYR A HB2  2  
ATOM 3850  H HB3  . TYR A 1 122 ? 9.377   -2.898  -18.211 1.00 1.00 ? 122 TYR A HB3  2  
ATOM 3851  H HD1  . TYR A 1 122 ? 11.980  -5.332  -16.939 1.00 1.00 ? 122 TYR A HD1  2  
ATOM 3852  H HD2  . TYR A 1 122 ? 8.637   -4.645  -19.585 1.00 1.00 ? 122 TYR A HD2  2  
ATOM 3853  H HE1  . TYR A 1 122 ? 12.081  -7.698  -17.685 1.00 1.00 ? 122 TYR A HE1  2  
ATOM 3854  H HE2  . TYR A 1 122 ? 8.735   -7.018  -20.324 1.00 1.00 ? 122 TYR A HE2  2  
ATOM 3855  H HH   . TYR A 1 122 ? 9.806   -9.050  -20.110 1.00 1.00 ? 122 TYR A HH   2  
ATOM 3856  N N    . GLY A 1 123 ? 11.246  -1.920  -20.521 1.00 1.00 ? 123 GLY A N    2  
ATOM 3857  C CA   . GLY A 1 123 ? 11.397  -1.957  -21.986 1.00 1.00 ? 123 GLY A CA   2  
ATOM 3858  C C    . GLY A 1 123 ? 12.380  -0.915  -22.532 1.00 1.00 ? 123 GLY A C    2  
ATOM 3859  O O    . GLY A 1 123 ? 12.274  -0.536  -23.698 1.00 1.00 ? 123 GLY A O    2  
ATOM 3860  H H    . GLY A 1 123 ? 10.616  -1.215  -20.160 1.00 1.00 ? 123 GLY A H    2  
ATOM 3861  H HA2  . GLY A 1 123 ? 11.745  -2.940  -22.303 1.00 1.00 ? 123 GLY A HA2  2  
ATOM 3862  H HA3  . GLY A 1 123 ? 10.427  -1.751  -22.440 1.00 1.00 ? 123 GLY A HA3  2  
ATOM 3863  N N    . LYS A 1 124 ? 13.321  -0.434  -21.706 1.00 1.00 ? 124 LYS A N    2  
ATOM 3864  C CA   . LYS A 1 124 ? 14.349  0.541   -22.108 1.00 1.00 ? 124 LYS A CA   2  
ATOM 3865  C C    . LYS A 1 124 ? 15.190  0.060   -23.325 1.00 1.00 ? 124 LYS A C    2  
ATOM 3866  O O    . LYS A 1 124 ? 15.400  -1.144  -23.511 1.00 1.00 ? 124 LYS A O    2  
ATOM 3867  C CB   . LYS A 1 124 ? 15.186  0.928   -20.865 1.00 1.00 ? 124 LYS A CB   2  
ATOM 3868  C CG   . LYS A 1 124 ? 16.190  -0.147  -20.395 1.00 1.00 ? 124 LYS A CG   2  
ATOM 3869  C CD   . LYS A 1 124 ? 17.568  0.015   -21.067 1.00 1.00 ? 124 LYS A CD   2  
ATOM 3870  C CE   . LYS A 1 124 ? 18.306  -1.328  -21.208 1.00 1.00 ? 124 LYS A CE   2  
ATOM 3871  N NZ   . LYS A 1 124 ? 19.486  -1.205  -22.111 1.00 1.00 ? 124 LYS A NZ   2  
ATOM 3872  H H    . LYS A 1 124 ? 13.347  -0.783  -20.760 1.00 1.00 ? 124 LYS A H    2  
ATOM 3873  H HA   . LYS A 1 124 ? 13.818  1.440   -22.429 1.00 1.00 ? 124 LYS A HA   2  
ATOM 3874  H HB2  . LYS A 1 124 ? 15.724  1.855   -21.060 1.00 1.00 ? 124 LYS A HB2  2  
ATOM 3875  H HB3  . LYS A 1 124 ? 14.498  1.144   -20.043 1.00 1.00 ? 124 LYS A HB3  2  
ATOM 3876  H HG2  . LYS A 1 124 ? 16.322  -0.056  -19.316 1.00 1.00 ? 124 LYS A HG2  2  
ATOM 3877  H HG3  . LYS A 1 124 ? 15.779  -1.136  -20.597 1.00 1.00 ? 124 LYS A HG3  2  
ATOM 3878  H HD2  . LYS A 1 124 ? 17.445  0.441   -22.059 1.00 1.00 ? 124 LYS A HD2  2  
ATOM 3879  H HD3  . LYS A 1 124 ? 18.175  0.720   -20.493 1.00 1.00 ? 124 LYS A HD3  2  
ATOM 3880  H HE2  . LYS A 1 124 ? 18.617  -1.680  -20.219 1.00 1.00 ? 124 LYS A HE2  2  
ATOM 3881  H HE3  . LYS A 1 124 ? 17.610  -2.066  -21.629 1.00 1.00 ? 124 LYS A HE3  2  
ATOM 3882  H HZ1  . LYS A 1 124 ? 20.191  -0.590  -21.731 1.00 1.00 ? 124 LYS A HZ1  2  
ATOM 3883  H HZ2  . LYS A 1 124 ? 19.917  -2.106  -22.273 1.00 1.00 ? 124 LYS A HZ2  2  
ATOM 3884  H HZ3  . LYS A 1 124 ? 19.200  -0.829  -23.020 1.00 1.00 ? 124 LYS A HZ3  2  
ATOM 3885  N N    . SER A 1 125 ? 15.681  1.014   -24.130 1.00 1.00 ? 125 SER A N    2  
ATOM 3886  C CA   . SER A 1 125 ? 16.420  0.804   -25.398 1.00 1.00 ? 125 SER A CA   2  
ATOM 3887  C C    . SER A 1 125 ? 17.598  -0.176  -25.305 1.00 1.00 ? 125 SER A C    2  
ATOM 3888  O O    . SER A 1 125 ? 18.478  0.005   -24.430 1.00 1.00 ? 125 SER A O    2  
ATOM 3889  C CB   . SER A 1 125 ? 16.922  2.147   -25.930 1.00 1.00 ? 125 SER A CB   2  
ATOM 3890  O OG   . SER A 1 125 ? 15.836  3.061   -26.024 1.00 1.00 ? 125 SER A OG   2  
ATOM 3891  O OXT  . SER A 1 125 ? 17.653  -1.113  -26.132 1.00 1.00 ? 125 SER A OXT  2  
ATOM 3892  H H    . SER A 1 125 ? 15.469  1.976   -23.910 1.00 1.00 ? 125 SER A H    2  
ATOM 3893  H HA   . SER A 1 125 ? 15.727  0.391   -26.132 1.00 1.00 ? 125 SER A HA   2  
ATOM 3894  H HB2  . SER A 1 125 ? 17.679  2.548   -25.251 1.00 1.00 ? 125 SER A HB2  2  
ATOM 3895  H HB3  . SER A 1 125 ? 17.380  1.999   -26.910 1.00 1.00 ? 125 SER A HB3  2  
ATOM 3896  H HG   . SER A 1 125 ? 15.265  2.815   -26.782 1.00 1.00 ? 125 SER A HG   2  
ATOM 3897  N N    . MET A 1 1   ? 6.593   14.361  17.184  1.00 1.00 ? 1   MET A N    3  
ATOM 3898  C CA   . MET A 1 1   ? 6.873   15.784  16.822  1.00 1.00 ? 1   MET A CA   3  
ATOM 3899  C C    . MET A 1 1   ? 6.712   16.010  15.306  1.00 1.00 ? 1   MET A C    3  
ATOM 3900  O O    . MET A 1 1   ? 5.646   16.453  14.878  1.00 1.00 ? 1   MET A O    3  
ATOM 3901  C CB   . MET A 1 1   ? 8.235   16.271  17.384  1.00 1.00 ? 1   MET A CB   3  
ATOM 3902  C CG   . MET A 1 1   ? 8.476   17.778  17.169  1.00 1.00 ? 1   MET A CG   3  
ATOM 3903  S SD   . MET A 1 1   ? 10.071  18.406  17.783  1.00 1.00 ? 1   MET A SD   3  
ATOM 3904  C CE   . MET A 1 1   ? 9.803   18.341  19.577  1.00 1.00 ? 1   MET A CE   3  
ATOM 3905  H H1   . MET A 1 1   ? 6.610   14.239  18.187  1.00 1.00 ? 1   MET A H1   3  
ATOM 3906  H H2   . MET A 1 1   ? 5.679   14.080  16.857  1.00 1.00 ? 1   MET A H2   3  
ATOM 3907  H H3   . MET A 1 1   ? 7.277   13.739  16.782  1.00 1.00 ? 1   MET A H3   3  
ATOM 3908  H HA   . MET A 1 1   ? 6.103   16.397  17.298  1.00 1.00 ? 1   MET A HA   3  
ATOM 3909  H HB2  . MET A 1 1   ? 8.263   16.074  18.457  1.00 1.00 ? 1   MET A HB2  3  
ATOM 3910  H HB3  . MET A 1 1   ? 9.055   15.711  16.926  1.00 1.00 ? 1   MET A HB3  3  
ATOM 3911  H HG2  . MET A 1 1   ? 8.436   17.991  16.100  1.00 1.00 ? 1   MET A HG2  3  
ATOM 3912  H HG3  . MET A 1 1   ? 7.677   18.337  17.655  1.00 1.00 ? 1   MET A HG3  3  
ATOM 3913  H HE1  . MET A 1 1   ? 9.664   17.308  19.896  1.00 1.00 ? 1   MET A HE1  3  
ATOM 3914  H HE2  . MET A 1 1   ? 10.672  18.756  20.089  1.00 1.00 ? 1   MET A HE2  3  
ATOM 3915  H HE3  . MET A 1 1   ? 8.923   18.928  19.839  1.00 1.00 ? 1   MET A HE3  3  
ATOM 3916  N N    . ALA A 1 2   ? 7.734   15.712  14.488  1.00 1.00 ? 2   ALA A N    3  
ATOM 3917  C CA   . ALA A 1 2   ? 7.755   15.932  13.031  1.00 1.00 ? 2   ALA A CA   3  
ATOM 3918  C C    . ALA A 1 2   ? 8.763   15.001  12.319  1.00 1.00 ? 2   ALA A C    3  
ATOM 3919  O O    . ALA A 1 2   ? 9.609   14.377  12.962  1.00 1.00 ? 2   ALA A O    3  
ATOM 3920  C CB   . ALA A 1 2   ? 8.076   17.415  12.773  1.00 1.00 ? 2   ALA A CB   3  
ATOM 3921  H H    . ALA A 1 2   ? 8.584   15.321  14.881  1.00 1.00 ? 2   ALA A H    3  
ATOM 3922  H HA   . ALA A 1 2   ? 6.767   15.713  12.617  1.00 1.00 ? 2   ALA A HA   3  
ATOM 3923  H HB1  . ALA A 1 2   ? 9.056   17.662  13.187  1.00 1.00 ? 2   ALA A HB1  3  
ATOM 3924  H HB2  . ALA A 1 2   ? 8.088   17.618  11.701  1.00 1.00 ? 2   ALA A HB2  3  
ATOM 3925  H HB3  . ALA A 1 2   ? 7.322   18.050  13.237  1.00 1.00 ? 2   ALA A HB3  3  
ATOM 3926  N N    . SER A 1 3   ? 8.691   14.927  10.988  1.00 1.00 ? 3   SER A N    3  
ATOM 3927  C CA   . SER A 1 3   ? 9.559   14.094  10.136  1.00 1.00 ? 3   SER A CA   3  
ATOM 3928  C C    . SER A 1 3   ? 9.573   14.614  8.677   1.00 1.00 ? 3   SER A C    3  
ATOM 3929  O O    . SER A 1 3   ? 8.540   15.138  8.233   1.00 1.00 ? 3   SER A O    3  
ATOM 3930  C CB   . SER A 1 3   ? 9.072   12.634  10.183  1.00 1.00 ? 3   SER A CB   3  
ATOM 3931  O OG   . SER A 1 3   ? 9.995   11.760  9.543   1.00 1.00 ? 3   SER A OG   3  
ATOM 3932  H H    . SER A 1 3   ? 7.985   15.479  10.513  1.00 1.00 ? 3   SER A H    3  
ATOM 3933  H HA   . SER A 1 3   ? 10.570  14.121  10.543  1.00 1.00 ? 3   SER A HA   3  
ATOM 3934  H HB2  . SER A 1 3   ? 8.959   12.322  11.224  1.00 1.00 ? 3   SER A HB2  3  
ATOM 3935  H HB3  . SER A 1 3   ? 8.098   12.565  9.693   1.00 1.00 ? 3   SER A HB3  3  
ATOM 3936  H HG   . SER A 1 3   ? 9.666   10.838  9.607   1.00 1.00 ? 3   SER A HG   3  
ATOM 3937  N N    . PRO A 1 4   ? 10.695  14.502  7.925   1.00 1.00 ? 4   PRO A N    3  
ATOM 3938  C CA   . PRO A 1 4   ? 10.774  14.916  6.519   1.00 1.00 ? 4   PRO A CA   3  
ATOM 3939  C C    . PRO A 1 4   ? 9.755   14.209  5.612   1.00 1.00 ? 4   PRO A C    3  
ATOM 3940  O O    . PRO A 1 4   ? 9.391   13.054  5.843   1.00 1.00 ? 4   PRO A O    3  
ATOM 3941  C CB   . PRO A 1 4   ? 12.208  14.612  6.064   1.00 1.00 ? 4   PRO A CB   3  
ATOM 3942  C CG   . PRO A 1 4   ? 13.006  14.650  7.363   1.00 1.00 ? 4   PRO A CG   3  
ATOM 3943  C CD   . PRO A 1 4   ? 12.016  14.089  8.383   1.00 1.00 ? 4   PRO A CD   3  
ATOM 3944  H HA   . PRO A 1 4   ? 10.615  15.992  6.475   1.00 1.00 ? 4   PRO A HA   3  
ATOM 3945  H HB2  . PRO A 1 4   ? 12.262  13.609  5.637   1.00 1.00 ? 4   PRO A HB2  3  
ATOM 3946  H HB3  . PRO A 1 4   ? 12.568  15.350  5.347   1.00 1.00 ? 4   PRO A HB3  3  
ATOM 3947  H HG2  . PRO A 1 4   ? 13.915  14.048  7.303   1.00 1.00 ? 4   PRO A HG2  3  
ATOM 3948  H HG3  . PRO A 1 4   ? 13.243  15.688  7.613   1.00 1.00 ? 4   PRO A HG3  3  
ATOM 3949  H HD2  . PRO A 1 4   ? 12.075  13.000  8.389   1.00 1.00 ? 4   PRO A HD2  3  
ATOM 3950  H HD3  . PRO A 1 4   ? 12.254  14.491  9.367   1.00 1.00 ? 4   PRO A HD3  3  
ATOM 3951  N N    . HIS A 1 5   ? 9.325   14.891  4.546   1.00 1.00 ? 5   HIS A N    3  
ATOM 3952  C CA   . HIS A 1 5   ? 8.396   14.349  3.546   1.00 1.00 ? 5   HIS A CA   3  
ATOM 3953  C C    . HIS A 1 5   ? 9.127   13.576  2.420   1.00 1.00 ? 5   HIS A C    3  
ATOM 3954  O O    . HIS A 1 5   ? 10.304  13.826  2.128   1.00 1.00 ? 5   HIS A O    3  
ATOM 3955  C CB   . HIS A 1 5   ? 7.550   15.507  2.985   1.00 1.00 ? 5   HIS A CB   3  
ATOM 3956  C CG   . HIS A 1 5   ? 6.290   15.068  2.273   1.00 1.00 ? 5   HIS A CG   3  
ATOM 3957  N ND1  . HIS A 1 5   ? 6.162   14.745  0.940   1.00 1.00 ? 5   HIS A ND1  3  
ATOM 3958  C CD2  . HIS A 1 5   ? 5.053   14.917  2.841   1.00 1.00 ? 5   HIS A CD2  3  
ATOM 3959  C CE1  . HIS A 1 5   ? 4.880   14.396  0.715   1.00 1.00 ? 5   HIS A CE1  3  
ATOM 3960  N NE2  . HIS A 1 5   ? 4.161   14.482  1.851   1.00 1.00 ? 5   HIS A NE2  3  
ATOM 3961  H H    . HIS A 1 5   ? 9.700   15.818  4.383   1.00 1.00 ? 5   HIS A H    3  
ATOM 3962  H HA   . HIS A 1 5   ? 7.721   13.651  4.046   1.00 1.00 ? 5   HIS A HA   3  
ATOM 3963  H HB2  . HIS A 1 5   ? 7.246   16.154  3.813   1.00 1.00 ? 5   HIS A HB2  3  
ATOM 3964  H HB3  . HIS A 1 5   ? 8.157   16.108  2.306   1.00 1.00 ? 5   HIS A HB3  3  
ATOM 3965  H HD1  . HIS A 1 5   ? 6.906   14.711  0.244   1.00 1.00 ? 5   HIS A HD1  3  
ATOM 3966  H HD2  . HIS A 1 5   ? 4.812   15.098  3.884   1.00 1.00 ? 5   HIS A HD2  3  
ATOM 3967  H HE1  . HIS A 1 5   ? 4.493   14.075  -0.247  1.00 1.00 ? 5   HIS A HE1  3  
ATOM 3968  N N    . GLN A 1 6   ? 8.425   12.656  1.745   1.00 1.00 ? 6   GLN A N    3  
ATOM 3969  C CA   . GLN A 1 6   ? 8.928   11.957  0.554   1.00 1.00 ? 6   GLN A CA   3  
ATOM 3970  C C    . GLN A 1 6   ? 9.062   12.936  -0.632  1.00 1.00 ? 6   GLN A C    3  
ATOM 3971  O O    . GLN A 1 6   ? 8.194   13.787  -0.836  1.00 1.00 ? 6   GLN A O    3  
ATOM 3972  C CB   . GLN A 1 6   ? 7.973   10.789  0.235   1.00 1.00 ? 6   GLN A CB   3  
ATOM 3973  C CG   . GLN A 1 6   ? 8.452   9.881   -0.914  1.00 1.00 ? 6   GLN A CG   3  
ATOM 3974  C CD   . GLN A 1 6   ? 7.487   8.719   -1.170  1.00 1.00 ? 6   GLN A CD   3  
ATOM 3975  O OE1  . GLN A 1 6   ? 6.536   8.828   -1.935  1.00 1.00 ? 6   GLN A OE1  3  
ATOM 3976  N NE2  . GLN A 1 6   ? 7.679   7.566   -0.567  1.00 1.00 ? 6   GLN A NE2  3  
ATOM 3977  H H    . GLN A 1 6   ? 7.465   12.488  2.015   1.00 1.00 ? 6   GLN A H    3  
ATOM 3978  H HA   . GLN A 1 6   ? 9.918   11.555  0.781   1.00 1.00 ? 6   GLN A HA   3  
ATOM 3979  H HB2  . GLN A 1 6   ? 7.867   10.175  1.134   1.00 1.00 ? 6   GLN A HB2  3  
ATOM 3980  H HB3  . GLN A 1 6   ? 6.992   11.191  -0.022  1.00 1.00 ? 6   GLN A HB3  3  
ATOM 3981  H HG2  . GLN A 1 6   ? 8.528   10.459  -1.835  1.00 1.00 ? 6   GLN A HG2  3  
ATOM 3982  H HG3  . GLN A 1 6   ? 9.439   9.487   -0.682  1.00 1.00 ? 6   GLN A HG3  3  
ATOM 3983  H HE21 . GLN A 1 6   ? 8.452   7.436   0.074   1.00 1.00 ? 6   GLN A HE21 3  
ATOM 3984  H HE22 . GLN A 1 6   ? 7.034   6.810   -0.754  1.00 1.00 ? 6   GLN A HE22 3  
ATOM 3985  N N    . GLU A 1 7   ? 10.126  12.797  -1.437  1.00 1.00 ? 7   GLU A N    3  
ATOM 3986  C CA   . GLU A 1 7   ? 10.353  13.588  -2.655  1.00 1.00 ? 7   GLU A CA   3  
ATOM 3987  C C    . GLU A 1 7   ? 10.798  12.662  -3.809  1.00 1.00 ? 7   GLU A C    3  
ATOM 3988  O O    . GLU A 1 7   ? 11.686  11.827  -3.592  1.00 1.00 ? 7   GLU A O    3  
ATOM 3989  C CB   . GLU A 1 7   ? 11.421  14.664  -2.381  1.00 1.00 ? 7   GLU A CB   3  
ATOM 3990  C CG   . GLU A 1 7   ? 11.629  15.622  -3.562  1.00 1.00 ? 7   GLU A CG   3  
ATOM 3991  C CD   . GLU A 1 7   ? 12.789  16.590  -3.298  1.00 1.00 ? 7   GLU A CD   3  
ATOM 3992  O OE1  . GLU A 1 7   ? 12.603  17.576  -2.546  1.00 1.00 ? 7   GLU A OE1  3  
ATOM 3993  O OE2  . GLU A 1 7   ? 13.896  16.376  -3.849  1.00 1.00 ? 7   GLU A OE2  3  
ATOM 3994  H H    . GLU A 1 7   ? 10.818  12.090  -1.222  1.00 1.00 ? 7   GLU A H    3  
ATOM 3995  H HA   . GLU A 1 7   ? 9.428   14.096  -2.917  1.00 1.00 ? 7   GLU A HA   3  
ATOM 3996  H HB2  . GLU A 1 7   ? 11.115  15.247  -1.511  1.00 1.00 ? 7   GLU A HB2  3  
ATOM 3997  H HB3  . GLU A 1 7   ? 12.367  14.175  -2.155  1.00 1.00 ? 7   GLU A HB3  3  
ATOM 3998  H HG2  . GLU A 1 7   ? 11.849  15.049  -4.465  1.00 1.00 ? 7   GLU A HG2  3  
ATOM 3999  H HG3  . GLU A 1 7   ? 10.710  16.184  -3.729  1.00 1.00 ? 7   GLU A HG3  3  
ATOM 4000  N N    . PRO A 1 8   ? 10.213  12.789  -5.019  1.00 1.00 ? 8   PRO A N    3  
ATOM 4001  C CA   . PRO A 1 8   ? 10.586  11.997  -6.182  1.00 1.00 ? 8   PRO A CA   3  
ATOM 4002  C C    . PRO A 1 8   ? 11.885  12.499  -6.824  1.00 1.00 ? 8   PRO A C    3  
ATOM 4003  O O    . PRO A 1 8   ? 12.172  13.696  -6.843  1.00 1.00 ? 8   PRO A O    3  
ATOM 4004  C CB   . PRO A 1 8   ? 9.410   12.115  -7.147  1.00 1.00 ? 8   PRO A CB   3  
ATOM 4005  C CG   . PRO A 1 8   ? 8.852   13.501  -6.848  1.00 1.00 ? 8   PRO A CG   3  
ATOM 4006  C CD   . PRO A 1 8   ? 9.092   13.661  -5.348  1.00 1.00 ? 8   PRO A CD   3  
ATOM 4007  H HA   . PRO A 1 8   ? 10.707  10.953  -5.902  1.00 1.00 ? 8   PRO A HA   3  
ATOM 4008  H HB2  . PRO A 1 8   ? 9.714   12.013  -8.189  1.00 1.00 ? 8   PRO A HB2  3  
ATOM 4009  H HB3  . PRO A 1 8   ? 8.658   11.371  -6.897  1.00 1.00 ? 8   PRO A HB3  3  
ATOM 4010  H HG2  . PRO A 1 8   ? 9.416   14.254  -7.397  1.00 1.00 ? 8   PRO A HG2  3  
ATOM 4011  H HG3  . PRO A 1 8   ? 7.794   13.554  -7.093  1.00 1.00 ? 8   PRO A HG3  3  
ATOM 4012  H HD2  . PRO A 1 8   ? 9.325   14.701  -5.112  1.00 1.00 ? 8   PRO A HD2  3  
ATOM 4013  H HD3  . PRO A 1 8   ? 8.208   13.338  -4.798  1.00 1.00 ? 8   PRO A HD3  3  
ATOM 4014  N N    . LYS A 1 9   ? 12.642  11.564  -7.396  1.00 1.00 ? 9   LYS A N    3  
ATOM 4015  C CA   . LYS A 1 9   ? 13.875  11.794  -8.159  1.00 1.00 ? 9   LYS A CA   3  
ATOM 4016  C C    . LYS A 1 9   ? 13.778  11.218  -9.591  1.00 1.00 ? 9   LYS A C    3  
ATOM 4017  O O    . LYS A 1 9   ? 12.882  10.412  -9.864  1.00 1.00 ? 9   LYS A O    3  
ATOM 4018  C CB   . LYS A 1 9   ? 15.059  11.186  -7.376  1.00 1.00 ? 9   LYS A CB   3  
ATOM 4019  C CG   . LYS A 1 9   ? 15.413  11.932  -6.079  1.00 1.00 ? 9   LYS A CG   3  
ATOM 4020  C CD   . LYS A 1 9   ? 15.688  13.432  -6.295  1.00 1.00 ? 9   LYS A CD   3  
ATOM 4021  C CE   . LYS A 1 9   ? 16.359  14.011  -5.037  1.00 1.00 ? 9   LYS A CE   3  
ATOM 4022  N NZ   . LYS A 1 9   ? 16.308  15.498  -4.993  1.00 1.00 ? 9   LYS A NZ   3  
ATOM 4023  H H    . LYS A 1 9   ? 12.330  10.597  -7.313  1.00 1.00 ? 9   LYS A H    3  
ATOM 4024  H HA   . LYS A 1 9   ? 14.017  12.866  -8.271  1.00 1.00 ? 9   LYS A HA   3  
ATOM 4025  H HB2  . LYS A 1 9   ? 14.824  10.149  -7.128  1.00 1.00 ? 9   LYS A HB2  3  
ATOM 4026  H HB3  . LYS A 1 9   ? 15.951  11.172  -8.001  1.00 1.00 ? 9   LYS A HB3  3  
ATOM 4027  H HG2  . LYS A 1 9   ? 14.596  11.816  -5.363  1.00 1.00 ? 9   LYS A HG2  3  
ATOM 4028  H HG3  . LYS A 1 9   ? 16.307  11.465  -5.659  1.00 1.00 ? 9   LYS A HG3  3  
ATOM 4029  H HD2  . LYS A 1 9   ? 16.333  13.568  -7.169  1.00 1.00 ? 9   LYS A HD2  3  
ATOM 4030  H HD3  . LYS A 1 9   ? 14.744  13.951  -6.484  1.00 1.00 ? 9   LYS A HD3  3  
ATOM 4031  H HE2  . LYS A 1 9   ? 15.858  13.608  -4.153  1.00 1.00 ? 9   LYS A HE2  3  
ATOM 4032  H HE3  . LYS A 1 9   ? 17.399  13.668  -5.008  1.00 1.00 ? 9   LYS A HE3  3  
ATOM 4033  H HZ1  . LYS A 1 9   ? 16.896  15.853  -4.253  1.00 1.00 ? 9   LYS A HZ1  3  
ATOM 4034  H HZ2  . LYS A 1 9   ? 16.617  15.915  -5.861  1.00 1.00 ? 9   LYS A HZ2  3  
ATOM 4035  H HZ3  . LYS A 1 9   ? 15.359  15.820  -4.782  1.00 1.00 ? 9   LYS A HZ3  3  
ATOM 4036  N N    . PRO A 1 10  ? 14.660  11.648  -10.527 1.00 1.00 ? 10  PRO A N    3  
ATOM 4037  C CA   . PRO A 1 10  ? 14.623  11.237  -11.930 1.00 1.00 ? 10  PRO A CA   3  
ATOM 4038  C C    . PRO A 1 10  ? 14.446  9.720   -12.114 1.00 1.00 ? 10  PRO A C    3  
ATOM 4039  O O    . PRO A 1 10  ? 15.179  8.929   -11.520 1.00 1.00 ? 10  PRO A O    3  
ATOM 4040  C CB   . PRO A 1 10  ? 15.929  11.757  -12.541 1.00 1.00 ? 10  PRO A CB   3  
ATOM 4041  C CG   . PRO A 1 10  ? 16.162  13.045  -11.761 1.00 1.00 ? 10  PRO A CG   3  
ATOM 4042  C CD   . PRO A 1 10  ? 15.698  12.666  -10.354 1.00 1.00 ? 10  PRO A CD   3  
ATOM 4043  H HA   . PRO A 1 10  ? 13.800  11.765  -12.401 1.00 1.00 ? 10  PRO A HA   3  
ATOM 4044  H HB2  . PRO A 1 10  ? 16.747  11.060  -12.349 1.00 1.00 ? 10  PRO A HB2  3  
ATOM 4045  H HB3  . PRO A 1 10  ? 15.841  11.956  -13.607 1.00 1.00 ? 10  PRO A HB3  3  
ATOM 4046  H HG2  . PRO A 1 10  ? 17.212  13.346  -11.778 1.00 1.00 ? 10  PRO A HG2  3  
ATOM 4047  H HG3  . PRO A 1 10  ? 15.527  13.836  -12.159 1.00 1.00 ? 10  PRO A HG3  3  
ATOM 4048  H HD2  . PRO A 1 10  ? 16.540  12.249  -9.804  1.00 1.00 ? 10  PRO A HD2  3  
ATOM 4049  H HD3  . PRO A 1 10  ? 15.324  13.559  -9.848  1.00 1.00 ? 10  PRO A HD3  3  
ATOM 4050  N N    . GLY A 1 11  ? 13.442  9.332   -12.912 1.00 1.00 ? 11  GLY A N    3  
ATOM 4051  C CA   . GLY A 1 11  ? 13.103  7.932   -13.213 1.00 1.00 ? 11  GLY A CA   3  
ATOM 4052  C C    . GLY A 1 11  ? 12.055  7.296   -12.286 1.00 1.00 ? 11  GLY A C    3  
ATOM 4053  O O    . GLY A 1 11  ? 11.606  6.189   -12.580 1.00 1.00 ? 11  GLY A O    3  
ATOM 4054  H H    . GLY A 1 11  ? 12.825  10.042  -13.296 1.00 1.00 ? 11  GLY A H    3  
ATOM 4055  H HA2  . GLY A 1 11  ? 12.703  7.883   -14.226 1.00 1.00 ? 11  GLY A HA2  3  
ATOM 4056  H HA3  . GLY A 1 11  ? 14.003  7.317   -13.152 1.00 1.00 ? 11  GLY A HA3  3  
ATOM 4057  N N    . ASP A 1 12  ? 11.656  7.960   -11.195 1.00 1.00 ? 12  ASP A N    3  
ATOM 4058  C CA   . ASP A 1 12  ? 10.683  7.428   -10.236 1.00 1.00 ? 12  ASP A CA   3  
ATOM 4059  C C    . ASP A 1 12  ? 9.270   7.268   -10.822 1.00 1.00 ? 12  ASP A C    3  
ATOM 4060  O O    . ASP A 1 12  ? 8.784   8.097   -11.600 1.00 1.00 ? 12  ASP A O    3  
ATOM 4061  C CB   . ASP A 1 12  ? 10.633  8.292   -8.963  1.00 1.00 ? 12  ASP A CB   3  
ATOM 4062  C CG   . ASP A 1 12  ? 11.817  8.080   -7.997  1.00 1.00 ? 12  ASP A CG   3  
ATOM 4063  O OD1  . ASP A 1 12  ? 12.645  7.158   -8.199  1.00 1.00 ? 12  ASP A OD1  3  
ATOM 4064  O OD2  . ASP A 1 12  ? 11.883  8.813   -6.985  1.00 1.00 ? 12  ASP A OD2  3  
ATOM 4065  H H    . ASP A 1 12  ? 12.095  8.842   -10.970 1.00 1.00 ? 12  ASP A H    3  
ATOM 4066  H HA   . ASP A 1 12  ? 11.018  6.434   -9.941  1.00 1.00 ? 12  ASP A HA   3  
ATOM 4067  H HB2  . ASP A 1 12  ? 10.559  9.343   -9.244  1.00 1.00 ? 12  ASP A HB2  3  
ATOM 4068  H HB3  . ASP A 1 12  ? 9.720   8.043   -8.424  1.00 1.00 ? 12  ASP A HB3  3  
ATOM 4069  N N    . LEU A 1 13  ? 8.595   6.199   -10.395 1.00 1.00 ? 13  LEU A N    3  
ATOM 4070  C CA   . LEU A 1 13  ? 7.193   5.921   -10.681 1.00 1.00 ? 13  LEU A CA   3  
ATOM 4071  C C    . LEU A 1 13  ? 6.319   6.578   -9.614  1.00 1.00 ? 13  LEU A C    3  
ATOM 4072  O O    . LEU A 1 13  ? 6.485   6.323   -8.425  1.00 1.00 ? 13  LEU A O    3  
ATOM 4073  C CB   . LEU A 1 13  ? 6.969   4.395   -10.719 1.00 1.00 ? 13  LEU A CB   3  
ATOM 4074  C CG   . LEU A 1 13  ? 7.760   3.656   -11.816 1.00 1.00 ? 13  LEU A CG   3  
ATOM 4075  C CD1  . LEU A 1 13  ? 7.530   2.140   -11.698 1.00 1.00 ? 13  LEU A CD1  3  
ATOM 4076  C CD2  . LEU A 1 13  ? 7.330   4.119   -13.209 1.00 1.00 ? 13  LEU A CD2  3  
ATOM 4077  H H    . LEU A 1 13  ? 9.059   5.588   -9.731  1.00 1.00 ? 13  LEU A H    3  
ATOM 4078  H HA   . LEU A 1 13  ? 6.922   6.358   -11.644 1.00 1.00 ? 13  LEU A HA   3  
ATOM 4079  H HB2  . LEU A 1 13  ? 7.253   3.981   -9.751  1.00 1.00 ? 13  LEU A HB2  3  
ATOM 4080  H HB3  . LEU A 1 13  ? 5.904   4.200   -10.857 1.00 1.00 ? 13  LEU A HB3  3  
ATOM 4081  H HG   . LEU A 1 13  ? 8.827   3.847   -11.691 1.00 1.00 ? 13  LEU A HG   3  
ATOM 4082  H HD11 . LEU A 1 13  ? 6.473   1.908   -11.842 1.00 1.00 ? 13  LEU A HD11 3  
ATOM 4083  H HD12 . LEU A 1 13  ? 8.116   1.619   -12.457 1.00 1.00 ? 13  LEU A HD12 3  
ATOM 4084  H HD13 . LEU A 1 13  ? 7.843   1.791   -10.714 1.00 1.00 ? 13  LEU A HD13 3  
ATOM 4085  H HD21 . LEU A 1 13  ? 7.483   5.192   -13.325 1.00 1.00 ? 13  LEU A HD21 3  
ATOM 4086  H HD22 . LEU A 1 13  ? 7.917   3.596   -13.964 1.00 1.00 ? 13  LEU A HD22 3  
ATOM 4087  H HD23 . LEU A 1 13  ? 6.274   3.900   -13.350 1.00 1.00 ? 13  LEU A HD23 3  
ATOM 4088  N N    . ILE A 1 14  ? 5.363   7.402   -10.042 1.00 1.00 ? 14  ILE A N    3  
ATOM 4089  C CA   . ILE A 1 14  ? 4.402   8.083   -9.170  1.00 1.00 ? 14  ILE A CA   3  
ATOM 4090  C C    . ILE A 1 14  ? 3.075   7.338   -9.280  1.00 1.00 ? 14  ILE A C    3  
ATOM 4091  O O    . ILE A 1 14  ? 2.622   7.082   -10.391 1.00 1.00 ? 14  ILE A O    3  
ATOM 4092  C CB   . ILE A 1 14  ? 4.225   9.569   -9.582  1.00 1.00 ? 14  ILE A CB   3  
ATOM 4093  C CG1  . ILE A 1 14  ? 5.552   10.333  -9.811  1.00 1.00 ? 14  ILE A CG1  3  
ATOM 4094  C CG2  . ILE A 1 14  ? 3.358   10.308  -8.545  1.00 1.00 ? 14  ILE A CG2  3  
ATOM 4095  C CD1  . ILE A 1 14  ? 6.495   10.365  -8.603  1.00 1.00 ? 14  ILE A CD1  3  
ATOM 4096  H H    . ILE A 1 14  ? 5.227   7.488   -11.049 1.00 1.00 ? 14  ILE A H    3  
ATOM 4097  H HA   . ILE A 1 14  ? 4.747   8.043   -8.133  1.00 1.00 ? 14  ILE A HA   3  
ATOM 4098  H HB   . ILE A 1 14  ? 3.687   9.587   -10.531 1.00 1.00 ? 14  ILE A HB   3  
ATOM 4099  H HG12 . ILE A 1 14  ? 6.084   9.886   -10.651 1.00 1.00 ? 14  ILE A HG12 3  
ATOM 4100  H HG13 . ILE A 1 14  ? 5.320   11.362  -10.093 1.00 1.00 ? 14  ILE A HG13 3  
ATOM 4101  H HG21 . ILE A 1 14  ? 3.247   11.358  -8.829  1.00 1.00 ? 14  ILE A HG21 3  
ATOM 4102  H HG22 . ILE A 1 14  ? 2.365   9.861   -8.497  1.00 1.00 ? 14  ILE A HG22 3  
ATOM 4103  H HG23 . ILE A 1 14  ? 3.810   10.251  -7.554  1.00 1.00 ? 14  ILE A HG23 3  
ATOM 4104  H HD11 . ILE A 1 14  ? 6.031   10.889  -7.765  1.00 1.00 ? 14  ILE A HD11 3  
ATOM 4105  H HD12 . ILE A 1 14  ? 6.763   9.352   -8.304  1.00 1.00 ? 14  ILE A HD12 3  
ATOM 4106  H HD13 . ILE A 1 14  ? 7.405   10.896  -8.875  1.00 1.00 ? 14  ILE A HD13 3  
ATOM 4107  N N    . GLU A 1 15  ? 2.461   7.023   -8.146  1.00 1.00 ? 15  GLU A N    3  
ATOM 4108  C CA   . GLU A 1 15  ? 1.124   6.454   -8.029  1.00 1.00 ? 15  GLU A CA   3  
ATOM 4109  C C    . GLU A 1 15  ? 0.194   7.529   -7.459  1.00 1.00 ? 15  GLU A C    3  
ATOM 4110  O O    . GLU A 1 15  ? 0.525   8.176   -6.466  1.00 1.00 ? 15  GLU A O    3  
ATOM 4111  C CB   . GLU A 1 15  ? 1.213   5.226   -7.115  1.00 1.00 ? 15  GLU A CB   3  
ATOM 4112  C CG   . GLU A 1 15  ? -0.129  4.541   -6.851  1.00 1.00 ? 15  GLU A CG   3  
ATOM 4113  C CD   . GLU A 1 15  ? 0.094   3.207   -6.124  1.00 1.00 ? 15  GLU A CD   3  
ATOM 4114  O OE1  . GLU A 1 15  ? 0.881   3.177   -5.149  1.00 1.00 ? 15  GLU A OE1  3  
ATOM 4115  O OE2  . GLU A 1 15  ? -0.482  2.176   -6.545  1.00 1.00 ? 15  GLU A OE2  3  
ATOM 4116  H H    . GLU A 1 15  ? 2.906   7.294   -7.274  1.00 1.00 ? 15  GLU A H    3  
ATOM 4117  H HA   . GLU A 1 15  ? 0.754   6.146   -9.009  1.00 1.00 ? 15  GLU A HA   3  
ATOM 4118  H HB2  . GLU A 1 15  ? 1.879   4.500   -7.584  1.00 1.00 ? 15  GLU A HB2  3  
ATOM 4119  H HB3  . GLU A 1 15  ? 1.646   5.524   -6.160  1.00 1.00 ? 15  GLU A HB3  3  
ATOM 4120  H HG2  . GLU A 1 15  ? -0.751  5.191   -6.233  1.00 1.00 ? 15  GLU A HG2  3  
ATOM 4121  H HG3  . GLU A 1 15  ? -0.640  4.373   -7.800  1.00 1.00 ? 15  GLU A HG3  3  
ATOM 4122  N N    . ILE A 1 16  ? -0.948  7.751   -8.109  1.00 1.00 ? 16  ILE A N    3  
ATOM 4123  C CA   . ILE A 1 16  ? -1.873  8.857   -7.829  1.00 1.00 ? 16  ILE A CA   3  
ATOM 4124  C C    . ILE A 1 16  ? -3.280  8.296   -7.600  1.00 1.00 ? 16  ILE A C    3  
ATOM 4125  O O    . ILE A 1 16  ? -3.895  7.719   -8.496  1.00 1.00 ? 16  ILE A O    3  
ATOM 4126  C CB   . ILE A 1 16  ? -1.862  9.888   -8.985  1.00 1.00 ? 16  ILE A CB   3  
ATOM 4127  C CG1  . ILE A 1 16  ? -0.428  10.317  -9.382  1.00 1.00 ? 16  ILE A CG1  3  
ATOM 4128  C CG2  . ILE A 1 16  ? -2.709  11.107  -8.571  1.00 1.00 ? 16  ILE A CG2  3  
ATOM 4129  C CD1  . ILE A 1 16  ? -0.359  11.231  -10.610 1.00 1.00 ? 16  ILE A CD1  3  
ATOM 4130  H H    . ILE A 1 16  ? -1.142  7.203   -8.950  1.00 1.00 ? 16  ILE A H    3  
ATOM 4131  H HA   . ILE A 1 16  ? -1.562  9.369   -6.914  1.00 1.00 ? 16  ILE A HA   3  
ATOM 4132  H HB   . ILE A 1 16  ? -2.322  9.429   -9.859  1.00 1.00 ? 16  ILE A HB   3  
ATOM 4133  H HG12 . ILE A 1 16  ? 0.049   10.812  -8.537  1.00 1.00 ? 16  ILE A HG12 3  
ATOM 4134  H HG13 . ILE A 1 16  ? 0.162   9.436   -9.633  1.00 1.00 ? 16  ILE A HG13 3  
ATOM 4135  H HG21 . ILE A 1 16  ? -2.250  11.619  -7.723  1.00 1.00 ? 16  ILE A HG21 3  
ATOM 4136  H HG22 . ILE A 1 16  ? -2.812  11.805  -9.400  1.00 1.00 ? 16  ILE A HG22 3  
ATOM 4137  H HG23 . ILE A 1 16  ? -3.714  10.790  -8.286  1.00 1.00 ? 16  ILE A HG23 3  
ATOM 4138  H HD11 . ILE A 1 16  ? -0.832  12.193  -10.402 1.00 1.00 ? 16  ILE A HD11 3  
ATOM 4139  H HD12 . ILE A 1 16  ? 0.686   11.403  -10.870 1.00 1.00 ? 16  ILE A HD12 3  
ATOM 4140  H HD13 . ILE A 1 16  ? -0.860  10.756  -11.453 1.00 1.00 ? 16  ILE A HD13 3  
ATOM 4141  N N    . PHE A 1 17  ? -3.821  8.510   -6.406  1.00 1.00 ? 17  PHE A N    3  
ATOM 4142  C CA   . PHE A 1 17  ? -5.124  8.015   -5.966  1.00 1.00 ? 17  PHE A CA   3  
ATOM 4143  C C    . PHE A 1 17  ? -6.233  9.017   -6.330  1.00 1.00 ? 17  PHE A C    3  
ATOM 4144  O O    . PHE A 1 17  ? -6.875  9.616   -5.462  1.00 1.00 ? 17  PHE A O    3  
ATOM 4145  C CB   . PHE A 1 17  ? -5.042  7.691   -4.467  1.00 1.00 ? 17  PHE A CB   3  
ATOM 4146  C CG   . PHE A 1 17  ? -3.959  6.683   -4.125  1.00 1.00 ? 17  PHE A CG   3  
ATOM 4147  C CD1  . PHE A 1 17  ? -4.128  5.332   -4.475  1.00 1.00 ? 17  PHE A CD1  3  
ATOM 4148  C CD2  . PHE A 1 17  ? -2.769  7.100   -3.494  1.00 1.00 ? 17  PHE A CD2  3  
ATOM 4149  C CE1  . PHE A 1 17  ? -3.118  4.397   -4.188  1.00 1.00 ? 17  PHE A CE1  3  
ATOM 4150  C CE2  . PHE A 1 17  ? -1.761  6.164   -3.205  1.00 1.00 ? 17  PHE A CE2  3  
ATOM 4151  C CZ   . PHE A 1 17  ? -1.937  4.812   -3.549  1.00 1.00 ? 17  PHE A CZ   3  
ATOM 4152  H H    . PHE A 1 17  ? -3.303  9.082   -5.749  1.00 1.00 ? 17  PHE A H    3  
ATOM 4153  H HA   . PHE A 1 17  ? -5.342  7.084   -6.494  1.00 1.00 ? 17  PHE A HA   3  
ATOM 4154  H HB2  . PHE A 1 17  ? -4.861  8.609   -3.910  1.00 1.00 ? 17  PHE A HB2  3  
ATOM 4155  H HB3  . PHE A 1 17  ? -6.002  7.286   -4.139  1.00 1.00 ? 17  PHE A HB3  3  
ATOM 4156  H HD1  . PHE A 1 17  ? -5.037  5.005   -4.964  1.00 1.00 ? 17  PHE A HD1  3  
ATOM 4157  H HD2  . PHE A 1 17  ? -2.626  8.139   -3.229  1.00 1.00 ? 17  PHE A HD2  3  
ATOM 4158  H HE1  . PHE A 1 17  ? -3.248  3.358   -4.462  1.00 1.00 ? 17  PHE A HE1  3  
ATOM 4159  H HE2  . PHE A 1 17  ? -0.853  6.481   -2.712  1.00 1.00 ? 17  PHE A HE2  3  
ATOM 4160  H HZ   . PHE A 1 17  ? -1.169  4.089   -3.329  1.00 1.00 ? 17  PHE A HZ   3  
ATOM 4161  N N    . ARG A 1 18  ? -6.440  9.214   -7.639  1.00 1.00 ? 18  ARG A N    3  
ATOM 4162  C CA   . ARG A 1 18  ? -7.585  9.961   -8.182  1.00 1.00 ? 18  ARG A CA   3  
ATOM 4163  C C    . ARG A 1 18  ? -8.910  9.255   -7.823  1.00 1.00 ? 18  ARG A C    3  
ATOM 4164  O O    . ARG A 1 18  ? -8.943  8.034   -7.652  1.00 1.00 ? 18  ARG A O    3  
ATOM 4165  C CB   . ARG A 1 18  ? -7.400  10.123  -9.705  1.00 1.00 ? 18  ARG A CB   3  
ATOM 4166  C CG   . ARG A 1 18  ? -8.438  11.055  -10.358 1.00 1.00 ? 18  ARG A CG   3  
ATOM 4167  C CD   . ARG A 1 18  ? -8.165  11.271  -11.848 1.00 1.00 ? 18  ARG A CD   3  
ATOM 4168  N NE   . ARG A 1 18  ? -9.062  12.308  -12.395 1.00 1.00 ? 18  ARG A NE   3  
ATOM 4169  C CZ   . ARG A 1 18  ? -9.102  12.743  -13.648 1.00 1.00 ? 18  ARG A CZ   3  
ATOM 4170  N NH1  . ARG A 1 18  ? -8.368  12.213  -14.604 1.00 1.00 ? 18  ARG A NH1  3  
ATOM 4171  N NH2  . ARG A 1 18  ? -9.899  13.743  -13.962 1.00 1.00 ? 18  ARG A NH2  3  
ATOM 4172  H H    . ARG A 1 18  ? -5.845  8.712   -8.284  1.00 1.00 ? 18  ARG A H    3  
ATOM 4173  H HA   . ARG A 1 18  ? -7.592  10.951  -7.719  1.00 1.00 ? 18  ARG A HA   3  
ATOM 4174  H HB2  . ARG A 1 18  ? -6.410  10.535  -9.887  1.00 1.00 ? 18  ARG A HB2  3  
ATOM 4175  H HB3  . ARG A 1 18  ? -7.449  9.145   -10.181 1.00 1.00 ? 18  ARG A HB3  3  
ATOM 4176  H HG2  . ARG A 1 18  ? -9.434  10.628  -10.256 1.00 1.00 ? 18  ARG A HG2  3  
ATOM 4177  H HG3  . ARG A 1 18  ? -8.418  12.021  -9.852  1.00 1.00 ? 18  ARG A HG3  3  
ATOM 4178  H HD2  . ARG A 1 18  ? -7.128  11.586  -11.985 1.00 1.00 ? 18  ARG A HD2  3  
ATOM 4179  H HD3  . ARG A 1 18  ? -8.328  10.329  -12.372 1.00 1.00 ? 18  ARG A HD3  3  
ATOM 4180  H HE   . ARG A 1 18  ? -9.674  12.766  -11.734 1.00 1.00 ? 18  ARG A HE   3  
ATOM 4181  H HH11 . ARG A 1 18  ? -7.795  11.395  -14.421 1.00 1.00 ? 18  ARG A HH11 3  
ATOM 4182  H HH12 . ARG A 1 18  ? -8.413  12.572  -15.544 1.00 1.00 ? 18  ARG A HH12 3  
ATOM 4183  H HH21 . ARG A 1 18  ? -10.478 14.176  -13.259 1.00 1.00 ? 18  ARG A HH21 3  
ATOM 4184  H HH22 . ARG A 1 18  ? -9.941  14.096  -14.906 1.00 1.00 ? 18  ARG A HH22 3  
ATOM 4185  N N    . LEU A 1 19  ? -10.002 10.024  -7.707  1.00 1.00 ? 19  LEU A N    3  
ATOM 4186  C CA   . LEU A 1 19  ? -11.353 9.507   -7.450  1.00 1.00 ? 19  LEU A CA   3  
ATOM 4187  C C    . LEU A 1 19  ? -11.750 8.462   -8.515  1.00 1.00 ? 19  LEU A C    3  
ATOM 4188  O O    . LEU A 1 19  ? -11.606 8.714   -9.714  1.00 1.00 ? 19  LEU A O    3  
ATOM 4189  C CB   . LEU A 1 19  ? -12.334 10.698  -7.407  1.00 1.00 ? 19  LEU A CB   3  
ATOM 4190  C CG   . LEU A 1 19  ? -13.807 10.328  -7.120  1.00 1.00 ? 19  LEU A CG   3  
ATOM 4191  C CD1  . LEU A 1 19  ? -13.992 9.666   -5.743  1.00 1.00 ? 19  LEU A CD1  3  
ATOM 4192  C CD2  . LEU A 1 19  ? -14.673 11.596  -7.193  1.00 1.00 ? 19  LEU A CD2  3  
ATOM 4193  H H    . LEU A 1 19  ? -9.893  11.018  -7.841  1.00 1.00 ? 19  LEU A H    3  
ATOM 4194  H HA   . LEU A 1 19  ? -11.342 9.021   -6.474  1.00 1.00 ? 19  LEU A HA   3  
ATOM 4195  H HB2  . LEU A 1 19  ? -12.004 11.399  -6.641  1.00 1.00 ? 19  LEU A HB2  3  
ATOM 4196  H HB3  . LEU A 1 19  ? -12.294 11.208  -8.369  1.00 1.00 ? 19  LEU A HB3  3  
ATOM 4197  H HG   . LEU A 1 19  ? -14.162 9.638   -7.885  1.00 1.00 ? 19  LEU A HG   3  
ATOM 4198  H HD11 . LEU A 1 19  ? -13.468 8.711   -5.710  1.00 1.00 ? 19  LEU A HD11 3  
ATOM 4199  H HD12 . LEU A 1 19  ? -13.602 10.319  -4.961  1.00 1.00 ? 19  LEU A HD12 3  
ATOM 4200  H HD13 . LEU A 1 19  ? -15.049 9.479   -5.559  1.00 1.00 ? 19  LEU A HD13 3  
ATOM 4201  H HD21 . LEU A 1 19  ? -14.580 12.053  -8.180  1.00 1.00 ? 19  LEU A HD21 3  
ATOM 4202  H HD22 . LEU A 1 19  ? -15.719 11.340  -7.021  1.00 1.00 ? 19  LEU A HD22 3  
ATOM 4203  H HD23 . LEU A 1 19  ? -14.354 12.318  -6.439  1.00 1.00 ? 19  LEU A HD23 3  
ATOM 4204  N N    . GLY A 1 20  ? -12.227 7.289   -8.077  1.00 1.00 ? 20  GLY A N    3  
ATOM 4205  C CA   . GLY A 1 20  ? -12.444 6.128   -8.948  1.00 1.00 ? 20  GLY A CA   3  
ATOM 4206  C C    . GLY A 1 20  ? -11.121 5.408   -9.220  1.00 1.00 ? 20  GLY A C    3  
ATOM 4207  O O    . GLY A 1 20  ? -10.438 4.982   -8.289  1.00 1.00 ? 20  GLY A O    3  
ATOM 4208  H H    . GLY A 1 20  ? -12.319 7.143   -7.081  1.00 1.00 ? 20  GLY A H    3  
ATOM 4209  H HA2  . GLY A 1 20  ? -13.121 5.421   -8.471  1.00 1.00 ? 20  GLY A HA2  3  
ATOM 4210  H HA3  . GLY A 1 20  ? -12.878 6.449   -9.897  1.00 1.00 ? 20  GLY A HA3  3  
ATOM 4211  N N    . TYR A 1 21  ? -10.768 5.254   -10.499 1.00 1.00 ? 21  TYR A N    3  
ATOM 4212  C CA   . TYR A 1 21  ? -9.510  4.636   -10.942 1.00 1.00 ? 21  TYR A CA   3  
ATOM 4213  C C    . TYR A 1 21  ? -8.266  5.457   -10.543 1.00 1.00 ? 21  TYR A C    3  
ATOM 4214  O O    . TYR A 1 21  ? -8.243  6.681   -10.713 1.00 1.00 ? 21  TYR A O    3  
ATOM 4215  C CB   . TYR A 1 21  ? -9.526  4.461   -12.471 1.00 1.00 ? 21  TYR A CB   3  
ATOM 4216  C CG   . TYR A 1 21  ? -10.787 3.840   -13.045 1.00 1.00 ? 21  TYR A CG   3  
ATOM 4217  C CD1  . TYR A 1 21  ? -10.937 2.440   -13.088 1.00 1.00 ? 21  TYR A CD1  3  
ATOM 4218  C CD2  . TYR A 1 21  ? -11.817 4.671   -13.534 1.00 1.00 ? 21  TYR A CD2  3  
ATOM 4219  C CE1  . TYR A 1 21  ? -12.106 1.870   -13.631 1.00 1.00 ? 21  TYR A CE1  3  
ATOM 4220  C CE2  . TYR A 1 21  ? -12.992 4.107   -14.061 1.00 1.00 ? 21  TYR A CE2  3  
ATOM 4221  C CZ   . TYR A 1 21  ? -13.136 2.702   -14.126 1.00 1.00 ? 21  TYR A CZ   3  
ATOM 4222  O OH   . TYR A 1 21  ? -14.253 2.149   -14.672 1.00 1.00 ? 21  TYR A OH   3  
ATOM 4223  H H    . TYR A 1 21  ? -11.380 5.615   -11.212 1.00 1.00 ? 21  TYR A H    3  
ATOM 4224  H HA   . TYR A 1 21  ? -9.438  3.650   -10.486 1.00 1.00 ? 21  TYR A HA   3  
ATOM 4225  H HB2  . TYR A 1 21  ? -9.382  5.437   -12.938 1.00 1.00 ? 21  TYR A HB2  3  
ATOM 4226  H HB3  . TYR A 1 21  ? -8.673  3.844   -12.754 1.00 1.00 ? 21  TYR A HB3  3  
ATOM 4227  H HD1  . TYR A 1 21  ? -10.149 1.801   -12.713 1.00 1.00 ? 21  TYR A HD1  3  
ATOM 4228  H HD2  . TYR A 1 21  ? -11.708 5.749   -13.509 1.00 1.00 ? 21  TYR A HD2  3  
ATOM 4229  H HE1  . TYR A 1 21  ? -12.214 0.795   -13.679 1.00 1.00 ? 21  TYR A HE1  3  
ATOM 4230  H HE2  . TYR A 1 21  ? -13.777 4.749   -14.434 1.00 1.00 ? 21  TYR A HE2  3  
ATOM 4231  H HH   . TYR A 1 21  ? -14.880 2.818   -14.983 1.00 1.00 ? 21  TYR A HH   3  
ATOM 4232  N N    . GLU A 1 22  ? -7.209  4.786   -10.080 1.00 1.00 ? 22  GLU A N    3  
ATOM 4233  C CA   . GLU A 1 22  ? -5.891  5.394   -9.859  1.00 1.00 ? 22  GLU A CA   3  
ATOM 4234  C C    . GLU A 1 22  ? -5.262  5.868   -11.189 1.00 1.00 ? 22  GLU A C    3  
ATOM 4235  O O    . GLU A 1 22  ? -5.656  5.438   -12.274 1.00 1.00 ? 22  GLU A O    3  
ATOM 4236  C CB   . GLU A 1 22  ? -4.927  4.422   -9.148  1.00 1.00 ? 22  GLU A CB   3  
ATOM 4237  C CG   . GLU A 1 22  ? -5.490  3.703   -7.914  1.00 1.00 ? 22  GLU A CG   3  
ATOM 4238  C CD   . GLU A 1 22  ? -6.057  2.318   -8.278  1.00 1.00 ? 22  GLU A CD   3  
ATOM 4239  O OE1  . GLU A 1 22  ? -7.134  2.247   -8.917  1.00 1.00 ? 22  GLU A OE1  3  
ATOM 4240  O OE2  . GLU A 1 22  ? -5.422  1.291   -7.939  1.00 1.00 ? 22  GLU A OE2  3  
ATOM 4241  H H    . GLU A 1 22  ? -7.305  3.789   -9.889  1.00 1.00 ? 22  GLU A H    3  
ATOM 4242  H HA   . GLU A 1 22  ? -6.024  6.267   -9.217  1.00 1.00 ? 22  GLU A HA   3  
ATOM 4243  H HB2  . GLU A 1 22  ? -4.589  3.672   -9.860  1.00 1.00 ? 22  GLU A HB2  3  
ATOM 4244  H HB3  . GLU A 1 22  ? -4.050  4.992   -8.839  1.00 1.00 ? 22  GLU A HB3  3  
ATOM 4245  H HG2  . GLU A 1 22  ? -4.677  3.578   -7.197  1.00 1.00 ? 22  GLU A HG2  3  
ATOM 4246  H HG3  . GLU A 1 22  ? -6.253  4.319   -7.433  1.00 1.00 ? 22  GLU A HG3  3  
ATOM 4247  N N    . HIS A 1 23  ? -4.276  6.762   -11.111 1.00 1.00 ? 23  HIS A N    3  
ATOM 4248  C CA   . HIS A 1 23  ? -3.457  7.242   -12.232 1.00 1.00 ? 23  HIS A CA   3  
ATOM 4249  C C    . HIS A 1 23  ? -1.960  7.141   -11.863 1.00 1.00 ? 23  HIS A C    3  
ATOM 4250  O O    . HIS A 1 23  ? -1.620  6.996   -10.689 1.00 1.00 ? 23  HIS A O    3  
ATOM 4251  C CB   . HIS A 1 23  ? -3.856  8.695   -12.582 1.00 1.00 ? 23  HIS A CB   3  
ATOM 4252  C CG   . HIS A 1 23  ? -5.167  8.859   -13.321 1.00 1.00 ? 23  HIS A CG   3  
ATOM 4253  N ND1  . HIS A 1 23  ? -6.217  7.972   -13.377 1.00 1.00 ? 23  HIS A ND1  3  
ATOM 4254  C CD2  . HIS A 1 23  ? -5.525  9.934   -14.088 1.00 1.00 ? 23  HIS A CD2  3  
ATOM 4255  C CE1  . HIS A 1 23  ? -7.183  8.498   -14.145 1.00 1.00 ? 23  HIS A CE1  3  
ATOM 4256  N NE2  . HIS A 1 23  ? -6.809  9.707   -14.596 1.00 1.00 ? 23  HIS A NE2  3  
ATOM 4257  H H    . HIS A 1 23  ? -3.959  7.034   -10.180 1.00 1.00 ? 23  HIS A H    3  
ATOM 4258  H HA   . HIS A 1 23  ? -3.612  6.618   -13.115 1.00 1.00 ? 23  HIS A HA   3  
ATOM 4259  H HB2  . HIS A 1 23  ? -3.896  9.286   -11.665 1.00 1.00 ? 23  HIS A HB2  3  
ATOM 4260  H HB3  . HIS A 1 23  ? -3.077  9.132   -13.209 1.00 1.00 ? 23  HIS A HB3  3  
ATOM 4261  H HD1  . HIS A 1 23  ? -6.238  7.050   -12.950 1.00 1.00 ? 23  HIS A HD1  3  
ATOM 4262  H HD2  . HIS A 1 23  ? -4.912  10.800  -14.284 1.00 1.00 ? 23  HIS A HD2  3  
ATOM 4263  H HE1  . HIS A 1 23  ? -8.124  8.014   -14.374 1.00 1.00 ? 23  HIS A HE1  3  
ATOM 4264  N N    . TRP A 1 24  ? -1.055  7.243   -12.845 1.00 1.00 ? 24  TRP A N    3  
ATOM 4265  C CA   . TRP A 1 24  ? 0.397   7.109   -12.637 1.00 1.00 ? 24  TRP A CA   3  
ATOM 4266  C C    . TRP A 1 24  ? 1.207   8.093   -13.492 1.00 1.00 ? 24  TRP A C    3  
ATOM 4267  O O    . TRP A 1 24  ? 0.708   8.649   -14.472 1.00 1.00 ? 24  TRP A O    3  
ATOM 4268  C CB   . TRP A 1 24  ? 0.832   5.661   -12.930 1.00 1.00 ? 24  TRP A CB   3  
ATOM 4269  C CG   . TRP A 1 24  ? 0.227   4.613   -12.050 1.00 1.00 ? 24  TRP A CG   3  
ATOM 4270  C CD1  . TRP A 1 24  ? 0.792   4.105   -10.932 1.00 1.00 ? 24  TRP A CD1  3  
ATOM 4271  C CD2  . TRP A 1 24  ? -1.067  3.949   -12.181 1.00 1.00 ? 24  TRP A CD2  3  
ATOM 4272  N NE1  . TRP A 1 24  ? -0.064  3.185   -10.359 1.00 1.00 ? 24  TRP A NE1  3  
ATOM 4273  C CE2  . TRP A 1 24  ? -1.230  3.060   -11.081 1.00 1.00 ? 24  TRP A CE2  3  
ATOM 4274  C CE3  . TRP A 1 24  ? -2.124  4.021   -13.111 1.00 1.00 ? 24  TRP A CE3  3  
ATOM 4275  C CZ2  . TRP A 1 24  ? -2.386  2.285   -10.915 1.00 1.00 ? 24  TRP A CZ2  3  
ATOM 4276  C CZ3  . TRP A 1 24  ? -3.283  3.235   -12.967 1.00 1.00 ? 24  TRP A CZ3  3  
ATOM 4277  C CH2  . TRP A 1 24  ? -3.413  2.361   -11.871 1.00 1.00 ? 24  TRP A CH2  3  
ATOM 4278  H H    . TRP A 1 24  ? -1.368  7.399   -13.796 1.00 1.00 ? 24  TRP A H    3  
ATOM 4279  H HA   . TRP A 1 24  ? 0.640   7.326   -11.596 1.00 1.00 ? 24  TRP A HA   3  
ATOM 4280  H HB2  . TRP A 1 24  ? 0.599   5.418   -13.968 1.00 1.00 ? 24  TRP A HB2  3  
ATOM 4281  H HB3  . TRP A 1 24  ? 1.911   5.596   -12.808 1.00 1.00 ? 24  TRP A HB3  3  
ATOM 4282  H HD1  . TRP A 1 24  ? 1.758   4.397   -10.543 1.00 1.00 ? 24  TRP A HD1  3  
ATOM 4283  H HE1  . TRP A 1 24  ? 0.151   2.667   -9.516  1.00 1.00 ? 24  TRP A HE1  3  
ATOM 4284  H HE3  . TRP A 1 24  ? -2.034  4.706   -13.937 1.00 1.00 ? 24  TRP A HE3  3  
ATOM 4285  H HZ2  . TRP A 1 24  ? -2.466  1.633   -10.059 1.00 1.00 ? 24  TRP A HZ2  3  
ATOM 4286  H HZ3  . TRP A 1 24  ? -4.088  3.314   -13.685 1.00 1.00 ? 24  TRP A HZ3  3  
ATOM 4287  H HH2  . TRP A 1 24  ? -4.312  1.771   -11.759 1.00 1.00 ? 24  TRP A HH2  3  
ATOM 4288  N N    . ALA A 1 25  ? 2.486   8.279   -13.145 1.00 1.00 ? 25  ALA A N    3  
ATOM 4289  C CA   . ALA A 1 25  ? 3.417   9.109   -13.917 1.00 1.00 ? 25  ALA A CA   3  
ATOM 4290  C C    . ALA A 1 25  ? 4.887   8.678   -13.756 1.00 1.00 ? 25  ALA A C    3  
ATOM 4291  O O    . ALA A 1 25  ? 5.263   8.101   -12.740 1.00 1.00 ? 25  ALA A O    3  
ATOM 4292  C CB   . ALA A 1 25  ? 3.217   10.576  -13.508 1.00 1.00 ? 25  ALA A CB   3  
ATOM 4293  H H    . ALA A 1 25  ? 2.825   7.804   -12.310 1.00 1.00 ? 25  ALA A H    3  
ATOM 4294  H HA   . ALA A 1 25  ? 3.167   9.017   -14.976 1.00 1.00 ? 25  ALA A HA   3  
ATOM 4295  H HB1  . ALA A 1 25  ? 3.725   11.208  -14.231 1.00 1.00 ? 25  ALA A HB1  3  
ATOM 4296  H HB2  . ALA A 1 25  ? 2.157   10.837  -13.503 1.00 1.00 ? 25  ALA A HB2  3  
ATOM 4297  H HB3  . ALA A 1 25  ? 3.634   10.759  -12.517 1.00 1.00 ? 25  ALA A HB3  3  
ATOM 4298  N N    . LEU A 1 26  ? 5.712   8.984   -14.760 1.00 1.00 ? 26  LEU A N    3  
ATOM 4299  C CA   . LEU A 1 26  ? 7.174   8.874   -14.739 1.00 1.00 ? 26  LEU A CA   3  
ATOM 4300  C C    . LEU A 1 26  ? 7.729   10.271  -14.424 1.00 1.00 ? 26  LEU A C    3  
ATOM 4301  O O    . LEU A 1 26  ? 7.539   11.199  -15.209 1.00 1.00 ? 26  LEU A O    3  
ATOM 4302  C CB   . LEU A 1 26  ? 7.627   8.336   -16.123 1.00 1.00 ? 26  LEU A CB   3  
ATOM 4303  C CG   . LEU A 1 26  ? 9.039   7.720   -16.238 1.00 1.00 ? 26  LEU A CG   3  
ATOM 4304  C CD1  . LEU A 1 26  ? 10.161  8.682   -15.837 1.00 1.00 ? 26  LEU A CD1  3  
ATOM 4305  C CD2  . LEU A 1 26  ? 9.152   6.423   -15.429 1.00 1.00 ? 26  LEU A CD2  3  
ATOM 4306  H H    . LEU A 1 26  ? 5.303   9.423   -15.579 1.00 1.00 ? 26  LEU A H    3  
ATOM 4307  H HA   . LEU A 1 26  ? 7.479   8.179   -13.953 1.00 1.00 ? 26  LEU A HA   3  
ATOM 4308  H HB2  . LEU A 1 26  ? 6.921   7.564   -16.431 1.00 1.00 ? 26  LEU A HB2  3  
ATOM 4309  H HB3  . LEU A 1 26  ? 7.541   9.136   -16.865 1.00 1.00 ? 26  LEU A HB3  3  
ATOM 4310  H HG   . LEU A 1 26  ? 9.193   7.478   -17.292 1.00 1.00 ? 26  LEU A HG   3  
ATOM 4311  H HD11 . LEU A 1 26  ? 10.165  8.844   -14.759 1.00 1.00 ? 26  LEU A HD11 3  
ATOM 4312  H HD12 . LEU A 1 26  ? 11.124  8.266   -16.135 1.00 1.00 ? 26  LEU A HD12 3  
ATOM 4313  H HD13 . LEU A 1 26  ? 10.018  9.634   -16.344 1.00 1.00 ? 26  LEU A HD13 3  
ATOM 4314  H HD21 . LEU A 1 26  ? 9.083   6.631   -14.360 1.00 1.00 ? 26  LEU A HD21 3  
ATOM 4315  H HD22 . LEU A 1 26  ? 8.354   5.734   -15.716 1.00 1.00 ? 26  LEU A HD22 3  
ATOM 4316  H HD23 . LEU A 1 26  ? 10.113  5.948   -15.625 1.00 1.00 ? 26  LEU A HD23 3  
ATOM 4317  N N    . TYR A 1 27  ? 8.392   10.454  -13.284 1.00 1.00 ? 27  TYR A N    3  
ATOM 4318  C CA   . TYR A 1 27  ? 8.981   11.743  -12.889 1.00 1.00 ? 27  TYR A CA   3  
ATOM 4319  C C    . TYR A 1 27  ? 10.343  11.979  -13.559 1.00 1.00 ? 27  TYR A C    3  
ATOM 4320  O O    . TYR A 1 27  ? 11.234  11.133  -13.498 1.00 1.00 ? 27  TYR A O    3  
ATOM 4321  C CB   . TYR A 1 27  ? 9.059   11.814  -11.360 1.00 1.00 ? 27  TYR A CB   3  
ATOM 4322  C CG   . TYR A 1 27  ? 9.611   13.117  -10.817 1.00 1.00 ? 27  TYR A CG   3  
ATOM 4323  C CD1  . TYR A 1 27  ? 8.755   14.199  -10.539 1.00 1.00 ? 27  TYR A CD1  3  
ATOM 4324  C CD2  . TYR A 1 27  ? 10.990  13.247  -10.579 1.00 1.00 ? 27  TYR A CD2  3  
ATOM 4325  C CE1  . TYR A 1 27  ? 9.274   15.405  -10.029 1.00 1.00 ? 27  TYR A CE1  3  
ATOM 4326  C CE2  . TYR A 1 27  ? 11.514  14.435  -10.029 1.00 1.00 ? 27  TYR A CE2  3  
ATOM 4327  C CZ   . TYR A 1 27  ? 10.655  15.522  -9.761  1.00 1.00 ? 27  TYR A CZ   3  
ATOM 4328  O OH   . TYR A 1 27  ? 11.151  16.679  -9.240  1.00 1.00 ? 27  TYR A OH   3  
ATOM 4329  H H    . TYR A 1 27  ? 8.528   9.657   -12.665 1.00 1.00 ? 27  TYR A H    3  
ATOM 4330  H HA   . TYR A 1 27  ? 8.324   12.545  -13.226 1.00 1.00 ? 27  TYR A HA   3  
ATOM 4331  H HB2  . TYR A 1 27  ? 8.055   11.674  -10.960 1.00 1.00 ? 27  TYR A HB2  3  
ATOM 4332  H HB3  . TYR A 1 27  ? 9.678   10.993  -10.989 1.00 1.00 ? 27  TYR A HB3  3  
ATOM 4333  H HD1  . TYR A 1 27  ? 7.693   14.106  -10.704 1.00 1.00 ? 27  TYR A HD1  3  
ATOM 4334  H HD2  . TYR A 1 27  ? 11.644  12.421  -10.803 1.00 1.00 ? 27  TYR A HD2  3  
ATOM 4335  H HE1  . TYR A 1 27  ? 8.618   16.233  -9.814  1.00 1.00 ? 27  TYR A HE1  3  
ATOM 4336  H HE2  . TYR A 1 27  ? 12.568  14.510  -9.807  1.00 1.00 ? 27  TYR A HE2  3  
ATOM 4337  H HH   . TYR A 1 27  ? 12.092  16.632  -9.018  1.00 1.00 ? 27  TYR A HH   3  
ATOM 4338  N N    . ILE A 1 28  ? 10.527  13.142  -14.200 1.00 1.00 ? 28  ILE A N    3  
ATOM 4339  C CA   . ILE A 1 28  ? 11.697  13.404  -15.066 1.00 1.00 ? 28  ILE A CA   3  
ATOM 4340  C C    . ILE A 1 28  ? 12.707  14.420  -14.492 1.00 1.00 ? 28  ILE A C    3  
ATOM 4341  O O    . ILE A 1 28  ? 13.676  14.756  -15.171 1.00 1.00 ? 28  ILE A O    3  
ATOM 4342  C CB   . ILE A 1 28  ? 11.233  13.760  -16.498 1.00 1.00 ? 28  ILE A CB   3  
ATOM 4343  C CG1  . ILE A 1 28  ? 10.503  15.116  -16.588 1.00 1.00 ? 28  ILE A CG1  3  
ATOM 4344  C CG2  . ILE A 1 28  ? 10.355  12.634  -17.078 1.00 1.00 ? 28  ILE A CG2  3  
ATOM 4345  C CD1  . ILE A 1 28  ? 10.273  15.557  -18.037 1.00 1.00 ? 28  ILE A CD1  3  
ATOM 4346  H H    . ILE A 1 28  ? 9.789   13.843  -14.151 1.00 1.00 ? 28  ILE A H    3  
ATOM 4347  H HA   . ILE A 1 28  ? 12.285  12.487  -15.159 1.00 1.00 ? 28  ILE A HA   3  
ATOM 4348  H HB   . ILE A 1 28  ? 12.131  13.827  -17.121 1.00 1.00 ? 28  ILE A HB   3  
ATOM 4349  H HG12 . ILE A 1 28  ? 9.538   15.045  -16.093 1.00 1.00 ? 28  ILE A HG12 3  
ATOM 4350  H HG13 . ILE A 1 28  ? 11.098  15.884  -16.094 1.00 1.00 ? 28  ILE A HG13 3  
ATOM 4351  H HG21 . ILE A 1 28  ? 9.345   12.656  -16.657 1.00 1.00 ? 28  ILE A HG21 3  
ATOM 4352  H HG22 . ILE A 1 28  ? 10.284  12.737  -18.160 1.00 1.00 ? 28  ILE A HG22 3  
ATOM 4353  H HG23 . ILE A 1 28  ? 10.801  11.666  -16.868 1.00 1.00 ? 28  ILE A HG23 3  
ATOM 4354  H HD11 . ILE A 1 28  ? 9.882   16.575  -18.045 1.00 1.00 ? 28  ILE A HD11 3  
ATOM 4355  H HD12 . ILE A 1 28  ? 11.216  15.532  -18.585 1.00 1.00 ? 28  ILE A HD12 3  
ATOM 4356  H HD13 . ILE A 1 28  ? 9.553   14.899  -18.522 1.00 1.00 ? 28  ILE A HD13 3  
ATOM 4357  N N    . GLY A 1 29  ? 12.497  14.891  -13.255 1.00 1.00 ? 29  GLY A N    3  
ATOM 4358  C CA   . GLY A 1 29  ? 13.299  15.956  -12.624 1.00 1.00 ? 29  GLY A CA   3  
ATOM 4359  C C    . GLY A 1 29  ? 12.695  17.347  -12.840 1.00 1.00 ? 29  GLY A C    3  
ATOM 4360  O O    . GLY A 1 29  ? 11.742  17.513  -13.599 1.00 1.00 ? 29  GLY A O    3  
ATOM 4361  H H    . GLY A 1 29  ? 11.672  14.576  -12.763 1.00 1.00 ? 29  GLY A H    3  
ATOM 4362  H HA2  . GLY A 1 29  ? 13.366  15.783  -11.551 1.00 1.00 ? 29  GLY A HA2  3  
ATOM 4363  H HA3  . GLY A 1 29  ? 14.310  15.966  -13.036 1.00 1.00 ? 29  GLY A HA3  3  
ATOM 4364  N N    . ASP A 1 30  ? 13.238  18.342  -12.128 1.00 1.00 ? 30  ASP A N    3  
ATOM 4365  C CA   . ASP A 1 30  ? 12.891  19.777  -12.233 1.00 1.00 ? 30  ASP A CA   3  
ATOM 4366  C C    . ASP A 1 30  ? 11.424  20.102  -11.854 1.00 1.00 ? 30  ASP A C    3  
ATOM 4367  O O    . ASP A 1 30  ? 10.907  21.174  -12.177 1.00 1.00 ? 30  ASP A O    3  
ATOM 4368  C CB   . ASP A 1 30  ? 13.284  20.305  -13.629 1.00 1.00 ? 30  ASP A CB   3  
ATOM 4369  C CG   . ASP A 1 30  ? 13.380  21.841  -13.699 1.00 1.00 ? 30  ASP A CG   3  
ATOM 4370  O OD1  . ASP A 1 30  ? 14.047  22.452  -12.828 1.00 1.00 ? 30  ASP A OD1  3  
ATOM 4371  O OD2  . ASP A 1 30  ? 12.833  22.436  -14.660 1.00 1.00 ? 30  ASP A OD2  3  
ATOM 4372  H H    . ASP A 1 30  ? 14.020  18.110  -11.528 1.00 1.00 ? 30  ASP A H    3  
ATOM 4373  H HA   . ASP A 1 30  ? 13.510  20.293  -11.499 1.00 1.00 ? 30  ASP A HA   3  
ATOM 4374  H HB2  . ASP A 1 30  ? 14.259  19.892  -13.897 1.00 1.00 ? 30  ASP A HB2  3  
ATOM 4375  H HB3  . ASP A 1 30  ? 12.558  19.948  -14.360 1.00 1.00 ? 30  ASP A HB3  3  
ATOM 4376  N N    . GLY A 1 31  ? 10.743  19.167  -11.174 1.00 1.00 ? 31  GLY A N    3  
ATOM 4377  C CA   . GLY A 1 31  ? 9.323   19.247  -10.814 1.00 1.00 ? 31  GLY A CA   3  
ATOM 4378  C C    . GLY A 1 31  ? 8.372   18.720  -11.891 1.00 1.00 ? 31  GLY A C    3  
ATOM 4379  O O    . GLY A 1 31  ? 7.161   18.803  -11.706 1.00 1.00 ? 31  GLY A O    3  
ATOM 4380  H H    . GLY A 1 31  ? 11.244  18.329  -10.906 1.00 1.00 ? 31  GLY A H    3  
ATOM 4381  H HA2  . GLY A 1 31  ? 9.153   18.656  -9.914  1.00 1.00 ? 31  GLY A HA2  3  
ATOM 4382  H HA3  . GLY A 1 31  ? 9.049   20.285  -10.621 1.00 1.00 ? 31  GLY A HA3  3  
ATOM 4383  N N    . TYR A 1 32  ? 8.869   18.188  -13.012 1.00 1.00 ? 32  TYR A N    3  
ATOM 4384  C CA   . TYR A 1 32  ? 8.055   17.711  -14.139 1.00 1.00 ? 32  TYR A CA   3  
ATOM 4385  C C    . TYR A 1 32  ? 7.825   16.187  -14.153 1.00 1.00 ? 32  TYR A C    3  
ATOM 4386  O O    . TYR A 1 32  ? 8.630   15.393  -13.656 1.00 1.00 ? 32  TYR A O    3  
ATOM 4387  C CB   . TYR A 1 32  ? 8.669   18.191  -15.466 1.00 1.00 ? 32  TYR A CB   3  
ATOM 4388  C CG   . TYR A 1 32  ? 8.322   19.626  -15.817 1.00 1.00 ? 32  TYR A CG   3  
ATOM 4389  C CD1  . TYR A 1 32  ? 9.052   20.692  -15.258 1.00 1.00 ? 32  TYR A CD1  3  
ATOM 4390  C CD2  . TYR A 1 32  ? 7.254   19.898  -16.696 1.00 1.00 ? 32  TYR A CD2  3  
ATOM 4391  C CE1  . TYR A 1 32  ? 8.717   22.024  -15.570 1.00 1.00 ? 32  TYR A CE1  3  
ATOM 4392  C CE2  . TYR A 1 32  ? 6.921   21.226  -17.022 1.00 1.00 ? 32  TYR A CE2  3  
ATOM 4393  C CZ   . TYR A 1 32  ? 7.651   22.296  -16.459 1.00 1.00 ? 32  TYR A CZ   3  
ATOM 4394  O OH   . TYR A 1 32  ? 7.321   23.588  -16.748 1.00 1.00 ? 32  TYR A OH   3  
ATOM 4395  H H    . TYR A 1 32  ? 9.880   18.122  -13.100 1.00 1.00 ? 32  TYR A H    3  
ATOM 4396  H HA   . TYR A 1 32  ? 7.067   18.164  -14.065 1.00 1.00 ? 32  TYR A HA   3  
ATOM 4397  H HB2  . TYR A 1 32  ? 9.756   18.075  -15.433 1.00 1.00 ? 32  TYR A HB2  3  
ATOM 4398  H HB3  . TYR A 1 32  ? 8.308   17.554  -16.277 1.00 1.00 ? 32  TYR A HB3  3  
ATOM 4399  H HD1  . TYR A 1 32  ? 9.877   20.488  -14.590 1.00 1.00 ? 32  TYR A HD1  3  
ATOM 4400  H HD2  . TYR A 1 32  ? 6.683   19.084  -17.121 1.00 1.00 ? 32  TYR A HD2  3  
ATOM 4401  H HE1  . TYR A 1 32  ? 9.280   22.839  -15.137 1.00 1.00 ? 32  TYR A HE1  3  
ATOM 4402  H HE2  . TYR A 1 32  ? 6.099   21.428  -17.695 1.00 1.00 ? 32  TYR A HE2  3  
ATOM 4403  H HH   . TYR A 1 32  ? 6.621   23.669  -17.417 1.00 1.00 ? 32  TYR A HH   3  
ATOM 4404  N N    . VAL A 1 33  ? 6.719   15.776  -14.782 1.00 1.00 ? 33  VAL A N    3  
ATOM 4405  C CA   . VAL A 1 33  ? 6.306   14.376  -14.963 1.00 1.00 ? 33  VAL A CA   3  
ATOM 4406  C C    . VAL A 1 33  ? 5.815   14.122  -16.386 1.00 1.00 ? 33  VAL A C    3  
ATOM 4407  O O    . VAL A 1 33  ? 5.333   15.028  -17.059 1.00 1.00 ? 33  VAL A O    3  
ATOM 4408  C CB   . VAL A 1 33  ? 5.167   13.977  -14.002 1.00 1.00 ? 33  VAL A CB   3  
ATOM 4409  C CG1  . VAL A 1 33  ? 5.628   13.841  -12.552 1.00 1.00 ? 33  VAL A CG1  3  
ATOM 4410  C CG2  . VAL A 1 33  ? 3.965   14.932  -14.033 1.00 1.00 ? 33  VAL A CG2  3  
ATOM 4411  H H    . VAL A 1 33  ? 6.103   16.490  -15.184 1.00 1.00 ? 33  VAL A H    3  
ATOM 4412  H HA   . VAL A 1 33  ? 7.159   13.723  -14.787 1.00 1.00 ? 33  VAL A HA   3  
ATOM 4413  H HB   . VAL A 1 33  ? 4.816   13.000  -14.307 1.00 1.00 ? 33  VAL A HB   3  
ATOM 4414  H HG11 . VAL A 1 33  ? 6.011   14.793  -12.188 1.00 1.00 ? 33  VAL A HG11 3  
ATOM 4415  H HG12 . VAL A 1 33  ? 4.789   13.527  -11.932 1.00 1.00 ? 33  VAL A HG12 3  
ATOM 4416  H HG13 . VAL A 1 33  ? 6.400   13.080  -12.485 1.00 1.00 ? 33  VAL A HG13 3  
ATOM 4417  H HG21 . VAL A 1 33  ? 3.150   14.508  -13.444 1.00 1.00 ? 33  VAL A HG21 3  
ATOM 4418  H HG22 . VAL A 1 33  ? 4.239   15.898  -13.613 1.00 1.00 ? 33  VAL A HG22 3  
ATOM 4419  H HG23 . VAL A 1 33  ? 3.624   15.070  -15.057 1.00 1.00 ? 33  VAL A HG23 3  
ATOM 4420  N N    . ILE A 1 34  ? 5.895   12.861  -16.812 1.00 1.00 ? 34  ILE A N    3  
ATOM 4421  C CA   . ILE A 1 34  ? 5.292   12.331  -18.043 1.00 1.00 ? 34  ILE A CA   3  
ATOM 4422  C C    . ILE A 1 34  ? 4.239   11.296  -17.627 1.00 1.00 ? 34  ILE A C    3  
ATOM 4423  O O    . ILE A 1 34  ? 4.462   10.517  -16.709 1.00 1.00 ? 34  ILE A O    3  
ATOM 4424  C CB   . ILE A 1 34  ? 6.412   11.817  -18.974 1.00 1.00 ? 34  ILE A CB   3  
ATOM 4425  C CG1  . ILE A 1 34  ? 7.123   13.062  -19.560 1.00 1.00 ? 34  ILE A CG1  3  
ATOM 4426  C CG2  . ILE A 1 34  ? 5.836   10.906  -20.076 1.00 1.00 ? 34  ILE A CG2  3  
ATOM 4427  C CD1  . ILE A 1 34  ? 8.324   12.781  -20.467 1.00 1.00 ? 34  ILE A CD1  3  
ATOM 4428  H H    . ILE A 1 34  ? 6.349   12.181  -16.196 1.00 1.00 ? 34  ILE A H    3  
ATOM 4429  H HA   . ILE A 1 34  ? 4.751   13.123  -18.562 1.00 1.00 ? 34  ILE A HA   3  
ATOM 4430  H HB   . ILE A 1 34  ? 7.138   11.250  -18.382 1.00 1.00 ? 34  ILE A HB   3  
ATOM 4431  H HG12 . ILE A 1 34  ? 6.400   13.652  -20.123 1.00 1.00 ? 34  ILE A HG12 3  
ATOM 4432  H HG13 . ILE A 1 34  ? 7.480   13.680  -18.738 1.00 1.00 ? 34  ILE A HG13 3  
ATOM 4433  H HG21 . ILE A 1 34  ? 5.440   9.991   -19.634 1.00 1.00 ? 34  ILE A HG21 3  
ATOM 4434  H HG22 . ILE A 1 34  ? 5.035   11.417  -20.613 1.00 1.00 ? 34  ILE A HG22 3  
ATOM 4435  H HG23 . ILE A 1 34  ? 6.609   10.617  -20.787 1.00 1.00 ? 34  ILE A HG23 3  
ATOM 4436  H HD11 . ILE A 1 34  ? 8.816   13.722  -20.720 1.00 1.00 ? 34  ILE A HD11 3  
ATOM 4437  H HD12 . ILE A 1 34  ? 9.041   12.138  -19.958 1.00 1.00 ? 34  ILE A HD12 3  
ATOM 4438  H HD13 . ILE A 1 34  ? 8.000   12.304  -21.387 1.00 1.00 ? 34  ILE A HD13 3  
ATOM 4439  N N    . HIS A 1 35  ? 3.074   11.287  -18.263 1.00 1.00 ? 35  HIS A N    3  
ATOM 4440  C CA   . HIS A 1 35  ? 1.906   10.522  -17.808 1.00 1.00 ? 35  HIS A CA   3  
ATOM 4441  C C    . HIS A 1 35  ? 0.966   10.177  -18.973 1.00 1.00 ? 35  HIS A C    3  
ATOM 4442  O O    . HIS A 1 35  ? 0.826   10.967  -19.900 1.00 1.00 ? 35  HIS A O    3  
ATOM 4443  C CB   . HIS A 1 35  ? 1.179   11.387  -16.754 1.00 1.00 ? 35  HIS A CB   3  
ATOM 4444  C CG   . HIS A 1 35  ? 0.901   12.812  -17.198 1.00 1.00 ? 35  HIS A CG   3  
ATOM 4445  N ND1  . HIS A 1 35  ? -0.283  13.306  -17.692 1.00 1.00 ? 35  HIS A ND1  3  
ATOM 4446  C CD2  . HIS A 1 35  ? 1.803   13.844  -17.231 1.00 1.00 ? 35  HIS A CD2  3  
ATOM 4447  C CE1  . HIS A 1 35  ? -0.089  14.598  -18.020 1.00 1.00 ? 35  HIS A CE1  3  
ATOM 4448  N NE2  . HIS A 1 35  ? 1.179   14.968  -17.776 1.00 1.00 ? 35  HIS A NE2  3  
ATOM 4449  H H    . HIS A 1 35  ? 2.918   11.936  -19.039 1.00 1.00 ? 35  HIS A H    3  
ATOM 4450  H HA   . HIS A 1 35  ? 2.230   9.588   -17.343 1.00 1.00 ? 35  HIS A HA   3  
ATOM 4451  H HB2  . HIS A 1 35  ? 0.240   10.907  -16.471 1.00 1.00 ? 35  HIS A HB2  3  
ATOM 4452  H HB3  . HIS A 1 35  ? 1.797   11.431  -15.857 1.00 1.00 ? 35  HIS A HB3  3  
ATOM 4453  H HD1  . HIS A 1 35  ? -1.152  12.798  -17.795 1.00 1.00 ? 35  HIS A HD1  3  
ATOM 4454  H HD2  . HIS A 1 35  ? 2.835   13.788  -16.921 1.00 1.00 ? 35  HIS A HD2  3  
ATOM 4455  H HE1  . HIS A 1 35  ? -0.849  15.249  -18.436 1.00 1.00 ? 35  HIS A HE1  3  
ATOM 4456  N N    . LEU A 1 36  ? 0.286   9.025   -18.921 1.00 1.00 ? 36  LEU A N    3  
ATOM 4457  C CA   . LEU A 1 36  ? -0.793  8.691   -19.862 1.00 1.00 ? 36  LEU A CA   3  
ATOM 4458  C C    . LEU A 1 36  ? -2.112  9.251   -19.306 1.00 1.00 ? 36  LEU A C    3  
ATOM 4459  O O    . LEU A 1 36  ? -2.442  9.010   -18.143 1.00 1.00 ? 36  LEU A O    3  
ATOM 4460  C CB   . LEU A 1 36  ? -0.818  7.161   -20.062 1.00 1.00 ? 36  LEU A CB   3  
ATOM 4461  C CG   . LEU A 1 36  ? -1.819  6.669   -21.121 1.00 1.00 ? 36  LEU A CG   3  
ATOM 4462  C CD1  . LEU A 1 36  ? -1.303  6.896   -22.548 1.00 1.00 ? 36  LEU A CD1  3  
ATOM 4463  C CD2  . LEU A 1 36  ? -2.098  5.175   -20.938 1.00 1.00 ? 36  LEU A CD2  3  
ATOM 4464  H H    . LEU A 1 36  ? 0.402   8.419   -18.118 1.00 1.00 ? 36  LEU A H    3  
ATOM 4465  H HA   . LEU A 1 36  ? -0.592  9.171   -20.822 1.00 1.00 ? 36  LEU A HA   3  
ATOM 4466  H HB2  . LEU A 1 36  ? 0.177   6.828   -20.357 1.00 1.00 ? 36  LEU A HB2  3  
ATOM 4467  H HB3  . LEU A 1 36  ? -1.065  6.696   -19.109 1.00 1.00 ? 36  LEU A HB3  3  
ATOM 4468  H HG   . LEU A 1 36  ? -2.756  7.204   -20.995 1.00 1.00 ? 36  LEU A HG   3  
ATOM 4469  H HD11 . LEU A 1 36  ? -0.420  6.280   -22.728 1.00 1.00 ? 36  LEU A HD11 3  
ATOM 4470  H HD12 . LEU A 1 36  ? -2.069  6.630   -23.275 1.00 1.00 ? 36  LEU A HD12 3  
ATOM 4471  H HD13 . LEU A 1 36  ? -1.045  7.939   -22.684 1.00 1.00 ? 36  LEU A HD13 3  
ATOM 4472  H HD21 . LEU A 1 36  ? -2.727  4.829   -21.754 1.00 1.00 ? 36  LEU A HD21 3  
ATOM 4473  H HD22 . LEU A 1 36  ? -1.166  4.609   -20.936 1.00 1.00 ? 36  LEU A HD22 3  
ATOM 4474  H HD23 . LEU A 1 36  ? -2.628  5.010   -20.002 1.00 1.00 ? 36  LEU A HD23 3  
ATOM 4475  N N    . ALA A 1 37  ? -2.858  10.005  -20.115 1.00 1.00 ? 37  ALA A N    3  
ATOM 4476  C CA   . ALA A 1 37  ? -4.029  10.776  -19.692 1.00 1.00 ? 37  ALA A CA   3  
ATOM 4477  C C    . ALA A 1 37  ? -5.318  10.209  -20.323 1.00 1.00 ? 37  ALA A C    3  
ATOM 4478  O O    . ALA A 1 37  ? -5.288  9.857   -21.509 1.00 1.00 ? 37  ALA A O    3  
ATOM 4479  C CB   . ALA A 1 37  ? -3.810  12.234  -20.126 1.00 1.00 ? 37  ALA A CB   3  
ATOM 4480  H H    . ALA A 1 37  ? -2.568  10.119  -21.085 1.00 1.00 ? 37  ALA A H    3  
ATOM 4481  H HA   . ALA A 1 37  ? -4.111  10.742  -18.605 1.00 1.00 ? 37  ALA A HA   3  
ATOM 4482  H HB1  . ALA A 1 37  ? -4.649  12.852  -19.795 1.00 1.00 ? 37  ALA A HB1  3  
ATOM 4483  H HB2  . ALA A 1 37  ? -2.891  12.620  -19.685 1.00 1.00 ? 37  ALA A HB2  3  
ATOM 4484  H HB3  . ALA A 1 37  ? -3.733  12.293  -21.214 1.00 1.00 ? 37  ALA A HB3  3  
ATOM 4485  N N    . PRO A 1 38  ? -6.439  10.141  -19.576 1.00 1.00 ? 38  PRO A N    3  
ATOM 4486  C CA   . PRO A 1 38  ? -7.714  9.654   -20.095 1.00 1.00 ? 38  PRO A CA   3  
ATOM 4487  C C    . PRO A 1 38  ? -8.348  10.672  -21.070 1.00 1.00 ? 38  PRO A C    3  
ATOM 4488  O O    . PRO A 1 38  ? -7.987  11.854  -21.041 1.00 1.00 ? 38  PRO A O    3  
ATOM 4489  C CB   . PRO A 1 38  ? -8.578  9.432   -18.846 1.00 1.00 ? 38  PRO A CB   3  
ATOM 4490  C CG   . PRO A 1 38  ? -8.090  10.513  -17.891 1.00 1.00 ? 38  PRO A CG   3  
ATOM 4491  C CD   . PRO A 1 38  ? -6.589  10.547  -18.179 1.00 1.00 ? 38  PRO A CD   3  
ATOM 4492  H HA   . PRO A 1 38  ? -7.561  8.701   -20.603 1.00 1.00 ? 38  PRO A HA   3  
ATOM 4493  H HB2  . PRO A 1 38  ? -9.646  9.526   -19.046 1.00 1.00 ? 38  PRO A HB2  3  
ATOM 4494  H HB3  . PRO A 1 38  ? -8.350  8.454   -18.412 1.00 1.00 ? 38  PRO A HB3  3  
ATOM 4495  H HG2  . PRO A 1 38  ? -8.539  11.473  -18.153 1.00 1.00 ? 38  PRO A HG2  3  
ATOM 4496  H HG3  . PRO A 1 38  ? -8.305  10.256  -16.853 1.00 1.00 ? 38  PRO A HG3  3  
ATOM 4497  H HD2  . PRO A 1 38  ? -6.202  11.550  -18.004 1.00 1.00 ? 38  PRO A HD2  3  
ATOM 4498  H HD3  . PRO A 1 38  ? -6.081  9.828   -17.530 1.00 1.00 ? 38  PRO A HD3  3  
ATOM 4499  N N    . PRO A 1 39  ? -9.299  10.233  -21.919 1.00 1.00 ? 39  PRO A N    3  
ATOM 4500  C CA   . PRO A 1 39  ? -10.025 11.105  -22.841 1.00 1.00 ? 39  PRO A CA   3  
ATOM 4501  C C    . PRO A 1 39  ? -10.916 12.099  -22.087 1.00 1.00 ? 39  PRO A C    3  
ATOM 4502  O O    . PRO A 1 39  ? -11.585 11.747  -21.118 1.00 1.00 ? 39  PRO A O    3  
ATOM 4503  C CB   . PRO A 1 39  ? -10.832 10.174  -23.750 1.00 1.00 ? 39  PRO A CB   3  
ATOM 4504  C CG   . PRO A 1 39  ? -11.026 8.924   -22.894 1.00 1.00 ? 39  PRO A CG   3  
ATOM 4505  C CD   . PRO A 1 39  ? -9.747  8.855   -22.067 1.00 1.00 ? 39  PRO A CD   3  
ATOM 4506  H HA   . PRO A 1 39  ? -9.309  11.656  -23.456 1.00 1.00 ? 39  PRO A HA   3  
ATOM 4507  H HB2  . PRO A 1 39  ? -11.788 10.610  -24.047 1.00 1.00 ? 39  PRO A HB2  3  
ATOM 4508  H HB3  . PRO A 1 39  ? -10.243 9.926   -24.634 1.00 1.00 ? 39  PRO A HB3  3  
ATOM 4509  H HG2  . PRO A 1 39  ? -11.880 9.065   -22.231 1.00 1.00 ? 39  PRO A HG2  3  
ATOM 4510  H HG3  . PRO A 1 39  ? -11.149 8.026   -23.495 1.00 1.00 ? 39  PRO A HG3  3  
ATOM 4511  H HD2  . PRO A 1 39  ? -9.954  8.387   -21.104 1.00 1.00 ? 39  PRO A HD2  3  
ATOM 4512  H HD3  . PRO A 1 39  ? -8.990  8.287   -22.609 1.00 1.00 ? 39  PRO A HD3  3  
ATOM 4513  N N    . SER A 1 40  ? -10.928 13.354  -22.541 1.00 1.00 ? 40  SER A N    3  
ATOM 4514  C CA   . SER A 1 40  ? -11.631 14.470  -21.878 1.00 1.00 ? 40  SER A CA   3  
ATOM 4515  C C    . SER A 1 40  ? -13.136 14.561  -22.214 1.00 1.00 ? 40  SER A C    3  
ATOM 4516  O O    . SER A 1 40  ? -13.875 15.324  -21.583 1.00 1.00 ? 40  SER A O    3  
ATOM 4517  C CB   . SER A 1 40  ? -10.927 15.787  -22.243 1.00 1.00 ? 40  SER A CB   3  
ATOM 4518  O OG   . SER A 1 40  ? -10.846 15.967  -23.658 1.00 1.00 ? 40  SER A OG   3  
ATOM 4519  H H    . SER A 1 40  ? -10.361 13.602  -23.344 1.00 1.00 ? 40  SER A H    3  
ATOM 4520  H HA   . SER A 1 40  ? -11.559 14.346  -20.794 1.00 1.00 ? 40  SER A HA   3  
ATOM 4521  H HB2  . SER A 1 40  ? -11.466 16.622  -21.793 1.00 1.00 ? 40  SER A HB2  3  
ATOM 4522  H HB3  . SER A 1 40  ? -9.917  15.764  -21.829 1.00 1.00 ? 40  SER A HB3  3  
ATOM 4523  H HG   . SER A 1 40  ? -10.417 16.829  -23.848 1.00 1.00 ? 40  SER A HG   3  
ATOM 4524  N N    . GLU A 1 41  ? -13.600 13.768  -23.186 1.00 1.00 ? 41  GLU A N    3  
ATOM 4525  C CA   . GLU A 1 41  ? -14.975 13.722  -23.692 1.00 1.00 ? 41  GLU A CA   3  
ATOM 4526  C C    . GLU A 1 41  ? -15.217 12.367  -24.382 1.00 1.00 ? 41  GLU A C    3  
ATOM 4527  O O    . GLU A 1 41  ? -14.288 11.797  -24.960 1.00 1.00 ? 41  GLU A O    3  
ATOM 4528  C CB   . GLU A 1 41  ? -15.216 14.910  -24.645 1.00 1.00 ? 41  GLU A CB   3  
ATOM 4529  C CG   . GLU A 1 41  ? -16.681 15.037  -25.080 1.00 1.00 ? 41  GLU A CG   3  
ATOM 4530  C CD   . GLU A 1 41  ? -16.946 16.386  -25.771 1.00 1.00 ? 41  GLU A CD   3  
ATOM 4531  O OE1  . GLU A 1 41  ? -16.288 16.702  -26.792 1.00 1.00 ? 41  GLU A OE1  3  
ATOM 4532  O OE2  . GLU A 1 41  ? -17.819 17.152  -25.294 1.00 1.00 ? 41  GLU A OE2  3  
ATOM 4533  H H    . GLU A 1 41  ? -12.933 13.153  -23.632 1.00 1.00 ? 41  GLU A H    3  
ATOM 4534  H HA   . GLU A 1 41  ? -15.658 13.810  -22.846 1.00 1.00 ? 41  GLU A HA   3  
ATOM 4535  H HB2  . GLU A 1 41  ? -14.939 15.834  -24.137 1.00 1.00 ? 41  GLU A HB2  3  
ATOM 4536  H HB3  . GLU A 1 41  ? -14.583 14.799  -25.527 1.00 1.00 ? 41  GLU A HB3  3  
ATOM 4537  H HG2  . GLU A 1 41  ? -16.930 14.227  -25.764 1.00 1.00 ? 41  GLU A HG2  3  
ATOM 4538  H HG3  . GLU A 1 41  ? -17.319 14.950  -24.197 1.00 1.00 ? 41  GLU A HG3  3  
ATOM 4539  N N    . TYR A 1 42  ? -16.442 11.831  -24.247 1.00 1.00 ? 42  TYR A N    3  
ATOM 4540  C CA   . TYR A 1 42  ? -16.943 10.551  -24.793 1.00 1.00 ? 42  TYR A CA   3  
ATOM 4541  C C    . TYR A 1 42  ? -16.724 9.244   -23.974 1.00 1.00 ? 42  TYR A C    3  
ATOM 4542  O O    . TYR A 1 42  ? -17.355 8.258   -24.371 1.00 1.00 ? 42  TYR A O    3  
ATOM 4543  C CB   . TYR A 1 42  ? -16.575 10.379  -26.281 1.00 1.00 ? 42  TYR A CB   3  
ATOM 4544  C CG   . TYR A 1 42  ? -16.962 11.538  -27.185 1.00 1.00 ? 42  TYR A CG   3  
ATOM 4545  C CD1  . TYR A 1 42  ? -18.322 11.815  -27.433 1.00 1.00 ? 42  TYR A CD1  3  
ATOM 4546  C CD2  . TYR A 1 42  ? -15.967 12.330  -27.792 1.00 1.00 ? 42  TYR A CD2  3  
ATOM 4547  C CE1  . TYR A 1 42  ? -18.685 12.879  -28.281 1.00 1.00 ? 42  TYR A CE1  3  
ATOM 4548  C CE2  . TYR A 1 42  ? -16.323 13.395  -28.638 1.00 1.00 ? 42  TYR A CE2  3  
ATOM 4549  C CZ   . TYR A 1 42  ? -17.686 13.674  -28.888 1.00 1.00 ? 42  TYR A CZ   3  
ATOM 4550  O OH   . TYR A 1 42  ? -18.032 14.702  -29.714 1.00 1.00 ? 42  TYR A OH   3  
ATOM 4551  H H    . TYR A 1 42  ? -17.124 12.382  -23.740 1.00 1.00 ? 42  TYR A H    3  
ATOM 4552  H HA   . TYR A 1 42  ? -18.022 10.621  -24.805 1.00 1.00 ? 42  TYR A HA   3  
ATOM 4553  H HB2  . TYR A 1 42  ? -15.510 10.200  -26.380 1.00 1.00 ? 42  TYR A HB2  3  
ATOM 4554  H HB3  . TYR A 1 42  ? -17.078 9.492   -26.662 1.00 1.00 ? 42  TYR A HB3  3  
ATOM 4555  H HD1  . TYR A 1 42  ? -19.090 11.209  -26.968 1.00 1.00 ? 42  TYR A HD1  3  
ATOM 4556  H HD2  . TYR A 1 42  ? -14.924 12.120  -27.600 1.00 1.00 ? 42  TYR A HD2  3  
ATOM 4557  H HE1  . TYR A 1 42  ? -19.730 13.091  -28.467 1.00 1.00 ? 42  TYR A HE1  3  
ATOM 4558  H HE2  . TYR A 1 42  ? -15.559 14.006  -29.098 1.00 1.00 ? 42  TYR A HE2  3  
ATOM 4559  H HH   . TYR A 1 42  ? -18.990 14.802  -29.823 1.00 1.00 ? 42  TYR A HH   3  
ATOM 4560  N N    . PRO A 1 43  ? -15.936 9.141   -22.868 1.00 1.00 ? 43  PRO A N    3  
ATOM 4561  C CA   . PRO A 1 43  ? -15.853 7.886   -22.116 1.00 1.00 ? 43  PRO A CA   3  
ATOM 4562  C C    . PRO A 1 43  ? -17.164 7.605   -21.371 1.00 1.00 ? 43  PRO A C    3  
ATOM 4563  O O    . PRO A 1 43  ? -17.860 8.531   -20.952 1.00 1.00 ? 43  PRO A O    3  
ATOM 4564  C CB   . PRO A 1 43  ? -14.679 8.039   -21.144 1.00 1.00 ? 43  PRO A CB   3  
ATOM 4565  C CG   . PRO A 1 43  ? -14.665 9.536   -20.871 1.00 1.00 ? 43  PRO A CG   3  
ATOM 4566  C CD   . PRO A 1 43  ? -15.099 10.137  -22.207 1.00 1.00 ? 43  PRO A CD   3  
ATOM 4567  H HA   . PRO A 1 43  ? -15.640 7.063   -22.794 1.00 1.00 ? 43  PRO A HA   3  
ATOM 4568  H HB2  . PRO A 1 43  ? -14.816 7.458   -20.229 1.00 1.00 ? 43  PRO A HB2  3  
ATOM 4569  H HB3  . PRO A 1 43  ? -13.754 7.747   -21.636 1.00 1.00 ? 43  PRO A HB3  3  
ATOM 4570  H HG2  . PRO A 1 43  ? -15.403 9.773   -20.105 1.00 1.00 ? 43  PRO A HG2  3  
ATOM 4571  H HG3  . PRO A 1 43  ? -13.677 9.883   -20.572 1.00 1.00 ? 43  PRO A HG3  3  
ATOM 4572  H HD2  . PRO A 1 43  ? -15.652 11.052  -22.008 1.00 1.00 ? 43  PRO A HD2  3  
ATOM 4573  H HD3  . PRO A 1 43  ? -14.217 10.334  -22.819 1.00 1.00 ? 43  PRO A HD3  3  
ATOM 4574  N N    . GLY A 1 44  ? -17.499 6.320   -21.196 1.00 1.00 ? 44  GLY A N    3  
ATOM 4575  C CA   . GLY A 1 44  ? -18.655 5.902   -20.392 1.00 1.00 ? 44  GLY A CA   3  
ATOM 4576  C C    . GLY A 1 44  ? -19.992 5.963   -21.139 1.00 1.00 ? 44  GLY A C    3  
ATOM 4577  O O    . GLY A 1 44  ? -21.035 5.791   -20.511 1.00 1.00 ? 44  GLY A O    3  
ATOM 4578  H H    . GLY A 1 44  ? -16.940 5.597   -21.637 1.00 1.00 ? 44  GLY A H    3  
ATOM 4579  H HA2  . GLY A 1 44  ? -18.503 4.880   -20.054 1.00 1.00 ? 44  GLY A HA2  3  
ATOM 4580  H HA3  . GLY A 1 44  ? -18.746 6.550   -19.522 1.00 1.00 ? 44  GLY A HA3  3  
ATOM 4581  N N    . ALA A 1 45  ? -19.972 6.227   -22.451 1.00 1.00 ? 45  ALA A N    3  
ATOM 4582  C CA   . ALA A 1 45  ? -21.162 6.312   -23.303 1.00 1.00 ? 45  ALA A CA   3  
ATOM 4583  C C    . ALA A 1 45  ? -21.913 4.968   -23.432 1.00 1.00 ? 45  ALA A C    3  
ATOM 4584  O O    . ALA A 1 45  ? -21.370 3.895   -23.143 1.00 1.00 ? 45  ALA A O    3  
ATOM 4585  C CB   . ALA A 1 45  ? -20.731 6.867   -24.669 1.00 1.00 ? 45  ALA A CB   3  
ATOM 4586  H H    . ALA A 1 45  ? -19.072 6.382   -22.881 1.00 1.00 ? 45  ALA A H    3  
ATOM 4587  H HA   . ALA A 1 45  ? -21.856 7.025   -22.851 1.00 1.00 ? 45  ALA A HA   3  
ATOM 4588  H HB1  . ALA A 1 45  ? -21.602 7.003   -25.311 1.00 1.00 ? 45  ALA A HB1  3  
ATOM 4589  H HB2  . ALA A 1 45  ? -20.240 7.833   -24.543 1.00 1.00 ? 45  ALA A HB2  3  
ATOM 4590  H HB3  . ALA A 1 45  ? -20.039 6.175   -25.157 1.00 1.00 ? 45  ALA A HB3  3  
ATOM 4591  N N    . GLY A 1 46  ? -23.168 5.033   -23.897 1.00 1.00 ? 46  GLY A N    3  
ATOM 4592  C CA   . GLY A 1 46  ? -24.085 3.888   -24.008 1.00 1.00 ? 46  GLY A CA   3  
ATOM 4593  C C    . GLY A 1 46  ? -25.005 3.749   -22.791 1.00 1.00 ? 46  GLY A C    3  
ATOM 4594  O O    . GLY A 1 46  ? -25.261 4.719   -22.077 1.00 1.00 ? 46  GLY A O    3  
ATOM 4595  H H    . GLY A 1 46  ? -23.540 5.946   -24.121 1.00 1.00 ? 46  GLY A H    3  
ATOM 4596  H HA2  . GLY A 1 46  ? -24.721 4.016   -24.884 1.00 1.00 ? 46  GLY A HA2  3  
ATOM 4597  H HA3  . GLY A 1 46  ? -23.510 2.966   -24.110 1.00 1.00 ? 46  GLY A HA3  3  
ATOM 4598  N N    . SER A 1 47  ? -25.523 2.541   -22.561 1.00 1.00 ? 47  SER A N    3  
ATOM 4599  C CA   . SER A 1 47  ? -26.422 2.233   -21.431 1.00 1.00 ? 47  SER A CA   3  
ATOM 4600  C C    . SER A 1 47  ? -25.697 2.152   -20.069 1.00 1.00 ? 47  SER A C    3  
ATOM 4601  O O    . SER A 1 47  ? -26.332 2.213   -19.013 1.00 1.00 ? 47  SER A O    3  
ATOM 4602  C CB   . SER A 1 47  ? -27.148 0.904   -21.695 1.00 1.00 ? 47  SER A CB   3  
ATOM 4603  O OG   . SER A 1 47  ? -27.849 0.926   -22.939 1.00 1.00 ? 47  SER A OG   3  
ATOM 4604  H H    . SER A 1 47  ? -25.361 1.809   -23.242 1.00 1.00 ? 47  SER A H    3  
ATOM 4605  H HA   . SER A 1 47  ? -27.176 3.015   -21.346 1.00 1.00 ? 47  SER A HA   3  
ATOM 4606  H HB2  . SER A 1 47  ? -26.420 0.093   -21.705 1.00 1.00 ? 47  SER A HB2  3  
ATOM 4607  H HB3  . SER A 1 47  ? -27.857 0.722   -20.882 1.00 1.00 ? 47  SER A HB3  3  
ATOM 4608  H HG   . SER A 1 47  ? -28.312 0.070   -23.064 1.00 1.00 ? 47  SER A HG   3  
ATOM 4609  N N    . SER A 1 48  ? -24.368 2.012   -20.078 1.00 1.00 ? 48  SER A N    3  
ATOM 4610  C CA   . SER A 1 48  ? -23.491 1.980   -18.895 1.00 1.00 ? 48  SER A CA   3  
ATOM 4611  C C    . SER A 1 48  ? -23.068 3.403   -18.436 1.00 1.00 ? 48  SER A C    3  
ATOM 4612  O O    . SER A 1 48  ? -23.670 4.404   -18.835 1.00 1.00 ? 48  SER A O    3  
ATOM 4613  C CB   . SER A 1 48  ? -22.268 1.098   -19.223 1.00 1.00 ? 48  SER A CB   3  
ATOM 4614  O OG   . SER A 1 48  ? -22.662 -0.223  -19.588 1.00 1.00 ? 48  SER A OG   3  
ATOM 4615  H H    . SER A 1 48  ? -23.921 1.953   -20.980 1.00 1.00 ? 48  SER A H    3  
ATOM 4616  H HA   . SER A 1 48  ? -24.016 1.512   -18.060 1.00 1.00 ? 48  SER A HA   3  
ATOM 4617  H HB2  . SER A 1 48  ? -21.725 1.554   -20.052 1.00 1.00 ? 48  SER A HB2  3  
ATOM 4618  H HB3  . SER A 1 48  ? -21.605 1.040   -18.360 1.00 1.00 ? 48  SER A HB3  3  
ATOM 4619  H HG   . SER A 1 48  ? -21.871 -0.761  -19.806 1.00 1.00 ? 48  SER A HG   3  
ATOM 4620  N N    . SER A 1 49  ? -22.031 3.527   -17.599 1.00 1.00 ? 49  SER A N    3  
ATOM 4621  C CA   . SER A 1 49  ? -21.423 4.811   -17.213 1.00 1.00 ? 49  SER A CA   3  
ATOM 4622  C C    . SER A 1 49  ? -19.910 4.657   -16.955 1.00 1.00 ? 49  SER A C    3  
ATOM 4623  O O    . SER A 1 49  ? -19.380 3.545   -16.995 1.00 1.00 ? 49  SER A O    3  
ATOM 4624  C CB   . SER A 1 49  ? -22.149 5.395   -15.988 1.00 1.00 ? 49  SER A CB   3  
ATOM 4625  O OG   . SER A 1 49  ? -21.691 6.721   -15.720 1.00 1.00 ? 49  SER A OG   3  
ATOM 4626  H H    . SER A 1 49  ? -21.561 2.695   -17.254 1.00 1.00 ? 49  SER A H    3  
ATOM 4627  H HA   . SER A 1 49  ? -21.538 5.526   -18.029 1.00 1.00 ? 49  SER A HA   3  
ATOM 4628  H HB2  . SER A 1 49  ? -23.220 5.419   -16.185 1.00 1.00 ? 49  SER A HB2  3  
ATOM 4629  H HB3  . SER A 1 49  ? -21.969 4.754   -15.123 1.00 1.00 ? 49  SER A HB3  3  
ATOM 4630  H HG   . SER A 1 49  ? -22.244 7.120   -15.011 1.00 1.00 ? 49  SER A HG   3  
ATOM 4631  N N    . VAL A 1 50  ? -19.197 5.751   -16.659 1.00 1.00 ? 50  VAL A N    3  
ATOM 4632  C CA   . VAL A 1 50  ? -17.720 5.749   -16.533 1.00 1.00 ? 50  VAL A CA   3  
ATOM 4633  C C    . VAL A 1 50  ? -17.204 4.793   -15.443 1.00 1.00 ? 50  VAL A C    3  
ATOM 4634  O O    . VAL A 1 50  ? -16.087 4.289   -15.542 1.00 1.00 ? 50  VAL A O    3  
ATOM 4635  C CB   . VAL A 1 50  ? -17.117 7.158   -16.305 1.00 1.00 ? 50  VAL A CB   3  
ATOM 4636  C CG1  . VAL A 1 50  ? -17.293 8.048   -17.543 1.00 1.00 ? 50  VAL A CG1  3  
ATOM 4637  C CG2  . VAL A 1 50  ? -17.681 7.875   -15.062 1.00 1.00 ? 50  VAL A CG2  3  
ATOM 4638  H H    . VAL A 1 50  ? -19.727 6.612   -16.519 1.00 1.00 ? 50  VAL A H    3  
ATOM 4639  H HA   . VAL A 1 50  ? -17.347 5.387   -17.491 1.00 1.00 ? 50  VAL A HA   3  
ATOM 4640  H HB   . VAL A 1 50  ? -16.044 7.041   -16.153 1.00 1.00 ? 50  VAL A HB   3  
ATOM 4641  H HG11 . VAL A 1 50  ? -16.830 7.569   -18.405 1.00 1.00 ? 50  VAL A HG11 3  
ATOM 4642  H HG12 . VAL A 1 50  ? -18.351 8.215   -17.751 1.00 1.00 ? 50  VAL A HG12 3  
ATOM 4643  H HG13 . VAL A 1 50  ? -16.805 9.012   -17.383 1.00 1.00 ? 50  VAL A HG13 3  
ATOM 4644  H HG21 . VAL A 1 50  ? -18.752 8.050   -15.167 1.00 1.00 ? 50  VAL A HG21 3  
ATOM 4645  H HG22 . VAL A 1 50  ? -17.506 7.279   -14.169 1.00 1.00 ? 50  VAL A HG22 3  
ATOM 4646  H HG23 . VAL A 1 50  ? -17.178 8.836   -14.936 1.00 1.00 ? 50  VAL A HG23 3  
ATOM 4647  N N    . PHE A 1 51  ? -18.021 4.510   -14.418 1.00 1.00 ? 51  PHE A N    3  
ATOM 4648  C CA   . PHE A 1 51  ? -17.703 3.560   -13.349 1.00 1.00 ? 51  PHE A CA   3  
ATOM 4649  C C    . PHE A 1 51  ? -17.830 2.090   -13.801 1.00 1.00 ? 51  PHE A C    3  
ATOM 4650  O O    . PHE A 1 51  ? -17.138 1.219   -13.275 1.00 1.00 ? 51  PHE A O    3  
ATOM 4651  C CB   . PHE A 1 51  ? -18.625 3.865   -12.157 1.00 1.00 ? 51  PHE A CB   3  
ATOM 4652  C CG   . PHE A 1 51  ? -18.330 3.046   -10.915 1.00 1.00 ? 51  PHE A CG   3  
ATOM 4653  C CD1  . PHE A 1 51  ? -17.234 3.380   -10.094 1.00 1.00 ? 51  PHE A CD1  3  
ATOM 4654  C CD2  . PHE A 1 51  ? -19.144 1.945   -10.580 1.00 1.00 ? 51  PHE A CD2  3  
ATOM 4655  C CE1  . PHE A 1 51  ? -16.956 2.619   -8.943  1.00 1.00 ? 51  PHE A CE1  3  
ATOM 4656  C CE2  . PHE A 1 51  ? -18.859 1.180   -9.433  1.00 1.00 ? 51  PHE A CE2  3  
ATOM 4657  C CZ   . PHE A 1 51  ? -17.767 1.517   -8.615  1.00 1.00 ? 51  PHE A CZ   3  
ATOM 4658  H H    . PHE A 1 51  ? -18.921 4.971   -14.389 1.00 1.00 ? 51  PHE A H    3  
ATOM 4659  H HA   . PHE A 1 51  ? -16.669 3.716   -13.030 1.00 1.00 ? 51  PHE A HA   3  
ATOM 4660  H HB2  . PHE A 1 51  ? -18.530 4.920   -11.897 1.00 1.00 ? 51  PHE A HB2  3  
ATOM 4661  H HB3  . PHE A 1 51  ? -19.663 3.698   -12.458 1.00 1.00 ? 51  PHE A HB3  3  
ATOM 4662  H HD1  . PHE A 1 51  ? -16.608 4.225   -10.347 1.00 1.00 ? 51  PHE A HD1  3  
ATOM 4663  H HD2  . PHE A 1 51  ? -19.987 1.683   -11.203 1.00 1.00 ? 51  PHE A HD2  3  
ATOM 4664  H HE1  . PHE A 1 51  ? -16.118 2.882   -8.311  1.00 1.00 ? 51  PHE A HE1  3  
ATOM 4665  H HE2  . PHE A 1 51  ? -19.485 0.335   -9.180  1.00 1.00 ? 51  PHE A HE2  3  
ATOM 4666  H HZ   . PHE A 1 51  ? -17.554 0.933   -7.730  1.00 1.00 ? 51  PHE A HZ   3  
ATOM 4667  N N    . SER A 1 52  ? -18.695 1.804   -14.778 1.00 1.00 ? 52  SER A N    3  
ATOM 4668  C CA   . SER A 1 52  ? -18.975 0.448   -15.283 1.00 1.00 ? 52  SER A CA   3  
ATOM 4669  C C    . SER A 1 52  ? -18.390 0.163   -16.684 1.00 1.00 ? 52  SER A C    3  
ATOM 4670  O O    . SER A 1 52  ? -18.285 -1.005  -17.065 1.00 1.00 ? 52  SER A O    3  
ATOM 4671  C CB   . SER A 1 52  ? -20.490 0.199   -15.248 1.00 1.00 ? 52  SER A CB   3  
ATOM 4672  O OG   . SER A 1 52  ? -21.239 1.258   -15.841 1.00 1.00 ? 52  SER A OG   3  
ATOM 4673  H H    . SER A 1 52  ? -19.245 2.556   -15.177 1.00 1.00 ? 52  SER A H    3  
ATOM 4674  H HA   . SER A 1 52  ? -18.522 -0.293  -14.621 1.00 1.00 ? 52  SER A HA   3  
ATOM 4675  H HB2  . SER A 1 52  ? -20.720 -0.742  -15.750 1.00 1.00 ? 52  SER A HB2  3  
ATOM 4676  H HB3  . SER A 1 52  ? -20.790 0.103   -14.202 1.00 1.00 ? 52  SER A HB3  3  
ATOM 4677  H HG   . SER A 1 52  ? -22.171 1.173   -15.536 1.00 1.00 ? 52  SER A HG   3  
ATOM 4678  N N    . VAL A 1 53  ? -17.955 1.185   -17.434 1.00 1.00 ? 53  VAL A N    3  
ATOM 4679  C CA   . VAL A 1 53  ? -17.258 1.047   -18.727 1.00 1.00 ? 53  VAL A CA   3  
ATOM 4680  C C    . VAL A 1 53  ? -16.343 2.249   -19.003 1.00 1.00 ? 53  VAL A C    3  
ATOM 4681  O O    . VAL A 1 53  ? -16.650 3.362   -18.591 1.00 1.00 ? 53  VAL A O    3  
ATOM 4682  C CB   . VAL A 1 53  ? -18.273 0.844   -19.885 1.00 1.00 ? 53  VAL A CB   3  
ATOM 4683  C CG1  . VAL A 1 53  ? -18.955 2.148   -20.338 1.00 1.00 ? 53  VAL A CG1  3  
ATOM 4684  C CG2  . VAL A 1 53  ? -17.620 0.174   -21.105 1.00 1.00 ? 53  VAL A CG2  3  
ATOM 4685  H H    . VAL A 1 53  ? -18.185 2.130   -17.125 1.00 1.00 ? 53  VAL A H    3  
ATOM 4686  H HA   . VAL A 1 53  ? -16.626 0.158   -18.661 1.00 1.00 ? 53  VAL A HA   3  
ATOM 4687  H HB   . VAL A 1 53  ? -19.059 0.169   -19.538 1.00 1.00 ? 53  VAL A HB   3  
ATOM 4688  H HG11 . VAL A 1 53  ? -18.233 2.802   -20.825 1.00 1.00 ? 53  VAL A HG11 3  
ATOM 4689  H HG12 . VAL A 1 53  ? -19.742 1.921   -21.055 1.00 1.00 ? 53  VAL A HG12 3  
ATOM 4690  H HG13 . VAL A 1 53  ? -19.386 2.667   -19.484 1.00 1.00 ? 53  VAL A HG13 3  
ATOM 4691  H HG21 . VAL A 1 53  ? -18.383 -0.059  -21.849 1.00 1.00 ? 53  VAL A HG21 3  
ATOM 4692  H HG22 . VAL A 1 53  ? -16.884 0.836   -21.557 1.00 1.00 ? 53  VAL A HG22 3  
ATOM 4693  H HG23 . VAL A 1 53  ? -17.139 -0.756  -20.802 1.00 1.00 ? 53  VAL A HG23 3  
ATOM 4694  N N    . LEU A 1 54  ? -15.241 2.032   -19.728 1.00 1.00 ? 54  LEU A N    3  
ATOM 4695  C CA   . LEU A 1 54  ? -14.373 3.088   -20.270 1.00 1.00 ? 54  LEU A CA   3  
ATOM 4696  C C    . LEU A 1 54  ? -14.218 2.917   -21.790 1.00 1.00 ? 54  LEU A C    3  
ATOM 4697  O O    . LEU A 1 54  ? -14.298 1.808   -22.318 1.00 1.00 ? 54  LEU A O    3  
ATOM 4698  C CB   . LEU A 1 54  ? -12.996 3.065   -19.570 1.00 1.00 ? 54  LEU A CB   3  
ATOM 4699  C CG   . LEU A 1 54  ? -13.003 3.480   -18.081 1.00 1.00 ? 54  LEU A CG   3  
ATOM 4700  C CD1  . LEU A 1 54  ? -11.586 3.291   -17.513 1.00 1.00 ? 54  LEU A CD1  3  
ATOM 4701  C CD2  . LEU A 1 54  ? -13.439 4.943   -17.888 1.00 1.00 ? 54  LEU A CD2  3  
ATOM 4702  H H    . LEU A 1 54  ? -15.040 1.086   -20.025 1.00 1.00 ? 54  LEU A H    3  
ATOM 4703  H HA   . LEU A 1 54  ? -14.837 4.062   -20.116 1.00 1.00 ? 54  LEU A HA   3  
ATOM 4704  H HB2  . LEU A 1 54  ? -12.589 2.055   -19.651 1.00 1.00 ? 54  LEU A HB2  3  
ATOM 4705  H HB3  . LEU A 1 54  ? -12.319 3.736   -20.105 1.00 1.00 ? 54  LEU A HB3  3  
ATOM 4706  H HG   . LEU A 1 54  ? -13.683 2.833   -17.527 1.00 1.00 ? 54  LEU A HG   3  
ATOM 4707  H HD11 . LEU A 1 54  ? -11.296 2.243   -17.589 1.00 1.00 ? 54  LEU A HD11 3  
ATOM 4708  H HD12 . LEU A 1 54  ? -10.874 3.903   -18.067 1.00 1.00 ? 54  LEU A HD12 3  
ATOM 4709  H HD13 . LEU A 1 54  ? -11.560 3.581   -16.464 1.00 1.00 ? 54  LEU A HD13 3  
ATOM 4710  H HD21 . LEU A 1 54  ? -12.812 5.604   -18.485 1.00 1.00 ? 54  LEU A HD21 3  
ATOM 4711  H HD22 . LEU A 1 54  ? -14.479 5.067   -18.182 1.00 1.00 ? 54  LEU A HD22 3  
ATOM 4712  H HD23 . LEU A 1 54  ? -13.350 5.216   -16.837 1.00 1.00 ? 54  LEU A HD23 3  
ATOM 4713  N N    . SER A 1 55  ? -13.986 4.020   -22.499 1.00 1.00 ? 55  SER A N    3  
ATOM 4714  C CA   . SER A 1 55  ? -13.981 4.064   -23.966 1.00 1.00 ? 55  SER A CA   3  
ATOM 4715  C C    . SER A 1 55  ? -13.298 5.334   -24.505 1.00 1.00 ? 55  SER A C    3  
ATOM 4716  O O    . SER A 1 55  ? -13.234 6.348   -23.808 1.00 1.00 ? 55  SER A O    3  
ATOM 4717  C CB   . SER A 1 55  ? -15.411 3.929   -24.527 1.00 1.00 ? 55  SER A CB   3  
ATOM 4718  O OG   . SER A 1 55  ? -16.290 4.916   -23.993 1.00 1.00 ? 55  SER A OG   3  
ATOM 4719  H H    . SER A 1 55  ? -13.881 4.906   -22.027 1.00 1.00 ? 55  SER A H    3  
ATOM 4720  H HA   . SER A 1 55  ? -13.408 3.214   -24.331 1.00 1.00 ? 55  SER A HA   3  
ATOM 4721  H HB2  . SER A 1 55  ? -15.382 4.016   -25.615 1.00 1.00 ? 55  SER A HB2  3  
ATOM 4722  H HB3  . SER A 1 55  ? -15.795 2.940   -24.277 1.00 1.00 ? 55  SER A HB3  3  
ATOM 4723  H HG   . SER A 1 55  ? -17.170 4.822   -24.416 1.00 1.00 ? 55  SER A HG   3  
ATOM 4724  N N    . ASN A 1 56  ? -12.795 5.269   -25.748 1.00 1.00 ? 56  ASN A N    3  
ATOM 4725  C CA   . ASN A 1 56  ? -11.959 6.269   -26.449 1.00 1.00 ? 56  ASN A CA   3  
ATOM 4726  C C    . ASN A 1 56  ? -10.481 6.207   -25.996 1.00 1.00 ? 56  ASN A C    3  
ATOM 4727  O O    . ASN A 1 56  ? -10.157 5.707   -24.919 1.00 1.00 ? 56  ASN A O    3  
ATOM 4728  C CB   . ASN A 1 56  ? -12.508 7.709   -26.385 1.00 1.00 ? 56  ASN A CB   3  
ATOM 4729  C CG   . ASN A 1 56  ? -13.979 7.835   -26.771 1.00 1.00 ? 56  ASN A CG   3  
ATOM 4730  O OD1  . ASN A 1 56  ? -14.326 8.105   -27.913 1.00 1.00 ? 56  ASN A OD1  3  
ATOM 4731  N ND2  . ASN A 1 56  ? -14.873 7.662   -25.816 1.00 1.00 ? 56  ASN A ND2  3  
ATOM 4732  H H    . ASN A 1 56  ? -12.921 4.396   -26.245 1.00 1.00 ? 56  ASN A H    3  
ATOM 4733  H HA   . ASN A 1 56  ? -11.972 5.988   -27.503 1.00 1.00 ? 56  ASN A HA   3  
ATOM 4734  H HB2  . ASN A 1 56  ? -12.375 8.113   -25.383 1.00 1.00 ? 56  ASN A HB2  3  
ATOM 4735  H HB3  . ASN A 1 56  ? -11.921 8.341   -27.055 1.00 1.00 ? 56  ASN A HB3  3  
ATOM 4736  H HD21 . ASN A 1 56  ? -14.549 7.366   -24.904 1.00 1.00 ? 56  ASN A HD21 3  
ATOM 4737  H HD22 . ASN A 1 56  ? -15.851 7.867   -25.980 1.00 1.00 ? 56  ASN A HD22 3  
ATOM 4738  N N    . SER A 1 57  ? -9.560  6.686   -26.835 1.00 1.00 ? 57  SER A N    3  
ATOM 4739  C CA   . SER A 1 57  ? -8.108  6.524   -26.624 1.00 1.00 ? 57  SER A CA   3  
ATOM 4740  C C    . SER A 1 57  ? -7.506  7.477   -25.570 1.00 1.00 ? 57  SER A C    3  
ATOM 4741  O O    . SER A 1 57  ? -7.939  8.620   -25.413 1.00 1.00 ? 57  SER A O    3  
ATOM 4742  C CB   . SER A 1 57  ? -7.365  6.686   -27.958 1.00 1.00 ? 57  SER A CB   3  
ATOM 4743  O OG   . SER A 1 57  ? -7.836  5.732   -28.902 1.00 1.00 ? 57  SER A OG   3  
ATOM 4744  H H    . SER A 1 57  ? -9.856  7.067   -27.724 1.00 1.00 ? 57  SER A H    3  
ATOM 4745  H HA   . SER A 1 57  ? -7.926  5.504   -26.282 1.00 1.00 ? 57  SER A HA   3  
ATOM 4746  H HB2  . SER A 1 57  ? -7.531  7.698   -28.338 1.00 1.00 ? 57  SER A HB2  3  
ATOM 4747  H HB3  . SER A 1 57  ? -6.296  6.546   -27.797 1.00 1.00 ? 57  SER A HB3  3  
ATOM 4748  H HG   . SER A 1 57  ? -7.416  5.891   -29.774 1.00 1.00 ? 57  SER A HG   3  
ATOM 4749  N N    . ALA A 1 58  ? -6.455  7.011   -24.881 1.00 1.00 ? 58  ALA A N    3  
ATOM 4750  C CA   . ALA A 1 58  ? -5.622  7.790   -23.957 1.00 1.00 ? 58  ALA A CA   3  
ATOM 4751  C C    . ALA A 1 58  ? -4.410  8.396   -24.690 1.00 1.00 ? 58  ALA A C    3  
ATOM 4752  O O    . ALA A 1 58  ? -3.957  7.829   -25.684 1.00 1.00 ? 58  ALA A O    3  
ATOM 4753  C CB   . ALA A 1 58  ? -5.208  6.844   -22.822 1.00 1.00 ? 58  ALA A CB   3  
ATOM 4754  H H    . ALA A 1 58  ? -6.124  6.076   -25.102 1.00 1.00 ? 58  ALA A H    3  
ATOM 4755  H HA   . ALA A 1 58  ? -6.185  8.617   -23.518 1.00 1.00 ? 58  ALA A HA   3  
ATOM 4756  H HB1  . ALA A 1 58  ? -4.655  7.398   -22.068 1.00 1.00 ? 58  ALA A HB1  3  
ATOM 4757  H HB2  . ALA A 1 58  ? -6.099  6.420   -22.352 1.00 1.00 ? 58  ALA A HB2  3  
ATOM 4758  H HB3  . ALA A 1 58  ? -4.585  6.034   -23.205 1.00 1.00 ? 58  ALA A HB3  3  
ATOM 4759  N N    . GLU A 1 59  ? -3.866  9.515   -24.206 1.00 1.00 ? 59  GLU A N    3  
ATOM 4760  C CA   . GLU A 1 59  ? -2.710  10.205  -24.801 1.00 1.00 ? 59  GLU A CA   3  
ATOM 4761  C C    . GLU A 1 59  ? -1.563  10.319  -23.790 1.00 1.00 ? 59  GLU A C    3  
ATOM 4762  O O    . GLU A 1 59  ? -1.818  10.621  -22.627 1.00 1.00 ? 59  GLU A O    3  
ATOM 4763  C CB   . GLU A 1 59  ? -3.118  11.613  -25.275 1.00 1.00 ? 59  GLU A CB   3  
ATOM 4764  C CG   . GLU A 1 59  ? -2.057  12.229  -26.200 1.00 1.00 ? 59  GLU A CG   3  
ATOM 4765  C CD   . GLU A 1 59  ? -2.492  13.608  -26.716 1.00 1.00 ? 59  GLU A CD   3  
ATOM 4766  O OE1  . GLU A 1 59  ? -3.417  13.678  -27.560 1.00 1.00 ? 59  GLU A OE1  3  
ATOM 4767  O OE2  . GLU A 1 59  ? -1.916  14.629  -26.273 1.00 1.00 ? 59  GLU A OE2  3  
ATOM 4768  H H    . GLU A 1 59  ? -4.248  9.899   -23.346 1.00 1.00 ? 59  GLU A H    3  
ATOM 4769  H HA   . GLU A 1 59  ? -2.356  9.646   -25.668 1.00 1.00 ? 59  GLU A HA   3  
ATOM 4770  H HB2  . GLU A 1 59  ? -4.057  11.543  -25.823 1.00 1.00 ? 59  GLU A HB2  3  
ATOM 4771  H HB3  . GLU A 1 59  ? -3.269  12.266  -24.407 1.00 1.00 ? 59  GLU A HB3  3  
ATOM 4772  H HG2  . GLU A 1 59  ? -1.118  12.331  -25.657 1.00 1.00 ? 59  GLU A HG2  3  
ATOM 4773  H HG3  . GLU A 1 59  ? -1.883  11.564  -27.044 1.00 1.00 ? 59  GLU A HG3  3  
ATOM 4774  N N    . VAL A 1 60  ? -0.313  10.112  -24.209 1.00 1.00 ? 60  VAL A N    3  
ATOM 4775  C CA   . VAL A 1 60  ? 0.862   10.384  -23.363 1.00 1.00 ? 60  VAL A CA   3  
ATOM 4776  C C    . VAL A 1 60  ? 1.169   11.883  -23.403 1.00 1.00 ? 60  VAL A C    3  
ATOM 4777  O O    . VAL A 1 60  ? 1.352   12.461  -24.473 1.00 1.00 ? 60  VAL A O    3  
ATOM 4778  C CB   . VAL A 1 60  ? 2.110   9.582   -23.782 1.00 1.00 ? 60  VAL A CB   3  
ATOM 4779  C CG1  . VAL A 1 60  ? 3.265   9.805   -22.788 1.00 1.00 ? 60  VAL A CG1  3  
ATOM 4780  C CG2  . VAL A 1 60  ? 1.845   8.067   -23.850 1.00 1.00 ? 60  VAL A CG2  3  
ATOM 4781  H H    . VAL A 1 60  ? -0.154  9.854   -25.187 1.00 1.00 ? 60  VAL A H    3  
ATOM 4782  H HA   . VAL A 1 60  ? 0.622   10.098  -22.339 1.00 1.00 ? 60  VAL A HA   3  
ATOM 4783  H HB   . VAL A 1 60  ? 2.408   9.923   -24.769 1.00 1.00 ? 60  VAL A HB   3  
ATOM 4784  H HG11 . VAL A 1 60  ? 4.159   9.270   -23.118 1.00 1.00 ? 60  VAL A HG11 3  
ATOM 4785  H HG12 . VAL A 1 60  ? 3.517   10.860  -22.710 1.00 1.00 ? 60  VAL A HG12 3  
ATOM 4786  H HG13 . VAL A 1 60  ? 2.970   9.455   -21.799 1.00 1.00 ? 60  VAL A HG13 3  
ATOM 4787  H HG21 . VAL A 1 60  ? 2.748   7.548   -24.173 1.00 1.00 ? 60  VAL A HG21 3  
ATOM 4788  H HG22 . VAL A 1 60  ? 1.553   7.693   -22.867 1.00 1.00 ? 60  VAL A HG22 3  
ATOM 4789  H HG23 . VAL A 1 60  ? 1.054   7.844   -24.566 1.00 1.00 ? 60  VAL A HG23 3  
ATOM 4790  N N    . LYS A 1 61  ? 1.250   12.504  -22.227 1.00 1.00 ? 61  LYS A N    3  
ATOM 4791  C CA   . LYS A 1 61  ? 1.434   13.942  -22.026 1.00 1.00 ? 61  LYS A CA   3  
ATOM 4792  C C    . LYS A 1 61  ? 2.549   14.240  -20.998 1.00 1.00 ? 61  LYS A C    3  
ATOM 4793  O O    . LYS A 1 61  ? 2.973   13.364  -20.242 1.00 1.00 ? 61  LYS A O    3  
ATOM 4794  C CB   . LYS A 1 61  ? 0.073   14.535  -21.592 1.00 1.00 ? 61  LYS A CB   3  
ATOM 4795  C CG   . LYS A 1 61  ? -0.974  14.553  -22.726 1.00 1.00 ? 61  LYS A CG   3  
ATOM 4796  C CD   . LYS A 1 61  ? -2.297  15.145  -22.208 1.00 1.00 ? 61  LYS A CD   3  
ATOM 4797  C CE   . LYS A 1 61  ? -3.423  15.278  -23.249 1.00 1.00 ? 61  LYS A CE   3  
ATOM 4798  N NZ   . LYS A 1 61  ? -3.097  16.226  -24.353 1.00 1.00 ? 61  LYS A NZ   3  
ATOM 4799  H H    . LYS A 1 61  ? 1.092   11.941  -21.394 1.00 1.00 ? 61  LYS A H    3  
ATOM 4800  H HA   . LYS A 1 61  ? 1.728   14.412  -22.967 1.00 1.00 ? 61  LYS A HA   3  
ATOM 4801  H HB2  . LYS A 1 61  ? -0.315  13.943  -20.759 1.00 1.00 ? 61  LYS A HB2  3  
ATOM 4802  H HB3  . LYS A 1 61  ? 0.218   15.560  -21.242 1.00 1.00 ? 61  LYS A HB3  3  
ATOM 4803  H HG2  . LYS A 1 61  ? -0.589  15.160  -23.548 1.00 1.00 ? 61  LYS A HG2  3  
ATOM 4804  H HG3  . LYS A 1 61  ? -1.157  13.542  -23.087 1.00 1.00 ? 61  LYS A HG3  3  
ATOM 4805  H HD2  . LYS A 1 61  ? -2.666  14.482  -21.427 1.00 1.00 ? 61  LYS A HD2  3  
ATOM 4806  H HD3  . LYS A 1 61  ? -2.106  16.121  -21.761 1.00 1.00 ? 61  LYS A HD3  3  
ATOM 4807  H HE2  . LYS A 1 61  ? -3.658  14.290  -23.656 1.00 1.00 ? 61  LYS A HE2  3  
ATOM 4808  H HE3  . LYS A 1 61  ? -4.319  15.638  -22.727 1.00 1.00 ? 61  LYS A HE3  3  
ATOM 4809  H HZ1  . LYS A 1 61  ? -3.921  16.452  -24.898 1.00 1.00 ? 61  LYS A HZ1  3  
ATOM 4810  H HZ2  . LYS A 1 61  ? -2.710  17.097  -24.008 1.00 1.00 ? 61  LYS A HZ2  3  
ATOM 4811  H HZ3  . LYS A 1 61  ? -2.437  15.798  -25.009 1.00 1.00 ? 61  LYS A HZ3  3  
ATOM 4812  N N    . ARG A 1 62  ? 3.043   15.484  -20.994 1.00 1.00 ? 62  ARG A N    3  
ATOM 4813  C CA   . ARG A 1 62  ? 3.993   16.030  -20.007 1.00 1.00 ? 62  ARG A CA   3  
ATOM 4814  C C    . ARG A 1 62  ? 3.369   17.235  -19.277 1.00 1.00 ? 62  ARG A C    3  
ATOM 4815  O O    . ARG A 1 62  ? 2.764   18.084  -19.930 1.00 1.00 ? 62  ARG A O    3  
ATOM 4816  C CB   . ARG A 1 62  ? 5.277   16.460  -20.750 1.00 1.00 ? 62  ARG A CB   3  
ATOM 4817  C CG   . ARG A 1 62  ? 6.410   16.933  -19.814 1.00 1.00 ? 62  ARG A CG   3  
ATOM 4818  C CD   . ARG A 1 62  ? 7.644   17.432  -20.582 1.00 1.00 ? 62  ARG A CD   3  
ATOM 4819  N NE   . ARG A 1 62  ? 7.367   18.691  -21.306 1.00 1.00 ? 62  ARG A NE   3  
ATOM 4820  C CZ   . ARG A 1 62  ? 8.138   19.272  -22.225 1.00 1.00 ? 62  ARG A CZ   3  
ATOM 4821  N NH1  . ARG A 1 62  ? 9.293   18.760  -22.599 1.00 1.00 ? 62  ARG A NH1  3  
ATOM 4822  N NH2  . ARG A 1 62  ? 7.746   20.394  -22.788 1.00 1.00 ? 62  ARG A NH2  3  
ATOM 4823  H H    . ARG A 1 62  ? 2.690   16.127  -21.692 1.00 1.00 ? 62  ARG A H    3  
ATOM 4824  H HA   . ARG A 1 62  ? 4.242   15.260  -19.274 1.00 1.00 ? 62  ARG A HA   3  
ATOM 4825  H HB2  . ARG A 1 62  ? 5.646   15.615  -21.333 1.00 1.00 ? 62  ARG A HB2  3  
ATOM 4826  H HB3  . ARG A 1 62  ? 5.025   17.259  -21.452 1.00 1.00 ? 62  ARG A HB3  3  
ATOM 4827  H HG2  . ARG A 1 62  ? 6.056   17.740  -19.174 1.00 1.00 ? 62  ARG A HG2  3  
ATOM 4828  H HG3  . ARG A 1 62  ? 6.707   16.101  -19.176 1.00 1.00 ? 62  ARG A HG3  3  
ATOM 4829  H HD2  . ARG A 1 62  ? 8.450   17.605  -19.867 1.00 1.00 ? 62  ARG A HD2  3  
ATOM 4830  H HD3  . ARG A 1 62  ? 7.960   16.654  -21.282 1.00 1.00 ? 62  ARG A HD3  3  
ATOM 4831  H HE   . ARG A 1 62  ? 6.523   19.189  -21.047 1.00 1.00 ? 62  ARG A HE   3  
ATOM 4832  H HH11 . ARG A 1 62  ? 9.644   17.920  -22.174 1.00 1.00 ? 62  ARG A HH11 3  
ATOM 4833  H HH12 . ARG A 1 62  ? 9.857   19.223  -23.296 1.00 1.00 ? 62  ARG A HH12 3  
ATOM 4834  H HH21 . ARG A 1 62  ? 6.866   20.821  -22.540 1.00 1.00 ? 62  ARG A HH21 3  
ATOM 4835  H HH22 . ARG A 1 62  ? 8.319   20.852  -23.483 1.00 1.00 ? 62  ARG A HH22 3  
ATOM 4836  N N    . GLU A 1 63  ? 3.605   17.361  -17.970 1.00 1.00 ? 63  GLU A N    3  
ATOM 4837  C CA   . GLU A 1 63  ? 3.242   18.534  -17.154 1.00 1.00 ? 63  GLU A CA   3  
ATOM 4838  C C    . GLU A 1 63  ? 4.029   18.553  -15.831 1.00 1.00 ? 63  GLU A C    3  
ATOM 4839  O O    . GLU A 1 63  ? 4.840   17.659  -15.567 1.00 1.00 ? 63  GLU A O    3  
ATOM 4840  C CB   . GLU A 1 63  ? 1.711   18.595  -16.910 1.00 1.00 ? 63  GLU A CB   3  
ATOM 4841  C CG   . GLU A 1 63  ? 0.991   19.728  -17.654 1.00 1.00 ? 63  GLU A CG   3  
ATOM 4842  C CD   . GLU A 1 63  ? 1.558   21.127  -17.345 1.00 1.00 ? 63  GLU A CD   3  
ATOM 4843  O OE1  . GLU A 1 63  ? 1.943   21.400  -16.184 1.00 1.00 ? 63  GLU A OE1  3  
ATOM 4844  O OE2  . GLU A 1 63  ? 1.630   21.959  -18.281 1.00 1.00 ? 63  GLU A OE2  3  
ATOM 4845  H H    . GLU A 1 63  ? 4.088   16.606  -17.495 1.00 1.00 ? 63  GLU A H    3  
ATOM 4846  H HA   . GLU A 1 63  ? 3.539   19.431  -17.697 1.00 1.00 ? 63  GLU A HA   3  
ATOM 4847  H HB2  . GLU A 1 63  ? 1.252   17.651  -17.196 1.00 1.00 ? 63  GLU A HB2  3  
ATOM 4848  H HB3  . GLU A 1 63  ? 1.505   18.725  -15.849 1.00 1.00 ? 63  GLU A HB3  3  
ATOM 4849  H HG2  . GLU A 1 63  ? 1.044   19.537  -18.724 1.00 1.00 ? 63  GLU A HG2  3  
ATOM 4850  H HG3  . GLU A 1 63  ? -0.065  19.707  -17.377 1.00 1.00 ? 63  GLU A HG3  3  
ATOM 4851  N N    . ARG A 1 64  ? 3.804   19.566  -14.994 1.00 1.00 ? 64  ARG A N    3  
ATOM 4852  C CA   . ARG A 1 64  ? 4.349   19.642  -13.637 1.00 1.00 ? 64  ARG A CA   3  
ATOM 4853  C C    . ARG A 1 64  ? 3.660   18.642  -12.700 1.00 1.00 ? 64  ARG A C    3  
ATOM 4854  O O    . ARG A 1 64  ? 2.450   18.410  -12.777 1.00 1.00 ? 64  ARG A O    3  
ATOM 4855  C CB   . ARG A 1 64  ? 4.249   21.078  -13.094 1.00 1.00 ? 64  ARG A CB   3  
ATOM 4856  C CG   . ARG A 1 64  ? 5.182   22.028  -13.864 1.00 1.00 ? 64  ARG A CG   3  
ATOM 4857  C CD   . ARG A 1 64  ? 5.170   23.444  -13.277 1.00 1.00 ? 64  ARG A CD   3  
ATOM 4858  N NE   . ARG A 1 64  ? 6.079   24.325  -14.032 1.00 1.00 ? 64  ARG A NE   3  
ATOM 4859  C CZ   . ARG A 1 64  ? 6.400   25.582  -13.743 1.00 1.00 ? 64  ARG A CZ   3  
ATOM 4860  N NH1  . ARG A 1 64  ? 5.911   26.209  -12.692 1.00 1.00 ? 64  ARG A NH1  3  
ATOM 4861  N NH2  . ARG A 1 64  ? 7.227   26.233  -14.530 1.00 1.00 ? 64  ARG A NH2  3  
ATOM 4862  H H    . ARG A 1 64  ? 3.139   20.282  -15.283 1.00 1.00 ? 64  ARG A H    3  
ATOM 4863  H HA   . ARG A 1 64  ? 5.406   19.383  -13.682 1.00 1.00 ? 64  ARG A HA   3  
ATOM 4864  H HB2  . ARG A 1 64  ? 3.217   21.427  -13.172 1.00 1.00 ? 64  ARG A HB2  3  
ATOM 4865  H HB3  . ARG A 1 64  ? 4.540   21.084  -12.040 1.00 1.00 ? 64  ARG A HB3  3  
ATOM 4866  H HG2  . ARG A 1 64  ? 6.199   21.639  -13.821 1.00 1.00 ? 64  ARG A HG2  3  
ATOM 4867  H HG3  . ARG A 1 64  ? 4.868   22.077  -14.908 1.00 1.00 ? 64  ARG A HG3  3  
ATOM 4868  H HD2  . ARG A 1 64  ? 4.153   23.844  -13.322 1.00 1.00 ? 64  ARG A HD2  3  
ATOM 4869  H HD3  . ARG A 1 64  ? 5.490   23.397  -12.234 1.00 1.00 ? 64  ARG A HD3  3  
ATOM 4870  H HE   . ARG A 1 64  ? 6.501   23.930  -14.864 1.00 1.00 ? 64  ARG A HE   3  
ATOM 4871  H HH11 . ARG A 1 64  ? 5.269   25.739  -12.074 1.00 1.00 ? 64  ARG A HH11 3  
ATOM 4872  H HH12 . ARG A 1 64  ? 6.168   27.164  -12.495 1.00 1.00 ? 64  ARG A HH12 3  
ATOM 4873  H HH21 . ARG A 1 64  ? 7.611   25.783  -15.349 1.00 1.00 ? 64  ARG A HH21 3  
ATOM 4874  H HH22 . ARG A 1 64  ? 7.488   27.186  -14.331 1.00 1.00 ? 64  ARG A HH22 3  
ATOM 4875  N N    . LEU A 1 65  ? 4.426   18.088  -11.754 1.00 1.00 ? 65  LEU A N    3  
ATOM 4876  C CA   . LEU A 1 65  ? 3.945   17.138  -10.739 1.00 1.00 ? 65  LEU A CA   3  
ATOM 4877  C C    . LEU A 1 65  ? 2.721   17.689  -9.999  1.00 1.00 ? 65  LEU A C    3  
ATOM 4878  O O    . LEU A 1 65  ? 1.687   17.030  -10.009 1.00 1.00 ? 65  LEU A O    3  
ATOM 4879  C CB   . LEU A 1 65  ? 5.109   16.794  -9.782  1.00 1.00 ? 65  LEU A CB   3  
ATOM 4880  C CG   . LEU A 1 65  ? 4.733   15.845  -8.618  1.00 1.00 ? 65  LEU A CG   3  
ATOM 4881  C CD1  . LEU A 1 65  ? 4.298   14.461  -9.120  1.00 1.00 ? 65  LEU A CD1  3  
ATOM 4882  C CD2  . LEU A 1 65  ? 5.932   15.694  -7.678  1.00 1.00 ? 65  LEU A CD2  3  
ATOM 4883  H H    . LEU A 1 65  ? 5.418   18.327  -11.754 1.00 1.00 ? 65  LEU A H    3  
ATOM 4884  H HA   . LEU A 1 65  ? 3.621   16.225  -11.245 1.00 1.00 ? 65  LEU A HA   3  
ATOM 4885  H HB2  . LEU A 1 65  ? 5.921   16.343  -10.356 1.00 1.00 ? 65  LEU A HB2  3  
ATOM 4886  H HB3  . LEU A 1 65  ? 5.496   17.721  -9.355  1.00 1.00 ? 65  LEU A HB3  3  
ATOM 4887  H HG   . LEU A 1 65  ? 3.914   16.277  -8.045  1.00 1.00 ? 65  LEU A HG   3  
ATOM 4888  H HD11 . LEU A 1 65  ? 4.006   13.839  -8.272  1.00 1.00 ? 65  LEU A HD11 3  
ATOM 4889  H HD12 . LEU A 1 65  ? 3.442   14.551  -9.790  1.00 1.00 ? 65  LEU A HD12 3  
ATOM 4890  H HD13 . LEU A 1 65  ? 5.123   13.972  -9.639  1.00 1.00 ? 65  LEU A HD13 3  
ATOM 4891  H HD21 . LEU A 1 65  ? 6.790   15.302  -8.228  1.00 1.00 ? 65  LEU A HD21 3  
ATOM 4892  H HD22 . LEU A 1 65  ? 6.193   16.665  -7.257  1.00 1.00 ? 65  LEU A HD22 3  
ATOM 4893  H HD23 . LEU A 1 65  ? 5.682   15.015  -6.863  1.00 1.00 ? 65  LEU A HD23 3  
ATOM 4894  N N    . GLU A 1 66  ? 2.822   18.902  -9.438  1.00 1.00 ? 66  GLU A N    3  
ATOM 4895  C CA   . GLU A 1 66  ? 1.745   19.560  -8.667  1.00 1.00 ? 66  GLU A CA   3  
ATOM 4896  C C    . GLU A 1 66  ? 0.449   19.653  -9.475  1.00 1.00 ? 66  GLU A C    3  
ATOM 4897  O O    . GLU A 1 66  ? -0.632  19.365  -8.965  1.00 1.00 ? 66  GLU A O    3  
ATOM 4898  C CB   . GLU A 1 66  ? 2.128   20.990  -8.238  1.00 1.00 ? 66  GLU A CB   3  
ATOM 4899  C CG   . GLU A 1 66  ? 3.571   21.134  -7.769  1.00 1.00 ? 66  GLU A CG   3  
ATOM 4900  C CD   . GLU A 1 66  ? 3.819   22.517  -7.147  1.00 1.00 ? 66  GLU A CD   3  
ATOM 4901  O OE1  . GLU A 1 66  ? 4.187   23.459  -7.889  1.00 1.00 ? 66  GLU A OE1  3  
ATOM 4902  O OE2  . GLU A 1 66  ? 3.649   22.668  -5.915  1.00 1.00 ? 66  GLU A OE2  3  
ATOM 4903  H H    . GLU A 1 66  ? 3.720   19.369  -9.492  1.00 1.00 ? 66  GLU A H    3  
ATOM 4904  H HA   . GLU A 1 66  ? 1.552   18.977  -7.770  1.00 1.00 ? 66  GLU A HA   3  
ATOM 4905  H HB2  . GLU A 1 66  ? 1.989   21.679  -9.071  1.00 1.00 ? 66  GLU A HB2  3  
ATOM 4906  H HB3  . GLU A 1 66  ? 1.459   21.294  -7.434  1.00 1.00 ? 66  GLU A HB3  3  
ATOM 4907  H HG2  . GLU A 1 66  ? 3.793   20.348  -7.046  1.00 1.00 ? 66  GLU A HG2  3  
ATOM 4908  H HG3  . GLU A 1 66  ? 4.209   21.009  -8.645  1.00 1.00 ? 66  GLU A HG3  3  
ATOM 4909  N N    . ASP A 1 67  ? 0.573   20.033  -10.753 1.00 1.00 ? 67  ASP A N    3  
ATOM 4910  C CA   . ASP A 1 67  ? -0.570  20.134  -11.659 1.00 1.00 ? 67  ASP A CA   3  
ATOM 4911  C C    . ASP A 1 67  ? -1.211  18.755  -11.908 1.00 1.00 ? 67  ASP A C    3  
ATOM 4912  O O    . ASP A 1 67  ? -2.434  18.619  -11.848 1.00 1.00 ? 67  ASP A O    3  
ATOM 4913  C CB   . ASP A 1 67  ? -0.136  20.787  -12.979 1.00 1.00 ? 67  ASP A CB   3  
ATOM 4914  C CG   . ASP A 1 67  ? -1.338  21.012  -13.910 1.00 1.00 ? 67  ASP A CG   3  
ATOM 4915  O OD1  . ASP A 1 67  ? -2.052  22.025  -13.723 1.00 1.00 ? 67  ASP A OD1  3  
ATOM 4916  O OD2  . ASP A 1 67  ? -1.569  20.178  -14.817 1.00 1.00 ? 67  ASP A OD2  3  
ATOM 4917  H H    . ASP A 1 67  ? 1.482   20.323  -11.083 1.00 1.00 ? 67  ASP A H    3  
ATOM 4918  H HA   . ASP A 1 67  ? -1.296  20.784  -11.177 1.00 1.00 ? 67  ASP A HA   3  
ATOM 4919  H HB2  . ASP A 1 67  ? 0.336   21.747  -12.766 1.00 1.00 ? 67  ASP A HB2  3  
ATOM 4920  H HB3  . ASP A 1 67  ? 0.596   20.147  -13.473 1.00 1.00 ? 67  ASP A HB3  3  
ATOM 4921  N N    . VAL A 1 68  ? -0.383  17.727  -12.139 1.00 1.00 ? 68  VAL A N    3  
ATOM 4922  C CA   . VAL A 1 68  ? -0.823  16.362  -12.446 1.00 1.00 ? 68  VAL A CA   3  
ATOM 4923  C C    . VAL A 1 68  ? -1.427  15.657  -11.221 1.00 1.00 ? 68  VAL A C    3  
ATOM 4924  O O    . VAL A 1 68  ? -2.471  15.020  -11.359 1.00 1.00 ? 68  VAL A O    3  
ATOM 4925  C CB   . VAL A 1 68  ? 0.320   15.538  -13.076 1.00 1.00 ? 68  VAL A CB   3  
ATOM 4926  C CG1  . VAL A 1 68  ? 0.008   14.038  -13.215 1.00 1.00 ? 68  VAL A CG1  3  
ATOM 4927  C CG2  . VAL A 1 68  ? 0.620   16.090  -14.477 1.00 1.00 ? 68  VAL A CG2  3  
ATOM 4928  H H    . VAL A 1 68  ? 0.609   17.939  -12.185 1.00 1.00 ? 68  VAL A H    3  
ATOM 4929  H HA   . VAL A 1 68  ? -1.605  16.455  -13.195 1.00 1.00 ? 68  VAL A HA   3  
ATOM 4930  H HB   . VAL A 1 68  ? 1.212   15.645  -12.456 1.00 1.00 ? 68  VAL A HB   3  
ATOM 4931  H HG11 . VAL A 1 68  ? -0.916  13.898  -13.777 1.00 1.00 ? 68  VAL A HG11 3  
ATOM 4932  H HG12 . VAL A 1 68  ? 0.823   13.529  -13.730 1.00 1.00 ? 68  VAL A HG12 3  
ATOM 4933  H HG13 . VAL A 1 68  ? -0.097  13.587  -12.230 1.00 1.00 ? 68  VAL A HG13 3  
ATOM 4934  H HG21 . VAL A 1 68  ? 1.407   15.511  -14.947 1.00 1.00 ? 68  VAL A HG21 3  
ATOM 4935  H HG22 . VAL A 1 68  ? -0.272  16.036  -15.103 1.00 1.00 ? 68  VAL A HG22 3  
ATOM 4936  H HG23 . VAL A 1 68  ? 0.944   17.124  -14.409 1.00 1.00 ? 68  VAL A HG23 3  
ATOM 4937  N N    . VAL A 1 69  ? -0.831  15.783  -10.028 1.00 1.00 ? 69  VAL A N    3  
ATOM 4938  C CA   . VAL A 1 69  ? -1.383  15.244  -8.780  1.00 1.00 ? 69  VAL A CA   3  
ATOM 4939  C C    . VAL A 1 69  ? -2.520  16.095  -8.178  1.00 1.00 ? 69  VAL A C    3  
ATOM 4940  O O    . VAL A 1 69  ? -3.080  15.721  -7.151  1.00 1.00 ? 69  VAL A O    3  
ATOM 4941  C CB   . VAL A 1 69  ? -0.278  15.016  -7.725  1.00 1.00 ? 69  VAL A CB   3  
ATOM 4942  C CG1  . VAL A 1 69  ? 0.861   14.148  -8.281  1.00 1.00 ? 69  VAL A CG1  3  
ATOM 4943  C CG2  . VAL A 1 69  ? 0.259   16.314  -7.101  1.00 1.00 ? 69  VAL A CG2  3  
ATOM 4944  H H    . VAL A 1 69  ? 0.074   16.241  -9.958  1.00 1.00 ? 69  VAL A H    3  
ATOM 4945  H HA   . VAL A 1 69  ? -1.793  14.268  -9.025  1.00 1.00 ? 69  VAL A HA   3  
ATOM 4946  H HB   . VAL A 1 69  ? -0.726  14.443  -6.931  1.00 1.00 ? 69  VAL A HB   3  
ATOM 4947  H HG11 . VAL A 1 69  ? 1.326   14.620  -9.142  1.00 1.00 ? 69  VAL A HG11 3  
ATOM 4948  H HG12 . VAL A 1 69  ? 1.619   14.000  -7.514  1.00 1.00 ? 69  VAL A HG12 3  
ATOM 4949  H HG13 . VAL A 1 69  ? 0.469   13.177  -8.581  1.00 1.00 ? 69  VAL A HG13 3  
ATOM 4950  H HG21 . VAL A 1 69  ? -0.495  16.760  -6.450  1.00 1.00 ? 69  VAL A HG21 3  
ATOM 4951  H HG22 . VAL A 1 69  ? 1.154   16.112  -6.512  1.00 1.00 ? 69  VAL A HG22 3  
ATOM 4952  H HG23 . VAL A 1 69  ? 0.505   17.028  -7.876  1.00 1.00 ? 69  VAL A HG23 3  
ATOM 4953  N N    . GLY A 1 70  ? -2.856  17.243  -8.782  1.00 1.00 ? 70  GLY A N    3  
ATOM 4954  C CA   . GLY A 1 70  ? -3.814  18.217  -8.243  1.00 1.00 ? 70  GLY A CA   3  
ATOM 4955  C C    . GLY A 1 70  ? -5.199  17.623  -7.962  1.00 1.00 ? 70  GLY A C    3  
ATOM 4956  O O    . GLY A 1 70  ? -5.788  16.955  -8.814  1.00 1.00 ? 70  GLY A O    3  
ATOM 4957  H H    . GLY A 1 70  ? -2.331  17.520  -9.603  1.00 1.00 ? 70  GLY A H    3  
ATOM 4958  H HA2  . GLY A 1 70  ? -3.410  18.617  -7.313  1.00 1.00 ? 70  GLY A HA2  3  
ATOM 4959  H HA3  . GLY A 1 70  ? -3.928  19.043  -8.947  1.00 1.00 ? 70  GLY A HA3  3  
ATOM 4960  N N    . GLY A 1 71  ? -5.707  17.850  -6.743  1.00 1.00 ? 71  GLY A N    3  
ATOM 4961  C CA   . GLY A 1 71  ? -6.995  17.327  -6.257  1.00 1.00 ? 71  GLY A CA   3  
ATOM 4962  C C    . GLY A 1 71  ? -6.972  15.853  -5.828  1.00 1.00 ? 71  GLY A C    3  
ATOM 4963  O O    . GLY A 1 71  ? -8.012  15.326  -5.433  1.00 1.00 ? 71  GLY A O    3  
ATOM 4964  H H    . GLY A 1 71  ? -5.169  18.425  -6.108  1.00 1.00 ? 71  GLY A H    3  
ATOM 4965  H HA2  . GLY A 1 71  ? -7.308  17.914  -5.393  1.00 1.00 ? 71  GLY A HA2  3  
ATOM 4966  H HA3  . GLY A 1 71  ? -7.739  17.422  -7.047  1.00 1.00 ? 71  GLY A HA3  3  
ATOM 4967  N N    . CYS A 1 72  ? -5.810  15.189  -5.904  1.00 1.00 ? 72  CYS A N    3  
ATOM 4968  C CA   . CYS A 1 72  ? -5.613  13.758  -5.634  1.00 1.00 ? 72  CYS A CA   3  
ATOM 4969  C C    . CYS A 1 72  ? -4.509  13.526  -4.577  1.00 1.00 ? 72  CYS A C    3  
ATOM 4970  O O    . CYS A 1 72  ? -3.624  14.364  -4.393  1.00 1.00 ? 72  CYS A O    3  
ATOM 4971  C CB   . CYS A 1 72  ? -5.201  13.069  -6.951  1.00 1.00 ? 72  CYS A CB   3  
ATOM 4972  S SG   . CYS A 1 72  ? -6.351  13.441  -8.311  1.00 1.00 ? 72  CYS A SG   3  
ATOM 4973  H H    . CYS A 1 72  ? -4.995  15.708  -6.207  1.00 1.00 ? 72  CYS A H    3  
ATOM 4974  H HA   . CYS A 1 72  ? -6.544  13.304  -5.279  1.00 1.00 ? 72  CYS A HA   3  
ATOM 4975  H HB2  . CYS A 1 72  ? -4.201  13.400  -7.239  1.00 1.00 ? 72  CYS A HB2  3  
ATOM 4976  H HB3  . CYS A 1 72  ? -5.165  11.987  -6.806  1.00 1.00 ? 72  CYS A HB3  3  
ATOM 4977  H HG   . CYS A 1 72  ? -6.148  14.770  -8.351  1.00 1.00 ? 72  CYS A HG   3  
ATOM 4978  N N    . CYS A 1 73  ? -4.529  12.363  -3.918  1.00 1.00 ? 73  CYS A N    3  
ATOM 4979  C CA   . CYS A 1 73  ? -3.418  11.907  -3.064  1.00 1.00 ? 73  CYS A CA   3  
ATOM 4980  C C    . CYS A 1 73  ? -2.380  11.176  -3.939  1.00 1.00 ? 73  CYS A C    3  
ATOM 4981  O O    . CYS A 1 73  ? -2.726  10.660  -5.000  1.00 1.00 ? 73  CYS A O    3  
ATOM 4982  C CB   . CYS A 1 73  ? -3.967  11.027  -1.928  1.00 1.00 ? 73  CYS A CB   3  
ATOM 4983  S SG   . CYS A 1 73  ? -4.983  12.043  -0.813  1.00 1.00 ? 73  CYS A SG   3  
ATOM 4984  H H    . CYS A 1 73  ? -5.270  11.705  -4.119  1.00 1.00 ? 73  CYS A H    3  
ATOM 4985  H HA   . CYS A 1 73  ? -2.916  12.768  -2.615  1.00 1.00 ? 73  CYS A HA   3  
ATOM 4986  H HB2  . CYS A 1 73  ? -4.568  10.207  -2.329  1.00 1.00 ? 73  CYS A HB2  3  
ATOM 4987  H HB3  . CYS A 1 73  ? -3.141  10.593  -1.355  1.00 1.00 ? 73  CYS A HB3  3  
ATOM 4988  H HG   . CYS A 1 73  ? -5.890  12.447  -1.721  1.00 1.00 ? 73  CYS A HG   3  
ATOM 4989  N N    . TYR A 1 74  ? -1.115  11.101  -3.519  1.00 1.00 ? 74  TYR A N    3  
ATOM 4990  C CA   . TYR A 1 74  ? -0.046  10.485  -4.326  1.00 1.00 ? 74  TYR A CA   3  
ATOM 4991  C C    . TYR A 1 74  ? 1.188   10.033  -3.518  1.00 1.00 ? 74  TYR A C    3  
ATOM 4992  O O    . TYR A 1 74  ? 1.385   10.465  -2.377  1.00 1.00 ? 74  TYR A O    3  
ATOM 4993  C CB   . TYR A 1 74  ? 0.371   11.438  -5.468  1.00 1.00 ? 74  TYR A CB   3  
ATOM 4994  C CG   . TYR A 1 74  ? 1.224   12.621  -5.037  1.00 1.00 ? 74  TYR A CG   3  
ATOM 4995  C CD1  . TYR A 1 74  ? 0.620   13.751  -4.447  1.00 1.00 ? 74  TYR A CD1  3  
ATOM 4996  C CD2  . TYR A 1 74  ? 2.620   12.592  -5.229  1.00 1.00 ? 74  TYR A CD2  3  
ATOM 4997  C CE1  . TYR A 1 74  ? 1.413   14.839  -4.040  1.00 1.00 ? 74  TYR A CE1  3  
ATOM 4998  C CE2  . TYR A 1 74  ? 3.417   13.681  -4.825  1.00 1.00 ? 74  TYR A CE2  3  
ATOM 4999  C CZ   . TYR A 1 74  ? 2.813   14.814  -4.233  1.00 1.00 ? 74  TYR A CZ   3  
ATOM 5000  O OH   . TYR A 1 74  ? 3.571   15.878  -3.840  1.00 1.00 ? 74  TYR A OH   3  
ATOM 5001  H H    . TYR A 1 74  ? -0.865  11.511  -2.628  1.00 1.00 ? 74  TYR A H    3  
ATOM 5002  H HA   . TYR A 1 74  ? -0.466  9.585   -4.775  1.00 1.00 ? 74  TYR A HA   3  
ATOM 5003  H HB2  . TYR A 1 74  ? 0.930   10.864  -6.208  1.00 1.00 ? 74  TYR A HB2  3  
ATOM 5004  H HB3  . TYR A 1 74  ? -0.515  11.816  -5.976  1.00 1.00 ? 74  TYR A HB3  3  
ATOM 5005  H HD1  . TYR A 1 74  ? -0.449  13.784  -4.303  1.00 1.00 ? 74  TYR A HD1  3  
ATOM 5006  H HD2  . TYR A 1 74  ? 3.087   11.731  -5.687  1.00 1.00 ? 74  TYR A HD2  3  
ATOM 5007  H HE1  . TYR A 1 74  ? 0.952   15.705  -3.583  1.00 1.00 ? 74  TYR A HE1  3  
ATOM 5008  H HE2  . TYR A 1 74  ? 4.486   13.651  -4.970  1.00 1.00 ? 74  TYR A HE2  3  
ATOM 5009  H HH   . TYR A 1 74  ? 4.518   15.757  -3.996  1.00 1.00 ? 74  TYR A HH   3  
ATOM 5010  N N    . ARG A 1 75  ? 2.032   9.193   -4.136  1.00 1.00 ? 75  ARG A N    3  
ATOM 5011  C CA   . ARG A 1 75  ? 3.298   8.684   -3.571  1.00 1.00 ? 75  ARG A CA   3  
ATOM 5012  C C    . ARG A 1 75  ? 4.237   8.135   -4.655  1.00 1.00 ? 75  ARG A C    3  
ATOM 5013  O O    . ARG A 1 75  ? 3.796   7.837   -5.762  1.00 1.00 ? 75  ARG A O    3  
ATOM 5014  C CB   . ARG A 1 75  ? 3.008   7.598   -2.503  1.00 1.00 ? 75  ARG A CB   3  
ATOM 5015  C CG   . ARG A 1 75  ? 2.381   6.312   -3.080  1.00 1.00 ? 75  ARG A CG   3  
ATOM 5016  C CD   . ARG A 1 75  ? 2.105   5.276   -1.987  1.00 1.00 ? 75  ARG A CD   3  
ATOM 5017  N NE   . ARG A 1 75  ? 1.547   4.047   -2.569  1.00 1.00 ? 75  ARG A NE   3  
ATOM 5018  C CZ   . ARG A 1 75  ? 1.200   2.936   -1.936  1.00 1.00 ? 75  ARG A CZ   3  
ATOM 5019  N NH1  . ARG A 1 75  ? 1.327   2.785   -0.633  1.00 1.00 ? 75  ARG A NH1  3  
ATOM 5020  N NH2  . ARG A 1 75  ? 0.711   1.955   -2.656  1.00 1.00 ? 75  ARG A NH2  3  
ATOM 5021  H H    . ARG A 1 75  ? 1.763   8.858   -5.058  1.00 1.00 ? 75  ARG A H    3  
ATOM 5022  H HA   . ARG A 1 75  ? 3.807   9.513   -3.077  1.00 1.00 ? 75  ARG A HA   3  
ATOM 5023  H HB2  . ARG A 1 75  ? 3.939   7.338   -2.001  1.00 1.00 ? 75  ARG A HB2  3  
ATOM 5024  H HB3  . ARG A 1 75  ? 2.336   8.010   -1.751  1.00 1.00 ? 75  ARG A HB3  3  
ATOM 5025  H HG2  . ARG A 1 75  ? 1.449   6.553   -3.587  1.00 1.00 ? 75  ARG A HG2  3  
ATOM 5026  H HG3  . ARG A 1 75  ? 3.063   5.867   -3.807  1.00 1.00 ? 75  ARG A HG3  3  
ATOM 5027  H HD2  . ARG A 1 75  ? 3.036   5.042   -1.468  1.00 1.00 ? 75  ARG A HD2  3  
ATOM 5028  H HD3  . ARG A 1 75  ? 1.394   5.695   -1.270  1.00 1.00 ? 75  ARG A HD3  3  
ATOM 5029  H HE   . ARG A 1 75  ? 1.397   4.023   -3.580  1.00 1.00 ? 75  ARG A HE   3  
ATOM 5030  H HH11 . ARG A 1 75  ? 1.694   3.534   -0.068  1.00 1.00 ? 75  ARG A HH11 3  
ATOM 5031  H HH12 . ARG A 1 75  ? 1.057   1.919   -0.187  1.00 1.00 ? 75  ARG A HH12 3  
ATOM 5032  H HH21 . ARG A 1 75  ? 0.626   2.114   -3.664  1.00 1.00 ? 75  ARG A HH21 3  
ATOM 5033  H HH22 . ARG A 1 75  ? 0.427   1.082   -2.243  1.00 1.00 ? 75  ARG A HH22 3  
ATOM 5034  N N    . VAL A 1 76  ? 5.517   7.965   -4.333  1.00 1.00 ? 76  VAL A N    3  
ATOM 5035  C CA   . VAL A 1 76  ? 6.491   7.232   -5.164  1.00 1.00 ? 76  VAL A CA   3  
ATOM 5036  C C    . VAL A 1 76  ? 6.312   5.738   -4.867  1.00 1.00 ? 76  VAL A C    3  
ATOM 5037  O O    . VAL A 1 76  ? 6.195   5.352   -3.701  1.00 1.00 ? 76  VAL A O    3  
ATOM 5038  C CB   . VAL A 1 76  ? 7.957   7.648   -4.891  1.00 1.00 ? 76  VAL A CB   3  
ATOM 5039  C CG1  . VAL A 1 76  ? 8.967   6.809   -5.696  1.00 1.00 ? 76  VAL A CG1  3  
ATOM 5040  C CG2  . VAL A 1 76  ? 8.175   9.126   -5.241  1.00 1.00 ? 76  VAL A CG2  3  
ATOM 5041  H H    . VAL A 1 76  ? 5.810   8.267   -3.399  1.00 1.00 ? 76  VAL A H    3  
ATOM 5042  H HA   . VAL A 1 76  ? 6.268   7.429   -6.212  1.00 1.00 ? 76  VAL A HA   3  
ATOM 5043  H HB   . VAL A 1 76  ? 8.172   7.515   -3.830  1.00 1.00 ? 76  VAL A HB   3  
ATOM 5044  H HG11 . VAL A 1 76  ? 8.958   5.775   -5.349  1.00 1.00 ? 76  VAL A HG11 3  
ATOM 5045  H HG12 . VAL A 1 76  ? 8.725   6.836   -6.760  1.00 1.00 ? 76  VAL A HG12 3  
ATOM 5046  H HG13 . VAL A 1 76  ? 9.975   7.199   -5.557  1.00 1.00 ? 76  VAL A HG13 3  
ATOM 5047  H HG21 . VAL A 1 76  ? 9.197   9.413   -4.990  1.00 1.00 ? 76  VAL A HG21 3  
ATOM 5048  H HG22 . VAL A 1 76  ? 8.014   9.272   -6.309  1.00 1.00 ? 76  VAL A HG22 3  
ATOM 5049  H HG23 . VAL A 1 76  ? 7.495   9.764   -4.679  1.00 1.00 ? 76  VAL A HG23 3  
ATOM 5050  N N    . ASN A 1 77  ? 6.294   4.904   -5.907  1.00 1.00 ? 77  ASN A N    3  
ATOM 5051  C CA   . ASN A 1 77  ? 6.098   3.456   -5.790  1.00 1.00 ? 77  ASN A CA   3  
ATOM 5052  C C    . ASN A 1 77  ? 6.887   2.696   -6.877  1.00 1.00 ? 77  ASN A C    3  
ATOM 5053  O O    . ASN A 1 77  ? 6.336   2.183   -7.852  1.00 1.00 ? 77  ASN A O    3  
ATOM 5054  C CB   . ASN A 1 77  ? 4.589   3.143   -5.760  1.00 1.00 ? 77  ASN A CB   3  
ATOM 5055  C CG   . ASN A 1 77  ? 4.280   1.675   -5.454  1.00 1.00 ? 77  ASN A CG   3  
ATOM 5056  O OD1  . ASN A 1 77  ? 5.162   0.837   -5.298  1.00 1.00 ? 77  ASN A OD1  3  
ATOM 5057  N ND2  . ASN A 1 77  ? 3.013   1.327   -5.337  1.00 1.00 ? 77  ASN A ND2  3  
ATOM 5058  H H    . ASN A 1 77  ? 6.379   5.304   -6.841  1.00 1.00 ? 77  ASN A H    3  
ATOM 5059  H HA   . ASN A 1 77  ? 6.514   3.133   -4.834  1.00 1.00 ? 77  ASN A HA   3  
ATOM 5060  H HB2  . ASN A 1 77  ? 4.121   3.756   -4.988  1.00 1.00 ? 77  ASN A HB2  3  
ATOM 5061  H HB3  . ASN A 1 77  ? 4.139   3.411   -6.717  1.00 1.00 ? 77  ASN A HB3  3  
ATOM 5062  H HD21 . ASN A 1 77  ? 2.275   2.031   -5.412  1.00 1.00 ? 77  ASN A HD21 3  
ATOM 5063  H HD22 . ASN A 1 77  ? 2.780   0.366   -5.139  1.00 1.00 ? 77  ASN A HD22 3  
ATOM 5064  N N    . ASN A 1 78  ? 8.209   2.616   -6.691  1.00 1.00 ? 78  ASN A N    3  
ATOM 5065  C CA   . ASN A 1 78  ? 9.154   1.906   -7.566  1.00 1.00 ? 78  ASN A CA   3  
ATOM 5066  C C    . ASN A 1 78  ? 9.113   0.377   -7.323  1.00 1.00 ? 78  ASN A C    3  
ATOM 5067  O O    . ASN A 1 78  ? 10.120  -0.237  -6.983  1.00 1.00 ? 78  ASN A O    3  
ATOM 5068  C CB   . ASN A 1 78  ? 10.573  2.488   -7.361  1.00 1.00 ? 78  ASN A CB   3  
ATOM 5069  C CG   . ASN A 1 78  ? 10.746  3.943   -7.783  1.00 1.00 ? 78  ASN A CG   3  
ATOM 5070  O OD1  . ASN A 1 78  ? 9.932   4.518   -8.493  1.00 1.00 ? 78  ASN A OD1  3  
ATOM 5071  N ND2  . ASN A 1 78  ? 11.835  4.567   -7.376  1.00 1.00 ? 78  ASN A ND2  3  
ATOM 5072  H H    . ASN A 1 78  ? 8.584   3.064   -5.865  1.00 1.00 ? 78  ASN A H    3  
ATOM 5073  H HA   . ASN A 1 78  ? 8.869   2.077   -8.604  1.00 1.00 ? 78  ASN A HA   3  
ATOM 5074  H HB2  . ASN A 1 78  ? 10.853  2.386   -6.311  1.00 1.00 ? 78  ASN A HB2  3  
ATOM 5075  H HB3  . ASN A 1 78  ? 11.282  1.906   -7.949  1.00 1.00 ? 78  ASN A HB3  3  
ATOM 5076  H HD21 . ASN A 1 78  ? 12.519  4.090   -6.807  1.00 1.00 ? 78  ASN A HD21 3  
ATOM 5077  H HD22 . ASN A 1 78  ? 12.006  5.518   -7.696  1.00 1.00 ? 78  ASN A HD22 3  
ATOM 5078  N N    . SER A 1 79  ? 7.950   -0.261  -7.479  1.00 1.00 ? 79  SER A N    3  
ATOM 5079  C CA   . SER A 1 79  ? 7.734   -1.665  -7.072  1.00 1.00 ? 79  SER A CA   3  
ATOM 5080  C C    . SER A 1 79  ? 8.666   -2.644  -7.813  1.00 1.00 ? 79  SER A C    3  
ATOM 5081  O O    . SER A 1 79  ? 9.258   -3.545  -7.210  1.00 1.00 ? 79  SER A O    3  
ATOM 5082  C CB   . SER A 1 79  ? 6.260   -2.032  -7.313  1.00 1.00 ? 79  SER A CB   3  
ATOM 5083  O OG   . SER A 1 79  ? 5.960   -3.329  -6.815  1.00 1.00 ? 79  SER A OG   3  
ATOM 5084  H H    . SER A 1 79  ? 7.149   0.279   -7.790  1.00 1.00 ? 79  SER A H    3  
ATOM 5085  H HA   . SER A 1 79  ? 7.936   -1.760  -6.005  1.00 1.00 ? 79  SER A HA   3  
ATOM 5086  H HB2  . SER A 1 79  ? 5.626   -1.306  -6.800  1.00 1.00 ? 79  SER A HB2  3  
ATOM 5087  H HB3  . SER A 1 79  ? 6.040   -1.990  -8.381  1.00 1.00 ? 79  SER A HB3  3  
ATOM 5088  H HG   . SER A 1 79  ? 5.000   -3.515  -6.924  1.00 1.00 ? 79  SER A HG   3  
ATOM 5089  N N    . LEU A 1 80  ? 8.875   -2.409  -9.120  1.00 1.00 ? 80  LEU A N    3  
ATOM 5090  C CA   . LEU A 1 80  ? 9.719   -3.259  -9.972  1.00 1.00 ? 80  LEU A CA   3  
ATOM 5091  C C    . LEU A 1 80  ? 11.222  -3.151  -9.673  1.00 1.00 ? 80  LEU A C    3  
ATOM 5092  O O    . LEU A 1 80  ? 11.989  -3.983  -10.144 1.00 1.00 ? 80  LEU A O    3  
ATOM 5093  C CB   . LEU A 1 80  ? 9.432   -3.008  -11.466 1.00 1.00 ? 80  LEU A CB   3  
ATOM 5094  C CG   . LEU A 1 80  ? 7.960   -3.105  -11.918 1.00 1.00 ? 80  LEU A CG   3  
ATOM 5095  C CD1  . LEU A 1 80  ? 7.891   -3.029  -13.450 1.00 1.00 ? 80  LEU A CD1  3  
ATOM 5096  C CD2  . LEU A 1 80  ? 7.284   -4.388  -11.420 1.00 1.00 ? 80  LEU A CD2  3  
ATOM 5097  H H    . LEU A 1 80  ? 8.379   -1.642  -9.549  1.00 1.00 ? 80  LEU A H    3  
ATOM 5098  H HA   . LEU A 1 80  ? 9.453   -4.292  -9.756  1.00 1.00 ? 80  LEU A HA   3  
ATOM 5099  H HB2  . LEU A 1 80  ? 9.821   -2.024  -11.745 1.00 1.00 ? 80  LEU A HB2  3  
ATOM 5100  H HB3  . LEU A 1 80  ? 9.997   -3.758  -12.019 1.00 1.00 ? 80  LEU A HB3  3  
ATOM 5101  H HG   . LEU A 1 80  ? 7.410   -2.254  -11.512 1.00 1.00 ? 80  LEU A HG   3  
ATOM 5102  H HD11 . LEU A 1 80  ? 8.470   -3.837  -13.900 1.00 1.00 ? 80  LEU A HD11 3  
ATOM 5103  H HD12 . LEU A 1 80  ? 6.852   -3.121  -13.773 1.00 1.00 ? 80  LEU A HD12 3  
ATOM 5104  H HD13 . LEU A 1 80  ? 8.286   -2.072  -13.795 1.00 1.00 ? 80  LEU A HD13 3  
ATOM 5105  H HD21 . LEU A 1 80  ? 6.276   -4.458  -11.831 1.00 1.00 ? 80  LEU A HD21 3  
ATOM 5106  H HD22 . LEU A 1 80  ? 7.859   -5.262  -11.728 1.00 1.00 ? 80  LEU A HD22 3  
ATOM 5107  H HD23 . LEU A 1 80  ? 7.207   -4.363  -10.331 1.00 1.00 ? 80  LEU A HD23 3  
ATOM 5108  N N    . ASP A 1 81  ? 11.658  -2.188  -8.856  1.00 1.00 ? 81  ASP A N    3  
ATOM 5109  C CA   . ASP A 1 81  ? 13.053  -2.103  -8.394  1.00 1.00 ? 81  ASP A CA   3  
ATOM 5110  C C    . ASP A 1 81  ? 13.472  -3.320  -7.557  1.00 1.00 ? 81  ASP A C    3  
ATOM 5111  O O    . ASP A 1 81  ? 14.634  -3.721  -7.544  1.00 1.00 ? 81  ASP A O    3  
ATOM 5112  C CB   . ASP A 1 81  ? 13.230  -0.836  -7.555  1.00 1.00 ? 81  ASP A CB   3  
ATOM 5113  C CG   . ASP A 1 81  ? 14.717  -0.479  -7.398  1.00 1.00 ? 81  ASP A CG   3  
ATOM 5114  O OD1  . ASP A 1 81  ? 15.344  -0.122  -8.426  1.00 1.00 ? 81  ASP A OD1  3  
ATOM 5115  O OD2  . ASP A 1 81  ? 15.235  -0.534  -6.258  1.00 1.00 ? 81  ASP A OD2  3  
ATOM 5116  H H    . ASP A 1 81  ? 10.988  -1.526  -8.481  1.00 1.00 ? 81  ASP A H    3  
ATOM 5117  H HA   . ASP A 1 81  ? 13.701  -2.058  -9.267  1.00 1.00 ? 81  ASP A HA   3  
ATOM 5118  H HB2  . ASP A 1 81  ? 12.722  -0.002  -8.044  1.00 1.00 ? 81  ASP A HB2  3  
ATOM 5119  H HB3  . ASP A 1 81  ? 12.767  -1.008  -6.576  1.00 1.00 ? 81  ASP A HB3  3  
ATOM 5120  N N    . HIS A 1 82  ? 12.497  -3.926  -6.879  1.00 1.00 ? 82  HIS A N    3  
ATOM 5121  C CA   . HIS A 1 82  ? 12.646  -5.152  -6.102  1.00 1.00 ? 82  HIS A CA   3  
ATOM 5122  C C    . HIS A 1 82  ? 12.523  -6.422  -6.995  1.00 1.00 ? 82  HIS A C    3  
ATOM 5123  O O    . HIS A 1 82  ? 12.736  -7.543  -6.518  1.00 1.00 ? 82  HIS A O    3  
ATOM 5124  C CB   . HIS A 1 82  ? 11.593  -5.067  -4.983  1.00 1.00 ? 82  HIS A CB   3  
ATOM 5125  C CG   . HIS A 1 82  ? 11.869  -5.931  -3.770  1.00 1.00 ? 82  HIS A CG   3  
ATOM 5126  N ND1  . HIS A 1 82  ? 12.193  -7.268  -3.768  1.00 1.00 ? 82  HIS A ND1  3  
ATOM 5127  C CD2  . HIS A 1 82  ? 11.802  -5.538  -2.460  1.00 1.00 ? 82  HIS A CD2  3  
ATOM 5128  C CE1  . HIS A 1 82  ? 12.324  -7.670  -2.493  1.00 1.00 ? 82  HIS A CE1  3  
ATOM 5129  N NE2  . HIS A 1 82  ? 12.097  -6.643  -1.649  1.00 1.00 ? 82  HIS A NE2  3  
ATOM 5130  H H    . HIS A 1 82  ? 11.568  -3.529  -6.953  1.00 1.00 ? 82  HIS A H    3  
ATOM 5131  H HA   . HIS A 1 82  ? 13.640  -5.166  -5.647  1.00 1.00 ? 82  HIS A HA   3  
ATOM 5132  H HB2  . HIS A 1 82  ? 11.545  -4.026  -4.647  1.00 1.00 ? 82  HIS A HB2  3  
ATOM 5133  H HB3  . HIS A 1 82  ? 10.613  -5.327  -5.387  1.00 1.00 ? 82  HIS A HB3  3  
ATOM 5134  H HD1  . HIS A 1 82  ? 12.335  -7.842  -4.596  1.00 1.00 ? 82  HIS A HD1  3  
ATOM 5135  H HD2  . HIS A 1 82  ? 11.557  -4.541  -2.112  1.00 1.00 ? 82  HIS A HD2  3  
ATOM 5136  H HE1  . HIS A 1 82  ? 12.583  -8.679  -2.191  1.00 1.00 ? 82  HIS A HE1  3  
ATOM 5137  N N    . GLU A 1 83  ? 12.208  -6.260  -8.289  1.00 1.00 ? 83  GLU A N    3  
ATOM 5138  C CA   . GLU A 1 83  ? 12.084  -7.341  -9.276  1.00 1.00 ? 83  GLU A CA   3  
ATOM 5139  C C    . GLU A 1 83  ? 13.306  -7.403  -10.208 1.00 1.00 ? 83  GLU A C    3  
ATOM 5140  O O    . GLU A 1 83  ? 13.865  -8.483  -10.417 1.00 1.00 ? 83  GLU A O    3  
ATOM 5141  C CB   . GLU A 1 83  ? 10.800  -7.160  -10.108 1.00 1.00 ? 83  GLU A CB   3  
ATOM 5142  C CG   . GLU A 1 83  ? 9.505   -7.235  -9.290  1.00 1.00 ? 83  GLU A CG   3  
ATOM 5143  C CD   . GLU A 1 83  ? 9.323   -8.590  -8.585  1.00 1.00 ? 83  GLU A CD   3  
ATOM 5144  O OE1  . GLU A 1 83  ? 9.268   -9.638  -9.272  1.00 1.00 ? 83  GLU A OE1  3  
ATOM 5145  O OE2  . GLU A 1 83  ? 9.189   -8.617  -7.338  1.00 1.00 ? 83  GLU A OE2  3  
ATOM 5146  H H    . GLU A 1 83  ? 12.124  -5.315  -8.638  1.00 1.00 ? 83  GLU A H    3  
ATOM 5147  H HA   . GLU A 1 83  ? 12.019  -8.295  -8.765  1.00 1.00 ? 83  GLU A HA   3  
ATOM 5148  H HB2  . GLU A 1 83  ? 10.825  -6.195  -10.618 1.00 1.00 ? 83  GLU A HB2  3  
ATOM 5149  H HB3  . GLU A 1 83  ? 10.769  -7.936  -10.873 1.00 1.00 ? 83  GLU A HB3  3  
ATOM 5150  H HG2  . GLU A 1 83  ? 9.492   -6.426  -8.556  1.00 1.00 ? 83  GLU A HG2  3  
ATOM 5151  H HG3  . GLU A 1 83  ? 8.662   -7.080  -9.964  1.00 1.00 ? 83  GLU A HG3  3  
ATOM 5152  N N    . TYR A 1 84  ? 13.737  -6.257  -10.750 1.00 1.00 ? 84  TYR A N    3  
ATOM 5153  C CA   . TYR A 1 84  ? 14.797  -6.147  -11.771 1.00 1.00 ? 84  TYR A CA   3  
ATOM 5154  C C    . TYR A 1 84  ? 15.891  -5.114  -11.415 1.00 1.00 ? 84  TYR A C    3  
ATOM 5155  O O    . TYR A 1 84  ? 15.623  -4.096  -10.775 1.00 1.00 ? 84  TYR A O    3  
ATOM 5156  C CB   . TYR A 1 84  ? 14.161  -5.790  -13.130 1.00 1.00 ? 84  TYR A CB   3  
ATOM 5157  C CG   . TYR A 1 84  ? 12.890  -6.558  -13.452 1.00 1.00 ? 84  TYR A CG   3  
ATOM 5158  C CD1  . TYR A 1 84  ? 12.943  -7.931  -13.764 1.00 1.00 ? 84  TYR A CD1  3  
ATOM 5159  C CD2  . TYR A 1 84  ? 11.646  -5.910  -13.364 1.00 1.00 ? 84  TYR A CD2  3  
ATOM 5160  C CE1  . TYR A 1 84  ? 11.752  -8.655  -13.969 1.00 1.00 ? 84  TYR A CE1  3  
ATOM 5161  C CE2  . TYR A 1 84  ? 10.450  -6.624  -13.562 1.00 1.00 ? 84  TYR A CE2  3  
ATOM 5162  C CZ   . TYR A 1 84  ? 10.501  -8.005  -13.862 1.00 1.00 ? 84  TYR A CZ   3  
ATOM 5163  O OH   . TYR A 1 84  ? 9.353   -8.717  -14.047 1.00 1.00 ? 84  TYR A OH   3  
ATOM 5164  H H    . TYR A 1 84  ? 13.192  -5.425  -10.546 1.00 1.00 ? 84  TYR A H    3  
ATOM 5165  H HA   . TYR A 1 84  ? 15.281  -7.119  -11.877 1.00 1.00 ? 84  TYR A HA   3  
ATOM 5166  H HB2  . TYR A 1 84  ? 13.936  -4.725  -13.142 1.00 1.00 ? 84  TYR A HB2  3  
ATOM 5167  H HB3  . TYR A 1 84  ? 14.888  -5.973  -13.924 1.00 1.00 ? 84  TYR A HB3  3  
ATOM 5168  H HD1  . TYR A 1 84  ? 13.898  -8.436  -13.819 1.00 1.00 ? 84  TYR A HD1  3  
ATOM 5169  H HD2  . TYR A 1 84  ? 11.612  -4.857  -13.122 1.00 1.00 ? 84  TYR A HD2  3  
ATOM 5170  H HE1  . TYR A 1 84  ? 11.790  -9.708  -14.200 1.00 1.00 ? 84  TYR A HE1  3  
ATOM 5171  H HE2  . TYR A 1 84  ? 9.501   -6.122  -13.465 1.00 1.00 ? 84  TYR A HE2  3  
ATOM 5172  H HH   . TYR A 1 84  ? 8.551   -8.180  -13.959 1.00 1.00 ? 84  TYR A HH   3  
ATOM 5173  N N    . GLN A 1 85  ? 17.123  -5.344  -11.893 1.00 1.00 ? 85  GLN A N    3  
ATOM 5174  C CA   . GLN A 1 85  ? 18.282  -4.464  -11.662 1.00 1.00 ? 85  GLN A CA   3  
ATOM 5175  C C    . GLN A 1 85  ? 18.085  -3.084  -12.333 1.00 1.00 ? 85  GLN A C    3  
ATOM 5176  O O    . GLN A 1 85  ? 17.353  -3.004  -13.327 1.00 1.00 ? 85  GLN A O    3  
ATOM 5177  C CB   . GLN A 1 85  ? 19.561  -5.154  -12.181 1.00 1.00 ? 85  GLN A CB   3  
ATOM 5178  C CG   . GLN A 1 85  ? 19.971  -6.370  -11.328 1.00 1.00 ? 85  GLN A CG   3  
ATOM 5179  C CD   . GLN A 1 85  ? 20.399  -6.018  -9.896  1.00 1.00 ? 85  GLN A CD   3  
ATOM 5180  O OE1  . GLN A 1 85  ? 20.998  -4.986  -9.624  1.00 1.00 ? 85  GLN A OE1  3  
ATOM 5181  N NE2  . GLN A 1 85  ? 20.083  -6.843  -8.917  1.00 1.00 ? 85  GLN A NE2  3  
ATOM 5182  H H    . GLN A 1 85  ? 17.275  -6.187  -12.428 1.00 1.00 ? 85  GLN A H    3  
ATOM 5183  H HA   . GLN A 1 85  ? 18.382  -4.323  -10.588 1.00 1.00 ? 85  GLN A HA   3  
ATOM 5184  H HB2  . GLN A 1 85  ? 19.400  -5.477  -13.210 1.00 1.00 ? 85  GLN A HB2  3  
ATOM 5185  H HB3  . GLN A 1 85  ? 20.391  -4.446  -12.195 1.00 1.00 ? 85  GLN A HB3  3  
ATOM 5186  H HG2  . GLN A 1 85  ? 19.137  -7.071  -11.281 1.00 1.00 ? 85  GLN A HG2  3  
ATOM 5187  H HG3  . GLN A 1 85  ? 20.802  -6.878  -11.814 1.00 1.00 ? 85  GLN A HG3  3  
ATOM 5188  H HE21 . GLN A 1 85  ? 19.589  -7.703  -9.105  1.00 1.00 ? 85  GLN A HE21 3  
ATOM 5189  H HE22 . GLN A 1 85  ? 20.367  -6.603  -7.978  1.00 1.00 ? 85  GLN A HE22 3  
ATOM 5190  N N    . PRO A 1 86  ? 18.697  -1.995  -11.814 1.00 1.00 ? 86  PRO A N    3  
ATOM 5191  C CA   . PRO A 1 86  ? 18.408  -0.632  -12.256 1.00 1.00 ? 86  PRO A CA   3  
ATOM 5192  C C    . PRO A 1 86  ? 18.940  -0.339  -13.663 1.00 1.00 ? 86  PRO A C    3  
ATOM 5193  O O    . PRO A 1 86  ? 20.090  -0.628  -13.992 1.00 1.00 ? 86  PRO A O    3  
ATOM 5194  C CB   . PRO A 1 86  ? 19.014  0.293   -11.194 1.00 1.00 ? 86  PRO A CB   3  
ATOM 5195  C CG   . PRO A 1 86  ? 20.156  -0.535  -10.618 1.00 1.00 ? 86  PRO A CG   3  
ATOM 5196  C CD   . PRO A 1 86  ? 19.607  -1.960  -10.672 1.00 1.00 ? 86  PRO A CD   3  
ATOM 5197  H HA   . PRO A 1 86  ? 17.330  -0.480  -12.262 1.00 1.00 ? 86  PRO A HA   3  
ATOM 5198  H HB2  . PRO A 1 86  ? 19.373  1.234   -11.615 1.00 1.00 ? 86  PRO A HB2  3  
ATOM 5199  H HB3  . PRO A 1 86  ? 18.280  0.486   -10.413 1.00 1.00 ? 86  PRO A HB3  3  
ATOM 5200  H HG2  . PRO A 1 86  ? 21.031  -0.454  -11.260 1.00 1.00 ? 86  PRO A HG2  3  
ATOM 5201  H HG3  . PRO A 1 86  ? 20.402  -0.234  -9.600  1.00 1.00 ? 86  PRO A HG3  3  
ATOM 5202  H HD2  . PRO A 1 86  ? 20.430  -2.668  -10.794 1.00 1.00 ? 86  PRO A HD2  3  
ATOM 5203  H HD3  . PRO A 1 86  ? 19.059  -2.171  -9.755  1.00 1.00 ? 86  PRO A HD3  3  
ATOM 5204  N N    . ARG A 1 87  ? 18.079  0.277   -14.483 1.00 1.00 ? 87  ARG A N    3  
ATOM 5205  C CA   . ARG A 1 87  ? 18.380  0.748   -15.840 1.00 1.00 ? 87  ARG A CA   3  
ATOM 5206  C C    . ARG A 1 87  ? 19.048  2.147   -15.835 1.00 1.00 ? 87  ARG A C    3  
ATOM 5207  O O    . ARG A 1 87  ? 18.893  2.889   -14.858 1.00 1.00 ? 87  ARG A O    3  
ATOM 5208  C CB   . ARG A 1 87  ? 17.055  0.771   -16.629 1.00 1.00 ? 87  ARG A CB   3  
ATOM 5209  C CG   . ARG A 1 87  ? 16.688  -0.584  -17.250 1.00 1.00 ? 87  ARG A CG   3  
ATOM 5210  C CD   . ARG A 1 87  ? 16.613  -1.790  -16.305 1.00 1.00 ? 87  ARG A CD   3  
ATOM 5211  N NE   . ARG A 1 87  ? 16.169  -2.974  -17.058 1.00 1.00 ? 87  ARG A NE   3  
ATOM 5212  C CZ   . ARG A 1 87  ? 16.401  -4.250  -16.784 1.00 1.00 ? 87  ARG A CZ   3  
ATOM 5213  N NH1  . ARG A 1 87  ? 16.936  -4.645  -15.647 1.00 1.00 ? 87  ARG A NH1  3  
ATOM 5214  N NH2  . ARG A 1 87  ? 16.081  -5.150  -17.687 1.00 1.00 ? 87  ARG A NH2  3  
ATOM 5215  H H    . ARG A 1 87  ? 17.148  0.470   -14.133 1.00 1.00 ? 87  ARG A H    3  
ATOM 5216  H HA   . ARG A 1 87  ? 19.065  0.042   -16.314 1.00 1.00 ? 87  ARG A HA   3  
ATOM 5217  H HB2  . ARG A 1 87  ? 16.240  1.095   -15.980 1.00 1.00 ? 87  ARG A HB2  3  
ATOM 5218  H HB3  . ARG A 1 87  ? 17.119  1.493   -17.444 1.00 1.00 ? 87  ARG A HB3  3  
ATOM 5219  H HG2  . ARG A 1 87  ? 15.711  -0.462  -17.711 1.00 1.00 ? 87  ARG A HG2  3  
ATOM 5220  H HG3  . ARG A 1 87  ? 17.414  -0.802  -18.032 1.00 1.00 ? 87  ARG A HG3  3  
ATOM 5221  H HD2  . ARG A 1 87  ? 17.603  -1.974  -15.879 1.00 1.00 ? 87  ARG A HD2  3  
ATOM 5222  H HD3  . ARG A 1 87  ? 15.909  -1.586  -15.497 1.00 1.00 ? 87  ARG A HD3  3  
ATOM 5223  H HE   . ARG A 1 87  ? 15.733  -2.799  -17.956 1.00 1.00 ? 87  ARG A HE   3  
ATOM 5224  H HH11 . ARG A 1 87  ? 17.133  -3.969  -14.913 1.00 1.00 ? 87  ARG A HH11 3  
ATOM 5225  H HH12 . ARG A 1 87  ? 17.145  -5.620  -15.499 1.00 1.00 ? 87  ARG A HH12 3  
ATOM 5226  H HH21 . ARG A 1 87  ? 15.715  -4.848  -18.581 1.00 1.00 ? 87  ARG A HH21 3  
ATOM 5227  H HH22 . ARG A 1 87  ? 16.236  -6.131  -17.524 1.00 1.00 ? 87  ARG A HH22 3  
ATOM 5228  N N    . PRO A 1 88  ? 19.736  2.544   -16.931 1.00 1.00 ? 88  PRO A N    3  
ATOM 5229  C CA   . PRO A 1 88  ? 20.301  3.886   -17.094 1.00 1.00 ? 88  PRO A CA   3  
ATOM 5230  C C    . PRO A 1 88  ? 19.175  4.918   -17.223 1.00 1.00 ? 88  PRO A C    3  
ATOM 5231  O O    . PRO A 1 88  ? 18.420  4.901   -18.192 1.00 1.00 ? 88  PRO A O    3  
ATOM 5232  C CB   . PRO A 1 88  ? 21.196  3.810   -18.338 1.00 1.00 ? 88  PRO A CB   3  
ATOM 5233  C CG   . PRO A 1 88  ? 20.584  2.676   -19.155 1.00 1.00 ? 88  PRO A CG   3  
ATOM 5234  C CD   . PRO A 1 88  ? 20.052  1.718   -18.093 1.00 1.00 ? 88  PRO A CD   3  
ATOM 5235  H HA   . PRO A 1 88  ? 20.931  4.135   -16.237 1.00 1.00 ? 88  PRO A HA   3  
ATOM 5236  H HB2  . PRO A 1 88  ? 21.214  4.747   -18.898 1.00 1.00 ? 88  PRO A HB2  3  
ATOM 5237  H HB3  . PRO A 1 88  ? 22.209  3.531   -18.042 1.00 1.00 ? 88  PRO A HB3  3  
ATOM 5238  H HG2  . PRO A 1 88  ? 19.750  3.055   -19.738 1.00 1.00 ? 88  PRO A HG2  3  
ATOM 5239  H HG3  . PRO A 1 88  ? 21.321  2.198   -19.803 1.00 1.00 ? 88  PRO A HG3  3  
ATOM 5240  H HD2  . PRO A 1 88  ? 19.174  1.196   -18.473 1.00 1.00 ? 88  PRO A HD2  3  
ATOM 5241  H HD3  . PRO A 1 88  ? 20.830  1.001   -17.828 1.00 1.00 ? 88  PRO A HD3  3  
ATOM 5242  N N    . VAL A 1 89  ? 19.068  5.836   -16.255 1.00 1.00 ? 89  VAL A N    3  
ATOM 5243  C CA   . VAL A 1 89  ? 17.914  6.756   -16.114 1.00 1.00 ? 89  VAL A CA   3  
ATOM 5244  C C    . VAL A 1 89  ? 17.656  7.635   -17.344 1.00 1.00 ? 89  VAL A C    3  
ATOM 5245  O O    . VAL A 1 89  ? 16.503  7.926   -17.657 1.00 1.00 ? 89  VAL A O    3  
ATOM 5246  C CB   . VAL A 1 89  ? 18.043  7.602   -14.823 1.00 1.00 ? 89  VAL A CB   3  
ATOM 5247  C CG1  . VAL A 1 89  ? 19.156  8.664   -14.886 1.00 1.00 ? 89  VAL A CG1  3  
ATOM 5248  C CG2  . VAL A 1 89  ? 16.713  8.265   -14.455 1.00 1.00 ? 89  VAL A CG2  3  
ATOM 5249  H H    . VAL A 1 89  ? 19.713  5.757   -15.467 1.00 1.00 ? 89  VAL A H    3  
ATOM 5250  H HA   . VAL A 1 89  ? 17.036  6.118   -15.998 1.00 1.00 ? 89  VAL A HA   3  
ATOM 5251  H HB   . VAL A 1 89  ? 18.294  6.919   -14.017 1.00 1.00 ? 89  VAL A HB   3  
ATOM 5252  H HG11 . VAL A 1 89  ? 18.915  9.436   -15.622 1.00 1.00 ? 89  VAL A HG11 3  
ATOM 5253  H HG12 . VAL A 1 89  ? 19.268  9.137   -13.910 1.00 1.00 ? 89  VAL A HG12 3  
ATOM 5254  H HG13 . VAL A 1 89  ? 20.105  8.196   -15.153 1.00 1.00 ? 89  VAL A HG13 3  
ATOM 5255  H HG21 . VAL A 1 89  ? 16.829  8.795   -13.511 1.00 1.00 ? 89  VAL A HG21 3  
ATOM 5256  H HG22 . VAL A 1 89  ? 16.411  8.977   -15.221 1.00 1.00 ? 89  VAL A HG22 3  
ATOM 5257  H HG23 . VAL A 1 89  ? 15.939  7.505   -14.349 1.00 1.00 ? 89  VAL A HG23 3  
ATOM 5258  N N    . GLU A 1 90  ? 18.708  7.984   -18.095 1.00 1.00 ? 90  GLU A N    3  
ATOM 5259  C CA   . GLU A 1 90  ? 18.586  8.737   -19.348 1.00 1.00 ? 90  GLU A CA   3  
ATOM 5260  C C    . GLU A 1 90  ? 17.772  7.976   -20.402 1.00 1.00 ? 90  GLU A C    3  
ATOM 5261  O O    . GLU A 1 90  ? 16.986  8.585   -21.124 1.00 1.00 ? 90  GLU A O    3  
ATOM 5262  C CB   . GLU A 1 90  ? 19.977  9.129   -19.875 1.00 1.00 ? 90  GLU A CB   3  
ATOM 5263  C CG   . GLU A 1 90  ? 20.898  7.964   -20.266 1.00 1.00 ? 90  GLU A CG   3  
ATOM 5264  C CD   . GLU A 1 90  ? 22.288  8.484   -20.660 1.00 1.00 ? 90  GLU A CD   3  
ATOM 5265  O OE1  . GLU A 1 90  ? 22.512  8.775   -21.861 1.00 1.00 ? 90  GLU A OE1  3  
ATOM 5266  O OE2  . GLU A 1 90  ? 23.173  8.593   -19.780 1.00 1.00 ? 90  GLU A OE2  3  
ATOM 5267  H H    . GLU A 1 90  ? 19.634  7.763   -17.753 1.00 1.00 ? 90  GLU A H    3  
ATOM 5268  H HA   . GLU A 1 90  ? 18.046  9.658   -19.126 1.00 1.00 ? 90  GLU A HA   3  
ATOM 5269  H HB2  . GLU A 1 90  ? 19.839  9.759   -20.753 1.00 1.00 ? 90  GLU A HB2  3  
ATOM 5270  H HB3  . GLU A 1 90  ? 20.471  9.719   -19.106 1.00 1.00 ? 90  GLU A HB3  3  
ATOM 5271  H HG2  . GLU A 1 90  ? 20.997  7.272   -19.425 1.00 1.00 ? 90  GLU A HG2  3  
ATOM 5272  H HG3  . GLU A 1 90  ? 20.466  7.419   -21.107 1.00 1.00 ? 90  GLU A HG3  3  
ATOM 5273  N N    . VAL A 1 91  ? 17.880  6.646   -20.449 1.00 1.00 ? 91  VAL A N    3  
ATOM 5274  C CA   . VAL A 1 91  ? 17.093  5.802   -21.370 1.00 1.00 ? 91  VAL A CA   3  
ATOM 5275  C C    . VAL A 1 91  ? 15.622  5.767   -20.944 1.00 1.00 ? 91  VAL A C    3  
ATOM 5276  O O    . VAL A 1 91  ? 14.741  5.839   -21.793 1.00 1.00 ? 91  VAL A O    3  
ATOM 5277  C CB   . VAL A 1 91  ? 17.677  4.378   -21.526 1.00 1.00 ? 91  VAL A CB   3  
ATOM 5278  C CG1  . VAL A 1 91  ? 16.843  3.502   -22.473 1.00 1.00 ? 91  VAL A CG1  3  
ATOM 5279  C CG2  . VAL A 1 91  ? 19.117  4.441   -22.068 1.00 1.00 ? 91  VAL A CG2  3  
ATOM 5280  H H    . VAL A 1 91  ? 18.528  6.205   -19.805 1.00 1.00 ? 91  VAL A H    3  
ATOM 5281  H HA   . VAL A 1 91  ? 17.149  6.280   -22.343 1.00 1.00 ? 91  VAL A HA   3  
ATOM 5282  H HB   . VAL A 1 91  ? 17.692  3.894   -20.552 1.00 1.00 ? 91  VAL A HB   3  
ATOM 5283  H HG11 . VAL A 1 91  ? 17.329  2.533   -22.603 1.00 1.00 ? 91  VAL A HG11 3  
ATOM 5284  H HG12 . VAL A 1 91  ? 15.852  3.335   -22.054 1.00 1.00 ? 91  VAL A HG12 3  
ATOM 5285  H HG13 . VAL A 1 91  ? 16.746  3.986   -23.446 1.00 1.00 ? 91  VAL A HG13 3  
ATOM 5286  H HG21 . VAL A 1 91  ? 19.508  3.430   -22.207 1.00 1.00 ? 91  VAL A HG21 3  
ATOM 5287  H HG22 . VAL A 1 91  ? 19.135  4.958   -23.030 1.00 1.00 ? 91  VAL A HG22 3  
ATOM 5288  H HG23 . VAL A 1 91  ? 19.769  4.963   -21.368 1.00 1.00 ? 91  VAL A HG23 3  
ATOM 5289  N N    . ILE A 1 92  ? 15.344  5.735   -19.634 1.00 1.00 ? 92  ILE A N    3  
ATOM 5290  C CA   . ILE A 1 92  ? 13.968  5.762   -19.093 1.00 1.00 ? 92  ILE A CA   3  
ATOM 5291  C C    . ILE A 1 92  ? 13.284  7.094   -19.445 1.00 1.00 ? 92  ILE A C    3  
ATOM 5292  O O    . ILE A 1 92  ? 12.177  7.110   -19.975 1.00 1.00 ? 92  ILE A O    3  
ATOM 5293  C CB   . ILE A 1 92  ? 13.993  5.503   -17.560 1.00 1.00 ? 92  ILE A CB   3  
ATOM 5294  C CG1  . ILE A 1 92  ? 14.841  4.256   -17.200 1.00 1.00 ? 92  ILE A CG1  3  
ATOM 5295  C CG2  . ILE A 1 92  ? 12.559  5.342   -17.022 1.00 1.00 ? 92  ILE A CG2  3  
ATOM 5296  C CD1  . ILE A 1 92  ? 14.935  4.000   -15.692 1.00 1.00 ? 92  ILE A CD1  3  
ATOM 5297  H H    . ILE A 1 92  ? 16.119  5.667   -18.982 1.00 1.00 ? 92  ILE A H    3  
ATOM 5298  H HA   . ILE A 1 92  ? 13.378  4.973   -19.572 1.00 1.00 ? 92  ILE A HA   3  
ATOM 5299  H HB   . ILE A 1 92  ? 14.441  6.365   -17.065 1.00 1.00 ? 92  ILE A HB   3  
ATOM 5300  H HG12 . ILE A 1 92  ? 14.430  3.374   -17.692 1.00 1.00 ? 92  ILE A HG12 3  
ATOM 5301  H HG13 . ILE A 1 92  ? 15.861  4.390   -17.552 1.00 1.00 ? 92  ILE A HG13 3  
ATOM 5302  H HG21 . ILE A 1 92  ? 12.563  5.353   -15.934 1.00 1.00 ? 92  ILE A HG21 3  
ATOM 5303  H HG22 . ILE A 1 92  ? 11.929  6.168   -17.352 1.00 1.00 ? 92  ILE A HG22 3  
ATOM 5304  H HG23 . ILE A 1 92  ? 12.133  4.398   -17.369 1.00 1.00 ? 92  ILE A HG23 3  
ATOM 5305  H HD11 . ILE A 1 92  ? 13.988  3.623   -15.311 1.00 1.00 ? 92  ILE A HD11 3  
ATOM 5306  H HD12 . ILE A 1 92  ? 15.709  3.261   -15.501 1.00 1.00 ? 92  ILE A HD12 3  
ATOM 5307  H HD13 . ILE A 1 92  ? 15.202  4.926   -15.173 1.00 1.00 ? 92  ILE A HD13 3  
ATOM 5308  N N    . ILE A 1 93  ? 13.964  8.219   -19.200 1.00 1.00 ? 93  ILE A N    3  
ATOM 5309  C CA   . ILE A 1 93  ? 13.451  9.571   -19.462 1.00 1.00 ? 93  ILE A CA   3  
ATOM 5310  C C    . ILE A 1 93  ? 13.387  9.887   -20.957 1.00 1.00 ? 93  ILE A C    3  
ATOM 5311  O O    . ILE A 1 93  ? 12.401  10.459  -21.404 1.00 1.00 ? 93  ILE A O    3  
ATOM 5312  C CB   . ILE A 1 93  ? 14.272  10.605  -18.649 1.00 1.00 ? 93  ILE A CB   3  
ATOM 5313  C CG1  . ILE A 1 93  ? 13.905  10.438  -17.154 1.00 1.00 ? 93  ILE A CG1  3  
ATOM 5314  C CG2  . ILE A 1 93  ? 13.989  12.055  -19.095 1.00 1.00 ? 93  ILE A CG2  3  
ATOM 5315  C CD1  . ILE A 1 93  ? 14.805  11.203  -16.180 1.00 1.00 ? 93  ILE A CD1  3  
ATOM 5316  H H    . ILE A 1 93  ? 14.859  8.136   -18.735 1.00 1.00 ? 93  ILE A H    3  
ATOM 5317  H HA   . ILE A 1 93  ? 12.421  9.609   -19.120 1.00 1.00 ? 93  ILE A HA   3  
ATOM 5318  H HB   . ILE A 1 93  ? 15.336  10.395  -18.804 1.00 1.00 ? 93  ILE A HB   3  
ATOM 5319  H HG12 . ILE A 1 93  ? 12.878  10.776  -17.002 1.00 1.00 ? 93  ILE A HG12 3  
ATOM 5320  H HG13 . ILE A 1 93  ? 13.957  9.387   -16.876 1.00 1.00 ? 93  ILE A HG13 3  
ATOM 5321  H HG21 . ILE A 1 93  ? 14.326  12.207  -20.121 1.00 1.00 ? 93  ILE A HG21 3  
ATOM 5322  H HG22 . ILE A 1 93  ? 12.921  12.269  -19.033 1.00 1.00 ? 93  ILE A HG22 3  
ATOM 5323  H HG23 . ILE A 1 93  ? 14.538  12.764  -18.475 1.00 1.00 ? 93  ILE A HG23 3  
ATOM 5324  H HD11 . ILE A 1 93  ? 14.517  10.943  -15.157 1.00 1.00 ? 93  ILE A HD11 3  
ATOM 5325  H HD12 . ILE A 1 93  ? 15.846  10.925  -16.353 1.00 1.00 ? 93  ILE A HD12 3  
ATOM 5326  H HD13 . ILE A 1 93  ? 14.689  12.281  -16.304 1.00 1.00 ? 93  ILE A HD13 3  
ATOM 5327  N N    . SER A 1 94  ? 14.377  9.506   -21.757 1.00 1.00 ? 94  SER A N    3  
ATOM 5328  C CA   . SER A 1 94  ? 14.302  9.712   -23.212 1.00 1.00 ? 94  SER A CA   3  
ATOM 5329  C C    . SER A 1 94  ? 13.183  8.875   -23.850 1.00 1.00 ? 94  SER A C    3  
ATOM 5330  O O    . SER A 1 94  ? 12.460  9.366   -24.714 1.00 1.00 ? 94  SER A O    3  
ATOM 5331  C CB   . SER A 1 94  ? 15.653  9.500   -23.908 1.00 1.00 ? 94  SER A CB   3  
ATOM 5332  O OG   . SER A 1 94  ? 16.202  8.216   -23.668 1.00 1.00 ? 94  SER A OG   3  
ATOM 5333  H H    . SER A 1 94  ? 15.201  9.070   -21.357 1.00 1.00 ? 94  SER A H    3  
ATOM 5334  H HA   . SER A 1 94  ? 14.026  10.748  -23.366 1.00 1.00 ? 94  SER A HA   3  
ATOM 5335  H HB2  . SER A 1 94  ? 15.520  9.639   -24.983 1.00 1.00 ? 94  SER A HB2  3  
ATOM 5336  H HB3  . SER A 1 94  ? 16.360  10.254  -23.555 1.00 1.00 ? 94  SER A HB3  3  
ATOM 5337  H HG   . SER A 1 94  ? 16.595  8.228   -22.771 1.00 1.00 ? 94  SER A HG   3  
ATOM 5338  N N    . SER A 1 95  ? 12.954  7.657   -23.353 1.00 1.00 ? 95  SER A N    3  
ATOM 5339  C CA   . SER A 1 95  ? 11.791  6.845   -23.719 1.00 1.00 ? 95  SER A CA   3  
ATOM 5340  C C    . SER A 1 95  ? 10.476  7.531   -23.336 1.00 1.00 ? 95  SER A C    3  
ATOM 5341  O O    . SER A 1 95  ? 9.569   7.605   -24.161 1.00 1.00 ? 95  SER A O    3  
ATOM 5342  C CB   . SER A 1 95  ? 11.873  5.467   -23.061 1.00 1.00 ? 95  SER A CB   3  
ATOM 5343  O OG   . SER A 1 95  ? 12.830  4.656   -23.725 1.00 1.00 ? 95  SER A OG   3  
ATOM 5344  H H    . SER A 1 95  ? 13.611  7.289   -22.678 1.00 1.00 ? 95  SER A H    3  
ATOM 5345  H HA   . SER A 1 95  ? 11.788  6.707   -24.798 1.00 1.00 ? 95  SER A HA   3  
ATOM 5346  H HB2  . SER A 1 95  ? 12.135  5.579   -22.009 1.00 1.00 ? 95  SER A HB2  3  
ATOM 5347  H HB3  . SER A 1 95  ? 10.898  4.981   -23.131 1.00 1.00 ? 95  SER A HB3  3  
ATOM 5348  H HG   . SER A 1 95  ? 13.729  5.014   -23.571 1.00 1.00 ? 95  SER A HG   3  
ATOM 5349  N N    . ALA A 1 96  ? 10.371  8.095   -22.125 1.00 1.00 ? 96  ALA A N    3  
ATOM 5350  C CA   . ALA A 1 96  ? 9.207   8.873   -21.701 1.00 1.00 ? 96  ALA A CA   3  
ATOM 5351  C C    . ALA A 1 96  ? 8.963   10.052  -22.664 1.00 1.00 ? 96  ALA A C    3  
ATOM 5352  O O    . ALA A 1 96  ? 7.858   10.225  -23.185 1.00 1.00 ? 96  ALA A O    3  
ATOM 5353  C CB   . ALA A 1 96  ? 9.448   9.308   -20.247 1.00 1.00 ? 96  ALA A CB   3  
ATOM 5354  H H    . ALA A 1 96  ? 11.139  7.999   -21.466 1.00 1.00 ? 96  ALA A H    3  
ATOM 5355  H HA   . ALA A 1 96  ? 8.330   8.223   -21.726 1.00 1.00 ? 96  ALA A HA   3  
ATOM 5356  H HB1  . ALA A 1 96  ? 9.771   8.456   -19.650 1.00 1.00 ? 96  ALA A HB1  3  
ATOM 5357  H HB2  . ALA A 1 96  ? 10.219  10.076  -20.200 1.00 1.00 ? 96  ALA A HB2  3  
ATOM 5358  H HB3  . ALA A 1 96  ? 8.529   9.702   -19.814 1.00 1.00 ? 96  ALA A HB3  3  
ATOM 5359  N N    . LYS A 1 97  ? 10.010  10.824  -22.979 1.00 1.00 ? 97  LYS A N    3  
ATOM 5360  C CA   . LYS A 1 97  ? 9.943   11.964  -23.898 1.00 1.00 ? 97  LYS A CA   3  
ATOM 5361  C C    . LYS A 1 97  ? 9.541   11.561  -25.325 1.00 1.00 ? 97  LYS A C    3  
ATOM 5362  O O    . LYS A 1 97  ? 8.717   12.239  -25.939 1.00 1.00 ? 97  LYS A O    3  
ATOM 5363  C CB   . LYS A 1 97  ? 11.294  12.694  -23.888 1.00 1.00 ? 97  LYS A CB   3  
ATOM 5364  C CG   . LYS A 1 97  ? 11.533  13.472  -22.584 1.00 1.00 ? 97  LYS A CG   3  
ATOM 5365  C CD   . LYS A 1 97  ? 12.978  13.988  -22.560 1.00 1.00 ? 97  LYS A CD   3  
ATOM 5366  C CE   . LYS A 1 97  ? 13.209  14.955  -21.384 1.00 1.00 ? 97  LYS A CE   3  
ATOM 5367  N NZ   . LYS A 1 97  ? 14.588  15.528  -21.406 1.00 1.00 ? 97  LYS A NZ   3  
ATOM 5368  H H    . LYS A 1 97  ? 10.908  10.619  -22.543 1.00 1.00 ? 97  LYS A H    3  
ATOM 5369  H HA   . LYS A 1 97  ? 9.169   12.644  -23.547 1.00 1.00 ? 97  LYS A HA   3  
ATOM 5370  H HB2  . LYS A 1 97  ? 12.097  11.975  -24.040 1.00 1.00 ? 97  LYS A HB2  3  
ATOM 5371  H HB3  . LYS A 1 97  ? 11.314  13.404  -24.720 1.00 1.00 ? 97  LYS A HB3  3  
ATOM 5372  H HG2  . LYS A 1 97  ? 10.837  14.311  -22.533 1.00 1.00 ? 97  LYS A HG2  3  
ATOM 5373  H HG3  . LYS A 1 97  ? 11.367  12.827  -21.720 1.00 1.00 ? 97  LYS A HG3  3  
ATOM 5374  H HD2  . LYS A 1 97  ? 13.642  13.123  -22.471 1.00 1.00 ? 97  LYS A HD2  3  
ATOM 5375  H HD3  . LYS A 1 97  ? 13.186  14.499  -23.502 1.00 1.00 ? 97  LYS A HD3  3  
ATOM 5376  H HE2  . LYS A 1 97  ? 12.476  15.767  -21.449 1.00 1.00 ? 97  LYS A HE2  3  
ATOM 5377  H HE3  . LYS A 1 97  ? 13.036  14.422  -20.442 1.00 1.00 ? 97  LYS A HE3  3  
ATOM 5378  H HZ1  . LYS A 1 97  ? 15.296  14.807  -21.353 1.00 1.00 ? 97  LYS A HZ1  3  
ATOM 5379  H HZ2  . LYS A 1 97  ? 14.753  16.064  -22.250 1.00 1.00 ? 97  LYS A HZ2  3  
ATOM 5380  H HZ3  . LYS A 1 97  ? 14.735  16.157  -20.626 1.00 1.00 ? 97  LYS A HZ3  3  
ATOM 5381  N N    . GLU A 1 98  ? 10.057  10.440  -25.830 1.00 1.00 ? 98  GLU A N    3  
ATOM 5382  C CA   . GLU A 1 98  ? 9.660   9.872   -27.124 1.00 1.00 ? 98  GLU A CA   3  
ATOM 5383  C C    . GLU A 1 98  ? 8.204   9.374   -27.126 1.00 1.00 ? 98  GLU A C    3  
ATOM 5384  O O    . GLU A 1 98  ? 7.520   9.462   -28.149 1.00 1.00 ? 98  GLU A O    3  
ATOM 5385  C CB   . GLU A 1 98  ? 10.605  8.738   -27.558 1.00 1.00 ? 98  GLU A CB   3  
ATOM 5386  C CG   . GLU A 1 98  ? 11.943  9.271   -28.090 1.00 1.00 ? 98  GLU A CG   3  
ATOM 5387  C CD   . GLU A 1 98  ? 12.785  8.131   -28.680 1.00 1.00 ? 98  GLU A CD   3  
ATOM 5388  O OE1  . GLU A 1 98  ? 13.567  7.492   -27.935 1.00 1.00 ? 98  GLU A OE1  3  
ATOM 5389  O OE2  . GLU A 1 98  ? 12.677  7.867   -29.903 1.00 1.00 ? 98  GLU A OE2  3  
ATOM 5390  H H    . GLU A 1 98  ? 10.770  9.968   -25.285 1.00 1.00 ? 98  GLU A H    3  
ATOM 5391  H HA   . GLU A 1 98  ? 9.730   10.662  -27.859 1.00 1.00 ? 98  GLU A HA   3  
ATOM 5392  H HB2  . GLU A 1 98  ? 10.776  8.053   -26.731 1.00 1.00 ? 98  GLU A HB2  3  
ATOM 5393  H HB3  . GLU A 1 98  ? 10.127  8.181   -28.364 1.00 1.00 ? 98  GLU A HB3  3  
ATOM 5394  H HG2  . GLU A 1 98  ? 11.747  10.016  -28.868 1.00 1.00 ? 98  GLU A HG2  3  
ATOM 5395  H HG3  . GLU A 1 98  ? 12.491  9.763   -27.287 1.00 1.00 ? 98  GLU A HG3  3  
ATOM 5396  N N    . MET A 1 99  ? 7.707   8.886   -25.987 1.00 1.00 ? 99  MET A N    3  
ATOM 5397  C CA   . MET A 1 99  ? 6.323   8.441   -25.827 1.00 1.00 ? 99  MET A CA   3  
ATOM 5398  C C    . MET A 1 99  ? 5.325   9.606   -25.760 1.00 1.00 ? 99  MET A C    3  
ATOM 5399  O O    . MET A 1 99  ? 4.256   9.494   -26.350 1.00 1.00 ? 99  MET A O    3  
ATOM 5400  C CB   . MET A 1 99  ? 6.199   7.501   -24.621 1.00 1.00 ? 99  MET A CB   3  
ATOM 5401  C CG   . MET A 1 99  ? 6.876   6.153   -24.915 1.00 1.00 ? 99  MET A CG   3  
ATOM 5402  S SD   . MET A 1 99  ? 5.987   5.059   -26.051 1.00 1.00 ? 99  MET A SD   3  
ATOM 5403  C CE   . MET A 1 99  ? 4.769   4.386   -24.897 1.00 1.00 ? 99  MET A CE   3  
ATOM 5404  H H    . MET A 1 99  ? 8.344   8.726   -25.215 1.00 1.00 ? 99  MET A H    3  
ATOM 5405  H HA   . MET A 1 99  ? 6.062   7.865   -26.708 1.00 1.00 ? 99  MET A HA   3  
ATOM 5406  H HB2  . MET A 1 99  ? 6.655   7.961   -23.743 1.00 1.00 ? 99  MET A HB2  3  
ATOM 5407  H HB3  . MET A 1 99  ? 5.143   7.331   -24.415 1.00 1.00 ? 99  MET A HB3  3  
ATOM 5408  H HG2  . MET A 1 99  ? 7.864   6.338   -25.344 1.00 1.00 ? 99  MET A HG2  3  
ATOM 5409  H HG3  . MET A 1 99  ? 7.043   5.619   -23.980 1.00 1.00 ? 99  MET A HG3  3  
ATOM 5410  H HE1  . MET A 1 99  ? 4.206   3.592   -25.392 1.00 1.00 ? 99  MET A HE1  3  
ATOM 5411  H HE2  . MET A 1 99  ? 5.283   3.970   -24.026 1.00 1.00 ? 99  MET A HE2  3  
ATOM 5412  H HE3  . MET A 1 99  ? 4.083   5.172   -24.582 1.00 1.00 ? 99  MET A HE3  3  
ATOM 5413  N N    . VAL A 1 100 ? 5.662   10.731  -25.110 1.00 1.00 ? 100 VAL A N    3  
ATOM 5414  C CA   . VAL A 1 100 ? 4.850   11.975  -25.156 1.00 1.00 ? 100 VAL A CA   3  
ATOM 5415  C C    . VAL A 1 100 ? 4.445   12.326  -26.595 1.00 1.00 ? 100 VAL A C    3  
ATOM 5416  O O    . VAL A 1 100 ? 5.282   12.402  -27.493 1.00 1.00 ? 100 VAL A O    3  
ATOM 5417  C CB   . VAL A 1 100 ? 5.537   13.186  -24.481 1.00 1.00 ? 100 VAL A CB   3  
ATOM 5418  C CG1  . VAL A 1 100 ? 4.747   14.499  -24.635 1.00 1.00 ? 100 VAL A CG1  3  
ATOM 5419  C CG2  . VAL A 1 100 ? 5.690   12.950  -22.977 1.00 1.00 ? 100 VAL A CG2  3  
ATOM 5420  H H    . VAL A 1 100 ? 6.506   10.695  -24.541 1.00 1.00 ? 100 VAL A H    3  
ATOM 5421  H HA   . VAL A 1 100 ? 3.933   11.781  -24.604 1.00 1.00 ? 100 VAL A HA   3  
ATOM 5422  H HB   . VAL A 1 100 ? 6.524   13.321  -24.915 1.00 1.00 ? 100 VAL A HB   3  
ATOM 5423  H HG11 . VAL A 1 100 ? 5.234   15.298  -24.074 1.00 1.00 ? 100 VAL A HG11 3  
ATOM 5424  H HG12 . VAL A 1 100 ? 4.701   14.797  -25.682 1.00 1.00 ? 100 VAL A HG12 3  
ATOM 5425  H HG13 . VAL A 1 100 ? 3.734   14.374  -24.254 1.00 1.00 ? 100 VAL A HG13 3  
ATOM 5426  H HG21 . VAL A 1 100 ? 6.158   11.991  -22.791 1.00 1.00 ? 100 VAL A HG21 3  
ATOM 5427  H HG22 . VAL A 1 100 ? 6.312   13.734  -22.548 1.00 1.00 ? 100 VAL A HG22 3  
ATOM 5428  H HG23 . VAL A 1 100 ? 4.713   12.965  -22.495 1.00 1.00 ? 100 VAL A HG23 3  
ATOM 5429  N N    . GLY A 1 101 ? 3.136   12.523  -26.792 1.00 1.00 ? 101 GLY A N    3  
ATOM 5430  C CA   . GLY A 1 101 ? 2.489   12.772  -28.084 1.00 1.00 ? 101 GLY A CA   3  
ATOM 5431  C C    . GLY A 1 101 ? 1.857   11.523  -28.715 1.00 1.00 ? 101 GLY A C    3  
ATOM 5432  O O    . GLY A 1 101 ? 1.037   11.665  -29.620 1.00 1.00 ? 101 GLY A O    3  
ATOM 5433  H H    . GLY A 1 101 ? 2.528   12.453  -25.983 1.00 1.00 ? 101 GLY A H    3  
ATOM 5434  H HA2  . GLY A 1 101 ? 1.689   13.498  -27.938 1.00 1.00 ? 101 GLY A HA2  3  
ATOM 5435  H HA3  . GLY A 1 101 ? 3.213   13.170  -28.796 1.00 1.00 ? 101 GLY A HA3  3  
ATOM 5436  N N    . GLN A 1 102 ? 2.198   10.316  -28.248 1.00 1.00 ? 102 GLN A N    3  
ATOM 5437  C CA   . GLN A 1 102 ? 1.616   9.059   -28.695 1.00 1.00 ? 102 GLN A CA   3  
ATOM 5438  C C    . GLN A 1 102 ? 0.335   8.723   -27.911 1.00 1.00 ? 102 GLN A C    3  
ATOM 5439  O O    . GLN A 1 102 ? 0.069   9.271   -26.838 1.00 1.00 ? 102 GLN A O    3  
ATOM 5440  C CB   . GLN A 1 102 ? 2.648   7.912   -28.633 1.00 1.00 ? 102 GLN A CB   3  
ATOM 5441  C CG   . GLN A 1 102 ? 3.918   8.212   -29.460 1.00 1.00 ? 102 GLN A CG   3  
ATOM 5442  C CD   . GLN A 1 102 ? 4.871   7.016   -29.555 1.00 1.00 ? 102 GLN A CD   3  
ATOM 5443  O OE1  . GLN A 1 102 ? 4.490   5.903   -29.900 1.00 1.00 ? 102 GLN A OE1  3  
ATOM 5444  N NE2  . GLN A 1 102 ? 6.147   7.186   -29.272 1.00 1.00 ? 102 GLN A NE2  3  
ATOM 5445  H H    . GLN A 1 102 ? 2.879   10.239  -27.509 1.00 1.00 ? 102 GLN A H    3  
ATOM 5446  H HA   . GLN A 1 102 ? 1.340   9.195   -29.735 1.00 1.00 ? 102 GLN A HA   3  
ATOM 5447  H HB2  . GLN A 1 102 ? 2.923   7.712   -27.596 1.00 1.00 ? 102 GLN A HB2  3  
ATOM 5448  H HB3  . GLN A 1 102 ? 2.182   7.010   -29.036 1.00 1.00 ? 102 GLN A HB3  3  
ATOM 5449  H HG2  . GLN A 1 102 ? 3.632   8.494   -30.474 1.00 1.00 ? 102 GLN A HG2  3  
ATOM 5450  H HG3  . GLN A 1 102 ? 4.447   9.057   -29.020 1.00 1.00 ? 102 GLN A HG3  3  
ATOM 5451  H HE21 . GLN A 1 102 ? 6.504   8.096   -28.982 1.00 1.00 ? 102 GLN A HE21 3  
ATOM 5452  H HE22 . GLN A 1 102 ? 6.757   6.388   -29.330 1.00 1.00 ? 102 GLN A HE22 3  
ATOM 5453  N N    . LYS A 1 103 ? -0.464  7.803   -28.456 1.00 1.00 ? 103 LYS A N    3  
ATOM 5454  C CA   . LYS A 1 103 ? -1.776  7.394   -27.929 1.00 1.00 ? 103 LYS A CA   3  
ATOM 5455  C C    . LYS A 1 103 ? -1.880  5.875   -27.680 1.00 1.00 ? 103 LYS A C    3  
ATOM 5456  O O    . LYS A 1 103 ? -1.113  5.088   -28.238 1.00 1.00 ? 103 LYS A O    3  
ATOM 5457  C CB   . LYS A 1 103 ? -2.874  7.861   -28.907 1.00 1.00 ? 103 LYS A CB   3  
ATOM 5458  C CG   . LYS A 1 103 ? -3.017  9.389   -28.934 1.00 1.00 ? 103 LYS A CG   3  
ATOM 5459  C CD   . LYS A 1 103 ? -4.087  9.827   -29.943 1.00 1.00 ? 103 LYS A CD   3  
ATOM 5460  C CE   . LYS A 1 103 ? -4.198  11.358  -29.931 1.00 1.00 ? 103 LYS A CE   3  
ATOM 5461  N NZ   . LYS A 1 103 ? -5.200  11.854  -30.916 1.00 1.00 ? 103 LYS A NZ   3  
ATOM 5462  H H    . LYS A 1 103 ? -0.152  7.348   -29.305 1.00 1.00 ? 103 LYS A H    3  
ATOM 5463  H HA   . LYS A 1 103 ? -1.940  7.880   -26.969 1.00 1.00 ? 103 LYS A HA   3  
ATOM 5464  H HB2  . LYS A 1 103 ? -2.641  7.497   -29.910 1.00 1.00 ? 103 LYS A HB2  3  
ATOM 5465  H HB3  . LYS A 1 103 ? -3.832  7.435   -28.602 1.00 1.00 ? 103 LYS A HB3  3  
ATOM 5466  H HG2  . LYS A 1 103 ? -3.300  9.735   -27.940 1.00 1.00 ? 103 LYS A HG2  3  
ATOM 5467  H HG3  . LYS A 1 103 ? -2.063  9.841   -29.211 1.00 1.00 ? 103 LYS A HG3  3  
ATOM 5468  H HD2  . LYS A 1 103 ? -3.804  9.482   -30.939 1.00 1.00 ? 103 LYS A HD2  3  
ATOM 5469  H HD3  . LYS A 1 103 ? -5.049  9.383   -29.672 1.00 1.00 ? 103 LYS A HD3  3  
ATOM 5470  H HE2  . LYS A 1 103 ? -4.471  11.678  -28.923 1.00 1.00 ? 103 LYS A HE2  3  
ATOM 5471  H HE3  . LYS A 1 103 ? -3.214  11.783  -30.152 1.00 1.00 ? 103 LYS A HE3  3  
ATOM 5472  H HZ1  . LYS A 1 103 ? -4.957  11.582  -31.861 1.00 1.00 ? 103 LYS A HZ1  3  
ATOM 5473  H HZ2  . LYS A 1 103 ? -6.127  11.495  -30.717 1.00 1.00 ? 103 LYS A HZ2  3  
ATOM 5474  H HZ3  . LYS A 1 103 ? -5.253  12.865  -30.891 1.00 1.00 ? 103 LYS A HZ3  3  
ATOM 5475  N N    . MET A 1 104 ? -2.852  5.465   -26.854 1.00 1.00 ? 104 MET A N    3  
ATOM 5476  C CA   . MET A 1 104 ? -3.143  4.058   -26.511 1.00 1.00 ? 104 MET A CA   3  
ATOM 5477  C C    . MET A 1 104 ? -4.645  3.746   -26.569 1.00 1.00 ? 104 MET A C    3  
ATOM 5478  O O    . MET A 1 104 ? -5.479  4.569   -26.190 1.00 1.00 ? 104 MET A O    3  
ATOM 5479  C CB   . MET A 1 104 ? -2.591  3.720   -25.115 1.00 1.00 ? 104 MET A CB   3  
ATOM 5480  C CG   . MET A 1 104 ? -1.061  3.820   -25.075 1.00 1.00 ? 104 MET A CG   3  
ATOM 5481  S SD   . MET A 1 104 ? -0.322  3.155   -23.564 1.00 1.00 ? 104 MET A SD   3  
ATOM 5482  C CE   . MET A 1 104 ? 1.410   3.351   -24.035 1.00 1.00 ? 104 MET A CE   3  
ATOM 5483  H H    . MET A 1 104 ? -3.446  6.180   -26.439 1.00 1.00 ? 104 MET A H    3  
ATOM 5484  H HA   . MET A 1 104 ? -2.655  3.402   -27.235 1.00 1.00 ? 104 MET A HA   3  
ATOM 5485  H HB2  . MET A 1 104 ? -3.020  4.389   -24.365 1.00 1.00 ? 104 MET A HB2  3  
ATOM 5486  H HB3  . MET A 1 104 ? -2.875  2.696   -24.862 1.00 1.00 ? 104 MET A HB3  3  
ATOM 5487  H HG2  . MET A 1 104 ? -0.649  3.270   -25.922 1.00 1.00 ? 104 MET A HG2  3  
ATOM 5488  H HG3  . MET A 1 104 ? -0.766  4.867   -25.175 1.00 1.00 ? 104 MET A HG3  3  
ATOM 5489  H HE1  . MET A 1 104 ? 1.593   2.868   -24.996 1.00 1.00 ? 104 MET A HE1  3  
ATOM 5490  H HE2  . MET A 1 104 ? 1.655   4.413   -24.115 1.00 1.00 ? 104 MET A HE2  3  
ATOM 5491  H HE3  . MET A 1 104 ? 2.043   2.883   -23.281 1.00 1.00 ? 104 MET A HE3  3  
ATOM 5492  N N    . LYS A 1 105 ? -4.975  2.537   -27.031 1.00 1.00 ? 105 LYS A N    3  
ATOM 5493  C CA   . LYS A 1 105 ? -6.349  2.023   -27.137 1.00 1.00 ? 105 LYS A CA   3  
ATOM 5494  C C    . LYS A 1 105 ? -6.925  1.555   -25.782 1.00 1.00 ? 105 LYS A C    3  
ATOM 5495  O O    . LYS A 1 105 ? -6.202  1.362   -24.803 1.00 1.00 ? 105 LYS A O    3  
ATOM 5496  C CB   . LYS A 1 105 ? -6.379  0.887   -28.183 1.00 1.00 ? 105 LYS A CB   3  
ATOM 5497  C CG   . LYS A 1 105 ? -6.073  1.378   -29.607 1.00 1.00 ? 105 LYS A CG   3  
ATOM 5498  C CD   . LYS A 1 105 ? -6.178  0.223   -30.618 1.00 1.00 ? 105 LYS A CD   3  
ATOM 5499  C CE   . LYS A 1 105 ? -5.982  0.673   -32.077 1.00 1.00 ? 105 LYS A CE   3  
ATOM 5500  N NZ   . LYS A 1 105 ? -4.574  1.050   -32.392 1.00 1.00 ? 105 LYS A NZ   3  
ATOM 5501  H H    . LYS A 1 105 ? -4.227  1.909   -27.296 1.00 1.00 ? 105 LYS A H    3  
ATOM 5502  H HA   . LYS A 1 105 ? -6.997  2.829   -27.493 1.00 1.00 ? 105 LYS A HA   3  
ATOM 5503  H HB2  . LYS A 1 105 ? -5.658  0.115   -27.902 1.00 1.00 ? 105 LYS A HB2  3  
ATOM 5504  H HB3  . LYS A 1 105 ? -7.371  0.434   -28.186 1.00 1.00 ? 105 LYS A HB3  3  
ATOM 5505  H HG2  . LYS A 1 105 ? -6.790  2.154   -29.878 1.00 1.00 ? 105 LYS A HG2  3  
ATOM 5506  H HG3  . LYS A 1 105 ? -5.070  1.800   -29.641 1.00 1.00 ? 105 LYS A HG3  3  
ATOM 5507  H HD2  . LYS A 1 105 ? -5.450  -0.554  -30.367 1.00 1.00 ? 105 LYS A HD2  3  
ATOM 5508  H HD3  . LYS A 1 105 ? -7.174  -0.218  -30.535 1.00 1.00 ? 105 LYS A HD3  3  
ATOM 5509  H HE2  . LYS A 1 105 ? -6.289  -0.149  -32.732 1.00 1.00 ? 105 LYS A HE2  3  
ATOM 5510  H HE3  . LYS A 1 105 ? -6.656  1.512   -32.281 1.00 1.00 ? 105 LYS A HE3  3  
ATOM 5511  H HZ1  . LYS A 1 105 ? -4.267  1.840   -31.839 1.00 1.00 ? 105 LYS A HZ1  3  
ATOM 5512  H HZ2  . LYS A 1 105 ? -3.938  0.281   -32.224 1.00 1.00 ? 105 LYS A HZ2  3  
ATOM 5513  H HZ3  . LYS A 1 105 ? -4.486  1.310   -33.367 1.00 1.00 ? 105 LYS A HZ3  3  
ATOM 5514  N N    . TYR A 1 106 ? -8.242  1.335   -25.744 1.00 1.00 ? 106 TYR A N    3  
ATOM 5515  C CA   . TYR A 1 106 ? -9.010  0.886   -24.569 1.00 1.00 ? 106 TYR A CA   3  
ATOM 5516  C C    . TYR A 1 106 ? -9.458  -0.588  -24.677 1.00 1.00 ? 106 TYR A C    3  
ATOM 5517  O O    . TYR A 1 106 ? -9.366  -1.189  -25.746 1.00 1.00 ? 106 TYR A O    3  
ATOM 5518  C CB   . TYR A 1 106 ? -10.196 1.840   -24.373 1.00 1.00 ? 106 TYR A CB   3  
ATOM 5519  C CG   . TYR A 1 106 ? -11.190 1.897   -25.522 1.00 1.00 ? 106 TYR A CG   3  
ATOM 5520  C CD1  . TYR A 1 106 ? -10.946 2.728   -26.636 1.00 1.00 ? 106 TYR A CD1  3  
ATOM 5521  C CD2  . TYR A 1 106 ? -12.365 1.125   -25.478 1.00 1.00 ? 106 TYR A CD2  3  
ATOM 5522  C CE1  . TYR A 1 106 ? -11.864 2.775   -27.703 1.00 1.00 ? 106 TYR A CE1  3  
ATOM 5523  C CE2  . TYR A 1 106 ? -13.295 1.177   -26.535 1.00 1.00 ? 106 TYR A CE2  3  
ATOM 5524  C CZ   . TYR A 1 106 ? -13.046 2.002   -27.655 1.00 1.00 ? 106 TYR A CZ   3  
ATOM 5525  O OH   . TYR A 1 106 ? -13.939 2.067   -28.683 1.00 1.00 ? 106 TYR A OH   3  
ATOM 5526  H H    . TYR A 1 106 ? -8.758  1.436   -26.609 1.00 1.00 ? 106 TYR A H    3  
ATOM 5527  H HA   . TYR A 1 106 ? -8.384  0.965   -23.675 1.00 1.00 ? 106 TYR A HA   3  
ATOM 5528  H HB2  . TYR A 1 106 ? -10.721 1.557   -23.460 1.00 1.00 ? 106 TYR A HB2  3  
ATOM 5529  H HB3  . TYR A 1 106 ? -9.797  2.843   -24.214 1.00 1.00 ? 106 TYR A HB3  3  
ATOM 5530  H HD1  . TYR A 1 106 ? -10.050 3.330   -26.676 1.00 1.00 ? 106 TYR A HD1  3  
ATOM 5531  H HD2  . TYR A 1 106 ? -12.562 0.493   -24.625 1.00 1.00 ? 106 TYR A HD2  3  
ATOM 5532  H HE1  . TYR A 1 106 ? -11.664 3.400   -28.563 1.00 1.00 ? 106 TYR A HE1  3  
ATOM 5533  H HE2  . TYR A 1 106 ? -14.197 0.582   -26.490 1.00 1.00 ? 106 TYR A HE2  3  
ATOM 5534  H HH   . TYR A 1 106 ? -14.713 1.491   -28.562 1.00 1.00 ? 106 TYR A HH   3  
ATOM 5535  N N    . SER A 1 107 ? -9.862  -1.197  -23.554 1.00 1.00 ? 107 SER A N    3  
ATOM 5536  C CA   . SER A 1 107 ? -10.342 -2.600  -23.393 1.00 1.00 ? 107 SER A CA   3  
ATOM 5537  C C    . SER A 1 107 ? -9.234  -3.666  -23.542 1.00 1.00 ? 107 SER A C    3  
ATOM 5538  O O    . SER A 1 107 ? -9.276  -4.705  -22.886 1.00 1.00 ? 107 SER A O    3  
ATOM 5539  C CB   . SER A 1 107 ? -11.509 -2.931  -24.342 1.00 1.00 ? 107 SER A CB   3  
ATOM 5540  O OG   . SER A 1 107 ? -12.631 -2.092  -24.084 1.00 1.00 ? 107 SER A OG   3  
ATOM 5541  H H    . SER A 1 107 ? -9.910  -0.626  -22.717 1.00 1.00 ? 107 SER A H    3  
ATOM 5542  H HA   . SER A 1 107 ? -10.733 -2.717  -22.380 1.00 1.00 ? 107 SER A HA   3  
ATOM 5543  H HB2  . SER A 1 107 ? -11.194 -2.825  -25.379 1.00 1.00 ? 107 SER A HB2  3  
ATOM 5544  H HB3  . SER A 1 107 ? -11.804 -3.971  -24.184 1.00 1.00 ? 107 SER A HB3  3  
ATOM 5545  H HG   . SER A 1 107 ? -13.385 -2.379  -24.643 1.00 1.00 ? 107 SER A HG   3  
ATOM 5546  N N    . ILE A 1 108 ? -8.213  -3.396  -24.368 1.00 1.00 ? 108 ILE A N    3  
ATOM 5547  C CA   . ILE A 1 108 ? -7.033  -4.251  -24.627 1.00 1.00 ? 108 ILE A CA   3  
ATOM 5548  C C    . ILE A 1 108 ? -6.240  -4.623  -23.356 1.00 1.00 ? 108 ILE A C    3  
ATOM 5549  O O    . ILE A 1 108 ? -5.754  -5.749  -23.252 1.00 1.00 ? 108 ILE A O    3  
ATOM 5550  C CB   . ILE A 1 108 ? -6.162  -3.561  -25.716 1.00 1.00 ? 108 ILE A CB   3  
ATOM 5551  C CG1  . ILE A 1 108 ? -4.990  -4.470  -26.146 1.00 1.00 ? 108 ILE A CG1  3  
ATOM 5552  C CG2  . ILE A 1 108 ? -5.667  -2.161  -25.287 1.00 1.00 ? 108 ILE A CG2  3  
ATOM 5553  C CD1  . ILE A 1 108 ? -4.256  -3.981  -27.401 1.00 1.00 ? 108 ILE A CD1  3  
ATOM 5554  H H    . ILE A 1 108 ? -8.340  -2.584  -24.965 1.00 1.00 ? 108 ILE A H    3  
ATOM 5555  H HA   . ILE A 1 108 ? -7.391  -5.198  -25.037 1.00 1.00 ? 108 ILE A HA   3  
ATOM 5556  H HB   . ILE A 1 108 ? -6.797  -3.425  -26.594 1.00 1.00 ? 108 ILE A HB   3  
ATOM 5557  H HG12 . ILE A 1 108 ? -4.266  -4.546  -25.335 1.00 1.00 ? 108 ILE A HG12 3  
ATOM 5558  H HG13 . ILE A 1 108 ? -5.379  -5.467  -26.357 1.00 1.00 ? 108 ILE A HG13 3  
ATOM 5559  H HG21 . ILE A 1 108 ? -5.203  -1.649  -26.130 1.00 1.00 ? 108 ILE A HG21 3  
ATOM 5560  H HG22 . ILE A 1 108 ? -6.496  -1.534  -24.954 1.00 1.00 ? 108 ILE A HG22 3  
ATOM 5561  H HG23 . ILE A 1 108 ? -4.934  -2.241  -24.488 1.00 1.00 ? 108 ILE A HG23 3  
ATOM 5562  H HD11 . ILE A 1 108 ? -3.742  -3.040  -27.202 1.00 1.00 ? 108 ILE A HD11 3  
ATOM 5563  H HD12 . ILE A 1 108 ? -3.515  -4.726  -27.697 1.00 1.00 ? 108 ILE A HD12 3  
ATOM 5564  H HD13 . ILE A 1 108 ? -4.963  -3.843  -28.215 1.00 1.00 ? 108 ILE A HD13 3  
ATOM 5565  N N    . VAL A 1 109 ? -6.163  -3.710  -22.382 1.00 1.00 ? 109 VAL A N    3  
ATOM 5566  C CA   . VAL A 1 109 ? -5.603  -3.906  -21.026 1.00 1.00 ? 109 VAL A CA   3  
ATOM 5567  C C    . VAL A 1 109 ? -6.344  -3.007  -20.024 1.00 1.00 ? 109 VAL A C    3  
ATOM 5568  O O    . VAL A 1 109 ? -6.926  -1.996  -20.418 1.00 1.00 ? 109 VAL A O    3  
ATOM 5569  C CB   . VAL A 1 109 ? -4.075  -3.642  -20.937 1.00 1.00 ? 109 VAL A CB   3  
ATOM 5570  C CG1  . VAL A 1 109 ? -3.232  -4.630  -21.758 1.00 1.00 ? 109 VAL A CG1  3  
ATOM 5571  C CG2  . VAL A 1 109 ? -3.680  -2.206  -21.323 1.00 1.00 ? 109 VAL A CG2  3  
ATOM 5572  H H    . VAL A 1 109 ? -6.649  -2.836  -22.549 1.00 1.00 ? 109 VAL A H    3  
ATOM 5573  H HA   . VAL A 1 109 ? -5.781  -4.941  -20.731 1.00 1.00 ? 109 VAL A HA   3  
ATOM 5574  H HB   . VAL A 1 109 ? -3.794  -3.787  -19.897 1.00 1.00 ? 109 VAL A HB   3  
ATOM 5575  H HG11 . VAL A 1 109 ? -3.505  -5.653  -21.504 1.00 1.00 ? 109 VAL A HG11 3  
ATOM 5576  H HG12 . VAL A 1 109 ? -3.382  -4.460  -22.825 1.00 1.00 ? 109 VAL A HG12 3  
ATOM 5577  H HG13 . VAL A 1 109 ? -2.176  -4.488  -21.528 1.00 1.00 ? 109 VAL A HG13 3  
ATOM 5578  H HG21 . VAL A 1 109 ? -2.601  -2.079  -21.221 1.00 1.00 ? 109 VAL A HG21 3  
ATOM 5579  H HG22 . VAL A 1 109 ? -3.962  -1.990  -22.352 1.00 1.00 ? 109 VAL A HG22 3  
ATOM 5580  H HG23 . VAL A 1 109 ? -4.172  -1.500  -20.658 1.00 1.00 ? 109 VAL A HG23 3  
ATOM 5581  N N    . SER A 1 110 ? -6.337  -3.363  -18.737 1.00 1.00 ? 110 SER A N    3  
ATOM 5582  C CA   . SER A 1 110 ? -7.091  -2.666  -17.682 1.00 1.00 ? 110 SER A CA   3  
ATOM 5583  C C    . SER A 1 110 ? -6.351  -1.432  -17.138 1.00 1.00 ? 110 SER A C    3  
ATOM 5584  O O    . SER A 1 110 ? -6.763  -0.298  -17.393 1.00 1.00 ? 110 SER A O    3  
ATOM 5585  C CB   . SER A 1 110 ? -7.436  -3.666  -16.562 1.00 1.00 ? 110 SER A CB   3  
ATOM 5586  O OG   . SER A 1 110 ? -6.280  -4.367  -16.104 1.00 1.00 ? 110 SER A OG   3  
ATOM 5587  H H    . SER A 1 110 ? -5.838  -4.201  -18.454 1.00 1.00 ? 110 SER A H    3  
ATOM 5588  H HA   . SER A 1 110 ? -8.037  -2.307  -18.092 1.00 1.00 ? 110 SER A HA   3  
ATOM 5589  H HB2  . SER A 1 110 ? -7.900  -3.133  -15.729 1.00 1.00 ? 110 SER A HB2  3  
ATOM 5590  H HB3  . SER A 1 110 ? -8.154  -4.390  -16.954 1.00 1.00 ? 110 SER A HB3  3  
ATOM 5591  H HG   . SER A 1 110 ? -6.549  -5.050  -15.451 1.00 1.00 ? 110 SER A HG   3  
ATOM 5592  N N    . ARG A 1 111 ? -5.232  -1.629  -16.425 1.00 1.00 ? 111 ARG A N    3  
ATOM 5593  C CA   . ARG A 1 111 ? -4.429  -0.575  -15.778 1.00 1.00 ? 111 ARG A CA   3  
ATOM 5594  C C    . ARG A 1 111 ? -3.450  0.080   -16.765 1.00 1.00 ? 111 ARG A C    3  
ATOM 5595  O O    . ARG A 1 111 ? -2.252  0.193   -16.517 1.00 1.00 ? 111 ARG A O    3  
ATOM 5596  C CB   . ARG A 1 111 ? -3.754  -1.146  -14.512 1.00 1.00 ? 111 ARG A CB   3  
ATOM 5597  C CG   . ARG A 1 111 ? -4.794  -1.456  -13.426 1.00 1.00 ? 111 ARG A CG   3  
ATOM 5598  C CD   . ARG A 1 111 ? -4.170  -2.110  -12.188 1.00 1.00 ? 111 ARG A CD   3  
ATOM 5599  N NE   . ARG A 1 111 ? -5.134  -2.085  -11.071 1.00 1.00 ? 111 ARG A NE   3  
ATOM 5600  C CZ   . ARG A 1 111 ? -5.170  -1.184  -10.096 1.00 1.00 ? 111 ARG A CZ   3  
ATOM 5601  N NH1  . ARG A 1 111 ? -4.193  -0.344  -9.859  1.00 1.00 ? 111 ARG A NH1  3  
ATOM 5602  N NH2  . ARG A 1 111 ? -6.215  -1.066  -9.313  1.00 1.00 ? 111 ARG A NH2  3  
ATOM 5603  H H    . ARG A 1 111 ? -4.944  -2.594  -16.283 1.00 1.00 ? 111 ARG A H    3  
ATOM 5604  H HA   . ARG A 1 111 ? -5.106  0.217   -15.451 1.00 1.00 ? 111 ARG A HA   3  
ATOM 5605  H HB2  . ARG A 1 111 ? -3.196  -2.050  -14.761 1.00 1.00 ? 111 ARG A HB2  3  
ATOM 5606  H HB3  . ARG A 1 111 ? -3.062  -0.406  -14.109 1.00 1.00 ? 111 ARG A HB3  3  
ATOM 5607  H HG2  . ARG A 1 111 ? -5.269  -0.517  -13.133 1.00 1.00 ? 111 ARG A HG2  3  
ATOM 5608  H HG3  . ARG A 1 111 ? -5.561  -2.125  -13.820 1.00 1.00 ? 111 ARG A HG3  3  
ATOM 5609  H HD2  . ARG A 1 111 ? -3.909  -3.142  -12.422 1.00 1.00 ? 111 ARG A HD2  3  
ATOM 5610  H HD3  . ARG A 1 111 ? -3.260  -1.578  -11.921 1.00 1.00 ? 111 ARG A HD3  3  
ATOM 5611  H HE   . ARG A 1 111 ? -5.908  -2.731  -11.131 1.00 1.00 ? 111 ARG A HE   3  
ATOM 5612  H HH11 . ARG A 1 111 ? -3.316  -0.403  -10.358 1.00 1.00 ? 111 ARG A HH11 3  
ATOM 5613  H HH12 . ARG A 1 111 ? -4.344  0.341   -9.120  1.00 1.00 ? 111 ARG A HH12 3  
ATOM 5614  H HH21 . ARG A 1 111 ? -7.026  -1.654  -9.417  1.00 1.00 ? 111 ARG A HH21 3  
ATOM 5615  H HH22 . ARG A 1 111 ? -6.210  -0.285  -8.657  1.00 1.00 ? 111 ARG A HH22 3  
ATOM 5616  N N    . ASN A 1 112 ? -3.966  0.529   -17.911 1.00 1.00 ? 112 ASN A N    3  
ATOM 5617  C CA   . ASN A 1 112 ? -3.196  0.995   -19.072 1.00 1.00 ? 112 ASN A CA   3  
ATOM 5618  C C    . ASN A 1 112 ? -2.129  2.064   -18.743 1.00 1.00 ? 112 ASN A C    3  
ATOM 5619  O O    . ASN A 1 112 ? -1.009  1.959   -19.227 1.00 1.00 ? 112 ASN A O    3  
ATOM 5620  C CB   . ASN A 1 112 ? -4.210  1.467   -20.136 1.00 1.00 ? 112 ASN A CB   3  
ATOM 5621  C CG   . ASN A 1 112 ? -3.619  1.873   -21.487 1.00 1.00 ? 112 ASN A CG   3  
ATOM 5622  O OD1  . ASN A 1 112 ? -4.137  2.763   -22.143 1.00 1.00 ? 112 ASN A OD1  3  
ATOM 5623  N ND2  . ASN A 1 112 ? -2.550  1.252   -21.955 1.00 1.00 ? 112 ASN A ND2  3  
ATOM 5624  H H    . ASN A 1 112 ? -4.973  0.437   -18.014 1.00 1.00 ? 112 ASN A H    3  
ATOM 5625  H HA   . ASN A 1 112 ? -2.667  0.130   -19.469 1.00 1.00 ? 112 ASN A HA   3  
ATOM 5626  H HB2  . ASN A 1 112 ? -4.923  0.662   -20.323 1.00 1.00 ? 112 ASN A HB2  3  
ATOM 5627  H HB3  . ASN A 1 112 ? -4.771  2.317   -19.739 1.00 1.00 ? 112 ASN A HB3  3  
ATOM 5628  H HD21 . ASN A 1 112 ? -2.097  0.509   -21.451 1.00 1.00 ? 112 ASN A HD21 3  
ATOM 5629  H HD22 . ASN A 1 112 ? -2.147  1.593   -22.818 1.00 1.00 ? 112 ASN A HD22 3  
ATOM 5630  N N    . CYS A 1 113 ? -2.418  3.029   -17.858 1.00 1.00 ? 113 CYS A N    3  
ATOM 5631  C CA   . CYS A 1 113 ? -1.434  4.042   -17.424 1.00 1.00 ? 113 CYS A CA   3  
ATOM 5632  C C    . CYS A 1 113 ? -0.311  3.463   -16.531 1.00 1.00 ? 113 CYS A C    3  
ATOM 5633  O O    . CYS A 1 113 ? 0.861   3.796   -16.730 1.00 1.00 ? 113 CYS A O    3  
ATOM 5634  C CB   . CYS A 1 113 ? -2.223  5.206   -16.797 1.00 1.00 ? 113 CYS A CB   3  
ATOM 5635  S SG   . CYS A 1 113 ? -1.075  6.513   -16.274 1.00 1.00 ? 113 CYS A SG   3  
ATOM 5636  H H    . CYS A 1 113 ? -3.366  3.079   -17.498 1.00 1.00 ? 113 CYS A H    3  
ATOM 5637  H HA   . CYS A 1 113 ? -0.923  4.431   -18.308 1.00 1.00 ? 113 CYS A HA   3  
ATOM 5638  H HB2  . CYS A 1 113 ? -2.904  5.625   -17.546 1.00 1.00 ? 113 CYS A HB2  3  
ATOM 5639  H HB3  . CYS A 1 113 ? -2.829  4.875   -15.949 1.00 1.00 ? 113 CYS A HB3  3  
ATOM 5640  H HG   . CYS A 1 113 ? -1.918  7.557   -16.422 1.00 1.00 ? 113 CYS A HG   3  
ATOM 5641  N N    . GLU A 1 114 ? -0.636  2.521   -15.637 1.00 1.00 ? 114 GLU A N    3  
ATOM 5642  C CA   . GLU A 1 114 ? 0.353   1.749   -14.871 1.00 1.00 ? 114 GLU A CA   3  
ATOM 5643  C C    . GLU A 1 114 ? 1.265   0.977   -15.837 1.00 1.00 ? 114 GLU A C    3  
ATOM 5644  O O    . GLU A 1 114 ? 2.479   1.168   -15.835 1.00 1.00 ? 114 GLU A O    3  
ATOM 5645  C CB   . GLU A 1 114 ? -0.359  0.781   -13.909 1.00 1.00 ? 114 GLU A CB   3  
ATOM 5646  C CG   . GLU A 1 114 ? 0.572   0.163   -12.864 1.00 1.00 ? 114 GLU A CG   3  
ATOM 5647  C CD   . GLU A 1 114 ? -0.154  -0.972  -12.116 1.00 1.00 ? 114 GLU A CD   3  
ATOM 5648  O OE1  . GLU A 1 114 ? -0.866  -0.701  -11.122 1.00 1.00 ? 114 GLU A OE1  3  
ATOM 5649  O OE2  . GLU A 1 114 ? -0.008  -2.149  -12.526 1.00 1.00 ? 114 GLU A OE2  3  
ATOM 5650  H H    . GLU A 1 114 ? -1.607  2.258   -15.554 1.00 1.00 ? 114 GLU A H    3  
ATOM 5651  H HA   . GLU A 1 114 ? 0.959   2.442   -14.288 1.00 1.00 ? 114 GLU A HA   3  
ATOM 5652  H HB2  . GLU A 1 114 ? -1.154  1.308   -13.390 1.00 1.00 ? 114 GLU A HB2  3  
ATOM 5653  H HB3  . GLU A 1 114 ? -0.810  -0.026  -14.478 1.00 1.00 ? 114 GLU A HB3  3  
ATOM 5654  H HG2  . GLU A 1 114 ? 1.463   -0.240  -13.353 1.00 1.00 ? 114 GLU A HG2  3  
ATOM 5655  H HG3  . GLU A 1 114 ? 0.894   0.934   -12.163 1.00 1.00 ? 114 GLU A HG3  3  
ATOM 5656  N N    . HIS A 1 115 ? 0.672   0.172   -16.728 1.00 1.00 ? 115 HIS A N    3  
ATOM 5657  C CA   . HIS A 1 115 ? 1.407   -0.622  -17.725 1.00 1.00 ? 115 HIS A CA   3  
ATOM 5658  C C    . HIS A 1 115 ? 2.243   0.243   -18.686 1.00 1.00 ? 115 HIS A C    3  
ATOM 5659  O O    . HIS A 1 115 ? 3.278   -0.204  -19.183 1.00 1.00 ? 115 HIS A O    3  
ATOM 5660  C CB   . HIS A 1 115 ? 0.409   -1.486  -18.518 1.00 1.00 ? 115 HIS A CB   3  
ATOM 5661  C CG   . HIS A 1 115 ? -0.511  -2.362  -17.693 1.00 1.00 ? 115 HIS A CG   3  
ATOM 5662  N ND1  . HIS A 1 115 ? -0.198  -3.070  -16.550 1.00 1.00 ? 115 HIS A ND1  3  
ATOM 5663  C CD2  . HIS A 1 115 ? -1.823  -2.634  -17.978 1.00 1.00 ? 115 HIS A CD2  3  
ATOM 5664  C CE1  . HIS A 1 115 ? -1.298  -3.743  -16.162 1.00 1.00 ? 115 HIS A CE1  3  
ATOM 5665  N NE2  . HIS A 1 115 ? -2.320  -3.508  -17.006 1.00 1.00 ? 115 HIS A NE2  3  
ATOM 5666  H H    . HIS A 1 115 ? -0.338  0.060   -16.673 1.00 1.00 ? 115 HIS A H    3  
ATOM 5667  H HA   . HIS A 1 115 ? 2.110   -1.278  -17.210 1.00 1.00 ? 115 HIS A HA   3  
ATOM 5668  H HB2  . HIS A 1 115 ? -0.205  -0.831  -19.142 1.00 1.00 ? 115 HIS A HB2  3  
ATOM 5669  H HB3  . HIS A 1 115 ? 0.975   -2.137  -19.189 1.00 1.00 ? 115 HIS A HB3  3  
ATOM 5670  H HD1  . HIS A 1 115 ? 0.697   -3.098  -16.079 1.00 1.00 ? 115 HIS A HD1  3  
ATOM 5671  H HD2  . HIS A 1 115 ? -2.379  -2.239  -18.815 1.00 1.00 ? 115 HIS A HD2  3  
ATOM 5672  H HE1  . HIS A 1 115 ? -1.346  -4.389  -15.293 1.00 1.00 ? 115 HIS A HE1  3  
ATOM 5673  N N    . PHE A 1 116 ? 1.821   1.482   -18.954 1.00 1.00 ? 116 PHE A N    3  
ATOM 5674  C CA   . PHE A 1 116 ? 2.624   2.463   -19.668 1.00 1.00 ? 116 PHE A CA   3  
ATOM 5675  C C    . PHE A 1 116 ? 3.871   2.813   -18.849 1.00 1.00 ? 116 PHE A C    3  
ATOM 5676  O O    . PHE A 1 116 ? 4.982   2.586   -19.329 1.00 1.00 ? 116 PHE A O    3  
ATOM 5677  C CB   . PHE A 1 116 ? 1.771   3.695   -20.017 1.00 1.00 ? 116 PHE A CB   3  
ATOM 5678  C CG   . PHE A 1 116 ? 2.582   4.943   -20.313 1.00 1.00 ? 116 PHE A CG   3  
ATOM 5679  C CD1  . PHE A 1 116 ? 3.448   4.973   -21.422 1.00 1.00 ? 116 PHE A CD1  3  
ATOM 5680  C CD2  . PHE A 1 116 ? 2.530   6.047   -19.442 1.00 1.00 ? 116 PHE A CD2  3  
ATOM 5681  C CE1  . PHE A 1 116 ? 4.248   6.102   -21.655 1.00 1.00 ? 116 PHE A CE1  3  
ATOM 5682  C CE2  . PHE A 1 116 ? 3.335   7.173   -19.676 1.00 1.00 ? 116 PHE A CE2  3  
ATOM 5683  C CZ   . PHE A 1 116 ? 4.196   7.201   -20.787 1.00 1.00 ? 116 PHE A CZ   3  
ATOM 5684  H H    . PHE A 1 116 ? 0.911   1.772   -18.619 1.00 1.00 ? 116 PHE A H    3  
ATOM 5685  H HA   . PHE A 1 116 ? 2.964   2.016   -20.600 1.00 1.00 ? 116 PHE A HA   3  
ATOM 5686  H HB2  . PHE A 1 116 ? 1.144   3.458   -20.880 1.00 1.00 ? 116 PHE A HB2  3  
ATOM 5687  H HB3  . PHE A 1 116 ? 1.101   3.913   -19.193 1.00 1.00 ? 116 PHE A HB3  3  
ATOM 5688  H HD1  . PHE A 1 116 ? 3.525   4.119   -22.076 1.00 1.00 ? 116 PHE A HD1  3  
ATOM 5689  H HD2  . PHE A 1 116 ? 1.873   6.026   -18.584 1.00 1.00 ? 116 PHE A HD2  3  
ATOM 5690  H HE1  . PHE A 1 116 ? 4.922   6.112   -22.496 1.00 1.00 ? 116 PHE A HE1  3  
ATOM 5691  H HE2  . PHE A 1 116 ? 3.309   8.013   -18.998 1.00 1.00 ? 116 PHE A HE2  3  
ATOM 5692  H HZ   . PHE A 1 116 ? 4.830   8.059   -20.961 1.00 1.00 ? 116 PHE A HZ   3  
ATOM 5693  N N    . VAL A 1 117 ? 3.715   3.337   -17.625 1.00 1.00 ? 117 VAL A N    3  
ATOM 5694  C CA   . VAL A 1 117 ? 4.876   3.866   -16.877 1.00 1.00 ? 117 VAL A CA   3  
ATOM 5695  C C    . VAL A 1 117 ? 5.889   2.785   -16.467 1.00 1.00 ? 117 VAL A C    3  
ATOM 5696  O O    . VAL A 1 117 ? 7.081   3.085   -16.420 1.00 1.00 ? 117 VAL A O    3  
ATOM 5697  C CB   . VAL A 1 117 ? 4.512   4.738   -15.657 1.00 1.00 ? 117 VAL A CB   3  
ATOM 5698  C CG1  . VAL A 1 117 ? 3.766   6.014   -16.070 1.00 1.00 ? 117 VAL A CG1  3  
ATOM 5699  C CG2  . VAL A 1 117 ? 3.725   3.994   -14.567 1.00 1.00 ? 117 VAL A CG2  3  
ATOM 5700  H H    . VAL A 1 117 ? 2.773   3.415   -17.241 1.00 1.00 ? 117 VAL A H    3  
ATOM 5701  H HA   . VAL A 1 117 ? 5.400   4.523   -17.569 1.00 1.00 ? 117 VAL A HA   3  
ATOM 5702  H HB   . VAL A 1 117 ? 5.450   5.069   -15.214 1.00 1.00 ? 117 VAL A HB   3  
ATOM 5703  H HG11 . VAL A 1 117 ? 3.614   6.641   -15.197 1.00 1.00 ? 117 VAL A HG11 3  
ATOM 5704  H HG12 . VAL A 1 117 ? 4.362   6.581   -16.787 1.00 1.00 ? 117 VAL A HG12 3  
ATOM 5705  H HG13 . VAL A 1 117 ? 2.797   5.767   -16.497 1.00 1.00 ? 117 VAL A HG13 3  
ATOM 5706  H HG21 . VAL A 1 117 ? 4.205   3.049   -14.322 1.00 1.00 ? 117 VAL A HG21 3  
ATOM 5707  H HG22 . VAL A 1 117 ? 3.705   4.601   -13.663 1.00 1.00 ? 117 VAL A HG22 3  
ATOM 5708  H HG23 . VAL A 1 117 ? 2.708   3.803   -14.898 1.00 1.00 ? 117 VAL A HG23 3  
ATOM 5709  N N    . THR A 1 118 ? 5.462   1.536   -16.220 1.00 1.00 ? 118 THR A N    3  
ATOM 5710  C CA   . THR A 1 118 ? 6.378   0.429   -15.887 1.00 1.00 ? 118 THR A CA   3  
ATOM 5711  C C    . THR A 1 118 ? 7.258   0.041   -17.063 1.00 1.00 ? 118 THR A C    3  
ATOM 5712  O O    . THR A 1 118 ? 8.466   -0.101  -16.897 1.00 1.00 ? 118 THR A O    3  
ATOM 5713  C CB   . THR A 1 118 ? 5.606   -0.798  -15.397 1.00 1.00 ? 118 THR A CB   3  
ATOM 5714  O OG1  . THR A 1 118 ? 4.606   -1.120  -16.333 1.00 1.00 ? 118 THR A OG1  3  
ATOM 5715  C CG2  . THR A 1 118 ? 4.953   -0.551  -14.036 1.00 1.00 ? 118 THR A CG2  3  
ATOM 5716  H H    . THR A 1 118 ? 4.464   1.324   -16.254 1.00 1.00 ? 118 THR A H    3  
ATOM 5717  H HA   . THR A 1 118 ? 7.054   0.744   -15.092 1.00 1.00 ? 118 THR A HA   3  
ATOM 5718  H HB   . THR A 1 118 ? 6.297   -1.637  -15.312 1.00 1.00 ? 118 THR A HB   3  
ATOM 5719  H HG1  . THR A 1 118 ? 4.262   -2.012  -16.142 1.00 1.00 ? 118 THR A HG1  3  
ATOM 5720  H HG21 . THR A 1 118 ? 4.432   -1.452  -13.711 1.00 1.00 ? 118 THR A HG21 3  
ATOM 5721  H HG22 . THR A 1 118 ? 5.716   -0.304  -13.299 1.00 1.00 ? 118 THR A HG22 3  
ATOM 5722  H HG23 . THR A 1 118 ? 4.238   0.268   -14.098 1.00 1.00 ? 118 THR A HG23 3  
ATOM 5723  N N    . GLN A 1 119 ? 6.686   -0.070  -18.263 1.00 1.00 ? 119 GLN A N    3  
ATOM 5724  C CA   . GLN A 1 119 ? 7.407   -0.439  -19.486 1.00 1.00 ? 119 GLN A CA   3  
ATOM 5725  C C    . GLN A 1 119 ? 8.500   0.569   -19.863 1.00 1.00 ? 119 GLN A C    3  
ATOM 5726  O O    . GLN A 1 119 ? 9.493   0.165   -20.466 1.00 1.00 ? 119 GLN A O    3  
ATOM 5727  C CB   . GLN A 1 119 ? 6.424   -0.647  -20.649 1.00 1.00 ? 119 GLN A CB   3  
ATOM 5728  C CG   . GLN A 1 119 ? 5.692   -1.998  -20.544 1.00 1.00 ? 119 GLN A CG   3  
ATOM 5729  C CD   . GLN A 1 119 ? 4.708   -2.195  -21.697 1.00 1.00 ? 119 GLN A CD   3  
ATOM 5730  O OE1  . GLN A 1 119 ? 4.967   -2.908  -22.658 1.00 1.00 ? 119 GLN A OE1  3  
ATOM 5731  N NE2  . GLN A 1 119 ? 3.555   -1.563  -21.654 1.00 1.00 ? 119 GLN A NE2  3  
ATOM 5732  H H    . GLN A 1 119 ? 5.681   0.031   -18.306 1.00 1.00 ? 119 GLN A H    3  
ATOM 5733  H HA   . GLN A 1 119 ? 7.919   -1.382  -19.305 1.00 1.00 ? 119 GLN A HA   3  
ATOM 5734  H HB2  . GLN A 1 119 ? 5.701   0.172   -20.675 1.00 1.00 ? 119 GLN A HB2  3  
ATOM 5735  H HB3  . GLN A 1 119 ? 6.974   -0.641  -21.592 1.00 1.00 ? 119 GLN A HB3  3  
ATOM 5736  H HG2  . GLN A 1 119 ? 6.425   -2.806  -20.566 1.00 1.00 ? 119 GLN A HG2  3  
ATOM 5737  H HG3  . GLN A 1 119 ? 5.152   -2.054  -19.597 1.00 1.00 ? 119 GLN A HG3  3  
ATOM 5738  H HE21 . GLN A 1 119 ? 3.343   -0.984  -20.846 1.00 1.00 ? 119 GLN A HE21 3  
ATOM 5739  H HE22 . GLN A 1 119 ? 2.901   -1.691  -22.412 1.00 1.00 ? 119 GLN A HE22 3  
ATOM 5740  N N    . LEU A 1 120 ? 8.391   1.840   -19.446 1.00 1.00 ? 120 LEU A N    3  
ATOM 5741  C CA   . LEU A 1 120 ? 9.452   2.847   -19.640 1.00 1.00 ? 120 LEU A CA   3  
ATOM 5742  C C    . LEU A 1 120 ? 10.783  2.447   -18.977 1.00 1.00 ? 120 LEU A C    3  
ATOM 5743  O O    . LEU A 1 120 ? 11.838  2.833   -19.478 1.00 1.00 ? 120 LEU A O    3  
ATOM 5744  C CB   . LEU A 1 120 ? 8.992   4.225   -19.126 1.00 1.00 ? 120 LEU A CB   3  
ATOM 5745  C CG   . LEU A 1 120 ? 7.735   4.792   -19.817 1.00 1.00 ? 120 LEU A CG   3  
ATOM 5746  C CD1  . LEU A 1 120 ? 7.346   6.107   -19.144 1.00 1.00 ? 120 LEU A CD1  3  
ATOM 5747  C CD2  . LEU A 1 120 ? 7.945   5.015   -21.319 1.00 1.00 ? 120 LEU A CD2  3  
ATOM 5748  H H    . LEU A 1 120 ? 7.541   2.110   -18.961 1.00 1.00 ? 120 LEU A H    3  
ATOM 5749  H HA   . LEU A 1 120 ? 9.666   2.917   -20.707 1.00 1.00 ? 120 LEU A HA   3  
ATOM 5750  H HB2  . LEU A 1 120 ? 8.805   4.155   -18.054 1.00 1.00 ? 120 LEU A HB2  3  
ATOM 5751  H HB3  . LEU A 1 120 ? 9.804   4.941   -19.266 1.00 1.00 ? 120 LEU A HB3  3  
ATOM 5752  H HG   . LEU A 1 120 ? 6.913   4.097   -19.686 1.00 1.00 ? 120 LEU A HG   3  
ATOM 5753  H HD11 . LEU A 1 120 ? 7.197   5.946   -18.075 1.00 1.00 ? 120 LEU A HD11 3  
ATOM 5754  H HD12 . LEU A 1 120 ? 8.127   6.849   -19.293 1.00 1.00 ? 120 LEU A HD12 3  
ATOM 5755  H HD13 . LEU A 1 120 ? 6.414   6.479   -19.567 1.00 1.00 ? 120 LEU A HD13 3  
ATOM 5756  H HD21 . LEU A 1 120 ? 8.069   4.060   -21.830 1.00 1.00 ? 120 LEU A HD21 3  
ATOM 5757  H HD22 . LEU A 1 120 ? 7.066   5.504   -21.739 1.00 1.00 ? 120 LEU A HD22 3  
ATOM 5758  H HD23 . LEU A 1 120 ? 8.824   5.637   -21.493 1.00 1.00 ? 120 LEU A HD23 3  
ATOM 5759  N N    . ARG A 1 121 ? 10.740  1.669   -17.884 1.00 1.00 ? 121 ARG A N    3  
ATOM 5760  C CA   . ARG A 1 121 ? 11.915  1.026   -17.266 1.00 1.00 ? 121 ARG A CA   3  
ATOM 5761  C C    . ARG A 1 121 ? 12.073  -0.436  -17.727 1.00 1.00 ? 121 ARG A C    3  
ATOM 5762  O O    . ARG A 1 121 ? 13.136  -0.831  -18.193 1.00 1.00 ? 121 ARG A O    3  
ATOM 5763  C CB   . ARG A 1 121 ? 11.807  1.131   -15.731 1.00 1.00 ? 121 ARG A CB   3  
ATOM 5764  C CG   . ARG A 1 121 ? 12.971  0.417   -15.010 1.00 1.00 ? 121 ARG A CG   3  
ATOM 5765  C CD   . ARG A 1 121 ? 12.933  0.614   -13.486 1.00 1.00 ? 121 ARG A CD   3  
ATOM 5766  N NE   . ARG A 1 121 ? 13.858  -0.320  -12.806 1.00 1.00 ? 121 ARG A NE   3  
ATOM 5767  C CZ   . ARG A 1 121 ? 14.391  -0.178  -11.597 1.00 1.00 ? 121 ARG A CZ   3  
ATOM 5768  N NH1  . ARG A 1 121 ? 14.223  0.892   -10.857 1.00 1.00 ? 121 ARG A NH1  3  
ATOM 5769  N NH2  . ARG A 1 121 ? 15.126  -1.127  -11.069 1.00 1.00 ? 121 ARG A NH2  3  
ATOM 5770  H H    . ARG A 1 121 ? 9.823   1.432   -17.520 1.00 1.00 ? 121 ARG A H    3  
ATOM 5771  H HA   . ARG A 1 121 ? 12.812  1.572   -17.571 1.00 1.00 ? 121 ARG A HA   3  
ATOM 5772  H HB2  . ARG A 1 121 ? 11.812  2.188   -15.457 1.00 1.00 ? 121 ARG A HB2  3  
ATOM 5773  H HB3  . ARG A 1 121 ? 10.860  0.697   -15.403 1.00 1.00 ? 121 ARG A HB3  3  
ATOM 5774  H HG2  . ARG A 1 121 ? 12.914  -0.653  -15.216 1.00 1.00 ? 121 ARG A HG2  3  
ATOM 5775  H HG3  . ARG A 1 121 ? 13.922  0.788   -15.396 1.00 1.00 ? 121 ARG A HG3  3  
ATOM 5776  H HD2  . ARG A 1 121 ? 13.193  1.650   -13.263 1.00 1.00 ? 121 ARG A HD2  3  
ATOM 5777  H HD3  . ARG A 1 121 ? 11.919  0.425   -13.129 1.00 1.00 ? 121 ARG A HD3  3  
ATOM 5778  H HE   . ARG A 1 121 ? 14.033  -1.202  -13.274 1.00 1.00 ? 121 ARG A HE   3  
ATOM 5779  H HH11 . ARG A 1 121 ? 13.677  1.675   -11.180 1.00 1.00 ? 121 ARG A HH11 3  
ATOM 5780  H HH12 . ARG A 1 121 ? 14.641  0.904   -9.927  1.00 1.00 ? 121 ARG A HH12 3  
ATOM 5781  H HH21 . ARG A 1 121 ? 15.241  -2.033  -11.505 1.00 1.00 ? 121 ARG A HH21 3  
ATOM 5782  H HH22 . ARG A 1 121 ? 15.466  -0.983  -10.119 1.00 1.00 ? 121 ARG A HH22 3  
ATOM 5783  N N    . TYR A 1 122 ? 11.027  -1.255  -17.585 1.00 1.00 ? 122 TYR A N    3  
ATOM 5784  C CA   . TYR A 1 122 ? 11.076  -2.716  -17.768 1.00 1.00 ? 122 TYR A CA   3  
ATOM 5785  C C    . TYR A 1 122 ? 11.401  -3.163  -19.210 1.00 1.00 ? 122 TYR A C    3  
ATOM 5786  O O    . TYR A 1 122 ? 12.027  -4.206  -19.408 1.00 1.00 ? 122 TYR A O    3  
ATOM 5787  C CB   . TYR A 1 122 ? 9.739   -3.304  -17.279 1.00 1.00 ? 122 TYR A CB   3  
ATOM 5788  C CG   . TYR A 1 122 ? 9.564   -4.795  -17.519 1.00 1.00 ? 122 TYR A CG   3  
ATOM 5789  C CD1  . TYR A 1 122 ? 10.441  -5.715  -16.914 1.00 1.00 ? 122 TYR A CD1  3  
ATOM 5790  C CD2  . TYR A 1 122 ? 8.540   -5.260  -18.368 1.00 1.00 ? 122 TYR A CD2  3  
ATOM 5791  C CE1  . TYR A 1 122 ? 10.304  -7.093  -17.163 1.00 1.00 ? 122 TYR A CE1  3  
ATOM 5792  C CE2  . TYR A 1 122 ? 8.394   -6.637  -18.617 1.00 1.00 ? 122 TYR A CE2  3  
ATOM 5793  C CZ   . TYR A 1 122 ? 9.276   -7.561  -18.015 1.00 1.00 ? 122 TYR A CZ   3  
ATOM 5794  O OH   . TYR A 1 122 ? 9.133   -8.895  -18.262 1.00 1.00 ? 122 TYR A OH   3  
ATOM 5795  H H    . TYR A 1 122 ? 10.157  -0.856  -17.236 1.00 1.00 ? 122 TYR A H    3  
ATOM 5796  H HA   . TYR A 1 122 ? 11.869  -3.112  -17.132 1.00 1.00 ? 122 TYR A HA   3  
ATOM 5797  H HB2  . TYR A 1 122 ? 9.644   -3.114  -16.209 1.00 1.00 ? 122 TYR A HB2  3  
ATOM 5798  H HB3  . TYR A 1 122 ? 8.924   -2.775  -17.776 1.00 1.00 ? 122 TYR A HB3  3  
ATOM 5799  H HD1  . TYR A 1 122 ? 11.223  -5.361  -16.258 1.00 1.00 ? 122 TYR A HD1  3  
ATOM 5800  H HD2  . TYR A 1 122 ? 7.863   -4.558  -18.834 1.00 1.00 ? 122 TYR A HD2  3  
ATOM 5801  H HE1  . TYR A 1 122 ? 10.984  -7.795  -16.697 1.00 1.00 ? 122 TYR A HE1  3  
ATOM 5802  H HE2  . TYR A 1 122 ? 7.608   -6.994  -19.271 1.00 1.00 ? 122 TYR A HE2  3  
ATOM 5803  H HH   . TYR A 1 122 ? 9.785   -9.441  -17.793 1.00 1.00 ? 122 TYR A HH   3  
ATOM 5804  N N    . GLY A 1 123 ? 11.034  -2.352  -20.212 1.00 1.00 ? 123 GLY A N    3  
ATOM 5805  C CA   . GLY A 1 123 ? 11.334  -2.610  -21.631 1.00 1.00 ? 123 GLY A CA   3  
ATOM 5806  C C    . GLY A 1 123 ? 12.773  -2.271  -22.045 1.00 1.00 ? 123 GLY A C    3  
ATOM 5807  O O    . GLY A 1 123 ? 13.141  -2.504  -23.196 1.00 1.00 ? 123 GLY A O    3  
ATOM 5808  H H    . GLY A 1 123 ? 10.527  -1.502  -19.981 1.00 1.00 ? 123 GLY A H    3  
ATOM 5809  H HA2  . GLY A 1 123 ? 11.174  -3.668  -21.846 1.00 1.00 ? 123 GLY A HA2  3  
ATOM 5810  H HA3  . GLY A 1 123 ? 10.664  -2.010  -22.249 1.00 1.00 ? 123 GLY A HA3  3  
ATOM 5811  N N    . LYS A 1 124 ? 13.579  -1.707  -21.137 1.00 1.00 ? 124 LYS A N    3  
ATOM 5812  C CA   . LYS A 1 124 ? 14.945  -1.221  -21.364 1.00 1.00 ? 124 LYS A CA   3  
ATOM 5813  C C    . LYS A 1 124 ? 15.997  -2.120  -20.677 1.00 1.00 ? 124 LYS A C    3  
ATOM 5814  O O    . LYS A 1 124 ? 15.655  -2.963  -19.843 1.00 1.00 ? 124 LYS A O    3  
ATOM 5815  C CB   . LYS A 1 124 ? 15.043  0.251   -20.887 1.00 1.00 ? 124 LYS A CB   3  
ATOM 5816  C CG   . LYS A 1 124 ? 13.836  1.143   -21.233 1.00 1.00 ? 124 LYS A CG   3  
ATOM 5817  C CD   . LYS A 1 124 ? 13.531  1.258   -22.737 1.00 1.00 ? 124 LYS A CD   3  
ATOM 5818  C CE   . LYS A 1 124 ? 12.092  1.759   -22.945 1.00 1.00 ? 124 LYS A CE   3  
ATOM 5819  N NZ   . LYS A 1 124 ? 11.809  2.023   -24.388 1.00 1.00 ? 124 LYS A NZ   3  
ATOM 5820  H H    . LYS A 1 124 ? 13.224  -1.574  -20.205 1.00 1.00 ? 124 LYS A H    3  
ATOM 5821  H HA   . LYS A 1 124 ? 15.148  -1.250  -22.431 1.00 1.00 ? 124 LYS A HA   3  
ATOM 5822  H HB2  . LYS A 1 124 ? 15.142  0.265   -19.799 1.00 1.00 ? 124 LYS A HB2  3  
ATOM 5823  H HB3  . LYS A 1 124 ? 15.947  0.699   -21.305 1.00 1.00 ? 124 LYS A HB3  3  
ATOM 5824  H HG2  . LYS A 1 124 ? 12.958  0.755   -20.715 1.00 1.00 ? 124 LYS A HG2  3  
ATOM 5825  H HG3  . LYS A 1 124 ? 14.020  2.143   -20.839 1.00 1.00 ? 124 LYS A HG3  3  
ATOM 5826  H HD2  . LYS A 1 124 ? 14.241  1.953   -23.195 1.00 1.00 ? 124 LYS A HD2  3  
ATOM 5827  H HD3  . LYS A 1 124 ? 13.632  0.289   -23.224 1.00 1.00 ? 124 LYS A HD3  3  
ATOM 5828  H HE2  . LYS A 1 124 ? 11.396  1.009   -22.548 1.00 1.00 ? 124 LYS A HE2  3  
ATOM 5829  H HE3  . LYS A 1 124 ? 11.957  2.681   -22.368 1.00 1.00 ? 124 LYS A HE3  3  
ATOM 5830  H HZ1  . LYS A 1 124 ? 12.030  1.221   -24.970 1.00 1.00 ? 124 LYS A HZ1  3  
ATOM 5831  H HZ2  . LYS A 1 124 ? 10.834  2.250   -24.537 1.00 1.00 ? 124 LYS A HZ2  3  
ATOM 5832  H HZ3  . LYS A 1 124 ? 12.353  2.821   -24.710 1.00 1.00 ? 124 LYS A HZ3  3  
ATOM 5833  N N    . SER A 1 125 ? 17.284  -1.916  -20.990 1.00 1.00 ? 125 SER A N    3  
ATOM 5834  C CA   . SER A 1 125 ? 18.442  -2.645  -20.445 1.00 1.00 ? 125 SER A CA   3  
ATOM 5835  C C    . SER A 1 125 ? 19.755  -1.887  -20.693 1.00 1.00 ? 125 SER A C    3  
ATOM 5836  O O    . SER A 1 125 ? 20.045  -1.550  -21.865 1.00 1.00 ? 125 SER A O    3  
ATOM 5837  C CB   . SER A 1 125 ? 18.503  -4.047  -21.053 1.00 1.00 ? 125 SER A CB   3  
ATOM 5838  O OG   . SER A 1 125 ? 19.460  -4.824  -20.349 1.00 1.00 ? 125 SER A OG   3  
ATOM 5839  O OXT  . SER A 1 125 ? 20.464  -1.582  -19.706 1.00 1.00 ? 125 SER A OXT  3  
ATOM 5840  H H    . SER A 1 125 ? 17.504  -1.219  -21.683 1.00 1.00 ? 125 SER A H    3  
ATOM 5841  H HA   . SER A 1 125 ? 18.315  -2.736  -19.372 1.00 1.00 ? 125 SER A HA   3  
ATOM 5842  H HB2  . SER A 1 125 ? 17.525  -4.522  -20.983 1.00 1.00 ? 125 SER A HB2  3  
ATOM 5843  H HB3  . SER A 1 125 ? 18.771  -3.968  -22.110 1.00 1.00 ? 125 SER A HB3  3  
ATOM 5844  H HG   . SER A 1 125 ? 19.518  -5.716  -20.756 1.00 1.00 ? 125 SER A HG   3  
ATOM 5845  N N    . MET A 1 1   ? 6.253   24.258  13.222  1.00 1.00 ? 1   MET A N    4  
ATOM 5846  C CA   . MET A 1 1   ? 6.929   23.788  11.972  1.00 1.00 ? 1   MET A CA   4  
ATOM 5847  C C    . MET A 1 1   ? 6.014   22.848  11.172  1.00 1.00 ? 1   MET A C    4  
ATOM 5848  O O    . MET A 1 1   ? 5.106   22.233  11.735  1.00 1.00 ? 1   MET A O    4  
ATOM 5849  C CB   . MET A 1 1   ? 8.292   23.103  12.248  1.00 1.00 ? 1   MET A CB   4  
ATOM 5850  C CG   . MET A 1 1   ? 9.382   24.042  12.792  1.00 1.00 ? 1   MET A CG   4  
ATOM 5851  S SD   . MET A 1 1   ? 9.790   25.448  11.713  1.00 1.00 ? 1   MET A SD   4  
ATOM 5852  C CE   . MET A 1 1   ? 11.131  26.198  12.683  1.00 1.00 ? 1   MET A CE   4  
ATOM 5853  H H1   . MET A 1 1   ? 5.371   24.700  13.006  1.00 1.00 ? 1   MET A H1   4  
ATOM 5854  H H2   . MET A 1 1   ? 6.063   23.482  13.841  1.00 1.00 ? 1   MET A H2   4  
ATOM 5855  H H3   . MET A 1 1   ? 6.820   24.930  13.718  1.00 1.00 ? 1   MET A H3   4  
ATOM 5856  H HA   . MET A 1 1   ? 7.115   24.660  11.338  1.00 1.00 ? 1   MET A HA   4  
ATOM 5857  H HB2  . MET A 1 1   ? 8.153   22.285  12.955  1.00 1.00 ? 1   MET A HB2  4  
ATOM 5858  H HB3  . MET A 1 1   ? 8.671   22.677  11.318  1.00 1.00 ? 1   MET A HB3  4  
ATOM 5859  H HG2  . MET A 1 1   ? 9.086   24.426  13.770  1.00 1.00 ? 1   MET A HG2  4  
ATOM 5860  H HG3  . MET A 1 1   ? 10.291  23.455  12.937  1.00 1.00 ? 1   MET A HG3  4  
ATOM 5861  H HE1  . MET A 1 1   ? 10.758  26.493  13.665  1.00 1.00 ? 1   MET A HE1  4  
ATOM 5862  H HE2  . MET A 1 1   ? 11.947  25.484  12.802  1.00 1.00 ? 1   MET A HE2  4  
ATOM 5863  H HE3  . MET A 1 1   ? 11.502  27.083  12.166  1.00 1.00 ? 1   MET A HE3  4  
ATOM 5864  N N    . ALA A 1 2   ? 6.245   22.725  9.858   1.00 1.00 ? 2   ALA A N    4  
ATOM 5865  C CA   . ALA A 1 2   ? 5.489   21.834  8.966   1.00 1.00 ? 2   ALA A CA   4  
ATOM 5866  C C    . ALA A 1 2   ? 5.862   20.346  9.148   1.00 1.00 ? 2   ALA A C    4  
ATOM 5867  O O    . ALA A 1 2   ? 6.929   20.007  9.669   1.00 1.00 ? 2   ALA A O    4  
ATOM 5868  C CB   . ALA A 1 2   ? 5.709   22.304  7.520   1.00 1.00 ? 2   ALA A CB   4  
ATOM 5869  H H    . ALA A 1 2   ? 7.015   23.240  9.447   1.00 1.00 ? 2   ALA A H    4  
ATOM 5870  H HA   . ALA A 1 2   ? 4.424   21.934  9.196   1.00 1.00 ? 2   ALA A HA   4  
ATOM 5871  H HB1  . ALA A 1 2   ? 5.109   21.700  6.835   1.00 1.00 ? 2   ALA A HB1  4  
ATOM 5872  H HB2  . ALA A 1 2   ? 5.406   23.347  7.418   1.00 1.00 ? 2   ALA A HB2  4  
ATOM 5873  H HB3  . ALA A 1 2   ? 6.760   22.204  7.245   1.00 1.00 ? 2   ALA A HB3  4  
ATOM 5874  N N    . SER A 1 3   ? 4.990   19.446  8.698   1.00 1.00 ? 3   SER A N    4  
ATOM 5875  C CA   . SER A 1 3   ? 5.209   17.992  8.701   1.00 1.00 ? 3   SER A CA   4  
ATOM 5876  C C    . SER A 1 3   ? 6.167   17.527  7.573   1.00 1.00 ? 3   SER A C    4  
ATOM 5877  O O    . SER A 1 3   ? 6.280   18.205  6.540   1.00 1.00 ? 3   SER A O    4  
ATOM 5878  C CB   . SER A 1 3   ? 3.846   17.273  8.599   1.00 1.00 ? 3   SER A CB   4  
ATOM 5879  O OG   . SER A 1 3   ? 3.054   17.764  7.518   1.00 1.00 ? 3   SER A OG   4  
ATOM 5880  H H    . SER A 1 3   ? 4.149   19.768  8.236   1.00 1.00 ? 3   SER A H    4  
ATOM 5881  H HA   . SER A 1 3   ? 5.654   17.717  9.660   1.00 1.00 ? 3   SER A HA   4  
ATOM 5882  H HB2  . SER A 1 3   ? 4.006   16.198  8.482   1.00 1.00 ? 3   SER A HB2  4  
ATOM 5883  H HB3  . SER A 1 3   ? 3.303   17.436  9.534   1.00 1.00 ? 3   SER A HB3  4  
ATOM 5884  H HG   . SER A 1 3   ? 2.201   17.280  7.495   1.00 1.00 ? 3   SER A HG   4  
ATOM 5885  N N    . PRO A 1 4   ? 6.863   16.379  7.743   1.00 1.00 ? 4   PRO A N    4  
ATOM 5886  C CA   . PRO A 1 4   ? 7.755   15.819  6.730   1.00 1.00 ? 4   PRO A CA   4  
ATOM 5887  C C    . PRO A 1 4   ? 6.972   15.172  5.574   1.00 1.00 ? 4   PRO A C    4  
ATOM 5888  O O    . PRO A 1 4   ? 5.791   14.846  5.700   1.00 1.00 ? 4   PRO A O    4  
ATOM 5889  C CB   . PRO A 1 4   ? 8.619   14.796  7.473   1.00 1.00 ? 4   PRO A CB   4  
ATOM 5890  C CG   . PRO A 1 4   ? 7.684   14.290  8.570   1.00 1.00 ? 4   PRO A CG   4  
ATOM 5891  C CD   . PRO A 1 4   ? 6.892   15.544  8.941   1.00 1.00 ? 4   PRO A CD   4  
ATOM 5892  H HA   . PRO A 1 4   ? 8.401   16.600  6.325   1.00 1.00 ? 4   PRO A HA   4  
ATOM 5893  H HB2  . PRO A 1 4   ? 8.959   13.985  6.827   1.00 1.00 ? 4   PRO A HB2  4  
ATOM 5894  H HB3  . PRO A 1 4   ? 9.472   15.303  7.931   1.00 1.00 ? 4   PRO A HB3  4  
ATOM 5895  H HG2  . PRO A 1 4   ? 7.010   13.537  8.164   1.00 1.00 ? 4   PRO A HG2  4  
ATOM 5896  H HG3  . PRO A 1 4   ? 8.237   13.892  9.423   1.00 1.00 ? 4   PRO A HG3  4  
ATOM 5897  H HD2  . PRO A 1 4   ? 5.893   15.263  9.266   1.00 1.00 ? 4   PRO A HD2  4  
ATOM 5898  H HD3  . PRO A 1 4   ? 7.407   16.076  9.743   1.00 1.00 ? 4   PRO A HD3  4  
ATOM 5899  N N    . HIS A 1 5   ? 7.657   14.953  4.446   1.00 1.00 ? 5   HIS A N    4  
ATOM 5900  C CA   . HIS A 1 5   ? 7.094   14.374  3.218   1.00 1.00 ? 5   HIS A CA   4  
ATOM 5901  C C    . HIS A 1 5   ? 8.201   13.750  2.330   1.00 1.00 ? 5   HIS A C    4  
ATOM 5902  O O    . HIS A 1 5   ? 9.387   14.071  2.477   1.00 1.00 ? 5   HIS A O    4  
ATOM 5903  C CB   . HIS A 1 5   ? 6.311   15.471  2.465   1.00 1.00 ? 5   HIS A CB   4  
ATOM 5904  C CG   . HIS A 1 5   ? 5.370   14.949  1.405   1.00 1.00 ? 5   HIS A CG   4  
ATOM 5905  N ND1  . HIS A 1 5   ? 5.644   14.779  0.064   1.00 1.00 ? 5   HIS A ND1  4  
ATOM 5906  C CD2  . HIS A 1 5   ? 4.070   14.561  1.601   1.00 1.00 ? 5   HIS A CD2  4  
ATOM 5907  C CE1  . HIS A 1 5   ? 4.538   14.296  -0.529  1.00 1.00 ? 5   HIS A CE1  4  
ATOM 5908  N NE2  . HIS A 1 5   ? 3.547   14.145  0.368   1.00 1.00 ? 5   HIS A NE2  4  
ATOM 5909  H H    . HIS A 1 5   ? 8.638   15.207  4.413   1.00 1.00 ? 5   HIS A H    4  
ATOM 5910  H HA   . HIS A 1 5   ? 6.399   13.576  3.493   1.00 1.00 ? 5   HIS A HA   4  
ATOM 5911  H HB2  . HIS A 1 5   ? 5.712   16.039  3.179   1.00 1.00 ? 5   HIS A HB2  4  
ATOM 5912  H HB3  . HIS A 1 5   ? 7.017   16.169  2.010   1.00 1.00 ? 5   HIS A HB3  4  
ATOM 5913  H HD1  . HIS A 1 5   ? 6.541   14.934  -0.396  1.00 1.00 ? 5   HIS A HD1  4  
ATOM 5914  H HD2  . HIS A 1 5   ? 3.543   14.577  2.548   1.00 1.00 ? 5   HIS A HD2  4  
ATOM 5915  H HE1  . HIS A 1 5   ? 4.465   14.054  -1.583  1.00 1.00 ? 5   HIS A HE1  4  
ATOM 5916  N N    . GLN A 1 6   ? 7.822   12.877  1.385   1.00 1.00 ? 6   GLN A N    4  
ATOM 5917  C CA   . GLN A 1 6   ? 8.736   12.350  0.358   1.00 1.00 ? 6   GLN A CA   4  
ATOM 5918  C C    . GLN A 1 6   ? 9.091   13.421  -0.693  1.00 1.00 ? 6   GLN A C    4  
ATOM 5919  O O    . GLN A 1 6   ? 8.276   14.295  -0.997  1.00 1.00 ? 6   GLN A O    4  
ATOM 5920  C CB   . GLN A 1 6   ? 8.095   11.143  -0.356  1.00 1.00 ? 6   GLN A CB   4  
ATOM 5921  C CG   . GLN A 1 6   ? 7.876   9.918   0.552   1.00 1.00 ? 6   GLN A CG   4  
ATOM 5922  C CD   . GLN A 1 6   ? 7.288   8.718   -0.201  1.00 1.00 ? 6   GLN A CD   4  
ATOM 5923  O OE1  . GLN A 1 6   ? 6.704   8.836   -1.274  1.00 1.00 ? 6   GLN A OE1  4  
ATOM 5924  N NE2  . GLN A 1 6   ? 7.417   7.514   0.315   1.00 1.00 ? 6   GLN A NE2  4  
ATOM 5925  H H    . GLN A 1 6   ? 6.840   12.654  1.300   1.00 1.00 ? 6   GLN A H    4  
ATOM 5926  H HA   . GLN A 1 6   ? 9.666   12.026  0.836   1.00 1.00 ? 6   GLN A HA   4  
ATOM 5927  H HB2  . GLN A 1 6   ? 7.136   11.449  -0.782  1.00 1.00 ? 6   GLN A HB2  4  
ATOM 5928  H HB3  . GLN A 1 6   ? 8.742   10.841  -1.183  1.00 1.00 ? 6   GLN A HB3  4  
ATOM 5929  H HG2  . GLN A 1 6   ? 8.834   9.624   0.981   1.00 1.00 ? 6   GLN A HG2  4  
ATOM 5930  H HG3  . GLN A 1 6   ? 7.202   10.174  1.368   1.00 1.00 ? 6   GLN A HG3  4  
ATOM 5931  H HE21 . GLN A 1 6   ? 7.886   7.377   1.198   1.00 1.00 ? 6   GLN A HE21 4  
ATOM 5932  H HE22 . GLN A 1 6   ? 7.043   6.731   -0.198  1.00 1.00 ? 6   GLN A HE22 4  
ATOM 5933  N N    . GLU A 1 7   ? 10.282  13.316  -1.295  1.00 1.00 ? 7   GLU A N    4  
ATOM 5934  C CA   . GLU A 1 7   ? 10.698  14.105  -2.460  1.00 1.00 ? 7   GLU A CA   4  
ATOM 5935  C C    . GLU A 1 7   ? 10.943  13.152  -3.654  1.00 1.00 ? 7   GLU A C    4  
ATOM 5936  O O    . GLU A 1 7   ? 11.663  12.158  -3.485  1.00 1.00 ? 7   GLU A O    4  
ATOM 5937  C CB   . GLU A 1 7   ? 11.962  14.915  -2.132  1.00 1.00 ? 7   GLU A CB   4  
ATOM 5938  C CG   . GLU A 1 7   ? 12.366  15.867  -3.265  1.00 1.00 ? 7   GLU A CG   4  
ATOM 5939  C CD   . GLU A 1 7   ? 13.675  16.601  -2.939  1.00 1.00 ? 7   GLU A CD   4  
ATOM 5940  O OE1  . GLU A 1 7   ? 13.648  17.588  -2.161  1.00 1.00 ? 7   GLU A OE1  4  
ATOM 5941  O OE2  . GLU A 1 7   ? 14.741  16.206  -3.470  1.00 1.00 ? 7   GLU A OE2  4  
ATOM 5942  H H    . GLU A 1 7   ? 10.913  12.577  -1.006  1.00 1.00 ? 7   GLU A H    4  
ATOM 5943  H HA   . GLU A 1 7   ? 9.909   14.816  -2.695  1.00 1.00 ? 7   GLU A HA   4  
ATOM 5944  H HB2  . GLU A 1 7   ? 11.766  15.507  -1.239  1.00 1.00 ? 7   GLU A HB2  4  
ATOM 5945  H HB3  . GLU A 1 7   ? 12.787  14.228  -1.926  1.00 1.00 ? 7   GLU A HB3  4  
ATOM 5946  H HG2  . GLU A 1 7   ? 12.499  15.302  -4.187  1.00 1.00 ? 7   GLU A HG2  4  
ATOM 5947  H HG3  . GLU A 1 7   ? 11.567  16.594  -3.421  1.00 1.00 ? 7   GLU A HG3  4  
ATOM 5948  N N    . PRO A 1 8   ? 10.373  13.433  -4.845  1.00 1.00 ? 8   PRO A N    4  
ATOM 5949  C CA   . PRO A 1 8   ? 10.554  12.626  -6.046  1.00 1.00 ? 8   PRO A CA   4  
ATOM 5950  C C    . PRO A 1 8   ? 11.923  12.881  -6.690  1.00 1.00 ? 8   PRO A C    4  
ATOM 5951  O O    . PRO A 1 8   ? 12.459  13.989  -6.649  1.00 1.00 ? 8   PRO A O    4  
ATOM 5952  C CB   . PRO A 1 8   ? 9.396   13.011  -6.962  1.00 1.00 ? 8   PRO A CB   4  
ATOM 5953  C CG   . PRO A 1 8   ? 9.166   14.480  -6.611  1.00 1.00 ? 8   PRO A CG   4  
ATOM 5954  C CD   . PRO A 1 8   ? 9.451   14.527  -5.112  1.00 1.00 ? 8   PRO A CD   4  
ATOM 5955  H HA   . PRO A 1 8   ? 10.475  11.569  -5.804  1.00 1.00 ? 8   PRO A HA   4  
ATOM 5956  H HB2  . PRO A 1 8   ? 9.641   12.872  -8.011  1.00 1.00 ? 8   PRO A HB2  4  
ATOM 5957  H HB3  . PRO A 1 8   ? 8.511   12.431  -6.696  1.00 1.00 ? 8   PRO A HB3  4  
ATOM 5958  H HG2  . PRO A 1 8   ? 9.890   15.101  -7.134  1.00 1.00 ? 8   PRO A HG2  4  
ATOM 5959  H HG3  . PRO A 1 8   ? 8.151   14.798  -6.837  1.00 1.00 ? 8   PRO A HG3  4  
ATOM 5960  H HD2  . PRO A 1 8   ? 9.897   15.485  -4.841  1.00 1.00 ? 8   PRO A HD2  4  
ATOM 5961  H HD3  . PRO A 1 8   ? 8.526   14.366  -4.556  1.00 1.00 ? 8   PRO A HD3  4  
ATOM 5962  N N    . LYS A 1 9   ? 12.486  11.835  -7.302  1.00 1.00 ? 9   LYS A N    4  
ATOM 5963  C CA   . LYS A 1 9   ? 13.808  11.812  -7.938  1.00 1.00 ? 9   LYS A CA   4  
ATOM 5964  C C    . LYS A 1 9   ? 13.761  11.298  -9.395  1.00 1.00 ? 9   LYS A C    4  
ATOM 5965  O O    . LYS A 1 9   ? 12.833  10.569  -9.759  1.00 1.00 ? 9   LYS A O    4  
ATOM 5966  C CB   . LYS A 1 9   ? 14.756  10.932  -7.097  1.00 1.00 ? 9   LYS A CB   4  
ATOM 5967  C CG   . LYS A 1 9   ? 15.137  11.527  -5.734  1.00 1.00 ? 9   LYS A CG   4  
ATOM 5968  C CD   . LYS A 1 9   ? 15.808  12.905  -5.853  1.00 1.00 ? 9   LYS A CD   4  
ATOM 5969  C CE   . LYS A 1 9   ? 16.478  13.254  -4.513  1.00 1.00 ? 9   LYS A CE   4  
ATOM 5970  N NZ   . LYS A 1 9   ? 16.886  14.684  -4.428  1.00 1.00 ? 9   LYS A NZ   4  
ATOM 5971  H H    . LYS A 1 9   ? 11.961  10.959  -7.315  1.00 1.00 ? 9   LYS A H    4  
ATOM 5972  H HA   . LYS A 1 9   ? 14.180  12.833  -7.971  1.00 1.00 ? 9   LYS A HA   4  
ATOM 5973  H HB2  . LYS A 1 9   ? 14.286  9.960   -6.932  1.00 1.00 ? 9   LYS A HB2  4  
ATOM 5974  H HB3  . LYS A 1 9   ? 15.677  10.753  -7.653  1.00 1.00 ? 9   LYS A HB3  4  
ATOM 5975  H HG2  . LYS A 1 9   ? 14.246  11.611  -5.109  1.00 1.00 ? 9   LYS A HG2  4  
ATOM 5976  H HG3  . LYS A 1 9   ? 15.827  10.831  -5.251  1.00 1.00 ? 9   LYS A HG3  4  
ATOM 5977  H HD2  . LYS A 1 9   ? 16.550  12.890  -6.658  1.00 1.00 ? 9   LYS A HD2  4  
ATOM 5978  H HD3  . LYS A 1 9   ? 15.056  13.657  -6.101  1.00 1.00 ? 9   LYS A HD3  4  
ATOM 5979  H HE2  . LYS A 1 9   ? 15.780  13.034  -3.698  1.00 1.00 ? 9   LYS A HE2  4  
ATOM 5980  H HE3  . LYS A 1 9   ? 17.351  12.608  -4.385  1.00 1.00 ? 9   LYS A HE3  4  
ATOM 5981  H HZ1  . LYS A 1 9   ? 16.071  15.287  -4.305  1.00 1.00 ? 9   LYS A HZ1  4  
ATOM 5982  H HZ2  . LYS A 1 9   ? 17.476  14.841  -3.622  1.00 1.00 ? 9   LYS A HZ2  4  
ATOM 5983  H HZ3  . LYS A 1 9   ? 17.396  14.981  -5.248  1.00 1.00 ? 9   LYS A HZ3  4  
ATOM 5984  N N    . PRO A 1 10  ? 14.755  11.672  -10.236 1.00 1.00 ? 10  PRO A N    4  
ATOM 5985  C CA   . PRO A 1 10  ? 14.800  11.333  -11.656 1.00 1.00 ? 10  PRO A CA   4  
ATOM 5986  C C    . PRO A 1 10  ? 14.449  9.865   -11.952 1.00 1.00 ? 10  PRO A C    4  
ATOM 5987  O O    . PRO A 1 10  ? 15.062  8.952   -11.399 1.00 1.00 ? 10  PRO A O    4  
ATOM 5988  C CB   . PRO A 1 10  ? 16.218  11.697  -12.116 1.00 1.00 ? 10  PRO A CB   4  
ATOM 5989  C CG   . PRO A 1 10  ? 16.542  12.908  -11.248 1.00 1.00 ? 10  PRO A CG   4  
ATOM 5990  C CD   . PRO A 1 10  ? 15.894  12.536  -9.918  1.00 1.00 ? 10  PRO A CD   4  
ATOM 5991  H HA   . PRO A 1 10  ? 14.101  11.996  -12.164 1.00 1.00 ? 10  PRO A HA   4  
ATOM 5992  H HB2  . PRO A 1 10  ? 16.914  10.894  -11.879 1.00 1.00 ? 10  PRO A HB2  4  
ATOM 5993  H HB3  . PRO A 1 10  ? 16.265  11.944  -13.175 1.00 1.00 ? 10  PRO A HB3  4  
ATOM 5994  H HG2  . PRO A 1 10  ? 17.618  13.057  -11.151 1.00 1.00 ? 10  PRO A HG2  4  
ATOM 5995  H HG3  . PRO A 1 10  ? 16.069  13.799  -11.660 1.00 1.00 ? 10  PRO A HG3  4  
ATOM 5996  H HD2  . PRO A 1 10  ? 16.618  11.985  -9.315  1.00 1.00 ? 10  PRO A HD2  4  
ATOM 5997  H HD3  . PRO A 1 10  ? 15.587  13.449  -9.406  1.00 1.00 ? 10  PRO A HD3  4  
ATOM 5998  N N    . GLY A 1 11  ? 13.448  9.654   -12.815 1.00 1.00 ? 11  GLY A N    4  
ATOM 5999  C CA   . GLY A 1 11  ? 13.066  8.348   -13.362 1.00 1.00 ? 11  GLY A CA   4  
ATOM 6000  C C    . GLY A 1 11  ? 12.170  7.485   -12.469 1.00 1.00 ? 11  GLY A C    4  
ATOM 6001  O O    . GLY A 1 11  ? 11.854  6.366   -12.874 1.00 1.00 ? 11  GLY A O    4  
ATOM 6002  H H    . GLY A 1 11  ? 12.891  10.446  -13.122 1.00 1.00 ? 11  GLY A H    4  
ATOM 6003  H HA2  . GLY A 1 11  ? 12.528  8.506   -14.294 1.00 1.00 ? 11  GLY A HA2  4  
ATOM 6004  H HA3  . GLY A 1 11  ? 13.961  7.764   -13.563 1.00 1.00 ? 11  GLY A HA3  4  
ATOM 6005  N N    . ASP A 1 12  ? 11.784  7.936   -11.269 1.00 1.00 ? 12  ASP A N    4  
ATOM 6006  C CA   . ASP A 1 12  ? 10.916  7.165   -10.375 1.00 1.00 ? 12  ASP A CA   4  
ATOM 6007  C C    . ASP A 1 12  ? 9.437   7.118   -10.813 1.00 1.00 ? 12  ASP A C    4  
ATOM 6008  O O    . ASP A 1 12  ? 8.954   7.941   -11.600 1.00 1.00 ? 12  ASP A O    4  
ATOM 6009  C CB   . ASP A 1 12  ? 11.122  7.542   -8.894  1.00 1.00 ? 12  ASP A CB   4  
ATOM 6010  C CG   . ASP A 1 12  ? 10.520  8.865   -8.374  1.00 1.00 ? 12  ASP A CG   4  
ATOM 6011  O OD1  . ASP A 1 12  ? 9.457   9.320   -8.854  1.00 1.00 ? 12  ASP A OD1  4  
ATOM 6012  O OD2  . ASP A 1 12  ? 11.096  9.384   -7.389  1.00 1.00 ? 12  ASP A OD2  4  
ATOM 6013  H H    . ASP A 1 12  ? 12.097  8.842   -10.959 1.00 1.00 ? 12  ASP A H    4  
ATOM 6014  H HA   . ASP A 1 12  ? 11.271  6.141   -10.440 1.00 1.00 ? 12  ASP A HA   4  
ATOM 6015  H HB2  . ASP A 1 12  ? 10.688  6.746   -8.290  1.00 1.00 ? 12  ASP A HB2  4  
ATOM 6016  H HB3  . ASP A 1 12  ? 12.195  7.540   -8.694  1.00 1.00 ? 12  ASP A HB3  4  
ATOM 6017  N N    . LEU A 1 13  ? 8.723   6.107   -10.302 1.00 1.00 ? 13  LEU A N    4  
ATOM 6018  C CA   . LEU A 1 13  ? 7.276   5.968   -10.427 1.00 1.00 ? 13  LEU A CA   4  
ATOM 6019  C C    . LEU A 1 13  ? 6.604   6.686   -9.252  1.00 1.00 ? 13  LEU A C    4  
ATOM 6020  O O    . LEU A 1 13  ? 6.852   6.357   -8.087  1.00 1.00 ? 13  LEU A O    4  
ATOM 6021  C CB   . LEU A 1 13  ? 6.862   4.478   -10.454 1.00 1.00 ? 13  LEU A CB   4  
ATOM 6022  C CG   . LEU A 1 13  ? 7.136   3.668   -11.739 1.00 1.00 ? 13  LEU A CG   4  
ATOM 6023  C CD1  . LEU A 1 13  ? 6.518   4.342   -12.971 1.00 1.00 ? 13  LEU A CD1  4  
ATOM 6024  C CD2  . LEU A 1 13  ? 8.623   3.371   -11.988 1.00 1.00 ? 13  LEU A CD2  4  
ATOM 6025  H H    . LEU A 1 13  ? 9.202   5.454   -9.694  1.00 1.00 ? 13  LEU A H    4  
ATOM 6026  H HA   . LEU A 1 13  ? 6.945   6.451   -11.344 1.00 1.00 ? 13  LEU A HA   4  
ATOM 6027  H HB2  . LEU A 1 13  ? 7.335   3.971   -9.611  1.00 1.00 ? 13  LEU A HB2  4  
ATOM 6028  H HB3  . LEU A 1 13  ? 5.785   4.434   -10.281 1.00 1.00 ? 13  LEU A HB3  4  
ATOM 6029  H HG   . LEU A 1 13  ? 6.633   2.708   -11.612 1.00 1.00 ? 13  LEU A HG   4  
ATOM 6030  H HD11 . LEU A 1 13  ? 6.564   3.662   -13.819 1.00 1.00 ? 13  LEU A HD11 4  
ATOM 6031  H HD12 . LEU A 1 13  ? 5.476   4.587   -12.766 1.00 1.00 ? 13  LEU A HD12 4  
ATOM 6032  H HD13 . LEU A 1 13  ? 7.059   5.255   -13.225 1.00 1.00 ? 13  LEU A HD13 4  
ATOM 6033  H HD21 . LEU A 1 13  ? 8.724   2.697   -12.839 1.00 1.00 ? 13  LEU A HD21 4  
ATOM 6034  H HD22 . LEU A 1 13  ? 9.175   4.286   -12.202 1.00 1.00 ? 13  LEU A HD22 4  
ATOM 6035  H HD23 . LEU A 1 13  ? 9.047   2.884   -11.107 1.00 1.00 ? 13  LEU A HD23 4  
ATOM 6036  N N    . ILE A 1 14  ? 5.697   7.618   -9.554  1.00 1.00 ? 14  ILE A N    4  
ATOM 6037  C CA   . ILE A 1 14  ? 4.810   8.249   -8.571  1.00 1.00 ? 14  ILE A CA   4  
ATOM 6038  C C    . ILE A 1 14  ? 3.456   7.559   -8.689  1.00 1.00 ? 14  ILE A C    4  
ATOM 6039  O O    . ILE A 1 14  ? 2.874   7.536   -9.771  1.00 1.00 ? 14  ILE A O    4  
ATOM 6040  C CB   . ILE A 1 14  ? 4.690   9.776   -8.795  1.00 1.00 ? 14  ILE A CB   4  
ATOM 6041  C CG1  . ILE A 1 14  ? 6.075   10.448  -8.642  1.00 1.00 ? 14  ILE A CG1  4  
ATOM 6042  C CG2  . ILE A 1 14  ? 3.674   10.376  -7.800  1.00 1.00 ? 14  ILE A CG2  4  
ATOM 6043  C CD1  . ILE A 1 14  ? 6.063   11.976  -8.764  1.00 1.00 ? 14  ILE A CD1  4  
ATOM 6044  H H    . ILE A 1 14  ? 5.487   7.781   -10.536 1.00 1.00 ? 14  ILE A H    4  
ATOM 6045  H HA   . ILE A 1 14  ? 5.199   8.083   -7.565  1.00 1.00 ? 14  ILE A HA   4  
ATOM 6046  H HB   . ILE A 1 14  ? 4.329   9.959   -9.809  1.00 1.00 ? 14  ILE A HB   4  
ATOM 6047  H HG12 . ILE A 1 14  ? 6.499   10.183  -7.672  1.00 1.00 ? 14  ILE A HG12 4  
ATOM 6048  H HG13 . ILE A 1 14  ? 6.738   10.064  -9.420  1.00 1.00 ? 14  ILE A HG13 4  
ATOM 6049  H HG21 . ILE A 1 14  ? 2.699   9.897   -7.895  1.00 1.00 ? 14  ILE A HG21 4  
ATOM 6050  H HG22 . ILE A 1 14  ? 4.036   10.240  -6.782  1.00 1.00 ? 14  ILE A HG22 4  
ATOM 6051  H HG23 . ILE A 1 14  ? 3.521   11.438  -7.994  1.00 1.00 ? 14  ILE A HG23 4  
ATOM 6052  H HD11 . ILE A 1 14  ? 7.089   12.345  -8.766  1.00 1.00 ? 14  ILE A HD11 4  
ATOM 6053  H HD12 . ILE A 1 14  ? 5.577   12.275  -9.692  1.00 1.00 ? 14  ILE A HD12 4  
ATOM 6054  H HD13 . ILE A 1 14  ? 5.547   12.417  -7.913  1.00 1.00 ? 14  ILE A HD13 4  
ATOM 6055  N N    . GLU A 1 15  ? 2.951   7.023   -7.585  1.00 1.00 ? 15  GLU A N    4  
ATOM 6056  C CA   . GLU A 1 15  ? 1.597   6.489   -7.504  1.00 1.00 ? 15  GLU A CA   4  
ATOM 6057  C C    . GLU A 1 15  ? 0.646   7.624   -7.099  1.00 1.00 ? 15  GLU A C    4  
ATOM 6058  O O    . GLU A 1 15  ? 0.795   8.179   -6.009  1.00 1.00 ? 15  GLU A O    4  
ATOM 6059  C CB   . GLU A 1 15  ? 1.544   5.329   -6.496  1.00 1.00 ? 15  GLU A CB   4  
ATOM 6060  C CG   . GLU A 1 15  ? 2.366   4.116   -6.949  1.00 1.00 ? 15  GLU A CG   4  
ATOM 6061  C CD   . GLU A 1 15  ? 2.201   2.926   -5.992  1.00 1.00 ? 15  GLU A CD   4  
ATOM 6062  O OE1  . GLU A 1 15  ? 2.301   3.122   -4.756  1.00 1.00 ? 15  GLU A OE1  4  
ATOM 6063  O OE2  . GLU A 1 15  ? 2.039   1.774   -6.456  1.00 1.00 ? 15  GLU A OE2  4  
ATOM 6064  H H    . GLU A 1 15  ? 3.454   7.150   -6.713  1.00 1.00 ? 15  GLU A H    4  
ATOM 6065  H HA   . GLU A 1 15  ? 1.308   6.108   -8.482  1.00 1.00 ? 15  GLU A HA   4  
ATOM 6066  H HB2  . GLU A 1 15  ? 1.913   5.670   -5.528  1.00 1.00 ? 15  GLU A HB2  4  
ATOM 6067  H HB3  . GLU A 1 15  ? 0.508   5.021   -6.372  1.00 1.00 ? 15  GLU A HB3  4  
ATOM 6068  H HG2  . GLU A 1 15  ? 2.055   3.829   -7.953  1.00 1.00 ? 15  GLU A HG2  4  
ATOM 6069  H HG3  . GLU A 1 15  ? 3.420   4.391   -6.990  1.00 1.00 ? 15  GLU A HG3  4  
ATOM 6070  N N    . ILE A 1 16  ? -0.303  7.996   -7.964  1.00 1.00 ? 16  ILE A N    4  
ATOM 6071  C CA   . ILE A 1 16  ? -1.326  9.018   -7.681  1.00 1.00 ? 16  ILE A CA   4  
ATOM 6072  C C    . ILE A 1 16  ? -2.663  8.319   -7.410  1.00 1.00 ? 16  ILE A C    4  
ATOM 6073  O O    . ILE A 1 16  ? -3.119  7.493   -8.204  1.00 1.00 ? 16  ILE A O    4  
ATOM 6074  C CB   . ILE A 1 16  ? -1.449  10.045  -8.841  1.00 1.00 ? 16  ILE A CB   4  
ATOM 6075  C CG1  . ILE A 1 16  ? -0.081  10.698  -9.161  1.00 1.00 ? 16  ILE A CG1  4  
ATOM 6076  C CG2  . ILE A 1 16  ? -2.521  11.103  -8.503  1.00 1.00 ? 16  ILE A CG2  4  
ATOM 6077  C CD1  . ILE A 1 16  ? -0.072  11.539  -10.445 1.00 1.00 ? 16  ILE A CD1  4  
ATOM 6078  H H    . ILE A 1 16  ? -0.363  7.542   -8.872  1.00 1.00 ? 16  ILE A H    4  
ATOM 6079  H HA   . ILE A 1 16  ? -1.053  9.566   -6.779  1.00 1.00 ? 16  ILE A HA   4  
ATOM 6080  H HB   . ILE A 1 16  ? -1.792  9.524   -9.734  1.00 1.00 ? 16  ILE A HB   4  
ATOM 6081  H HG12 . ILE A 1 16  ? 0.239   11.316  -8.324  1.00 1.00 ? 16  ILE A HG12 4  
ATOM 6082  H HG13 . ILE A 1 16  ? 0.665   9.916   -9.306  1.00 1.00 ? 16  ILE A HG13 4  
ATOM 6083  H HG21 . ILE A 1 16  ? -2.285  11.588  -7.558  1.00 1.00 ? 16  ILE A HG21 4  
ATOM 6084  H HG22 . ILE A 1 16  ? -2.581  11.858  -9.286  1.00 1.00 ? 16  ILE A HG22 4  
ATOM 6085  H HG23 . ILE A 1 16  ? -3.504  10.638  -8.423  1.00 1.00 ? 16  ILE A HG23 4  
ATOM 6086  H HD11 . ILE A 1 16  ? 0.957   11.828  -10.671 1.00 1.00 ? 16  ILE A HD11 4  
ATOM 6087  H HD12 . ILE A 1 16  ? -0.464  10.951  -11.278 1.00 1.00 ? 16  ILE A HD12 4  
ATOM 6088  H HD13 . ILE A 1 16  ? -0.666  12.444  -10.319 1.00 1.00 ? 16  ILE A HD13 4  
ATOM 6089  N N    . PHE A 1 17  ? -3.302  8.691   -6.303  1.00 1.00 ? 17  PHE A N    4  
ATOM 6090  C CA   . PHE A 1 17  ? -4.592  8.182   -5.851  1.00 1.00 ? 17  PHE A CA   4  
ATOM 6091  C C    . PHE A 1 17  ? -5.623  9.319   -5.900  1.00 1.00 ? 17  PHE A C    4  
ATOM 6092  O O    . PHE A 1 17  ? -5.681  10.179  -5.015  1.00 1.00 ? 17  PHE A O    4  
ATOM 6093  C CB   . PHE A 1 17  ? -4.431  7.589   -4.443  1.00 1.00 ? 17  PHE A CB   4  
ATOM 6094  C CG   . PHE A 1 17  ? -3.477  6.411   -4.389  1.00 1.00 ? 17  PHE A CG   4  
ATOM 6095  C CD1  . PHE A 1 17  ? -3.954  5.106   -4.615  1.00 1.00 ? 17  PHE A CD1  4  
ATOM 6096  C CD2  . PHE A 1 17  ? -2.106  6.621   -4.135  1.00 1.00 ? 17  PHE A CD2  4  
ATOM 6097  C CE1  . PHE A 1 17  ? -3.066  4.016   -4.581  1.00 1.00 ? 17  PHE A CE1  4  
ATOM 6098  C CE2  . PHE A 1 17  ? -1.219  5.532   -4.111  1.00 1.00 ? 17  PHE A CE2  4  
ATOM 6099  C CZ   . PHE A 1 17  ? -1.697  4.229   -4.334  1.00 1.00 ? 17  PHE A CZ   4  
ATOM 6100  H H    . PHE A 1 17  ? -2.877  9.415   -5.735  1.00 1.00 ? 17  PHE A H    4  
ATOM 6101  H HA   . PHE A 1 17  ? -4.930  7.382   -6.512  1.00 1.00 ? 17  PHE A HA   4  
ATOM 6102  H HB2  . PHE A 1 17  ? -4.074  8.362   -3.762  1.00 1.00 ? 17  PHE A HB2  4  
ATOM 6103  H HB3  . PHE A 1 17  ? -5.411  7.264   -4.086  1.00 1.00 ? 17  PHE A HB3  4  
ATOM 6104  H HD1  . PHE A 1 17  ? -5.002  4.937   -4.813  1.00 1.00 ? 17  PHE A HD1  4  
ATOM 6105  H HD2  . PHE A 1 17  ? -1.733  7.621   -3.967  1.00 1.00 ? 17  PHE A HD2  4  
ATOM 6106  H HE1  . PHE A 1 17  ? -3.437  3.014   -4.751  1.00 1.00 ? 17  PHE A HE1  4  
ATOM 6107  H HE2  . PHE A 1 17  ? -0.168  5.695   -3.920  1.00 1.00 ? 17  PHE A HE2  4  
ATOM 6108  H HZ   . PHE A 1 17  ? -1.012  3.393   -4.321  1.00 1.00 ? 17  PHE A HZ   4  
ATOM 6109  N N    . ARG A 1 18  ? -6.424  9.323   -6.969  1.00 1.00 ? 18  ARG A N    4  
ATOM 6110  C CA   . ARG A 1 18  ? -7.565  10.222  -7.167  1.00 1.00 ? 18  ARG A CA   4  
ATOM 6111  C C    . ARG A 1 18  ? -8.821  9.651   -6.483  1.00 1.00 ? 18  ARG A C    4  
ATOM 6112  O O    . ARG A 1 18  ? -8.814  8.519   -5.995  1.00 1.00 ? 18  ARG A O    4  
ATOM 6113  C CB   . ARG A 1 18  ? -7.804  10.452  -8.677  1.00 1.00 ? 18  ARG A CB   4  
ATOM 6114  C CG   . ARG A 1 18  ? -6.526  10.776  -9.473  1.00 1.00 ? 18  ARG A CG   4  
ATOM 6115  C CD   . ARG A 1 18  ? -6.864  11.290  -10.878 1.00 1.00 ? 18  ARG A CD   4  
ATOM 6116  N NE   . ARG A 1 18  ? -5.641  11.566  -11.659 1.00 1.00 ? 18  ARG A NE   4  
ATOM 6117  C CZ   . ARG A 1 18  ? -4.907  12.676  -11.653 1.00 1.00 ? 18  ARG A CZ   4  
ATOM 6118  N NH1  . ARG A 1 18  ? -5.157  13.692  -10.851 1.00 1.00 ? 18  ARG A NH1  4  
ATOM 6119  N NH2  . ARG A 1 18  ? -3.885  12.790  -12.474 1.00 1.00 ? 18  ARG A NH2  4  
ATOM 6120  H H    . ARG A 1 18  ? -6.335  8.554   -7.625  1.00 1.00 ? 18  ARG A H    4  
ATOM 6121  H HA   . ARG A 1 18  ? -7.345  11.184  -6.701  1.00 1.00 ? 18  ARG A HA   4  
ATOM 6122  H HB2  . ARG A 1 18  ? -8.265  9.563   -9.113  1.00 1.00 ? 18  ARG A HB2  4  
ATOM 6123  H HB3  . ARG A 1 18  ? -8.508  11.279  -8.791  1.00 1.00 ? 18  ARG A HB3  4  
ATOM 6124  H HG2  . ARG A 1 18  ? -5.944  11.529  -8.946  1.00 1.00 ? 18  ARG A HG2  4  
ATOM 6125  H HG3  . ARG A 1 18  ? -5.920  9.876   -9.570  1.00 1.00 ? 18  ARG A HG3  4  
ATOM 6126  H HD2  . ARG A 1 18  ? -7.450  10.529  -11.398 1.00 1.00 ? 18  ARG A HD2  4  
ATOM 6127  H HD3  . ARG A 1 18  ? -7.477  12.189  -10.807 1.00 1.00 ? 18  ARG A HD3  4  
ATOM 6128  H HE   . ARG A 1 18  ? -5.375  10.848  -12.318 1.00 1.00 ? 18  ARG A HE   4  
ATOM 6129  H HH11 . ARG A 1 18  ? -5.937  13.665  -10.213 1.00 1.00 ? 18  ARG A HH11 4  
ATOM 6130  H HH12 . ARG A 1 18  ? -4.584  14.526  -10.893 1.00 1.00 ? 18  ARG A HH12 4  
ATOM 6131  H HH21 . ARG A 1 18  ? -3.663  12.055  -13.130 1.00 1.00 ? 18  ARG A HH21 4  
ATOM 6132  H HH22 . ARG A 1 18  ? -3.356  13.652  -12.496 1.00 1.00 ? 18  ARG A HH22 4  
ATOM 6133  N N    . LEU A 1 19  ? -9.926  10.405  -6.486  1.00 1.00 ? 19  LEU A N    4  
ATOM 6134  C CA   . LEU A 1 19  ? -11.220 9.950   -5.969  1.00 1.00 ? 19  LEU A CA   4  
ATOM 6135  C C    . LEU A 1 19  ? -11.756 8.794   -6.840  1.00 1.00 ? 19  LEU A C    4  
ATOM 6136  O O    . LEU A 1 19  ? -12.216 9.016   -7.961  1.00 1.00 ? 19  LEU A O    4  
ATOM 6137  C CB   . LEU A 1 19  ? -12.218 11.130  -5.893  1.00 1.00 ? 19  LEU A CB   4  
ATOM 6138  C CG   . LEU A 1 19  ? -12.030 12.170  -4.761  1.00 1.00 ? 19  LEU A CG   4  
ATOM 6139  C CD1  . LEU A 1 19  ? -12.139 11.532  -3.368  1.00 1.00 ? 19  LEU A CD1  4  
ATOM 6140  C CD2  . LEU A 1 19  ? -10.726 12.978  -4.864  1.00 1.00 ? 19  LEU A CD2  4  
ATOM 6141  H H    . LEU A 1 19  ? -9.884  11.327  -6.890  1.00 1.00 ? 19  LEU A H    4  
ATOM 6142  H HA   . LEU A 1 19  ? -11.071 9.560   -4.962  1.00 1.00 ? 19  LEU A HA   4  
ATOM 6143  H HB2  . LEU A 1 19  ? -12.224 11.657  -6.851  1.00 1.00 ? 19  LEU A HB2  4  
ATOM 6144  H HB3  . LEU A 1 19  ? -13.219 10.711  -5.767  1.00 1.00 ? 19  LEU A HB3  4  
ATOM 6145  H HG   . LEU A 1 19  ? -12.850 12.884  -4.851  1.00 1.00 ? 19  LEU A HG   4  
ATOM 6146  H HD11 . LEU A 1 19  ? -11.285 10.881  -3.175  1.00 1.00 ? 19  LEU A HD11 4  
ATOM 6147  H HD12 . LEU A 1 19  ? -12.160 12.316  -2.609  1.00 1.00 ? 19  LEU A HD12 4  
ATOM 6148  H HD13 . LEU A 1 19  ? -13.060 10.951  -3.299  1.00 1.00 ? 19  LEU A HD13 4  
ATOM 6149  H HD21 . LEU A 1 19  ? -10.635 13.412  -5.859  1.00 1.00 ? 19  LEU A HD21 4  
ATOM 6150  H HD22 . LEU A 1 19  ? -10.747 13.788  -4.135  1.00 1.00 ? 19  LEU A HD22 4  
ATOM 6151  H HD23 . LEU A 1 19  ? -9.860  12.347  -4.660  1.00 1.00 ? 19  LEU A HD23 4  
ATOM 6152  N N    . GLY A 1 20  ? -11.669 7.560   -6.327  1.00 1.00 ? 20  GLY A N    4  
ATOM 6153  C CA   . GLY A 1 20  ? -12.181 6.338   -6.969  1.00 1.00 ? 20  GLY A CA   4  
ATOM 6154  C C    . GLY A 1 20  ? -11.249 5.675   -7.995  1.00 1.00 ? 20  GLY A C    4  
ATOM 6155  O O    . GLY A 1 20  ? -11.624 4.641   -8.549  1.00 1.00 ? 20  GLY A O    4  
ATOM 6156  H H    . GLY A 1 20  ? -11.246 7.459   -5.416  1.00 1.00 ? 20  GLY A H    4  
ATOM 6157  H HA2  . GLY A 1 20  ? -12.378 5.595   -6.195  1.00 1.00 ? 20  GLY A HA2  4  
ATOM 6158  H HA3  . GLY A 1 20  ? -13.109 6.568   -7.491  1.00 1.00 ? 20  GLY A HA3  4  
ATOM 6159  N N    . TYR A 1 21  ? -10.053 6.226   -8.255  1.00 1.00 ? 21  TYR A N    4  
ATOM 6160  C CA   . TYR A 1 21  ? -9.132  5.769   -9.306  1.00 1.00 ? 21  TYR A CA   4  
ATOM 6161  C C    . TYR A 1 21  ? -7.646  6.016   -8.980  1.00 1.00 ? 21  TYR A C    4  
ATOM 6162  O O    . TYR A 1 21  ? -7.268  7.100   -8.539  1.00 1.00 ? 21  TYR A O    4  
ATOM 6163  C CB   . TYR A 1 21  ? -9.469  6.456   -10.644 1.00 1.00 ? 21  TYR A CB   4  
ATOM 6164  C CG   . TYR A 1 21  ? -10.857 6.186   -11.200 1.00 1.00 ? 21  TYR A CG   4  
ATOM 6165  C CD1  . TYR A 1 21  ? -11.126 4.979   -11.873 1.00 1.00 ? 21  TYR A CD1  4  
ATOM 6166  C CD2  . TYR A 1 21  ? -11.877 7.148   -11.054 1.00 1.00 ? 21  TYR A CD2  4  
ATOM 6167  C CE1  . TYR A 1 21  ? -12.414 4.725   -12.386 1.00 1.00 ? 21  TYR A CE1  4  
ATOM 6168  C CE2  . TYR A 1 21  ? -13.166 6.901   -11.561 1.00 1.00 ? 21  TYR A CE2  4  
ATOM 6169  C CZ   . TYR A 1 21  ? -13.441 5.685   -12.229 1.00 1.00 ? 21  TYR A CZ   4  
ATOM 6170  O OH   . TYR A 1 21  ? -14.689 5.432   -12.719 1.00 1.00 ? 21  TYR A OH   4  
ATOM 6171  H H    . TYR A 1 21  ? -9.771  7.029   -7.718  1.00 1.00 ? 21  TYR A H    4  
ATOM 6172  H HA   . TYR A 1 21  ? -9.269  4.699   -9.421  1.00 1.00 ? 21  TYR A HA   4  
ATOM 6173  H HB2  . TYR A 1 21  ? -9.337  7.534   -10.528 1.00 1.00 ? 21  TYR A HB2  4  
ATOM 6174  H HB3  . TYR A 1 21  ? -8.745  6.130   -11.394 1.00 1.00 ? 21  TYR A HB3  4  
ATOM 6175  H HD1  . TYR A 1 21  ? -10.345 4.238   -11.988 1.00 1.00 ? 21  TYR A HD1  4  
ATOM 6176  H HD2  . TYR A 1 21  ? -11.673 8.076   -10.537 1.00 1.00 ? 21  TYR A HD2  4  
ATOM 6177  H HE1  . TYR A 1 21  ? -12.625 3.796   -12.894 1.00 1.00 ? 21  TYR A HE1  4  
ATOM 6178  H HE2  . TYR A 1 21  ? -13.944 7.641   -11.439 1.00 1.00 ? 21  TYR A HE2  4  
ATOM 6179  H HH   . TYR A 1 21  ? -15.317 6.153   -12.557 1.00 1.00 ? 21  TYR A HH   4  
ATOM 6180  N N    . GLU A 1 22  ? -6.793  5.033   -9.262  1.00 1.00 ? 22  GLU A N    4  
ATOM 6181  C CA   . GLU A 1 22  ? -5.328  5.105   -9.173  1.00 1.00 ? 22  GLU A CA   4  
ATOM 6182  C C    . GLU A 1 22  ? -4.705  5.299   -10.568 1.00 1.00 ? 22  GLU A C    4  
ATOM 6183  O O    . GLU A 1 22  ? -5.136  4.668   -11.532 1.00 1.00 ? 22  GLU A O    4  
ATOM 6184  C CB   . GLU A 1 22  ? -4.722  3.854   -8.483  1.00 1.00 ? 22  GLU A CB   4  
ATOM 6185  C CG   . GLU A 1 22  ? -5.675  2.759   -7.977  1.00 1.00 ? 22  GLU A CG   4  
ATOM 6186  C CD   . GLU A 1 22  ? -6.308  1.962   -9.125  1.00 1.00 ? 22  GLU A CD   4  
ATOM 6187  O OE1  . GLU A 1 22  ? -5.710  0.963   -9.585  1.00 1.00 ? 22  GLU A OE1  4  
ATOM 6188  O OE2  . GLU A 1 22  ? -7.404  2.345   -9.599  1.00 1.00 ? 22  GLU A OE2  4  
ATOM 6189  H H    . GLU A 1 22  ? -7.179  4.147   -9.585  1.00 1.00 ? 22  GLU A H    4  
ATOM 6190  H HA   . GLU A 1 22  ? -5.062  5.967   -8.564  1.00 1.00 ? 22  GLU A HA   4  
ATOM 6191  H HB2  . GLU A 1 22  ? -3.986  3.384   -9.142  1.00 1.00 ? 22  GLU A HB2  4  
ATOM 6192  H HB3  . GLU A 1 22  ? -4.172  4.210   -7.614  1.00 1.00 ? 22  GLU A HB3  4  
ATOM 6193  H HG2  . GLU A 1 22  ? -5.103  2.074   -7.349  1.00 1.00 ? 22  GLU A HG2  4  
ATOM 6194  H HG3  . GLU A 1 22  ? -6.448  3.200   -7.345  1.00 1.00 ? 22  GLU A HG3  4  
ATOM 6195  N N    . HIS A 1 23  ? -3.680  6.150   -10.689 1.00 1.00 ? 23  HIS A N    4  
ATOM 6196  C CA   . HIS A 1 23  ? -2.894  6.373   -11.914 1.00 1.00 ? 23  HIS A CA   4  
ATOM 6197  C C    . HIS A 1 23  ? -1.409  6.581   -11.560 1.00 1.00 ? 23  HIS A C    4  
ATOM 6198  O O    . HIS A 1 23  ? -1.081  7.432   -10.736 1.00 1.00 ? 23  HIS A O    4  
ATOM 6199  C CB   . HIS A 1 23  ? -3.414  7.621   -12.663 1.00 1.00 ? 23  HIS A CB   4  
ATOM 6200  C CG   . HIS A 1 23  ? -4.467  7.367   -13.720 1.00 1.00 ? 23  HIS A CG   4  
ATOM 6201  N ND1  . HIS A 1 23  ? -5.486  6.443   -13.669 1.00 1.00 ? 23  HIS A ND1  4  
ATOM 6202  C CD2  . HIS A 1 23  ? -4.586  8.022   -14.919 1.00 1.00 ? 23  HIS A CD2  4  
ATOM 6203  C CE1  . HIS A 1 23  ? -6.208  6.549   -14.797 1.00 1.00 ? 23  HIS A CE1  4  
ATOM 6204  N NE2  . HIS A 1 23  ? -5.691  7.497   -15.597 1.00 1.00 ? 23  HIS A NE2  4  
ATOM 6205  H H    . HIS A 1 23  ? -3.375  6.650   -9.850  1.00 1.00 ? 23  HIS A H    4  
ATOM 6206  H HA   . HIS A 1 23  ? -2.966  5.504   -12.572 1.00 1.00 ? 23  HIS A HA   4  
ATOM 6207  H HB2  . HIS A 1 23  ? -3.799  8.342   -11.940 1.00 1.00 ? 23  HIS A HB2  4  
ATOM 6208  H HB3  . HIS A 1 23  ? -2.571  8.105   -13.163 1.00 1.00 ? 23  HIS A HB3  4  
ATOM 6209  H HD1  . HIS A 1 23  ? -5.642  5.772   -12.919 1.00 1.00 ? 23  HIS A HD1  4  
ATOM 6210  H HD2  . HIS A 1 23  ? -3.939  8.810   -15.278 1.00 1.00 ? 23  HIS A HD2  4  
ATOM 6211  H HE1  . HIS A 1 23  ? -7.077  5.952   -15.035 1.00 1.00 ? 23  HIS A HE1  4  
ATOM 6212  N N    . TRP A 1 24  ? -0.487  5.833   -12.177 1.00 1.00 ? 24  TRP A N    4  
ATOM 6213  C CA   . TRP A 1 24  ? 0.953   5.993   -11.933 1.00 1.00 ? 24  TRP A CA   4  
ATOM 6214  C C    . TRP A 1 24  ? 1.580   6.925   -12.992 1.00 1.00 ? 24  TRP A C    4  
ATOM 6215  O O    . TRP A 1 24  ? 1.192   6.897   -14.160 1.00 1.00 ? 24  TRP A O    4  
ATOM 6216  C CB   . TRP A 1 24  ? 1.647   4.619   -11.903 1.00 1.00 ? 24  TRP A CB   4  
ATOM 6217  C CG   . TRP A 1 24  ? 1.110   3.513   -11.025 1.00 1.00 ? 24  TRP A CG   4  
ATOM 6218  C CD1  . TRP A 1 24  ? 1.503   2.227   -11.161 1.00 1.00 ? 24  TRP A CD1  4  
ATOM 6219  C CD2  . TRP A 1 24  ? 0.150   3.504   -9.906  1.00 1.00 ? 24  TRP A CD2  4  
ATOM 6220  N NE1  . TRP A 1 24  ? 0.808   1.422   -10.282 1.00 1.00 ? 24  TRP A NE1  4  
ATOM 6221  C CE2  . TRP A 1 24  ? -0.021  2.154   -9.469  1.00 1.00 ? 24  TRP A CE2  4  
ATOM 6222  C CE3  . TRP A 1 24  ? -0.580  4.472   -9.181  1.00 1.00 ? 24  TRP A CE3  4  
ATOM 6223  C CZ2  . TRP A 1 24  ? -0.863  1.788   -8.409  1.00 1.00 ? 24  TRP A CZ2  4  
ATOM 6224  C CZ3  . TRP A 1 24  ? -1.411  4.129   -8.101  1.00 1.00 ? 24  TRP A CZ3  4  
ATOM 6225  C CH2  . TRP A 1 24  ? -1.559  2.785   -7.715  1.00 1.00 ? 24  TRP A CH2  4  
ATOM 6226  H H    . TRP A 1 24  ? -0.771  5.150   -12.864 1.00 1.00 ? 24  TRP A H    4  
ATOM 6227  H HA   . TRP A 1 24  ? 1.118   6.453   -10.960 1.00 1.00 ? 24  TRP A HA   4  
ATOM 6228  H HB2  . TRP A 1 24  ? 1.648   4.233   -12.923 1.00 1.00 ? 24  TRP A HB2  4  
ATOM 6229  H HB3  . TRP A 1 24  ? 2.690   4.777   -11.623 1.00 1.00 ? 24  TRP A HB3  4  
ATOM 6230  H HD1  . TRP A 1 24  ? 2.228   1.877   -11.885 1.00 1.00 ? 24  TRP A HD1  4  
ATOM 6231  H HE1  . TRP A 1 24  ? 0.909   0.417   -10.234 1.00 1.00 ? 24  TRP A HE1  4  
ATOM 6232  H HE3  . TRP A 1 24  ? -0.470  5.506   -9.431  1.00 1.00 ? 24  TRP A HE3  4  
ATOM 6233  H HZ2  . TRP A 1 24  ? -0.954  0.751   -8.121  1.00 1.00 ? 24  TRP A HZ2  4  
ATOM 6234  H HZ3  . TRP A 1 24  ? -1.929  4.903   -7.552  1.00 1.00 ? 24  TRP A HZ3  4  
ATOM 6235  H HH2  . TRP A 1 24  ? -2.198  2.523   -6.883  1.00 1.00 ? 24  TRP A HH2  4  
ATOM 6236  N N    . ALA A 1 25  ? 2.571   7.730   -12.594 1.00 1.00 ? 25  ALA A N    4  
ATOM 6237  C CA   . ALA A 1 25  ? 3.299   8.675   -13.454 1.00 1.00 ? 25  ALA A CA   4  
ATOM 6238  C C    . ALA A 1 25  ? 4.825   8.468   -13.380 1.00 1.00 ? 25  ALA A C    4  
ATOM 6239  O O    . ALA A 1 25  ? 5.331   7.993   -12.363 1.00 1.00 ? 25  ALA A O    4  
ATOM 6240  C CB   . ALA A 1 25  ? 2.904   10.098  -13.030 1.00 1.00 ? 25  ALA A CB   4  
ATOM 6241  H H    . ALA A 1 25  ? 2.832   7.695   -11.611 1.00 1.00 ? 25  ALA A H    4  
ATOM 6242  H HA   . ALA A 1 25  ? 2.994   8.539   -14.493 1.00 1.00 ? 25  ALA A HA   4  
ATOM 6243  H HB1  . ALA A 1 25  ? 3.210   10.279  -11.998 1.00 1.00 ? 25  ALA A HB1  4  
ATOM 6244  H HB2  . ALA A 1 25  ? 3.391   10.829  -13.681 1.00 1.00 ? 25  ALA A HB2  4  
ATOM 6245  H HB3  . ALA A 1 25  ? 1.821   10.223  -13.106 1.00 1.00 ? 25  ALA A HB3  4  
ATOM 6246  N N    . LEU A 1 26  ? 5.552   8.845   -14.440 1.00 1.00 ? 26  LEU A N    4  
ATOM 6247  C CA   . LEU A 1 26  ? 7.021   8.813   -14.520 1.00 1.00 ? 26  LEU A CA   4  
ATOM 6248  C C    . LEU A 1 26  ? 7.553   10.236  -14.271 1.00 1.00 ? 26  LEU A C    4  
ATOM 6249  O O    . LEU A 1 26  ? 7.327   11.127  -15.084 1.00 1.00 ? 26  LEU A O    4  
ATOM 6250  C CB   . LEU A 1 26  ? 7.414   8.251   -15.918 1.00 1.00 ? 26  LEU A CB   4  
ATOM 6251  C CG   . LEU A 1 26  ? 8.826   7.651   -16.083 1.00 1.00 ? 26  LEU A CG   4  
ATOM 6252  C CD1  . LEU A 1 26  ? 9.942   8.640   -15.735 1.00 1.00 ? 26  LEU A CD1  4  
ATOM 6253  C CD2  . LEU A 1 26  ? 8.987   6.358   -15.266 1.00 1.00 ? 26  LEU A CD2  4  
ATOM 6254  H H    . LEU A 1 26  ? 5.070   9.264   -15.233 1.00 1.00 ? 26  LEU A H    4  
ATOM 6255  H HA   . LEU A 1 26  ? 7.409   8.157   -13.741 1.00 1.00 ? 26  LEU A HA   4  
ATOM 6256  H HB2  . LEU A 1 26  ? 6.708   7.464   -16.190 1.00 1.00 ? 26  LEU A HB2  4  
ATOM 6257  H HB3  . LEU A 1 26  ? 7.299   9.034   -16.673 1.00 1.00 ? 26  LEU A HB3  4  
ATOM 6258  H HG   . LEU A 1 26  ? 8.941   7.393   -17.138 1.00 1.00 ? 26  LEU A HG   4  
ATOM 6259  H HD11 . LEU A 1 26  ? 9.979   8.810   -14.660 1.00 1.00 ? 26  LEU A HD11 4  
ATOM 6260  H HD12 . LEU A 1 26  ? 10.903  8.239   -16.055 1.00 1.00 ? 26  LEU A HD12 4  
ATOM 6261  H HD13 . LEU A 1 26  ? 9.768   9.585   -16.248 1.00 1.00 ? 26  LEU A HD13 4  
ATOM 6262  H HD21 . LEU A 1 26  ? 9.945   5.896   -15.496 1.00 1.00 ? 26  LEU A HD21 4  
ATOM 6263  H HD22 . LEU A 1 26  ? 8.946   6.574   -14.199 1.00 1.00 ? 26  LEU A HD22 4  
ATOM 6264  H HD23 . LEU A 1 26  ? 8.192   5.654   -15.518 1.00 1.00 ? 26  LEU A HD23 4  
ATOM 6265  N N    . TYR A 1 27  ? 8.246   10.481  -13.158 1.00 1.00 ? 27  TYR A N    4  
ATOM 6266  C CA   . TYR A 1 27  ? 8.814   11.801  -12.831 1.00 1.00 ? 27  TYR A CA   4  
ATOM 6267  C C    . TYR A 1 27  ? 10.176  12.027  -13.505 1.00 1.00 ? 27  TYR A C    4  
ATOM 6268  O O    . TYR A 1 27  ? 11.052  11.164  -13.462 1.00 1.00 ? 27  TYR A O    4  
ATOM 6269  C CB   . TYR A 1 27  ? 8.908   11.946  -11.310 1.00 1.00 ? 27  TYR A CB   4  
ATOM 6270  C CG   . TYR A 1 27  ? 9.480   13.264  -10.825 1.00 1.00 ? 27  TYR A CG   4  
ATOM 6271  C CD1  . TYR A 1 27  ? 8.668   14.408  -10.719 1.00 1.00 ? 27  TYR A CD1  4  
ATOM 6272  C CD2  . TYR A 1 27  ? 10.831  13.339  -10.443 1.00 1.00 ? 27  TYR A CD2  4  
ATOM 6273  C CE1  . TYR A 1 27  ? 9.193   15.613  -10.214 1.00 1.00 ? 27  TYR A CE1  4  
ATOM 6274  C CE2  . TYR A 1 27  ? 11.360  14.531  -9.916  1.00 1.00 ? 27  TYR A CE2  4  
ATOM 6275  C CZ   . TYR A 1 27  ? 10.544  15.677  -9.802  1.00 1.00 ? 27  TYR A CZ   4  
ATOM 6276  O OH   . TYR A 1 27  ? 11.060  16.820  -9.274  1.00 1.00 ? 27  TYR A OH   4  
ATOM 6277  H H    . TYR A 1 27  ? 8.439   9.711   -12.524 1.00 1.00 ? 27  TYR A H    4  
ATOM 6278  H HA   . TYR A 1 27  ? 8.137   12.574  -13.193 1.00 1.00 ? 27  TYR A HA   4  
ATOM 6279  H HB2  . TYR A 1 27  ? 7.909   11.824  -10.896 1.00 1.00 ? 27  TYR A HB2  4  
ATOM 6280  H HB3  . TYR A 1 27  ? 9.525   11.137  -10.918 1.00 1.00 ? 27  TYR A HB3  4  
ATOM 6281  H HD1  . TYR A 1 27  ? 7.630   14.360  -11.009 1.00 1.00 ? 27  TYR A HD1  4  
ATOM 6282  H HD2  . TYR A 1 27  ? 11.450  12.460  -10.521 1.00 1.00 ? 27  TYR A HD2  4  
ATOM 6283  H HE1  . TYR A 1 27  ? 8.556   16.481  -10.119 1.00 1.00 ? 27  TYR A HE1  4  
ATOM 6284  H HE2  . TYR A 1 27  ? 12.381  14.572  -9.564  1.00 1.00 ? 27  TYR A HE2  4  
ATOM 6285  H HH   . TYR A 1 27  ? 10.408  17.527  -9.149  1.00 1.00 ? 27  TYR A HH   4  
ATOM 6286  N N    . ILE A 1 28  ? 10.381  13.203  -14.116 1.00 1.00 ? 28  ILE A N    4  
ATOM 6287  C CA   . ILE A 1 28  ? 11.563  13.451  -14.979 1.00 1.00 ? 28  ILE A CA   4  
ATOM 6288  C C    . ILE A 1 28  ? 12.610  14.431  -14.406 1.00 1.00 ? 28  ILE A C    4  
ATOM 6289  O O    . ILE A 1 28  ? 13.474  14.905  -15.140 1.00 1.00 ? 28  ILE A O    4  
ATOM 6290  C CB   . ILE A 1 28  ? 11.138  13.737  -16.440 1.00 1.00 ? 28  ILE A CB   4  
ATOM 6291  C CG1  . ILE A 1 28  ? 10.359  15.057  -16.603 1.00 1.00 ? 28  ILE A CG1  4  
ATOM 6292  C CG2  . ILE A 1 28  ? 10.336  12.538  -16.998 1.00 1.00 ? 28  ILE A CG2  4  
ATOM 6293  C CD1  . ILE A 1 28  ? 10.113  15.413  -18.074 1.00 1.00 ? 28  ILE A CD1  4  
ATOM 6294  H H    . ILE A 1 28  ? 9.635   13.903  -14.071 1.00 1.00 ? 28  ILE A H    4  
ATOM 6295  H HA   . ILE A 1 28  ? 12.139  12.524  -15.036 1.00 1.00 ? 28  ILE A HA   4  
ATOM 6296  H HB   . ILE A 1 28  ? 12.052  13.813  -17.034 1.00 1.00 ? 28  ILE A HB   4  
ATOM 6297  H HG12 . ILE A 1 28  ? 9.394   14.972  -16.108 1.00 1.00 ? 28  ILE A HG12 4  
ATOM 6298  H HG13 . ILE A 1 28  ? 10.921  15.870  -16.144 1.00 1.00 ? 28  ILE A HG13 4  
ATOM 6299  H HG21 . ILE A 1 28  ? 9.316   12.519  -16.600 1.00 1.00 ? 28  ILE A HG21 4  
ATOM 6300  H HG22 . ILE A 1 28  ? 10.284  12.596  -18.084 1.00 1.00 ? 28  ILE A HG22 4  
ATOM 6301  H HG23 . ILE A 1 28  ? 10.835  11.603  -16.746 1.00 1.00 ? 28  ILE A HG23 4  
ATOM 6302  H HD11 . ILE A 1 28  ? 11.054  15.380  -18.626 1.00 1.00 ? 28  ILE A HD11 4  
ATOM 6303  H HD12 . ILE A 1 28  ? 9.406   14.709  -18.511 1.00 1.00 ? 28  ILE A HD12 4  
ATOM 6304  H HD13 . ILE A 1 28  ? 9.690   16.414  -18.138 1.00 1.00 ? 28  ILE A HD13 4  
ATOM 6305  N N    . GLY A 1 29  ? 12.556  14.726  -13.099 1.00 1.00 ? 29  GLY A N    4  
ATOM 6306  C CA   . GLY A 1 29  ? 13.603  15.458  -12.354 1.00 1.00 ? 29  GLY A CA   4  
ATOM 6307  C C    . GLY A 1 29  ? 13.434  16.978  -12.258 1.00 1.00 ? 29  GLY A C    4  
ATOM 6308  O O    . GLY A 1 29  ? 13.911  17.581  -11.298 1.00 1.00 ? 29  GLY A O    4  
ATOM 6309  H H    . GLY A 1 29  ? 11.788  14.345  -12.562 1.00 1.00 ? 29  GLY A H    4  
ATOM 6310  H HA2  . GLY A 1 29  ? 13.653  15.077  -11.334 1.00 1.00 ? 29  GLY A HA2  4  
ATOM 6311  H HA3  . GLY A 1 29  ? 14.569  15.285  -12.831 1.00 1.00 ? 29  GLY A HA3  4  
ATOM 6312  N N    . ASP A 1 30  ? 12.764  17.601  -13.230 1.00 1.00 ? 30  ASP A N    4  
ATOM 6313  C CA   . ASP A 1 30  ? 12.682  19.070  -13.378 1.00 1.00 ? 30  ASP A CA   4  
ATOM 6314  C C    . ASP A 1 30  ? 11.413  19.690  -12.741 1.00 1.00 ? 30  ASP A C    4  
ATOM 6315  O O    . ASP A 1 30  ? 11.061  20.837  -13.023 1.00 1.00 ? 30  ASP A O    4  
ATOM 6316  C CB   . ASP A 1 30  ? 12.799  19.390  -14.879 1.00 1.00 ? 30  ASP A CB   4  
ATOM 6317  C CG   . ASP A 1 30  ? 13.100  20.875  -15.167 1.00 1.00 ? 30  ASP A CG   4  
ATOM 6318  O OD1  . ASP A 1 30  ? 14.041  21.435  -14.552 1.00 1.00 ? 30  ASP A OD1  4  
ATOM 6319  O OD2  . ASP A 1 30  ? 12.430  21.462  -16.051 1.00 1.00 ? 30  ASP A OD2  4  
ATOM 6320  H H    . ASP A 1 30  ? 12.460  17.034  -14.010 1.00 1.00 ? 30  ASP A H    4  
ATOM 6321  H HA   . ASP A 1 30  ? 13.540  19.515  -12.871 1.00 1.00 ? 30  ASP A HA   4  
ATOM 6322  H HB2  . ASP A 1 30  ? 13.613  18.800  -15.304 1.00 1.00 ? 30  ASP A HB2  4  
ATOM 6323  H HB3  . ASP A 1 30  ? 11.879  19.085  -15.380 1.00 1.00 ? 30  ASP A HB3  4  
ATOM 6324  N N    . GLY A 1 31  ? 10.690  18.916  -11.916 1.00 1.00 ? 31  GLY A N    4  
ATOM 6325  C CA   . GLY A 1 31  ? 9.351   19.259  -11.401 1.00 1.00 ? 31  GLY A CA   4  
ATOM 6326  C C    . GLY A 1 31  ? 8.226   18.762  -12.316 1.00 1.00 ? 31  GLY A C    4  
ATOM 6327  O O    . GLY A 1 31  ? 7.048   18.875  -11.980 1.00 1.00 ? 31  GLY A O    4  
ATOM 6328  H H    . GLY A 1 31  ? 11.076  18.014  -11.672 1.00 1.00 ? 31  GLY A H    4  
ATOM 6329  H HA2  . GLY A 1 31  ? 9.204   18.804  -10.422 1.00 1.00 ? 31  GLY A HA2  4  
ATOM 6330  H HA3  . GLY A 1 31  ? 9.253   20.342  -11.315 1.00 1.00 ? 31  GLY A HA3  4  
ATOM 6331  N N    . TYR A 1 32  ? 8.581   18.188  -13.471 1.00 1.00 ? 32  TYR A N    4  
ATOM 6332  C CA   . TYR A 1 32  ? 7.660   17.646  -14.471 1.00 1.00 ? 32  TYR A CA   4  
ATOM 6333  C C    . TYR A 1 32  ? 7.457   16.129  -14.337 1.00 1.00 ? 32  TYR A C    4  
ATOM 6334  O O    . TYR A 1 32  ? 8.321   15.395  -13.855 1.00 1.00 ? 32  TYR A O    4  
ATOM 6335  C CB   . TYR A 1 32  ? 8.159   18.027  -15.879 1.00 1.00 ? 32  TYR A CB   4  
ATOM 6336  C CG   . TYR A 1 32  ? 7.870   19.466  -16.266 1.00 1.00 ? 32  TYR A CG   4  
ATOM 6337  C CD1  . TYR A 1 32  ? 8.725   20.503  -15.848 1.00 1.00 ? 32  TYR A CD1  4  
ATOM 6338  C CD2  . TYR A 1 32  ? 6.737   19.770  -17.045 1.00 1.00 ? 32  TYR A CD2  4  
ATOM 6339  C CE1  . TYR A 1 32  ? 8.446   21.838  -16.191 1.00 1.00 ? 32  TYR A CE1  4  
ATOM 6340  C CE2  . TYR A 1 32  ? 6.447   21.103  -17.391 1.00 1.00 ? 32  TYR A CE2  4  
ATOM 6341  C CZ   . TYR A 1 32  ? 7.304   22.146  -16.965 1.00 1.00 ? 32  TYR A CZ   4  
ATOM 6342  O OH   . TYR A 1 32  ? 7.024   23.438  -17.298 1.00 1.00 ? 32  TYR A OH   4  
ATOM 6343  H H    . TYR A 1 32  ? 9.573   18.123  -13.662 1.00 1.00 ? 32  TYR A H    4  
ATOM 6344  H HA   . TYR A 1 32  ? 6.687   18.113  -14.330 1.00 1.00 ? 32  TYR A HA   4  
ATOM 6345  H HB2  . TYR A 1 32  ? 9.232   17.850  -15.948 1.00 1.00 ? 32  TYR A HB2  4  
ATOM 6346  H HB3  . TYR A 1 32  ? 7.682   17.380  -16.619 1.00 1.00 ? 32  TYR A HB3  4  
ATOM 6347  H HD1  . TYR A 1 32  ? 9.602   20.275  -15.259 1.00 1.00 ? 32  TYR A HD1  4  
ATOM 6348  H HD2  . TYR A 1 32  ? 6.087   18.975  -17.379 1.00 1.00 ? 32  TYR A HD2  4  
ATOM 6349  H HE1  . TYR A 1 32  ? 9.116   22.626  -15.870 1.00 1.00 ? 32  TYR A HE1  4  
ATOM 6350  H HE2  . TYR A 1 32  ? 5.573   21.342  -17.982 1.00 1.00 ? 32  TYR A HE2  4  
ATOM 6351  H HH   . TYR A 1 32  ? 7.686   24.072  -16.981 1.00 1.00 ? 32  TYR A HH   4  
ATOM 6352  N N    . VAL A 1 33  ? 6.312   15.657  -14.828 1.00 1.00 ? 33  VAL A N    4  
ATOM 6353  C CA   . VAL A 1 33  ? 5.952   14.238  -14.944 1.00 1.00 ? 33  VAL A CA   4  
ATOM 6354  C C    . VAL A 1 33  ? 5.505   13.921  -16.368 1.00 1.00 ? 33  VAL A C    4  
ATOM 6355  O O    . VAL A 1 33  ? 4.981   14.785  -17.070 1.00 1.00 ? 33  VAL A O    4  
ATOM 6356  C CB   . VAL A 1 33  ? 4.826   13.838  -13.961 1.00 1.00 ? 33  VAL A CB   4  
ATOM 6357  C CG1  . VAL A 1 33  ? 5.325   13.845  -12.511 1.00 1.00 ? 33  VAL A CG1  4  
ATOM 6358  C CG2  . VAL A 1 33  ? 3.591   14.741  -14.082 1.00 1.00 ? 33  VAL A CG2  4  
ATOM 6359  H H    . VAL A 1 33  ? 5.649   16.335  -15.223 1.00 1.00 ? 33  VAL A H    4  
ATOM 6360  H HA   . VAL A 1 33  ? 6.831   13.628  -14.730 1.00 1.00 ? 33  VAL A HA   4  
ATOM 6361  H HB   . VAL A 1 33  ? 4.524   12.818  -14.195 1.00 1.00 ? 33  VAL A HB   4  
ATOM 6362  H HG11 . VAL A 1 33  ? 4.528   13.519  -11.843 1.00 1.00 ? 33  VAL A HG11 4  
ATOM 6363  H HG12 . VAL A 1 33  ? 6.165   13.161  -12.410 1.00 1.00 ? 33  VAL A HG12 4  
ATOM 6364  H HG13 . VAL A 1 33  ? 5.639   14.845  -12.221 1.00 1.00 ? 33  VAL A HG13 4  
ATOM 6365  H HG21 . VAL A 1 33  ? 3.811   15.740  -13.708 1.00 1.00 ? 33  VAL A HG21 4  
ATOM 6366  H HG22 . VAL A 1 33  ? 3.279   14.822  -15.125 1.00 1.00 ? 33  VAL A HG22 4  
ATOM 6367  H HG23 . VAL A 1 33  ? 2.774   14.318  -13.496 1.00 1.00 ? 33  VAL A HG23 4  
ATOM 6368  N N    . ILE A 1 34  ? 5.687   12.670  -16.775 1.00 1.00 ? 34  ILE A N    4  
ATOM 6369  C CA   . ILE A 1 34  ? 5.142   12.096  -18.011 1.00 1.00 ? 34  ILE A CA   4  
ATOM 6370  C C    . ILE A 1 34  ? 4.194   10.950  -17.626 1.00 1.00 ? 34  ILE A C    4  
ATOM 6371  O O    . ILE A 1 34  ? 4.472   10.182  -16.709 1.00 1.00 ? 34  ILE A O    4  
ATOM 6372  C CB   . ILE A 1 34  ? 6.312   11.690  -18.944 1.00 1.00 ? 34  ILE A CB   4  
ATOM 6373  C CG1  . ILE A 1 34  ? 6.931   12.989  -19.515 1.00 1.00 ? 34  ILE A CG1  4  
ATOM 6374  C CG2  . ILE A 1 34  ? 5.821   10.759  -20.075 1.00 1.00 ? 34  ILE A CG2  4  
ATOM 6375  C CD1  . ILE A 1 34  ? 8.178   12.803  -20.383 1.00 1.00 ? 34  ILE A CD1  4  
ATOM 6376  H H    . ILE A 1 34  ? 6.186   12.033  -16.147 1.00 1.00 ? 34  ILE A H    4  
ATOM 6377  H HA   . ILE A 1 34  ? 4.535   12.842  -18.524 1.00 1.00 ? 34  ILE A HA   4  
ATOM 6378  H HB   . ILE A 1 34  ? 7.079   11.175  -18.358 1.00 1.00 ? 34  ILE A HB   4  
ATOM 6379  H HG12 . ILE A 1 34  ? 6.179   13.510  -20.103 1.00 1.00 ? 34  ILE A HG12 4  
ATOM 6380  H HG13 . ILE A 1 34  ? 7.219   13.640  -18.690 1.00 1.00 ? 34  ILE A HG13 4  
ATOM 6381  H HG21 . ILE A 1 34  ? 5.001   11.227  -20.620 1.00 1.00 ? 34  ILE A HG21 4  
ATOM 6382  H HG22 . ILE A 1 34  ? 6.624   10.536  -20.775 1.00 1.00 ? 34  ILE A HG22 4  
ATOM 6383  H HG23 . ILE A 1 34  ? 5.481   9.808   -19.668 1.00 1.00 ? 34  ILE A HG23 4  
ATOM 6384  H HD11 . ILE A 1 34  ? 8.581   13.780  -20.657 1.00 1.00 ? 34  ILE A HD11 4  
ATOM 6385  H HD12 . ILE A 1 34  ? 8.939   12.253  -19.836 1.00 1.00 ? 34  ILE A HD12 4  
ATOM 6386  H HD13 . ILE A 1 34  ? 7.933   12.274  -21.299 1.00 1.00 ? 34  ILE A HD13 4  
ATOM 6387  N N    . HIS A 1 35  ? 3.047   10.848  -18.289 1.00 1.00 ? 35  HIS A N    4  
ATOM 6388  C CA   . HIS A 1 35  ? 1.959   9.939   -17.912 1.00 1.00 ? 35  HIS A CA   4  
ATOM 6389  C C    . HIS A 1 35  ? 1.002   9.727   -19.095 1.00 1.00 ? 35  HIS A C    4  
ATOM 6390  O O    . HIS A 1 35  ? 1.068   10.464  -20.077 1.00 1.00 ? 35  HIS A O    4  
ATOM 6391  C CB   . HIS A 1 35  ? 1.203   10.548  -16.711 1.00 1.00 ? 35  HIS A CB   4  
ATOM 6392  C CG   . HIS A 1 35  ? 0.476   11.832  -17.048 1.00 1.00 ? 35  HIS A CG   4  
ATOM 6393  N ND1  . HIS A 1 35  ? -0.860  11.958  -17.366 1.00 1.00 ? 35  HIS A ND1  4  
ATOM 6394  C CD2  . HIS A 1 35  ? 1.037   13.077  -17.176 1.00 1.00 ? 35  HIS A CD2  4  
ATOM 6395  C CE1  . HIS A 1 35  ? -1.093  13.249  -17.674 1.00 1.00 ? 35  HIS A CE1  4  
ATOM 6396  N NE2  . HIS A 1 35  ? 0.037   13.971  -17.574 1.00 1.00 ? 35  HIS A NE2  4  
ATOM 6397  H H    . HIS A 1 35  ? 2.842   11.499  -19.050 1.00 1.00 ? 35  HIS A H    4  
ATOM 6398  H HA   . HIS A 1 35  ? 2.372   8.968   -17.627 1.00 1.00 ? 35  HIS A HA   4  
ATOM 6399  H HB2  . HIS A 1 35  ? 0.477   9.823   -16.337 1.00 1.00 ? 35  HIS A HB2  4  
ATOM 6400  H HB3  . HIS A 1 35  ? 1.907   10.749  -15.901 1.00 1.00 ? 35  HIS A HB3  4  
ATOM 6401  H HD1  . HIS A 1 35  ? -1.543  11.207  -17.413 1.00 1.00 ? 35  HIS A HD1  4  
ATOM 6402  H HD2  . HIS A 1 35  ? 2.081   13.313  -17.027 1.00 1.00 ? 35  HIS A HD2  4  
ATOM 6403  H HE1  . HIS A 1 35  ? -2.055  13.644  -17.976 1.00 1.00 ? 35  HIS A HE1  4  
ATOM 6404  N N    . LEU A 1 36  ? 0.087   8.755   -19.002 1.00 1.00 ? 36  LEU A N    4  
ATOM 6405  C CA   . LEU A 1 36  ? -1.012  8.618   -19.963 1.00 1.00 ? 36  LEU A CA   4  
ATOM 6406  C C    . LEU A 1 36  ? -2.214  9.440   -19.465 1.00 1.00 ? 36  LEU A C    4  
ATOM 6407  O O    . LEU A 1 36  ? -2.395  9.603   -18.255 1.00 1.00 ? 36  LEU A O    4  
ATOM 6408  C CB   . LEU A 1 36  ? -1.354  7.121   -20.125 1.00 1.00 ? 36  LEU A CB   4  
ATOM 6409  C CG   . LEU A 1 36  ? -2.044  6.766   -21.459 1.00 1.00 ? 36  LEU A CG   4  
ATOM 6410  C CD1  . LEU A 1 36  ? -1.069  6.818   -22.640 1.00 1.00 ? 36  LEU A CD1  4  
ATOM 6411  C CD2  . LEU A 1 36  ? -2.623  5.348   -21.403 1.00 1.00 ? 36  LEU A CD2  4  
ATOM 6412  H H    . LEU A 1 36  ? 0.049   8.181   -18.168 1.00 1.00 ? 36  LEU A H    4  
ATOM 6413  H HA   . LEU A 1 36  ? -0.697  9.031   -20.921 1.00 1.00 ? 36  LEU A HA   4  
ATOM 6414  H HB2  . LEU A 1 36  ? -0.443  6.526   -20.052 1.00 1.00 ? 36  LEU A HB2  4  
ATOM 6415  H HB3  . LEU A 1 36  ? -2.006  6.840   -19.296 1.00 1.00 ? 36  LEU A HB3  4  
ATOM 6416  H HG   . LEU A 1 36  ? -2.858  7.465   -21.638 1.00 1.00 ? 36  LEU A HG   4  
ATOM 6417  H HD11 . LEU A 1 36  ? -1.611  6.663   -23.572 1.00 1.00 ? 36  LEU A HD11 4  
ATOM 6418  H HD12 . LEU A 1 36  ? -0.585  7.787   -22.679 1.00 1.00 ? 36  LEU A HD12 4  
ATOM 6419  H HD13 . LEU A 1 36  ? -0.304  6.049   -22.532 1.00 1.00 ? 36  LEU A HD13 4  
ATOM 6420  H HD21 . LEU A 1 36  ? -3.074  5.091   -22.362 1.00 1.00 ? 36  LEU A HD21 4  
ATOM 6421  H HD22 . LEU A 1 36  ? -1.844  4.622   -21.171 1.00 1.00 ? 36  LEU A HD22 4  
ATOM 6422  H HD23 . LEU A 1 36  ? -3.402  5.301   -20.644 1.00 1.00 ? 36  LEU A HD23 4  
ATOM 6423  N N    . ALA A 1 37  ? -3.045  9.939   -20.378 1.00 1.00 ? 37  ALA A N    4  
ATOM 6424  C CA   . ALA A 1 37  ? -4.297  10.630  -20.079 1.00 1.00 ? 37  ALA A CA   4  
ATOM 6425  C C    . ALA A 1 37  ? -5.449  9.892   -20.788 1.00 1.00 ? 37  ALA A C    4  
ATOM 6426  O O    . ALA A 1 37  ? -5.402  9.782   -22.019 1.00 1.00 ? 37  ALA A O    4  
ATOM 6427  C CB   . ALA A 1 37  ? -4.167  12.082  -20.555 1.00 1.00 ? 37  ALA A CB   4  
ATOM 6428  H H    . ALA A 1 37  ? -2.797  9.848   -21.361 1.00 1.00 ? 37  ALA A H    4  
ATOM 6429  H HA   . ALA A 1 37  ? -4.464  10.650  -19.001 1.00 1.00 ? 37  ALA A HA   4  
ATOM 6430  H HB1  . ALA A 1 37  ? -3.348  12.571  -20.025 1.00 1.00 ? 37  ALA A HB1  4  
ATOM 6431  H HB2  . ALA A 1 37  ? -3.964  12.106  -21.628 1.00 1.00 ? 37  ALA A HB2  4  
ATOM 6432  H HB3  . ALA A 1 37  ? -5.093  12.623  -20.353 1.00 1.00 ? 37  ALA A HB3  4  
ATOM 6433  N N    . PRO A 1 38  ? -6.453  9.368   -20.057 1.00 1.00 ? 38  PRO A N    4  
ATOM 6434  C CA   . PRO A 1 38  ? -7.563  8.627   -20.646 1.00 1.00 ? 38  PRO A CA   4  
ATOM 6435  C C    . PRO A 1 38  ? -8.610  9.570   -21.276 1.00 1.00 ? 38  PRO A C    4  
ATOM 6436  O O    . PRO A 1 38  ? -8.665  10.750  -20.913 1.00 1.00 ? 38  PRO A O    4  
ATOM 6437  C CB   . PRO A 1 38  ? -8.150  7.817   -19.486 1.00 1.00 ? 38  PRO A CB   4  
ATOM 6438  C CG   . PRO A 1 38  ? -7.921  8.725   -18.284 1.00 1.00 ? 38  PRO A CG   4  
ATOM 6439  C CD   . PRO A 1 38  ? -6.567  9.361   -18.601 1.00 1.00 ? 38  PRO A CD   4  
ATOM 6440  H HA   . PRO A 1 38  ? -7.181  7.943   -21.399 1.00 1.00 ? 38  PRO A HA   4  
ATOM 6441  H HB2  . PRO A 1 38  ? -9.208  7.587   -19.628 1.00 1.00 ? 38  PRO A HB2  4  
ATOM 6442  H HB3  . PRO A 1 38  ? -7.573  6.902   -19.353 1.00 1.00 ? 38  PRO A HB3  4  
ATOM 6443  H HG2  . PRO A 1 38  ? -8.692  9.497   -18.250 1.00 1.00 ? 38  PRO A HG2  4  
ATOM 6444  H HG3  . PRO A 1 38  ? -7.894  8.160   -17.352 1.00 1.00 ? 38  PRO A HG3  4  
ATOM 6445  H HD2  . PRO A 1 38  ? -6.528  10.373  -18.194 1.00 1.00 ? 38  PRO A HD2  4  
ATOM 6446  H HD3  . PRO A 1 38  ? -5.769  8.748   -18.180 1.00 1.00 ? 38  PRO A HD3  4  
ATOM 6447  N N    . PRO A 1 39  ? -9.459  9.064   -22.196 1.00 1.00 ? 39  PRO A N    4  
ATOM 6448  C CA   . PRO A 1 39  ? -10.570 9.819   -22.767 1.00 1.00 ? 39  PRO A CA   4  
ATOM 6449  C C    . PRO A 1 39  ? -11.660 10.047  -21.711 1.00 1.00 ? 39  PRO A C    4  
ATOM 6450  O O    . PRO A 1 39  ? -12.280 9.106   -21.217 1.00 1.00 ? 39  PRO A O    4  
ATOM 6451  C CB   . PRO A 1 39  ? -11.062 8.990   -23.959 1.00 1.00 ? 39  PRO A CB   4  
ATOM 6452  C CG   . PRO A 1 39  ? -10.681 7.558   -23.579 1.00 1.00 ? 39  PRO A CG   4  
ATOM 6453  C CD   . PRO A 1 39  ? -9.393  7.733   -22.778 1.00 1.00 ? 39  PRO A CD   4  
ATOM 6454  H HA   . PRO A 1 39  ? -10.212 10.782  -23.131 1.00 1.00 ? 39  PRO A HA   4  
ATOM 6455  H HB2  . PRO A 1 39  ? -12.135 9.094   -24.122 1.00 1.00 ? 39  PRO A HB2  4  
ATOM 6456  H HB3  . PRO A 1 39  ? -10.515 9.285   -24.856 1.00 1.00 ? 39  PRO A HB3  4  
ATOM 6457  H HG2  . PRO A 1 39  ? -11.449 7.134   -22.932 1.00 1.00 ? 39  PRO A HG2  4  
ATOM 6458  H HG3  . PRO A 1 39  ? -10.525 6.934   -24.458 1.00 1.00 ? 39  PRO A HG3  4  
ATOM 6459  H HD2  . PRO A 1 39  ? -9.323  6.965   -22.010 1.00 1.00 ? 39  PRO A HD2  4  
ATOM 6460  H HD3  . PRO A 1 39  ? -8.536  7.675   -23.449 1.00 1.00 ? 39  PRO A HD3  4  
ATOM 6461  N N    . SER A 1 40  ? -11.908 11.313  -21.363 1.00 1.00 ? 40  SER A N    4  
ATOM 6462  C CA   . SER A 1 40  ? -12.884 11.707  -20.329 1.00 1.00 ? 40  SER A CA   4  
ATOM 6463  C C    . SER A 1 40  ? -14.335 11.794  -20.845 1.00 1.00 ? 40  SER A C    4  
ATOM 6464  O O    . SER A 1 40  ? -15.281 11.698  -20.056 1.00 1.00 ? 40  SER A O    4  
ATOM 6465  C CB   . SER A 1 40  ? -12.455 13.059  -19.737 1.00 1.00 ? 40  SER A CB   4  
ATOM 6466  O OG   . SER A 1 40  ? -12.310 14.056  -20.748 1.00 1.00 ? 40  SER A OG   4  
ATOM 6467  H H    . SER A 1 40  ? -11.349 12.058  -21.757 1.00 1.00 ? 40  SER A H    4  
ATOM 6468  H HA   . SER A 1 40  ? -12.875 10.971  -19.524 1.00 1.00 ? 40  SER A HA   4  
ATOM 6469  H HB2  . SER A 1 40  ? -13.198 13.384  -19.005 1.00 1.00 ? 40  SER A HB2  4  
ATOM 6470  H HB3  . SER A 1 40  ? -11.501 12.928  -19.224 1.00 1.00 ? 40  SER A HB3  4  
ATOM 6471  H HG   . SER A 1 40  ? -12.059 14.909  -20.332 1.00 1.00 ? 40  SER A HG   4  
ATOM 6472  N N    . GLU A 1 41  ? -14.521 11.940  -22.164 1.00 1.00 ? 41  GLU A N    4  
ATOM 6473  C CA   . GLU A 1 41  ? -15.824 12.057  -22.839 1.00 1.00 ? 41  GLU A CA   4  
ATOM 6474  C C    . GLU A 1 41  ? -16.343 10.688  -23.350 1.00 1.00 ? 41  GLU A C    4  
ATOM 6475  O O    . GLU A 1 41  ? -17.176 10.615  -24.258 1.00 1.00 ? 41  GLU A O    4  
ATOM 6476  C CB   . GLU A 1 41  ? -15.702 13.118  -23.954 1.00 1.00 ? 41  GLU A CB   4  
ATOM 6477  C CG   . GLU A 1 41  ? -17.036 13.800  -24.294 1.00 1.00 ? 41  GLU A CG   4  
ATOM 6478  C CD   . GLU A 1 41  ? -16.826 14.943  -25.300 1.00 1.00 ? 41  GLU A CD   4  
ATOM 6479  O OE1  . GLU A 1 41  ? -16.777 14.677  -26.526 1.00 1.00 ? 41  GLU A OE1  4  
ATOM 6480  O OE2  . GLU A 1 41  ? -16.717 16.119  -24.877 1.00 1.00 ? 41  GLU A OE2  4  
ATOM 6481  H H    . GLU A 1 41  ? -13.689 12.009  -22.733 1.00 1.00 ? 41  GLU A H    4  
ATOM 6482  H HA   . GLU A 1 41  ? -16.549 12.424  -22.113 1.00 1.00 ? 41  GLU A HA   4  
ATOM 6483  H HB2  . GLU A 1 41  ? -15.018 13.900  -23.618 1.00 1.00 ? 41  GLU A HB2  4  
ATOM 6484  H HB3  . GLU A 1 41  ? -15.275 12.664  -24.850 1.00 1.00 ? 41  GLU A HB3  4  
ATOM 6485  H HG2  . GLU A 1 41  ? -17.735 13.077  -24.712 1.00 1.00 ? 41  GLU A HG2  4  
ATOM 6486  H HG3  . GLU A 1 41  ? -17.474 14.200  -23.376 1.00 1.00 ? 41  GLU A HG3  4  
ATOM 6487  N N    . TYR A 1 42  ? -15.838 9.579   -22.795 1.00 1.00 ? 42  TYR A N    4  
ATOM 6488  C CA   . TYR A 1 42  ? -16.189 8.213   -23.212 1.00 1.00 ? 42  TYR A CA   4  
ATOM 6489  C C    . TYR A 1 42  ? -17.720 7.950   -23.153 1.00 1.00 ? 42  TYR A C    4  
ATOM 6490  O O    . TYR A 1 42  ? -18.341 8.268   -22.130 1.00 1.00 ? 42  TYR A O    4  
ATOM 6491  C CB   . TYR A 1 42  ? -15.417 7.209   -22.344 1.00 1.00 ? 42  TYR A CB   4  
ATOM 6492  C CG   . TYR A 1 42  ? -15.349 5.818   -22.947 1.00 1.00 ? 42  TYR A CG   4  
ATOM 6493  C CD1  . TYR A 1 42  ? -16.437 4.931   -22.831 1.00 1.00 ? 42  TYR A CD1  4  
ATOM 6494  C CD2  . TYR A 1 42  ? -14.202 5.422   -23.659 1.00 1.00 ? 42  TYR A CD2  4  
ATOM 6495  C CE1  . TYR A 1 42  ? -16.398 3.673   -23.459 1.00 1.00 ? 42  TYR A CE1  4  
ATOM 6496  C CE2  . TYR A 1 42  ? -14.143 4.153   -24.266 1.00 1.00 ? 42  TYR A CE2  4  
ATOM 6497  C CZ   . TYR A 1 42  ? -15.252 3.281   -24.187 1.00 1.00 ? 42  TYR A CZ   4  
ATOM 6498  O OH   . TYR A 1 42  ? -15.213 2.079   -24.827 1.00 1.00 ? 42  TYR A OH   4  
ATOM 6499  H H    . TYR A 1 42  ? -15.170 9.684   -22.046 1.00 1.00 ? 42  TYR A H    4  
ATOM 6500  H HA   . TYR A 1 42  ? -15.838 8.102   -24.238 1.00 1.00 ? 42  TYR A HA   4  
ATOM 6501  H HB2  . TYR A 1 42  ? -14.396 7.569   -22.208 1.00 1.00 ? 42  TYR A HB2  4  
ATOM 6502  H HB3  . TYR A 1 42  ? -15.875 7.151   -21.356 1.00 1.00 ? 42  TYR A HB3  4  
ATOM 6503  H HD1  . TYR A 1 42  ? -17.312 5.220   -22.265 1.00 1.00 ? 42  TYR A HD1  4  
ATOM 6504  H HD2  . TYR A 1 42  ? -13.363 6.097   -23.734 1.00 1.00 ? 42  TYR A HD2  4  
ATOM 6505  H HE1  . TYR A 1 42  ? -17.244 3.007   -23.384 1.00 1.00 ? 42  TYR A HE1  4  
ATOM 6506  H HE2  . TYR A 1 42  ? -13.255 3.845   -24.793 1.00 1.00 ? 42  TYR A HE2  4  
ATOM 6507  H HH   . TYR A 1 42  ? -16.034 1.577   -24.737 1.00 1.00 ? 42  TYR A HH   4  
ATOM 6508  N N    . PRO A 1 43  ? -18.340 7.373   -24.208 1.00 1.00 ? 43  PRO A N    4  
ATOM 6509  C CA   . PRO A 1 43  ? -19.789 7.196   -24.286 1.00 1.00 ? 43  PRO A CA   4  
ATOM 6510  C C    . PRO A 1 43  ? -20.268 6.066   -23.361 1.00 1.00 ? 43  PRO A C    4  
ATOM 6511  O O    . PRO A 1 43  ? -19.711 4.969   -23.364 1.00 1.00 ? 43  PRO A O    4  
ATOM 6512  C CB   . PRO A 1 43  ? -20.081 6.920   -25.763 1.00 1.00 ? 43  PRO A CB   4  
ATOM 6513  C CG   . PRO A 1 43  ? -18.810 6.229   -26.247 1.00 1.00 ? 43  PRO A CG   4  
ATOM 6514  C CD   . PRO A 1 43  ? -17.717 6.948   -25.455 1.00 1.00 ? 43  PRO A CD   4  
ATOM 6515  H HA   . PRO A 1 43  ? -20.281 8.126   -24.007 1.00 1.00 ? 43  PRO A HA   4  
ATOM 6516  H HB2  . PRO A 1 43  ? -20.961 6.297   -25.899 1.00 1.00 ? 43  PRO A HB2  4  
ATOM 6517  H HB3  . PRO A 1 43  ? -20.204 7.867   -26.291 1.00 1.00 ? 43  PRO A HB3  4  
ATOM 6518  H HG2  . PRO A 1 43  ? -18.833 5.174   -25.970 1.00 1.00 ? 43  PRO A HG2  4  
ATOM 6519  H HG3  . PRO A 1 43  ? -18.674 6.342   -27.322 1.00 1.00 ? 43  PRO A HG3  4  
ATOM 6520  H HD2  . PRO A 1 43  ? -16.881 6.274   -25.274 1.00 1.00 ? 43  PRO A HD2  4  
ATOM 6521  H HD3  . PRO A 1 43  ? -17.376 7.828   -26.004 1.00 1.00 ? 43  PRO A HD3  4  
ATOM 6522  N N    . GLY A 1 44  ? -21.309 6.346   -22.565 1.00 1.00 ? 44  GLY A N    4  
ATOM 6523  C CA   . GLY A 1 44  ? -21.794 5.461   -21.491 1.00 1.00 ? 44  GLY A CA   4  
ATOM 6524  C C    . GLY A 1 44  ? -23.188 4.866   -21.714 1.00 1.00 ? 44  GLY A C    4  
ATOM 6525  O O    . GLY A 1 44  ? -23.730 4.257   -20.791 1.00 1.00 ? 44  GLY A O    4  
ATOM 6526  H H    . GLY A 1 44  ? -21.723 7.268   -22.622 1.00 1.00 ? 44  GLY A H    4  
ATOM 6527  H HA2  . GLY A 1 44  ? -21.100 4.637   -21.332 1.00 1.00 ? 44  GLY A HA2  4  
ATOM 6528  H HA3  . GLY A 1 44  ? -21.856 6.048   -20.572 1.00 1.00 ? 44  GLY A HA3  4  
ATOM 6529  N N    . ALA A 1 45  ? -23.789 5.052   -22.896 1.00 1.00 ? 45  ALA A N    4  
ATOM 6530  C CA   . ALA A 1 45  ? -25.167 4.634   -23.180 1.00 1.00 ? 45  ALA A CA   4  
ATOM 6531  C C    . ALA A 1 45  ? -25.341 3.101   -23.124 1.00 1.00 ? 45  ALA A C    4  
ATOM 6532  O O    . ALA A 1 45  ? -24.586 2.345   -23.745 1.00 1.00 ? 45  ALA A O    4  
ATOM 6533  C CB   . ALA A 1 45  ? -25.618 5.232   -24.519 1.00 1.00 ? 45  ALA A CB   4  
ATOM 6534  H H    . ALA A 1 45  ? -23.274 5.540   -23.615 1.00 1.00 ? 45  ALA A H    4  
ATOM 6535  H HA   . ALA A 1 45  ? -25.807 5.062   -22.403 1.00 1.00 ? 45  ALA A HA   4  
ATOM 6536  H HB1  . ALA A 1 45  ? -25.546 6.320   -24.486 1.00 1.00 ? 45  ALA A HB1  4  
ATOM 6537  H HB2  . ALA A 1 45  ? -24.995 4.857   -25.330 1.00 1.00 ? 45  ALA A HB2  4  
ATOM 6538  H HB3  . ALA A 1 45  ? -26.654 4.953   -24.716 1.00 1.00 ? 45  ALA A HB3  4  
ATOM 6539  N N    . GLY A 1 46  ? -26.344 2.648   -22.363 1.00 1.00 ? 46  GLY A N    4  
ATOM 6540  C CA   . GLY A 1 46  ? -26.541 1.233   -22.025 1.00 1.00 ? 46  GLY A CA   4  
ATOM 6541  C C    . GLY A 1 46  ? -27.250 0.434   -23.115 1.00 1.00 ? 46  GLY A C    4  
ATOM 6542  O O    . GLY A 1 46  ? -26.857 -0.694  -23.407 1.00 1.00 ? 46  GLY A O    4  
ATOM 6543  H H    . GLY A 1 46  ? -26.914 3.328   -21.874 1.00 1.00 ? 46  GLY A H    4  
ATOM 6544  H HA2  . GLY A 1 46  ? -25.576 0.769   -21.832 1.00 1.00 ? 46  GLY A HA2  4  
ATOM 6545  H HA3  . GLY A 1 46  ? -27.151 1.169   -21.124 1.00 1.00 ? 46  GLY A HA3  4  
ATOM 6546  N N    . SER A 1 47  ? -28.265 1.017   -23.756 1.00 1.00 ? 47  SER A N    4  
ATOM 6547  C CA   . SER A 1 47  ? -29.107 0.343   -24.762 1.00 1.00 ? 47  SER A CA   4  
ATOM 6548  C C    . SER A 1 47  ? -28.356 0.012   -26.067 1.00 1.00 ? 47  SER A C    4  
ATOM 6549  O O    . SER A 1 47  ? -28.632 -1.001  -26.710 1.00 1.00 ? 47  SER A O    4  
ATOM 6550  C CB   . SER A 1 47  ? -30.340 1.214   -25.059 1.00 1.00 ? 47  SER A CB   4  
ATOM 6551  O OG   . SER A 1 47  ? -29.975 2.550   -25.403 1.00 1.00 ? 47  SER A OG   4  
ATOM 6552  H H    . SER A 1 47  ? -28.524 1.962   -23.499 1.00 1.00 ? 47  SER A H    4  
ATOM 6553  H HA   . SER A 1 47  ? -29.464 -0.604  -24.355 1.00 1.00 ? 47  SER A HA   4  
ATOM 6554  H HB2  . SER A 1 47  ? -30.913 0.762   -25.871 1.00 1.00 ? 47  SER A HB2  4  
ATOM 6555  H HB3  . SER A 1 47  ? -30.972 1.239   -24.170 1.00 1.00 ? 47  SER A HB3  4  
ATOM 6556  H HG   . SER A 1 47  ? -30.786 3.070   -25.594 1.00 1.00 ? 47  SER A HG   4  
ATOM 6557  N N    . SER A 1 48  ? -27.367 0.828   -26.440 1.00 1.00 ? 48  SER A N    4  
ATOM 6558  C CA   . SER A 1 48  ? -26.450 0.587   -27.565 1.00 1.00 ? 48  SER A CA   4  
ATOM 6559  C C    . SER A 1 48  ? -25.146 -0.125  -27.143 1.00 1.00 ? 48  SER A C    4  
ATOM 6560  O O    . SER A 1 48  ? -24.280 -0.383  -27.981 1.00 1.00 ? 48  SER A O    4  
ATOM 6561  C CB   . SER A 1 48  ? -26.133 1.934   -28.229 1.00 1.00 ? 48  SER A CB   4  
ATOM 6562  O OG   . SER A 1 48  ? -25.561 2.845   -27.292 1.00 1.00 ? 48  SER A OG   4  
ATOM 6563  H H    . SER A 1 48  ? -27.237 1.689   -25.919 1.00 1.00 ? 48  SER A H    4  
ATOM 6564  H HA   . SER A 1 48  ? -26.934 -0.048  -28.307 1.00 1.00 ? 48  SER A HA   4  
ATOM 6565  H HB2  . SER A 1 48  ? -25.449 1.781   -29.065 1.00 1.00 ? 48  SER A HB2  4  
ATOM 6566  H HB3  . SER A 1 48  ? -27.062 2.357   -28.618 1.00 1.00 ? 48  SER A HB3  4  
ATOM 6567  H HG   . SER A 1 48  ? -25.510 3.731   -27.699 1.00 1.00 ? 48  SER A HG   4  
ATOM 6568  N N    . SER A 1 49  ? -24.971 -0.417  -25.847 1.00 1.00 ? 49  SER A N    4  
ATOM 6569  C CA   . SER A 1 49  ? -23.844 -1.171  -25.256 1.00 1.00 ? 49  SER A CA   4  
ATOM 6570  C C    . SER A 1 49  ? -22.482 -0.449  -25.352 1.00 1.00 ? 49  SER A C    4  
ATOM 6571  O O    . SER A 1 49  ? -21.450 -1.040  -25.033 1.00 1.00 ? 49  SER A O    4  
ATOM 6572  C CB   . SER A 1 49  ? -23.752 -2.599  -25.831 1.00 1.00 ? 49  SER A CB   4  
ATOM 6573  O OG   . SER A 1 49  ? -24.971 -3.315  -25.641 1.00 1.00 ? 49  SER A OG   4  
ATOM 6574  H H    . SER A 1 49  ? -25.761 -0.244  -25.237 1.00 1.00 ? 49  SER A H    4  
ATOM 6575  H HA   . SER A 1 49  ? -24.044 -1.280  -24.191 1.00 1.00 ? 49  SER A HA   4  
ATOM 6576  H HB2  . SER A 1 49  ? -23.510 -2.555  -26.893 1.00 1.00 ? 49  SER A HB2  4  
ATOM 6577  H HB3  . SER A 1 49  ? -22.946 -3.132  -25.322 1.00 1.00 ? 49  SER A HB3  4  
ATOM 6578  H HG   . SER A 1 49  ? -24.887 -4.222  -26.017 1.00 1.00 ? 49  SER A HG   4  
ATOM 6579  N N    . VAL A 1 50  ? -22.438 0.820   -25.783 1.00 1.00 ? 50  VAL A N    4  
ATOM 6580  C CA   . VAL A 1 50  ? -21.184 1.549   -26.074 1.00 1.00 ? 50  VAL A CA   4  
ATOM 6581  C C    . VAL A 1 50  ? -20.281 1.769   -24.850 1.00 1.00 ? 50  VAL A C    4  
ATOM 6582  O O    . VAL A 1 50  ? -19.108 2.108   -25.013 1.00 1.00 ? 50  VAL A O    4  
ATOM 6583  C CB   . VAL A 1 50  ? -21.427 2.890   -26.798 1.00 1.00 ? 50  VAL A CB   4  
ATOM 6584  C CG1  . VAL A 1 50  ? -22.000 2.652   -28.203 1.00 1.00 ? 50  VAL A CG1  4  
ATOM 6585  C CG2  . VAL A 1 50  ? -22.348 3.825   -26.001 1.00 1.00 ? 50  VAL A CG2  4  
ATOM 6586  H H    . VAL A 1 50  ? -23.325 1.249   -26.030 1.00 1.00 ? 50  VAL A H    4  
ATOM 6587  H HA   . VAL A 1 50  ? -20.621 0.918   -26.762 1.00 1.00 ? 50  VAL A HA   4  
ATOM 6588  H HB   . VAL A 1 50  ? -20.469 3.394   -26.930 1.00 1.00 ? 50  VAL A HB   4  
ATOM 6589  H HG11 . VAL A 1 50  ? -21.329 2.009   -28.774 1.00 1.00 ? 50  VAL A HG11 4  
ATOM 6590  H HG12 . VAL A 1 50  ? -22.978 2.178   -28.141 1.00 1.00 ? 50  VAL A HG12 4  
ATOM 6591  H HG13 . VAL A 1 50  ? -22.104 3.605   -28.723 1.00 1.00 ? 50  VAL A HG13 4  
ATOM 6592  H HG21 . VAL A 1 50  ? -21.901 4.057   -25.035 1.00 1.00 ? 50  VAL A HG21 4  
ATOM 6593  H HG22 . VAL A 1 50  ? -22.508 4.749   -26.553 1.00 1.00 ? 50  VAL A HG22 4  
ATOM 6594  H HG23 . VAL A 1 50  ? -23.312 3.350   -25.838 1.00 1.00 ? 50  VAL A HG23 4  
ATOM 6595  N N    . PHE A 1 51  ? -20.794 1.534   -23.633 1.00 1.00 ? 51  PHE A N    4  
ATOM 6596  C CA   . PHE A 1 51  ? -19.987 1.486   -22.410 1.00 1.00 ? 51  PHE A CA   4  
ATOM 6597  C C    . PHE A 1 51  ? -19.032 0.268   -22.393 1.00 1.00 ? 51  PHE A C    4  
ATOM 6598  O O    . PHE A 1 51  ? -18.020 0.290   -21.699 1.00 1.00 ? 51  PHE A O    4  
ATOM 6599  C CB   . PHE A 1 51  ? -20.921 1.471   -21.188 1.00 1.00 ? 51  PHE A CB   4  
ATOM 6600  C CG   . PHE A 1 51  ? -21.643 0.154   -20.950 1.00 1.00 ? 51  PHE A CG   4  
ATOM 6601  C CD1  . PHE A 1 51  ? -22.865 -0.114  -21.595 1.00 1.00 ? 51  PHE A CD1  4  
ATOM 6602  C CD2  . PHE A 1 51  ? -21.087 -0.809  -20.084 1.00 1.00 ? 51  PHE A CD2  4  
ATOM 6603  C CE1  . PHE A 1 51  ? -23.530 -1.335  -21.378 1.00 1.00 ? 51  PHE A CE1  4  
ATOM 6604  C CE2  . PHE A 1 51  ? -21.747 -2.034  -19.870 1.00 1.00 ? 51  PHE A CE2  4  
ATOM 6605  C CZ   . PHE A 1 51  ? -22.969 -2.294  -20.517 1.00 1.00 ? 51  PHE A CZ   4  
ATOM 6606  H H    . PHE A 1 51  ? -21.769 1.282   -23.567 1.00 1.00 ? 51  PHE A H    4  
ATOM 6607  H HA   . PHE A 1 51  ? -19.376 2.390   -22.364 1.00 1.00 ? 51  PHE A HA   4  
ATOM 6608  H HB2  . PHE A 1 51  ? -20.328 1.703   -20.303 1.00 1.00 ? 51  PHE A HB2  4  
ATOM 6609  H HB3  . PHE A 1 51  ? -21.661 2.265   -21.288 1.00 1.00 ? 51  PHE A HB3  4  
ATOM 6610  H HD1  . PHE A 1 51  ? -23.304 0.625   -22.248 1.00 1.00 ? 51  PHE A HD1  4  
ATOM 6611  H HD2  . PHE A 1 51  ? -20.149 -0.611  -19.583 1.00 1.00 ? 51  PHE A HD2  4  
ATOM 6612  H HE1  . PHE A 1 51  ? -24.475 -1.534  -21.863 1.00 1.00 ? 51  PHE A HE1  4  
ATOM 6613  H HE2  . PHE A 1 51  ? -21.316 -2.770  -19.205 1.00 1.00 ? 51  PHE A HE2  4  
ATOM 6614  H HZ   . PHE A 1 51  ? -23.481 -3.233  -20.348 1.00 1.00 ? 51  PHE A HZ   4  
ATOM 6615  N N    . SER A 1 52  ? -19.344 -0.795  -23.143 1.00 1.00 ? 52  SER A N    4  
ATOM 6616  C CA   . SER A 1 52  ? -18.551 -2.030  -23.228 1.00 1.00 ? 52  SER A CA   4  
ATOM 6617  C C    . SER A 1 52  ? -18.087 -2.373  -24.659 1.00 1.00 ? 52  SER A C    4  
ATOM 6618  O O    . SER A 1 52  ? -16.952 -2.830  -24.817 1.00 1.00 ? 52  SER A O    4  
ATOM 6619  C CB   . SER A 1 52  ? -19.348 -3.206  -22.646 1.00 1.00 ? 52  SER A CB   4  
ATOM 6620  O OG   . SER A 1 52  ? -20.535 -3.453  -23.390 1.00 1.00 ? 52  SER A OG   4  
ATOM 6621  H H    . SER A 1 52  ? -20.220 -0.776  -23.653 1.00 1.00 ? 52  SER A H    4  
ATOM 6622  H HA   . SER A 1 52  ? -17.643 -1.925  -22.629 1.00 1.00 ? 52  SER A HA   4  
ATOM 6623  H HB2  . SER A 1 52  ? -18.721 -4.101  -22.659 1.00 1.00 ? 52  SER A HB2  4  
ATOM 6624  H HB3  . SER A 1 52  ? -19.606 -2.981  -21.609 1.00 1.00 ? 52  SER A HB3  4  
ATOM 6625  H HG   . SER A 1 52  ? -21.030 -4.193  -22.976 1.00 1.00 ? 52  SER A HG   4  
ATOM 6626  N N    . VAL A 1 53  ? -18.907 -2.135  -25.695 1.00 1.00 ? 53  VAL A N    4  
ATOM 6627  C CA   . VAL A 1 53  ? -18.490 -2.275  -27.108 1.00 1.00 ? 53  VAL A CA   4  
ATOM 6628  C C    . VAL A 1 53  ? -17.748 -1.024  -27.613 1.00 1.00 ? 53  VAL A C    4  
ATOM 6629  O O    . VAL A 1 53  ? -17.940 0.070   -27.082 1.00 1.00 ? 53  VAL A O    4  
ATOM 6630  C CB   . VAL A 1 53  ? -19.628 -2.669  -28.083 1.00 1.00 ? 53  VAL A CB   4  
ATOM 6631  C CG1  . VAL A 1 53  ? -20.337 -3.952  -27.626 1.00 1.00 ? 53  VAL A CG1  4  
ATOM 6632  C CG2  . VAL A 1 53  ? -20.671 -1.579  -28.366 1.00 1.00 ? 53  VAL A CG2  4  
ATOM 6633  H H    . VAL A 1 53  ? -19.844 -1.790  -25.479 1.00 1.00 ? 53  VAL A H    4  
ATOM 6634  H HA   . VAL A 1 53  ? -17.782 -3.099  -27.152 1.00 1.00 ? 53  VAL A HA   4  
ATOM 6635  H HB   . VAL A 1 53  ? -19.147 -2.895  -29.036 1.00 1.00 ? 53  VAL A HB   4  
ATOM 6636  H HG11 . VAL A 1 53  ? -20.883 -3.778  -26.699 1.00 1.00 ? 53  VAL A HG11 4  
ATOM 6637  H HG12 . VAL A 1 53  ? -21.041 -4.279  -28.393 1.00 1.00 ? 53  VAL A HG12 4  
ATOM 6638  H HG13 . VAL A 1 53  ? -19.605 -4.745  -27.464 1.00 1.00 ? 53  VAL A HG13 4  
ATOM 6639  H HG21 . VAL A 1 53  ? -20.195 -0.639  -28.642 1.00 1.00 ? 53  VAL A HG21 4  
ATOM 6640  H HG22 . VAL A 1 53  ? -21.313 -1.895  -29.189 1.00 1.00 ? 53  VAL A HG22 4  
ATOM 6641  H HG23 . VAL A 1 53  ? -21.292 -1.424  -27.494 1.00 1.00 ? 53  VAL A HG23 4  
ATOM 6642  N N    . LEU A 1 54  ? -16.909 -1.205  -28.648 1.00 1.00 ? 54  LEU A N    4  
ATOM 6643  C CA   . LEU A 1 54  ? -16.054 -0.175  -29.269 1.00 1.00 ? 54  LEU A CA   4  
ATOM 6644  C C    . LEU A 1 54  ? -14.950 0.316   -28.298 1.00 1.00 ? 54  LEU A C    4  
ATOM 6645  O O    . LEU A 1 54  ? -14.670 -0.311  -27.275 1.00 1.00 ? 54  LEU A O    4  
ATOM 6646  C CB   . LEU A 1 54  ? -16.907 0.978   -29.865 1.00 1.00 ? 54  LEU A CB   4  
ATOM 6647  C CG   . LEU A 1 54  ? -18.033 0.551   -30.832 1.00 1.00 ? 54  LEU A CG   4  
ATOM 6648  C CD1  . LEU A 1 54  ? -18.846 1.789   -31.242 1.00 1.00 ? 54  LEU A CD1  4  
ATOM 6649  C CD2  . LEU A 1 54  ? -17.484 -0.142  -32.087 1.00 1.00 ? 54  LEU A CD2  4  
ATOM 6650  H H    . LEU A 1 54  ? -16.803 -2.149  -28.996 1.00 1.00 ? 54  LEU A H    4  
ATOM 6651  H HA   . LEU A 1 54  ? -15.514 -0.641  -30.097 1.00 1.00 ? 54  LEU A HA   4  
ATOM 6652  H HB2  . LEU A 1 54  ? -17.348 1.552   -29.051 1.00 1.00 ? 54  LEU A HB2  4  
ATOM 6653  H HB3  . LEU A 1 54  ? -16.250 1.654   -30.413 1.00 1.00 ? 54  LEU A HB3  4  
ATOM 6654  H HG   . LEU A 1 54  ? -18.707 -0.138  -30.323 1.00 1.00 ? 54  LEU A HG   4  
ATOM 6655  H HD11 . LEU A 1 54  ? -19.264 2.267   -30.356 1.00 1.00 ? 54  LEU A HD11 4  
ATOM 6656  H HD12 . LEU A 1 54  ? -18.206 2.501   -31.765 1.00 1.00 ? 54  LEU A HD12 4  
ATOM 6657  H HD13 . LEU A 1 54  ? -19.668 1.496   -31.897 1.00 1.00 ? 54  LEU A HD13 4  
ATOM 6658  H HD21 . LEU A 1 54  ? -16.773 0.509   -32.596 1.00 1.00 ? 54  LEU A HD21 4  
ATOM 6659  H HD22 . LEU A 1 54  ? -16.988 -1.075  -31.814 1.00 1.00 ? 54  LEU A HD22 4  
ATOM 6660  H HD23 . LEU A 1 54  ? -18.305 -0.380  -32.765 1.00 1.00 ? 54  LEU A HD23 4  
ATOM 6661  N N    . SER A 1 55  ? -14.295 1.432   -28.624 1.00 1.00 ? 55  SER A N    4  
ATOM 6662  C CA   . SER A 1 55  ? -13.143 1.986   -27.893 1.00 1.00 ? 55  SER A CA   4  
ATOM 6663  C C    . SER A 1 55  ? -12.822 3.434   -28.318 1.00 1.00 ? 55  SER A C    4  
ATOM 6664  O O    . SER A 1 55  ? -13.300 3.919   -29.349 1.00 1.00 ? 55  SER A O    4  
ATOM 6665  C CB   . SER A 1 55  ? -11.902 1.089   -28.065 1.00 1.00 ? 55  SER A CB   4  
ATOM 6666  O OG   . SER A 1 55  ? -11.546 0.922   -29.437 1.00 1.00 ? 55  SER A OG   4  
ATOM 6667  H H    . SER A 1 55  ? -14.545 1.904   -29.480 1.00 1.00 ? 55  SER A H    4  
ATOM 6668  H HA   . SER A 1 55  ? -13.383 2.009   -26.829 1.00 1.00 ? 55  SER A HA   4  
ATOM 6669  H HB2  . SER A 1 55  ? -11.063 1.537   -27.532 1.00 1.00 ? 55  SER A HB2  4  
ATOM 6670  H HB3  . SER A 1 55  ? -12.101 0.113   -27.620 1.00 1.00 ? 55  SER A HB3  4  
ATOM 6671  H HG   . SER A 1 55  ? -10.826 0.260   -29.515 1.00 1.00 ? 55  SER A HG   4  
ATOM 6672  N N    . ASN A 1 56  ? -12.005 4.126   -27.513 1.00 1.00 ? 56  ASN A N    4  
ATOM 6673  C CA   . ASN A 1 56  ? -11.519 5.495   -27.746 1.00 1.00 ? 56  ASN A CA   4  
ATOM 6674  C C    . ASN A 1 56  ? -10.011 5.600   -27.419 1.00 1.00 ? 56  ASN A C    4  
ATOM 6675  O O    . ASN A 1 56  ? -9.410  4.636   -26.945 1.00 1.00 ? 56  ASN A O    4  
ATOM 6676  C CB   . ASN A 1 56  ? -12.367 6.480   -26.915 1.00 1.00 ? 56  ASN A CB   4  
ATOM 6677  C CG   . ASN A 1 56  ? -13.781 6.649   -27.474 1.00 1.00 ? 56  ASN A CG   4  
ATOM 6678  O OD1  . ASN A 1 56  ? -14.039 7.528   -28.288 1.00 1.00 ? 56  ASN A OD1  4  
ATOM 6679  N ND2  . ASN A 1 56  ? -14.734 5.826   -27.061 1.00 1.00 ? 56  ASN A ND2  4  
ATOM 6680  H H    . ASN A 1 56  ? -11.612 3.645   -26.709 1.00 1.00 ? 56  ASN A H    4  
ATOM 6681  H HA   . ASN A 1 56  ? -11.633 5.751   -28.800 1.00 1.00 ? 56  ASN A HA   4  
ATOM 6682  H HB2  . ASN A 1 56  ? -12.415 6.136   -25.883 1.00 1.00 ? 56  ASN A HB2  4  
ATOM 6683  H HB3  . ASN A 1 56  ? -11.899 7.465   -26.914 1.00 1.00 ? 56  ASN A HB3  4  
ATOM 6684  H HD21 . ASN A 1 56  ? -14.521 5.090   -26.409 1.00 1.00 ? 56  ASN A HD21 4  
ATOM 6685  H HD22 . ASN A 1 56  ? -15.652 5.909   -27.470 1.00 1.00 ? 56  ASN A HD22 4  
ATOM 6686  N N    . SER A 1 57  ? -9.378  6.748   -27.669 1.00 1.00 ? 57  SER A N    4  
ATOM 6687  C CA   . SER A 1 57  ? -7.913  6.892   -27.564 1.00 1.00 ? 57  SER A CA   4  
ATOM 6688  C C    . SER A 1 57  ? -7.452  7.678   -26.320 1.00 1.00 ? 57  SER A C    4  
ATOM 6689  O O    . SER A 1 57  ? -7.934  8.778   -26.041 1.00 1.00 ? 57  SER A O    4  
ATOM 6690  C CB   . SER A 1 57  ? -7.361  7.577   -28.828 1.00 1.00 ? 57  SER A CB   4  
ATOM 6691  O OG   . SER A 1 57  ? -7.664  6.808   -29.987 1.00 1.00 ? 57  SER A OG   4  
ATOM 6692  H H    . SER A 1 57  ? -9.898  7.517   -28.069 1.00 1.00 ? 57  SER A H    4  
ATOM 6693  H HA   . SER A 1 57  ? -7.452  5.904   -27.526 1.00 1.00 ? 57  SER A HA   4  
ATOM 6694  H HB2  . SER A 1 57  ? -7.796  8.572   -28.920 1.00 1.00 ? 57  SER A HB2  4  
ATOM 6695  H HB3  . SER A 1 57  ? -6.278  7.677   -28.730 1.00 1.00 ? 57  SER A HB3  4  
ATOM 6696  H HG   . SER A 1 57  ? -7.364  7.284   -30.794 1.00 1.00 ? 57  SER A HG   4  
ATOM 6697  N N    . ALA A 1 58  ? -6.483  7.118   -25.587 1.00 1.00 ? 58  ALA A N    4  
ATOM 6698  C CA   . ALA A 1 58  ? -5.732  7.763   -24.503 1.00 1.00 ? 58  ALA A CA   4  
ATOM 6699  C C    . ALA A 1 58  ? -4.391  8.280   -25.059 1.00 1.00 ? 58  ALA A C    4  
ATOM 6700  O O    . ALA A 1 58  ? -3.852  7.679   -25.987 1.00 1.00 ? 58  ALA A O    4  
ATOM 6701  C CB   . ALA A 1 58  ? -5.535  6.725   -23.389 1.00 1.00 ? 58  ALA A CB   4  
ATOM 6702  H H    . ALA A 1 58  ? -6.125  6.217   -25.893 1.00 1.00 ? 58  ALA A H    4  
ATOM 6703  H HA   . ALA A 1 58  ? -6.276  8.617   -24.098 1.00 1.00 ? 58  ALA A HA   4  
ATOM 6704  H HB1  . ALA A 1 58  ? -4.949  5.880   -23.757 1.00 1.00 ? 58  ALA A HB1  4  
ATOM 6705  H HB2  . ALA A 1 58  ? -5.012  7.179   -22.548 1.00 1.00 ? 58  ALA A HB2  4  
ATOM 6706  H HB3  . ALA A 1 58  ? -6.502  6.357   -23.046 1.00 1.00 ? 58  ALA A HB3  4  
ATOM 6707  N N    . GLU A 1 59  ? -3.835  9.366   -24.518 1.00 1.00 ? 59  GLU A N    4  
ATOM 6708  C CA   . GLU A 1 59  ? -2.615  10.008  -25.050 1.00 1.00 ? 59  GLU A CA   4  
ATOM 6709  C C    . GLU A 1 59  ? -1.507  10.077  -23.995 1.00 1.00 ? 59  GLU A C    4  
ATOM 6710  O O    . GLU A 1 59  ? -1.801  10.318  -22.828 1.00 1.00 ? 59  GLU A O    4  
ATOM 6711  C CB   . GLU A 1 59  ? -2.951  11.428  -25.545 1.00 1.00 ? 59  GLU A CB   4  
ATOM 6712  C CG   . GLU A 1 59  ? -1.851  11.992  -26.458 1.00 1.00 ? 59  GLU A CG   4  
ATOM 6713  C CD   . GLU A 1 59  ? -2.231  13.377  -26.998 1.00 1.00 ? 59  GLU A CD   4  
ATOM 6714  O OE1  . GLU A 1 59  ? -3.061  13.459  -27.933 1.00 1.00 ? 59  GLU A OE1  4  
ATOM 6715  O OE2  . GLU A 1 59  ? -1.708  14.391  -26.480 1.00 1.00 ? 59  GLU A OE2  4  
ATOM 6716  H H    . GLU A 1 59  ? -4.277  9.774   -23.700 1.00 1.00 ? 59  GLU A H    4  
ATOM 6717  H HA   . GLU A 1 59  ? -2.244  9.434   -25.897 1.00 1.00 ? 59  GLU A HA   4  
ATOM 6718  H HB2  . GLU A 1 59  ? -3.882  11.387  -26.111 1.00 1.00 ? 59  GLU A HB2  4  
ATOM 6719  H HB3  . GLU A 1 59  ? -3.096  12.089  -24.685 1.00 1.00 ? 59  GLU A HB3  4  
ATOM 6720  H HG2  . GLU A 1 59  ? -0.916  12.067  -25.901 1.00 1.00 ? 59  GLU A HG2  4  
ATOM 6721  H HG3  . GLU A 1 59  ? -1.686  11.309  -27.294 1.00 1.00 ? 59  GLU A HG3  4  
ATOM 6722  N N    . VAL A 1 60  ? -0.244  9.902   -24.393 1.00 1.00 ? 60  VAL A N    4  
ATOM 6723  C CA   . VAL A 1 60  ? 0.915   10.163  -23.516 1.00 1.00 ? 60  VAL A CA   4  
ATOM 6724  C C    . VAL A 1 60  ? 1.181   11.671  -23.486 1.00 1.00 ? 60  VAL A C    4  
ATOM 6725  O O    . VAL A 1 60  ? 1.400   12.283  -24.532 1.00 1.00 ? 60  VAL A O    4  
ATOM 6726  C CB   . VAL A 1 60  ? 2.199   9.434   -23.968 1.00 1.00 ? 60  VAL A CB   4  
ATOM 6727  C CG1  . VAL A 1 60  ? 3.348   9.686   -22.971 1.00 1.00 ? 60  VAL A CG1  4  
ATOM 6728  C CG2  . VAL A 1 60  ? 2.009   7.914   -24.106 1.00 1.00 ? 60  VAL A CG2  4  
ATOM 6729  H H    . VAL A 1 60  ? -0.070  9.662   -25.372 1.00 1.00 ? 60  VAL A H    4  
ATOM 6730  H HA   . VAL A 1 60  ? 0.674   9.814   -22.514 1.00 1.00 ? 60  VAL A HA   4  
ATOM 6731  H HB   . VAL A 1 60  ? 2.474   9.833   -24.940 1.00 1.00 ? 60  VAL A HB   4  
ATOM 6732  H HG11 . VAL A 1 60  ? 3.547   10.749  -22.846 1.00 1.00 ? 60  VAL A HG11 4  
ATOM 6733  H HG12 . VAL A 1 60  ? 3.082   9.290   -21.994 1.00 1.00 ? 60  VAL A HG12 4  
ATOM 6734  H HG13 . VAL A 1 60  ? 4.266   9.218   -23.327 1.00 1.00 ? 60  VAL A HG13 4  
ATOM 6735  H HG21 . VAL A 1 60  ? 1.766   7.477   -23.139 1.00 1.00 ? 60  VAL A HG21 4  
ATOM 6736  H HG22 . VAL A 1 60  ? 1.214   7.693   -24.817 1.00 1.00 ? 60  VAL A HG22 4  
ATOM 6737  H HG23 . VAL A 1 60  ? 2.930   7.461   -24.470 1.00 1.00 ? 60  VAL A HG23 4  
ATOM 6738  N N    . LYS A 1 61  ? 1.198   12.264  -22.290 1.00 1.00 ? 61  LYS A N    4  
ATOM 6739  C CA   . LYS A 1 61  ? 1.357   13.707  -22.064 1.00 1.00 ? 61  LYS A CA   4  
ATOM 6740  C C    . LYS A 1 61  ? 2.439   14.031  -21.008 1.00 1.00 ? 61  LYS A C    4  
ATOM 6741  O O    . LYS A 1 61  ? 2.788   13.200  -20.166 1.00 1.00 ? 61  LYS A O    4  
ATOM 6742  C CB   . LYS A 1 61  ? -0.022  14.292  -21.682 1.00 1.00 ? 61  LYS A CB   4  
ATOM 6743  C CG   . LYS A 1 61  ? -1.013  14.311  -22.863 1.00 1.00 ? 61  LYS A CG   4  
ATOM 6744  C CD   . LYS A 1 61  ? -2.342  14.951  -22.431 1.00 1.00 ? 61  LYS A CD   4  
ATOM 6745  C CE   . LYS A 1 61  ? -3.391  15.114  -23.547 1.00 1.00 ? 61  LYS A CE   4  
ATOM 6746  N NZ   . LYS A 1 61  ? -2.956  16.030  -24.640 1.00 1.00 ? 61  LYS A NZ   4  
ATOM 6747  H H    . LYS A 1 61  ? 1.033   11.677  -21.473 1.00 1.00 ? 61  LYS A H    4  
ATOM 6748  H HA   . LYS A 1 61  ? 1.680   14.182  -22.995 1.00 1.00 ? 61  LYS A HA   4  
ATOM 6749  H HB2  . LYS A 1 61  ? -0.443  13.708  -20.860 1.00 1.00 ? 61  LYS A HB2  4  
ATOM 6750  H HB3  . LYS A 1 61  ? 0.110   15.319  -21.332 1.00 1.00 ? 61  LYS A HB3  4  
ATOM 6751  H HG2  . LYS A 1 61  ? -0.575  14.885  -23.681 1.00 1.00 ? 61  LYS A HG2  4  
ATOM 6752  H HG3  . LYS A 1 61  ? -1.204  13.293  -23.208 1.00 1.00 ? 61  LYS A HG3  4  
ATOM 6753  H HD2  . LYS A 1 61  ? -2.781  14.312  -21.666 1.00 1.00 ? 61  LYS A HD2  4  
ATOM 6754  H HD3  . LYS A 1 61  ? -2.146  15.928  -21.984 1.00 1.00 ? 61  LYS A HD3  4  
ATOM 6755  H HE2  . LYS A 1 61  ? -3.644  14.133  -23.959 1.00 1.00 ? 61  LYS A HE2  4  
ATOM 6756  H HE3  . LYS A 1 61  ? -4.303  15.510  -23.087 1.00 1.00 ? 61  LYS A HE3  4  
ATOM 6757  H HZ1  . LYS A 1 61  ? -3.735  16.271  -25.242 1.00 1.00 ? 61  LYS A HZ1  4  
ATOM 6758  H HZ2  . LYS A 1 61  ? -2.569  16.893  -24.279 1.00 1.00 ? 61  LYS A HZ2  4  
ATOM 6759  H HZ3  . LYS A 1 61  ? -2.266  15.576  -25.243 1.00 1.00 ? 61  LYS A HZ3  4  
ATOM 6760  N N    . ARG A 1 62  ? 2.976   15.259  -21.072 1.00 1.00 ? 62  ARG A N    4  
ATOM 6761  C CA   . ARG A 1 62  ? 3.927   15.849  -20.108 1.00 1.00 ? 62  ARG A CA   4  
ATOM 6762  C C    . ARG A 1 62  ? 3.309   17.090  -19.444 1.00 1.00 ? 62  ARG A C    4  
ATOM 6763  O O    . ARG A 1 62  ? 2.799   17.950  -20.155 1.00 1.00 ? 62  ARG A O    4  
ATOM 6764  C CB   . ARG A 1 62  ? 5.208   16.246  -20.872 1.00 1.00 ? 62  ARG A CB   4  
ATOM 6765  C CG   . ARG A 1 62  ? 6.328   16.801  -19.968 1.00 1.00 ? 62  ARG A CG   4  
ATOM 6766  C CD   . ARG A 1 62  ? 7.607   17.135  -20.752 1.00 1.00 ? 62  ARG A CD   4  
ATOM 6767  N NE   . ARG A 1 62  ? 7.383   18.213  -21.740 1.00 1.00 ? 62  ARG A NE   4  
ATOM 6768  C CZ   . ARG A 1 62  ? 7.478   19.527  -21.549 1.00 1.00 ? 62  ARG A CZ   4  
ATOM 6769  N NH1  . ARG A 1 62  ? 7.799   20.056  -20.387 1.00 1.00 ? 62  ARG A NH1  4  
ATOM 6770  N NH2  . ARG A 1 62  ? 7.247   20.344  -22.553 1.00 1.00 ? 62  ARG A NH2  4  
ATOM 6771  H H    . ARG A 1 62  ? 2.663   15.863  -21.825 1.00 1.00 ? 62  ARG A H    4  
ATOM 6772  H HA   . ARG A 1 62  ? 4.181   15.114  -19.346 1.00 1.00 ? 62  ARG A HA   4  
ATOM 6773  H HB2  . ARG A 1 62  ? 5.584   15.370  -21.395 1.00 1.00 ? 62  ARG A HB2  4  
ATOM 6774  H HB3  . ARG A 1 62  ? 4.953   16.993  -21.627 1.00 1.00 ? 62  ARG A HB3  4  
ATOM 6775  H HG2  . ARG A 1 62  ? 5.984   17.707  -19.471 1.00 1.00 ? 62  ARG A HG2  4  
ATOM 6776  H HG3  . ARG A 1 62  ? 6.567   16.061  -19.203 1.00 1.00 ? 62  ARG A HG3  4  
ATOM 6777  H HD2  . ARG A 1 62  ? 8.396   17.421  -20.056 1.00 1.00 ? 62  ARG A HD2  4  
ATOM 6778  H HD3  . ARG A 1 62  ? 7.950   16.237  -21.272 1.00 1.00 ? 62  ARG A HD3  4  
ATOM 6779  H HE   . ARG A 1 62  ? 7.184   17.912  -22.686 1.00 1.00 ? 62  ARG A HE   4  
ATOM 6780  H HH11 . ARG A 1 62  ? 8.011   19.476  -19.594 1.00 1.00 ? 62  ARG A HH11 4  
ATOM 6781  H HH12 . ARG A 1 62  ? 7.860   21.058  -20.284 1.00 1.00 ? 62  ARG A HH12 4  
ATOM 6782  H HH21 . ARG A 1 62  ? 7.000   19.986  -23.466 1.00 1.00 ? 62  ARG A HH21 4  
ATOM 6783  H HH22 . ARG A 1 62  ? 7.314   21.342  -22.431 1.00 1.00 ? 62  ARG A HH22 4  
ATOM 6784  N N    . GLU A 1 63  ? 3.419   17.230  -18.118 1.00 1.00 ? 63  GLU A N    4  
ATOM 6785  C CA   . GLU A 1 63  ? 3.065   18.462  -17.386 1.00 1.00 ? 63  GLU A CA   4  
ATOM 6786  C C    . GLU A 1 63  ? 3.762   18.491  -16.018 1.00 1.00 ? 63  GLU A C    4  
ATOM 6787  O O    . GLU A 1 63  ? 4.443   17.529  -15.639 1.00 1.00 ? 63  GLU A O    4  
ATOM 6788  C CB   . GLU A 1 63  ? 1.531   18.621  -17.249 1.00 1.00 ? 63  GLU A CB   4  
ATOM 6789  C CG   . GLU A 1 63  ? 0.915   19.719  -18.134 1.00 1.00 ? 63  GLU A CG   4  
ATOM 6790  C CD   . GLU A 1 63  ? 1.508   21.121  -17.897 1.00 1.00 ? 63  GLU A CD   4  
ATOM 6791  O OE1  . GLU A 1 63  ? 1.998   21.418  -16.782 1.00 1.00 ? 63  GLU A OE1  4  
ATOM 6792  O OE2  . GLU A 1 63  ? 1.490   21.939  -18.849 1.00 1.00 ? 63  GLU A OE2  4  
ATOM 6793  H H    . GLU A 1 63  ? 3.804   16.464  -17.567 1.00 1.00 ? 63  GLU A H    4  
ATOM 6794  H HA   . GLU A 1 63  ? 3.454   19.317  -17.941 1.00 1.00 ? 63  GLU A HA   4  
ATOM 6795  H HB2  . GLU A 1 63  ? 1.046   17.673  -17.484 1.00 1.00 ? 63  GLU A HB2  4  
ATOM 6796  H HB3  . GLU A 1 63  ? 1.275   18.866  -16.222 1.00 1.00 ? 63  GLU A HB3  4  
ATOM 6797  H HG2  . GLU A 1 63  ? 1.032   19.446  -19.180 1.00 1.00 ? 63  GLU A HG2  4  
ATOM 6798  H HG3  . GLU A 1 63  ? -0.158  19.760  -17.937 1.00 1.00 ? 63  GLU A HG3  4  
ATOM 6799  N N    . ARG A 1 64  ? 3.627   19.591  -15.275 1.00 1.00 ? 64  ARG A N    4  
ATOM 6800  C CA   . ARG A 1 64  ? 4.150   19.722  -13.911 1.00 1.00 ? 64  ARG A CA   4  
ATOM 6801  C C    . ARG A 1 64  ? 3.448   18.743  -12.959 1.00 1.00 ? 64  ARG A C    4  
ATOM 6802  O O    . ARG A 1 64  ? 2.241   18.522  -13.070 1.00 1.00 ? 64  ARG A O    4  
ATOM 6803  C CB   . ARG A 1 64  ? 3.998   21.173  -13.416 1.00 1.00 ? 64  ARG A CB   4  
ATOM 6804  C CG   . ARG A 1 64  ? 4.941   22.133  -14.164 1.00 1.00 ? 64  ARG A CG   4  
ATOM 6805  C CD   . ARG A 1 64  ? 4.831   23.579  -13.658 1.00 1.00 ? 64  ARG A CD   4  
ATOM 6806  N NE   . ARG A 1 64  ? 5.221   23.711  -12.238 1.00 1.00 ? 64  ARG A NE   4  
ATOM 6807  C CZ   . ARG A 1 64  ? 6.450   23.754  -11.733 1.00 1.00 ? 64  ARG A CZ   4  
ATOM 6808  N NH1  . ARG A 1 64  ? 7.531   23.678  -12.485 1.00 1.00 ? 64  ARG A NH1  4  
ATOM 6809  N NH2  . ARG A 1 64  ? 6.597   23.880  -10.434 1.00 1.00 ? 64  ARG A NH2  4  
ATOM 6810  H H    . ARG A 1 64  ? 3.063   20.354  -15.655 1.00 1.00 ? 64  ARG A H    4  
ATOM 6811  H HA   . ARG A 1 64  ? 5.211   19.488  -13.926 1.00 1.00 ? 64  ARG A HA   4  
ATOM 6812  H HB2  . ARG A 1 64  ? 2.965   21.503  -13.548 1.00 1.00 ? 64  ARG A HB2  4  
ATOM 6813  H HB3  . ARG A 1 64  ? 4.242   21.204  -12.350 1.00 1.00 ? 64  ARG A HB3  4  
ATOM 6814  H HG2  . ARG A 1 64  ? 5.968   21.786  -14.049 1.00 1.00 ? 64  ARG A HG2  4  
ATOM 6815  H HG3  . ARG A 1 64  ? 4.691   22.123  -15.227 1.00 1.00 ? 64  ARG A HG3  4  
ATOM 6816  H HD2  . ARG A 1 64  ? 5.458   24.222  -14.276 1.00 1.00 ? 64  ARG A HD2  4  
ATOM 6817  H HD3  . ARG A 1 64  ? 3.799   23.912  -13.779 1.00 1.00 ? 64  ARG A HD3  4  
ATOM 6818  H HE   . ARG A 1 64  ? 4.467   23.826  -11.572 1.00 1.00 ? 64  ARG A HE   4  
ATOM 6819  H HH11 . ARG A 1 64  ? 7.449   23.594  -13.484 1.00 1.00 ? 64  ARG A HH11 4  
ATOM 6820  H HH12 . ARG A 1 64  ? 8.450   23.724  -12.070 1.00 1.00 ? 64  ARG A HH12 4  
ATOM 6821  H HH21 . ARG A 1 64  ? 5.767   23.918  -9.836  1.00 1.00 ? 64  ARG A HH21 4  
ATOM 6822  H HH22 . ARG A 1 64  ? 7.512   23.922  -10.010 1.00 1.00 ? 64  ARG A HH22 4  
ATOM 6823  N N    . LEU A 1 65  ? 4.183   18.211  -11.974 1.00 1.00 ? 65  LEU A N    4  
ATOM 6824  C CA   . LEU A 1 65  ? 3.641   17.323  -10.925 1.00 1.00 ? 65  LEU A CA   4  
ATOM 6825  C C    . LEU A 1 65  ? 2.410   17.959  -10.258 1.00 1.00 ? 65  LEU A C    4  
ATOM 6826  O O    . LEU A 1 65  ? 1.342   17.353  -10.276 1.00 1.00 ? 65  LEU A O    4  
ATOM 6827  C CB   . LEU A 1 65  ? 4.784   16.982  -9.936  1.00 1.00 ? 65  LEU A CB   4  
ATOM 6828  C CG   . LEU A 1 65  ? 4.556   15.769  -8.999  1.00 1.00 ? 65  LEU A CG   4  
ATOM 6829  C CD1  . LEU A 1 65  ? 5.842   15.536  -8.198  1.00 1.00 ? 65  LEU A CD1  4  
ATOM 6830  C CD2  . LEU A 1 65  ? 3.395   15.938  -8.012  1.00 1.00 ? 65  LEU A CD2  4  
ATOM 6831  H H    . LEU A 1 65  ? 5.176   18.441  -11.948 1.00 1.00 ? 65  LEU A H    4  
ATOM 6832  H HA   . LEU A 1 65  ? 3.300   16.395  -11.395 1.00 1.00 ? 65  LEU A HA   4  
ATOM 6833  H HB2  . LEU A 1 65  ? 5.672   16.756  -10.532 1.00 1.00 ? 65  LEU A HB2  4  
ATOM 6834  H HB3  . LEU A 1 65  ? 5.020   17.861  -9.331  1.00 1.00 ? 65  LEU A HB3  4  
ATOM 6835  H HG   . LEU A 1 65  ? 4.364   14.881  -9.604  1.00 1.00 ? 65  LEU A HG   4  
ATOM 6836  H HD11 . LEU A 1 65  ? 6.103   16.435  -7.638  1.00 1.00 ? 65  LEU A HD11 4  
ATOM 6837  H HD12 . LEU A 1 65  ? 5.708   14.714  -7.496  1.00 1.00 ? 65  LEU A HD12 4  
ATOM 6838  H HD13 . LEU A 1 65  ? 6.659   15.282  -8.875  1.00 1.00 ? 65  LEU A HD13 4  
ATOM 6839  H HD21 . LEU A 1 65  ? 3.474   16.895  -7.494  1.00 1.00 ? 65  LEU A HD21 4  
ATOM 6840  H HD22 . LEU A 1 65  ? 2.450   15.879  -8.544  1.00 1.00 ? 65  LEU A HD22 4  
ATOM 6841  H HD23 . LEU A 1 65  ? 3.406   15.133  -7.276  1.00 1.00 ? 65  LEU A HD23 4  
ATOM 6842  N N    . GLU A 1 66  ? 2.538   19.207  -9.786  1.00 1.00 ? 66  GLU A N    4  
ATOM 6843  C CA   . GLU A 1 66  ? 1.447   20.002  -9.185  1.00 1.00 ? 66  GLU A CA   4  
ATOM 6844  C C    . GLU A 1 66  ? 0.200   20.020  -10.082 1.00 1.00 ? 66  GLU A C    4  
ATOM 6845  O O    . GLU A 1 66  ? -0.906  19.711  -9.637  1.00 1.00 ? 66  GLU A O    4  
ATOM 6846  C CB   . GLU A 1 66  ? 1.870   21.469  -8.946  1.00 1.00 ? 66  GLU A CB   4  
ATOM 6847  C CG   . GLU A 1 66  ? 3.275   21.627  -8.372  1.00 1.00 ? 66  GLU A CG   4  
ATOM 6848  C CD   . GLU A 1 66  ? 3.602   23.103  -8.094  1.00 1.00 ? 66  GLU A CD   4  
ATOM 6849  O OE1  . GLU A 1 66  ? 3.267   23.608  -6.996  1.00 1.00 ? 66  GLU A OE1  4  
ATOM 6850  O OE2  . GLU A 1 66  ? 4.212   23.756  -8.973  1.00 1.00 ? 66  GLU A OE2  4  
ATOM 6851  H H    . GLU A 1 66  ? 3.468   19.608  -9.796  1.00 1.00 ? 66  GLU A H    4  
ATOM 6852  H HA   . GLU A 1 66  ? 1.186   19.562  -8.222  1.00 1.00 ? 66  GLU A HA   4  
ATOM 6853  H HB2  . GLU A 1 66  ? 1.840   22.023  -9.885  1.00 1.00 ? 66  GLU A HB2  4  
ATOM 6854  H HB3  . GLU A 1 66  ? 1.148   21.927  -8.267  1.00 1.00 ? 66  GLU A HB3  4  
ATOM 6855  H HG2  . GLU A 1 66  ? 3.356   21.039  -7.460  1.00 1.00 ? 66  GLU A HG2  4  
ATOM 6856  H HG3  . GLU A 1 66  ? 3.976   21.244  -9.117  1.00 1.00 ? 66  GLU A HG3  4  
ATOM 6857  N N    . ASP A 1 67  ? 0.395   20.348  -11.365 1.00 1.00 ? 67  ASP A N    4  
ATOM 6858  C CA   . ASP A 1 67  ? -0.693  20.478  -12.334 1.00 1.00 ? 67  ASP A CA   4  
ATOM 6859  C C    . ASP A 1 67  ? -1.394  19.136  -12.598 1.00 1.00 ? 67  ASP A C    4  
ATOM 6860  O O    . ASP A 1 67  ? -2.624  19.070  -12.610 1.00 1.00 ? 67  ASP A O    4  
ATOM 6861  C CB   . ASP A 1 67  ? -0.152  21.074  -13.639 1.00 1.00 ? 67  ASP A CB   4  
ATOM 6862  C CG   . ASP A 1 67  ? -1.290  21.350  -14.635 1.00 1.00 ? 67  ASP A CG   4  
ATOM 6863  O OD1  . ASP A 1 67  ? -1.929  22.424  -14.529 1.00 1.00 ? 67  ASP A OD1  4  
ATOM 6864  O OD2  . ASP A 1 67  ? -1.545  20.494  -15.515 1.00 1.00 ? 67  ASP A OD2  4  
ATOM 6865  H H    . ASP A 1 67  ? 1.329   20.617  -11.646 1.00 1.00 ? 67  ASP A H    4  
ATOM 6866  H HA   . ASP A 1 67  ? -1.413  21.176  -11.910 1.00 1.00 ? 67  ASP A HA   4  
ATOM 6867  H HB2  . ASP A 1 67  ? 0.367   22.010  -13.419 1.00 1.00 ? 67  ASP A HB2  4  
ATOM 6868  H HB3  . ASP A 1 67  ? 0.568   20.381  -14.081 1.00 1.00 ? 67  ASP A HB3  4  
ATOM 6869  N N    . VAL A 1 68  ? -0.608  18.065  -12.761 1.00 1.00 ? 68  VAL A N    4  
ATOM 6870  C CA   . VAL A 1 68  ? -1.105  16.703  -12.995 1.00 1.00 ? 68  VAL A CA   4  
ATOM 6871  C C    . VAL A 1 68  ? -1.785  16.114  -11.752 1.00 1.00 ? 68  VAL A C    4  
ATOM 6872  O O    . VAL A 1 68  ? -2.810  15.446  -11.887 1.00 1.00 ? 68  VAL A O    4  
ATOM 6873  C CB   . VAL A 1 68  ? 0.018   15.769  -13.509 1.00 1.00 ? 68  VAL A CB   4  
ATOM 6874  C CG1  . VAL A 1 68  ? -0.420  14.297  -13.620 1.00 1.00 ? 68  VAL A CG1  4  
ATOM 6875  C CG2  . VAL A 1 68  ? 0.481   16.237  -14.895 1.00 1.00 ? 68  VAL A CG2  4  
ATOM 6876  H H    . VAL A 1 68  ? 0.393   18.238  -12.801 1.00 1.00 ? 68  VAL A H    4  
ATOM 6877  H HA   . VAL A 1 68  ? -1.852  16.779  -13.779 1.00 1.00 ? 68  VAL A HA   4  
ATOM 6878  H HB   . VAL A 1 68  ? 0.860   15.821  -12.815 1.00 1.00 ? 68  VAL A HB   4  
ATOM 6879  H HG11 . VAL A 1 68  ? -0.638  13.895  -12.630 1.00 1.00 ? 68  VAL A HG11 4  
ATOM 6880  H HG12 . VAL A 1 68  ? -1.306  14.213  -14.251 1.00 1.00 ? 68  VAL A HG12 4  
ATOM 6881  H HG13 . VAL A 1 68  ? 0.384   13.700  -14.048 1.00 1.00 ? 68  VAL A HG13 4  
ATOM 6882  H HG21 . VAL A 1 68  ? 0.980   17.196  -14.811 1.00 1.00 ? 68  VAL A HG21 4  
ATOM 6883  H HG22 . VAL A 1 68  ? 1.188   15.529  -15.321 1.00 1.00 ? 68  VAL A HG22 4  
ATOM 6884  H HG23 . VAL A 1 68  ? -0.374  16.328  -15.568 1.00 1.00 ? 68  VAL A HG23 4  
ATOM 6885  N N    . VAL A 1 69  ? -1.236  16.328  -10.551 1.00 1.00 ? 69  VAL A N    4  
ATOM 6886  C CA   . VAL A 1 69  ? -1.755  15.722  -9.319  1.00 1.00 ? 69  VAL A CA   4  
ATOM 6887  C C    . VAL A 1 69  ? -2.974  16.469  -8.754  1.00 1.00 ? 69  VAL A C    4  
ATOM 6888  O O    . VAL A 1 69  ? -3.883  15.827  -8.232  1.00 1.00 ? 69  VAL A O    4  
ATOM 6889  C CB   . VAL A 1 69  ? -0.633  15.544  -8.272  1.00 1.00 ? 69  VAL A CB   4  
ATOM 6890  C CG1  . VAL A 1 69  ? -0.301  16.795  -7.444  1.00 1.00 ? 69  VAL A CG1  4  
ATOM 6891  C CG2  . VAL A 1 69  ? -0.962  14.383  -7.334  1.00 1.00 ? 69  VAL A CG2  4  
ATOM 6892  H H    . VAL A 1 69  ? -0.367  16.858  -10.498 1.00 1.00 ? 69  VAL A H    4  
ATOM 6893  H HA   . VAL A 1 69  ? -2.078  14.722  -9.601  1.00 1.00 ? 69  VAL A HA   4  
ATOM 6894  H HB   . VAL A 1 69  ? 0.263   15.253  -8.818  1.00 1.00 ? 69  VAL A HB   4  
ATOM 6895  H HG11 . VAL A 1 69  ? 0.586   16.608  -6.838  1.00 1.00 ? 69  VAL A HG11 4  
ATOM 6896  H HG12 . VAL A 1 69  ? -0.103  17.638  -8.104  1.00 1.00 ? 69  VAL A HG12 4  
ATOM 6897  H HG13 . VAL A 1 69  ? -1.129  17.044  -6.780  1.00 1.00 ? 69  VAL A HG13 4  
ATOM 6898  H HG21 . VAL A 1 69  ? -1.087  13.475  -7.919  1.00 1.00 ? 69  VAL A HG21 4  
ATOM 6899  H HG22 . VAL A 1 69  ? -0.133  14.233  -6.648  1.00 1.00 ? 69  VAL A HG22 4  
ATOM 6900  H HG23 . VAL A 1 69  ? -1.874  14.587  -6.771  1.00 1.00 ? 69  VAL A HG23 4  
ATOM 6901  N N    . GLY A 1 70  ? -3.028  17.802  -8.873  1.00 1.00 ? 70  GLY A N    4  
ATOM 6902  C CA   . GLY A 1 70  ? -4.142  18.619  -8.372  1.00 1.00 ? 70  GLY A CA   4  
ATOM 6903  C C    . GLY A 1 70  ? -4.323  18.493  -6.854  1.00 1.00 ? 70  GLY A C    4  
ATOM 6904  O O    . GLY A 1 70  ? -3.361  18.602  -6.094  1.00 1.00 ? 70  GLY A O    4  
ATOM 6905  H H    . GLY A 1 70  ? -2.245  18.293  -9.296  1.00 1.00 ? 70  GLY A H    4  
ATOM 6906  H HA2  . GLY A 1 70  ? -3.973  19.670  -8.614  1.00 1.00 ? 70  GLY A HA2  4  
ATOM 6907  H HA3  . GLY A 1 70  ? -5.063  18.300  -8.865  1.00 1.00 ? 70  GLY A HA3  4  
ATOM 6908  N N    . GLY A 1 71  ? -5.563  18.236  -6.422  1.00 1.00 ? 71  GLY A N    4  
ATOM 6909  C CA   . GLY A 1 71  ? -5.930  17.979  -5.018  1.00 1.00 ? 71  GLY A CA   4  
ATOM 6910  C C    . GLY A 1 71  ? -5.870  16.503  -4.598  1.00 1.00 ? 71  GLY A C    4  
ATOM 6911  O O    . GLY A 1 71  ? -6.272  16.177  -3.480  1.00 1.00 ? 71  GLY A O    4  
ATOM 6912  H H    . GLY A 1 71  ? -6.305  18.205  -7.109  1.00 1.00 ? 71  GLY A H    4  
ATOM 6913  H HA2  . GLY A 1 71  ? -5.263  18.536  -4.357  1.00 1.00 ? 71  GLY A HA2  4  
ATOM 6914  H HA3  . GLY A 1 71  ? -6.955  18.313  -4.861  1.00 1.00 ? 71  GLY A HA3  4  
ATOM 6915  N N    . CYS A 1 72  ? -5.402  15.605  -5.475  1.00 1.00 ? 72  CYS A N    4  
ATOM 6916  C CA   . CYS A 1 72  ? -5.333  14.158  -5.223  1.00 1.00 ? 72  CYS A CA   4  
ATOM 6917  C C    . CYS A 1 72  ? -4.118  13.776  -4.347  1.00 1.00 ? 72  CYS A C    4  
ATOM 6918  O O    . CYS A 1 72  ? -3.136  14.520  -4.256  1.00 1.00 ? 72  CYS A O    4  
ATOM 6919  C CB   . CYS A 1 72  ? -5.323  13.415  -6.571  1.00 1.00 ? 72  CYS A CB   4  
ATOM 6920  S SG   . CYS A 1 72  ? -6.842  13.823  -7.490  1.00 1.00 ? 72  CYS A SG   4  
ATOM 6921  H H    . CYS A 1 72  ? -5.019  15.949  -6.347  1.00 1.00 ? 72  CYS A H    4  
ATOM 6922  H HA   . CYS A 1 72  ? -6.230  13.854  -4.679  1.00 1.00 ? 72  CYS A HA   4  
ATOM 6923  H HB2  . CYS A 1 72  ? -4.440  13.696  -7.150  1.00 1.00 ? 72  CYS A HB2  4  
ATOM 6924  H HB3  . CYS A 1 72  ? -5.282  12.338  -6.399  1.00 1.00 ? 72  CYS A HB3  4  
ATOM 6925  H HG   . CYS A 1 72  ? -6.721  15.162  -7.466  1.00 1.00 ? 72  CYS A HG   4  
ATOM 6926  N N    . CYS A 1 73  ? -4.173  12.594  -3.723  1.00 1.00 ? 73  CYS A N    4  
ATOM 6927  C CA   . CYS A 1 73  ? -3.077  12.036  -2.917  1.00 1.00 ? 73  CYS A CA   4  
ATOM 6928  C C    . CYS A 1 73  ? -2.000  11.400  -3.811  1.00 1.00 ? 73  CYS A C    4  
ATOM 6929  O O    . CYS A 1 73  ? -2.294  10.950  -4.919  1.00 1.00 ? 73  CYS A O    4  
ATOM 6930  C CB   . CYS A 1 73  ? -3.666  11.015  -1.924  1.00 1.00 ? 73  CYS A CB   4  
ATOM 6931  S SG   . CYS A 1 73  ? -4.823  11.841  -0.789  1.00 1.00 ? 73  CYS A SG   4  
ATOM 6932  H H    . CYS A 1 73  ? -4.980  12.003  -3.877  1.00 1.00 ? 73  CYS A H    4  
ATOM 6933  H HA   . CYS A 1 73  ? -2.600  12.840  -2.352  1.00 1.00 ? 73  CYS A HA   4  
ATOM 6934  H HB2  . CYS A 1 73  ? -4.192  10.229  -2.470  1.00 1.00 ? 73  CYS A HB2  4  
ATOM 6935  H HB3  . CYS A 1 73  ? -2.864  10.548  -1.344  1.00 1.00 ? 73  CYS A HB3  4  
ATOM 6936  H HG   . CYS A 1 73  ? -3.941  12.673  -0.206  1.00 1.00 ? 73  CYS A HG   4  
ATOM 6937  N N    . TYR A 1 74  ? -0.758  11.301  -3.324  1.00 1.00 ? 74  TYR A N    4  
ATOM 6938  C CA   . TYR A 1 74  ? 0.352   10.680  -4.064  1.00 1.00 ? 74  TYR A CA   4  
ATOM 6939  C C    . TYR A 1 74  ? 1.534   10.235  -3.180  1.00 1.00 ? 74  TYR A C    4  
ATOM 6940  O O    . TYR A 1 74  ? 1.670   10.678  -2.037  1.00 1.00 ? 74  TYR A O    4  
ATOM 6941  C CB   . TYR A 1 74  ? 0.833   11.602  -5.202  1.00 1.00 ? 74  TYR A CB   4  
ATOM 6942  C CG   . TYR A 1 74  ? 1.647   12.808  -4.760  1.00 1.00 ? 74  TYR A CG   4  
ATOM 6943  C CD1  . TYR A 1 74  ? 1.004   13.944  -4.226  1.00 1.00 ? 74  TYR A CD1  4  
ATOM 6944  C CD2  . TYR A 1 74  ? 3.050   12.808  -4.900  1.00 1.00 ? 74  TYR A CD2  4  
ATOM 6945  C CE1  . TYR A 1 74  ? 1.754   15.075  -3.847  1.00 1.00 ? 74  TYR A CE1  4  
ATOM 6946  C CE2  . TYR A 1 74  ? 3.807   13.933  -4.523  1.00 1.00 ? 74  TYR A CE2  4  
ATOM 6947  C CZ   . TYR A 1 74  ? 3.160   15.075  -3.998  1.00 1.00 ? 74  TYR A CZ   4  
ATOM 6948  O OH   . TYR A 1 74  ? 3.895   16.165  -3.638  1.00 1.00 ? 74  TYR A OH   4  
ATOM 6949  H H    . TYR A 1 74  ? -0.562  11.667  -2.402  1.00 1.00 ? 74  TYR A H    4  
ATOM 6950  H HA   . TYR A 1 74  ? -0.051  9.777   -4.516  1.00 1.00 ? 74  TYR A HA   4  
ATOM 6951  H HB2  . TYR A 1 74  ? 1.436   11.008  -5.888  1.00 1.00 ? 74  TYR A HB2  4  
ATOM 6952  H HB3  . TYR A 1 74  ? -0.024  11.949  -5.777  1.00 1.00 ? 74  TYR A HB3  4  
ATOM 6953  H HD1  . TYR A 1 74  ? -0.073  13.954  -4.124  1.00 1.00 ? 74  TYR A HD1  4  
ATOM 6954  H HD2  . TYR A 1 74  ? 3.554   11.944  -5.302  1.00 1.00 ? 74  TYR A HD2  4  
ATOM 6955  H HE1  . TYR A 1 74  ? 1.252   15.944  -3.446  1.00 1.00 ? 74  TYR A HE1  4  
ATOM 6956  H HE2  . TYR A 1 74  ? 4.882   13.932  -4.638  1.00 1.00 ? 74  TYR A HE2  4  
ATOM 6957  H HH   . TYR A 1 74  ? 3.355   16.892  -3.287  1.00 1.00 ? 74  TYR A HH   4  
ATOM 6958  N N    . ARG A 1 75  ? 2.400   9.376   -3.738  1.00 1.00 ? 75  ARG A N    4  
ATOM 6959  C CA   . ARG A 1 75  ? 3.639   8.872   -3.115  1.00 1.00 ? 75  ARG A CA   4  
ATOM 6960  C C    . ARG A 1 75  ? 4.627   8.356   -4.175  1.00 1.00 ? 75  ARG A C    4  
ATOM 6961  O O    . ARG A 1 75  ? 4.215   7.991   -5.273  1.00 1.00 ? 75  ARG A O    4  
ATOM 6962  C CB   . ARG A 1 75  ? 3.306   7.783   -2.070  1.00 1.00 ? 75  ARG A CB   4  
ATOM 6963  C CG   . ARG A 1 75  ? 2.724   6.499   -2.691  1.00 1.00 ? 75  ARG A CG   4  
ATOM 6964  C CD   . ARG A 1 75  ? 2.274   5.496   -1.624  1.00 1.00 ? 75  ARG A CD   4  
ATOM 6965  N NE   . ARG A 1 75  ? 1.851   4.238   -2.260  1.00 1.00 ? 75  ARG A NE   4  
ATOM 6966  C CZ   . ARG A 1 75  ? 1.151   3.244   -1.737  1.00 1.00 ? 75  ARG A CZ   4  
ATOM 6967  N NH1  . ARG A 1 75  ? 0.699   3.254   -0.499  1.00 1.00 ? 75  ARG A NH1  4  
ATOM 6968  N NH2  . ARG A 1 75  ? 0.910   2.209   -2.507  1.00 1.00 ? 75  ARG A NH2  4  
ATOM 6969  H H    . ARG A 1 75  ? 2.169   9.019   -4.663  1.00 1.00 ? 75  ARG A H    4  
ATOM 6970  H HA   . ARG A 1 75  ? 4.113   9.705   -2.593  1.00 1.00 ? 75  ARG A HA   4  
ATOM 6971  H HB2  . ARG A 1 75  ? 4.213   7.527   -1.520  1.00 1.00 ? 75  ARG A HB2  4  
ATOM 6972  H HB3  . ARG A 1 75  ? 2.588   8.184   -1.353  1.00 1.00 ? 75  ARG A HB3  4  
ATOM 6973  H HG2  . ARG A 1 75  ? 1.866   6.753   -3.311  1.00 1.00 ? 75  ARG A HG2  4  
ATOM 6974  H HG3  . ARG A 1 75  ? 3.482   6.026   -3.321  1.00 1.00 ? 75  ARG A HG3  4  
ATOM 6975  H HD2  . ARG A 1 75  ? 3.106   5.292   -0.945  1.00 1.00 ? 75  ARG A HD2  4  
ATOM 6976  H HD3  . ARG A 1 75  ? 1.447   5.927   -1.057  1.00 1.00 ? 75  ARG A HD3  4  
ATOM 6977  H HE   . ARG A 1 75  ? 2.153   4.076   -3.222  1.00 1.00 ? 75  ARG A HE   4  
ATOM 6978  H HH11 . ARG A 1 75  ? 0.888   4.038   0.103   1.00 1.00 ? 75  ARG A HH11 4  
ATOM 6979  H HH12 . ARG A 1 75  ? 0.167   2.475   -0.141  1.00 1.00 ? 75  ARG A HH12 4  
ATOM 6980  H HH21 . ARG A 1 75  ? 1.285   2.242   -3.457  1.00 1.00 ? 75  ARG A HH21 4  
ATOM 6981  H HH22 . ARG A 1 75  ? 0.392   1.408   -2.181  1.00 1.00 ? 75  ARG A HH22 4  
ATOM 6982  N N    . VAL A 1 76  ? 5.913   8.280   -3.849  1.00 1.00 ? 76  VAL A N    4  
ATOM 6983  C CA   . VAL A 1 76  ? 6.940   7.611   -4.673  1.00 1.00 ? 76  VAL A CA   4  
ATOM 6984  C C    . VAL A 1 76  ? 6.959   6.122   -4.312  1.00 1.00 ? 76  VAL A C    4  
ATOM 6985  O O    . VAL A 1 76  ? 6.965   5.785   -3.128  1.00 1.00 ? 76  VAL A O    4  
ATOM 6986  C CB   . VAL A 1 76  ? 8.344   8.217   -4.449  1.00 1.00 ? 76  VAL A CB   4  
ATOM 6987  C CG1  . VAL A 1 76  ? 9.431   7.473   -5.244  1.00 1.00 ? 76  VAL A CG1  4  
ATOM 6988  C CG2  . VAL A 1 76  ? 8.372   9.707   -4.826  1.00 1.00 ? 76  VAL A CG2  4  
ATOM 6989  H H    . VAL A 1 76  ? 6.178   8.555   -2.899  1.00 1.00 ? 76  VAL A H    4  
ATOM 6990  H HA   . VAL A 1 76  ? 6.681   7.729   -5.725  1.00 1.00 ? 76  VAL A HA   4  
ATOM 6991  H HB   . VAL A 1 76  ? 8.592   8.138   -3.389  1.00 1.00 ? 76  VAL A HB   4  
ATOM 6992  H HG11 . VAL A 1 76  ? 9.175   7.460   -6.304  1.00 1.00 ? 76  VAL A HG11 4  
ATOM 6993  H HG12 . VAL A 1 76  ? 10.393  7.962   -5.106  1.00 1.00 ? 76  VAL A HG12 4  
ATOM 6994  H HG13 . VAL A 1 76  ? 9.528   6.447   -4.886  1.00 1.00 ? 76  VAL A HG13 4  
ATOM 6995  H HG21 . VAL A 1 76  ? 7.624   10.264  -4.258  1.00 1.00 ? 76  VAL A HG21 4  
ATOM 6996  H HG22 . VAL A 1 76  ? 9.352   10.115  -4.591  1.00 1.00 ? 76  VAL A HG22 4  
ATOM 6997  H HG23 . VAL A 1 76  ? 8.173   9.826   -5.892  1.00 1.00 ? 76  VAL A HG23 4  
ATOM 6998  N N    . ASN A 1 77  ? 6.993   5.242   -5.318  1.00 1.00 ? 77  ASN A N    4  
ATOM 6999  C CA   . ASN A 1 77  ? 7.026   3.786   -5.130  1.00 1.00 ? 77  ASN A CA   4  
ATOM 7000  C C    . ASN A 1 77  ? 7.478   3.052   -6.412  1.00 1.00 ? 77  ASN A C    4  
ATOM 7001  O O    . ASN A 1 77  ? 6.668   2.723   -7.280  1.00 1.00 ? 77  ASN A O    4  
ATOM 7002  C CB   . ASN A 1 77  ? 5.644   3.298   -4.647  1.00 1.00 ? 77  ASN A CB   4  
ATOM 7003  C CG   . ASN A 1 77  ? 5.597   1.799   -4.353  1.00 1.00 ? 77  ASN A CG   4  
ATOM 7004  O OD1  . ASN A 1 77  ? 6.611   1.125   -4.207  1.00 1.00 ? 77  ASN A OD1  4  
ATOM 7005  N ND2  . ASN A 1 77  ? 4.406   1.241   -4.256  1.00 1.00 ? 77  ASN A ND2  4  
ATOM 7006  H H    . ASN A 1 77  ? 6.986   5.594   -6.272  1.00 1.00 ? 77  ASN A H    4  
ATOM 7007  H HA   . ASN A 1 77  ? 7.752   3.565   -4.343  1.00 1.00 ? 77  ASN A HA   4  
ATOM 7008  H HB2  . ASN A 1 77  ? 5.354   3.825   -3.738  1.00 1.00 ? 77  ASN A HB2  4  
ATOM 7009  H HB3  . ASN A 1 77  ? 4.905   3.530   -5.409  1.00 1.00 ? 77  ASN A HB3  4  
ATOM 7010  H HD21 . ASN A 1 77  ? 3.580   1.813   -4.432  1.00 1.00 ? 77  ASN A HD21 4  
ATOM 7011  H HD22 . ASN A 1 77  ? 4.330   0.254   -4.069  1.00 1.00 ? 77  ASN A HD22 4  
ATOM 7012  N N    . ASN A 1 78  ? 8.783   2.773   -6.519  1.00 1.00 ? 78  ASN A N    4  
ATOM 7013  C CA   . ASN A 1 78  ? 9.346   1.934   -7.588  1.00 1.00 ? 78  ASN A CA   4  
ATOM 7014  C C    . ASN A 1 78  ? 9.088   0.441   -7.305  1.00 1.00 ? 78  ASN A C    4  
ATOM 7015  O O    . ASN A 1 78  ? 9.703   -0.146  -6.415  1.00 1.00 ? 78  ASN A O    4  
ATOM 7016  C CB   . ASN A 1 78  ? 10.854  2.216   -7.735  1.00 1.00 ? 78  ASN A CB   4  
ATOM 7017  C CG   . ASN A 1 78  ? 11.156  3.632   -8.209  1.00 1.00 ? 78  ASN A CG   4  
ATOM 7018  O OD1  . ASN A 1 78  ? 10.470  4.176   -9.061  1.00 1.00 ? 78  ASN A OD1  4  
ATOM 7019  N ND2  . ASN A 1 78  ? 12.184  4.267   -7.680  1.00 1.00 ? 78  ASN A ND2  4  
ATOM 7020  H H    . ASN A 1 78  ? 9.400   3.075   -5.777  1.00 1.00 ? 78  ASN A H    4  
ATOM 7021  H HA   . ASN A 1 78  ? 8.864   2.184   -8.536  1.00 1.00 ? 78  ASN A HA   4  
ATOM 7022  H HB2  . ASN A 1 78  ? 11.352  2.034   -6.779  1.00 1.00 ? 78  ASN A HB2  4  
ATOM 7023  H HB3  . ASN A 1 78  ? 11.279  1.530   -8.472  1.00 1.00 ? 78  ASN A HB3  4  
ATOM 7024  H HD21 . ASN A 1 78  ? 12.760  3.823   -6.977  1.00 1.00 ? 78  ASN A HD21 4  
ATOM 7025  H HD22 . ASN A 1 78  ? 12.366  5.215   -7.973  1.00 1.00 ? 78  ASN A HD22 4  
ATOM 7026  N N    . SER A 1 79  ? 8.200   -0.190  -8.076  1.00 1.00 ? 79  SER A N    4  
ATOM 7027  C CA   . SER A 1 79  ? 7.854   -1.611  -7.955  1.00 1.00 ? 79  SER A CA   4  
ATOM 7028  C C    . SER A 1 79  ? 8.942   -2.521  -8.554  1.00 1.00 ? 79  SER A C    4  
ATOM 7029  O O    . SER A 1 79  ? 9.457   -3.424  -7.890  1.00 1.00 ? 79  SER A O    4  
ATOM 7030  C CB   . SER A 1 79  ? 6.506   -1.848  -8.655  1.00 1.00 ? 79  SER A CB   4  
ATOM 7031  O OG   . SER A 1 79  ? 6.515   -1.284  -9.964  1.00 1.00 ? 79  SER A OG   4  
ATOM 7032  H H    . SER A 1 79  ? 7.655   0.334   -8.745  1.00 1.00 ? 79  SER A H    4  
ATOM 7033  H HA   . SER A 1 79  ? 7.741   -1.861  -6.905  1.00 1.00 ? 79  SER A HA   4  
ATOM 7034  H HB2  . SER A 1 79  ? 6.302   -2.920  -8.711  1.00 1.00 ? 79  SER A HB2  4  
ATOM 7035  H HB3  . SER A 1 79  ? 5.715   -1.375  -8.069  1.00 1.00 ? 79  SER A HB3  4  
ATOM 7036  H HG   . SER A 1 79  ? 5.634   -1.406  -10.375 1.00 1.00 ? 79  SER A HG   4  
ATOM 7037  N N    . LEU A 1 80  ? 9.345   -2.248  -9.805  1.00 1.00 ? 80  LEU A N    4  
ATOM 7038  C CA   . LEU A 1 80  ? 10.276  -3.077  -10.576 1.00 1.00 ? 80  LEU A CA   4  
ATOM 7039  C C    . LEU A 1 80  ? 11.713  -3.063  -10.038 1.00 1.00 ? 80  LEU A C    4  
ATOM 7040  O O    . LEU A 1 80  ? 12.498  -3.942  -10.374 1.00 1.00 ? 80  LEU A O    4  
ATOM 7041  C CB   . LEU A 1 80  ? 10.235  -2.678  -12.061 1.00 1.00 ? 80  LEU A CB   4  
ATOM 7042  C CG   . LEU A 1 80  ? 8.838   -2.636  -12.716 1.00 1.00 ? 80  LEU A CG   4  
ATOM 7043  C CD1  . LEU A 1 80  ? 8.983   -2.177  -14.174 1.00 1.00 ? 80  LEU A CD1  4  
ATOM 7044  C CD2  . LEU A 1 80  ? 8.118   -3.990  -12.624 1.00 1.00 ? 80  LEU A CD2  4  
ATOM 7045  H H    . LEU A 1 80  ? 8.856   -1.509  -10.295 1.00 1.00 ? 80  LEU A H    4  
ATOM 7046  H HA   . LEU A 1 80  ? 9.941   -4.110  -10.494 1.00 1.00 ? 80  LEU A HA   4  
ATOM 7047  H HB2  . LEU A 1 80  ? 10.705  -1.698  -12.169 1.00 1.00 ? 80  LEU A HB2  4  
ATOM 7048  H HB3  . LEU A 1 80  ? 10.846  -3.410  -12.596 1.00 1.00 ? 80  LEU A HB3  4  
ATOM 7049  H HG   . LEU A 1 80  ? 8.225   -1.892  -12.203 1.00 1.00 ? 80  LEU A HG   4  
ATOM 7050  H HD11 . LEU A 1 80  ? 8.023   -2.242  -14.682 1.00 1.00 ? 80  LEU A HD11 4  
ATOM 7051  H HD12 . LEU A 1 80  ? 9.324   -1.145  -14.200 1.00 1.00 ? 80  LEU A HD12 4  
ATOM 7052  H HD13 . LEU A 1 80  ? 9.706   -2.801  -14.696 1.00 1.00 ? 80  LEU A HD13 4  
ATOM 7053  H HD21 . LEU A 1 80  ? 7.171   -3.936  -13.158 1.00 1.00 ? 80  LEU A HD21 4  
ATOM 7054  H HD22 . LEU A 1 80  ? 8.725   -4.787  -13.053 1.00 1.00 ? 80  LEU A HD22 4  
ATOM 7055  H HD23 . LEU A 1 80  ? 7.910   -4.215  -11.578 1.00 1.00 ? 80  LEU A HD23 4  
ATOM 7056  N N    . ASP A 1 81  ? 12.041  -2.118  -9.151  1.00 1.00 ? 81  ASP A N    4  
ATOM 7057  C CA   . ASP A 1 81  ? 13.300  -2.101  -8.382  1.00 1.00 ? 81  ASP A CA   4  
ATOM 7058  C C    . ASP A 1 81  ? 13.501  -3.393  -7.565  1.00 1.00 ? 81  ASP A C    4  
ATOM 7059  O O    . ASP A 1 81  ? 14.627  -3.833  -7.335  1.00 1.00 ? 81  ASP A O    4  
ATOM 7060  C CB   . ASP A 1 81  ? 13.257  -0.913  -7.416  1.00 1.00 ? 81  ASP A CB   4  
ATOM 7061  C CG   . ASP A 1 81  ? 14.590  -0.718  -6.671  1.00 1.00 ? 81  ASP A CG   4  
ATOM 7062  O OD1  . ASP A 1 81  ? 15.577  -0.294  -7.318  1.00 1.00 ? 81  ASP A OD1  4  
ATOM 7063  O OD2  . ASP A 1 81  ? 14.637  -0.958  -5.441  1.00 1.00 ? 81  ASP A OD2  4  
ATOM 7064  H H    . ASP A 1 81  ? 11.342  -1.418  -8.948  1.00 1.00 ? 81  ASP A H    4  
ATOM 7065  H HA   . ASP A 1 81  ? 14.144  -1.983  -9.066  1.00 1.00 ? 81  ASP A HA   4  
ATOM 7066  H HB2  . ASP A 1 81  ? 13.026  -0.006  -7.973  1.00 1.00 ? 81  ASP A HB2  4  
ATOM 7067  H HB3  . ASP A 1 81  ? 12.453  -1.090  -6.691  1.00 1.00 ? 81  ASP A HB3  4  
ATOM 7068  N N    . HIS A 1 82  ? 12.395  -4.010  -7.144  1.00 1.00 ? 82  HIS A N    4  
ATOM 7069  C CA   . HIS A 1 82  ? 12.365  -5.278  -6.417  1.00 1.00 ? 82  HIS A CA   4  
ATOM 7070  C C    . HIS A 1 82  ? 12.289  -6.506  -7.365  1.00 1.00 ? 82  HIS A C    4  
ATOM 7071  O O    . HIS A 1 82  ? 12.397  -7.650  -6.910  1.00 1.00 ? 82  HIS A O    4  
ATOM 7072  C CB   . HIS A 1 82  ? 11.171  -5.190  -5.448  1.00 1.00 ? 82  HIS A CB   4  
ATOM 7073  C CG   . HIS A 1 82  ? 11.193  -6.217  -4.343  1.00 1.00 ? 82  HIS A CG   4  
ATOM 7074  N ND1  . HIS A 1 82  ? 11.911  -6.139  -3.169  1.00 1.00 ? 82  HIS A ND1  4  
ATOM 7075  C CD2  . HIS A 1 82  ? 10.494  -7.397  -4.305  1.00 1.00 ? 82  HIS A CD2  4  
ATOM 7076  C CE1  . HIS A 1 82  ? 11.651  -7.242  -2.445  1.00 1.00 ? 82  HIS A CE1  4  
ATOM 7077  N NE2  . HIS A 1 82  ? 10.786  -8.044  -3.093  1.00 1.00 ? 82  HIS A NE2  4  
ATOM 7078  H H    . HIS A 1 82  ? 11.502  -3.589  -7.378  1.00 1.00 ? 82  HIS A H    4  
ATOM 7079  H HA   . HIS A 1 82  ? 13.277  -5.379  -5.827  1.00 1.00 ? 82  HIS A HA   4  
ATOM 7080  H HB2  . HIS A 1 82  ? 11.163  -4.196  -4.990  1.00 1.00 ? 82  HIS A HB2  4  
ATOM 7081  H HB3  . HIS A 1 82  ? 10.247  -5.300  -6.016  1.00 1.00 ? 82  HIS A HB3  4  
ATOM 7082  H HD1  . HIS A 1 82  ? 12.514  -5.378  -2.884  1.00 1.00 ? 82  HIS A HD1  4  
ATOM 7083  H HD2  . HIS A 1 82  ? 9.831   -7.758  -5.080  1.00 1.00 ? 82  HIS A HD2  4  
ATOM 7084  H HE1  . HIS A 1 82  ? 12.080  -7.447  -1.470  1.00 1.00 ? 82  HIS A HE1  4  
ATOM 7085  N N    . GLU A 1 83  ? 12.130  -6.281  -8.677  1.00 1.00 ? 83  GLU A N    4  
ATOM 7086  C CA   . GLU A 1 83  ? 12.001  -7.318  -9.707  1.00 1.00 ? 83  GLU A CA   4  
ATOM 7087  C C    . GLU A 1 83  ? 13.322  -7.544  -10.459 1.00 1.00 ? 83  GLU A C    4  
ATOM 7088  O O    . GLU A 1 83  ? 13.771  -8.685  -10.601 1.00 1.00 ? 83  GLU A O    4  
ATOM 7089  C CB   . GLU A 1 83  ? 10.891  -6.950  -10.710 1.00 1.00 ? 83  GLU A CB   4  
ATOM 7090  C CG   . GLU A 1 83  ? 9.490   -6.871  -10.086 1.00 1.00 ? 83  GLU A CG   4  
ATOM 7091  C CD   . GLU A 1 83  ? 9.041   -8.208  -9.473  1.00 1.00 ? 83  GLU A CD   4  
ATOM 7092  O OE1  . GLU A 1 83  ? 8.929   -9.218  -10.212 1.00 1.00 ? 83  GLU A OE1  4  
ATOM 7093  O OE2  . GLU A 1 83  ? 8.765   -8.259  -8.250  1.00 1.00 ? 83  GLU A OE2  4  
ATOM 7094  H H    . GLU A 1 83  ? 12.178  -5.323  -9.000  1.00 1.00 ? 83  GLU A H    4  
ATOM 7095  H HA   . GLU A 1 83  ? 11.730  -8.260  -9.241  1.00 1.00 ? 83  GLU A HA   4  
ATOM 7096  H HB2  . GLU A 1 83  ? 11.117  -5.994  -11.189 1.00 1.00 ? 83  GLU A HB2  4  
ATOM 7097  H HB3  . GLU A 1 83  ? 10.870  -7.714  -11.486 1.00 1.00 ? 83  GLU A HB3  4  
ATOM 7098  H HG2  . GLU A 1 83  ? 9.473   -6.086  -9.325  1.00 1.00 ? 83  GLU A HG2  4  
ATOM 7099  H HG3  . GLU A 1 83  ? 8.783   -6.584  -10.867 1.00 1.00 ? 83  GLU A HG3  4  
ATOM 7100  N N    . TYR A 1 84  ? 13.951  -6.460  -10.925 1.00 1.00 ? 84  TYR A N    4  
ATOM 7101  C CA   . TYR A 1 84  ? 15.159  -6.460  -11.766 1.00 1.00 ? 84  TYR A CA   4  
ATOM 7102  C C    . TYR A 1 84  ? 16.247  -5.502  -11.237 1.00 1.00 ? 84  TYR A C    4  
ATOM 7103  O O    . TYR A 1 84  ? 16.000  -4.673  -10.358 1.00 1.00 ? 84  TYR A O    4  
ATOM 7104  C CB   . TYR A 1 84  ? 14.788  -6.032  -13.203 1.00 1.00 ? 84  TYR A CB   4  
ATOM 7105  C CG   . TYR A 1 84  ? 13.391  -6.389  -13.687 1.00 1.00 ? 84  TYR A CG   4  
ATOM 7106  C CD1  . TYR A 1 84  ? 12.974  -7.732  -13.794 1.00 1.00 ? 84  TYR A CD1  4  
ATOM 7107  C CD2  . TYR A 1 84  ? 12.487  -5.353  -13.989 1.00 1.00 ? 84  TYR A CD2  4  
ATOM 7108  C CE1  . TYR A 1 84  ? 11.646  -8.037  -14.156 1.00 1.00 ? 84  TYR A CE1  4  
ATOM 7109  C CE2  . TYR A 1 84  ? 11.167  -5.653  -14.361 1.00 1.00 ? 84  TYR A CE2  4  
ATOM 7110  C CZ   . TYR A 1 84  ? 10.731  -6.993  -14.422 1.00 1.00 ? 84  TYR A CZ   4  
ATOM 7111  O OH   . TYR A 1 84  ? 9.426   -7.247  -14.723 1.00 1.00 ? 84  TYR A OH   4  
ATOM 7112  H H    . TYR A 1 84  ? 13.494  -5.566  -10.788 1.00 1.00 ? 84  TYR A H    4  
ATOM 7113  H HA   . TYR A 1 84  ? 15.577  -7.468  -11.801 1.00 1.00 ? 84  TYR A HA   4  
ATOM 7114  H HB2  . TYR A 1 84  ? 14.879  -4.945  -13.254 1.00 1.00 ? 84  TYR A HB2  4  
ATOM 7115  H HB3  . TYR A 1 84  ? 15.513  -6.454  -13.900 1.00 1.00 ? 84  TYR A HB3  4  
ATOM 7116  H HD1  . TYR A 1 84  ? 13.668  -8.529  -13.561 1.00 1.00 ? 84  TYR A HD1  4  
ATOM 7117  H HD2  . TYR A 1 84  ? 12.800  -4.320  -13.918 1.00 1.00 ? 84  TYR A HD2  4  
ATOM 7118  H HE1  . TYR A 1 84  ? 11.324  -9.068  -14.202 1.00 1.00 ? 84  TYR A HE1  4  
ATOM 7119  H HE2  . TYR A 1 84  ? 10.474  -4.863  -14.587 1.00 1.00 ? 84  TYR A HE2  4  
ATOM 7120  H HH   . TYR A 1 84  ? 9.193   -8.184  -14.681 1.00 1.00 ? 84  TYR A HH   4  
ATOM 7121  N N    . GLN A 1 85  ? 17.457  -5.572  -11.808 1.00 1.00 ? 85  GLN A N    4  
ATOM 7122  C CA   . GLN A 1 85  ? 18.496  -4.567  -11.559 1.00 1.00 ? 85  GLN A CA   4  
ATOM 7123  C C    . GLN A 1 85  ? 18.100  -3.254  -12.267 1.00 1.00 ? 85  GLN A C    4  
ATOM 7124  O O    . GLN A 1 85  ? 17.594  -3.319  -13.394 1.00 1.00 ? 85  GLN A O    4  
ATOM 7125  C CB   . GLN A 1 85  ? 19.869  -5.068  -12.044 1.00 1.00 ? 85  GLN A CB   4  
ATOM 7126  C CG   . GLN A 1 85  ? 20.423  -6.208  -11.169 1.00 1.00 ? 85  GLN A CG   4  
ATOM 7127  C CD   . GLN A 1 85  ? 20.727  -5.798  -9.720  1.00 1.00 ? 85  GLN A CD   4  
ATOM 7128  O OE1  . GLN A 1 85  ? 21.131  -4.680  -9.421  1.00 1.00 ? 85  GLN A OE1  4  
ATOM 7129  N NE2  . GLN A 1 85  ? 20.525  -6.678  -8.759  1.00 1.00 ? 85  GLN A NE2  4  
ATOM 7130  H H    . GLN A 1 85  ? 17.620  -6.260  -12.527 1.00 1.00 ? 85  GLN A H    4  
ATOM 7131  H HA   . GLN A 1 85  ? 18.549  -4.413  -10.484 1.00 1.00 ? 85  GLN A HA   4  
ATOM 7132  H HB2  . GLN A 1 85  ? 19.782  -5.419  -13.073 1.00 1.00 ? 85  GLN A HB2  4  
ATOM 7133  H HB3  . GLN A 1 85  ? 20.580  -4.237  -12.036 1.00 1.00 ? 85  GLN A HB3  4  
ATOM 7134  H HG2  . GLN A 1 85  ? 19.695  -7.020  -11.163 1.00 1.00 ? 85  GLN A HG2  4  
ATOM 7135  H HG3  . GLN A 1 85  ? 21.344  -6.579  -11.616 1.00 1.00 ? 85  GLN A HG3  4  
ATOM 7136  H HE21 . GLN A 1 85  ? 20.192  -7.608  -8.972  1.00 1.00 ? 85  GLN A HE21 4  
ATOM 7137  H HE22 . GLN A 1 85  ? 20.717  -6.399  -7.808  1.00 1.00 ? 85  GLN A HE22 4  
ATOM 7138  N N    . PRO A 1 86  ? 18.310  -2.073  -11.649 1.00 1.00 ? 86  PRO A N    4  
ATOM 7139  C CA   . PRO A 1 86  ? 17.781  -0.798  -12.141 1.00 1.00 ? 86  PRO A CA   4  
ATOM 7140  C C    . PRO A 1 86  ? 18.387  -0.395  -13.493 1.00 1.00 ? 86  PRO A C    4  
ATOM 7141  O O    . PRO A 1 86  ? 19.566  -0.632  -13.755 1.00 1.00 ? 86  PRO A O    4  
ATOM 7142  C CB   . PRO A 1 86  ? 18.076  0.228   -11.039 1.00 1.00 ? 86  PRO A CB   4  
ATOM 7143  C CG   . PRO A 1 86  ? 19.277  -0.368  -10.309 1.00 1.00 ? 86  PRO A CG   4  
ATOM 7144  C CD   . PRO A 1 86  ? 19.012  -1.868  -10.390 1.00 1.00 ? 86  PRO A CD   4  
ATOM 7145  H HA   . PRO A 1 86  ? 16.699  -0.885  -12.250 1.00 1.00 ? 86  PRO A HA   4  
ATOM 7146  H HB2  . PRO A 1 86  ? 18.294  1.221   -11.437 1.00 1.00 ? 86  PRO A HB2  4  
ATOM 7147  H HB3  . PRO A 1 86  ? 17.227  0.275   -10.352 1.00 1.00 ? 86  PRO A HB3  4  
ATOM 7148  H HG2  . PRO A 1 86  ? 20.192  -0.129  -10.852 1.00 1.00 ? 86  PRO A HG2  4  
ATOM 7149  H HG3  . PRO A 1 86  ? 19.340  -0.023  -9.276  1.00 1.00 ? 86  PRO A HG3  4  
ATOM 7150  H HD2  . PRO A 1 86  ? 19.958  -2.410  -10.363 1.00 1.00 ? 86  PRO A HD2  4  
ATOM 7151  H HD3  . PRO A 1 86  ? 18.379  -2.175  -9.557  1.00 1.00 ? 86  PRO A HD3  4  
ATOM 7152  N N    . ARG A 1 87  ? 17.560  0.217   -14.355 1.00 1.00 ? 87  ARG A N    4  
ATOM 7153  C CA   . ARG A 1 87  ? 17.964  0.631   -15.712 1.00 1.00 ? 87  ARG A CA   4  
ATOM 7154  C C    . ARG A 1 87  ? 18.624  2.037   -15.695 1.00 1.00 ? 87  ARG A C    4  
ATOM 7155  O O    . ARG A 1 87  ? 18.422  2.782   -14.727 1.00 1.00 ? 87  ARG A O    4  
ATOM 7156  C CB   . ARG A 1 87  ? 16.768  0.559   -16.695 1.00 1.00 ? 87  ARG A CB   4  
ATOM 7157  C CG   . ARG A 1 87  ? 15.851  -0.681  -16.606 1.00 1.00 ? 87  ARG A CG   4  
ATOM 7158  C CD   . ARG A 1 87  ? 16.522  -2.047  -16.400 1.00 1.00 ? 87  ARG A CD   4  
ATOM 7159  N NE   . ARG A 1 87  ? 17.613  -2.299  -17.361 1.00 1.00 ? 87  ARG A NE   4  
ATOM 7160  C CZ   . ARG A 1 87  ? 18.770  -2.907  -17.100 1.00 1.00 ? 87  ARG A CZ   4  
ATOM 7161  N NH1  . ARG A 1 87  ? 19.085  -3.343  -15.897 1.00 1.00 ? 87  ARG A NH1  4  
ATOM 7162  N NH2  . ARG A 1 87  ? 19.640  -3.090  -18.069 1.00 1.00 ? 87  ARG A NH2  4  
ATOM 7163  H H    . ARG A 1 87  ? 16.623  0.445   -14.045 1.00 1.00 ? 87  ARG A H    4  
ATOM 7164  H HA   . ARG A 1 87  ? 18.709  -0.087  -16.057 1.00 1.00 ? 87  ARG A HA   4  
ATOM 7165  H HB2  . ARG A 1 87  ? 16.139  1.436   -16.563 1.00 1.00 ? 87  ARG A HB2  4  
ATOM 7166  H HB3  . ARG A 1 87  ? 17.158  0.599   -17.713 1.00 1.00 ? 87  ARG A HB3  4  
ATOM 7167  H HG2  . ARG A 1 87  ? 15.156  -0.530  -15.781 1.00 1.00 ? 87  ARG A HG2  4  
ATOM 7168  H HG3  . ARG A 1 87  ? 15.258  -0.721  -17.520 1.00 1.00 ? 87  ARG A HG3  4  
ATOM 7169  H HD2  . ARG A 1 87  ? 16.897  -2.086  -15.382 1.00 1.00 ? 87  ARG A HD2  4  
ATOM 7170  H HD3  . ARG A 1 87  ? 15.763  -2.828  -16.500 1.00 1.00 ? 87  ARG A HD3  4  
ATOM 7171  H HE   . ARG A 1 87  ? 17.426  -2.051  -18.323 1.00 1.00 ? 87  ARG A HE   4  
ATOM 7172  H HH11 . ARG A 1 87  ? 18.439  -3.244  -15.119 1.00 1.00 ? 87  ARG A HH11 4  
ATOM 7173  H HH12 . ARG A 1 87  ? 19.975  -3.788  -15.732 1.00 1.00 ? 87  ARG A HH12 4  
ATOM 7174  H HH21 . ARG A 1 87  ? 19.438  -2.786  -19.010 1.00 1.00 ? 87  ARG A HH21 4  
ATOM 7175  H HH22 . ARG A 1 87  ? 20.515  -3.558  -17.893 1.00 1.00 ? 87  ARG A HH22 4  
ATOM 7176  N N    . PRO A 1 88  ? 19.378  2.436   -16.747 1.00 1.00 ? 88  PRO A N    4  
ATOM 7177  C CA   . PRO A 1 88  ? 20.021  3.754   -16.829 1.00 1.00 ? 88  PRO A CA   4  
ATOM 7178  C C    . PRO A 1 88  ? 18.987  4.883   -16.858 1.00 1.00 ? 88  PRO A C    4  
ATOM 7179  O O    . PRO A 1 88  ? 18.194  4.964   -17.791 1.00 1.00 ? 88  PRO A O    4  
ATOM 7180  C CB   . PRO A 1 88  ? 20.877  3.736   -18.105 1.00 1.00 ? 88  PRO A CB   4  
ATOM 7181  C CG   . PRO A 1 88  ? 21.062  2.252   -18.406 1.00 1.00 ? 88  PRO A CG   4  
ATOM 7182  C CD   . PRO A 1 88  ? 19.758  1.635   -17.904 1.00 1.00 ? 88  PRO A CD   4  
ATOM 7183  H HA   . PRO A 1 88  ? 20.687  3.866   -15.970 1.00 1.00 ? 88  PRO A HA   4  
ATOM 7184  H HB2  . PRO A 1 88  ? 20.343  4.199   -18.933 1.00 1.00 ? 88  PRO A HB2  4  
ATOM 7185  H HB3  . PRO A 1 88  ? 21.836  4.235   -17.953 1.00 1.00 ? 88  PRO A HB3  4  
ATOM 7186  H HG2  . PRO A 1 88  ? 21.218  2.076   -19.471 1.00 1.00 ? 88  PRO A HG2  4  
ATOM 7187  H HG3  . PRO A 1 88  ? 21.900  1.874   -17.820 1.00 1.00 ? 88  PRO A HG3  4  
ATOM 7188  H HD2  . PRO A 1 88  ? 18.986  1.723   -18.670 1.00 1.00 ? 88  PRO A HD2  4  
ATOM 7189  H HD3  . PRO A 1 88  ? 19.919  0.586   -17.651 1.00 1.00 ? 88  PRO A HD3  4  
ATOM 7190  N N    . VAL A 1 89  ? 19.004  5.766   -15.852 1.00 1.00 ? 89  VAL A N    4  
ATOM 7191  C CA   . VAL A 1 89  ? 17.942  6.773   -15.637 1.00 1.00 ? 89  VAL A CA   4  
ATOM 7192  C C    . VAL A 1 89  ? 17.733  7.700   -16.838 1.00 1.00 ? 89  VAL A C    4  
ATOM 7193  O O    . VAL A 1 89  ? 16.598  8.063   -17.144 1.00 1.00 ? 89  VAL A O    4  
ATOM 7194  C CB   . VAL A 1 89  ? 18.194  7.580   -14.341 1.00 1.00 ? 89  VAL A CB   4  
ATOM 7195  C CG1  . VAL A 1 89  ? 19.417  8.511   -14.403 1.00 1.00 ? 89  VAL A CG1  4  
ATOM 7196  C CG2  . VAL A 1 89  ? 16.950  8.387   -13.956 1.00 1.00 ? 89  VAL A CG2  4  
ATOM 7197  H H    . VAL A 1 89  ? 19.668  5.602   -15.094 1.00 1.00 ? 89  VAL A H    4  
ATOM 7198  H HA   . VAL A 1 89  ? 17.014  6.215   -15.503 1.00 1.00 ? 89  VAL A HA   4  
ATOM 7199  H HB   . VAL A 1 89  ? 18.373  6.860   -13.546 1.00 1.00 ? 89  VAL A HB   4  
ATOM 7200  H HG11 . VAL A 1 89  ? 19.586  8.964   -13.424 1.00 1.00 ? 89  VAL A HG11 4  
ATOM 7201  H HG12 . VAL A 1 89  ? 20.306  7.948   -14.681 1.00 1.00 ? 89  VAL A HG12 4  
ATOM 7202  H HG13 . VAL A 1 89  ? 19.257  9.313   -15.126 1.00 1.00 ? 89  VAL A HG13 4  
ATOM 7203  H HG21 . VAL A 1 89  ? 17.133  8.878   -13.002 1.00 1.00 ? 89  VAL A HG21 4  
ATOM 7204  H HG22 . VAL A 1 89  ? 16.719  9.146   -14.704 1.00 1.00 ? 89  VAL A HG22 4  
ATOM 7205  H HG23 . VAL A 1 89  ? 16.102  7.712   -13.860 1.00 1.00 ? 89  VAL A HG23 4  
ATOM 7206  N N    . GLU A 1 90  ? 18.809  8.008   -17.575 1.00 1.00 ? 90  GLU A N    4  
ATOM 7207  C CA   . GLU A 1 90  ? 18.739  8.839   -18.778 1.00 1.00 ? 90  GLU A CA   4  
ATOM 7208  C C    . GLU A 1 90  ? 17.865  8.187   -19.858 1.00 1.00 ? 90  GLU A C    4  
ATOM 7209  O O    . GLU A 1 90  ? 17.069  8.868   -20.498 1.00 1.00 ? 90  GLU A O    4  
ATOM 7210  C CB   . GLU A 1 90  ? 20.151  9.170   -19.292 1.00 1.00 ? 90  GLU A CB   4  
ATOM 7211  C CG   . GLU A 1 90  ? 20.982  7.974   -19.782 1.00 1.00 ? 90  GLU A CG   4  
ATOM 7212  C CD   . GLU A 1 90  ? 22.414  8.411   -20.124 1.00 1.00 ? 90  GLU A CD   4  
ATOM 7213  O OE1  . GLU A 1 90  ? 22.659  8.850   -21.272 1.00 1.00 ? 90  GLU A OE1  4  
ATOM 7214  O OE2  . GLU A 1 90  ? 23.306  8.315   -19.249 1.00 1.00 ? 90  GLU A OE2  4  
ATOM 7215  H H    . GLU A 1 90  ? 19.717  7.685   -17.260 1.00 1.00 ? 90  GLU A H    4  
ATOM 7216  H HA   . GLU A 1 90  ? 18.266  9.781   -18.496 1.00 1.00 ? 90  GLU A HA   4  
ATOM 7217  H HB2  . GLU A 1 90  ? 20.060  9.878   -20.114 1.00 1.00 ? 90  GLU A HB2  4  
ATOM 7218  H HB3  . GLU A 1 90  ? 20.693  9.656   -18.481 1.00 1.00 ? 90  GLU A HB3  4  
ATOM 7219  H HG2  . GLU A 1 90  ? 21.012  7.200   -19.012 1.00 1.00 ? 90  GLU A HG2  4  
ATOM 7220  H HG3  . GLU A 1 90  ? 20.514  7.551   -20.672 1.00 1.00 ? 90  GLU A HG3  4  
ATOM 7221  N N    . VAL A 1 91  ? 17.930  6.857   -19.996 1.00 1.00 ? 91  VAL A N    4  
ATOM 7222  C CA   . VAL A 1 91  ? 17.139  6.103   -20.979 1.00 1.00 ? 91  VAL A CA   4  
ATOM 7223  C C    . VAL A 1 91  ? 15.672  6.001   -20.540 1.00 1.00 ? 91  VAL A C    4  
ATOM 7224  O O    . VAL A 1 91  ? 14.795  6.082   -21.388 1.00 1.00 ? 91  VAL A O    4  
ATOM 7225  C CB   . VAL A 1 91  ? 17.733  4.709   -21.298 1.00 1.00 ? 91  VAL A CB   4  
ATOM 7226  C CG1  . VAL A 1 91  ? 16.985  4.040   -22.460 1.00 1.00 ? 91  VAL A CG1  4  
ATOM 7227  C CG2  . VAL A 1 91  ? 19.217  4.799   -21.698 1.00 1.00 ? 91  VAL A CG2  4  
ATOM 7228  H H    . VAL A 1 91  ? 18.555  6.353   -19.379 1.00 1.00 ? 91  VAL A H    4  
ATOM 7229  H HA   . VAL A 1 91  ? 17.178  6.679   -21.899 1.00 1.00 ? 91  VAL A HA   4  
ATOM 7230  H HB   . VAL A 1 91  ? 17.648  4.078   -20.414 1.00 1.00 ? 91  VAL A HB   4  
ATOM 7231  H HG11 . VAL A 1 91  ? 17.456  3.087   -22.702 1.00 1.00 ? 91  VAL A HG11 4  
ATOM 7232  H HG12 . VAL A 1 91  ? 15.946  3.853   -22.195 1.00 1.00 ? 91  VAL A HG12 4  
ATOM 7233  H HG13 . VAL A 1 91  ? 17.014  4.686   -23.337 1.00 1.00 ? 91  VAL A HG13 4  
ATOM 7234  H HG21 . VAL A 1 91  ? 19.330  5.427   -22.583 1.00 1.00 ? 91  VAL A HG21 4  
ATOM 7235  H HG22 . VAL A 1 91  ? 19.811  5.220   -20.889 1.00 1.00 ? 91  VAL A HG22 4  
ATOM 7236  H HG23 . VAL A 1 91  ? 19.605  3.801   -21.916 1.00 1.00 ? 91  VAL A HG23 4  
ATOM 7237  N N    . ILE A 1 92  ? 15.381  5.905   -19.232 1.00 1.00 ? 92  ILE A N    4  
ATOM 7238  C CA   . ILE A 1 92  ? 13.994  5.929   -18.709 1.00 1.00 ? 92  ILE A CA   4  
ATOM 7239  C C    . ILE A 1 92  ? 13.331  7.295   -18.974 1.00 1.00 ? 92  ILE A C    4  
ATOM 7240  O O    . ILE A 1 92  ? 12.186  7.378   -19.407 1.00 1.00 ? 92  ILE A O    4  
ATOM 7241  C CB   . ILE A 1 92  ? 13.976  5.579   -17.196 1.00 1.00 ? 92  ILE A CB   4  
ATOM 7242  C CG1  . ILE A 1 92  ? 14.752  4.279   -16.865 1.00 1.00 ? 92  ILE A CG1  4  
ATOM 7243  C CG2  . ILE A 1 92  ? 12.516  5.450   -16.718 1.00 1.00 ? 92  ILE A CG2  4  
ATOM 7244  C CD1  . ILE A 1 92  ? 14.868  4.013   -15.361 1.00 1.00 ? 92  ILE A CD1  4  
ATOM 7245  H H    . ILE A 1 92  ? 16.150  5.809   -18.572 1.00 1.00 ? 92  ILE A H    4  
ATOM 7246  H HA   . ILE A 1 92  ? 13.395  5.187   -19.246 1.00 1.00 ? 92  ILE A HA   4  
ATOM 7247  H HB   . ILE A 1 92  ? 14.447  6.397   -16.642 1.00 1.00 ? 92  ILE A HB   4  
ATOM 7248  H HG12 . ILE A 1 92  ? 14.262  3.429   -17.345 1.00 1.00 ? 92  ILE A HG12 4  
ATOM 7249  H HG13 . ILE A 1 92  ? 15.767  4.341   -17.251 1.00 1.00 ? 92  ILE A HG13 4  
ATOM 7250  H HG21 . ILE A 1 92  ? 11.951  6.349   -16.965 1.00 1.00 ? 92  ILE A HG21 4  
ATOM 7251  H HG22 . ILE A 1 92  ? 12.040  4.586   -17.191 1.00 1.00 ? 92  ILE A HG22 4  
ATOM 7252  H HG23 . ILE A 1 92  ? 12.479  5.342   -15.635 1.00 1.00 ? 92  ILE A HG23 4  
ATOM 7253  H HD11 . ILE A 1 92  ? 15.253  4.899   -14.854 1.00 1.00 ? 92  ILE A HD11 4  
ATOM 7254  H HD12 . ILE A 1 92  ? 13.900  3.743   -14.943 1.00 1.00 ? 92  ILE A HD12 4  
ATOM 7255  H HD13 . ILE A 1 92  ? 15.558  3.186   -15.189 1.00 1.00 ? 92  ILE A HD13 4  
ATOM 7256  N N    . ILE A 1 93  ? 14.060  8.389   -18.753 1.00 1.00 ? 93  ILE A N    4  
ATOM 7257  C CA   . ILE A 1 93  ? 13.604  9.749   -19.076 1.00 1.00 ? 93  ILE A CA   4  
ATOM 7258  C C    . ILE A 1 93  ? 13.509  9.968   -20.593 1.00 1.00 ? 93  ILE A C    4  
ATOM 7259  O O    . ILE A 1 93  ? 12.583  10.621  -21.063 1.00 1.00 ? 93  ILE A O    4  
ATOM 7260  C CB   . ILE A 1 93  ? 14.516  10.768  -18.353 1.00 1.00 ? 93  ILE A CB   4  
ATOM 7261  C CG1  . ILE A 1 93  ? 14.221  10.686  -16.830 1.00 1.00 ? 93  ILE A CG1  4  
ATOM 7262  C CG2  . ILE A 1 93  ? 14.294  12.206  -18.867 1.00 1.00 ? 93  ILE A CG2  4  
ATOM 7263  C CD1  . ILE A 1 93  ? 15.186  11.465  -15.932 1.00 1.00 ? 93  ILE A CD1  4  
ATOM 7264  H H    . ILE A 1 93  ? 14.953  8.277   -18.297 1.00 1.00 ? 93  ILE A H    4  
ATOM 7265  H HA   . ILE A 1 93  ? 12.591  9.861   -18.699 1.00 1.00 ? 93  ILE A HA   4  
ATOM 7266  H HB   . ILE A 1 93  ? 15.555  10.490  -18.554 1.00 1.00 ? 93  ILE A HB   4  
ATOM 7267  H HG12 . ILE A 1 93  ? 13.209  11.057  -16.652 1.00 1.00 ? 93  ILE A HG12 4  
ATOM 7268  H HG13 . ILE A 1 93  ? 14.266  9.646   -16.499 1.00 1.00 ? 93  ILE A HG13 4  
ATOM 7269  H HG21 . ILE A 1 93  ? 14.588  12.281  -19.914 1.00 1.00 ? 93  ILE A HG21 4  
ATOM 7270  H HG22 . ILE A 1 93  ? 13.241  12.480  -18.767 1.00 1.00 ? 93  ILE A HG22 4  
ATOM 7271  H HG23 . ILE A 1 93  ? 14.904  12.917  -18.311 1.00 1.00 ? 93  ILE A HG23 4  
ATOM 7272  H HD11 . ILE A 1 93  ? 14.912  11.290  -14.889 1.00 1.00 ? 93  ILE A HD11 4  
ATOM 7273  H HD12 . ILE A 1 93  ? 16.205  11.115  -16.103 1.00 1.00 ? 93  ILE A HD12 4  
ATOM 7274  H HD13 . ILE A 1 93  ? 15.127  12.534  -16.130 1.00 1.00 ? 93  ILE A HD13 4  
ATOM 7275  N N    . SER A 1 94  ? 14.424  9.401   -21.373 1.00 1.00 ? 94  SER A N    4  
ATOM 7276  C CA   . SER A 1 94  ? 14.416  9.527   -22.832 1.00 1.00 ? 94  SER A CA   4  
ATOM 7277  C C    . SER A 1 94  ? 13.245  8.758   -23.453 1.00 1.00 ? 94  SER A C    4  
ATOM 7278  O O    . SER A 1 94  ? 12.564  9.259   -24.344 1.00 1.00 ? 94  SER A O    4  
ATOM 7279  C CB   . SER A 1 94  ? 15.759  9.062   -23.414 1.00 1.00 ? 94  SER A CB   4  
ATOM 7280  O OG   . SER A 1 94  ? 15.850  9.361   -24.801 1.00 1.00 ? 94  SER A OG   4  
ATOM 7281  H H    . SER A 1 94  ? 15.185  8.888   -20.947 1.00 1.00 ? 94  SER A H    4  
ATOM 7282  H HA   . SER A 1 94  ? 14.282  10.571  -23.077 1.00 1.00 ? 94  SER A HA   4  
ATOM 7283  H HB2  . SER A 1 94  ? 16.567  9.577   -22.895 1.00 1.00 ? 94  SER A HB2  4  
ATOM 7284  H HB3  . SER A 1 94  ? 15.865  7.986   -23.258 1.00 1.00 ? 94  SER A HB3  4  
ATOM 7285  H HG   . SER A 1 94  ? 16.729  9.087   -25.143 1.00 1.00 ? 94  SER A HG   4  
ATOM 7286  N N    . SER A 1 95  ? 12.946  7.571   -22.930 1.00 1.00 ? 95  SER A N    4  
ATOM 7287  C CA   . SER A 1 95  ? 11.820  6.755   -23.360 1.00 1.00 ? 95  SER A CA   4  
ATOM 7288  C C    . SER A 1 95  ? 10.488  7.435   -23.039 1.00 1.00 ? 95  SER A C    4  
ATOM 7289  O O    . SER A 1 95  ? 9.605   7.480   -23.896 1.00 1.00 ? 95  SER A O    4  
ATOM 7290  C CB   . SER A 1 95  ? 11.941  5.351   -22.756 1.00 1.00 ? 95  SER A CB   4  
ATOM 7291  O OG   . SER A 1 95  ? 11.589  5.297   -21.385 1.00 1.00 ? 95  SER A OG   4  
ATOM 7292  H H    . SER A 1 95  ? 13.506  7.218   -22.170 1.00 1.00 ? 95  SER A H    4  
ATOM 7293  H HA   . SER A 1 95  ? 11.874  6.649   -24.442 1.00 1.00 ? 95  SER A HA   4  
ATOM 7294  H HB2  . SER A 1 95  ? 11.286  4.676   -23.308 1.00 1.00 ? 95  SER A HB2  4  
ATOM 7295  H HB3  . SER A 1 95  ? 12.983  5.045   -22.854 1.00 1.00 ? 95  SER A HB3  4  
ATOM 7296  H HG   . SER A 1 95  ? 11.678  4.385   -21.046 1.00 1.00 ? 95  SER A HG   4  
ATOM 7297  N N    . ALA A 1 96  ? 10.365  8.072   -21.867 1.00 1.00 ? 96  ALA A N    4  
ATOM 7298  C CA   . ALA A 1 96  ? 9.228   8.909   -21.519 1.00 1.00 ? 96  ALA A CA   4  
ATOM 7299  C C    . ALA A 1 96  ? 9.062   10.055  -22.533 1.00 1.00 ? 96  ALA A C    4  
ATOM 7300  O O    . ALA A 1 96  ? 8.000   10.202  -23.146 1.00 1.00 ? 96  ALA A O    4  
ATOM 7301  C CB   . ALA A 1 96  ? 9.457   9.395   -20.078 1.00 1.00 ? 96  ALA A CB   4  
ATOM 7302  H H    . ALA A 1 96  ? 11.102  7.972   -21.177 1.00 1.00 ? 96  ALA A H    4  
ATOM 7303  H HA   . ALA A 1 96  ? 8.327   8.296   -21.559 1.00 1.00 ? 96  ALA A HA   4  
ATOM 7304  H HB1  . ALA A 1 96  ? 10.261  10.131  -20.044 1.00 1.00 ? 96  ALA A HB1  4  
ATOM 7305  H HB2  . ALA A 1 96  ? 8.546   9.833   -19.680 1.00 1.00 ? 96  ALA A HB2  4  
ATOM 7306  H HB3  . ALA A 1 96  ? 9.740   8.558   -19.438 1.00 1.00 ? 96  ALA A HB3  4  
ATOM 7307  N N    . LYS A 1 97  ? 10.122  10.832  -22.768 1.00 1.00 ? 97  LYS A N    4  
ATOM 7308  C CA   . LYS A 1 97  ? 10.109  11.961  -23.708 1.00 1.00 ? 97  LYS A CA   4  
ATOM 7309  C C    . LYS A 1 97  ? 9.768   11.537  -25.145 1.00 1.00 ? 97  LYS A C    4  
ATOM 7310  O O    . LYS A 1 97  ? 8.971   12.203  -25.807 1.00 1.00 ? 97  LYS A O    4  
ATOM 7311  C CB   . LYS A 1 97  ? 11.469  12.670  -23.650 1.00 1.00 ? 97  LYS A CB   4  
ATOM 7312  C CG   . LYS A 1 97  ? 11.645  13.515  -22.381 1.00 1.00 ? 97  LYS A CG   4  
ATOM 7313  C CD   . LYS A 1 97  ? 13.096  14.002  -22.297 1.00 1.00 ? 97  LYS A CD   4  
ATOM 7314  C CE   . LYS A 1 97  ? 13.277  15.012  -21.153 1.00 1.00 ? 97  LYS A CE   4  
ATOM 7315  N NZ   . LYS A 1 97  ? 14.653  15.594  -21.138 1.00 1.00 ? 97  LYS A NZ   4  
ATOM 7316  H H    . LYS A 1 97  ? 10.992  10.636  -22.275 1.00 1.00 ? 97  LYS A H    4  
ATOM 7317  H HA   . LYS A 1 97  ? 9.332   12.657  -23.400 1.00 1.00 ? 97  LYS A HA   4  
ATOM 7318  H HB2  . LYS A 1 97  ? 12.266  11.926  -23.714 1.00 1.00 ? 97  LYS A HB2  4  
ATOM 7319  H HB3  . LYS A 1 97  ? 11.557  13.336  -24.515 1.00 1.00 ? 97  LYS A HB3  4  
ATOM 7320  H HG2  . LYS A 1 97  ? 10.969  14.370  -22.426 1.00 1.00 ? 97  LYS A HG2  4  
ATOM 7321  H HG3  . LYS A 1 97  ? 11.406  12.930  -21.491 1.00 1.00 ? 97  LYS A HG3  4  
ATOM 7322  H HD2  . LYS A 1 97  ? 13.741  13.132  -22.138 1.00 1.00 ? 97  LYS A HD2  4  
ATOM 7323  H HD3  . LYS A 1 97  ? 13.363  14.471  -23.246 1.00 1.00 ? 97  LYS A HD3  4  
ATOM 7324  H HE2  . LYS A 1 97  ? 12.543  15.816  -21.280 1.00 1.00 ? 97  LYS A HE2  4  
ATOM 7325  H HE3  . LYS A 1 97  ? 13.064  14.515  -20.199 1.00 1.00 ? 97  LYS A HE3  4  
ATOM 7326  H HZ1  . LYS A 1 97  ? 15.367  14.879  -21.028 1.00 1.00 ? 97  LYS A HZ1  4  
ATOM 7327  H HZ2  . LYS A 1 97  ? 14.848  16.093  -21.998 1.00 1.00 ? 97  LYS A HZ2  4  
ATOM 7328  H HZ3  . LYS A 1 97  ? 14.764  16.258  -20.381 1.00 1.00 ? 97  LYS A HZ3  4  
ATOM 7329  N N    . GLU A 1 98  ? 10.312  10.410  -25.603 1.00 1.00 ? 98  GLU A N    4  
ATOM 7330  C CA   . GLU A 1 98  ? 10.005  9.824   -26.909 1.00 1.00 ? 98  GLU A CA   4  
ATOM 7331  C C    . GLU A 1 98  ? 8.550   9.341   -27.011 1.00 1.00 ? 98  GLU A C    4  
ATOM 7332  O O    . GLU A 1 98  ? 7.935   9.469   -28.074 1.00 1.00 ? 98  GLU A O    4  
ATOM 7333  C CB   . GLU A 1 98  ? 10.968  8.670   -27.236 1.00 1.00 ? 98  GLU A CB   4  
ATOM 7334  C CG   . GLU A 1 98  ? 12.368  9.143   -27.653 1.00 1.00 ? 98  GLU A CG   4  
ATOM 7335  C CD   . GLU A 1 98  ? 12.345  9.859   -29.013 1.00 1.00 ? 98  GLU A CD   4  
ATOM 7336  O OE1  . GLU A 1 98  ? 12.261  9.176   -30.062 1.00 1.00 ? 98  GLU A OE1  4  
ATOM 7337  O OE2  . GLU A 1 98  ? 12.420  11.111  -29.045 1.00 1.00 ? 98  GLU A OE2  4  
ATOM 7338  H H    . GLU A 1 98  ? 10.998  9.953   -25.014 1.00 1.00 ? 98  GLU A H    4  
ATOM 7339  H HA   . GLU A 1 98  ? 10.132  10.602  -27.648 1.00 1.00 ? 98  GLU A HA   4  
ATOM 7340  H HB2  . GLU A 1 98  ? 11.051  8.015   -26.370 1.00 1.00 ? 98  GLU A HB2  4  
ATOM 7341  H HB3  . GLU A 1 98  ? 10.553  8.081   -28.055 1.00 1.00 ? 98  GLU A HB3  4  
ATOM 7342  H HG2  . GLU A 1 98  ? 12.778  9.810   -26.896 1.00 1.00 ? 98  GLU A HG2  4  
ATOM 7343  H HG3  . GLU A 1 98  ? 13.022  8.272   -27.720 1.00 1.00 ? 98  GLU A HG3  4  
ATOM 7344  N N    . MET A 1 99  ? 7.977   8.819   -25.920 1.00 1.00 ? 99  MET A N    4  
ATOM 7345  C CA   . MET A 1 99  ? 6.596   8.342   -25.892 1.00 1.00 ? 99  MET A CA   4  
ATOM 7346  C C    . MET A 1 99  ? 5.563   9.474   -25.791 1.00 1.00 ? 99  MET A C    4  
ATOM 7347  O O    . MET A 1 99  ? 4.472   9.307   -26.322 1.00 1.00 ? 99  MET A O    4  
ATOM 7348  C CB   . MET A 1 99  ? 6.412   7.297   -24.786 1.00 1.00 ? 99  MET A CB   4  
ATOM 7349  C CG   . MET A 1 99  ? 7.155   5.996   -25.136 1.00 1.00 ? 99  MET A CG   4  
ATOM 7350  S SD   . MET A 1 99  ? 6.396   4.971   -26.419 1.00 1.00 ? 99  MET A SD   4  
ATOM 7351  C CE   . MET A 1 99  ? 5.145   4.137   -25.414 1.00 1.00 ? 99  MET A CE   4  
ATOM 7352  H H    . MET A 1 99  ? 8.548   8.643   -25.103 1.00 1.00 ? 99  MET A H    4  
ATOM 7353  H HA   . MET A 1 99  ? 6.412   7.846   -26.841 1.00 1.00 ? 99  MET A HA   4  
ATOM 7354  H HB2  . MET A 1 99  ? 6.788   7.698   -23.840 1.00 1.00 ? 99  MET A HB2  4  
ATOM 7355  H HB3  . MET A 1 99  ? 5.350   7.084   -24.673 1.00 1.00 ? 99  MET A HB3  4  
ATOM 7356  H HG2  . MET A 1 99  ? 8.167   6.241   -25.460 1.00 1.00 ? 99  MET A HG2  4  
ATOM 7357  H HG3  . MET A 1 99  ? 7.262   5.393   -24.237 1.00 1.00 ? 99  MET A HG3  4  
ATOM 7358  H HE1  . MET A 1 99  ? 4.371   4.848   -25.121 1.00 1.00 ? 99  MET A HE1  4  
ATOM 7359  H HE2  . MET A 1 99  ? 4.687   3.337   -26.000 1.00 1.00 ? 99  MET A HE2  4  
ATOM 7360  H HE3  . MET A 1 99  ? 5.611   3.708   -24.523 1.00 1.00 ? 99  MET A HE3  4  
ATOM 7361  N N    . VAL A 1 100 ? 5.869   10.619  -25.168 1.00 1.00 ? 100 VAL A N    4  
ATOM 7362  C CA   . VAL A 1 100 ? 5.004   11.824  -25.229 1.00 1.00 ? 100 VAL A CA   4  
ATOM 7363  C C    . VAL A 1 100 ? 4.583   12.133  -26.676 1.00 1.00 ? 100 VAL A C    4  
ATOM 7364  O O    . VAL A 1 100 ? 5.420   12.256  -27.570 1.00 1.00 ? 100 VAL A O    4  
ATOM 7365  C CB   . VAL A 1 100 ? 5.641   13.066  -24.567 1.00 1.00 ? 100 VAL A CB   4  
ATOM 7366  C CG1  . VAL A 1 100 ? 4.811   14.348  -24.758 1.00 1.00 ? 100 VAL A CG1  4  
ATOM 7367  C CG2  . VAL A 1 100 ? 5.774   12.859  -23.055 1.00 1.00 ? 100 VAL A CG2  4  
ATOM 7368  H H    . VAL A 1 100 ? 6.709   10.621  -24.597 1.00 1.00 ? 100 VAL A H    4  
ATOM 7369  H HA   . VAL A 1 100 ? 4.097   11.603  -24.678 1.00 1.00 ? 100 VAL A HA   4  
ATOM 7370  H HB   . VAL A 1 100 ? 6.631   13.222  -24.987 1.00 1.00 ? 100 VAL A HB   4  
ATOM 7371  H HG11 . VAL A 1 100 ? 3.791   14.200  -24.396 1.00 1.00 ? 100 VAL A HG11 4  
ATOM 7372  H HG12 . VAL A 1 100 ? 5.269   15.170  -24.204 1.00 1.00 ? 100 VAL A HG12 4  
ATOM 7373  H HG13 . VAL A 1 100 ? 4.781   14.629  -25.811 1.00 1.00 ? 100 VAL A HG13 4  
ATOM 7374  H HG21 . VAL A 1 100 ? 6.231   11.900  -22.837 1.00 1.00 ? 100 VAL A HG21 4  
ATOM 7375  H HG22 . VAL A 1 100 ? 6.403   13.646  -22.640 1.00 1.00 ? 100 VAL A HG22 4  
ATOM 7376  H HG23 . VAL A 1 100 ? 4.791   12.888  -22.580 1.00 1.00 ? 100 VAL A HG23 4  
ATOM 7377  N N    . GLY A 1 101 ? 3.264   12.236  -26.879 1.00 1.00 ? 101 GLY A N    4  
ATOM 7378  C CA   . GLY A 1 101 ? 2.613   12.387  -28.186 1.00 1.00 ? 101 GLY A CA   4  
ATOM 7379  C C    . GLY A 1 101 ? 2.055   11.081  -28.769 1.00 1.00 ? 101 GLY A C    4  
ATOM 7380  O O    . GLY A 1 101 ? 1.271   11.139  -29.716 1.00 1.00 ? 101 GLY A O    4  
ATOM 7381  H H    . GLY A 1 101 ? 2.659   12.149  -26.071 1.00 1.00 ? 101 GLY A H    4  
ATOM 7382  H HA2  . GLY A 1 101 ? 1.771   13.069  -28.072 1.00 1.00 ? 101 GLY A HA2  4  
ATOM 7383  H HA3  . GLY A 1 101 ? 3.316   12.798  -28.911 1.00 1.00 ? 101 GLY A HA3  4  
ATOM 7384  N N    . GLN A 1 102 ? 2.419   9.914   -28.223 1.00 1.00 ? 102 GLN A N    4  
ATOM 7385  C CA   . GLN A 1 102 ? 1.869   8.621   -28.618 1.00 1.00 ? 102 GLN A CA   4  
ATOM 7386  C C    . GLN A 1 102 ? 0.458   8.430   -28.049 1.00 1.00 ? 102 GLN A C    4  
ATOM 7387  O O    . GLN A 1 102 ? 0.092   9.008   -27.020 1.00 1.00 ? 102 GLN A O    4  
ATOM 7388  C CB   . GLN A 1 102 ? 2.779   7.460   -28.182 1.00 1.00 ? 102 GLN A CB   4  
ATOM 7389  C CG   . GLN A 1 102 ? 4.172   7.482   -28.836 1.00 1.00 ? 102 GLN A CG   4  
ATOM 7390  C CD   . GLN A 1 102 ? 4.215   7.067   -30.308 1.00 1.00 ? 102 GLN A CD   4  
ATOM 7391  O OE1  . GLN A 1 102 ? 3.208   6.828   -30.970 1.00 1.00 ? 102 GLN A OE1  4  
ATOM 7392  N NE2  . GLN A 1 102 ? 5.397   6.982   -30.883 1.00 1.00 ? 102 GLN A NE2  4  
ATOM 7393  H H    . GLN A 1 102 ? 3.088   9.898   -27.472 1.00 1.00 ? 102 GLN A H    4  
ATOM 7394  H HA   . GLN A 1 102 ? 1.817   8.609   -29.701 1.00 1.00 ? 102 GLN A HA   4  
ATOM 7395  H HB2  . GLN A 1 102 ? 2.891   7.493   -27.098 1.00 1.00 ? 102 GLN A HB2  4  
ATOM 7396  H HB3  . GLN A 1 102 ? 2.295   6.510   -28.419 1.00 1.00 ? 102 GLN A HB3  4  
ATOM 7397  H HG2  . GLN A 1 102 ? 4.588   8.483   -28.761 1.00 1.00 ? 102 GLN A HG2  4  
ATOM 7398  H HG3  . GLN A 1 102 ? 4.818   6.807   -28.275 1.00 1.00 ? 102 GLN A HG3  4  
ATOM 7399  H HE21 . GLN A 1 102 ? 6.235   7.180   -30.353 1.00 1.00 ? 102 GLN A HE21 4  
ATOM 7400  H HE22 . GLN A 1 102 ? 5.448   6.711   -31.853 1.00 1.00 ? 102 GLN A HE22 4  
ATOM 7401  N N    . LYS A 1 103 ? -0.322  7.574   -28.712 1.00 1.00 ? 103 LYS A N    4  
ATOM 7402  C CA   . LYS A 1 103 ? -1.694  7.218   -28.328 1.00 1.00 ? 103 LYS A CA   4  
ATOM 7403  C C    . LYS A 1 103 ? -1.870  5.703   -28.093 1.00 1.00 ? 103 LYS A C    4  
ATOM 7404  O O    . LYS A 1 103 ? -1.231  4.880   -28.754 1.00 1.00 ? 103 LYS A O    4  
ATOM 7405  C CB   . LYS A 1 103 ? -2.675  7.730   -29.400 1.00 1.00 ? 103 LYS A CB   4  
ATOM 7406  C CG   . LYS A 1 103 ? -2.746  9.265   -29.423 1.00 1.00 ? 103 LYS A CG   4  
ATOM 7407  C CD   . LYS A 1 103 ? -3.681  9.759   -30.536 1.00 1.00 ? 103 LYS A CD   4  
ATOM 7408  C CE   . LYS A 1 103 ? -3.707  11.294  -30.537 1.00 1.00 ? 103 LYS A CE   4  
ATOM 7409  N NZ   . LYS A 1 103 ? -4.559  11.843  -31.630 1.00 1.00 ? 103 LYS A NZ   4  
ATOM 7410  H H    . LYS A 1 103 ? 0.072   7.116   -29.525 1.00 1.00 ? 103 LYS A H    4  
ATOM 7411  H HA   . LYS A 1 103 ? -1.931  7.713   -27.390 1.00 1.00 ? 103 LYS A HA   4  
ATOM 7412  H HB2  . LYS A 1 103 ? -2.362  7.361   -30.377 1.00 1.00 ? 103 LYS A HB2  4  
ATOM 7413  H HB3  . LYS A 1 103 ? -3.674  7.342   -29.186 1.00 1.00 ? 103 LYS A HB3  4  
ATOM 7414  H HG2  . LYS A 1 103 ? -3.111  9.620   -28.458 1.00 1.00 ? 103 LYS A HG2  4  
ATOM 7415  H HG3  . LYS A 1 103 ? -1.750  9.677   -29.596 1.00 1.00 ? 103 LYS A HG3  4  
ATOM 7416  H HD2  . LYS A 1 103 ? -3.317  9.397   -31.500 1.00 1.00 ? 103 LYS A HD2  4  
ATOM 7417  H HD3  . LYS A 1 103 ? -4.689  9.376   -30.362 1.00 1.00 ? 103 LYS A HD3  4  
ATOM 7418  H HE2  . LYS A 1 103 ? -4.075  11.641  -29.566 1.00 1.00 ? 103 LYS A HE2  4  
ATOM 7419  H HE3  . LYS A 1 103 ? -2.682  11.663  -30.650 1.00 1.00 ? 103 LYS A HE3  4  
ATOM 7420  H HZ1  . LYS A 1 103 ? -5.519  11.530  -31.546 1.00 1.00 ? 103 LYS A HZ1  4  
ATOM 7421  H HZ2  . LYS A 1 103 ? -4.565  12.855  -31.606 1.00 1.00 ? 103 LYS A HZ2  4  
ATOM 7422  H HZ3  . LYS A 1 103 ? -4.220  11.562  -32.541 1.00 1.00 ? 103 LYS A HZ3  4  
ATOM 7423  N N    . MET A 1 104 ? -2.770  5.354   -27.168 1.00 1.00 ? 104 MET A N    4  
ATOM 7424  C CA   . MET A 1 104 ? -3.141  3.988   -26.769 1.00 1.00 ? 104 MET A CA   4  
ATOM 7425  C C    . MET A 1 104 ? -4.656  3.782   -26.902 1.00 1.00 ? 104 MET A C    4  
ATOM 7426  O O    . MET A 1 104 ? -5.429  4.722   -26.716 1.00 1.00 ? 104 MET A O    4  
ATOM 7427  C CB   . MET A 1 104 ? -2.731  3.735   -25.302 1.00 1.00 ? 104 MET A CB   4  
ATOM 7428  C CG   . MET A 1 104 ? -1.247  3.981   -24.999 1.00 1.00 ? 104 MET A CG   4  
ATOM 7429  S SD   . MET A 1 104 ? -0.095  2.898   -25.880 1.00 1.00 ? 104 MET A SD   4  
ATOM 7430  C CE   . MET A 1 104 ? 1.453   3.563   -25.221 1.00 1.00 ? 104 MET A CE   4  
ATOM 7431  H H    . MET A 1 104 ? -3.272  6.111   -26.712 1.00 1.00 ? 104 MET A H    4  
ATOM 7432  H HA   . MET A 1 104 ? -2.635  3.260   -27.406 1.00 1.00 ? 104 MET A HA   4  
ATOM 7433  H HB2  . MET A 1 104 ? -3.321  4.385   -24.655 1.00 1.00 ? 104 MET A HB2  4  
ATOM 7434  H HB3  . MET A 1 104 ? -2.969  2.703   -25.040 1.00 1.00 ? 104 MET A HB3  4  
ATOM 7435  H HG2  . MET A 1 104 ? -0.995  5.018   -25.231 1.00 1.00 ? 104 MET A HG2  4  
ATOM 7436  H HG3  . MET A 1 104 ? -1.095  3.839   -23.927 1.00 1.00 ? 104 MET A HG3  4  
ATOM 7437  H HE1  . MET A 1 104 ? 1.557   4.612   -25.496 1.00 1.00 ? 104 MET A HE1  4  
ATOM 7438  H HE2  . MET A 1 104 ? 1.461   3.468   -24.134 1.00 1.00 ? 104 MET A HE2  4  
ATOM 7439  H HE3  . MET A 1 104 ? 2.294   3.001   -25.630 1.00 1.00 ? 104 MET A HE3  4  
ATOM 7440  N N    . LYS A 1 105 ? -5.102  2.550   -27.159 1.00 1.00 ? 105 LYS A N    4  
ATOM 7441  C CA   . LYS A 1 105 ? -6.531  2.194   -27.122 1.00 1.00 ? 105 LYS A CA   4  
ATOM 7442  C C    . LYS A 1 105 ? -7.062  2.141   -25.673 1.00 1.00 ? 105 LYS A C    4  
ATOM 7443  O O    . LYS A 1 105 ? -6.308  1.871   -24.736 1.00 1.00 ? 105 LYS A O    4  
ATOM 7444  C CB   . LYS A 1 105 ? -6.748  0.856   -27.858 1.00 1.00 ? 105 LYS A CB   4  
ATOM 7445  C CG   . LYS A 1 105 ? -6.426  0.965   -29.360 1.00 1.00 ? 105 LYS A CG   4  
ATOM 7446  C CD   . LYS A 1 105 ? -6.748  -0.317  -30.144 1.00 1.00 ? 105 LYS A CD   4  
ATOM 7447  C CE   . LYS A 1 105 ? -5.869  -1.507  -29.723 1.00 1.00 ? 105 LYS A CE   4  
ATOM 7448  N NZ   . LYS A 1 105 ? -6.150  -2.720  -30.543 1.00 1.00 ? 105 LYS A NZ   4  
ATOM 7449  H H    . LYS A 1 105 ? -4.428  1.806   -27.297 1.00 1.00 ? 105 LYS A H    4  
ATOM 7450  H HA   . LYS A 1 105 ? -7.101  2.969   -27.641 1.00 1.00 ? 105 LYS A HA   4  
ATOM 7451  H HB2  . LYS A 1 105 ? -6.119  0.090   -27.398 1.00 1.00 ? 105 LYS A HB2  4  
ATOM 7452  H HB3  . LYS A 1 105 ? -7.792  0.557   -27.746 1.00 1.00 ? 105 LYS A HB3  4  
ATOM 7453  H HG2  . LYS A 1 105 ? -7.015  1.781   -29.782 1.00 1.00 ? 105 LYS A HG2  4  
ATOM 7454  H HG3  . LYS A 1 105 ? -5.371  1.204   -29.496 1.00 1.00 ? 105 LYS A HG3  4  
ATOM 7455  H HD2  . LYS A 1 105 ? -7.803  -0.565  -30.006 1.00 1.00 ? 105 LYS A HD2  4  
ATOM 7456  H HD3  . LYS A 1 105 ? -6.585  -0.113  -31.204 1.00 1.00 ? 105 LYS A HD3  4  
ATOM 7457  H HE2  . LYS A 1 105 ? -4.818  -1.221  -29.830 1.00 1.00 ? 105 LYS A HE2  4  
ATOM 7458  H HE3  . LYS A 1 105 ? -6.047  -1.727  -28.665 1.00 1.00 ? 105 LYS A HE3  4  
ATOM 7459  H HZ1  . LYS A 1 105 ? -7.112  -3.014  -30.450 1.00 1.00 ? 105 LYS A HZ1  4  
ATOM 7460  H HZ2  . LYS A 1 105 ? -5.972  -2.547  -31.525 1.00 1.00 ? 105 LYS A HZ2  4  
ATOM 7461  H HZ3  . LYS A 1 105 ? -5.564  -3.495  -30.261 1.00 1.00 ? 105 LYS A HZ3  4  
ATOM 7462  N N    . TYR A 1 106 ? -8.364  2.381   -25.487 1.00 1.00 ? 106 TYR A N    4  
ATOM 7463  C CA   . TYR A 1 106 ? -9.021  2.470   -24.174 1.00 1.00 ? 106 TYR A CA   4  
ATOM 7464  C C    . TYR A 1 106 ? -10.503 2.062   -24.259 1.00 1.00 ? 106 TYR A C    4  
ATOM 7465  O O    . TYR A 1 106 ? -11.199 2.464   -25.191 1.00 1.00 ? 106 TYR A O    4  
ATOM 7466  C CB   . TYR A 1 106 ? -8.877  3.916   -23.663 1.00 1.00 ? 106 TYR A CB   4  
ATOM 7467  C CG   . TYR A 1 106 ? -8.968  4.070   -22.161 1.00 1.00 ? 106 TYR A CG   4  
ATOM 7468  C CD1  . TYR A 1 106 ? -7.816  3.873   -21.375 1.00 1.00 ? 106 TYR A CD1  4  
ATOM 7469  C CD2  . TYR A 1 106 ? -10.176 4.467   -21.554 1.00 1.00 ? 106 TYR A CD2  4  
ATOM 7470  C CE1  . TYR A 1 106 ? -7.867  4.076   -19.983 1.00 1.00 ? 106 TYR A CE1  4  
ATOM 7471  C CE2  . TYR A 1 106 ? -10.223 4.684   -20.162 1.00 1.00 ? 106 TYR A CE2  4  
ATOM 7472  C CZ   . TYR A 1 106 ? -9.072  4.479   -19.369 1.00 1.00 ? 106 TYR A CZ   4  
ATOM 7473  O OH   . TYR A 1 106 ? -9.115  4.701   -18.024 1.00 1.00 ? 106 TYR A OH   4  
ATOM 7474  H H    . TYR A 1 106 ? -8.910  2.679   -26.289 1.00 1.00 ? 106 TYR A H    4  
ATOM 7475  H HA   . TYR A 1 106 ? -8.516  1.799   -23.477 1.00 1.00 ? 106 TYR A HA   4  
ATOM 7476  H HB2  . TYR A 1 106 ? -7.903  4.307   -23.963 1.00 1.00 ? 106 TYR A HB2  4  
ATOM 7477  H HB3  . TYR A 1 106 ? -9.631  4.547   -24.134 1.00 1.00 ? 106 TYR A HB3  4  
ATOM 7478  H HD1  . TYR A 1 106 ? -6.884  3.581   -21.842 1.00 1.00 ? 106 TYR A HD1  4  
ATOM 7479  H HD2  . TYR A 1 106 ? -11.058 4.643   -22.158 1.00 1.00 ? 106 TYR A HD2  4  
ATOM 7480  H HE1  . TYR A 1 106 ? -6.979  3.949   -19.384 1.00 1.00 ? 106 TYR A HE1  4  
ATOM 7481  H HE2  . TYR A 1 106 ? -11.133 5.036   -19.698 1.00 1.00 ? 106 TYR A HE2  4  
ATOM 7482  H HH   . TYR A 1 106 ? -9.988  4.984   -17.708 1.00 1.00 ? 106 TYR A HH   4  
ATOM 7483  N N    . SER A 1 107 ? -11.006 1.275   -23.307 1.00 1.00 ? 107 SER A N    4  
ATOM 7484  C CA   . SER A 1 107 ? -12.359 0.682   -23.380 1.00 1.00 ? 107 SER A CA   4  
ATOM 7485  C C    . SER A 1 107 ? -13.216 0.870   -22.115 1.00 1.00 ? 107 SER A C    4  
ATOM 7486  O O    . SER A 1 107 ? -14.308 0.308   -22.044 1.00 1.00 ? 107 SER A O    4  
ATOM 7487  C CB   . SER A 1 107 ? -12.200 -0.818  -23.661 1.00 1.00 ? 107 SER A CB   4  
ATOM 7488  O OG   . SER A 1 107 ? -11.577 -1.483  -22.562 1.00 1.00 ? 107 SER A OG   4  
ATOM 7489  H H    . SER A 1 107 ? -10.371 0.879   -22.621 1.00 1.00 ? 107 SER A H    4  
ATOM 7490  H HA   . SER A 1 107 ? -12.922 1.116   -24.205 1.00 1.00 ? 107 SER A HA   4  
ATOM 7491  H HB2  . SER A 1 107 ? -13.179 -1.263  -23.846 1.00 1.00 ? 107 SER A HB2  4  
ATOM 7492  H HB3  . SER A 1 107 ? -11.590 -0.944  -24.556 1.00 1.00 ? 107 SER A HB3  4  
ATOM 7493  H HG   . SER A 1 107 ? -11.370 -2.405  -22.835 1.00 1.00 ? 107 SER A HG   4  
ATOM 7494  N N    . ILE A 1 108 ? -12.707 1.571   -21.084 1.00 1.00 ? 108 ILE A N    4  
ATOM 7495  C CA   . ILE A 1 108 ? -13.216 1.734   -19.690 1.00 1.00 ? 108 ILE A CA   4  
ATOM 7496  C C    . ILE A 1 108 ? -13.402 0.419   -18.904 1.00 1.00 ? 108 ILE A C    4  
ATOM 7497  O O    . ILE A 1 108 ? -13.183 0.395   -17.693 1.00 1.00 ? 108 ILE A O    4  
ATOM 7498  C CB   . ILE A 1 108 ? -14.439 2.682   -19.559 1.00 1.00 ? 108 ILE A CB   4  
ATOM 7499  C CG1  . ILE A 1 108 ? -15.774 2.145   -20.119 1.00 1.00 ? 108 ILE A CG1  4  
ATOM 7500  C CG2  . ILE A 1 108 ? -14.095 4.057   -20.159 1.00 1.00 ? 108 ILE A CG2  4  
ATOM 7501  C CD1  . ILE A 1 108 ? -17.005 2.915   -19.619 1.00 1.00 ? 108 ILE A CD1  4  
ATOM 7502  H H    . ILE A 1 108 ? -11.811 2.007   -21.262 1.00 1.00 ? 108 ILE A H    4  
ATOM 7503  H HA   . ILE A 1 108 ? -12.416 2.234   -19.138 1.00 1.00 ? 108 ILE A HA   4  
ATOM 7504  H HB   . ILE A 1 108 ? -14.591 2.834   -18.488 1.00 1.00 ? 108 ILE A HB   4  
ATOM 7505  H HG12 . ILE A 1 108 ? -15.762 2.190   -21.204 1.00 1.00 ? 108 ILE A HG12 4  
ATOM 7506  H HG13 . ILE A 1 108 ? -15.897 1.105   -19.820 1.00 1.00 ? 108 ILE A HG13 4  
ATOM 7507  H HG21 . ILE A 1 108 ? -13.212 4.456   -19.664 1.00 1.00 ? 108 ILE A HG21 4  
ATOM 7508  H HG22 . ILE A 1 108 ? -13.898 3.971   -21.229 1.00 1.00 ? 108 ILE A HG22 4  
ATOM 7509  H HG23 . ILE A 1 108 ? -14.908 4.762   -20.004 1.00 1.00 ? 108 ILE A HG23 4  
ATOM 7510  H HD11 . ILE A 1 108 ? -16.993 3.940   -19.987 1.00 1.00 ? 108 ILE A HD11 4  
ATOM 7511  H HD12 . ILE A 1 108 ? -17.911 2.432   -19.983 1.00 1.00 ? 108 ILE A HD12 4  
ATOM 7512  H HD13 . ILE A 1 108 ? -17.020 2.922   -18.530 1.00 1.00 ? 108 ILE A HD13 4  
ATOM 7513  N N    . VAL A 1 109 ? -13.740 -0.673  -19.587 1.00 1.00 ? 109 VAL A N    4  
ATOM 7514  C CA   . VAL A 1 109 ? -13.765 -2.055  -19.085 1.00 1.00 ? 109 VAL A CA   4  
ATOM 7515  C C    . VAL A 1 109 ? -12.334 -2.544  -18.788 1.00 1.00 ? 109 VAL A C    4  
ATOM 7516  O O    . VAL A 1 109 ? -12.115 -3.233  -17.795 1.00 1.00 ? 109 VAL A O    4  
ATOM 7517  C CB   . VAL A 1 109 ? -14.454 -2.989  -20.113 1.00 1.00 ? 109 VAL A CB   4  
ATOM 7518  C CG1  . VAL A 1 109 ? -14.434 -4.466  -19.684 1.00 1.00 ? 109 VAL A CG1  4  
ATOM 7519  C CG2  . VAL A 1 109 ? -15.919 -2.575  -20.339 1.00 1.00 ? 109 VAL A CG2  4  
ATOM 7520  H H    . VAL A 1 109 ? -14.000 -0.503  -20.557 1.00 1.00 ? 109 VAL A H    4  
ATOM 7521  H HA   . VAL A 1 109 ? -14.345 -2.075  -18.160 1.00 1.00 ? 109 VAL A HA   4  
ATOM 7522  H HB   . VAL A 1 109 ? -13.929 -2.901  -21.065 1.00 1.00 ? 109 VAL A HB   4  
ATOM 7523  H HG11 . VAL A 1 109 ? -14.989 -5.074  -20.403 1.00 1.00 ? 109 VAL A HG11 4  
ATOM 7524  H HG12 . VAL A 1 109 ? -13.410 -4.836  -19.655 1.00 1.00 ? 109 VAL A HG12 4  
ATOM 7525  H HG13 . VAL A 1 109 ? -14.886 -4.579  -18.698 1.00 1.00 ? 109 VAL A HG13 4  
ATOM 7526  H HG21 . VAL A 1 109 ? -16.391 -3.248  -21.055 1.00 1.00 ? 109 VAL A HG21 4  
ATOM 7527  H HG22 . VAL A 1 109 ? -16.470 -2.613  -19.399 1.00 1.00 ? 109 VAL A HG22 4  
ATOM 7528  H HG23 . VAL A 1 109 ? -15.966 -1.561  -20.740 1.00 1.00 ? 109 VAL A HG23 4  
ATOM 7529  N N    . SER A 1 110 ? -11.356 -2.156  -19.618 1.00 1.00 ? 110 SER A N    4  
ATOM 7530  C CA   . SER A 1 110 ? -9.918  -2.354  -19.374 1.00 1.00 ? 110 SER A CA   4  
ATOM 7531  C C    . SER A 1 110 ? -9.163  -1.008  -19.315 1.00 1.00 ? 110 SER A C    4  
ATOM 7532  O O    . SER A 1 110 ? -9.667  0.023   -19.776 1.00 1.00 ? 110 SER A O    4  
ATOM 7533  C CB   . SER A 1 110 ? -9.337  -3.273  -20.461 1.00 1.00 ? 110 SER A CB   4  
ATOM 7534  O OG   . SER A 1 110 ? -8.040  -3.728  -20.094 1.00 1.00 ? 110 SER A OG   4  
ATOM 7535  H H    . SER A 1 110 ? -11.595 -1.599  -20.432 1.00 1.00 ? 110 SER A H    4  
ATOM 7536  H HA   . SER A 1 110 ? -9.768  -2.852  -18.415 1.00 1.00 ? 110 SER A HA   4  
ATOM 7537  H HB2  . SER A 1 110 ? -9.992  -4.139  -20.582 1.00 1.00 ? 110 SER A HB2  4  
ATOM 7538  H HB3  . SER A 1 110 ? -9.288  -2.734  -21.410 1.00 1.00 ? 110 SER A HB3  4  
ATOM 7539  H HG   . SER A 1 110 ? -7.709  -4.361  -20.771 1.00 1.00 ? 110 SER A HG   4  
ATOM 7540  N N    . ARG A 1 111 ? -7.950  -1.023  -18.744 1.00 1.00 ? 111 ARG A N    4  
ATOM 7541  C CA   . ARG A 1 111 ? -7.129  0.160   -18.444 1.00 1.00 ? 111 ARG A CA   4  
ATOM 7542  C C    . ARG A 1 111 ? -5.628  -0.144  -18.601 1.00 1.00 ? 111 ARG A C    4  
ATOM 7543  O O    . ARG A 1 111 ? -5.177  -1.255  -18.312 1.00 1.00 ? 111 ARG A O    4  
ATOM 7544  C CB   . ARG A 1 111 ? -7.453  0.635   -17.014 1.00 1.00 ? 111 ARG A CB   4  
ATOM 7545  C CG   . ARG A 1 111 ? -6.938  2.055   -16.727 1.00 1.00 ? 111 ARG A CG   4  
ATOM 7546  C CD   . ARG A 1 111 ? -7.257  2.506   -15.297 1.00 1.00 ? 111 ARG A CD   4  
ATOM 7547  N NE   . ARG A 1 111 ? -6.352  1.858   -14.336 1.00 1.00 ? 111 ARG A NE   4  
ATOM 7548  C CZ   . ARG A 1 111 ? -6.486  1.779   -13.022 1.00 1.00 ? 111 ARG A CZ   4  
ATOM 7549  N NH1  . ARG A 1 111 ? -7.517  2.251   -12.362 1.00 1.00 ? 111 ARG A NH1  4  
ATOM 7550  N NH2  . ARG A 1 111 ? -5.531  1.197   -12.351 1.00 1.00 ? 111 ARG A NH2  4  
ATOM 7551  H H    . ARG A 1 111 ? -7.576  -1.924  -18.469 1.00 1.00 ? 111 ARG A H    4  
ATOM 7552  H HA   . ARG A 1 111 ? -7.401  0.954   -19.142 1.00 1.00 ? 111 ARG A HA   4  
ATOM 7553  H HB2  . ARG A 1 111 ? -8.537  0.635   -16.882 1.00 1.00 ? 111 ARG A HB2  4  
ATOM 7554  H HB3  . ARG A 1 111 ? -7.028  -0.065  -16.291 1.00 1.00 ? 111 ARG A HB3  4  
ATOM 7555  H HG2  . ARG A 1 111 ? -5.863  2.111   -16.880 1.00 1.00 ? 111 ARG A HG2  4  
ATOM 7556  H HG3  . ARG A 1 111 ? -7.417  2.745   -17.421 1.00 1.00 ? 111 ARG A HG3  4  
ATOM 7557  H HD2  . ARG A 1 111 ? -7.120  3.586   -15.236 1.00 1.00 ? 111 ARG A HD2  4  
ATOM 7558  H HD3  . ARG A 1 111 ? -8.299  2.274   -15.065 1.00 1.00 ? 111 ARG A HD3  4  
ATOM 7559  H HE   . ARG A 1 111 ? -5.492  1.444   -14.699 1.00 1.00 ? 111 ARG A HE   4  
ATOM 7560  H HH11 . ARG A 1 111 ? -8.291  2.675   -12.842 1.00 1.00 ? 111 ARG A HH11 4  
ATOM 7561  H HH12 . ARG A 1 111 ? -7.512  2.187   -11.342 1.00 1.00 ? 111 ARG A HH12 4  
ATOM 7562  H HH21 . ARG A 1 111 ? -4.727  0.855   -12.873 1.00 1.00 ? 111 ARG A HH21 4  
ATOM 7563  H HH22 . ARG A 1 111 ? -5.596  1.107   -11.337 1.00 1.00 ? 111 ARG A HH22 4  
ATOM 7564  N N    . ASN A 1 112 ? -4.864  0.858   -19.057 1.00 1.00 ? 112 ASN A N    4  
ATOM 7565  C CA   . ASN A 1 112 ? -3.418  0.753   -19.340 1.00 1.00 ? 112 ASN A CA   4  
ATOM 7566  C C    . ASN A 1 112 ? -2.568  1.982   -18.915 1.00 1.00 ? 112 ASN A C    4  
ATOM 7567  O O    . ASN A 1 112 ? -1.369  2.016   -19.201 1.00 1.00 ? 112 ASN A O    4  
ATOM 7568  C CB   . ASN A 1 112 ? -3.231  0.387   -20.828 1.00 1.00 ? 112 ASN A CB   4  
ATOM 7569  C CG   . ASN A 1 112 ? -3.921  1.337   -21.810 1.00 1.00 ? 112 ASN A CG   4  
ATOM 7570  O OD1  . ASN A 1 112 ? -4.219  2.483   -21.505 1.00 1.00 ? 112 ASN A OD1  4  
ATOM 7571  N ND2  . ASN A 1 112 ? -4.235  0.858   -22.999 1.00 1.00 ? 112 ASN A ND2  4  
ATOM 7572  H H    . ASN A 1 112 ? -5.341  1.691   -19.374 1.00 1.00 ? 112 ASN A H    4  
ATOM 7573  H HA   . ASN A 1 112 ? -3.020  -0.080  -18.759 1.00 1.00 ? 112 ASN A HA   4  
ATOM 7574  H HB2  . ASN A 1 112 ? -2.167  0.340   -21.068 1.00 1.00 ? 112 ASN A HB2  4  
ATOM 7575  H HB3  . ASN A 1 112 ? -3.634  -0.617  -20.981 1.00 1.00 ? 112 ASN A HB3  4  
ATOM 7576  H HD21 . ASN A 1 112 ? -3.998  -0.089  -23.250 1.00 1.00 ? 112 ASN A HD21 4  
ATOM 7577  H HD22 . ASN A 1 112 ? -4.806  1.428   -23.616 1.00 1.00 ? 112 ASN A HD22 4  
ATOM 7578  N N    . CYS A 1 113 ? -3.140  2.989   -18.231 1.00 1.00 ? 113 CYS A N    4  
ATOM 7579  C CA   . CYS A 1 113 ? -2.439  4.226   -17.824 1.00 1.00 ? 113 CYS A CA   4  
ATOM 7580  C C    . CYS A 1 113 ? -1.214  3.993   -16.917 1.00 1.00 ? 113 CYS A C    4  
ATOM 7581  O O    . CYS A 1 113 ? -0.218  4.705   -17.029 1.00 1.00 ? 113 CYS A O    4  
ATOM 7582  C CB   . CYS A 1 113 ? -3.442  5.162   -17.120 1.00 1.00 ? 113 CYS A CB   4  
ATOM 7583  S SG   . CYS A 1 113 ? -4.832  5.589   -18.209 1.00 1.00 ? 113 CYS A SG   4  
ATOM 7584  H H    . CYS A 1 113 ? -4.122  2.924   -18.018 1.00 1.00 ? 113 CYS A H    4  
ATOM 7585  H HA   . CYS A 1 113 ? -2.061  4.719   -18.719 1.00 1.00 ? 113 CYS A HA   4  
ATOM 7586  H HB2  . CYS A 1 113 ? -3.829  4.702   -16.203 1.00 1.00 ? 113 CYS A HB2  4  
ATOM 7587  H HB3  . CYS A 1 113 ? -2.935  6.090   -16.833 1.00 1.00 ? 113 CYS A HB3  4  
ATOM 7588  H HG   . CYS A 1 113 ? -5.432  6.436   -17.349 1.00 1.00 ? 113 CYS A HG   4  
ATOM 7589  N N    . GLU A 1 114 ? -1.289  2.987   -16.046 1.00 1.00 ? 114 GLU A N    4  
ATOM 7590  C CA   . GLU A 1 114 ? -0.195  2.536   -15.182 1.00 1.00 ? 114 GLU A CA   4  
ATOM 7591  C C    . GLU A 1 114 ? 0.810   1.671   -15.963 1.00 1.00 ? 114 GLU A C    4  
ATOM 7592  O O    . GLU A 1 114 ? 2.005   1.960   -15.957 1.00 1.00 ? 114 GLU A O    4  
ATOM 7593  C CB   . GLU A 1 114 ? -0.747  1.833   -13.919 1.00 1.00 ? 114 GLU A CB   4  
ATOM 7594  C CG   . GLU A 1 114 ? -1.437  0.468   -14.073 1.00 1.00 ? 114 GLU A CG   4  
ATOM 7595  C CD   . GLU A 1 114 ? -2.662  0.522   -14.988 1.00 1.00 ? 114 GLU A CD   4  
ATOM 7596  O OE1  . GLU A 1 114 ? -2.462  0.489   -16.222 1.00 1.00 ? 114 GLU A OE1  4  
ATOM 7597  O OE2  . GLU A 1 114 ? -3.789  0.701   -14.480 1.00 1.00 ? 114 GLU A OE2  4  
ATOM 7598  H H    . GLU A 1 114 ? -2.092  2.371   -16.128 1.00 1.00 ? 114 GLU A H    4  
ATOM 7599  H HA   . GLU A 1 114 ? 0.346   3.407   -14.823 1.00 1.00 ? 114 GLU A HA   4  
ATOM 7600  H HB2  . GLU A 1 114 ? 0.098   1.675   -13.256 1.00 1.00 ? 114 GLU A HB2  4  
ATOM 7601  H HB3  . GLU A 1 114 ? -1.434  2.514   -13.416 1.00 1.00 ? 114 GLU A HB3  4  
ATOM 7602  H HG2  . GLU A 1 114 ? -0.718  -0.254  -14.457 1.00 1.00 ? 114 GLU A HG2  4  
ATOM 7603  H HG3  . GLU A 1 114 ? -1.740  0.130   -13.083 1.00 1.00 ? 114 GLU A HG3  4  
ATOM 7604  N N    . HIS A 1 115 ? 0.323   0.674   -16.710 1.00 1.00 ? 115 HIS A N    4  
ATOM 7605  C CA   . HIS A 1 115 ? 1.149   -0.242  -17.504 1.00 1.00 ? 115 HIS A CA   4  
ATOM 7606  C C    . HIS A 1 115 ? 2.070   0.502   -18.488 1.00 1.00 ? 115 HIS A C    4  
ATOM 7607  O O    . HIS A 1 115 ? 3.224   0.117   -18.678 1.00 1.00 ? 115 HIS A O    4  
ATOM 7608  C CB   . HIS A 1 115 ? 0.215   -1.223  -18.235 1.00 1.00 ? 115 HIS A CB   4  
ATOM 7609  C CG   . HIS A 1 115 ? 0.934   -2.256  -19.070 1.00 1.00 ? 115 HIS A CG   4  
ATOM 7610  N ND1  . HIS A 1 115 ? 0.751   -2.489  -20.416 1.00 1.00 ? 115 HIS A ND1  4  
ATOM 7611  C CD2  . HIS A 1 115 ? 1.853   -3.173  -18.629 1.00 1.00 ? 115 HIS A CD2  4  
ATOM 7612  C CE1  . HIS A 1 115 ? 1.537   -3.518  -20.773 1.00 1.00 ? 115 HIS A CE1  4  
ATOM 7613  N NE2  . HIS A 1 115 ? 2.234   -3.974  -19.716 1.00 1.00 ? 115 HIS A NE2  4  
ATOM 7614  H H    . HIS A 1 115 ? -0.684  0.509   -16.681 1.00 1.00 ? 115 HIS A H    4  
ATOM 7615  H HA   . HIS A 1 115 ? 1.797   -0.806  -16.831 1.00 1.00 ? 115 HIS A HA   4  
ATOM 7616  H HB2  . HIS A 1 115 ? -0.391  -1.750  -17.496 1.00 1.00 ? 115 HIS A HB2  4  
ATOM 7617  H HB3  . HIS A 1 115 ? -0.463  -0.663  -18.880 1.00 1.00 ? 115 HIS A HB3  4  
ATOM 7618  H HD1  . HIS A 1 115 ? 0.122   -1.993  -21.035 1.00 1.00 ? 115 HIS A HD1  4  
ATOM 7619  H HD2  . HIS A 1 115 ? 2.209   -3.269  -17.611 1.00 1.00 ? 115 HIS A HD2  4  
ATOM 7620  H HE1  . HIS A 1 115 ? 1.589   -3.930  -21.775 1.00 1.00 ? 115 HIS A HE1  4  
ATOM 7621  N N    . PHE A 1 116 ? 1.603   1.625   -19.048 1.00 1.00 ? 116 PHE A N    4  
ATOM 7622  C CA   . PHE A 1 116 ? 2.438   2.527   -19.829 1.00 1.00 ? 116 PHE A CA   4  
ATOM 7623  C C    . PHE A 1 116 ? 3.727   2.936   -19.081 1.00 1.00 ? 116 PHE A C    4  
ATOM 7624  O O    . PHE A 1 116 ? 4.810   2.785   -19.643 1.00 1.00 ? 116 PHE A O    4  
ATOM 7625  C CB   . PHE A 1 116 ? 1.599   3.753   -20.244 1.00 1.00 ? 116 PHE A CB   4  
ATOM 7626  C CG   . PHE A 1 116 ? 2.453   4.902   -20.744 1.00 1.00 ? 116 PHE A CG   4  
ATOM 7627  C CD1  . PHE A 1 116 ? 3.310   4.705   -21.842 1.00 1.00 ? 116 PHE A CD1  4  
ATOM 7628  C CD2  . PHE A 1 116 ? 2.494   6.115   -20.033 1.00 1.00 ? 116 PHE A CD2  4  
ATOM 7629  C CE1  . PHE A 1 116 ? 4.235   5.699   -22.192 1.00 1.00 ? 116 PHE A CE1  4  
ATOM 7630  C CE2  . PHE A 1 116 ? 3.417   7.112   -20.391 1.00 1.00 ? 116 PHE A CE2  4  
ATOM 7631  C CZ   . PHE A 1 116 ? 4.294   6.898   -21.465 1.00 1.00 ? 116 PHE A CZ   4  
ATOM 7632  H H    . PHE A 1 116 ? 0.631   1.873   -18.904 1.00 1.00 ? 116 PHE A H    4  
ATOM 7633  H HA   . PHE A 1 116 ? 2.749   2.002   -20.734 1.00 1.00 ? 116 PHE A HA   4  
ATOM 7634  H HB2  . PHE A 1 116 ? 0.895   3.465   -21.025 1.00 1.00 ? 116 PHE A HB2  4  
ATOM 7635  H HB3  . PHE A 1 116 ? 1.015   4.097   -19.387 1.00 1.00 ? 116 PHE A HB3  4  
ATOM 7636  H HD1  . PHE A 1 116 ? 3.299   3.769   -22.382 1.00 1.00 ? 116 PHE A HD1  4  
ATOM 7637  H HD2  . PHE A 1 116 ? 1.842   6.272   -19.185 1.00 1.00 ? 116 PHE A HD2  4  
ATOM 7638  H HE1  . PHE A 1 116 ? 4.924   5.528   -23.003 1.00 1.00 ? 116 PHE A HE1  4  
ATOM 7639  H HE2  . PHE A 1 116 ? 3.467   8.035   -19.833 1.00 1.00 ? 116 PHE A HE2  4  
ATOM 7640  H HZ   . PHE A 1 116 ? 5.025   7.652   -21.727 1.00 1.00 ? 116 PHE A HZ   4  
ATOM 7641  N N    . VAL A 1 117 ? 3.649   3.420   -17.835 1.00 1.00 ? 117 VAL A N    4  
ATOM 7642  C CA   . VAL A 1 117 ? 4.831   3.994   -17.158 1.00 1.00 ? 117 VAL A CA   4  
ATOM 7643  C C    . VAL A 1 117 ? 5.780   2.939   -16.585 1.00 1.00 ? 117 VAL A C    4  
ATOM 7644  O O    . VAL A 1 117 ? 6.968   3.223   -16.446 1.00 1.00 ? 117 VAL A O    4  
ATOM 7645  C CB   . VAL A 1 117 ? 4.500   5.057   -16.092 1.00 1.00 ? 117 VAL A CB   4  
ATOM 7646  C CG1  . VAL A 1 117 ? 3.863   6.297   -16.738 1.00 1.00 ? 117 VAL A CG1  4  
ATOM 7647  C CG2  . VAL A 1 117 ? 3.596   4.548   -14.967 1.00 1.00 ? 117 VAL A CG2  4  
ATOM 7648  H H    . VAL A 1 117 ? 2.772   3.316   -17.329 1.00 1.00 ? 117 VAL A H    4  
ATOM 7649  H HA   . VAL A 1 117 ? 5.398   4.521   -17.926 1.00 1.00 ? 117 VAL A HA   4  
ATOM 7650  H HB   . VAL A 1 117 ? 5.440   5.375   -15.640 1.00 1.00 ? 117 VAL A HB   4  
ATOM 7651  H HG11 . VAL A 1 117 ? 4.500   6.665   -17.544 1.00 1.00 ? 117 VAL A HG11 4  
ATOM 7652  H HG12 . VAL A 1 117 ? 2.878   6.053   -17.135 1.00 1.00 ? 117 VAL A HG12 4  
ATOM 7653  H HG13 . VAL A 1 117 ? 3.758   7.082   -15.995 1.00 1.00 ? 117 VAL A HG13 4  
ATOM 7654  H HG21 . VAL A 1 117 ? 3.979   3.611   -14.564 1.00 1.00 ? 117 VAL A HG21 4  
ATOM 7655  H HG22 . VAL A 1 117 ? 3.575   5.291   -14.174 1.00 1.00 ? 117 VAL A HG22 4  
ATOM 7656  H HG23 . VAL A 1 117 ? 2.582   4.403   -15.339 1.00 1.00 ? 117 VAL A HG23 4  
ATOM 7657  N N    . THR A 1 118 ? 5.310   1.713   -16.311 1.00 1.00 ? 118 THR A N    4  
ATOM 7658  C CA   . THR A 1 118 ? 6.193   0.586   -15.969 1.00 1.00 ? 118 THR A CA   4  
ATOM 7659  C C    . THR A 1 118 ? 6.908   0.060   -17.207 1.00 1.00 ? 118 THR A C    4  
ATOM 7660  O O    . THR A 1 118 ? 8.109   -0.197  -17.150 1.00 1.00 ? 118 THR A O    4  
ATOM 7661  C CB   . THR A 1 118 ? 5.415   -0.534  -15.275 1.00 1.00 ? 118 THR A CB   4  
ATOM 7662  O OG1  . THR A 1 118 ? 4.239   -0.810  -15.997 1.00 1.00 ? 118 THR A OG1  4  
ATOM 7663  C CG2  . THR A 1 118 ? 5.016   -0.129  -13.856 1.00 1.00 ? 118 THR A CG2  4  
ATOM 7664  H H    . THR A 1 118 ? 4.320   1.513   -16.415 1.00 1.00 ? 118 THR A H    4  
ATOM 7665  H HA   . THR A 1 118 ? 6.973   0.929   -15.286 1.00 1.00 ? 118 THR A HA   4  
ATOM 7666  H HB   . THR A 1 118 ? 6.032   -1.430  -15.240 1.00 1.00 ? 118 THR A HB   4  
ATOM 7667  H HG1  . THR A 1 118 ? 3.835   -1.621  -15.639 1.00 1.00 ? 118 THR A HG1  4  
ATOM 7668  H HG21 . THR A 1 118 ? 5.906   0.109   -13.273 1.00 1.00 ? 118 THR A HG21 4  
ATOM 7669  H HG22 . THR A 1 118 ? 4.359   0.740   -13.881 1.00 1.00 ? 118 THR A HG22 4  
ATOM 7670  H HG23 . THR A 1 118 ? 4.493   -0.958  -13.375 1.00 1.00 ? 118 THR A HG23 4  
ATOM 7671  N N    . GLN A 1 119 ? 6.219   -0.007  -18.349 1.00 1.00 ? 119 GLN A N    4  
ATOM 7672  C CA   . GLN A 1 119 ? 6.814   -0.348  -19.643 1.00 1.00 ? 119 GLN A CA   4  
ATOM 7673  C C    . GLN A 1 119 ? 7.887   0.656   -20.098 1.00 1.00 ? 119 GLN A C    4  
ATOM 7674  O O    . GLN A 1 119 ? 8.810   0.251   -20.801 1.00 1.00 ? 119 GLN A O    4  
ATOM 7675  C CB   . GLN A 1 119 ? 5.719   -0.503  -20.717 1.00 1.00 ? 119 GLN A CB   4  
ATOM 7676  C CG   . GLN A 1 119 ? 4.894   -1.794  -20.562 1.00 1.00 ? 119 GLN A CG   4  
ATOM 7677  C CD   . GLN A 1 119 ? 5.654   -3.081  -20.895 1.00 1.00 ? 119 GLN A CD   4  
ATOM 7678  O OE1  . GLN A 1 119 ? 6.792   -3.088  -21.352 1.00 1.00 ? 119 GLN A OE1  4  
ATOM 7679  N NE2  . GLN A 1 119 ? 5.052   -4.230  -20.666 1.00 1.00 ? 119 GLN A NE2  4  
ATOM 7680  H H    . GLN A 1 119 ? 5.224   0.162   -18.311 1.00 1.00 ? 119 GLN A H    4  
ATOM 7681  H HA   . GLN A 1 119 ? 7.319   -1.305  -19.533 1.00 1.00 ? 119 GLN A HA   4  
ATOM 7682  H HB2  . GLN A 1 119 ? 5.053   0.358   -20.680 1.00 1.00 ? 119 GLN A HB2  4  
ATOM 7683  H HB3  . GLN A 1 119 ? 6.182   -0.508  -21.705 1.00 1.00 ? 119 GLN A HB3  4  
ATOM 7684  H HG2  . GLN A 1 119 ? 4.526   -1.876  -19.540 1.00 1.00 ? 119 GLN A HG2  4  
ATOM 7685  H HG3  . GLN A 1 119 ? 4.028   -1.731  -21.219 1.00 1.00 ? 119 GLN A HG3  4  
ATOM 7686  H HE21 . GLN A 1 119 ? 4.104   -4.232  -20.290 1.00 1.00 ? 119 GLN A HE21 4  
ATOM 7687  H HE22 . GLN A 1 119 ? 5.530   -5.087  -20.892 1.00 1.00 ? 119 GLN A HE22 4  
ATOM 7688  N N    . LEU A 1 120 ? 7.847   1.926   -19.662 1.00 1.00 ? 120 LEU A N    4  
ATOM 7689  C CA   . LEU A 1 120 ? 8.952   2.878   -19.915 1.00 1.00 ? 120 LEU A CA   4  
ATOM 7690  C C    . LEU A 1 120 ? 10.297  2.422   -19.316 1.00 1.00 ? 120 LEU A C    4  
ATOM 7691  O O    . LEU A 1 120 ? 11.345  2.712   -19.896 1.00 1.00 ? 120 LEU A O    4  
ATOM 7692  C CB   . LEU A 1 120 ? 8.603   4.279   -19.368 1.00 1.00 ? 120 LEU A CB   4  
ATOM 7693  C CG   . LEU A 1 120 ? 7.477   5.028   -20.102 1.00 1.00 ? 120 LEU A CG   4  
ATOM 7694  C CD1  . LEU A 1 120 ? 7.262   6.369   -19.394 1.00 1.00 ? 120 LEU A CD1  4  
ATOM 7695  C CD2  . LEU A 1 120 ? 7.802   5.239   -21.587 1.00 1.00 ? 120 LEU A CD2  4  
ATOM 7696  H H    . LEU A 1 120 ? 7.028   2.233   -19.149 1.00 1.00 ? 120 LEU A H    4  
ATOM 7697  H HA   . LEU A 1 120 ? 9.112   2.944   -20.994 1.00 1.00 ? 120 LEU A HA   4  
ATOM 7698  H HB2  . LEU A 1 120 ? 8.348   4.191   -18.310 1.00 1.00 ? 120 LEU A HB2  4  
ATOM 7699  H HB3  . LEU A 1 120 ? 9.500   4.900   -19.427 1.00 1.00 ? 120 LEU A HB3  4  
ATOM 7700  H HG   . LEU A 1 120 ? 6.554   4.463   -20.032 1.00 1.00 ? 120 LEU A HG   4  
ATOM 7701  H HD11 . LEU A 1 120 ? 8.183   6.947   -19.423 1.00 1.00 ? 120 LEU A HD11 4  
ATOM 7702  H HD12 . LEU A 1 120 ? 6.467   6.931   -19.879 1.00 1.00 ? 120 LEU A HD12 4  
ATOM 7703  H HD13 . LEU A 1 120 ? 6.979   6.196   -18.356 1.00 1.00 ? 120 LEU A HD13 4  
ATOM 7704  H HD21 . LEU A 1 120 ? 8.832   5.581   -21.708 1.00 1.00 ? 120 LEU A HD21 4  
ATOM 7705  H HD22 . LEU A 1 120 ? 7.670   4.304   -22.135 1.00 1.00 ? 120 LEU A HD22 4  
ATOM 7706  H HD23 . LEU A 1 120 ? 7.126   5.979   -22.011 1.00 1.00 ? 120 LEU A HD23 4  
ATOM 7707  N N    . ARG A 1 121 ? 10.269  1.717   -18.175 1.00 1.00 ? 121 ARG A N    4  
ATOM 7708  C CA   . ARG A 1 121 ? 11.455  1.144   -17.514 1.00 1.00 ? 121 ARG A CA   4  
ATOM 7709  C C    . ARG A 1 121 ? 11.738  -0.279  -18.027 1.00 1.00 ? 121 ARG A C    4  
ATOM 7710  O O    . ARG A 1 121 ? 12.855  -0.570  -18.443 1.00 1.00 ? 121 ARG A O    4  
ATOM 7711  C CB   . ARG A 1 121 ? 11.244  1.201   -15.985 1.00 1.00 ? 121 ARG A CB   4  
ATOM 7712  C CG   . ARG A 1 121 ? 12.498  0.765   -15.202 1.00 1.00 ? 121 ARG A CG   4  
ATOM 7713  C CD   . ARG A 1 121 ? 12.316  0.826   -13.676 1.00 1.00 ? 121 ARG A CD   4  
ATOM 7714  N NE   . ARG A 1 121 ? 12.319  2.213   -13.155 1.00 1.00 ? 121 ARG A NE   4  
ATOM 7715  C CZ   . ARG A 1 121 ? 12.910  2.648   -12.041 1.00 1.00 ? 121 ARG A CZ   4  
ATOM 7716  N NH1  . ARG A 1 121 ? 13.549  1.839   -11.223 1.00 1.00 ? 121 ARG A NH1  4  
ATOM 7717  N NH2  . ARG A 1 121 ? 12.868  3.924   -11.725 1.00 1.00 ? 121 ARG A NH2  4  
ATOM 7718  H H    . ARG A 1 121 ? 9.361   1.518   -17.771 1.00 1.00 ? 121 ARG A H    4  
ATOM 7719  H HA   . ARG A 1 121 ? 12.326  1.761   -17.743 1.00 1.00 ? 121 ARG A HA   4  
ATOM 7720  H HB2  . ARG A 1 121 ? 10.991  2.226   -15.713 1.00 1.00 ? 121 ARG A HB2  4  
ATOM 7721  H HB3  . ARG A 1 121 ? 10.404  0.562   -15.709 1.00 1.00 ? 121 ARG A HB3  4  
ATOM 7722  H HG2  . ARG A 1 121 ? 12.734  -0.265  -15.465 1.00 1.00 ? 121 ARG A HG2  4  
ATOM 7723  H HG3  . ARG A 1 121 ? 13.351  1.382   -15.495 1.00 1.00 ? 121 ARG A HG3  4  
ATOM 7724  H HD2  . ARG A 1 121 ? 11.381  0.336   -13.402 1.00 1.00 ? 121 ARG A HD2  4  
ATOM 7725  H HD3  . ARG A 1 121 ? 13.137  0.259   -13.233 1.00 1.00 ? 121 ARG A HD3  4  
ATOM 7726  H HE   . ARG A 1 121 ? 11.798  2.902   -13.685 1.00 1.00 ? 121 ARG A HE   4  
ATOM 7727  H HH11 . ARG A 1 121 ? 13.589  0.849   -11.407 1.00 1.00 ? 121 ARG A HH11 4  
ATOM 7728  H HH12 . ARG A 1 121 ? 14.007  2.193   -10.397 1.00 1.00 ? 121 ARG A HH12 4  
ATOM 7729  H HH21 . ARG A 1 121 ? 12.391  4.607   -12.310 1.00 1.00 ? 121 ARG A HH21 4  
ATOM 7730  H HH22 . ARG A 1 121 ? 13.335  4.255   -10.893 1.00 1.00 ? 121 ARG A HH22 4  
ATOM 7731  N N    . TYR A 1 122 ? 10.742  -1.170  -18.026 1.00 1.00 ? 122 TYR A N    4  
ATOM 7732  C CA   . TYR A 1 122 ? 10.919  -2.577  -18.430 1.00 1.00 ? 122 TYR A CA   4  
ATOM 7733  C C    . TYR A 1 122 ? 11.238  -2.748  -19.931 1.00 1.00 ? 122 TYR A C    4  
ATOM 7734  O O    . TYR A 1 122 ? 12.077  -3.571  -20.304 1.00 1.00 ? 122 TYR A O    4  
ATOM 7735  C CB   . TYR A 1 122 ? 9.655   -3.359  -18.046 1.00 1.00 ? 122 TYR A CB   4  
ATOM 7736  C CG   . TYR A 1 122 ? 9.708   -4.839  -18.380 1.00 1.00 ? 122 TYR A CG   4  
ATOM 7737  C CD1  . TYR A 1 122 ? 10.687  -5.662  -17.793 1.00 1.00 ? 122 TYR A CD1  4  
ATOM 7738  C CD2  . TYR A 1 122 ? 8.780   -5.394  -19.285 1.00 1.00 ? 122 TYR A CD2  4  
ATOM 7739  C CE1  . TYR A 1 122 ? 10.739  -7.034  -18.104 1.00 1.00 ? 122 TYR A CE1  4  
ATOM 7740  C CE2  . TYR A 1 122 ? 8.829   -6.764  -19.604 1.00 1.00 ? 122 TYR A CE2  4  
ATOM 7741  C CZ   . TYR A 1 122 ? 9.814   -7.591  -19.014 1.00 1.00 ? 122 TYR A CZ   4  
ATOM 7742  O OH   . TYR A 1 122 ? 9.874   -8.920  -19.314 1.00 1.00 ? 122 TYR A OH   4  
ATOM 7743  H H    . TYR A 1 122 ? 9.835   -0.882  -17.673 1.00 1.00 ? 122 TYR A H    4  
ATOM 7744  H HA   . TYR A 1 122 ? 11.759  -2.997  -17.874 1.00 1.00 ? 122 TYR A HA   4  
ATOM 7745  H HB2  . TYR A 1 122 ? 9.488   -3.259  -16.974 1.00 1.00 ? 122 TYR A HB2  4  
ATOM 7746  H HB3  . TYR A 1 122 ? 8.799   -2.910  -18.552 1.00 1.00 ? 122 TYR A HB3  4  
ATOM 7747  H HD1  . TYR A 1 122 ? 11.399  -5.240  -17.101 1.00 1.00 ? 122 TYR A HD1  4  
ATOM 7748  H HD2  . TYR A 1 122 ? 8.027   -4.767  -19.740 1.00 1.00 ? 122 TYR A HD2  4  
ATOM 7749  H HE1  . TYR A 1 122 ? 11.493  -7.660  -17.650 1.00 1.00 ? 122 TYR A HE1  4  
ATOM 7750  H HE2  . TYR A 1 122 ? 8.111   -7.183  -20.292 1.00 1.00 ? 122 TYR A HE2  4  
ATOM 7751  H HH   . TYR A 1 122 ? 9.192   -9.200  -19.940 1.00 1.00 ? 122 TYR A HH   4  
ATOM 7752  N N    . GLY A 1 123 ? 10.603  -1.935  -20.781 1.00 1.00 ? 123 GLY A N    4  
ATOM 7753  C CA   . GLY A 1 123 ? 10.797  -1.851  -22.233 1.00 1.00 ? 123 GLY A CA   4  
ATOM 7754  C C    . GLY A 1 123 ? 11.551  -0.584  -22.651 1.00 1.00 ? 123 GLY A C    4  
ATOM 7755  O O    . GLY A 1 123 ? 11.215  0.020   -23.670 1.00 1.00 ? 123 GLY A O    4  
ATOM 7756  H H    . GLY A 1 123 ? 9.937   -1.275  -20.395 1.00 1.00 ? 123 GLY A H    4  
ATOM 7757  H HA2  . GLY A 1 123 ? 11.356  -2.713  -22.600 1.00 1.00 ? 123 GLY A HA2  4  
ATOM 7758  H HA3  . GLY A 1 123 ? 9.818   -1.816  -22.711 1.00 1.00 ? 123 GLY A HA3  4  
ATOM 7759  N N    . LYS A 1 124 ? 12.556  -0.170  -21.866 1.00 1.00 ? 124 LYS A N    4  
ATOM 7760  C CA   . LYS A 1 124 ? 13.433  0.974   -22.171 1.00 1.00 ? 124 LYS A CA   4  
ATOM 7761  C C    . LYS A 1 124 ? 14.062  0.891   -23.586 1.00 1.00 ? 124 LYS A C    4  
ATOM 7762  O O    . LYS A 1 124 ? 14.267  -0.205  -24.120 1.00 1.00 ? 124 LYS A O    4  
ATOM 7763  C CB   . LYS A 1 124 ? 14.477  1.129   -21.036 1.00 1.00 ? 124 LYS A CB   4  
ATOM 7764  C CG   . LYS A 1 124 ? 15.513  -0.010  -20.929 1.00 1.00 ? 124 LYS A CG   4  
ATOM 7765  C CD   . LYS A 1 124 ? 16.726  0.177   -21.864 1.00 1.00 ? 124 LYS A CD   4  
ATOM 7766  C CE   . LYS A 1 124 ? 17.086  -1.116  -22.617 1.00 1.00 ? 124 LYS A CE   4  
ATOM 7767  N NZ   . LYS A 1 124 ? 18.080  -0.860  -23.695 1.00 1.00 ? 124 LYS A NZ   4  
ATOM 7768  H H    . LYS A 1 124 ? 12.755  -0.702  -21.032 1.00 1.00 ? 124 LYS A H    4  
ATOM 7769  H HA   . LYS A 1 124 ? 12.806  1.868   -22.155 1.00 1.00 ? 124 LYS A HA   4  
ATOM 7770  H HB2  . LYS A 1 124 ? 14.993  2.083   -21.138 1.00 1.00 ? 124 LYS A HB2  4  
ATOM 7771  H HB3  . LYS A 1 124 ? 13.933  1.184   -20.091 1.00 1.00 ? 124 LYS A HB3  4  
ATOM 7772  H HG2  . LYS A 1 124 ? 15.880  -0.038  -19.903 1.00 1.00 ? 124 LYS A HG2  4  
ATOM 7773  H HG3  . LYS A 1 124 ? 15.026  -0.966  -21.121 1.00 1.00 ? 124 LYS A HG3  4  
ATOM 7774  H HD2  . LYS A 1 124 ? 16.512  0.958   -22.590 1.00 1.00 ? 124 LYS A HD2  4  
ATOM 7775  H HD3  . LYS A 1 124 ? 17.584  0.513   -21.274 1.00 1.00 ? 124 LYS A HD3  4  
ATOM 7776  H HE2  . LYS A 1 124 ? 17.471  -1.858  -21.908 1.00 1.00 ? 124 LYS A HE2  4  
ATOM 7777  H HE3  . LYS A 1 124 ? 16.172  -1.526  -23.063 1.00 1.00 ? 124 LYS A HE3  4  
ATOM 7778  H HZ1  . LYS A 1 124 ? 18.257  -1.699  -24.236 1.00 1.00 ? 124 LYS A HZ1  4  
ATOM 7779  H HZ2  . LYS A 1 124 ? 17.734  -0.140  -24.335 1.00 1.00 ? 124 LYS A HZ2  4  
ATOM 7780  H HZ3  . LYS A 1 124 ? 18.967  -0.545  -23.322 1.00 1.00 ? 124 LYS A HZ3  4  
ATOM 7781  N N    . SER A 1 125 ? 14.377  2.053   -24.178 1.00 1.00 ? 125 SER A N    4  
ATOM 7782  C CA   . SER A 1 125 ? 14.842  2.218   -25.572 1.00 1.00 ? 125 SER A CA   4  
ATOM 7783  C C    . SER A 1 125 ? 16.014  1.309   -25.977 1.00 1.00 ? 125 SER A C    4  
ATOM 7784  O O    . SER A 1 125 ? 15.930  0.689   -27.063 1.00 1.00 ? 125 SER A O    4  
ATOM 7785  C CB   . SER A 1 125 ? 15.216  3.678   -25.839 1.00 1.00 ? 125 SER A CB   4  
ATOM 7786  O OG   . SER A 1 125 ? 14.153  4.527   -25.423 1.00 1.00 ? 125 SER A OG   4  
ATOM 7787  O OXT  . SER A 1 125 ? 17.021  1.232   -25.235 1.00 1.00 ? 125 SER A OXT  4  
ATOM 7788  H H    . SER A 1 125 ? 14.181  2.910   -23.683 1.00 1.00 ? 125 SER A H    4  
ATOM 7789  H HA   . SER A 1 125 ? 14.013  1.973   -26.233 1.00 1.00 ? 125 SER A HA   4  
ATOM 7790  H HB2  . SER A 1 125 ? 16.130  3.923   -25.297 1.00 1.00 ? 125 SER A HB2  4  
ATOM 7791  H HB3  . SER A 1 125 ? 15.407  3.803   -26.909 1.00 1.00 ? 125 SER A HB3  4  
ATOM 7792  H HG   . SER A 1 125 ? 14.326  5.437   -25.741 1.00 1.00 ? 125 SER A HG   4  
ATOM 7793  N N    . MET A 1 1   ? 9.037   25.476  7.080   1.00 1.00 ? 1   MET A N    5  
ATOM 7794  C CA   . MET A 1 1   ? 8.505   24.096  7.314   1.00 1.00 ? 1   MET A CA   5  
ATOM 7795  C C    . MET A 1 1   ? 9.630   23.051  7.225   1.00 1.00 ? 1   MET A C    5  
ATOM 7796  O O    . MET A 1 1   ? 10.646  23.287  6.568   1.00 1.00 ? 1   MET A O    5  
ATOM 7797  C CB   . MET A 1 1   ? 7.354   23.727  6.343   1.00 1.00 ? 1   MET A CB   5  
ATOM 7798  C CG   . MET A 1 1   ? 6.064   24.533  6.569   1.00 1.00 ? 1   MET A CG   5  
ATOM 7799  S SD   . MET A 1 1   ? 4.680   24.011  5.509   1.00 1.00 ? 1   MET A SD   5  
ATOM 7800  C CE   . MET A 1 1   ? 3.399   25.151  6.102   1.00 1.00 ? 1   MET A CE   5  
ATOM 7801  H H1   . MET A 1 1   ? 8.319   26.176  7.205   1.00 1.00 ? 1   MET A H1   5  
ATOM 7802  H H2   . MET A 1 1   ? 9.784   25.683  7.729   1.00 1.00 ? 1   MET A H2   5  
ATOM 7803  H H3   . MET A 1 1   ? 9.410   25.562  6.144   1.00 1.00 ? 1   MET A H3   5  
ATOM 7804  H HA   . MET A 1 1   ? 8.113   24.047  8.333   1.00 1.00 ? 1   MET A HA   5  
ATOM 7805  H HB2  . MET A 1 1   ? 7.682   23.861  5.310   1.00 1.00 ? 1   MET A HB2  5  
ATOM 7806  H HB3  . MET A 1 1   ? 7.101   22.672  6.478   1.00 1.00 ? 1   MET A HB3  5  
ATOM 7807  H HG2  . MET A 1 1   ? 5.756   24.417  7.609   1.00 1.00 ? 1   MET A HG2  5  
ATOM 7808  H HG3  . MET A 1 1   ? 6.251   25.590  6.379   1.00 1.00 ? 1   MET A HG3  5  
ATOM 7809  H HE1  . MET A 1 1   ? 3.226   24.998  7.167   1.00 1.00 ? 1   MET A HE1  5  
ATOM 7810  H HE2  . MET A 1 1   ? 3.713   26.183  5.935   1.00 1.00 ? 1   MET A HE2  5  
ATOM 7811  H HE3  . MET A 1 1   ? 2.471   24.967  5.562   1.00 1.00 ? 1   MET A HE3  5  
ATOM 7812  N N    . ALA A 1 2   ? 9.460   21.892  7.878   1.00 1.00 ? 2   ALA A N    5  
ATOM 7813  C CA   . ALA A 1 2   ? 10.410  20.770  7.835   1.00 1.00 ? 2   ALA A CA   5  
ATOM 7814  C C    . ALA A 1 2   ? 10.362  19.991  6.500   1.00 1.00 ? 2   ALA A C    5  
ATOM 7815  O O    . ALA A 1 2   ? 9.402   20.096  5.734   1.00 1.00 ? 2   ALA A O    5  
ATOM 7816  C CB   . ALA A 1 2   ? 10.125  19.857  9.037   1.00 1.00 ? 2   ALA A CB   5  
ATOM 7817  H H    . ALA A 1 2   ? 8.602   21.748  8.397   1.00 1.00 ? 2   ALA A H    5  
ATOM 7818  H HA   . ALA A 1 2   ? 11.422  21.168  7.945   1.00 1.00 ? 2   ALA A HA   5  
ATOM 7819  H HB1  . ALA A 1 2   ? 10.197  20.427  9.966   1.00 1.00 ? 2   ALA A HB1  5  
ATOM 7820  H HB2  . ALA A 1 2   ? 9.126   19.423  8.955   1.00 1.00 ? 2   ALA A HB2  5  
ATOM 7821  H HB3  . ALA A 1 2   ? 10.857  19.049  9.069   1.00 1.00 ? 2   ALA A HB3  5  
ATOM 7822  N N    . SER A 1 3   ? 11.392  19.189  6.229   1.00 1.00 ? 3   SER A N    5  
ATOM 7823  C CA   . SER A 1 3   ? 11.491  18.355  5.017   1.00 1.00 ? 3   SER A CA   5  
ATOM 7824  C C    . SER A 1 3   ? 10.422  17.234  4.970   1.00 1.00 ? 3   SER A C    5  
ATOM 7825  O O    . SER A 1 3   ? 10.043  16.708  6.026   1.00 1.00 ? 3   SER A O    5  
ATOM 7826  C CB   . SER A 1 3   ? 12.892  17.725  4.932   1.00 1.00 ? 3   SER A CB   5  
ATOM 7827  O OG   . SER A 1 3   ? 13.909  18.724  4.936   1.00 1.00 ? 3   SER A OG   5  
ATOM 7828  H H    . SER A 1 3   ? 12.170  19.159  6.876   1.00 1.00 ? 3   SER A H    5  
ATOM 7829  H HA   . SER A 1 3   ? 11.359  19.005  4.150   1.00 1.00 ? 3   SER A HA   5  
ATOM 7830  H HB2  . SER A 1 3   ? 13.034  17.056  5.783   1.00 1.00 ? 3   SER A HB2  5  
ATOM 7831  H HB3  . SER A 1 3   ? 12.968  17.134  4.017   1.00 1.00 ? 3   SER A HB3  5  
ATOM 7832  H HG   . SER A 1 3   ? 14.792  18.294  4.875   1.00 1.00 ? 3   SER A HG   5  
ATOM 7833  N N    . PRO A 1 4   ? 9.947   16.835  3.769   1.00 1.00 ? 4   PRO A N    5  
ATOM 7834  C CA   . PRO A 1 4   ? 8.965   15.761  3.601   1.00 1.00 ? 4   PRO A CA   5  
ATOM 7835  C C    . PRO A 1 4   ? 9.591   14.377  3.838   1.00 1.00 ? 4   PRO A C    5  
ATOM 7836  O O    . PRO A 1 4   ? 10.806  14.201  3.746   1.00 1.00 ? 4   PRO A O    5  
ATOM 7837  C CB   . PRO A 1 4   ? 8.441   15.910  2.169   1.00 1.00 ? 4   PRO A CB   5  
ATOM 7838  C CG   . PRO A 1 4   ? 9.648   16.478  1.423   1.00 1.00 ? 4   PRO A CG   5  
ATOM 7839  C CD   . PRO A 1 4   ? 10.290  17.394  2.465   1.00 1.00 ? 4   PRO A CD   5  
ATOM 7840  H HA   . PRO A 1 4   ? 8.137   15.898  4.299   1.00 1.00 ? 4   PRO A HA   5  
ATOM 7841  H HB2  . PRO A 1 4   ? 8.106   14.965  1.742   1.00 1.00 ? 4   PRO A HB2  5  
ATOM 7842  H HB3  . PRO A 1 4   ? 7.627   16.638  2.154   1.00 1.00 ? 4   PRO A HB3  5  
ATOM 7843  H HG2  . PRO A 1 4   ? 10.336  15.672  1.169   1.00 1.00 ? 4   PRO A HG2  5  
ATOM 7844  H HG3  . PRO A 1 4   ? 9.348   17.024  0.529   1.00 1.00 ? 4   PRO A HG3  5  
ATOM 7845  H HD2  . PRO A 1 4   ? 11.369  17.422  2.310   1.00 1.00 ? 4   PRO A HD2  5  
ATOM 7846  H HD3  . PRO A 1 4   ? 9.866   18.396  2.377   1.00 1.00 ? 4   PRO A HD3  5  
ATOM 7847  N N    . HIS A 1 5   ? 8.749   13.373  4.111   1.00 1.00 ? 5   HIS A N    5  
ATOM 7848  C CA   . HIS A 1 5   ? 9.189   12.004  4.426   1.00 1.00 ? 5   HIS A CA   5  
ATOM 7849  C C    . HIS A 1 5   ? 9.634   11.187  3.187   1.00 1.00 ? 5   HIS A C    5  
ATOM 7850  O O    . HIS A 1 5   ? 10.172  10.086  3.330   1.00 1.00 ? 5   HIS A O    5  
ATOM 7851  C CB   . HIS A 1 5   ? 8.050   11.287  5.173   1.00 1.00 ? 5   HIS A CB   5  
ATOM 7852  C CG   . HIS A 1 5   ? 7.621   11.975  6.451   1.00 1.00 ? 5   HIS A CG   5  
ATOM 7853  N ND1  . HIS A 1 5   ? 6.359   12.436  6.745   1.00 1.00 ? 5   HIS A ND1  5  
ATOM 7854  C CD2  . HIS A 1 5   ? 8.408   12.233  7.542   1.00 1.00 ? 5   HIS A CD2  5  
ATOM 7855  C CE1  . HIS A 1 5   ? 6.385   12.964  7.981   1.00 1.00 ? 5   HIS A CE1  5  
ATOM 7856  N NE2  . HIS A 1 5   ? 7.618   12.863  8.514   1.00 1.00 ? 5   HIS A NE2  5  
ATOM 7857  H H    . HIS A 1 5   ? 7.761   13.583  4.204   1.00 1.00 ? 5   HIS A H    5  
ATOM 7858  H HA   . HIS A 1 5   ? 10.055  12.059  5.087   1.00 1.00 ? 5   HIS A HA   5  
ATOM 7859  H HB2  . HIS A 1 5   ? 7.187   11.191  4.511   1.00 1.00 ? 5   HIS A HB2  5  
ATOM 7860  H HB3  . HIS A 1 5   ? 8.378   10.278  5.431   1.00 1.00 ? 5   HIS A HB3  5  
ATOM 7861  H HD1  . HIS A 1 5   ? 5.542   12.378  6.148   1.00 1.00 ? 5   HIS A HD1  5  
ATOM 7862  H HD2  . HIS A 1 5   ? 9.457   11.981  7.637   1.00 1.00 ? 5   HIS A HD2  5  
ATOM 7863  H HE1  . HIS A 1 5   ? 5.525   13.400  8.480   1.00 1.00 ? 5   HIS A HE1  5  
ATOM 7864  N N    . GLN A 1 6   ? 9.415   11.711  1.974   1.00 1.00 ? 6   GLN A N    5  
ATOM 7865  C CA   . GLN A 1 6   ? 9.695   11.058  0.690   1.00 1.00 ? 6   GLN A CA   5  
ATOM 7866  C C    . GLN A 1 6   ? 9.825   12.122  -0.421  1.00 1.00 ? 6   GLN A C    5  
ATOM 7867  O O    . GLN A 1 6   ? 9.130   13.138  -0.390  1.00 1.00 ? 6   GLN A O    5  
ATOM 7868  C CB   . GLN A 1 6   ? 8.569   10.040  0.393   1.00 1.00 ? 6   GLN A CB   5  
ATOM 7869  C CG   . GLN A 1 6   ? 8.815   9.166   -0.848  1.00 1.00 ? 6   GLN A CG   5  
ATOM 7870  C CD   . GLN A 1 6   ? 7.706   8.131   -1.052  1.00 1.00 ? 6   GLN A CD   5  
ATOM 7871  O OE1  . GLN A 1 6   ? 6.706   8.378   -1.715  1.00 1.00 ? 6   GLN A OE1  5  
ATOM 7872  N NE2  . GLN A 1 6   ? 7.829   6.930   -0.524  1.00 1.00 ? 6   GLN A NE2  5  
ATOM 7873  H H    . GLN A 1 6   ? 9.006   12.635  1.933   1.00 1.00 ? 6   GLN A H    5  
ATOM 7874  H HA   . GLN A 1 6   ? 10.648  10.528  0.766   1.00 1.00 ? 6   GLN A HA   5  
ATOM 7875  H HB2  . GLN A 1 6   ? 8.460   9.378   1.253   1.00 1.00 ? 6   GLN A HB2  5  
ATOM 7876  H HB3  . GLN A 1 6   ? 7.628   10.580  0.265   1.00 1.00 ? 6   GLN A HB3  5  
ATOM 7877  H HG2  . GLN A 1 6   ? 8.855   9.797   -1.737  1.00 1.00 ? 6   GLN A HG2  5  
ATOM 7878  H HG3  . GLN A 1 6   ? 9.770   8.652   -0.746  1.00 1.00 ? 6   GLN A HG3  5  
ATOM 7879  H HE21 . GLN A 1 6   ? 8.638   6.686   0.029   1.00 1.00 ? 6   GLN A HE21 5  
ATOM 7880  H HE22 . GLN A 1 6   ? 7.097   6.254   -0.690  1.00 1.00 ? 6   GLN A HE22 5  
ATOM 7881  N N    . GLU A 1 7   ? 10.692  11.880  -1.413  1.00 1.00 ? 7   GLU A N    5  
ATOM 7882  C CA   . GLU A 1 7   ? 10.887  12.753  -2.581  1.00 1.00 ? 7   GLU A CA   5  
ATOM 7883  C C    . GLU A 1 7   ? 11.123  11.893  -3.843  1.00 1.00 ? 7   GLU A C    5  
ATOM 7884  O O    . GLU A 1 7   ? 11.906  10.936  -3.774  1.00 1.00 ? 7   GLU A O    5  
ATOM 7885  C CB   . GLU A 1 7   ? 12.087  13.681  -2.324  1.00 1.00 ? 7   GLU A CB   5  
ATOM 7886  C CG   . GLU A 1 7   ? 12.299  14.721  -3.431  1.00 1.00 ? 7   GLU A CG   5  
ATOM 7887  C CD   . GLU A 1 7   ? 13.574  15.541  -3.186  1.00 1.00 ? 7   GLU A CD   5  
ATOM 7888  O OE1  . GLU A 1 7   ? 13.530  16.525  -2.408  1.00 1.00 ? 7   GLU A OE1  5  
ATOM 7889  O OE2  . GLU A 1 7   ? 14.628  15.211  -3.783  1.00 1.00 ? 7   GLU A OE2  5  
ATOM 7890  H H    . GLU A 1 7   ? 11.249  11.036  -1.391  1.00 1.00 ? 7   GLU A H    5  
ATOM 7891  H HA   . GLU A 1 7   ? 9.998   13.368  -2.705  1.00 1.00 ? 7   GLU A HA   5  
ATOM 7892  H HB2  . GLU A 1 7   ? 11.923  14.211  -1.386  1.00 1.00 ? 7   GLU A HB2  5  
ATOM 7893  H HB3  . GLU A 1 7   ? 12.991  13.080  -2.223  1.00 1.00 ? 7   GLU A HB3  5  
ATOM 7894  H HG2  . GLU A 1 7   ? 12.384  14.221  -4.394  1.00 1.00 ? 7   GLU A HG2  5  
ATOM 7895  H HG3  . GLU A 1 7   ? 11.434  15.381  -3.470  1.00 1.00 ? 7   GLU A HG3  5  
ATOM 7896  N N    . PRO A 1 8   ? 10.475  12.203  -4.987  1.00 1.00 ? 8   PRO A N    5  
ATOM 7897  C CA   . PRO A 1 8   ? 10.678  11.496  -6.244  1.00 1.00 ? 8   PRO A CA   5  
ATOM 7898  C C    . PRO A 1 8   ? 11.984  11.925  -6.922  1.00 1.00 ? 8   PRO A C    5  
ATOM 7899  O O    . PRO A 1 8   ? 12.360  13.098  -6.901  1.00 1.00 ? 8   PRO A O    5  
ATOM 7900  C CB   . PRO A 1 8   ? 9.456   11.838  -7.098  1.00 1.00 ? 8   PRO A CB   5  
ATOM 7901  C CG   . PRO A 1 8   ? 9.102   13.250  -6.641  1.00 1.00 ? 8   PRO A CG   5  
ATOM 7902  C CD   . PRO A 1 8   ? 9.453   13.229  -5.152  1.00 1.00 ? 8   PRO A CD   5  
ATOM 7903  H HA   . PRO A 1 8   ? 10.697  10.422  -6.084  1.00 1.00 ? 8   PRO A HA   5  
ATOM 7904  H HB2  . PRO A 1 8   ? 9.667   11.787  -8.163  1.00 1.00 ? 8   PRO A HB2  5  
ATOM 7905  H HB3  . PRO A 1 8   ? 8.635   11.163  -6.853  1.00 1.00 ? 8   PRO A HB3  5  
ATOM 7906  H HG2  . PRO A 1 8   ? 9.728   13.975  -7.167  1.00 1.00 ? 8   PRO A HG2  5  
ATOM 7907  H HG3  . PRO A 1 8   ? 8.049   13.467  -6.799  1.00 1.00 ? 8   PRO A HG3  5  
ATOM 7908  H HD2  . PRO A 1 8   ? 9.821   14.208  -4.841  1.00 1.00 ? 8   PRO A HD2  5  
ATOM 7909  H HD3  . PRO A 1 8   ? 8.571   12.950  -4.574  1.00 1.00 ? 8   PRO A HD3  5  
ATOM 7910  N N    . LYS A 1 9   ? 12.658  10.967  -7.557  1.00 1.00 ? 9   LYS A N    5  
ATOM 7911  C CA   . LYS A 1 9   ? 13.865  11.158  -8.375  1.00 1.00 ? 9   LYS A CA   5  
ATOM 7912  C C    . LYS A 1 9   ? 13.620  10.809  -9.856  1.00 1.00 ? 9   LYS A C    5  
ATOM 7913  O O    . LYS A 1 9   ? 12.644  10.116  -10.160 1.00 1.00 ? 9   LYS A O    5  
ATOM 7914  C CB   . LYS A 1 9   ? 15.001  10.299  -7.771  1.00 1.00 ? 9   LYS A CB   5  
ATOM 7915  C CG   . LYS A 1 9   ? 15.538  10.819  -6.428  1.00 1.00 ? 9   LYS A CG   5  
ATOM 7916  C CD   . LYS A 1 9   ? 15.932  12.305  -6.479  1.00 1.00 ? 9   LYS A CD   5  
ATOM 7917  C CE   . LYS A 1 9   ? 16.752  12.668  -5.229  1.00 1.00 ? 9   LYS A CE   5  
ATOM 7918  N NZ   . LYS A 1 9   ? 16.893  14.139  -5.042  1.00 1.00 ? 9   LYS A NZ   5  
ATOM 7919  H H    . LYS A 1 9   ? 12.313  10.011  -7.480  1.00 1.00 ? 9   LYS A H    5  
ATOM 7920  H HA   . LYS A 1 9   ? 14.143  12.213  -8.364  1.00 1.00 ? 9   LYS A HA   5  
ATOM 7921  H HB2  . LYS A 1 9   ? 14.642  9.276   -7.632  1.00 1.00 ? 9   LYS A HB2  5  
ATOM 7922  H HB3  . LYS A 1 9   ? 15.838  10.245  -8.467  1.00 1.00 ? 9   LYS A HB3  5  
ATOM 7923  H HG2  . LYS A 1 9   ? 14.781  10.677  -5.656  1.00 1.00 ? 9   LYS A HG2  5  
ATOM 7924  H HG3  . LYS A 1 9   ? 16.413  10.222  -6.159  1.00 1.00 ? 9   LYS A HG3  5  
ATOM 7925  H HD2  . LYS A 1 9   ? 16.505  12.498  -7.391  1.00 1.00 ? 9   LYS A HD2  5  
ATOM 7926  H HD3  . LYS A 1 9   ? 15.025  12.911  -6.516  1.00 1.00 ? 9   LYS A HD3  5  
ATOM 7927  H HE2  . LYS A 1 9   ? 16.264  12.241  -4.348  1.00 1.00 ? 9   LYS A HE2  5  
ATOM 7928  H HE3  . LYS A 1 9   ? 17.739  12.201  -5.314  1.00 1.00 ? 9   LYS A HE3  5  
ATOM 7929  H HZ1  . LYS A 1 9   ? 17.216  14.602  -5.883  1.00 1.00 ? 9   LYS A HZ1  5  
ATOM 7930  H HZ2  . LYS A 1 9   ? 16.003  14.552  -4.757  1.00 1.00 ? 9   LYS A HZ2  5  
ATOM 7931  H HZ3  . LYS A 1 9   ? 17.552  14.346  -4.303  1.00 1.00 ? 9   LYS A HZ3  5  
ATOM 7932  N N    . PRO A 1 10  ? 14.462  11.299  -10.794 1.00 1.00 ? 10  PRO A N    5  
ATOM 7933  C CA   . PRO A 1 10  ? 14.270  11.027  -12.211 1.00 1.00 ? 10  PRO A CA   5  
ATOM 7934  C C    . PRO A 1 10  ? 14.233  9.512   -12.465 1.00 1.00 ? 10  PRO A C    5  
ATOM 7935  O O    . PRO A 1 10  ? 15.062  8.766   -11.949 1.00 1.00 ? 10  PRO A O    5  
ATOM 7936  C CB   . PRO A 1 10  ? 15.383  11.773  -12.957 1.00 1.00 ? 10  PRO A CB   5  
ATOM 7937  C CG   . PRO A 1 10  ? 16.443  12.034  -11.888 1.00 1.00 ? 10  PRO A CG   5  
ATOM 7938  C CD   . PRO A 1 10  ? 15.612  12.180  -10.615 1.00 1.00 ? 10  PRO A CD   5  
ATOM 7939  H HA   . PRO A 1 10  ? 13.322  11.460  -12.508 1.00 1.00 ? 10  PRO A HA   5  
ATOM 7940  H HB2  . PRO A 1 10  ? 15.784  11.202  -13.791 1.00 1.00 ? 10  PRO A HB2  5  
ATOM 7941  H HB3  . PRO A 1 10  ? 14.998  12.729  -13.318 1.00 1.00 ? 10  PRO A HB3  5  
ATOM 7942  H HG2  . PRO A 1 10  ? 17.100  11.165  -11.802 1.00 1.00 ? 10  PRO A HG2  5  
ATOM 7943  H HG3  . PRO A 1 10  ? 17.020  12.933  -12.099 1.00 1.00 ? 10  PRO A HG3  5  
ATOM 7944  H HD2  . PRO A 1 10  ? 16.223  11.914  -9.756  1.00 1.00 ? 10  PRO A HD2  5  
ATOM 7945  H HD3  . PRO A 1 10  ? 15.269  13.212  -10.524 1.00 1.00 ? 10  PRO A HD3  5  
ATOM 7946  N N    . GLY A 1 11  ? 13.215  9.069   -13.216 1.00 1.00 ? 11  GLY A N    5  
ATOM 7947  C CA   . GLY A 1 11  ? 12.954  7.659   -13.533 1.00 1.00 ? 11  GLY A CA   5  
ATOM 7948  C C    . GLY A 1 11  ? 12.029  6.950   -12.541 1.00 1.00 ? 11  GLY A C    5  
ATOM 7949  O O    . GLY A 1 11  ? 11.711  5.779   -12.755 1.00 1.00 ? 11  GLY A O    5  
ATOM 7950  H H    . GLY A 1 11  ? 12.527  9.747   -13.537 1.00 1.00 ? 11  GLY A H    5  
ATOM 7951  H HA2  . GLY A 1 11  ? 12.473  7.611   -14.509 1.00 1.00 ? 11  GLY A HA2  5  
ATOM 7952  H HA3  . GLY A 1 11  ? 13.895  7.107   -13.558 1.00 1.00 ? 11  GLY A HA3  5  
ATOM 7953  N N    . ASP A 1 12  ? 11.600  7.614   -11.464 1.00 1.00 ? 12  ASP A N    5  
ATOM 7954  C CA   . ASP A 1 12  ? 10.688  7.057   -10.465 1.00 1.00 ? 12  ASP A CA   5  
ATOM 7955  C C    . ASP A 1 12  ? 9.236   6.989   -10.953 1.00 1.00 ? 12  ASP A C    5  
ATOM 7956  O O    . ASP A 1 12  ? 8.768   7.831   -11.726 1.00 1.00 ? 12  ASP A O    5  
ATOM 7957  C CB   . ASP A 1 12  ? 10.734  7.844   -9.145  1.00 1.00 ? 12  ASP A CB   5  
ATOM 7958  C CG   . ASP A 1 12  ? 11.999  7.607   -8.298  1.00 1.00 ? 12  ASP A CG   5  
ATOM 7959  O OD1  . ASP A 1 12  ? 12.896  6.828   -8.699  1.00 1.00 ? 12  ASP A OD1  5  
ATOM 7960  O OD2  . ASP A 1 12  ? 12.048  8.164   -7.178  1.00 1.00 ? 12  ASP A OD2  5  
ATOM 7961  H H    . ASP A 1 12  ? 11.960  8.544   -11.291 1.00 1.00 ? 12  ASP A H    5  
ATOM 7962  H HA   . ASP A 1 12  ? 11.012  6.042   -10.253 1.00 1.00 ? 12  ASP A HA   5  
ATOM 7963  H HB2  . ASP A 1 12  ? 10.605  8.906   -9.348  1.00 1.00 ? 12  ASP A HB2  5  
ATOM 7964  H HB3  . ASP A 1 12  ? 9.882   7.537   -8.538  1.00 1.00 ? 12  ASP A HB3  5  
ATOM 7965  N N    . LEU A 1 13  ? 8.514   5.994   -10.436 1.00 1.00 ? 13  LEU A N    5  
ATOM 7966  C CA   . LEU A 1 13  ? 7.080   5.825   -10.630 1.00 1.00 ? 13  LEU A CA   5  
ATOM 7967  C C    . LEU A 1 13  ? 6.330   6.545   -9.514  1.00 1.00 ? 13  LEU A C    5  
ATOM 7968  O O    . LEU A 1 13  ? 6.545   6.260   -8.338  1.00 1.00 ? 13  LEU A O    5  
ATOM 7969  C CB   . LEU A 1 13  ? 6.741   4.319   -10.653 1.00 1.00 ? 13  LEU A CB   5  
ATOM 7970  C CG   . LEU A 1 13  ? 7.498   3.510   -11.722 1.00 1.00 ? 13  LEU A CG   5  
ATOM 7971  C CD1  . LEU A 1 13  ? 6.946   2.079   -11.782 1.00 1.00 ? 13  LEU A CD1  5  
ATOM 7972  C CD2  . LEU A 1 13  ? 7.375   4.177   -13.094 1.00 1.00 ? 13  LEU A CD2  5  
ATOM 7973  H H    . LEU A 1 13  ? 8.968   5.382   -9.765  1.00 1.00 ? 13  LEU A H    5  
ATOM 7974  H HA   . LEU A 1 13  ? 6.785   6.279   -11.578 1.00 1.00 ? 13  LEU A HA   5  
ATOM 7975  H HB2  . LEU A 1 13  ? 6.972   3.893   -9.676  1.00 1.00 ? 13  LEU A HB2  5  
ATOM 7976  H HB3  . LEU A 1 13  ? 5.667   4.211   -10.818 1.00 1.00 ? 13  LEU A HB3  5  
ATOM 7977  H HG   . LEU A 1 13  ? 8.553   3.454   -11.456 1.00 1.00 ? 13  LEU A HG   5  
ATOM 7978  H HD11 . LEU A 1 13  ? 7.505   1.494   -12.510 1.00 1.00 ? 13  LEU A HD11 5  
ATOM 7979  H HD12 . LEU A 1 13  ? 7.041   1.604   -10.805 1.00 1.00 ? 13  LEU A HD12 5  
ATOM 7980  H HD13 . LEU A 1 13  ? 5.892   2.091   -12.066 1.00 1.00 ? 13  LEU A HD13 5  
ATOM 7981  H HD21 . LEU A 1 13  ? 7.758   3.514   -13.868 1.00 1.00 ? 13  LEU A HD21 5  
ATOM 7982  H HD22 . LEU A 1 13  ? 6.334   4.427   -13.278 1.00 1.00 ? 13  LEU A HD22 5  
ATOM 7983  H HD23 . LEU A 1 13  ? 7.958   5.095   -13.106 1.00 1.00 ? 13  LEU A HD23 5  
ATOM 7984  N N    . ILE A 1 14  ? 5.422   7.450   -9.879  1.00 1.00 ? 14  ILE A N    5  
ATOM 7985  C CA   . ILE A 1 14  ? 4.530   8.139   -8.932  1.00 1.00 ? 14  ILE A CA   5  
ATOM 7986  C C    . ILE A 1 14  ? 3.143   7.511   -9.075  1.00 1.00 ? 14  ILE A C    5  
ATOM 7987  O O    . ILE A 1 14  ? 2.644   7.365   -10.190 1.00 1.00 ? 14  ILE A O    5  
ATOM 7988  C CB   . ILE A 1 14  ? 4.534   9.673   -9.157  1.00 1.00 ? 14  ILE A CB   5  
ATOM 7989  C CG1  . ILE A 1 14  ? 5.955   10.233  -8.884  1.00 1.00 ? 14  ILE A CG1  5  
ATOM 7990  C CG2  . ILE A 1 14  ? 3.490   10.355  -8.245  1.00 1.00 ? 14  ILE A CG2  5  
ATOM 7991  C CD1  . ILE A 1 14  ? 6.082   11.759  -8.977  1.00 1.00 ? 14  ILE A CD1  5  
ATOM 7992  H H    . ILE A 1 14  ? 5.222   7.543   -10.876 1.00 1.00 ? 14  ILE A H    5  
ATOM 7993  H HA   . ILE A 1 14  ? 4.868   7.954   -7.910  1.00 1.00 ? 14  ILE A HA   5  
ATOM 7994  H HB   . ILE A 1 14  ? 4.271   9.879   -10.195 1.00 1.00 ? 14  ILE A HB   5  
ATOM 7995  H HG12 . ILE A 1 14  ? 6.277   9.930   -7.887  1.00 1.00 ? 14  ILE A HG12 5  
ATOM 7996  H HG13 . ILE A 1 14  ? 6.649   9.803   -9.610  1.00 1.00 ? 14  ILE A HG13 5  
ATOM 7997  H HG21 . ILE A 1 14  ? 3.745   10.193  -7.196  1.00 1.00 ? 14  ILE A HG21 5  
ATOM 7998  H HG22 . ILE A 1 14  ? 3.447   11.426  -8.444  1.00 1.00 ? 14  ILE A HG22 5  
ATOM 7999  H HG23 . ILE A 1 14  ? 2.491   9.963   -8.433  1.00 1.00 ? 14  ILE A HG23 5  
ATOM 8000  H HD11 . ILE A 1 14  ? 7.131   12.037  -8.892  1.00 1.00 ? 14  ILE A HD11 5  
ATOM 8001  H HD12 . ILE A 1 14  ? 5.693   12.111  -9.934  1.00 1.00 ? 14  ILE A HD12 5  
ATOM 8002  H HD13 . ILE A 1 14  ? 5.536   12.237  -8.163  1.00 1.00 ? 14  ILE A HD13 5  
ATOM 8003  N N    . GLU A 1 15  ? 2.552   7.143   -7.947  1.00 1.00 ? 15  GLU A N    5  
ATOM 8004  C CA   . GLU A 1 15  ? 1.243   6.521   -7.796  1.00 1.00 ? 15  GLU A CA   5  
ATOM 8005  C C    . GLU A 1 15  ? 0.311   7.538   -7.137  1.00 1.00 ? 15  GLU A C    5  
ATOM 8006  O O    . GLU A 1 15  ? 0.665   8.148   -6.127  1.00 1.00 ? 15  GLU A O    5  
ATOM 8007  C CB   . GLU A 1 15  ? 1.438   5.263   -6.944  1.00 1.00 ? 15  GLU A CB   5  
ATOM 8008  C CG   . GLU A 1 15  ? 0.164   4.461   -6.681  1.00 1.00 ? 15  GLU A CG   5  
ATOM 8009  C CD   . GLU A 1 15  ? 0.564   3.051   -6.226  1.00 1.00 ? 15  GLU A CD   5  
ATOM 8010  O OE1  . GLU A 1 15  ? 0.969   2.236   -7.091  1.00 1.00 ? 15  GLU A OE1  5  
ATOM 8011  O OE2  . GLU A 1 15  ? 0.516   2.763   -5.006  1.00 1.00 ? 15  GLU A OE2  5  
ATOM 8012  H H    . GLU A 1 15  ? 3.032   7.358   -7.080  1.00 1.00 ? 15  GLU A H    5  
ATOM 8013  H HA   . GLU A 1 15  ? 0.847   6.238   -8.774  1.00 1.00 ? 15  GLU A HA   5  
ATOM 8014  H HB2  . GLU A 1 15  ? 2.150   4.624   -7.469  1.00 1.00 ? 15  GLU A HB2  5  
ATOM 8015  H HB3  . GLU A 1 15  ? 1.878   5.535   -5.982  1.00 1.00 ? 15  GLU A HB3  5  
ATOM 8016  H HG2  . GLU A 1 15  ? -0.433  4.962   -5.917  1.00 1.00 ? 15  GLU A HG2  5  
ATOM 8017  H HG3  . GLU A 1 15  ? -0.434  4.403   -7.589  1.00 1.00 ? 15  GLU A HG3  5  
ATOM 8018  N N    . ILE A 1 16  ? -0.863  7.747   -7.729  1.00 1.00 ? 16  ILE A N    5  
ATOM 8019  C CA   . ILE A 1 16  ? -1.798  8.828   -7.392  1.00 1.00 ? 16  ILE A CA   5  
ATOM 8020  C C    . ILE A 1 16  ? -3.176  8.231   -7.070  1.00 1.00 ? 16  ILE A C    5  
ATOM 8021  O O    . ILE A 1 16  ? -3.808  7.596   -7.914  1.00 1.00 ? 16  ILE A O    5  
ATOM 8022  C CB   . ILE A 1 16  ? -1.881  9.839   -8.567  1.00 1.00 ? 16  ILE A CB   5  
ATOM 8023  C CG1  . ILE A 1 16  ? -0.484  10.289  -9.082  1.00 1.00 ? 16  ILE A CG1  5  
ATOM 8024  C CG2  . ILE A 1 16  ? -2.710  11.068  -8.137  1.00 1.00 ? 16  ILE A CG2  5  
ATOM 8025  C CD1  . ILE A 1 16  ? -0.514  11.108  -10.376 1.00 1.00 ? 16  ILE A CD1  5  
ATOM 8026  H H    . ILE A 1 16  ? -1.075  7.206   -8.570  1.00 1.00 ? 16  ILE A H    5  
ATOM 8027  H HA   . ILE A 1 16  ? -1.436  9.356   -6.509  1.00 1.00 ? 16  ILE A HA   5  
ATOM 8028  H HB   . ILE A 1 16  ? -2.395  9.349   -9.392  1.00 1.00 ? 16  ILE A HB   5  
ATOM 8029  H HG12 . ILE A 1 16  ? 0.021   10.861  -8.305  1.00 1.00 ? 16  ILE A HG12 5  
ATOM 8030  H HG13 . ILE A 1 16  ? 0.132   9.417   -9.301  1.00 1.00 ? 16  ILE A HG13 5  
ATOM 8031  H HG21 . ILE A 1 16  ? -3.667  10.753  -7.720  1.00 1.00 ? 16  ILE A HG21 5  
ATOM 8032  H HG22 . ILE A 1 16  ? -2.175  11.643  -7.381  1.00 1.00 ? 16  ILE A HG22 5  
ATOM 8033  H HG23 . ILE A 1 16  ? -2.916  11.706  -8.995  1.00 1.00 ? 16  ILE A HG23 5  
ATOM 8034  H HD11 . ILE A 1 16  ? -1.027  10.544  -11.154 1.00 1.00 ? 16  ILE A HD11 5  
ATOM 8035  H HD12 . ILE A 1 16  ? -1.018  12.061  -10.219 1.00 1.00 ? 16  ILE A HD12 5  
ATOM 8036  H HD13 . ILE A 1 16  ? 0.510   11.302  -10.698 1.00 1.00 ? 16  ILE A HD13 5  
ATOM 8037  N N    . PHE A 1 17  ? -3.662  8.471   -5.856  1.00 1.00 ? 17  PHE A N    5  
ATOM 8038  C CA   . PHE A 1 17  ? -4.948  7.997   -5.351  1.00 1.00 ? 17  PHE A CA   5  
ATOM 8039  C C    . PHE A 1 17  ? -6.036  9.038   -5.650  1.00 1.00 ? 17  PHE A C    5  
ATOM 8040  O O    . PHE A 1 17  ? -6.457  9.798   -4.773  1.00 1.00 ? 17  PHE A O    5  
ATOM 8041  C CB   . PHE A 1 17  ? -4.812  7.660   -3.858  1.00 1.00 ? 17  PHE A CB   5  
ATOM 8042  C CG   . PHE A 1 17  ? -3.930  6.455   -3.588  1.00 1.00 ? 17  PHE A CG   5  
ATOM 8043  C CD1  . PHE A 1 17  ? -2.530  6.596   -3.514  1.00 1.00 ? 17  PHE A CD1  5  
ATOM 8044  C CD2  . PHE A 1 17  ? -4.510  5.179   -3.438  1.00 1.00 ? 17  PHE A CD2  5  
ATOM 8045  C CE1  . PHE A 1 17  ? -1.718  5.468   -3.307  1.00 1.00 ? 17  PHE A CE1  5  
ATOM 8046  C CE2  . PHE A 1 17  ? -3.697  4.054   -3.224  1.00 1.00 ? 17  PHE A CE2  5  
ATOM 8047  C CZ   . PHE A 1 17  ? -2.300  4.197   -3.161  1.00 1.00 ? 17  PHE A CZ   5  
ATOM 8048  H H    . PHE A 1 17  ? -3.131  9.092   -5.256  1.00 1.00 ? 17  PHE A H    5  
ATOM 8049  H HA   . PHE A 1 17  ? -5.222  7.081   -5.873  1.00 1.00 ? 17  PHE A HA   5  
ATOM 8050  H HB2  . PHE A 1 17  ? -4.409  8.521   -3.325  1.00 1.00 ? 17  PHE A HB2  5  
ATOM 8051  H HB3  . PHE A 1 17  ? -5.805  7.455   -3.447  1.00 1.00 ? 17  PHE A HB3  5  
ATOM 8052  H HD1  . PHE A 1 17  ? -2.077  7.572   -3.623  1.00 1.00 ? 17  PHE A HD1  5  
ATOM 8053  H HD2  . PHE A 1 17  ? -5.582  5.060   -3.500  1.00 1.00 ? 17  PHE A HD2  5  
ATOM 8054  H HE1  . PHE A 1 17  ? -0.646  5.574   -3.277  1.00 1.00 ? 17  PHE A HE1  5  
ATOM 8055  H HE2  . PHE A 1 17  ? -4.145  3.077   -3.114  1.00 1.00 ? 17  PHE A HE2  5  
ATOM 8056  H HZ   . PHE A 1 17  ? -1.676  3.331   -3.006  1.00 1.00 ? 17  PHE A HZ   5  
ATOM 8057  N N    . ARG A 1 18  ? -6.468  9.082   -6.916  1.00 1.00 ? 18  ARG A N    5  
ATOM 8058  C CA   . ARG A 1 18  ? -7.590  9.911   -7.378  1.00 1.00 ? 18  ARG A CA   5  
ATOM 8059  C C    . ARG A 1 18  ? -8.947  9.295   -6.984  1.00 1.00 ? 18  ARG A C    5  
ATOM 8060  O O    . ARG A 1 18  ? -9.021  8.129   -6.587  1.00 1.00 ? 18  ARG A O    5  
ATOM 8061  C CB   . ARG A 1 18  ? -7.538  10.101  -8.912  1.00 1.00 ? 18  ARG A CB   5  
ATOM 8062  C CG   . ARG A 1 18  ? -6.167  10.541  -9.464  1.00 1.00 ? 18  ARG A CG   5  
ATOM 8063  C CD   . ARG A 1 18  ? -6.249  11.040  -10.913 1.00 1.00 ? 18  ARG A CD   5  
ATOM 8064  N NE   . ARG A 1 18  ? -6.958  12.333  -10.995 1.00 1.00 ? 18  ARG A NE   5  
ATOM 8065  C CZ   . ARG A 1 18  ? -8.144  12.583  -11.544 1.00 1.00 ? 18  ARG A CZ   5  
ATOM 8066  N NH1  . ARG A 1 18  ? -8.871  11.650  -12.126 1.00 1.00 ? 18  ARG A NH1  5  
ATOM 8067  N NH2  . ARG A 1 18  ? -8.625  13.806  -11.513 1.00 1.00 ? 18  ARG A NH2  5  
ATOM 8068  H H    . ARG A 1 18  ? -6.041  8.447   -7.578  1.00 1.00 ? 18  ARG A H    5  
ATOM 8069  H HA   . ARG A 1 18  ? -7.513  10.890  -6.895  1.00 1.00 ? 18  ARG A HA   5  
ATOM 8070  H HB2  . ARG A 1 18  ? -7.813  9.164   -9.400  1.00 1.00 ? 18  ARG A HB2  5  
ATOM 8071  H HB3  . ARG A 1 18  ? -8.284  10.848  -9.177  1.00 1.00 ? 18  ARG A HB3  5  
ATOM 8072  H HG2  . ARG A 1 18  ? -5.757  11.333  -8.845  1.00 1.00 ? 18  ARG A HG2  5  
ATOM 8073  H HG3  . ARG A 1 18  ? -5.482  9.693   -9.430  1.00 1.00 ? 18  ARG A HG3  5  
ATOM 8074  H HD2  . ARG A 1 18  ? -5.236  11.183  -11.293 1.00 1.00 ? 18  ARG A HD2  5  
ATOM 8075  H HD3  . ARG A 1 18  ? -6.726  10.281  -11.535 1.00 1.00 ? 18  ARG A HD3  5  
ATOM 8076  H HE   . ARG A 1 18  ? -6.473  13.123  -10.589 1.00 1.00 ? 18  ARG A HE   5  
ATOM 8077  H HH11 . ARG A 1 18  ? -8.538  10.702  -12.190 1.00 1.00 ? 18  ARG A HH11 5  
ATOM 8078  H HH12 . ARG A 1 18  ? -9.769  11.878  -12.527 1.00 1.00 ? 18  ARG A HH12 5  
ATOM 8079  H HH21 . ARG A 1 18  ? -8.106  14.554  -11.079 1.00 1.00 ? 18  ARG A HH21 5  
ATOM 8080  H HH22 . ARG A 1 18  ? -9.521  14.019  -11.928 1.00 1.00 ? 18  ARG A HH22 5  
ATOM 8081  N N    . LEU A 1 19  ? -10.035 10.065  -7.134  1.00 1.00 ? 19  LEU A N    5  
ATOM 8082  C CA   . LEU A 1 19  ? -11.411 9.570   -7.013  1.00 1.00 ? 19  LEU A CA   5  
ATOM 8083  C C    . LEU A 1 19  ? -11.685 8.492   -8.081  1.00 1.00 ? 19  LEU A C    5  
ATOM 8084  O O    . LEU A 1 19  ? -11.342 8.678   -9.252  1.00 1.00 ? 19  LEU A O    5  
ATOM 8085  C CB   . LEU A 1 19  ? -12.379 10.769  -7.116  1.00 1.00 ? 19  LEU A CB   5  
ATOM 8086  C CG   . LEU A 1 19  ? -13.875 10.421  -6.972  1.00 1.00 ? 19  LEU A CG   5  
ATOM 8087  C CD1  . LEU A 1 19  ? -14.199 9.817   -5.594  1.00 1.00 ? 19  LEU A CD1  5  
ATOM 8088  C CD2  . LEU A 1 19  ? -14.710 11.691  -7.180  1.00 1.00 ? 19  LEU A CD2  5  
ATOM 8089  H H    . LEU A 1 19  ? -9.907  11.023  -7.422  1.00 1.00 ? 19  LEU A H    5  
ATOM 8090  H HA   . LEU A 1 19  ? -11.507 9.119   -6.024  1.00 1.00 ? 19  LEU A HA   5  
ATOM 8091  H HB2  . LEU A 1 19  ? -12.117 11.496  -6.343  1.00 1.00 ? 19  LEU A HB2  5  
ATOM 8092  H HB3  . LEU A 1 19  ? -12.229 11.245  -8.088  1.00 1.00 ? 19  LEU A HB3  5  
ATOM 8093  H HG   . LEU A 1 19  ? -14.155 9.704   -7.744  1.00 1.00 ? 19  LEU A HG   5  
ATOM 8094  H HD11 . LEU A 1 19  ? -15.272 9.647   -5.507  1.00 1.00 ? 19  LEU A HD11 5  
ATOM 8095  H HD12 . LEU A 1 19  ? -13.691 8.863   -5.470  1.00 1.00 ? 19  LEU A HD12 5  
ATOM 8096  H HD13 . LEU A 1 19  ? -13.883 10.498  -4.801  1.00 1.00 ? 19  LEU A HD13 5  
ATOM 8097  H HD21 . LEU A 1 19  ? -14.471 12.431  -6.415  1.00 1.00 ? 19  LEU A HD21 5  
ATOM 8098  H HD22 . LEU A 1 19  ? -14.503 12.113  -8.163  1.00 1.00 ? 19  LEU A HD22 5  
ATOM 8099  H HD23 . LEU A 1 19  ? -15.771 11.450  -7.118  1.00 1.00 ? 19  LEU A HD23 5  
ATOM 8100  N N    . GLY A 1 20  ? -12.291 7.364   -7.683  1.00 1.00 ? 20  GLY A N    5  
ATOM 8101  C CA   . GLY A 1 20  ? -12.441 6.173   -8.526  1.00 1.00 ? 20  GLY A CA   5  
ATOM 8102  C C    . GLY A 1 20  ? -11.153 5.348   -8.526  1.00 1.00 ? 20  GLY A C    5  
ATOM 8103  O O    . GLY A 1 20  ? -10.583 5.077   -7.467  1.00 1.00 ? 20  GLY A O    5  
ATOM 8104  H H    . GLY A 1 20  ? -12.523 7.259   -6.709  1.00 1.00 ? 20  GLY A H    5  
ATOM 8105  H HA2  . GLY A 1 20  ? -13.242 5.541   -8.144  1.00 1.00 ? 20  GLY A HA2  5  
ATOM 8106  H HA3  . GLY A 1 20  ? -12.675 6.466   -9.551  1.00 1.00 ? 20  GLY A HA3  5  
ATOM 8107  N N    . TYR A 1 21  ? -10.692 4.945   -9.711  1.00 1.00 ? 21  TYR A N    5  
ATOM 8108  C CA   . TYR A 1 21  ? -9.401  4.273   -9.893  1.00 1.00 ? 21  TYR A CA   5  
ATOM 8109  C C    . TYR A 1 21  ? -8.197  5.191   -9.591  1.00 1.00 ? 21  TYR A C    5  
ATOM 8110  O O    . TYR A 1 21  ? -8.245  6.409   -9.791  1.00 1.00 ? 21  TYR A O    5  
ATOM 8111  C CB   . TYR A 1 21  ? -9.265  3.740   -11.327 1.00 1.00 ? 21  TYR A CB   5  
ATOM 8112  C CG   . TYR A 1 21  ? -10.306 2.734   -11.788 1.00 1.00 ? 21  TYR A CG   5  
ATOM 8113  C CD1  . TYR A 1 21  ? -10.483 1.528   -11.084 1.00 1.00 ? 21  TYR A CD1  5  
ATOM 8114  C CD2  . TYR A 1 21  ? -11.051 2.975   -12.961 1.00 1.00 ? 21  TYR A CD2  5  
ATOM 8115  C CE1  . TYR A 1 21  ? -11.417 0.574   -11.532 1.00 1.00 ? 21  TYR A CE1  5  
ATOM 8116  C CE2  . TYR A 1 21  ? -11.985 2.025   -13.416 1.00 1.00 ? 21  TYR A CE2  5  
ATOM 8117  C CZ   . TYR A 1 21  ? -12.177 0.822   -12.699 1.00 1.00 ? 21  TYR A CZ   5  
ATOM 8118  O OH   . TYR A 1 21  ? -13.085 -0.094  -13.143 1.00 1.00 ? 21  TYR A OH   5  
ATOM 8119  H H    . TYR A 1 21  ? -11.219 5.190   -10.533 1.00 1.00 ? 21  TYR A H    5  
ATOM 8120  H HA   . TYR A 1 21  ? -9.363  3.427   -9.211  1.00 1.00 ? 21  TYR A HA   5  
ATOM 8121  H HB2  . TYR A 1 21  ? -9.267  4.593   -12.008 1.00 1.00 ? 21  TYR A HB2  5  
ATOM 8122  H HB3  . TYR A 1 21  ? -8.291  3.259   -11.417 1.00 1.00 ? 21  TYR A HB3  5  
ATOM 8123  H HD1  . TYR A 1 21  ? -9.899  1.327   -10.197 1.00 1.00 ? 21  TYR A HD1  5  
ATOM 8124  H HD2  . TYR A 1 21  ? -10.910 3.892   -13.519 1.00 1.00 ? 21  TYR A HD2  5  
ATOM 8125  H HE1  . TYR A 1 21  ? -11.548 -0.349  -10.982 1.00 1.00 ? 21  TYR A HE1  5  
ATOM 8126  H HE2  . TYR A 1 21  ? -12.559 2.214   -14.311 1.00 1.00 ? 21  TYR A HE2  5  
ATOM 8127  H HH   . TYR A 1 21  ? -13.143 -0.879  -12.577 1.00 1.00 ? 21  TYR A HH   5  
ATOM 8128  N N    . GLU A 1 22  ? -7.094  4.586   -9.153  1.00 1.00 ? 22  GLU A N    5  
ATOM 8129  C CA   . GLU A 1 22  ? -5.783  5.225   -9.017  1.00 1.00 ? 22  GLU A CA   5  
ATOM 8130  C C    . GLU A 1 22  ? -5.200  5.597   -10.402 1.00 1.00 ? 22  GLU A C    5  
ATOM 8131  O O    . GLU A 1 22  ? -5.670  5.128   -11.442 1.00 1.00 ? 22  GLU A O    5  
ATOM 8132  C CB   . GLU A 1 22  ? -4.816  4.290   -8.268  1.00 1.00 ? 22  GLU A CB   5  
ATOM 8133  C CG   . GLU A 1 22  ? -5.221  3.944   -6.824  1.00 1.00 ? 22  GLU A CG   5  
ATOM 8134  C CD   . GLU A 1 22  ? -6.449  3.018   -6.688  1.00 1.00 ? 22  GLU A CD   5  
ATOM 8135  O OE1  . GLU A 1 22  ? -6.774  2.252   -7.630  1.00 1.00 ? 22  GLU A OE1  5  
ATOM 8136  O OE2  . GLU A 1 22  ? -7.109  3.055   -5.624  1.00 1.00 ? 22  GLU A OE2  5  
ATOM 8137  H H    . GLU A 1 22  ? -7.138  3.599   -8.921  1.00 1.00 ? 22  GLU A H    5  
ATOM 8138  H HA   . GLU A 1 22  ? -5.890  6.141   -8.437  1.00 1.00 ? 22  GLU A HA   5  
ATOM 8139  H HB2  . GLU A 1 22  ? -4.690  3.370   -8.840  1.00 1.00 ? 22  GLU A HB2  5  
ATOM 8140  H HB3  . GLU A 1 22  ? -3.841  4.776   -8.221  1.00 1.00 ? 22  GLU A HB3  5  
ATOM 8141  H HG2  . GLU A 1 22  ? -4.373  3.452   -6.346  1.00 1.00 ? 22  GLU A HG2  5  
ATOM 8142  H HG3  . GLU A 1 22  ? -5.408  4.874   -6.288  1.00 1.00 ? 22  GLU A HG3  5  
ATOM 8143  N N    . HIS A 1 23  ? -4.161  6.431   -10.431 1.00 1.00 ? 23  HIS A N    5  
ATOM 8144  C CA   . HIS A 1 23  ? -3.452  6.847   -11.646 1.00 1.00 ? 23  HIS A CA   5  
ATOM 8145  C C    . HIS A 1 23  ? -1.924  6.873   -11.422 1.00 1.00 ? 23  HIS A C    5  
ATOM 8146  O O    . HIS A 1 23  ? -1.469  6.866   -10.280 1.00 1.00 ? 23  HIS A O    5  
ATOM 8147  C CB   . HIS A 1 23  ? -4.015  8.214   -12.081 1.00 1.00 ? 23  HIS A CB   5  
ATOM 8148  C CG   . HIS A 1 23  ? -3.710  8.572   -13.514 1.00 1.00 ? 23  HIS A CG   5  
ATOM 8149  N ND1  . HIS A 1 23  ? -2.820  9.525   -13.961 1.00 1.00 ? 23  HIS A ND1  5  
ATOM 8150  C CD2  . HIS A 1 23  ? -4.315  8.035   -14.618 1.00 1.00 ? 23  HIS A CD2  5  
ATOM 8151  C CE1  . HIS A 1 23  ? -2.890  9.554   -15.301 1.00 1.00 ? 23  HIS A CE1  5  
ATOM 8152  N NE2  . HIS A 1 23  ? -3.786  8.661   -15.748 1.00 1.00 ? 23  HIS A NE2  5  
ATOM 8153  H H    . HIS A 1 23  ? -3.792  6.767   -9.541  1.00 1.00 ? 23  HIS A H    5  
ATOM 8154  H HA   . HIS A 1 23  ? -3.652  6.122   -12.436 1.00 1.00 ? 23  HIS A HA   5  
ATOM 8155  H HB2  . HIS A 1 23  ? -5.103  8.192   -11.981 1.00 1.00 ? 23  HIS A HB2  5  
ATOM 8156  H HB3  . HIS A 1 23  ? -3.642  8.995   -11.418 1.00 1.00 ? 23  HIS A HB3  5  
ATOM 8157  H HD1  . HIS A 1 23  ? -2.248  10.132  -13.394 1.00 1.00 ? 23  HIS A HD1  5  
ATOM 8158  H HD2  . HIS A 1 23  ? -5.088  7.277   -14.613 1.00 1.00 ? 23  HIS A HD2  5  
ATOM 8159  H HE1  . HIS A 1 23  ? -2.316  10.218  -15.936 1.00 1.00 ? 23  HIS A HE1  5  
ATOM 8160  N N    . TRP A 1 24  ? -1.118  6.911   -12.491 1.00 1.00 ? 24  TRP A N    5  
ATOM 8161  C CA   . TRP A 1 24  ? 0.347   6.771   -12.412 1.00 1.00 ? 24  TRP A CA   5  
ATOM 8162  C C    . TRP A 1 24  ? 1.099   7.688   -13.391 1.00 1.00 ? 24  TRP A C    5  
ATOM 8163  O O    . TRP A 1 24  ? 0.579   8.035   -14.452 1.00 1.00 ? 24  TRP A O    5  
ATOM 8164  C CB   . TRP A 1 24  ? 0.733   5.297   -12.647 1.00 1.00 ? 24  TRP A CB   5  
ATOM 8165  C CG   . TRP A 1 24  ? 0.304   4.323   -11.588 1.00 1.00 ? 24  TRP A CG   5  
ATOM 8166  C CD1  . TRP A 1 24  ? 1.062   3.929   -10.541 1.00 1.00 ? 24  TRP A CD1  5  
ATOM 8167  C CD2  . TRP A 1 24  ? -0.969  3.618   -11.441 1.00 1.00 ? 24  TRP A CD2  5  
ATOM 8168  N NE1  . TRP A 1 24  ? 0.358   3.031   -9.765  1.00 1.00 ? 24  TRP A NE1  5  
ATOM 8169  C CE2  . TRP A 1 24  ? -0.900  2.802   -10.272 1.00 1.00 ? 24  TRP A CE2  5  
ATOM 8170  C CE3  . TRP A 1 24  ? -2.175  3.581   -12.176 1.00 1.00 ? 24  TRP A CE3  5  
ATOM 8171  C CZ2  . TRP A 1 24  ? -1.965  1.994   -9.852  1.00 1.00 ? 24  TRP A CZ2  5  
ATOM 8172  C CZ3  . TRP A 1 24  ? -3.254  2.779   -11.758 1.00 1.00 ? 24  TRP A CZ3  5  
ATOM 8173  C CH2  . TRP A 1 24  ? -3.149  1.973   -10.608 1.00 1.00 ? 24  TRP A CH2  5  
ATOM 8174  H H    . TRP A 1 24  ? -1.528  7.003   -13.411 1.00 1.00 ? 24  TRP A H    5  
ATOM 8175  H HA   . TRP A 1 24  ? 0.682   7.042   -11.410 1.00 1.00 ? 24  TRP A HA   5  
ATOM 8176  H HB2  . TRP A 1 24  ? 0.335   4.972   -13.607 1.00 1.00 ? 24  TRP A HB2  5  
ATOM 8177  H HB3  . TRP A 1 24  ? 1.816   5.237   -12.711 1.00 1.00 ? 24  TRP A HB3  5  
ATOM 8178  H HD1  . TRP A 1 24  ? 2.066   4.280   -10.341 1.00 1.00 ? 24  TRP A HD1  5  
ATOM 8179  H HE1  . TRP A 1 24  ? 0.706   2.647   -8.880  1.00 1.00 ? 24  TRP A HE1  5  
ATOM 8180  H HE3  . TRP A 1 24  ? -2.273  4.181   -13.065 1.00 1.00 ? 24  TRP A HE3  5  
ATOM 8181  H HZ2  . TRP A 1 24  ? -1.871  1.389   -8.963  1.00 1.00 ? 24  TRP A HZ2  5  
ATOM 8182  H HZ3  . TRP A 1 24  ? -4.177  2.787   -12.319 1.00 1.00 ? 24  TRP A HZ3  5  
ATOM 8183  H HH2  . TRP A 1 24  ? -3.981  1.360   -10.297 1.00 1.00 ? 24  TRP A HH2  5  
ATOM 8184  N N    . ALA A 1 25  ? 2.344   8.040   -13.046 1.00 1.00 ? 25  ALA A N    5  
ATOM 8185  C CA   . ALA A 1 25  ? 3.226   8.899   -13.851 1.00 1.00 ? 25  ALA A CA   5  
ATOM 8186  C C    . ALA A 1 25  ? 4.721   8.550   -13.672 1.00 1.00 ? 25  ALA A C    5  
ATOM 8187  O O    . ALA A 1 25  ? 5.115   8.018   -12.637 1.00 1.00 ? 25  ALA A O    5  
ATOM 8188  C CB   . ALA A 1 25  ? 2.935   10.361  -13.471 1.00 1.00 ? 25  ALA A CB   5  
ATOM 8189  H H    . ALA A 1 25  ? 2.688   7.729   -12.141 1.00 1.00 ? 25  ALA A H    5  
ATOM 8190  H HA   . ALA A 1 25  ? 2.985   8.770   -14.908 1.00 1.00 ? 25  ALA A HA   5  
ATOM 8191  H HB1  . ALA A 1 25  ? 3.496   11.024  -14.128 1.00 1.00 ? 25  ALA A HB1  5  
ATOM 8192  H HB2  . ALA A 1 25  ? 1.871   10.577  -13.592 1.00 1.00 ? 25  ALA A HB2  5  
ATOM 8193  H HB3  . ALA A 1 25  ? 3.214   10.551  -12.434 1.00 1.00 ? 25  ALA A HB3  5  
ATOM 8194  N N    . LEU A 1 26  ? 5.547   8.867   -14.675 1.00 1.00 ? 26  LEU A N    5  
ATOM 8195  C CA   . LEU A 1 26  ? 7.016   8.787   -14.659 1.00 1.00 ? 26  LEU A CA   5  
ATOM 8196  C C    . LEU A 1 26  ? 7.576   10.187  -14.361 1.00 1.00 ? 26  LEU A C    5  
ATOM 8197  O O    . LEU A 1 26  ? 7.341   11.117  -15.133 1.00 1.00 ? 26  LEU A O    5  
ATOM 8198  C CB   . LEU A 1 26  ? 7.472   8.242   -16.041 1.00 1.00 ? 26  LEU A CB   5  
ATOM 8199  C CG   . LEU A 1 26  ? 8.914   7.709   -16.200 1.00 1.00 ? 26  LEU A CG   5  
ATOM 8200  C CD1  . LEU A 1 26  ? 9.989   8.773   -15.946 1.00 1.00 ? 26  LEU A CD1  5  
ATOM 8201  C CD2  . LEU A 1 26  ? 9.165   6.476   -15.324 1.00 1.00 ? 26  LEU A CD2  5  
ATOM 8202  H H    . LEU A 1 26  ? 5.133   9.285   -15.505 1.00 1.00 ? 26  LEU A H    5  
ATOM 8203  H HA   . LEU A 1 26  ? 7.339   8.102   -13.869 1.00 1.00 ? 26  LEU A HA   5  
ATOM 8204  H HB2  . LEU A 1 26  ? 6.809   7.417   -16.305 1.00 1.00 ? 26  LEU A HB2  5  
ATOM 8205  H HB3  . LEU A 1 26  ? 7.324   9.011   -16.806 1.00 1.00 ? 26  LEU A HB3  5  
ATOM 8206  H HG   . LEU A 1 26  ? 9.020   7.397   -17.241 1.00 1.00 ? 26  LEU A HG   5  
ATOM 8207  H HD11 . LEU A 1 26  ? 10.954  8.415   -16.310 1.00 1.00 ? 26  LEU A HD11 5  
ATOM 8208  H HD12 . LEU A 1 26  ? 9.735   9.688   -16.475 1.00 1.00 ? 26  LEU A HD12 5  
ATOM 8209  H HD13 . LEU A 1 26  ? 10.076  8.969   -14.879 1.00 1.00 ? 26  LEU A HD13 5  
ATOM 8210  H HD21 . LEU A 1 26  ? 10.138  6.048   -15.564 1.00 1.00 ? 26  LEU A HD21 5  
ATOM 8211  H HD22 . LEU A 1 26  ? 9.152   6.750   -14.270 1.00 1.00 ? 26  LEU A HD22 5  
ATOM 8212  H HD23 . LEU A 1 26  ? 8.401   5.723   -15.513 1.00 1.00 ? 26  LEU A HD23 5  
ATOM 8213  N N    . TYR A 1 27  ? 8.313   10.369  -13.265 1.00 1.00 ? 27  TYR A N    5  
ATOM 8214  C CA   . TYR A 1 27  ? 8.923   11.667  -12.927 1.00 1.00 ? 27  TYR A CA   5  
ATOM 8215  C C    . TYR A 1 27  ? 10.243  11.899  -13.676 1.00 1.00 ? 27  TYR A C    5  
ATOM 8216  O O    . TYR A 1 27  ? 11.126  11.045  -13.663 1.00 1.00 ? 27  TYR A O    5  
ATOM 8217  C CB   . TYR A 1 27  ? 9.110   11.769  -11.405 1.00 1.00 ? 27  TYR A CB   5  
ATOM 8218  C CG   . TYR A 1 27  ? 9.642   13.111  -10.929 1.00 1.00 ? 27  TYR A CG   5  
ATOM 8219  C CD1  . TYR A 1 27  ? 8.955   14.302  -11.239 1.00 1.00 ? 27  TYR A CD1  5  
ATOM 8220  C CD2  . TYR A 1 27  ? 10.833  13.184  -10.188 1.00 1.00 ? 27  TYR A CD2  5  
ATOM 8221  C CE1  . TYR A 1 27  ? 9.458   15.548  -10.829 1.00 1.00 ? 27  TYR A CE1  5  
ATOM 8222  C CE2  . TYR A 1 27  ? 11.338  14.427  -9.759  1.00 1.00 ? 27  TYR A CE2  5  
ATOM 8223  C CZ   . TYR A 1 27  ? 10.653  15.617  -10.082 1.00 1.00 ? 27  TYR A CZ   5  
ATOM 8224  O OH   . TYR A 1 27  ? 11.131  16.827  -9.679  1.00 1.00 ? 27  TYR A OH   5  
ATOM 8225  H H    . TYR A 1 27  ? 8.488   9.576   -12.653 1.00 1.00 ? 27  TYR A H    5  
ATOM 8226  H HA   . TYR A 1 27  ? 8.235   12.452  -13.233 1.00 1.00 ? 27  TYR A HA   5  
ATOM 8227  H HB2  . TYR A 1 27  ? 8.145   11.602  -10.931 1.00 1.00 ? 27  TYR A HB2  5  
ATOM 8228  H HB3  . TYR A 1 27  ? 9.783   10.974  -11.075 1.00 1.00 ? 27  TYR A HB3  5  
ATOM 8229  H HD1  . TYR A 1 27  ? 8.030   14.269  -11.790 1.00 1.00 ? 27  TYR A HD1  5  
ATOM 8230  H HD2  . TYR A 1 27  ? 11.351  12.277  -9.923  1.00 1.00 ? 27  TYR A HD2  5  
ATOM 8231  H HE1  . TYR A 1 27  ? 8.923   16.452  -11.069 1.00 1.00 ? 27  TYR A HE1  5  
ATOM 8232  H HE2  . TYR A 1 27  ? 12.246  14.468  -9.174  1.00 1.00 ? 27  TYR A HE2  5  
ATOM 8233  H HH   . TYR A 1 27  ? 11.937  16.763  -9.141  1.00 1.00 ? 27  TYR A HH   5  
ATOM 8234  N N    . ILE A 1 28  ? 10.409  13.067  -14.315 1.00 1.00 ? 28  ILE A N    5  
ATOM 8235  C CA   . ILE A 1 28  ? 11.591  13.353  -15.168 1.00 1.00 ? 28  ILE A CA   5  
ATOM 8236  C C    . ILE A 1 28  ? 12.634  14.291  -14.527 1.00 1.00 ? 28  ILE A C    5  
ATOM 8237  O O    . ILE A 1 28  ? 13.605  14.663  -15.184 1.00 1.00 ? 28  ILE A O    5  
ATOM 8238  C CB   . ILE A 1 28  ? 11.166  13.747  -16.606 1.00 1.00 ? 28  ILE A CB   5  
ATOM 8239  C CG1  . ILE A 1 28  ? 10.327  15.040  -16.672 1.00 1.00 ? 28  ILE A CG1  5  
ATOM 8240  C CG2  . ILE A 1 28  ? 10.409  12.574  -17.266 1.00 1.00 ? 28  ILE A CG2  5  
ATOM 8241  C CD1  . ILE A 1 28  ? 10.127  15.557  -18.103 1.00 1.00 ? 28  ILE A CD1  5  
ATOM 8242  H H    . ILE A 1 28  ? 9.663   13.764  -14.260 1.00 1.00 ? 28  ILE A H    5  
ATOM 8243  H HA   . ILE A 1 28  ? 12.158  12.428  -15.286 1.00 1.00 ? 28  ILE A HA   5  
ATOM 8244  H HB   . ILE A 1 28  ? 12.077  13.907  -17.190 1.00 1.00 ? 28  ILE A HB   5  
ATOM 8245  H HG12 . ILE A 1 28  ? 9.343   14.849  -16.253 1.00 1.00 ? 28  ILE A HG12 5  
ATOM 8246  H HG13 . ILE A 1 28  ? 10.813  15.823  -16.091 1.00 1.00 ? 28  ILE A HG13 5  
ATOM 8247  H HG21 . ILE A 1 28  ? 10.959  11.645  -17.125 1.00 1.00 ? 28  ILE A HG21 5  
ATOM 8248  H HG22 . ILE A 1 28  ? 9.404   12.461  -16.848 1.00 1.00 ? 28  ILE A HG22 5  
ATOM 8249  H HG23 . ILE A 1 28  ? 10.323  12.746  -18.336 1.00 1.00 ? 28  ILE A HG23 5  
ATOM 8250  H HD11 . ILE A 1 28  ? 9.634   16.528  -18.068 1.00 1.00 ? 28  ILE A HD11 5  
ATOM 8251  H HD12 . ILE A 1 28  ? 11.090  15.664  -18.602 1.00 1.00 ? 28  ILE A HD12 5  
ATOM 8252  H HD13 . ILE A 1 28  ? 9.493   14.874  -18.667 1.00 1.00 ? 28  ILE A HD13 5  
ATOM 8253  N N    . GLY A 1 29  ? 12.468  14.658  -13.246 1.00 1.00 ? 29  GLY A N    5  
ATOM 8254  C CA   . GLY A 1 29  ? 13.479  15.359  -12.426 1.00 1.00 ? 29  GLY A CA   5  
ATOM 8255  C C    . GLY A 1 29  ? 13.431  16.893  -12.437 1.00 1.00 ? 29  GLY A C    5  
ATOM 8256  O O    . GLY A 1 29  ? 14.002  17.520  -11.547 1.00 1.00 ? 29  GLY A O    5  
ATOM 8257  H H    . GLY A 1 29  ? 11.630  14.345  -12.771 1.00 1.00 ? 29  GLY A H    5  
ATOM 8258  H HA2  . GLY A 1 29  ? 13.373  15.044  -11.390 1.00 1.00 ? 29  GLY A HA2  5  
ATOM 8259  H HA3  . GLY A 1 29  ? 14.478  15.080  -12.771 1.00 1.00 ? 29  GLY A HA3  5  
ATOM 8260  N N    . ASP A 1 30  ? 12.752  17.501  -13.412 1.00 1.00 ? 30  ASP A N    5  
ATOM 8261  C CA   . ASP A 1 30  ? 12.714  18.961  -13.629 1.00 1.00 ? 30  ASP A CA   5  
ATOM 8262  C C    . ASP A 1 30  ? 11.479  19.649  -12.994 1.00 1.00 ? 30  ASP A C    5  
ATOM 8263  O O    . ASP A 1 30  ? 11.149  20.788  -13.329 1.00 1.00 ? 30  ASP A O    5  
ATOM 8264  C CB   . ASP A 1 30  ? 12.790  19.206  -15.149 1.00 1.00 ? 30  ASP A CB   5  
ATOM 8265  C CG   . ASP A 1 30  ? 13.120  20.666  -15.517 1.00 1.00 ? 30  ASP A CG   5  
ATOM 8266  O OD1  . ASP A 1 30  ? 14.098  21.230  -14.967 1.00 1.00 ? 30  ASP A OD1  5  
ATOM 8267  O OD2  . ASP A 1 30  ? 12.430  21.231  -16.400 1.00 1.00 ? 30  ASP A OD2  5  
ATOM 8268  H H    . ASP A 1 30  ? 12.360  16.910  -14.130 1.00 1.00 ? 30  ASP A H    5  
ATOM 8269  H HA   . ASP A 1 30  ? 13.600  19.406  -13.175 1.00 1.00 ? 30  ASP A HA   5  
ATOM 8270  H HB2  . ASP A 1 30  ? 13.575  18.574  -15.569 1.00 1.00 ? 30  ASP A HB2  5  
ATOM 8271  H HB3  . ASP A 1 30  ? 11.841  18.905  -15.601 1.00 1.00 ? 30  ASP A HB3  5  
ATOM 8272  N N    . GLY A 1 31  ? 10.759  18.942  -12.110 1.00 1.00 ? 31  GLY A N    5  
ATOM 8273  C CA   . GLY A 1 31  ? 9.445   19.340  -11.576 1.00 1.00 ? 31  GLY A CA   5  
ATOM 8274  C C    . GLY A 1 31  ? 8.287   18.875  -12.471 1.00 1.00 ? 31  GLY A C    5  
ATOM 8275  O O    . GLY A 1 31  ? 7.120   19.002  -12.102 1.00 1.00 ? 31  GLY A O    5  
ATOM 8276  H H    . GLY A 1 31  ? 11.131  18.047  -11.817 1.00 1.00 ? 31  GLY A H    5  
ATOM 8277  H HA2  . GLY A 1 31  ? 9.302   18.892  -10.592 1.00 1.00 ? 31  GLY A HA2  5  
ATOM 8278  H HA3  . GLY A 1 31  ? 9.389   20.426  -11.496 1.00 1.00 ? 31  GLY A HA3  5  
ATOM 8279  N N    . TYR A 1 32  ? 8.606   18.302  -13.634 1.00 1.00 ? 32  TYR A N    5  
ATOM 8280  C CA   . TYR A 1 32  ? 7.663   17.738  -14.598 1.00 1.00 ? 32  TYR A CA   5  
ATOM 8281  C C    . TYR A 1 32  ? 7.537   16.212  -14.474 1.00 1.00 ? 32  TYR A C    5  
ATOM 8282  O O    . TYR A 1 32  ? 8.450   15.513  -14.035 1.00 1.00 ? 32  TYR A O    5  
ATOM 8283  C CB   . TYR A 1 32  ? 8.092   18.151  -16.018 1.00 1.00 ? 32  TYR A CB   5  
ATOM 8284  C CG   . TYR A 1 32  ? 7.732   19.581  -16.380 1.00 1.00 ? 32  TYR A CG   5  
ATOM 8285  C CD1  . TYR A 1 32  ? 8.539   20.654  -15.956 1.00 1.00 ? 32  TYR A CD1  5  
ATOM 8286  C CD2  . TYR A 1 32  ? 6.574   19.840  -17.140 1.00 1.00 ? 32  TYR A CD2  5  
ATOM 8287  C CE1  . TYR A 1 32  ? 8.190   21.978  -16.282 1.00 1.00 ? 32  TYR A CE1  5  
ATOM 8288  C CE2  . TYR A 1 32  ? 6.217   21.160  -17.471 1.00 1.00 ? 32  TYR A CE2  5  
ATOM 8289  C CZ   . TYR A 1 32  ? 7.023   22.237  -17.038 1.00 1.00 ? 32  TYR A CZ   5  
ATOM 8290  O OH   . TYR A 1 32  ? 6.674   23.515  -17.354 1.00 1.00 ? 32  TYR A OH   5  
ATOM 8291  H H    . TYR A 1 32  ? 9.592   18.228  -13.846 1.00 1.00 ? 32  TYR A H    5  
ATOM 8292  H HA   . TYR A 1 32  ? 6.677   18.160  -14.416 1.00 1.00 ? 32  TYR A HA   5  
ATOM 8293  H HB2  . TYR A 1 32  ? 9.171   18.018  -16.124 1.00 1.00 ? 32  TYR A HB2  5  
ATOM 8294  H HB3  . TYR A 1 32  ? 7.616   17.489  -16.741 1.00 1.00 ? 32  TYR A HB3  5  
ATOM 8295  H HD1  . TYR A 1 32  ? 9.431   20.464  -15.376 1.00 1.00 ? 32  TYR A HD1  5  
ATOM 8296  H HD2  . TYR A 1 32  ? 5.955   19.022  -17.472 1.00 1.00 ? 32  TYR A HD2  5  
ATOM 8297  H HE1  . TYR A 1 32  ? 8.814   22.798  -15.950 1.00 1.00 ? 32  TYR A HE1  5  
ATOM 8298  H HE2  . TYR A 1 32  ? 5.327   21.356  -18.053 1.00 1.00 ? 32  TYR A HE2  5  
ATOM 8299  H HH   . TYR A 1 32  ? 7.295   24.175  -17.013 1.00 1.00 ? 32  TYR A HH   5  
ATOM 8300  N N    . VAL A 1 33  ? 6.404   15.690  -14.935 1.00 1.00 ? 33  VAL A N    5  
ATOM 8301  C CA   . VAL A 1 33  ? 6.105   14.262  -15.067 1.00 1.00 ? 33  VAL A CA   5  
ATOM 8302  C C    . VAL A 1 33  ? 5.658   13.955  -16.493 1.00 1.00 ? 33  VAL A C    5  
ATOM 8303  O O    . VAL A 1 33  ? 5.133   14.824  -17.187 1.00 1.00 ? 33  VAL A O    5  
ATOM 8304  C CB   . VAL A 1 33  ? 4.981   13.819  -14.105 1.00 1.00 ? 33  VAL A CB   5  
ATOM 8305  C CG1  . VAL A 1 33  ? 5.443   13.779  -12.647 1.00 1.00 ? 33  VAL A CG1  5  
ATOM 8306  C CG2  . VAL A 1 33  ? 3.730   14.701  -14.196 1.00 1.00 ? 33  VAL A CG2  5  
ATOM 8307  H H    . VAL A 1 33  ? 5.704   16.342  -15.312 1.00 1.00 ? 33  VAL A H    5  
ATOM 8308  H HA   . VAL A 1 33  ? 6.999   13.678  -14.858 1.00 1.00 ? 33  VAL A HA   5  
ATOM 8309  H HB   . VAL A 1 33  ? 4.700   12.808  -14.382 1.00 1.00 ? 33  VAL A HB   5  
ATOM 8310  H HG11 . VAL A 1 33  ? 4.618   13.466  -12.008 1.00 1.00 ? 33  VAL A HG11 5  
ATOM 8311  H HG12 . VAL A 1 33  ? 6.245   13.054  -12.542 1.00 1.00 ? 33  VAL A HG12 5  
ATOM 8312  H HG13 . VAL A 1 33  ? 5.791   14.764  -12.336 1.00 1.00 ? 33  VAL A HG13 5  
ATOM 8313  H HG21 . VAL A 1 33  ? 3.413   14.815  -15.234 1.00 1.00 ? 33  VAL A HG21 5  
ATOM 8314  H HG22 . VAL A 1 33  ? 2.922   14.242  -13.625 1.00 1.00 ? 33  VAL A HG22 5  
ATOM 8315  H HG23 . VAL A 1 33  ? 3.930   15.690  -13.781 1.00 1.00 ? 33  VAL A HG23 5  
ATOM 8316  N N    . ILE A 1 34  ? 5.839   12.709  -16.916 1.00 1.00 ? 34  ILE A N    5  
ATOM 8317  C CA   . ILE A 1 34  ? 5.272   12.161  -18.152 1.00 1.00 ? 34  ILE A CA   5  
ATOM 8318  C C    . ILE A 1 34  ? 4.234   11.104  -17.758 1.00 1.00 ? 34  ILE A C    5  
ATOM 8319  O O    . ILE A 1 34  ? 4.434   10.339  -16.819 1.00 1.00 ? 34  ILE A O    5  
ATOM 8320  C CB   . ILE A 1 34  ? 6.409   11.666  -19.078 1.00 1.00 ? 34  ILE A CB   5  
ATOM 8321  C CG1  . ILE A 1 34  ? 7.093   12.922  -19.673 1.00 1.00 ? 34  ILE A CG1  5  
ATOM 8322  C CG2  . ILE A 1 34  ? 5.855   10.730  -20.175 1.00 1.00 ? 34  ILE A CG2  5  
ATOM 8323  C CD1  . ILE A 1 34  ? 8.313   12.665  -20.567 1.00 1.00 ? 34  ILE A CD1  5  
ATOM 8324  H H    . ILE A 1 34  ? 6.321   12.056  -16.290 1.00 1.00 ? 34  ILE A H    5  
ATOM 8325  H HA   . ILE A 1 34  ? 4.722   12.939  -18.682 1.00 1.00 ? 34  ILE A HA   5  
ATOM 8326  H HB   . ILE A 1 34  ? 7.145   11.123  -18.475 1.00 1.00 ? 34  ILE A HB   5  
ATOM 8327  H HG12 . ILE A 1 34  ? 6.358   13.481  -20.248 1.00 1.00 ? 34  ILE A HG12 5  
ATOM 8328  H HG13 . ILE A 1 34  ? 7.427   13.559  -18.853 1.00 1.00 ? 34  ILE A HG13 5  
ATOM 8329  H HG21 . ILE A 1 34  ? 5.483   9.802   -19.737 1.00 1.00 ? 34  ILE A HG21 5  
ATOM 8330  H HG22 . ILE A 1 34  ? 5.042   11.217  -20.712 1.00 1.00 ? 34  ILE A HG22 5  
ATOM 8331  H HG23 . ILE A 1 34  ? 6.631   10.459  -20.886 1.00 1.00 ? 34  ILE A HG23 5  
ATOM 8332  H HD11 . ILE A 1 34  ? 8.763   13.620  -20.846 1.00 1.00 ? 34  ILE A HD11 5  
ATOM 8333  H HD12 . ILE A 1 34  ? 9.053   12.077  -20.030 1.00 1.00 ? 34  ILE A HD12 5  
ATOM 8334  H HD13 . ILE A 1 34  ? 8.023   12.143  -21.472 1.00 1.00 ? 34  ILE A HD13 5  
ATOM 8335  N N    . HIS A 1 35  ? 3.095   11.079  -18.443 1.00 1.00 ? 35  HIS A N    5  
ATOM 8336  C CA   . HIS A 1 35  ? 1.917   10.297  -18.059 1.00 1.00 ? 35  HIS A CA   5  
ATOM 8337  C C    . HIS A 1 35  ? 0.986   10.084  -19.266 1.00 1.00 ? 35  HIS A C    5  
ATOM 8338  O O    . HIS A 1 35  ? 1.229   10.638  -20.333 1.00 1.00 ? 35  HIS A O    5  
ATOM 8339  C CB   . HIS A 1 35  ? 1.189   11.078  -16.940 1.00 1.00 ? 35  HIS A CB   5  
ATOM 8340  C CG   . HIS A 1 35  ? 0.678   12.432  -17.390 1.00 1.00 ? 35  HIS A CG   5  
ATOM 8341  N ND1  . HIS A 1 35  ? -0.593  12.722  -17.840 1.00 1.00 ? 35  HIS A ND1  5  
ATOM 8342  C CD2  . HIS A 1 35  ? 1.417   13.578  -17.514 1.00 1.00 ? 35  HIS A CD2  5  
ATOM 8343  C CE1  . HIS A 1 35  ? -0.604  14.009  -18.238 1.00 1.00 ? 35  HIS A CE1  5  
ATOM 8344  N NE2  . HIS A 1 35  ? 0.606   14.574  -18.065 1.00 1.00 ? 35  HIS A NE2  5  
ATOM 8345  H H    . HIS A 1 35  ? 2.969   11.711  -19.236 1.00 1.00 ? 35  HIS A H    5  
ATOM 8346  H HA   . HIS A 1 35  ? 2.224   9.319   -17.680 1.00 1.00 ? 35  HIS A HA   5  
ATOM 8347  H HB2  . HIS A 1 35  ? 0.350   10.490  -16.560 1.00 1.00 ? 35  HIS A HB2  5  
ATOM 8348  H HB3  . HIS A 1 35  ? 1.871   11.230  -16.102 1.00 1.00 ? 35  HIS A HB3  5  
ATOM 8349  H HD1  . HIS A 1 35  ? -1.376  12.076  -17.910 1.00 1.00 ? 35  HIS A HD1  5  
ATOM 8350  H HD2  . HIS A 1 35  ? 2.467   13.676  -17.283 1.00 1.00 ? 35  HIS A HD2  5  
ATOM 8351  H HE1  . HIS A 1 35  ? -1.466  14.514  -18.652 1.00 1.00 ? 35  HIS A HE1  5  
ATOM 8352  N N    . LEU A 1 36  ? -0.090  9.313   -19.106 1.00 1.00 ? 36  LEU A N    5  
ATOM 8353  C CA   . LEU A 1 36  ? -1.170  9.220   -20.096 1.00 1.00 ? 36  LEU A CA   5  
ATOM 8354  C C    . LEU A 1 36  ? -2.292  10.194  -19.714 1.00 1.00 ? 36  LEU A C    5  
ATOM 8355  O O    . LEU A 1 36  ? -2.465  10.536  -18.546 1.00 1.00 ? 36  LEU A O    5  
ATOM 8356  C CB   . LEU A 1 36  ? -1.703  7.772   -20.149 1.00 1.00 ? 36  LEU A CB   5  
ATOM 8357  C CG   . LEU A 1 36  ? -0.923  6.837   -21.093 1.00 1.00 ? 36  LEU A CG   5  
ATOM 8358  C CD1  . LEU A 1 36  ? -1.275  5.379   -20.787 1.00 1.00 ? 36  LEU A CD1  5  
ATOM 8359  C CD2  . LEU A 1 36  ? -1.261  7.121   -22.562 1.00 1.00 ? 36  LEU A CD2  5  
ATOM 8360  H H    . LEU A 1 36  ? -0.266  8.894   -18.202 1.00 1.00 ? 36  LEU A H    5  
ATOM 8361  H HA   . LEU A 1 36  ? -0.809  9.516   -21.084 1.00 1.00 ? 36  LEU A HA   5  
ATOM 8362  H HB2  . LEU A 1 36  ? -1.684  7.363   -19.140 1.00 1.00 ? 36  LEU A HB2  5  
ATOM 8363  H HB3  . LEU A 1 36  ? -2.747  7.775   -20.466 1.00 1.00 ? 36  LEU A HB3  5  
ATOM 8364  H HG   . LEU A 1 36  ? 0.144   6.983   -20.939 1.00 1.00 ? 36  LEU A HG   5  
ATOM 8365  H HD11 . LEU A 1 36  ? -1.013  5.153   -19.758 1.00 1.00 ? 36  LEU A HD11 5  
ATOM 8366  H HD12 . LEU A 1 36  ? -2.344  5.209   -20.929 1.00 1.00 ? 36  LEU A HD12 5  
ATOM 8367  H HD13 . LEU A 1 36  ? -0.710  4.715   -21.440 1.00 1.00 ? 36  LEU A HD13 5  
ATOM 8368  H HD21 . LEU A 1 36  ? -2.324  6.971   -22.742 1.00 1.00 ? 36  LEU A HD21 5  
ATOM 8369  H HD22 . LEU A 1 36  ? -0.998  8.142   -22.811 1.00 1.00 ? 36  LEU A HD22 5  
ATOM 8370  H HD23 . LEU A 1 36  ? -0.696  6.454   -23.209 1.00 1.00 ? 36  LEU A HD23 5  
ATOM 8371  N N    . ALA A 1 37  ? -3.051  10.644  -20.707 1.00 1.00 ? 37  ALA A N    5  
ATOM 8372  C CA   . ALA A 1 37  ? -4.299  11.381  -20.533 1.00 1.00 ? 37  ALA A CA   5  
ATOM 8373  C C    . ALA A 1 37  ? -5.453  10.389  -20.803 1.00 1.00 ? 37  ALA A C    5  
ATOM 8374  O O    . ALA A 1 37  ? -5.551  9.919   -21.944 1.00 1.00 ? 37  ALA A O    5  
ATOM 8375  C CB   . ALA A 1 37  ? -4.301  12.571  -21.501 1.00 1.00 ? 37  ALA A CB   5  
ATOM 8376  H H    . ALA A 1 37  ? -2.753  10.444  -21.660 1.00 1.00 ? 37  ALA A H    5  
ATOM 8377  H HA   . ALA A 1 37  ? -4.366  11.779  -19.519 1.00 1.00 ? 37  ALA A HA   5  
ATOM 8378  H HB1  . ALA A 1 37  ? -5.247  13.111  -21.427 1.00 1.00 ? 37  ALA A HB1  5  
ATOM 8379  H HB2  . ALA A 1 37  ? -3.489  13.246  -21.233 1.00 1.00 ? 37  ALA A HB2  5  
ATOM 8380  H HB3  . ALA A 1 37  ? -4.159  12.236  -22.530 1.00 1.00 ? 37  ALA A HB3  5  
ATOM 8381  N N    . PRO A 1 38  ? -6.278  10.022  -19.796 1.00 1.00 ? 38  PRO A N    5  
ATOM 8382  C CA   . PRO A 1 38  ? -7.343  9.028   -19.942 1.00 1.00 ? 38  PRO A CA   5  
ATOM 8383  C C    . PRO A 1 38  ? -8.352  9.353   -21.065 1.00 1.00 ? 38  PRO A C    5  
ATOM 8384  O O    . PRO A 1 38  ? -8.609  10.534  -21.324 1.00 1.00 ? 38  PRO A O    5  
ATOM 8385  C CB   . PRO A 1 38  ? -8.037  8.950   -18.579 1.00 1.00 ? 38  PRO A CB   5  
ATOM 8386  C CG   . PRO A 1 38  ? -6.918  9.316   -17.609 1.00 1.00 ? 38  PRO A CG   5  
ATOM 8387  C CD   . PRO A 1 38  ? -6.129  10.369  -18.387 1.00 1.00 ? 38  PRO A CD   5  
ATOM 8388  H HA   . PRO A 1 38  ? -6.856  8.073   -20.140 1.00 1.00 ? 38  PRO A HA   5  
ATOM 8389  H HB2  . PRO A 1 38  ? -8.832  9.696   -18.512 1.00 1.00 ? 38  PRO A HB2  5  
ATOM 8390  H HB3  . PRO A 1 38  ? -8.427  7.949   -18.382 1.00 1.00 ? 38  PRO A HB3  5  
ATOM 8391  H HG2  . PRO A 1 38  ? -7.305  9.708   -16.666 1.00 1.00 ? 38  PRO A HG2  5  
ATOM 8392  H HG3  . PRO A 1 38  ? -6.289  8.442   -17.431 1.00 1.00 ? 38  PRO A HG3  5  
ATOM 8393  H HD2  . PRO A 1 38  ? -6.553  11.359  -18.207 1.00 1.00 ? 38  PRO A HD2  5  
ATOM 8394  H HD3  . PRO A 1 38  ? -5.087  10.342  -18.069 1.00 1.00 ? 38  PRO A HD3  5  
ATOM 8395  N N    . PRO A 1 39  ? -8.942  8.328   -21.715 1.00 1.00 ? 39  PRO A N    5  
ATOM 8396  C CA   . PRO A 1 39  ? -9.864  8.497   -22.834 1.00 1.00 ? 39  PRO A CA   5  
ATOM 8397  C C    . PRO A 1 39  ? -11.283 8.868   -22.369 1.00 1.00 ? 39  PRO A C    5  
ATOM 8398  O O    . PRO A 1 39  ? -11.601 8.849   -21.180 1.00 1.00 ? 39  PRO A O    5  
ATOM 8399  C CB   . PRO A 1 39  ? -9.848  7.150   -23.563 1.00 1.00 ? 39  PRO A CB   5  
ATOM 8400  C CG   . PRO A 1 39  ? -9.641  6.155   -22.425 1.00 1.00 ? 39  PRO A CG   5  
ATOM 8401  C CD   . PRO A 1 39  ? -8.732  6.908   -21.452 1.00 1.00 ? 39  PRO A CD   5  
ATOM 8402  H HA   . PRO A 1 39  ? -9.499  9.264   -23.511 1.00 1.00 ? 39  PRO A HA   5  
ATOM 8403  H HB2  . PRO A 1 39  ? -10.769 6.960   -24.114 1.00 1.00 ? 39  PRO A HB2  5  
ATOM 8404  H HB3  . PRO A 1 39  ? -8.992  7.116   -24.238 1.00 1.00 ? 39  PRO A HB3  5  
ATOM 8405  H HG2  . PRO A 1 39  ? -10.597 5.945   -21.946 1.00 1.00 ? 39  PRO A HG2  5  
ATOM 8406  H HG3  . PRO A 1 39  ? -9.171  5.236   -22.777 1.00 1.00 ? 39  PRO A HG3  5  
ATOM 8407  H HD2  . PRO A 1 39  ? -8.999  6.659   -20.424 1.00 1.00 ? 39  PRO A HD2  5  
ATOM 8408  H HD3  . PRO A 1 39  ? -7.692  6.643   -21.645 1.00 1.00 ? 39  PRO A HD3  5  
ATOM 8409  N N    . SER A 1 40  ? -12.157 9.169   -23.331 1.00 1.00 ? 40  SER A N    5  
ATOM 8410  C CA   . SER A 1 40  ? -13.586 9.449   -23.130 1.00 1.00 ? 40  SER A CA   5  
ATOM 8411  C C    . SER A 1 40  ? -14.415 9.013   -24.360 1.00 1.00 ? 40  SER A C    5  
ATOM 8412  O O    . SER A 1 40  ? -13.861 8.703   -25.418 1.00 1.00 ? 40  SER A O    5  
ATOM 8413  C CB   . SER A 1 40  ? -13.789 10.939  -22.819 1.00 1.00 ? 40  SER A CB   5  
ATOM 8414  O OG   . SER A 1 40  ? -15.107 11.183  -22.335 1.00 1.00 ? 40  SER A OG   5  
ATOM 8415  H H    . SER A 1 40  ? -11.837 9.148   -24.299 1.00 1.00 ? 40  SER A H    5  
ATOM 8416  H HA   . SER A 1 40  ? -13.945 8.876   -22.273 1.00 1.00 ? 40  SER A HA   5  
ATOM 8417  H HB2  . SER A 1 40  ? -13.071 11.243  -22.052 1.00 1.00 ? 40  SER A HB2  5  
ATOM 8418  H HB3  . SER A 1 40  ? -13.606 11.525  -23.722 1.00 1.00 ? 40  SER A HB3  5  
ATOM 8419  H HG   . SER A 1 40  ? -15.190 12.128  -22.082 1.00 1.00 ? 40  SER A HG   5  
ATOM 8420  N N    . GLU A 1 41  ? -15.747 8.968   -24.230 1.00 1.00 ? 41  GLU A N    5  
ATOM 8421  C CA   . GLU A 1 41  ? -16.652 8.506   -25.286 1.00 1.00 ? 41  GLU A CA   5  
ATOM 8422  C C    . GLU A 1 41  ? -16.591 9.433   -26.516 1.00 1.00 ? 41  GLU A C    5  
ATOM 8423  O O    . GLU A 1 41  ? -16.790 10.649  -26.416 1.00 1.00 ? 41  GLU A O    5  
ATOM 8424  C CB   . GLU A 1 41  ? -18.082 8.388   -24.732 1.00 1.00 ? 41  GLU A CB   5  
ATOM 8425  C CG   . GLU A 1 41  ? -19.052 7.756   -25.737 1.00 1.00 ? 41  GLU A CG   5  
ATOM 8426  C CD   . GLU A 1 41  ? -20.438 7.553   -25.104 1.00 1.00 ? 41  GLU A CD   5  
ATOM 8427  O OE1  . GLU A 1 41  ? -21.260 8.500   -25.108 1.00 1.00 ? 41  GLU A OE1  5  
ATOM 8428  O OE2  . GLU A 1 41  ? -20.720 6.441   -24.595 1.00 1.00 ? 41  GLU A OE2  5  
ATOM 8429  H H    . GLU A 1 41  ? -16.150 9.331   -23.375 1.00 1.00 ? 41  GLU A H    5  
ATOM 8430  H HA   . GLU A 1 41  ? -16.333 7.505   -25.587 1.00 1.00 ? 41  GLU A HA   5  
ATOM 8431  H HB2  . GLU A 1 41  ? -18.058 7.765   -23.836 1.00 1.00 ? 41  GLU A HB2  5  
ATOM 8432  H HB3  . GLU A 1 41  ? -18.447 9.378   -24.452 1.00 1.00 ? 41  GLU A HB3  5  
ATOM 8433  H HG2  . GLU A 1 41  ? -19.142 8.400   -26.615 1.00 1.00 ? 41  GLU A HG2  5  
ATOM 8434  H HG3  . GLU A 1 41  ? -18.651 6.797   -26.065 1.00 1.00 ? 41  GLU A HG3  5  
ATOM 8435  N N    . TYR A 1 42  ? -16.334 8.857   -27.696 1.00 1.00 ? 42  TYR A N    5  
ATOM 8436  C CA   . TYR A 1 42  ? -16.241 9.616   -28.946 1.00 1.00 ? 42  TYR A CA   5  
ATOM 8437  C C    . TYR A 1 42  ? -17.606 10.204  -29.392 1.00 1.00 ? 42  TYR A C    5  
ATOM 8438  O O    . TYR A 1 42  ? -18.640 9.538   -29.248 1.00 1.00 ? 42  TYR A O    5  
ATOM 8439  C CB   . TYR A 1 42  ? -15.583 8.763   -30.042 1.00 1.00 ? 42  TYR A CB   5  
ATOM 8440  C CG   . TYR A 1 42  ? -16.262 7.439   -30.351 1.00 1.00 ? 42  TYR A CG   5  
ATOM 8441  C CD1  . TYR A 1 42  ? -17.310 7.382   -31.292 1.00 1.00 ? 42  TYR A CD1  5  
ATOM 8442  C CD2  . TYR A 1 42  ? -15.838 6.258   -29.705 1.00 1.00 ? 42  TYR A CD2  5  
ATOM 8443  C CE1  . TYR A 1 42  ? -17.940 6.156   -31.580 1.00 1.00 ? 42  TYR A CE1  5  
ATOM 8444  C CE2  . TYR A 1 42  ? -16.465 5.029   -29.985 1.00 1.00 ? 42  TYR A CE2  5  
ATOM 8445  C CZ   . TYR A 1 42  ? -17.521 4.975   -30.925 1.00 1.00 ? 42  TYR A CZ   5  
ATOM 8446  O OH   . TYR A 1 42  ? -18.138 3.791   -31.203 1.00 1.00 ? 42  TYR A OH   5  
ATOM 8447  H H    . TYR A 1 42  ? -16.195 7.857   -27.733 1.00 1.00 ? 42  TYR A H    5  
ATOM 8448  H HA   . TYR A 1 42  ? -15.558 10.441  -28.744 1.00 1.00 ? 42  TYR A HA   5  
ATOM 8449  H HB2  . TYR A 1 42  ? -15.536 9.351   -30.959 1.00 1.00 ? 42  TYR A HB2  5  
ATOM 8450  H HB3  . TYR A 1 42  ? -14.554 8.561   -29.746 1.00 1.00 ? 42  TYR A HB3  5  
ATOM 8451  H HD1  . TYR A 1 42  ? -17.632 8.281   -31.799 1.00 1.00 ? 42  TYR A HD1  5  
ATOM 8452  H HD2  . TYR A 1 42  ? -15.023 6.291   -28.993 1.00 1.00 ? 42  TYR A HD2  5  
ATOM 8453  H HE1  . TYR A 1 42  ? -18.745 6.111   -32.298 1.00 1.00 ? 42  TYR A HE1  5  
ATOM 8454  H HE2  . TYR A 1 42  ? -16.134 4.128   -29.487 1.00 1.00 ? 42  TYR A HE2  5  
ATOM 8455  H HH   . TYR A 1 42  ? -17.781 3.045   -30.698 1.00 1.00 ? 42  TYR A HH   5  
ATOM 8456  N N    . PRO A 1 43  ? -17.630 11.438  -29.938 1.00 1.00 ? 43  PRO A N    5  
ATOM 8457  C CA   . PRO A 1 43  ? -18.846 12.131  -30.368 1.00 1.00 ? 43  PRO A CA   5  
ATOM 8458  C C    . PRO A 1 43  ? -19.284 11.688  -31.779 1.00 1.00 ? 43  PRO A C    5  
ATOM 8459  O O    . PRO A 1 43  ? -18.734 10.742  -32.343 1.00 1.00 ? 43  PRO A O    5  
ATOM 8460  C CB   . PRO A 1 43  ? -18.458 13.614  -30.299 1.00 1.00 ? 43  PRO A CB   5  
ATOM 8461  C CG   . PRO A 1 43  ? -17.006 13.586  -30.768 1.00 1.00 ? 43  PRO A CG   5  
ATOM 8462  C CD   . PRO A 1 43  ? -16.482 12.322  -30.095 1.00 1.00 ? 43  PRO A CD   5  
ATOM 8463  H HA   . PRO A 1 43  ? -19.662 11.946  -29.670 1.00 1.00 ? 43  PRO A HA   5  
ATOM 8464  H HB2  . PRO A 1 43  ? -19.078 14.253  -30.919 1.00 1.00 ? 43  PRO A HB2  5  
ATOM 8465  H HB3  . PRO A 1 43  ? -18.502 13.950  -29.264 1.00 1.00 ? 43  PRO A HB3  5  
ATOM 8466  H HG2  . PRO A 1 43  ? -16.970 13.468  -31.850 1.00 1.00 ? 43  PRO A HG2  5  
ATOM 8467  H HG3  . PRO A 1 43  ? -16.456 14.471  -30.453 1.00 1.00 ? 43  PRO A HG3  5  
ATOM 8468  H HD2  . PRO A 1 43  ? -15.709 11.862  -30.710 1.00 1.00 ? 43  PRO A HD2  5  
ATOM 8469  H HD3  . PRO A 1 43  ? -16.088 12.572  -29.107 1.00 1.00 ? 43  PRO A HD3  5  
ATOM 8470  N N    . GLY A 1 44  ? -20.276 12.382  -32.356 1.00 1.00 ? 44  GLY A N    5  
ATOM 8471  C CA   . GLY A 1 44  ? -20.790 12.153  -33.716 1.00 1.00 ? 44  GLY A CA   5  
ATOM 8472  C C    . GLY A 1 44  ? -22.082 11.327  -33.778 1.00 1.00 ? 44  GLY A C    5  
ATOM 8473  O O    . GLY A 1 44  ? -22.762 11.337  -34.805 1.00 1.00 ? 44  GLY A O    5  
ATOM 8474  H H    . GLY A 1 44  ? -20.677 13.172  -31.855 1.00 1.00 ? 44  GLY A H    5  
ATOM 8475  H HA2  . GLY A 1 44  ? -21.014 13.121  -34.165 1.00 1.00 ? 44  GLY A HA2  5  
ATOM 8476  H HA3  . GLY A 1 44  ? -20.039 11.642  -34.320 1.00 1.00 ? 44  GLY A HA3  5  
ATOM 8477  N N    . ALA A 1 45  ? -22.450 10.643  -32.686 1.00 1.00 ? 45  ALA A N    5  
ATOM 8478  C CA   . ALA A 1 45  ? -23.710 9.897   -32.561 1.00 1.00 ? 45  ALA A CA   5  
ATOM 8479  C C    . ALA A 1 45  ? -24.929 10.814  -32.324 1.00 1.00 ? 45  ALA A C    5  
ATOM 8480  O O    . ALA A 1 45  ? -26.040 10.491  -32.757 1.00 1.00 ? 45  ALA A O    5  
ATOM 8481  C CB   . ALA A 1 45  ? -23.545 8.875   -31.428 1.00 1.00 ? 45  ALA A CB   5  
ATOM 8482  H H    . ALA A 1 45  ? -21.811 10.636  -31.905 1.00 1.00 ? 45  ALA A H    5  
ATOM 8483  H HA   . ALA A 1 45  ? -23.893 9.352   -33.490 1.00 1.00 ? 45  ALA A HA   5  
ATOM 8484  H HB1  . ALA A 1 45  ? -22.709 8.206   -31.647 1.00 1.00 ? 45  ALA A HB1  5  
ATOM 8485  H HB2  . ALA A 1 45  ? -23.359 9.383   -30.481 1.00 1.00 ? 45  ALA A HB2  5  
ATOM 8486  H HB3  . ALA A 1 45  ? -24.455 8.278   -31.342 1.00 1.00 ? 45  ALA A HB3  5  
ATOM 8487  N N    . GLY A 1 46  ? -24.723 11.952  -31.647 1.00 1.00 ? 46  GLY A N    5  
ATOM 8488  C CA   . GLY A 1 46  ? -25.716 13.009  -31.411 1.00 1.00 ? 46  GLY A CA   5  
ATOM 8489  C C    . GLY A 1 46  ? -25.419 14.283  -32.209 1.00 1.00 ? 46  GLY A C    5  
ATOM 8490  O O    . GLY A 1 46  ? -24.756 14.245  -33.248 1.00 1.00 ? 46  GLY A O    5  
ATOM 8491  H H    . GLY A 1 46  ? -23.781 12.131  -31.335 1.00 1.00 ? 46  GLY A H    5  
ATOM 8492  H HA2  . GLY A 1 46  ? -26.722 12.670  -31.663 1.00 1.00 ? 46  GLY A HA2  5  
ATOM 8493  H HA3  . GLY A 1 46  ? -25.693 13.278  -30.354 1.00 1.00 ? 46  GLY A HA3  5  
ATOM 8494  N N    . SER A 1 47  ? -25.904 15.425  -31.716 1.00 1.00 ? 47  SER A N    5  
ATOM 8495  C CA   . SER A 1 47  ? -25.680 16.743  -32.339 1.00 1.00 ? 47  SER A CA   5  
ATOM 8496  C C    . SER A 1 47  ? -24.229 17.251  -32.184 1.00 1.00 ? 47  SER A C    5  
ATOM 8497  O O    . SER A 1 47  ? -23.743 18.024  -33.014 1.00 1.00 ? 47  SER A O    5  
ATOM 8498  C CB   . SER A 1 47  ? -26.637 17.775  -31.721 1.00 1.00 ? 47  SER A CB   5  
ATOM 8499  O OG   . SER A 1 47  ? -27.999 17.368  -31.843 1.00 1.00 ? 47  SER A OG   5  
ATOM 8500  H H    . SER A 1 47  ? -26.522 15.388  -30.915 1.00 1.00 ? 47  SER A H    5  
ATOM 8501  H HA   . SER A 1 47  ? -25.894 16.683  -33.406 1.00 1.00 ? 47  SER A HA   5  
ATOM 8502  H HB2  . SER A 1 47  ? -26.392 17.904  -30.663 1.00 1.00 ? 47  SER A HB2  5  
ATOM 8503  H HB3  . SER A 1 47  ? -26.495 18.731  -32.229 1.00 1.00 ? 47  SER A HB3  5  
ATOM 8504  H HG   . SER A 1 47  ? -28.581 18.059  -31.456 1.00 1.00 ? 47  SER A HG   5  
ATOM 8505  N N    . SER A 1 48  ? -23.518 16.821  -31.136 1.00 1.00 ? 48  SER A N    5  
ATOM 8506  C CA   . SER A 1 48  ? -22.095 17.123  -30.912 1.00 1.00 ? 48  SER A CA   5  
ATOM 8507  C C    . SER A 1 48  ? -21.174 16.238  -31.774 1.00 1.00 ? 48  SER A C    5  
ATOM 8508  O O    . SER A 1 48  ? -21.435 15.048  -31.962 1.00 1.00 ? 48  SER A O    5  
ATOM 8509  C CB   . SER A 1 48  ? -21.735 16.937  -29.427 1.00 1.00 ? 48  SER A CB   5  
ATOM 8510  O OG   . SER A 1 48  ? -22.499 17.812  -28.600 1.00 1.00 ? 48  SER A OG   5  
ATOM 8511  H H    . SER A 1 48  ? -23.972 16.202  -30.479 1.00 1.00 ? 48  SER A H    5  
ATOM 8512  H HA   . SER A 1 48  ? -21.904 18.167  -31.169 1.00 1.00 ? 48  SER A HA   5  
ATOM 8513  H HB2  . SER A 1 48  ? -21.925 15.898  -29.141 1.00 1.00 ? 48  SER A HB2  5  
ATOM 8514  H HB3  . SER A 1 48  ? -20.671 17.141  -29.289 1.00 1.00 ? 48  SER A HB3  5  
ATOM 8515  H HG   . SER A 1 48  ? -22.279 17.653  -27.653 1.00 1.00 ? 48  SER A HG   5  
ATOM 8516  N N    . SER A 1 49  ? -20.064 16.796  -32.264 1.00 1.00 ? 49  SER A N    5  
ATOM 8517  C CA   . SER A 1 49  ? -19.084 16.116  -33.124 1.00 1.00 ? 49  SER A CA   5  
ATOM 8518  C C    . SER A 1 49  ? -17.631 16.333  -32.643 1.00 1.00 ? 49  SER A C    5  
ATOM 8519  O O    . SER A 1 49  ? -17.388 16.909  -31.580 1.00 1.00 ? 49  SER A O    5  
ATOM 8520  C CB   . SER A 1 49  ? -19.298 16.578  -34.578 1.00 1.00 ? 49  SER A CB   5  
ATOM 8521  O OG   . SER A 1 49  ? -18.500 15.809  -35.475 1.00 1.00 ? 49  SER A OG   5  
ATOM 8522  H H    . SER A 1 49  ? -19.879 17.775  -32.042 1.00 1.00 ? 49  SER A H    5  
ATOM 8523  H HA   . SER A 1 49  ? -19.260 15.040  -33.110 1.00 1.00 ? 49  SER A HA   5  
ATOM 8524  H HB2  . SER A 1 49  ? -20.351 16.445  -34.834 1.00 1.00 ? 49  SER A HB2  5  
ATOM 8525  H HB3  . SER A 1 49  ? -19.052 17.637  -34.668 1.00 1.00 ? 49  SER A HB3  5  
ATOM 8526  H HG   . SER A 1 49  ? -18.780 15.992  -36.401 1.00 1.00 ? 49  SER A HG   5  
ATOM 8527  N N    . VAL A 1 50  ? -16.638 15.890  -33.419 1.00 1.00 ? 50  VAL A N    5  
ATOM 8528  C CA   . VAL A 1 50  ? -15.206 15.956  -33.044 1.00 1.00 ? 50  VAL A CA   5  
ATOM 8529  C C    . VAL A 1 50  ? -14.684 17.396  -32.905 1.00 1.00 ? 50  VAL A C    5  
ATOM 8530  O O    . VAL A 1 50  ? -13.695 17.622  -32.217 1.00 1.00 ? 50  VAL A O    5  
ATOM 8531  C CB   . VAL A 1 50  ? -14.290 15.157  -34.002 1.00 1.00 ? 50  VAL A CB   5  
ATOM 8532  C CG1  . VAL A 1 50  ? -14.650 13.663  -33.979 1.00 1.00 ? 50  VAL A CG1  5  
ATOM 8533  C CG2  . VAL A 1 50  ? -14.322 15.681  -35.452 1.00 1.00 ? 50  VAL A CG2  5  
ATOM 8534  H H    . VAL A 1 50  ? -16.913 15.499  -34.325 1.00 1.00 ? 50  VAL A H    5  
ATOM 8535  H HA   . VAL A 1 50  ? -15.126 15.497  -32.058 1.00 1.00 ? 50  VAL A HA   5  
ATOM 8536  H HB   . VAL A 1 50  ? -13.263 15.246  -33.639 1.00 1.00 ? 50  VAL A HB   5  
ATOM 8537  H HG11 . VAL A 1 50  ? -14.620 13.287  -32.955 1.00 1.00 ? 50  VAL A HG11 5  
ATOM 8538  H HG12 . VAL A 1 50  ? -15.648 13.499  -34.391 1.00 1.00 ? 50  VAL A HG12 5  
ATOM 8539  H HG13 . VAL A 1 50  ? -13.931 13.101  -34.575 1.00 1.00 ? 50  VAL A HG13 5  
ATOM 8540  H HG21 . VAL A 1 50  ? -14.006 16.723  -35.484 1.00 1.00 ? 50  VAL A HG21 5  
ATOM 8541  H HG22 . VAL A 1 50  ? -13.640 15.097  -36.072 1.00 1.00 ? 50  VAL A HG22 5  
ATOM 8542  H HG23 . VAL A 1 50  ? -15.326 15.598  -35.866 1.00 1.00 ? 50  VAL A HG23 5  
ATOM 8543  N N    . PHE A 1 51  ? -15.369 18.375  -33.513 1.00 1.00 ? 51  PHE A N    5  
ATOM 8544  C CA   . PHE A 1 51  ? -15.112 19.806  -33.327 1.00 1.00 ? 51  PHE A CA   5  
ATOM 8545  C C    . PHE A 1 51  ? -15.771 20.360  -32.048 1.00 1.00 ? 51  PHE A C    5  
ATOM 8546  O O    . PHE A 1 51  ? -15.317 21.361  -31.495 1.00 1.00 ? 51  PHE A O    5  
ATOM 8547  C CB   . PHE A 1 51  ? -15.601 20.560  -34.576 1.00 1.00 ? 51  PHE A CB   5  
ATOM 8548  C CG   . PHE A 1 51  ? -15.009 20.042  -35.876 1.00 1.00 ? 51  PHE A CG   5  
ATOM 8549  C CD1  . PHE A 1 51  ? -13.654 20.282  -36.180 1.00 1.00 ? 51  PHE A CD1  5  
ATOM 8550  C CD2  . PHE A 1 51  ? -15.801 19.296  -36.773 1.00 1.00 ? 51  PHE A CD2  5  
ATOM 8551  C CE1  . PHE A 1 51  ? -13.095 19.777  -37.367 1.00 1.00 ? 51  PHE A CE1  5  
ATOM 8552  C CE2  . PHE A 1 51  ? -15.240 18.791  -37.961 1.00 1.00 ? 51  PHE A CE2  5  
ATOM 8553  C CZ   . PHE A 1 51  ? -13.886 19.032  -38.259 1.00 1.00 ? 51  PHE A CZ   5  
ATOM 8554  H H    . PHE A 1 51  ? -16.125 18.115  -34.131 1.00 1.00 ? 51  PHE A H    5  
ATOM 8555  H HA   . PHE A 1 51  ? -14.036 19.965  -33.233 1.00 1.00 ? 51  PHE A HA   5  
ATOM 8556  H HB2  . PHE A 1 51  ? -16.690 20.498  -34.629 1.00 1.00 ? 51  PHE A HB2  5  
ATOM 8557  H HB3  . PHE A 1 51  ? -15.342 21.618  -34.475 1.00 1.00 ? 51  PHE A HB3  5  
ATOM 8558  H HD1  . PHE A 1 51  ? -13.039 20.850  -35.495 1.00 1.00 ? 51  PHE A HD1  5  
ATOM 8559  H HD2  . PHE A 1 51  ? -16.844 19.105  -36.554 1.00 1.00 ? 51  PHE A HD2  5  
ATOM 8560  H HE1  . PHE A 1 51  ? -12.052 19.964  -37.592 1.00 1.00 ? 51  PHE A HE1  5  
ATOM 8561  H HE2  . PHE A 1 51  ? -15.848 18.219  -38.646 1.00 1.00 ? 51  PHE A HE2  5  
ATOM 8562  H HZ   . PHE A 1 51  ? -13.454 18.646  -39.174 1.00 1.00 ? 51  PHE A HZ   5  
ATOM 8563  N N    . SER A 1 52  ? -16.823 19.698  -31.548 1.00 1.00 ? 52  SER A N    5  
ATOM 8564  C CA   . SER A 1 52  ? -17.480 20.012  -30.270 1.00 1.00 ? 52  SER A CA   5  
ATOM 8565  C C    . SER A 1 52  ? -16.687 19.454  -29.073 1.00 1.00 ? 52  SER A C    5  
ATOM 8566  O O    . SER A 1 52  ? -16.677 20.071  -28.006 1.00 1.00 ? 52  SER A O    5  
ATOM 8567  C CB   . SER A 1 52  ? -18.899 19.417  -30.235 1.00 1.00 ? 52  SER A CB   5  
ATOM 8568  O OG   . SER A 1 52  ? -19.594 19.553  -31.473 1.00 1.00 ? 52  SER A OG   5  
ATOM 8569  H H    . SER A 1 52  ? -17.184 18.901  -32.059 1.00 1.00 ? 52  SER A H    5  
ATOM 8570  H HA   . SER A 1 52  ? -17.556 21.095  -30.152 1.00 1.00 ? 52  SER A HA   5  
ATOM 8571  H HB2  . SER A 1 52  ? -18.821 18.355  -30.006 1.00 1.00 ? 52  SER A HB2  5  
ATOM 8572  H HB3  . SER A 1 52  ? -19.470 19.892  -29.435 1.00 1.00 ? 52  SER A HB3  5  
ATOM 8573  H HG   . SER A 1 52  ? -19.758 20.503  -31.657 1.00 1.00 ? 52  SER A HG   5  
ATOM 8574  N N    . VAL A 1 53  ? -16.004 18.311  -29.250 1.00 1.00 ? 53  VAL A N    5  
ATOM 8575  C CA   . VAL A 1 53  ? -15.090 17.721  -28.250 1.00 1.00 ? 53  VAL A CA   5  
ATOM 8576  C C    . VAL A 1 53  ? -13.947 16.960  -28.931 1.00 1.00 ? 53  VAL A C    5  
ATOM 8577  O O    . VAL A 1 53  ? -14.161 15.934  -29.575 1.00 1.00 ? 53  VAL A O    5  
ATOM 8578  C CB   . VAL A 1 53  ? -15.844 16.874  -27.194 1.00 1.00 ? 53  VAL A CB   5  
ATOM 8579  C CG1  . VAL A 1 53  ? -16.649 15.696  -27.772 1.00 1.00 ? 53  VAL A CG1  5  
ATOM 8580  C CG2  . VAL A 1 53  ? -14.885 16.361  -26.108 1.00 1.00 ? 53  VAL A CG2  5  
ATOM 8581  H H    . VAL A 1 53  ? -16.142 17.816  -30.132 1.00 1.00 ? 53  VAL A H    5  
ATOM 8582  H HA   . VAL A 1 53  ? -14.632 18.550  -27.710 1.00 1.00 ? 53  VAL A HA   5  
ATOM 8583  H HB   . VAL A 1 53  ? -16.558 17.532  -26.698 1.00 1.00 ? 53  VAL A HB   5  
ATOM 8584  H HG11 . VAL A 1 53  ? -17.296 16.039  -28.583 1.00 1.00 ? 53  VAL A HG11 5  
ATOM 8585  H HG12 . VAL A 1 53  ? -15.984 14.921  -28.150 1.00 1.00 ? 53  VAL A HG12 5  
ATOM 8586  H HG13 . VAL A 1 53  ? -17.275 15.268  -26.988 1.00 1.00 ? 53  VAL A HG13 5  
ATOM 8587  H HG21 . VAL A 1 53  ? -14.177 15.653  -26.532 1.00 1.00 ? 53  VAL A HG21 5  
ATOM 8588  H HG22 . VAL A 1 53  ? -14.337 17.197  -25.674 1.00 1.00 ? 53  VAL A HG22 5  
ATOM 8589  H HG23 . VAL A 1 53  ? -15.449 15.865  -25.316 1.00 1.00 ? 53  VAL A HG23 5  
ATOM 8590  N N    . LEU A 1 54  ? -12.724 17.491  -28.796 1.00 1.00 ? 54  LEU A N    5  
ATOM 8591  C CA   . LEU A 1 54  ? -11.540 17.008  -29.523 1.00 1.00 ? 54  LEU A CA   5  
ATOM 8592  C C    . LEU A 1 54  ? -10.853 15.830  -28.813 1.00 1.00 ? 54  LEU A C    5  
ATOM 8593  O O    . LEU A 1 54  ? -10.331 14.932  -29.469 1.00 1.00 ? 54  LEU A O    5  
ATOM 8594  C CB   . LEU A 1 54  ? -10.537 18.165  -29.723 1.00 1.00 ? 54  LEU A CB   5  
ATOM 8595  C CG   . LEU A 1 54  ? -10.890 19.165  -30.846 1.00 1.00 ? 54  LEU A CG   5  
ATOM 8596  C CD1  . LEU A 1 54  ? -12.101 20.056  -30.527 1.00 1.00 ? 54  LEU A CD1  5  
ATOM 8597  C CD2  . LEU A 1 54  ? -9.678  20.065  -31.118 1.00 1.00 ? 54  LEU A CD2  5  
ATOM 8598  H H    . LEU A 1 54  ? -12.636 18.351  -28.266 1.00 1.00 ? 54  LEU A H    5  
ATOM 8599  H HA   . LEU A 1 54  ? -11.845 16.651  -30.508 1.00 1.00 ? 54  LEU A HA   5  
ATOM 8600  H HB2  . LEU A 1 54  ? -10.390 18.699  -28.779 1.00 1.00 ? 54  LEU A HB2  5  
ATOM 8601  H HB3  . LEU A 1 54  ? -9.577  17.717  -29.989 1.00 1.00 ? 54  LEU A HB3  5  
ATOM 8602  H HG   . LEU A 1 54  ? -11.105 18.606  -31.759 1.00 1.00 ? 54  LEU A HG   5  
ATOM 8603  H HD11 . LEU A 1 54  ? -12.243 20.788  -31.323 1.00 1.00 ? 54  LEU A HD11 5  
ATOM 8604  H HD12 . LEU A 1 54  ? -13.006 19.456  -30.460 1.00 1.00 ? 54  LEU A HD12 5  
ATOM 8605  H HD13 . LEU A 1 54  ? -11.944 20.582  -29.585 1.00 1.00 ? 54  LEU A HD13 5  
ATOM 8606  H HD21 . LEU A 1 54  ? -9.429  20.639  -30.224 1.00 1.00 ? 54  LEU A HD21 5  
ATOM 8607  H HD22 . LEU A 1 54  ? -8.817  19.460  -31.404 1.00 1.00 ? 54  LEU A HD22 5  
ATOM 8608  H HD23 . LEU A 1 54  ? -9.899  20.754  -31.930 1.00 1.00 ? 54  LEU A HD23 5  
ATOM 8609  N N    . SER A 1 55  ? -10.845 15.818  -27.477 1.00 1.00 ? 55  SER A N    5  
ATOM 8610  C CA   . SER A 1 55  ? -10.240 14.738  -26.683 1.00 1.00 ? 55  SER A CA   5  
ATOM 8611  C C    . SER A 1 55  ? -11.161 13.503  -26.671 1.00 1.00 ? 55  SER A C    5  
ATOM 8612  O O    . SER A 1 55  ? -12.268 13.545  -26.127 1.00 1.00 ? 55  SER A O    5  
ATOM 8613  C CB   . SER A 1 55  ? -9.944  15.232  -25.260 1.00 1.00 ? 55  SER A CB   5  
ATOM 8614  O OG   . SER A 1 55  ? -9.178  14.268  -24.546 1.00 1.00 ? 55  SER A OG   5  
ATOM 8615  H H    . SER A 1 55  ? -11.298 16.577  -26.989 1.00 1.00 ? 55  SER A H    5  
ATOM 8616  H HA   . SER A 1 55  ? -9.285  14.458  -27.127 1.00 1.00 ? 55  SER A HA   5  
ATOM 8617  H HB2  . SER A 1 55  ? -9.376  16.162  -25.318 1.00 1.00 ? 55  SER A HB2  5  
ATOM 8618  H HB3  . SER A 1 55  ? -10.882 15.424  -24.734 1.00 1.00 ? 55  SER A HB3  5  
ATOM 8619  H HG   . SER A 1 55  ? -8.999  14.598  -23.638 1.00 1.00 ? 55  SER A HG   5  
ATOM 8620  N N    . ASN A 1 56  ? -10.736 12.410  -27.320 1.00 1.00 ? 56  ASN A N    5  
ATOM 8621  C CA   . ASN A 1 56  ? -11.530 11.184  -27.492 1.00 1.00 ? 56  ASN A CA   5  
ATOM 8622  C C    . ASN A 1 56  ? -10.707 9.957   -27.037 1.00 1.00 ? 56  ASN A C    5  
ATOM 8623  O O    . ASN A 1 56  ? -10.901 9.454   -25.932 1.00 1.00 ? 56  ASN A O    5  
ATOM 8624  C CB   . ASN A 1 56  ? -12.013 11.056  -28.957 1.00 1.00 ? 56  ASN A CB   5  
ATOM 8625  C CG   . ASN A 1 56  ? -12.864 12.205  -29.516 1.00 1.00 ? 56  ASN A CG   5  
ATOM 8626  O OD1  . ASN A 1 56  ? -13.035 12.318  -30.722 1.00 1.00 ? 56  ASN A OD1  5  
ATOM 8627  N ND2  . ASN A 1 56  ? -13.439 13.076  -28.708 1.00 1.00 ? 56  ASN A ND2  5  
ATOM 8628  H H    . ASN A 1 56  ? -9.814  12.430  -27.738 1.00 1.00 ? 56  ASN A H    5  
ATOM 8629  H HA   . ASN A 1 56  ? -12.416 11.220  -26.856 1.00 1.00 ? 56  ASN A HA   5  
ATOM 8630  H HB2  . ASN A 1 56  ? -11.148 10.949  -29.611 1.00 1.00 ? 56  ASN A HB2  5  
ATOM 8631  H HB3  . ASN A 1 56  ? -12.611 10.149  -29.033 1.00 1.00 ? 56  ASN A HB3  5  
ATOM 8632  H HD21 . ASN A 1 56  ? -13.230 13.057  -27.716 1.00 1.00 ? 56  ASN A HD21 5  
ATOM 8633  H HD22 . ASN A 1 56  ? -13.908 13.873  -29.121 1.00 1.00 ? 56  ASN A HD22 5  
ATOM 8634  N N    . SER A 1 57  ? -9.760  9.489   -27.856 1.00 1.00 ? 57  SER A N    5  
ATOM 8635  C CA   . SER A 1 57  ? -8.763  8.475   -27.480 1.00 1.00 ? 57  SER A CA   5  
ATOM 8636  C C    . SER A 1 57  ? -7.707  9.017   -26.487 1.00 1.00 ? 57  SER A C    5  
ATOM 8637  O O    . SER A 1 57  ? -7.620  10.226  -26.240 1.00 1.00 ? 57  SER A O    5  
ATOM 8638  C CB   . SER A 1 57  ? -8.092  7.929   -28.752 1.00 1.00 ? 57  SER A CB   5  
ATOM 8639  O OG   . SER A 1 57  ? -7.691  8.982   -29.627 1.00 1.00 ? 57  SER A OG   5  
ATOM 8640  H H    . SER A 1 57  ? -9.605  9.938   -28.748 1.00 1.00 ? 57  SER A H    5  
ATOM 8641  H HA   . SER A 1 57  ? -9.271  7.643   -26.988 1.00 1.00 ? 57  SER A HA   5  
ATOM 8642  H HB2  . SER A 1 57  ? -7.228  7.327   -28.475 1.00 1.00 ? 57  SER A HB2  5  
ATOM 8643  H HB3  . SER A 1 57  ? -8.806  7.288   -29.273 1.00 1.00 ? 57  SER A HB3  5  
ATOM 8644  H HG   . SER A 1 57  ? -7.347  8.600   -30.464 1.00 1.00 ? 57  SER A HG   5  
ATOM 8645  N N    . ALA A 1 58  ? -6.896  8.122   -25.900 1.00 1.00 ? 58  ALA A N    5  
ATOM 8646  C CA   . ALA A 1 58  ? -5.857  8.497   -24.942 1.00 1.00 ? 58  ALA A CA   5  
ATOM 8647  C C    . ALA A 1 58  ? -4.574  8.984   -25.643 1.00 1.00 ? 58  ALA A C    5  
ATOM 8648  O O    . ALA A 1 58  ? -4.285  8.578   -26.770 1.00 1.00 ? 58  ALA A O    5  
ATOM 8649  C CB   . ALA A 1 58  ? -5.585  7.294   -24.029 1.00 1.00 ? 58  ALA A CB   5  
ATOM 8650  H H    . ALA A 1 58  ? -6.919  7.152   -26.197 1.00 1.00 ? 58  ALA A H    5  
ATOM 8651  H HA   . ALA A 1 58  ? -6.231  9.316   -24.327 1.00 1.00 ? 58  ALA A HA   5  
ATOM 8652  H HB1  . ALA A 1 58  ? -6.504  7.002   -23.520 1.00 1.00 ? 58  ALA A HB1  5  
ATOM 8653  H HB2  . ALA A 1 58  ? -5.228  6.449   -24.616 1.00 1.00 ? 58  ALA A HB2  5  
ATOM 8654  H HB3  . ALA A 1 58  ? -4.831  7.554   -23.283 1.00 1.00 ? 58  ALA A HB3  5  
ATOM 8655  N N    . GLU A 1 59  ? -3.767  9.801   -24.958 1.00 1.00 ? 59  GLU A N    5  
ATOM 8656  C CA   . GLU A 1 59  ? -2.480  10.295  -25.461 1.00 1.00 ? 59  GLU A CA   5  
ATOM 8657  C C    . GLU A 1 59  ? -1.441  10.351  -24.338 1.00 1.00 ? 59  GLU A C    5  
ATOM 8658  O O    . GLU A 1 59  ? -1.786  10.704  -23.214 1.00 1.00 ? 59  GLU A O    5  
ATOM 8659  C CB   . GLU A 1 59  ? -2.647  11.691  -26.091 1.00 1.00 ? 59  GLU A CB   5  
ATOM 8660  C CG   . GLU A 1 59  ? -1.472  12.049  -27.011 1.00 1.00 ? 59  GLU A CG   5  
ATOM 8661  C CD   . GLU A 1 59  ? -1.644  13.449  -27.619 1.00 1.00 ? 59  GLU A CD   5  
ATOM 8662  O OE1  . GLU A 1 59  ? -2.455  13.613  -28.562 1.00 1.00 ? 59  GLU A OE1  5  
ATOM 8663  O OE2  . GLU A 1 59  ? -0.980  14.398  -27.141 1.00 1.00 ? 59  GLU A OE2  5  
ATOM 8664  H H    . GLU A 1 59  ? -4.041  10.076  -24.022 1.00 1.00 ? 59  GLU A H    5  
ATOM 8665  H HA   . GLU A 1 59  ? -2.116  9.613   -26.224 1.00 1.00 ? 59  GLU A HA   5  
ATOM 8666  H HB2  . GLU A 1 59  ? -3.565  11.710  -26.684 1.00 1.00 ? 59  GLU A HB2  5  
ATOM 8667  H HB3  . GLU A 1 59  ? -2.731  12.440  -25.297 1.00 1.00 ? 59  GLU A HB3  5  
ATOM 8668  H HG2  . GLU A 1 59  ? -0.539  12.014  -26.448 1.00 1.00 ? 59  GLU A HG2  5  
ATOM 8669  H HG3  . GLU A 1 59  ? -1.401  11.316  -27.813 1.00 1.00 ? 59  GLU A HG3  5  
ATOM 8670  N N    . VAL A 1 60  ? -0.181  10.027  -24.632 1.00 1.00 ? 60  VAL A N    5  
ATOM 8671  C CA   . VAL A 1 60  ? 0.944   10.248  -23.708 1.00 1.00 ? 60  VAL A CA   5  
ATOM 8672  C C    . VAL A 1 60  ? 1.317   11.732  -23.735 1.00 1.00 ? 60  VAL A C    5  
ATOM 8673  O O    . VAL A 1 60  ? 1.543   12.298  -24.805 1.00 1.00 ? 60  VAL A O    5  
ATOM 8674  C CB   . VAL A 1 60  ? 2.181   9.403   -24.068 1.00 1.00 ? 60  VAL A CB   5  
ATOM 8675  C CG1  . VAL A 1 60  ? 3.300   9.585   -23.026 1.00 1.00 ? 60  VAL A CG1  5  
ATOM 8676  C CG2  . VAL A 1 60  ? 1.881   7.897   -24.172 1.00 1.00 ? 60  VAL A CG2  5  
ATOM 8677  H H    . VAL A 1 60  ? 0.029   9.710   -25.582 1.00 1.00 ? 60  VAL A H    5  
ATOM 8678  H HA   . VAL A 1 60  ? 0.627   9.969   -22.706 1.00 1.00 ? 60  VAL A HA   5  
ATOM 8679  H HB   . VAL A 1 60  ? 2.533   9.743   -25.037 1.00 1.00 ? 60  VAL A HB   5  
ATOM 8680  H HG11 . VAL A 1 60  ? 2.953   9.237   -22.053 1.00 1.00 ? 60  VAL A HG11 5  
ATOM 8681  H HG12 . VAL A 1 60  ? 4.188   9.026   -23.321 1.00 1.00 ? 60  VAL A HG12 5  
ATOM 8682  H HG13 . VAL A 1 60  ? 3.582   10.630  -22.929 1.00 1.00 ? 60  VAL A HG13 5  
ATOM 8683  H HG21 . VAL A 1 60  ? 1.549   7.517   -23.206 1.00 1.00 ? 60  VAL A HG21 5  
ATOM 8684  H HG22 . VAL A 1 60  ? 1.110   7.711   -24.918 1.00 1.00 ? 60  VAL A HG22 5  
ATOM 8685  H HG23 . VAL A 1 60  ? 2.784   7.363   -24.471 1.00 1.00 ? 60  VAL A HG23 5  
ATOM 8686  N N    . LYS A 1 61  ? 1.408   12.361  -22.562 1.00 1.00 ? 61  LYS A N    5  
ATOM 8687  C CA   . LYS A 1 61  ? 1.651   13.798  -22.390 1.00 1.00 ? 61  LYS A CA   5  
ATOM 8688  C C    . LYS A 1 61  ? 2.658   14.099  -21.254 1.00 1.00 ? 61  LYS A C    5  
ATOM 8689  O O    . LYS A 1 61  ? 2.952   13.256  -20.406 1.00 1.00 ? 61  LYS A O    5  
ATOM 8690  C CB   . LYS A 1 61  ? 0.294   14.505  -22.167 1.00 1.00 ? 61  LYS A CB   5  
ATOM 8691  C CG   . LYS A 1 61  ? -0.582  14.552  -23.437 1.00 1.00 ? 61  LYS A CG   5  
ATOM 8692  C CD   . LYS A 1 61  ? -1.869  15.352  -23.172 1.00 1.00 ? 61  LYS A CD   5  
ATOM 8693  C CE   . LYS A 1 61  ? -2.821  15.496  -24.369 1.00 1.00 ? 61  LYS A CE   5  
ATOM 8694  N NZ   . LYS A 1 61  ? -2.229  16.249  -25.512 1.00 1.00 ? 61  LYS A NZ   5  
ATOM 8695  H H    . LYS A 1 61  ? 1.246   11.810  -21.719 1.00 1.00 ? 61  LYS A H    5  
ATOM 8696  H HA   . LYS A 1 61  ? 2.091   14.199  -23.304 1.00 1.00 ? 61  LYS A HA   5  
ATOM 8697  H HB2  . LYS A 1 61  ? -0.251  13.997  -21.367 1.00 1.00 ? 61  LYS A HB2  5  
ATOM 8698  H HB3  . LYS A 1 61  ? 0.475   15.533  -21.846 1.00 1.00 ? 61  LYS A HB3  5  
ATOM 8699  H HG2  . LYS A 1 61  ? -0.018  15.026  -24.240 1.00 1.00 ? 61  LYS A HG2  5  
ATOM 8700  H HG3  . LYS A 1 61  ? -0.854  13.539  -23.735 1.00 1.00 ? 61  LYS A HG3  5  
ATOM 8701  H HD2  . LYS A 1 61  ? -2.416  14.834  -22.389 1.00 1.00 ? 61  LYS A HD2  5  
ATOM 8702  H HD3  . LYS A 1 61  ? -1.610  16.346  -22.802 1.00 1.00 ? 61  LYS A HD3  5  
ATOM 8703  H HE2  . LYS A 1 61  ? -3.146  14.503  -24.699 1.00 1.00 ? 61  LYS A HE2  5  
ATOM 8704  H HE3  . LYS A 1 61  ? -3.714  16.024  -24.016 1.00 1.00 ? 61  LYS A HE3  5  
ATOM 8705  H HZ1  . LYS A 1 61  ? -1.544  15.679  -26.014 1.00 1.00 ? 61  LYS A HZ1  5  
ATOM 8706  H HZ2  . LYS A 1 61  ? -2.943  16.494  -26.185 1.00 1.00 ? 61  LYS A HZ2  5  
ATOM 8707  H HZ3  . LYS A 1 61  ? -1.785  17.109  -25.212 1.00 1.00 ? 61  LYS A HZ3  5  
ATOM 8708  N N    . ARG A 1 62  ? 3.214   15.317  -21.271 1.00 1.00 ? 62  ARG A N    5  
ATOM 8709  C CA   . ARG A 1 62  ? 4.086   15.892  -20.232 1.00 1.00 ? 62  ARG A CA   5  
ATOM 8710  C C    . ARG A 1 62  ? 3.372   17.066  -19.534 1.00 1.00 ? 62  ARG A C    5  
ATOM 8711  O O    . ARG A 1 62  ? 2.826   17.923  -20.226 1.00 1.00 ? 62  ARG A O    5  
ATOM 8712  C CB   . ARG A 1 62  ? 5.392   16.353  -20.912 1.00 1.00 ? 62  ARG A CB   5  
ATOM 8713  C CG   . ARG A 1 62  ? 6.432   16.951  -19.948 1.00 1.00 ? 62  ARG A CG   5  
ATOM 8714  C CD   . ARG A 1 62  ? 7.743   17.344  -20.655 1.00 1.00 ? 62  ARG A CD   5  
ATOM 8715  N NE   . ARG A 1 62  ? 7.525   18.384  -21.683 1.00 1.00 ? 62  ARG A NE   5  
ATOM 8716  C CZ   . ARG A 1 62  ? 7.557   19.708  -21.534 1.00 1.00 ? 62  ARG A CZ   5  
ATOM 8717  N NH1  . ARG A 1 62  ? 7.787   20.288  -20.375 1.00 1.00 ? 62  ARG A NH1  5  
ATOM 8718  N NH2  . ARG A 1 62  ? 7.345   20.478  -22.576 1.00 1.00 ? 62  ARG A NH2  5  
ATOM 8719  H H    . ARG A 1 62  ? 2.967   15.926  -22.043 1.00 1.00 ? 62  ARG A H    5  
ATOM 8720  H HA   . ARG A 1 62  ? 4.328   15.132  -19.491 1.00 1.00 ? 62  ARG A HA   5  
ATOM 8721  H HB2  . ARG A 1 62  ? 5.837   15.500  -21.422 1.00 1.00 ? 62  ARG A HB2  5  
ATOM 8722  H HB3  . ARG A 1 62  ? 5.146   17.103  -21.669 1.00 1.00 ? 62  ARG A HB3  5  
ATOM 8723  H HG2  . ARG A 1 62  ? 6.018   17.840  -19.476 1.00 1.00 ? 62  ARG A HG2  5  
ATOM 8724  H HG3  . ARG A 1 62  ? 6.656   16.219  -19.172 1.00 1.00 ? 62  ARG A HG3  5  
ATOM 8725  H HD2  . ARG A 1 62  ? 8.459   17.694  -19.913 1.00 1.00 ? 62  ARG A HD2  5  
ATOM 8726  H HD3  . ARG A 1 62  ? 8.172   16.457  -21.125 1.00 1.00 ? 62  ARG A HD3  5  
ATOM 8727  H HE   . ARG A 1 62  ? 7.379   18.047  -22.628 1.00 1.00 ? 62  ARG A HE   5  
ATOM 8728  H HH11 . ARG A 1 62  ? 7.977   19.742  -19.550 1.00 1.00 ? 62  ARG A HH11 5  
ATOM 8729  H HH12 . ARG A 1 62  ? 7.800   21.296  -20.300 1.00 1.00 ? 62  ARG A HH12 5  
ATOM 8730  H HH21 . ARG A 1 62  ? 7.159   20.080  -23.487 1.00 1.00 ? 62  ARG A HH21 5  
ATOM 8731  H HH22 . ARG A 1 62  ? 7.361   21.482  -22.484 1.00 1.00 ? 62  ARG A HH22 5  
ATOM 8732  N N    . GLU A 1 63  ? 3.445   17.158  -18.203 1.00 1.00 ? 63  GLU A N    5  
ATOM 8733  C CA   . GLU A 1 63  ? 2.984   18.318  -17.420 1.00 1.00 ? 63  GLU A CA   5  
ATOM 8734  C C    . GLU A 1 63  ? 3.705   18.375  -16.065 1.00 1.00 ? 63  GLU A C    5  
ATOM 8735  O O    . GLU A 1 63  ? 4.484   17.481  -15.720 1.00 1.00 ? 63  GLU A O    5  
ATOM 8736  C CB   . GLU A 1 63  ? 1.441   18.318  -17.258 1.00 1.00 ? 63  GLU A CB   5  
ATOM 8737  C CG   . GLU A 1 63  ? 0.703   19.387  -18.084 1.00 1.00 ? 63  GLU A CG   5  
ATOM 8738  C CD   . GLU A 1 63  ? 0.879   20.827  -17.564 1.00 1.00 ? 63  GLU A CD   5  
ATOM 8739  O OE1  . GLU A 1 63  ? 1.823   21.116  -16.797 1.00 1.00 ? 63  GLU A OE1  5  
ATOM 8740  O OE2  . GLU A 1 63  ? 0.071   21.709  -17.941 1.00 1.00 ? 63  GLU A OE2  5  
ATOM 8741  H H    . GLU A 1 63  ? 3.874   16.399  -17.681 1.00 1.00 ? 63  GLU A H    5  
ATOM 8742  H HA   . GLU A 1 63  ? 3.269   19.227  -17.956 1.00 1.00 ? 63  GLU A HA   5  
ATOM 8743  H HB2  . GLU A 1 63  ? 1.051   17.338  -17.536 1.00 1.00 ? 63  GLU A HB2  5  
ATOM 8744  H HB3  . GLU A 1 63  ? 1.175   18.479  -16.214 1.00 1.00 ? 63  GLU A HB3  5  
ATOM 8745  H HG2  . GLU A 1 63  ? 1.026   19.338  -19.123 1.00 1.00 ? 63  GLU A HG2  5  
ATOM 8746  H HG3  . GLU A 1 63  ? -0.359  19.142  -18.061 1.00 1.00 ? 63  GLU A HG3  5  
ATOM 8747  N N    . ARG A 1 64  ? 3.481   19.442  -15.302 1.00 1.00 ? 64  ARG A N    5  
ATOM 8748  C CA   . ARG A 1 64  ? 4.035   19.670  -13.963 1.00 1.00 ? 64  ARG A CA   5  
ATOM 8749  C C    . ARG A 1 64  ? 3.474   18.644  -12.969 1.00 1.00 ? 64  ARG A C    5  
ATOM 8750  O O    . ARG A 1 64  ? 2.288   18.309  -13.015 1.00 1.00 ? 64  ARG A O    5  
ATOM 8751  C CB   . ARG A 1 64  ? 3.694   21.106  -13.520 1.00 1.00 ? 64  ARG A CB   5  
ATOM 8752  C CG   . ARG A 1 64  ? 4.370   22.191  -14.384 1.00 1.00 ? 64  ARG A CG   5  
ATOM 8753  C CD   . ARG A 1 64  ? 3.564   23.496  -14.410 1.00 1.00 ? 64  ARG A CD   5  
ATOM 8754  N NE   . ARG A 1 64  ? 2.319   23.314  -15.179 1.00 1.00 ? 64  ARG A NE   5  
ATOM 8755  C CZ   . ARG A 1 64  ? 1.208   24.030  -15.136 1.00 1.00 ? 64  ARG A CZ   5  
ATOM 8756  N NH1  . ARG A 1 64  ? 1.063   25.081  -14.353 1.00 1.00 ? 64  ARG A NH1  5  
ATOM 8757  N NH2  . ARG A 1 64  ? 0.213   23.666  -15.909 1.00 1.00 ? 64  ARG A NH2  5  
ATOM 8758  H H    . ARG A 1 64  ? 2.844   20.142  -15.679 1.00 1.00 ? 64  ARG A H    5  
ATOM 8759  H HA   . ARG A 1 64  ? 5.119   19.576  -14.006 1.00 1.00 ? 64  ARG A HA   5  
ATOM 8760  H HB2  . ARG A 1 64  ? 2.612   21.225  -13.560 1.00 1.00 ? 64  ARG A HB2  5  
ATOM 8761  H HB3  . ARG A 1 64  ? 4.011   21.255  -12.485 1.00 1.00 ? 64  ARG A HB3  5  
ATOM 8762  H HG2  . ARG A 1 64  ? 5.369   22.384  -13.989 1.00 1.00 ? 64  ARG A HG2  5  
ATOM 8763  H HG3  . ARG A 1 64  ? 4.482   21.849  -15.411 1.00 1.00 ? 64  ARG A HG3  5  
ATOM 8764  H HD2  . ARG A 1 64  ? 3.344   23.799  -13.387 1.00 1.00 ? 64  ARG A HD2  5  
ATOM 8765  H HD3  . ARG A 1 64  ? 4.164   24.271  -14.890 1.00 1.00 ? 64  ARG A HD3  5  
ATOM 8766  H HE   . ARG A 1 64  ? 2.292   22.526  -15.831 1.00 1.00 ? 64  ARG A HE   5  
ATOM 8767  H HH11 . ARG A 1 64  ? 1.824   25.389  -13.769 1.00 1.00 ? 64  ARG A HH11 5  
ATOM 8768  H HH12 . ARG A 1 64  ? 0.200   25.604  -14.344 1.00 1.00 ? 64  ARG A HH12 5  
ATOM 8769  H HH21 . ARG A 1 64  ? 0.333   22.862  -16.533 1.00 1.00 ? 64  ARG A HH21 5  
ATOM 8770  H HH22 . ARG A 1 64  ? -0.668  24.151  -15.891 1.00 1.00 ? 64  ARG A HH22 5  
ATOM 8771  N N    . LEU A 1 65  ? 4.295   18.190  -12.013 1.00 1.00 ? 65  LEU A N    5  
ATOM 8772  C CA   . LEU A 1 65  ? 3.890   17.247  -10.951 1.00 1.00 ? 65  LEU A CA   5  
ATOM 8773  C C    . LEU A 1 65  ? 2.640   17.766  -10.218 1.00 1.00 ? 65  LEU A C    5  
ATOM 8774  O O    . LEU A 1 65  ? 1.614   17.086  -10.241 1.00 1.00 ? 65  LEU A O    5  
ATOM 8775  C CB   . LEU A 1 65  ? 5.117   16.972  -10.046 1.00 1.00 ? 65  LEU A CB   5  
ATOM 8776  C CG   . LEU A 1 65  ? 5.009   15.744  -9.114  1.00 1.00 ? 65  LEU A CG   5  
ATOM 8777  C CD1  . LEU A 1 65  ? 6.382   15.464  -8.493  1.00 1.00 ? 65  LEU A CD1  5  
ATOM 8778  C CD2  . LEU A 1 65  ? 3.994   15.923  -7.980  1.00 1.00 ? 65  LEU A CD2  5  
ATOM 8779  H H    . LEU A 1 65  ? 5.258   18.523  -12.018 1.00 1.00 ? 65  LEU A H    5  
ATOM 8780  H HA   . LEU A 1 65  ? 3.597   16.297  -11.407 1.00 1.00 ? 65  LEU A HA   5  
ATOM 8781  H HB2  . LEU A 1 65  ? 5.974   16.797  -10.700 1.00 1.00 ? 65  LEU A HB2  5  
ATOM 8782  H HB3  . LEU A 1 65  ? 5.350   17.858  -9.449  1.00 1.00 ? 65  LEU A HB3  5  
ATOM 8783  H HG   . LEU A 1 65  ? 4.720   14.877  -9.708  1.00 1.00 ? 65  LEU A HG   5  
ATOM 8784  H HD11 . LEU A 1 65  ? 6.726   16.332  -7.931  1.00 1.00 ? 65  LEU A HD11 5  
ATOM 8785  H HD12 . LEU A 1 65  ? 6.313   14.612  -7.817  1.00 1.00 ? 65  LEU A HD12 5  
ATOM 8786  H HD13 . LEU A 1 65  ? 7.105   15.232  -9.276  1.00 1.00 ? 65  LEU A HD13 5  
ATOM 8787  H HD21 . LEU A 1 65  ? 4.036   15.066  -7.309  1.00 1.00 ? 65  LEU A HD21 5  
ATOM 8788  H HD22 . LEU A 1 65  ? 4.214   16.831  -7.415  1.00 1.00 ? 65  LEU A HD22 5  
ATOM 8789  H HD23 . LEU A 1 65  ? 2.990   15.973  -8.386  1.00 1.00 ? 65  LEU A HD23 5  
ATOM 8790  N N    . GLU A 1 66  ? 2.699   18.989  -9.674  1.00 1.00 ? 66  GLU A N    5  
ATOM 8791  C CA   . GLU A 1 66  ? 1.579   19.650  -8.970  1.00 1.00 ? 66  GLU A CA   5  
ATOM 8792  C C    . GLU A 1 66  ? 0.303   19.661  -9.822  1.00 1.00 ? 66  GLU A C    5  
ATOM 8793  O O    . GLU A 1 66  ? -0.769  19.289  -9.351  1.00 1.00 ? 66  GLU A O    5  
ATOM 8794  C CB   . GLU A 1 66  ? 1.901   21.113  -8.596  1.00 1.00 ? 66  GLU A CB   5  
ATOM 8795  C CG   . GLU A 1 66  ? 3.313   21.323  -8.057  1.00 1.00 ? 66  GLU A CG   5  
ATOM 8796  C CD   . GLU A 1 66  ? 3.481   22.737  -7.479  1.00 1.00 ? 66  GLU A CD   5  
ATOM 8797  O OE1  . GLU A 1 66  ? 3.840   23.665  -8.241  1.00 1.00 ? 66  GLU A OE1  5  
ATOM 8798  O OE2  . GLU A 1 66  ? 3.260   22.927  -6.258  1.00 1.00 ? 66  GLU A OE2  5  
ATOM 8799  H H    . GLU A 1 66  ? 3.585   19.476  -9.710  1.00 1.00 ? 66  GLU A H    5  
ATOM 8800  H HA   . GLU A 1 66  ? 1.381   19.107  -8.046  1.00 1.00 ? 66  GLU A HA   5  
ATOM 8801  H HB2  . GLU A 1 66  ? 1.786   21.755  -9.472  1.00 1.00 ? 66  GLU A HB2  5  
ATOM 8802  H HB3  . GLU A 1 66  ? 1.182   21.440  -7.845  1.00 1.00 ? 66  GLU A HB3  5  
ATOM 8803  H HG2  . GLU A 1 66  ? 3.515   20.574  -7.291  1.00 1.00 ? 66  GLU A HG2  5  
ATOM 8804  H HG3  . GLU A 1 66  ? 4.000   21.181  -8.894  1.00 1.00 ? 66  GLU A HG3  5  
ATOM 8805  N N    . ASP A 1 67  ? 0.438   20.055  -11.095 1.00 1.00 ? 67  ASP A N    5  
ATOM 8806  C CA   . ASP A 1 67  ? -0.692  20.144  -12.024 1.00 1.00 ? 67  ASP A CA   5  
ATOM 8807  C C    . ASP A 1 67  ? -1.341  18.767  -12.265 1.00 1.00 ? 67  ASP A C    5  
ATOM 8808  O O    . ASP A 1 67  ? -2.569  18.657  -12.279 1.00 1.00 ? 67  ASP A O    5  
ATOM 8809  C CB   . ASP A 1 67  ? -0.239  20.768  -13.351 1.00 1.00 ? 67  ASP A CB   5  
ATOM 8810  C CG   . ASP A 1 67  ? -1.430  20.965  -14.306 1.00 1.00 ? 67  ASP A CG   5  
ATOM 8811  O OD1  . ASP A 1 67  ? -2.159  21.976  -14.149 1.00 1.00 ? 67  ASP A OD1  5  
ATOM 8812  O OD2  . ASP A 1 67  ? -1.633  20.111  -15.201 1.00 1.00 ? 67  ASP A OD2  5  
ATOM 8813  H H    . ASP A 1 67  ? 1.343   20.385  -11.395 1.00 1.00 ? 67  ASP A H    5  
ATOM 8814  H HA   . ASP A 1 67  ? -1.430  20.805  -11.567 1.00 1.00 ? 67  ASP A HA   5  
ATOM 8815  H HB2  . ASP A 1 67  ? 0.224   21.738  -13.151 1.00 1.00 ? 67  ASP A HB2  5  
ATOM 8816  H HB3  . ASP A 1 67  ? 0.502   20.124  -13.824 1.00 1.00 ? 67  ASP A HB3  5  
ATOM 8817  N N    . VAL A 1 68  ? -0.519  17.723  -12.414 1.00 1.00 ? 68  VAL A N    5  
ATOM 8818  C CA   . VAL A 1 68  ? -0.971  16.347  -12.654 1.00 1.00 ? 68  VAL A CA   5  
ATOM 8819  C C    . VAL A 1 68  ? -1.595  15.711  -11.404 1.00 1.00 ? 68  VAL A C    5  
ATOM 8820  O O    . VAL A 1 68  ? -2.650  15.088  -11.521 1.00 1.00 ? 68  VAL A O    5  
ATOM 8821  C CB   . VAL A 1 68  ? 0.163   15.469  -13.230 1.00 1.00 ? 68  VAL A CB   5  
ATOM 8822  C CG1  . VAL A 1 68  ? -0.180  13.968  -13.277 1.00 1.00 ? 68  VAL A CG1  5  
ATOM 8823  C CG2  . VAL A 1 68  ? 0.472   15.929  -14.663 1.00 1.00 ? 68  VAL A CG2  5  
ATOM 8824  H H    . VAL A 1 68  ? 0.479   17.920  -12.432 1.00 1.00 ? 68  VAL A H    5  
ATOM 8825  H HA   . VAL A 1 68  ? -1.743  16.411  -13.413 1.00 1.00 ? 68  VAL A HA   5  
ATOM 8826  H HB   . VAL A 1 68  ? 1.055   15.594  -12.608 1.00 1.00 ? 68  VAL A HB   5  
ATOM 8827  H HG11 . VAL A 1 68  ? 0.616   13.420  -13.778 1.00 1.00 ? 68  VAL A HG11 5  
ATOM 8828  H HG12 . VAL A 1 68  ? -0.278  13.575  -12.268 1.00 1.00 ? 68  VAL A HG12 5  
ATOM 8829  H HG13 . VAL A 1 68  ? -1.116  13.815  -13.818 1.00 1.00 ? 68  VAL A HG13 5  
ATOM 8830  H HG21 . VAL A 1 68  ? 1.212   15.277  -15.119 1.00 1.00 ? 68  VAL A HG21 5  
ATOM 8831  H HG22 . VAL A 1 68  ? -0.433  15.899  -15.274 1.00 1.00 ? 68  VAL A HG22 5  
ATOM 8832  H HG23 . VAL A 1 68  ? 0.863   16.941  -14.649 1.00 1.00 ? 68  VAL A HG23 5  
ATOM 8833  N N    . VAL A 1 69  ? -0.991  15.863  -10.217 1.00 1.00 ? 69  VAL A N    5  
ATOM 8834  C CA   . VAL A 1 69  ? -1.531  15.271  -8.988  1.00 1.00 ? 69  VAL A CA   5  
ATOM 8835  C C    . VAL A 1 69  ? -2.765  16.019  -8.460  1.00 1.00 ? 69  VAL A C    5  
ATOM 8836  O O    . VAL A 1 69  ? -3.663  15.383  -7.915  1.00 1.00 ? 69  VAL A O    5  
ATOM 8837  C CB   . VAL A 1 69  ? -0.457  15.132  -7.891  1.00 1.00 ? 69  VAL A CB   5  
ATOM 8838  C CG1  . VAL A 1 69  ? 0.710   14.245  -8.358  1.00 1.00 ? 69  VAL A CG1  5  
ATOM 8839  C CG2  . VAL A 1 69  ? 0.045   16.464  -7.316  1.00 1.00 ? 69  VAL A CG2  5  
ATOM 8840  H H    . VAL A 1 69  ? -0.104  16.357  -10.140 1.00 1.00 ? 69  VAL A H    5  
ATOM 8841  H HA   . VAL A 1 69  ? -1.839  14.259  -9.246  1.00 1.00 ? 69  VAL A HA   5  
ATOM 8842  H HB   . VAL A 1 69  ? -0.933  14.603  -7.079  1.00 1.00 ? 69  VAL A HB   5  
ATOM 8843  H HG11 . VAL A 1 69  ? 0.334   13.258  -8.622  1.00 1.00 ? 69  VAL A HG11 5  
ATOM 8844  H HG12 . VAL A 1 69  ? 1.207   14.673  -9.226  1.00 1.00 ? 69  VAL A HG12 5  
ATOM 8845  H HG13 . VAL A 1 69  ? 1.436   14.126  -7.554  1.00 1.00 ? 69  VAL A HG13 5  
ATOM 8846  H HG21 . VAL A 1 69  ? 0.876   16.288  -6.638  1.00 1.00 ? 69  VAL A HG21 5  
ATOM 8847  H HG22 . VAL A 1 69  ? 0.386   17.109  -8.116  1.00 1.00 ? 69  VAL A HG22 5  
ATOM 8848  H HG23 . VAL A 1 69  ? -0.754  16.963  -6.773  1.00 1.00 ? 69  VAL A HG23 5  
ATOM 8849  N N    . GLY A 1 70  ? -2.846  17.346  -8.647  1.00 1.00 ? 70  GLY A N    5  
ATOM 8850  C CA   . GLY A 1 70  ? -4.007  18.162  -8.270  1.00 1.00 ? 70  GLY A CA   5  
ATOM 8851  C C    . GLY A 1 70  ? -4.338  18.074  -6.777  1.00 1.00 ? 70  GLY A C    5  
ATOM 8852  O O    . GLY A 1 70  ? -3.448  18.142  -5.927  1.00 1.00 ? 70  GLY A O    5  
ATOM 8853  H H    . GLY A 1 70  ? -2.061  17.829  -9.077  1.00 1.00 ? 70  GLY A H    5  
ATOM 8854  H HA2  . GLY A 1 70  ? -3.822  19.205  -8.528  1.00 1.00 ? 70  GLY A HA2  5  
ATOM 8855  H HA3  . GLY A 1 70  ? -4.875  17.821  -8.836  1.00 1.00 ? 70  GLY A HA3  5  
ATOM 8856  N N    . GLY A 1 71  ? -5.630  17.897  -6.468  1.00 1.00 ? 71  GLY A N    5  
ATOM 8857  C CA   . GLY A 1 71  ? -6.145  17.667  -5.106  1.00 1.00 ? 71  GLY A CA   5  
ATOM 8858  C C    . GLY A 1 71  ? -6.141  16.195  -4.664  1.00 1.00 ? 71  GLY A C    5  
ATOM 8859  O O    . GLY A 1 71  ? -6.573  15.895  -3.550  1.00 1.00 ? 71  GLY A O    5  
ATOM 8860  H H    . GLY A 1 71  ? -6.305  17.909  -7.220  1.00 1.00 ? 71  GLY A H    5  
ATOM 8861  H HA2  . GLY A 1 71  ? -5.544  18.229  -4.390  1.00 1.00 ? 71  GLY A HA2  5  
ATOM 8862  H HA3  . GLY A 1 71  ? -7.174  18.021  -5.057  1.00 1.00 ? 71  GLY A HA3  5  
ATOM 8863  N N    . CYS A 1 72  ? -5.666  15.281  -5.519  1.00 1.00 ? 72  CYS A N    5  
ATOM 8864  C CA   . CYS A 1 72  ? -5.550  13.843  -5.235  1.00 1.00 ? 72  CYS A CA   5  
ATOM 8865  C C    . CYS A 1 72  ? -4.265  13.545  -4.433  1.00 1.00 ? 72  CYS A C    5  
ATOM 8866  O O    . CYS A 1 72  ? -3.238  14.211  -4.619  1.00 1.00 ? 72  CYS A O    5  
ATOM 8867  C CB   . CYS A 1 72  ? -5.587  13.071  -6.562  1.00 1.00 ? 72  CYS A CB   5  
ATOM 8868  S SG   . CYS A 1 72  ? -7.102  13.496  -7.484  1.00 1.00 ? 72  CYS A SG   5  
ATOM 8869  H H    . CYS A 1 72  ? -5.245  15.615  -6.374  1.00 1.00 ? 72  CYS A H    5  
ATOM 8870  H HA   . CYS A 1 72  ? -6.416  13.513  -4.655  1.00 1.00 ? 72  CYS A HA   5  
ATOM 8871  H HB2  . CYS A 1 72  ? -4.704  13.303  -7.159  1.00 1.00 ? 72  CYS A HB2  5  
ATOM 8872  H HB3  . CYS A 1 72  ? -5.575  11.999  -6.349  1.00 1.00 ? 72  CYS A HB3  5  
ATOM 8873  H HG   . CYS A 1 72  ? -6.913  14.828  -7.554  1.00 1.00 ? 72  CYS A HG   5  
ATOM 8874  N N    . CYS A 1 73  ? -4.301  12.527  -3.568  1.00 1.00 ? 73  CYS A N    5  
ATOM 8875  C CA   . CYS A 1 73  ? -3.129  12.072  -2.804  1.00 1.00 ? 73  CYS A CA   5  
ATOM 8876  C C    . CYS A 1 73  ? -2.133  11.332  -3.713  1.00 1.00 ? 73  CYS A C    5  
ATOM 8877  O O    . CYS A 1 73  ? -2.524  10.766  -4.732  1.00 1.00 ? 73  CYS A O    5  
ATOM 8878  C CB   . CYS A 1 73  ? -3.602  11.203  -1.621  1.00 1.00 ? 73  CYS A CB   5  
ATOM 8879  S SG   . CYS A 1 73  ? -4.646  12.188  -0.504  1.00 1.00 ? 73  CYS A SG   5  
ATOM 8880  H H    . CYS A 1 73  ? -5.162  12.006  -3.482  1.00 1.00 ? 73  CYS A H    5  
ATOM 8881  H HA   . CYS A 1 73  ? -2.611  12.946  -2.402  1.00 1.00 ? 73  CYS A HA   5  
ATOM 8882  H HB2  . CYS A 1 73  ? -4.165  10.343  -1.987  1.00 1.00 ? 73  CYS A HB2  5  
ATOM 8883  H HB3  . CYS A 1 73  ? -2.735  10.832  -1.063  1.00 1.00 ? 73  CYS A HB3  5  
ATOM 8884  H HG   . CYS A 1 73  ? -4.920  11.218  0.390   1.00 1.00 ? 73  CYS A HG   5  
ATOM 8885  N N    . TYR A 1 74  ? -0.852  11.280  -3.338  1.00 1.00 ? 74  TYR A N    5  
ATOM 8886  C CA   . TYR A 1 74  ? 0.192   10.621  -4.143  1.00 1.00 ? 74  TYR A CA   5  
ATOM 8887  C C    . TYR A 1 74  ? 1.433   10.176  -3.342  1.00 1.00 ? 74  TYR A C    5  
ATOM 8888  O O    . TYR A 1 74  ? 1.671   10.644  -2.226  1.00 1.00 ? 74  TYR A O    5  
ATOM 8889  C CB   . TYR A 1 74  ? 0.585   11.511  -5.341  1.00 1.00 ? 74  TYR A CB   5  
ATOM 8890  C CG   . TYR A 1 74  ? 1.381   12.755  -4.980  1.00 1.00 ? 74  TYR A CG   5  
ATOM 8891  C CD1  . TYR A 1 74  ? 0.717   13.918  -4.541  1.00 1.00 ? 74  TYR A CD1  5  
ATOM 8892  C CD2  . TYR A 1 74  ? 2.786   12.748  -5.089  1.00 1.00 ? 74  TYR A CD2  5  
ATOM 8893  C CE1  . TYR A 1 74  ? 1.454   15.067  -4.199  1.00 1.00 ? 74  TYR A CE1  5  
ATOM 8894  C CE2  . TYR A 1 74  ? 3.528   13.895  -4.753  1.00 1.00 ? 74  TYR A CE2  5  
ATOM 8895  C CZ   . TYR A 1 74  ? 2.865   15.060  -4.309  1.00 1.00 ? 74  TYR A CZ   5  
ATOM 8896  O OH   . TYR A 1 74  ? 3.588   16.170  -3.988  1.00 1.00 ? 74  TYR A OH   5  
ATOM 8897  H H    . TYR A 1 74  ? -0.573  11.735  -2.480  1.00 1.00 ? 74  TYR A H    5  
ATOM 8898  H HA   . TYR A 1 74  ? -0.246  9.710   -4.544  1.00 1.00 ? 74  TYR A HA   5  
ATOM 8899  H HB2  . TYR A 1 74  ? 1.171   10.917  -6.042  1.00 1.00 ? 74  TYR A HB2  5  
ATOM 8900  H HB3  . TYR A 1 74  ? -0.314  11.817  -5.872  1.00 1.00 ? 74  TYR A HB3  5  
ATOM 8901  H HD1  . TYR A 1 74  ? -0.360  13.927  -4.463  1.00 1.00 ? 74  TYR A HD1  5  
ATOM 8902  H HD2  . TYR A 1 74  ? 3.305   11.863  -5.425  1.00 1.00 ? 74  TYR A HD2  5  
ATOM 8903  H HE1  . TYR A 1 74  ? 0.940   15.955  -3.857  1.00 1.00 ? 74  TYR A HE1  5  
ATOM 8904  H HE2  . TYR A 1 74  ? 4.606   13.891  -4.831  1.00 1.00 ? 74  TYR A HE2  5  
ATOM 8905  H HH   . TYR A 1 74  ? 3.044   16.913  -3.688  1.00 1.00 ? 74  TYR A HH   5  
ATOM 8906  N N    . ARG A 1 75  ? 2.226   9.272   -3.938  1.00 1.00 ? 75  ARG A N    5  
ATOM 8907  C CA   . ARG A 1 75  ? 3.453   8.678   -3.371  1.00 1.00 ? 75  ARG A CA   5  
ATOM 8908  C C    . ARG A 1 75  ? 4.349   8.085   -4.470  1.00 1.00 ? 75  ARG A C    5  
ATOM 8909  O O    . ARG A 1 75  ? 3.889   7.861   -5.586  1.00 1.00 ? 75  ARG A O    5  
ATOM 8910  C CB   . ARG A 1 75  ? 3.082   7.615   -2.308  1.00 1.00 ? 75  ARG A CB   5  
ATOM 8911  C CG   . ARG A 1 75  ? 2.316   6.406   -2.890  1.00 1.00 ? 75  ARG A CG   5  
ATOM 8912  C CD   . ARG A 1 75  ? 1.930   5.366   -1.828  1.00 1.00 ? 75  ARG A CD   5  
ATOM 8913  N NE   . ARG A 1 75  ? 0.870   5.856   -0.922  1.00 1.00 ? 75  ARG A NE   5  
ATOM 8914  C CZ   . ARG A 1 75  ? 0.181   5.125   -0.050  1.00 1.00 ? 75  ARG A CZ   5  
ATOM 8915  N NH1  . ARG A 1 75  ? 0.407   3.837   0.122   1.00 1.00 ? 75  ARG A NH1  5  
ATOM 8916  N NH2  . ARG A 1 75  ? -0.758  5.689   0.679   1.00 1.00 ? 75  ARG A NH2  5  
ATOM 8917  H H    . ARG A 1 75  ? 1.920   8.914   -4.843  1.00 1.00 ? 75  ARG A H    5  
ATOM 8918  H HA   . ARG A 1 75  ? 4.018   9.470   -2.875  1.00 1.00 ? 75  ARG A HA   5  
ATOM 8919  H HB2  . ARG A 1 75  ? 3.993   7.251   -1.830  1.00 1.00 ? 75  ARG A HB2  5  
ATOM 8920  H HB3  . ARG A 1 75  ? 2.480   8.089   -1.535  1.00 1.00 ? 75  ARG A HB3  5  
ATOM 8921  H HG2  . ARG A 1 75  ? 1.410   6.745   -3.395  1.00 1.00 ? 75  ARG A HG2  5  
ATOM 8922  H HG3  . ARG A 1 75  ? 2.946   5.908   -3.626  1.00 1.00 ? 75  ARG A HG3  5  
ATOM 8923  H HD2  . ARG A 1 75  ? 1.573   4.474   -2.347  1.00 1.00 ? 75  ARG A HD2  5  
ATOM 8924  H HD3  . ARG A 1 75  ? 2.813   5.091   -1.250  1.00 1.00 ? 75  ARG A HD3  5  
ATOM 8925  H HE   . ARG A 1 75  ? 0.642   6.839   -0.970  1.00 1.00 ? 75  ARG A HE   5  
ATOM 8926  H HH11 . ARG A 1 75  ? 1.128   3.373   -0.404  1.00 1.00 ? 75  ARG A HH11 5  
ATOM 8927  H HH12 . ARG A 1 75  ? -0.131  3.301   0.788   1.00 1.00 ? 75  ARG A HH12 5  
ATOM 8928  H HH21 . ARG A 1 75  ? -0.969  6.668   0.585   1.00 1.00 ? 75  ARG A HH21 5  
ATOM 8929  H HH22 . ARG A 1 75  ? -1.284  5.142   1.346   1.00 1.00 ? 75  ARG A HH22 5  
ATOM 8930  N N    . VAL A 1 76  ? 5.607   7.780   -4.159  1.00 1.00 ? 76  VAL A N    5  
ATOM 8931  C CA   . VAL A 1 76  ? 6.514   7.009   -5.033  1.00 1.00 ? 76  VAL A CA   5  
ATOM 8932  C C    . VAL A 1 76  ? 6.268   5.510   -4.804  1.00 1.00 ? 76  VAL A C    5  
ATOM 8933  O O    . VAL A 1 76  ? 6.095   5.082   -3.662  1.00 1.00 ? 76  VAL A O    5  
ATOM 8934  C CB   . VAL A 1 76  ? 8.005   7.359   -4.784  1.00 1.00 ? 76  VAL A CB   5  
ATOM 8935  C CG1  . VAL A 1 76  ? 8.974   6.519   -5.636  1.00 1.00 ? 76  VAL A CG1  5  
ATOM 8936  C CG2  . VAL A 1 76  ? 8.264   8.843   -5.081  1.00 1.00 ? 76  VAL A CG2  5  
ATOM 8937  H H    . VAL A 1 76  ? 5.922   8.005   -3.212  1.00 1.00 ? 76  VAL A H    5  
ATOM 8938  H HA   . VAL A 1 76  ? 6.285   7.256   -6.068  1.00 1.00 ? 76  VAL A HA   5  
ATOM 8939  H HB   . VAL A 1 76  ? 8.240   7.174   -3.738  1.00 1.00 ? 76  VAL A HB   5  
ATOM 8940  H HG11 . VAL A 1 76  ? 8.919   5.467   -5.355  1.00 1.00 ? 76  VAL A HG11 5  
ATOM 8941  H HG12 . VAL A 1 76  ? 8.725   6.614   -6.695  1.00 1.00 ? 76  VAL A HG12 5  
ATOM 8942  H HG13 . VAL A 1 76  ? 9.997   6.856   -5.478  1.00 1.00 ? 76  VAL A HG13 5  
ATOM 8943  H HG21 . VAL A 1 76  ? 7.644   9.478   -4.450  1.00 1.00 ? 76  VAL A HG21 5  
ATOM 8944  H HG22 . VAL A 1 76  ? 9.305   9.085   -4.881  1.00 1.00 ? 76  VAL A HG22 5  
ATOM 8945  H HG23 . VAL A 1 76  ? 8.039   9.050   -6.128  1.00 1.00 ? 76  VAL A HG23 5  
ATOM 8946  N N    . ASN A 1 77  ? 6.283   4.709   -5.875  1.00 1.00 ? 77  ASN A N    5  
ATOM 8947  C CA   . ASN A 1 77  ? 6.133   3.250   -5.822  1.00 1.00 ? 77  ASN A CA   5  
ATOM 8948  C C    . ASN A 1 77  ? 6.964   2.549   -6.918  1.00 1.00 ? 77  ASN A C    5  
ATOM 8949  O O    . ASN A 1 77  ? 6.434   2.051   -7.912  1.00 1.00 ? 77  ASN A O    5  
ATOM 8950  C CB   . ASN A 1 77  ? 4.636   2.872   -5.853  1.00 1.00 ? 77  ASN A CB   5  
ATOM 8951  C CG   . ASN A 1 77  ? 4.403   1.368   -5.682  1.00 1.00 ? 77  ASN A CG   5  
ATOM 8952  O OD1  . ASN A 1 77  ? 5.275   0.619   -5.250  1.00 1.00 ? 77  ASN A OD1  5  
ATOM 8953  N ND2  . ASN A 1 77  ? 3.222   0.875   -6.011  1.00 1.00 ? 77  ASN A ND2  5  
ATOM 8954  H H    . ASN A 1 77  ? 6.412   5.145   -6.787  1.00 1.00 ? 77  ASN A H    5  
ATOM 8955  H HA   . ASN A 1 77  ? 6.530   2.904   -4.866  1.00 1.00 ? 77  ASN A HA   5  
ATOM 8956  H HB2  . ASN A 1 77  ? 4.119   3.392   -5.043  1.00 1.00 ? 77  ASN A HB2  5  
ATOM 8957  H HB3  . ASN A 1 77  ? 4.196   3.199   -6.795  1.00 1.00 ? 77  ASN A HB3  5  
ATOM 8958  H HD21 . ASN A 1 77  ? 2.477   1.481   -6.359  1.00 1.00 ? 77  ASN A HD21 5  
ATOM 8959  H HD22 . ASN A 1 77  ? 3.058   -0.113  -5.904  1.00 1.00 ? 77  ASN A HD22 5  
ATOM 8960  N N    . ASN A 1 78  ? 8.289   2.500   -6.728  1.00 1.00 ? 78  ASN A N    5  
ATOM 8961  C CA   . ASN A 1 78  ? 9.230   1.794   -7.608  1.00 1.00 ? 78  ASN A CA   5  
ATOM 8962  C C    . ASN A 1 78  ? 9.173   0.266   -7.381  1.00 1.00 ? 78  ASN A C    5  
ATOM 8963  O O    . ASN A 1 78  ? 10.103  -0.337  -6.847  1.00 1.00 ? 78  ASN A O    5  
ATOM 8964  C CB   . ASN A 1 78  ? 10.659  2.347   -7.395  1.00 1.00 ? 78  ASN A CB   5  
ATOM 8965  C CG   . ASN A 1 78  ? 10.884  3.768   -7.904  1.00 1.00 ? 78  ASN A CG   5  
ATOM 8966  O OD1  . ASN A 1 78  ? 10.070  4.350   -8.607  1.00 1.00 ? 78  ASN A OD1  5  
ATOM 8967  N ND2  . ASN A 1 78  ? 12.025  4.348   -7.587  1.00 1.00 ? 78  ASN A ND2  5  
ATOM 8968  H H    . ASN A 1 78  ? 8.661   2.934   -5.892  1.00 1.00 ? 78  ASN A H    5  
ATOM 8969  H HA   . ASN A 1 78  ? 8.947   1.975   -8.648  1.00 1.00 ? 78  ASN A HA   5  
ATOM 8970  H HB2  . ASN A 1 78  ? 10.909  2.305   -6.334  1.00 1.00 ? 78  ASN A HB2  5  
ATOM 8971  H HB3  . ASN A 1 78  ? 11.370  1.708   -7.921  1.00 1.00 ? 78  ASN A HB3  5  
ATOM 8972  H HD21 . ASN A 1 78  ? 12.698  3.869   -7.009  1.00 1.00 ? 78  ASN A HD21 5  
ATOM 8973  H HD22 . ASN A 1 78  ? 12.228  5.277   -7.953  1.00 1.00 ? 78  ASN A HD22 5  
ATOM 8974  N N    . SER A 1 79  ? 8.081   -0.382  -7.786  1.00 1.00 ? 79  SER A N    5  
ATOM 8975  C CA   . SER A 1 79  ? 7.852   -1.826  -7.603  1.00 1.00 ? 79  SER A CA   5  
ATOM 8976  C C    . SER A 1 79  ? 8.911   -2.705  -8.294  1.00 1.00 ? 79  SER A C    5  
ATOM 8977  O O    . SER A 1 79  ? 9.300   -3.751  -7.765  1.00 1.00 ? 79  SER A O    5  
ATOM 8978  C CB   . SER A 1 79  ? 6.453   -2.169  -8.141  1.00 1.00 ? 79  SER A CB   5  
ATOM 8979  O OG   . SER A 1 79  ? 6.301   -1.700  -9.478  1.00 1.00 ? 79  SER A OG   5  
ATOM 8980  H H    . SER A 1 79  ? 7.326   0.149   -8.207  1.00 1.00 ? 79  SER A H    5  
ATOM 8981  H HA   . SER A 1 79  ? 7.877   -2.060  -6.540  1.00 1.00 ? 79  SER A HA   5  
ATOM 8982  H HB2  . SER A 1 79  ? 6.304   -3.251  -8.108  1.00 1.00 ? 79  SER A HB2  5  
ATOM 8983  H HB3  . SER A 1 79  ? 5.701   -1.691  -7.509  1.00 1.00 ? 79  SER A HB3  5  
ATOM 8984  H HG   . SER A 1 79  ? 5.410   -1.934  -9.808  1.00 1.00 ? 79  SER A HG   5  
ATOM 8985  N N    . LEU A 1 80  ? 9.430   -2.255  -9.447  1.00 1.00 ? 80  LEU A N    5  
ATOM 8986  C CA   . LEU A 1 80  ? 10.403  -2.993  -10.260 1.00 1.00 ? 80  LEU A CA   5  
ATOM 8987  C C    . LEU A 1 80  ? 11.809  -3.070  -9.640  1.00 1.00 ? 80  LEU A C    5  
ATOM 8988  O O    . LEU A 1 80  ? 12.630  -3.855  -10.104 1.00 1.00 ? 80  LEU A O    5  
ATOM 8989  C CB   . LEU A 1 80  ? 10.468  -2.410  -11.683 1.00 1.00 ? 80  LEU A CB   5  
ATOM 8990  C CG   . LEU A 1 80  ? 9.122   -2.210  -12.413 1.00 1.00 ? 80  LEU A CG   5  
ATOM 8991  C CD1  . LEU A 1 80  ? 9.407   -1.718  -13.839 1.00 1.00 ? 80  LEU A CD1  5  
ATOM 8992  C CD2  . LEU A 1 80  ? 8.276   -3.489  -12.455 1.00 1.00 ? 80  LEU A CD2  5  
ATOM 8993  H H    . LEU A 1 80  ? 9.039   -1.406  -9.825  1.00 1.00 ? 80  LEU A H    5  
ATOM 8994  H HA   . LEU A 1 80  ? 10.050  -4.020  -10.336 1.00 1.00 ? 80  LEU A HA   5  
ATOM 8995  H HB2  . LEU A 1 80  ? 10.989  -1.451  -11.645 1.00 1.00 ? 80  LEU A HB2  5  
ATOM 8996  H HB3  . LEU A 1 80  ? 11.080  -3.096  -12.274 1.00 1.00 ? 80  LEU A HB3  5  
ATOM 8997  H HG   . LEU A 1 80  ? 8.545   -1.437  -11.902 1.00 1.00 ? 80  LEU A HG   5  
ATOM 8998  H HD11 . LEU A 1 80  ? 9.996   -2.457  -14.382 1.00 1.00 ? 80  LEU A HD11 5  
ATOM 8999  H HD12 . LEU A 1 80  ? 8.472   -1.550  -14.371 1.00 1.00 ? 80  LEU A HD12 5  
ATOM 9000  H HD13 . LEU A 1 80  ? 9.962   -0.781  -13.799 1.00 1.00 ? 80  LEU A HD13 5  
ATOM 9001  H HD21 . LEU A 1 80  ? 7.978   -3.768  -11.443 1.00 1.00 ? 80  LEU A HD21 5  
ATOM 9002  H HD22 . LEU A 1 80  ? 7.373   -3.315  -13.040 1.00 1.00 ? 80  LEU A HD22 5  
ATOM 9003  H HD23 . LEU A 1 80  ? 8.841   -4.306  -12.904 1.00 1.00 ? 80  LEU A HD23 5  
ATOM 9004  N N    . ASP A 1 81  ? 12.076  -2.322  -8.564  1.00 1.00 ? 81  ASP A N    5  
ATOM 9005  C CA   . ASP A 1 81  ? 13.298  -2.442  -7.746  1.00 1.00 ? 81  ASP A CA   5  
ATOM 9006  C C    . ASP A 1 81  ? 13.524  -3.881  -7.246  1.00 1.00 ? 81  ASP A C    5  
ATOM 9007  O O    . ASP A 1 81  ? 14.655  -4.355  -7.138  1.00 1.00 ? 81  ASP A O    5  
ATOM 9008  C CB   . ASP A 1 81  ? 13.142  -1.533  -6.521  1.00 1.00 ? 81  ASP A CB   5  
ATOM 9009  C CG   . ASP A 1 81  ? 14.421  -1.488  -5.667  1.00 1.00 ? 81  ASP A CG   5  
ATOM 9010  O OD1  . ASP A 1 81  ? 15.429  -0.896  -6.120  1.00 1.00 ? 81  ASP A OD1  5  
ATOM 9011  O OD2  . ASP A 1 81  ? 14.409  -2.033  -4.537  1.00 1.00 ? 81  ASP A OD2  5  
ATOM 9012  H H    . ASP A 1 81  ? 11.353  -1.691  -8.236  1.00 1.00 ? 81  ASP A H    5  
ATOM 9013  H HA   . ASP A 1 81  ? 14.165  -2.126  -8.327  1.00 1.00 ? 81  ASP A HA   5  
ATOM 9014  H HB2  . ASP A 1 81  ? 12.900  -0.520  -6.845  1.00 1.00 ? 81  ASP A HB2  5  
ATOM 9015  H HB3  . ASP A 1 81  ? 12.309  -1.917  -5.919  1.00 1.00 ? 81  ASP A HB3  5  
ATOM 9016  N N    . HIS A 1 82  ? 12.421  -4.576  -6.958  1.00 1.00 ? 82  HIS A N    5  
ATOM 9017  C CA   . HIS A 1 82  ? 12.392  -5.969  -6.523  1.00 1.00 ? 82  HIS A CA   5  
ATOM 9018  C C    . HIS A 1 82  ? 12.634  -6.966  -7.687  1.00 1.00 ? 82  HIS A C    5  
ATOM 9019  O O    . HIS A 1 82  ? 12.930  -8.143  -7.454  1.00 1.00 ? 82  HIS A O    5  
ATOM 9020  C CB   . HIS A 1 82  ? 11.018  -6.159  -5.863  1.00 1.00 ? 82  HIS A CB   5  
ATOM 9021  C CG   . HIS A 1 82  ? 10.784  -7.521  -5.258  1.00 1.00 ? 82  HIS A CG   5  
ATOM 9022  N ND1  . HIS A 1 82  ? 10.204  -8.596  -5.892  1.00 1.00 ? 82  HIS A ND1  5  
ATOM 9023  C CD2  . HIS A 1 82  ? 11.084  -7.920  -3.982  1.00 1.00 ? 82  HIS A CD2  5  
ATOM 9024  C CE1  . HIS A 1 82  ? 10.164  -9.620  -5.023  1.00 1.00 ? 82  HIS A CE1  5  
ATOM 9025  N NE2  . HIS A 1 82  ? 10.688  -9.257  -3.834  1.00 1.00 ? 82  HIS A NE2  5  
ATOM 9026  H H    . HIS A 1 82  ? 11.535  -4.101  -7.088  1.00 1.00 ? 82  HIS A H    5  
ATOM 9027  H HA   . HIS A 1 82  ? 13.173  -6.133  -5.778  1.00 1.00 ? 82  HIS A HA   5  
ATOM 9028  H HB2  . HIS A 1 82  ? 10.909  -5.397  -5.082  1.00 1.00 ? 82  HIS A HB2  5  
ATOM 9029  H HB3  . HIS A 1 82  ? 10.242  -5.977  -6.610  1.00 1.00 ? 82  HIS A HB3  5  
ATOM 9030  H HD1  . HIS A 1 82  ? 9.896   -8.623  -6.868  1.00 1.00 ? 82  HIS A HD1  5  
ATOM 9031  H HD2  . HIS A 1 82  ? 11.547  -7.299  -3.222  1.00 1.00 ? 82  HIS A HD2  5  
ATOM 9032  H HE1  . HIS A 1 82  ? 9.764   -10.602 -5.254  1.00 1.00 ? 82  HIS A HE1  5  
ATOM 9033  N N    . GLU A 1 83  ? 12.527  -6.501  -8.939  1.00 1.00 ? 83  GLU A N    5  
ATOM 9034  C CA   . GLU A 1 83  ? 12.515  -7.325  -10.148 1.00 1.00 ? 83  GLU A CA   5  
ATOM 9035  C C    . GLU A 1 83  ? 13.844  -7.268  -10.913 1.00 1.00 ? 83  GLU A C    5  
ATOM 9036  O O    . GLU A 1 83  ? 14.388  -8.315  -11.274 1.00 1.00 ? 83  GLU A O    5  
ATOM 9037  C CB   . GLU A 1 83  ? 11.355  -6.891  -11.064 1.00 1.00 ? 83  GLU A CB   5  
ATOM 9038  C CG   . GLU A 1 83  ? 9.967   -6.993  -10.408 1.00 1.00 ? 83  GLU A CG   5  
ATOM 9039  C CD   . GLU A 1 83  ? 9.666   -8.402  -9.870  1.00 1.00 ? 83  GLU A CD   5  
ATOM 9040  O OE1  . GLU A 1 83  ? 9.596   -9.363  -10.674 1.00 1.00 ? 83  GLU A OE1  5  
ATOM 9041  O OE2  . GLU A 1 83  ? 9.470   -8.556  -8.639  1.00 1.00 ? 83  GLU A OE2  5  
ATOM 9042  H H    . GLU A 1 83  ? 12.434  -5.502  -9.064  1.00 1.00 ? 83  GLU A H    5  
ATOM 9043  H HA   . GLU A 1 83  ? 12.346  -8.362  -9.870  1.00 1.00 ? 83  GLU A HA   5  
ATOM 9044  H HB2  . GLU A 1 83  ? 11.505  -5.858  -11.391 1.00 1.00 ? 83  GLU A HB2  5  
ATOM 9045  H HB3  . GLU A 1 83  ? 11.362  -7.528  -11.948 1.00 1.00 ? 83  GLU A HB3  5  
ATOM 9046  H HG2  . GLU A 1 83  ? 9.895   -6.264  -9.600  1.00 1.00 ? 83  GLU A HG2  5  
ATOM 9047  H HG3  . GLU A 1 83  ? 9.213   -6.726  -11.149 1.00 1.00 ? 83  GLU A HG3  5  
ATOM 9048  N N    . TYR A 1 84  ? 14.379  -6.064  -11.139 1.00 1.00 ? 84  TYR A N    5  
ATOM 9049  C CA   . TYR A 1 84  ? 15.577  -5.814  -11.962 1.00 1.00 ? 84  TYR A CA   5  
ATOM 9050  C C    . TYR A 1 84  ? 16.620  -4.909  -11.273 1.00 1.00 ? 84  TYR A C    5  
ATOM 9051  O O    . TYR A 1 84  ? 16.288  -4.089  -10.411 1.00 1.00 ? 84  TYR A O    5  
ATOM 9052  C CB   . TYR A 1 84  ? 15.164  -5.182  -13.309 1.00 1.00 ? 84  TYR A CB   5  
ATOM 9053  C CG   . TYR A 1 84  ? 13.905  -5.769  -13.925 1.00 1.00 ? 84  TYR A CG   5  
ATOM 9054  C CD1  . TYR A 1 84  ? 13.900  -7.092  -14.405 1.00 1.00 ? 84  TYR A CD1  5  
ATOM 9055  C CD2  . TYR A 1 84  ? 12.718  -5.014  -13.931 1.00 1.00 ? 84  TYR A CD2  5  
ATOM 9056  C CE1  . TYR A 1 84  ? 12.699  -7.672  -14.859 1.00 1.00 ? 84  TYR A CE1  5  
ATOM 9057  C CE2  . TYR A 1 84  ? 11.514  -5.587  -14.380 1.00 1.00 ? 84  TYR A CE2  5  
ATOM 9058  C CZ   . TYR A 1 84  ? 11.499  -6.925  -14.838 1.00 1.00 ? 84  TYR A CZ   5  
ATOM 9059  O OH   . TYR A 1 84  ? 10.335  -7.499  -15.257 1.00 1.00 ? 84  TYR A OH   5  
ATOM 9060  H H    . TYR A 1 84  ? 13.846  -5.261  -10.821 1.00 1.00 ? 84  TYR A H    5  
ATOM 9061  H HA   . TYR A 1 84  ? 16.059  -6.769  -12.178 1.00 1.00 ? 84  TYR A HA   5  
ATOM 9062  H HB2  . TYR A 1 84  ? 15.005  -4.113  -13.159 1.00 1.00 ? 84  TYR A HB2  5  
ATOM 9063  H HB3  . TYR A 1 84  ? 15.986  -5.289  -14.018 1.00 1.00 ? 84  TYR A HB3  5  
ATOM 9064  H HD1  . TYR A 1 84  ? 14.808  -7.680  -14.385 1.00 1.00 ? 84  TYR A HD1  5  
ATOM 9065  H HD2  . TYR A 1 84  ? 12.725  -3.999  -13.564 1.00 1.00 ? 84  TYR A HD2  5  
ATOM 9066  H HE1  . TYR A 1 84  ? 12.687  -8.693  -15.208 1.00 1.00 ? 84  TYR A HE1  5  
ATOM 9067  H HE2  . TYR A 1 84  ? 10.602  -5.010  -14.357 1.00 1.00 ? 84  TYR A HE2  5  
ATOM 9068  H HH   . TYR A 1 84  ? 9.573   -6.903  -15.206 1.00 1.00 ? 84  TYR A HH   5  
ATOM 9069  N N    . GLN A 1 85  ? 17.891  -5.017  -11.692 1.00 1.00 ? 85  GLN A N    5  
ATOM 9070  C CA   . GLN A 1 85  ? 18.950  -4.080  -11.300 1.00 1.00 ? 85  GLN A CA   5  
ATOM 9071  C C    . GLN A 1 85  ? 18.737  -2.717  -12.000 1.00 1.00 ? 85  GLN A C    5  
ATOM 9072  O O    . GLN A 1 85  ? 18.102  -2.698  -13.060 1.00 1.00 ? 85  GLN A O    5  
ATOM 9073  C CB   . GLN A 1 85  ? 20.337  -4.670  -11.627 1.00 1.00 ? 85  GLN A CB   5  
ATOM 9074  C CG   . GLN A 1 85  ? 20.717  -5.839  -10.699 1.00 1.00 ? 85  GLN A CG   5  
ATOM 9075  C CD   . GLN A 1 85  ? 20.889  -5.443  -9.227  1.00 1.00 ? 85  GLN A CD   5  
ATOM 9076  O OE1  . GLN A 1 85  ? 21.333  -4.354  -8.885  1.00 1.00 ? 85  GLN A OE1  5  
ATOM 9077  N NE2  . GLN A 1 85  ? 20.525  -6.296  -8.292  1.00 1.00 ? 85  GLN A NE2  5  
ATOM 9078  H H    . GLN A 1 85  ? 18.113  -5.706  -12.396 1.00 1.00 ? 85  GLN A H    5  
ATOM 9079  H HA   . GLN A 1 85  ? 18.874  -3.945  -10.224 1.00 1.00 ? 85  GLN A HA   5  
ATOM 9080  H HB2  . GLN A 1 85  ? 20.347  -5.016  -12.662 1.00 1.00 ? 85  GLN A HB2  5  
ATOM 9081  H HB3  . GLN A 1 85  ? 21.099  -3.892  -11.535 1.00 1.00 ? 85  GLN A HB3  5  
ATOM 9082  H HG2  . GLN A 1 85  ? 19.945  -6.606  -10.772 1.00 1.00 ? 85  GLN A HG2  5  
ATOM 9083  H HG3  . GLN A 1 85  ? 21.657  -6.267  -11.043 1.00 1.00 ? 85  GLN A HG3  5  
ATOM 9084  H HE21 . GLN A 1 85  ? 20.150  -7.201  -8.540  1.00 1.00 ? 85  GLN A HE21 5  
ATOM 9085  H HE22 . GLN A 1 85  ? 20.642  -6.030  -7.326  1.00 1.00 ? 85  GLN A HE22 5  
ATOM 9086  N N    . PRO A 1 86  ? 19.239  -1.589  -11.458 1.00 1.00 ? 86  PRO A N    5  
ATOM 9087  C CA   . PRO A 1 86  ? 18.910  -0.242  -11.931 1.00 1.00 ? 86  PRO A CA   5  
ATOM 9088  C C    . PRO A 1 86  ? 19.157  -0.003  -13.431 1.00 1.00 ? 86  PRO A C    5  
ATOM 9089  O O    . PRO A 1 86  ? 20.246  -0.264  -13.947 1.00 1.00 ? 86  PRO A O    5  
ATOM 9090  C CB   . PRO A 1 86  ? 19.735  0.724   -11.069 1.00 1.00 ? 86  PRO A CB   5  
ATOM 9091  C CG   . PRO A 1 86  ? 19.914  -0.050  -9.768  1.00 1.00 ? 86  PRO A CG   5  
ATOM 9092  C CD   . PRO A 1 86  ? 20.038  -1.494  -10.241 1.00 1.00 ? 86  PRO A CD   5  
ATOM 9093  H HA   . PRO A 1 86  ? 17.855  -0.070  -11.710 1.00 1.00 ? 86  PRO A HA   5  
ATOM 9094  H HB2  . PRO A 1 86  ? 20.717  0.899   -11.515 1.00 1.00 ? 86  PRO A HB2  5  
ATOM 9095  H HB3  . PRO A 1 86  ? 19.215  1.668   -10.906 1.00 1.00 ? 86  PRO A HB3  5  
ATOM 9096  H HG2  . PRO A 1 86  ? 20.801  0.270   -9.222  1.00 1.00 ? 86  PRO A HG2  5  
ATOM 9097  H HG3  . PRO A 1 86  ? 19.019  0.052   -9.151  1.00 1.00 ? 86  PRO A HG3  5  
ATOM 9098  H HD2  . PRO A 1 86  ? 21.082  -1.718  -10.474 1.00 1.00 ? 86  PRO A HD2  5  
ATOM 9099  H HD3  . PRO A 1 86  ? 19.683  -2.159  -9.454  1.00 1.00 ? 86  PRO A HD3  5  
ATOM 9100  N N    . ARG A 1 87  ? 18.138  0.538   -14.116 1.00 1.00 ? 87  ARG A N    5  
ATOM 9101  C CA   . ARG A 1 87  ? 18.236  1.043   -15.494 1.00 1.00 ? 87  ARG A CA   5  
ATOM 9102  C C    . ARG A 1 87  ? 19.036  2.372   -15.563 1.00 1.00 ? 87  ARG A C    5  
ATOM 9103  O O    . ARG A 1 87  ? 19.102  3.090   -14.560 1.00 1.00 ? 87  ARG A O    5  
ATOM 9104  C CB   . ARG A 1 87  ? 16.806  1.246   -16.040 1.00 1.00 ? 87  ARG A CB   5  
ATOM 9105  C CG   . ARG A 1 87  ? 16.185  0.023   -16.726 1.00 1.00 ? 87  ARG A CG   5  
ATOM 9106  C CD   . ARG A 1 87  ? 15.764  -1.163  -15.844 1.00 1.00 ? 87  ARG A CD   5  
ATOM 9107  N NE   . ARG A 1 87  ? 16.895  -2.044  -15.509 1.00 1.00 ? 87  ARG A NE   5  
ATOM 9108  C CZ   . ARG A 1 87  ? 17.483  -2.960  -16.274 1.00 1.00 ? 87  ARG A CZ   5  
ATOM 9109  N NH1  . ARG A 1 87  ? 17.114  -3.196  -17.516 1.00 1.00 ? 87  ARG A NH1  5  
ATOM 9110  N NH2  . ARG A 1 87  ? 18.472  -3.660  -15.768 1.00 1.00 ? 87  ARG A NH2  5  
ATOM 9111  H H    . ARG A 1 87  ? 17.259  0.695   -13.642 1.00 1.00 ? 87  ARG A H    5  
ATOM 9112  H HA   . ARG A 1 87  ? 18.747  0.292   -16.104 1.00 1.00 ? 87  ARG A HA   5  
ATOM 9113  H HB2  . ARG A 1 87  ? 16.143  1.574   -15.241 1.00 1.00 ? 87  ARG A HB2  5  
ATOM 9114  H HB3  . ARG A 1 87  ? 16.824  2.038   -16.792 1.00 1.00 ? 87  ARG A HB3  5  
ATOM 9115  H HG2  . ARG A 1 87  ? 15.287  0.394   -17.209 1.00 1.00 ? 87  ARG A HG2  5  
ATOM 9116  H HG3  . ARG A 1 87  ? 16.868  -0.327  -17.499 1.00 1.00 ? 87  ARG A HG3  5  
ATOM 9117  H HD2  . ARG A 1 87  ? 15.306  -0.788  -14.928 1.00 1.00 ? 87  ARG A HD2  5  
ATOM 9118  H HD3  . ARG A 1 87  ? 15.004  -1.744  -16.369 1.00 1.00 ? 87  ARG A HD3  5  
ATOM 9119  H HE   . ARG A 1 87  ? 17.233  -2.003  -14.549 1.00 1.00 ? 87  ARG A HE   5  
ATOM 9120  H HH11 . ARG A 1 87  ? 16.347  -2.693  -17.927 1.00 1.00 ? 87  ARG A HH11 5  
ATOM 9121  H HH12 . ARG A 1 87  ? 17.579  -3.908  -18.060 1.00 1.00 ? 87  ARG A HH12 5  
ATOM 9122  H HH21 . ARG A 1 87  ? 18.737  -3.498  -14.804 1.00 1.00 ? 87  ARG A HH21 5  
ATOM 9123  H HH22 . ARG A 1 87  ? 18.944  -4.366  -16.313 1.00 1.00 ? 87  ARG A HH22 5  
ATOM 9124  N N    . PRO A 1 88  ? 19.581  2.752   -16.742 1.00 1.00 ? 88  PRO A N    5  
ATOM 9125  C CA   . PRO A 1 88  ? 20.271  4.031   -16.939 1.00 1.00 ? 88  PRO A CA   5  
ATOM 9126  C C    . PRO A 1 88  ? 19.249  5.171   -17.055 1.00 1.00 ? 88  PRO A C    5  
ATOM 9127  O O    . PRO A 1 88  ? 18.530  5.274   -18.045 1.00 1.00 ? 88  PRO A O    5  
ATOM 9128  C CB   . PRO A 1 88  ? 21.121  3.841   -18.198 1.00 1.00 ? 88  PRO A CB   5  
ATOM 9129  C CG   . PRO A 1 88  ? 20.331  2.819   -19.015 1.00 1.00 ? 88  PRO A CG   5  
ATOM 9130  C CD   . PRO A 1 88  ? 19.621  1.961   -17.971 1.00 1.00 ? 88  PRO A CD   5  
ATOM 9131  H HA   . PRO A 1 88  ? 20.948  4.230   -16.107 1.00 1.00 ? 88  PRO A HA   5  
ATOM 9132  H HB2  . PRO A 1 88  ? 21.276  4.772   -18.746 1.00 1.00 ? 88  PRO A HB2  5  
ATOM 9133  H HB3  . PRO A 1 88  ? 22.085  3.407   -17.918 1.00 1.00 ? 88  PRO A HB3  5  
ATOM 9134  H HG2  . PRO A 1 88  ? 19.579  3.328   -19.609 1.00 1.00 ? 88  PRO A HG2  5  
ATOM 9135  H HG3  . PRO A 1 88  ? 20.982  2.224   -19.658 1.00 1.00 ? 88  PRO A HG3  5  
ATOM 9136  H HD2  . PRO A 1 88  ? 18.617  1.730   -18.333 1.00 1.00 ? 88  PRO A HD2  5  
ATOM 9137  H HD3  . PRO A 1 88  ? 20.190  1.046   -17.810 1.00 1.00 ? 88  PRO A HD3  5  
ATOM 9138  N N    . VAL A 1 89  ? 19.189  6.036   -16.038 1.00 1.00 ? 89  VAL A N    5  
ATOM 9139  C CA   . VAL A 1 89  ? 18.136  7.063   -15.856 1.00 1.00 ? 89  VAL A CA   5  
ATOM 9140  C C    . VAL A 1 89  ? 17.907  7.982   -17.060 1.00 1.00 ? 89  VAL A C    5  
ATOM 9141  O O    . VAL A 1 89  ? 16.756  8.277   -17.376 1.00 1.00 ? 89  VAL A O    5  
ATOM 9142  C CB   . VAL A 1 89  ? 18.385  7.879   -14.563 1.00 1.00 ? 89  VAL A CB   5  
ATOM 9143  C CG1  . VAL A 1 89  ? 19.686  8.705   -14.583 1.00 1.00 ? 89  VAL A CG1  5  
ATOM 9144  C CG2  . VAL A 1 89  ? 17.204  8.805   -14.262 1.00 1.00 ? 89  VAL A CG2  5  
ATOM 9145  H H    . VAL A 1 89  ? 19.804  5.854   -15.243 1.00 1.00 ? 89  VAL A H    5  
ATOM 9146  H HA   . VAL A 1 89  ? 17.204  6.516   -15.716 1.00 1.00 ? 89  VAL A HA   5  
ATOM 9147  H HB   . VAL A 1 89  ? 18.466  7.165   -13.746 1.00 1.00 ? 89  VAL A HB   5  
ATOM 9148  H HG11 . VAL A 1 89  ? 19.843  9.163   -13.605 1.00 1.00 ? 89  VAL A HG11 5  
ATOM 9149  H HG12 . VAL A 1 89  ? 20.538  8.064   -14.806 1.00 1.00 ? 89  VAL A HG12 5  
ATOM 9150  H HG13 . VAL A 1 89  ? 19.629  9.497   -15.330 1.00 1.00 ? 89  VAL A HG13 5  
ATOM 9151  H HG21 . VAL A 1 89  ? 17.334  9.235   -13.272 1.00 1.00 ? 89  VAL A HG21 5  
ATOM 9152  H HG22 . VAL A 1 89  ? 17.156  9.614   -14.993 1.00 1.00 ? 89  VAL A HG22 5  
ATOM 9153  H HG23 . VAL A 1 89  ? 16.274  8.236   -14.295 1.00 1.00 ? 89  VAL A HG23 5  
ATOM 9154  N N    . GLU A 1 90  ? 18.967  8.367   -17.781 1.00 1.00 ? 90  GLU A N    5  
ATOM 9155  C CA   . GLU A 1 90  ? 18.846  9.203   -18.984 1.00 1.00 ? 90  GLU A CA   5  
ATOM 9156  C C    . GLU A 1 90  ? 18.004  8.515   -20.068 1.00 1.00 ? 90  GLU A C    5  
ATOM 9157  O O    . GLU A 1 90  ? 17.201  9.159   -20.740 1.00 1.00 ? 90  GLU A O    5  
ATOM 9158  C CB   . GLU A 1 90  ? 20.237  9.609   -19.505 1.00 1.00 ? 90  GLU A CB   5  
ATOM 9159  C CG   . GLU A 1 90  ? 21.126  8.459   -19.998 1.00 1.00 ? 90  GLU A CG   5  
ATOM 9160  C CD   . GLU A 1 90  ? 22.527  8.976   -20.360 1.00 1.00 ? 90  GLU A CD   5  
ATOM 9161  O OE1  . GLU A 1 90  ? 22.753  9.369   -21.530 1.00 1.00 ? 90  GLU A OE1  5  
ATOM 9162  O OE2  . GLU A 1 90  ? 23.417  8.989   -19.474 1.00 1.00 ? 90  GLU A OE2  5  
ATOM 9163  H H    . GLU A 1 90  ? 19.895  8.130   -17.445 1.00 1.00 ? 90  GLU A H    5  
ATOM 9164  H HA   . GLU A 1 90  ? 18.327  10.118  -18.699 1.00 1.00 ? 90  GLU A HA   5  
ATOM 9165  H HB2  . GLU A 1 90  ? 20.100  10.311  -20.326 1.00 1.00 ? 90  GLU A HB2  5  
ATOM 9166  H HB3  . GLU A 1 90  ? 20.758  10.127  -18.701 1.00 1.00 ? 90  GLU A HB3  5  
ATOM 9167  H HG2  . GLU A 1 90  ? 21.212  7.696   -19.222 1.00 1.00 ? 90  GLU A HG2  5  
ATOM 9168  H HG3  . GLU A 1 90  ? 20.675  8.001   -20.879 1.00 1.00 ? 90  GLU A HG3  5  
ATOM 9169  N N    . VAL A 1 91  ? 18.111  7.188   -20.179 1.00 1.00 ? 91  VAL A N    5  
ATOM 9170  C CA   . VAL A 1 91  ? 17.347  6.387   -21.143 1.00 1.00 ? 91  VAL A CA   5  
ATOM 9171  C C    . VAL A 1 91  ? 15.896  6.219   -20.686 1.00 1.00 ? 91  VAL A C    5  
ATOM 9172  O O    . VAL A 1 91  ? 15.013  6.196   -21.532 1.00 1.00 ? 91  VAL A O    5  
ATOM 9173  C CB   . VAL A 1 91  ? 17.990  5.012   -21.442 1.00 1.00 ? 91  VAL A CB   5  
ATOM 9174  C CG1  . VAL A 1 91  ? 17.360  4.373   -22.687 1.00 1.00 ? 91  VAL A CG1  5  
ATOM 9175  C CG2  . VAL A 1 91  ? 19.509  5.107   -21.674 1.00 1.00 ? 91  VAL A CG2  5  
ATOM 9176  H H    . VAL A 1 91  ? 18.762  6.717   -19.559 1.00 1.00 ? 91  VAL A H    5  
ATOM 9177  H HA   . VAL A 1 91  ? 17.351  6.953   -22.070 1.00 1.00 ? 91  VAL A HA   5  
ATOM 9178  H HB   . VAL A 1 91  ? 17.814  4.353   -20.595 1.00 1.00 ? 91  VAL A HB   5  
ATOM 9179  H HG11 . VAL A 1 91  ? 17.436  5.055   -23.535 1.00 1.00 ? 91  VAL A HG11 5  
ATOM 9180  H HG12 . VAL A 1 91  ? 17.885  3.448   -22.927 1.00 1.00 ? 91  VAL A HG12 5  
ATOM 9181  H HG13 . VAL A 1 91  ? 16.312  4.138   -22.502 1.00 1.00 ? 91  VAL A HG13 5  
ATOM 9182  H HG21 . VAL A 1 91  ? 19.905  4.122   -21.920 1.00 1.00 ? 91  VAL A HG21 5  
ATOM 9183  H HG22 . VAL A 1 91  ? 19.724  5.804   -22.487 1.00 1.00 ? 91  VAL A HG22 5  
ATOM 9184  H HG23 . VAL A 1 91  ? 20.008  5.441   -20.764 1.00 1.00 ? 91  VAL A HG23 5  
ATOM 9185  N N    . ILE A 1 92  ? 15.612  6.174   -19.375 1.00 1.00 ? 92  ILE A N    5  
ATOM 9186  C CA   . ILE A 1 92  ? 14.222  6.144   -18.860 1.00 1.00 ? 92  ILE A CA   5  
ATOM 9187  C C    . ILE A 1 92  ? 13.501  7.452   -19.219 1.00 1.00 ? 92  ILE A C    5  
ATOM 9188  O O    . ILE A 1 92  ? 12.433  7.425   -19.818 1.00 1.00 ? 92  ILE A O    5  
ATOM 9189  C CB   . ILE A 1 92  ? 14.189  5.876   -17.331 1.00 1.00 ? 92  ILE A CB   5  
ATOM 9190  C CG1  . ILE A 1 92  ? 15.049  4.660   -16.916 1.00 1.00 ? 92  ILE A CG1  5  
ATOM 9191  C CG2  . ILE A 1 92  ? 12.725  5.661   -16.886 1.00 1.00 ? 92  ILE A CG2  5  
ATOM 9192  C CD1  . ILE A 1 92  ? 15.153  4.522   -15.394 1.00 1.00 ? 92  ILE A CD1  5  
ATOM 9193  H H    . ILE A 1 92  ? 16.387  6.161   -18.715 1.00 1.00 ? 92  ILE A H    5  
ATOM 9194  H HA   . ILE A 1 92  ? 13.680  5.337   -19.363 1.00 1.00 ? 92  ILE A HA   5  
ATOM 9195  H HB   . ILE A 1 92  ? 14.590  6.750   -16.809 1.00 1.00 ? 92  ILE A HB   5  
ATOM 9196  H HG12 . ILE A 1 92  ? 14.640  3.741   -17.341 1.00 1.00 ? 92  ILE A HG12 5  
ATOM 9197  H HG13 . ILE A 1 92  ? 16.062  4.783   -17.291 1.00 1.00 ? 92  ILE A HG13 5  
ATOM 9198  H HG21 . ILE A 1 92  ? 12.110  6.521   -17.151 1.00 1.00 ? 92  ILE A HG21 5  
ATOM 9199  H HG22 . ILE A 1 92  ? 12.310  4.772   -17.369 1.00 1.00 ? 92  ILE A HG22 5  
ATOM 9200  H HG23 . ILE A 1 92  ? 12.660  5.535   -15.806 1.00 1.00 ? 92  ILE A HG23 5  
ATOM 9201  H HD11 . ILE A 1 92  ? 15.363  5.489   -14.945 1.00 1.00 ? 92  ILE A HD11 5  
ATOM 9202  H HD12 . ILE A 1 92  ? 14.223  4.125   -14.987 1.00 1.00 ? 92  ILE A HD12 5  
ATOM 9203  H HD13 . ILE A 1 92  ? 15.970  3.849   -15.143 1.00 1.00 ? 92  ILE A HD13 5  
ATOM 9204  N N    . ILE A 1 93  ? 14.125  8.603   -18.938 1.00 1.00 ? 93  ILE A N    5  
ATOM 9205  C CA   . ILE A 1 93  ? 13.626  9.934   -19.321 1.00 1.00 ? 93  ILE A CA   5  
ATOM 9206  C C    . ILE A 1 93  ? 13.480  10.040  -20.847 1.00 1.00 ? 93  ILE A C    5  
ATOM 9207  O O    . ILE A 1 93  ? 12.492  10.575  -21.332 1.00 1.00 ? 93  ILE A O    5  
ATOM 9208  C CB   . ILE A 1 93  ? 14.596  10.992  -18.726 1.00 1.00 ? 93  ILE A CB   5  
ATOM 9209  C CG1  . ILE A 1 93  ? 14.630  11.168  -17.188 1.00 1.00 ? 93  ILE A CG1  5  
ATOM 9210  C CG2  . ILE A 1 93  ? 14.441  12.385  -19.368 1.00 1.00 ? 93  ILE A CG2  5  
ATOM 9211  C CD1  . ILE A 1 93  ? 13.813  10.210  -16.334 1.00 1.00 ? 93  ILE A CD1  5  
ATOM 9212  H H    . ILE A 1 93  ? 14.996  8.581   -18.411 1.00 1.00 ? 93  ILE A H    5  
ATOM 9213  H HA   . ILE A 1 93  ? 12.627  10.078  -18.912 1.00 1.00 ? 93  ILE A HA   5  
ATOM 9214  H HB   . ILE A 1 93  ? 15.594  10.631  -18.948 1.00 1.00 ? 93  ILE A HB   5  
ATOM 9215  H HG12 . ILE A 1 93  ? 15.665  11.008  -16.892 1.00 1.00 ? 93  ILE A HG12 5  
ATOM 9216  H HG13 . ILE A 1 93  ? 14.340  12.181  -16.915 1.00 1.00 ? 93  ILE A HG13 5  
ATOM 9217  H HG21 . ILE A 1 93  ? 14.678  12.347  -20.432 1.00 1.00 ? 93  ILE A HG21 5  
ATOM 9218  H HG22 . ILE A 1 93  ? 13.420  12.742  -19.233 1.00 1.00 ? 93  ILE A HG22 5  
ATOM 9219  H HG23 . ILE A 1 93  ? 15.135  13.091  -18.909 1.00 1.00 ? 93  ILE A HG23 5  
ATOM 9220  H HD11 . ILE A 1 93  ? 14.264  9.225   -16.423 1.00 1.00 ? 93  ILE A HD11 5  
ATOM 9221  H HD12 . ILE A 1 93  ? 13.851  10.542  -15.294 1.00 1.00 ? 93  ILE A HD12 5  
ATOM 9222  H HD13 . ILE A 1 93  ? 12.781  10.190  -16.667 1.00 1.00 ? 93  ILE A HD13 5  
ATOM 9223  N N    . SER A 1 94  ? 14.425  9.495   -21.614 1.00 1.00 ? 94  SER A N    5  
ATOM 9224  C CA   . SER A 1 94  ? 14.372  9.527   -23.082 1.00 1.00 ? 94  SER A CA   5  
ATOM 9225  C C    . SER A 1 94  ? 13.241  8.654   -23.634 1.00 1.00 ? 94  SER A C    5  
ATOM 9226  O O    . SER A 1 94  ? 12.543  9.045   -24.563 1.00 1.00 ? 94  SER A O    5  
ATOM 9227  C CB   . SER A 1 94  ? 15.717  9.100   -23.693 1.00 1.00 ? 94  SER A CB   5  
ATOM 9228  O OG   . SER A 1 94  ? 16.778  9.951   -23.284 1.00 1.00 ? 94  SER A OG   5  
ATOM 9229  H H    . SER A 1 94  ? 15.239  9.091   -21.167 1.00 1.00 ? 94  SER A H    5  
ATOM 9230  H HA   . SER A 1 94  ? 14.178  10.547  -23.389 1.00 1.00 ? 94  SER A HA   5  
ATOM 9231  H HB2  . SER A 1 94  ? 15.941  8.071   -23.406 1.00 1.00 ? 94  SER A HB2  5  
ATOM 9232  H HB3  . SER A 1 94  ? 15.634  9.138   -24.782 1.00 1.00 ? 94  SER A HB3  5  
ATOM 9233  H HG   . SER A 1 94  ? 17.011  9.735   -22.355 1.00 1.00 ? 94  SER A HG   5  
ATOM 9234  N N    . SER A 1 95  ? 13.006  7.491   -23.028 1.00 1.00 ? 95  SER A N    5  
ATOM 9235  C CA   . SER A 1 95  ? 11.907  6.584   -23.363 1.00 1.00 ? 95  SER A CA   5  
ATOM 9236  C C    . SER A 1 95  ? 10.552  7.250   -23.096 1.00 1.00 ? 95  SER A C    5  
ATOM 9237  O O    . SER A 1 95  ? 9.662   7.219   -23.946 1.00 1.00 ? 95  SER A O    5  
ATOM 9238  C CB   . SER A 1 95  ? 12.044  5.288   -22.552 1.00 1.00 ? 95  SER A CB   5  
ATOM 9239  O OG   . SER A 1 95  ? 13.171  4.536   -22.992 1.00 1.00 ? 95  SER A OG   5  
ATOM 9240  H H    . SER A 1 95  ? 13.599  7.244   -22.247 1.00 1.00 ? 95  SER A H    5  
ATOM 9241  H HA   . SER A 1 95  ? 11.957  6.330   -24.420 1.00 1.00 ? 95  SER A HA   5  
ATOM 9242  H HB2  . SER A 1 95  ? 12.169  5.540   -21.496 1.00 1.00 ? 95  SER A HB2  5  
ATOM 9243  H HB3  . SER A 1 95  ? 11.144  4.686   -22.676 1.00 1.00 ? 95  SER A HB3  5  
ATOM 9244  H HG   . SER A 1 95  ? 13.976  5.080   -22.897 1.00 1.00 ? 95  SER A HG   5  
ATOM 9245  N N    . ALA A 1 96  ? 10.408  7.932   -21.951 1.00 1.00 ? 96  ALA A N    5  
ATOM 9246  C CA   . ALA A 1 96  ? 9.232   8.733   -21.636 1.00 1.00 ? 96  ALA A CA   5  
ATOM 9247  C C    . ALA A 1 96  ? 9.021   9.842   -22.684 1.00 1.00 ? 96  ALA A C    5  
ATOM 9248  O O    . ALA A 1 96  ? 7.937   9.959   -23.264 1.00 1.00 ? 96  ALA A O    5  
ATOM 9249  C CB   . ALA A 1 96  ? 9.434   9.254   -20.201 1.00 1.00 ? 96  ALA A CB   5  
ATOM 9250  H H    . ALA A 1 96  ? 11.167  7.935   -21.271 1.00 1.00 ? 96  ALA A H    5  
ATOM 9251  H HA   . ALA A 1 96  ? 8.352   8.088   -21.661 1.00 1.00 ? 96  ALA A HA   5  
ATOM 9252  H HB1  . ALA A 1 96  ? 9.688   8.423   -19.536 1.00 1.00 ? 96  ALA A HB1  5  
ATOM 9253  H HB2  . ALA A 1 96  ? 10.243  9.985   -20.167 1.00 1.00 ? 96  ALA A HB2  5  
ATOM 9254  H HB3  . ALA A 1 96  ? 8.519   9.712   -19.832 1.00 1.00 ? 96  ALA A HB3  5  
ATOM 9255  N N    . LYS A 1 97  ? 10.064  10.616  -23.004 1.00 1.00 ? 97  LYS A N    5  
ATOM 9256  C CA   . LYS A 1 97  ? 9.997   11.685  -24.008 1.00 1.00 ? 97  LYS A CA   5  
ATOM 9257  C C    . LYS A 1 97  ? 9.657   11.171  -25.418 1.00 1.00 ? 97  LYS A C    5  
ATOM 9258  O O    . LYS A 1 97  ? 8.871   11.804  -26.121 1.00 1.00 ? 97  LYS A O    5  
ATOM 9259  C CB   . LYS A 1 97  ? 11.330  12.447  -24.014 1.00 1.00 ? 97  LYS A CB   5  
ATOM 9260  C CG   . LYS A 1 97  ? 11.478  13.364  -22.790 1.00 1.00 ? 97  LYS A CG   5  
ATOM 9261  C CD   . LYS A 1 97  ? 12.900  13.931  -22.756 1.00 1.00 ? 97  LYS A CD   5  
ATOM 9262  C CE   . LYS A 1 97  ? 13.038  15.016  -21.677 1.00 1.00 ? 97  LYS A CE   5  
ATOM 9263  N NZ   . LYS A 1 97  ? 14.377  15.676  -21.717 1.00 1.00 ? 97  LYS A NZ   5  
ATOM 9264  H H    . LYS A 1 97  ? 10.951  10.474  -22.521 1.00 1.00 ? 97  LYS A H    5  
ATOM 9265  H HA   . LYS A 1 97  ? 9.201   12.367  -23.731 1.00 1.00 ? 97  LYS A HA   5  
ATOM 9266  H HB2  . LYS A 1 97  ? 12.152  11.731  -24.050 1.00 1.00 ? 97  LYS A HB2  5  
ATOM 9267  H HB3  . LYS A 1 97  ? 11.379  13.066  -24.910 1.00 1.00 ? 97  LYS A HB3  5  
ATOM 9268  H HG2  . LYS A 1 97  ? 10.757  14.180  -22.868 1.00 1.00 ? 97  LYS A HG2  5  
ATOM 9269  H HG3  . LYS A 1 97  ? 11.286  12.814  -21.869 1.00 1.00 ? 97  LYS A HG3  5  
ATOM 9270  H HD2  . LYS A 1 97  ? 13.588  13.105  -22.555 1.00 1.00 ? 97  LYS A HD2  5  
ATOM 9271  H HD3  . LYS A 1 97  ? 13.136  14.359  -23.732 1.00 1.00 ? 97  LYS A HD3  5  
ATOM 9272  H HE2  . LYS A 1 97  ? 12.257  15.770  -21.836 1.00 1.00 ? 97  LYS A HE2  5  
ATOM 9273  H HE3  . LYS A 1 97  ? 12.863  14.568  -20.693 1.00 1.00 ? 97  LYS A HE3  5  
ATOM 9274  H HZ1  . LYS A 1 97  ? 14.458  16.383  -20.994 1.00 1.00 ? 97  LYS A HZ1  5  
ATOM 9275  H HZ2  . LYS A 1 97  ? 15.131  15.012  -21.585 1.00 1.00 ? 97  LYS A HZ2  5  
ATOM 9276  H HZ3  . LYS A 1 97  ? 14.528  16.140  -22.606 1.00 1.00 ? 97  LYS A HZ3  5  
ATOM 9277  N N    . GLU A 1 98  ? 10.189  10.011  -25.808 1.00 1.00 ? 98  GLU A N    5  
ATOM 9278  C CA   . GLU A 1 98  ? 9.857   9.351   -27.074 1.00 1.00 ? 98  GLU A CA   5  
ATOM 9279  C C    . GLU A 1 98  ? 8.394   8.876   -27.119 1.00 1.00 ? 98  GLU A C    5  
ATOM 9280  O O    . GLU A 1 98  ? 7.759   8.920   -28.177 1.00 1.00 ? 98  GLU A O    5  
ATOM 9281  C CB   . GLU A 1 98  ? 10.805  8.169   -27.347 1.00 1.00 ? 98  GLU A CB   5  
ATOM 9282  C CG   . GLU A 1 98  ? 12.196  8.606   -27.828 1.00 1.00 ? 98  GLU A CG   5  
ATOM 9283  C CD   . GLU A 1 98  ? 12.149  9.235   -29.230 1.00 1.00 ? 98  GLU A CD   5  
ATOM 9284  O OE1  . GLU A 1 98  ? 12.049  8.489   -30.234 1.00 1.00 ? 98  GLU A OE1  5  
ATOM 9285  O OE2  . GLU A 1 98  ? 12.223  10.482  -29.345 1.00 1.00 ? 98  GLU A OE2  5  
ATOM 9286  H H    . GLU A 1 98  ? 10.886  9.589   -25.204 1.00 1.00 ? 98  GLU A H    5  
ATOM 9287  H HA   . GLU A 1 98  ? 9.978   10.080  -27.863 1.00 1.00 ? 98  GLU A HA   5  
ATOM 9288  H HB2  . GLU A 1 98  ? 10.905  7.572   -26.440 1.00 1.00 ? 98  GLU A HB2  5  
ATOM 9289  H HB3  . GLU A 1 98  ? 10.368  7.531   -28.116 1.00 1.00 ? 98  GLU A HB3  5  
ATOM 9290  H HG2  . GLU A 1 98  ? 12.626  9.315   -27.120 1.00 1.00 ? 98  GLU A HG2  5  
ATOM 9291  H HG3  . GLU A 1 98  ? 12.844  7.730   -27.852 1.00 1.00 ? 98  GLU A HG3  5  
ATOM 9292  N N    . MET A 1 99  ? 7.841   8.451   -25.977 1.00 1.00 ? 99  MET A N    5  
ATOM 9293  C CA   . MET A 1 99  ? 6.439   8.053   -25.860 1.00 1.00 ? 99  MET A CA   5  
ATOM 9294  C C    . MET A 1 99  ? 5.477   9.250   -25.857 1.00 1.00 ? 99  MET A C    5  
ATOM 9295  O O    . MET A 1 99  ? 4.427   9.156   -26.490 1.00 1.00 ? 99  MET A O    5  
ATOM 9296  C CB   . MET A 1 99  ? 6.245   7.123   -24.656 1.00 1.00 ? 99  MET A CB   5  
ATOM 9297  C CG   . MET A 1 99  ? 6.926   5.767   -24.914 1.00 1.00 ? 99  MET A CG   5  
ATOM 9298  S SD   . MET A 1 99  ? 6.162   4.711   -26.171 1.00 1.00 ? 99  MET A SD   5  
ATOM 9299  C CE   . MET A 1 99  ? 4.791   4.048   -25.191 1.00 1.00 ? 99  MET A CE   5  
ATOM 9300  H H    . MET A 1 99  ? 8.441   8.320   -25.172 1.00 1.00 ? 99  MET A H    5  
ATOM 9301  H HA   . MET A 1 99  ? 6.197   7.481   -26.747 1.00 1.00 ? 99  MET A HA   5  
ATOM 9302  H HB2  . MET A 1 99  ? 6.667   7.579   -23.760 1.00 1.00 ? 99  MET A HB2  5  
ATOM 9303  H HB3  . MET A 1 99  ? 5.181   6.965   -24.492 1.00 1.00 ? 99  MET A HB3  5  
ATOM 9304  H HG2  . MET A 1 99  ? 7.963   5.940   -25.211 1.00 1.00 ? 99  MET A HG2  5  
ATOM 9305  H HG3  . MET A 1 99  ? 6.962   5.205   -23.985 1.00 1.00 ? 99  MET A HG3  5  
ATOM 9306  H HE1  . MET A 1 99  ? 4.069   4.838   -24.993 1.00 1.00 ? 99  MET A HE1  5  
ATOM 9307  H HE2  . MET A 1 99  ? 4.298   3.248   -25.748 1.00 1.00 ? 99  MET A HE2  5  
ATOM 9308  H HE3  . MET A 1 99  ? 5.178   3.647   -24.250 1.00 1.00 ? 99  MET A HE3  5  
ATOM 9309  N N    . VAL A 1 100 ? 5.823   10.379  -25.222 1.00 1.00 ? 100 VAL A N    5  
ATOM 9310  C CA   . VAL A 1 100 ? 5.057   11.648  -25.336 1.00 1.00 ? 100 VAL A CA   5  
ATOM 9311  C C    . VAL A 1 100 ? 4.722   11.979  -26.797 1.00 1.00 ? 100 VAL A C    5  
ATOM 9312  O O    . VAL A 1 100 ? 5.590   11.973  -27.672 1.00 1.00 ? 100 VAL A O    5  
ATOM 9313  C CB   . VAL A 1 100 ? 5.752   12.852  -24.652 1.00 1.00 ? 100 VAL A CB   5  
ATOM 9314  C CG1  . VAL A 1 100 ? 5.067   14.204  -24.927 1.00 1.00 ? 100 VAL A CG1  5  
ATOM 9315  C CG2  . VAL A 1 100 ? 5.747   12.676  -23.131 1.00 1.00 ? 100 VAL A CG2  5  
ATOM 9316  H H    . VAL A 1 100 ? 6.653   10.339  -24.631 1.00 1.00 ? 100 VAL A H    5  
ATOM 9317  H HA   . VAL A 1 100 ? 4.111   11.493  -24.824 1.00 1.00 ? 100 VAL A HA   5  
ATOM 9318  H HB   . VAL A 1 100 ? 6.782   12.913  -24.991 1.00 1.00 ? 100 VAL A HB   5  
ATOM 9319  H HG11 . VAL A 1 100 ? 4.013   14.163  -24.648 1.00 1.00 ? 100 VAL A HG11 5  
ATOM 9320  H HG12 . VAL A 1 100 ? 5.552   14.992  -24.348 1.00 1.00 ? 100 VAL A HG12 5  
ATOM 9321  H HG13 . VAL A 1 100 ? 5.147   14.469  -25.982 1.00 1.00 ? 100 VAL A HG13 5  
ATOM 9322  H HG21 . VAL A 1 100 ? 6.337   13.470  -22.671 1.00 1.00 ? 100 VAL A HG21 5  
ATOM 9323  H HG22 . VAL A 1 100 ? 4.728   12.722  -22.750 1.00 1.00 ? 100 VAL A HG22 5  
ATOM 9324  H HG23 . VAL A 1 100 ? 6.179   11.716  -22.867 1.00 1.00 ? 100 VAL A HG23 5  
ATOM 9325  N N    . GLY A 1 101 ? 3.436   12.263  -27.035 1.00 1.00 ? 101 GLY A N    5  
ATOM 9326  C CA   . GLY A 1 101 ? 2.844   12.536  -28.348 1.00 1.00 ? 101 GLY A CA   5  
ATOM 9327  C C    . GLY A 1 101 ? 2.159   11.324  -28.989 1.00 1.00 ? 101 GLY A C    5  
ATOM 9328  O O    . GLY A 1 101 ? 1.369   11.508  -29.914 1.00 1.00 ? 101 GLY A O    5  
ATOM 9329  H H    . GLY A 1 101 ? 2.801   12.261  -26.242 1.00 1.00 ? 101 GLY A H    5  
ATOM 9330  H HA2  . GLY A 1 101 ? 2.084   13.311  -28.227 1.00 1.00 ? 101 GLY A HA2  5  
ATOM 9331  H HA3  . GLY A 1 101 ? 3.615   12.887  -29.037 1.00 1.00 ? 101 GLY A HA3  5  
ATOM 9332  N N    . GLN A 1 102 ? 2.426   10.100  -28.515 1.00 1.00 ? 102 GLN A N    5  
ATOM 9333  C CA   . GLN A 1 102 ? 1.809   8.879   -29.014 1.00 1.00 ? 102 GLN A CA   5  
ATOM 9334  C C    . GLN A 1 102 ? 0.433   8.645   -28.368 1.00 1.00 ? 102 GLN A C    5  
ATOM 9335  O O    . GLN A 1 102 ? 0.189   9.022   -27.219 1.00 1.00 ? 102 GLN A O    5  
ATOM 9336  C CB   . GLN A 1 102 ? 2.746   7.671   -28.822 1.00 1.00 ? 102 GLN A CB   5  
ATOM 9337  C CG   . GLN A 1 102 ? 4.091   7.842   -29.557 1.00 1.00 ? 102 GLN A CG   5  
ATOM 9338  C CD   . GLN A 1 102 ? 4.962   6.581   -29.523 1.00 1.00 ? 102 GLN A CD   5  
ATOM 9339  O OE1  . GLN A 1 102 ? 4.510   5.470   -29.775 1.00 1.00 ? 102 GLN A OE1  5  
ATOM 9340  N NE2  . GLN A 1 102 ? 6.244   6.695   -29.235 1.00 1.00 ? 102 GLN A NE2  5  
ATOM 9341  H H    . GLN A 1 102 ? 3.083   9.986   -27.760 1.00 1.00 ? 102 GLN A H    5  
ATOM 9342  H HA   . GLN A 1 102 ? 1.658   9.014   -30.080 1.00 1.00 ? 102 GLN A HA   5  
ATOM 9343  H HB2  . GLN A 1 102 ? 2.918   7.504   -27.758 1.00 1.00 ? 102 GLN A HB2  5  
ATOM 9344  H HB3  . GLN A 1 102 ? 2.246   6.786   -29.216 1.00 1.00 ? 102 GLN A HB3  5  
ATOM 9345  H HG2  . GLN A 1 102 ? 3.904   8.094   -30.602 1.00 1.00 ? 102 GLN A HG2  5  
ATOM 9346  H HG3  . GLN A 1 102 ? 4.643   8.668   -29.111 1.00 1.00 ? 102 GLN A HG3  5  
ATOM 9347  H HE21 . GLN A 1 102 ? 6.655   7.596   -29.001 1.00 1.00 ? 102 GLN A HE21 5  
ATOM 9348  H HE22 . GLN A 1 102 ? 6.801   5.856   -29.218 1.00 1.00 ? 102 GLN A HE22 5  
ATOM 9349  N N    . LYS A 1 103 ? -0.468  8.015   -29.125 1.00 1.00 ? 103 LYS A N    5  
ATOM 9350  C CA   . LYS A 1 103 ? -1.864  7.752   -28.739 1.00 1.00 ? 103 LYS A CA   5  
ATOM 9351  C C    . LYS A 1 103 ? -2.126  6.282   -28.356 1.00 1.00 ? 103 LYS A C    5  
ATOM 9352  O O    . LYS A 1 103 ? -1.406  5.377   -28.785 1.00 1.00 ? 103 LYS A O    5  
ATOM 9353  C CB   . LYS A 1 103 ? -2.797  8.206   -29.877 1.00 1.00 ? 103 LYS A CB   5  
ATOM 9354  C CG   . LYS A 1 103 ? -2.790  9.734   -30.047 1.00 1.00 ? 103 LYS A CG   5  
ATOM 9355  C CD   . LYS A 1 103 ? -3.716  10.170  -31.189 1.00 1.00 ? 103 LYS A CD   5  
ATOM 9356  C CE   . LYS A 1 103 ? -3.693  11.700  -31.320 1.00 1.00 ? 103 LYS A CE   5  
ATOM 9357  N NZ   . LYS A 1 103 ? -4.562  12.176  -32.432 1.00 1.00 ? 103 LYS A NZ   5  
ATOM 9358  H H    . LYS A 1 103 ? -0.173  7.708   -30.041 1.00 1.00 ? 103 LYS A H    5  
ATOM 9359  H HA   . LYS A 1 103 ? -2.099  8.345   -27.860 1.00 1.00 ? 103 LYS A HA   5  
ATOM 9360  H HB2  . LYS A 1 103 ? -2.491  7.729   -30.811 1.00 1.00 ? 103 LYS A HB2  5  
ATOM 9361  H HB3  . LYS A 1 103 ? -3.818  7.893   -29.651 1.00 1.00 ? 103 LYS A HB3  5  
ATOM 9362  H HG2  . LYS A 1 103 ? -3.129  10.196  -29.119 1.00 1.00 ? 103 LYS A HG2  5  
ATOM 9363  H HG3  . LYS A 1 103 ? -1.777  10.078  -30.266 1.00 1.00 ? 103 LYS A HG3  5  
ATOM 9364  H HD2  . LYS A 1 103 ? -3.377  9.713   -32.120 1.00 1.00 ? 103 LYS A HD2  5  
ATOM 9365  H HD3  . LYS A 1 103 ? -4.734  9.835   -30.976 1.00 1.00 ? 103 LYS A HD3  5  
ATOM 9366  H HE2  . LYS A 1 103 ? -4.027  12.139  -30.372 1.00 1.00 ? 103 LYS A HE2  5  
ATOM 9367  H HE3  . LYS A 1 103 ? -2.662  12.029  -31.487 1.00 1.00 ? 103 LYS A HE3  5  
ATOM 9368  H HZ1  . LYS A 1 103 ? -5.530  11.913  -32.287 1.00 1.00 ? 103 LYS A HZ1  5  
ATOM 9369  H HZ2  . LYS A 1 103 ? -4.529  13.185  -32.505 1.00 1.00 ? 103 LYS A HZ2  5  
ATOM 9370  H HZ3  . LYS A 1 103 ? -4.261  11.794  -33.317 1.00 1.00 ? 103 LYS A HZ3  5  
ATOM 9371  N N    . MET A 1 104 ? -3.177  6.049   -27.558 1.00 1.00 ? 104 MET A N    5  
ATOM 9372  C CA   . MET A 1 104 ? -3.617  4.727   -27.068 1.00 1.00 ? 104 MET A CA   5  
ATOM 9373  C C    . MET A 1 104 ? -5.154  4.594   -27.067 1.00 1.00 ? 104 MET A C    5  
ATOM 9374  O O    . MET A 1 104 ? -5.881  5.571   -27.249 1.00 1.00 ? 104 MET A O    5  
ATOM 9375  C CB   . MET A 1 104 ? -3.017  4.448   -25.674 1.00 1.00 ? 104 MET A CB   5  
ATOM 9376  C CG   . MET A 1 104 ? -1.485  4.353   -25.704 1.00 1.00 ? 104 MET A CG   5  
ATOM 9377  S SD   . MET A 1 104 ? -0.769  3.680   -24.188 1.00 1.00 ? 104 MET A SD   5  
ATOM 9378  C CE   . MET A 1 104 ? 0.983   3.877   -24.605 1.00 1.00 ? 104 MET A CE   5  
ATOM 9379  H H    . MET A 1 104 ? -3.751  6.849   -27.305 1.00 1.00 ? 104 MET A H    5  
ATOM 9380  H HA   . MET A 1 104 ? -3.253  3.956   -27.750 1.00 1.00 ? 104 MET A HA   5  
ATOM 9381  H HB2  . MET A 1 104 ? -3.307  5.231   -24.976 1.00 1.00 ? 104 MET A HB2  5  
ATOM 9382  H HB3  . MET A 1 104 ? -3.402  3.499   -25.297 1.00 1.00 ? 104 MET A HB3  5  
ATOM 9383  H HG2  . MET A 1 104 ? -1.186  3.707   -26.533 1.00 1.00 ? 104 MET A HG2  5  
ATOM 9384  H HG3  . MET A 1 104 ? -1.066  5.346   -25.879 1.00 1.00 ? 104 MET A HG3  5  
ATOM 9385  H HE1  . MET A 1 104 ? 1.595   3.459   -23.807 1.00 1.00 ? 104 MET A HE1  5  
ATOM 9386  H HE2  . MET A 1 104 ? 1.201   3.350   -25.536 1.00 1.00 ? 104 MET A HE2  5  
ATOM 9387  H HE3  . MET A 1 104 ? 1.223   4.934   -24.722 1.00 1.00 ? 104 MET A HE3  5  
ATOM 9388  N N    . LYS A 1 105 ? -5.643  3.363   -26.886 1.00 1.00 ? 105 LYS A N    5  
ATOM 9389  C CA   . LYS A 1 105 ? -7.056  2.969   -27.055 1.00 1.00 ? 105 LYS A CA   5  
ATOM 9390  C C    . LYS A 1 105 ? -8.038  3.571   -26.017 1.00 1.00 ? 105 LYS A C    5  
ATOM 9391  O O    . LYS A 1 105 ? -7.657  4.269   -25.079 1.00 1.00 ? 105 LYS A O    5  
ATOM 9392  C CB   . LYS A 1 105 ? -7.121  1.421   -27.087 1.00 1.00 ? 105 LYS A CB   5  
ATOM 9393  C CG   . LYS A 1 105 ? -6.379  0.816   -28.296 1.00 1.00 ? 105 LYS A CG   5  
ATOM 9394  C CD   . LYS A 1 105 ? -6.526  -0.712  -28.323 1.00 1.00 ? 105 LYS A CD   5  
ATOM 9395  C CE   . LYS A 1 105 ? -5.776  -1.285  -29.537 1.00 1.00 ? 105 LYS A CE   5  
ATOM 9396  N NZ   . LYS A 1 105 ? -5.885  -2.769  -29.611 1.00 1.00 ? 105 LYS A NZ   5  
ATOM 9397  H H    . LYS A 1 105 ? -4.981  2.622   -26.696 1.00 1.00 ? 105 LYS A H    5  
ATOM 9398  H HA   . LYS A 1 105 ? -7.396  3.336   -28.028 1.00 1.00 ? 105 LYS A HA   5  
ATOM 9399  H HB2  . LYS A 1 105 ? -6.697  1.017   -26.164 1.00 1.00 ? 105 LYS A HB2  5  
ATOM 9400  H HB3  . LYS A 1 105 ? -8.162  1.097   -27.145 1.00 1.00 ? 105 LYS A HB3  5  
ATOM 9401  H HG2  . LYS A 1 105 ? -6.788  1.234   -29.218 1.00 1.00 ? 105 LYS A HG2  5  
ATOM 9402  H HG3  . LYS A 1 105 ? -5.318  1.066   -28.242 1.00 1.00 ? 105 LYS A HG3  5  
ATOM 9403  H HD2  . LYS A 1 105 ? -6.110  -1.131  -27.401 1.00 1.00 ? 105 LYS A HD2  5  
ATOM 9404  H HD3  . LYS A 1 105 ? -7.586  -0.972  -28.390 1.00 1.00 ? 105 LYS A HD3  5  
ATOM 9405  H HE2  . LYS A 1 105 ? -6.192  -0.840  -30.447 1.00 1.00 ? 105 LYS A HE2  5  
ATOM 9406  H HE3  . LYS A 1 105 ? -4.722  -0.993  -29.472 1.00 1.00 ? 105 LYS A HE3  5  
ATOM 9407  H HZ1  . LYS A 1 105 ? -5.496  -3.207  -28.784 1.00 1.00 ? 105 LYS A HZ1  5  
ATOM 9408  H HZ2  . LYS A 1 105 ? -6.851  -3.062  -29.696 1.00 1.00 ? 105 LYS A HZ2  5  
ATOM 9409  H HZ3  . LYS A 1 105 ? -5.387  -3.132  -30.412 1.00 1.00 ? 105 LYS A HZ3  5  
ATOM 9410  N N    . TYR A 1 106 ? -9.332  3.273   -26.191 1.00 1.00 ? 106 TYR A N    5  
ATOM 9411  C CA   . TYR A 1 106 ? -10.459 3.820   -25.409 1.00 1.00 ? 106 TYR A CA   5  
ATOM 9412  C C    . TYR A 1 106 ? -10.722 3.116   -24.053 1.00 1.00 ? 106 TYR A C    5  
ATOM 9413  O O    . TYR A 1 106 ? -11.653 3.486   -23.341 1.00 1.00 ? 106 TYR A O    5  
ATOM 9414  C CB   . TYR A 1 106 ? -11.717 3.794   -26.299 1.00 1.00 ? 106 TYR A CB   5  
ATOM 9415  C CG   . TYR A 1 106 ? -11.726 4.858   -27.381 1.00 1.00 ? 106 TYR A CG   5  
ATOM 9416  C CD1  . TYR A 1 106 ? -12.278 6.123   -27.102 1.00 1.00 ? 106 TYR A CD1  5  
ATOM 9417  C CD2  . TYR A 1 106 ? -11.195 4.597   -28.661 1.00 1.00 ? 106 TYR A CD2  5  
ATOM 9418  C CE1  . TYR A 1 106 ? -12.312 7.118   -28.094 1.00 1.00 ? 106 TYR A CE1  5  
ATOM 9419  C CE2  . TYR A 1 106 ? -11.215 5.594   -29.657 1.00 1.00 ? 106 TYR A CE2  5  
ATOM 9420  C CZ   . TYR A 1 106 ? -11.776 6.859   -29.375 1.00 1.00 ? 106 TYR A CZ   5  
ATOM 9421  O OH   . TYR A 1 106 ? -11.800 7.837   -30.326 1.00 1.00 ? 106 TYR A OH   5  
ATOM 9422  H H    . TYR A 1 106 ? -9.570  2.674   -26.972 1.00 1.00 ? 106 TYR A H    5  
ATOM 9423  H HA   . TYR A 1 106 ? -10.247 4.863   -25.173 1.00 1.00 ? 106 TYR A HA   5  
ATOM 9424  H HB2  . TYR A 1 106 ? -11.823 2.807   -26.751 1.00 1.00 ? 106 TYR A HB2  5  
ATOM 9425  H HB3  . TYR A 1 106 ? -12.600 3.954   -25.680 1.00 1.00 ? 106 TYR A HB3  5  
ATOM 9426  H HD1  . TYR A 1 106 ? -12.693 6.330   -26.125 1.00 1.00 ? 106 TYR A HD1  5  
ATOM 9427  H HD2  . TYR A 1 106 ? -10.779 3.624   -28.889 1.00 1.00 ? 106 TYR A HD2  5  
ATOM 9428  H HE1  . TYR A 1 106 ? -12.755 8.078   -27.876 1.00 1.00 ? 106 TYR A HE1  5  
ATOM 9429  H HE2  . TYR A 1 106 ? -10.811 5.387   -30.638 1.00 1.00 ? 106 TYR A HE2  5  
ATOM 9430  H HH   . TYR A 1 106 ? -11.421 7.560   -31.172 1.00 1.00 ? 106 TYR A HH   5  
ATOM 9431  N N    . SER A 1 107 ? -9.927  2.105   -23.683 1.00 1.00 ? 107 SER A N    5  
ATOM 9432  C CA   . SER A 1 107 ? -10.082 1.323   -22.440 1.00 1.00 ? 107 SER A CA   5  
ATOM 9433  C C    . SER A 1 107 ? -10.078 2.208   -21.170 1.00 1.00 ? 107 SER A C    5  
ATOM 9434  O O    . SER A 1 107 ? -9.105  2.912   -20.895 1.00 1.00 ? 107 SER A O    5  
ATOM 9435  C CB   . SER A 1 107 ? -8.964  0.268   -22.351 1.00 1.00 ? 107 SER A CB   5  
ATOM 9436  O OG   . SER A 1 107 ? -8.908  -0.510  -23.545 1.00 1.00 ? 107 SER A OG   5  
ATOM 9437  H H    . SER A 1 107 ? -9.210  1.801   -24.325 1.00 1.00 ? 107 SER A H    5  
ATOM 9438  H HA   . SER A 1 107 ? -11.028 0.782   -22.488 1.00 1.00 ? 107 SER A HA   5  
ATOM 9439  H HB2  . SER A 1 107 ? -8.004  0.770   -22.204 1.00 1.00 ? 107 SER A HB2  5  
ATOM 9440  H HB3  . SER A 1 107 ? -9.149  -0.383  -21.498 1.00 1.00 ? 107 SER A HB3  5  
ATOM 9441  H HG   . SER A 1 107 ? -8.247  -1.226  -23.440 1.00 1.00 ? 107 SER A HG   5  
ATOM 9442  N N    . ILE A 1 108 ? -11.157 2.172   -20.369 1.00 1.00 ? 108 ILE A N    5  
ATOM 9443  C CA   . ILE A 1 108 ? -11.374 3.122   -19.251 1.00 1.00 ? 108 ILE A CA   5  
ATOM 9444  C C    . ILE A 1 108 ? -10.731 2.740   -17.904 1.00 1.00 ? 108 ILE A C    5  
ATOM 9445  O O    . ILE A 1 108 ? -10.713 3.569   -16.993 1.00 1.00 ? 108 ILE A O    5  
ATOM 9446  C CB   . ILE A 1 108 ? -12.880 3.458   -19.066 1.00 1.00 ? 108 ILE A CB   5  
ATOM 9447  C CG1  . ILE A 1 108 ? -13.737 2.373   -18.364 1.00 1.00 ? 108 ILE A CG1  5  
ATOM 9448  C CG2  . ILE A 1 108 ? -13.522 3.936   -20.381 1.00 1.00 ? 108 ILE A CG2  5  
ATOM 9449  C CD1  . ILE A 1 108 ? -13.874 1.018   -19.071 1.00 1.00 ? 108 ILE A CD1  5  
ATOM 9450  H H    . ILE A 1 108 ? -11.949 1.609   -20.664 1.00 1.00 ? 108 ILE A H    5  
ATOM 9451  H HA   . ILE A 1 108 ? -10.884 4.061   -19.526 1.00 1.00 ? 108 ILE A HA   5  
ATOM 9452  H HB   . ILE A 1 108 ? -12.911 4.323   -18.401 1.00 1.00 ? 108 ILE A HB   5  
ATOM 9453  H HG12 . ILE A 1 108 ? -13.337 2.191   -17.365 1.00 1.00 ? 108 ILE A HG12 5  
ATOM 9454  H HG13 . ILE A 1 108 ? -14.742 2.774   -18.229 1.00 1.00 ? 108 ILE A HG13 5  
ATOM 9455  H HG21 . ILE A 1 108 ? -12.932 4.751   -20.800 1.00 1.00 ? 108 ILE A HG21 5  
ATOM 9456  H HG22 . ILE A 1 108 ? -13.579 3.130   -21.112 1.00 1.00 ? 108 ILE A HG22 5  
ATOM 9457  H HG23 . ILE A 1 108 ? -14.533 4.298   -20.183 1.00 1.00 ? 108 ILE A HG23 5  
ATOM 9458  H HD11 . ILE A 1 108 ? -14.556 0.387   -18.500 1.00 1.00 ? 108 ILE A HD11 5  
ATOM 9459  H HD12 . ILE A 1 108 ? -14.285 1.152   -20.071 1.00 1.00 ? 108 ILE A HD12 5  
ATOM 9460  H HD13 . ILE A 1 108 ? -12.911 0.509   -19.123 1.00 1.00 ? 108 ILE A HD13 5  
ATOM 9461  N N    . VAL A 1 109 ? -10.217 1.512   -17.753 1.00 1.00 ? 109 VAL A N    5  
ATOM 9462  C CA   . VAL A 1 109 ? -9.611  1.028   -16.491 1.00 1.00 ? 109 VAL A CA   5  
ATOM 9463  C C    . VAL A 1 109 ? -8.186  1.579   -16.376 1.00 1.00 ? 109 VAL A C    5  
ATOM 9464  O O    . VAL A 1 109 ? -7.283  1.149   -17.093 1.00 1.00 ? 109 VAL A O    5  
ATOM 9465  C CB   . VAL A 1 109 ? -9.641  -0.517  -16.364 1.00 1.00 ? 109 VAL A CB   5  
ATOM 9466  C CG1  . VAL A 1 109 ? -9.002  -0.984  -15.044 1.00 1.00 ? 109 VAL A CG1  5  
ATOM 9467  C CG2  . VAL A 1 109 ? -11.084 -1.047  -16.426 1.00 1.00 ? 109 VAL A CG2  5  
ATOM 9468  H H    . VAL A 1 109 ? -10.198 0.918   -18.573 1.00 1.00 ? 109 VAL A H    5  
ATOM 9469  H HA   . VAL A 1 109 ? -10.201 1.424   -15.660 1.00 1.00 ? 109 VAL A HA   5  
ATOM 9470  H HB   . VAL A 1 109 ? -9.084  -0.954  -17.192 1.00 1.00 ? 109 VAL A HB   5  
ATOM 9471  H HG11 . VAL A 1 109 ? -9.503  -0.516  -14.197 1.00 1.00 ? 109 VAL A HG11 5  
ATOM 9472  H HG12 . VAL A 1 109 ? -9.088  -2.068  -14.951 1.00 1.00 ? 109 VAL A HG12 5  
ATOM 9473  H HG13 . VAL A 1 109 ? -7.944  -0.724  -15.021 1.00 1.00 ? 109 VAL A HG13 5  
ATOM 9474  H HG21 . VAL A 1 109 ? -11.085 -2.129  -16.296 1.00 1.00 ? 109 VAL A HG21 5  
ATOM 9475  H HG22 . VAL A 1 109 ? -11.685 -0.591  -15.638 1.00 1.00 ? 109 VAL A HG22 5  
ATOM 9476  H HG23 . VAL A 1 109 ? -11.532 -0.822  -17.392 1.00 1.00 ? 109 VAL A HG23 5  
ATOM 9477  N N    . SER A 1 110 ? -7.988  2.519   -15.453 1.00 1.00 ? 110 SER A N    5  
ATOM 9478  C CA   . SER A 1 110 ? -6.767  3.335   -15.316 1.00 1.00 ? 110 SER A CA   5  
ATOM 9479  C C    . SER A 1 110 ? -5.472  2.577   -14.970 1.00 1.00 ? 110 SER A C    5  
ATOM 9480  O O    . SER A 1 110 ? -4.389  3.158   -15.063 1.00 1.00 ? 110 SER A O    5  
ATOM 9481  C CB   . SER A 1 110 ? -7.007  4.437   -14.273 1.00 1.00 ? 110 SER A CB   5  
ATOM 9482  O OG   . SER A 1 110 ? -8.185  5.176   -14.584 1.00 1.00 ? 110 SER A OG   5  
ATOM 9483  H H    . SER A 1 110 ? -8.811  2.895   -14.996 1.00 1.00 ? 110 SER A H    5  
ATOM 9484  H HA   . SER A 1 110 ? -6.583  3.833   -16.269 1.00 1.00 ? 110 SER A HA   5  
ATOM 9485  H HB2  . SER A 1 110 ? -7.112  3.974   -13.290 1.00 1.00 ? 110 SER A HB2  5  
ATOM 9486  H HB3  . SER A 1 110 ? -6.146  5.108   -14.259 1.00 1.00 ? 110 SER A HB3  5  
ATOM 9487  H HG   . SER A 1 110 ? -8.261  5.952   -13.996 1.00 1.00 ? 110 SER A HG   5  
ATOM 9488  N N    . ARG A 1 111 ? -5.524  1.275   -14.633 1.00 1.00 ? 111 ARG A N    5  
ATOM 9489  C CA   . ARG A 1 111 ? -4.303  0.456   -14.481 1.00 1.00 ? 111 ARG A CA   5  
ATOM 9490  C C    . ARG A 1 111 ? -3.479  0.376   -15.781 1.00 1.00 ? 111 ARG A C    5  
ATOM 9491  O O    . ARG A 1 111 ? -2.268  0.162   -15.733 1.00 1.00 ? 111 ARG A O    5  
ATOM 9492  C CB   . ARG A 1 111 ? -4.627  -0.924  -13.877 1.00 1.00 ? 111 ARG A CB   5  
ATOM 9493  C CG   . ARG A 1 111 ? -3.352  -1.527  -13.269 1.00 1.00 ? 111 ARG A CG   5  
ATOM 9494  C CD   . ARG A 1 111 ? -3.564  -2.865  -12.559 1.00 1.00 ? 111 ARG A CD   5  
ATOM 9495  N NE   . ARG A 1 111 ? -2.273  -3.332  -12.045 1.00 1.00 ? 111 ARG A NE   5  
ATOM 9496  C CZ   . ARG A 1 111 ? -1.990  -4.419  -11.351 1.00 1.00 ? 111 ARG A CZ   5  
ATOM 9497  N NH1  . ARG A 1 111 ? -2.897  -5.302  -10.984 1.00 1.00 ? 111 ARG A NH1  5  
ATOM 9498  N NH2  . ARG A 1 111 ? -0.731  -4.588  -11.030 1.00 1.00 ? 111 ARG A NH2  5  
ATOM 9499  H H    . ARG A 1 111 ? -6.427  0.831   -14.534 1.00 1.00 ? 111 ARG A H    5  
ATOM 9500  H HA   . ARG A 1 111 ? -3.674  0.972   -13.756 1.00 1.00 ? 111 ARG A HA   5  
ATOM 9501  H HB2  . ARG A 1 111 ? -5.362  -0.807  -13.079 1.00 1.00 ? 111 ARG A HB2  5  
ATOM 9502  H HB3  . ARG A 1 111 ? -5.035  -1.589  -14.644 1.00 1.00 ? 111 ARG A HB3  5  
ATOM 9503  H HG2  . ARG A 1 111 ? -2.612  -1.681  -14.051 1.00 1.00 ? 111 ARG A HG2  5  
ATOM 9504  H HG3  . ARG A 1 111 ? -2.937  -0.824  -12.546 1.00 1.00 ? 111 ARG A HG3  5  
ATOM 9505  H HD2  . ARG A 1 111 ? -4.267  -2.731  -11.736 1.00 1.00 ? 111 ARG A HD2  5  
ATOM 9506  H HD3  . ARG A 1 111 ? -3.969  -3.594  -13.266 1.00 1.00 ? 111 ARG A HD3  5  
ATOM 9507  H HE   . ARG A 1 111 ? -1.463  -2.756  -12.266 1.00 1.00 ? 111 ARG A HE   5  
ATOM 9508  H HH11 . ARG A 1 111 ? -3.866  -5.167  -11.225 1.00 1.00 ? 111 ARG A HH11 5  
ATOM 9509  H HH12 . ARG A 1 111 ? -2.633  -6.116  -10.449 1.00 1.00 ? 111 ARG A HH12 5  
ATOM 9510  H HH21 . ARG A 1 111 ? -0.081  -3.862  -11.342 1.00 1.00 ? 111 ARG A HH21 5  
ATOM 9511  H HH22 . ARG A 1 111 ? -0.416  -5.387  -10.503 1.00 1.00 ? 111 ARG A HH22 5  
ATOM 9512  N N    . ASN A 1 112 ? -4.068  0.665   -16.945 1.00 1.00 ? 112 ASN A N    5  
ATOM 9513  C CA   . ASN A 1 112 ? -3.314  0.843   -18.193 1.00 1.00 ? 112 ASN A CA   5  
ATOM 9514  C C    . ASN A 1 112 ? -2.223  1.937   -18.075 1.00 1.00 ? 112 ASN A C    5  
ATOM 9515  O O    . ASN A 1 112 ? -1.172  1.801   -18.691 1.00 1.00 ? 112 ASN A O    5  
ATOM 9516  C CB   . ASN A 1 112 ? -4.278  1.094   -19.371 1.00 1.00 ? 112 ASN A CB   5  
ATOM 9517  C CG   . ASN A 1 112 ? -5.089  2.393   -19.311 1.00 1.00 ? 112 ASN A CG   5  
ATOM 9518  O OD1  . ASN A 1 112 ? -5.181  3.063   -18.292 1.00 1.00 ? 112 ASN A OD1  5  
ATOM 9519  N ND2  . ASN A 1 112 ? -5.701  2.777   -20.415 1.00 1.00 ? 112 ASN A ND2  5  
ATOM 9520  H H    . ASN A 1 112 ? -5.060  0.857   -16.950 1.00 1.00 ? 112 ASN A H    5  
ATOM 9521  H HA   . ASN A 1 112 ? -2.798  -0.097  -18.399 1.00 1.00 ? 112 ASN A HA   5  
ATOM 9522  H HB2  . ASN A 1 112 ? -3.689  1.099   -20.291 1.00 1.00 ? 112 ASN A HB2  5  
ATOM 9523  H HB3  . ASN A 1 112 ? -4.975  0.261   -19.441 1.00 1.00 ? 112 ASN A HB3  5  
ATOM 9524  H HD21 . ASN A 1 112 ? -5.642  2.227   -21.259 1.00 1.00 ? 112 ASN A HD21 5  
ATOM 9525  H HD22 . ASN A 1 112 ? -6.286  3.597   -20.374 1.00 1.00 ? 112 ASN A HD22 5  
ATOM 9526  N N    . CYS A 1 113 ? -2.396  2.953   -17.215 1.00 1.00 ? 113 CYS A N    5  
ATOM 9527  C CA   . CYS A 1 113 ? -1.357  3.933   -16.884 1.00 1.00 ? 113 CYS A CA   5  
ATOM 9528  C C    . CYS A 1 113 ? -0.205  3.328   -16.057 1.00 1.00 ? 113 CYS A C    5  
ATOM 9529  O O    . CYS A 1 113 ? 0.955   3.621   -16.352 1.00 1.00 ? 113 CYS A O    5  
ATOM 9530  C CB   . CYS A 1 113 ? -2.014  5.148   -16.214 1.00 1.00 ? 113 CYS A CB   5  
ATOM 9531  S SG   . CYS A 1 113 ? -3.256  5.844   -17.346 1.00 1.00 ? 113 CYS A SG   5  
ATOM 9532  H H    . CYS A 1 113 ? -3.315  3.081   -16.793 1.00 1.00 ? 113 CYS A H    5  
ATOM 9533  H HA   . CYS A 1 113 ? -0.908  4.278   -17.814 1.00 1.00 ? 113 CYS A HA   5  
ATOM 9534  H HB2  . CYS A 1 113 ? -2.505  4.860   -15.281 1.00 1.00 ? 113 CYS A HB2  5  
ATOM 9535  H HB3  . CYS A 1 113 ? -1.258  5.908   -15.998 1.00 1.00 ? 113 CYS A HB3  5  
ATOM 9536  H HG   . CYS A 1 113 ? -3.541  6.952   -16.638 1.00 1.00 ? 113 CYS A HG   5  
ATOM 9537  N N    . GLU A 1 114 ? -0.498  2.434   -15.102 1.00 1.00 ? 114 GLU A N    5  
ATOM 9538  C CA   . GLU A 1 114 ? 0.528   1.638   -14.405 1.00 1.00 ? 114 GLU A CA   5  
ATOM 9539  C C    . GLU A 1 114 ? 1.333   0.836   -15.436 1.00 1.00 ? 114 GLU A C    5  
ATOM 9540  O O    . GLU A 1 114 ? 2.542   1.021   -15.556 1.00 1.00 ? 114 GLU A O    5  
ATOM 9541  C CB   . GLU A 1 114 ? -0.091  0.680   -13.366 1.00 1.00 ? 114 GLU A CB   5  
ATOM 9542  C CG   . GLU A 1 114 ? 0.972   0.043   -12.465 1.00 1.00 ? 114 GLU A CG   5  
ATOM 9543  C CD   . GLU A 1 114 ? 0.383   -1.141  -11.677 1.00 1.00 ? 114 GLU A CD   5  
ATOM 9544  O OE1  . GLU A 1 114 ? 0.364   -2.276  -12.213 1.00 1.00 ? 114 GLU A OE1  5  
ATOM 9545  O OE2  . GLU A 1 114 ? -0.044  -0.968  -10.513 1.00 1.00 ? 114 GLU A OE2  5  
ATOM 9546  H H    . GLU A 1 114 ? -1.468  2.209   -14.932 1.00 1.00 ? 114 GLU A H    5  
ATOM 9547  H HA   . GLU A 1 114 ? 1.204   2.318   -13.885 1.00 1.00 ? 114 GLU A HA   5  
ATOM 9548  H HB2  . GLU A 1 114 ? -0.803  1.214   -12.742 1.00 1.00 ? 114 GLU A HB2  5  
ATOM 9549  H HB3  . GLU A 1 114 ? -0.630  -0.115  -13.874 1.00 1.00 ? 114 GLU A HB3  5  
ATOM 9550  H HG2  . GLU A 1 114 ? 1.801   -0.320  -13.072 1.00 1.00 ? 114 GLU A HG2  5  
ATOM 9551  H HG3  . GLU A 1 114 ? 1.365   0.796   -11.781 1.00 1.00 ? 114 GLU A HG3  5  
ATOM 9552  N N    . HIS A 1 115 ? 0.650   0.013   -16.240 1.00 1.00 ? 115 HIS A N    5  
ATOM 9553  C CA   . HIS A 1 115 ? 1.275   -0.832  -17.265 1.00 1.00 ? 115 HIS A CA   5  
ATOM 9554  C C    . HIS A 1 115 ? 2.075   -0.027  -18.308 1.00 1.00 ? 115 HIS A C    5  
ATOM 9555  O O    . HIS A 1 115 ? 3.060   -0.523  -18.857 1.00 1.00 ? 115 HIS A O    5  
ATOM 9556  C CB   . HIS A 1 115 ? 0.183   -1.661  -17.967 1.00 1.00 ? 115 HIS A CB   5  
ATOM 9557  C CG   . HIS A 1 115 ? -0.664  -2.552  -17.085 1.00 1.00 ? 115 HIS A CG   5  
ATOM 9558  N ND1  . HIS A 1 115 ? -1.878  -3.101  -17.437 1.00 1.00 ? 115 HIS A ND1  5  
ATOM 9559  C CD2  . HIS A 1 115 ? -0.362  -3.031  -15.835 1.00 1.00 ? 115 HIS A CD2  5  
ATOM 9560  C CE1  . HIS A 1 115 ? -2.295  -3.886  -16.430 1.00 1.00 ? 115 HIS A CE1  5  
ATOM 9561  N NE2  . HIS A 1 115 ? -1.401  -3.876  -15.426 1.00 1.00 ? 115 HIS A NE2  5  
ATOM 9562  H H    . HIS A 1 115 ? -0.349  -0.091  -16.080 1.00 1.00 ? 115 HIS A H    5  
ATOM 9563  H HA   . HIS A 1 115 ? 1.981   -1.507  -16.780 1.00 1.00 ? 115 HIS A HA   5  
ATOM 9564  H HB2  . HIS A 1 115 ? -0.478  -0.985  -18.510 1.00 1.00 ? 115 HIS A HB2  5  
ATOM 9565  H HB3  . HIS A 1 115 ? 0.667   -2.302  -18.709 1.00 1.00 ? 115 HIS A HB3  5  
ATOM 9566  H HD1  . HIS A 1 115 ? -2.352  -2.989  -18.326 1.00 1.00 ? 115 HIS A HD1  5  
ATOM 9567  H HD2  . HIS A 1 115 ? 0.536   -2.816  -15.272 1.00 1.00 ? 115 HIS A HD2  5  
ATOM 9568  H HE1  . HIS A 1 115 ? -3.213  -4.460  -16.438 1.00 1.00 ? 115 HIS A HE1  5  
ATOM 9569  N N    . PHE A 1 116 ? 1.675   1.217   -18.594 1.00 1.00 ? 116 PHE A N    5  
ATOM 9570  C CA   . PHE A 1 116 ? 2.451   2.154   -19.391 1.00 1.00 ? 116 PHE A CA   5  
ATOM 9571  C C    . PHE A 1 116 ? 3.735   2.570   -18.658 1.00 1.00 ? 116 PHE A C    5  
ATOM 9572  O O    . PHE A 1 116 ? 4.821   2.375   -19.203 1.00 1.00 ? 116 PHE A O    5  
ATOM 9573  C CB   . PHE A 1 116 ? 1.561   3.351   -19.773 1.00 1.00 ? 116 PHE A CB   5  
ATOM 9574  C CG   . PHE A 1 116 ? 2.326   4.554   -20.290 1.00 1.00 ? 116 PHE A CG   5  
ATOM 9575  C CD1  . PHE A 1 116 ? 3.089   4.446   -21.467 1.00 1.00 ? 116 PHE A CD1  5  
ATOM 9576  C CD2  . PHE A 1 116 ? 2.323   5.762   -19.565 1.00 1.00 ? 116 PHE A CD2  5  
ATOM 9577  C CE1  . PHE A 1 116 ? 3.854   5.535   -21.909 1.00 1.00 ? 116 PHE A CE1  5  
ATOM 9578  C CE2  . PHE A 1 116 ? 3.099   6.849   -20.007 1.00 1.00 ? 116 PHE A CE2  5  
ATOM 9579  C CZ   . PHE A 1 116 ? 3.866   6.731   -21.177 1.00 1.00 ? 116 PHE A CZ   5  
ATOM 9580  H H    . PHE A 1 116 ? 0.797   1.537   -18.213 1.00 1.00 ? 116 PHE A H    5  
ATOM 9581  H HA   . PHE A 1 116 ? 2.752   1.654   -20.309 1.00 1.00 ? 116 PHE A HA   5  
ATOM 9582  H HB2  . PHE A 1 116 ? 0.852   3.029   -20.535 1.00 1.00 ? 116 PHE A HB2  5  
ATOM 9583  H HB3  . PHE A 1 116 ? 0.983   3.661   -18.910 1.00 1.00 ? 116 PHE A HB3  5  
ATOM 9584  H HD1  . PHE A 1 116 ? 3.103   3.518   -22.019 1.00 1.00 ? 116 PHE A HD1  5  
ATOM 9585  H HD2  . PHE A 1 116 ? 1.740   5.854   -18.660 1.00 1.00 ? 116 PHE A HD2  5  
ATOM 9586  H HE1  . PHE A 1 116 ? 4.453   5.446   -22.801 1.00 1.00 ? 116 PHE A HE1  5  
ATOM 9587  H HE2  . PHE A 1 116 ? 3.123   7.771   -19.446 1.00 1.00 ? 116 PHE A HE2  5  
ATOM 9588  H HZ   . PHE A 1 116 ? 4.488   7.552   -21.503 1.00 1.00 ? 116 PHE A HZ   5  
ATOM 9589  N N    . VAL A 1 117 ? 3.647   3.112   -17.436 1.00 1.00 ? 117 VAL A N    5  
ATOM 9590  C CA   . VAL A 1 117 ? 4.842   3.672   -16.769 1.00 1.00 ? 117 VAL A CA   5  
ATOM 9591  C C    . VAL A 1 117 ? 5.857   2.611   -16.318 1.00 1.00 ? 117 VAL A C    5  
ATOM 9592  O O    . VAL A 1 117 ? 7.048   2.915   -16.284 1.00 1.00 ? 117 VAL A O    5  
ATOM 9593  C CB   . VAL A 1 117 ? 4.536   4.656   -15.622 1.00 1.00 ? 117 VAL A CB   5  
ATOM 9594  C CG1  . VAL A 1 117 ? 3.730   5.859   -16.133 1.00 1.00 ? 117 VAL A CG1  5  
ATOM 9595  C CG2  . VAL A 1 117 ? 3.844   4.020   -14.409 1.00 1.00 ? 117 VAL A CG2  5  
ATOM 9596  H H    . VAL A 1 117 ? 2.726   3.176   -16.988 1.00 1.00 ? 117 VAL A H    5  
ATOM 9597  H HA   . VAL A 1 117 ? 5.350   4.270   -17.526 1.00 1.00 ? 117 VAL A HA   5  
ATOM 9598  H HB   . VAL A 1 117 ? 5.490   5.053   -15.281 1.00 1.00 ? 117 VAL A HB   5  
ATOM 9599  H HG11 . VAL A 1 117 ? 3.603   6.575   -15.325 1.00 1.00 ? 117 VAL A HG11 5  
ATOM 9600  H HG12 . VAL A 1 117 ? 4.268   6.347   -16.945 1.00 1.00 ? 117 VAL A HG12 5  
ATOM 9601  H HG13 . VAL A 1 117 ? 2.751   5.545   -16.487 1.00 1.00 ? 117 VAL A HG13 5  
ATOM 9602  H HG21 . VAL A 1 117 ? 3.828   4.742   -13.593 1.00 1.00 ? 117 VAL A HG21 5  
ATOM 9603  H HG22 . VAL A 1 117 ? 2.827   3.739   -14.658 1.00 1.00 ? 117 VAL A HG22 5  
ATOM 9604  H HG23 . VAL A 1 117 ? 4.389   3.140   -14.073 1.00 1.00 ? 117 VAL A HG23 5  
ATOM 9605  N N    . THR A 1 118 ? 5.440   1.363   -16.049 1.00 1.00 ? 118 THR A N    5  
ATOM 9606  C CA   . THR A 1 118 ? 6.369   0.238   -15.826 1.00 1.00 ? 118 THR A CA   5  
ATOM 9607  C C    . THR A 1 118 ? 7.142   -0.084  -17.098 1.00 1.00 ? 118 THR A C    5  
ATOM 9608  O O    . THR A 1 118 ? 8.363   -0.211  -17.045 1.00 1.00 ? 118 THR A O    5  
ATOM 9609  C CB   . THR A 1 118 ? 5.640   -1.012  -15.323 1.00 1.00 ? 118 THR A CB   5  
ATOM 9610  O OG1  . THR A 1 118 ? 4.579   -1.309  -16.199 1.00 1.00 ? 118 THR A OG1  5  
ATOM 9611  C CG2  . THR A 1 118 ? 5.073   -0.816  -13.917 1.00 1.00 ? 118 THR A CG2  5  
ATOM 9612  H H    . THR A 1 118 ? 4.441   1.150   -16.056 1.00 1.00 ? 118 THR A H    5  
ATOM 9613  H HA   . THR A 1 118 ? 7.112   0.524   -15.078 1.00 1.00 ? 118 THR A HA   5  
ATOM 9614  H HB   . THR A 1 118 ? 6.337   -1.850  -15.312 1.00 1.00 ? 118 THR A HB   5  
ATOM 9615  H HG1  . THR A 1 118 ? 4.253   -2.207  -16.013 1.00 1.00 ? 118 THR A HG1  5  
ATOM 9616  H HG21 . THR A 1 118 ? 4.364   0.009   -13.905 1.00 1.00 ? 118 THR A HG21 5  
ATOM 9617  H HG22 . THR A 1 118 ? 4.570   -1.727  -13.595 1.00 1.00 ? 118 THR A HG22 5  
ATOM 9618  H HG23 . THR A 1 118 ? 5.883   -0.605  -13.219 1.00 1.00 ? 118 THR A HG23 5  
ATOM 9619  N N    . GLN A 1 119 ? 6.470   -0.135  -18.249 1.00 1.00 ? 119 GLN A N    5  
ATOM 9620  C CA   . GLN A 1 119 ? 7.097   -0.387  -19.545 1.00 1.00 ? 119 GLN A CA   5  
ATOM 9621  C C    . GLN A 1 119 ? 8.042   0.740   -19.994 1.00 1.00 ? 119 GLN A C    5  
ATOM 9622  O O    . GLN A 1 119 ? 8.993   0.453   -20.714 1.00 1.00 ? 119 GLN A O    5  
ATOM 9623  C CB   . GLN A 1 119 ? 6.034   -0.683  -20.615 1.00 1.00 ? 119 GLN A CB   5  
ATOM 9624  C CG   . GLN A 1 119 ? 5.461   -2.102  -20.461 1.00 1.00 ? 119 GLN A CG   5  
ATOM 9625  C CD   . GLN A 1 119 ? 4.387   -2.394  -21.510 1.00 1.00 ? 119 GLN A CD   5  
ATOM 9626  O OE1  . GLN A 1 119 ? 4.617   -3.064  -22.511 1.00 1.00 ? 119 GLN A OE1  5  
ATOM 9627  N NE2  . GLN A 1 119 ? 3.185   -1.888  -21.333 1.00 1.00 ? 119 GLN A NE2  5  
ATOM 9628  H H    . GLN A 1 119 ? 5.463   -0.055  -18.211 1.00 1.00 ? 119 GLN A H    5  
ATOM 9629  H HA   . GLN A 1 119 ? 7.715   -1.276  -19.439 1.00 1.00 ? 119 GLN A HA   5  
ATOM 9630  H HB2  . GLN A 1 119 ? 5.235   0.056   -20.557 1.00 1.00 ? 119 GLN A HB2  5  
ATOM 9631  H HB3  . GLN A 1 119 ? 6.493   -0.607  -21.600 1.00 1.00 ? 119 GLN A HB3  5  
ATOM 9632  H HG2  . GLN A 1 119 ? 6.266   -2.831  -20.566 1.00 1.00 ? 119 GLN A HG2  5  
ATOM 9633  H HG3  . GLN A 1 119 ? 5.029   -2.220  -19.465 1.00 1.00 ? 119 GLN A HG3  5  
ATOM 9634  H HE21 . GLN A 1 119 ? 3.010   -1.342  -20.493 1.00 1.00 ? 119 GLN A HE21 5  
ATOM 9635  H HE22 . GLN A 1 119 ? 2.465   -2.072  -22.015 1.00 1.00 ? 119 GLN A HE22 5  
ATOM 9636  N N    . LEU A 1 120 ? 7.876   1.987   -19.526 1.00 1.00 ? 120 LEU A N    5  
ATOM 9637  C CA   . LEU A 1 120 ? 8.877   3.048   -19.754 1.00 1.00 ? 120 LEU A CA   5  
ATOM 9638  C C    . LEU A 1 120 ? 10.246  2.723   -19.127 1.00 1.00 ? 120 LEU A C    5  
ATOM 9639  O O    . LEU A 1 120 ? 11.273  3.159   -19.649 1.00 1.00 ? 120 LEU A O    5  
ATOM 9640  C CB   . LEU A 1 120 ? 8.383   4.397   -19.196 1.00 1.00 ? 120 LEU A CB   5  
ATOM 9641  C CG   . LEU A 1 120 ? 7.162   5.021   -19.895 1.00 1.00 ? 120 LEU A CG   5  
ATOM 9642  C CD1  . LEU A 1 120 ? 6.868   6.361   -19.212 1.00 1.00 ? 120 LEU A CD1  5  
ATOM 9643  C CD2  . LEU A 1 120 ? 7.412   5.227   -21.393 1.00 1.00 ? 120 LEU A CD2  5  
ATOM 9644  H H    . LEU A 1 120 ? 7.040   2.192   -18.991 1.00 1.00 ? 120 LEU A H    5  
ATOM 9645  H HA   . LEU A 1 120 ? 9.055   3.140   -20.825 1.00 1.00 ? 120 LEU A HA   5  
ATOM 9646  H HB2  . LEU A 1 120 ? 8.162   4.284   -18.135 1.00 1.00 ? 120 LEU A HB2  5  
ATOM 9647  H HB3  . LEU A 1 120 ? 9.209   5.110   -19.271 1.00 1.00 ? 120 LEU A HB3  5  
ATOM 9648  H HG   . LEU A 1 120 ? 6.294   4.380   -19.771 1.00 1.00 ? 120 LEU A HG   5  
ATOM 9649  H HD11 . LEU A 1 120 ? 7.732   7.019   -19.284 1.00 1.00 ? 120 LEU A HD11 5  
ATOM 9650  H HD12 . LEU A 1 120 ? 6.021   6.851   -19.679 1.00 1.00 ? 120 LEU A HD12 5  
ATOM 9651  H HD13 . LEU A 1 120 ? 6.628   6.178   -18.167 1.00 1.00 ? 120 LEU A HD13 5  
ATOM 9652  H HD21 . LEU A 1 120 ? 6.648   5.880   -21.807 1.00 1.00 ? 120 LEU A HD21 5  
ATOM 9653  H HD22 . LEU A 1 120 ? 8.391   5.678   -21.557 1.00 1.00 ? 120 LEU A HD22 5  
ATOM 9654  H HD23 . LEU A 1 120 ? 7.357   4.269   -21.913 1.00 1.00 ? 120 LEU A HD23 5  
ATOM 9655  N N    . ARG A 1 121 ? 10.259  1.972   -18.017 1.00 1.00 ? 121 ARG A N    5  
ATOM 9656  C CA   . ARG A 1 121 ? 11.464  1.559   -17.285 1.00 1.00 ? 121 ARG A CA   5  
ATOM 9657  C C    . ARG A 1 121 ? 11.943  0.171   -17.742 1.00 1.00 ? 121 ARG A C    5  
ATOM 9658  O O    . ARG A 1 121 ? 13.068  0.039   -18.211 1.00 1.00 ? 121 ARG A O    5  
ATOM 9659  C CB   . ARG A 1 121 ? 11.159  1.681   -15.780 1.00 1.00 ? 121 ARG A CB   5  
ATOM 9660  C CG   . ARG A 1 121 ? 12.383  1.489   -14.866 1.00 1.00 ? 121 ARG A CG   5  
ATOM 9661  C CD   . ARG A 1 121 ? 12.092  2.049   -13.462 1.00 1.00 ? 121 ARG A CD   5  
ATOM 9662  N NE   . ARG A 1 121 ? 13.190  1.752   -12.520 1.00 1.00 ? 121 ARG A NE   5  
ATOM 9663  C CZ   . ARG A 1 121 ? 13.663  2.533   -11.547 1.00 1.00 ? 121 ARG A CZ   5  
ATOM 9664  N NH1  . ARG A 1 121 ? 13.255  3.771   -11.365 1.00 1.00 ? 121 ARG A NH1  5  
ATOM 9665  N NH2  . ARG A 1 121 ? 14.579  2.069   -10.728 1.00 1.00 ? 121 ARG A NH2  5  
ATOM 9666  H H    . ARG A 1 121 ? 9.362   1.653   -17.663 1.00 1.00 ? 121 ARG A H    5  
ATOM 9667  H HA   . ARG A 1 121 ? 12.270  2.262   -17.511 1.00 1.00 ? 121 ARG A HA   5  
ATOM 9668  H HB2  . ARG A 1 121 ? 10.765  2.686   -15.609 1.00 1.00 ? 121 ARG A HB2  5  
ATOM 9669  H HB3  . ARG A 1 121 ? 10.379  0.972   -15.493 1.00 1.00 ? 121 ARG A HB3  5  
ATOM 9670  H HG2  . ARG A 1 121 ? 12.617  0.426   -14.800 1.00 1.00 ? 121 ARG A HG2  5  
ATOM 9671  H HG3  . ARG A 1 121 ? 13.247  2.004   -15.289 1.00 1.00 ? 121 ARG A HG3  5  
ATOM 9672  H HD2  . ARG A 1 121 ? 11.935  3.125   -13.546 1.00 1.00 ? 121 ARG A HD2  5  
ATOM 9673  H HD3  . ARG A 1 121 ? 11.176  1.598   -13.075 1.00 1.00 ? 121 ARG A HD3  5  
ATOM 9674  H HE   . ARG A 1 121 ? 13.577  0.817   -12.579 1.00 1.00 ? 121 ARG A HE   5  
ATOM 9675  H HH11 . ARG A 1 121 ? 12.571  4.198   -11.980 1.00 1.00 ? 121 ARG A HH11 5  
ATOM 9676  H HH12 . ARG A 1 121 ? 13.642  4.330   -10.618 1.00 1.00 ? 121 ARG A HH12 5  
ATOM 9677  H HH21 . ARG A 1 121 ? 14.903  1.114   -10.796 1.00 1.00 ? 121 ARG A HH21 5  
ATOM 9678  H HH22 . ARG A 1 121 ? 14.955  2.648   -9.991  1.00 1.00 ? 121 ARG A HH22 5  
ATOM 9679  N N    . TYR A 1 122 ? 11.104  -0.866  -17.677 1.00 1.00 ? 122 TYR A N    5  
ATOM 9680  C CA   . TYR A 1 122 ? 11.470  -2.232  -18.099 1.00 1.00 ? 122 TYR A CA   5  
ATOM 9681  C C    . TYR A 1 122 ? 11.736  -2.354  -19.617 1.00 1.00 ? 122 TYR A C    5  
ATOM 9682  O O    . TYR A 1 122 ? 12.668  -3.043  -20.035 1.00 1.00 ? 122 TYR A O    5  
ATOM 9683  C CB   . TYR A 1 122 ? 10.355  -3.199  -17.665 1.00 1.00 ? 122 TYR A CB   5  
ATOM 9684  C CG   . TYR A 1 122 ? 10.522  -4.620  -18.178 1.00 1.00 ? 122 TYR A CG   5  
ATOM 9685  C CD1  . TYR A 1 122 ? 11.650  -5.377  -17.808 1.00 1.00 ? 122 TYR A CD1  5  
ATOM 9686  C CD2  . TYR A 1 122 ? 9.564   -5.175  -19.049 1.00 1.00 ? 122 TYR A CD2  5  
ATOM 9687  C CE1  . TYR A 1 122 ? 11.825  -6.684  -18.305 1.00 1.00 ? 122 TYR A CE1  5  
ATOM 9688  C CE2  . TYR A 1 122 ? 9.727   -6.484  -19.541 1.00 1.00 ? 122 TYR A CE2  5  
ATOM 9689  C CZ   . TYR A 1 122 ? 10.861  -7.244  -19.173 1.00 1.00 ? 122 TYR A CZ   5  
ATOM 9690  O OH   . TYR A 1 122 ? 11.013  -8.511  -19.655 1.00 1.00 ? 122 TYR A OH   5  
ATOM 9691  H H    . TYR A 1 122 ? 10.173  -0.712  -17.297 1.00 1.00 ? 122 TYR A H    5  
ATOM 9692  H HA   . TYR A 1 122 ? 12.391  -2.524  -17.586 1.00 1.00 ? 122 TYR A HA   5  
ATOM 9693  H HB2  . TYR A 1 122 ? 10.321  -3.230  -16.577 1.00 1.00 ? 122 TYR A HB2  5  
ATOM 9694  H HB3  . TYR A 1 122 ? 9.395   -2.814  -18.010 1.00 1.00 ? 122 TYR A HB3  5  
ATOM 9695  H HD1  . TYR A 1 122 ? 12.387  -4.960  -17.137 1.00 1.00 ? 122 TYR A HD1  5  
ATOM 9696  H HD2  . TYR A 1 122 ? 8.695   -4.601  -19.339 1.00 1.00 ? 122 TYR A HD2  5  
ATOM 9697  H HE1  . TYR A 1 122 ? 12.691  -7.260  -18.009 1.00 1.00 ? 122 TYR A HE1  5  
ATOM 9698  H HE2  . TYR A 1 122 ? 8.991   -6.912  -20.208 1.00 1.00 ? 122 TYR A HE2  5  
ATOM 9699  H HH   . TYR A 1 122 ? 11.821  -8.945  -19.336 1.00 1.00 ? 122 TYR A HH   5  
ATOM 9700  N N    . GLY A 1 123 ? 10.934  -1.659  -20.433 1.00 1.00 ? 123 GLY A N    5  
ATOM 9701  C CA   . GLY A 1 123 ? 10.992  -1.636  -21.901 1.00 1.00 ? 123 GLY A CA   5  
ATOM 9702  C C    . GLY A 1 123 ? 11.699  -0.399  -22.463 1.00 1.00 ? 123 GLY A C    5  
ATOM 9703  O O    . GLY A 1 123 ? 11.438  -0.017  -23.605 1.00 1.00 ? 123 GLY A O    5  
ATOM 9704  H H    . GLY A 1 123 ? 10.227  -1.072  -20.012 1.00 1.00 ? 123 GLY A H    5  
ATOM 9705  H HA2  . GLY A 1 123 ? 11.513  -2.519  -22.272 1.00 1.00 ? 123 GLY A HA2  5  
ATOM 9706  H HA3  . GLY A 1 123 ? 9.973   -1.623  -22.293 1.00 1.00 ? 123 GLY A HA3  5  
ATOM 9707  N N    . LYS A 1 124 ? 12.584  0.233   -21.681 1.00 1.00 ? 124 LYS A N    5  
ATOM 9708  C CA   . LYS A 1 124 ? 13.417  1.364   -22.119 1.00 1.00 ? 124 LYS A CA   5  
ATOM 9709  C C    . LYS A 1 124 ? 14.196  1.052   -23.421 1.00 1.00 ? 124 LYS A C    5  
ATOM 9710  O O    . LYS A 1 124 ? 14.559  -0.106  -23.659 1.00 1.00 ? 124 LYS A O    5  
ATOM 9711  C CB   . LYS A 1 124 ? 14.336  1.796   -20.953 1.00 1.00 ? 124 LYS A CB   5  
ATOM 9712  C CG   . LYS A 1 124 ? 15.457  0.786   -20.625 1.00 1.00 ? 124 LYS A CG   5  
ATOM 9713  C CD   . LYS A 1 124 ? 16.792  1.152   -21.299 1.00 1.00 ? 124 LYS A CD   5  
ATOM 9714  C CE   . LYS A 1 124 ? 17.729  -0.052  -21.502 1.00 1.00 ? 124 LYS A CE   5  
ATOM 9715  N NZ   . LYS A 1 124 ? 17.404  -0.804  -22.748 1.00 1.00 ? 124 LYS A NZ   5  
ATOM 9716  H H    . LYS A 1 124 ? 12.730  -0.120  -20.747 1.00 1.00 ? 124 LYS A H    5  
ATOM 9717  H HA   . LYS A 1 124 ? 12.748  2.195   -22.336 1.00 1.00 ? 124 LYS A HA   5  
ATOM 9718  H HB2  . LYS A 1 124 ? 14.767  2.773   -21.173 1.00 1.00 ? 124 LYS A HB2  5  
ATOM 9719  H HB3  . LYS A 1 124 ? 13.721  1.926   -20.062 1.00 1.00 ? 124 LYS A HB3  5  
ATOM 9720  H HG2  . LYS A 1 124 ? 15.619  0.780   -19.549 1.00 1.00 ? 124 LYS A HG2  5  
ATOM 9721  H HG3  . LYS A 1 124 ? 15.147  -0.220  -20.917 1.00 1.00 ? 124 LYS A HG3  5  
ATOM 9722  H HD2  . LYS A 1 124 ? 16.608  1.620   -22.265 1.00 1.00 ? 124 LYS A HD2  5  
ATOM 9723  H HD3  . LYS A 1 124 ? 17.293  1.891   -20.671 1.00 1.00 ? 124 LYS A HD3  5  
ATOM 9724  H HE2  . LYS A 1 124 ? 18.756  0.325   -21.580 1.00 1.00 ? 124 LYS A HE2  5  
ATOM 9725  H HE3  . LYS A 1 124 ? 17.688  -0.708  -20.628 1.00 1.00 ? 124 LYS A HE3  5  
ATOM 9726  H HZ1  . LYS A 1 124 ? 18.082  -1.535  -22.927 1.00 1.00 ? 124 LYS A HZ1  5  
ATOM 9727  H HZ2  . LYS A 1 124 ? 16.485  -1.227  -22.708 1.00 1.00 ? 124 LYS A HZ2  5  
ATOM 9728  H HZ3  . LYS A 1 124 ? 17.405  -0.173  -23.553 1.00 1.00 ? 124 LYS A HZ3  5  
ATOM 9729  N N    . SER A 1 125 ? 14.469  2.082   -24.235 1.00 1.00 ? 125 SER A N    5  
ATOM 9730  C CA   . SER A 1 125 ? 15.121  2.009   -25.566 1.00 1.00 ? 125 SER A CA   5  
ATOM 9731  C C    . SER A 1 125 ? 16.305  1.035   -25.669 1.00 1.00 ? 125 SER A C    5  
ATOM 9732  O O    . SER A 1 125 ? 17.225  1.082   -24.818 1.00 1.00 ? 125 SER A O    5  
ATOM 9733  C CB   . SER A 1 125 ? 15.585  3.395   -26.010 1.00 1.00 ? 125 SER A CB   5  
ATOM 9734  O OG   . SER A 1 125 ? 14.472  4.278   -26.051 1.00 1.00 ? 125 SER A OG   5  
ATOM 9735  O OXT  . SER A 1 125 ? 16.310  0.215   -26.618 1.00 1.00 ? 125 SER A OXT  5  
ATOM 9736  H H    . SER A 1 125 ? 14.108  2.990   -23.960 1.00 1.00 ? 125 SER A H    5  
ATOM 9737  H HA   . SER A 1 125 ? 14.378  1.673   -26.288 1.00 1.00 ? 125 SER A HA   5  
ATOM 9738  H HB2  . SER A 1 125 ? 16.339  3.764   -25.310 1.00 1.00 ? 125 SER A HB2  5  
ATOM 9739  H HB3  . SER A 1 125 ? 16.033  3.313   -27.004 1.00 1.00 ? 125 SER A HB3  5  
ATOM 9740  H HG   . SER A 1 125 ? 14.750  5.137   -26.426 1.00 1.00 ? 125 SER A HG   5  
ATOM 9741  N N    . MET A 1 1   ? 11.223  23.077  11.823  1.00 1.00 ? 1   MET A N    6  
ATOM 9742  C CA   . MET A 1 1   ? 11.294  22.264  10.569  1.00 1.00 ? 1   MET A CA   6  
ATOM 9743  C C    . MET A 1 1   ? 10.090  21.312  10.460  1.00 1.00 ? 1   MET A C    6  
ATOM 9744  O O    . MET A 1 1   ? 9.508   20.929  11.478  1.00 1.00 ? 1   MET A O    6  
ATOM 9745  C CB   . MET A 1 1   ? 12.616  21.462  10.451  1.00 1.00 ? 1   MET A CB   6  
ATOM 9746  C CG   . MET A 1 1   ? 13.872  22.334  10.280  1.00 1.00 ? 1   MET A CG   6  
ATOM 9747  S SD   . MET A 1 1   ? 13.898  23.436  8.832   1.00 1.00 ? 1   MET A SD   6  
ATOM 9748  C CE   . MET A 1 1   ? 14.127  22.236  7.488   1.00 1.00 ? 1   MET A CE   6  
ATOM 9749  H H1   . MET A 1 1   ? 11.976  23.749  11.871  1.00 1.00 ? 1   MET A H1   6  
ATOM 9750  H H2   . MET A 1 1   ? 10.352  23.585  11.866  1.00 1.00 ? 1   MET A H2   6  
ATOM 9751  H H3   . MET A 1 1   ? 11.272  22.482  12.639  1.00 1.00 ? 1   MET A H3   6  
ATOM 9752  H HA   . MET A 1 1   ? 11.232  22.946  9.717   1.00 1.00 ? 1   MET A HA   6  
ATOM 9753  H HB2  . MET A 1 1   ? 12.745  20.838  11.336  1.00 1.00 ? 1   MET A HB2  6  
ATOM 9754  H HB3  . MET A 1 1   ? 12.557  20.793  9.589   1.00 1.00 ? 1   MET A HB3  6  
ATOM 9755  H HG2  . MET A 1 1   ? 14.009  22.943  11.174  1.00 1.00 ? 1   MET A HG2  6  
ATOM 9756  H HG3  . MET A 1 1   ? 14.740  21.676  10.211  1.00 1.00 ? 1   MET A HG3  6  
ATOM 9757  H HE1  . MET A 1 1   ? 15.035  21.655  7.663   1.00 1.00 ? 1   MET A HE1  6  
ATOM 9758  H HE2  . MET A 1 1   ? 13.273  21.560  7.435   1.00 1.00 ? 1   MET A HE2  6  
ATOM 9759  H HE3  . MET A 1 1   ? 14.220  22.765  6.540   1.00 1.00 ? 1   MET A HE3  6  
ATOM 9760  N N    . ALA A 1 2   ? 9.719   20.917  9.236   1.00 1.00 ? 2   ALA A N    6  
ATOM 9761  C CA   . ALA A 1 2   ? 8.637   19.956  8.972   1.00 1.00 ? 2   ALA A CA   6  
ATOM 9762  C C    . ALA A 1 2   ? 9.034   18.503  9.321   1.00 1.00 ? 2   ALA A C    6  
ATOM 9763  O O    . ALA A 1 2   ? 10.213  18.178  9.476   1.00 1.00 ? 2   ALA A O    6  
ATOM 9764  C CB   . ALA A 1 2   ? 8.222   20.094  7.499   1.00 1.00 ? 2   ALA A CB   6  
ATOM 9765  H H    . ALA A 1 2   ? 10.240  21.252  8.437   1.00 1.00 ? 2   ALA A H    6  
ATOM 9766  H HA   . ALA A 1 2   ? 7.775   20.216  9.593   1.00 1.00 ? 2   ALA A HA   6  
ATOM 9767  H HB1  . ALA A 1 2   ? 7.371   19.444  7.289   1.00 1.00 ? 2   ALA A HB1  6  
ATOM 9768  H HB2  . ALA A 1 2   ? 7.927   21.123  7.289   1.00 1.00 ? 2   ALA A HB2  6  
ATOM 9769  H HB3  . ALA A 1 2   ? 9.048   19.811  6.845   1.00 1.00 ? 2   ALA A HB3  6  
ATOM 9770  N N    . SER A 1 3   ? 8.048   17.613  9.416   1.00 1.00 ? 3   SER A N    6  
ATOM 9771  C CA   . SER A 1 3   ? 8.253   16.170  9.617   1.00 1.00 ? 3   SER A CA   6  
ATOM 9772  C C    . SER A 1 3   ? 8.735   15.443  8.331   1.00 1.00 ? 3   SER A C    6  
ATOM 9773  O O    . SER A 1 3   ? 8.541   15.968  7.223   1.00 1.00 ? 3   SER A O    6  
ATOM 9774  C CB   . SER A 1 3   ? 6.955   15.538  10.160  1.00 1.00 ? 3   SER A CB   6  
ATOM 9775  O OG   . SER A 1 3   ? 5.831   15.835  9.337   1.00 1.00 ? 3   SER A OG   6  
ATOM 9776  H H    . SER A 1 3   ? 7.099   17.911  9.235   1.00 1.00 ? 3   SER A H    6  
ATOM 9777  H HA   . SER A 1 3   ? 9.019   16.050  10.382  1.00 1.00 ? 3   SER A HA   6  
ATOM 9778  H HB2  . SER A 1 3   ? 7.081   14.457  10.232  1.00 1.00 ? 3   SER A HB2  6  
ATOM 9779  H HB3  . SER A 1 3   ? 6.770   15.925  11.165  1.00 1.00 ? 3   SER A HB3  6  
ATOM 9780  H HG   . SER A 1 3   ? 5.026   15.421  9.721   1.00 1.00 ? 3   SER A HG   6  
ATOM 9781  N N    . PRO A 1 4   ? 9.361   14.247  8.448   1.00 1.00 ? 4   PRO A N    6  
ATOM 9782  C CA   . PRO A 1 4   ? 9.809   13.448  7.306   1.00 1.00 ? 4   PRO A CA   6  
ATOM 9783  C C    . PRO A 1 4   ? 8.674   13.063  6.346   1.00 1.00 ? 4   PRO A C    6  
ATOM 9784  O O    . PRO A 1 4   ? 7.554   12.781  6.771   1.00 1.00 ? 4   PRO A O    6  
ATOM 9785  C CB   . PRO A 1 4   ? 10.470  12.194  7.891   1.00 1.00 ? 4   PRO A CB   6  
ATOM 9786  C CG   . PRO A 1 4   ? 10.912  12.645  9.280   1.00 1.00 ? 4   PRO A CG   6  
ATOM 9787  C CD   . PRO A 1 4   ? 9.803   13.612  9.684   1.00 1.00 ? 4   PRO A CD   6  
ATOM 9788  H HA   . PRO A 1 4   ? 10.563  14.027  6.768   1.00 1.00 ? 4   PRO A HA   6  
ATOM 9789  H HB2  . PRO A 1 4   ? 9.738   11.389  7.991   1.00 1.00 ? 4   PRO A HB2  6  
ATOM 9790  H HB3  . PRO A 1 4   ? 11.316  11.865  7.287   1.00 1.00 ? 4   PRO A HB3  6  
ATOM 9791  H HG2  . PRO A 1 4   ? 10.996  11.806  9.974   1.00 1.00 ? 4   PRO A HG2  6  
ATOM 9792  H HG3  . PRO A 1 4   ? 11.860  13.181  9.210   1.00 1.00 ? 4   PRO A HG3  6  
ATOM 9793  H HD2  . PRO A 1 4   ? 8.970   13.056  10.121  1.00 1.00 ? 4   PRO A HD2  6  
ATOM 9794  H HD3  . PRO A 1 4   ? 10.202  14.329  10.402  1.00 1.00 ? 4   PRO A HD3  6  
ATOM 9795  N N    . HIS A 1 5   ? 8.987   12.995  5.049   1.00 1.00 ? 5   HIS A N    6  
ATOM 9796  C CA   . HIS A 1 5   ? 8.070   12.625  3.963   1.00 1.00 ? 5   HIS A CA   6  
ATOM 9797  C C    . HIS A 1 5   ? 8.857   12.237  2.684   1.00 1.00 ? 5   HIS A C    6  
ATOM 9798  O O    . HIS A 1 5   ? 10.075  12.437  2.614   1.00 1.00 ? 5   HIS A O    6  
ATOM 9799  C CB   . HIS A 1 5   ? 7.084   13.788  3.709   1.00 1.00 ? 5   HIS A CB   6  
ATOM 9800  C CG   . HIS A 1 5   ? 5.849   13.384  2.940   1.00 1.00 ? 5   HIS A CG   6  
ATOM 9801  N ND1  . HIS A 1 5   ? 4.798   12.634  3.423   1.00 1.00 ? 5   HIS A ND1  6  
ATOM 9802  C CD2  . HIS A 1 5   ? 5.550   13.703  1.641   1.00 1.00 ? 5   HIS A CD2  6  
ATOM 9803  C CE1  . HIS A 1 5   ? 3.898   12.496  2.433   1.00 1.00 ? 5   HIS A CE1  6  
ATOM 9804  N NE2  . HIS A 1 5   ? 4.316   13.126  1.319   1.00 1.00 ? 5   HIS A NE2  6  
ATOM 9805  H H    . HIS A 1 5   ? 9.940   13.201  4.765   1.00 1.00 ? 5   HIS A H    6  
ATOM 9806  H HA   . HIS A 1 5   ? 7.500   11.746  4.277   1.00 1.00 ? 5   HIS A HA   6  
ATOM 9807  H HB2  . HIS A 1 5   ? 6.751   14.200  4.661   1.00 1.00 ? 5   HIS A HB2  6  
ATOM 9808  H HB3  . HIS A 1 5   ? 7.604   14.590  3.178   1.00 1.00 ? 5   HIS A HB3  6  
ATOM 9809  H HD1  . HIS A 1 5   ? 4.703   12.270  4.363   1.00 1.00 ? 5   HIS A HD1  6  
ATOM 9810  H HD2  . HIS A 1 5   ? 6.174   14.294  0.978   1.00 1.00 ? 5   HIS A HD2  6  
ATOM 9811  H HE1  . HIS A 1 5   ? 2.964   11.955  2.527   1.00 1.00 ? 5   HIS A HE1  6  
ATOM 9812  N N    . GLN A 1 6   ? 8.185   11.676  1.669   1.00 1.00 ? 6   GLN A N    6  
ATOM 9813  C CA   . GLN A 1 6   ? 8.811   11.320  0.389   1.00 1.00 ? 6   GLN A CA   6  
ATOM 9814  C C    . GLN A 1 6   ? 9.073   12.553  -0.496  1.00 1.00 ? 6   GLN A C    6  
ATOM 9815  O O    . GLN A 1 6   ? 8.287   13.503  -0.510  1.00 1.00 ? 6   GLN A O    6  
ATOM 9816  C CB   . GLN A 1 6   ? 7.929   10.332  -0.398  1.00 1.00 ? 6   GLN A CB   6  
ATOM 9817  C CG   . GLN A 1 6   ? 7.792   8.944   0.254   1.00 1.00 ? 6   GLN A CG   6  
ATOM 9818  C CD   . GLN A 1 6   ? 7.077   7.942   -0.656  1.00 1.00 ? 6   GLN A CD   6  
ATOM 9819  O OE1  . GLN A 1 6   ? 6.441   8.285   -1.646  1.00 1.00 ? 6   GLN A OE1  6  
ATOM 9820  N NE2  . GLN A 1 6   ? 7.159   6.655   -0.385  1.00 1.00 ? 6   GLN A NE2  6  
ATOM 9821  H H    . GLN A 1 6   ? 7.182   11.572  1.746   1.00 1.00 ? 6   GLN A H    6  
ATOM 9822  H HA   . GLN A 1 6   ? 9.774   10.846  0.591   1.00 1.00 ? 6   GLN A HA   6  
ATOM 9823  H HB2  . GLN A 1 6   ? 6.934   10.765  -0.534  1.00 1.00 ? 6   GLN A HB2  6  
ATOM 9824  H HB3  . GLN A 1 6   ? 8.373   10.197  -1.388  1.00 1.00 ? 6   GLN A HB3  6  
ATOM 9825  H HG2  . GLN A 1 6   ? 8.785   8.559   0.479   1.00 1.00 ? 6   GLN A HG2  6  
ATOM 9826  H HG3  . GLN A 1 6   ? 7.237   9.028   1.189   1.00 1.00 ? 6   GLN A HG3  6  
ATOM 9827  H HE21 . GLN A 1 6   ? 7.681   6.334   0.420   1.00 1.00 ? 6   GLN A HE21 6  
ATOM 9828  H HE22 . GLN A 1 6   ? 6.727   6.005   -1.023  1.00 1.00 ? 6   GLN A HE22 6  
ATOM 9829  N N    . GLU A 1 7   ? 10.147  12.497  -1.296  1.00 1.00 ? 7   GLU A N    6  
ATOM 9830  C CA   . GLU A 1 7   ? 10.457  13.454  -2.364  1.00 1.00 ? 7   GLU A CA   6  
ATOM 9831  C C    . GLU A 1 7   ? 10.954  12.673  -3.602  1.00 1.00 ? 7   GLU A C    6  
ATOM 9832  O O    . GLU A 1 7   ? 11.880  11.865  -3.457  1.00 1.00 ? 7   GLU A O    6  
ATOM 9833  C CB   . GLU A 1 7   ? 11.533  14.463  -1.917  1.00 1.00 ? 7   GLU A CB   6  
ATOM 9834  C CG   . GLU A 1 7   ? 11.041  15.440  -0.841  1.00 1.00 ? 7   GLU A CG   6  
ATOM 9835  C CD   . GLU A 1 7   ? 12.117  16.490  -0.524  1.00 1.00 ? 7   GLU A CD   6  
ATOM 9836  O OE1  . GLU A 1 7   ? 12.967  16.248  0.367   1.00 1.00 ? 7   GLU A OE1  6  
ATOM 9837  O OE2  . GLU A 1 7   ? 12.120  17.571  -1.158  1.00 1.00 ? 7   GLU A OE2  6  
ATOM 9838  H H    . GLU A 1 7   ? 10.769  11.702  -1.226  1.00 1.00 ? 7   GLU A H    6  
ATOM 9839  H HA   . GLU A 1 7   ? 9.555   14.012  -2.610  1.00 1.00 ? 7   GLU A HA   6  
ATOM 9840  H HB2  . GLU A 1 7   ? 12.405  13.926  -1.542  1.00 1.00 ? 7   GLU A HB2  6  
ATOM 9841  H HB3  . GLU A 1 7   ? 11.840  15.043  -2.789  1.00 1.00 ? 7   GLU A HB3  6  
ATOM 9842  H HG2  . GLU A 1 7   ? 10.136  15.939  -1.196  1.00 1.00 ? 7   GLU A HG2  6  
ATOM 9843  H HG3  . GLU A 1 7   ? 10.790  14.888  0.069   1.00 1.00 ? 7   GLU A HG3  6  
ATOM 9844  N N    . PRO A 1 8   ? 10.364  12.874  -4.801  1.00 1.00 ? 8   PRO A N    6  
ATOM 9845  C CA   . PRO A 1 8   ? 10.685  12.091  -5.991  1.00 1.00 ? 8   PRO A CA   6  
ATOM 9846  C C    . PRO A 1 8   ? 12.002  12.530  -6.643  1.00 1.00 ? 8   PRO A C    6  
ATOM 9847  O O    . PRO A 1 8   ? 12.390  13.697  -6.593  1.00 1.00 ? 8   PRO A O    6  
ATOM 9848  C CB   . PRO A 1 8   ? 9.497   12.285  -6.937  1.00 1.00 ? 8   PRO A CB   6  
ATOM 9849  C CG   . PRO A 1 8   ? 9.006   13.687  -6.587  1.00 1.00 ? 8   PRO A CG   6  
ATOM 9850  C CD   . PRO A 1 8   ? 9.242   13.762  -5.078  1.00 1.00 ? 8   PRO A CD   6  
ATOM 9851  H HA   . PRO A 1 8   ? 10.759  11.036  -5.731  1.00 1.00 ? 8   PRO A HA   6  
ATOM 9852  H HB2  . PRO A 1 8   ? 9.784   12.202  -7.985  1.00 1.00 ? 8   PRO A HB2  6  
ATOM 9853  H HB3  . PRO A 1 8   ? 8.719   11.557  -6.702  1.00 1.00 ? 8   PRO A HB3  6  
ATOM 9854  H HG2  . PRO A 1 8   ? 9.625   14.431  -7.088  1.00 1.00 ? 8   PRO A HG2  6  
ATOM 9855  H HG3  . PRO A 1 8   ? 7.955   13.826  -6.840  1.00 1.00 ? 8   PRO A HG3  6  
ATOM 9856  H HD2  . PRO A 1 8   ? 9.473   14.786  -4.780  1.00 1.00 ? 8   PRO A HD2  6  
ATOM 9857  H HD3  . PRO A 1 8   ? 8.357   13.401  -4.550  1.00 1.00 ? 8   PRO A HD3  6  
ATOM 9858  N N    . LYS A 1 9   ? 12.673  11.572  -7.289  1.00 1.00 ? 9   LYS A N    6  
ATOM 9859  C CA   . LYS A 1 9   ? 13.897  11.754  -8.077  1.00 1.00 ? 9   LYS A CA   6  
ATOM 9860  C C    . LYS A 1 9   ? 13.763  11.185  -9.511  1.00 1.00 ? 9   LYS A C    6  
ATOM 9861  O O    . LYS A 1 9   ? 12.877  10.361  -9.759  1.00 1.00 ? 9   LYS A O    6  
ATOM 9862  C CB   . LYS A 1 9   ? 15.071  11.100  -7.318  1.00 1.00 ? 9   LYS A CB   6  
ATOM 9863  C CG   . LYS A 1 9   ? 15.508  11.872  -6.062  1.00 1.00 ? 9   LYS A CG   6  
ATOM 9864  C CD   . LYS A 1 9   ? 16.091  13.260  -6.394  1.00 1.00 ? 9   LYS A CD   6  
ATOM 9865  C CE   . LYS A 1 9   ? 16.784  13.919  -5.188  1.00 1.00 ? 9   LYS A CE   6  
ATOM 9866  N NZ   . LYS A 1 9   ? 15.832  14.287  -4.097  1.00 1.00 ? 9   LYS A NZ   6  
ATOM 9867  H H    . LYS A 1 9   ? 12.314  10.620  -7.225  1.00 1.00 ? 9   LYS A H    6  
ATOM 9868  H HA   . LYS A 1 9   ? 14.078  12.820  -8.180  1.00 1.00 ? 9   LYS A HA   6  
ATOM 9869  H HB2  . LYS A 1 9   ? 14.781  10.089  -7.020  1.00 1.00 ? 9   LYS A HB2  6  
ATOM 9870  H HB3  . LYS A 1 9   ? 15.938  11.000  -7.975  1.00 1.00 ? 9   LYS A HB3  6  
ATOM 9871  H HG2  . LYS A 1 9   ? 14.655  11.972  -5.390  1.00 1.00 ? 9   LYS A HG2  6  
ATOM 9872  H HG3  . LYS A 1 9   ? 16.272  11.283  -5.555  1.00 1.00 ? 9   LYS A HG3  6  
ATOM 9873  H HD2  . LYS A 1 9   ? 16.832  13.142  -7.190  1.00 1.00 ? 9   LYS A HD2  6  
ATOM 9874  H HD3  . LYS A 1 9   ? 15.308  13.923  -6.768  1.00 1.00 ? 9   LYS A HD3  6  
ATOM 9875  H HE2  . LYS A 1 9   ? 17.551  13.235  -4.806  1.00 1.00 ? 9   LYS A HE2  6  
ATOM 9876  H HE3  . LYS A 1 9   ? 17.302  14.818  -5.538  1.00 1.00 ? 9   LYS A HE3  6  
ATOM 9877  H HZ1  . LYS A 1 9   ? 15.118  14.922  -4.432  1.00 1.00 ? 9   LYS A HZ1  6  
ATOM 9878  H HZ2  . LYS A 1 9   ? 15.381  13.471  -3.703  1.00 1.00 ? 9   LYS A HZ2  6  
ATOM 9879  H HZ3  . LYS A 1 9   ? 16.323  14.753  -3.345  1.00 1.00 ? 9   LYS A HZ3  6  
ATOM 9880  N N    . PRO A 1 10  ? 14.606  11.645  -10.469 1.00 1.00 ? 10  PRO A N    6  
ATOM 9881  C CA   . PRO A 1 10  ? 14.558  11.240  -11.874 1.00 1.00 ? 10  PRO A CA   6  
ATOM 9882  C C    . PRO A 1 10  ? 14.428  9.718   -12.059 1.00 1.00 ? 10  PRO A C    6  
ATOM 9883  O O    . PRO A 1 10  ? 15.200  8.954   -11.482 1.00 1.00 ? 10  PRO A O    6  
ATOM 9884  C CB   . PRO A 1 10  ? 15.837  11.802  -12.507 1.00 1.00 ? 10  PRO A CB   6  
ATOM 9885  C CG   . PRO A 1 10  ? 16.060  13.086  -11.712 1.00 1.00 ? 10  PRO A CG   6  
ATOM 9886  C CD   . PRO A 1 10  ? 15.639  12.673  -10.305 1.00 1.00 ? 10  PRO A CD   6  
ATOM 9887  H HA   . PRO A 1 10  ? 13.708  11.737  -12.342 1.00 1.00 ? 10  PRO A HA   6  
ATOM 9888  H HB2  . PRO A 1 10  ? 16.679  11.129  -12.338 1.00 1.00 ? 10  PRO A HB2  6  
ATOM 9889  H HB3  . PRO A 1 10  ? 15.717  12.010  -13.570 1.00 1.00 ? 10  PRO A HB3  6  
ATOM 9890  H HG2  . PRO A 1 10  ? 17.100  13.411  -11.748 1.00 1.00 ? 10  PRO A HG2  6  
ATOM 9891  H HG3  . PRO A 1 10  ? 15.397  13.869  -12.085 1.00 1.00 ? 10  PRO A HG3  6  
ATOM 9892  H HD2  . PRO A 1 10  ? 16.500  12.247  -9.788  1.00 1.00 ? 10  PRO A HD2  6  
ATOM 9893  H HD3  . PRO A 1 10  ? 15.274  13.548  -9.767  1.00 1.00 ? 10  PRO A HD3  6  
ATOM 9894  N N    . GLY A 1 11  ? 13.432  9.296   -12.851 1.00 1.00 ? 11  GLY A N    6  
ATOM 9895  C CA   . GLY A 1 11  ? 13.146  7.891   -13.168 1.00 1.00 ? 11  GLY A CA   6  
ATOM 9896  C C    . GLY A 1 11  ? 12.128  7.208   -12.243 1.00 1.00 ? 11  GLY A C    6  
ATOM 9897  O O    . GLY A 1 11  ? 11.723  6.084   -12.538 1.00 1.00 ? 11  GLY A O    6  
ATOM 9898  H H    . GLY A 1 11  ? 12.789  9.983   -13.232 1.00 1.00 ? 11  GLY A H    6  
ATOM 9899  H HA2  . GLY A 1 11  ? 12.745  7.837   -14.183 1.00 1.00 ? 11  GLY A HA2  6  
ATOM 9900  H HA3  . GLY A 1 11  ? 14.070  7.314   -13.115 1.00 1.00 ? 11  GLY A HA3  6  
ATOM 9901  N N    . ASP A 1 12  ? 11.708  7.849   -11.147 1.00 1.00 ? 12  ASP A N    6  
ATOM 9902  C CA   . ASP A 1 12  ? 10.750  7.289   -10.188 1.00 1.00 ? 12  ASP A CA   6  
ATOM 9903  C C    . ASP A 1 12  ? 9.331   7.123   -10.761 1.00 1.00 ? 12  ASP A C    6  
ATOM 9904  O O    . ASP A 1 12  ? 8.829   7.966   -11.512 1.00 1.00 ? 12  ASP A O    6  
ATOM 9905  C CB   . ASP A 1 12  ? 10.672  8.149   -8.912  1.00 1.00 ? 12  ASP A CB   6  
ATOM 9906  C CG   . ASP A 1 12  ? 11.873  8.014   -7.951  1.00 1.00 ? 12  ASP A CG   6  
ATOM 9907  O OD1  . ASP A 1 12  ? 12.746  7.134   -8.146  1.00 1.00 ? 12  ASP A OD1  6  
ATOM 9908  O OD2  . ASP A 1 12  ? 11.906  8.774   -6.954  1.00 1.00 ? 12  ASP A OD2  6  
ATOM 9909  H H    . ASP A 1 12  ? 12.121  8.742   -10.921 1.00 1.00 ? 12  ASP A H    6  
ATOM 9910  H HA   . ASP A 1 12  ? 11.103  6.302   -9.902  1.00 1.00 ? 12  ASP A HA   6  
ATOM 9911  H HB2  . ASP A 1 12  ? 10.533  9.194   -9.187  1.00 1.00 ? 12  ASP A HB2  6  
ATOM 9912  H HB3  . ASP A 1 12  ? 9.778   7.852   -8.361  1.00 1.00 ? 12  ASP A HB3  6  
ATOM 9913  N N    . LEU A 1 13  ? 8.668   6.042   -10.345 1.00 1.00 ? 13  LEU A N    6  
ATOM 9914  C CA   . LEU A 1 13  ? 7.250   5.790   -10.577 1.00 1.00 ? 13  LEU A CA   6  
ATOM 9915  C C    . LEU A 1 13  ? 6.455   6.480   -9.466  1.00 1.00 ? 13  LEU A C    6  
ATOM 9916  O O    . LEU A 1 13  ? 6.701   6.232   -8.286  1.00 1.00 ? 13  LEU A O    6  
ATOM 9917  C CB   . LEU A 1 13  ? 6.950   4.274   -10.572 1.00 1.00 ? 13  LEU A CB   6  
ATOM 9918  C CG   . LEU A 1 13  ? 7.476   3.408   -11.738 1.00 1.00 ? 13  LEU A CG   6  
ATOM 9919  C CD1  . LEU A 1 13  ? 7.258   4.091   -13.087 1.00 1.00 ? 13  LEU A CD1  6  
ATOM 9920  C CD2  . LEU A 1 13  ? 8.947   2.997   -11.583 1.00 1.00 ? 13  LEU A CD2  6  
ATOM 9921  H H    . LEU A 1 13  ? 9.150   5.419   -9.706  1.00 1.00 ? 13  LEU A H    6  
ATOM 9922  H HA   . LEU A 1 13  ? 6.947   6.231   -11.528 1.00 1.00 ? 13  LEU A HA   6  
ATOM 9923  H HB2  . LEU A 1 13  ? 7.310   3.848   -9.636  1.00 1.00 ? 13  LEU A HB2  6  
ATOM 9924  H HB3  . LEU A 1 13  ? 5.864   4.163   -10.568 1.00 1.00 ? 13  LEU A HB3  6  
ATOM 9925  H HG   . LEU A 1 13  ? 6.894   2.486   -11.739 1.00 1.00 ? 13  LEU A HG   6  
ATOM 9926  H HD11 . LEU A 1 13  ? 6.235   4.458   -13.144 1.00 1.00 ? 13  LEU A HD11 6  
ATOM 9927  H HD12 . LEU A 1 13  ? 7.940   4.932   -13.193 1.00 1.00 ? 13  LEU A HD12 6  
ATOM 9928  H HD13 . LEU A 1 13  ? 7.436   3.383   -13.894 1.00 1.00 ? 13  LEU A HD13 6  
ATOM 9929  H HD21 . LEU A 1 13  ? 9.601   3.871   -11.592 1.00 1.00 ? 13  LEU A HD21 6  
ATOM 9930  H HD22 . LEU A 1 13  ? 9.079   2.462   -10.642 1.00 1.00 ? 13  LEU A HD22 6  
ATOM 9931  H HD23 . LEU A 1 13  ? 9.230   2.335   -12.402 1.00 1.00 ? 13  LEU A HD23 6  
ATOM 9932  N N    . ILE A 1 14  ? 5.469   7.305   -9.820  1.00 1.00 ? 14  ILE A N    6  
ATOM 9933  C CA   . ILE A 1 14  ? 4.549   7.936   -8.862  1.00 1.00 ? 14  ILE A CA   6  
ATOM 9934  C C    . ILE A 1 14  ? 3.163   7.342   -9.099  1.00 1.00 ? 14  ILE A C    6  
ATOM 9935  O O    . ILE A 1 14  ? 2.717   7.294   -10.244 1.00 1.00 ? 14  ILE A O    6  
ATOM 9936  C CB   . ILE A 1 14  ? 4.561   9.479   -9.006  1.00 1.00 ? 14  ILE A CB   6  
ATOM 9937  C CG1  . ILE A 1 14  ? 5.989   10.038  -8.788  1.00 1.00 ? 14  ILE A CG1  6  
ATOM 9938  C CG2  . ILE A 1 14  ? 3.580   10.125  -8.003  1.00 1.00 ? 14  ILE A CG2  6  
ATOM 9939  C CD1  . ILE A 1 14  ? 6.088   11.568  -8.813  1.00 1.00 ? 14  ILE A CD1  6  
ATOM 9940  H H    . ILE A 1 14  ? 5.252   7.409   -10.813 1.00 1.00 ? 14  ILE A H    6  
ATOM 9941  H HA   . ILE A 1 14  ? 4.851   7.690   -7.842  1.00 1.00 ? 14  ILE A HA   6  
ATOM 9942  H HB   . ILE A 1 14  ? 4.236   9.736   -10.016 1.00 1.00 ? 14  ILE A HB   6  
ATOM 9943  H HG12 . ILE A 1 14  ? 6.365   9.685   -7.828  1.00 1.00 ? 14  ILE A HG12 6  
ATOM 9944  H HG13 . ILE A 1 14  ? 6.646   9.656   -9.572  1.00 1.00 ? 14  ILE A HG13 6  
ATOM 9945  H HG21 . ILE A 1 14  ? 3.951   10.003  -6.985  1.00 1.00 ? 14  ILE A HG21 6  
ATOM 9946  H HG22 . ILE A 1 14  ? 3.461   11.188  -8.217  1.00 1.00 ? 14  ILE A HG22 6  
ATOM 9947  H HG23 . ILE A 1 14  ? 2.591   9.675   -8.075  1.00 1.00 ? 14  ILE A HG23 6  
ATOM 9948  H HD11 . ILE A 1 14  ? 7.135   11.865  -8.757  1.00 1.00 ? 14  ILE A HD11 6  
ATOM 9949  H HD12 . ILE A 1 14  ? 5.652   11.957  -9.734  1.00 1.00 ? 14  ILE A HD12 6  
ATOM 9950  H HD13 . ILE A 1 14  ? 5.571   11.996  -7.951  1.00 1.00 ? 14  ILE A HD13 6  
ATOM 9951  N N    . GLU A 1 15  ? 2.496   6.908   -8.032  1.00 1.00 ? 15  GLU A N    6  
ATOM 9952  C CA   . GLU A 1 15  ? 1.090   6.509   -8.039  1.00 1.00 ? 15  GLU A CA   6  
ATOM 9953  C C    . GLU A 1 15  ? 0.248   7.631   -7.424  1.00 1.00 ? 15  GLU A C    6  
ATOM 9954  O O    . GLU A 1 15  ? 0.652   8.278   -6.455  1.00 1.00 ? 15  GLU A O    6  
ATOM 9955  C CB   . GLU A 1 15  ? 0.899   5.153   -7.337  1.00 1.00 ? 15  GLU A CB   6  
ATOM 9956  C CG   . GLU A 1 15  ? 1.322   5.108   -5.862  1.00 1.00 ? 15  GLU A CG   6  
ATOM 9957  C CD   . GLU A 1 15  ? 1.247   3.697   -5.247  1.00 1.00 ? 15  GLU A CD   6  
ATOM 9958  O OE1  . GLU A 1 15  ? 1.131   2.688   -5.984  1.00 1.00 ? 15  GLU A OE1  6  
ATOM 9959  O OE2  . GLU A 1 15  ? 1.369   3.588   -4.004  1.00 1.00 ? 15  GLU A OE2  6  
ATOM 9960  H H    . GLU A 1 15  ? 2.917   7.048   -7.118  1.00 1.00 ? 15  GLU A H    6  
ATOM 9961  H HA   . GLU A 1 15  ? 0.760   6.377   -9.072  1.00 1.00 ? 15  GLU A HA   6  
ATOM 9962  H HB2  . GLU A 1 15  ? -0.151  4.872   -7.411  1.00 1.00 ? 15  GLU A HB2  6  
ATOM 9963  H HB3  . GLU A 1 15  ? 1.488   4.421   -7.890  1.00 1.00 ? 15  GLU A HB3  6  
ATOM 9964  H HG2  . GLU A 1 15  ? 2.348   5.462   -5.773  1.00 1.00 ? 15  GLU A HG2  6  
ATOM 9965  H HG3  . GLU A 1 15  ? 0.675   5.779   -5.295  1.00 1.00 ? 15  GLU A HG3  6  
ATOM 9966  N N    . ILE A 1 16  ? -0.905  7.898   -8.028  1.00 1.00 ? 16  ILE A N    6  
ATOM 9967  C CA   . ILE A 1 16  ? -1.783  9.045   -7.768  1.00 1.00 ? 16  ILE A CA   6  
ATOM 9968  C C    . ILE A 1 16  ? -3.217  8.527   -7.591  1.00 1.00 ? 16  ILE A C    6  
ATOM 9969  O O    . ILE A 1 16  ? -3.689  7.708   -8.381  1.00 1.00 ? 16  ILE A O    6  
ATOM 9970  C CB   . ILE A 1 16  ? -1.682  10.053  -8.945  1.00 1.00 ? 16  ILE A CB   6  
ATOM 9971  C CG1  . ILE A 1 16  ? -0.247  10.610  -9.120  1.00 1.00 ? 16  ILE A CG1  6  
ATOM 9972  C CG2  . ILE A 1 16  ? -2.674  11.226  -8.784  1.00 1.00 ? 16  ILE A CG2  6  
ATOM 9973  C CD1  . ILE A 1 16  ? 0.054   11.127  -10.533 1.00 1.00 ? 16  ILE A CD1  6  
ATOM 9974  H H    . ILE A 1 16  ? -1.166  7.315   -8.826  1.00 1.00 ? 16  ILE A H    6  
ATOM 9975  H HA   . ILE A 1 16  ? -1.481  9.541   -6.844  1.00 1.00 ? 16  ILE A HA   6  
ATOM 9976  H HB   . ILE A 1 16  ? -1.946  9.516   -9.855  1.00 1.00 ? 16  ILE A HB   6  
ATOM 9977  H HG12 . ILE A 1 16  ? -0.077  11.410  -8.404  1.00 1.00 ? 16  ILE A HG12 6  
ATOM 9978  H HG13 . ILE A 1 16  ? 0.490   9.837   -8.926  1.00 1.00 ? 16  ILE A HG13 6  
ATOM 9979  H HG21 . ILE A 1 16  ? -2.466  11.769  -7.861  1.00 1.00 ? 16  ILE A HG21 6  
ATOM 9980  H HG22 . ILE A 1 16  ? -2.588  11.919  -9.622  1.00 1.00 ? 16  ILE A HG22 6  
ATOM 9981  H HG23 . ILE A 1 16  ? -3.701  10.863  -8.764  1.00 1.00 ? 16  ILE A HG23 6  
ATOM 9982  H HD11 . ILE A 1 16  ? -0.696  11.848  -10.859 1.00 1.00 ? 16  ILE A HD11 6  
ATOM 9983  H HD12 . ILE A 1 16  ? 1.033   11.612  -10.534 1.00 1.00 ? 16  ILE A HD12 6  
ATOM 9984  H HD13 . ILE A 1 16  ? 0.084   10.288  -11.227 1.00 1.00 ? 16  ILE A HD13 6  
ATOM 9985  N N    . PHE A 1 17  ? -3.922  9.017   -6.574  1.00 1.00 ? 17  PHE A N    6  
ATOM 9986  C CA   . PHE A 1 17  ? -5.262  8.575   -6.196  1.00 1.00 ? 17  PHE A CA   6  
ATOM 9987  C C    . PHE A 1 17  ? -6.254  9.721   -6.421  1.00 1.00 ? 17  PHE A C    6  
ATOM 9988  O O    . PHE A 1 17  ? -6.424  10.590  -5.562  1.00 1.00 ? 17  PHE A O    6  
ATOM 9989  C CB   . PHE A 1 17  ? -5.227  8.085   -4.739  1.00 1.00 ? 17  PHE A CB   6  
ATOM 9990  C CG   . PHE A 1 17  ? -4.187  7.005   -4.489  1.00 1.00 ? 17  PHE A CG   6  
ATOM 9991  C CD1  . PHE A 1 17  ? -4.473  5.661   -4.802  1.00 1.00 ? 17  PHE A CD1  6  
ATOM 9992  C CD2  . PHE A 1 17  ? -2.916  7.352   -3.990  1.00 1.00 ? 17  PHE A CD2  6  
ATOM 9993  C CE1  . PHE A 1 17  ? -3.491  4.670   -4.616  1.00 1.00 ? 17  PHE A CE1  6  
ATOM 9994  C CE2  . PHE A 1 17  ? -1.937  6.360   -3.805  1.00 1.00 ? 17  PHE A CE2  6  
ATOM 9995  C CZ   . PHE A 1 17  ? -2.223  5.019   -4.120  1.00 1.00 ? 17  PHE A CZ   6  
ATOM 9996  H H    . PHE A 1 17  ? -3.480  9.712   -5.987  1.00 1.00 ? 17  PHE A H    6  
ATOM 9997  H HA   . PHE A 1 17  ? -5.562  7.731   -6.820  1.00 1.00 ? 17  PHE A HA   6  
ATOM 9998  H HB2  . PHE A 1 17  ? -5.021  8.927   -4.078  1.00 1.00 ? 17  PHE A HB2  6  
ATOM 9999  H HB3  . PHE A 1 17  ? -6.209  7.694   -4.470  1.00 1.00 ? 17  PHE A HB3  6  
ATOM 10000 H HD1  . PHE A 1 17  ? -5.446  5.389   -5.185  1.00 1.00 ? 17  PHE A HD1  6  
ATOM 10001 H HD2  . PHE A 1 17  ? -2.682  8.381   -3.756  1.00 1.00 ? 17  PHE A HD2  6  
ATOM 10002 H HE1  . PHE A 1 17  ? -3.715  3.639   -4.861  1.00 1.00 ? 17  PHE A HE1  6  
ATOM 10003 H HE2  . PHE A 1 17  ? -0.967  6.629   -3.417  1.00 1.00 ? 17  PHE A HE2  6  
ATOM 10004 H HZ   . PHE A 1 17  ? -1.469  4.258   -3.976  1.00 1.00 ? 17  PHE A HZ   6  
ATOM 10005 N N    . ARG A 1 18  ? -6.885  9.735   -7.604  1.00 1.00 ? 18  ARG A N    6  
ATOM 10006 C CA   . ARG A 1 18  ? -7.960  10.676  -7.943  1.00 1.00 ? 18  ARG A CA   6  
ATOM 10007 C C    . ARG A 1 18  ? -9.301  10.193  -7.362  1.00 1.00 ? 18  ARG A C    6  
ATOM 10008 O O    . ARG A 1 18  ? -9.427  9.041   -6.937  1.00 1.00 ? 18  ARG A O    6  
ATOM 10009 C CB   . ARG A 1 18  ? -8.061  10.892  -9.471  1.00 1.00 ? 18  ARG A CB   6  
ATOM 10010 C CG   . ARG A 1 18  ? -6.717  11.145  -10.184 1.00 1.00 ? 18  ARG A CG   6  
ATOM 10011 C CD   . ARG A 1 18  ? -6.963  11.666  -11.609 1.00 1.00 ? 18  ARG A CD   6  
ATOM 10012 N NE   . ARG A 1 18  ? -5.710  11.897  -12.359 1.00 1.00 ? 18  ARG A NE   6  
ATOM 10013 C CZ   . ARG A 1 18  ? -4.967  13.001  -12.365 1.00 1.00 ? 18  ARG A CZ   6  
ATOM 10014 N NH1  . ARG A 1 18  ? -5.185  14.005  -11.538 1.00 1.00 ? 18  ARG A NH1  6  
ATOM 10015 N NH2  . ARG A 1 18  ? -3.977  13.124  -13.224 1.00 1.00 ? 18  ARG A NH2  6  
ATOM 10016 H H    . ARG A 1 18  ? -6.721  8.971   -8.247  1.00 1.00 ? 18  ARG A H    6  
ATOM 10017 H HA   . ARG A 1 18  ? -7.729  11.636  -7.476  1.00 1.00 ? 18  ARG A HA   6  
ATOM 10018 H HB2  . ARG A 1 18  ? -8.542  10.028  -9.933  1.00 1.00 ? 18  ARG A HB2  6  
ATOM 10019 H HB3  . ARG A 1 18  ? -8.713  11.750  -9.640  1.00 1.00 ? 18  ARG A HB3  6  
ATOM 10020 H HG2  . ARG A 1 18  ? -6.134  11.876  -9.629  1.00 1.00 ? 18  ARG A HG2  6  
ATOM 10021 H HG3  . ARG A 1 18  ? -6.148  10.215  -10.237 1.00 1.00 ? 18  ARG A HG3  6  
ATOM 10022 H HD2  . ARG A 1 18  ? -7.557  10.924  -12.145 1.00 1.00 ? 18  ARG A HD2  6  
ATOM 10023 H HD3  . ARG A 1 18  ? -7.549  12.585  -11.570 1.00 1.00 ? 18  ARG A HD3  6  
ATOM 10024 H HE   . ARG A 1 18  ? -5.472  11.191  -13.043 1.00 1.00 ? 18  ARG A HE   6  
ATOM 10025 H HH11 . ARG A 1 18  ? -5.935  13.969  -10.867 1.00 1.00 ? 18  ARG A HH11 6  
ATOM 10026 H HH12 . ARG A 1 18  ? -4.608  14.835  -11.588 1.00 1.00 ? 18  ARG A HH12 6  
ATOM 10027 H HH21 . ARG A 1 18  ? -3.770  12.399  -13.905 1.00 1.00 ? 18  ARG A HH21 6  
ATOM 10028 H HH22 . ARG A 1 18  ? -3.447  13.986  -13.253 1.00 1.00 ? 18  ARG A HH22 6  
ATOM 10029 N N    . LEU A 1 19  ? -10.322 11.058  -7.354  1.00 1.00 ? 19  LEU A N    6  
ATOM 10030 C CA   . LEU A 1 19  ? -11.662 10.729  -6.855  1.00 1.00 ? 19  LEU A CA   6  
ATOM 10031 C C    . LEU A 1 19  ? -12.296 9.593   -7.686  1.00 1.00 ? 19  LEU A C    6  
ATOM 10032 O O    . LEU A 1 19  ? -12.723 9.805   -8.822  1.00 1.00 ? 19  LEU A O    6  
ATOM 10033 C CB   . LEU A 1 19  ? -12.515 12.016  -6.837  1.00 1.00 ? 19  LEU A CB   6  
ATOM 10034 C CG   . LEU A 1 19  ? -13.953 11.839  -6.303  1.00 1.00 ? 19  LEU A CG   6  
ATOM 10035 C CD1  . LEU A 1 19  ? -13.987 11.326  -4.855  1.00 1.00 ? 19  LEU A CD1  6  
ATOM 10036 C CD2  . LEU A 1 19  ? -14.692 13.185  -6.385  1.00 1.00 ? 19  LEU A CD2  6  
ATOM 10037 H H    . LEU A 1 19  ? -10.159 11.995  -7.694  1.00 1.00 ? 19  LEU A H    6  
ATOM 10038 H HA   . LEU A 1 19  ? -11.555 10.385  -5.823  1.00 1.00 ? 19  LEU A HA   6  
ATOM 10039 H HB2  . LEU A 1 19  ? -12.009 12.759  -6.220  1.00 1.00 ? 19  LEU A HB2  6  
ATOM 10040 H HB3  . LEU A 1 19  ? -12.569 12.413  -7.854  1.00 1.00 ? 19  LEU A HB3  6  
ATOM 10041 H HG   . LEU A 1 19  ? -14.485 11.125  -6.934  1.00 1.00 ? 19  LEU A HG   6  
ATOM 10042 H HD11 . LEU A 1 19  ? -13.421 11.998  -4.205  1.00 1.00 ? 19  LEU A HD11 6  
ATOM 10043 H HD12 . LEU A 1 19  ? -15.018 11.281  -4.501  1.00 1.00 ? 19  LEU A HD12 6  
ATOM 10044 H HD13 . LEU A 1 19  ? -13.563 10.325  -4.798  1.00 1.00 ? 19  LEU A HD13 6  
ATOM 10045 H HD21 . LEU A 1 19  ? -14.193 13.927  -5.758  1.00 1.00 ? 19  LEU A HD21 6  
ATOM 10046 H HD22 . LEU A 1 19  ? -14.712 13.537  -7.416  1.00 1.00 ? 19  LEU A HD22 6  
ATOM 10047 H HD23 . LEU A 1 19  ? -15.720 13.062  -6.041  1.00 1.00 ? 19  LEU A HD23 6  
ATOM 10048 N N    . GLY A 1 20  ? -12.343 8.385   -7.107  1.00 1.00 ? 20  GLY A N    6  
ATOM 10049 C CA   . GLY A 1 20  ? -12.959 7.187   -7.694  1.00 1.00 ? 20  GLY A CA   6  
ATOM 10050 C C    . GLY A 1 20  ? -12.045 6.314   -8.569  1.00 1.00 ? 20  GLY A C    6  
ATOM 10051 O O    . GLY A 1 20  ? -12.500 5.261   -9.015  1.00 1.00 ? 20  GLY A O    6  
ATOM 10052 H H    . GLY A 1 20  ? -11.933 8.288   -6.186  1.00 1.00 ? 20  GLY A H    6  
ATOM 10053 H HA2  . GLY A 1 20  ? -13.318 6.552   -6.883  1.00 1.00 ? 20  GLY A HA2  6  
ATOM 10054 H HA3  . GLY A 1 20  ? -13.810 7.481   -8.310  1.00 1.00 ? 20  GLY A HA3  6  
ATOM 10055 N N    . TYR A 1 21  ? -10.782 6.701   -8.811  1.00 1.00 ? 21  TYR A N    6  
ATOM 10056 C CA   . TYR A 1 21  ? -9.843  5.974   -9.686  1.00 1.00 ? 21  TYR A CA   6  
ATOM 10057 C C    . TYR A 1 21  ? -8.366  6.395   -9.547  1.00 1.00 ? 21  TYR A C    6  
ATOM 10058 O O    . TYR A 1 21  ? -8.045  7.569   -9.361  1.00 1.00 ? 21  TYR A O    6  
ATOM 10059 C CB   . TYR A 1 21  ? -10.276 6.049   -11.165 1.00 1.00 ? 21  TYR A CB   6  
ATOM 10060 C CG   . TYR A 1 21  ? -10.173 7.414   -11.825 1.00 1.00 ? 21  TYR A CG   6  
ATOM 10061 C CD1  . TYR A 1 21  ? -11.155 8.394   -11.589 1.00 1.00 ? 21  TYR A CD1  6  
ATOM 10062 C CD2  . TYR A 1 21  ? -9.116  7.691   -12.714 1.00 1.00 ? 21  TYR A CD2  6  
ATOM 10063 C CE1  . TYR A 1 21  ? -11.077 9.648   -12.224 1.00 1.00 ? 21  TYR A CE1  6  
ATOM 10064 C CE2  . TYR A 1 21  ? -9.037  8.938   -13.361 1.00 1.00 ? 21  TYR A CE2  6  
ATOM 10065 C CZ   . TYR A 1 21  ? -10.021 9.924   -13.120 1.00 1.00 ? 21  TYR A CZ   6  
ATOM 10066 O OH   . TYR A 1 21  ? -9.955  11.138  -13.741 1.00 1.00 ? 21  TYR A OH   6  
ATOM 10067 H H    . TYR A 1 21  ? -10.443 7.545   -8.368  1.00 1.00 ? 21  TYR A H    6  
ATOM 10068 H HA   . TYR A 1 21  ? -9.898  4.928   -9.390  1.00 1.00 ? 21  TYR A HA   6  
ATOM 10069 H HB2  . TYR A 1 21  ? -9.653  5.351   -11.725 1.00 1.00 ? 21  TYR A HB2  6  
ATOM 10070 H HB3  . TYR A 1 21  ? -11.299 5.695   -11.266 1.00 1.00 ? 21  TYR A HB3  6  
ATOM 10071 H HD1  . TYR A 1 21  ? -11.978 8.187   -10.919 1.00 1.00 ? 21  TYR A HD1  6  
ATOM 10072 H HD2  . TYR A 1 21  ? -8.360  6.942   -12.906 1.00 1.00 ? 21  TYR A HD2  6  
ATOM 10073 H HE1  . TYR A 1 21  ? -11.832 10.398  -12.037 1.00 1.00 ? 21  TYR A HE1  6  
ATOM 10074 H HE2  . TYR A 1 21  ? -8.223  9.136   -14.044 1.00 1.00 ? 21  TYR A HE2  6  
ATOM 10075 H HH   . TYR A 1 21  ? -9.216  11.217  -14.361 1.00 1.00 ? 21  TYR A HH   6  
ATOM 10076 N N    . GLU A 1 22  ? -7.463  5.423   -9.667  1.00 1.00 ? 22  GLU A N    6  
ATOM 10077 C CA   . GLU A 1 22  ? -6.012  5.598   -9.626  1.00 1.00 ? 22  GLU A CA   6  
ATOM 10078 C C    . GLU A 1 22  ? -5.422  6.072   -10.972 1.00 1.00 ? 22  GLU A C    6  
ATOM 10079 O O    . GLU A 1 22  ? -6.012  5.898   -12.040 1.00 1.00 ? 22  GLU A O    6  
ATOM 10080 C CB   . GLU A 1 22  ? -5.337  4.280   -9.206  1.00 1.00 ? 22  GLU A CB   6  
ATOM 10081 C CG   . GLU A 1 22  ? -5.866  3.669   -7.899  1.00 1.00 ? 22  GLU A CG   6  
ATOM 10082 C CD   . GLU A 1 22  ? -6.928  2.577   -8.149  1.00 1.00 ? 22  GLU A CD   6  
ATOM 10083 O OE1  . GLU A 1 22  ? -7.989  2.872   -8.749  1.00 1.00 ? 22  GLU A OE1  6  
ATOM 10084 O OE2  . GLU A 1 22  ? -6.711  1.415   -7.733  1.00 1.00 ? 22  GLU A OE2  6  
ATOM 10085 H H    . GLU A 1 22  ? -7.806  4.465   -9.686  1.00 1.00 ? 22  GLU A H    6  
ATOM 10086 H HA   . GLU A 1 22  ? -5.778  6.347   -8.870  1.00 1.00 ? 22  GLU A HA   6  
ATOM 10087 H HB2  . GLU A 1 22  ? -5.454  3.551   -10.004 1.00 1.00 ? 22  GLU A HB2  6  
ATOM 10088 H HB3  . GLU A 1 22  ? -4.269  4.474   -9.084  1.00 1.00 ? 22  GLU A HB3  6  
ATOM 10089 H HG2  . GLU A 1 22  ? -5.022  3.224   -7.372  1.00 1.00 ? 22  GLU A HG2  6  
ATOM 10090 H HG3  . GLU A 1 22  ? -6.278  4.453   -7.262  1.00 1.00 ? 22  GLU A HG3  6  
ATOM 10091 N N    . HIS A 1 23  ? -4.219  6.647   -10.917 1.00 1.00 ? 23  HIS A N    6  
ATOM 10092 C CA   . HIS A 1 23  ? -3.445  7.188   -12.039 1.00 1.00 ? 23  HIS A CA   6  
ATOM 10093 C C    . HIS A 1 23  ? -1.936  7.078   -11.711 1.00 1.00 ? 23  HIS A C    6  
ATOM 10094 O O    . HIS A 1 23  ? -1.563  6.986   -10.545 1.00 1.00 ? 23  HIS A O    6  
ATOM 10095 C CB   . HIS A 1 23  ? -3.923  8.641   -12.258 1.00 1.00 ? 23  HIS A CB   6  
ATOM 10096 C CG   . HIS A 1 23  ? -3.178  9.456   -13.290 1.00 1.00 ? 23  HIS A CG   6  
ATOM 10097 N ND1  . HIS A 1 23  ? -1.966  10.079  -13.095 1.00 1.00 ? 23  HIS A ND1  6  
ATOM 10098 C CD2  . HIS A 1 23  ? -3.643  9.867   -14.512 1.00 1.00 ? 23  HIS A CD2  6  
ATOM 10099 C CE1  . HIS A 1 23  ? -1.708  10.848  -14.160 1.00 1.00 ? 23  HIS A CE1  6  
ATOM 10100 N NE2  . HIS A 1 23  ? -2.717  10.775  -15.044 1.00 1.00 ? 23  HIS A NE2  6  
ATOM 10101 H H    . HIS A 1 23  ? -3.799  6.778   -9.996  1.00 1.00 ? 23  HIS A H    6  
ATOM 10102 H HA   . HIS A 1 23  ? -3.640  6.607   -12.941 1.00 1.00 ? 23  HIS A HA   6  
ATOM 10103 H HB2  . HIS A 1 23  ? -4.980  8.614   -12.532 1.00 1.00 ? 23  HIS A HB2  6  
ATOM 10104 H HB3  . HIS A 1 23  ? -3.852  9.177   -11.307 1.00 1.00 ? 23  HIS A HB3  6  
ATOM 10105 H HD1  . HIS A 1 23  ? -1.352  9.953   -12.306 1.00 1.00 ? 23  HIS A HD1  6  
ATOM 10106 H HD2  . HIS A 1 23  ? -4.592  9.595   -14.956 1.00 1.00 ? 23  HIS A HD2  6  
ATOM 10107 H HE1  . HIS A 1 23  ? -0.821  11.456  -14.282 1.00 1.00 ? 23  HIS A HE1  6  
ATOM 10108 N N    . TRP A 1 24  ? -1.048  7.112   -12.711 1.00 1.00 ? 24  TRP A N    6  
ATOM 10109 C CA   . TRP A 1 24  ? 0.402   6.919   -12.526 1.00 1.00 ? 24  TRP A CA   6  
ATOM 10110 C C    . TRP A 1 24  ? 1.230   7.887   -13.379 1.00 1.00 ? 24  TRP A C    6  
ATOM 10111 O O    . TRP A 1 24  ? 0.735   8.447   -14.355 1.00 1.00 ? 24  TRP A O    6  
ATOM 10112 C CB   . TRP A 1 24  ? 0.756   5.457   -12.837 1.00 1.00 ? 24  TRP A CB   6  
ATOM 10113 C CG   . TRP A 1 24  ? 0.285   4.465   -11.822 1.00 1.00 ? 24  TRP A CG   6  
ATOM 10114 C CD1  . TRP A 1 24  ? 1.026   3.990   -10.795 1.00 1.00 ? 24  TRP A CD1  6  
ATOM 10115 C CD2  . TRP A 1 24  ? -1.022  3.816   -11.702 1.00 1.00 ? 24  TRP A CD2  6  
ATOM 10116 N NE1  . TRP A 1 24  ? 0.273   3.100   -10.049 1.00 1.00 ? 24  TRP A NE1  6  
ATOM 10117 C CE2  . TRP A 1 24  ? -0.998  2.955   -10.566 1.00 1.00 ? 24  TRP A CE2  6  
ATOM 10118 C CE3  . TRP A 1 24  ? -2.221  3.859   -12.449 1.00 1.00 ? 24  TRP A CE3  6  
ATOM 10119 C CZ2  . TRP A 1 24  ? -2.096  2.165   -10.197 1.00 1.00 ? 24  TRP A CZ2  6  
ATOM 10120 C CZ3  . TRP A 1 24  ? -3.334  3.074   -12.084 1.00 1.00 ? 24  TRP A CZ3  6  
ATOM 10121 C CH2  . TRP A 1 24  ? -3.268  2.221   -10.967 1.00 1.00 ? 24  TRP A CH2  6  
ATOM 10122 H H    . TRP A 1 24  ? -1.375  7.247   -13.661 1.00 1.00 ? 24  TRP A H    6  
ATOM 10123 H HA   . TRP A 1 24  ? 0.685   7.110   -11.487 1.00 1.00 ? 24  TRP A HA   6  
ATOM 10124 H HB2  . TRP A 1 24  ? 0.355   5.185   -13.815 1.00 1.00 ? 24  TRP A HB2  6  
ATOM 10125 H HB3  . TRP A 1 24  ? 1.840   5.365   -12.897 1.00 1.00 ? 24  TRP A HB3  6  
ATOM 10126 H HD1  . TRP A 1 24  ? 2.052   4.274   -10.592 1.00 1.00 ? 24  TRP A HD1  6  
ATOM 10127 H HE1  . TRP A 1 24  ? 0.628   2.620   -9.229  1.00 1.00 ? 24  TRP A HE1  6  
ATOM 10128 H HE3  . TRP A 1 24  ? -2.277  4.497   -13.315 1.00 1.00 ? 24  TRP A HE3  6  
ATOM 10129 H HZ2  . TRP A 1 24  ? -2.036  1.517   -9.334  1.00 1.00 ? 24  TRP A HZ2  6  
ATOM 10130 H HZ3  . TRP A 1 24  ? -4.244  3.120   -12.667 1.00 1.00 ? 24  TRP A HZ3  6  
ATOM 10131 H HH2  . TRP A 1 24  ? -4.122  1.610   -10.706 1.00 1.00 ? 24  TRP A HH2  6  
ATOM 10132 N N    . ALA A 1 25  ? 2.498   8.086   -13.013 1.00 1.00 ? 25  ALA A N    6  
ATOM 10133 C CA   . ALA A 1 25  ? 3.418   8.972   -13.723 1.00 1.00 ? 25  ALA A CA   6  
ATOM 10134 C C    . ALA A 1 25  ? 4.887   8.542   -13.580 1.00 1.00 ? 25  ALA A C    6  
ATOM 10135 O O    . ALA A 1 25  ? 5.270   7.928   -12.583 1.00 1.00 ? 25  ALA A O    6  
ATOM 10136 C CB   . ALA A 1 25  ? 3.203   10.403  -13.214 1.00 1.00 ? 25  ALA A CB   6  
ATOM 10137 H H    . ALA A 1 25  ? 2.821   7.649   -12.150 1.00 1.00 ? 25  ALA A H    6  
ATOM 10138 H HA   . ALA A 1 25  ? 3.177   8.949   -14.789 1.00 1.00 ? 25  ALA A HA   6  
ATOM 10139 H HB1  . ALA A 1 25  ? 3.816   11.084  -13.802 1.00 1.00 ? 25  ALA A HB1  6  
ATOM 10140 H HB2  . ALA A 1 25  ? 2.157   10.698  -13.315 1.00 1.00 ? 25  ALA A HB2  6  
ATOM 10141 H HB3  . ALA A 1 25  ? 3.490   10.480  -12.162 1.00 1.00 ? 25  ALA A HB3  6  
ATOM 10142 N N    . LEU A 1 26  ? 5.702   8.894   -14.578 1.00 1.00 ? 26  LEU A N    6  
ATOM 10143 C CA   . LEU A 1 26  ? 7.160   8.796   -14.590 1.00 1.00 ? 26  LEU A CA   6  
ATOM 10144 C C    . LEU A 1 26  ? 7.707   10.198  -14.279 1.00 1.00 ? 26  LEU A C    6  
ATOM 10145 O O    . LEU A 1 26  ? 7.464   11.131  -15.039 1.00 1.00 ? 26  LEU A O    6  
ATOM 10146 C CB   . LEU A 1 26  ? 7.587   8.280   -15.990 1.00 1.00 ? 26  LEU A CB   6  
ATOM 10147 C CG   . LEU A 1 26  ? 9.000   7.674   -16.143 1.00 1.00 ? 26  LEU A CG   6  
ATOM 10148 C CD1  . LEU A 1 26  ? 10.133  8.642   -15.791 1.00 1.00 ? 26  LEU A CD1  6  
ATOM 10149 C CD2  . LEU A 1 26  ? 9.138   6.392   -15.315 1.00 1.00 ? 26  LEU A CD2  6  
ATOM 10150 H H    . LEU A 1 26  ? 5.281   9.394   -15.354 1.00 1.00 ? 26  LEU A H    6  
ATOM 10151 H HA   . LEU A 1 26  ? 7.485   8.101   -13.813 1.00 1.00 ? 26  LEU A HA   6  
ATOM 10152 H HB2  . LEU A 1 26  ? 6.880   7.509   -16.301 1.00 1.00 ? 26  LEU A HB2  6  
ATOM 10153 H HB3  . LEU A 1 26  ? 7.489   9.090   -16.718 1.00 1.00 ? 26  LEU A HB3  6  
ATOM 10154 H HG   . LEU A 1 26  ? 9.119   7.412   -17.197 1.00 1.00 ? 26  LEU A HG   6  
ATOM 10155 H HD11 . LEU A 1 26  ? 11.091  8.212   -16.088 1.00 1.00 ? 26  LEU A HD11 6  
ATOM 10156 H HD12 . LEU A 1 26  ? 9.986   9.581   -16.324 1.00 1.00 ? 26  LEU A HD12 6  
ATOM 10157 H HD13 . LEU A 1 26  ? 10.156  8.830   -14.718 1.00 1.00 ? 26  LEU A HD13 6  
ATOM 10158 H HD21 . LEU A 1 26  ? 9.116   6.625   -14.251 1.00 1.00 ? 26  LEU A HD21 6  
ATOM 10159 H HD22 . LEU A 1 26  ? 8.329   5.701   -15.556 1.00 1.00 ? 26  LEU A HD22 6  
ATOM 10160 H HD23 . LEU A 1 26  ? 10.086  5.906   -15.538 1.00 1.00 ? 26  LEU A HD23 6  
ATOM 10161 N N    . TYR A 1 27  ? 8.407   10.374  -13.160 1.00 1.00 ? 27  TYR A N    6  
ATOM 10162 C CA   . TYR A 1 27  ? 8.982   11.668  -12.768 1.00 1.00 ? 27  TYR A CA   6  
ATOM 10163 C C    . TYR A 1 27  ? 10.323  11.935  -13.468 1.00 1.00 ? 27  TYR A C    6  
ATOM 10164 O O    . TYR A 1 27  ? 11.223  11.098  -13.451 1.00 1.00 ? 27  TYR A O    6  
ATOM 10165 C CB   . TYR A 1 27  ? 9.113   11.712  -11.243 1.00 1.00 ? 27  TYR A CB   6  
ATOM 10166 C CG   . TYR A 1 27  ? 9.636   13.026  -10.693 1.00 1.00 ? 27  TYR A CG   6  
ATOM 10167 C CD1  . TYR A 1 27  ? 8.758   14.084  -10.396 1.00 1.00 ? 27  TYR A CD1  6  
ATOM 10168 C CD2  . TYR A 1 27  ? 11.012  13.187  -10.463 1.00 1.00 ? 27  TYR A CD2  6  
ATOM 10169 C CE1  . TYR A 1 27  ? 9.249   15.294  -9.869  1.00 1.00 ? 27  TYR A CE1  6  
ATOM 10170 C CE2  . TYR A 1 27  ? 11.509  14.373  -9.890  1.00 1.00 ? 27  TYR A CE2  6  
ATOM 10171 C CZ   . TYR A 1 27  ? 10.628  15.437  -9.599  1.00 1.00 ? 27  TYR A CZ   6  
ATOM 10172 O OH   . TYR A 1 27  ? 11.096  16.589  -9.044  1.00 1.00 ? 27  TYR A OH   6  
ATOM 10173 H H    . TYR A 1 27  ? 8.579   9.576   -12.554 1.00 1.00 ? 27  TYR A H    6  
ATOM 10174 H HA   . TYR A 1 27  ? 8.297   12.462  -13.064 1.00 1.00 ? 27  TYR A HA   6  
ATOM 10175 H HB2  . TYR A 1 27  ? 8.133   11.520  -10.810 1.00 1.00 ? 27  TYR A HB2  6  
ATOM 10176 H HB3  . TYR A 1 27  ? 9.773   10.904  -10.922 1.00 1.00 ? 27  TYR A HB3  6  
ATOM 10177 H HD1  . TYR A 1 27  ? 7.698   13.968  -10.561 1.00 1.00 ? 27  TYR A HD1  6  
ATOM 10178 H HD2  . TYR A 1 27  ? 11.681  12.382  -10.708 1.00 1.00 ? 27  TYR A HD2  6  
ATOM 10179 H HE1  . TYR A 1 27  ? 8.573   16.103  -9.636  1.00 1.00 ? 27  TYR A HE1  6  
ATOM 10180 H HE2  . TYR A 1 27  ? 12.563  14.470  -9.673  1.00 1.00 ? 27  TYR A HE2  6  
ATOM 10181 H HH   . TYR A 1 27  ? 12.037  16.553  -8.815  1.00 1.00 ? 27  TYR A HH   6  
ATOM 10182 N N    . ILE A 1 28  ? 10.476  13.113  -14.083 1.00 1.00 ? 28  ILE A N    6  
ATOM 10183 C CA   . ILE A 1 28  ? 11.625  13.411  -14.967 1.00 1.00 ? 28  ILE A CA   6  
ATOM 10184 C C    . ILE A 1 28  ? 12.616  14.450  -14.401 1.00 1.00 ? 28  ILE A C    6  
ATOM 10185 O O    . ILE A 1 28  ? 13.578  14.801  -15.083 1.00 1.00 ? 28  ILE A O    6  
ATOM 10186 C CB   . ILE A 1 28  ? 11.137  13.753  -16.396 1.00 1.00 ? 28  ILE A CB   6  
ATOM 10187 C CG1  . ILE A 1 28  ? 10.404  15.105  -16.492 1.00 1.00 ? 28  ILE A CG1  6  
ATOM 10188 C CG2  . ILE A 1 28  ? 10.255  12.614  -16.950 1.00 1.00 ? 28  ILE A CG2  6  
ATOM 10189 C CD1  . ILE A 1 28  ? 10.091  15.506  -17.937 1.00 1.00 ? 28  ILE A CD1  6  
ATOM 10190 H H    . ILE A 1 28  ? 9.725   13.802  -14.007 1.00 1.00 ? 28  ILE A H    6  
ATOM 10191 H HA   . ILE A 1 28  ? 12.232  12.510  -15.068 1.00 1.00 ? 28  ILE A HA   6  
ATOM 10192 H HB   . ILE A 1 28  ? 12.027  13.815  -17.029 1.00 1.00 ? 28  ILE A HB   6  
ATOM 10193 H HG12 . ILE A 1 28  ? 9.468   15.050  -15.944 1.00 1.00 ? 28  ILE A HG12 6  
ATOM 10194 H HG13 . ILE A 1 28  ? 11.023  15.885  -16.051 1.00 1.00 ? 28  ILE A HG13 6  
ATOM 10195 H HG21 . ILE A 1 28  ? 10.695  11.650  -16.709 1.00 1.00 ? 28  ILE A HG21 6  
ATOM 10196 H HG22 . ILE A 1 28  ? 9.243   12.653  -16.537 1.00 1.00 ? 28  ILE A HG22 6  
ATOM 10197 H HG23 . ILE A 1 28  ? 10.193  12.690  -18.033 1.00 1.00 ? 28  ILE A HG23 6  
ATOM 10198 H HD11 . ILE A 1 28  ? 9.349   14.832  -18.362 1.00 1.00 ? 28  ILE A HD11 6  
ATOM 10199 H HD12 . ILE A 1 28  ? 9.696   16.523  -17.954 1.00 1.00 ? 28  ILE A HD12 6  
ATOM 10200 H HD13 . ILE A 1 28  ? 11.002  15.466  -18.537 1.00 1.00 ? 28  ILE A HD13 6  
ATOM 10201 N N    . GLY A 1 29  ? 12.413  14.907  -13.159 1.00 1.00 ? 29  GLY A N    6  
ATOM 10202 C CA   . GLY A 1 29  ? 13.247  15.925  -12.495 1.00 1.00 ? 29  GLY A CA   6  
ATOM 10203 C C    . GLY A 1 29  ? 12.649  17.332  -12.569 1.00 1.00 ? 29  GLY A C    6  
ATOM 10204 O O    . GLY A 1 29  ? 11.738  17.595  -13.354 1.00 1.00 ? 29  GLY A O    6  
ATOM 10205 H H    . GLY A 1 29  ? 11.592  14.583  -12.666 1.00 1.00 ? 29  GLY A H    6  
ATOM 10206 H HA2  . GLY A 1 29  ? 13.367  15.667  -11.442 1.00 1.00 ? 29  GLY A HA2  6  
ATOM 10207 H HA3  . GLY A 1 29  ? 14.238  15.964  -12.951 1.00 1.00 ? 29  GLY A HA3  6  
ATOM 10208 N N    . ASP A 1 30  ? 13.157  18.232  -11.720 1.00 1.00 ? 30  ASP A N    6  
ATOM 10209 C CA   . ASP A 1 30  ? 12.841  19.676  -11.692 1.00 1.00 ? 30  ASP A CA   6  
ATOM 10210 C C    . ASP A 1 30  ? 11.346  19.998  -11.426 1.00 1.00 ? 30  ASP A C    6  
ATOM 10211 O O    . ASP A 1 30  ? 10.863  21.091  -11.735 1.00 1.00 ? 30  ASP A O    6  
ATOM 10212 C CB   . ASP A 1 30  ? 13.398  20.342  -12.965 1.00 1.00 ? 30  ASP A CB   6  
ATOM 10213 C CG   . ASP A 1 30  ? 13.503  21.877  -12.864 1.00 1.00 ? 30  ASP A CG   6  
ATOM 10214 O OD1  . ASP A 1 30  ? 14.025  22.381  -11.840 1.00 1.00 ? 30  ASP A OD1  6  
ATOM 10215 O OD2  . ASP A 1 30  ? 13.123  22.575  -13.836 1.00 1.00 ? 30  ASP A OD2  6  
ATOM 10216 H H    . ASP A 1 30  ? 13.903  17.921  -11.108 1.00 1.00 ? 30  ASP A H    6  
ATOM 10217 H HA   . ASP A 1 30  ? 13.388  20.088  -10.843 1.00 1.00 ? 30  ASP A HA   6  
ATOM 10218 H HB2  . ASP A 1 30  ? 14.404  19.955  -13.151 1.00 1.00 ? 30  ASP A HB2  6  
ATOM 10219 H HB3  . ASP A 1 30  ? 12.781  20.065  -13.819 1.00 1.00 ? 30  ASP A HB3  6  
ATOM 10220 N N    . GLY A 1 31  ? 10.606  19.036  -10.855 1.00 1.00 ? 31  GLY A N    6  
ATOM 10221 C CA   . GLY A 1 31  ? 9.169   19.123  -10.565 1.00 1.00 ? 31  GLY A CA   6  
ATOM 10222 C C    . GLY A 1 31  ? 8.260   18.605  -11.683 1.00 1.00 ? 31  GLY A C    6  
ATOM 10223 O O    . GLY A 1 31  ? 7.041   18.665  -11.536 1.00 1.00 ? 31  GLY A O    6  
ATOM 10224 H H    . GLY A 1 31  ? 11.078  18.182  -10.594 1.00 1.00 ? 31  GLY A H    6  
ATOM 10225 H HA2  . GLY A 1 31  ? 8.954   18.530  -9.677  1.00 1.00 ? 31  GLY A HA2  6  
ATOM 10226 H HA3  . GLY A 1 31  ? 8.893   20.162  -10.377 1.00 1.00 ? 31  GLY A HA3  6  
ATOM 10227 N N    . TYR A 1 32  ? 8.804   18.094  -12.793 1.00 1.00 ? 32  TYR A N    6  
ATOM 10228 C CA   . TYR A 1 32  ? 8.030   17.644  -13.959 1.00 1.00 ? 32  TYR A CA   6  
ATOM 10229 C C    . TYR A 1 32  ? 7.793   16.122  -14.003 1.00 1.00 ? 32  TYR A C    6  
ATOM 10230 O O    . TYR A 1 32  ? 8.583   15.322  -13.498 1.00 1.00 ? 32  TYR A O    6  
ATOM 10231 C CB   . TYR A 1 32  ? 8.702   18.133  -15.254 1.00 1.00 ? 32  TYR A CB   6  
ATOM 10232 C CG   . TYR A 1 32  ? 8.649   19.637  -15.454 1.00 1.00 ? 32  TYR A CG   6  
ATOM 10233 C CD1  . TYR A 1 32  ? 9.652   20.457  -14.905 1.00 1.00 ? 32  TYR A CD1  6  
ATOM 10234 C CD2  . TYR A 1 32  ? 7.592   20.219  -16.185 1.00 1.00 ? 32  TYR A CD2  6  
ATOM 10235 C CE1  . TYR A 1 32  ? 9.606   21.852  -15.074 1.00 1.00 ? 32  TYR A CE1  6  
ATOM 10236 C CE2  . TYR A 1 32  ? 7.541   21.616  -16.363 1.00 1.00 ? 32  TYR A CE2  6  
ATOM 10237 C CZ   . TYR A 1 32  ? 8.545   22.437  -15.800 1.00 1.00 ? 32  TYR A CZ   6  
ATOM 10238 O OH   . TYR A 1 32  ? 8.486   23.790  -15.955 1.00 1.00 ? 32  TYR A OH   6  
ATOM 10239 H H    . TYR A 1 32  ? 9.815   18.067  -12.858 1.00 1.00 ? 32  TYR A H    6  
ATOM 10240 H HA   . TYR A 1 32  ? 7.046   18.109  -13.909 1.00 1.00 ? 32  TYR A HA   6  
ATOM 10241 H HB2  . TYR A 1 32  ? 9.745   17.810  -15.269 1.00 1.00 ? 32  TYR A HB2  6  
ATOM 10242 H HB3  . TYR A 1 32  ? 8.210   17.667  -16.109 1.00 1.00 ? 32  TYR A HB3  6  
ATOM 10243 H HD1  . TYR A 1 32  ? 10.460  20.011  -14.343 1.00 1.00 ? 32  TYR A HD1  6  
ATOM 10244 H HD2  . TYR A 1 32  ? 6.823   19.595  -16.613 1.00 1.00 ? 32  TYR A HD2  6  
ATOM 10245 H HE1  . TYR A 1 32  ? 10.376  22.474  -14.639 1.00 1.00 ? 32  TYR A HE1  6  
ATOM 10246 H HE2  . TYR A 1 32  ? 6.736   22.064  -16.927 1.00 1.00 ? 32  TYR A HE2  6  
ATOM 10247 H HH   . TYR A 1 32  ? 9.263   24.241  -15.590 1.00 1.00 ? 32  TYR A HH   6  
ATOM 10248 N N    . VAL A 1 33  ? 6.705   15.722  -14.668 1.00 1.00 ? 33  VAL A N    6  
ATOM 10249 C CA   . VAL A 1 33  ? 6.259   14.327  -14.821 1.00 1.00 ? 33  VAL A CA   6  
ATOM 10250 C C    . VAL A 1 33  ? 5.766   14.047  -16.240 1.00 1.00 ? 33  VAL A C    6  
ATOM 10251 O O    . VAL A 1 33  ? 5.346   14.953  -16.957 1.00 1.00 ? 33  VAL A O    6  
ATOM 10252 C CB   . VAL A 1 33  ? 5.112   13.977  -13.844 1.00 1.00 ? 33  VAL A CB   6  
ATOM 10253 C CG1  . VAL A 1 33  ? 5.578   13.887  -12.387 1.00 1.00 ? 33  VAL A CG1  6  
ATOM 10254 C CG2  . VAL A 1 33  ? 3.927   14.950  -13.935 1.00 1.00 ? 33  VAL A CG2  6  
ATOM 10255 H H    . VAL A 1 33  ? 6.114   16.443  -15.097 1.00 1.00 ? 33  VAL A H    6  
ATOM 10256 H HA   . VAL A 1 33  ? 7.098   13.662  -14.628 1.00 1.00 ? 33  VAL A HA   6  
ATOM 10257 H HB   . VAL A 1 33  ? 4.743   12.996  -14.116 1.00 1.00 ? 33  VAL A HB   6  
ATOM 10258 H HG11 . VAL A 1 33  ? 5.972   14.847  -12.053 1.00 1.00 ? 33  VAL A HG11 6  
ATOM 10259 H HG12 . VAL A 1 33  ? 4.738   13.606  -11.752 1.00 1.00 ? 33  VAL A HG12 6  
ATOM 10260 H HG13 . VAL A 1 33  ? 6.345   13.119  -12.294 1.00 1.00 ? 33  VAL A HG13 6  
ATOM 10261 H HG21 . VAL A 1 33  ? 3.090   14.570  -13.346 1.00 1.00 ? 33  VAL A HG21 6  
ATOM 10262 H HG22 . VAL A 1 33  ? 4.208   15.927  -13.547 1.00 1.00 ? 33  VAL A HG22 6  
ATOM 10263 H HG23 . VAL A 1 33  ? 3.611   15.058  -14.973 1.00 1.00 ? 33  VAL A HG23 6  
ATOM 10264 N N    . ILE A 1 34  ? 5.778   12.772  -16.619 1.00 1.00 ? 34  ILE A N    6  
ATOM 10265 C CA   . ILE A 1 34  ? 5.155   12.232  -17.835 1.00 1.00 ? 34  ILE A CA   6  
ATOM 10266 C C    . ILE A 1 34  ? 4.128   11.169  -17.416 1.00 1.00 ? 34  ILE A C    6  
ATOM 10267 O O    . ILE A 1 34  ? 4.364   10.421  -16.473 1.00 1.00 ? 34  ILE A O    6  
ATOM 10268 C CB   . ILE A 1 34  ? 6.275   11.717  -18.778 1.00 1.00 ? 34  ILE A CB   6  
ATOM 10269 C CG1  . ILE A 1 34  ? 6.981   12.953  -19.388 1.00 1.00 ? 34  ILE A CG1  6  
ATOM 10270 C CG2  . ILE A 1 34  ? 5.707   10.782  -19.865 1.00 1.00 ? 34  ILE A CG2  6  
ATOM 10271 C CD1  . ILE A 1 34  ? 8.196   12.655  -20.274 1.00 1.00 ? 34  ILE A CD1  6  
ATOM 10272 H H    . ILE A 1 34  ? 6.210   12.093  -15.984 1.00 1.00 ? 34  ILE A H    6  
ATOM 10273 H HA   . ILE A 1 34  ? 4.599   13.021  -18.344 1.00 1.00 ? 34  ILE A HA   6  
ATOM 10274 H HB   . ILE A 1 34  ? 7.015   11.168  -18.184 1.00 1.00 ? 34  ILE A HB   6  
ATOM 10275 H HG12 . ILE A 1 34  ? 6.260   13.522  -19.969 1.00 1.00 ? 34  ILE A HG12 6  
ATOM 10276 H HG13 . ILE A 1 34  ? 7.335   13.592  -18.578 1.00 1.00 ? 34  ILE A HG13 6  
ATOM 10277 H HG21 . ILE A 1 34  ? 6.478   10.486  -20.574 1.00 1.00 ? 34  ILE A HG21 6  
ATOM 10278 H HG22 . ILE A 1 34  ? 5.314   9.868   -19.415 1.00 1.00 ? 34  ILE A HG22 6  
ATOM 10279 H HG23 . ILE A 1 34  ? 4.903   11.282  -20.405 1.00 1.00 ? 34  ILE A HG23 6  
ATOM 10280 H HD11 . ILE A 1 34  ? 8.920   12.057  -19.727 1.00 1.00 ? 34  ILE A HD11 6  
ATOM 10281 H HD12 . ILE A 1 34  ? 7.894   12.129  -21.173 1.00 1.00 ? 34  ILE A HD12 6  
ATOM 10282 H HD13 . ILE A 1 34  ? 8.669   13.593  -20.571 1.00 1.00 ? 34  ILE A HD13 6  
ATOM 10283 N N    . HIS A 1 35  ? 2.977   11.098  -18.076 1.00 1.00 ? 35  HIS A N    6  
ATOM 10284 C CA   . HIS A 1 35  ? 1.862   10.221  -17.692 1.00 1.00 ? 35  HIS A CA   6  
ATOM 10285 C C    . HIS A 1 35  ? 0.985   9.882   -18.910 1.00 1.00 ? 35  HIS A C    6  
ATOM 10286 O O    . HIS A 1 35  ? 1.058   10.577  -19.920 1.00 1.00 ? 35  HIS A O    6  
ATOM 10287 C CB   . HIS A 1 35  ? 1.038   10.903  -16.579 1.00 1.00 ? 35  HIS A CB   6  
ATOM 10288 C CG   . HIS A 1 35  ? 0.288   12.147  -17.009 1.00 1.00 ? 35  HIS A CG   6  
ATOM 10289 N ND1  . HIS A 1 35  ? -1.083  12.294  -17.053 1.00 1.00 ? 35  HIS A ND1  6  
ATOM 10290 C CD2  . HIS A 1 35  ? 0.832   13.346  -17.394 1.00 1.00 ? 35  HIS A CD2  6  
ATOM 10291 C CE1  . HIS A 1 35  ? -1.351  13.545  -17.459 1.00 1.00 ? 35  HIS A CE1  6  
ATOM 10292 N NE2  . HIS A 1 35  ? -0.215  14.228  -17.682 1.00 1.00 ? 35  HIS A NE2  6  
ATOM 10293 H H    . HIS A 1 35  ? 2.817   11.709  -18.880 1.00 1.00 ? 35  HIS A H    6  
ATOM 10294 H HA   . HIS A 1 35  ? 2.262   9.282   -17.300 1.00 1.00 ? 35  HIS A HA   6  
ATOM 10295 H HB2  . HIS A 1 35  ? 0.311   10.184  -16.198 1.00 1.00 ? 35  HIS A HB2  6  
ATOM 10296 H HB3  . HIS A 1 35  ? 1.705   11.163  -15.754 1.00 1.00 ? 35  HIS A HB3  6  
ATOM 10297 H HD1  . HIS A 1 35  ? -1.774  11.614  -16.736 1.00 1.00 ? 35  HIS A HD1  6  
ATOM 10298 H HD2  . HIS A 1 35  ? 1.888   13.575  -17.452 1.00 1.00 ? 35  HIS A HD2  6  
ATOM 10299 H HE1  . HIS A 1 35  ? -2.347  13.960  -17.561 1.00 1.00 ? 35  HIS A HE1  6  
ATOM 10300 N N    . LEU A 1 36  ? 0.146   8.846   -18.824 1.00 1.00 ? 36  LEU A N    6  
ATOM 10301 C CA   . LEU A 1 36  ? -0.854  8.513   -19.844 1.00 1.00 ? 36  LEU A CA   6  
ATOM 10302 C C    . LEU A 1 36  ? -2.238  8.922   -19.329 1.00 1.00 ? 36  LEU A C    6  
ATOM 10303 O O    . LEU A 1 36  ? -2.677  8.434   -18.288 1.00 1.00 ? 36  LEU A O    6  
ATOM 10304 C CB   . LEU A 1 36  ? -0.717  7.011   -20.167 1.00 1.00 ? 36  LEU A CB   6  
ATOM 10305 C CG   . LEU A 1 36  ? -1.792  6.385   -21.076 1.00 1.00 ? 36  LEU A CG   6  
ATOM 10306 C CD1  . LEU A 1 36  ? -1.933  7.135   -22.402 1.00 1.00 ? 36  LEU A CD1  6  
ATOM 10307 C CD2  . LEU A 1 36  ? -1.415  4.924   -21.358 1.00 1.00 ? 36  LEU A CD2  6  
ATOM 10308 H H    . LEU A 1 36  ? 0.109   8.318   -17.960 1.00 1.00 ? 36  LEU A H    6  
ATOM 10309 H HA   . LEU A 1 36  ? -0.658  9.083   -20.754 1.00 1.00 ? 36  LEU A HA   6  
ATOM 10310 H HB2  . LEU A 1 36  ? 0.256   6.876   -20.647 1.00 1.00 ? 36  LEU A HB2  6  
ATOM 10311 H HB3  . LEU A 1 36  ? -0.705  6.454   -19.230 1.00 1.00 ? 36  LEU A HB3  6  
ATOM 10312 H HG   . LEU A 1 36  ? -2.756  6.402   -20.563 1.00 1.00 ? 36  LEU A HG   6  
ATOM 10313 H HD11 . LEU A 1 36  ? -0.963  7.243   -22.887 1.00 1.00 ? 36  LEU A HD11 6  
ATOM 10314 H HD12 . LEU A 1 36  ? -2.610  6.604   -23.064 1.00 1.00 ? 36  LEU A HD12 6  
ATOM 10315 H HD13 . LEU A 1 36  ? -2.359  8.115   -22.214 1.00 1.00 ? 36  LEU A HD13 6  
ATOM 10316 H HD21 . LEU A 1 36  ? -1.398  4.360   -20.424 1.00 1.00 ? 36  LEU A HD21 6  
ATOM 10317 H HD22 . LEU A 1 36  ? -2.149  4.474   -22.025 1.00 1.00 ? 36  LEU A HD22 6  
ATOM 10318 H HD23 . LEU A 1 36  ? -0.430  4.874   -21.822 1.00 1.00 ? 36  LEU A HD23 6  
ATOM 10319 N N    . ALA A 1 37  ? -2.921  9.829   -20.034 1.00 1.00 ? 37  ALA A N    6  
ATOM 10320 C CA   . ALA A 1 37  ? -4.207  10.379  -19.607 1.00 1.00 ? 37  ALA A CA   6  
ATOM 10321 C C    . ALA A 1 37  ? -5.362  9.511   -20.150 1.00 1.00 ? 37  ALA A C    6  
ATOM 10322 O O    . ALA A 1 37  ? -5.314  9.148   -21.330 1.00 1.00 ? 37  ALA A O    6  
ATOM 10323 C CB   . ALA A 1 37  ? -4.294  11.832  -20.095 1.00 1.00 ? 37  ALA A CB   6  
ATOM 10324 H H    . ALA A 1 37  ? -2.561  10.128  -20.939 1.00 1.00 ? 37  ALA A H    6  
ATOM 10325 H HA   . ALA A 1 37  ? -4.234  10.388  -18.515 1.00 1.00 ? 37  ALA A HA   6  
ATOM 10326 H HB1  . ALA A 1 37  ? -3.468  12.409  -19.675 1.00 1.00 ? 37  ALA A HB1  6  
ATOM 10327 H HB2  . ALA A 1 37  ? -4.243  11.871  -21.187 1.00 1.00 ? 37  ALA A HB2  6  
ATOM 10328 H HB3  . ALA A 1 37  ? -5.235  12.277  -19.769 1.00 1.00 ? 37  ALA A HB3  6  
ATOM 10329 N N    . PRO A 1 38  ? -6.390  9.182   -19.337 1.00 1.00 ? 38  PRO A N    6  
ATOM 10330 C CA   . PRO A 1 38  ? -7.537  8.392   -19.785 1.00 1.00 ? 38  PRO A CA   6  
ATOM 10331 C C    . PRO A 1 38  ? -8.459  9.212   -20.710 1.00 1.00 ? 38  PRO A C    6  
ATOM 10332 O O    . PRO A 1 38  ? -8.386  10.445  -20.698 1.00 1.00 ? 38  PRO A O    6  
ATOM 10333 C CB   . PRO A 1 38  ? -8.248  7.950   -18.504 1.00 1.00 ? 38  PRO A CB   6  
ATOM 10334 C CG   . PRO A 1 38  ? -7.952  9.089   -17.531 1.00 1.00 ? 38  PRO A CG   6  
ATOM 10335 C CD   . PRO A 1 38  ? -6.538  9.520   -17.924 1.00 1.00 ? 38  PRO A CD   6  
ATOM 10336 H HA   . PRO A 1 38  ? -7.169  7.513   -20.313 1.00 1.00 ? 38  PRO A HA   6  
ATOM 10337 H HB2  . PRO A 1 38  ? -9.321  7.811   -18.647 1.00 1.00 ? 38  PRO A HB2  6  
ATOM 10338 H HB3  . PRO A 1 38  ? -7.794  7.030   -18.137 1.00 1.00 ? 38  PRO A HB3  6  
ATOM 10339 H HG2  . PRO A 1 38  ? -8.651  9.911   -17.700 1.00 1.00 ? 38  PRO A HG2  6  
ATOM 10340 H HG3  . PRO A 1 38  ? -7.993  8.754   -16.493 1.00 1.00 ? 38  PRO A HG3  6  
ATOM 10341 H HD2  . PRO A 1 38  ? -6.414  10.591  -17.753 1.00 1.00 ? 38  PRO A HD2  6  
ATOM 10342 H HD3  . PRO A 1 38  ? -5.807  8.957   -17.339 1.00 1.00 ? 38  PRO A HD3  6  
ATOM 10343 N N    . PRO A 1 39  ? -9.334  8.557   -21.505 1.00 1.00 ? 39  PRO A N    6  
ATOM 10344 C CA   . PRO A 1 39  ? -10.245 9.242   -22.421 1.00 1.00 ? 39  PRO A CA   6  
ATOM 10345 C C    . PRO A 1 39  ? -11.297 10.094  -21.703 1.00 1.00 ? 39  PRO A C    6  
ATOM 10346 O O    . PRO A 1 39  ? -11.738 9.762   -20.603 1.00 1.00 ? 39  PRO A O    6  
ATOM 10347 C CB   . PRO A 1 39  ? -10.916 8.146   -23.257 1.00 1.00 ? 39  PRO A CB   6  
ATOM 10348 C CG   . PRO A 1 39  ? -10.047 6.909   -23.054 1.00 1.00 ? 39  PRO A CG   6  
ATOM 10349 C CD   . PRO A 1 39  ? -9.476  7.114   -21.654 1.00 1.00 ? 39  PRO A CD   6  
ATOM 10350 H HA   . PRO A 1 39  ? -9.652  9.879   -23.075 1.00 1.00 ? 39  PRO A HA   6  
ATOM 10351 H HB2  . PRO A 1 39  ? -11.921 7.944   -22.881 1.00 1.00 ? 39  PRO A HB2  6  
ATOM 10352 H HB3  . PRO A 1 39  ? -10.951 8.432   -24.305 1.00 1.00 ? 39  PRO A HB3  6  
ATOM 10353 H HG2  . PRO A 1 39  ? -10.628 5.989   -23.123 1.00 1.00 ? 39  PRO A HG2  6  
ATOM 10354 H HG3  . PRO A 1 39  ? -9.236  6.906   -23.785 1.00 1.00 ? 39  PRO A HG3  6  
ATOM 10355 H HD2  . PRO A 1 39  ? -10.181 6.746   -20.907 1.00 1.00 ? 39  PRO A HD2  6  
ATOM 10356 H HD3  . PRO A 1 39  ? -8.529  6.586   -21.567 1.00 1.00 ? 39  PRO A HD3  6  
ATOM 10357 N N    . SER A 1 40  ? -11.756 11.166  -22.361 1.00 1.00 ? 40  SER A N    6  
ATOM 10358 C CA   . SER A 1 40  ? -12.784 12.076  -21.819 1.00 1.00 ? 40  SER A CA   6  
ATOM 10359 C C    . SER A 1 40  ? -14.169 11.412  -21.663 1.00 1.00 ? 40  SER A C    6  
ATOM 10360 O O    . SER A 1 40  ? -14.967 11.826  -20.819 1.00 1.00 ? 40  SER A O    6  
ATOM 10361 C CB   . SER A 1 40  ? -12.917 13.307  -22.733 1.00 1.00 ? 40  SER A CB   6  
ATOM 10362 O OG   . SER A 1 40  ? -11.658 13.915  -23.017 1.00 1.00 ? 40  SER A OG   6  
ATOM 10363 H H    . SER A 1 40  ? -11.291 11.461  -23.214 1.00 1.00 ? 40  SER A H    6  
ATOM 10364 H HA   . SER A 1 40  ? -12.472 12.414  -20.828 1.00 1.00 ? 40  SER A HA   6  
ATOM 10365 H HB2  . SER A 1 40  ? -13.369 12.993  -23.675 1.00 1.00 ? 40  SER A HB2  6  
ATOM 10366 H HB3  . SER A 1 40  ? -13.579 14.038  -22.263 1.00 1.00 ? 40  SER A HB3  6  
ATOM 10367 H HG   . SER A 1 40  ? -11.318 14.369  -22.214 1.00 1.00 ? 40  SER A HG   6  
ATOM 10368 N N    . GLU A 1 41  ? -14.432 10.355  -22.446 1.00 1.00 ? 41  GLU A N    6  
ATOM 10369 C CA   . GLU A 1 41  ? -15.598 9.471   -22.346 1.00 1.00 ? 41  GLU A CA   6  
ATOM 10370 C C    . GLU A 1 41  ? -15.286 8.148   -23.069 1.00 1.00 ? 41  GLU A C    6  
ATOM 10371 O O    . GLU A 1 41  ? -15.451 8.012   -24.282 1.00 1.00 ? 41  GLU A O    6  
ATOM 10372 C CB   . GLU A 1 41  ? -16.866 10.153  -22.887 1.00 1.00 ? 41  GLU A CB   6  
ATOM 10373 C CG   . GLU A 1 41  ? -18.116 9.309   -22.618 1.00 1.00 ? 41  GLU A CG   6  
ATOM 10374 C CD   . GLU A 1 41  ? -19.370 10.087  -23.025 1.00 1.00 ? 41  GLU A CD   6  
ATOM 10375 O OE1  . GLU A 1 41  ? -19.648 10.170  -24.244 1.00 1.00 ? 41  GLU A OE1  6  
ATOM 10376 O OE2  . GLU A 1 41  ? -20.074 10.624  -22.134 1.00 1.00 ? 41  GLU A OE2  6  
ATOM 10377 H H    . GLU A 1 41  ? -13.709 10.085  -23.100 1.00 1.00 ? 41  GLU A H    6  
ATOM 10378 H HA   . GLU A 1 41  ? -15.764 9.250   -21.291 1.00 1.00 ? 41  GLU A HA   6  
ATOM 10379 H HB2  . GLU A 1 41  ? -16.998 11.114  -22.391 1.00 1.00 ? 41  GLU A HB2  6  
ATOM 10380 H HB3  . GLU A 1 41  ? -16.763 10.336  -23.957 1.00 1.00 ? 41  GLU A HB3  6  
ATOM 10381 H HG2  . GLU A 1 41  ? -18.066 8.381   -23.187 1.00 1.00 ? 41  GLU A HG2  6  
ATOM 10382 H HG3  . GLU A 1 41  ? -18.162 9.061   -21.558 1.00 1.00 ? 41  GLU A HG3  6  
ATOM 10383 N N    . TYR A 1 42  ? -14.781 7.179   -22.307 1.00 1.00 ? 42  TYR A N    6  
ATOM 10384 C CA   . TYR A 1 42  ? -14.340 5.866   -22.785 1.00 1.00 ? 42  TYR A CA   6  
ATOM 10385 C C    . TYR A 1 42  ? -15.474 4.968   -23.346 1.00 1.00 ? 42  TYR A C    6  
ATOM 10386 O O    . TYR A 1 42  ? -16.648 5.164   -23.009 1.00 1.00 ? 42  TYR A O    6  
ATOM 10387 C CB   . TYR A 1 42  ? -13.571 5.168   -21.642 1.00 1.00 ? 42  TYR A CB   6  
ATOM 10388 C CG   . TYR A 1 42  ? -14.185 5.284   -20.252 1.00 1.00 ? 42  TYR A CG   6  
ATOM 10389 C CD1  . TYR A 1 42  ? -15.426 4.685   -19.960 1.00 1.00 ? 42  TYR A CD1  6  
ATOM 10390 C CD2  . TYR A 1 42  ? -13.521 6.025   -19.253 1.00 1.00 ? 42  TYR A CD2  6  
ATOM 10391 C CE1  . TYR A 1 42  ? -16.008 4.833   -18.688 1.00 1.00 ? 42  TYR A CE1  6  
ATOM 10392 C CE2  . TYR A 1 42  ? -14.087 6.163   -17.972 1.00 1.00 ? 42  TYR A CE2  6  
ATOM 10393 C CZ   . TYR A 1 42  ? -15.338 5.570   -17.686 1.00 1.00 ? 42  TYR A CZ   6  
ATOM 10394 O OH   . TYR A 1 42  ? -15.882 5.701   -16.442 1.00 1.00 ? 42  TYR A OH   6  
ATOM 10395 H H    . TYR A 1 42  ? -14.671 7.367   -21.319 1.00 1.00 ? 42  TYR A H    6  
ATOM 10396 H HA   . TYR A 1 42  ? -13.640 6.038   -23.604 1.00 1.00 ? 42  TYR A HA   6  
ATOM 10397 H HB2  . TYR A 1 42  ? -13.447 4.110   -21.870 1.00 1.00 ? 42  TYR A HB2  6  
ATOM 10398 H HB3  . TYR A 1 42  ? -12.571 5.601   -21.609 1.00 1.00 ? 42  TYR A HB3  6  
ATOM 10399 H HD1  . TYR A 1 42  ? -15.942 4.107   -20.714 1.00 1.00 ? 42  TYR A HD1  6  
ATOM 10400 H HD2  . TYR A 1 42  ? -12.564 6.486   -19.465 1.00 1.00 ? 42  TYR A HD2  6  
ATOM 10401 H HE1  . TYR A 1 42  ? -16.963 4.376   -18.474 1.00 1.00 ? 42  TYR A HE1  6  
ATOM 10402 H HE2  . TYR A 1 42  ? -13.572 6.729   -17.207 1.00 1.00 ? 42  TYR A HE2  6  
ATOM 10403 H HH   . TYR A 1 42  ? -16.740 5.255   -16.348 1.00 1.00 ? 42  TYR A HH   6  
ATOM 10404 N N    . PRO A 1 43  ? -15.136 3.945   -24.167 1.00 1.00 ? 43  PRO A N    6  
ATOM 10405 C CA   . PRO A 1 43  ? -16.078 2.906   -24.575 1.00 1.00 ? 43  PRO A CA   6  
ATOM 10406 C C    . PRO A 1 43  ? -16.511 2.058   -23.371 1.00 1.00 ? 43  PRO A C    6  
ATOM 10407 O O    . PRO A 1 43  ? -15.803 1.977   -22.369 1.00 1.00 ? 43  PRO A O    6  
ATOM 10408 C CB   . PRO A 1 43  ? -15.347 2.059   -25.620 1.00 1.00 ? 43  PRO A CB   6  
ATOM 10409 C CG   . PRO A 1 43  ? -13.878 2.232   -25.248 1.00 1.00 ? 43  PRO A CG   6  
ATOM 10410 C CD   . PRO A 1 43  ? -13.822 3.673   -24.742 1.00 1.00 ? 43  PRO A CD   6  
ATOM 10411 H HA   . PRO A 1 43  ? -16.954 3.355   -25.038 1.00 1.00 ? 43  PRO A HA   6  
ATOM 10412 H HB2  . PRO A 1 43  ? -15.646 1.009   -25.596 1.00 1.00 ? 43  PRO A HB2  6  
ATOM 10413 H HB3  . PRO A 1 43  ? -15.517 2.476   -26.610 1.00 1.00 ? 43  PRO A HB3  6  
ATOM 10414 H HG2  . PRO A 1 43  ? -13.624 1.551   -24.437 1.00 1.00 ? 43  PRO A HG2  6  
ATOM 10415 H HG3  . PRO A 1 43  ? -13.230 2.074   -26.108 1.00 1.00 ? 43  PRO A HG3  6  
ATOM 10416 H HD2  . PRO A 1 43  ? -13.018 3.777   -24.015 1.00 1.00 ? 43  PRO A HD2  6  
ATOM 10417 H HD3  . PRO A 1 43  ? -13.650 4.345   -25.584 1.00 1.00 ? 43  PRO A HD3  6  
ATOM 10418 N N    . GLY A 1 44  ? -17.684 1.425   -23.477 1.00 1.00 ? 44  GLY A N    6  
ATOM 10419 C CA   . GLY A 1 44  ? -18.232 0.547   -22.432 1.00 1.00 ? 44  GLY A CA   6  
ATOM 10420 C C    . GLY A 1 44  ? -19.037 1.265   -21.341 1.00 1.00 ? 44  GLY A C    6  
ATOM 10421 O O    . GLY A 1 44  ? -19.531 0.603   -20.428 1.00 1.00 ? 44  GLY A O    6  
ATOM 10422 H H    . GLY A 1 44  ? -18.198 1.493   -24.348 1.00 1.00 ? 44  GLY A H    6  
ATOM 10423 H HA2  . GLY A 1 44  ? -18.903 -0.174  -22.902 1.00 1.00 ? 44  GLY A HA2  6  
ATOM 10424 H HA3  . GLY A 1 44  ? -17.418 0.014   -21.942 1.00 1.00 ? 44  GLY A HA3  6  
ATOM 10425 N N    . ALA A 1 45  ? -19.202 2.592   -21.431 1.00 1.00 ? 45  ALA A N    6  
ATOM 10426 C CA   . ALA A 1 45  ? -20.044 3.370   -20.510 1.00 1.00 ? 45  ALA A CA   6  
ATOM 10427 C C    . ALA A 1 45  ? -21.546 3.027   -20.635 1.00 1.00 ? 45  ALA A C    6  
ATOM 10428 O O    . ALA A 1 45  ? -22.292 3.172   -19.664 1.00 1.00 ? 45  ALA A O    6  
ATOM 10429 C CB   . ALA A 1 45  ? -19.789 4.864   -20.751 1.00 1.00 ? 45  ALA A CB   6  
ATOM 10430 H H    . ALA A 1 45  ? -18.731 3.081   -22.181 1.00 1.00 ? 45  ALA A H    6  
ATOM 10431 H HA   . ALA A 1 45  ? -19.746 3.137   -19.486 1.00 1.00 ? 45  ALA A HA   6  
ATOM 10432 H HB1  . ALA A 1 45  ? -20.295 5.447   -19.981 1.00 1.00 ? 45  ALA A HB1  6  
ATOM 10433 H HB2  . ALA A 1 45  ? -18.720 5.079   -20.706 1.00 1.00 ? 45  ALA A HB2  6  
ATOM 10434 H HB3  . ALA A 1 45  ? -20.178 5.161   -21.724 1.00 1.00 ? 45  ALA A HB3  6  
ATOM 10435 N N    . GLY A 1 46  ? -21.974 2.533   -21.807 1.00 1.00 ? 46  GLY A N    6  
ATOM 10436 C CA   . GLY A 1 46  ? -23.309 1.962   -22.041 1.00 1.00 ? 46  GLY A CA   6  
ATOM 10437 C C    . GLY A 1 46  ? -24.358 2.955   -22.550 1.00 1.00 ? 46  GLY A C    6  
ATOM 10438 O O    . GLY A 1 46  ? -25.552 2.679   -22.448 1.00 1.00 ? 46  GLY A O    6  
ATOM 10439 H H    . GLY A 1 46  ? -21.307 2.501   -22.568 1.00 1.00 ? 46  GLY A H    6  
ATOM 10440 H HA2  . GLY A 1 46  ? -23.224 1.181   -22.796 1.00 1.00 ? 46  GLY A HA2  6  
ATOM 10441 H HA3  . GLY A 1 46  ? -23.685 1.524   -21.114 1.00 1.00 ? 46  GLY A HA3  6  
ATOM 10442 N N    . SER A 1 47  ? -23.939 4.096   -23.098 1.00 1.00 ? 47  SER A N    6  
ATOM 10443 C CA   . SER A 1 47  ? -24.836 5.169   -23.564 1.00 1.00 ? 47  SER A CA   6  
ATOM 10444 C C    . SER A 1 47  ? -24.123 6.067   -24.595 1.00 1.00 ? 47  SER A C    6  
ATOM 10445 O O    . SER A 1 47  ? -23.798 5.602   -25.686 1.00 1.00 ? 47  SER A O    6  
ATOM 10446 C CB   . SER A 1 47  ? -25.441 5.934   -22.362 1.00 1.00 ? 47  SER A CB   6  
ATOM 10447 O OG   . SER A 1 47  ? -24.449 6.569   -21.554 1.00 1.00 ? 47  SER A OG   6  
ATOM 10448 H H    . SER A 1 47  ? -22.940 4.246   -23.175 1.00 1.00 ? 47  SER A H    6  
ATOM 10449 H HA   . SER A 1 47  ? -25.671 4.717   -24.100 1.00 1.00 ? 47  SER A HA   6  
ATOM 10450 H HB2  . SER A 1 47  ? -26.141 6.686   -22.735 1.00 1.00 ? 47  SER A HB2  6  
ATOM 10451 H HB3  . SER A 1 47  ? -26.006 5.230   -21.748 1.00 1.00 ? 47  SER A HB3  6  
ATOM 10452 H HG   . SER A 1 47  ? -24.865 6.892   -20.724 1.00 1.00 ? 47  SER A HG   6  
ATOM 10453 N N    . SER A 1 48  ? -23.828 7.330   -24.273 1.00 1.00 ? 48  SER A N    6  
ATOM 10454 C CA   . SER A 1 48  ? -23.174 8.313   -25.157 1.00 1.00 ? 48  SER A CA   6  
ATOM 10455 C C    . SER A 1 48  ? -21.832 7.819   -25.732 1.00 1.00 ? 48  SER A C    6  
ATOM 10456 O O    . SER A 1 48  ? -21.392 8.276   -26.790 1.00 1.00 ? 48  SER A O    6  
ATOM 10457 C CB   . SER A 1 48  ? -22.970 9.629   -24.395 1.00 1.00 ? 48  SER A CB   6  
ATOM 10458 O OG   . SER A 1 48  ? -24.212 10.137  -23.907 1.00 1.00 ? 48  SER A OG   6  
ATOM 10459 H H    . SER A 1 48  ? -24.086 7.650   -23.346 1.00 1.00 ? 48  SER A H    6  
ATOM 10460 H HA   . SER A 1 48  ? -23.830 8.511   -26.003 1.00 1.00 ? 48  SER A HA   6  
ATOM 10461 H HB2  . SER A 1 48  ? -22.297 9.449   -23.555 1.00 1.00 ? 48  SER A HB2  6  
ATOM 10462 H HB3  . SER A 1 48  ? -22.514 10.360  -25.065 1.00 1.00 ? 48  SER A HB3  6  
ATOM 10463 H HG   . SER A 1 48  ? -24.049 10.979  -23.427 1.00 1.00 ? 48  SER A HG   6  
ATOM 10464 N N    . SER A 1 49  ? -21.221 6.807   -25.101 1.00 1.00 ? 49  SER A N    6  
ATOM 10465 C CA   . SER A 1 49  ? -20.071 6.060   -25.607 1.00 1.00 ? 49  SER A CA   6  
ATOM 10466 C C    . SER A 1 49  ? -20.277 5.571   -27.049 1.00 1.00 ? 49  SER A C    6  
ATOM 10467 O O    . SER A 1 49  ? -19.332 5.642   -27.833 1.00 1.00 ? 49  SER A O    6  
ATOM 10468 C CB   . SER A 1 49  ? -19.792 4.879   -24.662 1.00 1.00 ? 49  SER A CB   6  
ATOM 10469 O OG   . SER A 1 49  ? -20.986 4.187   -24.292 1.00 1.00 ? 49  SER A OG   6  
ATOM 10470 H H    . SER A 1 49  ? -21.656 6.448   -24.261 1.00 1.00 ? 49  SER A H    6  
ATOM 10471 H HA   . SER A 1 49  ? -19.191 6.701   -25.605 1.00 1.00 ? 49  SER A HA   6  
ATOM 10472 H HB2  . SER A 1 49  ? -19.087 4.190   -25.130 1.00 1.00 ? 49  SER A HB2  6  
ATOM 10473 H HB3  . SER A 1 49  ? -19.332 5.274   -23.755 1.00 1.00 ? 49  SER A HB3  6  
ATOM 10474 H HG   . SER A 1 49  ? -21.157 3.450   -24.922 1.00 1.00 ? 49  SER A HG   6  
ATOM 10475 N N    . VAL A 1 50  ? -21.497 5.165   -27.444 1.00 1.00 ? 50  VAL A N    6  
ATOM 10476 C CA   . VAL A 1 50  ? -21.775 4.664   -28.812 1.00 1.00 ? 50  VAL A CA   6  
ATOM 10477 C C    . VAL A 1 50  ? -21.582 5.729   -29.907 1.00 1.00 ? 50  VAL A C    6  
ATOM 10478 O O    . VAL A 1 50  ? -21.442 5.378   -31.080 1.00 1.00 ? 50  VAL A O    6  
ATOM 10479 C CB   . VAL A 1 50  ? -23.171 4.011   -28.976 1.00 1.00 ? 50  VAL A CB   6  
ATOM 10480 C CG1  . VAL A 1 50  ? -23.408 2.911   -27.927 1.00 1.00 ? 50  VAL A CG1  6  
ATOM 10481 C CG2  . VAL A 1 50  ? -24.332 5.022   -28.997 1.00 1.00 ? 50  VAL A CG2  6  
ATOM 10482 H H    . VAL A 1 50  ? -22.263 5.225   -26.763 1.00 1.00 ? 50  VAL A H    6  
ATOM 10483 H HA   . VAL A 1 50  ? -21.041 3.877   -28.998 1.00 1.00 ? 50  VAL A HA   6  
ATOM 10484 H HB   . VAL A 1 50  ? -23.180 3.512   -29.947 1.00 1.00 ? 50  VAL A HB   6  
ATOM 10485 H HG11 . VAL A 1 50  ? -24.334 2.378   -28.158 1.00 1.00 ? 50  VAL A HG11 6  
ATOM 10486 H HG12 . VAL A 1 50  ? -22.584 2.196   -27.943 1.00 1.00 ? 50  VAL A HG12 6  
ATOM 10487 H HG13 . VAL A 1 50  ? -23.492 3.336   -26.930 1.00 1.00 ? 50  VAL A HG13 6  
ATOM 10488 H HG21 . VAL A 1 50  ? -24.273 5.640   -29.892 1.00 1.00 ? 50  VAL A HG21 6  
ATOM 10489 H HG22 . VAL A 1 50  ? -25.285 4.494   -29.014 1.00 1.00 ? 50  VAL A HG22 6  
ATOM 10490 H HG23 . VAL A 1 50  ? -24.296 5.671   -28.127 1.00 1.00 ? 50  VAL A HG23 6  
ATOM 10491 N N    . PHE A 1 51  ? -21.549 7.015   -29.531 1.00 1.00 ? 51  PHE A N    6  
ATOM 10492 C CA   . PHE A 1 51  ? -21.167 8.130   -30.400 1.00 1.00 ? 51  PHE A CA   6  
ATOM 10493 C C    . PHE A 1 51  ? -19.717 8.546   -30.118 1.00 1.00 ? 51  PHE A C    6  
ATOM 10494 O O    . PHE A 1 51  ? -18.931 8.717   -31.047 1.00 1.00 ? 51  PHE A O    6  
ATOM 10495 C CB   . PHE A 1 51  ? -22.144 9.298   -30.181 1.00 1.00 ? 51  PHE A CB   6  
ATOM 10496 C CG   . PHE A 1 51  ? -23.601 8.934   -30.406 1.00 1.00 ? 51  PHE A CG   6  
ATOM 10497 C CD1  . PHE A 1 51  ? -24.069 8.671   -31.707 1.00 1.00 ? 51  PHE A CD1  6  
ATOM 10498 C CD2  . PHE A 1 51  ? -24.482 8.821   -29.312 1.00 1.00 ? 51  PHE A CD2  6  
ATOM 10499 C CE1  . PHE A 1 51  ? -25.412 8.303   -31.914 1.00 1.00 ? 51  PHE A CE1  6  
ATOM 10500 C CE2  . PHE A 1 51  ? -25.822 8.450   -29.518 1.00 1.00 ? 51  PHE A CE2  6  
ATOM 10501 C CZ   . PHE A 1 51  ? -26.288 8.193   -30.821 1.00 1.00 ? 51  PHE A CZ   6  
ATOM 10502 H H    . PHE A 1 51  ? -21.694 7.226   -28.551 1.00 1.00 ? 51  PHE A H    6  
ATOM 10503 H HA   . PHE A 1 51  ? -21.233 7.826   -31.447 1.00 1.00 ? 51  PHE A HA   6  
ATOM 10504 H HB2  . PHE A 1 51  ? -22.023 9.684   -29.167 1.00 1.00 ? 51  PHE A HB2  6  
ATOM 10505 H HB3  . PHE A 1 51  ? -21.881 10.105  -30.867 1.00 1.00 ? 51  PHE A HB3  6  
ATOM 10506 H HD1  . PHE A 1 51  ? -23.397 8.746   -32.552 1.00 1.00 ? 51  PHE A HD1  6  
ATOM 10507 H HD2  . PHE A 1 51  ? -24.126 9.009   -28.308 1.00 1.00 ? 51  PHE A HD2  6  
ATOM 10508 H HE1  . PHE A 1 51  ? -25.770 8.099   -32.914 1.00 1.00 ? 51  PHE A HE1  6  
ATOM 10509 H HE2  . PHE A 1 51  ? -26.492 8.359   -28.674 1.00 1.00 ? 51  PHE A HE2  6  
ATOM 10510 H HZ   . PHE A 1 51  ? -27.317 7.906   -30.982 1.00 1.00 ? 51  PHE A HZ   6  
ATOM 10511 N N    . SER A 1 52  ? -19.321 8.641   -28.844 1.00 1.00 ? 52  SER A N    6  
ATOM 10512 C CA   . SER A 1 52  ? -17.973 9.074   -28.440 1.00 1.00 ? 52  SER A CA   6  
ATOM 10513 C C    . SER A 1 52  ? -16.853 8.106   -28.863 1.00 1.00 ? 52  SER A C    6  
ATOM 10514 O O    . SER A 1 52  ? -15.701 8.534   -28.940 1.00 1.00 ? 52  SER A O    6  
ATOM 10515 C CB   . SER A 1 52  ? -17.936 9.353   -26.931 1.00 1.00 ? 52  SER A CB   6  
ATOM 10516 O OG   . SER A 1 52  ? -18.807 10.428  -26.625 1.00 1.00 ? 52  SER A OG   6  
ATOM 10517 H H    . SER A 1 52  ? -20.026 8.561   -28.111 1.00 1.00 ? 52  SER A H    6  
ATOM 10518 H HA   . SER A 1 52  ? -17.753 10.019  -28.939 1.00 1.00 ? 52  SER A HA   6  
ATOM 10519 H HB2  . SER A 1 52  ? -18.242 8.464   -26.384 1.00 1.00 ? 52  SER A HB2  6  
ATOM 10520 H HB3  . SER A 1 52  ? -16.921 9.615   -26.629 1.00 1.00 ? 52  SER A HB3  6  
ATOM 10521 H HG   . SER A 1 52  ? -19.127 10.312  -25.690 1.00 1.00 ? 52  SER A HG   6  
ATOM 10522 N N    . VAL A 1 53  ? -17.144 6.843   -29.218 1.00 1.00 ? 53  VAL A N    6  
ATOM 10523 C CA   . VAL A 1 53  ? -16.160 5.926   -29.854 1.00 1.00 ? 53  VAL A CA   6  
ATOM 10524 C C    . VAL A 1 53  ? -15.517 6.505   -31.128 1.00 1.00 ? 53  VAL A C    6  
ATOM 10525 O O    . VAL A 1 53  ? -14.415 6.094   -31.494 1.00 1.00 ? 53  VAL A O    6  
ATOM 10526 C CB   . VAL A 1 53  ? -16.741 4.532   -30.207 1.00 1.00 ? 53  VAL A CB   6  
ATOM 10527 C CG1  . VAL A 1 53  ? -16.812 3.641   -28.962 1.00 1.00 ? 53  VAL A CG1  6  
ATOM 10528 C CG2  . VAL A 1 53  ? -18.092 4.596   -30.936 1.00 1.00 ? 53  VAL A CG2  6  
ATOM 10529 H H    . VAL A 1 53  ? -18.078 6.490   -28.990 1.00 1.00 ? 53  VAL A H    6  
ATOM 10530 H HA   . VAL A 1 53  ? -15.354 5.770   -29.141 1.00 1.00 ? 53  VAL A HA   6  
ATOM 10531 H HB   . VAL A 1 53  ? -16.046 4.040   -30.885 1.00 1.00 ? 53  VAL A HB   6  
ATOM 10532 H HG11 . VAL A 1 53  ? -17.232 2.668   -29.221 1.00 1.00 ? 53  VAL A HG11 6  
ATOM 10533 H HG12 . VAL A 1 53  ? -15.802 3.499   -28.582 1.00 1.00 ? 53  VAL A HG12 6  
ATOM 10534 H HG13 . VAL A 1 53  ? -17.421 4.095   -28.183 1.00 1.00 ? 53  VAL A HG13 6  
ATOM 10535 H HG21 . VAL A 1 53  ? -18.401 3.592   -31.225 1.00 1.00 ? 53  VAL A HG21 6  
ATOM 10536 H HG22 . VAL A 1 53  ? -18.853 5.026   -30.290 1.00 1.00 ? 53  VAL A HG22 6  
ATOM 10537 H HG23 . VAL A 1 53  ? -17.998 5.204   -31.836 1.00 1.00 ? 53  VAL A HG23 6  
ATOM 10538 N N    . LEU A 1 54  ? -16.169 7.471   -31.789 1.00 1.00 ? 54  LEU A N    6  
ATOM 10539 C CA   . LEU A 1 54  ? -15.646 8.165   -32.973 1.00 1.00 ? 54  LEU A CA   6  
ATOM 10540 C C    . LEU A 1 54  ? -14.616 9.268   -32.637 1.00 1.00 ? 54  LEU A C    6  
ATOM 10541 O O    . LEU A 1 54  ? -13.938 9.755   -33.543 1.00 1.00 ? 54  LEU A O    6  
ATOM 10542 C CB   . LEU A 1 54  ? -16.831 8.761   -33.761 1.00 1.00 ? 54  LEU A CB   6  
ATOM 10543 C CG   . LEU A 1 54  ? -17.913 7.755   -34.221 1.00 1.00 ? 54  LEU A CG   6  
ATOM 10544 C CD1  . LEU A 1 54  ? -19.039 8.511   -34.940 1.00 1.00 ? 54  LEU A CD1  6  
ATOM 10545 C CD2  . LEU A 1 54  ? -17.341 6.669   -35.147 1.00 1.00 ? 54  LEU A CD2  6  
ATOM 10546 H H    . LEU A 1 54  ? -17.077 7.761   -31.448 1.00 1.00 ? 54  LEU A H    6  
ATOM 10547 H HA   . LEU A 1 54  ? -15.126 7.446   -33.609 1.00 1.00 ? 54  LEU A HA   6  
ATOM 10548 H HB2  . LEU A 1 54  ? -17.306 9.526   -33.143 1.00 1.00 ? 54  LEU A HB2  6  
ATOM 10549 H HB3  . LEU A 1 54  ? -16.438 9.265   -34.646 1.00 1.00 ? 54  LEU A HB3  6  
ATOM 10550 H HG   . LEU A 1 54  ? -18.346 7.266   -33.349 1.00 1.00 ? 54  LEU A HG   6  
ATOM 10551 H HD11 . LEU A 1 54  ? -19.826 7.813   -35.231 1.00 1.00 ? 54  LEU A HD11 6  
ATOM 10552 H HD12 . LEU A 1 54  ? -19.469 9.258   -34.273 1.00 1.00 ? 54  LEU A HD12 6  
ATOM 10553 H HD13 . LEU A 1 54  ? -18.654 9.007   -35.832 1.00 1.00 ? 54  LEU A HD13 6  
ATOM 10554 H HD21 . LEU A 1 54  ? -16.618 6.059   -34.605 1.00 1.00 ? 54  LEU A HD21 6  
ATOM 10555 H HD22 . LEU A 1 54  ? -18.146 6.019   -35.495 1.00 1.00 ? 54  LEU A HD22 6  
ATOM 10556 H HD23 . LEU A 1 54  ? -16.853 7.128   -36.006 1.00 1.00 ? 54  LEU A HD23 6  
ATOM 10557 N N    . SER A 1 55  ? -14.483 9.659   -31.364 1.00 1.00 ? 55  SER A N    6  
ATOM 10558 C CA   . SER A 1 55  ? -13.702 10.843  -30.952 1.00 1.00 ? 55  SER A CA   6  
ATOM 10559 C C    . SER A 1 55  ? -12.726 10.601  -29.783 1.00 1.00 ? 55  SER A C    6  
ATOM 10560 O O    . SER A 1 55  ? -11.646 11.197  -29.763 1.00 1.00 ? 55  SER A O    6  
ATOM 10561 C CB   . SER A 1 55  ? -14.664 11.972  -30.542 1.00 1.00 ? 55  SER A CB   6  
ATOM 10562 O OG   . SER A 1 55  ? -15.533 12.350  -31.608 1.00 1.00 ? 55  SER A OG   6  
ATOM 10563 H H    . SER A 1 55  ? -15.057 9.200   -30.667 1.00 1.00 ? 55  SER A H    6  
ATOM 10564 H HA   . SER A 1 55  ? -13.103 11.212  -31.787 1.00 1.00 ? 55  SER A HA   6  
ATOM 10565 H HB2  . SER A 1 55  ? -15.261 11.643  -29.689 1.00 1.00 ? 55  SER A HB2  6  
ATOM 10566 H HB3  . SER A 1 55  ? -14.076 12.841  -30.238 1.00 1.00 ? 55  SER A HB3  6  
ATOM 10567 H HG   . SER A 1 55  ? -16.103 13.096  -31.317 1.00 1.00 ? 55  SER A HG   6  
ATOM 10568 N N    . ASN A 1 56  ? -13.077 9.761   -28.800 1.00 1.00 ? 56  ASN A N    6  
ATOM 10569 C CA   . ASN A 1 56  ? -12.292 9.595   -27.567 1.00 1.00 ? 56  ASN A CA   6  
ATOM 10570 C C    . ASN A 1 56  ? -10.991 8.782   -27.771 1.00 1.00 ? 56  ASN A C    6  
ATOM 10571 O O    . ASN A 1 56  ? -10.932 7.879   -28.606 1.00 1.00 ? 56  ASN A O    6  
ATOM 10572 C CB   . ASN A 1 56  ? -13.175 9.014   -26.445 1.00 1.00 ? 56  ASN A CB   6  
ATOM 10573 C CG   . ASN A 1 56  ? -13.221 7.487   -26.419 1.00 1.00 ? 56  ASN A CG   6  
ATOM 10574 O OD1  . ASN A 1 56  ? -12.491 6.841   -25.681 1.00 1.00 ? 56  ASN A OD1  6  
ATOM 10575 N ND2  . ASN A 1 56  ? -14.041 6.859   -27.236 1.00 1.00 ? 56  ASN A ND2  6  
ATOM 10576 H H    . ASN A 1 56  ? -13.963 9.273   -28.867 1.00 1.00 ? 56  ASN A H    6  
ATOM 10577 H HA   . ASN A 1 56  ? -11.999 10.597  -27.243 1.00 1.00 ? 56  ASN A HA   6  
ATOM 10578 H HB2  . ASN A 1 56  ? -12.780 9.352   -25.486 1.00 1.00 ? 56  ASN A HB2  6  
ATOM 10579 H HB3  . ASN A 1 56  ? -14.189 9.406   -26.532 1.00 1.00 ? 56  ASN A HB3  6  
ATOM 10580 H HD21 . ASN A 1 56  ? -14.638 7.384   -27.864 1.00 1.00 ? 56  ASN A HD21 6  
ATOM 10581 H HD22 . ASN A 1 56  ? -14.046 5.855   -27.229 1.00 1.00 ? 56  ASN A HD22 6  
ATOM 10582 N N    . SER A 1 57  ? -9.957  9.066   -26.968 1.00 1.00 ? 57  SER A N    6  
ATOM 10583 C CA   . SER A 1 57  ? -8.667  8.346   -26.967 1.00 1.00 ? 57  SER A CA   6  
ATOM 10584 C C    . SER A 1 57  ? -7.820  8.678   -25.718 1.00 1.00 ? 57  SER A C    6  
ATOM 10585 O O    . SER A 1 57  ? -7.999  9.732   -25.101 1.00 1.00 ? 57  SER A O    6  
ATOM 10586 C CB   . SER A 1 57  ? -7.867  8.651   -28.254 1.00 1.00 ? 57  SER A CB   6  
ATOM 10587 O OG   . SER A 1 57  ? -7.673  10.049  -28.470 1.00 1.00 ? 57  SER A OG   6  
ATOM 10588 H H    . SER A 1 57  ? -10.039 9.840   -26.317 1.00 1.00 ? 57  SER A H    6  
ATOM 10589 H HA   . SER A 1 57  ? -8.871  7.272   -26.950 1.00 1.00 ? 57  SER A HA   6  
ATOM 10590 H HB2  . SER A 1 57  ? -6.891  8.165   -28.192 1.00 1.00 ? 57  SER A HB2  6  
ATOM 10591 H HB3  . SER A 1 57  ? -8.390  8.232   -29.114 1.00 1.00 ? 57  SER A HB3  6  
ATOM 10592 H HG   . SER A 1 57  ? -8.542  10.501  -28.512 1.00 1.00 ? 57  SER A HG   6  
ATOM 10593 N N    . ALA A 1 58  ? -6.896  7.783   -25.339 1.00 1.00 ? 58  ALA A N    6  
ATOM 10594 C CA   . ALA A 1 58  ? -5.878  8.034   -24.310 1.00 1.00 ? 58  ALA A CA   6  
ATOM 10595 C C    . ALA A 1 58  ? -4.583  8.551   -24.954 1.00 1.00 ? 58  ALA A C    6  
ATOM 10596 O O    . ALA A 1 58  ? -4.232  8.124   -26.053 1.00 1.00 ? 58  ALA A O    6  
ATOM 10597 C CB   . ALA A 1 58  ? -5.645  6.733   -23.529 1.00 1.00 ? 58  ALA A CB   6  
ATOM 10598 H H    . ALA A 1 58  ? -6.783  6.934   -25.882 1.00 1.00 ? 58  ALA A H    6  
ATOM 10599 H HA   . ALA A 1 58  ? -6.220  8.799   -23.607 1.00 1.00 ? 58  ALA A HA   6  
ATOM 10600 H HB1  . ALA A 1 58  ? -4.940  6.916   -22.717 1.00 1.00 ? 58  ALA A HB1  6  
ATOM 10601 H HB2  . ALA A 1 58  ? -6.585  6.381   -23.099 1.00 1.00 ? 58  ALA A HB2  6  
ATOM 10602 H HB3  . ALA A 1 58  ? -5.242  5.961   -24.189 1.00 1.00 ? 58  ALA A HB3  6  
ATOM 10603 N N    . GLU A 1 59  ? -3.858  9.439   -24.273 1.00 1.00 ? 59  GLU A N    6  
ATOM 10604 C CA   . GLU A 1 59  ? -2.666  10.112  -24.815 1.00 1.00 ? 59  GLU A CA   6  
ATOM 10605 C C    . GLU A 1 59  ? -1.568  10.240  -23.758 1.00 1.00 ? 59  GLU A C    6  
ATOM 10606 O O    . GLU A 1 59  ? -1.865  10.577  -22.611 1.00 1.00 ? 59  GLU A O    6  
ATOM 10607 C CB   . GLU A 1 59  ? -3.047  11.508  -25.339 1.00 1.00 ? 59  GLU A CB   6  
ATOM 10608 C CG   . GLU A 1 59  ? -1.970  12.092  -26.262 1.00 1.00 ? 59  GLU A CG   6  
ATOM 10609 C CD   . GLU A 1 59  ? -2.384  13.477  -26.779 1.00 1.00 ? 59  GLU A CD   6  
ATOM 10610 O OE1  . GLU A 1 59  ? -3.145  13.550  -27.771 1.00 1.00 ? 59  GLU A OE1  6  
ATOM 10611 O OE2  . GLU A 1 59  ? -1.969  14.494  -26.176 1.00 1.00 ? 59  GLU A OE2  6  
ATOM 10612 H H    . GLU A 1 59  ? -4.151  9.680   -23.333 1.00 1.00 ? 59  GLU A H    6  
ATOM 10613 H HA   . GLU A 1 59  ? -2.276  9.530   -25.646 1.00 1.00 ? 59  GLU A HA   6  
ATOM 10614 H HB2  . GLU A 1 59  ? -3.976  11.434  -25.904 1.00 1.00 ? 59  GLU A HB2  6  
ATOM 10615 H HB3  . GLU A 1 59  ? -3.207  12.182  -24.491 1.00 1.00 ? 59  GLU A HB3  6  
ATOM 10616 H HG2  . GLU A 1 59  ? -1.027  12.179  -25.720 1.00 1.00 ? 59  GLU A HG2  6  
ATOM 10617 H HG3  . GLU A 1 59  ? -1.809  11.416  -27.106 1.00 1.00 ? 59  GLU A HG3  6  
ATOM 10618 N N    . VAL A 1 60  ? -0.310  10.004  -24.139 1.00 1.00 ? 60  VAL A N    6  
ATOM 10619 C CA   . VAL A 1 60  ? 0.841   10.279  -23.262 1.00 1.00 ? 60  VAL A CA   6  
ATOM 10620 C C    . VAL A 1 60  ? 1.132   11.779  -23.266 1.00 1.00 ? 60  VAL A C    6  
ATOM 10621 O O    . VAL A 1 60  ? 1.273   12.388  -24.325 1.00 1.00 ? 60  VAL A O    6  
ATOM 10622 C CB   . VAL A 1 60  ? 2.104   9.499   -23.670 1.00 1.00 ? 60  VAL A CB   6  
ATOM 10623 C CG1  . VAL A 1 60  ? 3.243   9.707   -22.653 1.00 1.00 ? 60  VAL A CG1  6  
ATOM 10624 C CG2  . VAL A 1 60  ? 1.840   7.987   -23.771 1.00 1.00 ? 60  VAL A CG2  6  
ATOM 10625 H H    . VAL A 1 60  ? -0.129  9.729   -25.108 1.00 1.00 ? 60  VAL A H    6  
ATOM 10626 H HA   . VAL A 1 60  ? 0.576   9.962   -22.257 1.00 1.00 ? 60  VAL A HA   6  
ATOM 10627 H HB   . VAL A 1 60  ? 2.416   9.868   -24.644 1.00 1.00 ? 60  VAL A HB   6  
ATOM 10628 H HG11 . VAL A 1 60  ? 2.942   9.332   -21.676 1.00 1.00 ? 60  VAL A HG11 6  
ATOM 10629 H HG12 . VAL A 1 60  ? 4.143   9.188   -22.988 1.00 1.00 ? 60  VAL A HG12 6  
ATOM 10630 H HG13 . VAL A 1 60  ? 3.481   10.762  -22.550 1.00 1.00 ? 60  VAL A HG13 6  
ATOM 10631 H HG21 . VAL A 1 60  ? 1.508   7.597   -22.812 1.00 1.00 ? 60  VAL A HG21 6  
ATOM 10632 H HG22 . VAL A 1 60  ? 1.082   7.782   -24.526 1.00 1.00 ? 60  VAL A HG22 6  
ATOM 10633 H HG23 . VAL A 1 60  ? 2.758   7.478   -24.059 1.00 1.00 ? 60  VAL A HG23 6  
ATOM 10634 N N    . LYS A 1 61  ? 1.244   12.373  -22.078 1.00 1.00 ? 61  LYS A N    6  
ATOM 10635 C CA   . LYS A 1 61  ? 1.379   13.819  -21.852 1.00 1.00 ? 61  LYS A CA   6  
ATOM 10636 C C    . LYS A 1 61  ? 2.477   14.143  -20.817 1.00 1.00 ? 61  LYS A C    6  
ATOM 10637 O O    . LYS A 1 61  ? 2.841   13.309  -19.986 1.00 1.00 ? 61  LYS A O    6  
ATOM 10638 C CB   . LYS A 1 61  ? -0.002  14.360  -21.417 1.00 1.00 ? 61  LYS A CB   6  
ATOM 10639 C CG   . LYS A 1 61  ? -1.048  14.350  -22.551 1.00 1.00 ? 61  LYS A CG   6  
ATOM 10640 C CD   . LYS A 1 61  ? -2.407  14.834  -22.020 1.00 1.00 ? 61  LYS A CD   6  
ATOM 10641 C CE   . LYS A 1 61  ? -3.522  14.969  -23.072 1.00 1.00 ? 61  LYS A CE   6  
ATOM 10642 N NZ   . LYS A 1 61  ? -3.200  15.943  -24.155 1.00 1.00 ? 61  LYS A NZ   6  
ATOM 10643 H H    . LYS A 1 61  ? 1.127   11.785  -21.254 1.00 1.00 ? 61  LYS A H    6  
ATOM 10644 H HA   . LYS A 1 61  ? 1.665   14.308  -22.787 1.00 1.00 ? 61  LYS A HA   6  
ATOM 10645 H HB2  . LYS A 1 61  ? -0.370  13.758  -20.582 1.00 1.00 ? 61  LYS A HB2  6  
ATOM 10646 H HB3  . LYS A 1 61  ? 0.108   15.389  -21.064 1.00 1.00 ? 61  LYS A HB3  6  
ATOM 10647 H HG2  . LYS A 1 61  ? -0.702  15.003  -23.351 1.00 1.00 ? 61  LYS A HG2  6  
ATOM 10648 H HG3  . LYS A 1 61  ? -1.166  13.338  -22.946 1.00 1.00 ? 61  LYS A HG3  6  
ATOM 10649 H HD2  . LYS A 1 61  ? -2.751  14.109  -21.284 1.00 1.00 ? 61  LYS A HD2  6  
ATOM 10650 H HD3  . LYS A 1 61  ? -2.279  15.793  -21.514 1.00 1.00 ? 61  LYS A HD3  6  
ATOM 10651 H HE2  . LYS A 1 61  ? -3.735  13.987  -23.503 1.00 1.00 ? 61  LYS A HE2  6  
ATOM 10652 H HE3  . LYS A 1 61  ? -4.431  15.294  -22.554 1.00 1.00 ? 61  LYS A HE3  6  
ATOM 10653 H HZ1  . LYS A 1 61  ? -2.839  16.813  -23.781 1.00 1.00 ? 61  LYS A HZ1  6  
ATOM 10654 H HZ2  . LYS A 1 61  ? -2.522  15.552  -24.813 1.00 1.00 ? 61  LYS A HZ2  6  
ATOM 10655 H HZ3  . LYS A 1 61  ? -4.025  16.162  -24.699 1.00 1.00 ? 61  LYS A HZ3  6  
ATOM 10656 N N    . ARG A 1 62  ? 3.023   15.366  -20.879 1.00 1.00 ? 62  ARG A N    6  
ATOM 10657 C CA   . ARG A 1 62  ? 4.010   15.927  -19.933 1.00 1.00 ? 62  ARG A CA   6  
ATOM 10658 C C    . ARG A 1 62  ? 3.429   17.164  -19.225 1.00 1.00 ? 62  ARG A C    6  
ATOM 10659 O O    . ARG A 1 62  ? 2.817   17.997  -19.890 1.00 1.00 ? 62  ARG A O    6  
ATOM 10660 C CB   . ARG A 1 62  ? 5.276   16.314  -20.727 1.00 1.00 ? 62  ARG A CB   6  
ATOM 10661 C CG   . ARG A 1 62  ? 6.446   16.802  -19.849 1.00 1.00 ? 62  ARG A CG   6  
ATOM 10662 C CD   . ARG A 1 62  ? 7.663   17.246  -20.679 1.00 1.00 ? 62  ARG A CD   6  
ATOM 10663 N NE   . ARG A 1 62  ? 7.374   18.475  -21.450 1.00 1.00 ? 62  ARG A NE   6  
ATOM 10664 C CZ   . ARG A 1 62  ? 8.128   19.020  -22.401 1.00 1.00 ? 62  ARG A CZ   6  
ATOM 10665 N NH1  . ARG A 1 62  ? 9.284   18.504  -22.762 1.00 1.00 ? 62  ARG A NH1  6  
ATOM 10666 N NH2  . ARG A 1 62  ? 7.723   20.113  -23.004 1.00 1.00 ? 62  ARG A NH2  6  
ATOM 10667 H H    . ARG A 1 62  ? 2.700   15.986  -21.613 1.00 1.00 ? 62  ARG A H    6  
ATOM 10668 H HA   . ARG A 1 62  ? 4.279   15.180  -19.187 1.00 1.00 ? 62  ARG A HA   6  
ATOM 10669 H HB2  . ARG A 1 62  ? 5.611   15.445  -21.291 1.00 1.00 ? 62  ARG A HB2  6  
ATOM 10670 H HB3  . ARG A 1 62  ? 5.014   17.092  -21.449 1.00 1.00 ? 62  ARG A HB3  6  
ATOM 10671 H HG2  . ARG A 1 62  ? 6.128   17.640  -19.230 1.00 1.00 ? 62  ARG A HG2  6  
ATOM 10672 H HG3  . ARG A 1 62  ? 6.750   15.990  -19.189 1.00 1.00 ? 62  ARG A HG3  6  
ATOM 10673 H HD2  . ARG A 1 62  ? 8.498   17.443  -20.003 1.00 1.00 ? 62  ARG A HD2  6  
ATOM 10674 H HD3  . ARG A 1 62  ? 7.947   16.434  -21.353 1.00 1.00 ? 62  ARG A HD3  6  
ATOM 10675 H HE   . ARG A 1 62  ? 6.530   18.975  -21.205 1.00 1.00 ? 62  ARG A HE   6  
ATOM 10676 H HH11 . ARG A 1 62  ? 9.646   17.682  -22.308 1.00 1.00 ? 62  ARG A HH11 6  
ATOM 10677 H HH12 . ARG A 1 62  ? 9.837   18.943  -23.487 1.00 1.00 ? 62  ARG A HH12 6  
ATOM 10678 H HH21 . ARG A 1 62  ? 6.845   20.546  -22.758 1.00 1.00 ? 62  ARG A HH21 6  
ATOM 10679 H HH22 . ARG A 1 62  ? 8.285   20.544  -23.723 1.00 1.00 ? 62  ARG A HH22 6  
ATOM 10680 N N    . GLU A 1 63  ? 3.685   17.330  -17.922 1.00 1.00 ? 63  GLU A N    6  
ATOM 10681 C CA   . GLU A 1 63  ? 3.382   18.556  -17.159 1.00 1.00 ? 63  GLU A CA   6  
ATOM 10682 C C    . GLU A 1 63  ? 4.134   18.565  -15.815 1.00 1.00 ? 63  GLU A C    6  
ATOM 10683 O O    . GLU A 1 63  ? 4.877   17.630  -15.503 1.00 1.00 ? 63  GLU A O    6  
ATOM 10684 C CB   . GLU A 1 63  ? 1.851   18.726  -16.958 1.00 1.00 ? 63  GLU A CB   6  
ATOM 10685 C CG   . GLU A 1 63  ? 1.213   19.875  -17.759 1.00 1.00 ? 63  GLU A CG   6  
ATOM 10686 C CD   . GLU A 1 63  ? 1.905   21.234  -17.542 1.00 1.00 ? 63  GLU A CD   6  
ATOM 10687 O OE1  . GLU A 1 63  ? 2.312   21.540  -16.396 1.00 1.00 ? 63  GLU A OE1  6  
ATOM 10688 O OE2  . GLU A 1 63  ? 2.051   21.999  -18.527 1.00 1.00 ? 63  GLU A OE2  6  
ATOM 10689 H H    . GLU A 1 63  ? 4.176   16.592  -17.422 1.00 1.00 ? 63  GLU A H    6  
ATOM 10690 H HA   . GLU A 1 63  ? 3.758   19.410  -17.725 1.00 1.00 ? 63  GLU A HA   6  
ATOM 10691 H HB2  . GLU A 1 63  ? 1.339   17.800  -17.226 1.00 1.00 ? 63  GLU A HB2  6  
ATOM 10692 H HB3  . GLU A 1 63  ? 1.628   18.912  -15.909 1.00 1.00 ? 63  GLU A HB3  6  
ATOM 10693 H HG2  . GLU A 1 63  ? 1.222   19.623  -18.817 1.00 1.00 ? 63  GLU A HG2  6  
ATOM 10694 H HG3  . GLU A 1 63  ? 0.168   19.964  -17.460 1.00 1.00 ? 63  GLU A HG3  6  
ATOM 10695 N N    . ARG A 1 64  ? 3.955   19.619  -15.013 1.00 1.00 ? 64  ARG A N    6  
ATOM 10696 C CA   . ARG A 1 64  ? 4.425   19.691  -13.626 1.00 1.00 ? 64  ARG A CA   6  
ATOM 10697 C C    . ARG A 1 64  ? 3.611   18.743  -12.733 1.00 1.00 ? 64  ARG A C    6  
ATOM 10698 O O    . ARG A 1 64  ? 2.397   18.612  -12.899 1.00 1.00 ? 64  ARG A O    6  
ATOM 10699 C CB   . ARG A 1 64  ? 4.325   21.136  -13.113 1.00 1.00 ? 64  ARG A CB   6  
ATOM 10700 C CG   . ARG A 1 64  ? 5.284   22.087  -13.847 1.00 1.00 ? 64  ARG A CG   6  
ATOM 10701 C CD   . ARG A 1 64  ? 5.111   23.531  -13.369 1.00 1.00 ? 64  ARG A CD   6  
ATOM 10702 N NE   . ARG A 1 64  ? 5.973   24.450  -14.136 1.00 1.00 ? 64  ARG A NE   6  
ATOM 10703 C CZ   . ARG A 1 64  ? 5.952   25.777  -14.083 1.00 1.00 ? 64  ARG A CZ   6  
ATOM 10704 N NH1  . ARG A 1 64  ? 5.145   26.433  -13.272 1.00 1.00 ? 64  ARG A NH1  6  
ATOM 10705 N NH2  . ARG A 1 64  ? 6.756   26.472  -14.861 1.00 1.00 ? 64  ARG A NH2  6  
ATOM 10706 H H    . ARG A 1 64  ? 3.355   20.373  -15.347 1.00 1.00 ? 64  ARG A H    6  
ATOM 10707 H HA   . ARG A 1 64  ? 5.471   19.397  -13.592 1.00 1.00 ? 64  ARG A HA   6  
ATOM 10708 H HB2  . ARG A 1 64  ? 3.304   21.485  -13.248 1.00 1.00 ? 64  ARG A HB2  6  
ATOM 10709 H HB3  . ARG A 1 64  ? 4.563   21.161  -12.048 1.00 1.00 ? 64  ARG A HB3  6  
ATOM 10710 H HG2  . ARG A 1 64  ? 6.312   21.767  -13.669 1.00 1.00 ? 64  ARG A HG2  6  
ATOM 10711 H HG3  . ARG A 1 64  ? 5.080   22.051  -14.918 1.00 1.00 ? 64  ARG A HG3  6  
ATOM 10712 H HD2  . ARG A 1 64  ? 4.068   23.822  -13.500 1.00 1.00 ? 64  ARG A HD2  6  
ATOM 10713 H HD3  . ARG A 1 64  ? 5.366   23.586  -12.310 1.00 1.00 ? 64  ARG A HD3  6  
ATOM 10714 H HE   . ARG A 1 64  ? 6.636   24.026  -14.775 1.00 1.00 ? 64  ARG A HE   6  
ATOM 10715 H HH11 . ARG A 1 64  ? 4.519   25.929  -12.665 1.00 1.00 ? 64  ARG A HH11 6  
ATOM 10716 H HH12 . ARG A 1 64  ? 5.140   27.441  -13.249 1.00 1.00 ? 64  ARG A HH12 6  
ATOM 10717 H HH21 . ARG A 1 64  ? 7.380   26.001  -15.499 1.00 1.00 ? 64  ARG A HH21 6  
ATOM 10718 H HH22 . ARG A 1 64  ? 6.759   27.479  -14.832 1.00 1.00 ? 64  ARG A HH22 6  
ATOM 10719 N N    . LEU A 1 65  ? 4.260   18.122  -11.742 1.00 1.00 ? 65  LEU A N    6  
ATOM 10720 C CA   . LEU A 1 65  ? 3.639   17.193  -10.777 1.00 1.00 ? 65  LEU A CA   6  
ATOM 10721 C C    . LEU A 1 65  ? 2.371   17.808  -10.165 1.00 1.00 ? 65  LEU A C    6  
ATOM 10722 O O    . LEU A 1 65  ? 1.290   17.241  -10.339 1.00 1.00 ? 65  LEU A O    6  
ATOM 10723 C CB   . LEU A 1 65  ? 4.714   16.788  -9.736  1.00 1.00 ? 65  LEU A CB   6  
ATOM 10724 C CG   . LEU A 1 65  ? 4.408   15.542  -8.876  1.00 1.00 ? 65  LEU A CG   6  
ATOM 10725 C CD1  . LEU A 1 65  ? 5.641   15.210  -8.022  1.00 1.00 ? 65  LEU A CD1  6  
ATOM 10726 C CD2  . LEU A 1 65  ? 3.207   15.705  -7.937  1.00 1.00 ? 65  LEU A CD2  6  
ATOM 10727 H H    . LEU A 1 65  ? 5.262   18.284  -11.674 1.00 1.00 ? 65  LEU A H    6  
ATOM 10728 H HA   . LEU A 1 65  ? 3.317   16.294  -11.309 1.00 1.00 ? 65  LEU A HA   6  
ATOM 10729 H HB2  . LEU A 1 65  ? 5.639   16.575  -10.278 1.00 1.00 ? 65  LEU A HB2  6  
ATOM 10730 H HB3  . LEU A 1 65  ? 4.926   17.633  -9.077  1.00 1.00 ? 65  LEU A HB3  6  
ATOM 10731 H HG   . LEU A 1 65  ? 4.213   14.699  -9.538  1.00 1.00 ? 65  LEU A HG   6  
ATOM 10732 H HD11 . LEU A 1 65  ? 5.442   14.332  -7.407  1.00 1.00 ? 65  LEU A HD11 6  
ATOM 10733 H HD12 . LEU A 1 65  ? 6.494   14.996  -8.665  1.00 1.00 ? 65  LEU A HD12 6  
ATOM 10734 H HD13 . LEU A 1 65  ? 5.882   16.048  -7.368  1.00 1.00 ? 65  LEU A HD13 6  
ATOM 10735 H HD21 . LEU A 1 65  ? 2.292   15.795  -8.509  1.00 1.00 ? 65  LEU A HD21 6  
ATOM 10736 H HD22 . LEU A 1 65  ? 3.110   14.820  -7.312  1.00 1.00 ? 65  LEU A HD22 6  
ATOM 10737 H HD23 . LEU A 1 65  ? 3.334   16.583  -7.302  1.00 1.00 ? 65  LEU A HD23 6  
ATOM 10738 N N    . GLU A 1 66  ? 2.490   18.988  -9.541  1.00 1.00 ? 66  GLU A N    6  
ATOM 10739 C CA   . GLU A 1 66  ? 1.374   19.713  -8.904  1.00 1.00 ? 66  GLU A CA   6  
ATOM 10740 C C    . GLU A 1 66  ? 0.195   19.878  -9.870  1.00 1.00 ? 66  GLU A C    6  
ATOM 10741 O O    . GLU A 1 66  ? -0.941  19.550  -9.535  1.00 1.00 ? 66  GLU A O    6  
ATOM 10742 C CB   . GLU A 1 66  ? 1.787   21.117  -8.418  1.00 1.00 ? 66  GLU A CB   6  
ATOM 10743 C CG   . GLU A 1 66  ? 3.145   21.156  -7.728  1.00 1.00 ? 66  GLU A CG   6  
ATOM 10744 C CD   . GLU A 1 66  ? 3.379   22.508  -7.037  1.00 1.00 ? 66  GLU A CD   6  
ATOM 10745 O OE1  . GLU A 1 66  ? 2.985   22.668  -5.856  1.00 1.00 ? 66  GLU A OE1  6  
ATOM 10746 O OE2  . GLU A 1 66  ? 3.968   23.419  -7.666  1.00 1.00 ? 66  GLU A OE2  6  
ATOM 10747 H H    . GLU A 1 66  ? 3.415   19.382  -9.457  1.00 1.00 ? 66  GLU A H    6  
ATOM 10748 H HA   . GLU A 1 66  ? 1.040   19.143  -8.038  1.00 1.00 ? 66  GLU A HA   6  
ATOM 10749 H HB2  . GLU A 1 66  ? 1.826   21.809  -9.260  1.00 1.00 ? 66  GLU A HB2  6  
ATOM 10750 H HB3  . GLU A 1 66  ? 1.023   21.474  -7.725  1.00 1.00 ? 66  GLU A HB3  6  
ATOM 10751 H HG2  . GLU A 1 66  ? 3.196   20.347  -7.000  1.00 1.00 ? 66  GLU A HG2  6  
ATOM 10752 H HG3  . GLU A 1 66  ? 3.900   20.997  -8.498  1.00 1.00 ? 66  GLU A HG3  6  
ATOM 10753 N N    . ASP A 1 67  ? 0.483   20.348  -11.088 1.00 1.00 ? 67  ASP A N    6  
ATOM 10754 C CA   . ASP A 1 67  ? -0.528  20.588  -12.116 1.00 1.00 ? 67  ASP A CA   6  
ATOM 10755 C C    . ASP A 1 67  ? -1.181  19.287  -12.623 1.00 1.00 ? 67  ASP A C    6  
ATOM 10756 O O    . ASP A 1 67  ? -2.379  19.283  -12.911 1.00 1.00 ? 67  ASP A O    6  
ATOM 10757 C CB   . ASP A 1 67  ? 0.082   21.381  -13.281 1.00 1.00 ? 67  ASP A CB   6  
ATOM 10758 C CG   . ASP A 1 67  ? 0.369   22.842  -12.892 1.00 1.00 ? 67  ASP A CG   6  
ATOM 10759 O OD1  . ASP A 1 67  ? 1.461   23.122  -12.341 1.00 1.00 ? 67  ASP A OD1  6  
ATOM 10760 O OD2  . ASP A 1 67  ? -0.507  23.709  -13.139 1.00 1.00 ? 67  ASP A OD2  6  
ATOM 10761 H H    . ASP A 1 67  ? 1.428   20.654  -11.266 1.00 1.00 ? 67  ASP A H    6  
ATOM 10762 H HA   . ASP A 1 67  ? -1.300  21.206  -11.659 1.00 1.00 ? 67  ASP A HA   6  
ATOM 10763 H HB2  . ASP A 1 67  ? 0.994   20.889  -13.621 1.00 1.00 ? 67  ASP A HB2  6  
ATOM 10764 H HB3  . ASP A 1 67  ? -0.626  21.369  -14.113 1.00 1.00 ? 67  ASP A HB3  6  
ATOM 10765 N N    . VAL A 1 68  ? -0.426  18.181  -12.689 1.00 1.00 ? 68  VAL A N    6  
ATOM 10766 C CA   . VAL A 1 68  ? -0.952  16.848  -13.011 1.00 1.00 ? 68  VAL A CA   6  
ATOM 10767 C C    . VAL A 1 68  ? -1.850  16.300  -11.893 1.00 1.00 ? 68  VAL A C    6  
ATOM 10768 O O    . VAL A 1 68  ? -2.916  15.764  -12.202 1.00 1.00 ? 68  VAL A O    6  
ATOM 10769 C CB   . VAL A 1 68  ? 0.165   15.834  -13.372 1.00 1.00 ? 68  VAL A CB   6  
ATOM 10770 C CG1  . VAL A 1 68  ? -0.320  14.375  -13.454 1.00 1.00 ? 68  VAL A CG1  6  
ATOM 10771 C CG2  . VAL A 1 68  ? 0.770   16.200  -14.734 1.00 1.00 ? 68  VAL A CG2  6  
ATOM 10772 H H    . VAL A 1 68  ? 0.569   18.291  -12.511 1.00 1.00 ? 68  VAL A H    6  
ATOM 10773 H HA   . VAL A 1 68  ? -1.568  16.976  -13.895 1.00 1.00 ? 68  VAL A HA   6  
ATOM 10774 H HB   . VAL A 1 68  ? 0.946   15.880  -12.613 1.00 1.00 ? 68  VAL A HB   6  
ATOM 10775 H HG11 . VAL A 1 68  ? -1.131  14.287  -14.176 1.00 1.00 ? 68  VAL A HG11 6  
ATOM 10776 H HG12 . VAL A 1 68  ? 0.503   13.725  -13.764 1.00 1.00 ? 68  VAL A HG12 6  
ATOM 10777 H HG13 . VAL A 1 68  ? -0.661  14.030  -12.478 1.00 1.00 ? 68  VAL A HG13 6  
ATOM 10778 H HG21 . VAL A 1 68  ? 1.361   17.105  -14.639 1.00 1.00 ? 68  VAL A HG21 6  
ATOM 10779 H HG22 . VAL A 1 68  ? 1.416   15.402  -15.091 1.00 1.00 ? 68  VAL A HG22 6  
ATOM 10780 H HG23 . VAL A 1 68  ? -0.016  16.356  -15.473 1.00 1.00 ? 68  VAL A HG23 6  
ATOM 10781 N N    . VAL A 1 69  ? -1.450  16.396  -10.619 1.00 1.00 ? 69  VAL A N    6  
ATOM 10782 C CA   . VAL A 1 69  ? -2.206  15.806  -9.512  1.00 1.00 ? 69  VAL A CA   6  
ATOM 10783 C C    . VAL A 1 69  ? -3.386  16.664  -9.041  1.00 1.00 ? 69  VAL A C    6  
ATOM 10784 O O    . VAL A 1 69  ? -4.401  16.107  -8.636  1.00 1.00 ? 69  VAL A O    6  
ATOM 10785 C CB   . VAL A 1 69  ? -1.296  15.428  -8.326  1.00 1.00 ? 69  VAL A CB   6  
ATOM 10786 C CG1  . VAL A 1 69  ? -0.239  14.405  -8.769  1.00 1.00 ? 69  VAL A CG1  6  
ATOM 10787 C CG2  . VAL A 1 69  ? -0.647  16.609  -7.590  1.00 1.00 ? 69  VAL A CG2  6  
ATOM 10788 H H    . VAL A 1 69  ? -0.542  16.797  -10.395 1.00 1.00 ? 69  VAL A H    6  
ATOM 10789 H HA   . VAL A 1 69  ? -2.614  14.868  -9.882  1.00 1.00 ? 69  VAL A HA   6  
ATOM 10790 H HB   . VAL A 1 69  ? -1.930  14.927  -7.616  1.00 1.00 ? 69  VAL A HB   6  
ATOM 10791 H HG11 . VAL A 1 69  ? -0.743  13.553  -9.216  1.00 1.00 ? 69  VAL A HG11 6  
ATOM 10792 H HG12 . VAL A 1 69  ? 0.441   14.837  -9.508  1.00 1.00 ? 69  VAL A HG12 6  
ATOM 10793 H HG13 . VAL A 1 69  ? 0.338   14.066  -7.910  1.00 1.00 ? 69  VAL A HG13 6  
ATOM 10794 H HG21 . VAL A 1 69  ? -0.052  17.200  -8.276  1.00 1.00 ? 69  VAL A HG21 6  
ATOM 10795 H HG22 . VAL A 1 69  ? -1.414  17.239  -7.146  1.00 1.00 ? 69  VAL A HG22 6  
ATOM 10796 H HG23 . VAL A 1 69  ? -0.003  16.241  -6.792  1.00 1.00 ? 69  VAL A HG23 6  
ATOM 10797 N N    . GLY A 1 70  ? -3.296  17.998  -9.098  1.00 1.00 ? 70  GLY A N    6  
ATOM 10798 C CA   . GLY A 1 70  ? -4.340  18.898  -8.590  1.00 1.00 ? 70  GLY A CA   6  
ATOM 10799 C C    . GLY A 1 70  ? -4.548  18.713  -7.081  1.00 1.00 ? 70  GLY A C    6  
ATOM 10800 O O    . GLY A 1 70  ? -3.600  18.806  -6.302  1.00 1.00 ? 70  GLY A O    6  
ATOM 10801 H H    . GLY A 1 70  ? -2.434  18.424  -9.432  1.00 1.00 ? 70  GLY A H    6  
ATOM 10802 H HA2  . GLY A 1 70  ? -4.061  19.936  -8.784  1.00 1.00 ? 70  GLY A HA2  6  
ATOM 10803 H HA3  . GLY A 1 70  ? -5.278  18.688  -9.106  1.00 1.00 ? 70  GLY A HA3  6  
ATOM 10804 N N    . GLY A 1 71  ? -5.787  18.411  -6.680  1.00 1.00 ? 71  GLY A N    6  
ATOM 10805 C CA   . GLY A 1 71  ? -6.161  18.076  -5.294  1.00 1.00 ? 71  GLY A CA   6  
ATOM 10806 C C    . GLY A 1 71  ? -6.027  16.588  -4.934  1.00 1.00 ? 71  GLY A C    6  
ATOM 10807 O O    . GLY A 1 71  ? -6.370  16.203  -3.816  1.00 1.00 ? 71  GLY A O    6  
ATOM 10808 H H    . GLY A 1 71  ? -6.521  18.392  -7.376  1.00 1.00 ? 71  GLY A H    6  
ATOM 10809 H HA2  . GLY A 1 71  ? -5.539  18.640  -4.594  1.00 1.00 ? 71  GLY A HA2  6  
ATOM 10810 H HA3  . GLY A 1 71  ? -7.206  18.348  -5.139  1.00 1.00 ? 71  GLY A HA3  6  
ATOM 10811 N N    . CYS A 1 72  ? -5.556  15.742  -5.859  1.00 1.00 ? 72  CYS A N    6  
ATOM 10812 C CA   . CYS A 1 72  ? -5.442  14.289  -5.676  1.00 1.00 ? 72  CYS A CA   6  
ATOM 10813 C C    . CYS A 1 72  ? -4.209  13.914  -4.822  1.00 1.00 ? 72  CYS A C    6  
ATOM 10814 O O    . CYS A 1 72  ? -3.167  14.574  -4.896  1.00 1.00 ? 72  CYS A O    6  
ATOM 10815 C CB   . CYS A 1 72  ? -5.402  13.608  -7.058  1.00 1.00 ? 72  CYS A CB   6  
ATOM 10816 S SG   . CYS A 1 72  ? -6.844  14.112  -8.048  1.00 1.00 ? 72  CYS A SG   6  
ATOM 10817 H H    . CYS A 1 72  ? -5.231  16.129  -6.735  1.00 1.00 ? 72  CYS A H    6  
ATOM 10818 H HA   . CYS A 1 72  ? -6.336  13.931  -5.158  1.00 1.00 ? 72  CYS A HA   6  
ATOM 10819 H HB2  . CYS A 1 72  ? -4.477  13.867  -7.575  1.00 1.00 ? 72  CYS A HB2  6  
ATOM 10820 H HB3  . CYS A 1 72  ? -5.415  12.526  -6.926  1.00 1.00 ? 72  CYS A HB3  6  
ATOM 10821 H HG   . CYS A 1 72  ? -6.484  15.391  -8.258  1.00 1.00 ? 72  CYS A HG   6  
ATOM 10822 N N    . CYS A 1 73  ? -4.311  12.833  -4.040  1.00 1.00 ? 73  CYS A N    6  
ATOM 10823 C CA   . CYS A 1 73  ? -3.197  12.294  -3.243  1.00 1.00 ? 73  CYS A CA   6  
ATOM 10824 C C    . CYS A 1 73  ? -2.186  11.551  -4.140  1.00 1.00 ? 73  CYS A C    6  
ATOM 10825 O O    . CYS A 1 73  ? -2.553  11.076  -5.215  1.00 1.00 ? 73  CYS A O    6  
ATOM 10826 C CB   . CYS A 1 73  ? -3.792  11.409  -2.133  1.00 1.00 ? 73  CYS A CB   6  
ATOM 10827 S SG   . CYS A 1 73  ? -2.513  10.964  -0.920  1.00 1.00 ? 73  CYS A SG   6  
ATOM 10828 H H    . CYS A 1 73  ? -5.173  12.305  -4.072  1.00 1.00 ? 73  CYS A H    6  
ATOM 10829 H HA   . CYS A 1 73  ? -2.669  13.127  -2.773  1.00 1.00 ? 73  CYS A HA   6  
ATOM 10830 H HB2  . CYS A 1 73  ? -4.582  11.956  -1.612  1.00 1.00 ? 73  CYS A HB2  6  
ATOM 10831 H HB3  . CYS A 1 73  ? -4.220  10.503  -2.565  1.00 1.00 ? 73  CYS A HB3  6  
ATOM 10832 H HG   . CYS A 1 73  ? -3.303  10.266  -0.083  1.00 1.00 ? 73  CYS A HG   6  
ATOM 10833 N N    . TYR A 1 74  ? -0.932  11.410  -3.707  1.00 1.00 ? 74  TYR A N    6  
ATOM 10834 C CA   . TYR A 1 74  ? 0.130   10.727  -4.465  1.00 1.00 ? 74  TYR A CA   6  
ATOM 10835 C C    . TYR A 1 74  ? 1.317   10.265  -3.595  1.00 1.00 ? 74  TYR A C    6  
ATOM 10836 O O    . TYR A 1 74  ? 1.519   10.770  -2.488  1.00 1.00 ? 74  TYR A O    6  
ATOM 10837 C CB   . TYR A 1 74  ? 0.614   11.621  -5.623  1.00 1.00 ? 74  TYR A CB   6  
ATOM 10838 C CG   . TYR A 1 74  ? 1.428   12.834  -5.207  1.00 1.00 ? 74  TYR A CG   6  
ATOM 10839 C CD1  . TYR A 1 74  ? 0.779   14.043  -4.886  1.00 1.00 ? 74  TYR A CD1  6  
ATOM 10840 C CD2  . TYR A 1 74  ? 2.835   12.757  -5.138  1.00 1.00 ? 74  TYR A CD2  6  
ATOM 10841 C CE1  . TYR A 1 74  ? 1.530   15.169  -4.493  1.00 1.00 ? 74  TYR A CE1  6  
ATOM 10842 C CE2  . TYR A 1 74  ? 3.591   13.877  -4.740  1.00 1.00 ? 74  TYR A CE2  6  
ATOM 10843 C CZ   . TYR A 1 74  ? 2.940   15.089  -4.415  1.00 1.00 ? 74  TYR A CZ   6  
ATOM 10844 O OH   . TYR A 1 74  ? 3.675   16.171  -4.032  1.00 1.00 ? 74  TYR A OH   6  
ATOM 10845 H H    . TYR A 1 74  ? -0.696  11.775  -2.793  1.00 1.00 ? 74  TYR A H    6  
ATOM 10846 H HA   . TYR A 1 74  ? -0.310  9.830   -4.898  1.00 1.00 ? 74  TYR A HA   6  
ATOM 10847 H HB2  . TYR A 1 74  ? 1.221   11.013  -6.297  1.00 1.00 ? 74  TYR A HB2  6  
ATOM 10848 H HB3  . TYR A 1 74  ? -0.249  11.966  -6.191  1.00 1.00 ? 74  TYR A HB3  6  
ATOM 10849 H HD1  . TYR A 1 74  ? -0.298  14.110  -4.939  1.00 1.00 ? 74  TYR A HD1  6  
ATOM 10850 H HD2  . TYR A 1 74  ? 3.339   11.834  -5.388  1.00 1.00 ? 74  TYR A HD2  6  
ATOM 10851 H HE1  . TYR A 1 74  ? 1.024   16.094  -4.248  1.00 1.00 ? 74  TYR A HE1  6  
ATOM 10852 H HE2  . TYR A 1 74  ? 4.670   13.815  -4.685  1.00 1.00 ? 74  TYR A HE2  6  
ATOM 10853 H HH   . TYR A 1 74  ? 3.137   16.947  -3.817  1.00 1.00 ? 74  TYR A HH   6  
ATOM 10854 N N    . ARG A 1 75  ? 2.122   9.328   -4.124  1.00 1.00 ? 75  ARG A N    6  
ATOM 10855 C CA   . ARG A 1 75  ? 3.351   8.797   -3.502  1.00 1.00 ? 75  ARG A CA   6  
ATOM 10856 C C    . ARG A 1 75  ? 4.264   8.112   -4.532  1.00 1.00 ? 75  ARG A C    6  
ATOM 10857 O O    . ARG A 1 75  ? 3.801   7.713   -5.597  1.00 1.00 ? 75  ARG A O    6  
ATOM 10858 C CB   . ARG A 1 75  ? 3.009   7.867   -2.315  1.00 1.00 ? 75  ARG A CB   6  
ATOM 10859 C CG   . ARG A 1 75  ? 2.234   6.599   -2.717  1.00 1.00 ? 75  ARG A CG   6  
ATOM 10860 C CD   . ARG A 1 75  ? 1.769   5.787   -1.500  1.00 1.00 ? 75  ARG A CD   6  
ATOM 10861 N NE   . ARG A 1 75  ? 2.902   5.236   -0.730  1.00 1.00 ? 75  ARG A NE   6  
ATOM 10862 C CZ   . ARG A 1 75  ? 3.527   4.083   -0.948  1.00 1.00 ? 75  ARG A CZ   6  
ATOM 10863 N NH1  . ARG A 1 75  ? 3.226   3.295   -1.958  1.00 1.00 ? 75  ARG A NH1  6  
ATOM 10864 N NH2  . ARG A 1 75  ? 4.484   3.702   -0.129  1.00 1.00 ? 75  ARG A NH2  6  
ATOM 10865 H H    . ARG A 1 75  ? 1.849   8.939   -5.026  1.00 1.00 ? 75  ARG A H    6  
ATOM 10866 H HA   . ARG A 1 75  ? 3.907   9.646   -3.098  1.00 1.00 ? 75  ARG A HA   6  
ATOM 10867 H HB2  . ARG A 1 75  ? 3.930   7.568   -1.816  1.00 1.00 ? 75  ARG A HB2  6  
ATOM 10868 H HB3  . ARG A 1 75  ? 2.418   8.424   -1.588  1.00 1.00 ? 75  ARG A HB3  6  
ATOM 10869 H HG2  . ARG A 1 75  ? 1.350   6.888   -3.285  1.00 1.00 ? 75  ARG A HG2  6  
ATOM 10870 H HG3  . ARG A 1 75  ? 2.865   5.970   -3.345  1.00 1.00 ? 75  ARG A HG3  6  
ATOM 10871 H HD2  . ARG A 1 75  ? 1.171   6.430   -0.853  1.00 1.00 ? 75  ARG A HD2  6  
ATOM 10872 H HD3  . ARG A 1 75  ? 1.117   4.978   -1.832  1.00 1.00 ? 75  ARG A HD3  6  
ATOM 10873 H HE   . ARG A 1 75  ? 3.182   5.765   0.085   1.00 1.00 ? 75  ARG A HE   6  
ATOM 10874 H HH11 . ARG A 1 75  ? 2.483   3.548   -2.617  1.00 1.00 ? 75  ARG A HH11 6  
ATOM 10875 H HH12 . ARG A 1 75  ? 3.690   2.409   -2.075  1.00 1.00 ? 75  ARG A HH12 6  
ATOM 10876 H HH21 . ARG A 1 75  ? 4.721   4.255   0.682   1.00 1.00 ? 75  ARG A HH21 6  
ATOM 10877 H HH22 . ARG A 1 75  ? 4.961   2.823   -0.269  1.00 1.00 ? 75  ARG A HH22 6  
ATOM 10878 N N    . VAL A 1 76  ? 5.549   7.949   -4.220  1.00 1.00 ? 76  VAL A N    6  
ATOM 10879 C CA   . VAL A 1 76  ? 6.500   7.159   -5.028  1.00 1.00 ? 76  VAL A CA   6  
ATOM 10880 C C    . VAL A 1 76  ? 6.308   5.667   -4.724  1.00 1.00 ? 76  VAL A C    6  
ATOM 10881 O O    . VAL A 1 76  ? 6.128   5.288   -3.566  1.00 1.00 ? 76  VAL A O    6  
ATOM 10882 C CB   . VAL A 1 76  ? 7.970   7.590   -4.779  1.00 1.00 ? 76  VAL A CB   6  
ATOM 10883 C CG1  . VAL A 1 76  ? 8.995   6.712   -5.524  1.00 1.00 ? 76  VAL A CG1  6  
ATOM 10884 C CG2  . VAL A 1 76  ? 8.194   9.049   -5.214  1.00 1.00 ? 76  VAL A CG2  6  
ATOM 10885 H H    . VAL A 1 76  ? 5.847   8.240   -3.284  1.00 1.00 ? 76  VAL A H    6  
ATOM 10886 H HA   . VAL A 1 76  ? 6.280   7.340   -6.079  1.00 1.00 ? 76  VAL A HA   6  
ATOM 10887 H HB   . VAL A 1 76  ? 8.178   7.515   -3.711  1.00 1.00 ? 76  VAL A HB   6  
ATOM 10888 H HG11 . VAL A 1 76  ? 8.972   5.692   -5.142  1.00 1.00 ? 76  VAL A HG11 6  
ATOM 10889 H HG12 . VAL A 1 76  ? 8.783   6.700   -6.592  1.00 1.00 ? 76  VAL A HG12 6  
ATOM 10890 H HG13 . VAL A 1 76  ? 10.003  7.098   -5.371  1.00 1.00 ? 76  VAL A HG13 6  
ATOM 10891 H HG21 . VAL A 1 76  ? 8.059   9.140   -6.293  1.00 1.00 ? 76  VAL A HG21 6  
ATOM 10892 H HG22 . VAL A 1 76  ? 7.502   9.717   -4.701  1.00 1.00 ? 76  VAL A HG22 6  
ATOM 10893 H HG23 . VAL A 1 76  ? 9.210   9.355   -4.963  1.00 1.00 ? 76  VAL A HG23 6  
ATOM 10894 N N    . ASN A 1 77  ? 6.367   4.825   -5.762  1.00 1.00 ? 77  ASN A N    6  
ATOM 10895 C CA   . ASN A 1 77  ? 6.259   3.367   -5.654  1.00 1.00 ? 77  ASN A CA   6  
ATOM 10896 C C    . ASN A 1 77  ? 7.074   2.659   -6.756  1.00 1.00 ? 77  ASN A C    6  
ATOM 10897 O O    . ASN A 1 77  ? 6.534   2.192   -7.758  1.00 1.00 ? 77  ASN A O    6  
ATOM 10898 C CB   . ASN A 1 77  ? 4.770   2.954   -5.638  1.00 1.00 ? 77  ASN A CB   6  
ATOM 10899 C CG   . ASN A 1 77  ? 4.567   1.461   -5.370  1.00 1.00 ? 77  ASN A CG   6  
ATOM 10900 O OD1  . ASN A 1 77  ? 5.496   0.704   -5.109  1.00 1.00 ? 77  ASN A OD1  6  
ATOM 10901 N ND2  . ASN A 1 77  ? 3.334   0.992   -5.412  1.00 1.00 ? 77  ASN A ND2  6  
ATOM 10902 H H    . ASN A 1 77  ? 6.505   5.228   -6.687  1.00 1.00 ? 77  ASN A H    6  
ATOM 10903 H HA   . ASN A 1 77  ? 6.687   3.068   -4.697  1.00 1.00 ? 77  ASN A HA   6  
ATOM 10904 H HB2  . ASN A 1 77  ? 4.253   3.510   -4.856  1.00 1.00 ? 77  ASN A HB2  6  
ATOM 10905 H HB3  . ASN A 1 77  ? 4.309   3.215   -6.592  1.00 1.00 ? 77  ASN A HB3  6  
ATOM 10906 H HD21 . ASN A 1 77  ? 2.554   1.622   -5.608  1.00 1.00 ? 77  ASN A HD21 6  
ATOM 10907 H HD22 . ASN A 1 77  ? 3.172   0.013   -5.235  1.00 1.00 ? 77  ASN A HD22 6  
ATOM 10908 N N    . ASN A 1 78  ? 8.395   2.570   -6.557  1.00 1.00 ? 78  ASN A N    6  
ATOM 10909 C CA   . ASN A 1 78  ? 9.328   1.867   -7.450  1.00 1.00 ? 78  ASN A CA   6  
ATOM 10910 C C    . ASN A 1 78  ? 9.262   0.340   -7.224  1.00 1.00 ? 78  ASN A C    6  
ATOM 10911 O O    . ASN A 1 78  ? 10.165  -0.265  -6.650  1.00 1.00 ? 78  ASN A O    6  
ATOM 10912 C CB   . ASN A 1 78  ? 10.753  2.428   -7.261  1.00 1.00 ? 78  ASN A CB   6  
ATOM 10913 C CG   . ASN A 1 78  ? 10.927  3.879   -7.705  1.00 1.00 ? 78  ASN A CG   6  
ATOM 10914 O OD1  . ASN A 1 78  ? 10.104  4.454   -8.405  1.00 1.00 ? 78  ASN A OD1  6  
ATOM 10915 N ND2  . ASN A 1 78  ? 12.022  4.504   -7.317  1.00 1.00 ? 78  ASN A ND2  6  
ATOM 10916 H H    . ASN A 1 78  ? 8.775   2.978   -5.714  1.00 1.00 ? 78  ASN A H    6  
ATOM 10917 H HA   . ASN A 1 78  ? 9.032   2.042   -8.485  1.00 1.00 ? 78  ASN A HA   6  
ATOM 10918 H HB2  . ASN A 1 78  ? 11.035  2.340   -6.210  1.00 1.00 ? 78  ASN A HB2  6  
ATOM 10919 H HB3  . ASN A 1 78  ? 11.451  1.826   -7.846  1.00 1.00 ? 78  ASN A HB3  6  
ATOM 10920 H HD21 . ASN A 1 78  ? 12.711  4.035   -6.747  1.00 1.00 ? 78  ASN A HD21 6  
ATOM 10921 H HD22 . ASN A 1 78  ? 12.182  5.457   -7.636  1.00 1.00 ? 78  ASN A HD22 6  
ATOM 10922 N N    . SER A 1 79  ? 8.171   -0.289  -7.666  1.00 1.00 ? 79  SER A N    6  
ATOM 10923 C CA   . SER A 1 79  ? 7.856   -1.698  -7.400  1.00 1.00 ? 79  SER A CA   6  
ATOM 10924 C C    . SER A 1 79  ? 8.824   -2.668  -8.101  1.00 1.00 ? 79  SER A C    6  
ATOM 10925 O O    . SER A 1 79  ? 9.342   -3.598  -7.477  1.00 1.00 ? 79  SER A O    6  
ATOM 10926 C CB   . SER A 1 79  ? 6.410   -1.976  -7.836  1.00 1.00 ? 79  SER A CB   6  
ATOM 10927 O OG   . SER A 1 79  ? 6.188   -1.537  -9.174  1.00 1.00 ? 79  SER A OG   6  
ATOM 10928 H H    . SER A 1 79  ? 7.455   0.253   -8.142  1.00 1.00 ? 79  SER A H    6  
ATOM 10929 H HA   . SER A 1 79  ? 7.922   -1.878  -6.328  1.00 1.00 ? 79  SER A HA   6  
ATOM 10930 H HB2  . SER A 1 79  ? 6.207   -3.045  -7.762  1.00 1.00 ? 79  SER A HB2  6  
ATOM 10931 H HB3  . SER A 1 79  ? 5.729   -1.443  -7.170  1.00 1.00 ? 79  SER A HB3  6  
ATOM 10932 H HG   . SER A 1 79  ? 5.255   -1.708  -9.423  1.00 1.00 ? 79  SER A HG   6  
ATOM 10933 N N    . LEU A 1 80  ? 9.109   -2.433  -9.391  1.00 1.00 ? 80  LEU A N    6  
ATOM 10934 C CA   . LEU A 1 80  ? 9.913   -3.337  -10.221 1.00 1.00 ? 80  LEU A CA   6  
ATOM 10935 C C    . LEU A 1 80  ? 11.417  -3.275  -9.933  1.00 1.00 ? 80  LEU A C    6  
ATOM 10936 O O    . LEU A 1 80  ? 12.160  -4.131  -10.404 1.00 1.00 ? 80  LEU A O    6  
ATOM 10937 C CB   . LEU A 1 80  ? 9.622   -3.107  -11.717 1.00 1.00 ? 80  LEU A CB   6  
ATOM 10938 C CG   . LEU A 1 80  ? 8.139   -3.131  -12.135 1.00 1.00 ? 80  LEU A CG   6  
ATOM 10939 C CD1  . LEU A 1 80  ? 8.055   -3.080  -13.668 1.00 1.00 ? 80  LEU A CD1  6  
ATOM 10940 C CD2  . LEU A 1 80  ? 7.400   -4.378  -11.622 1.00 1.00 ? 80  LEU A CD2  6  
ATOM 10941 H H    . LEU A 1 80  ? 8.616   -1.678  -9.845  1.00 1.00 ? 80  LEU A H    6  
ATOM 10942 H HA   . LEU A 1 80  ? 9.611   -4.351  -9.976  1.00 1.00 ? 80  LEU A HA   6  
ATOM 10943 H HB2  . LEU A 1 80  ? 10.058  -2.153  -12.023 1.00 1.00 ? 80  LEU A HB2  6  
ATOM 10944 H HB3  . LEU A 1 80  ? 10.136  -3.902  -12.258 1.00 1.00 ? 80  LEU A HB3  6  
ATOM 10945 H HG   . LEU A 1 80  ? 7.644   -2.243  -11.735 1.00 1.00 ? 80  LEU A HG   6  
ATOM 10946 H HD11 . LEU A 1 80  ? 8.608   -3.910  -14.103 1.00 1.00 ? 80  LEU A HD11 6  
ATOM 10947 H HD12 . LEU A 1 80  ? 7.014   -3.160  -13.980 1.00 1.00 ? 80  LEU A HD12 6  
ATOM 10948 H HD13 . LEU A 1 80  ? 8.472   -2.139  -14.036 1.00 1.00 ? 80  LEU A HD13 6  
ATOM 10949 H HD21 . LEU A 1 80  ? 7.349   -4.357  -10.535 1.00 1.00 ? 80  LEU A HD21 6  
ATOM 10950 H HD22 . LEU A 1 80  ? 6.382   -4.390  -12.010 1.00 1.00 ? 80  LEU A HD22 6  
ATOM 10951 H HD23 . LEU A 1 80  ? 7.916   -5.282  -11.946 1.00 1.00 ? 80  LEU A HD23 6  
ATOM 10952 N N    . ASP A 1 81  ? 11.877  -2.325  -9.115  1.00 1.00 ? 81  ASP A N    6  
ATOM 10953 C CA   . ASP A 1 81  ? 13.270  -2.257  -8.647  1.00 1.00 ? 81  ASP A CA   6  
ATOM 10954 C C    . ASP A 1 81  ? 13.697  -3.494  -7.840  1.00 1.00 ? 81  ASP A C    6  
ATOM 10955 O O    . ASP A 1 81  ? 14.867  -3.869  -7.794  1.00 1.00 ? 81  ASP A O    6  
ATOM 10956 C CB   . ASP A 1 81  ? 13.426  -1.029  -7.748  1.00 1.00 ? 81  ASP A CB   6  
ATOM 10957 C CG   . ASP A 1 81  ? 14.902  -0.614  -7.643  1.00 1.00 ? 81  ASP A CG   6  
ATOM 10958 O OD1  . ASP A 1 81  ? 15.485  -0.263  -8.700  1.00 1.00 ? 81  ASP A OD1  6  
ATOM 10959 O OD2  . ASP A 1 81  ? 15.454  -0.618  -6.517  1.00 1.00 ? 81  ASP A OD2  6  
ATOM 10960 H H    . ASP A 1 81  ? 11.215  -1.647  -8.763  1.00 1.00 ? 81  ASP A H    6  
ATOM 10961 H HA   . ASP A 1 81  ? 13.924  -2.171  -9.512  1.00 1.00 ? 81  ASP A HA   6  
ATOM 10962 H HB2  . ASP A 1 81  ? 12.858  -0.195  -8.162  1.00 1.00 ? 81  ASP A HB2  6  
ATOM 10963 H HB3  . ASP A 1 81  ? 13.010  -1.280  -6.760  1.00 1.00 ? 81  ASP A HB3  6  
ATOM 10964 N N    . HIS A 1 82  ? 12.718  -4.131  -7.201  1.00 1.00 ? 82  HIS A N    6  
ATOM 10965 C CA   . HIS A 1 82  ? 12.862  -5.382  -6.467  1.00 1.00 ? 82  HIS A CA   6  
ATOM 10966 C C    . HIS A 1 82  ? 12.881  -6.616  -7.406  1.00 1.00 ? 82  HIS A C    6  
ATOM 10967 O O    . HIS A 1 82  ? 13.293  -7.706  -7.000  1.00 1.00 ? 82  HIS A O    6  
ATOM 10968 C CB   . HIS A 1 82  ? 11.684  -5.388  -5.484  1.00 1.00 ? 82  HIS A CB   6  
ATOM 10969 C CG   . HIS A 1 82  ? 11.625  -6.586  -4.572  1.00 1.00 ? 82  HIS A CG   6  
ATOM 10970 N ND1  . HIS A 1 82  ? 10.985  -7.774  -4.843  1.00 1.00 ? 82  HIS A ND1  6  
ATOM 10971 C CD2  . HIS A 1 82  ? 12.162  -6.695  -3.316  1.00 1.00 ? 82  HIS A CD2  6  
ATOM 10972 C CE1  . HIS A 1 82  ? 11.141  -8.584  -3.783  1.00 1.00 ? 82  HIS A CE1  6  
ATOM 10973 N NE2  . HIS A 1 82  ? 11.852  -7.969  -2.816  1.00 1.00 ? 82  HIS A NE2  6  
ATOM 10974 H H    . HIS A 1 82  ? 11.790  -3.731  -7.270  1.00 1.00 ? 82  HIS A H    6  
ATOM 10975 H HA   . HIS A 1 82  ? 13.799  -5.376  -5.909  1.00 1.00 ? 82  HIS A HA   6  
ATOM 10976 H HB2  . HIS A 1 82  ? 11.743  -4.473  -4.886  1.00 1.00 ? 82  HIS A HB2  6  
ATOM 10977 H HB3  . HIS A 1 82  ? 10.753  -5.346  -6.047  1.00 1.00 ? 82  HIS A HB3  6  
ATOM 10978 H HD1  . HIS A 1 82  ? 10.509  -8.018  -5.716  1.00 1.00 ? 82  HIS A HD1  6  
ATOM 10979 H HD2  . HIS A 1 82  ? 12.725  -5.924  -2.804  1.00 1.00 ? 82  HIS A HD2  6  
ATOM 10980 H HE1  . HIS A 1 82  ? 10.755  -9.594  -3.723  1.00 1.00 ? 82  HIS A HE1  6  
ATOM 10981 N N    . GLU A 1 83  ? 12.459  -6.448  -8.667  1.00 1.00 ? 83  GLU A N    6  
ATOM 10982 C CA   . GLU A 1 83  ? 12.294  -7.512  -9.658  1.00 1.00 ? 83  GLU A CA   6  
ATOM 10983 C C    . GLU A 1 83  ? 13.454  -7.552  -10.668 1.00 1.00 ? 83  GLU A C    6  
ATOM 10984 O O    . GLU A 1 83  ? 13.931  -8.633  -11.021 1.00 1.00 ? 83  GLU A O    6  
ATOM 10985 C CB   . GLU A 1 83  ? 10.953  -7.325  -10.397 1.00 1.00 ? 83  GLU A CB   6  
ATOM 10986 C CG   . GLU A 1 83  ? 9.728   -7.305  -9.466  1.00 1.00 ? 83  GLU A CG   6  
ATOM 10987 C CD   . GLU A 1 83  ? 9.647   -8.543  -8.559  1.00 1.00 ? 83  GLU A CD   6  
ATOM 10988 O OE1  . GLU A 1 83  ? 9.476   -9.671  -9.081  1.00 1.00 ? 83  GLU A OE1  6  
ATOM 10989 O OE2  . GLU A 1 83  ? 9.731   -8.395  -7.315  1.00 1.00 ? 83  GLU A OE2  6  
ATOM 10990 H H    . GLU A 1 83  ? 12.263  -5.504  -8.975  1.00 1.00 ? 83  GLU A H    6  
ATOM 10991 H HA   . GLU A 1 83  ? 12.272  -8.478  -9.157  1.00 1.00 ? 83  GLU A HA   6  
ATOM 10992 H HB2  . GLU A 1 83  ? 10.969  -6.388  -10.958 1.00 1.00 ? 83  GLU A HB2  6  
ATOM 10993 H HB3  . GLU A 1 83  ? 10.836  -8.137  -11.117 1.00 1.00 ? 83  GLU A HB3  6  
ATOM 10994 H HG2  . GLU A 1 83  ? 9.753   -6.400  -8.855  1.00 1.00 ? 83  GLU A HG2  6  
ATOM 10995 H HG3  . GLU A 1 83  ? 8.830   -7.254  -10.083 1.00 1.00 ? 83  GLU A HG3  6  
ATOM 10996 N N    . TYR A 1 84  ? 13.931  -6.380  -11.104 1.00 1.00 ? 84  TYR A N    6  
ATOM 10997 C CA   . TYR A 1 84  ? 15.018  -6.204  -12.083 1.00 1.00 ? 84  TYR A CA   6  
ATOM 10998 C C    . TYR A 1 84  ? 16.146  -5.279  -11.578 1.00 1.00 ? 84  TYR A C    6  
ATOM 10999 O O    . TYR A 1 84  ? 15.954  -4.465  -10.672 1.00 1.00 ? 84  TYR A O    6  
ATOM 11000 C CB   . TYR A 1 84  ? 14.438  -5.671  -13.405 1.00 1.00 ? 84  TYR A CB   6  
ATOM 11001 C CG   . TYR A 1 84  ? 13.199  -6.411  -13.869 1.00 1.00 ? 84  TYR A CG   6  
ATOM 11002 C CD1  . TYR A 1 84  ? 13.298  -7.704  -14.421 1.00 1.00 ? 84  TYR A CD1  6  
ATOM 11003 C CD2  . TYR A 1 84  ? 11.934  -5.831  -13.663 1.00 1.00 ? 84  TYR A CD2  6  
ATOM 11004 C CE1  . TYR A 1 84  ? 12.132  -8.421  -14.748 1.00 1.00 ? 84  TYR A CE1  6  
ATOM 11005 C CE2  . TYR A 1 84  ? 10.765  -6.544  -13.980 1.00 1.00 ? 84  TYR A CE2  6  
ATOM 11006 C CZ   . TYR A 1 84  ? 10.860  -7.843  -14.524 1.00 1.00 ? 84  TYR A CZ   6  
ATOM 11007 O OH   . TYR A 1 84  ? 9.732   -8.549  -14.822 1.00 1.00 ? 84  TYR A OH   6  
ATOM 11008 H H    . TYR A 1 84  ? 13.434  -5.548  -10.808 1.00 1.00 ? 84  TYR A H    6  
ATOM 11009 H HA   . TYR A 1 84  ? 15.466  -7.179  -12.289 1.00 1.00 ? 84  TYR A HA   6  
ATOM 11010 H HB2  . TYR A 1 84  ? 14.191  -4.615  -13.281 1.00 1.00 ? 84  TYR A HB2  6  
ATOM 11011 H HB3  . TYR A 1 84  ? 15.198  -5.738  -14.187 1.00 1.00 ? 84  TYR A HB3  6  
ATOM 11012 H HD1  . TYR A 1 84  ? 14.269  -8.158  -14.565 1.00 1.00 ? 84  TYR A HD1  6  
ATOM 11013 H HD2  . TYR A 1 84  ? 11.871  -4.846  -13.226 1.00 1.00 ? 84  TYR A HD2  6  
ATOM 11014 H HE1  . TYR A 1 84  ? 12.205  -9.418  -15.162 1.00 1.00 ? 84  TYR A HE1  6  
ATOM 11015 H HE2  . TYR A 1 84  ? 9.801   -6.100  -13.784 1.00 1.00 ? 84  TYR A HE2  6  
ATOM 11016 H HH   . TYR A 1 84  ? 8.913   -8.066  -14.627 1.00 1.00 ? 84  TYR A HH   6  
ATOM 11017 N N    . GLN A 1 85  ? 17.328  -5.371  -12.200 1.00 1.00 ? 85  GLN A N    6  
ATOM 11018 C CA   . GLN A 1 85  ? 18.509  -4.557  -11.872 1.00 1.00 ? 85  GLN A CA   6  
ATOM 11019 C C    . GLN A 1 85  ? 18.271  -3.064  -12.196 1.00 1.00 ? 85  GLN A C    6  
ATOM 11020 O O    . GLN A 1 85  ? 17.398  -2.758  -13.016 1.00 1.00 ? 85  GLN A O    6  
ATOM 11021 C CB   . GLN A 1 85  ? 19.725  -5.127  -12.637 1.00 1.00 ? 85  GLN A CB   6  
ATOM 11022 C CG   . GLN A 1 85  ? 20.158  -6.511  -12.115 1.00 1.00 ? 85  GLN A CG   6  
ATOM 11023 C CD   . GLN A 1 85  ? 20.712  -6.496  -10.683 1.00 1.00 ? 85  GLN A CD   6  
ATOM 11024 O OE1  . GLN A 1 85  ? 21.436  -5.601  -10.267 1.00 1.00 ? 85  GLN A OE1  6  
ATOM 11025 N NE2  . GLN A 1 85  ? 20.373  -7.470  -9.859  1.00 1.00 ? 85  GLN A NE2  6  
ATOM 11026 H H    . GLN A 1 85  ? 17.409  -6.030  -12.963 1.00 1.00 ? 85  GLN A H    6  
ATOM 11027 H HA   . GLN A 1 85  ? 18.696  -4.658  -10.803 1.00 1.00 ? 85  GLN A HA   6  
ATOM 11028 H HB2  . GLN A 1 85  ? 19.470  -5.218  -13.696 1.00 1.00 ? 85  GLN A HB2  6  
ATOM 11029 H HB3  . GLN A 1 85  ? 20.572  -4.444  -12.570 1.00 1.00 ? 85  GLN A HB3  6  
ATOM 11030 H HG2  . GLN A 1 85  ? 19.306  -7.190  -12.159 1.00 1.00 ? 85  GLN A HG2  6  
ATOM 11031 H HG3  . GLN A 1 85  ? 20.931  -6.911  -12.769 1.00 1.00 ? 85  GLN A HG3  6  
ATOM 11032 H HE21 . GLN A 1 85  ? 19.779  -8.228  -10.165 1.00 1.00 ? 85  GLN A HE21 6  
ATOM 11033 H HE22 . GLN A 1 85  ? 20.744  -7.456  -8.920  1.00 1.00 ? 85  GLN A HE22 6  
ATOM 11034 N N    . PRO A 1 86  ? 19.026  -2.112  -11.604 1.00 1.00 ? 86  PRO A N    6  
ATOM 11035 C CA   . PRO A 1 86  ? 18.885  -0.687  -11.911 1.00 1.00 ? 86  PRO A CA   6  
ATOM 11036 C C    . PRO A 1 86  ? 19.217  -0.412  -13.380 1.00 1.00 ? 86  PRO A C    6  
ATOM 11037 O O    . PRO A 1 86  ? 20.262  -0.832  -13.880 1.00 1.00 ? 86  PRO A O    6  
ATOM 11038 C CB   . PRO A 1 86  ? 19.812  0.054   -10.940 1.00 1.00 ? 86  PRO A CB   6  
ATOM 11039 C CG   . PRO A 1 86  ? 20.856  -0.995  -10.564 1.00 1.00 ? 86  PRO A CG   6  
ATOM 11040 C CD   . PRO A 1 86  ? 20.062  -2.299  -10.591 1.00 1.00 ? 86  PRO A CD   6  
ATOM 11041 H HA   . PRO A 1 86  ? 17.863  -0.369  -11.715 1.00 1.00 ? 86  PRO A HA   6  
ATOM 11042 H HB2  . PRO A 1 86  ? 20.270  0.937   -11.389 1.00 1.00 ? 86  PRO A HB2  6  
ATOM 11043 H HB3  . PRO A 1 86  ? 19.249  0.334   -10.049 1.00 1.00 ? 86  PRO A HB3  6  
ATOM 11044 H HG2  . PRO A 1 86  ? 21.637  -1.027  -11.325 1.00 1.00 ? 86  PRO A HG2  6  
ATOM 11045 H HG3  . PRO A 1 86  ? 21.284  -0.805  -9.579  1.00 1.00 ? 86  PRO A HG3  6  
ATOM 11046 H HD2  . PRO A 1 86  ? 20.729  -3.125  -10.827 1.00 1.00 ? 86  PRO A HD2  6  
ATOM 11047 H HD3  . PRO A 1 86  ? 19.593  -2.459  -9.617  1.00 1.00 ? 86  PRO A HD3  6  
ATOM 11048 N N    . ARG A 1 87  ? 18.292  0.258   -14.085 1.00 1.00 ? 87  ARG A N    6  
ATOM 11049 C CA   . ARG A 1 87  ? 18.420  0.643   -15.502 1.00 1.00 ? 87  ARG A CA   6  
ATOM 11050 C C    . ARG A 1 87  ? 18.952  2.097   -15.616 1.00 1.00 ? 87  ARG A C    6  
ATOM 11051 O O    . ARG A 1 87  ? 18.774  2.871   -14.669 1.00 1.00 ? 87  ARG A O    6  
ATOM 11052 C CB   . ARG A 1 87  ? 17.046  0.475   -16.198 1.00 1.00 ? 87  ARG A CB   6  
ATOM 11053 C CG   . ARG A 1 87  ? 16.359  -0.905  -16.080 1.00 1.00 ? 87  ARG A CG   6  
ATOM 11054 C CD   . ARG A 1 87  ? 17.099  -2.103  -16.698 1.00 1.00 ? 87  ARG A CD   6  
ATOM 11055 N NE   . ARG A 1 87  ? 18.298  -2.477  -15.925 1.00 1.00 ? 87  ARG A NE   6  
ATOM 11056 C CZ   . ARG A 1 87  ? 19.372  -3.119  -16.377 1.00 1.00 ? 87  ARG A CZ   6  
ATOM 11057 N NH1  . ARG A 1 87  ? 19.382  -3.739  -17.537 1.00 1.00 ? 87  ARG A NH1  6  
ATOM 11058 N NH2  . ARG A 1 87  ? 20.467  -3.138  -15.652 1.00 1.00 ? 87  ARG A NH2  6  
ATOM 11059 H H    . ARG A 1 87  ? 17.473  0.592   -13.588 1.00 1.00 ? 87  ARG A H    6  
ATOM 11060 H HA   . ARG A 1 87  ? 19.135  -0.021  -15.991 1.00 1.00 ? 87  ARG A HA   6  
ATOM 11061 H HB2  . ARG A 1 87  ? 16.359  1.206   -15.771 1.00 1.00 ? 87  ARG A HB2  6  
ATOM 11062 H HB3  . ARG A 1 87  ? 17.140  0.718   -17.258 1.00 1.00 ? 87  ARG A HB3  6  
ATOM 11063 H HG2  . ARG A 1 87  ? 16.156  -1.116  -15.031 1.00 1.00 ? 87  ARG A HG2  6  
ATOM 11064 H HG3  . ARG A 1 87  ? 15.396  -0.823  -16.589 1.00 1.00 ? 87  ARG A HG3  6  
ATOM 11065 H HD2  . ARG A 1 87  ? 16.421  -2.958  -16.717 1.00 1.00 ? 87  ARG A HD2  6  
ATOM 11066 H HD3  . ARG A 1 87  ? 17.374  -1.858  -17.723 1.00 1.00 ? 87  ARG A HD3  6  
ATOM 11067 H HE   . ARG A 1 87  ? 18.280  -2.251  -14.935 1.00 1.00 ? 87  ARG A HE   6  
ATOM 11068 H HH11 . ARG A 1 87  ? 18.537  -3.817  -18.078 1.00 1.00 ? 87  ARG A HH11 6  
ATOM 11069 H HH12 . ARG A 1 87  ? 20.216  -4.213  -17.864 1.00 1.00 ? 87  ARG A HH12 6  
ATOM 11070 H HH21 . ARG A 1 87  ? 20.549  -2.534  -14.841 1.00 1.00 ? 87  ARG A HH21 6  
ATOM 11071 H HH22 . ARG A 1 87  ? 21.294  -3.614  -15.981 1.00 1.00 ? 87  ARG A HH22 6  
ATOM 11072 N N    . PRO A 1 88  ? 19.571  2.504   -16.749 1.00 1.00 ? 88  PRO A N    6  
ATOM 11073 C CA   . PRO A 1 88  ? 20.105  3.858   -16.921 1.00 1.00 ? 88  PRO A CA   6  
ATOM 11074 C C    . PRO A 1 88  ? 18.964  4.879   -17.048 1.00 1.00 ? 88  PRO A C    6  
ATOM 11075 O O    . PRO A 1 88  ? 18.250  4.895   -18.048 1.00 1.00 ? 88  PRO A O    6  
ATOM 11076 C CB   . PRO A 1 88  ? 21.009  3.800   -18.160 1.00 1.00 ? 88  PRO A CB   6  
ATOM 11077 C CG   . PRO A 1 88  ? 20.415  2.654   -18.978 1.00 1.00 ? 88  PRO A CG   6  
ATOM 11078 C CD   . PRO A 1 88  ? 19.893  1.687   -17.921 1.00 1.00 ? 88  PRO A CD   6  
ATOM 11079 H HA   . PRO A 1 88  ? 20.729  4.123   -16.065 1.00 1.00 ? 88  PRO A HA   6  
ATOM 11080 H HB2  . PRO A 1 88  ? 21.018  4.738   -18.716 1.00 1.00 ? 88  PRO A HB2  6  
ATOM 11081 H HB3  . PRO A 1 88  ? 22.023  3.534   -17.857 1.00 1.00 ? 88  PRO A HB3  6  
ATOM 11082 H HG2  . PRO A 1 88  ? 19.572  3.024   -19.557 1.00 1.00 ? 88  PRO A HG2  6  
ATOM 11083 H HG3  . PRO A 1 88  ? 21.155  2.188   -19.629 1.00 1.00 ? 88  PRO A HG3  6  
ATOM 11084 H HD2  . PRO A 1 88  ? 19.016  1.180   -18.323 1.00 1.00 ? 88  PRO A HD2  6  
ATOM 11085 H HD3  . PRO A 1 88  ? 20.673  0.965   -17.667 1.00 1.00 ? 88  PRO A HD3  6  
ATOM 11086 N N    . VAL A 1 89  ? 18.800  5.741   -16.039 1.00 1.00 ? 89  VAL A N    6  
ATOM 11087 C CA   . VAL A 1 89  ? 17.635  6.646   -15.885 1.00 1.00 ? 89  VAL A CA   6  
ATOM 11088 C C    . VAL A 1 89  ? 17.446  7.579   -17.083 1.00 1.00 ? 89  VAL A C    6  
ATOM 11089 O O    . VAL A 1 89  ? 16.307  7.857   -17.453 1.00 1.00 ? 89  VAL A O    6  
ATOM 11090 C CB   . VAL A 1 89  ? 17.735  7.430   -14.551 1.00 1.00 ? 89  VAL A CB   6  
ATOM 11091 C CG1  . VAL A 1 89  ? 16.820  8.664   -14.466 1.00 1.00 ? 89  VAL A CG1  6  
ATOM 11092 C CG2  . VAL A 1 89  ? 17.420  6.497   -13.367 1.00 1.00 ? 89  VAL A CG2  6  
ATOM 11093 H H    . VAL A 1 89  ? 19.442  5.656   -15.251 1.00 1.00 ? 89  VAL A H    6  
ATOM 11094 H HA   . VAL A 1 89  ? 16.743  6.023   -15.837 1.00 1.00 ? 89  VAL A HA   6  
ATOM 11095 H HB   . VAL A 1 89  ? 18.760  7.776   -14.446 1.00 1.00 ? 89  VAL A HB   6  
ATOM 11096 H HG11 . VAL A 1 89  ? 15.780  8.378   -14.638 1.00 1.00 ? 89  VAL A HG11 6  
ATOM 11097 H HG12 . VAL A 1 89  ? 16.922  9.114   -13.480 1.00 1.00 ? 89  VAL A HG12 6  
ATOM 11098 H HG13 . VAL A 1 89  ? 17.129  9.412   -15.196 1.00 1.00 ? 89  VAL A HG13 6  
ATOM 11099 H HG21 . VAL A 1 89  ? 17.559  7.033   -12.425 1.00 1.00 ? 89  VAL A HG21 6  
ATOM 11100 H HG22 . VAL A 1 89  ? 16.390  6.146   -13.430 1.00 1.00 ? 89  VAL A HG22 6  
ATOM 11101 H HG23 . VAL A 1 89  ? 18.090  5.636   -13.375 1.00 1.00 ? 89  VAL A HG23 6  
ATOM 11102 N N    . GLU A 1 90  ? 18.534  7.994   -17.741 1.00 1.00 ? 90  GLU A N    6  
ATOM 11103 C CA   . GLU A 1 90  ? 18.470  8.811   -18.958 1.00 1.00 ? 90  GLU A CA   6  
ATOM 11104 C C    . GLU A 1 90  ? 17.693  8.115   -20.085 1.00 1.00 ? 90  GLU A C    6  
ATOM 11105 O O    . GLU A 1 90  ? 16.908  8.759   -20.774 1.00 1.00 ? 90  GLU A O    6  
ATOM 11106 C CB   . GLU A 1 90  ? 19.883  9.231   -19.405 1.00 1.00 ? 90  GLU A CB   6  
ATOM 11107 C CG   . GLU A 1 90  ? 20.822  8.091   -19.836 1.00 1.00 ? 90  GLU A CG   6  
ATOM 11108 C CD   . GLU A 1 90  ? 22.222  8.635   -20.163 1.00 1.00 ? 90  GLU A CD   6  
ATOM 11109 O OE1  . GLU A 1 90  ? 22.474  9.004   -21.334 1.00 1.00 ? 90  GLU A OE1  6  
ATOM 11110 O OE2  . GLU A 1 90  ? 23.082  8.689   -19.252 1.00 1.00 ? 90  GLU A OE2  6  
ATOM 11111 H H    . GLU A 1 90  ? 19.445  7.771   -17.352 1.00 1.00 ? 90  GLU A H    6  
ATOM 11112 H HA   . GLU A 1 90  ? 17.924  9.722   -18.708 1.00 1.00 ? 90  GLU A HA   6  
ATOM 11113 H HB2  . GLU A 1 90  ? 19.780  9.920   -20.241 1.00 1.00 ? 90  GLU A HB2  6  
ATOM 11114 H HB3  . GLU A 1 90  ? 20.346  9.770   -18.581 1.00 1.00 ? 90  GLU A HB3  6  
ATOM 11115 H HG2  . GLU A 1 90  ? 20.896  7.353   -19.036 1.00 1.00 ? 90  GLU A HG2  6  
ATOM 11116 H HG3  . GLU A 1 90  ? 20.414  7.601   -20.722 1.00 1.00 ? 90  GLU A HG3  6  
ATOM 11117 N N    . VAL A 1 91  ? 17.823  6.790   -20.214 1.00 1.00 ? 91  VAL A N    6  
ATOM 11118 C CA   . VAL A 1 91  ? 17.094  5.987   -21.214 1.00 1.00 ? 91  VAL A CA   6  
ATOM 11119 C C    . VAL A 1 91  ? 15.610  5.880   -20.848 1.00 1.00 ? 91  VAL A C    6  
ATOM 11120 O O    . VAL A 1 91  ? 14.764  5.963   -21.732 1.00 1.00 ? 91  VAL A O    6  
ATOM 11121 C CB   . VAL A 1 91  ? 17.707  4.577   -21.403 1.00 1.00 ? 91  VAL A CB   6  
ATOM 11122 C CG1  . VAL A 1 91  ? 16.991  3.773   -22.500 1.00 1.00 ? 91  VAL A CG1  6  
ATOM 11123 C CG2  . VAL A 1 91  ? 19.201  4.645   -21.759 1.00 1.00 ? 91  VAL A CG2  6  
ATOM 11124 H H    . VAL A 1 91  ? 18.448  6.321   -19.566 1.00 1.00 ? 91  VAL A H    6  
ATOM 11125 H HA   . VAL A 1 91  ? 17.187  6.511   -22.162 1.00 1.00 ? 91  VAL A HA   6  
ATOM 11126 H HB   . VAL A 1 91  ? 17.608  4.031   -20.470 1.00 1.00 ? 91  VAL A HB   6  
ATOM 11127 H HG11 . VAL A 1 91  ? 17.489  2.814   -22.640 1.00 1.00 ? 91  VAL A HG11 6  
ATOM 11128 H HG12 . VAL A 1 91  ? 15.957  3.582   -22.210 1.00 1.00 ? 91  VAL A HG12 6  
ATOM 11129 H HG13 . VAL A 1 91  ? 17.009  4.320   -23.443 1.00 1.00 ? 91  VAL A HG13 6  
ATOM 11130 H HG21 . VAL A 1 91  ? 19.346  5.216   -22.675 1.00 1.00 ? 91  VAL A HG21 6  
ATOM 11131 H HG22 . VAL A 1 91  ? 19.762  5.112   -20.952 1.00 1.00 ? 91  VAL A HG22 6  
ATOM 11132 H HG23 . VAL A 1 91  ? 19.593  3.634   -21.890 1.00 1.00 ? 91  VAL A HG23 6  
ATOM 11133 N N    . ILE A 1 92  ? 15.278  5.754   -19.552 1.00 1.00 ? 92  ILE A N    6  
ATOM 11134 C CA   . ILE A 1 92  ? 13.880  5.737   -19.073 1.00 1.00 ? 92  ILE A CA   6  
ATOM 11135 C C    . ILE A 1 92  ? 13.189  7.065   -19.411 1.00 1.00 ? 92  ILE A C    6  
ATOM 11136 O O    . ILE A 1 92  ? 12.109  7.079   -19.990 1.00 1.00 ? 92  ILE A O    6  
ATOM 11137 C CB   . ILE A 1 92  ? 13.825  5.439   -17.547 1.00 1.00 ? 92  ILE A CB   6  
ATOM 11138 C CG1  . ILE A 1 92  ? 14.682  4.212   -17.150 1.00 1.00 ? 92  ILE A CG1  6  
ATOM 11139 C CG2  . ILE A 1 92  ? 12.366  5.232   -17.100 1.00 1.00 ? 92  ILE A CG2  6  
ATOM 11140 C CD1  . ILE A 1 92  ? 14.708  3.962   -15.638 1.00 1.00 ? 92  ILE A CD1  6  
ATOM 11141 H H    . ILE A 1 92  ? 16.027  5.661   -18.872 1.00 1.00 ? 92  ILE A H    6  
ATOM 11142 H HA   . ILE A 1 92  ? 13.328  4.953   -19.600 1.00 1.00 ? 92  ILE A HA   6  
ATOM 11143 H HB   . ILE A 1 92  ? 14.217  6.305   -17.011 1.00 1.00 ? 92  ILE A HB   6  
ATOM 11144 H HG12 . ILE A 1 92  ? 14.313  3.321   -17.658 1.00 1.00 ? 92  ILE A HG12 6  
ATOM 11145 H HG13 . ILE A 1 92  ? 15.716  4.370   -17.458 1.00 1.00 ? 92  ILE A HG13 6  
ATOM 11146 H HG21 . ILE A 1 92  ? 11.981  4.295   -17.506 1.00 1.00 ? 92  ILE A HG21 6  
ATOM 11147 H HG22 . ILE A 1 92  ? 12.307  5.196   -16.013 1.00 1.00 ? 92  ILE A HG22 6  
ATOM 11148 H HG23 . ILE A 1 92  ? 11.738  6.055   -17.439 1.00 1.00 ? 92  ILE A HG23 6  
ATOM 11149 H HD11 . ILE A 1 92  ? 13.759  3.551   -15.304 1.00 1.00 ? 92  ILE A HD11 6  
ATOM 11150 H HD12 . ILE A 1 92  ? 15.502  3.254   -15.406 1.00 1.00 ? 92  ILE A HD12 6  
ATOM 11151 H HD13 . ILE A 1 92  ? 14.911  4.896   -15.113 1.00 1.00 ? 92  ILE A HD13 6  
ATOM 11152 N N    . ILE A 1 93  ? 13.834  8.190   -19.099 1.00 1.00 ? 93  ILE A N    6  
ATOM 11153 C CA   . ILE A 1 93  ? 13.325  9.543   -19.381 1.00 1.00 ? 93  ILE A CA   6  
ATOM 11154 C C    . ILE A 1 93  ? 13.299  9.840   -20.882 1.00 1.00 ? 93  ILE A C    6  
ATOM 11155 O O    . ILE A 1 93  ? 12.332  10.420  -21.357 1.00 1.00 ? 93  ILE A O    6  
ATOM 11156 C CB   . ILE A 1 93  ? 14.126  10.584  -18.558 1.00 1.00 ? 93  ILE A CB   6  
ATOM 11157 C CG1  . ILE A 1 93  ? 13.765  10.412  -17.062 1.00 1.00 ? 93  ILE A CG1  6  
ATOM 11158 C CG2  . ILE A 1 93  ? 13.827  12.027  -19.009 1.00 1.00 ? 93  ILE A CG2  6  
ATOM 11159 C CD1  . ILE A 1 93  ? 14.670  11.185  -16.099 1.00 1.00 ? 93  ILE A CD1  6  
ATOM 11160 H H    . ILE A 1 93  ? 14.709  8.105   -18.598 1.00 1.00 ? 93  ILE A H    6  
ATOM 11161 H HA   . ILE A 1 93  ? 12.287  9.575   -19.060 1.00 1.00 ? 93  ILE A HA   6  
ATOM 11162 H HB   . ILE A 1 93  ? 15.193  10.396  -18.705 1.00 1.00 ? 93  ILE A HB   6  
ATOM 11163 H HG12 . ILE A 1 93  ? 12.736  10.736  -16.907 1.00 1.00 ? 93  ILE A HG12 6  
ATOM 11164 H HG13 . ILE A 1 93  ? 13.826  9.360   -16.782 1.00 1.00 ? 93  ILE A HG13 6  
ATOM 11165 H HG21 . ILE A 1 93  ? 14.357  12.747  -18.387 1.00 1.00 ? 93  ILE A HG21 6  
ATOM 11166 H HG22 . ILE A 1 93  ? 14.171  12.180  -20.032 1.00 1.00 ? 93  ILE A HG22 6  
ATOM 11167 H HG23 . ILE A 1 93  ? 12.752  12.223  -18.957 1.00 1.00 ? 93  ILE A HG23 6  
ATOM 11168 H HD11 . ILE A 1 93  ? 14.407  10.912  -15.075 1.00 1.00 ? 93  ILE A HD11 6  
ATOM 11169 H HD12 . ILE A 1 93  ? 15.713  10.929  -16.283 1.00 1.00 ? 93  ILE A HD12 6  
ATOM 11170 H HD13 . ILE A 1 93  ? 14.531  12.259  -16.211 1.00 1.00 ? 93  ILE A HD13 6  
ATOM 11171 N N    . SER A 1 94  ? 14.296  9.415   -21.648 1.00 1.00 ? 94  SER A N    6  
ATOM 11172 C CA   . SER A 1 94  ? 14.272  9.531   -23.113 1.00 1.00 ? 94  SER A CA   6  
ATOM 11173 C C    . SER A 1 94  ? 13.099  8.745   -23.719 1.00 1.00 ? 94  SER A C    6  
ATOM 11174 O O    . SER A 1 94  ? 12.359  9.263   -24.555 1.00 1.00 ? 94  SER A O    6  
ATOM 11175 C CB   . SER A 1 94  ? 15.618  9.077   -23.701 1.00 1.00 ? 94  SER A CB   6  
ATOM 11176 O OG   . SER A 1 94  ? 15.688  9.360   -25.095 1.00 1.00 ? 94  SER A OG   6  
ATOM 11177 H H    . SER A 1 94  ? 15.121  9.022   -21.207 1.00 1.00 ? 94  SER A H    6  
ATOM 11178 H HA   . SER A 1 94  ? 14.123  10.574  -23.363 1.00 1.00 ? 94  SER A HA   6  
ATOM 11179 H HB2  . SER A 1 94  ? 16.424  9.611   -23.196 1.00 1.00 ? 94  SER A HB2  6  
ATOM 11180 H HB3  . SER A 1 94  ? 15.746  8.005   -23.532 1.00 1.00 ? 94  SER A HB3  6  
ATOM 11181 H HG   . SER A 1 94  ? 16.571  9.099   -25.439 1.00 1.00 ? 94  SER A HG   6  
ATOM 11182 N N    . SER A 1 95  ? 12.853  7.530   -23.226 1.00 1.00 ? 95  SER A N    6  
ATOM 11183 C CA   . SER A 1 95  ? 11.695  6.721   -23.604 1.00 1.00 ? 95  SER A CA   6  
ATOM 11184 C C    . SER A 1 95  ? 10.373  7.412   -23.236 1.00 1.00 ? 95  SER A C    6  
ATOM 11185 O O    . SER A 1 95  ? 9.475   7.509   -24.074 1.00 1.00 ? 95  SER A O    6  
ATOM 11186 C CB   . SER A 1 95  ? 11.803  5.329   -22.968 1.00 1.00 ? 95  SER A CB   6  
ATOM 11187 O OG   . SER A 1 95  ? 10.784  4.472   -23.462 1.00 1.00 ? 95  SER A OG   6  
ATOM 11188 H H    . SER A 1 95  ? 13.484  7.168   -22.529 1.00 1.00 ? 95  SER A H    6  
ATOM 11189 H HA   . SER A 1 95  ? 11.705  6.594   -24.687 1.00 1.00 ? 95  SER A HA   6  
ATOM 11190 H HB2  . SER A 1 95  ? 12.779  4.906   -23.219 1.00 1.00 ? 95  SER A HB2  6  
ATOM 11191 H HB3  . SER A 1 95  ? 11.725  5.412   -21.882 1.00 1.00 ? 95  SER A HB3  6  
ATOM 11192 H HG   . SER A 1 95  ? 11.018  3.537   -23.300 1.00 1.00 ? 95  SER A HG   6  
ATOM 11193 N N    . ALA A 1 96  ? 10.272  7.999   -22.035 1.00 1.00 ? 96  ALA A N    6  
ATOM 11194 C CA   . ALA A 1 96  ? 9.119   8.793   -21.618 1.00 1.00 ? 96  ALA A CA   6  
ATOM 11195 C C    . ALA A 1 96  ? 8.877   9.958   -22.595 1.00 1.00 ? 96  ALA A C    6  
ATOM 11196 O O    . ALA A 1 96  ? 7.775   10.129  -23.123 1.00 1.00 ? 96  ALA A O    6  
ATOM 11197 C CB   . ALA A 1 96  ? 9.379   9.262   -20.176 1.00 1.00 ? 96  ALA A CB   6  
ATOM 11198 H H    . ALA A 1 96  ? 11.043  7.912   -21.379 1.00 1.00 ? 96  ALA A H    6  
ATOM 11199 H HA   . ALA A 1 96  ? 8.235   8.153   -21.624 1.00 1.00 ? 96  ALA A HA   6  
ATOM 11200 H HB1  . ALA A 1 96  ? 9.743   8.434   -19.566 1.00 1.00 ? 96  ALA A HB1  6  
ATOM 11201 H HB2  . ALA A 1 96  ? 10.132  10.053  -20.160 1.00 1.00 ? 96  ALA A HB2  6  
ATOM 11202 H HB3  . ALA A 1 96  ? 8.459   9.637   -19.733 1.00 1.00 ? 96  ALA A HB3  6  
ATOM 11203 N N    . LYS A 1 97  ? 9.921   10.732  -22.904 1.00 1.00 ? 97  LYS A N    6  
ATOM 11204 C CA   . LYS A 1 97  ? 9.867   11.857  -23.845 1.00 1.00 ? 97  LYS A CA   6  
ATOM 11205 C C    . LYS A 1 97  ? 9.497   11.433  -25.275 1.00 1.00 ? 97  LYS A C    6  
ATOM 11206 O O    . LYS A 1 97  ? 8.720   12.128  -25.931 1.00 1.00 ? 97  LYS A O    6  
ATOM 11207 C CB   . LYS A 1 97  ? 11.219  12.581  -23.823 1.00 1.00 ? 97  LYS A CB   6  
ATOM 11208 C CG   . LYS A 1 97  ? 11.439  13.393  -22.535 1.00 1.00 ? 97  LYS A CG   6  
ATOM 11209 C CD   . LYS A 1 97  ? 12.889  13.893  -22.498 1.00 1.00 ? 97  LYS A CD   6  
ATOM 11210 C CE   . LYS A 1 97  ? 13.120  14.865  -21.327 1.00 1.00 ? 97  LYS A CE   6  
ATOM 11211 N NZ   . LYS A 1 97  ? 14.508  15.424  -21.334 1.00 1.00 ? 97  LYS A NZ   6  
ATOM 11212 H H    . LYS A 1 97  ? 10.815  10.535  -22.457 1.00 1.00 ? 97  LYS A H    6  
ATOM 11213 H HA   . LYS A 1 97  ? 9.090   12.543  -23.517 1.00 1.00 ? 97  LYS A HA   6  
ATOM 11214 H HB2  . LYS A 1 97  ? 12.018  11.848  -23.944 1.00 1.00 ? 97  LYS A HB2  6  
ATOM 11215 H HB3  . LYS A 1 97  ? 11.262  13.269  -24.671 1.00 1.00 ? 97  LYS A HB3  6  
ATOM 11216 H HG2  . LYS A 1 97  ? 10.757  14.240  -22.524 1.00 1.00 ? 97  LYS A HG2  6  
ATOM 11217 H HG3  . LYS A 1 97  ? 11.250  12.776  -21.656 1.00 1.00 ? 97  LYS A HG3  6  
ATOM 11218 H HD2  . LYS A 1 97  ? 13.548  13.026  -22.403 1.00 1.00 ? 97  LYS A HD2  6  
ATOM 11219 H HD3  . LYS A 1 97  ? 13.109  14.402  -23.437 1.00 1.00 ? 97  LYS A HD3  6  
ATOM 11220 H HE2  . LYS A 1 97  ? 12.394  15.684  -21.401 1.00 1.00 ? 97  LYS A HE2  6  
ATOM 11221 H HE3  . LYS A 1 97  ? 12.928  14.342  -20.383 1.00 1.00 ? 97  LYS A HE3  6  
ATOM 11222 H HZ1  . LYS A 1 97  ? 15.211  14.700  -21.259 1.00 1.00 ? 97  LYS A HZ1  6  
ATOM 11223 H HZ2  . LYS A 1 97  ? 14.690  15.941  -22.187 1.00 1.00 ? 97  LYS A HZ2  6  
ATOM 11224 H HZ3  . LYS A 1 97  ? 14.646  16.066  -20.563 1.00 1.00 ? 97  LYS A HZ3  6  
ATOM 11225 N N    . GLU A 1 98  ? 9.992   10.286  -25.740 1.00 1.00 ? 98  GLU A N    6  
ATOM 11226 C CA   . GLU A 1 98  ? 9.604   9.697   -27.026 1.00 1.00 ? 98  GLU A CA   6  
ATOM 11227 C C    . GLU A 1 98  ? 8.133   9.257   -27.040 1.00 1.00 ? 98  GLU A C    6  
ATOM 11228 O O    . GLU A 1 98  ? 7.452   9.405   -28.056 1.00 1.00 ? 98  GLU A O    6  
ATOM 11229 C CB   . GLU A 1 98  ? 10.512  8.511   -27.397 1.00 1.00 ? 98  GLU A CB   6  
ATOM 11230 C CG   . GLU A 1 98  ? 11.883  8.961   -27.911 1.00 1.00 ? 98  GLU A CG   6  
ATOM 11231 C CD   . GLU A 1 98  ? 12.699  7.765   -28.426 1.00 1.00 ? 98  GLU A CD   6  
ATOM 11232 O OE1  . GLU A 1 98  ? 13.102  6.895   -27.618 1.00 1.00 ? 98  GLU A OE1  6  
ATOM 11233 O OE2  . GLU A 1 98  ? 12.948  7.688   -29.653 1.00 1.00 ? 98  GLU A OE2  6  
ATOM 11234 H H    . GLU A 1 98  ? 10.677  9.803   -25.167 1.00 1.00 ? 98  GLU A H    6  
ATOM 11235 H HA   . GLU A 1 98  ? 9.723   10.463  -27.781 1.00 1.00 ? 98  GLU A HA   6  
ATOM 11236 H HB2  . GLU A 1 98  ? 10.631  7.854   -26.535 1.00 1.00 ? 98  GLU A HB2  6  
ATOM 11237 H HB3  . GLU A 1 98  ? 10.029  7.940   -28.194 1.00 1.00 ? 98  GLU A HB3  6  
ATOM 11238 H HG2  . GLU A 1 98  ? 11.734  9.673   -28.724 1.00 1.00 ? 98  GLU A HG2  6  
ATOM 11239 H HG3  . GLU A 1 98  ? 12.434  9.471   -27.124 1.00 1.00 ? 98  GLU A HG3  6  
ATOM 11240 N N    . MET A 1 99  ? 7.624   8.747   -25.915 1.00 1.00 ? 99  MET A N    6  
ATOM 11241 C CA   . MET A 1 99  ? 6.232   8.326   -25.768 1.00 1.00 ? 99  MET A CA   6  
ATOM 11242 C C    . MET A 1 99  ? 5.260   9.510   -25.681 1.00 1.00 ? 99  MET A C    6  
ATOM 11243 O O    . MET A 1 99  ? 4.193   9.438   -26.285 1.00 1.00 ? 99  MET A O    6  
ATOM 11244 C CB   . MET A 1 99  ? 6.097   7.362   -24.584 1.00 1.00 ? 99  MET A CB   6  
ATOM 11245 C CG   . MET A 1 99  ? 6.791   6.022   -24.887 1.00 1.00 ? 99  MET A CG   6  
ATOM 11246 S SD   . MET A 1 99  ? 5.930   4.936   -26.052 1.00 1.00 ? 99  MET A SD   6  
ATOM 11247 C CE   . MET A 1 99  ? 4.853   4.072   -24.885 1.00 1.00 ? 99  MET A CE   6  
ATOM 11248 H H    . MET A 1 99  ? 8.258   8.549   -25.147 1.00 1.00 ? 99  MET A H    6  
ATOM 11249 H HA   . MET A 1 99  ? 5.963   7.776   -26.662 1.00 1.00 ? 99  MET A HA   6  
ATOM 11250 H HB2  . MET A 1 99  ? 6.536   7.806   -23.689 1.00 1.00 ? 99  MET A HB2  6  
ATOM 11251 H HB3  . MET A 1 99  ? 5.040   7.176   -24.403 1.00 1.00 ? 99  MET A HB3  6  
ATOM 11252 H HG2  . MET A 1 99  ? 7.783   6.217   -25.295 1.00 1.00 ? 99  MET A HG2  6  
ATOM 11253 H HG3  . MET A 1 99  ? 6.949   5.478   -23.958 1.00 1.00 ? 99  MET A HG3  6  
ATOM 11254 H HE1  . MET A 1 99  ? 5.452   3.599   -24.106 1.00 1.00 ? 99  MET A HE1  6  
ATOM 11255 H HE2  . MET A 1 99  ? 4.159   4.778   -24.432 1.00 1.00 ? 99  MET A HE2  6  
ATOM 11256 H HE3  . MET A 1 99  ? 4.284   3.304   -25.415 1.00 1.00 ? 99  MET A HE3  6  
ATOM 11257 N N    . VAL A 1 100 ? 5.624   10.605  -25.000 1.00 1.00 ? 100 VAL A N    6  
ATOM 11258 C CA   . VAL A 1 100 ? 4.845   11.869  -24.995 1.00 1.00 ? 100 VAL A CA   6  
ATOM 11259 C C    . VAL A 1 100 ? 4.429   12.281  -26.411 1.00 1.00 ? 100 VAL A C    6  
ATOM 11260 O O    . VAL A 1 100 ? 5.245   12.341  -27.330 1.00 1.00 ? 100 VAL A O    6  
ATOM 11261 C CB   . VAL A 1 100 ? 5.582   13.038  -24.302 1.00 1.00 ? 100 VAL A CB   6  
ATOM 11262 C CG1  . VAL A 1 100 ? 4.900   14.410  -24.484 1.00 1.00 ? 100 VAL A CG1  6  
ATOM 11263 C CG2  . VAL A 1 100 ? 5.648   12.794  -22.793 1.00 1.00 ? 100 VAL A CG2  6  
ATOM 11264 H H    . VAL A 1 100 ? 6.474   10.538  -24.444 1.00 1.00 ? 100 VAL A H    6  
ATOM 11265 H HA   . VAL A 1 100 ? 3.932   11.686  -24.433 1.00 1.00 ? 100 VAL A HA   6  
ATOM 11266 H HB   . VAL A 1 100 ? 6.596   13.101  -24.686 1.00 1.00 ? 100 VAL A HB   6  
ATOM 11267 H HG11 . VAL A 1 100 ? 5.422   15.164  -23.895 1.00 1.00 ? 100 VAL A HG11 6  
ATOM 11268 H HG12 . VAL A 1 100 ? 4.934   14.718  -25.527 1.00 1.00 ? 100 VAL A HG12 6  
ATOM 11269 H HG13 . VAL A 1 100 ? 3.862   14.366  -24.151 1.00 1.00 ? 100 VAL A HG13 6  
ATOM 11270 H HG21 . VAL A 1 100 ? 6.316   13.529  -22.343 1.00 1.00 ? 100 VAL A HG21 6  
ATOM 11271 H HG22 . VAL A 1 100 ? 4.653   12.890  -22.353 1.00 1.00 ? 100 VAL A HG22 6  
ATOM 11272 H HG23 . VAL A 1 100 ? 6.027   11.798  -22.584 1.00 1.00 ? 100 VAL A HG23 6  
ATOM 11273 N N    . GLY A 1 101 ? 3.130   12.568  -26.556 1.00 1.00 ? 101 GLY A N    6  
ATOM 11274 C CA   . GLY A 1 101 ? 2.472   12.944  -27.810 1.00 1.00 ? 101 GLY A CA   6  
ATOM 11275 C C    . GLY A 1 101 ? 1.813   11.763  -28.532 1.00 1.00 ? 101 GLY A C    6  
ATOM 11276 O O    . GLY A 1 101 ? 1.013   11.994  -29.438 1.00 1.00 ? 101 GLY A O    6  
ATOM 11277 H H    . GLY A 1 101 ? 2.537   12.481  -25.735 1.00 1.00 ? 101 GLY A H    6  
ATOM 11278 H HA2  . GLY A 1 101 ? 1.685   13.666  -27.590 1.00 1.00 ? 101 GLY A HA2  6  
ATOM 11279 H HA3  . GLY A 1 101 ? 3.197   13.391  -28.493 1.00 1.00 ? 101 GLY A HA3  6  
ATOM 11280 N N    . GLN A 1 102 ? 2.112   10.518  -28.144 1.00 1.00 ? 102 GLN A N    6  
ATOM 11281 C CA   . GLN A 1 102 ? 1.522   9.322   -28.726 1.00 1.00 ? 102 GLN A CA   6  
ATOM 11282 C C    . GLN A 1 102 ? 0.205   8.949   -28.030 1.00 1.00 ? 102 GLN A C    6  
ATOM 11283 O O    . GLN A 1 102 ? 0.045   9.110   -26.816 1.00 1.00 ? 102 GLN A O    6  
ATOM 11284 C CB   . GLN A 1 102 ? 2.511   8.141   -28.705 1.00 1.00 ? 102 GLN A CB   6  
ATOM 11285 C CG   . GLN A 1 102 ? 3.812   8.426   -29.487 1.00 1.00 ? 102 GLN A CG   6  
ATOM 11286 C CD   . GLN A 1 102 ? 4.703   7.185   -29.609 1.00 1.00 ? 102 GLN A CD   6  
ATOM 11287 O OE1  . GLN A 1 102 ? 4.274   6.113   -30.013 1.00 1.00 ? 102 GLN A OE1  6  
ATOM 11288 N NE2  . GLN A 1 102 ? 5.977   7.274   -29.284 1.00 1.00 ? 102 GLN A NE2  6  
ATOM 11289 H H    . GLN A 1 102 ? 2.764   10.366  -27.393 1.00 1.00 ? 102 GLN A H    6  
ATOM 11290 H HA   . GLN A 1 102 ? 1.307   9.547   -29.764 1.00 1.00 ? 102 GLN A HA   6  
ATOM 11291 H HB2  . GLN A 1 102 ? 2.760   7.888   -27.676 1.00 1.00 ? 102 GLN A HB2  6  
ATOM 11292 H HB3  . GLN A 1 102 ? 2.015   7.277   -29.151 1.00 1.00 ? 102 GLN A HB3  6  
ATOM 11293 H HG2  . GLN A 1 102 ? 3.565   8.764   -30.494 1.00 1.00 ? 102 GLN A HG2  6  
ATOM 11294 H HG3  . GLN A 1 102 ? 4.370   9.221   -28.991 1.00 1.00 ? 102 GLN A HG3  6  
ATOM 11295 H HE21 . GLN A 1 102 ? 6.375   8.150   -28.947 1.00 1.00 ? 102 GLN A HE21 6  
ATOM 11296 H HE22 . GLN A 1 102 ? 6.552   6.452   -29.382 1.00 1.00 ? 102 GLN A HE22 6  
ATOM 11297 N N    . LYS A 1 103 ? -0.734  8.415   -28.817 1.00 1.00 ? 103 LYS A N    6  
ATOM 11298 C CA   . LYS A 1 103 ? -2.015  7.875   -28.344 1.00 1.00 ? 103 LYS A CA   6  
ATOM 11299 C C    . LYS A 1 103 ? -1.964  6.349   -28.123 1.00 1.00 ? 103 LYS A C    6  
ATOM 11300 O O    . LYS A 1 103 ? -1.250  5.629   -28.824 1.00 1.00 ? 103 LYS A O    6  
ATOM 11301 C CB   . LYS A 1 103 ? -3.140  8.264   -29.319 1.00 1.00 ? 103 LYS A CB   6  
ATOM 11302 C CG   . LYS A 1 103 ? -3.472  9.761   -29.238 1.00 1.00 ? 103 LYS A CG   6  
ATOM 11303 C CD   . LYS A 1 103 ? -4.623  10.112  -30.189 1.00 1.00 ? 103 LYS A CD   6  
ATOM 11304 C CE   . LYS A 1 103 ? -5.045  11.575  -29.982 1.00 1.00 ? 103 LYS A CE   6  
ATOM 11305 N NZ   . LYS A 1 103 ? -6.213  11.940  -30.828 1.00 1.00 ? 103 LYS A NZ   6  
ATOM 11306 H H    . LYS A 1 103 ? -0.521  8.304   -29.799 1.00 1.00 ? 103 LYS A H    6  
ATOM 11307 H HA   . LYS A 1 103 ? -2.239  8.324   -27.380 1.00 1.00 ? 103 LYS A HA   6  
ATOM 11308 H HB2  . LYS A 1 103 ? -2.852  8.001   -30.339 1.00 1.00 ? 103 LYS A HB2  6  
ATOM 11309 H HB3  . LYS A 1 103 ? -4.041  7.700   -29.064 1.00 1.00 ? 103 LYS A HB3  6  
ATOM 11310 H HG2  . LYS A 1 103 ? -3.767  10.006  -28.217 1.00 1.00 ? 103 LYS A HG2  6  
ATOM 11311 H HG3  . LYS A 1 103 ? -2.593  10.351  -29.503 1.00 1.00 ? 103 LYS A HG3  6  
ATOM 11312 H HD2  . LYS A 1 103 ? -4.300  9.960   -31.220 1.00 1.00 ? 103 LYS A HD2  6  
ATOM 11313 H HD3  . LYS A 1 103 ? -5.470  9.453   -29.986 1.00 1.00 ? 103 LYS A HD3  6  
ATOM 11314 H HE2  . LYS A 1 103 ? -5.302  11.719  -28.926 1.00 1.00 ? 103 LYS A HE2  6  
ATOM 11315 H HE3  . LYS A 1 103 ? -4.195  12.225  -30.213 1.00 1.00 ? 103 LYS A HE3  6  
ATOM 11316 H HZ1  . LYS A 1 103 ? -7.018  11.369  -30.597 1.00 1.00 ? 103 LYS A HZ1  6  
ATOM 11317 H HZ2  . LYS A 1 103 ? -6.477  12.907  -30.684 1.00 1.00 ? 103 LYS A HZ2  6  
ATOM 11318 H HZ3  . LYS A 1 103 ? -6.009  11.819  -31.814 1.00 1.00 ? 103 LYS A HZ3  6  
ATOM 11319 N N    . MET A 1 104 ? -2.741  5.870   -27.145 1.00 1.00 ? 104 MET A N    6  
ATOM 11320 C CA   . MET A 1 104 ? -2.753  4.474   -26.665 1.00 1.00 ? 104 MET A CA   6  
ATOM 11321 C C    . MET A 1 104 ? -4.174  3.887   -26.636 1.00 1.00 ? 104 MET A C    6  
ATOM 11322 O O    . MET A 1 104 ? -5.159  4.584   -26.886 1.00 1.00 ? 104 MET A O    6  
ATOM 11323 C CB   . MET A 1 104 ? -2.114  4.412   -25.258 1.00 1.00 ? 104 MET A CB   6  
ATOM 11324 C CG   . MET A 1 104 ? -0.697  5.001   -25.201 1.00 1.00 ? 104 MET A CG   6  
ATOM 11325 S SD   . MET A 1 104 ? 0.510   4.143   -26.245 1.00 1.00 ? 104 MET A SD   6  
ATOM 11326 C CE   . MET A 1 104 ? 1.840   5.365   -26.174 1.00 1.00 ? 104 MET A CE   6  
ATOM 11327 H H    . MET A 1 104 ? -3.378  6.525   -26.696 1.00 1.00 ? 104 MET A H    6  
ATOM 11328 H HA   . MET A 1 104 ? -2.164  3.846   -27.336 1.00 1.00 ? 104 MET A HA   6  
ATOM 11329 H HB2  . MET A 1 104 ? -2.758  4.948   -24.560 1.00 1.00 ? 104 MET A HB2  6  
ATOM 11330 H HB3  . MET A 1 104 ? -2.056  3.374   -24.926 1.00 1.00 ? 104 MET A HB3  6  
ATOM 11331 H HG2  . MET A 1 104 ? -0.732  6.056   -25.485 1.00 1.00 ? 104 MET A HG2  6  
ATOM 11332 H HG3  . MET A 1 104 ? -0.342  4.955   -24.171 1.00 1.00 ? 104 MET A HG3  6  
ATOM 11333 H HE1  . MET A 1 104 ? 2.175   5.482   -25.147 1.00 1.00 ? 104 MET A HE1  6  
ATOM 11334 H HE2  . MET A 1 104 ? 2.677   5.037   -26.793 1.00 1.00 ? 104 MET A HE2  6  
ATOM 11335 H HE3  . MET A 1 104 ? 1.475   6.323   -26.541 1.00 1.00 ? 104 MET A HE3  6  
ATOM 11336 N N    . LYS A 1 105 ? -4.280  2.599   -26.288 1.00 1.00 ? 105 LYS A N    6  
ATOM 11337 C CA   . LYS A 1 105 ? -5.553  1.892   -26.080 1.00 1.00 ? 105 LYS A CA   6  
ATOM 11338 C C    . LYS A 1 105 ? -6.391  2.490   -24.929 1.00 1.00 ? 105 LYS A C    6  
ATOM 11339 O O    . LYS A 1 105 ? -5.893  3.241   -24.086 1.00 1.00 ? 105 LYS A O    6  
ATOM 11340 C CB   . LYS A 1 105 ? -5.270  0.389   -25.858 1.00 1.00 ? 105 LYS A CB   6  
ATOM 11341 C CG   . LYS A 1 105 ? -4.659  -0.291  -27.097 1.00 1.00 ? 105 LYS A CG   6  
ATOM 11342 C CD   . LYS A 1 105 ? -4.428  -1.788  -26.841 1.00 1.00 ? 105 LYS A CD   6  
ATOM 11343 C CE   . LYS A 1 105 ? -3.752  -2.498  -28.026 1.00 1.00 ? 105 LYS A CE   6  
ATOM 11344 N NZ   . LYS A 1 105 ? -4.641  -2.639  -29.213 1.00 1.00 ? 105 LYS A NZ   6  
ATOM 11345 H H    . LYS A 1 105 ? -3.429  2.083   -26.099 1.00 1.00 ? 105 LYS A H    6  
ATOM 11346 H HA   . LYS A 1 105 ? -6.154  1.996   -26.988 1.00 1.00 ? 105 LYS A HA   6  
ATOM 11347 H HB2  . LYS A 1 105 ? -4.596  0.270   -25.008 1.00 1.00 ? 105 LYS A HB2  6  
ATOM 11348 H HB3  . LYS A 1 105 ? -6.206  -0.121  -25.618 1.00 1.00 ? 105 LYS A HB3  6  
ATOM 11349 H HG2  . LYS A 1 105 ? -5.338  -0.165  -27.940 1.00 1.00 ? 105 LYS A HG2  6  
ATOM 11350 H HG3  . LYS A 1 105 ? -3.706  0.178   -27.341 1.00 1.00 ? 105 LYS A HG3  6  
ATOM 11351 H HD2  . LYS A 1 105 ? -3.781  -1.896  -25.968 1.00 1.00 ? 105 LYS A HD2  6  
ATOM 11352 H HD3  . LYS A 1 105 ? -5.380  -2.271  -26.612 1.00 1.00 ? 105 LYS A HD3  6  
ATOM 11353 H HE2  . LYS A 1 105 ? -2.845  -1.947  -28.300 1.00 1.00 ? 105 LYS A HE2  6  
ATOM 11354 H HE3  . LYS A 1 105 ? -3.435  -3.491  -27.693 1.00 1.00 ? 105 LYS A HE3  6  
ATOM 11355 H HZ1  . LYS A 1 105 ? -5.487  -3.146  -28.979 1.00 1.00 ? 105 LYS A HZ1  6  
ATOM 11356 H HZ2  . LYS A 1 105 ? -4.907  -1.740  -29.595 1.00 1.00 ? 105 LYS A HZ2  6  
ATOM 11357 H HZ3  . LYS A 1 105 ? -4.179  -3.156  -29.948 1.00 1.00 ? 105 LYS A HZ3  6  
ATOM 11358 N N    . TYR A 1 106 ? -7.683  2.151   -24.899 1.00 1.00 ? 106 TYR A N    6  
ATOM 11359 C CA   . TYR A 1 106 ? -8.663  2.673   -23.932 1.00 1.00 ? 106 TYR A CA   6  
ATOM 11360 C C    . TYR A 1 106 ? -8.482  2.126   -22.499 1.00 1.00 ? 106 TYR A C    6  
ATOM 11361 O O    . TYR A 1 106 ? -7.781  1.143   -22.260 1.00 1.00 ? 106 TYR A O    6  
ATOM 11362 C CB   . TYR A 1 106 ? -10.079 2.312   -24.424 1.00 1.00 ? 106 TYR A CB   6  
ATOM 11363 C CG   . TYR A 1 106 ? -10.402 2.714   -25.853 1.00 1.00 ? 106 TYR A CG   6  
ATOM 11364 C CD1  . TYR A 1 106 ? -10.685 4.059   -26.163 1.00 1.00 ? 106 TYR A CD1  6  
ATOM 11365 C CD2  . TYR A 1 106 ? -10.443 1.738   -26.870 1.00 1.00 ? 106 TYR A CD2  6  
ATOM 11366 C CE1  . TYR A 1 106 ? -11.021 4.426   -27.480 1.00 1.00 ? 106 TYR A CE1  6  
ATOM 11367 C CE2  . TYR A 1 106 ? -10.776 2.099   -28.190 1.00 1.00 ? 106 TYR A CE2  6  
ATOM 11368 C CZ   . TYR A 1 106 ? -11.070 3.448   -28.497 1.00 1.00 ? 106 TYR A CZ   6  
ATOM 11369 O OH   . TYR A 1 106 ? -11.402 3.814   -29.767 1.00 1.00 ? 106 TYR A OH   6  
ATOM 11370 H H    . TYR A 1 106 ? -8.019  1.510   -25.605 1.00 1.00 ? 106 TYR A H    6  
ATOM 11371 H HA   . TYR A 1 106 ? -8.575  3.761   -23.895 1.00 1.00 ? 106 TYR A HA   6  
ATOM 11372 H HB2  . TYR A 1 106 ? -10.220 1.234   -24.323 1.00 1.00 ? 106 TYR A HB2  6  
ATOM 11373 H HB3  . TYR A 1 106 ? -10.815 2.779   -23.766 1.00 1.00 ? 106 TYR A HB3  6  
ATOM 11374 H HD1  . TYR A 1 106 ? -10.661 4.813   -25.390 1.00 1.00 ? 106 TYR A HD1  6  
ATOM 11375 H HD2  . TYR A 1 106 ? -10.236 0.702   -26.638 1.00 1.00 ? 106 TYR A HD2  6  
ATOM 11376 H HE1  . TYR A 1 106 ? -11.246 5.453   -27.719 1.00 1.00 ? 106 TYR A HE1  6  
ATOM 11377 H HE2  . TYR A 1 106 ? -10.816 1.347   -28.964 1.00 1.00 ? 106 TYR A HE2  6  
ATOM 11378 H HH   . TYR A 1 106 ? -11.401 3.073   -30.395 1.00 1.00 ? 106 TYR A HH   6  
ATOM 11379 N N    . SER A 1 107 ? -9.183  2.746   -21.544 1.00 1.00 ? 107 SER A N    6  
ATOM 11380 C CA   . SER A 1 107 ? -9.341  2.257   -20.168 1.00 1.00 ? 107 SER A CA   6  
ATOM 11381 C C    . SER A 1 107 ? -10.709 2.677   -19.623 1.00 1.00 ? 107 SER A C    6  
ATOM 11382 O O    . SER A 1 107 ? -11.148 3.807   -19.830 1.00 1.00 ? 107 SER A O    6  
ATOM 11383 C CB   . SER A 1 107 ? -8.244  2.791   -19.239 1.00 1.00 ? 107 SER A CB   6  
ATOM 11384 O OG   . SER A 1 107 ? -8.459  2.319   -17.907 1.00 1.00 ? 107 SER A OG   6  
ATOM 11385 H H    . SER A 1 107 ? -9.733  3.560   -21.794 1.00 1.00 ? 107 SER A H    6  
ATOM 11386 H HA   . SER A 1 107 ? -9.281  1.171   -20.159 1.00 1.00 ? 107 SER A HA   6  
ATOM 11387 H HB2  . SER A 1 107 ? -7.276  2.445   -19.599 1.00 1.00 ? 107 SER A HB2  6  
ATOM 11388 H HB3  . SER A 1 107 ? -8.260  3.881   -19.248 1.00 1.00 ? 107 SER A HB3  6  
ATOM 11389 H HG   . SER A 1 107 ? -7.756  2.677   -17.320 1.00 1.00 ? 107 SER A HG   6  
ATOM 11390 N N    . ILE A 1 108 ? -11.360 1.781   -18.882 1.00 1.00 ? 108 ILE A N    6  
ATOM 11391 C CA   . ILE A 1 108 ? -12.576 2.036   -18.089 1.00 1.00 ? 108 ILE A CA   6  
ATOM 11392 C C    . ILE A 1 108 ? -12.232 1.756   -16.607 1.00 1.00 ? 108 ILE A C    6  
ATOM 11393 O O    . ILE A 1 108 ? -12.955 1.081   -15.876 1.00 1.00 ? 108 ILE A O    6  
ATOM 11394 C CB   . ILE A 1 108 ? -13.773 1.271   -18.724 1.00 1.00 ? 108 ILE A CB   6  
ATOM 11395 C CG1  . ILE A 1 108 ? -15.100 1.467   -17.951 1.00 1.00 ? 108 ILE A CG1  6  
ATOM 11396 C CG2  . ILE A 1 108 ? -13.478 -0.222  -18.971 1.00 1.00 ? 108 ILE A CG2  6  
ATOM 11397 C CD1  . ILE A 1 108 ? -16.352 1.223   -18.802 1.00 1.00 ? 108 ILE A CD1  6  
ATOM 11398 H H    . ILE A 1 108 ? -10.945 0.853   -18.790 1.00 1.00 ? 108 ILE A H    6  
ATOM 11399 H HA   . ILE A 1 108 ? -12.828 3.097   -18.136 1.00 1.00 ? 108 ILE A HA   6  
ATOM 11400 H HB   . ILE A 1 108 ? -13.920 1.722   -19.708 1.00 1.00 ? 108 ILE A HB   6  
ATOM 11401 H HG12 . ILE A 1 108 ? -15.138 0.791   -17.098 1.00 1.00 ? 108 ILE A HG12 6  
ATOM 11402 H HG13 . ILE A 1 108 ? -15.143 2.488   -17.574 1.00 1.00 ? 108 ILE A HG13 6  
ATOM 11403 H HG21 . ILE A 1 108 ? -13.244 -0.723  -18.030 1.00 1.00 ? 108 ILE A HG21 6  
ATOM 11404 H HG22 . ILE A 1 108 ? -14.339 -0.710  -19.424 1.00 1.00 ? 108 ILE A HG22 6  
ATOM 11405 H HG23 . ILE A 1 108 ? -12.644 -0.335  -19.665 1.00 1.00 ? 108 ILE A HG23 6  
ATOM 11406 H HD11 . ILE A 1 108 ? -16.398 0.185   -19.131 1.00 1.00 ? 108 ILE A HD11 6  
ATOM 11407 H HD12 . ILE A 1 108 ? -17.241 1.441   -18.210 1.00 1.00 ? 108 ILE A HD12 6  
ATOM 11408 H HD13 . ILE A 1 108 ? -16.347 1.873   -19.674 1.00 1.00 ? 108 ILE A HD13 6  
ATOM 11409 N N    . VAL A 1 109 ? -11.049 2.238   -16.191 1.00 1.00 ? 109 VAL A N    6  
ATOM 11410 C CA   . VAL A 1 109 ? -10.387 1.925   -14.904 1.00 1.00 ? 109 VAL A CA   6  
ATOM 11411 C C    . VAL A 1 109 ? -10.050 0.422   -14.894 1.00 1.00 ? 109 VAL A C    6  
ATOM 11412 O O    . VAL A 1 109 ? -10.354 -0.320  -13.962 1.00 1.00 ? 109 VAL A O    6  
ATOM 11413 C CB   . VAL A 1 109 ? -11.182 2.405   -13.655 1.00 1.00 ? 109 VAL A CB   6  
ATOM 11414 C CG1  . VAL A 1 109 ? -10.277 2.426   -12.408 1.00 1.00 ? 109 VAL A CG1  6  
ATOM 11415 C CG2  . VAL A 1 109 ? -11.728 3.835   -13.839 1.00 1.00 ? 109 VAL A CG2  6  
ATOM 11416 H H    . VAL A 1 109 ? -10.515 2.788   -16.857 1.00 1.00 ? 109 VAL A H    6  
ATOM 11417 H HA   . VAL A 1 109 ? -9.439  2.466   -14.913 1.00 1.00 ? 109 VAL A HA   6  
ATOM 11418 H HB   . VAL A 1 109 ? -12.027 1.741   -13.464 1.00 1.00 ? 109 VAL A HB   6  
ATOM 11419 H HG11 . VAL A 1 109 ? -9.415  3.072   -12.577 1.00 1.00 ? 109 VAL A HG11 6  
ATOM 11420 H HG12 . VAL A 1 109 ? -10.834 2.799   -11.548 1.00 1.00 ? 109 VAL A HG12 6  
ATOM 11421 H HG13 . VAL A 1 109 ? -9.922  1.425   -12.167 1.00 1.00 ? 109 VAL A HG13 6  
ATOM 11422 H HG21 . VAL A 1 109 ? -10.912 4.525   -14.058 1.00 1.00 ? 109 VAL A HG21 6  
ATOM 11423 H HG22 . VAL A 1 109 ? -12.448 3.869   -14.655 1.00 1.00 ? 109 VAL A HG22 6  
ATOM 11424 H HG23 . VAL A 1 109 ? -12.238 4.159   -12.931 1.00 1.00 ? 109 VAL A HG23 6  
ATOM 11425 N N    . SER A 1 110 ? -9.459  -0.037  -16.005 1.00 1.00 ? 110 SER A N    6  
ATOM 11426 C CA   . SER A 1 110 ? -9.249  -1.456  -16.340 1.00 1.00 ? 110 SER A CA   6  
ATOM 11427 C C    . SER A 1 110 ? -7.766  -1.856  -16.527 1.00 1.00 ? 110 SER A C    6  
ATOM 11428 O O    . SER A 1 110 ? -7.484  -2.942  -17.038 1.00 1.00 ? 110 SER A O    6  
ATOM 11429 C CB   . SER A 1 110 ? -10.085 -1.739  -17.603 1.00 1.00 ? 110 SER A CB   6  
ATOM 11430 O OG   . SER A 1 110 ? -9.796  -0.814  -18.654 1.00 1.00 ? 110 SER A OG   6  
ATOM 11431 H H    . SER A 1 110 ? -9.258  0.627   -16.750 1.00 1.00 ? 110 SER A H    6  
ATOM 11432 H HA   . SER A 1 110 ? -9.637  -2.088  -15.539 1.00 1.00 ? 110 SER A HA   6  
ATOM 11433 H HB2  . SER A 1 110 ? -9.929  -2.762  -17.945 1.00 1.00 ? 110 SER A HB2  6  
ATOM 11434 H HB3  . SER A 1 110 ? -11.136 -1.637  -17.339 1.00 1.00 ? 110 SER A HB3  6  
ATOM 11435 H HG   . SER A 1 110 ? -9.116  -1.211  -19.238 1.00 1.00 ? 110 SER A HG   6  
ATOM 11436 N N    . ARG A 1 111 ? -6.838  -0.967  -16.120 1.00 1.00 ? 111 ARG A N    6  
ATOM 11437 C CA   . ARG A 1 111 ? -5.363  -1.018  -16.245 1.00 1.00 ? 111 ARG A CA   6  
ATOM 11438 C C    . ARG A 1 111 ? -4.898  -0.553  -17.633 1.00 1.00 ? 111 ARG A C    6  
ATOM 11439 O O    . ARG A 1 111 ? -5.441  -0.971  -18.657 1.00 1.00 ? 111 ARG A O    6  
ATOM 11440 C CB   . ARG A 1 111 ? -4.729  -2.380  -15.896 1.00 1.00 ? 111 ARG A CB   6  
ATOM 11441 C CG   . ARG A 1 111 ? -5.023  -2.829  -14.452 1.00 1.00 ? 111 ARG A CG   6  
ATOM 11442 C CD   . ARG A 1 111 ? -4.277  -4.122  -14.089 1.00 1.00 ? 111 ARG A CD   6  
ATOM 11443 N NE   . ARG A 1 111 ? -2.822  -3.909  -14.109 1.00 1.00 ? 111 ARG A NE   6  
ATOM 11444 C CZ   . ARG A 1 111 ? -1.856  -4.788  -13.907 1.00 1.00 ? 111 ARG A CZ   6  
ATOM 11445 N NH1  . ARG A 1 111 ? -2.085  -6.051  -13.606 1.00 1.00 ? 111 ARG A NH1  6  
ATOM 11446 N NH2  . ARG A 1 111 ? -0.624  -4.354  -14.021 1.00 1.00 ? 111 ARG A NH2  6  
ATOM 11447 H H    . ARG A 1 111 ? -7.207  -0.128  -15.691 1.00 1.00 ? 111 ARG A H    6  
ATOM 11448 H HA   . ARG A 1 111 ? -4.963  -0.302  -15.522 1.00 1.00 ? 111 ARG A HA   6  
ATOM 11449 H HB2  . ARG A 1 111 ? -5.055  -3.149  -16.597 1.00 1.00 ? 111 ARG A HB2  6  
ATOM 11450 H HB3  . ARG A 1 111 ? -3.651  -2.278  -16.022 1.00 1.00 ? 111 ARG A HB3  6  
ATOM 11451 H HG2  . ARG A 1 111 ? -4.724  -2.040  -13.761 1.00 1.00 ? 111 ARG A HG2  6  
ATOM 11452 H HG3  . ARG A 1 111 ? -6.095  -3.002  -14.342 1.00 1.00 ? 111 ARG A HG3  6  
ATOM 11453 H HD2  . ARG A 1 111 ? -4.582  -4.433  -13.087 1.00 1.00 ? 111 ARG A HD2  6  
ATOM 11454 H HD3  . ARG A 1 111 ? -4.548  -4.903  -14.802 1.00 1.00 ? 111 ARG A HD3  6  
ATOM 11455 H HE   . ARG A 1 111 ? -2.493  -2.969  -14.332 1.00 1.00 ? 111 ARG A HE   6  
ATOM 11456 H HH11 . ARG A 1 111 ? -3.032  -6.388  -13.511 1.00 1.00 ? 111 ARG A HH11 6  
ATOM 11457 H HH12 . ARG A 1 111 ? -1.319  -6.691  -13.464 1.00 1.00 ? 111 ARG A HH12 6  
ATOM 11458 H HH21 . ARG A 1 111 ? -0.501  -3.369  -14.261 1.00 1.00 ? 111 ARG A HH21 6  
ATOM 11459 H HH22 . ARG A 1 111 ? 0.168   -4.959  -13.873 1.00 1.00 ? 111 ARG A HH22 6  
ATOM 11460 N N    . ASN A 1 112 ? -3.878  0.316   -17.645 1.00 1.00 ? 112 ASN A N    6  
ATOM 11461 C CA   . ASN A 1 112 ? -3.312  1.004   -18.815 1.00 1.00 ? 112 ASN A CA   6  
ATOM 11462 C C    . ASN A 1 112 ? -2.102  1.882   -18.422 1.00 1.00 ? 112 ASN A C    6  
ATOM 11463 O O    . ASN A 1 112 ? -1.002  1.695   -18.937 1.00 1.00 ? 112 ASN A O    6  
ATOM 11464 C CB   . ASN A 1 112 ? -4.410  1.845   -19.521 1.00 1.00 ? 112 ASN A CB   6  
ATOM 11465 C CG   . ASN A 1 112 ? -4.026  2.350   -20.911 1.00 1.00 ? 112 ASN A CG   6  
ATOM 11466 O OD1  . ASN A 1 112 ? -3.142  1.827   -21.578 1.00 1.00 ? 112 ASN A OD1  6  
ATOM 11467 N ND2  . ASN A 1 112 ? -4.722  3.363   -21.394 1.00 1.00 ? 112 ASN A ND2  6  
ATOM 11468 H H    . ASN A 1 112 ? -3.360  0.410   -16.772 1.00 1.00 ? 112 ASN A H    6  
ATOM 11469 H HA   . ASN A 1 112 ? -2.963  0.241   -19.511 1.00 1.00 ? 112 ASN A HA   6  
ATOM 11470 H HB2  . ASN A 1 112 ? -5.310  1.254   -19.664 1.00 1.00 ? 112 ASN A HB2  6  
ATOM 11471 H HB3  . ASN A 1 112 ? -4.682  2.694   -18.890 1.00 1.00 ? 112 ASN A HB3  6  
ATOM 11472 H HD21 . ASN A 1 112 ? -5.460  3.789   -20.857 1.00 1.00 ? 112 ASN A HD21 6  
ATOM 11473 H HD22 . ASN A 1 112 ? -4.632  3.578   -22.380 1.00 1.00 ? 112 ASN A HD22 6  
ATOM 11474 N N    . CYS A 1 113 ? -2.291  2.856   -17.514 1.00 1.00 ? 113 CYS A N    6  
ATOM 11475 C CA   . CYS A 1 113 ? -1.280  3.892   -17.215 1.00 1.00 ? 113 CYS A CA   6  
ATOM 11476 C C    . CYS A 1 113 ? -0.094  3.383   -16.367 1.00 1.00 ? 113 CYS A C    6  
ATOM 11477 O O    . CYS A 1 113 ? 1.058   3.708   -16.676 1.00 1.00 ? 113 CYS A O    6  
ATOM 11478 C CB   . CYS A 1 113 ? -2.010  5.096   -16.590 1.00 1.00 ? 113 CYS A CB   6  
ATOM 11479 S SG   . CYS A 1 113 ? -0.835  6.455   -16.347 1.00 1.00 ? 113 CYS A SG   6  
ATOM 11480 H H    . CYS A 1 113 ? -3.204  2.932   -17.078 1.00 1.00 ? 113 CYS A H    6  
ATOM 11481 H HA   . CYS A 1 113 ? -0.845  4.233   -18.157 1.00 1.00 ? 113 CYS A HA   6  
ATOM 11482 H HB2  . CYS A 1 113 ? -2.800  5.441   -17.268 1.00 1.00 ? 113 CYS A HB2  6  
ATOM 11483 H HB3  . CYS A 1 113 ? -2.471  4.825   -15.635 1.00 1.00 ? 113 CYS A HB3  6  
ATOM 11484 H HG   . CYS A 1 113 ? -1.742  7.449   -16.294 1.00 1.00 ? 113 CYS A HG   6  
ATOM 11485 N N    . GLU A 1 114 ? -0.351  2.534   -15.367 1.00 1.00 ? 114 GLU A N    6  
ATOM 11486 C CA   . GLU A 1 114 ? 0.716   1.833   -14.638 1.00 1.00 ? 114 GLU A CA   6  
ATOM 11487 C C    . GLU A 1 114 ? 1.556   0.991   -15.609 1.00 1.00 ? 114 GLU A C    6  
ATOM 11488 O O    . GLU A 1 114 ? 2.775   1.136   -15.647 1.00 1.00 ? 114 GLU A O    6  
ATOM 11489 C CB   . GLU A 1 114 ? 0.209   0.974   -13.453 1.00 1.00 ? 114 GLU A CB   6  
ATOM 11490 C CG   . GLU A 1 114 ? -1.224  0.422   -13.496 1.00 1.00 ? 114 GLU A CG   6  
ATOM 11491 C CD   . GLU A 1 114 ? -1.480  -0.446  -14.717 1.00 1.00 ? 114 GLU A CD   6  
ATOM 11492 O OE1  . GLU A 1 114 ? -1.848  0.137   -15.761 1.00 1.00 ? 114 GLU A OE1  6  
ATOM 11493 O OE2  . GLU A 1 114 ? -1.246  -1.671  -14.657 1.00 1.00 ? 114 GLU A OE2  6  
ATOM 11494 H H    . GLU A 1 114 ? -1.298  2.194   -15.263 1.00 1.00 ? 114 GLU A H    6  
ATOM 11495 H HA   . GLU A 1 114 ? 1.380   2.582   -14.209 1.00 1.00 ? 114 GLU A HA   6  
ATOM 11496 H HB2  . GLU A 1 114 ? 0.894   0.136   -13.312 1.00 1.00 ? 114 GLU A HB2  6  
ATOM 11497 H HB3  . GLU A 1 114 ? 0.297   1.578   -12.555 1.00 1.00 ? 114 GLU A HB3  6  
ATOM 11498 H HG2  . GLU A 1 114 ? -1.407  -0.159  -12.591 1.00 1.00 ? 114 GLU A HG2  6  
ATOM 11499 H HG3  . GLU A 1 114 ? -1.927  1.250   -13.502 1.00 1.00 ? 114 GLU A HG3  6  
ATOM 11500 N N    . HIS A 1 115 ? 0.907   0.185   -16.454 1.00 1.00 ? 115 HIS A N    6  
ATOM 11501 C CA   . HIS A 1 115 ? 1.568   -0.676  -17.429 1.00 1.00 ? 115 HIS A CA   6  
ATOM 11502 C C    . HIS A 1 115 ? 2.391   0.139   -18.449 1.00 1.00 ? 115 HIS A C    6  
ATOM 11503 O O    . HIS A 1 115 ? 3.493   -0.265  -18.830 1.00 1.00 ? 115 HIS A O    6  
ATOM 11504 C CB   . HIS A 1 115 ? 0.490   -1.540  -18.105 1.00 1.00 ? 115 HIS A CB   6  
ATOM 11505 C CG   . HIS A 1 115 ? 1.028   -2.835  -18.663 1.00 1.00 ? 115 HIS A CG   6  
ATOM 11506 N ND1  . HIS A 1 115 ? 1.852   -2.989  -19.757 1.00 1.00 ? 115 HIS A ND1  6  
ATOM 11507 C CD2  . HIS A 1 115 ? 0.795   -4.087  -18.161 1.00 1.00 ? 115 HIS A CD2  6  
ATOM 11508 C CE1  . HIS A 1 115 ? 2.104   -4.301  -19.910 1.00 1.00 ? 115 HIS A CE1  6  
ATOM 11509 N NE2  . HIS A 1 115 ? 1.477   -5.019  -18.957 1.00 1.00 ? 115 HIS A NE2  6  
ATOM 11510 H H    . HIS A 1 115 ? -0.108  0.115   -16.369 1.00 1.00 ? 115 HIS A H    6  
ATOM 11511 H HA   . HIS A 1 115 ? 2.257   -1.332  -16.896 1.00 1.00 ? 115 HIS A HA   6  
ATOM 11512 H HB2  . HIS A 1 115 ? -0.279  -1.793  -17.374 1.00 1.00 ? 115 HIS A HB2  6  
ATOM 11513 H HB3  . HIS A 1 115 ? 0.011   -0.977  -18.906 1.00 1.00 ? 115 HIS A HB3  6  
ATOM 11514 H HD1  . HIS A 1 115 ? 2.230   -2.251  -20.347 1.00 1.00 ? 115 HIS A HD1  6  
ATOM 11515 H HD2  . HIS A 1 115 ? 0.184   -4.313  -17.294 1.00 1.00 ? 115 HIS A HD2  6  
ATOM 11516 H HE1  . HIS A 1 115 ? 2.725   -4.719  -20.693 1.00 1.00 ? 115 HIS A HE1  6  
ATOM 11517 N N    . PHE A 1 116 ? 1.894   1.317   -18.847 1.00 1.00 ? 116 PHE A N    6  
ATOM 11518 C CA   . PHE A 1 116 ? 2.648   2.285   -19.628 1.00 1.00 ? 116 PHE A CA   6  
ATOM 11519 C C    . PHE A 1 116 ? 3.909   2.737   -18.871 1.00 1.00 ? 116 PHE A C    6  
ATOM 11520 O O    . PHE A 1 116 ? 5.006   2.572   -19.409 1.00 1.00 ? 116 PHE A O    6  
ATOM 11521 C CB   . PHE A 1 116 ? 1.742   3.468   -20.020 1.00 1.00 ? 116 PHE A CB   6  
ATOM 11522 C CG   . PHE A 1 116 ? 2.503   4.734   -20.361 1.00 1.00 ? 116 PHE A CG   6  
ATOM 11523 C CD1  . PHE A 1 116 ? 3.345   4.760   -21.486 1.00 1.00 ? 116 PHE A CD1  6  
ATOM 11524 C CD2  . PHE A 1 116 ? 2.466   5.839   -19.491 1.00 1.00 ? 116 PHE A CD2  6  
ATOM 11525 C CE1  . PHE A 1 116 ? 4.156   5.879   -21.727 1.00 1.00 ? 116 PHE A CE1  6  
ATOM 11526 C CE2  . PHE A 1 116 ? 3.276   6.962   -19.734 1.00 1.00 ? 116 PHE A CE2  6  
ATOM 11527 C CZ   . PHE A 1 116 ? 4.132   6.975   -20.849 1.00 1.00 ? 116 PHE A CZ   6  
ATOM 11528 H H    . PHE A 1 116 ? 0.959   1.564   -18.562 1.00 1.00 ? 116 PHE A H    6  
ATOM 11529 H HA   . PHE A 1 116 ? 2.981   1.796   -20.545 1.00 1.00 ? 116 PHE A HA   6  
ATOM 11530 H HB2  . PHE A 1 116 ? 1.129   3.177   -20.874 1.00 1.00 ? 116 PHE A HB2  6  
ATOM 11531 H HB3  . PHE A 1 116 ? 1.067   3.688   -19.199 1.00 1.00 ? 116 PHE A HB3  6  
ATOM 11532 H HD1  . PHE A 1 116 ? 3.395   3.902   -22.143 1.00 1.00 ? 116 PHE A HD1  6  
ATOM 11533 H HD2  . PHE A 1 116 ? 1.825   5.823   -18.621 1.00 1.00 ? 116 PHE A HD2  6  
ATOM 11534 H HE1  . PHE A 1 116 ? 4.827   5.882   -22.568 1.00 1.00 ? 116 PHE A HE1  6  
ATOM 11535 H HE2  . PHE A 1 116 ? 3.263   7.802   -19.056 1.00 1.00 ? 116 PHE A HE2  6  
ATOM 11536 H HZ   . PHE A 1 116 ? 4.776   7.827   -21.028 1.00 1.00 ? 116 PHE A HZ   6  
ATOM 11537 N N    . VAL A 1 117 ? 3.795   3.283   -17.650 1.00 1.00 ? 117 VAL A N    6  
ATOM 11538 C CA   . VAL A 1 117 ? 4.977   3.856   -16.971 1.00 1.00 ? 117 VAL A CA   6  
ATOM 11539 C C    . VAL A 1 117 ? 6.023   2.804   -16.560 1.00 1.00 ? 117 VAL A C    6  
ATOM 11540 O O    . VAL A 1 117 ? 7.211   3.127   -16.548 1.00 1.00 ? 117 VAL A O    6  
ATOM 11541 C CB   . VAL A 1 117 ? 4.661   4.794   -15.783 1.00 1.00 ? 117 VAL A CB   6  
ATOM 11542 C CG1  . VAL A 1 117 ? 3.876   6.034   -16.235 1.00 1.00 ? 117 VAL A CG1  6  
ATOM 11543 C CG2  . VAL A 1 117 ? 3.926   4.113   -14.624 1.00 1.00 ? 117 VAL A CG2  6  
ATOM 11544 H H    . VAL A 1 117 ? 2.870   3.342   -17.225 1.00 1.00